2E33A

Structural basis for selection of glycosylated substrate by scffbs1 ubiquitin ligase
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
175
structure length
175
Chain Sequence
RRRNLLRNPCGEEDLEGWSDVEHGGDGWKVEELPGDNGVEFTQDDSVKKYFASSFEWCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRTDAGSLYELTVRLLSENEDVLAEFATGQVAVPEDGSWMEISHTFIDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSSVWVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-box only protein 2
publication title Structural basis for the selection of glycosylated substrates by SCFFbs1 ubiquitin ligase
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase/hydrolase
total genus 39
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2006-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04300 FBA F-box associated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2e33A00
3K4AA 3ZM8A 1JZ2A 5JUVA 1JYVA 4UOJA 1OT5A 2VMFA 2WBKA 2C4XA 4D0QA 4L0PA 3WNNA 4DXSA 2YB7A 2Y6HA 3VDAA 3SKVA 3T09A 2ZEZA 1UY0A 2VMEA 1K45A 1GU3A 1SDDB 5C71A 3LEKA 2DCKA 3OGSA 5IFPA 1UY3A 2ZEYA 1IQDC 3HNBM 4A6OA 3LQCA 1WKYA 1F4AA 2Y6KA 2VCBA 3HOBA 4XUTA 2VZ1A 2VTFA 3GGLA 4CVUA 1UY2A 2YG0A 2ORZA 1W0NA 1H6YA 1CIYA 2J1VA 3DYPA 4CUCA 1YQ2A 3I97A 4ARYA 4DUWA 1L7RA 1MPXA 1UX7A 3OEAA 3VD4A 3P1IA 2E31A 2V5DA 1UWWA 1UY4A 4MGSA 5C7GA 2WO3A 4JHZA 4A44A 2BBAA 2VC9A 3MO4A 4W8JA 3K4DA 2VZUA 2J22A 3K4ZA 4XUNA 1JU3A 4QAWA 3T2OA 2VCCA 1UMIA 1TG7A 1ULOA 1ULPA 1GUIA 4RYDA 2W95A 5LCWL 3ACFA 3THDA 1OF4A 5I0DA 2WUHA 3NJXA 1JHJA 1UY1A 2HLEA 3CQOA 2JKXA 4QDQA 4TXWA 4CUAA 5J1XA 1NKGA 2CDOA 3SKJE 3EYPA 2V72A 3PUHA 5LA2A 3LPFA 2BERA 1JU4A 3A22A 2V4VA 2J7MA 4DXTA 4QX2A 1PX4A 3WF3A 4AAXA 4XZUG 2J1UA 3NNGA 3MV01 2X10A 1UMHA 2VZVA 3C7FA 5B4XA 3I3BA 2X05A 1GOHA 2XQXA 3DECA 1NUKA 1K42A 4HG6B 1K3IA 1D7PM 1F4HA 1OF3A 5DPNA 2Z4FA 4DUVA 2VCAA 2E33A 5JR2A 3OGRA 1PMJX 3DYMA 3WF2A 4E8CA 2VZQA 3T08A 2WO2A 4W4ZA 3HEIA 2WO1A 1UZ0A 1CX1A 2YFZA 3I3DA 4OMCA 1OD3A 1O8SA 1O8PA 4W50A 3ACGA 2WABA 1KGYA 4PT6A 2XHNA 2VL4A 4JKLA 2EIBA 3WNPA 5CZKA 1RYYA 2ZEXA 2WQ8A 1W8NA 5IJRA 3OEBA 2J1SA 1T2XA 3WEZA 3HJRA 3AC0A 1DYOA 4OZOA 2VOTA 4ET7A 4BJ0A 2VM9A 3K46A 4OMDA 4CUBA 3FN9A 3UETA 4QB2A 1W9SA 1JZ8A 3JXSA 2X09A 1SG3A 3FHQA 4ZZ8A 2WN2A 4QX1A 1XPWA 2BZDA 3A7QA 1HN1A 1LNSA 2VMDA 2W3JA 3IIIA 2W47A 3NRUA 3HNYM 4DEVA 3LPGA 3VDBA 2YFUA 2EIEA 2Y6LA 4XUOA 3WSOA 3WQBA 1CZSA 2DCJA 2B9VA 1SHWB 3MUY1 3ABZA 4A42A 4DEQA 2HYXA 3THCA 4CU8A 4MO3M 5EIYB 3LE0A 3K77A 3W5NA 4IUGA 4QB1A 1H6XA 1GOGA 1JYNA 2W87A 4XUPA 2DDUA 4JKMA 5JMOA 1J83A 3OB8A 3WF4A 2QQNA 3CKHA 2QQMA 2BGOA 2QQIA 1EUTA 5C70A 3CZUA 2JD9A 4ZY9A 1UYYA 4JX0A 4LQRA 3C7HA 1UYZA 2QQKA 4MOAA 2VZTA 3T2PA 2W1QA 4GWIA 1KEXA 3I2HA 3I3EA 1JI6A 2QQOA 2E32A 2J1EA 3C7OA 3BGAA 4GWJA 3GM8A 4A41A 5HPOA 2YC4A 3GXUA 2ID4A 5JXJA 4M4RA 4QX3A 4FI9A 2W1UA 3OG2A 2W5FA 3CMGA 4KWUA 5G04L 3C8XA 4UI9L 3VD5A 4P02B 1NAEA 2B4KA 3MUZ1 2VZ3A 5JXHA 4P5YA 3T0AA 2KD7A 4A3ZA 3LEGA 2WYSA 3HN3A 3MBWA 2WN3A 3ACIA 3GDBA 3CZJA 3ETPA 2VQUA 5B4NA 2W92A 1XNTA 1GQPA 4GZ9A 1JYWA 3U37A 3W5MA 1JZ7A 4MADA 4TTGA 2YC2A 4RN5A 3A23A 1JZ3A 4ZXEA 4BK5A 3CDZB 2PQSA 2BGPA 4XURA 3T0BA 3WF1A 4QDSA 2C9KA 3WNMA 4P00B 3NJVA 4LKSA 2LW8A 4A45A 3UNPA 1US3A 5G05L 1GNYA 4JKKA 1J84A 2W91A 2VMCA 2W94A 3SEEA 3FHAA 4QDRA 4QX0A 3F2ZA 3HNMA 2RVAA 4XVHA 1CZVA 2ZXQA 3FL7A 5LA1A 2C26A 2R7EB 3MV11 2LS6A 2VR4A 1WCQA 3HPNA 1O59A 2J1RA 1P8JA 1L7QA 4QPWA 1DP0A 3T2QA 1JZ5A 2L9LA 2VQTA 3T0DA 2RV9A 4BDVB 3VD3A 2CDPA 2WDBA 3WNLA 2QQJA 3EB7A 1XNAA 5DMYA 2QQLA 3P6BA 4OYUA 3ECQA 2Y6JA 4AG4A 3BN6A 5DN2A 4Z2AA 4E8DA 2XOMA 5JXIA 3IAPA 3I2FA 1UXXX 3DYOA 4LHSA 5EJ1B 5FUIA 4BXSV 3WNOA 4M4PA 4A4AA 3PUIA 1CZTA 5HXMA 2OKXA 3OGVA 2WZ8A 1GMMA 3C7EA 2W46A 2VJXA 4BK4A 1PX3A 2EICA 1EUUA 1UXZA 3VD7A 2RJ2A 3E1F1 5F7UA 3WNKA 4UAPA 2VO5A 3CIHA 4DUXA 5A1AA 4LPLA 4MGQA 5IHRA 2W9XA 4CU6A 5IYYA 2QBXA 2VZRA 3ACHA 1R64A 2Y8KA 2JDAA 3J7HA 1PMHX 4DXRA 3I2KA 5JXGA 5LA0A 5CYYA 1XC6A 3IB3A 1NX9A 3K75B 4D8MA 1JZ6A 1K12A 2Y6GA 2J1AA 1UYXA 1W99A 4PQQA 3VDCA 2JE8A 3I2IA 1W9TA 3SEPA 3IDAA 1US2A 2Y64A 1GOFA 3UESA 2W1WA 1OH4A 2EIDA 2J1TA 4ARXA 3NQHA 5EJZB 2ORXA 4CU9A 4PF1A 1I5PA 4P08A 1DLCA 3D3AA 5IFTA 2E26A 4ZZ5A 2WAOA 3VD9A 3I2JA 3I2GA 1JYXA 3OBAA 2VZOA 1TVGA 2WZEA 2WAAA 1JZ4A 4YPJA 4OUEA 2ZEWA 3IAQA 4KI5M 4QB6A 1W9WA 1W8OA 2VZSA 3C7GA 4XUQA 3A21A 4KMQA 3WF0A 5DQ0A 2VZPA 4CU7A 2XONA 3LEIA 1BHGA 2W1SA
chains in the Genus database with same CATH superfamily
4GB31 2VPVA 1CD3G 3POGA 3Q8FA 1YO8A 3R6SA 3BTZA 4XFAA 1W8TA 3B9CA 3THPA 5JUVA 3ASIA 2HKXA 1QJX1 5E88A 3DV8A 1FPN1 1CAWB 5FZ9A 4Y22A 2WR9A 3OY8A 5LY1A 4DXSA 4LO6B 1I9RA 4IEPA 5BUVA 2A6VA 3T09A 4QU1A 3KS7A 1SBEA 3ZYIB 1N47A 5ACA1 1NE4A 1N1YA 4HANA 2D3RA 3H3UA 1LOAA 3N7KA 3FUQA 2X53S 4FT8A 5FYYA 5JAXA 5FPXA 1V6NA 1YLLA 3LGRA 3HNBM 4QX8A 4LIUA 3LQCA 4TLFA 2RM23 4RFRB 4DQAA 5HV0A 1XU2A 1V6JA 1PVC3 1W90A 2X5IC 4AHYA 1NT0A 2HWE2 5FYBA 3T1LA 3AZVA 4GH4B 5E1RA 4XQWA 2CU5A 1POV3 1NLRA 1UY2A 1CQ9A 2JICA 3MIEA 4K8RB 3W20A 1UZZA 3QBQA 2J1VA 1D0GA 5JOXA 1S0CA 4GALA 2ZHLA 1F31A 4LA3A 1DZTA 5CB7A 4BMEA 2JWPA 2XJVA 3D8CA 4DUWA 2OIIA 1MPXA 1UX7A 4QGLA 3CEWA 4TN7A 5A1LA 5A3LA 5SV5A 4QKBA 2OUJA 3W58A 4CXXA 2ZMKA 4DPNA 1RUJ3 1SLTA 1UY4A 3TRSB 5LATA 3TAYA 1LKNA 4O61A 3H7YA 4ATEA 5DG1A 5KXBA 2VC9A 2DBNA 2NYYA 2ZAHA 1D0HA 4N43A 4XFCA 4W8JA 3OD0A 1ZRFA 3LKJA 2WL1A 2BFUL 3AKRA 4HT1T 4HZFA 5F5AA 5A3TA 3MGUA 3O0XA 1I6XA 4IV3B 1K5JA 1UL9A 2OUHA 2PAMA 4B4PA 2XLGA 4KU8A 2VVFA 1GUIA 3P3NA 3VBSB 1BMV2 1OVSA 1O6UA 3UJQA 2XJTA 1OQDA 3TN93 4GMP3 4A7KA 2LRPA 4K40A 5DAQA 1JUIA 3V56A 1OF4A 5I0DA 5BV6A 2GU9A 1RUC3 4YZ4A 5C6CA 2SBAA 1JHJA 3H9AA 4ORFA 1SPPA 4XTMA 2VY0A 4QDQA 4KWJA 4LT5A 3DCQA 1G86A 4EJRA 1O3TA 1KS5A 2PHDA 1DBNA 1XNBA 1DIWA 1MS0A 1UX6A 1YYNA 2CDOA 1OQEA 5IWFA 3VBHC 3PUHA 3ZIWA 1NCRC 5CIRA 2F17A 3ZXEA 4FTSA 3LPFA 4IV1B 1XSRA 5JVVA 4QX2A 5EYXA 3WF3A 1RUNA 1BEV3 2J1UA 3GCWA 4HSJA 2VZVA 3C7FA 3LA2A 4HMZA 5ANNA 4CDQA 4AVBA 4IEXA 5F39A 2X05A 4BZ4A 3ZKYA 4CDUC 3DECA 3WUCA 2UY9A 1MVEA 1V6LA 2XR4A 4O9GA 2A7AA 3AP7A 2Q8EA 1LR5A 1F4HA 1OPOA 4CDXA 1O5UA 4JRLA 4P9YA 1CAVA 1PVXA 3ZO0B 4DUVA 4Q4W1 1XU1A 3ENRA 2XJUA 2GC1A 2E33A 3HWJA 4SLIA 1DLLA 3ZFGC 1E5IA 4Y4RA 4AEJA 1OOPC 3KF3A 1IS4A 5BNNB 3FX3A 3O0WA 1NY72 1H9WA 4RL7A 3VBFC 2FDKA 1DQ2A 5D8AB 4DZGA 2ZGMA 3BIEA 1LB2A 2D3SA 3GCXA 1OI6A 1YNAA 3WOGA 3ZN6B 4Y20B 3I54A 4OMCA 5FV3A 1S4CA 5KHIA 5J7MA 2F6BA 1O8PA 3WT3A 4COZA 4W50A 1A8MA 1RUE2 2P37A 4JDNA 1H2KA 1HXS2 3ACGA 5A33B 2WABA 5F3GA 2JX9A 3L2YA 3R4UA 3J9SA 3N9NA 2XHNA 4JKLA 1QQP3 5CZKA 3HQXA 4ZKTB 2WQ8A 2PHFA 4IE6A 3PURA 2UWCA 1POV1 4ZU7A 3FBMA 4NIGA 1QWRA 3KV4A 5JOWA 1CWPA 2XB6C 2A3XA 2YMZA 3HJRA 2H0BA 4EN6B 4CZSA 4OHYA 1R092 2A3WA 1IGOA 4YGCA 2I45A 3ZYPA 2C9AA 4KWLA 4OZOA 2O0OA 2ETEA 1J59A 4YZ5A 1QHDA 3M3IA 4QHZA 5FMDA 4QGNA 2BUKA 2BU9A 4KBZA 4ZPIA 2ZKLA 1VMJA 4FPYA 1ZBE3 3KV9A 3MIGA 4OMDA 4BPZA 2BNOA 3UETA 3IPVB 4QB2A 4CP9B 1W28A 1TMF3 4HLTA 1OFSA 4Q8LA 3PNAA 1GZCA 3WR0A 5BNOC 3VBUA 2X29A 1VBE2 2CV6A 5GKAC 1UPSA 2C24A 3IIIA 2W47A 3JU9A 1QU0A 2E63A 3WCSA 3ZFFB 4AI9A 4EN0A 1NXD1 4LTAA 4J25A 3VDBA 3S7IA 3VV1A 1N3PA 3TN91 2XWBB 4GMP1 2HWE3 4NPMA 1WCUA 5CFCC 1HV1A 1FV2A 2K2SA 1RUC1 4CCNA 3VL9A 3KB5A 3NO8A 4EN8B 1FMD3 2DCJA 5FO9B 4KQ7A 4I09A 1MQTC 3OBRA 4LR4A 3AMMA 1SHWB 3T4HB 2OA2A 2PQQA 4L9BA 3THCA 1H2NA 1OLME 2GMEA 5FZDA 4AQTA 4K1YA 3R0RA 2RMU2 3VHRA 2DYCA 1KITA 3W5NA 2JJ6A 3HVDA 4QB1A 5FZ3A 2P17A 1BEV1 4P9GA 4Q29A 4C1XA 2W87A 3JZVA 2JDPA 1W0PA 5FPAA 1J83A 1JYTA 2WNVB 3RMXA 3WF4A 2R49A 2OXBA 4K3UA 2QQIA 3KQRA 4FPKA 1CJDA 2LROA 4HVRA 1A3KA 2JD9A 2VG9A 5LW9A 5DZGA 3WV6A 1UYYA 4BQ4A 4XIKA 5A7WB 1LULA 1LU1A 2UYAA 5CKNA 1AR82 5FY7A 3VKLA 1EAH2 4GD4A 4RS5C 3U10A 2HH9A 2JG8B 5K0UB 3ZMOA 4KU7A 4DNYA 2YU1A 3O0VA 2NMOA 3C3VA 5DUWA 3HT2A 3SLIA 4GWIA 5FWEA 4BLJA 1WW6A 2FMDA 3OD4A 4YW4A 3OGGA 3J4UH 3MF9A 2DVFA 1JI6A 1SDWA 4OHVA 2VOVA 4NPRA 1SFNA 1GP5A 2E32A 2J1EA 3C7OA 4NHLA 4PDWC 3WZ1A 1X9TA 1W6OA 2WSVA 1H2LA 2PLV3 1Y9GA 4GWJA 1G9DA 1GYKA 3RYRA 2YGLA 4DXZA 3DN7A 2WWSA 3GM8A 1Q3EA 3VZKA 5JZGA 4P9XA 4NAOA 1QJY3 4JQRA 4A41A 3Q9OA 3NAPB 2YC4A 1IKPA 4R9DA 5HPOA 3FBYA 2AUYA 3ETQA 3L2HA 4LORA 3VZMA 1ZX5A 3AZXA 4LOSA 4WM8A 2W1UA 3RZZA 1GZ9A 4G9SB 1QQP1 1VB4A 4LK6A 3C8XA 4CDWC 1JYIA 2PHRA 5FZMA 3SCHA 2DTWA 3MUZ1 3POSA 2VZ3A 1H8TA 2XXZA 4LJHA 4WVVA 4SBVA 2V09A 2YUEA 1XQNA 3E6BA 4YFZA 5FPLA 3NNLA 5JPNB 3BTXA 4LLOA 4OUSA 5T50A 1VBA3 4HPKB 2I2SA 1ULEA 4IERA 3ZYHA 2GNDA 4HKLA 3CZJA 1W6MB 3ZN4A 1LJ7A 3UK9A 4I01A 2VNRA 3I4IA 4ZU4A 3U11A 3ZPOA 3KSCA 1G7YA 5JI7A 1LHWA 4MHRA 4YVSA 2DBIA 2R043 4FOYA 1NCQB 4XMAA 3U37A 4P9WA 4Q2FA 5FXWA 1CJPA 2R1DA 2CWSA 4J6GA 2WO7A 4LBQA 1HDKA 4FQ4A 1DGWA 2ZMNA 4IW3A 2OQ7A 4Q4V1 1D2QA 1IPJA 4YW3A 2PTMA 5T55A 5L9VA 5E8AA 1ULGA 1W2OA 3TWIA 2DUQA 5C3RA 2BGPA 3T0BA 1DZQA 4LK7A 4QDSA 2Q1FA 4RSUA 2QQUA 3AXEA 1LEMA 5JWPA 3AVSA 4QPYA 3OF1A 3VKFC 4YM2A 4X8NA 5F5IA 1AYN2 2OX0A 2ZJCA 5IAVA 1XXNA 1GNYA 2OZJA 3D0SA 1C3HA 3MPBA 4FO9A 3V0AB 1FMD1 1ENSA 4QPIC 2E9QA 2VMCA 3IMNA 2N7GA 5FZOA 3FHAA 3KCXA 1CPMA 4CEYB 5FXVA 1OVPA 1XSQA 3B02A 5FBZA 3RPQA 1J3PA 4YG3A 3F2ZA 3BPSA 1HB1A 3HNMA 3VZOA 3IDBB 4NE9A 5FJKA 2JDNA 1G6NA 1RJ8A 1TNRA 2F4PA 1KS4A 2C26A 4GB32 5GJ6A 4D3WA 3IZOA 3MV11 4P9JA 1UZYA 3N36A 1XYOA 1J3QA 4K9SA 2EXHA 1QJX2 4P5HA 1G9FA 3WNXA 1W39A 4QKFA 4FP2A 1FPN2 1GQHA 1O59A 1Q56A 3AJZA 4CPBD 3PVBB 3OPZA 2J1RA 4M3CF 5LEKA 4BH9A 1HQLA 1NXMA 1SZBA 1ONAA 3V0BA 1QXPA 3O7OA 2IXJA 5HBAA 3IMMA 4Y5TA 4OHZA 1S0JA 2VQTA 3ZVXA 1ZA4A 5T3NA 4JC1A 3VZLA 5ACA2 3TNQA 3VD3A 2QQJA 1QOSA 1IKQA 1W6PA 1UO9A 3HAGA 4XPVA 3ROUA 3B94A 5AC91 5FZ8A 3VBOB 2BVVA 3RZKA 4QM8A 3BN6A 5DN2A 1NE6A 4N53A 3JB4C 2DU1A 4OCTA 5D2AA 2GN7A 2XOMA 3THTA 5BNPC 1W8UA 3IAPA 5FYZA 4AQSA 3I2FA 5EJ1B 4AF9A 3WNOA 1POQA 1PGW2 3PUIA 2PLV1 2IXLA 4BXFA 1GMMA 4LA2A 2YPDA 4QPGB 1ULDA 1NCRB 1SFYA 2H6CA 1PX3A 2VJXA 3UV9A 5M0TA 1UXZA 2RJ2A 1QJY1 1WMDA 2GMMA 3OYWB 4UAPA 3CIHA 1I5ZA 3GBFA 2XUEA 1S0DA 2GNTA 1BBT3 2JDHA 2VBPA 1SCSA 5FPZA 4CU6A 4OVEA 2UYBA 2VZRA 2Y8KA 4HL0A 2CAUA 1VAVA 2VUAA 5A3MA 3J7HA 4PBPA 3CU7A 1DQ5A 4ZS3A 4NHKA 1LGCA 4IXLA 5TSWA 4LMFA 3KHCA 4NWVA 1NX9A 4AEKA 4DIQA 1U5IA 4HOOA 1CIWA 1WLDA 1K12A 4IE7A 5DUXA 2P3KA 1ZA7A 3OUHA 4XFGA 3ZFGB 1RUI2 1UYXA 2WIIB 3M3EA 5LEJA 1R1A1 1OOPB 1UIJA 1SBDA 3KGLA 4PQQA 2XBO1 4CCCA 2JE8A 1CONA 4Z8BA 3BU0A 4QT6A 3F95A 2R041 1VBB2 1URXA 2PHWA 1EPWA 3NKTA 2OYZA 1X8MA 4QGMA 4PF5A 2VMHA 2Y64A 1LGNA 2HWC1 3GALA 1U12A 1PZ7A 1XE8A 1QMJA 3AB0A 3I8TA 5FTTC 2Y60A 3VN4A 3GZAA 2EIDA 1LOCA 5GZDA 4AOCA 3VHOA 2J1TA 3WP5A 1HX6A 4IESA 4YW7A 4ARXA 2ORXA 4AZZA 1F8VA 1SCRA 1FNZA 1TEIA 1FI2A 3POFA 5CKMA 1B35B 1X36A 3AK0A 4BMBA 2JIJA 4M00A 4CU9A 1I5PA 4ES9A 5L7OC 4KWKA 2HYKA 3VKNA 1OXCA 4XFFA 3T30A 5IVFA 1AR92 3RJ2X 2H6BA 4DMIA 1K5MA 2RR13 1IHMA 1J1TA 1VMHA 2XMLA 3M3CA 1OPMA 4LO4B 2E53A 4O7XA 1Z7S3 1ZZBA 4S2HA 5FZ4A 1ZREA 4AVVA 3VD9A 1JYXA 3H8RA 4IEZA 1TVGA 4UF0B 4GKYA 2WZEA 1RVF2 4IV3A 4LBJA 5IUQA 1TE1B 2WAAA 1BCXA 3FE5A 1G9AA 2ZEWA 5LZ6A 5EQUA 1AR61 2QNKA 1DQ1A 2QVSB 1F35A 2D43A 1S2EA 4KMQA 5KXEA 4E2QA 1W8HA 2Y38A 1UZWA 5DQ0A 4ZS2A 4Q4Y3 3VLBB 1XOYA 4HVOA 3S5AA 2W1SA 5C8CC 2PHUA 3OGJA 3ZSEA 2W68A 4NIIA 1QJU1 3K4AA 3MI8A 3NVCA 5FUNA 3VDDC 4FOQA 1DGWX 4UOJA 2JG9B 2JDZA 4LHNA 3BUCA 2GP5A 3O1PA 4D0QA 1S0FA 2C4XA 4L0PA 3L9JT 4P9IA 5C4WC 5ABJB 2ZBJA 1YC61 5I8TA 2XUMA 2YB7A 5L9BA 1NA1C 1YI7A 2Y6HA 4JGZC 1ZNPA 2CGOA 1YEWA 2RS53 3ZOIA 3LOBA 1OD5A 1MQTB 2A6YA 2MNGA 2ZEZA 5F3EA 1GU3A 2RM22 1ZYBA 2K0GA 3HBKA 2B7YA 4HN0A 4JV4A 4YW2A 5C71A 3H8XA 4LLFA 1O4YA 1PVC2 3TEZA 1C1FA 2WA4A 5IW0A 4ASMB 1UY3A 1DU3D 2A5ZA 4GB33 3TEXA 1NLQA 4UFHA 4JVAA 4YWAA 3U75A 3WD5A 1WKYA 1F4AA 2PFWA 2LALA 1DCSA 2XG3A 2QQWA 4L92A 1MZEA 2Y6KA 4L2NA 1ST8A 4FAGA 1F5JA 4YM3A 2VCBA 3D4KA 3RI8A 1XNKA 2VZ1A 2ZGSA 3GGLA 1JUHA 2ZAAA 2RDQA 4YRDA 2ORZA 2KXLA 2Y34A 1W2UA 3W9AA 4BU2A 4Y3OA 5BNNA 5FWJA 5K8SA 4QMAA 1ZRCA 1ZZCA 1RUJ2 4JQTA 3NMBA 4XBQA 2B46X 3P3PA 4RS5B 1T6BX 1AXKA 1H2MA 2AZ5A 4XOGA 4XHXA 4Y20A 5LY2A 4NPLA 3ZN6A 5FY8A 5FOJB 2BDRA 1W9FA 1T6GC 4XAEA 3R05A 4C0BA 2V5DA 2R1BA 3DGTA 4FXGB 1JN2P 3B3QE 5C7GA 2BFUS 2GAUA 1IZ3A 2WO3A 3CJXA 4JHZA 4KG8A 5H9SA 3E97A 5C3SA 3RZJA 5CU1A 1PIV1 5FK7A 1PK6B 2GSYA 3SHRA 3K4DA 3ILFA 3WINE 4CCDA 1W6QB 5J96B 3TN92 1JU3A 4QAWA 3T2OA 2JIGA 2VCCA 3FJSA 3U0ZA 2RS33 1UMIA 5DUUA 1TG7A 2W08A 3MLLA 1RUC2 3H8OA 1OUXA 3AP4A 3LF7A 4RR3C 3WQ7A 5GLUA 2VE1A 1DQ0A 2E7AA 4UFIA 3NKGA 3NNFA 2CL2A 1X33A 3BPZA 4LEJA 3ACFA 3THDA 3H1MA 1DYPA 4AWDA 1D4M3 2JENA 2A6WA 3NJXA 4HK9A 4BOWA 2RR11 3K2OA 1UIKA 3WG1A 3ZSLA 2HLEA 3CQOA 1Z7S1 4OHXA 2XVKA 2ET7A 3HD8B 4ZONA 2XL7A 5FY1A 5J1XA 2ENRA 1BEV2 3OSDA 3EYPA 2V72A 4XQ4A 3I59B 4BCUA 2OVUA 3POBA 5LA2A 4QWNA 4YG0A 5A3OA 3ZFFA 1J1LA 3SITA 4F7ZA 3AXDA 1NZCA 4QHOA 4WVMA 4AAXA 1IPSA 2B8MA 5BXXA 3E5UA 2VNVA 2X10A 3N7MA 2A70A 4FQZA 4IEOA 1CN1A 1S0BA 5FZHA 5B4XA 3I3BA 3ILRA 1CAUB 1GOHA 2XQXA 2DF7A 1K42A 1HJFA 3PHMA 4HG6B 3AL5A 2B9UA 4M3CA 3WDUA 1LECA 1OLRA 4DRVA 1IOAA 2Z69A 4LBQD 1YFWA 1ND3C 5FFOC 4EV0A 4XCBA 3HR9A 3JD73 5JR2A 5FPVA 3DYMA 3WF2A 4C90A 5IVJA 4QPIB 2RS51 5HXVA 1Y4WA 5LBFA 3RYKA 3O1RA 1E5SA 4CEWA 1RHI3 4Z92B 2VZQA 3T08A 4N8MA 5IVVA 2D40A 3RZGA 4PI0A 4E4ZA 2ZX2A 3UT0A 2Q8CA 5C9AB 5FZBA 2IVJA 4CE8A 1QQP2 4PLMA 5KHHA 1O8SA 4L8QA 2D5FA 2TBVA 5J36A 5I8SA 2R6QA 4J1XA 4WM7B 3WG4A 1JH5A 1KGYA 1XYPA 2OPKA 2PA7A 1AUYA 1REEA 1WZXA 1Z78A 2KM2A 3BCWA 4PT6A 5IK7A 2ZA9A 4QXBA 3UJOA 4IGOA 1AZDA 2JDMA 2VL4A 4Q4W3 5FZAA 3AYDA 4B1LA 1RYYA 1W8NA 3ELNA 2Q4SA 4YGEA 3S5QA 4OUMA 1T2XA 4R52A 5CADA 5APAA 5GM0A 5JOYA 4YZ1A 4LBLA 3N9PA 1ZBE2 1SEFA 2EIGA 2AREA 4LKFA 4V2WA 3BTYA 5CAZA 4XF0A 1KFXL 1TMF2 3OBTA 2AENA 4FPOB 1FYUA 1QOTA 3U07A 4BJ0A 2LTNA 3DPRB 1HRI1 4CUBA 1QJZA 5FMBA 3FMGA 3ZSKA 1UPIA 4KL1A 1JZ8A 5IATA 3M70A 5T5JA 1NG0A 5A7QA 4ZZ8A 2WN2A 3TBDA 4Q27A 2WFF1 3A7QA 1W6NA 3R4DB 5IK8A 2VU9A 4XF1A 4X6QB 3T1MA 2RS31 1OKQA 4AVCA 3BI3A 4AFCA 4DEVA 1FMD2 5FIXA 5A7PA 1H30A 3RMYA 1GBGA 1QIQA 5KBFA 1KDKA 3ORJA 4HPKA 1O4ZA 3ME2A 2Z79A 1XBFA 2VUDA 4JHTA 4N43C 1C28A 4XYXA 1D4M1 4IE0A 3USUB 1LODA 1OA4A 2FCTA 2MPFA 5CNAA 2B9VA 3RS6A 3GBWA 1NCQA 3MF6A 5D1IA 4XFBA 3ZDVA 4A42A 1UU5A 2ZGUA 2XJRA 2HEWF 3KVAA 3IWZA 3KT4A 2HYXA 2RJLA 4GQ7A 2HWB1 4MO3M 3WW1A 5CISA 5I8YA 4AVSA 4AAPA 4LBOA 1W03A 2G9ZA 3LE0A 2RS13 2WLQA 4Q4X3 4IUGA 1H6XA 2V5YA 4BB3A 1GWLA 3KM5A 1GOGA 1MS8A 3LDBA 4O9EA 2DDUA 1C8M1 4K8FA 5JMOA 2IZWA 4YFWA 4F8AA 1WLWA 2BGOA 5C70A 3V0AA 5FZGA 3LDKA 1YFXA 1QDCA 5GALA 3WUDA 3DUIA 3C2UA 5J98B 4LQRA 5JSRA 2OPWA 4CEYA 3GJBA 4X8PA 1AXYA 2VOXA 1GSLA 1UYZA 5C5UA 2Q8OA 4TYSA 2VZTA 2ARXA 2PLV2 1MZ5A 2WNUB 3GHMA 3JD71 4CDQC 2P34A 2JXAA 5B2GB 4XABA 3WW2A 3WLUA 1SLBA 1XNDA 1E57A 1QJY2 2ET1A 3AZZA 1RHI1 1H1AA 1TZOA 1ND2B 3RVHA 4CDXC 1YUDA 2QQOA 3BGAA 2FMYA 1LOFA 5FYUA 4PIYA 3RDIA 5FP3A 1YQCA 3B69A 2Q30A 4GIQA 1LHOA 4MGIE 3SQOA 5GZFA 5J3UA 3TEYA 4K7JA 1V6KA 1Q5OA 5EHDA 2W39A 2A1XA 2DWRA 2ID4A 3UGHA 5JXJA 4OI0A 2XVLA 5JI9A 1YIPA 1AJOA 2YDEA 2WS93 4ISQA 1GQGA 3VBOA 1X7NA 2GNBA 3CMGA 1W06A 5ANQA 1U5XA 2O8QA 1VBA2 3FFQA 5SV8A 1NAEA 5GZGA 1O7FA 5LBBA 1FAYA 2VNOA 4QD2A 1YJLA 3PVNA 2Q1ZB 3WDTA 4P5YA 4YYOA 2XBO2 5H9QA 3J7LA 5CFDA 4RA0A 4XJUA 2ZGLA 4TWTA 5A7NA 5FZLA 2FDFA 2R042 4QPGA 4P9LA 3LEGA 4A3ZA 1IQAA 3HN3A 4BA6A 1WD3A 5FQ0B 4NJ4A 3Q8CA 3OYWA 2A71A 1JW6A 2D6PA 1ZBA3 4CP9A 1WWYA 1XNTA 3M3OA 4HK8A 4YLZA 4FTEA 2XH6A 4YGDA 2EALA 3ZXLA 4E2SA 1AL23 4UFLA 4QKNA 4RN5A 1ODNA 4YVWB 3CJIB 2CAVA 3ZN5A 2BRTA 2GMPA 3DEMA 1R083 4JGYB 1GV9A 2P3YA 3WNMA 3ALQA 2KR2A 4A45A 1JHNA 1U5ZA 3WHUA 3J8F1 5ISLA 4C1WA 3VBUC 1E5RA 5G05L 2HWD3 1LU2A 3KZ4C 4B4RA 4BIOA 4URAA 1J84A 3MFCA 4R8HA 2W94A 1W3XA 2PHXA 4QDRA 2PAEA 4LE3A 5F5CA 3VBRB 4BQ1A 4DY3A 4QXCA 2P5BA 2FDIA 1PO11 2D6LX 1HQNA 3G6JB 1ASJ1 2ZXQA 2Y0IA 3FL7A 3PMSA 4Q4V3 4E2GA 5LA1A 3PU8A 3R4SA 2RS11 1QJU2 4AEDB 1PGL1 4Q4X1 1B35A 2LS6A 2QFEA 2VR4A 3ACLA 3MEPA 4B1MA 5C5TA 1WCQA 2FD8A 1Q43A 5CG8A 4N9IA 5FJHA 5FXZA 1UOBA 3IDEA 3RSJA 3ZSMA 4W6YA 2RJKA 4CCOA 2I07B 1U5YA 2DVDA 3VZNA 1HQWA 5DXDA 3ZXFA 1VBD3 4UF0A 3S6PA 4EROA 3WNLA 5A7SA 2ZX4A 2WT0A 1XNAA 3LCPA 5GZCA 3P6BA 3ECQA 4KGQA 2DVGA 1Q8VA 2GH8A 1TNFA 3FZ3A 4BIFA 1HJGA 3B9IA 4E8DA 2R063 4MGZE 3N4MA 4K1ZA 4LHLA 2GNMA 3DYOA 4KNCA 1A8DA 4BXSV 2C5DA 4KBBA 5FZ1A 1N1VA 4M4PA 4A4AA 3MW3A 1H8VA 5HXMA 1CZTA 1XNCA 2E6VA 2OKXA 1A6CA 2PELA 4MXVA 2OW4A 4E27A 1BBT2 1WW5A 5EPAA 2HWF1 4BK4A 1EUUA 2X8KA 5FMCA 4KG0A 2AEZA 4XILA 2JG9A 3E1F1 5F7UA 1TME3 3WNKA 1SQ4A 2BOJA 5ABJA 1M06G 4DUXA 3ZFEB 5I0RA 3WDXA 3GHNA 2WS91 3NV4A 4FPEA 4TZDA 5F3IA 4QX7A 1FNYA 2NPIA 4QQ2A 5IHRA 5AC93 2D5HA 1W8FA 3WCRA 5IYYA 2QBXA 3JBG3 3TEWA 1QNWA 4YW5A 5JZGC 5LASA 5FREA 1RUF1 4CCMA 4QM9A 4XFHA 3BIWE 1ZZ6A 3I2KA 3JB8A 5CYYA 5JOZA 4CCKA 1BKZA 3IB3A 1ND3B 1AXZA 4WM8C 3K75B 1WBFA 2BV4A 2Y6GA 3ILNA 2B45X 3BOWA 1W99A 1WCKA 3V64A 5JCTA 1H8TC 3OJBA 1ZBA1 1XYNA 3QACA 2J42A 2PN5A 3I2IA 4RQPB 4AFDA 3PVEA 3SEPA 4Y22B 3QOPA 1KFUL 1AL21 3CNAA 3OY8B 5FY4A 5JMCA 4DB5A 3UESA 2VOWA 1MZ6A 1OH4A 2W1WA 5FZEA 2RR12 1ZRRA 3GF6A 5FYMA 3NQHA 1Z7S2 4PI2A 1GWKA 1S0GA 1R081 3GZUC 1LESA 4YVSC 4PF1A 4FCAA 4D7TA 4XJ8A 3MW4A 4F83A 1GLHA 3J26N 5LRRA 3KWVA 2Z2SB 2HWD1 1SLAA 5EXOA 1R1A3 4ZZ5A 2WAOA 3KCCA 3MPPG 4LBKA 1RC6A 1H1IA 2D6OX 2XBO3 4AR2A 3AFKA 1PK6A 4CTEA 1W6QA 2BGCA 2GALA 3BOPA 3J7MA 3SH4A 3KHBA 3AKQA 1VBC3 2DUOA 5JSPA 4L99A 1RUH3 1JZ4A 2HWC3 1VAMA 4Q4Y2 2I74A 1YFUA 5FY0A 4OUEA 5ERLA 4QB6A 3MW2A 1RMU3 2VQ0A 4LXLA 4B8EA 2VZSA 5H9RA 3USSA 4XUQA 4A6SA 1H4GA 3AMHA 3MIFA 4K21A 3NNMA 4YARA 2XHKA 2X5IB 2VZPA 1X50A 3OBZA 4K20A 1LHUA 1BHGA 1NZIA 4LE4A 5LRSA 3Q8BA 3KLSA 2FDGA 2P3IA 3ZM8A 1OKOA 2WC2A 2AGSA 4TLGA 1JZ2A 2RS52 1JYVA 2VTXA 3V65A 1WW7A 1MVQA 5FYSA 3N9OA 1OT5A 1VBD1 2EA7A 2PHTA 2VMFA 1ULCA 2IFWA 2WBKA 1ZZ8A 3I59A 4J1WA 5DUVA 4Q1PA 2DCYA 4LITA 2P6HA 1VMFA 5E16A 5FYHA 2VTXJ 3VDAA 1HB2A 1V00A 2R061 1C1LA 2RDNA 1ODMA 4BISA 5JPMB 1SDDB 1AR63 1PO21 3E6CC 1YFYA 2Q1MA 2WZR3 4CSWA 2AH2A 5HI0A 1LHNA 2DCKA 1FOD3 3OGSA 5IFPA 1STMA 3NJZA 2QUOA 2ZEYA 4BQ2A 2V73A 4UW4A 1AR73 3AVRA 3B7MA 3EQEA 4N53C 3KT7A 4RHV3 1QJU3 4ONUA 4A6OA 4BYYA 2FQPA 1TME1 2BNNA 2E7QA 4QQHA 4YZ2A 1COV3 5K7PA 1YWKA 4S2FA 3UKTA 2IVIB 3OTFA 2WQ4A 2XKPA 3OPTA 5KHGA 1V6IA 4XUTA 5J48A 2BPA2 1C57A 2VTFA 4GAZA 1S2KA 2YG0A 3GNEA 3JBG1 1W0NA 1H6YA 5FZIA 2VW2A 4GA9A 4L97A 5CA6A 3MLJA 2K46A 1MS9A 4Z1VA 1EV11 1H1MA 4CUCA 1AJKA 1GANA 1U0AA 1UN1A 3I97A 4ARYA 4D8MA 5C9AA 5FYIA 3N3HA 3RQ0A 4IDZA 2QKDA 3OEAA 3VD4A 1RUD3 1W3VA 3P1IA 4JAAA 3VBHB 4EWDA 2C1FA 2JEMA 4Q1RA 2WFF2 3HMYA 2C6SA 2G1MA 4CXWA 4WM7A 3ZYRA 2RS32 4MGSA 4HKOA 3GZEA 4HN1A 5J09A 4FTBA 1A34A 4AFMA 1CAWA 2BBAA 4O65A 1QGLA 2EF6A 2JB8A 1OUSA 1CAVB 3PUSA 1CAXB 1MS5A 4PHZA 4X6RB 1W05A 2J22A 3VUOA 4FSJA 4I02A 3ZDSA 2ZABA 4IEWA 2XJQA 4CDUB 5F32A 1D4M2 4FPCA 4RFT0 1BVP1 1LGBA 1ULOA 3PJYA 1ULPA 3WY6A 5CVRA 4COYA 2P1BA 1SLCA 2ZOEB 2UY8A 5FYVA 2W95A 2Q8DA 4XDOA 3DPRA 1YQ5A 2WUHA 3JQXA 2QDRA 4LUKA 2YBSA 4CUAA 4TXWA 1O3QA 2JKXA 2EXKA 3O1OA 1VRH3 1UNBA 2ZHNA 3VBFB 2XL9A 4EZHA 3OUIA 4H7LA 1PIV3 5DZEA 5EYYA 4OZXA 4GH4A 1VBC1 3SNMA 4D94A 1RUH1 2WT2A 3I3QA 3ZXKA 2JDYA 1SFPA 1K5MC 1JU4A 1KRIA 2ZGKA 4QXHA 4B3NA 3WDWA 4DXTA 5I0UA 1RMU1 1PX4A 3NWKA 4XZUG 3NNGA 3DXUA 1UMHA 2AEYA 1DG6A 2DUPA 4NHMA 1JZ6A 3USUA 4CCLA 1ZRDA 1ALYA 2DVBA 4XCAA 4XTPA 1AF9A 4IV3C 2ATFA 2YXSA 3JD72 1UYPA 1K3IA 3KV6A 1RTVA 5DPNA 1RHI2 3APBA 2IXKA 2RHPA 4AFBA 3D82A 2VCAA 3URFA 1NQJA 3BTAA 2JB4A 4YG6A 4AEMA 3RZLA 3OGRA 4JZRA 1PMJX 4NRMA 5JIAA 1S2BA 1VJ2A 4DFSA 2IXHA 5EP9A 3AKSA 2YPJA 4E8CA 2O14A 3OCPA 1ZVFA 2XDVA 3FLPA 3VBSA 3N7LA 2WO2A 5LA9A 4Z07A 4ASLA 5F8PA 2WZR1 5K9YA 4DS0A 1O5LA 1QJFA 2DURA 3O1TA 1FOD1 3HT1A 3I3DA 4Q4W2 5BNOB 3IM0A 2VH9A 3PJQA 3LWCA 4FOVA 1GP6A 4YM1A 1AR71 1J3RA 4RHV1 5I93A 4Z2WA 1D4VB 2B5HA 1R091 1QEXA 3IIAA 1UMZA 1COV1 2LUWA 3AYAA 2VVDA 1W2NA 3TB0A 2EIBA 2WNUA 5L9RA 3HQUA 3WNPA 4DRRA 2A6XA 3MHZA 3CBNA 5CFCB 5IJRA 4IEUA 4IV1A 3OEBA 1RGSA 1VE0A 4Q5OA 5FZKA 4MX3A 1ND2A 2VD7A 3WEZA 1MEC3 1ULFA 1BVVA 4XXAA 2XPJA 3H3ZA 3AC0A 1MZFA 1DYOA 3UYJA 2VOTA 3FUOA 1RUD1 3I49A 4UWDA 3POJA 1I3HA 1IG3A 1H0BA 1VAKA 2BWAA 4EN9B 4E4SA 2WRAA 3CL1A 1GNHA 4Z82A 5BNNC 1G9BA 3FN9A 1RINA 2QDNA 3MIBA 5C3OA 1YHFA 2BJSA 2X09A 3JXSA 4P14A 1SG3A 3EXUA 3FHQA 5FRAA 1LCLA 4XC9A 5JLVA 1VRBA 4QX1A 5FYTA 5A3NA 5FOBB 3LA7A 3M8LA 3K51A 1XE0A 3PIJA 2CNAA 2W2IA 5LWBA 1LNSA 1WUVA 2W3JA 3AYCA 1Y7BA 1WA6X 4MGKE 3O14A 3NRUA 2HEYF 3D6EA 3HNYM 4YW6A 5K0UA 4AQ2A 1LRHA 2YFUA 5D8AA 4AQ6A 1W8WA 1QY4A 2P6CA 2AR6A 1W6OB 1AX1A 4MG2A 4XEZA 2JDKA 1HKDA 2Y6LA 2A75A 3AM2A 1PZ9A 4AGGA 1Q8OA 2EXJA 1CZSA 5C33A 4ASKA 5JZGB 1HRI3 1H4HA 3JUUA 4C8DA 1BZWA 4Y5SA 1VRH1 2RS12 2NLRA 3ABZA 3MUY1 2XWJB 3PUAA 4XF4A 3WG2A 4Q4X2 2G9FA 2JKBA 3ON7A 4BQXA 4DEQA 1PGL2 1QH7A 4FPGA 2IXCA 2JECA 4HONA 4PDWB 4WM8B 1IS3A 4IEVA 4YVWA 3H1YA 4OFGA 1E5HA 2WFF3 4M3CE 3CJIA 4FVVA 1DGRN 5FXXA 4BQ3A 4CXYA 3CO2A 5IT6A 3S30A 4JGYA 2PHLA 1GNZA 2WYFA 2QZ3A 4EYUA 3I2DA 1AL0G 1C5HA 2ARBA 4XUPA 3RYPA 4JKMA 1UQXA 4JTOA 2A6ZA 5F37A 4FXKB 2QQNA 4CDWB 4ITCA 5I91A 4EWAA 1UKRA 3CZUA 3KVBA 1KJRA 4LKEA 4ZY9A 1ENRA 4E4HA 4A7YA 4FPHA 3ZFFC 1KDMA 4RGGA 5KWRA 2D97A 3O1UA 3IPVA 4FPFA 5HCFA 5FZ7A 1HRV3 3GZTB 4R9BA 3C7HA 4YM0A 4ZXKA 3VBRA 4DY5A 2ZZJA 2ES3A 1CGPA 4COWA 3S57A 4XACA 1FATA 2XJPA 3NL1A 2WNEA 1EPZA 4BQWA 2W1QA 3BYWA 2HWB3 3RGBA 3RG0A 1PNFA 1AHSA 4Q0QA 3RZHA 1AX2A 1LOBA 3I2HA 4AEDA 1RUG3 1FXZA 3I3EA 3ST7A 4AGRA 4YW1A 4ZU5A 4MVTA 3U14A 1WLCA 3SXWA 5FZ0A 4OQ9A 4RGAA 1C8M3 1WMFA 1Y3TA 2W0XA 2WS92 3EMRA 3IN9A 1V9U3 5DABA 3MIDA 3HQRA 2VUJA 1SACA 3H3LA 4IETA 1WMXA 3GXUA 3HIFA 5GLZA 3I3MA 4M4RA 4S2GA 1RUF2 2UWBA 4CEWC 5KHJA 4FI9A 3OG2A 2W5FA 4I0BA 3QH6A 4KWUA 1ZZ7A 4WVWA 5DAWA 5G04L 4INDA 5D21A 4OI1A 1WW4A 2B4KA 4QHBA 5A6XA 1N3QA 4ATFA 2Y33A 3FC0A 2SLIA 5FPUA 5DDJ3 1N1SA 1CR7A 5A6ZA 1MEC1 1ZBA2 5K0UC 1F15A 4EWEA 2WA3A 2VVEA 2WNVA 2WYSA 2ARCA 3TNPB 4FBFA 1AL22 2WN3A 5F6LB 3S0MA 1WGPA 3BB6A 1GKBA 3A0NA 4HFSA 3RWKX 4RD7A 2DFBA 4ISRA 5A7WA 3V0BB 2W92A 5AFBA 3ZFEA 2WKKA 2JG8A 3E6DA 3K3OA 1JYWA 3W5MA 1JZ7A 1R082 2G19A 4MADA 2XGXA 4TTGA 3DKQA 1HW5A 1UU6A 1BLZA 1VB2A 1KD7A 1UOJA 2CYFA 2R073 2D98A 1JZ3A 4BK5A 1QKQA 2CSGA 2HWD2 2PQSA 5E89A 3UKVA 4XURA 1S0IA 3NV1A 3O1VA 2VAUA 4HVQA 3AMQA 2C9KA 3O12A 4XQDA 4P00B 3NJVA 3RJRA 2XLFA 4C91A 4EZ4A 3UNPA 1US3A 2CHHA 2JD4A 4YZ3A 4S2DA 4H55A 4LBMA 4W6XA 4AK3A 2QE3A 3NAPA 1FX5A 4XMIA 3RRDA 4Q4V2 3ZKUA 2W91A 1VP6A 4RQPA 3VHNA 5BNPB 1VPHA 3ZYJB 4CP2A 3SEEA 1UKGA 2NMNA 2QCSB 4QXKA 1V6MA 2ZHMA 1BYHA 5DG2A 5A70A 3H50A 3LIGA 4N7IA 1DF0A 2VUCA 3SH5A 4QQPA 5FK8A 2RDRA 1Q8QA 4LBNA 1RXGA 5FLHA 3K3NA 5KC6A 3VB9A 1NCQC 4FOWA 3ES4A 2E7TA 2DFCA 5DZFA 5T5PA 5A6QA 4AGVA 4Y5Z0 4BWOA 1VBD2 2ZX3A 4XDQA 5T5OA 3J8F3 4HBNA 1P8JA 4FFIA 1UF2C 4QKDA 5FO7B 4CYDA 1W6MA 1DP0A 2NM1A 3ES1A 2P2KA 3LA3A 3T2QA 1KXGA 1AVBA 3WHTA 3ZLIA 1JZ5A 2ZGRA 4XIOA 2R062 2RV9A 3AJYA 1PGW1 1HRV1 1OURA 4PIXA 2CDPA 4JDMA 3LEMA 1PO22 3D0JA 5DMYA 4OYUA 2Y6JA 4ZHNA 1UW8A 1PO13 4MXWB 4UW5A 1ASJ3 2GC3A 3O5SA 3AFGA 1RUG1 1OC1A 5T5LA 4R9AA 2ZS6B 4B7KA 1UXXX 1WCSA 3BVCA 5GLWA 4NN0A 4R4ZA 1TME2 4CEYC 2X5IA 2ZZQA 2H0VA 4LO8A 4Q0SA 4CPBA 2WZ8A 3ATGA 1ZRIA 4FPJA 1YRZA 4MHUA 3SMHA 1V9U1 1JOBA 1K5MB 2EICA 4AVAA 1YCIA 2ZHKA 4QX5A 3VD7A 5AC92 3JBG2 3MIHA 2DV9A 3TOJA 2Z5WA 1EV12 1Z0HA 2ZACA 4IEYA 1W0OA 1RUI1 5JR7B 2UU8A 1LOFC 2PXJA 3N9LA 2W9XA 4MGQA 5L7OB 3PTYA 4AFAA 1VLNA 2D3PA 2IXIA 4LO5B 3ACHA 2ADEA 2GP3A 5F9TA 1R64A 3WG3A 2JDAA 3PDQA 4U2AA 1VBB1 1PMHX 4DXRA 1SLIA 4OI2A 5DDJ1 5JXGA 4OLLA 1V6OA 1F5FA 4XE9A 1RIRA 3KT1A 4D6QA 5A3PA 1F2NA 4U36A 3VBOC 2D7FA 5L73A 4E4DX 5A1FA 4XBNA 1OBNA 1OHFA 5FMOL 4AW7A 5JSOA 3EBRA 4DO0A 2HWF3 1DGRA 1TQ5A 2LM3A 3H0OA 1W8ZA 1O3SA 4CP1A 5CBLA 2ADDA 2D93A 3GYDA 1W9TA 3KGZA 4BQ5A 1PM7A 4F3JA 1JYCA 1HB3A 5CFDC 1AR91 5EV7A 4I3PA 5IAXA 3IDAA 4QPGC 1AYM3 1US2A 3U1XA 5T54A 4FFHA 1GOFA 2R071 1MACA 4HXCA 5C8CB 2FHRA 2YGMA 4R4XA 3VDDB 4MLOA 3QD6A 3MDPA 1RUF3 1R1A2 3M7AA 5EJZB 4BQYA 4UFKA 3AZWA 3FHIB 1WBLA 2CTVA 3AKTA 1RVF1 2P3JA 3VBHA 5C4WB 2YU2A 1DLCA 3D3AA 1NCRA 4NHYA 1NA1B 1VBC2 1PZ8A 2CY6A 4JGZB 4W65A 2GDFA 3PUQA 4Y4YA 1CPNA 1RUH2 4JDOA 2HWC2 1PNGA 2O1QA 1POV0 1DQ6A 2Y26A 1DFQA 1CAXA 2VZOA 1RMU2 1EY2A 3OOXA 5F3CA 1LHVA 2B42B 4BLIA 1NQDA 5KR7A 2DTYA 3DF0A 1HB4A 4CDUA 4DOUA 4H7MA 2QQPA 3POIA 3WDVA 3B00A 5AVPA 5EZWA 3ZXDA 2AACA 3IAQA 4KI5M 4NAMA 2ZGTA 1W9WA 2MEV3 1CVNA 3FLRA 4D69A 3WF0A 2GZWA 2R0HA 3Q8EA 5FY9A 4D7SA 3SC7X 4IQPA 2XONA 3ZFGA 5A80A 3LEIA 3OBAA 5FP4A 3TYJA 4B4QA 3WW4A 4YSFA 5DAVA 5KHKA 2XLAA 3K48A 4KGGA 1OOPA 3H42B 2RM21 3VBFA 2VQAA 3UGGA 1PVC1 3LSEA 1PGSA 1B35C 1BJQA 5AFEA 3POWA 1B09A 1AR62 3WNNA 4GJZA 3ZXJA 2WZR2 1KJLA 1FOD2 4GMP0 3WQ1A 1JMUB 1GZWB 5JDBA 2WQZC 3SCFA 4W6WA 4XJZA 3SKVA 5FO8B 2QQVA 4I30A 3WDYA 4NVPA 1AR72 1UY0A 4RHV2 1QXRA 2VMEA 2YV8A 1UOFA 1K45A 4XJ9A 3CF6E 1HN0A 2NQYA 1COV2 3WX5A 3LEKA 1SLLA 3LZZA 4LO7A 3AX4A 4YNIA 4AI2A 1IQDC 4WBBA 1RUJ1 5HV4A 5LK7B 3ZXAC 1SBFA 2OZ6A 5A3WA 4RR3B 1GICA 1OFNA 2CGNA 3GJAA 1WMEA 2ZGQA 3WQ0A 5J37A 2VOKA 1WCDJ 3HOBA 1DZRA 2GC0A 4CVUA 2BBVA 2BWCA 4AE2A 1PMIA 1RUD2 1YIFA 1CIYA 5JIUA 1YXWA 4AI8A 3NNJA 2JG9C 3E5QA 4CA9A 3DYPA 1UD1A 4WVMB 1YQ2A 5ABJC 1PO23 5BNOA 1L7RA 4V1PA 1HLCA 4PJYA 2A3YA 2E31A 5FY5A 2WT1A 5A32B 1UWWA 2XVGA 4M3CB 4Y26A 5K4LA 4AHWA 3B5LB 3ZX7A 2VW0A 4A44A 2VULA 1LEDA 2ZMLA 4NMIA 3AL6A 4MH0E 3MO4A 5CFCA 3I2OA 2VZUA 3A0KA 2CWMA 3K4ZA 4XUNA 5FLJA 4BM8A 2YBPA 1AYM1 3N9QA 1XJAA 5IVEA 1GWMA 2W52A 1J58A 3QLQA 1PM4A 4AYUA 1MQTA 2D6NA 4CEWB 3N35A 2RDSA 1VRH2 1EV13 4OHWA 3WVJA 2BOIA 5DAPA 1ZZ9A 4RYDA 4XW3A 4H3WA 5LCWL 4MGYE 1BQPA 1PIV2 2D6KA 1LTEA 4M0NA 1EYBA 1FV3A 3AMNA 4LHKA 2FDJA 1UY1A 1VIWB 2ZGNA 3BODA 3BKZA 5FP9A 4QQLA 4NR1A 1NKGA 4V2VA 4D6RA 2WZPP 3CHXA 3SKJE 1QXJA 2BERA 1APNA 1Y9QA 3AYEA 3LB9A 4MGTA 4EQVA 3A22A 4FFGA 1X8EA 2J7MA 2V4VA 4TSVA 1JBCA 2VMIA 5LK5A 4RS5A 2MEV1 4PLOA 5IVBA 1NOVA 1PK6C 3MV01 5FKCA 2VXJA 4R9CA 1Y9MA 5LBCA 3W21A 1O91A 2QZ2A 4JCKA 4WZCA 5GLTA 4CRQA 5FP8A 2YYOA 4IE4A 4UYBA 3UKNA 4IE5A 1NUKA 4C0HA 4UXAA 1OLMA 3O1MA 5A33A 1D7PM 1Q8SA 1YI9A 2EVXA 1OF3A 3U78A 4PDWA 2XKOA 3O1SA 5LB6A 2Z4FA 1OA2A 2GH2A 5F1RA 1SMVA 2D44A 4IL7A 4AVTA 4XBLA 3IDCB 3LAGA 3IBMA 1W6NB 4WVZA 4GKXA 4UFMA 4HSLA 2DVAA 4M01A 2YC0A 4I0WB 4N90A 3NV2A 2WSUA 4W4ZA 5FBJA 3HEIA 3SISA 2WO1A 3FWEA 1UZ0A 4GJYA 1CX1A 4CDWA 2VBDA 2YFZA 2VMGA 3GBGA 1IPKA 5A6YA 1OD3A 2JE9A 1ZBE1 4XJWA 2FZ1A 4COVA 4Q26A 1TMF1 2BEOA 3OUJA 1G9CA 1MEC2 5KXDA 4H2AA 3E5XA 3EJKA 4N43B 2AC1A 1LOEA 2ZEXA 5FCCA 4XXPA 5IK5A 3M4FA 5EFUA 1ACCA 1RUE3 1ZM1A 2J1SA 2FBEA 1HXS3 1MR5A 4GWMA 3IKWA 3RNSA 3PL0A 4FPLA 2ZKNA 2YHJA 4UBGA 2VNGA 1C4RA 2ZTNA 4I0AA 4HKWA 2HWE1 5E6HA 2WFPA 4G3YC 5LBEA 1X9PA 1RITA 2MHFA 1CAUA 5F2SA 3WXPA 5IVCA 4IGPA 4ET7A 3ZYBA 3VZJA 1GZTA 2VM9A 3K46A 3POYA 3VKOA 1RL3A 4AXOA 4CP0A 1BK0A 1XB9A 3N9MA 3KD4A 4JRAA 2KA3A 1JTZX 1SPPB 5CKQA 1R093 1XRUA 3PMEA 1W9SA 2DCZA 3AZYA 4LOTA 2OS2A 3HN1A 3PLQA 4Y1ZA 5BNQA 3WP3A 2UURA 5C9AC 3S7EA 2EAKA 4RGKA 1XPWA 2BZDA 3VHPA 1JOJA 1QF3A 1HN1A 4NOTA 3RFRA 1UU4A 4QPIA 4K6BA 2VMDA 5FZ6A 1DGLA 4WM7C 1YQ8A 4IGQA 3N7JA 1HRI2 2OQ6A 1O4TA 1QH6A 1REFA 2B39A 2PMWB 3LPGA 4H14A 2EIEA 4NUBA 3ZYGA 5IK4A 1O3RA 4LUMA 5FR3A 1IS6A 5FP7A 1DQ4A 1VBE3 4META 2Q5TA 4CDQB 5C8WA 4XUOA 3WSOA 3WQBA 4Y1UA 2IFRA 2NZ9A 4NIAA 1RXFA 2K9ZA 4IEQA 1BMV1 4GXLA 1KQRA 1UAIA 1BXHA 4CDXB 3LFMA 2GC2A 3ZSJA 3MLKA 5HCBA 3RZMA 4CU8A 4LULA 2BQPA 3DPRC 5HCHA 4M0HA 5A7OA 1OA3A 1VALA 1W2AX 2DCTA 3INAA 5EIYB 2D6MA 3K77A 2Z42A 1S1AA 2ZGOA 3IT8A 2VXRA 4GWNA 4PBOA 1JYNA 5CFDB 1HRV2 1IS5A 5CEHA 3OB8A 1DDLA 1OSGA 4UBHA 3CKHA 4FFFA 4GH4C 2QQMA 2RMU3 4XAAA 1EUTA 5FPBA 4B7EA 4NIDA 5BNPA 2HWB2 4N7UA 5FUPA 4JX0A 1GFF2 4NWWA 4G4FA 1RUG2 4AI0A 4WZFA 3AP5A 4A3XA 1L7LA 2R16A 1WA4A 2QQKA 2WWJA 4MOAA 4A2UA 1DHKB 2YZ4A 2BYVE 1C8M2 3T2PA 3KF5A 1KEXA 1FT9A 2R30A 4UT5A 4A7ZA 1V9U2 5FYCA 1AR83 5AVAA 1EAH3 5GLVA 1MS1A 3RWNA 1VBA1 3M2MA 2TEPA 2FCVA 4EE2A 1ENXA 4UW6A 3U4SA 5EJ3A 5FLIA 5F6KA 2GN3A 3FFZA 3LDRA 2BP6A 4OULA 4LNVA 1NY71 5CG9A 4XZPA 2ZGPA 3JCIA 5C3PA 1CESA 4L11A 3X29B 4QX3A 3VBSC 5DDJ2 5I0TA 2HBTA 4PQ9A 3WP4A 4PIZA 2Y6FA 2BTVC 1WLTA 3DXTA 3MICA 4LKDA 4MXWA 4UI9L 1GR3A 4COUA 1RB8G 3VD5A 2V4AA 3KQ4B 4P02B 2A73B 3VBUB 2BVBA 1RUE1 3WP6A 5JXHA 1HXS1 2JDUA 4MV2A 2VECA 2WNOA 1A78A 3NJYA 4NO4A 5IVYA 2RG4A 4I3GA 1UZVA 2O8OA 2FCUA 1CX4A 3T0AA 2KD7A 2WWUA 2WNUC 3MBWA 2OT7A 5BYNA 1F9KA 3ACIA 3GDBA 4AI1A 3ETPA 2DU0A 1Q8PA 1EP0A 2VQUA 2R072 4IV1C 2VCMA 3I7DA 5B4NA 1GQPA 1ND2C 3LFIA 4JTNA 2HEVF 4GZ9A 1MS3A 5L7OA 1JS9A 2YC2A 1N1TA 3PU3A 1NYWA 3AP6A 2VGDA 1QDOA 3ZR5A 5A3UA 1S55A 1JODA 3A23A 3M3QA 4NRPA 4WV8A 4ZXEA 2QTWB 3T2TA 3CDZB 3ZIXA 2ZPXA 2ERFA 5C3QA 3WF1A 2CGPA 3PIGA 5BPXA 2FZ2A 1W04A 3ZR6A 2PAKA 1DYKA 4CUGA 4LKSA 2LW8A 4AHZA 1C5IA 3PTRB 2RE9A 1VBE1 2PYTA 3FLTA 1JXNA 4PLNA 4OQ8A 4DINB 2VBBA 4JKKA 2E51A 2XJSA 1OH3A 3MZHA 5D8AC 4QX0A 5F2WA 1AYN3 3AKPA 1V0AA 5T52A 1X82A 5C8CA 2RVAA 3EO6A 3H8UA 1JOPA 1CZVA 3J8F2 3NV3A 4XVHA 3VDDA 2F4LA 2HBUA 5FDBA 1AX0A 3UGFA 3ZPYA 2R7EB 2C0ZA 5FAXA 5C4WA 3OPWA 3ZMNA 3HPNA 4NRQA 2VW1A 2R32A 1N3OA 1NA1A 2YROA 2TNFA 4ES8A 1WD4A 1W2TA 3NSTA 4JGZA 5FQ0A 4QPWA 4YVWC 1L7QA 1Y43B 2JE7A 1HIXA 2P4EA 2RMU1 3BALA 5FZCA 3BU7A 3CJIC 5I0SA 1PO12 3MYXA 2L9LA 2G9GA 3KCYA 1ASJ2 3T0DA 1D2SA 1QJX3 4MSVA 4XF3A 1PHMA 4JGYC 3VKMA 4BDVB 4YGBA 1FPN3 4QQOA 2WDBA 3EB7A 1BBT1 2QJVA 1YJKA 3SH3A 2QQLA 3PVOA 2IUWA 3QCWA 3AP9A 4AG4A 4Z2AA 4UFJA 4XHBA 1S0EA 1ENQA 5JXIA 2XQRA 1AR81 3KV5A 5ACA3 3ZYFA 4I2OA 5FUIA 1H8TB 1EAH1 4LHSA 4EN7B 2NP0A 1MS4A 3VBRC 4FAHA 2WJSA 5L19A 4XETA 4Q0VA 3OGVA 4FP3A 1LENA 3C7EA 4NHXA 2W46A 1RUOA 1HV0A 1L3JA 5EWSA 4QU2A 4AEDC 2WLPA 4NROA 2G4IA 3D5OA 2NN8A 2VO5A 1BK1A 2EXIA 4HETA 1H9PA 4KH9A 5A1AA 4YVSB 4LPLA 2BW8A 4Q8KA 3QH7A 1OMIA 4AHXA 1GZWA 2Y0OA 3P5BA 2ZCWA 4LBQB 3SCGA 2WINB 4LIVA 4XF9A 3ZXGA 2HWF2 2ZX0A 4GULA 2ARAA 3LD8A 2UWAA 3H7JA 3MFAA 3M1HA 5FMOS 4CCEA 5BY5A 1XC6A 5LA0A 3DKWA 3LIHA 1LOGA 3KMHA 1YQ6A 4URTA 4NIHA 3POEA 4Y1XA 3RI9A 2J1AA 2ILMA 1AYM2 2AYHA 3T3YA 1IG0A 1RJ7A 3JQWA 1NLSA 4RR3A 4Y33A 1REDA 3VDCA 4XDPA 5KC5A 2BNMA 3VGIA 4MUVA 5FZOB 4Q0UA 4Y1VA 1UCXA 3CLPA 4Y1YA 1RUI3 2WNVC 3HBZA 1LAJA 1G8WA 5FZFA 4AI3A 2YY1A 3Q8AA 1W9YA 4UW3A 5H9PA 3J7NA 1QNYA 1I1EA 1OLQA 2TUNA 3B01A 1VBB3 2R0FA 3W59A 3LOIA 3ZFEC 1V70A 4Q0PA 2FDHA 4PCRA 1M4WA 4BHPA 2JG8C 2Q0AA 4D7YA 3EHKA 3AMPA 4P08A 4Q4Y1 3T4VA 1OQ1A 5A32A 5IFTA 3U4XA 2HJIA 2E26A 3A4UA 1XE7A 4MZUA 3WW3A 2ZX1A 3B93A 3I2JA 3I2GA 1R1ZA 4CCJA 1C8NA 5F5QA 4XJAA 4MYEA 4AL9A 3NW4A 2MEV2 5L36A 2IWGB 3LSDA 1AR93 1AYN1 3H1WA 5DAXA 1UOGA 5GZEA 1W6PB 3UL2A 4D6SA 4XFIA 3DL3A 1GP4A 5KXCA 4YPJA 3ITQA 1QJEA 5HCAA 4N53B 3NAPC 4RQPC 1VR3A 3VL8A 1W8OA 1QOOA 2YBKA 3C7GA 3G7DA 3A21A 1ND3A 2EAAA 4OI4A 4E9KA 4N9HA 1RVF3 4BE3A 4Y24A 4CU7A 5FKBA 4B29A 2IC1A
chains in the Genus database with same CATH topology
3K4AA 3ZM8A 1JZ2A 5JUVA 1JYVA 4UOJA 1OT5A 2VMFA 2WBKA 2C4XA 4D0QA 4L0PA 3WNNA 4DXSA 2YB7A 2Y6HA 3VDAA 3SKVA 3T09A 2ZEZA 1UY0A 2VMEA 1K45A 1GU3A 1SDDB 5C71A 3LEKA 2DCKA 3OGSA 5IFPA 1UY3A 2ZEYA 1IQDC 3HNBM 4A6OA 3LQCA 1WKYA 1F4AA 2Y6KA 2VCBA 3HOBA 4XUTA 2VZ1A 2VTFA 3GGLA 4CVUA 1UY2A 2YG0A 2ORZA 1W0NA 1H6YA 1CIYA 2J1VA 3DYPA 4CUCA 1YQ2A 3I97A 4ARYA 4DUWA 1L7RA 1MPXA 1UX7A 3OEAA 3VD4A 3P1IA 2E31A 2V5DA 1UWWA 1UY4A 4MGSA 5C7GA 2WO3A 4JHZA 4A44A 2BBAA 2VC9A 3MO4A 4W8JA 3K4DA 2VZUA 2J22A 3K4ZA 4XUNA 1JU3A 4QAWA 3T2OA 2VCCA 1UMIA 1TG7A 1ULOA 1ULPA 1GUIA 4RYDA 2W95A 5LCWL 3ACFA 3THDA 1OF4A 5I0DA 2WUHA 3NJXA 1JHJA 1UY1A 2HLEA 3CQOA 2JKXA 4QDQA 4TXWA 4CUAA 5J1XA 1NKGA 2CDOA 3SKJE 3EYPA 2V72A 3PUHA 5LA2A 3LPFA 2BERA 1JU4A 3A22A 2V4VA 2J7MA 4DXTA 4QX2A 1PX4A 3WF3A 4AAXA 4XZUG 2J1UA 3NNGA 3MV01 2X10A 1UMHA 2VZVA 3C7FA 5B4XA 3I3BA 2X05A 1GOHA 2XQXA 3DECA 1NUKA 1K42A 4HG6B 1K3IA 1D7PM 1F4HA 1OF3A 5DPNA 2Z4FA 4DUVA 2VCAA 2E33A 5JR2A 3OGRA 1PMJX 3DYMA 3WF2A 4E8CA 2VZQA 3T08A 2WO2A 4W4ZA 3HEIA 2WO1A 1UZ0A 1CX1A 2YFZA 3I3DA 4OMCA 1OD3A 1O8SA 1O8PA 4W50A 3ACGA 2WABA 1KGYA 4PT6A 2XHNA 2VL4A 4JKLA 2EIBA 3WNPA 5CZKA 1RYYA 2ZEXA 2WQ8A 1W8NA 5IJRA 3OEBA 2J1SA 1T2XA 3WEZA 3HJRA 3AC0A 1DYOA 4OZOA 2VOTA 4ET7A 4BJ0A 2VM9A 3K46A 4OMDA 4CUBA 3FN9A 3UETA 4QB2A 1W9SA 1JZ8A 3JXSA 2X09A 1SG3A 3FHQA 4ZZ8A 2WN2A 4QX1A 1XPWA 2BZDA 3A7QA 1HN1A 1LNSA 2VMDA 2W3JA 3IIIA 2W47A 3NRUA 3HNYM 4DEVA 3LPGA 3VDBA 2YFUA 2EIEA 2Y6LA 4XUOA 3WSOA 3WQBA 1CZSA 2DCJA 2B9VA 1SHWB 3MUY1 3ABZA 4A42A 4DEQA 2HYXA 3THCA 4CU8A 4MO3M 5EIYB 3LE0A 3K77A 3W5NA 4IUGA 4QB1A 1H6XA 1GOGA 1JYNA 2W87A 4XUPA 2DDUA 4JKMA 5JMOA 1J83A 3OB8A 3WF4A 2QQNA 3CKHA 2QQMA 2BGOA 2QQIA 1EUTA 5C70A 3CZUA 2JD9A 4ZY9A 1UYYA 4JX0A 4LQRA 3C7HA 1UYZA 2QQKA 4MOAA 2VZTA 3T2PA 2W1QA 4GWIA 1KEXA 3I2HA 3I3EA 1JI6A 2QQOA 2E32A 2J1EA 3C7OA 3BGAA 4GWJA 3GM8A 4A41A 5HPOA 2YC4A 3GXUA 2ID4A 5JXJA 4M4RA 4QX3A 4FI9A 2W1UA 3OG2A 2W5FA 3CMGA 4KWUA 5G04L 3C8XA 4UI9L 3VD5A 4P02B 1NAEA 2B4KA 3MUZ1 2VZ3A 5JXHA 4P5YA 3T0AA 2KD7A 4A3ZA 3LEGA 2WYSA 3HN3A 3MBWA 2WN3A 3ACIA 3GDBA 3CZJA 3ETPA 2VQUA 5B4NA 2W92A 1XNTA 1GQPA 4GZ9A 1JYWA 3U37A 3W5MA 1JZ7A 4MADA 4TTGA 2YC2A 4RN5A 3A23A 1JZ3A 4ZXEA 4BK5A 3CDZB 2PQSA 2BGPA 4XURA 3T0BA 3WF1A 4QDSA 2C9KA 3WNMA 4P00B 3NJVA 4LKSA 2LW8A 4A45A 3UNPA 1US3A 5G05L 1GNYA 4JKKA 1J84A 2W91A 2VMCA 2W94A 3SEEA 3FHAA 4QDRA 4QX0A 3F2ZA 3HNMA 2RVAA 4XVHA 1CZVA 2ZXQA 3FL7A 5LA1A 2C26A 2R7EB 3MV11 2LS6A 2VR4A 1WCQA 3HPNA 1O59A 2J1RA 1P8JA 1L7QA 4QPWA 1DP0A 3T2QA 1JZ5A 2L9LA 2VQTA 3T0DA 2RV9A 4BDVB 3VD3A 2CDPA 2WDBA 3WNLA 2QQJA 3EB7A 1XNAA 5DMYA 2QQLA 3P6BA 4OYUA 3ECQA 2Y6JA 4AG4A 3BN6A 5DN2A 4Z2AA 4E8DA 2XOMA 5JXIA 3IAPA 3I2FA 1UXXX 3DYOA 4LHSA 5EJ1B 5FUIA 4BXSV 3WNOA 4M4PA 4A4AA 3PUIA 1CZTA 5HXMA 2OKXA 3OGVA 2WZ8A 1GMMA 3C7EA 2W46A 2VJXA 4BK4A 1PX3A 2EICA 1EUUA 1UXZA 3VD7A 2RJ2A 3E1F1 5F7UA 3WNKA 4UAPA 2VO5A 3CIHA 4DUXA 5A1AA 4LPLA 4MGQA 5IHRA 2W9XA 4CU6A 5IYYA 2QBXA 2VZRA 3ACHA 1R64A 2Y8KA 2JDAA 3J7HA 1PMHX 4DXRA 3I2KA 5JXGA 5LA0A 5CYYA 1XC6A 3IB3A 1NX9A 3K75B 4D8MA 1JZ6A 1K12A 2Y6GA 2J1AA 1UYXA 1W99A 4PQQA 3VDCA 2JE8A 3I2IA 1W9TA 3SEPA 3IDAA 1US2A 2Y64A 1GOFA 3UESA 2W1WA 1OH4A 2EIDA 2J1TA 4ARXA 3NQHA 5EJZB 2ORXA 4CU9A 4PF1A 1I5PA 4P08A 1DLCA 3D3AA 5IFTA 2E26A 4ZZ5A 2WAOA 3VD9A 3I2JA 3I2GA 1JYXA 3OBAA 2VZOA 1TVGA 2WZEA 2WAAA 1JZ4A 4YPJA 4OUEA 2ZEWA 3IAQA 4KI5M 4QB6A 1W9WA 1W8OA 2VZSA 3C7GA 4XUQA 3A21A 4KMQA 3WF0A 5DQ0A 2VZPA 4CU7A 2XONA 3LEIA 1BHGA 2W1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K4A A;  3ZM8 A;  1JZ2 A;  5JUV A;  1JYV A;  4UOJ A;  1OT5 A;  2VMF A;  2WBK A;  2C4X A;  4D0Q A;  4L0P A;  3WNN A;  4DXS A;  2YB7 A;  2Y6H A;  3VDA A;  3SKV A;  3T09 A;  2ZEZ A;  1UY0 A;  2VME A;  1K45 A;  1GU3 A;  1SDD B;  5C71 A;  3LEK A;  2DCK A;  3OGS A;  5IFP A;  1UY3 A;  2ZEY A;  1IQD C;  3HNB M;  4A6O A;  3LQC A;  1WKY A;  1F4A A;  2Y6K A;  2VCB A;  3HOB A;  4XUT A;  2VZ1 A;  2VTF A;  3GGL A;  4CVU A;  1UY2 A;  2YG0 A;  2ORZ A;  1W0N A;  1H6Y A;  1CIY A;  2J1V A;  3DYP A;  4CUC A;  1YQ2 A;  3I97 A;  4ARY A;  4DUW A;  1L7R A;  1MPX A;  1UX7 A;  3OEA A;  3VD4 A;  3P1I A;  2E31 A;  2V5D A;  1UWW A;  1UY4 A;  4MGS A;  5C7G A;  2WO3 A;  4JHZ A;  4A44 A;  2BBA A;  2VC9 A;  3MO4 A;  4W8J A;  3K4D A;  2VZU A;  2J22 A;  3K4Z A;  4XUN A;  1JU3 A;  4QAW A;  3T2O A;  2VCC A;  1UMI A;  1TG7 A;  1ULO A;  1ULP A;  1GUI A;  4RYD A;  2W95 A;  5LCW L;  3ACF A;  3THD A;  1OF4 A;  5I0D A;  2WUH A;  3NJX A;  1JHJ A;  1UY1 A;  2HLE A;  3CQO A;  2JKX A;  4QDQ A;  4TXW A;  4CUA A;  5J1X A;  1NKG A;  2CDO A;  3SKJ E;  3EYP A;  2V72 A;  3PUH A;  5LA2 A;  3LPF A;  2BER A;  1JU4 A;  3A22 A;  2V4V A;  2J7M A;  4DXT A;  4QX2 A;  1PX4 A;  3WF3 A;  4AAX A;  4XZU G;  2J1U A;  3NNG A;  3MV0 1;  2X10 A;  1UMH A;  2VZV A;  3C7F A;  5B4X A;  3I3B A;  2X05 A;  1GOH A;  2XQX A;  3DEC A;  1NUK A;  1K42 A;  4HG6 B;  1K3I A;  1D7P M;  1F4H A;  1OF3 A;  5DPN A;  2Z4F A;  4DUV A;  2VCA A;  2E33 A;  5JR2 A;  3OGR A;  1PMJ X;  3DYM A;  3WF2 A;  4E8C A;  2VZQ A;  3T08 A;  2WO2 A;  4W4Z A;  3HEI A;  2WO1 A;  1UZ0 A;  1CX1 A;  2YFZ A;  3I3D A;  4OMC A;  1OD3 A;  1O8S A;  1O8P A;  4W50 A;  3ACG A;  2WAB A;  1KGY A;  4PT6 A;  2XHN A;  2VL4 A;  4JKL A;  2EIB A;  3WNP A;  5CZK A;  1RYY A;  2ZEX A;  2WQ8 A;  1W8N A;  5IJR A;  3OEB A;  2J1S A;  1T2X A;  3WEZ A;  3HJR A;  3AC0 A;  1DYO A;  4OZO A;  2VOT A;  4ET7 A;  4BJ0 A;  2VM9 A;  3K46 A;  4OMD A;  4CUB A;  3FN9 A;  3UET A;  4QB2 A;  1W9S A;  1JZ8 A;  3JXS A;  2X09 A;  1SG3 A;  3FHQ A;  4ZZ8 A;  2WN2 A;  4QX1 A;  1XPW A;  2BZD A;  3A7Q A;  1HN1 A;  1LNS A;  2VMD A;  2W3J A;  3III A;  2W47 A;  3NRU A;  3HNY M;  4DEV A;  3LPG A;  3VDB A;  2YFU A;  2EIE A;  2Y6L A;  4XUO A;  3WSO A;  3WQB A;  1CZS A;  2DCJ A;  2B9V A;  1SHW B;  3MUY 1;  3ABZ A;  4A42 A;  4DEQ A;  2HYX A;  3THC A;  4CU8 A;  4MO3 M;  5EIY B;  3LE0 A;  3K77 A;  3W5N A;  4IUG A;  4QB1 A;  1H6X A;  1GOG A;  1JYN A;  2W87 A;  4XUP A;  2DDU A;  4JKM A;  5JMO A;  1J83 A;  3OB8 A;  3WF4 A;  2QQN A;  3CKH A;  2QQM A;  2BGO A;  2QQI A;  1EUT A;  5C70 A;  3CZU A;  2JD9 A;  4ZY9 A;  1UYY A;  4JX0 A;  4LQR A;  3C7H A;  1UYZ A;  2QQK A;  4MOA A;  2VZT A;  3T2P A;  2W1Q A;  4GWI A;  1KEX A;  3I2H A;  3I3E A;  1JI6 A;  2QQO A;  2E32 A;  2J1E A;  3C7O A;  3BGA A;  4GWJ A;  3GM8 A;  4A41 A;  5HPO A;  2YC4 A;  3GXU A;  2ID4 A;  5JXJ A;  4M4R A;  4QX3 A;  4FI9 A;  2W1U A;  3OG2 A;  2W5F A;  3CMG A;  4KWU A;  5G04 L;  3C8X A;  4UI9 L;  3VD5 A;  4P02 B;  1NAE A;  2B4K A;  3MUZ 1;  2VZ3 A;  5JXH A;  4P5Y A;  3T0A A;  2KD7 A;  4A3Z A;  3LEG A;  2WYS A;  3HN3 A;  3MBW A;  2WN3 A;  3ACI A;  3GDB A;  3CZJ A;  3ETP A;  2VQU A;  5B4N A;  2W92 A;  1XNT A;  1GQP A;  4GZ9 A;  1JYW A;  3U37 A;  3W5M A;  1JZ7 A;  4MAD A;  4TTG A;  2YC2 A;  4RN5 A;  3A23 A;  1JZ3 A;  4ZXE A;  4BK5 A;  3CDZ B;  2PQS A;  2BGP A;  4XUR A;  3T0B A;  3WF1 A;  4QDS A;  2C9K A;  3WNM A;  4P00 B;  3NJV A;  4LKS A;  2LW8 A;  4A45 A;  3UNP A;  1US3 A;  5G05 L;  1GNY A;  4JKK A;  1J84 A;  2W91 A;  2VMC A;  2W94 A;  3SEE A;  3FHA A;  4QDR A;  4QX0 A;  3F2Z A;  3HNM A;  2RVA A;  4XVH A;  1CZV A;  2ZXQ A;  3FL7 A;  5LA1 A;  2C26 A;  2R7E B;  3MV1 1;  2LS6 A;  2VR4 A;  1WCQ A;  3HPN A;  1O59 A;  2J1R A;  1P8J A;  1L7Q A;  4QPW A;  1DP0 A;  3T2Q A;  1JZ5 A;  2L9L A;  2VQT A;  3T0D A;  2RV9 A;  4BDV B;  3VD3 A;  2CDP A;  2WDB A;  3WNL A;  2QQJ A;  3EB7 A;  1XNA A;  5DMY A;  2QQL A;  3P6B A;  4OYU A;  3ECQ A;  2Y6J A;  4AG4 A;  3BN6 A;  5DN2 A;  4Z2A A;  4E8D A;  2XOM A;  5JXI A;  3IAP A;  3I2F A;  1UXX X;  3DYO A;  4LHS A;  5EJ1 B;  5FUI A;  4BXS V;  3WNO A;  4M4P A;  4A4A A;  3PUI A;  1CZT A;  5HXM A;  2OKX A;  3OGV A;  2WZ8 A;  1GMM A;  3C7E A;  2W46 A;  2VJX A;  4BK4 A;  1PX3 A;  2EIC A;  1EUU A;  1UXZ A;  3VD7 A;  2RJ2 A;  3E1F 1;  5F7U A;  3WNK A;  4UAP A;  2VO5 A;  3CIH A;  4DUX A;  5A1A A;  4LPL A;  4MGQ A;  5IHR A;  2W9X A;  4CU6 A;  5IYY A;  2QBX A;  2VZR A;  3ACH A;  1R64 A;  2Y8K A;  2JDA A;  3J7H A;  1PMH X;  4DXR A;  3I2K A;  5JXG A;  5LA0 A;  5CYY A;  1XC6 A;  3IB3 A;  1NX9 A;  3K75 B;  4D8M A;  1JZ6 A;  1K12 A;  2Y6G A;  2J1A A;  1UYX A;  1W99 A;  4PQQ A;  3VDC A;  2JE8 A;  3I2I A;  1W9T A;  3SEP A;  3IDA A;  1US2 A;  2Y64 A;  1GOF A;  3UES A;  2W1W A;  1OH4 A;  2EID A;  2J1T A;  4ARX A;  3NQH A;  5EJZ B;  2ORX A;  4CU9 A;  4PF1 A;  1I5P A;  4P08 A;  1DLC A;  3D3A A;  5IFT A;  2E26 A;  4ZZ5 A;  2WAO A;  3VD9 A;  3I2J A;  3I2G A;  1JYX A;  3OBA A;  2VZO A;  1TVG A;  2WZE A;  2WAA A;  1JZ4 A;  4YPJ A;  4OUE A;  2ZEW A;  3IAQ A;  4KI5 M;  4QB6 A;  1W9W A;  1W8O A;  2VZS A;  3C7G A;  4XUQ A;  3A21 A;  4KMQ A;  3WF0 A;  5DQ0 A;  2VZP A;  4CU7 A;  2XON A;  3LEI A;  1BHG A;  2W1S A; 
#chains in the Genus database with same CATH topology
 4GB3 1;  2VPV A;  1CD3 G;  3POG A;  3Q8F A;  1YO8 A;  3R6S A;  3BTZ A;  4XFA A;  1W8T A;  3B9C A;  3THP A;  5JUV A;  3ASI A;  2HKX A;  1QJX 1;  5E88 A;  3DV8 A;  1FPN 1;  1CAW B;  5FZ9 A;  4Y22 A;  2WR9 A;  3OY8 A;  5LY1 A;  4DXS A;  4LO6 B;  1I9R A;  4IEP A;  5BUV A;  2A6V A;  3T09 A;  4QU1 A;  3KS7 A;  1SBE A;  3ZYI B;  1N47 A;  5ACA 1;  1NE4 A;  1N1Y A;  4HAN A;  2D3R A;  3H3U A;  1LOA A;  3N7K A;  3FUQ A;  2X53 S;  4FT8 A;  5FYY A;  5JAX A;  5FPX A;  1V6N A;  1YLL A;  3LGR A;  3HNB M;  4QX8 A;  4LIU A;  3LQC A;  4TLF A;  2RM2 3;  4RFR B;  4DQA A;  5HV0 A;  1XU2 A;  1V6J A;  1PVC 3;  1W90 A;  2X5I C;  4AHY A;  1NT0 A;  2HWE 2;  5FYB A;  3T1L A;  3AZV A;  4GH4 B;  5E1R A;  4XQW A;  2CU5 A;  1POV 3;  1NLR A;  1UY2 A;  1CQ9 A;  2JIC A;  3MIE A;  4K8R B;  3W20 A;  1UZZ A;  3QBQ A;  2J1V A;  1D0G A;  5JOX A;  1S0C A;  4GAL A;  2ZHL A;  1F31 A;  4LA3 A;  1DZT A;  5CB7 A;  4BME A;  2JWP A;  2XJV A;  3D8C A;  4DUW A;  2OII A;  1MPX A;  1UX7 A;  4QGL A;  3CEW A;  4TN7 A;  5A1L A;  5A3L A;  5SV5 A;  4QKB A;  2OUJ A;  3W58 A;  4CXX A;  2ZMK A;  4DPN A;  1RUJ 3;  1SLT A;  1UY4 A;  3TRS B;  5LAT A;  3TAY A;  1LKN A;  4O61 A;  3H7Y A;  4ATE A;  5DG1 A;  5KXB A;  2VC9 A;  2DBN A;  2NYY A;  2ZAH A;  1D0H A;  4N43 A;  4XFC A;  4W8J A;  3OD0 A;  1ZRF A;  3LKJ A;  2WL1 A;  2BFU L;  3AKR A;  4HT1 T;  4HZF A;  5F5A A;  5A3T A;  3MGU A;  3O0X A;  1I6X A;  4IV3 B;  1K5J A;  1UL9 A;  2OUH A;  2PAM A;  4B4P A;  2XLG A;  4KU8 A;  2VVF A;  1GUI A;  3P3N A;  3VBS B;  1BMV 2;  1OVS A;  1O6U A;  3UJQ A;  2XJT A;  1OQD A;  3TN9 3;  4GMP 3;  4A7K A;  2LRP A;  4K40 A;  5DAQ A;  1JUI A;  3V56 A;  1OF4 A;  5I0D A;  5BV6 A;  2GU9 A;  1RUC 3;  4YZ4 A;  5C6C A;  2SBA A;  1JHJ A;  3H9A A;  4ORF A;  1SPP A;  4XTM A;  2VY0 A;  4QDQ A;  4KWJ A;  4LT5 A;  3DCQ A;  1G86 A;  4EJR A;  1O3T A;  1KS5 A;  2PHD A;  1DBN A;  1XNB A;  1DIW A;  1MS0 A;  1UX6 A;  1YYN A;  2CDO A;  1OQE A;  5IWF A;  3VBH C;  3PUH A;  3ZIW A;  1NCR C;  5CIR A;  2F17 A;  3ZXE A;  4FTS A;  3LPF A;  4IV1 B;  1XSR A;  5JVV A;  4QX2 A;  5EYX A;  3WF3 A;  1RUN A;  1BEV 3;  2J1U A;  3GCW A;  4HSJ A;  2VZV A;  3C7F A;  3LA2 A;  4HMZ A;  5ANN A;  4CDQ A;  4AVB A;  4IEX A;  5F39 A;  2X05 A;  4BZ4 A;  3ZKY A;  4CDU C;  3DEC A;  3WUC A;  2UY9 A;  1MVE A;  1V6L A;  2XR4 A;  4O9G A;  2A7A A;  3AP7 A;  2Q8E A;  1LR5 A;  1F4H A;  1OPO A;  4CDX A;  1O5U A;  4JRL A;  4P9Y A;  1CAV A;  1PVX A;  3ZO0 B;  4DUV A;  4Q4W 1;  1XU1 A;  3ENR A;  2XJU A;  2GC1 A;  2E33 A;  3HWJ A;  4SLI A;  1DLL A;  3ZFG C;  1E5I A;  4Y4R A;  4AEJ A;  1OOP C;  3KF3 A;  1IS4 A;  5BNN B;  3FX3 A;  3O0W A;  1NY7 2;  1H9W A;  4RL7 A;  3VBF C;  2FDK A;  1DQ2 A;  5D8A B;  4DZG A;  2ZGM A;  3BIE A;  1LB2 A;  2D3S A;  3GCX A;  1OI6 A;  1YNA A;  3WOG A;  3ZN6 B;  4Y20 B;  3I54 A;  4OMC A;  5FV3 A;  1S4C A;  5KHI A;  5J7M A;  2F6B A;  1O8P A;  3WT3 A;  4COZ A;  4W50 A;  1A8M A;  1RUE 2;  2P37 A;  4JDN A;  1H2K A;  1HXS 2;  3ACG A;  5A33 B;  2WAB A;  5F3G A;  2JX9 A;  3L2Y A;  3R4U A;  3J9S A;  3N9N A;  2XHN A;  4JKL A;  1QQP 3;  5CZK A;  3HQX A;  4ZKT B;  2WQ8 A;  2PHF A;  4IE6 A;  3PUR A;  2UWC A;  1POV 1;  4ZU7 A;  3FBM A;  4NIG A;  1QWR A;  3KV4 A;  5JOW A;  1CWP A;  2XB6 C;  2A3X A;  2YMZ A;  3HJR A;  2H0B A;  4EN6 B;  4CZS A;  4OHY A;  1R09 2;  2A3W A;  1IGO A;  4YGC A;  2I45 A;  3ZYP A;  2C9A A;  4KWL A;  4OZO A;  2O0O A;  2ETE A;  1J59 A;  4YZ5 A;  1QHD A;  3M3I A;  4QHZ A;  5FMD A;  4QGN A;  2BUK A;  2BU9 A;  4KBZ A;  4ZPI A;  2ZKL A;  1VMJ A;  4FPY A;  1ZBE 3;  3KV9 A;  3MIG A;  4OMD A;  4BPZ A;  2BNO A;  3UET A;  3IPV B;  4QB2 A;  4CP9 B;  1W28 A;  1TMF 3;  4HLT A;  1OFS A;  4Q8L A;  3PNA A;  1GZC A;  3WR0 A;  5BNO C;  3VBU A;  2X29 A;  1VBE 2;  2CV6 A;  5GKA C;  1UPS A;  2C24 A;  3III A;  2W47 A;  3JU9 A;  1QU0 A;  2E63 A;  3WCS A;  3ZFF B;  4AI9 A;  4EN0 A;  1NXD 1;  4LTA A;  4J25 A;  3VDB A;  3S7I A;  3VV1 A;  1N3P A;  3TN9 1;  2XWB B;  4GMP 1;  2HWE 3;  4NPM A;  1WCU A;  5CFC C;  1HV1 A;  1FV2 A;  2K2S A;  1RUC 1;  4CCN A;  3VL9 A;  3KB5 A;  3NO8 A;  4EN8 B;  1FMD 3;  2DCJ A;  5FO9 B;  4KQ7 A;  4I09 A;  1MQT C;  3OBR A;  4LR4 A;  3AMM A;  1SHW B;  3T4H B;  2OA2 A;  2PQQ A;  4L9B A;  3THC A;  1H2N A;  1OLM E;  2GME A;  5FZD A;  4AQT A;  4K1Y A;  3R0R A;  2RMU 2;  3VHR A;  2DYC A;  1KIT A;  3W5N A;  2JJ6 A;  3HVD A;  4QB1 A;  5FZ3 A;  2P17 A;  1BEV 1;  4P9G A;  4Q29 A;  4C1X A;  2W87 A;  3JZV A;  2JDP A;  1W0P A;  5FPA A;  1J83 A;  1JYT A;  2WNV B;  3RMX A;  3WF4 A;  2R49 A;  2OXB A;  4K3U A;  2QQI A;  3KQR A;  4FPK A;  1CJD A;  2LRO A;  4HVR A;  1A3K A;  2JD9 A;  2VG9 A;  5LW9 A;  5DZG A;  3WV6 A;  1UYY A;  4BQ4 A;  4XIK A;  5A7W B;  1LUL A;  1LU1 A;  2UYA A;  5CKN A;  1AR8 2;  5FY7 A;  3VKL A;  1EAH 2;  4GD4 A;  4RS5 C;  3U10 A;  2HH9 A;  2JG8 B;  5K0U B;  3ZMO A;  4KU7 A;  4DNY A;  2YU1 A;  3O0V A;  2NMO A;  3C3V A;  5DUW A;  3HT2 A;  3SLI A;  4GWI A;  5FWE A;  4BLJ A;  1WW6 A;  2FMD A;  3OD4 A;  4YW4 A;  3OGG A;  3J4U H;  3MF9 A;  2DVF A;  1JI6 A;  1SDW A;  4OHV A;  2VOV A;  4NPR A;  1SFN A;  1GP5 A;  2E32 A;  2J1E A;  3C7O A;  4NHL A;  4PDW C;  3WZ1 A;  1X9T A;  1W6O A;  2WSV A;  1H2L A;  2PLV 3;  1Y9G A;  4GWJ A;  1G9D A;  1GYK A;  3RYR A;  2YGL A;  4DXZ A;  3DN7 A;  2WWS A;  3GM8 A;  1Q3E A;  3VZK A;  5JZG A;  4P9X A;  4NAO A;  1QJY 3;  4JQR A;  4A41 A;  3Q9O A;  3NAP B;  2YC4 A;  1IKP A;  4R9D A;  5HPO A;  3FBY A;  2AUY A;  3ETQ A;  3L2H A;  4LOR A;  3VZM A;  1ZX5 A;  3AZX A;  4LOS A;  4WM8 A;  2W1U A;  3RZZ A;  1GZ9 A;  4G9S B;  1QQP 1;  1VB4 A;  4LK6 A;  3C8X A;  4CDW C;  1JYI A;  2PHR A;  5FZM A;  3SCH A;  2DTW A;  3MUZ 1;  3POS A;  2VZ3 A;  1H8T A;  2XXZ A;  4LJH A;  4WVV A;  4SBV A;  2V09 A;  2YUE A;  1XQN A;  3E6B A;  4YFZ A;  5FPL A;  3NNL A;  5JPN B;  3BTX A;  4LLO A;  4OUS A;  5T50 A;  1VBA 3;  4HPK B;  2I2S A;  1ULE A;  4IER A;  3ZYH A;  2GND A;  4HKL A;  3CZJ A;  1W6M B;  3ZN4 A;  1LJ7 A;  3UK9 A;  4I01 A;  2VNR A;  3I4I A;  4ZU4 A;  3U11 A;  3ZPO A;  3KSC A;  1G7Y A;  5JI7 A;  1LHW A;  4MHR A;  4YVS A;  2DBI A;  2R04 3;  4FOY A;  1NCQ B;  4XMA A;  3U37 A;  4P9W A;  4Q2F A;  5FXW A;  1CJP A;  2R1D A;  2CWS A;  4J6G A;  2WO7 A;  4LBQ A;  1HDK A;  4FQ4 A;  1DGW A;  2ZMN A;  4IW3 A;  2OQ7 A;  4Q4V 1;  1D2Q A;  1IPJ A;  4YW3 A;  2PTM A;  5T55 A;  5L9V A;  5E8A A;  1ULG A;  1W2O A;  3TWI A;  2DUQ A;  5C3R A;  2BGP A;  3T0B A;  1DZQ A;  4LK7 A;  4QDS A;  2Q1F A;  4RSU A;  2QQU A;  3AXE A;  1LEM A;  5JWP A;  3AVS A;  4QPY A;  3OF1 A;  3VKF C;  4YM2 A;  4X8N A;  5F5I A;  1AYN 2;  2OX0 A;  2ZJC A;  5IAV A;  1XXN A;  1GNY A;  2OZJ A;  3D0S A;  1C3H A;  3MPB A;  4FO9 A;  3V0A B;  1FMD 1;  1ENS A;  4QPI C;  2E9Q A;  2VMC A;  3IMN A;  2N7G A;  5FZO A;  3FHA A;  3KCX A;  1CPM A;  4CEY B;  5FXV A;  1OVP A;  1XSQ A;  3B02 A;  5FBZ A;  3RPQ A;  1J3P A;  4YG3 A;  3F2Z A;  3BPS A;  1HB1 A;  3HNM A;  3VZO A;  3IDB B;  4NE9 A;  5FJK A;  2JDN A;  1G6N A;  1RJ8 A;  1TNR A;  2F4P A;  1KS4 A;  2C26 A;  4GB3 2;  5GJ6 A;  4D3W A;  3IZO A;  3MV1 1;  4P9J A;  1UZY A;  3N36 A;  1XYO A;  1J3Q A;  4K9S A;  2EXH A;  1QJX 2;  4P5H A;  1G9F A;  3WNX A;  1W39 A;  4QKF A;  4FP2 A;  1FPN 2;  1GQH A;  1O59 A;  1Q56 A;  3AJZ A;  4CPB D;  3PVB B;  3OPZ A;  2J1R A;  4M3C F;  5LEK A;  4BH9 A;  1HQL A;  1NXM A;  1SZB A;  1ONA A;  3V0B A;  1QXP A;  3O7O A;  2IXJ A;  5HBA A;  3IMM A;  4Y5T A;  4OHZ A;  1S0J A;  2VQT A;  3ZVX A;  1ZA4 A;  5T3N A;  4JC1 A;  3VZL A;  5ACA 2;  3TNQ A;  3VD3 A;  2QQJ A;  1QOS A;  1IKQ A;  1W6P A;  1UO9 A;  3HAG A;  4XPV A;  3ROU A;  3B94 A;  5AC9 1;  5FZ8 A;  3VBO B;  2BVV A;  3RZK A;  4QM8 A;  3BN6 A;  5DN2 A;  1NE6 A;  4N53 A;  3JB4 C;  2DU1 A;  4OCT A;  5D2A A;  2GN7 A;  2XOM A;  3THT A;  5BNP C;  1W8U A;  3IAP A;  5FYZ A;  4AQS A;  3I2F A;  5EJ1 B;  4AF9 A;  3WNO A;  1POQ A;  1PGW 2;  3PUI A;  2PLV 1;  2IXL A;  4BXF A;  1GMM A;  4LA2 A;  2YPD A;  4QPG B;  1ULD A;  1NCR B;  1SFY A;  2H6C A;  1PX3 A;  2VJX A;  3UV9 A;  5M0T A;  1UXZ A;  2RJ2 A;  1QJY 1;  1WMD A;  2GMM A;  3OYW B;  4UAP A;  3CIH A;  1I5Z A;  3GBF A;  2XUE A;  1S0D A;  2GNT A;  1BBT 3;  2JDH A;  2VBP A;  1SCS A;  5FPZ A;  4CU6 A;  4OVE A;  2UYB A;  2VZR A;  2Y8K A;  4HL0 A;  2CAU A;  1VAV A;  2VUA A;  5A3M A;  3J7H A;  4PBP A;  3CU7 A;  1DQ5 A;  4ZS3 A;  4NHK A;  1LGC A;  4IXL A;  5TSW A;  4LMF A;  3KHC A;  4NWV A;  1NX9 A;  4AEK A;  4DIQ A;  1U5I A;  4HOO A;  1CIW A;  1WLD A;  1K12 A;  4IE7 A;  5DUX A;  2P3K A;  1ZA7 A;  3OUH A;  4XFG A;  3ZFG B;  1RUI 2;  1UYX A;  2WII B;  3M3E A;  5LEJ A;  1R1A 1;  1OOP B;  1UIJ A;  1SBD A;  3KGL A;  4PQQ A;  2XBO 1;  4CCC A;  2JE8 A;  1CON A;  4Z8B A;  3BU0 A;  4QT6 A;  3F95 A;  2R04 1;  1VBB 2;  1URX A;  2PHW A;  1EPW A;  3NKT A;  2OYZ A;  1X8M A;  4QGM A;  4PF5 A;  2VMH A;  2Y64 A;  1LGN A;  2HWC 1;  3GAL A;  1U12 A;  1PZ7 A;  1XE8 A;  1QMJ A;  3AB0 A;  3I8T A;  5FTT C;  2Y60 A;  3VN4 A;  3GZA A;  2EID A;  1LOC A;  5GZD A;  4AOC A;  3VHO A;  2J1T A;  3WP5 A;  1HX6 A;  4IES A;  4YW7 A;  4ARX A;  2ORX A;  4AZZ A;  1F8V A;  1SCR A;  1FNZ A;  1TEI A;  1FI2 A;  3POF A;  5CKM A;  1B35 B;  1X36 A;  3AK0 A;  4BMB A;  2JIJ A;  4M00 A;  4CU9 A;  1I5P A;  4ES9 A;  5L7O C;  4KWK A;  2HYK A;  3VKN A;  1OXC A;  4XFF A;  3T30 A;  5IVF A;  1AR9 2;  3RJ2 X;  2H6B A;  4DMI A;  1K5M A;  2RR1 3;  1IHM A;  1J1T A;  1VMH A;  2XML A;  3M3C A;  1OPM A;  4LO4 B;  2E53 A;  4O7X A;  1Z7S 3;  1ZZB A;  4S2H A;  5FZ4 A;  1ZRE A;  4AVV A;  3VD9 A;  1JYX A;  3H8R A;  4IEZ A;  1TVG A;  4UF0 B;  4GKY A;  2WZE A;  1RVF 2;  4IV3 A;  4LBJ A;  5IUQ A;  1TE1 B;  2WAA A;  1BCX A;  3FE5 A;  1G9A A;  2ZEW A;  5LZ6 A;  5EQU A;  1AR6 1;  2QNK A;  1DQ1 A;  2QVS B;  1F35 A;  2D43 A;  1S2E A;  4KMQ A;  5KXE A;  4E2Q A;  1W8H A;  2Y38 A;  1UZW A;  5DQ0 A;  4ZS2 A;  4Q4Y 3;  3VLB B;  1XOY A;  4HVO A;  3S5A A;  2W1S A;  5C8C C;  2PHU A;  3OGJ A;  3ZSE A;  2W68 A;  4NII A;  1QJU 1;  3K4A A;  3MI8 A;  3NVC A;  5FUN A;  3VDD C;  4FOQ A;  1DGW X;  4UOJ A;  2JG9 B;  2JDZ A;  4LHN A;  3BUC A;  2GP5 A;  3O1P A;  4D0Q A;  1S0F A;  2C4X A;  4L0P A;  3L9J T;  4P9I A;  5C4W C;  5ABJ B;  2ZBJ A;  1YC6 1;  5I8T A;  2XUM A;  2YB7 A;  5L9B A;  1NA1 C;  1YI7 A;  2Y6H A;  4JGZ C;  1ZNP A;  2CGO A;  1YEW A;  2RS5 3;  3ZOI A;  3LOB A;  1OD5 A;  1MQT B;  2A6Y A;  2MNG A;  2ZEZ A;  5F3E A;  1GU3 A;  2RM2 2;  1ZYB A;  2K0G A;  3HBK A;  2B7Y A;  4HN0 A;  4JV4 A;  4YW2 A;  5C71 A;  3H8X A;  4LLF A;  1O4Y A;  1PVC 2;  3TEZ A;  1C1F A;  2WA4 A;  5IW0 A;  4ASM B;  1UY3 A;  1DU3 D;  2A5Z A;  4GB3 3;  3TEX A;  1NLQ A;  4UFH A;  4JVA A;  4YWA A;  3U75 A;  3WD5 A;  1WKY A;  1F4A A;  2PFW A;  2LAL A;  1DCS A;  2XG3 A;  2QQW A;  4L92 A;  1MZE A;  2Y6K A;  4L2N A;  1ST8 A;  4FAG A;  1F5J A;  4YM3 A;  2VCB A;  3D4K A;  3RI8 A;  1XNK A;  2VZ1 A;  2ZGS A;  3GGL A;  1JUH A;  2ZAA A;  2RDQ A;  4YRD A;  2ORZ A;  2KXL A;  2Y34 A;  1W2U A;  3W9A A;  4BU2 A;  4Y3O A;  5BNN A;  5FWJ A;  5K8S A;  4QMA A;  1ZRC A;  1ZZC A;  1RUJ 2;  4JQT A;  3NMB A;  4XBQ A;  2B46 X;  3P3P A;  4RS5 B;  1T6B X;  1AXK A;  1H2M A;  2AZ5 A;  4XOG A;  4XHX A;  4Y20 A;  5LY2 A;  4NPL A;  3ZN6 A;  5FY8 A;  5FOJ B;  2BDR A;  1W9F A;  1T6G C;  4XAE A;  3R05 A;  4C0B A;  2V5D A;  2R1B A;  3DGT A;  4FXG B;  1JN2 P;  3B3Q E;  5C7G A;  2BFU S;  2GAU A;  1IZ3 A;  2WO3 A;  3CJX A;  4JHZ A;  4KG8 A;  5H9S A;  3E97 A;  5C3S A;  3RZJ A;  5CU1 A;  1PIV 1;  5FK7 A;  1PK6 B;  2GSY A;  3SHR A;  3K4D A;  3ILF A;  3WIN E;  4CCD A;  1W6Q B;  5J96 B;  3TN9 2;  1JU3 A;  4QAW A;  3T2O A;  2JIG A;  2VCC A;  3FJS A;  3U0Z A;  2RS3 3;  1UMI A;  5DUU A;  1TG7 A;  2W08 A;  3MLL A;  1RUC 2;  3H8O A;  1OUX A;  3AP4 A;  3LF7 A;  4RR3 C;  3WQ7 A;  5GLU A;  2VE1 A;  1DQ0 A;  2E7A A;  4UFI A;  3NKG A;  3NNF A;  2CL2 A;  1X33 A;  3BPZ A;  4LEJ A;  3ACF A;  3THD A;  3H1M A;  1DYP A;  4AWD A;  1D4M 3;  2JEN A;  2A6W A;  3NJX A;  4HK9 A;  4BOW A;  2RR1 1;  3K2O A;  1UIK A;  3WG1 A;  3ZSL A;  2HLE A;  3CQO A;  1Z7S 1;  4OHX A;  2XVK A;  2ET7 A;  3HD8 B;  4ZON A;  2XL7 A;  5FY1 A;  5J1X A;  2ENR A;  1BEV 2;  3OSD A;  3EYP A;  2V72 A;  4XQ4 A;  3I59 B;  4BCU A;  2OVU A;  3POB A;  5LA2 A;  4QWN A;  4YG0 A;  5A3O A;  3ZFF A;  1J1L A;  3SIT A;  4F7Z A;  3AXD A;  1NZC A;  4QHO A;  4WVM A;  4AAX A;  1IPS A;  2B8M A;  5BXX A;  3E5U A;  2VNV A;  2X10 A;  3N7M A;  2A70 A;  4FQZ A;  4IEO A;  1CN1 A;  1S0B A;  5FZH A;  5B4X A;  3I3B A;  3ILR A;  1CAU B;  1GOH A;  2XQX A;  2DF7 A;  1K42 A;  1HJF A;  3PHM A;  4HG6 B;  3AL5 A;  2B9U A;  4M3C A;  3WDU A;  1LEC A;  1OLR A;  4DRV A;  1IOA A;  2Z69 A;  4LBQ D;  1YFW A;  1ND3 C;  5FFO C;  4EV0 A;  4XCB A;  3HR9 A;  3JD7 3;  5JR2 A;  5FPV A;  3DYM A;  3WF2 A;  4C90 A;  5IVJ A;  4QPI B;  2RS5 1;  5HXV A;  1Y4W A;  5LBF A;  3RYK A;  3O1R A;  1E5S A;  4CEW A;  1RHI 3;  4Z92 B;  2VZQ A;  3T08 A;  4N8M A;  5IVV A;  2D40 A;  3RZG A;  4PI0 A;  4E4Z A;  2ZX2 A;  3UT0 A;  2Q8C A;  5C9A B;  5FZB A;  2IVJ A;  4CE8 A;  1QQP 2;  4PLM A;  5KHH A;  1O8S A;  4L8Q A;  2D5F A;  2TBV A;  5J36 A;  5I8S A;  2R6Q A;  4J1X A;  4WM7 B;  3WG4 A;  1JH5 A;  1KGY A;  1XYP A;  2OPK A;  2PA7 A;  1AUY A;  1REE A;  1WZX A;  1Z78 A;  2KM2 A;  3BCW A;  4PT6 A;  5IK7 A;  2ZA9 A;  4QXB A;  3UJO A;  4IGO A;  1AZD A;  2JDM A;  2VL4 A;  4Q4W 3;  5FZA A;  3AYD A;  4B1L A;  1RYY A;  1W8N A;  3ELN A;  2Q4S A;  4YGE A;  3S5Q A;  4OUM A;  1T2X A;  4R52 A;  5CAD A;  5APA A;  5GM0 A;  5JOY A;  4YZ1 A;  4LBL A;  3N9P A;  1ZBE 2;  1SEF A;  2EIG A;  2ARE A;  4LKF A;  4V2W A;  3BTY A;  5CAZ A;  4XF0 A;  1KFX L;  1TMF 2;  3OBT A;  2AEN A;  4FPO B;  1FYU A;  1QOT A;  3U07 A;  4BJ0 A;  2LTN A;  3DPR B;  1HRI 1;  4CUB A;  1QJZ A;  5FMB A;  3FMG A;  3ZSK A;  1UPI A;  4KL1 A;  1JZ8 A;  5IAT A;  3M70 A;  5T5J A;  1NG0 A;  5A7Q A;  4ZZ8 A;  2WN2 A;  3TBD A;  4Q27 A;  2WFF 1;  3A7Q A;  1W6N A;  3R4D B;  5IK8 A;  2VU9 A;  4XF1 A;  4X6Q B;  3T1M A;  2RS3 1;  1OKQ A;  4AVC A;  3BI3 A;  4AFC A;  4DEV A;  1FMD 2;  5FIX A;  5A7P A;  1H30 A;  3RMY A;  1GBG A;  1QIQ A;  5KBF A;  1KDK A;  3ORJ A;  4HPK A;  1O4Z A;  3ME2 A;  2Z79 A;  1XBF A;  2VUD A;  4JHT A;  4N43 C;  1C28 A;  4XYX A;  1D4M 1;  4IE0 A;  3USU B;  1LOD A;  1OA4 A;  2FCT A;  2MPF A;  5CNA A;  2B9V A;  3RS6 A;  3GBW A;  1NCQ A;  3MF6 A;  5D1I A;  4XFB A;  3ZDV A;  4A42 A;  1UU5 A;  2ZGU A;  2XJR A;  2HEW F;  3KVA A;  3IWZ A;  3KT4 A;  2HYX A;  2RJL A;  4GQ7 A;  2HWB 1;  4MO3 M;  3WW1 A;  5CIS A;  5I8Y A;  4AVS A;  4AAP A;  4LBO A;  1W03 A;  2G9Z A;  3LE0 A;  2RS1 3;  2WLQ A;  4Q4X 3;  4IUG A;  1H6X A;  2V5Y A;  4BB3 A;  1GWL A;  3KM5 A;  1GOG A;  1MS8 A;  3LDB A;  4O9E A;  2DDU A;  1C8M 1;  4K8F A;  5JMO A;  2IZW A;  4YFW A;  4F8A A;  1WLW A;  2BGO A;  5C70 A;  3V0A A;  5FZG A;  3LDK A;  1YFX A;  1QDC A;  5GAL A;  3WUD A;  3DUI A;  3C2U A;  5J98 B;  4LQR A;  5JSR A;  2OPW A;  4CEY A;  3GJB A;  4X8P A;  1AXY A;  2VOX A;  1GSL A;  1UYZ A;  5C5U A;  2Q8O A;  4TYS A;  2VZT A;  2ARX A;  2PLV 2;  1MZ5 A;  2WNU B;  3GHM A;  3JD7 1;  4CDQ C;  2P34 A;  2JXA A;  5B2G B;  4XAB A;  3WW2 A;  3WLU A;  1SLB A;  1XND A;  1E57 A;  1QJY 2;  2ET1 A;  3AZZ A;  1RHI 1;  1H1A A;  1TZO A;  1ND2 B;  3RVH A;  4CDX C;  1YUD A;  2QQO A;  3BGA A;  2FMY A;  1LOF A;  5FYU A;  4PIY A;  3RDI A;  5FP3 A;  1YQC A;  3B69 A;  2Q30 A;  4GIQ A;  1LHO A;  4MGI E;  3SQO A;  5GZF A;  5J3U A;  3TEY A;  4K7J A;  1V6K A;  1Q5O A;  5EHD A;  2W39 A;  2A1X A;  2DWR A;  2ID4 A;  3UGH A;  5JXJ A;  4OI0 A;  2XVL A;  5JI9 A;  1YIP A;  1AJO A;  2YDE A;  2WS9 3;  4ISQ A;  1GQG A;  3VBO A;  1X7N A;  2GNB A;  3CMG A;  1W06 A;  5ANQ A;  1U5X A;  2O8Q A;  1VBA 2;  3FFQ A;  5SV8 A;  1NAE A;  5GZG A;  1O7F A;  5LBB A;  1FAY A;  2VNO A;  4QD2 A;  1YJL A;  3PVN A;  2Q1Z B;  3WDT A;  4P5Y A;  4YYO A;  2XBO 2;  5H9Q A;  3J7L A;  5CFD A;  4RA0 A;  4XJU A;  2ZGL A;  4TWT A;  5A7N A;  5FZL A;  2FDF A;  2R04 2;  4QPG A;  4P9L A;  3LEG A;  4A3Z A;  1IQA A;  3HN3 A;  4BA6 A;  1WD3 A;  5FQ0 B;  4NJ4 A;  3Q8C A;  3OYW A;  2A71 A;  1JW6 A;  2D6P A;  1ZBA 3;  4CP9 A;  1WWY A;  1XNT A;  3M3O A;  4HK8 A;  4YLZ A;  4FTE A;  2XH6 A;  4YGD A;  2EAL A;  3ZXL A;  4E2S A;  1AL2 3;  4UFL A;  4QKN A;  4RN5 A;  1ODN A;  4YVW B;  3CJI B;  2CAV A;  3ZN5 A;  2BRT A;  2GMP A;  3DEM A;  1R08 3;  4JGY B;  1GV9 A;  2P3Y A;  3WNM A;  3ALQ A;  2KR2 A;  4A45 A;  1JHN A;  1U5Z A;  3WHU A;  3J8F 1;  5ISL A;  4C1W A;  3VBU C;  1E5R A;  5G05 L;  2HWD 3;  1LU2 A;  3KZ4 C;  4B4R A;  4BIO A;  4URA A;  1J84 A;  3MFC A;  4R8H A;  2W94 A;  1W3X A;  2PHX A;  4QDR A;  2PAE A;  4LE3 A;  5F5C A;  3VBR B;  4BQ1 A;  4DY3 A;  4QXC A;  2P5B A;  2FDI A;  1PO1 1;  2D6L X;  1HQN A;  3G6J B;  1ASJ 1;  2ZXQ A;  2Y0I A;  3FL7 A;  3PMS A;  4Q4V 3;  4E2G A;  5LA1 A;  3PU8 A;  3R4S A;  2RS1 1;  1QJU 2;  4AED B;  1PGL 1;  4Q4X 1;  1B35 A;  2LS6 A;  2QFE A;  2VR4 A;  3ACL A;  3MEP A;  4B1M A;  5C5T A;  1WCQ A;  2FD8 A;  1Q43 A;  5CG8 A;  4N9I A;  5FJH A;  5FXZ A;  1UOB A;  3IDE A;  3RSJ A;  3ZSM A;  4W6Y A;  2RJK A;  4CCO A;  2I07 B;  1U5Y A;  2DVD A;  3VZN A;  1HQW A;  5DXD A;  3ZXF A;  1VBD 3;  4UF0 A;  3S6P A;  4ERO A;  3WNL A;  5A7S A;  2ZX4 A;  2WT0 A;  1XNA A;  3LCP A;  5GZC A;  3P6B A;  3ECQ A;  4KGQ A;  2DVG A;  1Q8V A;  2GH8 A;  1TNF A;  3FZ3 A;  4BIF A;  1HJG A;  3B9I A;  4E8D A;  2R06 3;  4MGZ E;  3N4M A;  4K1Z A;  4LHL A;  2GNM A;  3DYO A;  4KNC A;  1A8D A;  4BXS V;  2C5D A;  4KBB A;  5FZ1 A;  1N1V A;  4M4P A;  4A4A A;  3MW3 A;  1H8V A;  5HXM A;  1CZT A;  1XNC A;  2E6V A;  2OKX A;  1A6C A;  2PEL A;  4MXV A;  2OW4 A;  4E27 A;  1BBT 2;  1WW5 A;  5EPA A;  2HWF 1;  4BK4 A;  1EUU A;  2X8K A;  5FMC A;  4KG0 A;  2AEZ A;  4XIL A;  2JG9 A;  3E1F 1;  5F7U A;  1TME 3;  3WNK A;  1SQ4 A;  2BOJ A;  5ABJ A;  1M06 G;  4DUX A;  3ZFE B;  5I0R A;  3WDX A;  3GHN A;  2WS9 1;  3NV4 A;  4FPE A;  4TZD A;  5F3I A;  4QX7 A;  1FNY A;  2NPI A;  4QQ2 A;  5IHR A;  5AC9 3;  2D5H A;  1W8F A;  3WCR A;  5IYY A;  2QBX A;  3JBG 3;  3TEW A;  1QNW A;  4YW5 A;  5JZG C;  5LAS A;  5FRE A;  1RUF 1;  4CCM A;  4QM9 A;  4XFH A;  3BIW E;  1ZZ6 A;  3I2K A;  3JB8 A;  5CYY A;  5JOZ A;  4CCK A;  1BKZ A;  3IB3 A;  1ND3 B;  1AXZ A;  4WM8 C;  3K75 B;  1WBF A;  2BV4 A;  2Y6G A;  3ILN A;  2B45 X;  3BOW A;  1W99 A;  1WCK A;  3V64 A;  5JCT A;  1H8T C;  3OJB A;  1ZBA 1;  1XYN A;  3QAC A;  2J42 A;  2PN5 A;  3I2I A;  4RQP B;  4AFD A;  3PVE A;  3SEP A;  4Y22 B;  3QOP A;  1KFU L;  1AL2 1;  3CNA A;  3OY8 B;  5FY4 A;  5JMC A;  4DB5 A;  3UES A;  2VOW A;  1MZ6 A;  1OH4 A;  2W1W A;  5FZE A;  2RR1 2;  1ZRR A;  3GF6 A;  5FYM A;  3NQH A;  1Z7S 2;  4PI2 A;  1GWK A;  1S0G A;  1R08 1;  3GZU C;  1LES A;  4YVS C;  4PF1 A;  4FCA A;  4D7T A;  4XJ8 A;  3MW4 A;  4F83 A;  1GLH A;  3J26 N;  5LRR A;  3KWV A;  2Z2S B;  2HWD 1;  1SLA A;  5EXO A;  1R1A 3;  4ZZ5 A;  2WAO A;  3KCC A;  3MPP G;  4LBK A;  1RC6 A;  1H1I A;  2D6O X;  2XBO 3;  4AR2 A;  3AFK A;  1PK6 A;  4CTE A;  1W6Q A;  2BGC A;  2GAL A;  3BOP A;  3J7M A;  3SH4 A;  3KHB A;  3AKQ A;  1VBC 3;  2DUO A;  5JSP A;  4L99 A;  1RUH 3;  1JZ4 A;  2HWC 3;  1VAM A;  4Q4Y 2;  2I74 A;  1YFU A;  5FY0 A;  4OUE A;  5ERL A;  4QB6 A;  3MW2 A;  1RMU 3;  2VQ0 A;  4LXL A;  4B8E A;  2VZS A;  5H9R A;  3USS A;  4XUQ A;  4A6S A;  1H4G A;  3AMH A;  3MIF A;  4K21 A;  3NNM A;  4YAR A;  2XHK A;  2X5I B;  2VZP A;  1X50 A;  3OBZ A;  4K20 A;  1LHU A;  1BHG A;  1NZI A;  4LE4 A;  5LRS A;  3Q8B A;  3KLS A;  2FDG A;  2P3I A;  3ZM8 A;  1OKO A;  2WC2 A;  2AGS A;  4TLG A;  1JZ2 A;  2RS5 2;  1JYV A;  2VTX A;  3V65 A;  1WW7 A;  1MVQ A;  5FYS A;  3N9O A;  1OT5 A;  1VBD 1;  2EA7 A;  2PHT A;  2VMF A;  1ULC A;  2IFW A;  2WBK A;  1ZZ8 A;  3I59 A;  4J1W A;  5DUV A;  4Q1P A;  2DCY A;  4LIT A;  2P6H A;  1VMF A;  5E16 A;  5FYH A;  2VTX J;  3VDA A;  1HB2 A;  1V00 A;  2R06 1;  1C1L A;  2RDN A;  1ODM A;  4BIS A;  5JPM B;  1SDD B;  1AR6 3;  1PO2 1;  3E6C C;  1YFY A;  2Q1M A;  2WZR 3;  4CSW A;  2AH2 A;  5HI0 A;  1LHN A;  2DCK A;  1FOD 3;  3OGS A;  5IFP A;  1STM A;  3NJZ A;  2QUO A;  2ZEY A;  4BQ2 A;  2V73 A;  4UW4 A;  1AR7 3;  3AVR A;  3B7M A;  3EQE A;  4N53 C;  3KT7 A;  4RHV 3;  1QJU 3;  4ONU A;  4A6O A;  4BYY A;  2FQP A;  1TME 1;  2BNN A;  2E7Q A;  4QQH A;  4YZ2 A;  1COV 3;  5K7P A;  1YWK A;  4S2F A;  3UKT A;  2IVI B;  3OTF A;  2WQ4 A;  2XKP A;  3OPT A;  5KHG A;  1V6I A;  4XUT A;  5J48 A;  2BPA 2;  1C57 A;  2VTF A;  4GAZ A;  1S2K A;  2YG0 A;  3GNE A;  3JBG 1;  1W0N A;  1H6Y A;  5FZI A;  2VW2 A;  4GA9 A;  4L97 A;  5CA6 A;  3MLJ A;  2K46 A;  1MS9 A;  4Z1V A;  1EV1 1;  1H1M A;  4CUC A;  1AJK A;  1GAN A;  1U0A A;  1UN1 A;  3I97 A;  4ARY A;  4D8M A;  5C9A A;  5FYI A;  3N3H A;  3RQ0 A;  4IDZ A;  2QKD A;  3OEA A;  3VD4 A;  1RUD 3;  1W3V A;  3P1I A;  4JAA A;  3VBH B;  4EWD A;  2C1F A;  2JEM A;  4Q1R A;  2WFF 2;  3HMY A;  2C6S A;  2G1M A;  4CXW A;  4WM7 A;  3ZYR A;  2RS3 2;  4MGS A;  4HKO A;  3GZE A;  4HN1 A;  5J09 A;  4FTB A;  1A34 A;  4AFM A;  1CAW A;  2BBA A;  4O65 A;  1QGL A;  2EF6 A;  2JB8 A;  1OUS A;  1CAV B;  3PUS A;  1CAX B;  1MS5 A;  4PHZ A;  4X6R B;  1W05 A;  2J22 A;  3VUO A;  4FSJ A;  4I02 A;  3ZDS A;  2ZAB A;  4IEW A;  2XJQ A;  4CDU B;  5F32 A;  1D4M 2;  4FPC A;  4RFT 0;  1BVP 1;  1LGB A;  1ULO A;  3PJY A;  1ULP A;  3WY6 A;  5CVR A;  4COY A;  2P1B A;  1SLC A;  2ZOE B;  2UY8 A;  5FYV A;  2W95 A;  2Q8D A;  4XDO A;  3DPR A;  1YQ5 A;  2WUH A;  3JQX A;  2QDR A;  4LUK A;  2YBS A;  4CUA A;  4TXW A;  1O3Q A;  2JKX A;  2EXK A;  3O1O A;  1VRH 3;  1UNB A;  2ZHN A;  3VBF B;  2XL9 A;  4EZH A;  3OUI A;  4H7L A;  1PIV 3;  5DZE A;  5EYY A;  4OZX A;  4GH4 A;  1VBC 1;  3SNM A;  4D94 A;  1RUH 1;  2WT2 A;  3I3Q A;  3ZXK A;  2JDY A;  1SFP A;  1K5M C;  1JU4 A;  1KRI A;  2ZGK A;  4QXH A;  4B3N A;  3WDW A;  4DXT A;  5I0U A;  1RMU 1;  1PX4 A;  3NWK A;  4XZU G;  3NNG A;  3DXU A;  1UMH A;  2AEY A;  1DG6 A;  2DUP A;  4NHM A;  1JZ6 A;  3USU A;  4CCL A;  1ZRD A;  1ALY A;  2DVB A;  4XCA A;  4XTP A;  1AF9 A;  4IV3 C;  2ATF A;  2YXS A;  3JD7 2;  1UYP A;  1K3I A;  3KV6 A;  1RTV A;  5DPN A;  1RHI 2;  3APB A;  2IXK A;  2RHP A;  4AFB A;  3D82 A;  2VCA A;  3URF A;  1NQJ A;  3BTA A;  2JB4 A;  4YG6 A;  4AEM A;  3RZL A;  3OGR A;  4JZR A;  1PMJ X;  4NRM A;  5JIA A;  1S2B A;  1VJ2 A;  4DFS A;  2IXH A;  5EP9 A;  3AKS A;  2YPJ A;  4E8C A;  2O14 A;  3OCP A;  1ZVF A;  2XDV A;  3FLP A;  3VBS A;  3N7L A;  2WO2 A;  5LA9 A;  4Z07 A;  4ASL A;  5F8P A;  2WZR 1;  5K9Y A;  4DS0 A;  1O5L A;  1QJF A;  2DUR A;  3O1T A;  1FOD 1;  3HT1 A;  3I3D A;  4Q4W 2;  5BNO B;  3IM0 A;  2VH9 A;  3PJQ A;  3LWC A;  4FOV A;  1GP6 A;  4YM1 A;  1AR7 1;  1J3R A;  4RHV 1;  5I93 A;  4Z2W A;  1D4V B;  2B5H A;  1R09 1;  1QEX A;  3IIA A;  1UMZ A;  1COV 1;  2LUW A;  3AYA A;  2VVD A;  1W2N A;  3TB0 A;  2EIB A;  2WNU A;  5L9R A;  3HQU A;  3WNP A;  4DRR A;  2A6X A;  3MHZ A;  3CBN A;  5CFC B;  5IJR A;  4IEU A;  4IV1 A;  3OEB A;  1RGS A;  1VE0 A;  4Q5O A;  5FZK A;  4MX3 A;  1ND2 A;  2VD7 A;  3WEZ A;  1MEC 3;  1ULF A;  1BVV A;  4XXA A;  2XPJ A;  3H3Z A;  3AC0 A;  1MZF A;  1DYO A;  3UYJ A;  2VOT A;  3FUO A;  1RUD 1;  3I49 A;  4UWD A;  3POJ A;  1I3H A;  1IG3 A;  1H0B A;  1VAK A;  2BWA A;  4EN9 B;  4E4S A;  2WRA A;  3CL1 A;  1GNH A;  4Z82 A;  5BNN C;  1G9B A;  3FN9 A;  1RIN A;  2QDN A;  3MIB A;  5C3O A;  1YHF A;  2BJS A;  2X09 A;  3JXS A;  4P14 A;  1SG3 A;  3EXU A;  3FHQ A;  5FRA A;  1LCL A;  4XC9 A;  5JLV A;  1VRB A;  4QX1 A;  5FYT A;  5A3N A;  5FOB B;  3LA7 A;  3M8L A;  3K51 A;  1XE0 A;  3PIJ A;  2CNA A;  2W2I A;  5LWB A;  1LNS A;  1WUV A;  2W3J A;  3AYC A;  1Y7B A;  1WA6 X;  4MGK E;  3O14 A;  3NRU A;  2HEY F;  3D6E A;  3HNY M;  4YW6 A;  5K0U A;  4AQ2 A;  1LRH A;  2YFU A;  5D8A A;  4AQ6 A;  1W8W A;  1QY4 A;  2P6C A;  2AR6 A;  1W6O B;  1AX1 A;  4MG2 A;  4XEZ A;  2JDK A;  1HKD A;  2Y6L A;  2A75 A;  3AM2 A;  1PZ9 A;  4AGG A;  1Q8O A;  2EXJ A;  1CZS A;  5C33 A;  4ASK A;  5JZG B;  1HRI 3;  1H4H A;  3JUU A;  4C8D A;  1BZW A;  4Y5S A;  1VRH 1;  2RS1 2;  2NLR A;  3ABZ A;  3MUY 1;  2XWJ B;  3PUA A;  4XF4 A;  3WG2 A;  4Q4X 2;  2G9F A;  2JKB A;  3ON7 A;  4BQX A;  4DEQ A;  1PGL 2;  1QH7 A;  4FPG A;  2IXC A;  2JEC A;  4HON A;  4PDW B;  4WM8 B;  1IS3 A;  4IEV A;  4YVW A;  3H1Y A;  4OFG A;  1E5H A;  2WFF 3;  4M3C E;  3CJI A;  4FVV A;  1DGR N;  5FXX A;  4BQ3 A;  4CXY A;  3CO2 A;  5IT6 A;  3S30 A;  4JGY A;  2PHL A;  1GNZ A;  2WYF A;  2QZ3 A;  4EYU A;  3I2D A;  1AL0 G;  1C5H A;  2ARB A;  4XUP A;  3RYP A;  4JKM A;  1UQX A;  4JTO A;  2A6Z A;  5F37 A;  4FXK B;  2QQN A;  4CDW B;  4ITC A;  5I91 A;  4EWA A;  1UKR A;  3CZU A;  3KVB A;  1KJR A;  4LKE A;  4ZY9 A;  1ENR A;  4E4H A;  4A7Y A;  4FPH A;  3ZFF C;  1KDM A;  4RGG A;  5KWR A;  2D97 A;  3O1U A;  3IPV A;  4FPF A;  5HCF A;  5FZ7 A;  1HRV 3;  3GZT B;  4R9B A;  3C7H A;  4YM0 A;  4ZXK A;  3VBR A;  4DY5 A;  2ZZJ A;  2ES3 A;  1CGP A;  4COW A;  3S57 A;  4XAC A;  1FAT A;  2XJP A;  3NL1 A;  2WNE A;  1EPZ A;  4BQW A;  2W1Q A;  3BYW A;  2HWB 3;  3RGB A;  3RG0 A;  1PNF A;  1AHS A;  4Q0Q A;  3RZH A;  1AX2 A;  1LOB A;  3I2H A;  4AED A;  1RUG 3;  1FXZ A;  3I3E A;  3ST7 A;  4AGR A;  4YW1 A;  4ZU5 A;  4MVT A;  3U14 A;  1WLC A;  3SXW A;  5FZ0 A;  4OQ9 A;  4RGA A;  1C8M 3;  1WMF A;  1Y3T A;  2W0X A;  2WS9 2;  3EMR A;  3IN9 A;  1V9U 3;  5DAB A;  3MID A;  3HQR A;  2VUJ A;  1SAC A;  3H3L A;  4IET A;  1WMX A;  3GXU A;  3HIF A;  5GLZ A;  3I3M A;  4M4R A;  4S2G A;  1RUF 2;  2UWB A;  4CEW C;  5KHJ A;  4FI9 A;  3OG2 A;  2W5F A;  4I0B A;  3QH6 A;  4KWU A;  1ZZ7 A;  4WVW A;  5DAW A;  5G04 L;  4IND A;  5D21 A;  4OI1 A;  1WW4 A;  2B4K A;  4QHB A;  5A6X A;  1N3Q A;  4ATF A;  2Y33 A;  3FC0 A;  2SLI A;  5FPU A;  5DDJ 3;  1N1S A;  1CR7 A;  5A6Z A;  1MEC 1;  1ZBA 2;  5K0U C;  1F15 A;  4EWE A;  2WA3 A;  2VVE A;  2WNV A;  2WYS A;  2ARC A;  3TNP B;  4FBF A;  1AL2 2;  2WN3 A;  5F6L B;  3S0M A;  1WGP A;  3BB6 A;  1GKB A;  3A0N A;  4HFS A;  3RWK X;  4RD7 A;  2DFB A;  4ISR A;  5A7W A;  3V0B B;  2W92 A;  5AFB A;  3ZFE A;  2WKK A;  2JG8 A;  3E6D A;  3K3O A;  1JYW A;  3W5M A;  1JZ7 A;  1R08 2;  2G19 A;  4MAD A;  2XGX A;  4TTG A;  3DKQ A;  1HW5 A;  1UU6 A;  1BLZ A;  1VB2 A;  1KD7 A;  1UOJ A;  2CYF A;  2R07 3;  2D98 A;  1JZ3 A;  4BK5 A;  1QKQ A;  2CSG A;  2HWD 2;  2PQS A;  5E89 A;  3UKV A;  4XUR A;  1S0I A;  3NV1 A;  3O1V A;  2VAU A;  4HVQ A;  3AMQ A;  2C9K A;  3O12 A;  4XQD A;  4P00 B;  3NJV A;  3RJR A;  2XLF A;  4C91 A;  4EZ4 A;  3UNP A;  1US3 A;  2CHH A;  2JD4 A;  4YZ3 A;  4S2D A;  4H55 A;  4LBM A;  4W6X A;  4AK3 A;  2QE3 A;  3NAP A;  1FX5 A;  4XMI A;  3RRD A;  4Q4V 2;  3ZKU A;  2W91 A;  1VP6 A;  4RQP A;  3VHN A;  5BNP B;  1VPH A;  3ZYJ B;  4CP2 A;  3SEE A;  1UKG A;  2NMN A;  2QCS B;  4QXK A;  1V6M A;  2ZHM A;  1BYH A;  5DG2 A;  5A70 A;  3H50 A;  3LIG A;  4N7I A;  1DF0 A;  2VUC A;  3SH5 A;  4QQP A;  5FK8 A;  2RDR A;  1Q8Q A;  4LBN A;  1RXG A;  5FLH A;  3K3N A;  5KC6 A;  3VB9 A;  1NCQ C;  4FOW A;  3ES4 A;  2E7T A;  2DFC A;  5DZF A;  5T5P A;  5A6Q A;  4AGV A;  4Y5Z 0;  4BWO A;  1VBD 2;  2ZX3 A;  4XDQ A;  5T5O A;  3J8F 3;  4HBN A;  1P8J A;  4FFI A;  1UF2 C;  4QKD A;  5FO7 B;  4CYD A;  1W6M A;  1DP0 A;  2NM1 A;  3ES1 A;  2P2K A;  3LA3 A;  3T2Q A;  1KXG A;  1AVB A;  3WHT A;  3ZLI A;  1JZ5 A;  2ZGR A;  4XIO A;  2R06 2;  2RV9 A;  3AJY A;  1PGW 1;  1HRV 1;  1OUR A;  4PIX A;  2CDP A;  4JDM A;  3LEM A;  1PO2 2;  3D0J A;  5DMY A;  4OYU A;  2Y6J A;  4ZHN A;  1UW8 A;  1PO1 3;  4MXW B;  4UW5 A;  1ASJ 3;  2GC3 A;  3O5S A;  3AFG A;  1RUG 1;  1OC1 A;  5T5L A;  4R9A A;  2ZS6 B;  4B7K A;  1UXX X;  1WCS A;  3BVC A;  5GLW A;  4NN0 A;  4R4Z A;  1TME 2;  4CEY C;  2X5I A;  2ZZQ A;  2H0V A;  4LO8 A;  4Q0S A;  4CPB A;  2WZ8 A;  3ATG A;  1ZRI A;  4FPJ A;  1YRZ A;  4MHU A;  3SMH A;  1V9U 1;  1JOB A;  1K5M B;  2EIC A;  4AVA A;  1YCI A;  2ZHK A;  4QX5 A;  3VD7 A;  5AC9 2;  3JBG 2;  3MIH A;  2DV9 A;  3TOJ A;  2Z5W A;  1EV1 2;  1Z0H A;  2ZAC A;  4IEY A;  1W0O A;  1RUI 1;  5JR7 B;  2UU8 A;  1LOF C;  2PXJ A;  3N9L A;  2W9X A;  4MGQ A;  5L7O B;  3PTY A;  4AFA A;  1VLN A;  2D3P A;  2IXI A;  4LO5 B;  3ACH A;  2ADE A;  2GP3 A;  5F9T A;  1R64 A;  3WG3 A;  2JDA A;  3PDQ A;  4U2A A;  1VBB 1;  1PMH X;  4DXR A;  1SLI A;  4OI2 A;  5DDJ 1;  5JXG A;  4OLL A;  1V6O A;  1F5F A;  4XE9 A;  1RIR A;  3KT1 A;  4D6Q A;  5A3P A;  1F2N A;  4U36 A;  3VBO C;  2D7F A;  5L73 A;  4E4D X;  5A1F A;  4XBN A;  1OBN A;  1OHF A;  5FMO L;  4AW7 A;  5JSO A;  3EBR A;  4DO0 A;  2HWF 3;  1DGR A;  1TQ5 A;  2LM3 A;  3H0O A;  1W8Z A;  1O3S A;  4CP1 A;  5CBL A;  2ADD A;  2D93 A;  3GYD A;  1W9T A;  3KGZ A;  4BQ5 A;  1PM7 A;  4F3J A;  1JYC A;  1HB3 A;  5CFD C;  1AR9 1;  5EV7 A;  4I3P A;  5IAX A;  3IDA A;  4QPG C;  1AYM 3;  1US2 A;  3U1X A;  5T54 A;  4FFH A;  1GOF A;  2R07 1;  1MAC A;  4HXC A;  5C8C B;  2FHR A;  2YGM A;  4R4X A;  3VDD B;  4MLO A;  3QD6 A;  3MDP A;  1RUF 3;  1R1A 2;  3M7A A;  5EJZ B;  4BQY A;  4UFK A;  3AZW A;  3FHI B;  1WBL A;  2CTV A;  3AKT A;  1RVF 1;  2P3J A;  3VBH A;  5C4W B;  2YU2 A;  1DLC A;  3D3A A;  1NCR A;  4NHY A;  1NA1 B;  1VBC 2;  1PZ8 A;  2CY6 A;  4JGZ B;  4W65 A;  2GDF A;  3PUQ A;  4Y4Y A;  1CPN A;  1RUH 2;  4JDO A;  2HWC 2;  1PNG A;  2O1Q A;  1POV 0;  1DQ6 A;  2Y26 A;  1DFQ A;  1CAX A;  2VZO A;  1RMU 2;  1EY2 A;  3OOX A;  5F3C A;  1LHV A;  2B42 B;  4BLI A;  1NQD A;  5KR7 A;  2DTY A;  3DF0 A;  1HB4 A;  4CDU A;  4DOU A;  4H7M A;  2QQP A;  3POI A;  3WDV A;  3B00 A;  5AVP A;  5EZW A;  3ZXD A;  2AAC A;  3IAQ A;  4KI5 M;  4NAM A;  2ZGT A;  1W9W A;  2MEV 3;  1CVN A;  3FLR A;  4D69 A;  3WF0 A;  2GZW A;  2R0H A;  3Q8E A;  5FY9 A;  4D7S A;  3SC7 X;  4IQP A;  2XON A;  3ZFG A;  5A80 A;  3LEI A;  3OBA A;  5FP4 A;  3TYJ A;  4B4Q A;  3WW4 A;  4YSF A;  5DAV A;  5KHK A;  2XLA A;  3K48 A;  4KGG A;  1OOP A;  3H42 B;  2RM2 1;  3VBF A;  2VQA A;  3UGG A;  1PVC 1;  3LSE A;  1PGS A;  1B35 C;  1BJQ A;  5AFE A;  3POW A;  1B09 A;  1AR6 2;  3WNN A;  4GJZ A;  3ZXJ A;  2WZR 2;  1KJL A;  1FOD 2;  4GMP 0;  3WQ1 A;  1JMU B;  1GZW B;  5JDB A;  2WQZ C;  3SCF A;  4W6W A;  4XJZ A;  3SKV A;  5FO8 B;  2QQV A;  4I30 A;  3WDY A;  4NVP A;  1AR7 2;  1UY0 A;  4RHV 2;  1QXR A;  2VME A;  2YV8 A;  1UOF A;  1K45 A;  4XJ9 A;  3CF6 E;  1HN0 A;  2NQY A;  1COV 2;  3WX5 A;  3LEK A;  1SLL A;  3LZZ A;  4LO7 A;  3AX4 A;  4YNI A;  4AI2 A;  1IQD C;  4WBB A;  1RUJ 1;  5HV4 A;  5LK7 B;  3ZXA C;  1SBF A;  2OZ6 A;  5A3W A;  4RR3 B;  1GIC A;  1OFN A;  2CGN A;  3GJA A;  1WME A;  2ZGQ A;  3WQ0 A;  5J37 A;  2VOK A;  1WCD J;  3HOB A;  1DZR A;  2GC0 A;  4CVU A;  2BBV A;  2BWC A;  4AE2 A;  1PMI A;  1RUD 2;  1YIF A;  1CIY A;  5JIU A;  1YXW A;  4AI8 A;  3NNJ A;  2JG9 C;  3E5Q A;  4CA9 A;  3DYP A;  1UD1 A;  4WVM B;  1YQ2 A;  5ABJ C;  1PO2 3;  5BNO A;  1L7R A;  4V1P A;  1HLC A;  4PJY A;  2A3Y A;  2E31 A;  5FY5 A;  2WT1 A;  5A32 B;  1UWW A;  2XVG A;  4M3C B;  4Y26 A;  5K4L A;  4AHW A;  3B5L B;  3ZX7 A;  2VW0 A;  4A44 A;  2VUL A;  1LED A;  2ZML A;  4NMI A;  3AL6 A;  4MH0 E;  3MO4 A;  5CFC A;  3I2O A;  2VZU A;  3A0K A;  2CWM A;  3K4Z A;  4XUN A;  5FLJ A;  4BM8 A;  2YBP A;  1AYM 1;  3N9Q A;  1XJA A;  5IVE A;  1GWM A;  2W52 A;  1J58 A;  3QLQ A;  1PM4 A;  4AYU A;  1MQT A;  2D6N A;  4CEW B;  3N35 A;  2RDS A;  1VRH 2;  1EV1 3;  4OHW A;  3WVJ A;  2BOI A;  5DAP A;  1ZZ9 A;  4RYD A;  4XW3 A;  4H3W A;  5LCW L;  4MGY E;  1BQP A;  1PIV 2;  2D6K A;  1LTE A;  4M0N A;  1EYB A;  1FV3 A;  3AMN A;  4LHK A;  2FDJ A;  1UY1 A;  1VIW B;  2ZGN A;  3BOD A;  3BKZ A;  5FP9 A;  4QQL A;  4NR1 A;  1NKG A;  4V2V A;  4D6R A;  2WZP P;  3CHX A;  3SKJ E;  1QXJ A;  2BER A;  1APN A;  1Y9Q A;  3AYE A;  3LB9 A;  4MGT A;  4EQV A;  3A22 A;  4FFG A;  1X8E A;  2J7M A;  2V4V A;  4TSV A;  1JBC A;  2VMI A;  5LK5 A;  4RS5 A;  2MEV 1;  4PLO A;  5IVB A;  1NOV A;  1PK6 C;  3MV0 1;  5FKC A;  2VXJ A;  4R9C A;  1Y9M A;  5LBC A;  3W21 A;  1O91 A;  2QZ2 A;  4JCK A;  4WZC A;  5GLT A;  4CRQ A;  5FP8 A;  2YYO A;  4IE4 A;  4UYB A;  3UKN A;  4IE5 A;  1NUK A;  4C0H A;  4UXA A;  1OLM A;  3O1M A;  5A33 A;  1D7P M;  1Q8S A;  1YI9 A;  2EVX A;  1OF3 A;  3U78 A;  4PDW A;  2XKO A;  3O1S A;  5LB6 A;  2Z4F A;  1OA2 A;  2GH2 A;  5F1R A;  1SMV A;  2D44 A;  4IL7 A;  4AVT A;  4XBL A;  3IDC B;  3LAG A;  3IBM A;  1W6N B;  4WVZ A;  4GKX A;  4UFM A;  4HSL A;  2DVA A;  4M01 A;  2YC0 A;  4I0W B;  4N90 A;  3NV2 A;  2WSU A;  4W4Z A;  5FBJ A;  3HEI A;  3SIS A;  2WO1 A;  3FWE A;  1UZ0 A;  4GJY A;  1CX1 A;  4CDW A;  2VBD A;  2YFZ A;  2VMG A;  3GBG A;  1IPK A;  5A6Y A;  1OD3 A;  2JE9 A;  1ZBE 1;  4XJW A;  2FZ1 A;  4COV A;  4Q26 A;  1TMF 1;  2BEO A;  3OUJ A;  1G9C A;  1MEC 2;  5KXD A;  4H2A A;  3E5X A;  3EJK A;  4N43 B;  2AC1 A;  1LOE A;  2ZEX A;  5FCC A;  4XXP A;  5IK5 A;  3M4F A;  5EFU A;  1ACC A;  1RUE 3;  1ZM1 A;  2J1S A;  2FBE A;  1HXS 3;  1MR5 A;  4GWM A;  3IKW A;  3RNS A;  3PL0 A;  4FPL A;  2ZKN A;  2YHJ A;  4UBG A;  2VNG A;  1C4R A;  2ZTN A;  4I0A A;  4HKW A;  2HWE 1;  5E6H A;  2WFP A;  4G3Y C;  5LBE A;  1X9P A;  1RIT A;  2MHF A;  1CAU A;  5F2S A;  3WXP A;  5IVC A;  4IGP A;  4ET7 A;  3ZYB A;  3VZJ A;  1GZT A;  2VM9 A;  3K46 A;  3POY A;  3VKO A;  1RL3 A;  4AXO A;  4CP0 A;  1BK0 A;  1XB9 A;  3N9M A;  3KD4 A;  4JRA A;  2KA3 A;  1JTZ X;  1SPP B;  5CKQ A;  1R09 3;  1XRU A;  3PME A;  1W9S A;  2DCZ A;  3AZY A;  4LOT A;  2OS2 A;  3HN1 A;  3PLQ A;  4Y1Z A;  5BNQ A;  3WP3 A;  2UUR A;  5C9A C;  3S7E A;  2EAK A;  4RGK A;  1XPW A;  2BZD A;  3VHP A;  1JOJ A;  1QF3 A;  1HN1 A;  4NOT A;  3RFR A;  1UU4 A;  4QPI A;  4K6B A;  2VMD A;  5FZ6 A;  1DGL A;  4WM7 C;  1YQ8 A;  4IGQ A;  3N7J A;  1HRI 2;  2OQ6 A;  1O4T A;  1QH6 A;  1REF A;  2B39 A;  2PMW B;  3LPG A;  4H14 A;  2EIE A;  4NUB A;  3ZYG A;  5IK4 A;  1O3R A;  4LUM A;  5FR3 A;  1IS6 A;  5FP7 A;  1DQ4 A;  1VBE 3;  4MET A;  2Q5T A;  4CDQ B;  5C8W A;  4XUO A;  3WSO A;  3WQB A;  4Y1U A;  2IFR A;  2NZ9 A;  4NIA A;  1RXF A;  2K9Z A;  4IEQ A;  1BMV 1;  4GXL A;  1KQR A;  1UAI A;  1BXH A;  4CDX B;  3LFM A;  2GC2 A;  3ZSJ A;  3MLK A;  5HCB A;  3RZM A;  4CU8 A;  4LUL A;  2BQP A;  3DPR C;  5HCH A;  4M0H A;  5A7O A;  1OA3 A;  1VAL A;  1W2A X;  2DCT A;  3INA A;  5EIY B;  2D6M A;  3K77 A;  2Z42 A;  1S1A A;  2ZGO A;  3IT8 A;  2VXR A;  4GWN A;  4PBO A;  1JYN A;  5CFD B;  1HRV 2;  1IS5 A;  5CEH A;  3OB8 A;  1DDL A;  1OSG A;  4UBH A;  3CKH A;  4FFF A;  4GH4 C;  2QQM A;  2RMU 3;  4XAA A;  1EUT A;  5FPB A;  4B7E A;  4NID A;  5BNP A;  2HWB 2;  4N7U A;  5FUP A;  4JX0 A;  1GFF 2;  4NWW A;  4G4F A;  1RUG 2;  4AI0 A;  4WZF A;  3AP5 A;  4A3X A;  1L7L A;  2R16 A;  1WA4 A;  2QQK A;  2WWJ A;  4MOA A;  4A2U A;  1DHK B;  2YZ4 A;  2BYV E;  1C8M 2;  3T2P A;  3KF5 A;  1KEX A;  1FT9 A;  2R30 A;  4UT5 A;  4A7Z A;  1V9U 2;  5FYC A;  1AR8 3;  5AVA A;  1EAH 3;  5GLV A;  1MS1 A;  3RWN A;  1VBA 1;  3M2M A;  2TEP A;  2FCV A;  4EE2 A;  1ENX A;  4UW6 A;  3U4S A;  5EJ3 A;  5FLI A;  5F6K A;  2GN3 A;  3FFZ A;  3LDR A;  2BP6 A;  4OUL A;  4LNV A;  1NY7 1;  5CG9 A;  4XZP A;  2ZGP A;  3JCI A;  5C3P A;  1CES A;  4L11 A;  3X29 B;  4QX3 A;  3VBS C;  5DDJ 2;  5I0T A;  2HBT A;  4PQ9 A;  3WP4 A;  4PIZ A;  2Y6F A;  2BTV C;  1WLT A;  3DXT A;  3MIC A;  4LKD A;  4MXW A;  4UI9 L;  1GR3 A;  4COU A;  1RB8 G;  3VD5 A;  2V4A A;  3KQ4 B;  4P02 B;  2A73 B;  3VBU B;  2BVB A;  1RUE 1;  3WP6 A;  5JXH A;  1HXS 1;  2JDU A;  4MV2 A;  2VEC A;  2WNO A;  1A78 A;  3NJY A;  4NO4 A;  5IVY A;  2RG4 A;  4I3G A;  1UZV A;  2O8O A;  2FCU A;  1CX4 A;  3T0A A;  2KD7 A;  2WWU A;  2WNU C;  3MBW A;  2OT7 A;  5BYN A;  1F9K A;  3ACI A;  3GDB A;  4AI1 A;  3ETP A;  2DU0 A;  1Q8P A;  1EP0 A;  2VQU A;  2R07 2;  4IV1 C;  2VCM A;  3I7D A;  5B4N A;  1GQP A;  1ND2 C;  3LFI A;  4JTN A;  2HEV F;  4GZ9 A;  1MS3 A;  5L7O A;  1JS9 A;  2YC2 A;  1N1T A;  3PU3 A;  1NYW A;  3AP6 A;  2VGD A;  1QDO A;  3ZR5 A;  5A3U A;  1S55 A;  1JOD A;  3A23 A;  3M3Q A;  4NRP A;  4WV8 A;  4ZXE A;  2QTW B;  3T2T A;  3CDZ B;  3ZIX A;  2ZPX A;  2ERF A;  5C3Q A;  3WF1 A;  2CGP A;  3PIG A;  5BPX A;  2FZ2 A;  1W04 A;  3ZR6 A;  2PAK A;  1DYK A;  4CUG A;  4LKS A;  2LW8 A;  4AHZ A;  1C5I A;  3PTR B;  2RE9 A;  1VBE 1;  2PYT A;  3FLT A;  1JXN A;  4PLN A;  4OQ8 A;  4DIN B;  2VBB A;  4JKK A;  2E51 A;  2XJS A;  1OH3 A;  3MZH A;  5D8A C;  4QX0 A;  5F2W A;  1AYN 3;  3AKP A;  1V0A A;  5T52 A;  1X82 A;  5C8C A;  2RVA A;  3EO6 A;  3H8U A;  1JOP A;  1CZV A;  3J8F 2;  3NV3 A;  4XVH A;  3VDD A;  2F4L A;  2HBU A;  5FDB A;  1AX0 A;  3UGF A;  3ZPY A;  2R7E B;  2C0Z A;  5FAX A;  5C4W A;  3OPW A;  3ZMN A;  3HPN A;  4NRQ A;  2VW1 A;  2R32 A;  1N3O A;  1NA1 A;  2YRO A;  2TNF A;  4ES8 A;  1WD4 A;  1W2T A;  3NST A;  4JGZ A;  5FQ0 A;  4QPW A;  4YVW C;  1L7Q A;  1Y43 B;  2JE7 A;  1HIX A;  2P4E A;  2RMU 1;  3BAL A;  5FZC A;  3BU7 A;  3CJI C;  5I0S A;  1PO1 2;  3MYX A;  2L9L A;  2G9G A;  3KCY A;  1ASJ 2;  3T0D A;  1D2S A;  1QJX 3;  4MSV A;  4XF3 A;  1PHM A;  4JGY C;  3VKM A;  4BDV B;  4YGB A;  1FPN 3;  4QQO A;  2WDB A;  3EB7 A;  1BBT 1;  2QJV A;  1YJK A;  3SH3 A;  2QQL A;  3PVO A;  2IUW A;  3QCW A;  3AP9 A;  4AG4 A;  4Z2A A;  4UFJ A;  4XHB A;  1S0E A;  1ENQ A;  5JXI A;  2XQR A;  1AR8 1;  3KV5 A;  5ACA 3;  3ZYF A;  4I2O A;  5FUI A;  1H8T B;  1EAH 1;  4LHS A;  4EN7 B;  2NP0 A;  1MS4 A;  3VBR C;  4FAH A;  2WJS A;  5L19 A;  4XET A;  4Q0V A;  3OGV A;  4FP3 A;  1LEN A;  3C7E A;  4NHX A;  2W46 A;  1RUO A;  1HV0 A;  1L3J A;  5EWS A;  4QU2 A;  4AED C;  2WLP A;  4NRO A;  2G4I A;  3D5O A;  2NN8 A;  2VO5 A;  1BK1 A;  2EXI A;  4HET A;  1H9P A;  4KH9 A;  5A1A A;  4YVS B;  4LPL A;  2BW8 A;  4Q8K A;  3QH7 A;  1OMI A;  4AHX A;  1GZW A;  2Y0O A;  3P5B A;  2ZCW A;  4LBQ B;  3SCG A;  2WIN B;  4LIV A;  4XF9 A;  3ZXG A;  2HWF 2;  2ZX0 A;  4GUL A;  2ARA A;  3LD8 A;  2UWA A;  3H7J A;  3MFA A;  3M1H A;  5FMO S;  4CCE A;  5BY5 A;  1XC6 A;  5LA0 A;  3DKW A;  3LIH A;  1LOG A;  3KMH A;  1YQ6 A;  4URT A;  4NIH A;  3POE A;  4Y1X A;  3RI9 A;  2J1A A;  2ILM A;  1AYM 2;  2AYH A;  3T3Y A;  1IG0 A;  1RJ7 A;  3JQW A;  1NLS A;  4RR3 A;  4Y33 A;  1RED A;  3VDC A;  4XDP A;  5KC5 A;  2BNM A;  3VGI A;  4MUV A;  5FZO B;  4Q0U A;  4Y1V A;  1UCX A;  3CLP A;  4Y1Y A;  1RUI 3;  2WNV C;  3HBZ A;  1LAJ A;  1G8W A;  5FZF A;  4AI3 A;  2YY1 A;  3Q8A A;  1W9Y A;  4UW3 A;  5H9P A;  3J7N A;  1QNY A;  1I1E A;  1OLQ A;  2TUN A;  3B01 A;  1VBB 3;  2R0F A;  3W59 A;  3LOI A;  3ZFE C;  1V70 A;  4Q0P A;  2FDH A;  4PCR A;  1M4W A;  4BHP A;  2JG8 C;  2Q0A A;  4D7Y A;  3EHK A;  3AMP A;  4P08 A;  4Q4Y 1;  3T4V A;  1OQ1 A;  5A32 A;  5IFT A;  3U4X A;  2HJI A;  2E26 A;  3A4U A;  1XE7 A;  4MZU A;  3WW3 A;  2ZX1 A;  3B93 A;  3I2J A;  3I2G A;  1R1Z A;  4CCJ A;  1C8N A;  5F5Q A;  4XJA A;  4MYE A;  4AL9 A;  3NW4 A;  2MEV 2;  5L36 A;  2IWG B;  3LSD A;  1AR9 3;  1AYN 1;  3H1W A;  5DAX A;  1UOG A;  5GZE A;  1W6P B;  3UL2 A;  4D6S A;  4XFI A;  3DL3 A;  1GP4 A;  5KXC A;  4YPJ A;  3ITQ A;  1QJE A;  5HCA A;  4N53 B;  3NAP C;  4RQP C;  1VR3 A;  3VL8 A;  1W8O A;  1QOO A;  2YBK A;  3C7G A;  3G7D A;  3A21 A;  1ND3 A;  2EAA A;  4OI4 A;  4E9K A;  4N9H A;  1RVF 3;  4BE3 A;  4Y24 A;  4CU7 A;  5FKB A;  4B29 A;  2IC1 A; 
#chains in the Genus database with same CATH homology
 3K4A A;  3ZM8 A;  1JZ2 A;  5JUV A;  1JYV A;  4UOJ A;  1OT5 A;  2VMF A;  2WBK A;  2C4X A;  4D0Q A;  4L0P A;  3WNN A;  4DXS A;  2YB7 A;  2Y6H A;  3VDA A;  3SKV A;  3T09 A;  2ZEZ A;  1UY0 A;  2VME A;  1K45 A;  1GU3 A;  1SDD B;  5C71 A;  3LEK A;  2DCK A;  3OGS A;  5IFP A;  1UY3 A;  2ZEY A;  1IQD C;  3HNB M;  4A6O A;  3LQC A;  1WKY A;  1F4A A;  2Y6K A;  2VCB A;  3HOB A;  4XUT A;  2VZ1 A;  2VTF A;  3GGL A;  4CVU A;  1UY2 A;  2YG0 A;  2ORZ A;  1W0N A;  1H6Y A;  1CIY A;  2J1V A;  3DYP A;  4CUC A;  1YQ2 A;  3I97 A;  4ARY A;  4DUW A;  1L7R A;  1MPX A;  1UX7 A;  3OEA A;  3VD4 A;  3P1I A;  2E31 A;  2V5D A;  1UWW A;  1UY4 A;  4MGS A;  5C7G A;  2WO3 A;  4JHZ A;  4A44 A;  2BBA A;  2VC9 A;  3MO4 A;  4W8J A;  3K4D A;  2VZU A;  2J22 A;  3K4Z A;  4XUN A;  1JU3 A;  4QAW A;  3T2O A;  2VCC A;  1UMI A;  1TG7 A;  1ULO A;  1ULP A;  1GUI A;  4RYD A;  2W95 A;  5LCW L;  3ACF A;  3THD A;  1OF4 A;  5I0D A;  2WUH A;  3NJX A;  1JHJ A;  1UY1 A;  2HLE A;  3CQO A;  2JKX A;  4QDQ A;  4TXW A;  4CUA A;  5J1X A;  1NKG A;  2CDO A;  3SKJ E;  3EYP A;  2V72 A;  3PUH A;  5LA2 A;  3LPF A;  2BER A;  1JU4 A;  3A22 A;  2V4V A;  2J7M A;  4DXT A;  4QX2 A;  1PX4 A;  3WF3 A;  4AAX A;  4XZU G;  2J1U A;  3NNG A;  3MV0 1;  2X10 A;  1UMH A;  2VZV A;  3C7F A;  5B4X A;  3I3B A;  2X05 A;  1GOH A;  2XQX A;  3DEC A;  1NUK A;  1K42 A;  4HG6 B;  1K3I A;  1D7P M;  1F4H A;  1OF3 A;  5DPN A;  2Z4F A;  4DUV A;  2VCA A;  2E33 A;  5JR2 A;  3OGR A;  1PMJ X;  3DYM A;  3WF2 A;  4E8C A;  2VZQ A;  3T08 A;  2WO2 A;  4W4Z A;  3HEI A;  2WO1 A;  1UZ0 A;  1CX1 A;  2YFZ A;  3I3D A;  4OMC A;  1OD3 A;  1O8S A;  1O8P A;  4W50 A;  3ACG A;  2WAB A;  1KGY A;  4PT6 A;  2XHN A;  2VL4 A;  4JKL A;  2EIB A;  3WNP A;  5CZK A;  1RYY A;  2ZEX A;  2WQ8 A;  1W8N A;  5IJR A;  3OEB A;  2J1S A;  1T2X A;  3WEZ A;  3HJR A;  3AC0 A;  1DYO A;  4OZO A;  2VOT A;  4ET7 A;  4BJ0 A;  2VM9 A;  3K46 A;  4OMD A;  4CUB A;  3FN9 A;  3UET A;  4QB2 A;  1W9S A;  1JZ8 A;  3JXS A;  2X09 A;  1SG3 A;  3FHQ A;  4ZZ8 A;  2WN2 A;  4QX1 A;  1XPW A;  2BZD A;  3A7Q A;  1HN1 A;  1LNS A;  2VMD A;  2W3J A;  3III A;  2W47 A;  3NRU A;  3HNY M;  4DEV A;  3LPG A;  3VDB A;  2YFU A;  2EIE A;  2Y6L A;  4XUO A;  3WSO A;  3WQB A;  1CZS A;  2DCJ A;  2B9V A;  1SHW B;  3MUY 1;  3ABZ A;  4A42 A;  4DEQ A;  2HYX A;  3THC A;  4CU8 A;  4MO3 M;  5EIY B;  3LE0 A;  3K77 A;  3W5N A;  4IUG A;  4QB1 A;  1H6X A;  1GOG A;  1JYN A;  2W87 A;  4XUP A;  2DDU A;  4JKM A;  5JMO A;  1J83 A;  3OB8 A;  3WF4 A;  2QQN A;  3CKH A;  2QQM A;  2BGO A;  2QQI A;  1EUT A;  5C70 A;  3CZU A;  2JD9 A;  4ZY9 A;  1UYY A;  4JX0 A;  4LQR A;  3C7H A;  1UYZ A;  2QQK A;  4MOA A;  2VZT A;  3T2P A;  2W1Q A;  4GWI A;  1KEX A;  3I2H A;  3I3E A;  1JI6 A;  2QQO A;  2E32 A;  2J1E A;  3C7O A;  3BGA A;  4GWJ A;  3GM8 A;  4A41 A;  5HPO A;  2YC4 A;  3GXU A;  2ID4 A;  5JXJ A;  4M4R A;  4QX3 A;  4FI9 A;  2W1U A;  3OG2 A;  2W5F A;  3CMG A;  4KWU A;  5G04 L;  3C8X A;  4UI9 L;  3VD5 A;  4P02 B;  1NAE A;  2B4K A;  3MUZ 1;  2VZ3 A;  5JXH A;  4P5Y A;  3T0A A;  2KD7 A;  4A3Z A;  3LEG A;  2WYS A;  3HN3 A;  3MBW A;  2WN3 A;  3ACI A;  3GDB A;  3CZJ A;  3ETP A;  2VQU A;  5B4N A;  2W92 A;  1XNT A;  1GQP A;  4GZ9 A;  1JYW A;  3U37 A;  3W5M A;  1JZ7 A;  4MAD A;  4TTG A;  2YC2 A;  4RN5 A;  3A23 A;  1JZ3 A;  4ZXE A;  4BK5 A;  3CDZ B;  2PQS A;  2BGP A;  4XUR A;  3T0B A;  3WF1 A;  4QDS A;  2C9K A;  3WNM A;  4P00 B;  3NJV A;  4LKS A;  2LW8 A;  4A45 A;  3UNP A;  1US3 A;  5G05 L;  1GNY A;  4JKK A;  1J84 A;  2W91 A;  2VMC A;  2W94 A;  3SEE A;  3FHA A;  4QDR A;  4QX0 A;  3F2Z A;  3HNM A;  2RVA A;  4XVH A;  1CZV A;  2ZXQ A;  3FL7 A;  5LA1 A;  2C26 A;  2R7E B;  3MV1 1;  2LS6 A;  2VR4 A;  1WCQ A;  3HPN A;  1O59 A;  2J1R A;  1P8J A;  1L7Q A;  4QPW A;  1DP0 A;  3T2Q A;  1JZ5 A;  2L9L A;  2VQT A;  3T0D A;  2RV9 A;  4BDV B;  3VD3 A;  2CDP A;  2WDB A;  3WNL A;  2QQJ A;  3EB7 A;  1XNA A;  5DMY A;  2QQL A;  3P6B A;  4OYU A;  3ECQ A;  2Y6J A;  4AG4 A;  3BN6 A;  5DN2 A;  4Z2A A;  4E8D A;  2XOM A;  5JXI A;  3IAP A;  3I2F A;  1UXX X;  3DYO A;  4LHS A;  5EJ1 B;  5FUI A;  4BXS V;  3WNO A;  4M4P A;  4A4A A;  3PUI A;  1CZT A;  5HXM A;  2OKX A;  3OGV A;  2WZ8 A;  1GMM A;  3C7E A;  2W46 A;  2VJX A;  4BK4 A;  1PX3 A;  2EIC A;  1EUU A;  1UXZ A;  3VD7 A;  2RJ2 A;  3E1F 1;  5F7U A;  3WNK A;  4UAP A;  2VO5 A;  3CIH A;  4DUX A;  5A1A A;  4LPL A;  4MGQ A;  5IHR A;  2W9X A;  4CU6 A;  5IYY A;  2QBX A;  2VZR A;  3ACH A;  1R64 A;  2Y8K A;  2JDA A;  3J7H A;  1PMH X;  4DXR A;  3I2K A;  5JXG A;  5LA0 A;  5CYY A;  1XC6 A;  3IB3 A;  1NX9 A;  3K75 B;  4D8M A;  1JZ6 A;  1K12 A;  2Y6G A;  2J1A A;  1UYX A;  1W99 A;  4PQQ A;  3VDC A;  2JE8 A;  3I2I A;  1W9T A;  3SEP A;  3IDA A;  1US2 A;  2Y64 A;  1GOF A;  3UES A;  2W1W A;  1OH4 A;  2EID A;  2J1T A;  4ARX A;  3NQH A;  5EJZ B;  2ORX A;  4CU9 A;  4PF1 A;  1I5P A;  4P08 A;  1DLC A;  3D3A A;  5IFT A;  2E26 A;  4ZZ5 A;  2WAO A;  3VD9 A;  3I2J A;  3I2G A;  1JYX A;  3OBA A;  2VZO A;  1TVG A;  2WZE A;  2WAA A;  1JZ4 A;  4YPJ A;  4OUE A;  2ZEW A;  3IAQ A;  4KI5 M;  4QB6 A;  1W9W A;  1W8O A;  2VZS A;  3C7G A;  4XUQ A;  3A21 A;  4KMQ A;  3WF0 A;  5DQ0 A;  2VZP A;  4CU7 A;  2XON A;  3LEI A;  1BHG A;  2W1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...