2E33A

Structural basis for selection of glycosylated substrate by scffbs1 ubiquitin ligase
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
175
structure length
175
Chain Sequence
RRRNLLRNPCGEEDLEGWSDVEHGGDGWKVEELPGDNGVEFTQDDSVKKYFASSFEWCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRTDAGSLYELTVRLLSENEDVLAEFATGQVAVPEDGSWMEISHTFIDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSSVWVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-box only protein 2
publication title Structural basis for the selection of glycosylated substrates by SCFFbs1 ubiquitin ligase
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase/hydrolase
total genus 39
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2006-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04300 FBA F-box associated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2e33A00
1T2XA 1PMJX 2XONA 3CDZB 2VZSA 2BBAA 2WN3A 2ZXQA 5C71A 3DYOA 2VMCA 5LA1A 3CMGA 1XC6A 2Y64A 1XNAA 2B9VA 2W3JA 4XVHA 2WO1A 3VD7A 5B4NA 2XQXA 5F7UA 3HN3A 4JHZA 1TG7A 3CKHA 4M4RA 4KI5M 3WNLA 1JZ8A 3UETA 4BDVB 2L9LA 4UOJA 3MBWA 3WNNA 3WF2A 5CZKA 1UYYA 1K42A 2E33A 3T0DA 2DCJA 3MO4A 4P00B 2W1WA 1O8SA 1UMIA 3HEIA 1US2A 1JYVA 2E26A 1UYZA 2RV9A 3BGAA 1KEXA 3D3AA 2DDUA 3T2OA 3DYPA 4TXWA 5DQ0A 1UXXX 2W5FA 4OZOA 1UY0A 2VZVA 3THCA 3WQBA 3VDBA 1BHGA 4KWUA 3WNKA 5IYYA 2VZRA 2VL4A 3T2QA 2BGOA 4P02B 2RJ2A 4GZ9A 1DYOA 3GDBA 4BXSV 1CZTA 2WO3A 3DECA 2QBXA 2JE8A 4CU9A 4MO3M 4ARXA 3FHAA 3IDAA 3WF4A 2J1EA 1JHJA 4DEQA 2YG0A 4QDSA 4MGSA 3ABZA 1PX3A 2Y6KA 4AAXA 2WAOA 1RYYA 3K4DA 4CUCA 1I5PA 4GWIA 1JYWA 2JDAA 3VD4A 1UX7A 4GWJA 1O8PA 4Z2AA 3FN9A 1JU4A 3F2ZA 4P08A 4PQQA 5B4XA 3IB3A 3WF3A 2W1QA 3I97A 2VZTA 2J1RA 2PQSA 5G04L 3NRUA 2VZQA 4QDQA 2HYXA 2C9KA 2Y6LA 3C7HA 3GM8A 5A1AA 3I3BA 2XHNA 2J1UA 2W87A 4XURA 2VZUA 1UZ0A 4D0QA 3C7GA 1JZ6A 4XUPA 2RVAA 3CZJA 2WN2A 2V72A 2VMFA 3LEKA 2BERA 2DCKA 5CYYA 4QAWA 3T0AA 4CU7A 1JU3A 2Y6JA 3A21A 2WQ8A 2VQTA 5LA0A 3HOBA 3FHQA 4W50A 4DXRA 5JXHA 2VJXA 3BN6A 4AG4A 3I2IA 1P8JA 3MV11 2BGPA 1HN1A 1JZ5A 5C7GA 4QX3A 4JKLA 5HPOA 1L7QA 2WZ8A 4QPWA 3OBAA 1K12A 3K77A 5HXMA 3NJVA 4DXTA 4YPJA 3GGLA 1XPWA 4QDRA 1H6YA 2X10A 1W9WA 2VMEA 4QX1A 1UY1A 4LPLA 1UXZA 4ZXEA 3OEAA 5EIYB 4UI9L 1UY3A 3K4AA 1PMHX 1UY4A 2Y8KA 1EUTA 3I2JA 3LEGA 3SKVA 3WF0A 2WUHA 2X09A 2VC9A 1F4AA 3OG2A 3IAPA 1CZVA 4PF1A 1NX9A 4CUBA 1W8NA 3NJXA 2C4XA 2C26A 2J1VA 2E31A 1R64A 3C7EA 1GQPA 4JKMA 2VCCA 2VM9A 2BZDA 3OGSA 1JZ7A 2HLEA 1WCQA 2WBKA 1J83A 1XNTA 3K75B 4CUAA 2J22A 2ZEWA 1H6XA 1MPXA 3ACIA 3PUIA 2W94A 4XUNA 1GOGA 4MADA 4E8CA 2Z4FA 3P6BA 3HNBM 4QB2A 3CQOA 1JZ3A 2LW8A 1UWWA 1OT5A 4XUOA 2WZEA 2VQUA 2X05A 2YC2A 4ARYA 2VZ3A 3SKJE 1D7PM 4UAPA 2VOTA 3A22A 2VCBA 2WYSA 4D8MA 3I2GA 4TTGA 3WNMA 1UYXA 1GOFA 2LS6A 1OF3A 3WEZA 1GNYA 1JYNA 4CU8A 4XUQA 3LQCA 3OEBA 4MGQA 1W99A 1UY2A 4XUTA 1K3IA 3VD3A 3LE0A 4QX0A 1DLCA 4QB6A 4A44A 3HPNA 2QQKA 3I2FA 3MUZ1 4JX0A 2CDPA 2V5DA 5EJ1B 3OGVA 2CDOA 4W8JA 3E1F1 1W9SA 2W9XA 4QX2A 3LPFA 2VCAA 4W4ZA 4CVUA 4RYDA 4A4AA 3AC0A 4CU6A 1SHWB 2R7EB 5JUVA 2VR4A 2XOMA 1ULOA 3C8XA 1DP0A 5FUIA 2WAAA 3WF1A 3I3DA 1GMMA 2B4KA 2QQNA 2QQOA 3NQHA 2W46A 3W5NA 2ZEXA 4ZZ8A 4A41A 2VZ1A 2W47A 4LKSA 4DUWA 2EIBA 1NUKA 3HNMA 3WNPA 3P1IA 5JXGA 3GXUA 2YFZA 3OB8A 2QQMA 1IQDC 1TVGA 5LCWL 3J7HA 4MOAA 3DYMA 2VTFA 1JYXA 2ZEZA 3ACFA 3HJRA 2WO2A 4DXSA 2ID4A 5JMOA 4LQRA 3W5MA 3SEPA 4DEVA 2EICA 4IUGA 4RN5A 4OMCA 3LPGA 3I2HA 1GOHA 1US3A 3T2PA 2YB7A 4DUXA 2EIEA 3K4ZA 3VD9A 3MV01 3SEEA 2VO5A 3VDAA 3K46A 3ETPA 2VMDA 4XZUG 3JXSA 1LNSA 5JXIA 2VZPA 1F4HA 5DN2A 2W1SA 2YFUA 2WDBA 4BK5A 2J1AA 3UESA 1SG3A 1SDDB 1OD3A 4ZZ5A 2W92A 3ZM8A 1YQ2A 1GU3A 2W91A 3I3EA 5G05L 3CZUA 5IHRA 3PUHA 4JKKA 4A3ZA 2E32A 2VZOA 3LEIA 4QB1A 3C7FA 1WKYA 3I2KA 2Y6GA 2ORXA 4ET7A 2V4VA 1JI6A 3IIIA 1L7RA 2J1TA 1CZSA 4KMQA 4A42A 1W0NA 3ACHA 3UNPA 4PT6A 4DUVA 4LHSA 2QQLA 2EIDA 5I0DA 3VDCA 1EUUA 5C70A 2YC4A 1OH4A 2QQIA 5IFPA 2OKXA 1OF4A 2W95A 1J84A 4P5YA 1CIYA 1JZ4A 3C7OA 3A23A 4L0PA 4E8DA 1KGYA 3FL7A 2J1SA 3EYPA 5EJZB 3OGRA 5IFTA 4BK4A 2JKXA 3ECQA 3T0BA 4BJ0A 2W1UA 3WNOA 2KD7A 1UMHA 4M4PA 3EB7A 2JD9A 4A6OA 1O59A 3ACGA 3CIHA 3WSOA 2J7MA 2Y6HA 4OMDA 3THDA 1NAEA 5IJRA 4OUEA 1ULPA 2ZEYA 1JZ2A 5JR2A 1W8OA 3MUY1 2QQJA 4A45A 3T09A 3HNYM 3IAQA 4OYUA 5LA2A 3U37A 1GUIA 5JXJA 1NKGA 3T08A 3A7QA 5J1XA 1K45A 2WABA 4ZY9A 5DMYA 1PX4A 3VD5A 4FI9A 4HG6B 2ORZA 3NNGA 1CX1A 5DPNA 1W9TA
chains in the Genus database with same CATH superfamily
1T2XA 1PMJX 5FKBA 1OFNA 5F32A 4YM0A 2CYFA 4HOOA 4GXLA 4D69A 2HWF3 3FMGA 5FZOA 5FY8A 4D7YA 4LBQA 3CMGA 1OQ1A 2ERFA 1O7FA 2IXHA 1COV2 1RUJ2 4IE4A 2UWBA 5LBCA 2D44A 4Q8LA 4XVHA 2B7YA 1X8EA 2WO1A 3J8F3 4N43C 4JAAA 3W59A 4ONUA 1OC1A 3HN3A 4JHZA 4ZU4A 1TG7A 5A3UA 3KCCA 3POYA 1W8UA 1TNRA 4Z1VA 3B94A 4KI5M 1S0IA 4PI0A 2BQPA 1JZ8A 1E5RA 2B8MA 1QMJA 1YCIA 3UETA 4A6SA 5BY5A 1FMD1 3MBWA 1Q8QA 1XSQA 3QH7A 5A70A 2A75A 4Y1ZA 5FY1A 5I0TA 1UD1A 3O1RA 3E6BA 4IEZA 3MO4A 4WVMB 4AHZA 1BMV2 1O8SA 3N3HA 3VBUB 1Z78A 4HKOA 3S7IA 1QDCA 3I59A 4KG8A 4YWAA 3ZMNA 4BQ2A 1JXNA 3RDIA 4TLFA 2DUOA 3CU7A 3ZFFA 1MEC3 4CSWA 1VIWB 5FP4A 3T2TA 1AR93 1Q56A 1QJX1 2IXKA 3CLPA 2DDUA 4XDQA 1IG0A 3ZYPA 4QPIB 3T2OA 4BU2A 4Q4V1 4CCJA 4EWEA 1NQDA 4NIIA 5DQ0A 3O0VA 1UXXX 5FXZA 2CTVA 2PHUA 3HT2A 3H9AA 1KS4A 1LEMA 1OOPC 4KWUA 4BB3A 1DQ6A 3APBA 1D0GA 2UY9A 2HWB3 4KU7A 3QOPA 4CDUB 4LA2A 4OHWA 1EV12 4M0HA 2I2SA 2CL2A 1G8WA 4SLIA 5F9TA 1W2AX 1WD3A 3GDBA 4CDQB 2VY0A 2PLV2 2XJPA 3NVCA 4ISRA 3MGUA 4AQSA 2WO3A 4QX5A 3DECA 5F6LB 1VBE1 1JODA 4YG0A 4L11A 1YYNA 5JZGB 1D0HA 1RUH1 1W6MA 2HWE1 3KB5A 4NPRA 2WKKA 3FHAA 3IDAA 2AGSA 3J8F1 3OYWB 1HX6A 4W6XA 5JOYA 2X29A 1YJKA 4BMBA 1QH6A 3VBSA 4OI0A 5GJ6A 1J3RA 1QY4A 3V56A 4LE3A 3ABZA 3AJZA 3AP5A 4UFKA 2P4EA 2DFCA 3VGIA 1O4TA 3WQ7A 4HT1T 4J25A 2BPA2 4Y1YA 3I49A 2WZR1 4LK6A 4CDWC 1UQXA 2P6HA 2DVDA 2XWJB 3K4DA 5J7MA 1AX1A 1OKQA 3VD4A 4GWIA 5JI7A 1A34A 3U4SA 1W0OA 2VVDA 2MPFA 1FATA 1GZCA 1LU1A 2UU8A 4R9DA 4PQQA 4EZ4A 1RUC2 5KHGA 1WMFA 3TEZA 5A7QA 4IW3A 4OUSA 3WF3A 3AX4A 3ZVXA 3I97A 2VZTA 4GJZA 4IL7A 4Y4YA 4CDXC 2BWAA 1H30A 2VUCA 1GV9A 1DYKA 2IVJA 1W8TA 2VZQA 3MFAA 4QDQA 2VBDA 2C9KA 2Y6LA 3C7HA 3GM8A 4FAHA 3OJBA 1RINA 4XF3A 2X5IB 1F5FA 4LORA 4LMFA 4I0AA 2TEPA 3VV1A 3FLTA 4E4ZA 2BNMA 1F35A 2A7AA 5A7NA 2HWB1 2RVAA 1OA3A 4CTEA 3H0OA 1CN1A 2OZ6A 2XR4A 5C3SA 2WN2A 1T6BX 2NN8A 5FP7A 2WZPP 4CEYB 3LEKA 3KT7A 2BERA 1ASJ2 4GH4A 2JDHA 1VBC2 3JD71 1CR7A 3T3YA 1MS1A 1YFUA 3A21A 2VQTA 3SCHA 2VULA 3UJQA 4CP9A 5LA0A 3NNJA 4QXHA 2DU1A 5CB7A 1AR62 5JXHA 3ZYFA 1GNHA 4AR2A 1PGL1 3Q9OA 3RYKA 1V6JA 2BGPA 4CP0A 1H8TB 1HN1A 4WM7B 4IEQA 2GP3A 5C7GA 4E2SA 3K48A 2QNKA 2RR13 4NMIA 5HPOA 4JKLA 1HB2A 3VBFC 1AYM1 3WP5A 2WC2A 1UNBA 2D3RA 3M3OA 3OBAA 4QHBA 5D8AA 3ZN4A 3IPVB 4FPLA 4XJUA 1XPWA 3KS7A 4XQWA 4YPJA 1H6YA 1ZZ8A 2VMIA 3KT1A 1XYNA 3JU9A 5K8SA 3O1UA 1DZQA 2F4LA 2PELA 4B4RA 1C8M1 4EROA 1BEV1 3N7MA 3QCWA 5DDJ1 2OYZA 3AVRA 4HXCA 4CXWA 1OD5A 5IK4A 4XIOA 4AEDC 2FDJA 5IVJA 1UY3A 1MS3A 1XJAA 1HN0A 1PMHX 2E6VA 1PO12 3K4AA 3VHPA 1XNDA 3LEGA 4M0NA 5F3IA 1E57A 3GCXA 3RZMA 1E5IA 2WNVC 3DGTA 1GICA 4YGBA 5L7OB 2R073 1EAH1 1WW4A 4H55A 1PVXA 5FJHA 2JB8A 1KITA 5ABJA 1A78A 2DCZA 2J1VA 3POGA 3L2YA 1G7YA 1ZA4A 2BZDA 1SZBA 2Y33A 3OGSA 5FZCA 4AVVA 1HXS2 3RRDA 4KQ7A 2WBKA 2QDRA 1XNTA 3RZKA 5JOXA 3JZVA 1W6QA 3J4UH 5JOZA 1N1VA 3O5SA 5CEHA 1AJKA 1LGCA 1QKQA 1H6XA 4FPOB 4A7ZA 2BW8A 2XBO2 4LHNA 5H9SA 3O1OA 1TME3 3BYWA 1XE7A 4OHXA 4ZKTB 4E8CA 2K0GA 2KXLA 1R093 1W6NA 3HNBM 3PVEA 5FZ9A 3S6PA 5KXEA 1BVVA 1JYCA 3DXUA 4QXKA 4XMAA 1JZ3A 2QJVA 1VRBA 5C3OA 3AKPA 3MW3A 3GBWA 5FAXA 4XILA 2X05A 2YC2A 4P9XA 2RR11 3WD5A 2RS51 5I8SA 1D7PM 1ZX5A 3MPBA 5JAXA 4UAPA 1QH7A 2HEYF 1C57A 1GP4A 1NCRA 5DG2A 4EV0A 3TN91 2VCBA 1YFYA 2WYSA 1UPSA 5DABA 4YZ3A 1GOFA 1ND3C 1ZNPA 2ZGTA 3WEZA 1JYNA 2Y26A 3LQCA 3OEBA 5KXDA 1AX2A 4B4QA 4KBZA 5DZGA 4LBQD 4H7LA 2DF7A 1QQP2 4QPGA 3TN92 3VD3A 3ZIWA 2E53A 3PUSA 4QX0A 4QB6A 4PDWB 3FBMA 3HPNA 5SV8A 4MLOA 4XDPA 5A3TA 3MUZ1 3H7JA 1SFPA 2W2IA 4XJAA 4H14A 3SNMA 4AK3A 4ES9A 2AREA 1VRH3 3B3QE 3PNAA 4RR3A 4Q4W1 3P3NA 4BIOA 2XUMA 4DIQA 5IK5A 4AWDA 3E1F1 3GYDA 2XKOA 2WO7A 2Y60A 4AZZA 1WA6X 2A6YA 2Z5WA 5FY4A 1D4M1 3WP4A 1UYPA 1ZRCA 1ONAA 2HWC2 4OULA 1D2QA 3ME2A 4CU6A 4ZU7A 5JUVA 3QD6A 5KR7A 3JUUA 4YW7A 3N9QA 4LUMA 2VTXA 4WM8B 2O1QA 3HVDA 1SLLA 3NW4A 2VR4A 4Z82A 1UZYA 2XOMA 5EFUA 5A33B 5F1RA 2MEV3 3C8XA 1DP0A 1O3RA 5HCHA 1MVQA 2WAAA 3WF1A 1V6NA 4NAMA 4C1WA 5M0TA 2UWCA 5FZHA 3TEYA 4IV3B 2GU9A 2PXJA 4A3XA 4NIHA 2DTYA 2ZEXA 4ZZ8A 4A41A 2EA7A 1H1MA 2R043 3MFCA 3JBG3 2IXLA 2X53S 5AC93 3UGFA 3VBHA 4XTMA 5KHHA 3HNMA 2BUKA 1IPSA 2WT1A 4I02A 3N9OA 5JXGA 2YPDA 1ULFA 1Z7S2 3OB8A 4KWKA 1O5LA 1PVC1 2NMOA 4TWTA 5DZFA 3ZFEB 4AW7A 1J3PA 5IVEA 1TVGA 2NMNA 4CA9A 1JBCA 2VXRA 4MOAA 2FDGA 4E2GA 1JYXA 2ZEZA 2HEWF 3WW4A 2AEYA 3ACFA 1ENXA 1MVEA 5ACA1 1I9RA 4LQRA 5ANQA 5JMOA 3W5MA 1FYUA 3HWJA 3O0WA 5FCCA 1RMU1 2P3YA 5FYSA 5BNNA 4DEVA 3HR9A 2WNUC 2K46A 2WRAA 4IUGA 4YVWC 5F2SA 3NAPA 4WVVA 4RN5A 2D6LX 2IVIB 3LPGA 4P9YA 5FZ7A 3ZFGB 1UIJA 2WS91 4Q4X3 3N7KA 1AZDA 1PO22 1S2KA 4ZS2A 1ULDA 4BMEA 3OCPA 1N3PA 4LKEA 4COZA 4UT5A 3KV9A 2BVBA 3SEEA 1R1A3 1MR5A 3DCQA 1YQ8A 3KGZA 4HKLA 2WA3A 3ETPA 1K5MB 2VMDA 3S5QA 1LOFC 2R061 4FCAA 4QXCA 3CL1A 5BNOB 3WG1A 2VZPA 5FZDA 1RUF3 2YFUA 4MVTA 2HWF2 2ZGKA 3UESA 5L36A 2CNAA 3AP9A 4PBOA 3DUIA 2OIIA 4K1ZA 5JMCA 4YVSB 3J8F2 2W91A 1GU3A 3KVBA 5C9AC 4FTSA 1W28A 1U0AA 2DV9A 3ON7A 4JKKA 5AC91 1GP5A 5K0UA 4A3ZA 4E4DX 1JMUB 2JB4A 1WBFA 4Q0UA 3ZXJA 3OUIA 2V5YA 2ORXA 4WM8A 3DKWA 2C24A 4K20A 3U75A 2LROA 4Y26A 1AR83 1H2LA 1JI6A 1SLCA 4Q4Y3 1L7RA 2J1TA 2CAUA 2OUHA 3K3NA 5LA9A 4KMQA 4P9JA 1W0NA 4GMP1 5A6QA 4N53B 1Y9MA 1AHSA 1DU3D 5FLIA 3ZSEA 5JSPA 1TMF3 5DUWA 5I8YA 2E51A 2VBBA 4PQ9A 5EXOA 1F31A 5B2GB 3GZEA 2QQLA 2EIDA 1VAVA 3L9JT 2JG9A 4HPKA 2BTVC 1V6IA 1MEC2 1UL9A 1AR92 3HBKA 4FFGA 3MF9A 4EN6B 3VDCA 1EUUA 1UOBA 5FPVA 1SBFA 1OVPA 4Y22A 5C3QA 1WW5A 4CEWC 1EYBA 2OKXA 4YFZA 4P5YA 1LTEA 4MV2A 1CIYA 1C28A 1JZ4A 1L7LA 3A23A 1N1YA 1BLZA 4NHXA 1RHI1 2XLFA 1SCRA 2TNFA 4QX7A 2J1SA 2XJQA 1XQNA 2HWB2 1KDMA 4UW6A 2JKXA 4PLNA 3T0BA 2EVXA 4HANA 1V6MA 3NNMA 1EP0A 2Y34A 4BJ0A 5KWRA 4LOSA 3ZFGA 3GZUC 1ODNA 3CJIC 4ORFA 1UMHA 2ET1A 3RZJA 4FPKA 2YROA 4XE9A 2XH6A 2GN7A 5A7WA 1Y4WA 2ZMKA 2VU9A 4YZ5A 3LA3A 1NA1B 3IZOA 3H8XA 5FUPA 1Q8PA 2G9FA 3Q8BA 4HVRA 5BNPB 4F7ZA 2RS11 4LBKA 5JR2A 4AI2A 4A7YA 1C5IA 4B29A 3N7LA 3MF6A 2RS33 5F3EA 4TLGA 5FYHA 4Q8KA 5F3CA 2ILMA 4AGRA 2P37A 3B5LB 5F6KA 1X82A 3LB9A 2VXJA 3MLKA 1VMHA 4MGZE 4N9HA 2JG8B 2WA4A 4KNCA 2VMGA 3ZSJA 4CXYA 3SISA 3N35A 1HB3A 1LGNA 2W52A 2RJKA 1QXPA 1NY71 1KFXL 2WABA 4D7SA 2GMPA 3WDYA 1FV3A 2IWGB 2SBAA 1NCQC 3MPPG 3NNGA 1ZBE3 1CX1A 4LBLA 1X8MA 3HQUA 3ZXFA 4QGMA 3UKVA 4N7IA 5JR7B 2XONA 3CDZB 1W9FA 3ZYIB 3POEA 4MUVA 4P9LA 5FYMA 3ZSLA 4NIDA 1EPZA 3VBOC 1YUDA 2FCTA 2GNDA 2D43A 4NWVA 2XKPA 3DYOA 4E2QA 1O91A 2HKXA 4URTA 2OVUA 1XC6A 3BCWA 4HZFA 2HYKA 2Y64A 1XNAA 2I07B 4TN7A 4XJ9A 5FO9B 2R1BA 4CYDA 1HRI1 3VDDB 5B4NA 2XQXA 5L19A 1RIRA 5FZEA 4IESA 2JWPA 4LKDA 4NWWA 1DQ0A 3GBFA 4IV1C 4W6YA 5I0SA 2RJLA 3WG2A 2UWAA 5T50A 3MHZA 2FMDA 5FQ0A 1IKPA 5DUVA 5C8CB 4Q5OA 5FIXA 3NV4A 4UOJA 4JGZB 3BU0A 4WZFA 3AZWA 1QJY1 5CZKA 1UYYA 4YM1A 3Q8CA 2WFPA 4IEYA 2VOKA 4NHYA 4FPJA 4Z8BA 2DURA 5JIUA 4E4SA 4FPCA 2E33A 1N1SA 4MYEA 1IPKA 2DCJA 5A7PA 4P00B 2W1WA 2XLAA 2RR12 2RS31 3BOWA 1US2A 4MH0E 4YYOA 4D94A 2PTMA 4C8DA 1UF2C 1IG3A 2E26A 5A6ZA 3KQ4B 1UYZA 2RV9A 2YZ4A 5I0RA 3BGAA 4PBPA 4HK9A 3HD8B 5FPXA 5C5UA 2D3PA 3M7AA 1DBNA 4RS5A 4YLZA 4TXWA 2Q30A 4QGLA 1RL3A 3B9IA 2YYOA 5JWPA 1UY0A 3M2MA 1RUE1 2VZVA 3BPZA 3AB0A 3LDBA 1MS0A 3THCA 4NIGA 4FSJA 1BHGA 4OVEA 2ZAAA 4I3GA 4PIXA 3INAA 3O1PA 2VZRA 2BGOA 4P02B 3O1MA 2QKDA 4BIFA 1AL21 2CSGA 2D93A 2R072 3H3ZA 4BXSV 2ZMNA 4LBQB 3VBRC 3S7EA 4Q1PA 5FP9A 2F17A 1GZ9A 2GMEA 4AQTA 2JE8A 3EO6A 5IVVA 5BNQA 1NT0A 1RUG3 3P5BA 5HCBA 4CP2A 1MQTC 3MI8A 2ZGUA 2J42A 5GZFA 1ZBA3 2YBPA 4R8HA 1B35C 3KT4A 3IDCB 1DF0A 1ZYBA 4U36A 3WY6A 1YNAA 4LO7A 4LO4B 1TME2 4XCBA 2P3IA 3VKFC 1FPN1 2WAOA 1LJ7A 1DFQA 2XG3A 4YM3A 5FMCA 1R092 1F9KA 1PZ9A 1J1TA 1QNYA 1WCSA 4QQHA 3DL3A 5E6HA 4BOWA 3I59B 2JDAA 1UX7A 1QJU1 5C4WA 1O8PA 2VTXJ 3ZFFB 1APNA 1BK0A 1FMD3 5HCFA 4LXLA 1JU4A 2VMHA 2GNBA 3F2ZA 3NJZA 3NV1A 4JGYC 4P08A 2ETEA 1N3QA 5HXVA 1R081 5A3WA 1ND2A 1VE0A 2H0BA 1SPPA 2YUEA 3B7MA 4LTAA 4EWAA 4IDZA 3MYXA 1LGBA 2W1QA 2XL7A 2ZGQA 2UY8A 2ZKLA 1CQ9A 1ZRRA 5G04L 4RFRB 4QWNA 1MACA 1CAXA 5A1AA 4B3NA 3UJOA 4CCDA 1KS5A 4NHLA 1YHFA 2XJSA 5C8WA 2W87A 3BB6A 2WFF1 2AH2A 5FOBB 1QJX3 2ENRA 2EXIA 2VZUA 3PURA 1FNYA 4EN7B 4D0QA 4BQ3A 4Q0VA 4XUPA 4AVSA 1OPOA 3DKQA 4Q4V3 1OQEA 3CZJA 3EQEA 2BOIA 3H3UA 4JTOA 5CU1A 2V72A 3DPRA 4F8AA 3BUCA 4OHYA 3WUDA 1S0BA 3CHXA 1VRH2 4Z92B 2Y6JA 3UK9A 4NOTA 3WT3A 3HQXA 3GBGA 3LF7A 2D6OX 2WLQA 2P2KA 3VBSB 2VOVA 3HOBA 3FHQA 1F2NA 1G9BA 1ZBA1 2GAUA 4WBBA 3FBYA 1P8JA 5FWEA 2HEVF 2JKBA 3OUJA 2Q1FA 3MV11 3VZOA 1Q8VA 3WQ0A 2Q1ZB 1JZ5A 1VBE3 3KF5A 4LHKA 4COVA 5FYYA 3TNPB 3SHRA 4P9GA 1RUH3 2HWE3 5APAA 4YG3A 2BDRA 4QX3A 3KV6A 2MEV2 2QFEA 1XNBA 2WZ8A 1H2NA 4DXTA 1WMXA 2MHFA 3W9AA 2FDKA 5FXWA 2VMEA 4IEVA 4JV4A 4QX1A 5BPXA 1UZWA 2R042 1UKGA 3JBG2 2C1FA 2D3SA 2WZR3 1UW8A 4QMAA 3RZZA 1LHVA 1DYPA 4UI9L 1G9CA 1UY4A 3I2JA 3SKVA 3URFA 2E7AA 1PIV1 1Q3EA 1DG6A 2OZJA 2WUHA 2ZGSA 5FYZA 3V65A 3VZLA 3WF0A 3B9CA 3JQWA 4CZSA 3OG2A 4P9WA 5KHIA 5FK8A 2RM23 4RHV1 1PGW1 2FCVA 5CFDA 1W3XA 3ENRA 3THTA 1BK1A 4PF1A 1NX9A 4R4ZA 1IKQA 4NAOA 3D6EA 4V2VA 2WINB 2CGPA 2ZJCA 4PJYA 2CHHA 5FREA 4MHRA 1R64A 4H2AA 2G9ZA 5GZEA 2OPKA 4JKMA 3W21A 4NE9A 4ZONA 3I7DA 4GH4B 2PAMA 3POSA 4I30A 3USSA 3WVJA 4QQ2A 4AXOA 3MLLA 1HIXA 1KJRA 3VBUC 1WCQA 1RUI1 1H2KA 4CP9B 1SMVA 2HWD1 3FHIB 1KDKA 3K75B 5FK7A 1S0JA 3BALA 2ZEWA 4Q4X2 1MPXA 2XB6C 3ACIA 1XB9A 5DAPA 5F5CA 4XUNA 4QPIC 1GOGA 4MADA 2PN5A 2CU5A 3GJAA 1R1A2 1SEFA 1MZFA 3P6BA 1JYTA 1QF3A 2LW8A 4NUBA 3JD73 1UWWA 2QQPA 3OTFA 1HLCA 3D8CA 1N47A 2JD4A 5D8AB 1RUF2 4CDUC 4COYA 2ZHNA 1C1LA 1TZOA 1G9DA 4O9EA 1UOGA 2ARAA 1C4RA 1FV2A 1POV1 1S2EA 3D82A 4CDQC 2JENA 1PK6A 2VOTA 3EMRA 2YXSA 4WZCA 2WIIB 3RFRA 3TRSB 3WW2A 1RUOA 4OLLA 3MIBA 1UU5A 4IEWA 1UYXA 2LS6A 1NE6A 3MLJA 4M00A 1BBT1 1AYM3 5JZGC 4HLTA 4AI9A 3CEWA 3RSJA 3TBDA 4GWNA 4MGQA 4LLOA 2ZX0A 1X50A 4XUTA 4HONA 3ZKYA 1AR82 4Q4Y2 4TSVA 4CDWB 1RXFA 5CISA 1N3OA 1C8M3 5ABJB 2A6WA 1BEV3 2RM21 3LD8A 1FNZA 5DDJ3 3H42B 4CCOA 4A44A 1CONA 1H1IA 2E63A 4N43A 4Q0SA 1DQ4A 2QQKA 5T54A 3OD0A 3W20A 3HN1A 1TMF2 2O14A 5EZWA 5E8AA 1WLCA 2ZGNA 3IDBB 3IM0A 1DGWX 4D6SA 3OGVA 2ZHMA 2Z2SB 1LODA 2G19A 3M3QA 1W6QB 2CDOA 1VB2A 1W9SA 2W9XA 2CV6A 4O7XA 3THPA 1EAH3 3J7LA 1BCXA 5D21A 3SXWA 1UPIA 4XHBA 1WD4A 3WUCA 3LPFA 2Q8CA 2VCAA 5CKNA 2EF6A 4YARA 4JZRA 1W6NB 4S2DA 5DUXA 2WYFA 2HJIA 2IZWA 3V64A 4IETA 5A80A 5FOJB 3LZZA 2R32A 4XBNA 2JDMA 3OOXA 5EV7A 3B02A 3I3DA 3AYCA 4XTPA 3ZO0B 1F15A 1PNFA 2K2SA 4NIAA 2X5IC 3UGGA 2XDVA 5I91A 2YY1A 2WWUA 2FZ1A 1JTZX 1VMFA 1OLME 1ZZCA 1NCRB 2PYTA 4DOUA 2W47A 2JDPA 3U14A 2PHFA 4DUWA 1A3KA 4CEYC 1NUKA 2ZMLA 3WNPA 3P1IA 1RUNA 3UGHA 4AF9A 2YFZA 1LHUA 1OOPA 3POBA 3H8OA 4XZPA 1IQDC 1ZZBA 4BQ5A 2RS53 1MS9A 3JB4C 1MZEA 1BZWA 3J7HA 5F39A 4QPGB 4Q0QA 2IXIA 1LCLA 3H50A 3ZR5A 4J1XA 5LZ6A 1REDA 2OX0A 4DRRA 1BKZA 3TN93 2WO2A 4LOTA 1H8TC 1YQCA 4WM7C 3BKZA 4LJHA 1W39A 3PL0A 4NRQA 4XFBA 3RWNA 2XLGA 1MZ6A 1QOSA 4RR3B 5GKAC 2Y38A 3HMYA 5JLVA 4UW3A 2EICA 5IAXA 4Y1XA 1WGPA 1ENRA 4XF9A 1I5ZA 3C2UA 2W39A 1US3A 3AMPA 3FZ3A 3UYJA 2BGCA 2IUWA 3BU7A 2DUQA 5K4LA 4MZUA 1X36A 4RQPC 3AMQA 5SV5A 5CAZA 2VO5A 3VDAA 4HBNA 4CDWA 3JCIA 5IK7A 3MZHA 1ZBE2 3J26N 2O8QA 1YC61 1VP6A 4XZUG 3JXSA 1LNSA 1DCSA 4Q4W3 4Y33A 3AL6A 3BIWE 1JUIA 4AAPA 4DFSA 1F4HA 3RYPA 4LA3A 3WDTA 1AR71 2B5HA 1VBA1 1GZTA 3SQOA 1URXA 2XHKA 5FYVA 2Q5TA 1A8MA 2BEOA 2ZGPA 2HBTA 5L7OC 1D4M3 4RGKA 1O3QA 4XQDA 3H1YA 2W92A 4QD2A 2PHDA 3VBHB 1WMEA 2XJTA 3O1SA 1GLHA 4L99A 4CDXA 5A1LA 4C0BA 3CZUA 3PUHA 5GZCA 4W6WA 3PVBB 4MSVA 2JEMA 4QGNA 2VZOA 1C3HA 1WKYA 2AR6A 3IWZA 4AE2A 2Y6GA 2ADEA 4BE3A 2GSYA 2GH8A 4GB31 3KMHA 2JDZA 2WLPA 5F2WA 2XPJA 1CX4A 2JE7A 2YGMA 3HQRA 4A42A 3KCYA 5FXXA 4IGQA 1N1TA 2ARBA 4Y20A 3IBMA 4FFHA 5K7PA 4HVQA 3ROUA 4K21A 4DUVA 2VD7A 5EHDA 5BNNB 4XXAA 1HW5A 4ZXKA 3U1XA 3EXUA 1RUD2 2W08A 2DBIA 4LHLA 1PVC3 5I0DA 4E27A 2ZABA 3NAPB 2BBVA 1Q43A 1R1ZA 2G1MA 2GC3A 4S2GA 5FKCA 1W9YA 2XVKA 3U10A 3WW1A 2YC4A 1VPHA 4BWOA 1OH4A 2QQIA 2UURA 2ZGLA 4META 2ZPXA 1REEA 2W95A 3PHMA 1CAVA 2ZTNA 2D40A 4FP2A 5ACA3 2GZWA 3AZXA 2XJRA 4AI3A 3V0AA 3C7OA 1HQNA 1RMU3 3MW2A 4L0PA 3VBFA 2GNMA 4GA9A 1RVF1 4FBFA 3EYPA 3T4VA 4C91A 1SLAA 3OGRA 5LRRA 2PHWA 2ZACA 1QEXA 5T5PA 1O3TA 5JOWA 1JOPA 3VHRA 2WS93 2QZ2A 1YJLA 2RMU1 4EN0A 1CJPA 4XDOA 2H6BA 2EXHA 4KL1A 2DWRA 4BQ1A 2JXAA 4MXVA 5C3RA 2Q0AA 1SLTA 4XFCA 3ZPOA 4LT5A 4PDWC 1HRV2 2D5FA 1CAUA 4Q1RA 3NV3A 4AEDA 2GP5A 2R30A 2DFBA 1RUG2 2RE9A 2R063 1NYWA 2ES3A 5K0UB 1UU6A 1XNCA 4OHZA 2JDKA 1J3QA 5FZLA 2Y6HA 3WP3A 4OMDA 2WNVA 3THDA 4AFMA 3O14A 2I45A 4UFIA 3DF0A 5FYCA 3N9PA 1JZ2A 1FOD1 2YBKA 5CKMA 4KU8A 3NMBA 1FI2A 1VLNA 4CXXA 4LE4A 3LA7A 4FO9A 1W8OA 3ZYJB 5FPLA 4YRDA 4RL7A 4B1MA 5LASA 2AC1A 1YEWA 5A7OA 1C8NA 3VHOA 2GC2A 4A45A 5FZ6A 3FUQA 4J1WA 1W0PA 4QHOA 3U37A 4Y5Z0 1GWMA 2JG9B 4HPKB 2D6NA 1RXGA 2EIGA 4XFAA 5EPAA 4Y24A 1FMD2 4IV3C 3LOIA 4PHZA 3E6CC 4HN1A 1K45A 4Y22B 5FPUA 2QTWB 4GMP3 1PX4A 5DMYA 2PA7A 1C5HA 4AVTA 2ZGRA 4HG6B 2QCSB 1S0EA 3W58A 4OQ9A 3NKGA 2C5DA 2NM1A 3FFZA 4LBOA 1UKRA 1KXGA 1SLBA 3GF6A 3LIGA 5IVFA 4NROA 1ULEA 1QWRA 3ZFEC 1QJX2 3ILNA 2ZXQA 4B1LA 4Q4V2 2VMCA 3VKLA 3ZN6B 3AKQA 3UKTA 2B9VA 4IEPA 3UL2A 2PFWA 4JQRA 1AXZA 4S2FA 3MIEA 2V09A 1W6OB 4HETA 4IXLA 5BXXA 2AACA 1ND3A 5A7WB 1UZZA 4JTNA 1RHI3 2QVSB 4QT6A 1M4WA 3CKHA 3ES4A 1H1AA 5JPMB 3WNLA 4AI8A 1XU2A 2W0XA 4BDVB 4OUMA 1ZVFA 4HKWA 1W2NA 1W2TA 1YXWA 4MX3A 5FPBA 1VBD1 4ZS3A 3ZFGC 3ZXKA 4BQYA 5J3UA 5A32A 2RDNA 3KGLA 5FRAA 1RJ8A 1J1LA 2H0VA 3MDPA 3VLBB 1VBE2 1V9U1 1K42A 5FY9A 3ZXLA 4ASLA 3OGGA 5I93A 3T0DA 1RUH2 5JVVA 1XE0A 2HWE2 3KVAA 3LIHA 4HL0A 3HEIA 2DYCA 1K5MC 5GLZA 5GALA 3AM2A 1OLMA 1QGLA 5BNOC 2OW4A 4GD4A 4DXZA 5DG1A 3WCSA 2RS13 1OA2A 1KEXA 3E5XA 2VNVA 4XC9A 3D3AA 5F5QA 5C9AB 3ZXDA 5FMBA 4ASMB 4INDA 2RDSA 3HBZA 2WZR2 1COV1 1RUJ1 2NLRA 5FO8B 4YVSC 2OS2A 2W5FA 5FYTA 1ZRFA 3OUHA 2WNOA 3WQBA 2GN3A 4AFBA 3VDBA 2QQWA 5FMDA 4N90A 3WNKA 5IYYA 3B69A 4CCMA 2VL4A 2RM22 2Q8EA 3T2QA 4GKXA 2RJ2A 3AK0A 1OLQA 2DVBA 4GZ9A 3FLRA 4DPNA 3NV2A 5FZBA 4Z07A 1XE8A 1CZTA 3MW4A 4UBGA 4YNIA 1CPMA 1ENSA 5FMOL 3PIJA 2R1DA 1O6UA 2IFRA 1WW7A 2QBXA 2VGDA 4LO6B 1H8VA 4QM8A 3TWIA 4N53C 4CU9A 2WL1A 4MO3M 1GQGA 4QKBA 1BMV1 3FJSA 2VW1A 3KLSA 3WF4A 2J1EA 1NZCA 2EALA 1GQHA 5CIRA 1WA4A 5FQ0B 5IAVA 1JHJA 1XOYA 3WG4A 4DEQA 3V0BA 2YG0A 4LO5B 4XHXA 1RGSA 3OF1A 2OQ6A 1DHKB 1CPNA 1PX3A 1QJFA 2EXJA 2Y6KA 5FYIA 4AAXA 3RMYA 5IVBA 2RDQA 1HRI3 1WLWA 1V00A 1RYYA 2YPJA 5FZ1A 3ZN6A 2VVEA 3AYDA 3BI3A 4MGTA 1LOEA 2R0HA 3JD72 1W8ZA 3N9MA 4CUCA 1JYWA 3OY8A 2WNUA 3SCFA 1W6OA 1D4VB 1G86A 1YI7A 3KF3A 4V2WA 2A1XA 1QJZA 4GWJA 4YVWA 4A2UA 3RI9A 1JUHA 3FN9A 4Z2AA 2XMLA 4KH9A 2FCUA 2OA2A 1EV11 2LM3A 3ILFA 2ZA9A 1IS6A 4XPVA 4UFLA 5CKQA 1QJY3 5TSWA 1AUYA 1PGL2 5B4XA 2O0OA 2PLV1 3IB3A 2PHLA 4RS5B 1GFF2 5A3LA 2XWBB 4ISQA 5JPNB 1TEIA 2P1BA 3JQXA 3LKJA 3WXPA 5D2AA 2PQSA 4DNYA 1ZZ9A 2GH2A 1AYM2 1LOFA 3BODA 2HYXA 2PAKA 2VUAA 5J98B 4YZ2A 1IGOA 4L8QA 3I3BA 1IS5A 2XHNA 4XABA 1NA1C 2QUOA 4NPMA 4XURA 5BNPC 4AFAA 1UZ0A 5FYBA 3C7GA 4LBJA 1JZ6A 2F4PA 4AL9A 1C8M2 3ATGA 2ZX4A 1BEV2 5DDJ2 3AYAA 4Y1VA 3EHKA 1NLRA 1NXMA 3WLUA 2B39A 4IE0A 4UW5A 1ZZ7A 3LEMA 4RGGA 5C9AA 3T1LA 4QAWA 4M3CE 1AVBA 1JU3A 1RUE3 2FQPA 3T0AA 5L9VA 2FDHA 1GYKA 4R9BA 1JH5A 1V70A 1VAKA 2WQ8A 5FZIA 1W2OA 3ES1A 4QKDA 3VB9A 4CCCA 2JG8C 3KSCA 4FQZA 5T5JA 2EAAA 3POWA 1AL23 4W50A 4XF0A 1EAH2 5LEJA 4BA6A 4XBLA 4FPEA 4NJ4A 1YIFA 2VJXA 3BN6A 1RUC1 4AG4A 2HH9A 1GR3A 2B45X 3ZYGA 2BRTA 1DZTA 4UF0A 2P3KA 4IGPA 3S5AA 2FMYA 2P5BA 5HBAA 4QKFA 5L73A 5JSOA 3IMMA 1SACA 3I3QA 4QPWA 1RJ7A 5C4WB 3K77A 3NJVA 4QDRA 4Q26A 5T5LA 4Y5TA 1QOTA 1V0AA 3OPZA 3J9SA 3U07A 3PIGA 4PLMA 4X8NA 3E5UA 3SLIA 1JOJA 1ND2B 3UV9A 1SPPB 1FPN3 3AJYA 3ETQA 4FFIA 4XEZA 4CEWA 3WV6A 2GALA 3MICA 3AP4A 4K9SA 3RJ2X 5EIYB 3VDDC 2QQUA 1ASJ1 3B01A 5LA1A 1CAXB 2A6XA 3AP7A 1QJU3 4FAGA 5CA6A 2X09A 3O1TA 3KZ4C 2GC0A 4LK7A 2TBVA 2OPWA 1VJ2A 3IAPA 4IE7A 4EZHA 2RS52 3VZMA 3G6JB 5LB6A 5C8CC 2ZOEB 4JGZC 1AR61 3RZLA 4GAZA 3NJXA 1R083 1SBEA 5FYUA 4ASKA 1POQA 5FY5A 2C26A 3QBQA 2E31A 3BVCA 5LY2A 3DPRB 3C7EA 3LSDA 4QQPA 4XQ4A 1XRUA 3CJIA 3LDKA 3I4IA 4BXFA 2G9GA 4EYUA 1ZM1A 2VM9A 4ES8A 5CFCC 3BTZA 4CE8A 2HLEA 2NYYA 3QLQA 3PJYA 4JC1A 1GP6A 1DGRA 1J83A 2VPVA 2ZGOA 4ITCA 1I1EA 2WFF3 3KD4A 3ZN5A 5FPAA 4CUAA 2J22A 3LGRA 3RZGA 1AYN3 3POIA 5FY0A 5FFOC 1EPWA 2CGNA 4GKYA 3USUA 1PZ8A 1SFYA 2AEZA 1XBFA 3KWVA 5FMOS 5IW0A 3ZXAC 4CUGA 3CQOA 5A1FA 5IWFA 3ZPYA 4URAA 3BTAA 1PO11 2ZX3A 4Q4W2 3M70A 1VMJA 3AKTA 1OLRA 2BVVA 2VQUA 1RTVA 1Y43B 1NLQA 3JB8A 1S4CA 1UOFA 3R4DB 3SKJE 3TOJA 4XW3A 3GHNA 5A3OA 1D4M2 2YC0A 3ST7A 1VR3A 3ZIXA 3A22A 1NCQA 2RDRA 2AZ5A 3R4SA 3LFMA 3WNMA 4HK8A 1O4ZA 1S2BA 5AVPA 3U11A 2YU2A 1GNYA 1ENQA 3SH5A 4XUQA 4CU8A 3E6DA 4RD7A 1HXS1 5H9RA 5IVCA 3FC0A 2IXCA 1BQPA 5CFDB 2DVFA 4IQPA 3AMNA 3D0JA 5FJKA 3AFKA 2VBPA 4AVCA 4N9IA 1K3IA 3M3EA 4B4PA 2XBO1 1NQJA 1DLCA 2QQVA 1WCUA 3N9LA 1HQLA 3I2FA 4PF5A 1REFA 2VOXA 4JX0A 3NJYA 2V5DA 2BNOA 2IC1A 2VE1A 3K51A 4IV1A 1PIV3 3GCWA 5EJ1B 1PVC2 4X6QB 4W8JA 4RHV3 4FOWA 4COUA 4QX2A 2LALA 5C33A 5EWSA 4YGDA 3ZFFC 4IE6A 4YGCA 3H1WA 3S30A 5LBBA 4AOCA 1QXRA 2QE3A 5ERLA 1H9PA 3OPTA 4ATEA 3NKTA 5GZDA 2Q1MA 4W4ZA 4CVUA 4DZGA 3PVOA 1FAYA 1FT9A 1AYN1 4A4AA 5ACA2 1CVNA 2JE9A 5FZ4A 1RMU2 3QACA 3SH4A 4BYYA 3VKOA 3WNXA 2JECA 2F6BA 1RUI3 5FXVA 1UO9A 4YW2A 3KV5A 5FUIA 2HWD3 1DQ2A 1GMMA 2B4KA 1YI9A 2JDUA 1WMDA 2QQNA 3DEMA 2WS92 1BJQA 1AF9A 4GWMA 1H4HA 3LWCA 1QQP1 1PK6B 2ATFA 3VZJA 1ZA7A 2VZ1A 2FBEA 2FDIA 1PZ7A 2UYAA 5E89A 1LOAA 1O4YA 2XXZA 1LHNA 2EIBA 1SFNA 2WQZC 1Z0HA 3Q8AA 4MXWB 1OA4A 2C9AA 2AUYA 2R062 3GXUA 3ILRA 4LEJA 1RITA 4LBMA 4RGAA 3LSEA 2OT7A 4Y5SA 1OFSA 1PMIA 4JQTA 4YW5A 1XYOA 1DGWA 5IATA 4PIYA 1Q8SA 2DUPA 2YU1A 3VBSC 2YDEA 3ZX7A 4PCRA 5KBFA 5LCWL 1PGSA 1POV3 1HQWA 3VBRA 5DZEA 3AMMA 4N43B 2HWC1 3HJRA 4P9IA 5DAXA 5FZAA 1U5YA 4FT8A 1DQ5A 2ID4A 4DXSA 1MQTA 2FD8A 1BBT3 5LW9A 4X8PA 1YFXA 5AC92 2PHTA 3GHMA 2AYHA 3D0SA 2LRPA 3M4FA 4NN0A 1B35A 3CBNA 3P3PA 1J58A 4OMCA 4SBVA 4XOGA 1G9AA 2A71A 3I2HA 1GOHA 2ADDA 4QPYA 5T55A 3T2PA 1CIWA 4LBNA 4DUXA 4E4HA 4LNVA 4UW4A 4F3JA 3MV01 3A0NA 3L2HA 3FFQA 1S1AA 4BZ4A 5D1IA 4QHZA 3K46A 2EAKA 1WWYA 2PQQA 2VNGA 3FE5A 4JHTA 4BISA 1GSLA 1Y9GA 5JXIA 4I0BA 1AXYA 1Z7S1 1UN1A 4V1PA 2TUNA 5T52A 2CWMA 5DN2A 1WBLA 3DXTA 4Q29A 5GM0A 2D6PA 4Y1UA 2WDBA 4YG6A 4BK5A 4JGYA 3X29B 1SG3A 4AI1A 1SDDB 4O65A 4AEKA 4M3CA 5H9QA 1OURA 1W06A 5L9BA 3G7DA 5IK8A 5AVAA 5A3PA 3WR0A 1LU2A 2Q4SA 2JDYA 3BPSA 3ELNA 3M1HA 3ZDSA 4MHUA 1MZ5A 3CO2A 5F5IA 3SC7X 1YQ2A 3I3EA 2ARXA 3WZ1A 1VAMA 5IHRA 1QNWA 1RHI2 2BFUL 4GH4C 1HB1A 1OOPB 5F5AA 4CRQA 2BOJA 3LEIA 3FLPA 4QB1A 1RC6A 3BTXA 4LLFA 1S55A 2VNOA 5BUVA 1GWKA 4IEXA 1DZRA 2LUWA 2VG9A 3OD4A 4KBBA 1PO21 4I09A 5C3PA 2ZX2A 1TQ5A 4K3UA 3POFA 5KHKA 3ACHA 5EJ3A 4Q27A 3UNPA 4GQ7A 4K8FA 4UBHA 5KC5A 3LDRA 3POJA 4LHSA 1LOGA 4JVAA 4LIVA 3PTYA 5D8AC 4MXWA 4A7KA 1UX6A 2RS12 4OI1A 1WCDJ 2Z42A 3VUOA 2HWF1 5LEKA 1UOJA 2G4IA 4O61A 1XU1A 2CAVA 2ZS6B 4QX8A 4BLJA 1W05A 3SCGA 3WP6A 5FWJA 3N9NA 1XYPA 2ZHLA 4XJWA 1X9PA 1G9FA 4BLIA 2UYBA 4NPLA 1SBDA 4YM2A 1LAJA 1LHOA 4YZ4A 4EN9B 1LULA 5IFTA 3BIEA 2NQYA 2ZZQA 4BK4A 5EQUA 1NY72 3ECQA 3I54A 1KQRA 4XFFA 4U2AA 3SMHA 1JOBA 5FP8A 5ABJC 3KHCA 2K9ZA 4CCKA 4CDXB 2IXJA 2Y0IA 3QH6A 3EB7A 3HIFA 2W68A 5EYXA 1U5XA 4LITA 1UU4A 1O59A 1ZZ6A 3ACGA 3WSOA 1QJEA 4DMIA 4DRVA 4XETA 1AR73 1W8WA 2RHPA 1VBA3 2GNTA 3FUOA 5IJRA 3TYJA 4DS0A 1ULPA 1MEC1 5HI0A 1AR91 2V4AA 2YV8A 5AFEA 3VKNA 4EE2A 2A70A 1W8FA 2GDFA 5LY1A 1S0CA 1HRI2 3S57A 5DAVA 4L92A 4Y20B 1HKDA 2QQJA 3IN9A 3T09A 1PHMA 2JIJA 4WVMA 3ZXGA 3IAQA 4HSJA 1Y7BA 5LA2A 4FP3A 3VBUA 1GUIA 2BYVE 4FTEA 2WNEA 4Q0PA 5DUUA 1HJFA 1Y9QA 2DVAA 5EYYA 5LBEA 3AZYA 4PLOA 3T1MA 4I3PA 4GB33 3EBRA 3T08A 3PU3A 3WW3A 1Q5OA 2YHJA 1QJY2 2E7TA 1ZRIA 1SDWA 4QPIA 3BOPA 4ZY9A 1KRIA 3VD5A 1CAVB 1NCRC 1DIWA 1OPMA 2CWSA 1LECA 4LIUA 2ORZA 5L9RA 3HT1A 5KXCA 2RS32 3V0AB 3VBFB 2FHRA 3NO8A 2VZSA 3LFIA 4G9SB 2A3XA 2BBAA 5FTTC 4CDUA 2XVLA 2D98A 2DCYA 1W2UA 2A3WA 2VUJA 2WN3A 5C71A 4QU1A 4NR1A 3N4MA 3AP6A 4R9AA 4QPGC 2YMZA 4CDQA 3AXEA 2EXKA 3D4KA 3RVHA 1W6PB 2W3JA 1CAUB 4AEDB 3KCXA 3VD7A 1OH3A 5FLHA 3ZYHA 4JDMA 2V73A 5F7UA 1RUE2 5FZMA 1NOVA 3WCRA 3CJXA 4QQLA 3WQ1A 5JZGA 1RVF3 2O8OA 2VQAA 4M4RA 1WLTA 2R6QA 4GMP0 4RR3C 2WNVB 3OYWA 3A4UA 4FQ4A 3RS6A 1AL22 2L9LA 4B7KA 2RMU3 4K7JA 4RQPB 4K8RB 3WNNA 5LK5A 4KG0A 3N7JA 3WF2A 2XVGA 2D6MA 1BVP1 2CGOA 4AGVA 2QDNA 2WWJA 5FY7A 2BNNA 3MIHA 2ARCA 1UMIA 1JYVA 1VBB3 2BFUS 1WUVA 1UMZA 1JW6A 4D6RA 4XXPA 3VZKA 1FOD3 4WVWA 4CCNA 3I8TA 2VQ0A 1GKBA 5IVYA 5FZGA 1FPN2 2OQ7A 3DYPA 1IPJA 4AVBA 1XXNA 3BTYA 1UCXA 3VBHC 1W03A 4OZOA 4DY3A 1G6NA 5JIAA 4K1YA 1KD7A 1QJU2 2VW2A 4LKFA 4KGGA 4ATFA 2X5IA 1V6KA 4UFHA 4FTBA 2PHXA 2YBSA 1DYOA 1GZWB 4GJYA 1R082 1STMA 4AEMA 1NZIA 2VW0A 4TYSA 3WX5A 1GWLA 4CCEA 4J6GA 4CEYA 4UFMA 3M3IA 4DY5A 4BQXA 4MG2A 3AL5A 1ND3B 4DB5A 4NRPA 4QM9A 4ARXA 4YW4A 3I2DA 3TAYA 5BNNC 2XUEA 1SLIA 1S0FA 2WFF2 4UFJA 1LESA 3NNLA 3NAPC 4QDSA 1W3VA 4MGSA 2WJSA 5FZ8A 1AYN2 1LOBA 5KC6A 3UT0A 5A32B 4BH9A 3TEWA 5I8TA 3O7OA 1H8TA 1NXD1 4WM7A 2XL9A 4XCAA 4W65A 4O9GA 4BPZA 1CESA 1PM7A 3RGBA 1HV0A 1W6PA 3H3LA 1I5PA 3OGJA 4KWJA 4BQ4A 5KHJA 4AQ2A 2DVGA 1OMIA 3H7YA 3R0RA 4ZU5A 3AMHA 3ZXEA 3IPVA 4COWA 1VBB1 3OSDA 1OVSA 3IT8A 1Q8OA 5J48A 1L3JA 1VBD3 2A3YA 2P34A 1ZBA2 4B7EA 3AKRA 2R071 3WDVA 3PDQA 3ZMOA 1X7NA 4Y4RA 4JDNA 1V9U3 1X9TA 4RQPA 1CWPA 2J1RA 5AFBA 4GULA 3NRUA 1W04A 4R4XA 3FWEA 5K0UC 3TNQA 3LAGA 4IEUA 2J1UA 2Z69A 1GBGA 1S0GA 3DV8A 4WM8C 1DLLA 1U5ZA 1GANA 4OFGA 2WWSA 2WT2A 4HN0A 4WV8A 5L7OA 3H1MA 3PU8A 2R0FA 1COV3 1RUJ3 1TME1 3GZTB 1JHNA 4YFWA 1NLSA 2VMFA 5FV3A 5K9YA 3AZZA 2DCKA 5CYYA 4CU7A 1R091 4XFIA 1QHDA 1WCKA 2A6ZA 3AVSA 4M3CF 5FZ0A 4I2OA 1PIV2 3DN7A 2BV4A 4OI4A 4XJ8A 3PVNA 5FZKA 5T5OA 5JDBA 3AYEA 1YQ5A 1LENA 3V0BB 2X8KA 1PGW2 2JG9C 2ZCWA 4RHV2 2N7GA 5C5TA 3NSTA 4CPBA 4Z2WA 1BYHA 4DXRA 2GC1A 4HVOA 2P17A 2OUJA 3I2IA 1XSRA 5IUQA 1U12A 1VB4A 1EY2A 1LHWA 3RG0A 1YFWA 1GZWA 4CCLA 1O5UA 1PM4A 4YW6A 4L2NA 5LBFA 1LEDA 4R9CA 2FDFA 3K3OA 3PMEA 1RUI2 2DCTA 2WNUB 2NPIA 3OY8B 1L7QA 2BP6A 4MGKE 4XF1A 4YVWB 5H9PA 4EQVA 1K12A 5HXMA 2HWD2 3ZSMA 3GGLA 5JSRA 4XIKA 5ISLA 4KGQA 2X10A 4XFHA 5FUNA 1W9WA 5J37A 1H4GA 1UY1A 5KXBA 3HAGA 4LPLA 1UXZA 3R4UA 2DU0A 2ZX1A 2PHRA 3SH3A 1A8DA 4ZXEA 3OEAA 3LA2A 4H3WA 1OXCA 5CVRA 4JRAA 2Y8KA 1EUTA 1IZ3A 4LULA 4AHWA 2VNRA 1AL0G 1VRH1 3KV4A 2VC9A 5JCTA 3RNSA 1F4AA 3ZLIA 4QU2A 3RI8A 1OUXA 1EV13 5FZFA 4FXGB 1CZVA 1YRZA 1Y3TA 4XJZA 1XNKA 3RYRA 4CUBA 3NL1A 5F8PA 4D7TA 1W8NA 3U0ZA 2PLV3 5JI9A 2C4XA 4K6BA 4FOVA 2VCMA 3IMNA 4PDWA 3H8RA 3EJKA 1GQPA 3ZKUA 4AI0A 2VCCA 1YO8A 4NHMA 1BBT2 3FX3A 1JZ7A 1JYIA 2H6CA 2VH9A 3RJRA 1HB4A 4UYBA 3PMSA 4AHXA 4CP1A 3F95A 2MEV1 4YZ1A 4FOYA 2E7QA 4MGYE 2BJSA 3PTRB 1WW6A 2QZ3A 3PUIA 3H8UA 2W94A 3S0MA 2D7FA 3M3CA 2R041 1CD3G 4I0WB 3JBG1 4HMZA 4KWLA 1E5SA 3OBRA 4UF0B 3ASIA 2Z4FA 4M01A 2VVFA 4QB2A 2R49A 2A73B 3D5OA 4UXAA 3RMXA 1YWKA 1F8VA 3VN4A 1OT5A 4OCTA 4XUOA 1AJOA 5A33A 1QOOA 4OQ8A 2WZEA 4ZHNA 1OSGA 4C1XA 4YSFA 4ARYA 5BYNA 1UIKA 4AFCA 2VZ3A 1DDLA 2BU9A 4IV3A 5F3GA 4IGOA 1RUC3 1I3HA 1CJDA 1CAWB 4CEWB 4L97A 2XJVA 4AVAA 3OBTA 4G3YC 2SLIA 1NG0A 5F37A 4IEOA 4PI2A 4D8MA 3I2GA 3OPWA 3R05A 5FBJA 2VECA 2OXBA 4TTGA 3AFGA 4L9BA 3RZHA 4PIZA 1IQAA 1OF3A 2NZ9A 3Q8FA 2RG4A 4FXKB 2KR2A 4EJRA 1LOCA 2B42B 1W99A 1UY2A 2I74A 2VOWA 4QXBA 4Y3OA 2C6SA 3M8LA 3ZFEA 3U4XA 1QXJA 2GMMA 4DO0A 4AGGA 5FBZA 1M06G 1LB2A 2FZ2A 1H2MA 2MNGA 3VKMA 1ALYA 4Q4X1 5LRSA 1WZXA 2P3JA 2WR9A 1KFUL 2JDNA 2LTNA 3KQRA 3LE0A 3U78A 1A6CA 1B09A 1QIQA 2ZKNA 3CJIB 4OI2A 4RSUA 3WDUA 1LRHA 3Q8EA 1CGPA 1R1A1 1SQ4A 3UKNA 1ASJ3 2CDPA 4G4FA 5A6XA 1AXKA 3WDWA 1VBC3 1X33A 4WVZA 5C6CA 5A3NA 2IFWA 2ZZJA 1RUF1 4EN8B 4GIQA 4JDOA 1C1FA 5HCAA 3RWKX 2D97A 3LOBA 1ST8A 1AR63 2KM2A 4N8MA 3ORJA 4AHYA 3IIAA 3USUB 4RS5C 1IHMA 2Y6FA 3VL9A 4EWDA 4RYDA 3AC0A 4S2HA 1SHWB 2R7EB 4FPFA 3GALA 2R16A 1K5MA 3KM5A 3OBZA 4XBQA 1ACCA 1KJLA 1ULOA 4LR4A 3R6SA 4FPGA 5BNOA 2QQOA 1DGRN 3NQHA 1W90A 1H0BA 2W46A 3W5NA 1NE4A 3CF6E 3AKSA 3AXDA 1AR81 4Q4Y1 4BQWA 3MIDA 1ZREA 1WLDA 4LKSA 1NCQB 3B93A 4YVSA 2CY6A 2DTWA 2B46X 2KA3A 1FX5A 1TMF1 1J59A 3ALQA 1PO13 3MEPA 4NO4A 1JS9A 4NRMA 2A6VA 3ZR6A 4D6QA 4DINB 1YIPA 5GZGA 2ET7A 3RQ0A 2QQMA 2YGLA 1AR72 1OUSA 1VBA2 3VBOB 2VUDA 5HV0A 3VZNA 2ZHKA 4GALA 3TB0A 5E1RA 2Q8OA 5CADA 4HFSA 3I2OA 3DYMA 1TE1B 1V6OA 2DBNA 2VTFA 2C0ZA 3NNFA 3RPQA 4MGIE 1YLLA 1LKNA 4N53A 4N7UA 4RA0A 1OQDA 4C90A 4D3WA 4JRLA 1CAWA 3SEPA 4Q2FA 4IV1B 3MIFA 3GNEA 4DQAA 3ZYBA 1HXS3 3WDXA 1AX0A 3WINE 4I01A 3J7MA 1FXZA 1MS5A 5C4WC 5J36A 4GB32 5J96B 1VBC1 4IE5A 3E5QA 3T30A 2JJ6A 4XAEA 2XBO3 2YB7A 1F5JA 2EIEA 3K4ZA 3C3VA 1ND2C 5A6YA 4R52A 3VD9A 2BWCA 4QKNA 5FPZA 4P5HA 3AZVA 3NWKA 2WSVA 2HBUA 5GLWA 1POV0 5GLVA 5LK7B 2AENA 4AFDA 3GJBA 2WQ4A 1T6GC 2W1SA 2J1AA 5J09A 1IS4A 1V6LA 3MIGA 3CNAA 4HSLA 1LR5A 1OD3A 5LATA 4P14A 2JX9A 5CFCB 4ZZ5A 5CNAA 4QQOA 4NVPA 3ZM8A 3IDEA 5E88A 5HV4A 3DPRC 1RUD3 5G05L 5IT6A 1D2SA 1RVF2 3B00A 2E32A 4K40A 3WHUA 3C7FA 3SITA 3I2KA 2ZBJA 1NA1A 4FVVA 3ACLA 2A5ZA 5DAWA 5BNPA 5T3NA 2RMU2 3PLQA 4ET7A 2V4VA 3IIIA 3VBRB 1QQP3 4XFGA 1OBNA 1CZSA 4XACA 5DXDA 3ZSKA 1S0DA 4XAAA 2WT0A 2Z79A 3VL8A 2P6CA 3ITQA 3A0KA 1HDKA 4IERA 2XGXA 4E9KA 1I6XA 1JN2P 1MQTB 3E97A 1OI6A 2ZAHA 1ZBE1 4PT6A 1VBB2 3GZAA 4OZXA 3KHBA 3WHTA 1HV1A 4CPBD 5FZOB 4LO8A 1B35B 2JG8A 5FZ3A 1FOD2 5CG9A 5C70A 3T4HB 1HRV3 4C0HA 3VBOA 3ZOIA 4BCUA 2PAEA 3WG3A 4AQ6A 4RFT0 5IFPA 2NP0A 2HWC3 1MS8A 1OF4A 1J84A 1E5HA 1H9WA 5CG8A 4E8DA 5GLTA 1K5JA 2PMWB 1KGYA 4XYXA 4OHVA 3FL7A 3O1VA 1PNGA 3K2OA 5EJZB 5DAQA 4JGYB 4B8EA 5CFDC 1ULGA 4M3CB 1ULCA 4YW3A 4F83A 4FOQA 5FLJA 5BV6A 4UWDA 1OHFA 2W1UA 3WNOA 2KD7A 4AEJA 3VDDA 2XQRA 4M4PA 4LUKA 1IOAA 2JD9A 3N36A 4AYUA 4TZDA 4X6RB 4A6OA 4BM8A 2D5HA 3CIHA 5FP3A 5A7SA 5CBLA 1ZRDA 4NHKA 1BXHA 1Z7S3 2J7MA 1ODMA 1RUD1 5GLUA 2XJUA 1OKOA 1UZVA 2WSUA 1NAEA 1U5IA 3LCPA 4OUEA 5ANNA 5A3MA 2ZEYA 2D6KA 3PJQA 5C8CA 5FR3A 1O3SA 4JGZA 5I0UA 1RB8G 1IS3A 4FFFA 2ZGMA 4H7MA 2JIGA 3MUY1 1VALA 1MS4A 2Y0OA 4YW1A 3WOGA 5FDBA 1QU0A 3ZDVA 3HNYM 5CFCA 4XMIA 2E9QA 4OYUA 3PUQA 4FPYA 1DGLA 5EP9A 1GNZA 3O12A 3O0XA 1TNFA 3ZYRA 3IKWA 5JXJA 5E16A 1YQ6A 3I3MA 1NKGA 1QDOA 2B9UA 2VAUA 4JCKA 4YGEA 1DQ1A 3A7QA 1VBD2 5J1XA 1HJGA 2JICA 1PO23 1SCSA 1W6MB 1PK6C 4XF4A 1UAIA 4BHPA 2Q8DA 1V9U2 1W8HA 5FO7B 3VHNA 3J7NA 4FI9A 1HRV1 3TEXA 4FPHA 5DPNA 1RUG1 1W9TA 3PUAA 4ZPIA 5LWBA
chains in the Genus database with same CATH topology
1T2XA 1PMJX 2XONA 3CDZB 2VZSA 2BBAA 2WN3A 2ZXQA 5C71A 3DYOA 2VMCA 5LA1A 3CMGA 1XC6A 2Y64A 1XNAA 2B9VA 2W3JA 4XVHA 2WO1A 3VD7A 5B4NA 2XQXA 5F7UA 3HN3A 4JHZA 1TG7A 3CKHA 4M4RA 4KI5M 3WNLA 1JZ8A 3UETA 4BDVB 2L9LA 4UOJA 3MBWA 3WNNA 3WF2A 5CZKA 1UYYA 1K42A 2E33A 3T0DA 2DCJA 3MO4A 4P00B 2W1WA 1O8SA 1UMIA 3HEIA 1US2A 1JYVA 2E26A 1UYZA 2RV9A 3BGAA 1KEXA 3D3AA 2DDUA 3T2OA 3DYPA 4TXWA 5DQ0A 1UXXX 2W5FA 4OZOA 1UY0A 2VZVA 3THCA 3WQBA 3VDBA 1BHGA 4KWUA 3WNKA 5IYYA 2VZRA 2VL4A 3T2QA 2BGOA 4P02B 2RJ2A 4GZ9A 1DYOA 3GDBA 4BXSV 1CZTA 2WO3A 3DECA 2QBXA 2JE8A 4CU9A 4MO3M 4ARXA 3FHAA 3IDAA 3WF4A 2J1EA 1JHJA 4DEQA 2YG0A 4QDSA 4MGSA 3ABZA 1PX3A 2Y6KA 4AAXA 2WAOA 1RYYA 3K4DA 4CUCA 1I5PA 4GWIA 1JYWA 2JDAA 3VD4A 1UX7A 4GWJA 1O8PA 4Z2AA 3FN9A 1JU4A 3F2ZA 4P08A 4PQQA 5B4XA 3IB3A 3WF3A 2W1QA 3I97A 2VZTA 2J1RA 2PQSA 5G04L 3NRUA 2VZQA 4QDQA 2HYXA 2C9KA 2Y6LA 3C7HA 3GM8A 5A1AA 3I3BA 2XHNA 2J1UA 2W87A 4XURA 2VZUA 1UZ0A 4D0QA 3C7GA 1JZ6A 4XUPA 2RVAA 3CZJA 2WN2A 2V72A 2VMFA 3LEKA 2BERA 2DCKA 5CYYA 4QAWA 3T0AA 4CU7A 1JU3A 2Y6JA 3A21A 2WQ8A 2VQTA 5LA0A 3HOBA 3FHQA 4W50A 4DXRA 5JXHA 2VJXA 3BN6A 4AG4A 3I2IA 1P8JA 3MV11 2BGPA 1HN1A 1JZ5A 5C7GA 4QX3A 4JKLA 5HPOA 1L7QA 2WZ8A 4QPWA 3OBAA 1K12A 3K77A 5HXMA 3NJVA 4DXTA 4YPJA 3GGLA 1XPWA 4QDRA 1H6YA 2X10A 1W9WA 2VMEA 4QX1A 1UY1A 4LPLA 1UXZA 4ZXEA 3OEAA 5EIYB 4UI9L 1UY3A 3K4AA 1PMHX 1UY4A 2Y8KA 1EUTA 3I2JA 3LEGA 3SKVA 3WF0A 2WUHA 2X09A 2VC9A 1F4AA 3OG2A 3IAPA 1CZVA 4PF1A 1NX9A 4CUBA 1W8NA 3NJXA 2C4XA 2C26A 2J1VA 2E31A 1R64A 3C7EA 1GQPA 4JKMA 2VCCA 2VM9A 2BZDA 3OGSA 1JZ7A 2HLEA 1WCQA 2WBKA 1J83A 1XNTA 3K75B 4CUAA 2J22A 2ZEWA 1H6XA 1MPXA 3ACIA 3PUIA 2W94A 4XUNA 1GOGA 4MADA 4E8CA 2Z4FA 3P6BA 3HNBM 4QB2A 3CQOA 1JZ3A 2LW8A 1UWWA 1OT5A 4XUOA 2WZEA 2VQUA 2X05A 2YC2A 4ARYA 2VZ3A 3SKJE 1D7PM 4UAPA 2VOTA 3A22A 2VCBA 2WYSA 4D8MA 3I2GA 4TTGA 3WNMA 1UYXA 1GOFA 2LS6A 1OF3A 3WEZA 1GNYA 1JYNA 4CU8A 4XUQA 3LQCA 3OEBA 4MGQA 1W99A 1UY2A 4XUTA 1K3IA 3VD3A 3LE0A 4QX0A 1DLCA 4QB6A 4A44A 3HPNA 2QQKA 3I2FA 3MUZ1 4JX0A 2CDPA 2V5DA 5EJ1B 3OGVA 2CDOA 4W8JA 3E1F1 1W9SA 2W9XA 4QX2A 3LPFA 2VCAA 4W4ZA 4CVUA 4RYDA 4A4AA 3AC0A 4CU6A 1SHWB 2R7EB 5JUVA 2VR4A 2XOMA 1ULOA 3C8XA 1DP0A 5FUIA 2WAAA 3WF1A 3I3DA 1GMMA 2B4KA 2QQNA 2QQOA 3NQHA 2W46A 3W5NA 2ZEXA 4ZZ8A 4A41A 2VZ1A 2W47A 4LKSA 4DUWA 2EIBA 1NUKA 3HNMA 3WNPA 3P1IA 5JXGA 3GXUA 2YFZA 3OB8A 2QQMA 1IQDC 1TVGA 5LCWL 3J7HA 4MOAA 3DYMA 2VTFA 1JYXA 2ZEZA 3ACFA 3HJRA 2WO2A 4DXSA 2ID4A 5JMOA 4LQRA 3W5MA 3SEPA 4DEVA 2EICA 4IUGA 4RN5A 4OMCA 3LPGA 3I2HA 1GOHA 1US3A 3T2PA 2YB7A 4DUXA 2EIEA 3K4ZA 3VD9A 3MV01 3SEEA 2VO5A 3VDAA 3K46A 3ETPA 2VMDA 4XZUG 3JXSA 1LNSA 5JXIA 2VZPA 1F4HA 5DN2A 2W1SA 2YFUA 2WDBA 4BK5A 2J1AA 3UESA 1SG3A 1SDDB 1OD3A 4ZZ5A 2W92A 3ZM8A 1YQ2A 1GU3A 2W91A 3I3EA 5G05L 3CZUA 5IHRA 3PUHA 4JKKA 4A3ZA 2E32A 2VZOA 3LEIA 4QB1A 3C7FA 1WKYA 3I2KA 2Y6GA 2ORXA 4ET7A 2V4VA 1JI6A 3IIIA 1L7RA 2J1TA 1CZSA 4KMQA 4A42A 1W0NA 3ACHA 3UNPA 4PT6A 4DUVA 4LHSA 2QQLA 2EIDA 5I0DA 3VDCA 1EUUA 5C70A 2YC4A 1OH4A 2QQIA 5IFPA 2OKXA 1OF4A 2W95A 1J84A 4P5YA 1CIYA 1JZ4A 3C7OA 3A23A 4L0PA 4E8DA 1KGYA 3FL7A 2J1SA 3EYPA 5EJZB 3OGRA 5IFTA 4BK4A 2JKXA 3ECQA 3T0BA 4BJ0A 2W1UA 3WNOA 2KD7A 1UMHA 4M4PA 3EB7A 2JD9A 4A6OA 1O59A 3ACGA 3CIHA 3WSOA 2J7MA 2Y6HA 4OMDA 3THDA 1NAEA 5IJRA 4OUEA 1ULPA 2ZEYA 1JZ2A 5JR2A 1W8OA 3MUY1 2QQJA 4A45A 3T09A 3HNYM 3IAQA 4OYUA 5LA2A 3U37A 1GUIA 5JXJA 1NKGA 3T08A 3A7QA 5J1XA 1K45A 2WABA 4ZY9A 5DMYA 1PX4A 3VD5A 4FI9A 4HG6B 2ORZA 3NNGA 1CX1A 5DPNA 1W9TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T2X A;  1PMJ X;  2XON A;  3CDZ B;  2VZS A;  2BBA A;  2WN3 A;  2ZXQ A;  5C71 A;  3DYO A;  2VMC A;  5LA1 A;  3CMG A;  1XC6 A;  2Y64 A;  1XNA A;  2B9V A;  2W3J A;  4XVH A;  2WO1 A;  3VD7 A;  5B4N A;  2XQX A;  5F7U A;  3HN3 A;  4JHZ A;  1TG7 A;  3CKH A;  4M4R A;  4KI5 M;  3WNL A;  1JZ8 A;  3UET A;  4BDV B;  2L9L A;  4UOJ A;  3MBW A;  3WNN A;  3WF2 A;  5CZK A;  1UYY A;  1K42 A;  2E33 A;  3T0D A;  2DCJ A;  3MO4 A;  4P00 B;  2W1W A;  1O8S A;  1UMI A;  3HEI A;  1US2 A;  1JYV A;  2E26 A;  1UYZ A;  2RV9 A;  3BGA A;  1KEX A;  3D3A A;  2DDU A;  3T2O A;  3DYP A;  4TXW A;  5DQ0 A;  1UXX X;  2W5F A;  4OZO A;  1UY0 A;  2VZV A;  3THC A;  3WQB A;  3VDB A;  1BHG A;  4KWU A;  3WNK A;  5IYY A;  2VZR A;  2VL4 A;  3T2Q A;  2BGO A;  4P02 B;  2RJ2 A;  4GZ9 A;  1DYO A;  3GDB A;  4BXS V;  1CZT A;  2WO3 A;  3DEC A;  2QBX A;  2JE8 A;  4CU9 A;  4MO3 M;  4ARX A;  3FHA A;  3IDA A;  3WF4 A;  2J1E A;  1JHJ A;  4DEQ A;  2YG0 A;  4QDS A;  4MGS A;  3ABZ A;  1PX3 A;  2Y6K A;  4AAX A;  2WAO A;  1RYY A;  3K4D A;  4CUC A;  1I5P A;  4GWI A;  1JYW A;  2JDA A;  3VD4 A;  1UX7 A;  4GWJ A;  1O8P A;  4Z2A A;  3FN9 A;  1JU4 A;  3F2Z A;  4P08 A;  4PQQ A;  5B4X A;  3IB3 A;  3WF3 A;  2W1Q A;  3I97 A;  2VZT A;  2J1R A;  2PQS A;  5G04 L;  3NRU A;  2VZQ A;  4QDQ A;  2HYX A;  2C9K A;  2Y6L A;  3C7H A;  3GM8 A;  5A1A A;  3I3B A;  2XHN A;  2J1U A;  2W87 A;  4XUR A;  2VZU A;  1UZ0 A;  4D0Q A;  3C7G A;  1JZ6 A;  4XUP A;  2RVA A;  3CZJ A;  2WN2 A;  2V72 A;  2VMF A;  3LEK A;  2BER A;  2DCK A;  5CYY A;  4QAW A;  3T0A A;  4CU7 A;  1JU3 A;  2Y6J A;  3A21 A;  2WQ8 A;  2VQT A;  5LA0 A;  3HOB A;  3FHQ A;  4W50 A;  4DXR A;  5JXH A;  2VJX A;  3BN6 A;  4AG4 A;  3I2I A;  1P8J A;  3MV1 1;  2BGP A;  1HN1 A;  1JZ5 A;  5C7G A;  4QX3 A;  4JKL A;  5HPO A;  1L7Q A;  2WZ8 A;  4QPW A;  3OBA A;  1K12 A;  3K77 A;  5HXM A;  3NJV A;  4DXT A;  4YPJ A;  3GGL A;  1XPW A;  4QDR A;  1H6Y A;  2X10 A;  1W9W A;  2VME A;  4QX1 A;  1UY1 A;  4LPL A;  1UXZ A;  4ZXE A;  3OEA A;  5EIY B;  4UI9 L;  1UY3 A;  3K4A A;  1PMH X;  1UY4 A;  2Y8K A;  1EUT A;  3I2J A;  3LEG A;  3SKV A;  3WF0 A;  2WUH A;  2X09 A;  2VC9 A;  1F4A A;  3OG2 A;  3IAP A;  1CZV A;  4PF1 A;  1NX9 A;  4CUB A;  1W8N A;  3NJX A;  2C4X A;  2C26 A;  2J1V A;  2E31 A;  1R64 A;  3C7E A;  1GQP A;  4JKM A;  2VCC A;  2VM9 A;  2BZD A;  3OGS A;  1JZ7 A;  2HLE A;  1WCQ A;  2WBK A;  1J83 A;  1XNT A;  3K75 B;  4CUA A;  2J22 A;  2ZEW A;  1H6X A;  1MPX A;  3ACI A;  3PUI A;  2W94 A;  4XUN A;  1GOG A;  4MAD A;  4E8C A;  2Z4F A;  3P6B A;  3HNB M;  4QB2 A;  3CQO A;  1JZ3 A;  2LW8 A;  1UWW A;  1OT5 A;  4XUO A;  2WZE A;  2VQU A;  2X05 A;  2YC2 A;  4ARY A;  2VZ3 A;  3SKJ E;  1D7P M;  4UAP A;  2VOT A;  3A22 A;  2VCB A;  2WYS A;  4D8M A;  3I2G A;  4TTG A;  3WNM A;  1UYX A;  1GOF A;  2LS6 A;  1OF3 A;  3WEZ A;  1GNY A;  1JYN A;  4CU8 A;  4XUQ A;  3LQC A;  3OEB A;  4MGQ A;  1W99 A;  1UY2 A;  4XUT A;  1K3I A;  3VD3 A;  3LE0 A;  4QX0 A;  1DLC A;  4QB6 A;  4A44 A;  3HPN A;  2QQK A;  3I2F A;  3MUZ 1;  4JX0 A;  2CDP A;  2V5D A;  5EJ1 B;  3OGV A;  2CDO A;  4W8J A;  3E1F 1;  1W9S A;  2W9X A;  4QX2 A;  3LPF A;  2VCA A;  4W4Z A;  4CVU A;  4RYD A;  4A4A A;  3AC0 A;  4CU6 A;  1SHW B;  2R7E B;  5JUV A;  2VR4 A;  2XOM A;  1ULO A;  3C8X A;  1DP0 A;  5FUI A;  2WAA A;  3WF1 A;  3I3D A;  1GMM A;  2B4K A;  2QQN A;  2QQO A;  3NQH A;  2W46 A;  3W5N A;  2ZEX A;  4ZZ8 A;  4A41 A;  2VZ1 A;  2W47 A;  4LKS A;  4DUW A;  2EIB A;  1NUK A;  3HNM A;  3WNP A;  3P1I A;  5JXG A;  3GXU A;  2YFZ A;  3OB8 A;  2QQM A;  1IQD C;  1TVG A;  5LCW L;  3J7H A;  4MOA A;  3DYM A;  2VTF A;  1JYX A;  2ZEZ A;  3ACF A;  3HJR A;  2WO2 A;  4DXS A;  2ID4 A;  5JMO A;  4LQR A;  3W5M A;  3SEP A;  4DEV A;  2EIC A;  4IUG A;  4RN5 A;  4OMC A;  3LPG A;  3I2H A;  1GOH A;  1US3 A;  3T2P A;  2YB7 A;  4DUX A;  2EIE A;  3K4Z A;  3VD9 A;  3MV0 1;  3SEE A;  2VO5 A;  3VDA A;  3K46 A;  3ETP A;  2VMD A;  4XZU G;  3JXS A;  1LNS A;  5JXI A;  2VZP A;  1F4H A;  5DN2 A;  2W1S A;  2YFU A;  2WDB A;  4BK5 A;  2J1A A;  3UES A;  1SG3 A;  1SDD B;  1OD3 A;  4ZZ5 A;  2W92 A;  3ZM8 A;  1YQ2 A;  1GU3 A;  2W91 A;  3I3E A;  5G05 L;  3CZU A;  5IHR A;  3PUH A;  4JKK A;  4A3Z A;  2E32 A;  2VZO A;  3LEI A;  4QB1 A;  3C7F A;  1WKY A;  3I2K A;  2Y6G A;  2ORX A;  4ET7 A;  2V4V A;  1JI6 A;  3III A;  1L7R A;  2J1T A;  1CZS A;  4KMQ A;  4A42 A;  1W0N A;  3ACH A;  3UNP A;  4PT6 A;  4DUV A;  4LHS A;  2QQL A;  2EID A;  5I0D A;  3VDC A;  1EUU A;  5C70 A;  2YC4 A;  1OH4 A;  2QQI A;  5IFP A;  2OKX A;  1OF4 A;  2W95 A;  1J84 A;  4P5Y A;  1CIY A;  1JZ4 A;  3C7O A;  3A23 A;  4L0P A;  4E8D A;  1KGY A;  3FL7 A;  2J1S A;  3EYP A;  5EJZ B;  3OGR A;  5IFT A;  4BK4 A;  2JKX A;  3ECQ A;  3T0B A;  4BJ0 A;  2W1U A;  3WNO A;  2KD7 A;  1UMH A;  4M4P A;  3EB7 A;  2JD9 A;  4A6O A;  1O59 A;  3ACG A;  3CIH A;  3WSO A;  2J7M A;  2Y6H A;  4OMD A;  3THD A;  1NAE A;  5IJR A;  4OUE A;  1ULP A;  2ZEY A;  1JZ2 A;  5JR2 A;  1W8O A;  3MUY 1;  2QQJ A;  4A45 A;  3T09 A;  3HNY M;  3IAQ A;  4OYU A;  5LA2 A;  3U37 A;  1GUI A;  5JXJ A;  1NKG A;  3T08 A;  3A7Q A;  5J1X A;  1K45 A;  2WAB A;  4ZY9 A;  5DMY A;  1PX4 A;  3VD5 A;  4FI9 A;  4HG6 B;  2ORZ A;  3NNG A;  1CX1 A;  5DPN A;  1W9T A; 
#chains in the Genus database with same CATH topology
 1T2X A;  1PMJ X;  5FKB A;  1OFN A;  5F32 A;  4YM0 A;  2CYF A;  4HOO A;  4GXL A;  4D69 A;  2HWF 3;  3FMG A;  5FZO A;  5FY8 A;  4D7Y A;  4LBQ A;  3CMG A;  1OQ1 A;  2ERF A;  1O7F A;  2IXH A;  1COV 2;  1RUJ 2;  4IE4 A;  2UWB A;  5LBC A;  2D44 A;  4Q8L A;  4XVH A;  2B7Y A;  1X8E A;  2WO1 A;  3J8F 3;  4N43 C;  4JAA A;  3W59 A;  4ONU A;  1OC1 A;  3HN3 A;  4JHZ A;  4ZU4 A;  1TG7 A;  5A3U A;  3KCC A;  3POY A;  1W8U A;  1TNR A;  4Z1V A;  3B94 A;  4KI5 M;  1S0I A;  4PI0 A;  2BQP A;  1JZ8 A;  1E5R A;  2B8M A;  1QMJ A;  1YCI A;  3UET A;  4A6S A;  5BY5 A;  1FMD 1;  3MBW A;  1Q8Q A;  1XSQ A;  3QH7 A;  5A70 A;  2A75 A;  4Y1Z A;  5FY1 A;  5I0T A;  1UD1 A;  3O1R A;  3E6B A;  4IEZ A;  3MO4 A;  4WVM B;  4AHZ A;  1BMV 2;  1O8S A;  3N3H A;  3VBU B;  1Z78 A;  4HKO A;  3S7I A;  1QDC A;  3I59 A;  4KG8 A;  4YWA A;  3ZMN A;  4BQ2 A;  1JXN A;  3RDI A;  4TLF A;  2DUO A;  3CU7 A;  3ZFF A;  1MEC 3;  4CSW A;  1VIW B;  5FP4 A;  3T2T A;  1AR9 3;  1Q56 A;  1QJX 1;  2IXK A;  3CLP A;  2DDU A;  4XDQ A;  1IG0 A;  3ZYP A;  4QPI B;  3T2O A;  4BU2 A;  4Q4V 1;  4CCJ A;  4EWE A;  1NQD A;  4NII A;  5DQ0 A;  3O0V A;  1UXX X;  5FXZ A;  2CTV A;  2PHU A;  3HT2 A;  3H9A A;  1KS4 A;  1LEM A;  1OOP C;  4KWU A;  4BB3 A;  1DQ6 A;  3APB A;  1D0G A;  2UY9 A;  2HWB 3;  4KU7 A;  3QOP A;  4CDU B;  4LA2 A;  4OHW A;  1EV1 2;  4M0H A;  2I2S A;  2CL2 A;  1G8W A;  4SLI A;  5F9T A;  1W2A X;  1WD3 A;  3GDB A;  4CDQ B;  2VY0 A;  2PLV 2;  2XJP A;  3NVC A;  4ISR A;  3MGU A;  4AQS A;  2WO3 A;  4QX5 A;  3DEC A;  5F6L B;  1VBE 1;  1JOD A;  4YG0 A;  4L11 A;  1YYN A;  5JZG B;  1D0H A;  1RUH 1;  1W6M A;  2HWE 1;  3KB5 A;  4NPR A;  2WKK A;  3FHA A;  3IDA A;  2AGS A;  3J8F 1;  3OYW B;  1HX6 A;  4W6X A;  5JOY A;  2X29 A;  1YJK A;  4BMB A;  1QH6 A;  3VBS A;  4OI0 A;  5GJ6 A;  1J3R A;  1QY4 A;  3V56 A;  4LE3 A;  3ABZ A;  3AJZ A;  3AP5 A;  4UFK A;  2P4E A;  2DFC A;  3VGI A;  1O4T A;  3WQ7 A;  4HT1 T;  4J25 A;  2BPA 2;  4Y1Y A;  3I49 A;  2WZR 1;  4LK6 A;  4CDW C;  1UQX A;  2P6H A;  2DVD A;  2XWJ B;  3K4D A;  5J7M A;  1AX1 A;  1OKQ A;  3VD4 A;  4GWI A;  5JI7 A;  1A34 A;  3U4S A;  1W0O A;  2VVD A;  2MPF A;  1FAT A;  1GZC A;  1LU1 A;  2UU8 A;  4R9D A;  4PQQ A;  4EZ4 A;  1RUC 2;  5KHG A;  1WMF A;  3TEZ A;  5A7Q A;  4IW3 A;  4OUS A;  3WF3 A;  3AX4 A;  3ZVX A;  3I97 A;  2VZT A;  4GJZ A;  4IL7 A;  4Y4Y A;  4CDX C;  2BWA A;  1H30 A;  2VUC A;  1GV9 A;  1DYK A;  2IVJ A;  1W8T A;  2VZQ A;  3MFA A;  4QDQ A;  2VBD A;  2C9K A;  2Y6L A;  3C7H A;  3GM8 A;  4FAH A;  3OJB A;  1RIN A;  4XF3 A;  2X5I B;  1F5F A;  4LOR A;  4LMF A;  4I0A A;  2TEP A;  3VV1 A;  3FLT A;  4E4Z A;  2BNM A;  1F35 A;  2A7A A;  5A7N A;  2HWB 1;  2RVA A;  1OA3 A;  4CTE A;  3H0O A;  1CN1 A;  2OZ6 A;  2XR4 A;  5C3S A;  2WN2 A;  1T6B X;  2NN8 A;  5FP7 A;  2WZP P;  4CEY B;  3LEK A;  3KT7 A;  2BER A;  1ASJ 2;  4GH4 A;  2JDH A;  1VBC 2;  3JD7 1;  1CR7 A;  3T3Y A;  1MS1 A;  1YFU A;  3A21 A;  2VQT A;  3SCH A;  2VUL A;  3UJQ A;  4CP9 A;  5LA0 A;  3NNJ A;  4QXH A;  2DU1 A;  5CB7 A;  1AR6 2;  5JXH A;  3ZYF A;  1GNH A;  4AR2 A;  1PGL 1;  3Q9O A;  3RYK A;  1V6J A;  2BGP A;  4CP0 A;  1H8T B;  1HN1 A;  4WM7 B;  4IEQ A;  2GP3 A;  5C7G A;  4E2S A;  3K48 A;  2QNK A;  2RR1 3;  4NMI A;  5HPO A;  4JKL A;  1HB2 A;  3VBF C;  1AYM 1;  3WP5 A;  2WC2 A;  1UNB A;  2D3R A;  3M3O A;  3OBA A;  4QHB A;  5D8A A;  3ZN4 A;  3IPV B;  4FPL A;  4XJU A;  1XPW A;  3KS7 A;  4XQW A;  4YPJ A;  1H6Y A;  1ZZ8 A;  2VMI A;  3KT1 A;  1XYN A;  3JU9 A;  5K8S A;  3O1U A;  1DZQ A;  2F4L A;  2PEL A;  4B4R A;  1C8M 1;  4ERO A;  1BEV 1;  3N7M A;  3QCW A;  5DDJ 1;  2OYZ A;  3AVR A;  4HXC A;  4CXW A;  1OD5 A;  5IK4 A;  4XIO A;  4AED C;  2FDJ A;  5IVJ A;  1UY3 A;  1MS3 A;  1XJA A;  1HN0 A;  1PMH X;  2E6V A;  1PO1 2;  3K4A A;  3VHP A;  1XND A;  3LEG A;  4M0N A;  5F3I A;  1E57 A;  3GCX A;  3RZM A;  1E5I A;  2WNV C;  3DGT A;  1GIC A;  4YGB A;  5L7O B;  2R07 3;  1EAH 1;  1WW4 A;  4H55 A;  1PVX A;  5FJH A;  2JB8 A;  1KIT A;  5ABJ A;  1A78 A;  2DCZ A;  2J1V A;  3POG A;  3L2Y A;  1G7Y A;  1ZA4 A;  2BZD A;  1SZB A;  2Y33 A;  3OGS A;  5FZC A;  4AVV A;  1HXS 2;  3RRD A;  4KQ7 A;  2WBK A;  2QDR A;  1XNT A;  3RZK A;  5JOX A;  3JZV A;  1W6Q A;  3J4U H;  5JOZ A;  1N1V A;  3O5S A;  5CEH A;  1AJK A;  1LGC A;  1QKQ A;  1H6X A;  4FPO B;  4A7Z A;  2BW8 A;  2XBO 2;  4LHN A;  5H9S A;  3O1O A;  1TME 3;  3BYW A;  1XE7 A;  4OHX A;  4ZKT B;  4E8C A;  2K0G A;  2KXL A;  1R09 3;  1W6N A;  3HNB M;  3PVE A;  5FZ9 A;  3S6P A;  5KXE A;  1BVV A;  1JYC A;  3DXU A;  4QXK A;  4XMA A;  1JZ3 A;  2QJV A;  1VRB A;  5C3O A;  3AKP A;  3MW3 A;  3GBW A;  5FAX A;  4XIL A;  2X05 A;  2YC2 A;  4P9X A;  2RR1 1;  3WD5 A;  2RS5 1;  5I8S A;  1D7P M;  1ZX5 A;  3MPB A;  5JAX A;  4UAP A;  1QH7 A;  2HEY F;  1C57 A;  1GP4 A;  1NCR A;  5DG2 A;  4EV0 A;  3TN9 1;  2VCB A;  1YFY A;  2WYS A;  1UPS A;  5DAB A;  4YZ3 A;  1GOF A;  1ND3 C;  1ZNP A;  2ZGT A;  3WEZ A;  1JYN A;  2Y26 A;  3LQC A;  3OEB A;  5KXD A;  1AX2 A;  4B4Q A;  4KBZ A;  5DZG A;  4LBQ D;  4H7L A;  2DF7 A;  1QQP 2;  4QPG A;  3TN9 2;  3VD3 A;  3ZIW A;  2E53 A;  3PUS A;  4QX0 A;  4QB6 A;  4PDW B;  3FBM A;  3HPN A;  5SV8 A;  4MLO A;  4XDP A;  5A3T A;  3MUZ 1;  3H7J A;  1SFP A;  2W2I A;  4XJA A;  4H14 A;  3SNM A;  4AK3 A;  4ES9 A;  2ARE A;  1VRH 3;  3B3Q E;  3PNA A;  4RR3 A;  4Q4W 1;  3P3N A;  4BIO A;  2XUM A;  4DIQ A;  5IK5 A;  4AWD A;  3E1F 1;  3GYD A;  2XKO A;  2WO7 A;  2Y60 A;  4AZZ A;  1WA6 X;  2A6Y A;  2Z5W A;  5FY4 A;  1D4M 1;  3WP4 A;  1UYP A;  1ZRC A;  1ONA A;  2HWC 2;  4OUL A;  1D2Q A;  3ME2 A;  4CU6 A;  4ZU7 A;  5JUV A;  3QD6 A;  5KR7 A;  3JUU A;  4YW7 A;  3N9Q A;  4LUM A;  2VTX A;  4WM8 B;  2O1Q A;  3HVD A;  1SLL A;  3NW4 A;  2VR4 A;  4Z82 A;  1UZY A;  2XOM A;  5EFU A;  5A33 B;  5F1R A;  2MEV 3;  3C8X A;  1DP0 A;  1O3R A;  5HCH A;  1MVQ A;  2WAA A;  3WF1 A;  1V6N A;  4NAM A;  4C1W A;  5M0T A;  2UWC A;  5FZH A;  3TEY A;  4IV3 B;  2GU9 A;  2PXJ A;  4A3X A;  4NIH A;  2DTY A;  2ZEX A;  4ZZ8 A;  4A41 A;  2EA7 A;  1H1M A;  2R04 3;  3MFC A;  3JBG 3;  2IXL A;  2X53 S;  5AC9 3;  3UGF A;  3VBH A;  4XTM A;  5KHH A;  3HNM A;  2BUK A;  1IPS A;  2WT1 A;  4I02 A;  3N9O A;  5JXG A;  2YPD A;  1ULF A;  1Z7S 2;  3OB8 A;  4KWK A;  1O5L A;  1PVC 1;  2NMO A;  4TWT A;  5DZF A;  3ZFE B;  4AW7 A;  1J3P A;  5IVE A;  1TVG A;  2NMN A;  4CA9 A;  1JBC A;  2VXR A;  4MOA A;  2FDG A;  4E2G A;  1JYX A;  2ZEZ A;  2HEW F;  3WW4 A;  2AEY A;  3ACF A;  1ENX A;  1MVE A;  5ACA 1;  1I9R A;  4LQR A;  5ANQ A;  5JMO A;  3W5M A;  1FYU A;  3HWJ A;  3O0W A;  5FCC A;  1RMU 1;  2P3Y A;  5FYS A;  5BNN A;  4DEV A;  3HR9 A;  2WNU C;  2K46 A;  2WRA A;  4IUG A;  4YVW C;  5F2S A;  3NAP A;  4WVV A;  4RN5 A;  2D6L X;  2IVI B;  3LPG A;  4P9Y A;  5FZ7 A;  3ZFG B;  1UIJ A;  2WS9 1;  4Q4X 3;  3N7K A;  1AZD A;  1PO2 2;  1S2K A;  4ZS2 A;  1ULD A;  4BME A;  3OCP A;  1N3P A;  4LKE A;  4COZ A;  4UT5 A;  3KV9 A;  2BVB A;  3SEE A;  1R1A 3;  1MR5 A;  3DCQ A;  1YQ8 A;  3KGZ A;  4HKL A;  2WA3 A;  3ETP A;  1K5M B;  2VMD A;  3S5Q A;  1LOF C;  2R06 1;  4FCA A;  4QXC A;  3CL1 A;  5BNO B;  3WG1 A;  2VZP A;  5FZD A;  1RUF 3;  2YFU A;  4MVT A;  2HWF 2;  2ZGK A;  3UES A;  5L36 A;  2CNA A;  3AP9 A;  4PBO A;  3DUI A;  2OII A;  4K1Z A;  5JMC A;  4YVS B;  3J8F 2;  2W91 A;  1GU3 A;  3KVB A;  5C9A C;  4FTS A;  1W28 A;  1U0A A;  2DV9 A;  3ON7 A;  4JKK A;  5AC9 1;  1GP5 A;  5K0U A;  4A3Z A;  4E4D X;  1JMU B;  2JB4 A;  1WBF A;  4Q0U A;  3ZXJ A;  3OUI A;  2V5Y A;  2ORX A;  4WM8 A;  3DKW A;  2C24 A;  4K20 A;  3U75 A;  2LRO A;  4Y26 A;  1AR8 3;  1H2L A;  1JI6 A;  1SLC A;  4Q4Y 3;  1L7R A;  2J1T A;  2CAU A;  2OUH A;  3K3N A;  5LA9 A;  4KMQ A;  4P9J A;  1W0N A;  4GMP 1;  5A6Q A;  4N53 B;  1Y9M A;  1AHS A;  1DU3 D;  5FLI A;  3ZSE A;  5JSP A;  1TMF 3;  5DUW A;  5I8Y A;  2E51 A;  2VBB A;  4PQ9 A;  5EXO A;  1F31 A;  5B2G B;  3GZE A;  2QQL A;  2EID A;  1VAV A;  3L9J T;  2JG9 A;  4HPK A;  2BTV C;  1V6I A;  1MEC 2;  1UL9 A;  1AR9 2;  3HBK A;  4FFG A;  3MF9 A;  4EN6 B;  3VDC A;  1EUU A;  1UOB A;  5FPV A;  1SBF A;  1OVP A;  4Y22 A;  5C3Q A;  1WW5 A;  4CEW C;  1EYB A;  2OKX A;  4YFZ A;  4P5Y A;  1LTE A;  4MV2 A;  1CIY A;  1C28 A;  1JZ4 A;  1L7L A;  3A23 A;  1N1Y A;  1BLZ A;  4NHX A;  1RHI 1;  2XLF A;  1SCR A;  2TNF A;  4QX7 A;  2J1S A;  2XJQ A;  1XQN A;  2HWB 2;  1KDM A;  4UW6 A;  2JKX A;  4PLN A;  3T0B A;  2EVX A;  4HAN A;  1V6M A;  3NNM A;  1EP0 A;  2Y34 A;  4BJ0 A;  5KWR A;  4LOS A;  3ZFG A;  3GZU C;  1ODN A;  3CJI C;  4ORF A;  1UMH A;  2ET1 A;  3RZJ A;  4FPK A;  2YRO A;  4XE9 A;  2XH6 A;  2GN7 A;  5A7W A;  1Y4W A;  2ZMK A;  2VU9 A;  4YZ5 A;  3LA3 A;  1NA1 B;  3IZO A;  3H8X A;  5FUP A;  1Q8P A;  2G9F A;  3Q8B A;  4HVR A;  5BNP B;  4F7Z A;  2RS1 1;  4LBK A;  5JR2 A;  4AI2 A;  4A7Y A;  1C5I A;  4B29 A;  3N7L A;  3MF6 A;  2RS3 3;  5F3E A;  4TLG A;  5FYH A;  4Q8K A;  5F3C A;  2ILM A;  4AGR A;  2P37 A;  3B5L B;  5F6K A;  1X82 A;  3LB9 A;  2VXJ A;  3MLK A;  1VMH A;  4MGZ E;  4N9H A;  2JG8 B;  2WA4 A;  4KNC A;  2VMG A;  3ZSJ A;  4CXY A;  3SIS A;  3N35 A;  1HB3 A;  1LGN A;  2W52 A;  2RJK A;  1QXP A;  1NY7 1;  1KFX L;  2WAB A;  4D7S A;  2GMP A;  3WDY A;  1FV3 A;  2IWG B;  2SBA A;  1NCQ C;  3MPP G;  3NNG A;  1ZBE 3;  1CX1 A;  4LBL A;  1X8M A;  3HQU A;  3ZXF A;  4QGM A;  3UKV A;  4N7I A;  5JR7 B;  2XON A;  3CDZ B;  1W9F A;  3ZYI B;  3POE A;  4MUV A;  4P9L A;  5FYM A;  3ZSL A;  4NID A;  1EPZ A;  3VBO C;  1YUD A;  2FCT A;  2GND A;  2D43 A;  4NWV A;  2XKP A;  3DYO A;  4E2Q A;  1O91 A;  2HKX A;  4URT A;  2OVU A;  1XC6 A;  3BCW A;  4HZF A;  2HYK A;  2Y64 A;  1XNA A;  2I07 B;  4TN7 A;  4XJ9 A;  5FO9 B;  2R1B A;  4CYD A;  1HRI 1;  3VDD B;  5B4N A;  2XQX A;  5L19 A;  1RIR A;  5FZE A;  4IES A;  2JWP A;  4LKD A;  4NWW A;  1DQ0 A;  3GBF A;  4IV1 C;  4W6Y A;  5I0S A;  2RJL A;  3WG2 A;  2UWA A;  5T50 A;  3MHZ A;  2FMD A;  5FQ0 A;  1IKP A;  5DUV A;  5C8C B;  4Q5O A;  5FIX A;  3NV4 A;  4UOJ A;  4JGZ B;  3BU0 A;  4WZF A;  3AZW A;  1QJY 1;  5CZK A;  1UYY A;  4YM1 A;  3Q8C A;  2WFP A;  4IEY A;  2VOK A;  4NHY A;  4FPJ A;  4Z8B A;  2DUR A;  5JIU A;  4E4S A;  4FPC A;  2E33 A;  1N1S A;  4MYE A;  1IPK A;  2DCJ A;  5A7P A;  4P00 B;  2W1W A;  2XLA A;  2RR1 2;  2RS3 1;  3BOW A;  1US2 A;  4MH0 E;  4YYO A;  4D94 A;  2PTM A;  4C8D A;  1UF2 C;  1IG3 A;  2E26 A;  5A6Z A;  3KQ4 B;  1UYZ A;  2RV9 A;  2YZ4 A;  5I0R A;  3BGA A;  4PBP A;  4HK9 A;  3HD8 B;  5FPX A;  5C5U A;  2D3P A;  3M7A A;  1DBN A;  4RS5 A;  4YLZ A;  4TXW A;  2Q30 A;  4QGL A;  1RL3 A;  3B9I A;  2YYO A;  5JWP A;  1UY0 A;  3M2M A;  1RUE 1;  2VZV A;  3BPZ A;  3AB0 A;  3LDB A;  1MS0 A;  3THC A;  4NIG A;  4FSJ A;  1BHG A;  4OVE A;  2ZAA A;  4I3G A;  4PIX A;  3INA A;  3O1P A;  2VZR A;  2BGO A;  4P02 B;  3O1M A;  2QKD A;  4BIF A;  1AL2 1;  2CSG A;  2D93 A;  2R07 2;  3H3Z A;  4BXS V;  2ZMN A;  4LBQ B;  3VBR C;  3S7E A;  4Q1P A;  5FP9 A;  2F17 A;  1GZ9 A;  2GME A;  4AQT A;  2JE8 A;  3EO6 A;  5IVV A;  5BNQ A;  1NT0 A;  1RUG 3;  3P5B A;  5HCB A;  4CP2 A;  1MQT C;  3MI8 A;  2ZGU A;  2J42 A;  5GZF A;  1ZBA 3;  2YBP A;  4R8H A;  1B35 C;  3KT4 A;  3IDC B;  1DF0 A;  1ZYB A;  4U36 A;  3WY6 A;  1YNA A;  4LO7 A;  4LO4 B;  1TME 2;  4XCB A;  2P3I A;  3VKF C;  1FPN 1;  2WAO A;  1LJ7 A;  1DFQ A;  2XG3 A;  4YM3 A;  5FMC A;  1R09 2;  1F9K A;  1PZ9 A;  1J1T A;  1QNY A;  1WCS A;  4QQH A;  3DL3 A;  5E6H A;  4BOW A;  3I59 B;  2JDA A;  1UX7 A;  1QJU 1;  5C4W A;  1O8P A;  2VTX J;  3ZFF B;  1APN A;  1BK0 A;  1FMD 3;  5HCF A;  4LXL A;  1JU4 A;  2VMH A;  2GNB A;  3F2Z A;  3NJZ A;  3NV1 A;  4JGY C;  4P08 A;  2ETE A;  1N3Q A;  5HXV A;  1R08 1;  5A3W A;  1ND2 A;  1VE0 A;  2H0B A;  1SPP A;  2YUE A;  3B7M A;  4LTA A;  4EWA A;  4IDZ A;  3MYX A;  1LGB A;  2W1Q A;  2XL7 A;  2ZGQ A;  2UY8 A;  2ZKL A;  1CQ9 A;  1ZRR A;  5G04 L;  4RFR B;  4QWN A;  1MAC A;  1CAX A;  5A1A A;  4B3N A;  3UJO A;  4CCD A;  1KS5 A;  4NHL A;  1YHF A;  2XJS A;  5C8W A;  2W87 A;  3BB6 A;  2WFF 1;  2AH2 A;  5FOB B;  1QJX 3;  2ENR A;  2EXI A;  2VZU A;  3PUR A;  1FNY A;  4EN7 B;  4D0Q A;  4BQ3 A;  4Q0V A;  4XUP A;  4AVS A;  1OPO A;  3DKQ A;  4Q4V 3;  1OQE A;  3CZJ A;  3EQE A;  2BOI A;  3H3U A;  4JTO A;  5CU1 A;  2V72 A;  3DPR A;  4F8A A;  3BUC A;  4OHY A;  3WUD A;  1S0B A;  3CHX A;  1VRH 2;  4Z92 B;  2Y6J A;  3UK9 A;  4NOT A;  3WT3 A;  3HQX A;  3GBG A;  3LF7 A;  2D6O X;  2WLQ A;  2P2K A;  3VBS B;  2VOV A;  3HOB A;  3FHQ A;  1F2N A;  1G9B A;  1ZBA 1;  2GAU A;  4WBB A;  3FBY A;  1P8J A;  5FWE A;  2HEV F;  2JKB A;  3OUJ A;  2Q1F A;  3MV1 1;  3VZO A;  1Q8V A;  3WQ0 A;  2Q1Z B;  1JZ5 A;  1VBE 3;  3KF5 A;  4LHK A;  4COV A;  5FYY A;  3TNP B;  3SHR A;  4P9G A;  1RUH 3;  2HWE 3;  5APA A;  4YG3 A;  2BDR A;  4QX3 A;  3KV6 A;  2MEV 2;  2QFE A;  1XNB A;  2WZ8 A;  1H2N A;  4DXT A;  1WMX A;  2MHF A;  3W9A A;  2FDK A;  5FXW A;  2VME A;  4IEV A;  4JV4 A;  4QX1 A;  5BPX A;  1UZW A;  2R04 2;  1UKG A;  3JBG 2;  2C1F A;  2D3S A;  2WZR 3;  1UW8 A;  4QMA A;  3RZZ A;  1LHV A;  1DYP A;  4UI9 L;  1G9C A;  1UY4 A;  3I2J A;  3SKV A;  3URF A;  2E7A A;  1PIV 1;  1Q3E A;  1DG6 A;  2OZJ A;  2WUH A;  2ZGS A;  5FYZ A;  3V65 A;  3VZL A;  3WF0 A;  3B9C A;  3JQW A;  4CZS A;  3OG2 A;  4P9W A;  5KHI A;  5FK8 A;  2RM2 3;  4RHV 1;  1PGW 1;  2FCV A;  5CFD A;  1W3X A;  3ENR A;  3THT A;  1BK1 A;  4PF1 A;  1NX9 A;  4R4Z A;  1IKQ A;  4NAO A;  3D6E A;  4V2V A;  2WIN B;  2CGP A;  2ZJC A;  4PJY A;  2CHH A;  5FRE A;  4MHR A;  1R64 A;  4H2A A;  2G9Z A;  5GZE A;  2OPK A;  4JKM A;  3W21 A;  4NE9 A;  4ZON A;  3I7D A;  4GH4 B;  2PAM A;  3POS A;  4I30 A;  3USS A;  3WVJ A;  4QQ2 A;  4AXO A;  3MLL A;  1HIX A;  1KJR A;  3VBU C;  1WCQ A;  1RUI 1;  1H2K A;  4CP9 B;  1SMV A;  2HWD 1;  3FHI B;  1KDK A;  3K75 B;  5FK7 A;  1S0J A;  3BAL A;  2ZEW A;  4Q4X 2;  1MPX A;  2XB6 C;  3ACI A;  1XB9 A;  5DAP A;  5F5C A;  4XUN A;  4QPI C;  1GOG A;  4MAD A;  2PN5 A;  2CU5 A;  3GJA A;  1R1A 2;  1SEF A;  1MZF A;  3P6B A;  1JYT A;  1QF3 A;  2LW8 A;  4NUB A;  3JD7 3;  1UWW A;  2QQP A;  3OTF A;  1HLC A;  3D8C A;  1N47 A;  2JD4 A;  5D8A B;  1RUF 2;  4CDU C;  4COY A;  2ZHN A;  1C1L A;  1TZO A;  1G9D A;  4O9E A;  1UOG A;  2ARA A;  1C4R A;  1FV2 A;  1POV 1;  1S2E A;  3D82 A;  4CDQ C;  2JEN A;  1PK6 A;  2VOT A;  3EMR A;  2YXS A;  4WZC A;  2WII B;  3RFR A;  3TRS B;  3WW2 A;  1RUO A;  4OLL A;  3MIB A;  1UU5 A;  4IEW A;  1UYX A;  2LS6 A;  1NE6 A;  3MLJ A;  4M00 A;  1BBT 1;  1AYM 3;  5JZG C;  4HLT A;  4AI9 A;  3CEW A;  3RSJ A;  3TBD A;  4GWN A;  4MGQ A;  4LLO A;  2ZX0 A;  1X50 A;  4XUT A;  4HON A;  3ZKY A;  1AR8 2;  4Q4Y 2;  4TSV A;  4CDW B;  1RXF A;  5CIS A;  1N3O A;  1C8M 3;  5ABJ B;  2A6W A;  1BEV 3;  2RM2 1;  3LD8 A;  1FNZ A;  5DDJ 3;  3H42 B;  4CCO A;  4A44 A;  1CON A;  1H1I A;  2E63 A;  4N43 A;  4Q0S A;  1DQ4 A;  2QQK A;  5T54 A;  3OD0 A;  3W20 A;  3HN1 A;  1TMF 2;  2O14 A;  5EZW A;  5E8A A;  1WLC A;  2ZGN A;  3IDB B;  3IM0 A;  1DGW X;  4D6S A;  3OGV A;  2ZHM A;  2Z2S B;  1LOD A;  2G19 A;  3M3Q A;  1W6Q B;  2CDO A;  1VB2 A;  1W9S A;  2W9X A;  2CV6 A;  4O7X A;  3THP A;  1EAH 3;  3J7L A;  1BCX A;  5D21 A;  3SXW A;  1UPI A;  4XHB A;  1WD4 A;  3WUC A;  3LPF A;  2Q8C A;  2VCA A;  5CKN A;  2EF6 A;  4YAR A;  4JZR A;  1W6N B;  4S2D A;  5DUX A;  2WYF A;  2HJI A;  2IZW A;  3V64 A;  4IET A;  5A80 A;  5FOJ B;  3LZZ A;  2R32 A;  4XBN A;  2JDM A;  3OOX A;  5EV7 A;  3B02 A;  3I3D A;  3AYC A;  4XTP A;  3ZO0 B;  1F15 A;  1PNF A;  2K2S A;  4NIA A;  2X5I C;  3UGG A;  2XDV A;  5I91 A;  2YY1 A;  2WWU A;  2FZ1 A;  1JTZ X;  1VMF A;  1OLM E;  1ZZC A;  1NCR B;  2PYT A;  4DOU A;  2W47 A;  2JDP A;  3U14 A;  2PHF A;  4DUW A;  1A3K A;  4CEY C;  1NUK A;  2ZML A;  3WNP A;  3P1I A;  1RUN A;  3UGH A;  4AF9 A;  2YFZ A;  1LHU A;  1OOP A;  3POB A;  3H8O A;  4XZP A;  1IQD C;  1ZZB A;  4BQ5 A;  2RS5 3;  1MS9 A;  3JB4 C;  1MZE A;  1BZW A;  3J7H A;  5F39 A;  4QPG B;  4Q0Q A;  2IXI A;  1LCL A;  3H50 A;  3ZR5 A;  4J1X A;  5LZ6 A;  1RED A;  2OX0 A;  4DRR A;  1BKZ A;  3TN9 3;  2WO2 A;  4LOT A;  1H8T C;  1YQC A;  4WM7 C;  3BKZ A;  4LJH A;  1W39 A;  3PL0 A;  4NRQ A;  4XFB A;  3RWN A;  2XLG A;  1MZ6 A;  1QOS A;  4RR3 B;  5GKA C;  2Y38 A;  3HMY A;  5JLV A;  4UW3 A;  2EIC A;  5IAX A;  4Y1X A;  1WGP A;  1ENR A;  4XF9 A;  1I5Z A;  3C2U A;  2W39 A;  1US3 A;  3AMP A;  3FZ3 A;  3UYJ A;  2BGC A;  2IUW A;  3BU7 A;  2DUQ A;  5K4L A;  4MZU A;  1X36 A;  4RQP C;  3AMQ A;  5SV5 A;  5CAZ A;  2VO5 A;  3VDA A;  4HBN A;  4CDW A;  3JCI A;  5IK7 A;  3MZH A;  1ZBE 2;  3J26 N;  2O8Q A;  1YC6 1;  1VP6 A;  4XZU G;  3JXS A;  1LNS A;  1DCS A;  4Q4W 3;  4Y33 A;  3AL6 A;  3BIW E;  1JUI A;  4AAP A;  4DFS A;  1F4H A;  3RYP A;  4LA3 A;  3WDT A;  1AR7 1;  2B5H A;  1VBA 1;  1GZT A;  3SQO A;  1URX A;  2XHK A;  5FYV A;  2Q5T A;  1A8M A;  2BEO A;  2ZGP A;  2HBT A;  5L7O C;  1D4M 3;  4RGK A;  1O3Q A;  4XQD A;  3H1Y A;  2W92 A;  4QD2 A;  2PHD A;  3VBH B;  1WME A;  2XJT A;  3O1S A;  1GLH A;  4L99 A;  4CDX A;  5A1L A;  4C0B A;  3CZU A;  3PUH A;  5GZC A;  4W6W A;  3PVB B;  4MSV A;  2JEM A;  4QGN A;  2VZO A;  1C3H A;  1WKY A;  2AR6 A;  3IWZ A;  4AE2 A;  2Y6G A;  2ADE A;  4BE3 A;  2GSY A;  2GH8 A;  4GB3 1;  3KMH A;  2JDZ A;  2WLP A;  5F2W A;  2XPJ A;  1CX4 A;  2JE7 A;  2YGM A;  3HQR A;  4A42 A;  3KCY A;  5FXX A;  4IGQ A;  1N1T A;  2ARB A;  4Y20 A;  3IBM A;  4FFH A;  5K7P A;  4HVQ A;  3ROU A;  4K21 A;  4DUV A;  2VD7 A;  5EHD A;  5BNN B;  4XXA A;  1HW5 A;  4ZXK A;  3U1X A;  3EXU A;  1RUD 2;  2W08 A;  2DBI A;  4LHL A;  1PVC 3;  5I0D A;  4E27 A;  2ZAB A;  3NAP B;  2BBV A;  1Q43 A;  1R1Z A;  2G1M A;  2GC3 A;  4S2G A;  5FKC A;  1W9Y A;  2XVK A;  3U10 A;  3WW1 A;  2YC4 A;  1VPH A;  4BWO A;  1OH4 A;  2QQI A;  2UUR A;  2ZGL A;  4MET A;  2ZPX A;  1REE A;  2W95 A;  3PHM A;  1CAV A;  2ZTN A;  2D40 A;  4FP2 A;  5ACA 3;  2GZW A;  3AZX A;  2XJR A;  4AI3 A;  3V0A A;  3C7O A;  1HQN A;  1RMU 3;  3MW2 A;  4L0P A;  3VBF A;  2GNM A;  4GA9 A;  1RVF 1;  4FBF A;  3EYP A;  3T4V A;  4C91 A;  1SLA A;  3OGR A;  5LRR A;  2PHW A;  2ZAC A;  1QEX A;  5T5P A;  1O3T A;  5JOW A;  1JOP A;  3VHR A;  2WS9 3;  2QZ2 A;  1YJL A;  2RMU 1;  4EN0 A;  1CJP A;  4XDO A;  2H6B A;  2EXH A;  4KL1 A;  2DWR A;  4BQ1 A;  2JXA A;  4MXV A;  5C3R A;  2Q0A A;  1SLT A;  4XFC A;  3ZPO A;  4LT5 A;  4PDW C;  1HRV 2;  2D5F A;  1CAU A;  4Q1R A;  3NV3 A;  4AED A;  2GP5 A;  2R30 A;  2DFB A;  1RUG 2;  2RE9 A;  2R06 3;  1NYW A;  2ES3 A;  5K0U B;  1UU6 A;  1XNC A;  4OHZ A;  2JDK A;  1J3Q A;  5FZL A;  2Y6H A;  3WP3 A;  4OMD A;  2WNV A;  3THD A;  4AFM A;  3O14 A;  2I45 A;  4UFI A;  3DF0 A;  5FYC A;  3N9P A;  1JZ2 A;  1FOD 1;  2YBK A;  5CKM A;  4KU8 A;  3NMB A;  1FI2 A;  1VLN A;  4CXX A;  4LE4 A;  3LA7 A;  4FO9 A;  1W8O A;  3ZYJ B;  5FPL A;  4YRD A;  4RL7 A;  4B1M A;  5LAS A;  2AC1 A;  1YEW A;  5A7O A;  1C8N A;  3VHO A;  2GC2 A;  4A45 A;  5FZ6 A;  3FUQ A;  4J1W A;  1W0P A;  4QHO A;  3U37 A;  4Y5Z 0;  1GWM A;  2JG9 B;  4HPK B;  2D6N A;  1RXG A;  2EIG A;  4XFA A;  5EPA A;  4Y24 A;  1FMD 2;  4IV3 C;  3LOI A;  4PHZ A;  3E6C C;  4HN1 A;  1K45 A;  4Y22 B;  5FPU A;  2QTW B;  4GMP 3;  1PX4 A;  5DMY A;  2PA7 A;  1C5H A;  4AVT A;  2ZGR A;  4HG6 B;  2QCS B;  1S0E A;  3W58 A;  4OQ9 A;  3NKG A;  2C5D A;  2NM1 A;  3FFZ A;  4LBO A;  1UKR A;  1KXG A;  1SLB A;  3GF6 A;  3LIG A;  5IVF A;  4NRO A;  1ULE A;  1QWR A;  3ZFE C;  1QJX 2;  3ILN A;  2ZXQ A;  4B1L A;  4Q4V 2;  2VMC A;  3VKL A;  3ZN6 B;  3AKQ A;  3UKT A;  2B9V A;  4IEP A;  3UL2 A;  2PFW A;  4JQR A;  1AXZ A;  4S2F A;  3MIE A;  2V09 A;  1W6O B;  4HET A;  4IXL A;  5BXX A;  2AAC A;  1ND3 A;  5A7W B;  1UZZ A;  4JTN A;  1RHI 3;  2QVS B;  4QT6 A;  1M4W A;  3CKH A;  3ES4 A;  1H1A A;  5JPM B;  3WNL A;  4AI8 A;  1XU2 A;  2W0X A;  4BDV B;  4OUM A;  1ZVF A;  4HKW A;  1W2N A;  1W2T A;  1YXW A;  4MX3 A;  5FPB A;  1VBD 1;  4ZS3 A;  3ZFG C;  3ZXK A;  4BQY A;  5J3U A;  5A32 A;  2RDN A;  3KGL A;  5FRA A;  1RJ8 A;  1J1L A;  2H0V A;  3MDP A;  3VLB B;  1VBE 2;  1V9U 1;  1K42 A;  5FY9 A;  3ZXL A;  4ASL A;  3OGG A;  5I93 A;  3T0D A;  1RUH 2;  5JVV A;  1XE0 A;  2HWE 2;  3KVA A;  3LIH A;  4HL0 A;  3HEI A;  2DYC A;  1K5M C;  5GLZ A;  5GAL A;  3AM2 A;  1OLM A;  1QGL A;  5BNO C;  2OW4 A;  4GD4 A;  4DXZ A;  5DG1 A;  3WCS A;  2RS1 3;  1OA2 A;  1KEX A;  3E5X A;  2VNV A;  4XC9 A;  3D3A A;  5F5Q A;  5C9A B;  3ZXD A;  5FMB A;  4ASM B;  4IND A;  2RDS A;  3HBZ A;  2WZR 2;  1COV 1;  1RUJ 1;  2NLR A;  5FO8 B;  4YVS C;  2OS2 A;  2W5F A;  5FYT A;  1ZRF A;  3OUH A;  2WNO A;  3WQB A;  2GN3 A;  4AFB A;  3VDB A;  2QQW A;  5FMD A;  4N90 A;  3WNK A;  5IYY A;  3B69 A;  4CCM A;  2VL4 A;  2RM2 2;  2Q8E A;  3T2Q A;  4GKX A;  2RJ2 A;  3AK0 A;  1OLQ A;  2DVB A;  4GZ9 A;  3FLR A;  4DPN A;  3NV2 A;  5FZB A;  4Z07 A;  1XE8 A;  1CZT A;  3MW4 A;  4UBG A;  4YNI A;  1CPM A;  1ENS A;  5FMO L;  3PIJ A;  2R1D A;  1O6U A;  2IFR A;  1WW7 A;  2QBX A;  2VGD A;  4LO6 B;  1H8V A;  4QM8 A;  3TWI A;  4N53 C;  4CU9 A;  2WL1 A;  4MO3 M;  1GQG A;  4QKB A;  1BMV 1;  3FJS A;  2VW1 A;  3KLS A;  3WF4 A;  2J1E A;  1NZC A;  2EAL A;  1GQH A;  5CIR A;  1WA4 A;  5FQ0 B;  5IAV A;  1JHJ A;  1XOY A;  3WG4 A;  4DEQ A;  3V0B A;  2YG0 A;  4LO5 B;  4XHX A;  1RGS A;  3OF1 A;  2OQ6 A;  1DHK B;  1CPN A;  1PX3 A;  1QJF A;  2EXJ A;  2Y6K A;  5FYI A;  4AAX A;  3RMY A;  5IVB A;  2RDQ A;  1HRI 3;  1WLW A;  1V00 A;  1RYY A;  2YPJ A;  5FZ1 A;  3ZN6 A;  2VVE A;  3AYD A;  3BI3 A;  4MGT A;  1LOE A;  2R0H A;  3JD7 2;  1W8Z A;  3N9M A;  4CUC A;  1JYW A;  3OY8 A;  2WNU A;  3SCF A;  1W6O A;  1D4V B;  1G86 A;  1YI7 A;  3KF3 A;  4V2W A;  2A1X A;  1QJZ A;  4GWJ A;  4YVW A;  4A2U A;  3RI9 A;  1JUH A;  3FN9 A;  4Z2A A;  2XML A;  4KH9 A;  2FCU A;  2OA2 A;  1EV1 1;  2LM3 A;  3ILF A;  2ZA9 A;  1IS6 A;  4XPV A;  4UFL A;  5CKQ A;  1QJY 3;  5TSW A;  1AUY A;  1PGL 2;  5B4X A;  2O0O A;  2PLV 1;  3IB3 A;  2PHL A;  4RS5 B;  1GFF 2;  5A3L A;  2XWB B;  4ISQ A;  5JPN B;  1TEI A;  2P1B A;  3JQX A;  3LKJ A;  3WXP A;  5D2A A;  2PQS A;  4DNY A;  1ZZ9 A;  2GH2 A;  1AYM 2;  1LOF A;  3BOD A;  2HYX A;  2PAK A;  2VUA A;  5J98 B;  4YZ2 A;  1IGO A;  4L8Q A;  3I3B A;  1IS5 A;  2XHN A;  4XAB A;  1NA1 C;  2QUO A;  4NPM A;  4XUR A;  5BNP C;  4AFA A;  1UZ0 A;  5FYB A;  3C7G A;  4LBJ A;  1JZ6 A;  2F4P A;  4AL9 A;  1C8M 2;  3ATG A;  2ZX4 A;  1BEV 2;  5DDJ 2;  3AYA A;  4Y1V A;  3EHK A;  1NLR A;  1NXM A;  3WLU A;  2B39 A;  4IE0 A;  4UW5 A;  1ZZ7 A;  3LEM A;  4RGG A;  5C9A A;  3T1L A;  4QAW A;  4M3C E;  1AVB A;  1JU3 A;  1RUE 3;  2FQP A;  3T0A A;  5L9V A;  2FDH A;  1GYK A;  4R9B A;  1JH5 A;  1V70 A;  1VAK A;  2WQ8 A;  5FZI A;  1W2O A;  3ES1 A;  4QKD A;  3VB9 A;  4CCC A;  2JG8 C;  3KSC A;  4FQZ A;  5T5J A;  2EAA A;  3POW A;  1AL2 3;  4W50 A;  4XF0 A;  1EAH 2;  5LEJ A;  4BA6 A;  4XBL A;  4FPE A;  4NJ4 A;  1YIF A;  2VJX A;  3BN6 A;  1RUC 1;  4AG4 A;  2HH9 A;  1GR3 A;  2B45 X;  3ZYG A;  2BRT A;  1DZT A;  4UF0 A;  2P3K A;  4IGP A;  3S5A A;  2FMY A;  2P5B A;  5HBA A;  4QKF A;  5L73 A;  5JSO A;  3IMM A;  1SAC A;  3I3Q A;  4QPW A;  1RJ7 A;  5C4W B;  3K77 A;  3NJV A;  4QDR A;  4Q26 A;  5T5L A;  4Y5T A;  1QOT A;  1V0A A;  3OPZ A;  3J9S A;  3U07 A;  3PIG A;  4PLM A;  4X8N A;  3E5U A;  3SLI A;  1JOJ A;  1ND2 B;  3UV9 A;  1SPP B;  1FPN 3;  3AJY A;  3ETQ A;  4FFI A;  4XEZ A;  4CEW A;  3WV6 A;  2GAL A;  3MIC A;  3AP4 A;  4K9S A;  3RJ2 X;  5EIY B;  3VDD C;  2QQU A;  1ASJ 1;  3B01 A;  5LA1 A;  1CAX B;  2A6X A;  3AP7 A;  1QJU 3;  4FAG A;  5CA6 A;  2X09 A;  3O1T A;  3KZ4 C;  2GC0 A;  4LK7 A;  2TBV A;  2OPW A;  1VJ2 A;  3IAP A;  4IE7 A;  4EZH A;  2RS5 2;  3VZM A;  3G6J B;  5LB6 A;  5C8C C;  2ZOE B;  4JGZ C;  1AR6 1;  3RZL A;  4GAZ A;  3NJX A;  1R08 3;  1SBE A;  5FYU A;  4ASK A;  1POQ A;  5FY5 A;  2C26 A;  3QBQ A;  2E31 A;  3BVC A;  5LY2 A;  3DPR B;  3C7E A;  3LSD A;  4QQP A;  4XQ4 A;  1XRU A;  3CJI A;  3LDK A;  3I4I A;  4BXF A;  2G9G A;  4EYU A;  1ZM1 A;  2VM9 A;  4ES8 A;  5CFC C;  3BTZ A;  4CE8 A;  2HLE A;  2NYY A;  3QLQ A;  3PJY A;  4JC1 A;  1GP6 A;  1DGR A;  1J83 A;  2VPV A;  2ZGO A;  4ITC A;  1I1E A;  2WFF 3;  3KD4 A;  3ZN5 A;  5FPA A;  4CUA A;  2J22 A;  3LGR A;  3RZG A;  1AYN 3;  3POI A;  5FY0 A;  5FFO C;  1EPW A;  2CGN A;  4GKY A;  3USU A;  1PZ8 A;  1SFY A;  2AEZ A;  1XBF A;  3KWV A;  5FMO S;  5IW0 A;  3ZXA C;  4CUG A;  3CQO A;  5A1F A;  5IWF A;  3ZPY A;  4URA A;  3BTA A;  1PO1 1;  2ZX3 A;  4Q4W 2;  3M70 A;  1VMJ A;  3AKT A;  1OLR A;  2BVV A;  2VQU A;  1RTV A;  1Y43 B;  1NLQ A;  3JB8 A;  1S4C A;  1UOF A;  3R4D B;  3SKJ E;  3TOJ A;  4XW3 A;  3GHN A;  5A3O A;  1D4M 2;  2YC0 A;  3ST7 A;  1VR3 A;  3ZIX A;  3A22 A;  1NCQ A;  2RDR A;  2AZ5 A;  3R4S A;  3LFM A;  3WNM A;  4HK8 A;  1O4Z A;  1S2B A;  5AVP A;  3U11 A;  2YU2 A;  1GNY A;  1ENQ A;  3SH5 A;  4XUQ A;  4CU8 A;  3E6D A;  4RD7 A;  1HXS 1;  5H9R A;  5IVC A;  3FC0 A;  2IXC A;  1BQP A;  5CFD B;  2DVF A;  4IQP A;  3AMN A;  3D0J A;  5FJK A;  3AFK A;  2VBP A;  4AVC A;  4N9I A;  1K3I A;  3M3E A;  4B4P A;  2XBO 1;  1NQJ A;  1DLC A;  2QQV A;  1WCU A;  3N9L A;  1HQL A;  3I2F A;  4PF5 A;  1REF A;  2VOX A;  4JX0 A;  3NJY A;  2V5D A;  2BNO A;  2IC1 A;  2VE1 A;  3K51 A;  4IV1 A;  1PIV 3;  3GCW A;  5EJ1 B;  1PVC 2;  4X6Q B;  4W8J A;  4RHV 3;  4FOW A;  4COU A;  4QX2 A;  2LAL A;  5C33 A;  5EWS A;  4YGD A;  3ZFF C;  4IE6 A;  4YGC A;  3H1W A;  3S30 A;  5LBB A;  4AOC A;  1QXR A;  2QE3 A;  5ERL A;  1H9P A;  3OPT A;  4ATE A;  3NKT A;  5GZD A;  2Q1M A;  4W4Z A;  4CVU A;  4DZG A;  3PVO A;  1FAY A;  1FT9 A;  1AYN 1;  4A4A A;  5ACA 2;  1CVN A;  2JE9 A;  5FZ4 A;  1RMU 2;  3QAC A;  3SH4 A;  4BYY A;  3VKO A;  3WNX A;  2JEC A;  2F6B A;  1RUI 3;  5FXV A;  1UO9 A;  4YW2 A;  3KV5 A;  5FUI A;  2HWD 3;  1DQ2 A;  1GMM A;  2B4K A;  1YI9 A;  2JDU A;  1WMD A;  2QQN A;  3DEM A;  2WS9 2;  1BJQ A;  1AF9 A;  4GWM A;  1H4H A;  3LWC A;  1QQP 1;  1PK6 B;  2ATF A;  3VZJ A;  1ZA7 A;  2VZ1 A;  2FBE A;  2FDI A;  1PZ7 A;  2UYA A;  5E89 A;  1LOA A;  1O4Y A;  2XXZ A;  1LHN A;  2EIB A;  1SFN A;  2WQZ C;  1Z0H A;  3Q8A A;  4MXW B;  1OA4 A;  2C9A A;  2AUY A;  2R06 2;  3GXU A;  3ILR A;  4LEJ A;  1RIT A;  4LBM A;  4RGA A;  3LSE A;  2OT7 A;  4Y5S A;  1OFS A;  1PMI A;  4JQT A;  4YW5 A;  1XYO A;  1DGW A;  5IAT A;  4PIY A;  1Q8S A;  2DUP A;  2YU1 A;  3VBS C;  2YDE A;  3ZX7 A;  4PCR A;  5KBF A;  5LCW L;  1PGS A;  1POV 3;  1HQW A;  3VBR A;  5DZE A;  3AMM A;  4N43 B;  2HWC 1;  3HJR A;  4P9I A;  5DAX A;  5FZA A;  1U5Y A;  4FT8 A;  1DQ5 A;  2ID4 A;  4DXS A;  1MQT A;  2FD8 A;  1BBT 3;  5LW9 A;  4X8P A;  1YFX A;  5AC9 2;  2PHT A;  3GHM A;  2AYH A;  3D0S A;  2LRP A;  3M4F A;  4NN0 A;  1B35 A;  3CBN A;  3P3P A;  1J58 A;  4OMC A;  4SBV A;  4XOG A;  1G9A A;  2A71 A;  3I2H A;  1GOH A;  2ADD A;  4QPY A;  5T55 A;  3T2P A;  1CIW A;  4LBN A;  4DUX A;  4E4H A;  4LNV A;  4UW4 A;  4F3J A;  3MV0 1;  3A0N A;  3L2H A;  3FFQ A;  1S1A A;  4BZ4 A;  5D1I A;  4QHZ A;  3K46 A;  2EAK A;  1WWY A;  2PQQ A;  2VNG A;  3FE5 A;  4JHT A;  4BIS A;  1GSL A;  1Y9G A;  5JXI A;  4I0B A;  1AXY A;  1Z7S 1;  1UN1 A;  4V1P A;  2TUN A;  5T52 A;  2CWM A;  5DN2 A;  1WBL A;  3DXT A;  4Q29 A;  5GM0 A;  2D6P A;  4Y1U A;  2WDB A;  4YG6 A;  4BK5 A;  4JGY A;  3X29 B;  1SG3 A;  4AI1 A;  1SDD B;  4O65 A;  4AEK A;  4M3C A;  5H9Q A;  1OUR A;  1W06 A;  5L9B A;  3G7D A;  5IK8 A;  5AVA A;  5A3P A;  3WR0 A;  1LU2 A;  2Q4S A;  2JDY A;  3BPS A;  3ELN A;  3M1H A;  3ZDS A;  4MHU A;  1MZ5 A;  3CO2 A;  5F5I A;  3SC7 X;  1YQ2 A;  3I3E A;  2ARX A;  3WZ1 A;  1VAM A;  5IHR A;  1QNW A;  1RHI 2;  2BFU L;  4GH4 C;  1HB1 A;  1OOP B;  5F5A A;  4CRQ A;  2BOJ A;  3LEI A;  3FLP A;  4QB1 A;  1RC6 A;  3BTX A;  4LLF A;  1S55 A;  2VNO A;  5BUV A;  1GWK A;  4IEX A;  1DZR A;  2LUW A;  2VG9 A;  3OD4 A;  4KBB A;  1PO2 1;  4I09 A;  5C3P A;  2ZX2 A;  1TQ5 A;  4K3U A;  3POF A;  5KHK A;  3ACH A;  5EJ3 A;  4Q27 A;  3UNP A;  4GQ7 A;  4K8F A;  4UBH A;  5KC5 A;  3LDR A;  3POJ A;  4LHS A;  1LOG A;  4JVA A;  4LIV A;  3PTY A;  5D8A C;  4MXW A;  4A7K A;  1UX6 A;  2RS1 2;  4OI1 A;  1WCD J;  2Z42 A;  3VUO A;  2HWF 1;  5LEK A;  1UOJ A;  2G4I A;  4O61 A;  1XU1 A;  2CAV A;  2ZS6 B;  4QX8 A;  4BLJ A;  1W05 A;  3SCG A;  3WP6 A;  5FWJ A;  3N9N A;  1XYP A;  2ZHL A;  4XJW A;  1X9P A;  1G9F A;  4BLI A;  2UYB A;  4NPL A;  1SBD A;  4YM2 A;  1LAJ A;  1LHO A;  4YZ4 A;  4EN9 B;  1LUL A;  5IFT A;  3BIE A;  2NQY A;  2ZZQ A;  4BK4 A;  5EQU A;  1NY7 2;  3ECQ A;  3I54 A;  1KQR A;  4XFF A;  4U2A A;  3SMH A;  1JOB A;  5FP8 A;  5ABJ C;  3KHC A;  2K9Z A;  4CCK A;  4CDX B;  2IXJ A;  2Y0I A;  3QH6 A;  3EB7 A;  3HIF A;  2W68 A;  5EYX A;  1U5X A;  4LIT A;  1UU4 A;  1O59 A;  1ZZ6 A;  3ACG A;  3WSO A;  1QJE A;  4DMI A;  4DRV A;  4XET A;  1AR7 3;  1W8W A;  2RHP A;  1VBA 3;  2GNT A;  3FUO A;  5IJR A;  3TYJ A;  4DS0 A;  1ULP A;  1MEC 1;  5HI0 A;  1AR9 1;  2V4A A;  2YV8 A;  5AFE A;  3VKN A;  4EE2 A;  2A70 A;  1W8F A;  2GDF A;  5LY1 A;  1S0C A;  1HRI 2;  3S57 A;  5DAV A;  4L92 A;  4Y20 B;  1HKD A;  2QQJ A;  3IN9 A;  3T09 A;  1PHM A;  2JIJ A;  4WVM A;  3ZXG A;  3IAQ A;  4HSJ A;  1Y7B A;  5LA2 A;  4FP3 A;  3VBU A;  1GUI A;  2BYV E;  4FTE A;  2WNE A;  4Q0P A;  5DUU A;  1HJF A;  1Y9Q A;  2DVA A;  5EYY A;  5LBE A;  3AZY A;  4PLO A;  3T1M A;  4I3P A;  4GB3 3;  3EBR A;  3T08 A;  3PU3 A;  3WW3 A;  1Q5O A;  2YHJ A;  1QJY 2;  2E7T A;  1ZRI A;  1SDW A;  4QPI A;  3BOP A;  4ZY9 A;  1KRI A;  3VD5 A;  1CAV B;  1NCR C;  1DIW A;  1OPM A;  2CWS A;  1LEC A;  4LIU A;  2ORZ A;  5L9R A;  3HT1 A;  5KXC A;  2RS3 2;  3V0A B;  3VBF B;  2FHR A;  3NO8 A;  2VZS A;  3LFI A;  4G9S B;  2A3X A;  2BBA A;  5FTT C;  4CDU A;  2XVL A;  2D98 A;  2DCY A;  1W2U A;  2A3W A;  2VUJ A;  2WN3 A;  5C71 A;  4QU1 A;  4NR1 A;  3N4M A;  3AP6 A;  4R9A A;  4QPG C;  2YMZ A;  4CDQ A;  3AXE A;  2EXK A;  3D4K A;  3RVH A;  1W6P B;  2W3J A;  1CAU B;  4AED B;  3KCX A;  3VD7 A;  1OH3 A;  5FLH A;  3ZYH A;  4JDM A;  2V73 A;  5F7U A;  1RUE 2;  5FZM A;  1NOV A;  3WCR A;  3CJX A;  4QQL A;  3WQ1 A;  5JZG A;  1RVF 3;  2O8O A;  2VQA A;  4M4R A;  1WLT A;  2R6Q A;  4GMP 0;  4RR3 C;  2WNV B;  3OYW A;  3A4U A;  4FQ4 A;  3RS6 A;  1AL2 2;  2L9L A;  4B7K A;  2RMU 3;  4K7J A;  4RQP B;  4K8R B;  3WNN A;  5LK5 A;  4KG0 A;  3N7J A;  3WF2 A;  2XVG A;  2D6M A;  1BVP 1;  2CGO A;  4AGV A;  2QDN A;  2WWJ A;  5FY7 A;  2BNN A;  3MIH A;  2ARC A;  1UMI A;  1JYV A;  1VBB 3;  2BFU S;  1WUV A;  1UMZ A;  1JW6 A;  4D6R A;  4XXP A;  3VZK A;  1FOD 3;  4WVW A;  4CCN A;  3I8T A;  2VQ0 A;  1GKB A;  5IVY A;  5FZG A;  1FPN 2;  2OQ7 A;  3DYP A;  1IPJ A;  4AVB A;  1XXN A;  3BTY A;  1UCX A;  3VBH C;  1W03 A;  4OZO A;  4DY3 A;  1G6N A;  5JIA A;  4K1Y A;  1KD7 A;  1QJU 2;  2VW2 A;  4LKF A;  4KGG A;  4ATF A;  2X5I A;  1V6K A;  4UFH A;  4FTB A;  2PHX A;  2YBS A;  1DYO A;  1GZW B;  4GJY A;  1R08 2;  1STM A;  4AEM A;  1NZI A;  2VW0 A;  4TYS A;  3WX5 A;  1GWL A;  4CCE A;  4J6G A;  4CEY A;  4UFM A;  3M3I A;  4DY5 A;  4BQX A;  4MG2 A;  3AL5 A;  1ND3 B;  4DB5 A;  4NRP A;  4QM9 A;  4ARX A;  4YW4 A;  3I2D A;  3TAY A;  5BNN C;  2XUE A;  1SLI A;  1S0F A;  2WFF 2;  4UFJ A;  1LES A;  3NNL A;  3NAP C;  4QDS A;  1W3V A;  4MGS A;  2WJS A;  5FZ8 A;  1AYN 2;  1LOB A;  5KC6 A;  3UT0 A;  5A32 B;  4BH9 A;  3TEW A;  5I8T A;  3O7O A;  1H8T A;  1NXD 1;  4WM7 A;  2XL9 A;  4XCA A;  4W65 A;  4O9G A;  4BPZ A;  1CES A;  1PM7 A;  3RGB A;  1HV0 A;  1W6P A;  3H3L A;  1I5P A;  3OGJ A;  4KWJ A;  4BQ4 A;  5KHJ A;  4AQ2 A;  2DVG A;  1OMI A;  3H7Y A;  3R0R A;  4ZU5 A;  3AMH A;  3ZXE A;  3IPV A;  4COW A;  1VBB 1;  3OSD A;  1OVS A;  3IT8 A;  1Q8O A;  5J48 A;  1L3J A;  1VBD 3;  2A3Y A;  2P34 A;  1ZBA 2;  4B7E A;  3AKR A;  2R07 1;  3WDV A;  3PDQ A;  3ZMO A;  1X7N A;  4Y4R A;  4JDN A;  1V9U 3;  1X9T A;  4RQP A;  1CWP A;  2J1R A;  5AFB A;  4GUL A;  3NRU A;  1W04 A;  4R4X A;  3FWE A;  5K0U C;  3TNQ A;  3LAG A;  4IEU A;  2J1U A;  2Z69 A;  1GBG A;  1S0G A;  3DV8 A;  4WM8 C;  1DLL A;  1U5Z A;  1GAN A;  4OFG A;  2WWS A;  2WT2 A;  4HN0 A;  4WV8 A;  5L7O A;  3H1M A;  3PU8 A;  2R0F A;  1COV 3;  1RUJ 3;  1TME 1;  3GZT B;  1JHN A;  4YFW A;  1NLS A;  2VMF A;  5FV3 A;  5K9Y A;  3AZZ A;  2DCK A;  5CYY A;  4CU7 A;  1R09 1;  4XFI A;  1QHD A;  1WCK A;  2A6Z A;  3AVS A;  4M3C F;  5FZ0 A;  4I2O A;  1PIV 2;  3DN7 A;  2BV4 A;  4OI4 A;  4XJ8 A;  3PVN A;  5FZK A;  5T5O A;  5JDB A;  3AYE A;  1YQ5 A;  1LEN A;  3V0B B;  2X8K A;  1PGW 2;  2JG9 C;  2ZCW A;  4RHV 2;  2N7G A;  5C5T A;  3NST A;  4CPB A;  4Z2W A;  1BYH A;  4DXR A;  2GC1 A;  4HVO A;  2P17 A;  2OUJ A;  3I2I A;  1XSR A;  5IUQ A;  1U12 A;  1VB4 A;  1EY2 A;  1LHW A;  3RG0 A;  1YFW A;  1GZW A;  4CCL A;  1O5U A;  1PM4 A;  4YW6 A;  4L2N A;  5LBF A;  1LED A;  4R9C A;  2FDF A;  3K3O A;  3PME A;  1RUI 2;  2DCT A;  2WNU B;  2NPI A;  3OY8 B;  1L7Q A;  2BP6 A;  4MGK E;  4XF1 A;  4YVW B;  5H9P A;  4EQV A;  1K12 A;  5HXM A;  2HWD 2;  3ZSM A;  3GGL A;  5JSR A;  4XIK A;  5ISL A;  4KGQ A;  2X10 A;  4XFH A;  5FUN A;  1W9W A;  5J37 A;  1H4G A;  1UY1 A;  5KXB A;  3HAG A;  4LPL A;  1UXZ A;  3R4U A;  2DU0 A;  2ZX1 A;  2PHR A;  3SH3 A;  1A8D A;  4ZXE A;  3OEA A;  3LA2 A;  4H3W A;  1OXC A;  5CVR A;  4JRA A;  2Y8K A;  1EUT A;  1IZ3 A;  4LUL A;  4AHW A;  2VNR A;  1AL0 G;  1VRH 1;  3KV4 A;  2VC9 A;  5JCT A;  3RNS A;  1F4A A;  3ZLI A;  4QU2 A;  3RI8 A;  1OUX A;  1EV1 3;  5FZF A;  4FXG B;  1CZV A;  1YRZ A;  1Y3T A;  4XJZ A;  1XNK A;  3RYR A;  4CUB A;  3NL1 A;  5F8P A;  4D7T A;  1W8N A;  3U0Z A;  2PLV 3;  5JI9 A;  2C4X A;  4K6B A;  4FOV A;  2VCM A;  3IMN A;  4PDW A;  3H8R A;  3EJK A;  1GQP A;  3ZKU A;  4AI0 A;  2VCC A;  1YO8 A;  4NHM A;  1BBT 2;  3FX3 A;  1JZ7 A;  1JYI A;  2H6C A;  2VH9 A;  3RJR A;  1HB4 A;  4UYB A;  3PMS A;  4AHX A;  4CP1 A;  3F95 A;  2MEV 1;  4YZ1 A;  4FOY A;  2E7Q A;  4MGY E;  2BJS A;  3PTR B;  1WW6 A;  2QZ3 A;  3PUI A;  3H8U A;  2W94 A;  3S0M A;  2D7F A;  3M3C A;  2R04 1;  1CD3 G;  4I0W B;  3JBG 1;  4HMZ A;  4KWL A;  1E5S A;  3OBR A;  4UF0 B;  3ASI A;  2Z4F A;  4M01 A;  2VVF A;  4QB2 A;  2R49 A;  2A73 B;  3D5O A;  4UXA A;  3RMX A;  1YWK A;  1F8V A;  3VN4 A;  1OT5 A;  4OCT A;  4XUO A;  1AJO A;  5A33 A;  1QOO A;  4OQ8 A;  2WZE A;  4ZHN A;  1OSG A;  4C1X A;  4YSF A;  4ARY A;  5BYN A;  1UIK A;  4AFC A;  2VZ3 A;  1DDL A;  2BU9 A;  4IV3 A;  5F3G A;  4IGO A;  1RUC 3;  1I3H A;  1CJD A;  1CAW B;  4CEW B;  4L97 A;  2XJV A;  4AVA A;  3OBT A;  4G3Y C;  2SLI A;  1NG0 A;  5F37 A;  4IEO A;  4PI2 A;  4D8M A;  3I2G A;  3OPW A;  3R05 A;  5FBJ A;  2VEC A;  2OXB A;  4TTG A;  3AFG A;  4L9B A;  3RZH A;  4PIZ A;  1IQA A;  1OF3 A;  2NZ9 A;  3Q8F A;  2RG4 A;  4FXK B;  2KR2 A;  4EJR A;  1LOC A;  2B42 B;  1W99 A;  1UY2 A;  2I74 A;  2VOW A;  4QXB A;  4Y3O A;  2C6S A;  3M8L A;  3ZFE A;  3U4X A;  1QXJ A;  2GMM A;  4DO0 A;  4AGG A;  5FBZ A;  1M06 G;  1LB2 A;  2FZ2 A;  1H2M A;  2MNG A;  3VKM A;  1ALY A;  4Q4X 1;  5LRS A;  1WZX A;  2P3J A;  2WR9 A;  1KFU L;  2JDN A;  2LTN A;  3KQR A;  3LE0 A;  3U78 A;  1A6C A;  1B09 A;  1QIQ A;  2ZKN A;  3CJI B;  4OI2 A;  4RSU A;  3WDU A;  1LRH A;  3Q8E A;  1CGP A;  1R1A 1;  1SQ4 A;  3UKN A;  1ASJ 3;  2CDP A;  4G4F A;  5A6X A;  1AXK A;  3WDW A;  1VBC 3;  1X33 A;  4WVZ A;  5C6C A;  5A3N A;  2IFW A;  2ZZJ A;  1RUF 1;  4EN8 B;  4GIQ A;  4JDO A;  1C1F A;  5HCA A;  3RWK X;  2D97 A;  3LOB A;  1ST8 A;  1AR6 3;  2KM2 A;  4N8M A;  3ORJ A;  4AHY A;  3IIA A;  3USU B;  4RS5 C;  1IHM A;  2Y6F A;  3VL9 A;  4EWD A;  4RYD A;  3AC0 A;  4S2H A;  1SHW B;  2R7E B;  4FPF A;  3GAL A;  2R16 A;  1K5M A;  3KM5 A;  3OBZ A;  4XBQ A;  1ACC A;  1KJL A;  1ULO A;  4LR4 A;  3R6S A;  4FPG A;  5BNO A;  2QQO A;  1DGR N;  3NQH A;  1W90 A;  1H0B A;  2W46 A;  3W5N A;  1NE4 A;  3CF6 E;  3AKS A;  3AXD A;  1AR8 1;  4Q4Y 1;  4BQW A;  3MID A;  1ZRE A;  1WLD A;  4LKS A;  1NCQ B;  3B93 A;  4YVS A;  2CY6 A;  2DTW A;  2B46 X;  2KA3 A;  1FX5 A;  1TMF 1;  1J59 A;  3ALQ A;  1PO1 3;  3MEP A;  4NO4 A;  1JS9 A;  4NRM A;  2A6V A;  3ZR6 A;  4D6Q A;  4DIN B;  1YIP A;  5GZG A;  2ET7 A;  3RQ0 A;  2QQM A;  2YGL A;  1AR7 2;  1OUS A;  1VBA 2;  3VBO B;  2VUD A;  5HV0 A;  3VZN A;  2ZHK A;  4GAL A;  3TB0 A;  5E1R A;  2Q8O A;  5CAD A;  4HFS A;  3I2O A;  3DYM A;  1TE1 B;  1V6O A;  2DBN A;  2VTF A;  2C0Z A;  3NNF A;  3RPQ A;  4MGI E;  1YLL A;  1LKN A;  4N53 A;  4N7U A;  4RA0 A;  1OQD A;  4C90 A;  4D3W A;  4JRL A;  1CAW A;  3SEP A;  4Q2F A;  4IV1 B;  3MIF A;  3GNE A;  4DQA A;  3ZYB A;  1HXS 3;  3WDX A;  1AX0 A;  3WIN E;  4I01 A;  3J7M A;  1FXZ A;  1MS5 A;  5C4W C;  5J36 A;  4GB3 2;  5J96 B;  1VBC 1;  4IE5 A;  3E5Q A;  3T30 A;  2JJ6 A;  4XAE A;  2XBO 3;  2YB7 A;  1F5J A;  2EIE A;  3K4Z A;  3C3V A;  1ND2 C;  5A6Y A;  4R52 A;  3VD9 A;  2BWC A;  4QKN A;  5FPZ A;  4P5H A;  3AZV A;  3NWK A;  2WSV A;  2HBU A;  5GLW A;  1POV 0;  5GLV A;  5LK7 B;  2AEN A;  4AFD A;  3GJB A;  2WQ4 A;  1T6G C;  2W1S A;  2J1A A;  5J09 A;  1IS4 A;  1V6L A;  3MIG A;  3CNA A;  4HSL A;  1LR5 A;  1OD3 A;  5LAT A;  4P14 A;  2JX9 A;  5CFC B;  4ZZ5 A;  5CNA A;  4QQO A;  4NVP A;  3ZM8 A;  3IDE A;  5E88 A;  5HV4 A;  3DPR C;  1RUD 3;  5G05 L;  5IT6 A;  1D2S A;  1RVF 2;  3B00 A;  2E32 A;  4K40 A;  3WHU A;  3C7F A;  3SIT A;  3I2K A;  2ZBJ A;  1NA1 A;  4FVV A;  3ACL A;  2A5Z A;  5DAW A;  5BNP A;  5T3N A;  2RMU 2;  3PLQ A;  4ET7 A;  2V4V A;  3III A;  3VBR B;  1QQP 3;  4XFG A;  1OBN A;  1CZS A;  4XAC A;  5DXD A;  3ZSK A;  1S0D A;  4XAA A;  2WT0 A;  2Z79 A;  3VL8 A;  2P6C A;  3ITQ A;  3A0K A;  1HDK A;  4IER A;  2XGX A;  4E9K A;  1I6X A;  1JN2 P;  1MQT B;  3E97 A;  1OI6 A;  2ZAH A;  1ZBE 1;  4PT6 A;  1VBB 2;  3GZA A;  4OZX A;  3KHB A;  3WHT A;  1HV1 A;  4CPB D;  5FZO B;  4LO8 A;  1B35 B;  2JG8 A;  5FZ3 A;  1FOD 2;  5CG9 A;  5C70 A;  3T4H B;  1HRV 3;  4C0H A;  3VBO A;  3ZOI A;  4BCU A;  2PAE A;  3WG3 A;  4AQ6 A;  4RFT 0;  5IFP A;  2NP0 A;  2HWC 3;  1MS8 A;  1OF4 A;  1J84 A;  1E5H A;  1H9W A;  5CG8 A;  4E8D A;  5GLT A;  1K5J A;  2PMW B;  1KGY A;  4XYX A;  4OHV A;  3FL7 A;  3O1V A;  1PNG A;  3K2O A;  5EJZ B;  5DAQ A;  4JGY B;  4B8E A;  5CFD C;  1ULG A;  4M3C B;  1ULC A;  4YW3 A;  4F83 A;  4FOQ A;  5FLJ A;  5BV6 A;  4UWD A;  1OHF A;  2W1U A;  3WNO A;  2KD7 A;  4AEJ A;  3VDD A;  2XQR A;  4M4P A;  4LUK A;  1IOA A;  2JD9 A;  3N36 A;  4AYU A;  4TZD A;  4X6R B;  4A6O A;  4BM8 A;  2D5H A;  3CIH A;  5FP3 A;  5A7S A;  5CBL A;  1ZRD A;  4NHK A;  1BXH A;  1Z7S 3;  2J7M A;  1ODM A;  1RUD 1;  5GLU A;  2XJU A;  1OKO A;  1UZV A;  2WSU A;  1NAE A;  1U5I A;  3LCP A;  4OUE A;  5ANN A;  5A3M A;  2ZEY A;  2D6K A;  3PJQ A;  5C8C A;  5FR3 A;  1O3S A;  4JGZ A;  5I0U A;  1RB8 G;  1IS3 A;  4FFF A;  2ZGM A;  4H7M A;  2JIG A;  3MUY 1;  1VAL A;  1MS4 A;  2Y0O A;  4YW1 A;  3WOG A;  5FDB A;  1QU0 A;  3ZDV A;  3HNY M;  5CFC A;  4XMI A;  2E9Q A;  4OYU A;  3PUQ A;  4FPY A;  1DGL A;  5EP9 A;  1GNZ A;  3O12 A;  3O0X A;  1TNF A;  3ZYR A;  3IKW A;  5JXJ A;  5E16 A;  1YQ6 A;  3I3M A;  1NKG A;  1QDO A;  2B9U A;  2VAU A;  4JCK A;  4YGE A;  1DQ1 A;  3A7Q A;  1VBD 2;  5J1X A;  1HJG A;  2JIC A;  1PO2 3;  1SCS A;  1W6M B;  1PK6 C;  4XF4 A;  1UAI A;  4BHP A;  2Q8D A;  1V9U 2;  1W8H A;  5FO7 B;  3VHN A;  3J7N A;  4FI9 A;  1HRV 1;  3TEX A;  4FPH A;  5DPN A;  1RUG 1;  1W9T A;  3PUA A;  4ZPI A;  5LWB A; 
#chains in the Genus database with same CATH homology
 1T2X A;  1PMJ X;  2XON A;  3CDZ B;  2VZS A;  2BBA A;  2WN3 A;  2ZXQ A;  5C71 A;  3DYO A;  2VMC A;  5LA1 A;  3CMG A;  1XC6 A;  2Y64 A;  1XNA A;  2B9V A;  2W3J A;  4XVH A;  2WO1 A;  3VD7 A;  5B4N A;  2XQX A;  5F7U A;  3HN3 A;  4JHZ A;  1TG7 A;  3CKH A;  4M4R A;  4KI5 M;  3WNL A;  1JZ8 A;  3UET A;  4BDV B;  2L9L A;  4UOJ A;  3MBW A;  3WNN A;  3WF2 A;  5CZK A;  1UYY A;  1K42 A;  2E33 A;  3T0D A;  2DCJ A;  3MO4 A;  4P00 B;  2W1W A;  1O8S A;  1UMI A;  3HEI A;  1US2 A;  1JYV A;  2E26 A;  1UYZ A;  2RV9 A;  3BGA A;  1KEX A;  3D3A A;  2DDU A;  3T2O A;  3DYP A;  4TXW A;  5DQ0 A;  1UXX X;  2W5F A;  4OZO A;  1UY0 A;  2VZV A;  3THC A;  3WQB A;  3VDB A;  1BHG A;  4KWU A;  3WNK A;  5IYY A;  2VZR A;  2VL4 A;  3T2Q A;  2BGO A;  4P02 B;  2RJ2 A;  4GZ9 A;  1DYO A;  3GDB A;  4BXS V;  1CZT A;  2WO3 A;  3DEC A;  2QBX A;  2JE8 A;  4CU9 A;  4MO3 M;  4ARX A;  3FHA A;  3IDA A;  3WF4 A;  2J1E A;  1JHJ A;  4DEQ A;  2YG0 A;  4QDS A;  4MGS A;  3ABZ A;  1PX3 A;  2Y6K A;  4AAX A;  2WAO A;  1RYY A;  3K4D A;  4CUC A;  1I5P A;  4GWI A;  1JYW A;  2JDA A;  3VD4 A;  1UX7 A;  4GWJ A;  1O8P A;  4Z2A A;  3FN9 A;  1JU4 A;  3F2Z A;  4P08 A;  4PQQ A;  5B4X A;  3IB3 A;  3WF3 A;  2W1Q A;  3I97 A;  2VZT A;  2J1R A;  2PQS A;  5G04 L;  3NRU A;  2VZQ A;  4QDQ A;  2HYX A;  2C9K A;  2Y6L A;  3C7H A;  3GM8 A;  5A1A A;  3I3B A;  2XHN A;  2J1U A;  2W87 A;  4XUR A;  2VZU A;  1UZ0 A;  4D0Q A;  3C7G A;  1JZ6 A;  4XUP A;  2RVA A;  3CZJ A;  2WN2 A;  2V72 A;  2VMF A;  3LEK A;  2BER A;  2DCK A;  5CYY A;  4QAW A;  3T0A A;  4CU7 A;  1JU3 A;  2Y6J A;  3A21 A;  2WQ8 A;  2VQT A;  5LA0 A;  3HOB A;  3FHQ A;  4W50 A;  4DXR A;  5JXH A;  2VJX A;  3BN6 A;  4AG4 A;  3I2I A;  1P8J A;  3MV1 1;  2BGP A;  1HN1 A;  1JZ5 A;  5C7G A;  4QX3 A;  4JKL A;  5HPO A;  1L7Q A;  2WZ8 A;  4QPW A;  3OBA A;  1K12 A;  3K77 A;  5HXM A;  3NJV A;  4DXT A;  4YPJ A;  3GGL A;  1XPW A;  4QDR A;  1H6Y A;  2X10 A;  1W9W A;  2VME A;  4QX1 A;  1UY1 A;  4LPL A;  1UXZ A;  4ZXE A;  3OEA A;  5EIY B;  4UI9 L;  1UY3 A;  3K4A A;  1PMH X;  1UY4 A;  2Y8K A;  1EUT A;  3I2J A;  3LEG A;  3SKV A;  3WF0 A;  2WUH A;  2X09 A;  2VC9 A;  1F4A A;  3OG2 A;  3IAP A;  1CZV A;  4PF1 A;  1NX9 A;  4CUB A;  1W8N A;  3NJX A;  2C4X A;  2C26 A;  2J1V A;  2E31 A;  1R64 A;  3C7E A;  1GQP A;  4JKM A;  2VCC A;  2VM9 A;  2BZD A;  3OGS A;  1JZ7 A;  2HLE A;  1WCQ A;  2WBK A;  1J83 A;  1XNT A;  3K75 B;  4CUA A;  2J22 A;  2ZEW A;  1H6X A;  1MPX A;  3ACI A;  3PUI A;  2W94 A;  4XUN A;  1GOG A;  4MAD A;  4E8C A;  2Z4F A;  3P6B A;  3HNB M;  4QB2 A;  3CQO A;  1JZ3 A;  2LW8 A;  1UWW A;  1OT5 A;  4XUO A;  2WZE A;  2VQU A;  2X05 A;  2YC2 A;  4ARY A;  2VZ3 A;  3SKJ E;  1D7P M;  4UAP A;  2VOT A;  3A22 A;  2VCB A;  2WYS A;  4D8M A;  3I2G A;  4TTG A;  3WNM A;  1UYX A;  1GOF A;  2LS6 A;  1OF3 A;  3WEZ A;  1GNY A;  1JYN A;  4CU8 A;  4XUQ A;  3LQC A;  3OEB A;  4MGQ A;  1W99 A;  1UY2 A;  4XUT A;  1K3I A;  3VD3 A;  3LE0 A;  4QX0 A;  1DLC A;  4QB6 A;  4A44 A;  3HPN A;  2QQK A;  3I2F A;  3MUZ 1;  4JX0 A;  2CDP A;  2V5D A;  5EJ1 B;  3OGV A;  2CDO A;  4W8J A;  3E1F 1;  1W9S A;  2W9X A;  4QX2 A;  3LPF A;  2VCA A;  4W4Z A;  4CVU A;  4RYD A;  4A4A A;  3AC0 A;  4CU6 A;  1SHW B;  2R7E B;  5JUV A;  2VR4 A;  2XOM A;  1ULO A;  3C8X A;  1DP0 A;  5FUI A;  2WAA A;  3WF1 A;  3I3D A;  1GMM A;  2B4K A;  2QQN A;  2QQO A;  3NQH A;  2W46 A;  3W5N A;  2ZEX A;  4ZZ8 A;  4A41 A;  2VZ1 A;  2W47 A;  4LKS A;  4DUW A;  2EIB A;  1NUK A;  3HNM A;  3WNP A;  3P1I A;  5JXG A;  3GXU A;  2YFZ A;  3OB8 A;  2QQM A;  1IQD C;  1TVG A;  5LCW L;  3J7H A;  4MOA A;  3DYM A;  2VTF A;  1JYX A;  2ZEZ A;  3ACF A;  3HJR A;  2WO2 A;  4DXS A;  2ID4 A;  5JMO A;  4LQR A;  3W5M A;  3SEP A;  4DEV A;  2EIC A;  4IUG A;  4RN5 A;  4OMC A;  3LPG A;  3I2H A;  1GOH A;  1US3 A;  3T2P A;  2YB7 A;  4DUX A;  2EIE A;  3K4Z A;  3VD9 A;  3MV0 1;  3SEE A;  2VO5 A;  3VDA A;  3K46 A;  3ETP A;  2VMD A;  4XZU G;  3JXS A;  1LNS A;  5JXI A;  2VZP A;  1F4H A;  5DN2 A;  2W1S A;  2YFU A;  2WDB A;  4BK5 A;  2J1A A;  3UES A;  1SG3 A;  1SDD B;  1OD3 A;  4ZZ5 A;  2W92 A;  3ZM8 A;  1YQ2 A;  1GU3 A;  2W91 A;  3I3E A;  5G05 L;  3CZU A;  5IHR A;  3PUH A;  4JKK A;  4A3Z A;  2E32 A;  2VZO A;  3LEI A;  4QB1 A;  3C7F A;  1WKY A;  3I2K A;  2Y6G A;  2ORX A;  4ET7 A;  2V4V A;  1JI6 A;  3III A;  1L7R A;  2J1T A;  1CZS A;  4KMQ A;  4A42 A;  1W0N A;  3ACH A;  3UNP A;  4PT6 A;  4DUV A;  4LHS A;  2QQL A;  2EID A;  5I0D A;  3VDC A;  1EUU A;  5C70 A;  2YC4 A;  1OH4 A;  2QQI A;  5IFP A;  2OKX A;  1OF4 A;  2W95 A;  1J84 A;  4P5Y A;  1CIY A;  1JZ4 A;  3C7O A;  3A23 A;  4L0P A;  4E8D A;  1KGY A;  3FL7 A;  2J1S A;  3EYP A;  5EJZ B;  3OGR A;  5IFT A;  4BK4 A;  2JKX A;  3ECQ A;  3T0B A;  4BJ0 A;  2W1U A;  3WNO A;  2KD7 A;  1UMH A;  4M4P A;  3EB7 A;  2JD9 A;  4A6O A;  1O59 A;  3ACG A;  3CIH A;  3WSO A;  2J7M A;  2Y6H A;  4OMD A;  3THD A;  1NAE A;  5IJR A;  4OUE A;  1ULP A;  2ZEY A;  1JZ2 A;  5JR2 A;  1W8O A;  3MUY 1;  2QQJ A;  4A45 A;  3T09 A;  3HNY M;  3IAQ A;  4OYU A;  5LA2 A;  3U37 A;  1GUI A;  5JXJ A;  1NKG A;  3T08 A;  3A7Q A;  5J1X A;  1K45 A;  2WAB A;  4ZY9 A;  5DMY A;  1PX4 A;  3VD5 A;  4FI9 A;  4HG6 B;  2ORZ A;  3NNG A;  1CX1 A;  5DPN A;  1W9T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...