2E33A

Structural basis for selection of glycosylated substrate by scffbs1 ubiquitin ligase
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
175
structure length
175
Chain Sequence
RRRNLLRNPCGEEDLEGWSDVEHGGDGWKVEELPGDNGVEFTQDDSVKKYFASSFEWCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRTDAGSLYELTVRLLSENEDVLAEFATGQVAVPEDGSWMEISHTFIDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSSVWVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/hydrolase
molecule keywords F-box only protein 2
publication title Structural basis for the selection of glycosylated substrates by SCFFbs1 ubiquitin ligase
pubmed doi rcsb
source organism Mus musculus
total genus 39
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2006-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04300 FBA F-box associated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2e33A00
3HEIA 3NQHA 1UWWA 5JXJA 2YC4A 2PQSA 4LHSA 1JI6A 1KEXA 1UYYA 2W1WA 4MO3M 3K4ZA 2RV9A 4CU7A 2YC2A 4W4ZA 4P00B 2BBAA 1W8OA 4BDVB 3K46A 1XNAA 1XPWA 2JD9A 2YG0A 4A44A 4LQRA 5JXGA 3HPNA 5G05L 3HNMA 4Z2AA 1P8JA 1CZSA 3PUHA 1UXZA 2QQLA 2VZOA 4CVUA 2EIDA 4LPLA 4IUGA 3VD4A 3C8XA 1K42A 2CDOA 1US3A 1SDDB 2Y6LA 3MV11 2JKXA 4DXSA 2VM9A 2BGPA 1JU3A 3VDCA 2VMCA 2WZ8A 4PQQA 2WBKA 3CZJA 2WZEA 5I0DA 3I3EA 2E31A 4PT6A 2X09A 4QB2A 2W47A 1UMIA 5B4NA 2W9XA 4RN5A 2QBXA 4JHZA 2VQUA 4CUCA 5FUIA 1W99A 4QDSA 5LA1A 5DQ0A 2Y6GA 2ORXA 4A6OA 1UYXA 2QQJA 2VZTA 5JUVA 4UOJA 3ZM8A 3WQBA 4DEVA 3UNPA 2W95A 1UZ0A 3IAPA 1JYVA 2VZUA 2C9KA 3I97A 1SG3A 2YFZA 1JZ2A 2QQIA 2B9VA 3ACGA 2WDBA 4P02B 4XURA 4ZXEA 2YB7A 2J1VA 1PMHX 3LEGA 2L9LA 3ACIA 1I5PA 5CZKA 4A42A 1GOFA 1L7QA 1BHGA 5EIYB 1UY0A 4XUQA 2W1SA 4JKKA 4P08A 3THCA 1JZ8A 2VQTA 1OT5A 3NJVA 3DYPA 4A4AA 4CU6A 2J1RA 2VL4A 2WO3A 2X05A 5LCWL 1PX4A 2VOTA 2J1AA 1UYZA 2B4KA 4QX1A 4TTGA 5C7GA 3DYMA 3HNBM 4MADA 3WF4A 2QQKA 1US2A 1JZ3A 2VTFA 3T2QA 1K12A 3NJXA 1JZ4A 5C71A 3GGLA 2W5FA 2VCBA 2V4VA 2ZEYA 3WF0A 1JU4A 1XC6A 4A41A 2WAAA 2QQMA 4XUNA 2W94A 3CMGA 1W9WA 4ARXA 1JZ6A 3DYOA 3EYPA 5DN2A 4MOAA 4JKLA 2WN3A 3I2KA 5JXIA 4M4PA 1CZTA 2J7MA 4DXRA 4QDRA 2E26A 4DUXA 1H6XA 3T0DA 2WO2A 3UETA 3C7FA 5JMOA 3IAQA 4CU9A 1NKGA 3MUY1 1DYOA 1LNSA 3NNGA 1JZ7A 3VD7A 4TXWA 1OD3A 1UXXX 1UX7A 3HOBA 1SHWB 3SKJE 3C7OA 1F4AA 2W1QA 1EUTA 3VD9A 1OH4A 5JR2A 1GUIA 2LW8A 3ABZA 3LE0A 3NRUA 3CDZB 4GWJA 2XHNA 2YFUA 1GOGA 2VC9A 5CYYA 3ACFA 1UY3A 2E33A 2JE8A 1ULOA 2XOMA 1MPXA 5HPOA 2WQ8A 2KD7A 2R7EB 2VJXA 4LKSA 4XZUG 3T0AA 3FL7A 2WAOA 2DCKA 3GM8A 2Z4FA 2CDPA 2W87A 3WNMA 3WNOA 2V72A 3WF1A 4XUOA 5C70A 5IFTA 2ZEZA 3GXUA 3AC0A 1GOHA 4QB6A 2BERA 3VD5A 4ZY9A 5IJRA 3A21A 3VDAA 3WF2A 3K77A 2VZRA 1JZ5A 2EICA 4JKMA 1UY4A 1K3IA 4A45A 2BGOA 2RVAA 3VD3A 2QQOA 3ACHA 5IFPA 1XNTA 3J7HA 2VR4A 1GU3A 3WEZA 2XONA 2RJ2A 2W91A 3I2JA 4D0QA 2VZQA 1W0NA 3C7GA 3U37A 3E1F1 4QX3A 4HG6B 4DUWA 4KI5M 3T2PA 3BN6A 4UI9L 4QAWA 3I2HA 2C4XA 1T2XA 1OF3A 1W9TA 2Y6HA 2VZPA 3I3DA 3UESA 4OMCA 3WSOA 5EJZB 2ZXQA 4YPJA 4D8MA 5HXMA 4XUTA 3C7EA 2BZDA 3P1IA 3W5MA 3OGRA 1J84A 4QX2A 2EIEA 3K4DA 2WYSA 1J83A 4XVHA 1NUKA 4A3ZA 2V5DA 1PX3A 1W9SA 2Y8KA 5B4XA 1F4HA 1TG7A 3JXSA 2J1TA 3I2IA 4BK5A 3SEEA 1JYXA 1D7PM 4GZ9A 4ET7A 3D3AA 3EB7A 4MGSA 3CKHA 3WNNA 1DP0A 1PMJX 1W8NA 4P5YA 1HN1A 1UY1A 3OG2A 2HYXA 5F7UA 4ZZ8A 2DDUA 2DCJA 1RYYA 5LA2A 5LA0A 3WNKA 2VZ3A 4AAXA 3GDBA 3OBAA 2J1SA 4PF1A 5G04L 1EUUA 2VMEA 3MV01 3I2FA 2VMDA 1ULPA 1GMMA 2Y6KA 3A22A 4DXTA 3HN3A 2QQNA 2Y6JA 5IYYA 1TVGA 3I3BA 3OGSA 3A23A 2XQXA 3WNPA 4JX0A 2W92A 3LEKA 2LS6A 1R64A 1GQPA 4DEQA 3P6BA 3T2OA 3K75B 3WNLA 3HJRA 4XUPA 1NAEA 5DPNA 4L0PA 5DMYA 5EJ1B 4QDQA 1WCQA 4E8CA 1UMHA 2E32A 3THDA 3SKVA 2W46A 5JXHA 1H6YA 4OMDA 2VMFA 1UY2A 3SEPA 3VDBA 2J1UA 3LQCA 1O8PA 3K4AA 2HLEA 2WABA 3OEAA 3T09A 3FHAA 1JYNA 2J1EA 1WKYA 2X10A 4QB1A 1GNYA 4QX0A 4E8DA 3MO4A 1CZVA 2OKXA 2VZ1A 4W8JA 3T08A 4RYDA 4ZZ5A 1DLCA 4AG4A 2EIBA 3FN9A 4KMQA 4GWIA 1CX1A 2VO5A 1O59A 1JHJA 4DUVA 2JDAA 3IB3A 1KGYA 2VCAA 2ORZA 3IIIA 3OGVA 1NX9A 3ETPA 4UAPA 4ARYA 3DECA 3ECQA 2ZEXA 3WF3A 2Y64A 4FI9A 2W3JA 3HNYM 3OEBA 1O8SA 3CQOA 4QPWA 4MGQA 4CUAA 3PUIA 1K45A 2VZVA 3T0BA 4CU8A 4OYUA 2ID4A 2WO1A 4W50A 2VCCA 4BK4A 3A7QA 4KWUA 3C7HA 3IDAA 5IHRA 3I2GA 1JYWA 3FHQA 4M4RA 1OF4A 3MUZ1 3LPGA 1IQDC 4OZOA 3LEIA 2J22A 2ZEWA 2WN2A 3F2ZA 3CZUA 4OUEA 1YQ2A 4BJ0A 3LPFA 2VZSA 4CUBA 1L7RA 4BXSV 3OB8A 3W5NA 3MBWA 3BGAA 1CIYA 2WUHA 3CIHA 2C26A 2W1UA 5J1XA 5A1AA
chains in the Genus database with same CATH superfamily
2D97A 3I4IA 2JDZA 3DL3A 1PZ7A 3LIHA 2P6HA 1K5MC 3JBG2 4RQPC 4Y5Z0 1KJLA 2PQSA 2YC4A 4LNVA 5D8AA 4E4SA 3O1TA 1OI6A 1Y3TA 1PMIA 3ZXFA 1KEXA 2FDGA 1UYYA 1EPZA 1NCRA 4G3YC 1VB2A 2VUCA 3H3LA 3MF6A 5A7WB 2OUJA 5FZEA 4XW3A 1S0DA 1G7YA 2RDRA 3Q8AA 2YC2A 1UAIA 1GQGA 4NO4A 4P00B 2BBAA 4H7LA 4PDWB 1PVC2 4BDVB 4M0NA 1VBE1 3NSTA 4Y24A 4A44A 4E2QA 4LQRA 4QXBA 4FOVA 2BVVA 3KGLA 1FMD2 4CCKA 1CZSA 3CHXA 1A78A 1UF2C 2AYHA 3U10A 2QQLA 1LOFA 5CISA 3RMXA 2EIDA 2VTXJ 3QCWA 4A2UA 3JQWA 3UL2A 3VD4A 4JTOA 1HRI2 2Z69A 3C8XA 1PGW1 4QHBA 2Q8DA 3RYRA 3S0MA 4MGIE 4I0AA 1OOPB 1YI7A 1OLQA 4PQ9A 4Y20A 4OVEA 1JBCA 2A75A 1WLTA 1OQEA 3M8LA 2VM9A 5E88A 4AEKA 2HWF1 3CO2A 1Q8QA 3KWVA 1TME2 3VBRA 3ZSJA 5C8CC 5H9RA 1DQ2A 3VDCA 1NCQA 1N1YA 2VMCA 1DDLA 2WBKA 1ZVFA 4Y22A 3CZJA 3J9SA 4E4ZA 4BIFA 2WZEA 2V5YA 3O0WA 1VALA 4CE8A 5JOWA 4PT6A 4AF9A 2VBPA 4K7JA 1CAXB 3AP6A 1BEV2 1COV3 3OD0A 4GKXA 4QHOA 4LE3A 4AW7A 1SLLA 2QBXA 1LHWA 3DCQA 3GBGA 2ZGTA 4Z82A 4YNIA 5BNOA 1E5HA 4QX5A 4UYBA 4Y3OA 5FUIA 4LK7A 4QDSA 3TN91 1PO11 2XVLA 3DUIA 5DQ0A 4WM8C 3SH3A 2DFCA 5L7OA 5SV8A 1RUF3 3RZKA 1LULA 2HWB3 2ARBA 3KQ4B 1AX0A 5T5JA 1I9RA 2QQJA 2VUDA 3RZZA 2WNUB 4K20A 1S0CA 1VBC3 4Q26A 1HRV3 5JUVA 1XB9A 1WD3A 1VMFA 3ZM8A 2QNKA 4Q4X2 5FJHA 3WQBA 4LHLA 5HBAA 4U36A 1YIPA 1R1A1 4JCKA 1AHSA 2BVBA 2Y60A 1KITA 2WWJA 3GCWA 4GH4C 3PUQA 4PF5A 1ZZ9A 1D4M1 2ZMKA 4A7YA 1UW8A 2LROA 1U5YA 5KXEA 2WDBA 4JGYA 1QXJA 2FDIA 2AC1A 2UWBA 4XURA 4ZXEA 5DAXA 4LBKA 1PMHX 3ZYHA 2L9LA 3HQUA 2QQUA 1MEC1 5GLWA 5JZGB 3VBHB 4NRQA 3MLKA 4A42A 1GOFA 1KFXL 2OZJA 1HQNA 1AYM1 3B01A 2E51A 5EJ3A 2ES3A 4BIOA 1POV3 1UY0A 4YG6A 3JU9A 1SCSA 1BMV1 2W1SA 1Q56A 2AGSA 4XF0A 1QJY3 4JKKA 3ZX7A 2OW4A 1HB1A 4QT6A 2VQTA 2BDRA 1ZREA 2CHHA 1VMHA 1XYOA 3AMNA 5DAVA 4JDNA 3SITA 5E16A 1B35B 3K3NA 2CWMA 2GC0A 2D44A 3IM0A 1UOFA 2FCUA 2RS33 3B7MA 3WQ1A 3A4UA 2J1AA 3BU7A 3LA7A 3MIDA 4UT5A 1RTVA 2B4KA 4QKBA 3V64A 4YZ5A 3GZAA 5C7GA 2C1FA 3DYMA 3KQRA 1ASJ2 4H3WA 5IAVA 3WF4A 4FAGA 3TNQA 1PO23 5T3NA 1RUG3 1A3KA 1YFUA 4O9EA 3U14A 1JZ4A 2YGLA 1RUC3 4UBHA 2RJLA 1F2NA 2W5FA 4QPIB 3MICA 1NA1A 1T6GC 4MXVA 5DG2A 1NCQC 1XE8A 3USUA 5J96B 4UF0A 4IE5A 3HT2A 4ZU4A 2VAUA 3IBMA 2VOWA 3INAA 3NJZA 4Q4Y2 2JWPA 5FYSA 4BQ3A 3KF5A 1W6MB 2ZMNA 1F8VA 1KQRA 3L9JT 2RS51 4IESA 5FMDA 5JIAA 1QJX1 3H50A 2KA3A 4UWDA 3JZVA 1IG0A 1HJFA 1ZX5A 2DUQA 5HCFA 5IK8A 4DXRA 1CR7A 1CZTA 1HV1A 4HK9A 5A32A 3TNPB 3KSCA 1KRIA 1AZDA 4CCNA 1OSGA 5L7OC 3KCCA 5IK7A 5CBLA 3C7FA 4HPKB 1M06G 3Q8FA 4BYYA 3SNMA 4BQ4A 5JMOA 2XXZA 5BNNA 2WNOA 3NNGA 1JZ7A 2Y26A 4AR2A 5FY4A 2GDFA 1UXXX 4Y26A 2PYTA 3JBG1 2D93A 2AZ5A 2Y6FA 2NP0A 1SHWB 3FZ3A 2BP6A 3SKJE 2FDKA 5FV3A 5FZ6A 1UKGA 3WVJA 1EAH1 2QQWA 4Q5OA 5I0UA 5FPAA 2ZAAA 1EUTA 5FZGA 1WBFA 2UYAA 1XNKA 4EN0A 1OH4A 1ZZBA 4E2GA 3N7JA 3KS7A 3NL1A 4JGYC 4RGKA 1PVC1 3VDDB 2LW8A 1MS5A 1DLLA 3AZXA 2VXJA 4R9DA 4RS5B 3ZFFA 3OGGA 4AQSA 3LE0A 1QQP2 3NRUA 2IXLA 2YFUA 2PELA 1GOGA 4L97A 3TWIA 1FMD1 2E33A 1GBGA 1W2UA 1ZZ6A 2E7QA 2XOMA 4YM0A 5CEHA 4NIHA 3KV5A 1PHMA 2KD7A 2D3PA 4XMIA 4AEDA 3AZWA 1X8MA 3SMHA 3FL7A 4EN7B 2LRPA 1EV13 1ZBE3 2DCKA 2Z4FA 2VW0A 5CFDB 2W87A 2X5IB 3OPWA 1IKPA 1ZA7A 2V72A 3ZN6A 4Y1YA 3K48A 2WLPA 5FBZA 2MEV3 1O3SA 3Q8CA 4BLJA 1R093 1L7LA 1FT9A 2R16A 1Z7S1 3AC0A 1J1LA 2XLAA 4YYOA 4QB6A 2F4LA 4KWJA 2BERA 3VD5A 1ZZ7A 1RVF2 2Q8CA 4EZHA 3AM2A 3J8F3 4MX3A 1CONA 2XDVA 2WO7A 4I09A 3VBOB 3PUAA 4CDWA 1M4WA 3E6CC 1JZ5A 1J3QA 4HZFA 1GP6A 4Q27A 4NHXA 1LHUA 4FPGA 1QGLA 2BGOA 4HXCA 1F9KA 2QQOA 2UWCA 4XOGA 4IV3B 4CDUA 4XPVA 4Y1XA 3VBUA 3BODA 1W2AX 1SACA 2XUMA 1WMDA 2VR4A 3J7HA 5K0UA 1DGLA 3WEZA 3V56A 4LIUA 1VBD1 5DUVA 4MSVA 5FTTC 2VD7A 2DUOA 2W91A 4XF1A 4Q4X1 4RL7A 5T50A 4MGYE 2VOVA 3RJ2X 3U1XA 1UYPA 1SZBA 4IE7A 4YLZA 3ES4A 3E1F1 3U11A 3WD5A 5BY5A 4DUWA 4HG6B 3KHCA 1UCXA 4LJHA 1K5MB 4RQPB 2H0BA 4OQ9A 3H0OA 3ACLA 4QAWA 2B45X 2ZJCA 2C4XA 5FZHA 1D2QA 2GC3A 1W9TA 2WS92 3J7LA 1O4ZA 4UFHA 1AR91 2WFF3 2WJSA 2OPWA 5EJZB 2ZXQA 4YPJA 1STMA 1OURA 5HXMA 1OH3A 4XUTA 2R072 3U4XA 1WCUA 5F6KA 4AWDA 2XJQA 3ELNA 2RR12 3TEXA 4YW6A 3P1IA 3MLLA 4LR4A 3W5MA 3V0AA 1CWPA 4META 3E5UA 1HLCA 2XVGA 4YW2A 3HQXA 4QX2A 5JLVA 1QDCA 3B94A 2WYSA 4R4ZA 2MNGA 4BPZA 5A3MA 1PZ9A 2YBPA 3M70A 2O8QA 3OYWB 2B39A 1W9SA 4JRLA 4QPGC 5CA6A 4B29A 4FOQA 3SCHA 1BBT1 5F1RA 3GBWA 2XJTA 3GBFA 4GMP0 5GKAC 3LFIA 1F4HA 4ZS2A 5DUXA 5IVCA 5FP4A 3JXSA 1C1FA 3AP4A 4ZPIA 5C8CB 2DWRA 4Q0QA 5FXZA 1LU2A 1O7FA 4QKDA 4V2WA 1MQTB 1QH7A 1JYXA 1D7PM 2CV6A 2KR2A 4D69A 2Q1ZB 3AP5A 1W6OB 3T1LA 4K9SA 4PDWA 4HFSA 3OG2A 2CGOA 2HYXA 4GD4A 4XCAA 2DDUA 2R043 4XJ9A 5IW0A 2DCJA 3RZJA 5BNQA 1VBB3 1W2TA 2PAEA 5JSPA 3FLTA 4KWLA 1VR3A 2Z5WA 2JXAA 5E1RA 3BTYA 3PL0A 2Q5TA 1H8TC 1X7NA 2CAVA 4WM8B 4GKYA 5FY5A 2WA4A 3WNKA 4CEYA 5LA0A 5A80A 4GB31 1YFWA 3ZO0B 3OBAA 3HAGA 4FTBA 1ALYA 1EUUA 5A6ZA 1LGCA 4IE4A 2VMEA 3PJYA 3AMPA 2GC2A 2HWC2 4N43A 2UU8A 3J4UH 2R061 1HJGA 5GLZA 1W0PA 3J26N 1SQ4A 3QACA 4RFT0 3AJYA 4GH4B 1UN1A 5FUPA 1MZ6A 5FZ9A 1REEA 3KB5A 4J6GA 5F6LB 3TYJA 4MV2A 2UURA 4P9IA 2WZPP 1CAXA 4X8NA 1AR82 1OPOA 3LEKA 4JQRA 5KHJA 2FD8A 2LS6A 1HXS3 4C0BA 1LEMA 1QQP1 1RUE1 2B9UA 4IEVA 5DABA 4YVSC 1VRH3 2JJ6A 4P9GA 2SBAA 4WVVA 1AYN3 1NAEA 3DF0A 1DQ6A 1QXRA 3AXDA 4AEJA 1IG3A 2YPJA 3BPSA 1BVP1 4Y1ZA 4M3CB 2WNUA 2RMU1 5J09A 4OZXA 4A6SA 2W46A 5DZFA 4DFSA 5JXHA 1H6YA 2VVEA 3IDCB 5GLTA 2NLRA 1PIV1 4AI0A 4KGGA 4YG0A 3VN4A 1AR71 1W8FA 1X9PA 2HLEA 3T09A 5F3EA 4DPNA 4UFIA 4Q8LA 1WKYA 3KV6A 1GNYA 2Q30A 1QWRA 3VGIA 1V6LA 5FO9B 1AR62 4E8DA 1H9PA 2RM23 2WC2A 4ZU7A 2VZ1A 4XTPA 4XXAA 1Q8PA 1C57A 5FY7A 4OI1A 2W2IA 5AVAA 1BLZA 3DXUA 1N47A 1G8WA 3AP9A 4KG8A 4WM7C 1O3QA 4K8FA 2IXCA 2YU1A 3WNXA 2HWE1 2VTXA 4KMQA 4CUGA 5J3UA 1QDOA 4CSWA 1J1TA 2AH2A 4QU2A 3GHMA 5CFCB 4O7XA 3ILRA 4OHVA 5I8YA 3S30A 1WCSA 2F6BA 3ALQA 3D5OA 1W6QA 3AYAA 2FDFA 3DECA 2PLV3 3ECQA 3R4DB 2MHFA 3EMRA 4N53A 4QHZA 5JWPA 3WF3A 4UXAA 4NAMA 1BYHA 1B35A 2CSGA 2DURA 2O14A 4FVVA 4CEYC 4LBMA 2GZWA 3LKJA 4FPEA 2ERFA 3P3PA 3V65A 3ZR6A 5IVFA 1OA2A 3C2UA 4QPWA 4AFMA 3PUIA 1EY2A 4NWWA 2ZGRA 3T0BA 1JTZX 2JG9B 2XGXA 3B00A 5H9QA 2W52A 2ID4A 5KR7A 1VRBA 4LEJA 4BK4A 4E4HA 4NRMA 4QPIA 1JUIA 4FQ4A 1W6PA 4RSUA 2NQYA 5C4WB 2WA3A 5JI9A 4CCLA 3UK9A 3VZJA 2VNOA 4OCTA 4IGQA 1CAUA 1W28A 1W6MA 1MACA 2VMIA 5FREA 4I01A 4Q1RA 5FZAA 4OZOA 3LEIA 1IPKA 4DO0A 4NPLA 2ZEWA 3G6JB 4EN8B 1TE1B 1T6BX 3ZYBA 3POWA 1OKQA 3ZFEA 4OHYA 2N7GA 3HBZA 3LPFA 1L7RA 3NAPB 3VBSB 1S55A 3OB8A 4HVOA 3EHKA 4UBGA 1V0AA 3IN9A 4XTMA 3DPRA 2AACA 4C0HA 1LKNA 1DGRN 2DBNA 3O1MA 2A6YA 5A33B 1YQ8A 4AAPA 5FYBA 1UWWA 4Y4YA 1NLQA 5JXJA 2VGDA 5C9AA 1QJU3 3ENRA 1FAYA 3OUHA 1OUSA 2WQZC 2RS13 4LHKA 4MO3M 2D7FA 4K1ZA 2RV9A 4TWTA 2JX9A 4WVMA 4IV1A 1RUF2 1DQ1A 2HWB2 5FYCA 1PGSA 4NIDA 2VCMA 3KM5A 1UQXA 2Q8EA 1O3TA 1CVNA 1YJKA 2JD9A 2YG0A 5K4LA 4C90A 3T4HB 4B8EA 1VBC2 1HRV2 2GNDA 5LWBA 4LA2A 1XYPA 5FYVA 1P8JA 1NG0A 2Q8OA 3NNLA 3PLQA 5ABJC 1RUI2 2UY8A 3MIHA 5DAQA 3OGJA 3N7LA 5CFDA 4CVUA 4BOWA 3PIGA 4IUGA 4I0WB 3USSA 4CP9B 2I07B 1W2NA 2HWC1 3JQXA 4RHV3 1K42A 5C3SA 3NJYA 1GR3A 1IKQA 1S0JA 2WNEA 3WG1A 4LA3A 5F3IA 3MV11 1ENXA 4EZ4A 5F7UA 2BGPA 2JG8B 1JU3A 1DGWX 1DZTA 1JUHA 1RUJ3 1ULEA 2ADEA 3AZVA 4K21A 4XC9A 1GZWA 3CLPA 1UO9A 3ZXDA 4KU7A 4PQQA 4Z2WA 2X8KA 2WNVC 4BB3A 5BNPC 3VBOA 5IVVA 2C5DA 2E31A 3I3EA 1WD4A 3KCXA 4XBQA 2H6BA 1QJY2 2W47A 1K5JA 4ZU5A 2W9XA 3O5SA 4RN5A 1LB2A 4YGDA 1WLWA 3HN1A 1I1EA 4IV3A 1QKQA 4Q0VA 4EQVA 3LCPA 2ARAA 3GF6A 4DRRA 3LF7A 2QVSB 2RS32 2ORXA 3CU7A 4MVTA 4A6OA 2VULA 4Z92B 2XWBB 3H8UA 4IETA 4QPGB 3FWEA 3TBDA 1Y7BA 1RUD1 3KT4A 5LBBA 3WW3A 1BJQA 4CPBD 1RGSA 3C3VA 3MHZA 1E5RA 3RQ0A 1I3HA 1PO22 1LCLA 1RUG2 4XJUA 3MIBA 5A7QA 3BTXA 2ZX3A 4SLIA 2W95A 2QTWB 1UZ0A 1RUC2 3IAPA 4FPFA 3VZLA 2VZUA 4PJYA 3AMQA 1IZ3A 1XYNA 2EXHA 2ZHNA 3VL9A 4DINB 5GM0A 2GALA 1PZ8A 1R083 3VKMA 3WP3A 5K8SA 1Q8SA 5FP9A 1RXFA 1X36A 3H3UA 2B9VA 3ACGA 1A8DA 1O5LA 4DB5A 2D6OX 2D3SA 5C9AC 5FZ1A 1OD5A 2YB7A 1F5JA 3LEGA 5IUQA 3I7DA 5J48A 4I2OA 1I5PA 3H1WA 3MPPG 2HEYF 5FP3A 3LD8A 2JB8A 1O4TA 1H0BA 2VQAA 3I54A 5LY2A 3ZSEA 4AI9A 4IEUA 5EIYB 1CAWB 1LENA 1PK6C 3GALA 5ACA3 4CEWC 3QBQA 3FMGA 1LOGA 4XJAA 5FLIA 4QMAA 5LK5A 2EIGA 2IC1A 1H8TB 2WT2A 4XUQA 1SPPA 5FMOL 1LHVA 1CGPA 4P08A 3THCA 1OT5A 2P2KA 4QKFA 2CY6A 3TAYA 5L19A 1RMU3 2VVDA 3WG4A 5JDBA 1OPMA 5C3PA 2VL4A 2XJVA 4QPYA 5HXVA 3ME2A 4UW4A 2B46X 4AHXA 2B5HA 3ZXKA 4CA9A 1W06A 4PLNA 3VBFC 4YGBA 5FPZA 3RJRA 4XBNA 3RI9A 1UYZA 1V6KA 2W68A 5T54A 1VP6A 4QX1A 3M3EA 4C8DA 4ASLA 4TTGA 4BQ1A 1TZOA 5A6XA 2DF7A 5K9YA 5FZOA 1VAVA 3HNBM 3VKNA 4KH9A 3AKRA 3FJSA 1OUXA 1US2A 4JTNA 4OFGA 4YFZA 4XFGA 2ZZJA 1JOPA 3NJXA 4EWAA 4DQAA 1ND2A 4YW5A 4AQ2A 1OXCA 2Q1FA 3LDKA 4G9SB 3OY8B 4I30A 4OI4A 2VCBA 1G86A 2JIJA 2DTYA 5F5QA 2ZEYA 2ZMLA 3FBYA 2QQMA 4GULA 1NLRA 1SLBA 4HKOA 4YVSB 4QXCA 4XUNA 5JMCA 2W94A 2EA7A 2QUOA 4Y33A 3DYOA 1UZWA 1EV12 1MS8A 1ZBE2 1HDKA 2WN3A 4HK8A 4ITCA 3MEPA 1IHMA 5JXIA 4AVVA 4CTEA 5DAPA 1H2MA 3LDRA 4QDRA 2EXKA 1LESA 4YVWA 4FFHA 2BUKA 3TB0A 2G19A 2MEV2 4NIGA 1NXD1 3VLBB 2WO2A 1R092 1H8VA 2E9QA 1ZZCA 3TRSB 3VHPA 5FDBA 3HT1A 3MUY1 2DU1A 3PMSA 4HONA 4Y5SA 4TXWA 3J8F2 1F35A 3SHRA 3HOBA 4FPOB 4Q4W3 1REFA 2LTNA 5A7PA 5FPLA 4LBJA 1OBNA 1UOBA 1H1MA 3WW1A 1O3RA 2W1QA 1H9WA 3A0NA 2WZR3 3MW3A 1MVEA 5A3PA 3IPVB 2QDRA 2FMDA 1FOD1 4WM7B 5A6YA 1QH6A 4FPYA 1RUF1 1UU5A 2D6PA 2JDPA 3K2OA 4MGZE 3ABZA 1FNYA 3OF1A 4MZUA 5BXXA 1X50A 3B93A 4Y1VA 3H7YA 3ZFGB 2XHNA 1HRV1 1C8NA 2QZ3A 3DGTA 1UNBA 1UY3A 2JE8A 3MIEA 4NR1A 4RR3C 5H9SA 5HPOA 1RUI1 3N35A 3UKNA 1AJKA 4XZUG 2VJXA 1XU1A 4LKSA 2Y38A 1ODNA 1OFSA 4PHZA 3T0AA 5A7OA 3WQ0A 3UJOA 3ZDVA 2XUEA 4I3GA 3NV1A 1V6JA 3TOJA 3ES1A 4O65A 3VV1A 3WX5A 2WQ4A 4BHPA 4CDQC 2WFF2 4LIVA 1LAJA 1XU2A 1WLDA 5FAXA 3K51A 2ET7A 2VY0A 3VZOA 1NT0A 4YM3A 3OTFA 2CGPA 2YPDA 4ZS3A 1QF3A 3ETQA 4BQXA 1POV1 2Z2SB 3D6EA 3NKGA 1CAVB 1G9DA 4NHYA 4LKDA 3A21A 1ND3B 1QJY1 3H1MA 2Q4SA 1ND2C 3WT3A 4MXWA 5GALA 2DVFA 4COZA 3WUDA 3I2DA 1N3OA 4A45A 3H1YA 1SFYA 1AX1A 2C6SA 5JSRA 3ACHA 5C33A 1GLHA 1JYCA 4XF9A 3ATGA 4FXKB 5D8AC 3WY6A 2GH2A 3ZR5A 5EHDA 2OIIA 3PNAA 4FPHA 4AI3A 2RJ2A 1NCRC 2GNMA 4XDPA 4YFWA 2VZQA 4XAAA 1HKDA 1RUC1 1SBFA 1ZBA2 3BIEA 1NLSA 5FUNA 4UI9L 4W6WA 5KXDA 3RDIA 2R042 1OF3A 2B7YA 1POQA 1MZ5A 2Y6HA 1YQ5A 1VBB2 1EYBA 4AEMA 2YXSA 3ZPOA 4P14A 3KHBA 4FP3A 4PI2A 4S2DA 4UFMA 4AHWA 1LOFC 2C9AA 5FIXA 2E53A 2GMMA 4PLOA 4CPBA 1PO13 5CKNA 2NN8A 2BU9A 2BZDA 4LOSA 5CVRA 5C3QA 2TBVA 3SCGA 1RUH1 4GWNA 5FLHA 1E5IA 4CCEA 1FPN2 1IPJA 4FPLA 1CD3G 3MI8A 1G9FA 4IEPA 4LBLA 3E5XA 5ABJB 3NAPA 3D8CA 1WW7A 3VBRC 2GN7A 4XVHA 1L3JA 2G4IA 2ZGMA 1PX3A 1IS3A 1ULCA 5AFEA 4JGZA 2A6VA 4CDXA 3RFRA 3LB9A 1UOJA 3M3CA 4HT1T 5LRRA 1DZQA 1W04A 3MLJA 1R1A3 4LXLA 3THPA 5A33A 1DQ4A 2A7AA 2J1TA 4CRQA 4NE9A 4CXYA 4NVPA 1HXS2 3ZXAC 5LRSA 1ACCA 5BNOC 4W6YA 1TQ5A 3RZHA 1HQWA 4ET7A 4ZKTB 5BNPB 1VRH2 4MUVA 5T55A 1C5HA 1DP0A 5FZFA 1AYN2 3LDBA 1W8NA 4TN7A 1HN1A 1AYM3 1Y9GA 1OQ1A 1X33A 5GLUA 1V00A 1DF0A 5KXCA 1MS1A 1EV11 1CPNA 2AUYA 5K0UB 4PLMA 1N1VA 2RDQA 1C1LA 2VZ3A 4F8AA 3RYKA 3ZXEA 2YC0A 5EYYA 1F5FA 3GDBA 2PAKA 1D0HA 3UGGA 2ZA9A 2XJRA 5EQUA 4PF1A 4W6XA 4CP9A 1QOTA 1S0IA 3BTZA 1REDA 3ILNA 3KV9A 3DEMA 2GNTA 2DBIA 4ATEA 2A6WA 1KDKA 2Y6KA 2JDHA 3O1VA 4FPCA 1AL22 2RM22 4CCOA 1LODA 5EFUA 3POGA 4UFJA 2C24A 4H14A 5E8AA 3HN3A 4XHXA 3WP5A 5GZDA 2HWD3 1W9YA 2QQNA 5IYYA 3P3NA 4X6QB 5FMBA 4J1WA 3S57A 4CCJA 4FAHA 2WINB 3KLSA 3A23A 3PDQA 1J58A 5FBJA 4JX0A 3BB6A 1HRI1 2BFUS 4YM1A 5T5LA 1S0BA 3PVOA 1LGBA 1R64A 3WW4A 2PLV2 1QJX3 1GQPA 2ZX0A 4KNCA 4DEQA 1DU3D 4IEWA 1XRUA 1GFF2 3DKQA 3P6BA 2ENRA 5C8WA 1TME1 2D40A 5IATA 3ZOIA 3WNLA 5DPNA 2OVUA 1JS9A 4RA0A 5DMYA 3EBRA 4HVRA 3IZOA 2ZS6B 2ZX2A 4IE0A 1WCQA 1UMHA 4HN1A 1W6NB 1MR5A 2E32A 4EROA 3IMNA 3THDA 4OMDA 2JIGA 1QJEA 1UY2A 1WWYA 1BEV1 2FMYA 2VMFA 3R4UA 5SV5A 4BISA 3VBFB 5LZ6A 3VDBA 5ISLA 2PN5A 1O8PA 2XLFA 5FJKA 2OZ6A 1NA1C 2WABA 3OEAA 2NMNA 4CDXC 5LW9A 3FHAA 1EAH3 4NRPA 1ENRA 4XF3A 1UIJA 4B3NA 4QU1A 5LB6A 3LFMA 3KT7A 2X10A 1VBA2 4FPJA 4GA9A 4QX0A 1RUOA 4GJZA 4NPRA 3HVDA 2YUEA 3VL8A 4Z8BA 2ZGNA 2GSYA 2O1QA 3S7EA 1D4VB 2EVXA 3FUQA 3MFCA 4ATFA 4QX8A 2ZHMA 2VNRA 1Y43B 5DUUA 3K3OA 4AG4A 2OQ6A 4HETA 3FN9A 4K3UA 3KD4A 1NE4A 3I2OA 4DRVA 5FXXA 4O9GA 5ANQA 1FMD3 3WDTA 4LORA 2JICA 2BEOA 3OPTA 3N9PA 3UYJA 5BNNC 2XMLA 1KGYA 3IB3A 2ORZA 3IIIA 3OGVA 3VZMA 1N3QA 1X9TA 5D2AA 5FPXA 4QQPA 3WDXA 2ZEXA 4FPKA 1AL0G 1H2LA 3CJIA 4M3CF 4C1XA 4FI9A 2W3JA 3HNYM 1MS9A 3I59A 1KS4A 4XJWA 4AVCA 4ZXKA 4CCDA 3OUIA 4QXHA 2R1DA 5DAWA 1ZBA1 4YZ4A 4QXKA 5B2GB 2RS12 4WVWA 3ZKUA 1IS6A 1YC61 1K45A 1Z7S3 2DU0A 2CU5A 4HKWA 4IL7A 4ZONA 5FK8A 3RS6A 4AE2A 2ET1A 4P9LA 2E63A 3ZFFC 5BPXA 2BWAA 5L73A 2D98A 4CU8A 5F8PA 1GKBA 2ZX4A 3AFKA 1Q8OA 2WO1A 5FZ7A 4W50A 3AP7A 3WR0A 5FOBB 3A7QA 1UPSA 3C7HA 3IDAA 3OY8A 1AJOA 1VBB1 3ZDSA 4AVTA 1V9U2 3I2GA 2JDUA 4MHRA 5L9VA 2FZ2A 3IMMA 1OF4A 4URTA 5GJ6A 4AFBA 4AEDC 3IT8A 2BNMA 1ULDA 1YCIA 1XNDA 1Y4WA 3PU8A 4BA6A 1TMF2 4ONUA 1ASJ1 3UKVA 2RE9A 4AQTA 1HX6A 1FPN1 2OQ7A 4RHV2 4OQ8A 1VBD3 4N9HA 2BYVE 4P9JA 4RR3B 5C6CA 1QY4A 1YQ2A 2VU9A 5A7WA 2P34A 4DS0A 3M1HA 4Q4X3 2ZOEB 1ZRDA 1SLCA 4YW4A 3MBWA 4A7KA 1RUJ2 1FX5A 2XL7A 1GWKA 2IWGB 3ZYJB 3FBMA 4Q4Y1 1W3XA 4HANA 4RFRB 2ZCWA 2XKOA 1A34A 2D6KA 3H9AA 2FHRA 4RGGA 4Q1PA 3HEIA 2Y0OA 3NQHA 5JPNB 3IIAA 4CDWC 1HXS1 1UKRA 5BUVA 1AR93 2HH9A 1C8M3 3NNJA 3NWKA 4LHSA 1RUNA 1DYPA 5LEJA 4LO4B 3PMEA 5EYXA 4IGOA 4MG2A 4CDUC 3O1RA 4XQ4A 2W1WA 4TSVA 3K4ZA 4WVZA 5KC5A 4CU7A 5IVYA 4NIIA 4S2GA 3ROUA 3VBUC 5K0UC 3JUUA 1OHFA 1OOPA 3I8TA 4GALA 3POBA 3WDVA 1W8OA 2ZGOA 3MIGA 3K46A 1KS5A 3PTYA 2JEMA 2EALA 5DZEA 1EP0A 1LJ7A 1NY72 5GZGA 3LZZA 2VECA 2PHRA 2ZGQA 3HPNA 1Q5OA 5G05L 4BLIA 4QM9A 3CJXA 1BBT3 3M4FA 4K8RB 5D8AB 3RWNA 4YWAA 2DVBA 4Z2AA 4XF4A 3TEWA 4LBQB 2WKKA 3EXUA 4PIZA 4XQWA 1NCRB 1F15A 2CGNA 1R082 4LPLA 2WSUA 3LAGA 4YRDA 4OULA 5APAA 3ILFA 1AL21 2FQPA 2CDOA 4LBOA 1NQJA 1U12A 1SDDB 4BXFA 4DMIA 2Y6LA 3LOIA 1LHNA 1IS5A 4DXSA 1GYKA 4AGGA 1WW6A 1FI2A 2DFBA 1GNZA 1V70A 2W39A 3N9OA 5KHHA 4ASKA 4XFFA 5T5PA 2WWSA 1XE7A 1CAVA 1AXYA 2A70A 5ACA2 2XH6A 4QGNA 1ND3A 3BCWA 4ASMB 5I93A 4ZHNA 3NV3A 2D5HA 3OUJA 4ISRA 4Q2FA 3KVAA 4LKFA 2PLV1 4AK3A 1JN2P 2G9GA 1H2NA 3Q9OA 3DV8A 1WMFA 2VQ0A 1RMU2 1WCDJ 4GB33 1YFXA 1Z0HA 3N9LA 3VHOA 3W59A 1JOBA 1RINA 3AYCA 4HKLA 4Y20B 3RNSA 2JECA 2QFEA 3ZYPA 5A3LA 2ATFA 2Y6GA 5FZ8A 3VBRB 4LUKA 5FYYA 4YSFA 2JE9A 1JOJA 4C1WA 1RVF1 1NCQB 5DDJ3 2R063 5JZGA 3VBHA 4Y22B 5LEKA 2VXRA 2VZTA 3BALA 1YNAA 3DKWA 4NN0A 5FQ0B 4DEVA 3UNPA 2RHPA 1JYVA 1S2BA 1GZ9A 2OT7A 4PDWC 5FKBA 2C9KA 4LITA 1LU1A 4L9BA 3JCIA 1SG3A 4W65A 3VB9A 4D6RA 1VBA1 5BNOB 4B4QA 2QQIA 4K40A 3S6PA 5L7OB 4P02B 2VOXA 2ARCA 5FZBA 1RUE3 4MHUA 2VNVA 1LOAA 3H42B 4OI2A 2XBO3 2YBKA 3FFQA 3M7AA 5CZKA 4AFCA 3WCRA 4AI1A 2Y33A 5FYZA 1NQDA 1OOPC 3JD73 4A3XA 3UV9A 4N43C 5I0TA 2RMU3 1U0AA 2WS91 5EPAA 1PIV3 2K2SA 4Y1UA 4D6SA 5JIUA 3DYPA 1AR73 2QQPA 4BMEA 4CU6A 2VBDA 4OUSA 2R071 4Q4W2 1Y9QA 2J1RA 2Y34A 3A0KA 4JGYB 2RR11 4XZPA 4D94A 5LCWL 5IK5A 2VOTA 2RS11 2WZR2 3OSDA 2ARXA 5I8SA 3AVRA 1PNFA 1O91A 2WFPA 1F31A 2XG3A 1GV9A 2ZTNA 1QJFA 5L9RA 2QQKA 1FV2A 4Y5TA 5FP7A 4D7TA 1ZA4A 1JZ3A 1K12A 2HEVF 1X8EA 1W2OA 1YJLA 5C71A 4BCUA 1YRZA 3GGLA 2HWE3 1V9U1 1DIWA 2YYOA 4HPKA 4QQLA 3QD6A 4GAZA 2GC1A 2V4VA 4MH0E 4LO8A 4Z07A 5IVEA 2WNUC 1JU4A 4A41A 2A73B 2WAAA 4JHTA 4XJ8A 4M00A 4NUBA 4I3PA 4XXPA 1V6IA 1OFNA 4IE6A 1TMF1 3SCFA 3CMGA 4ARXA 4XETA 1JZ6A 2QCSB 1YEWA 1SLTA 4JKLA 4MOAA 1COV2 4RHV1 5CU1A 5IAXA 3I2KA 4E2SA 3V0BB 4M4PA 1V6MA 2J7MA 3IWZA 3BVCA 3QLQA 3E5QA 4XCBA 3H7JA 1U5ZA 5CB7A 5CG8A 4AHZA 3GZUC 3VDDA 1RUJ1 4RS5A 3RVHA 1BQPA 2PTMA 2VE1A 3R4SA 5FY9A 4HLTA 4LUMA 1DYOA 1QOSA 5JZGC 2YHJA 1OD3A 2DCTA 1UX7A 5FMOS 3ZSLA 4B7EA 5C3OA 5HI0A 2WL1A 2K46A 1JH5A 3VHNA 3POJA 3C7OA 3FHIB 1F4AA 1UU4A 1VJ2A 1SBDA 4GIQA 4N7UA 1N1SA 1OMIA 3B69A 4CCCA 1C5IA 3AB0A 5A32B 3OD4A 2X5IA 5GZEA 2MPFA 1GUIA 1HW5A 4N53C 2AEYA 3HR9A 1B35C 3WP4A 2GP3A 1NY71 3CDZB 4GWJA 4X6RB 2A3YA 2PHFA 3VKFC 1X82A 2IXJA 4L11A 4NOTA 5BNNB 5CYYA 3UT0A 3ACFA 2XVKA 3N9MA 1CESA 1MPXA 3R05A 5K7PA 5C5TA 4LHNA 2P37A 2WQ8A 1AR81 2E6VA 1KD7A 2VNGA 4XEZA 4B7KA 1R081 2WAOA 1W8WA 1CN1A 2SLIA 4OI0A 2LM3A 4QPIC 3GM8A 3H8RA 1JHNA 4ISQA 2IZWA 3O12A 5E89A 1ZRCA 3KZ4C 2R30A 3U0ZA 1DG6A 1WBLA 4U2AA 3WNOA 1UZYA 1H2KA 3AYDA 4HN0A 5I91A 4S2HA 4GMP1 4XUOA 3ZIXA 4YG3A 3SC7X 3VUOA 1GOHA 2YY1A 3MGUA 5CKQA 1RXGA 4JDOA 2WIIB 5IJRA 3NV4A 4FO9A 3RMYA 3VDAA 5CKMA 3ZFEC 4D7YA 3WHTA 2OXBA 4LMFA 4Q4V3 3WF2A 4AEDB 4DNYA 3K77A 2VZRA 5FRAA 4LTAA 1PVXA 2EICA 2TUNA 1K5MA 4RQPA 3MFAA 4XIOA 5FZ3A 1QU0A 1RMU1 1S1AA 1UY4A 1K3IA 3DPRC 4FCAA 3HD8B 3O1UA 1SFPA 2BTVC 3LSEA 4UFLA 2RVAA 3VD3A 1BZWA 3X29B 4KWKA 1AR61 1XNTA 3ZN6B 2A1XA 4B1MA 5A3TA 5FO8B 5FMCA 2ZABA 4M0HA 4FOWA 2BPA2 5KC6A 5LBCA 2ILMA 5HCBA 3B02A 1YYNA 1DZRA 3I2JA 2ZZQA 4CP1A 4KU8A 1W0NA 2QDNA 4PCRA 4UW3A 4IV1C 2UYBA 2R1BA 4QX3A 4XQDA 4CDWB 4KI5M 4Q0PA 3T2PA 1GP4A 3ZSMA 1AYM2 4R52A 2W08A 4XABA 1GICA 2YBSA 2PFWA 3I2HA 3U78A 4DOUA 4FTEA 3THTA 1OVPA 4KG0A 4AQ6A 3OYWA 3POEA 4CDUB 2VZPA 3I3DA 3POYA 4N9IA 3WSOA 3ZLIA 4AOCA 1VPHA 1RITA 1JMUB 4PBOA 1ZZ8A 1UMZA 1DGWA 4L8QA 4L92A 4D8MA 1NZIA 4N8MA 2GH8A 1H1AA 2ZGSA 4E4DX 2WYFA 3I3MA 2JE7A 3C7EA 5LASA 5CFDC 3ORJA 4WBBA 5EZWA 5C8CA 2CL2A 1RHI3 3L2YA 3ITQA 4GQ7A 5IT6A 4DY3A 5EV7A 2XWJB 3B5LB 3W9AA 1MQTA 5HV0A 3WDYA 1GANA 1XE0A 1RUD3 4EN9B 3K4DA 3QH6A 1WA4A 2RG4A 1J83A 1W6OA 1C3HA 3MIFA 4E27A 1NUKA 4A3ZA 2V5DA 5IWFA 4Q0SA 2HWD2 2YGMA 2EXIA 1I5ZA 2VG9A 3GCXA 5FP8A 2G9FA 4MLOA 5B4XA 4AVSA 3VBOC 1TG7A 1KJRA 2PHXA 3RI8A 4BE3A 4WM8A 4TYSA 4BWOA 3FUOA 2BNNA 2LALA 3I2IA 3ZN4A 5D21A 5JOZA 3V0AB 1QJX2 1HB2A 4IV3C 2P17A 3SEEA 4GZ9A 3T1MA 2JDNA 2XJPA 4E9KA 3CKHA 3WNNA 4B4PA 5DG1A 1PMJX 1WMXA 3AKQA 1UY1A 1UU6A 3ZXJA 5J36A 3ASIA 1OC1A 5F5AA 2O0OA 4NHLA 4EWEA 2BV4A 2DTWA 3O7OA 4GH4A 5DUWA 3BPZA 4NAOA 2DVAA 1YFYA 4TLFA 1COV1 1O5UA 4BQ5A 1G9CA 4FT8A 4XACA 4LBQA 5LA2A 1CJPA 4A7ZA 4CCMA 4F83A 4XFCA 5AC93 4EJRA 1SMVA 1EAH2 2IXIA 2P3IA 1MZEA 4MGKE 1S2KA 2ZPXA 1ZRRA 5EP9A 3MV01 2HWB1 1GMMA 4QGMA 4KQ7A 2RJKA 4AVBA 2JDYA 2D3RA 2ADDA 3I49A 3WXPA 3A22A 2CYFA 2ZACA 3FX3A 5ERLA 4DXTA 3LOBA 1VBC1 2IVIB 1W8UA 5FR3A 4M3CA 2LUWA 3AMMA 2C0ZA 2VUAA 4Q8KA 4Z1VA 3I3BA 2BOJA 3H8XA 4R9BA 3NNMA 4CEYB 5FZIA 4J1XA 2VW1A 1GZCA 3WQ7A 2W92A 1TEIA 1GQHA 5E6HA 4YGCA 1FV3A 2P3KA 5FXWA 5FLJA 4LO5B 3KF3A 2HBUA 1A6CA 2BBVA 3CEWA 3O0XA 1B09A 2VVFA 1JYTA 2RDSA 2WRAA 1ULFA 3DN7A 4N43B 3BIWE 3T2OA 3HQRA 2O8OA 5AFBA 1N3PA 2P3JA 1SDWA 3K75B 1YLLA 3HJRA 3OPZA 4XUPA 3SH5A 4WV8A 4GXLA 4L0PA 2A71A 5EJ1B 4QDQA 1Z7S2 2ZHLA 1MQTC 4E8CA 1ST8A 1ENSA 4BM8A 2A6ZA 3SKVA 1U5IA 1VBE3 2GU9A 3S5QA 4K1YA 1UZZA 4LULA 1LOEA 1SBEA 2FZ1A 3SEPA 1OQDA 5FQ0A 3LQCA 4RGAA 4LOTA 3DXTA 3GHNA 5CFCA 3K4AA 1YIFA 1ONAA 2DYCA 4AZZA 3W21A 4BMBA 3LIGA 5GZCA 4HSJA 5FYMA 3PURA 3WG3A 3M3QA 2VMHA 2RS31 4PIYA 4FOYA 1FOD3 5FPVA 4XMAA 4YW3A 5LY1A 1YUDA 3ZYRA 2XJSA 1CZVA 5FYTA 3U07A 1WW5A 4R8HA 4P9WA 4RYDA 1E5SA 1BKZA 1VBD2 1PO21 1KXGA 1RUG1 1DLCA 3I3QA 4YVWC 2HWF3 5A3WA 4B1LA 1LHOA 2JG9A 3ZXGA 4GWIA 1CX1A 1V6NA 5A1LA 1O59A 4IDZA 5FOJB 1RUI3 1ZYBA 2WSVA 4PI0A 1JHJA 1XNBA 2VCAA 3NO8A 3ETPA 4KGQA 5C4WA 2EXJA 4XFIA 2GAUA 3M2MA 2V09A 2UWAA 3B9IA 2A3WA 5EWSA 4QKNA 1AR92 1FATA 1C8M2 3AYEA 3OEBA 5KWRA 1O8SA 4JAAA 3BI3A 4QGLA 5D1IA 3TN93 4MGQA 4V2VA 5FFOC 4CUAA 4HVQA 4XFAA 2VZVA 5KBFA 1LEDA 2Y0IA 1ZRFA 3AKSA 1PM4A 4OYUA 5I8TA 5AVPA 4EWDA 1R1ZA 3VBSA 1NZCA 3PTRB 3PHMA 5TSWA 5IHRA 1W6QB 2YMZA 2Q1MA 4JDMA 4AGVA 2AR6A 5KHKA 1Q3EA 1J59A 4N53B 4IEQA 2A5ZA 2YV8A 2JENA 3LPGA 2D43A 1BBT2 1OVSA 1IQDC 2NPIA 1O6UA 5FPUA 4LKEA 1D4M3 1QEXA 4EN6B 1S2EA 5FZDA 3AZYA 3V0BA 1UOGA 4NMIA 5FY1A 3H8OA 4XYXA 5IVJA 2ZGPA 4F7ZA 4WZFA 2WNVB 1MEC3 4G4FA 3POSA 2VZSA 1EPWA 2HWD1 2PHWA 4I0BA 2XPJA 1GNHA 3RG0A 2KXLA 1W6PB 3BGAA 3ZKYA 3W5NA 2ZKLA 3D0JA 3CNAA 2WUHA 1ULGA 5FY8A 3W20A 1J3PA 2W1UA 3APBA 3HIFA 1CAUB 1OLRA 2HYKA 1HB4A 2JKBA 3KMHA 1ZBE1 2XL9A 2YU2A 4UW5A 1RJ7A 5CFCC 3J7NA 1SLAA 5ANNA 3GZEA 2XQRA 4DIQA 1JI6A 1Y9MA 4CP2A 2ZGLA 4COYA 1G9BA 3WUCA 4GB32 2MEV1 1QIQA 2DVDA 2P4EA 1W8HA 2D6LX 3CBNA 3WG2A 3ZFEB 4OHXA 2E7TA 1R091 5F39A 4CP0A 2I2SA 1PNGA 1FNZA 1RUH3 4IEZA 1ZM1A 4W4ZA 4FQZA 5FYIA 3DPRB 5DDJ2 3J8F1 3LEMA 2R062 3LWCA 2JG8A 1XNAA 1XPWA 3OCPA 3WV6A 3GJAA 2P1BA 2BRTA 5JXGA 1MS3A 4GWMA 2JG9C 3HNMA 5IVBA 3LGRA 2VPVA 3PUHA 1UXZA 5C9AB 2VZOA 3BOPA 1UL9A 2P6CA 3WLUA 5C4WC 2RS53 3E97A 3NNFA 5FZCA 1OKOA 1VB4A 5KXBA 2TEPA 4M3CE 1H30A 2FDJA 1PK6B 1US3A 4IV1B 4WVMB 3E6BA 4RD7A 4HBNA 4BH9A 4CEWB 3WDUA 4BQ2A 3BKZA 3MW4A 2F17A 4YW7A 1RUE2 2JKXA 3IDBB 5F3GA 2IUWA 4FBFA 1BVVA 2XBO2 3AVSA 3TEYA 3RRDA 4QPGA 4P9XA 2WZ8A 3ZYGA 1YWKA 4N90A 4IW3A 1HQLA 1YXWA 3JD72 4PIXA 4LLFA 1PM7A 4LE4A 3RPQA 3LSDA 5BV6A 2RMU2 4NIAA 1JW6A 5I0DA 2NYYA 3NAPC 3QH7A 3VBSC 2G9ZA 2GMEA 4X8PA 2X09A 1RL3A 3JBG3 1OA3A 2HJIA 3D4KA 1UMIA 4QB2A 5B4NA 1PIV2 2WFF1 4JGZC 2ZGUA 4N7IA 3BUCA 1AR72 4JHZA 2VQUA 5C3RA 3BYWA 1GWLA 4CUCA 3PIJA 1W99A 1W39A 5A3NA 3MW2A 4URAA 2BOIA 3NW4A 4YW1A 1AXKA 2J42A 5LA1A 2DV9A 1XNCA 2NZ9A 1S4CA 2PAMA 3ZYFA 1PVC3 1CJDA 1UYXA 1XQNA 3SQOA 1RIRA 4AI8A 5J7MA 4IEOA 1GZWB 4OHWA 1KFUL 4SBVA 1MS4A 3O1SA 2AEZA 4UW6A 1URXA 4J25A 3PVNA 4BU2A 4UOJA 1CAWA 1AX2A 2Q0AA 4AFAA 1AVBA 2WLQA 2HWE2 1JXNA 1H8TA 3B3QE 5A1FA 3I97A 3B9CA 1O4YA 2PHUA 2YFZA 4COUA 1IGOA 3VHRA 1JZ2A 4JV4A 1HRI3 1W9FA 4LLOA 3JB4C 1NXMA 3WZ1A 5FO7B 3OBTA 2B42B 4CXWA 1IPSA 2I45A 1FYUA 2J1VA 4QQOA 3UGFA 1QJU2 3R6SA 4LO7A 4R4XA 3N9QA 5F5CA 3ACIA 1TME3 3BOWA 4D3WA 2ETEA 1LOBA 4JVAA 3KGZA 1L7QA 1BHGA 5FWEA 5JVVA 2CNAA 1W03A 1OLMA 1V6OA 2HBTA 1Q43A 2R041 4CYDA 1CX4A 1DFQA 2P3YA 5JAXA 5CG9A 4AGRA 1BEV3 2JG8C 1JZ8A 1VLNA 1WGPA 1UPIA 3NJVA 4H2AA 5HV4A 4A4AA 1C8M1 3FC0A 3Q8BA 4EV0A 3WDWA 2IFWA 2WO3A 4YVSA 3N4MA 4XJZA 2D6MA 2BWCA 2X05A 1PX4A 2BQPA 3G7DA 1CQ9A 1S0GA 2NMOA 3VZKA 2W0XA 2UY9A 1AF9A 4MADA 2IXKA 4L99A 4AVAA 4GJYA 1LOCA 2VTFA 1BCXA 3T2QA 3LA3A 1SPPB 2I74A 5L36A 2PA7A 2VUJA 1E57A 2QE3A 3ZXLA 3OBRA 2BNOA 5FYHA 1PGL2 3R0RA 4WZCA 1GSLA 4PBPA 5LA9A 1A8MA 3WF0A 4F3JA 5A6QA 1XC6A 4CDQB 4NPMA 2PHTA 2D6NA 3ZSKA 2BFUL 3ZIWA 3UKTA 1SFNA 4C91A 3IDEA 3VKOA 3UJQA 1LR5A 1W9WA 1YQ6A 3EJKA 3EYPA 5DN2A 3KCYA 4XILA 4JZRA 3IPVA 5FZOB 4ES9A 2JDMA 1VRH1 2QQVA 3S7IA 2E26A 4WM7A 3T4VA 1ZBA3 4AYUA 1AYN1 2QZ2A 5BYNA 1H6XA 2K0GA 2YDEA 3O0VA 5C5UA 3T0DA 5FCCA 1G6NA 1ND2B 3UETA 3IAQA 4CU9A 1NKGA 3N7KA 3ZFGA 3AL6A 1LNSA 5L9BA 1YI9A 3VD7A 3WP6A 5KHIA 4KBZA 5FZKA 2TNFA 1LGNA 4Q4V2 2ZX1A 5FYUA 2IFRA 2ZBJA 3POIA 3P5BA 4I02A 4IEYA 3N36A 3VD9A 3AXEA 1DQ0A 4D7SA 4B4RA 4YARA 4FTSA 5JR2A 4YVWB 2XLGA 1IS4A 3EO6A 1ASJ3 2RM21 4AFDA 1FPN3 3QOPA 3CJIC 3WCSA 2CAUA 5DDJ1 4OUMA 3E6DA 4XE9A 4OHZA 5CAZA 2OX0A 1GZTA 5A70A 3RSJA 2EF6A 1W8ZA 3T3YA 3ZYIB 1HV0A 2VC9A 3ZMNA 5GLVA 3MZHA 4TLGA 1QNYA 1ULOA 3AK0A 2WWUA 4H55A 3CL1A 3KVBA 4Q4Y3 2R7EB 2WT1A 3JB8A 5F32A 4O61A 4NWVA 4ES8A 3NMBA 2ZGKA 1WUVA 4EYUA 2V73A 4EE2A 3AKPA 3OBZA 4IGPA 2CDPA 2OS2A 3CF6E 3WNMA 4D6QA 3RYPA 4HMZA 3MF9A 2IXHA 3FE5A 4P5HA 2XR4A 2XBO1 2OYZA 4FFIA 3WF1A 5JOXA 5C70A 3ZVXA 2VMGA 2ZEZA 5IFTA 3GXUA 4HOOA 3KT1A 1RHI2 1DQ5A 2K9ZA 3JD71 3ON7A 4LT5A 3LA2A 1J3RA 3WW2A 2YZ4A 4ZY9A 4LBNA 1ZRIA 4R9CA 3ZPYA 5LBFA 2GNBA 1RUD2 4FFFA 2QJVA 5FZMA 4BQYA 2PHDA 4L2NA 1MZFA 4CXXA 5CIRA 4JKMA 4XHBA 4H7MA 4DY5A 1WA6X 2XHKA 5IFPA 1WLCA 5A7NA 2XKPA 4XIKA 3KV4A 1Z78A 5FZLA 1OA4A 3AMHA 4AI2A 3VZNA 3WHUA 5I0SA 1AL23 1DBNA 1GU3A 1WMEA 3O14A 2Z42A 2XONA 1QQP3 3T30A 5KHGA 1CPMA 3FFZA 2V4AA 2NM1A 1CIWA 3AKTA 1VAMA 1MS0A 3PVBB 4D0QA 4KL1A 1W05A 3C7GA 4S2FA 3U37A 1BXHA 2BJSA 4V1PA 3AX4A 4MXWB 2WR9A 3BN6A 2AREA 1TNRA 2Z79A 1W90A 5ABJA 2X29A 3ZFGC 3D0SA 1T2XA 2OUHA 2GMPA 3NKTA 1S0FA 3UESA 4NROA 3AJZA 4OMCA 5LATA 3ZN5A 4BZ4A 4Q0UA 3PU3A 2ZAHA 1QJU1 1OLME 3GYDA 5AC92 2BGCA 2AENA 4IEXA 5CNAA 2DCZA 1LECA 1VE0A 4LBQD 4AL9A 1DHKB 3OGRA 1J84A 4UFKA 1RVF3 1YHFA 2WNVA 5BNPA 5J98B 2P5BA 2GP5A 2EIEA 5F2SA 1MVQA 5DZGA 2VH9A 1UZVA 3UGHA 4K6BA 2BW8A 4Q29A 2CWSA 5CADA 2Y8KA 4XDOA 3RZGA 5F2WA 5LK7B 1ND3C 3HBKA 1VBA3 3D82A 4FP2A 3EQEA 2FBEA 4LO6B 3RZMA 1POV0 1IQAA 4BK5A 3MYXA 4XAEA 4NJ4A 4Y4RA 2G1MA 3L2HA 5FKCA 1QNWA 3POFA 2DCYA 3TEZA 3D3AA 3F95A 3EB7A 3ST7A 4MGSA 4JRAA 2DVGA 1VMJA 1PGL1 4P5YA 2ZKNA 1AUYA 3AFGA 4DXZA 1BK0A 1NA1B 3USUB 1DGRA 1QHDA 1S0EA 4INDA 4JGZB 4CDXB 1HB3A 4ZZ8A 4UF0B 2HKXA 3U4SA 2DUPA 2JB4A 3VBHC 2WS93 1C28A 1VBE2 2WT0A 2FCTA 4QM8A 4FXGB 3SISA 4CZSA 5EXOA 2R49A 3GNEA 1NE6A 1RYYA 2R073 4NHMA 2JDKA 3SLIA 4HL0A 4AAXA 1ODMA 2RR13 1APNA 2J1SA 4QD2A 1UD1A 5G04L 3I2FA 3RGBA 4P9YA 4NHKA 1PK6A 2VMDA 1FOD2 1ULPA 4CEWA 1PGW2 3ZMOA 3SH4A 3WOGA 3WINE 4XDQA 1G9AA 1QXPA 4Q4V1 1SLIA 1V9U3 2HWF2 4TZDA 1NOVA 2Y6JA 4YZ2A 3O1OA 1W6NA 2VOKA 3AL5A 1WZXA 1TVGA 2JD4A 3OGSA 4BQWA 2XQXA 2R0HA 3S5AA 3MPBA 3WNPA 3VBFA 1YO8A 5H9PA 4AHYA 1VAKA 4MGTA 2IVJA 2PHLA 1TMF3 2R0FA 5T52A 2EAKA 3N9NA 1LRHA 1QOOA 1C4RA 2PXJA 2HEWF 3RWKX 1W3VA 3ZFFB 5F9TA 4QWNA 3PUSA 4IXLA 4YM2A 1D0GA 3RZLA 3PVEA 5FWJA 2H0VA 3TN92 1PO12 1TNFA 4QX7A 1H4HA 3Q8EA 3AZZA 4COVA 5ACA1 3VKLA 4QQ2A 5M0TA 4AXOA 4DUXA 4MYEA 3U75A 4XFHA 2A3XA 3GJBA 5J37A 2J1UA 1Q8VA 1HIXA 4QQHA 5I0RA 2PQQA 5JR7B 1DYKA 1JODA 1FXZA 1JYNA 5FZ4A 1ZNPA 5A3OA 1R1A2 2J1EA 5T5OA 3J7MA 3NVCA 4QB1A 2RDNA 4YGEA 3URFA 1QJZA 3BTAA 1D4M2 1RHI1 1LTEA 1SEFA 2HWC3 3MO4A 2FDHA 1GP5A 1JYIA 4FFGA 2OKXA 1I6XA 5AC91 1H1IA 2OA2A 4W8JA 5FY0A 1XXNA 3GZTB 4R9AA 3T08A 4ZZ5A 4KBBA 2D5FA 2EIBA 3IKWA 2VBBA 1MEC2 1AXZA 4IQPA 3VDDC 5JPMB 4RS5C 1N1TA 2VO5A 5JOYA 3HWJA 4XBLA 4DUVA 2JDAA 1AR83 2FCVA 3M3OA 4YZ3A 1XJAA 4ARYA 4UAPA 1XSRA 1NX9A 4OLLA 1BMV2 1D2SA 3SXWA 3H3ZA 2X53S 5FK7A 1GWMA 2OPKA 2PMWB 3VBUB 1NYWA 1XBFA 2KM2A 2XB6C 3FLRA 3N3HA 2Y64A 5F5IA 1RC6A 3FLPA 2H6CA 1RB8G 4COWA 3CQOA 4GMP3 3O1PA 4YZ1A 2X5IC 5FXVA 5A7SA 3N7MA 1UIKA 3PJQA 5JI7A 5F37A 4RR3A 1ENQA 5LBEA 1W0OA 2A6XA 5DXDA 5JCTA 1RUH2 1XOYA 3NV2A 5A3UA 3T2TA 1VIWB 2VCCA 5GZFA 2F4PA 4KWUA 1HN0A 2XJUA 4HSLA 4JC1A 5HCHA 2E7AA 3OOXA 4Q4W1 3BU0A 1JYWA 3FHQA 4M4RA 1WW4A 2VW2A 4JQTA 4CDQA 3MUZ1 1UX6A 3CJIB 1RJ8A 2WZR1 3OJBA 1DCSA 1YQCA 1H4GA 4LK6A 2R32A 1AR63 3I59B 3M3IA 4XFBA 4ORFA 2EAAA 1BK1A 5F3CA 2RS52 1W8TA 5FPBA 2J22A 1SCRA 2WN2A 3MDPA 2ZHKA 1U5XA 1QMJA 2B8MA 2YROA 3CZUA 3F2ZA 4OUEA 5JSOA 3HMYA 4IERA 3W58A 4BJ0A 4FSJA 5FZ0A 4CUBA 4BXSV 2QKDA 1CIYA 5HCAA 1WCKA 3CIHA 1IOAA 2C26A 4DZGA 5IK4A 5J1XA 2CTVA 1KDMA 5A1AA 1XSQA 4M01A 2GN3A 2R6QA
chains in the Genus database with same CATH topology
3HEIA 3NQHA 1UWWA 5JXJA 2YC4A 2PQSA 4LHSA 1JI6A 1KEXA 1UYYA 2W1WA 4MO3M 3K4ZA 2RV9A 4CU7A 2YC2A 4W4ZA 4P00B 2BBAA 1W8OA 4BDVB 3K46A 1XNAA 1XPWA 2JD9A 2YG0A 4A44A 4LQRA 5JXGA 3HPNA 5G05L 3HNMA 4Z2AA 1P8JA 1CZSA 3PUHA 1UXZA 2QQLA 2VZOA 4CVUA 2EIDA 4LPLA 4IUGA 3VD4A 3C8XA 1K42A 2CDOA 1US3A 1SDDB 2Y6LA 3MV11 2JKXA 4DXSA 2VM9A 2BGPA 1JU3A 3VDCA 2VMCA 2WZ8A 4PQQA 2WBKA 3CZJA 2WZEA 5I0DA 3I3EA 2E31A 4PT6A 2X09A 4QB2A 2W47A 1UMIA 5B4NA 2W9XA 4RN5A 2QBXA 4JHZA 2VQUA 4CUCA 5FUIA 1W99A 4QDSA 5LA1A 5DQ0A 2Y6GA 2ORXA 4A6OA 1UYXA 2QQJA 2VZTA 5JUVA 4UOJA 3ZM8A 3WQBA 4DEVA 3UNPA 2W95A 1UZ0A 3IAPA 1JYVA 2VZUA 2C9KA 3I97A 1SG3A 2YFZA 1JZ2A 2QQIA 2B9VA 3ACGA 2WDBA 4P02B 4XURA 4ZXEA 2YB7A 2J1VA 1PMHX 3LEGA 2L9LA 3ACIA 1I5PA 5CZKA 4A42A 1GOFA 1L7QA 1BHGA 5EIYB 1UY0A 4XUQA 2W1SA 4JKKA 4P08A 3THCA 1JZ8A 2VQTA 1OT5A 3NJVA 3DYPA 4A4AA 4CU6A 2J1RA 2VL4A 2WO3A 2X05A 5LCWL 1PX4A 2VOTA 2J1AA 1UYZA 2B4KA 4QX1A 4TTGA 5C7GA 3DYMA 3HNBM 4MADA 3WF4A 2QQKA 1US2A 1JZ3A 2VTFA 3T2QA 1K12A 3NJXA 1JZ4A 5C71A 3GGLA 2W5FA 2VCBA 2V4VA 2ZEYA 3WF0A 1JU4A 1XC6A 4A41A 2WAAA 2QQMA 4XUNA 2W94A 3CMGA 1W9WA 4ARXA 1JZ6A 3DYOA 3EYPA 5DN2A 4MOAA 4JKLA 2WN3A 3I2KA 5JXIA 4M4PA 1CZTA 2J7MA 4DXRA 4QDRA 2E26A 4DUXA 1H6XA 3T0DA 2WO2A 3UETA 3C7FA 5JMOA 3IAQA 4CU9A 1NKGA 3MUY1 1DYOA 1LNSA 3NNGA 1JZ7A 3VD7A 4TXWA 1OD3A 1UXXX 1UX7A 3HOBA 1SHWB 3SKJE 3C7OA 1F4AA 2W1QA 1EUTA 3VD9A 1OH4A 5JR2A 1GUIA 2LW8A 3ABZA 3LE0A 3NRUA 3CDZB 4GWJA 2XHNA 2YFUA 1GOGA 2VC9A 5CYYA 3ACFA 1UY3A 2E33A 2JE8A 1ULOA 2XOMA 1MPXA 5HPOA 2WQ8A 2KD7A 2R7EB 2VJXA 4LKSA 4XZUG 3T0AA 3FL7A 2WAOA 2DCKA 3GM8A 2Z4FA 2CDPA 2W87A 3WNMA 3WNOA 2V72A 3WF1A 4XUOA 5C70A 5IFTA 2ZEZA 3GXUA 3AC0A 1GOHA 4QB6A 2BERA 3VD5A 4ZY9A 5IJRA 3A21A 3VDAA 3WF2A 3K77A 2VZRA 1JZ5A 2EICA 4JKMA 1UY4A 1K3IA 4A45A 2BGOA 2RVAA 3VD3A 2QQOA 3ACHA 5IFPA 1XNTA 3J7HA 2VR4A 1GU3A 3WEZA 2XONA 2RJ2A 2W91A 3I2JA 4D0QA 2VZQA 1W0NA 3C7GA 3U37A 3E1F1 4QX3A 4HG6B 4DUWA 4KI5M 3T2PA 3BN6A 4UI9L 4QAWA 3I2HA 2C4XA 1T2XA 1OF3A 1W9TA 2Y6HA 2VZPA 3I3DA 3UESA 4OMCA 3WSOA 5EJZB 2ZXQA 4YPJA 4D8MA 5HXMA 4XUTA 3C7EA 2BZDA 3P1IA 3W5MA 3OGRA 1J84A 4QX2A 2EIEA 3K4DA 2WYSA 1J83A 4XVHA 1NUKA 4A3ZA 2V5DA 1PX3A 1W9SA 2Y8KA 5B4XA 1F4HA 1TG7A 3JXSA 2J1TA 3I2IA 4BK5A 3SEEA 1JYXA 1D7PM 4GZ9A 4ET7A 3D3AA 3EB7A 4MGSA 3CKHA 3WNNA 1DP0A 1PMJX 1W8NA 4P5YA 1HN1A 1UY1A 3OG2A 2HYXA 5F7UA 4ZZ8A 2DDUA 2DCJA 1RYYA 5LA2A 5LA0A 3WNKA 2VZ3A 4AAXA 3GDBA 3OBAA 2J1SA 4PF1A 5G04L 1EUUA 2VMEA 3MV01 3I2FA 2VMDA 1ULPA 1GMMA 2Y6KA 3A22A 4DXTA 3HN3A 2QQNA 2Y6JA 5IYYA 1TVGA 3I3BA 3OGSA 3A23A 2XQXA 3WNPA 4JX0A 2W92A 3LEKA 2LS6A 1R64A 1GQPA 4DEQA 3P6BA 3T2OA 3K75B 3WNLA 3HJRA 4XUPA 1NAEA 5DPNA 4L0PA 5DMYA 5EJ1B 4QDQA 1WCQA 4E8CA 1UMHA 2E32A 3THDA 3SKVA 2W46A 5JXHA 1H6YA 4OMDA 2VMFA 1UY2A 3SEPA 3VDBA 2J1UA 3LQCA 1O8PA 3K4AA 2HLEA 2WABA 3OEAA 3T09A 3FHAA 1JYNA 2J1EA 1WKYA 2X10A 4QB1A 1GNYA 4QX0A 4E8DA 3MO4A 1CZVA 2OKXA 2VZ1A 4W8JA 3T08A 4RYDA 4ZZ5A 1DLCA 4AG4A 2EIBA 3FN9A 4KMQA 4GWIA 1CX1A 2VO5A 1O59A 1JHJA 4DUVA 2JDAA 3IB3A 1KGYA 2VCAA 2ORZA 3IIIA 3OGVA 1NX9A 3ETPA 4UAPA 4ARYA 3DECA 3ECQA 2ZEXA 3WF3A 2Y64A 4FI9A 2W3JA 3HNYM 3OEBA 1O8SA 3CQOA 4QPWA 4MGQA 4CUAA 3PUIA 1K45A 2VZVA 3T0BA 4CU8A 4OYUA 2ID4A 2WO1A 4W50A 2VCCA 4BK4A 3A7QA 4KWUA 3C7HA 3IDAA 5IHRA 3I2GA 1JYWA 3FHQA 4M4RA 1OF4A 3MUZ1 3LPGA 1IQDC 4OZOA 3LEIA 2J22A 2ZEWA 2WN2A 3F2ZA 3CZUA 4OUEA 1YQ2A 4BJ0A 3LPFA 2VZSA 4CUBA 1L7RA 4BXSV 3OB8A 3W5NA 3MBWA 3BGAA 1CIYA 2WUHA 3CIHA 2C26A 2W1UA 5J1XA 5A1AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HEI A;  3NQH A;  1UWW A;  5JXJ A;  2YC4 A;  2PQS A;  4LHS A;  1JI6 A;  1KEX A;  1UYY A;  2W1W A;  4MO3 M;  3K4Z A;  2RV9 A;  4CU7 A;  2YC2 A;  4W4Z A;  4P00 B;  2BBA A;  1W8O A;  4BDV B;  3K46 A;  1XNA A;  1XPW A;  2JD9 A;  2YG0 A;  4A44 A;  4LQR A;  5JXG A;  3HPN A;  5G05 L;  3HNM A;  4Z2A A;  1P8J A;  1CZS A;  3PUH A;  1UXZ A;  2QQL A;  2VZO A;  4CVU A;  2EID A;  4LPL A;  4IUG A;  3VD4 A;  3C8X A;  1K42 A;  2CDO A;  1US3 A;  1SDD B;  2Y6L A;  3MV1 1;  2JKX A;  4DXS A;  2VM9 A;  2BGP A;  1JU3 A;  3VDC A;  2VMC A;  2WZ8 A;  4PQQ A;  2WBK A;  3CZJ A;  2WZE A;  5I0D A;  3I3E A;  2E31 A;  4PT6 A;  2X09 A;  4QB2 A;  2W47 A;  1UMI A;  5B4N A;  2W9X A;  4RN5 A;  2QBX A;  4JHZ A;  2VQU A;  4CUC A;  5FUI A;  1W99 A;  4QDS A;  5LA1 A;  5DQ0 A;  2Y6G A;  2ORX A;  4A6O A;  1UYX A;  2QQJ A;  2VZT A;  5JUV A;  4UOJ A;  3ZM8 A;  3WQB A;  4DEV A;  3UNP A;  2W95 A;  1UZ0 A;  3IAP A;  1JYV A;  2VZU A;  2C9K A;  3I97 A;  1SG3 A;  2YFZ A;  1JZ2 A;  2QQI A;  2B9V A;  3ACG A;  2WDB A;  4P02 B;  4XUR A;  4ZXE A;  2YB7 A;  2J1V A;  1PMH X;  3LEG A;  2L9L A;  3ACI A;  1I5P A;  5CZK A;  4A42 A;  1GOF A;  1L7Q A;  1BHG A;  5EIY B;  1UY0 A;  4XUQ A;  2W1S A;  4JKK A;  4P08 A;  3THC A;  1JZ8 A;  2VQT A;  1OT5 A;  3NJV A;  3DYP A;  4A4A A;  4CU6 A;  2J1R A;  2VL4 A;  2WO3 A;  2X05 A;  5LCW L;  1PX4 A;  2VOT A;  2J1A A;  1UYZ A;  2B4K A;  4QX1 A;  4TTG A;  5C7G A;  3DYM A;  3HNB M;  4MAD A;  3WF4 A;  2QQK A;  1US2 A;  1JZ3 A;  2VTF A;  3T2Q A;  1K12 A;  3NJX A;  1JZ4 A;  5C71 A;  3GGL A;  2W5F A;  2VCB A;  2V4V A;  2ZEY A;  3WF0 A;  1JU4 A;  1XC6 A;  4A41 A;  2WAA A;  2QQM A;  4XUN A;  2W94 A;  3CMG A;  1W9W A;  4ARX A;  1JZ6 A;  3DYO A;  3EYP A;  5DN2 A;  4MOA A;  4JKL A;  2WN3 A;  3I2K A;  5JXI A;  4M4P A;  1CZT A;  2J7M A;  4DXR A;  4QDR A;  2E26 A;  4DUX A;  1H6X A;  3T0D A;  2WO2 A;  3UET A;  3C7F A;  5JMO A;  3IAQ A;  4CU9 A;  1NKG A;  3MUY 1;  1DYO A;  1LNS A;  3NNG A;  1JZ7 A;  3VD7 A;  4TXW A;  1OD3 A;  1UXX X;  1UX7 A;  3HOB A;  1SHW B;  3SKJ E;  3C7O A;  1F4A A;  2W1Q A;  1EUT A;  3VD9 A;  1OH4 A;  5JR2 A;  1GUI A;  2LW8 A;  3ABZ A;  3LE0 A;  3NRU A;  3CDZ B;  4GWJ A;  2XHN A;  2YFU A;  1GOG A;  2VC9 A;  5CYY A;  3ACF A;  1UY3 A;  2E33 A;  2JE8 A;  1ULO A;  2XOM A;  1MPX A;  5HPO A;  2WQ8 A;  2KD7 A;  2R7E B;  2VJX A;  4LKS A;  4XZU G;  3T0A A;  3FL7 A;  2WAO A;  2DCK A;  3GM8 A;  2Z4F A;  2CDP A;  2W87 A;  3WNM A;  3WNO A;  2V72 A;  3WF1 A;  4XUO A;  5C70 A;  5IFT A;  2ZEZ A;  3GXU A;  3AC0 A;  1GOH A;  4QB6 A;  2BER A;  3VD5 A;  4ZY9 A;  5IJR A;  3A21 A;  3VDA A;  3WF2 A;  3K77 A;  2VZR A;  1JZ5 A;  2EIC A;  4JKM A;  1UY4 A;  1K3I A;  4A45 A;  2BGO A;  2RVA A;  3VD3 A;  2QQO A;  3ACH A;  5IFP A;  1XNT A;  3J7H A;  2VR4 A;  1GU3 A;  3WEZ A;  2XON A;  2RJ2 A;  2W91 A;  3I2J A;  4D0Q A;  2VZQ A;  1W0N A;  3C7G A;  3U37 A;  3E1F 1;  4QX3 A;  4HG6 B;  4DUW A;  4KI5 M;  3T2P A;  3BN6 A;  4UI9 L;  4QAW A;  3I2H A;  2C4X A;  1T2X A;  1OF3 A;  1W9T A;  2Y6H A;  2VZP A;  3I3D A;  3UES A;  4OMC A;  3WSO A;  5EJZ B;  2ZXQ A;  4YPJ A;  4D8M A;  5HXM A;  4XUT A;  3C7E A;  2BZD A;  3P1I A;  3W5M A;  3OGR A;  1J84 A;  4QX2 A;  2EIE A;  3K4D A;  2WYS A;  1J83 A;  4XVH A;  1NUK A;  4A3Z A;  2V5D A;  1PX3 A;  1W9S A;  2Y8K A;  5B4X A;  1F4H A;  1TG7 A;  3JXS A;  2J1T A;  3I2I A;  4BK5 A;  3SEE A;  1JYX A;  1D7P M;  4GZ9 A;  4ET7 A;  3D3A A;  3EB7 A;  4MGS A;  3CKH A;  3WNN A;  1DP0 A;  1PMJ X;  1W8N A;  4P5Y A;  1HN1 A;  1UY1 A;  3OG2 A;  2HYX A;  5F7U A;  4ZZ8 A;  2DDU A;  2DCJ A;  1RYY A;  5LA2 A;  5LA0 A;  3WNK A;  2VZ3 A;  4AAX A;  3GDB A;  3OBA A;  2J1S A;  4PF1 A;  5G04 L;  1EUU A;  2VME A;  3MV0 1;  3I2F A;  2VMD A;  1ULP A;  1GMM A;  2Y6K A;  3A22 A;  4DXT A;  3HN3 A;  2QQN A;  2Y6J A;  5IYY A;  1TVG A;  3I3B A;  3OGS A;  3A23 A;  2XQX A;  3WNP A;  4JX0 A;  2W92 A;  3LEK A;  2LS6 A;  1R64 A;  1GQP A;  4DEQ A;  3P6B A;  3T2O A;  3K75 B;  3WNL A;  3HJR A;  4XUP A;  1NAE A;  5DPN A;  4L0P A;  5DMY A;  5EJ1 B;  4QDQ A;  1WCQ A;  4E8C A;  1UMH A;  2E32 A;  3THD A;  3SKV A;  2W46 A;  5JXH A;  1H6Y A;  4OMD A;  2VMF A;  1UY2 A;  3SEP A;  3VDB A;  2J1U A;  3LQC A;  1O8P A;  3K4A A;  2HLE A;  2WAB A;  3OEA A;  3T09 A;  3FHA A;  1JYN A;  2J1E A;  1WKY A;  2X10 A;  4QB1 A;  1GNY A;  4QX0 A;  4E8D A;  3MO4 A;  1CZV A;  2OKX A;  2VZ1 A;  4W8J A;  3T08 A;  4RYD A;  4ZZ5 A;  1DLC A;  4AG4 A;  2EIB A;  3FN9 A;  4KMQ A;  4GWI A;  1CX1 A;  2VO5 A;  1O59 A;  1JHJ A;  4DUV A;  2JDA A;  3IB3 A;  1KGY A;  2VCA A;  2ORZ A;  3III A;  3OGV A;  1NX9 A;  3ETP A;  4UAP A;  4ARY A;  3DEC A;  3ECQ A;  2ZEX A;  3WF3 A;  2Y64 A;  4FI9 A;  2W3J A;  3HNY M;  3OEB A;  1O8S A;  3CQO A;  4QPW A;  4MGQ A;  4CUA A;  3PUI A;  1K45 A;  2VZV A;  3T0B A;  4CU8 A;  4OYU A;  2ID4 A;  2WO1 A;  4W50 A;  2VCC A;  4BK4 A;  3A7Q A;  4KWU A;  3C7H A;  3IDA A;  5IHR A;  3I2G A;  1JYW A;  3FHQ A;  4M4R A;  1OF4 A;  3MUZ 1;  3LPG A;  1IQD C;  4OZO A;  3LEI A;  2J22 A;  2ZEW A;  2WN2 A;  3F2Z A;  3CZU A;  4OUE A;  1YQ2 A;  4BJ0 A;  3LPF A;  2VZS A;  4CUB A;  1L7R A;  4BXS V;  3OB8 A;  3W5N A;  3MBW A;  3BGA A;  1CIY A;  2WUH A;  3CIH A;  2C26 A;  2W1U A;  5J1X A;  5A1A A; 
#chains in the Genus database with same CATH topology
 2D97 A;  3I4I A;  2JDZ A;  3DL3 A;  1PZ7 A;  3LIH A;  2P6H A;  1K5M C;  3JBG 2;  4RQP C;  4Y5Z 0;  1KJL A;  2PQS A;  2YC4 A;  4LNV A;  5D8A A;  4E4S A;  3O1T A;  1OI6 A;  1Y3T A;  1PMI A;  3ZXF A;  1KEX A;  2FDG A;  1UYY A;  1EPZ A;  1NCR A;  4G3Y C;  1VB2 A;  2VUC A;  3H3L A;  3MF6 A;  5A7W B;  2OUJ A;  5FZE A;  4XW3 A;  1S0D A;  1G7Y A;  2RDR A;  3Q8A A;  2YC2 A;  1UAI A;  1GQG A;  4NO4 A;  4P00 B;  2BBA A;  4H7L A;  4PDW B;  1PVC 2;  4BDV B;  4M0N A;  1VBE 1;  3NST A;  4Y24 A;  4A44 A;  4E2Q A;  4LQR A;  4QXB A;  4FOV A;  2BVV A;  3KGL A;  1FMD 2;  4CCK A;  1CZS A;  3CHX A;  1A78 A;  1UF2 C;  2AYH A;  3U10 A;  2QQL A;  1LOF A;  5CIS A;  3RMX A;  2EID A;  2VTX J;  3QCW A;  4A2U A;  3JQW A;  3UL2 A;  3VD4 A;  4JTO A;  1HRI 2;  2Z69 A;  3C8X A;  1PGW 1;  4QHB A;  2Q8D A;  3RYR A;  3S0M A;  4MGI E;  4I0A A;  1OOP B;  1YI7 A;  1OLQ A;  4PQ9 A;  4Y20 A;  4OVE A;  1JBC A;  2A75 A;  1WLT A;  1OQE A;  3M8L A;  2VM9 A;  5E88 A;  4AEK A;  2HWF 1;  3CO2 A;  1Q8Q A;  3KWV A;  1TME 2;  3VBR A;  3ZSJ A;  5C8C C;  5H9R A;  1DQ2 A;  3VDC A;  1NCQ A;  1N1Y A;  2VMC A;  1DDL A;  2WBK A;  1ZVF A;  4Y22 A;  3CZJ A;  3J9S A;  4E4Z A;  4BIF A;  2WZE A;  2V5Y A;  3O0W A;  1VAL A;  4CE8 A;  5JOW A;  4PT6 A;  4AF9 A;  2VBP A;  4K7J A;  1CAX B;  3AP6 A;  1BEV 2;  1COV 3;  3OD0 A;  4GKX A;  4QHO A;  4LE3 A;  4AW7 A;  1SLL A;  2QBX A;  1LHW A;  3DCQ A;  3GBG A;  2ZGT A;  4Z82 A;  4YNI A;  5BNO A;  1E5H A;  4QX5 A;  4UYB A;  4Y3O A;  5FUI A;  4LK7 A;  4QDS A;  3TN9 1;  1PO1 1;  2XVL A;  3DUI A;  5DQ0 A;  4WM8 C;  3SH3 A;  2DFC A;  5L7O A;  5SV8 A;  1RUF 3;  3RZK A;  1LUL A;  2HWB 3;  2ARB A;  3KQ4 B;  1AX0 A;  5T5J A;  1I9R A;  2QQJ A;  2VUD A;  3RZZ A;  2WNU B;  4K20 A;  1S0C A;  1VBC 3;  4Q26 A;  1HRV 3;  5JUV A;  1XB9 A;  1WD3 A;  1VMF A;  3ZM8 A;  2QNK A;  4Q4X 2;  5FJH A;  3WQB A;  4LHL A;  5HBA A;  4U36 A;  1YIP A;  1R1A 1;  4JCK A;  1AHS A;  2BVB A;  2Y60 A;  1KIT A;  2WWJ A;  3GCW A;  4GH4 C;  3PUQ A;  4PF5 A;  1ZZ9 A;  1D4M 1;  2ZMK A;  4A7Y A;  1UW8 A;  2LRO A;  1U5Y A;  5KXE A;  2WDB A;  4JGY A;  1QXJ A;  2FDI A;  2AC1 A;  2UWB A;  4XUR A;  4ZXE A;  5DAX A;  4LBK A;  1PMH X;  3ZYH A;  2L9L A;  3HQU A;  2QQU A;  1MEC 1;  5GLW A;  5JZG B;  3VBH B;  4NRQ A;  3MLK A;  4A42 A;  1GOF A;  1KFX L;  2OZJ A;  1HQN A;  1AYM 1;  3B01 A;  2E51 A;  5EJ3 A;  2ES3 A;  4BIO A;  1POV 3;  1UY0 A;  4YG6 A;  3JU9 A;  1SCS A;  1BMV 1;  2W1S A;  1Q56 A;  2AGS A;  4XF0 A;  1QJY 3;  4JKK A;  3ZX7 A;  2OW4 A;  1HB1 A;  4QT6 A;  2VQT A;  2BDR A;  1ZRE A;  2CHH A;  1VMH A;  1XYO A;  3AMN A;  5DAV A;  4JDN A;  3SIT A;  5E16 A;  1B35 B;  3K3N A;  2CWM A;  2GC0 A;  2D44 A;  3IM0 A;  1UOF A;  2FCU A;  2RS3 3;  3B7M A;  3WQ1 A;  3A4U A;  2J1A A;  3BU7 A;  3LA7 A;  3MID A;  4UT5 A;  1RTV A;  2B4K A;  4QKB A;  3V64 A;  4YZ5 A;  3GZA A;  5C7G A;  2C1F A;  3DYM A;  3KQR A;  1ASJ 2;  4H3W A;  5IAV A;  3WF4 A;  4FAG A;  3TNQ A;  1PO2 3;  5T3N A;  1RUG 3;  1A3K A;  1YFU A;  4O9E A;  3U14 A;  1JZ4 A;  2YGL A;  1RUC 3;  4UBH A;  2RJL A;  1F2N A;  2W5F A;  4QPI B;  3MIC A;  1NA1 A;  1T6G C;  4MXV A;  5DG2 A;  1NCQ C;  1XE8 A;  3USU A;  5J96 B;  4UF0 A;  4IE5 A;  3HT2 A;  4ZU4 A;  2VAU A;  3IBM A;  2VOW A;  3INA A;  3NJZ A;  4Q4Y 2;  2JWP A;  5FYS A;  4BQ3 A;  3KF5 A;  1W6M B;  2ZMN A;  1F8V A;  1KQR A;  3L9J T;  2RS5 1;  4IES A;  5FMD A;  5JIA A;  1QJX 1;  3H50 A;  2KA3 A;  4UWD A;  3JZV A;  1IG0 A;  1HJF A;  1ZX5 A;  2DUQ A;  5HCF A;  5IK8 A;  4DXR A;  1CR7 A;  1CZT A;  1HV1 A;  4HK9 A;  5A32 A;  3TNP B;  3KSC A;  1KRI A;  1AZD A;  4CCN A;  1OSG A;  5L7O C;  3KCC A;  5IK7 A;  5CBL A;  3C7F A;  4HPK B;  1M06 G;  3Q8F A;  4BYY A;  3SNM A;  4BQ4 A;  5JMO A;  2XXZ A;  5BNN A;  2WNO A;  3NNG A;  1JZ7 A;  2Y26 A;  4AR2 A;  5FY4 A;  2GDF A;  1UXX X;  4Y26 A;  2PYT A;  3JBG 1;  2D93 A;  2AZ5 A;  2Y6F A;  2NP0 A;  1SHW B;  3FZ3 A;  2BP6 A;  3SKJ E;  2FDK A;  5FV3 A;  5FZ6 A;  1UKG A;  3WVJ A;  1EAH 1;  2QQW A;  4Q5O A;  5I0U A;  5FPA A;  2ZAA A;  1EUT A;  5FZG A;  1WBF A;  2UYA A;  1XNK A;  4EN0 A;  1OH4 A;  1ZZB A;  4E2G A;  3N7J A;  3KS7 A;  3NL1 A;  4JGY C;  4RGK A;  1PVC 1;  3VDD B;  2LW8 A;  1MS5 A;  1DLL A;  3AZX A;  2VXJ A;  4R9D A;  4RS5 B;  3ZFF A;  3OGG A;  4AQS A;  3LE0 A;  1QQP 2;  3NRU A;  2IXL A;  2YFU A;  2PEL A;  1GOG A;  4L97 A;  3TWI A;  1FMD 1;  2E33 A;  1GBG A;  1W2U A;  1ZZ6 A;  2E7Q A;  2XOM A;  4YM0 A;  5CEH A;  4NIH A;  3KV5 A;  1PHM A;  2KD7 A;  2D3P A;  4XMI A;  4AED A;  3AZW A;  1X8M A;  3SMH A;  3FL7 A;  4EN7 B;  2LRP A;  1EV1 3;  1ZBE 3;  2DCK A;  2Z4F A;  2VW0 A;  5CFD B;  2W87 A;  2X5I B;  3OPW A;  1IKP A;  1ZA7 A;  2V72 A;  3ZN6 A;  4Y1Y A;  3K48 A;  2WLP A;  5FBZ A;  2MEV 3;  1O3S A;  3Q8C A;  4BLJ A;  1R09 3;  1L7L A;  1FT9 A;  2R16 A;  1Z7S 1;  3AC0 A;  1J1L A;  2XLA A;  4YYO A;  4QB6 A;  2F4L A;  4KWJ A;  2BER A;  3VD5 A;  1ZZ7 A;  1RVF 2;  2Q8C A;  4EZH A;  3AM2 A;  3J8F 3;  4MX3 A;  1CON A;  2XDV A;  2WO7 A;  4I09 A;  3VBO B;  3PUA A;  4CDW A;  1M4W A;  3E6C C;  1JZ5 A;  1J3Q A;  4HZF A;  1GP6 A;  4Q27 A;  4NHX A;  1LHU A;  4FPG A;  1QGL A;  2BGO A;  4HXC A;  1F9K A;  2QQO A;  2UWC A;  4XOG A;  4IV3 B;  4CDU A;  4XPV A;  4Y1X A;  3VBU A;  3BOD A;  1W2A X;  1SAC A;  2XUM A;  1WMD A;  2VR4 A;  3J7H A;  5K0U A;  1DGL A;  3WEZ A;  3V56 A;  4LIU A;  1VBD 1;  5DUV A;  4MSV A;  5FTT C;  2VD7 A;  2DUO A;  2W91 A;  4XF1 A;  4Q4X 1;  4RL7 A;  5T50 A;  4MGY E;  2VOV A;  3RJ2 X;  3U1X A;  1UYP A;  1SZB A;  4IE7 A;  4YLZ A;  3ES4 A;  3E1F 1;  3U11 A;  3WD5 A;  5BY5 A;  4DUW A;  4HG6 B;  3KHC A;  1UCX A;  4LJH A;  1K5M B;  4RQP B;  2H0B A;  4OQ9 A;  3H0O A;  3ACL A;  4QAW A;  2B45 X;  2ZJC A;  2C4X A;  5FZH A;  1D2Q A;  2GC3 A;  1W9T A;  2WS9 2;  3J7L A;  1O4Z A;  4UFH A;  1AR9 1;  2WFF 3;  2WJS A;  2OPW A;  5EJZ B;  2ZXQ A;  4YPJ A;  1STM A;  1OUR A;  5HXM A;  1OH3 A;  4XUT A;  2R07 2;  3U4X A;  1WCU A;  5F6K A;  4AWD A;  2XJQ A;  3ELN A;  2RR1 2;  3TEX A;  4YW6 A;  3P1I A;  3MLL A;  4LR4 A;  3W5M A;  3V0A A;  1CWP A;  4MET A;  3E5U A;  1HLC A;  2XVG A;  4YW2 A;  3HQX A;  4QX2 A;  5JLV A;  1QDC A;  3B94 A;  2WYS A;  4R4Z A;  2MNG A;  4BPZ A;  5A3M A;  1PZ9 A;  2YBP A;  3M70 A;  2O8Q A;  3OYW B;  2B39 A;  1W9S A;  4JRL A;  4QPG C;  5CA6 A;  4B29 A;  4FOQ A;  3SCH A;  1BBT 1;  5F1R A;  3GBW A;  2XJT A;  3GBF A;  4GMP 0;  5GKA C;  3LFI A;  1F4H A;  4ZS2 A;  5DUX A;  5IVC A;  5FP4 A;  3JXS A;  1C1F A;  3AP4 A;  4ZPI A;  5C8C B;  2DWR A;  4Q0Q A;  5FXZ A;  1LU2 A;  1O7F A;  4QKD A;  4V2W A;  1MQT B;  1QH7 A;  1JYX A;  1D7P M;  2CV6 A;  2KR2 A;  4D69 A;  2Q1Z B;  3AP5 A;  1W6O B;  3T1L A;  4K9S A;  4PDW A;  4HFS A;  3OG2 A;  2CGO A;  2HYX A;  4GD4 A;  4XCA A;  2DDU A;  2R04 3;  4XJ9 A;  5IW0 A;  2DCJ A;  3RZJ A;  5BNQ A;  1VBB 3;  1W2T A;  2PAE A;  5JSP A;  3FLT A;  4KWL A;  1VR3 A;  2Z5W A;  2JXA A;  5E1R A;  3BTY A;  3PL0 A;  2Q5T A;  1H8T C;  1X7N A;  2CAV A;  4WM8 B;  4GKY A;  5FY5 A;  2WA4 A;  3WNK A;  4CEY A;  5LA0 A;  5A80 A;  4GB3 1;  1YFW A;  3ZO0 B;  3OBA A;  3HAG A;  4FTB A;  1ALY A;  1EUU A;  5A6Z A;  1LGC A;  4IE4 A;  2VME A;  3PJY A;  3AMP A;  2GC2 A;  2HWC 2;  4N43 A;  2UU8 A;  3J4U H;  2R06 1;  1HJG A;  5GLZ A;  1W0P A;  3J26 N;  1SQ4 A;  3QAC A;  4RFT 0;  3AJY A;  4GH4 B;  1UN1 A;  5FUP A;  1MZ6 A;  5FZ9 A;  1REE A;  3KB5 A;  4J6G A;  5F6L B;  3TYJ A;  4MV2 A;  2UUR A;  4P9I A;  2WZP P;  1CAX A;  4X8N A;  1AR8 2;  1OPO A;  3LEK A;  4JQR A;  5KHJ A;  2FD8 A;  2LS6 A;  1HXS 3;  4C0B A;  1LEM A;  1QQP 1;  1RUE 1;  2B9U A;  4IEV A;  5DAB A;  4YVS C;  1VRH 3;  2JJ6 A;  4P9G A;  2SBA A;  4WVV A;  1AYN 3;  1NAE A;  3DF0 A;  1DQ6 A;  1QXR A;  3AXD A;  4AEJ A;  1IG3 A;  2YPJ A;  3BPS A;  1BVP 1;  4Y1Z A;  4M3C B;  2WNU A;  2RMU 1;  5J09 A;  4OZX A;  4A6S A;  2W46 A;  5DZF A;  4DFS A;  5JXH A;  1H6Y A;  2VVE A;  3IDC B;  5GLT A;  2NLR A;  1PIV 1;  4AI0 A;  4KGG A;  4YG0 A;  3VN4 A;  1AR7 1;  1W8F A;  1X9P A;  2HLE A;  3T09 A;  5F3E A;  4DPN A;  4UFI A;  4Q8L A;  1WKY A;  3KV6 A;  1GNY A;  2Q30 A;  1QWR A;  3VGI A;  1V6L A;  5FO9 B;  1AR6 2;  4E8D A;  1H9P A;  2RM2 3;  2WC2 A;  4ZU7 A;  2VZ1 A;  4XTP A;  4XXA A;  1Q8P A;  1C57 A;  5FY7 A;  4OI1 A;  2W2I A;  5AVA A;  1BLZ A;  3DXU A;  1N47 A;  1G8W A;  3AP9 A;  4KG8 A;  4WM7 C;  1O3Q A;  4K8F A;  2IXC A;  2YU1 A;  3WNX A;  2HWE 1;  2VTX A;  4KMQ A;  4CUG A;  5J3U A;  1QDO A;  4CSW A;  1J1T A;  2AH2 A;  4QU2 A;  3GHM A;  5CFC B;  4O7X A;  3ILR A;  4OHV A;  5I8Y A;  3S30 A;  1WCS A;  2F6B A;  3ALQ A;  3D5O A;  1W6Q A;  3AYA A;  2FDF A;  3DEC A;  2PLV 3;  3ECQ A;  3R4D B;  2MHF A;  3EMR A;  4N53 A;  4QHZ A;  5JWP A;  3WF3 A;  4UXA A;  4NAM A;  1BYH A;  1B35 A;  2CSG A;  2DUR A;  2O14 A;  4FVV A;  4CEY C;  4LBM A;  2GZW A;  3LKJ A;  4FPE A;  2ERF A;  3P3P A;  3V65 A;  3ZR6 A;  5IVF A;  1OA2 A;  3C2U A;  4QPW A;  4AFM A;  3PUI A;  1EY2 A;  4NWW A;  2ZGR A;  3T0B A;  1JTZ X;  2JG9 B;  2XGX A;  3B00 A;  5H9Q A;  2W52 A;  2ID4 A;  5KR7 A;  1VRB A;  4LEJ A;  4BK4 A;  4E4H A;  4NRM A;  4QPI A;  1JUI A;  4FQ4 A;  1W6P A;  4RSU A;  2NQY A;  5C4W B;  2WA3 A;  5JI9 A;  4CCL A;  3UK9 A;  3VZJ A;  2VNO A;  4OCT A;  4IGQ A;  1CAU A;  1W28 A;  1W6M A;  1MAC A;  2VMI A;  5FRE A;  4I01 A;  4Q1R A;  5FZA A;  4OZO A;  3LEI A;  1IPK A;  4DO0 A;  4NPL A;  2ZEW A;  3G6J B;  4EN8 B;  1TE1 B;  1T6B X;  3ZYB A;  3POW A;  1OKQ A;  3ZFE A;  4OHY A;  2N7G A;  3HBZ A;  3LPF A;  1L7R A;  3NAP B;  3VBS B;  1S55 A;  3OB8 A;  4HVO A;  3EHK A;  4UBG A;  1V0A A;  3IN9 A;  4XTM A;  3DPR A;  2AAC A;  4C0H A;  1LKN A;  1DGR N;  2DBN A;  3O1M A;  2A6Y A;  5A33 B;  1YQ8 A;  4AAP A;  5FYB A;  1UWW A;  4Y4Y A;  1NLQ A;  5JXJ A;  2VGD A;  5C9A A;  1QJU 3;  3ENR A;  1FAY A;  3OUH A;  1OUS A;  2WQZ C;  2RS1 3;  4LHK A;  4MO3 M;  2D7F A;  4K1Z A;  2RV9 A;  4TWT A;  2JX9 A;  4WVM A;  4IV1 A;  1RUF 2;  1DQ1 A;  2HWB 2;  5FYC A;  1PGS A;  4NID A;  2VCM A;  3KM5 A;  1UQX A;  2Q8E A;  1O3T A;  1CVN A;  1YJK A;  2JD9 A;  2YG0 A;  5K4L A;  4C90 A;  3T4H B;  4B8E A;  1VBC 2;  1HRV 2;  2GND A;  5LWB A;  4LA2 A;  1XYP A;  5FYV A;  1P8J A;  1NG0 A;  2Q8O A;  3NNL A;  3PLQ A;  5ABJ C;  1RUI 2;  2UY8 A;  3MIH A;  5DAQ A;  3OGJ A;  3N7L A;  5CFD A;  4CVU A;  4BOW A;  3PIG A;  4IUG A;  4I0W B;  3USS A;  4CP9 B;  2I07 B;  1W2N A;  2HWC 1;  3JQX A;  4RHV 3;  1K42 A;  5C3S A;  3NJY A;  1GR3 A;  1IKQ A;  1S0J A;  2WNE A;  3WG1 A;  4LA3 A;  5F3I A;  3MV1 1;  1ENX A;  4EZ4 A;  5F7U A;  2BGP A;  2JG8 B;  1JU3 A;  1DGW X;  1DZT A;  1JUH A;  1RUJ 3;  1ULE A;  2ADE A;  3AZV A;  4K21 A;  4XC9 A;  1GZW A;  3CLP A;  1UO9 A;  3ZXD A;  4KU7 A;  4PQQ A;  4Z2W A;  2X8K A;  2WNV C;  4BB3 A;  5BNP C;  3VBO A;  5IVV A;  2C5D A;  2E31 A;  3I3E A;  1WD4 A;  3KCX A;  4XBQ A;  2H6B A;  1QJY 2;  2W47 A;  1K5J A;  4ZU5 A;  2W9X A;  3O5S A;  4RN5 A;  1LB2 A;  4YGD A;  1WLW A;  3HN1 A;  1I1E A;  4IV3 A;  1QKQ A;  4Q0V A;  4EQV A;  3LCP A;  2ARA A;  3GF6 A;  4DRR A;  3LF7 A;  2QVS B;  2RS3 2;  2ORX A;  3CU7 A;  4MVT A;  4A6O A;  2VUL A;  4Z92 B;  2XWB B;  3H8U A;  4IET A;  4QPG B;  3FWE A;  3TBD A;  1Y7B A;  1RUD 1;  3KT4 A;  5LBB A;  3WW3 A;  1BJQ A;  4CPB D;  1RGS A;  3C3V A;  3MHZ A;  1E5R A;  3RQ0 A;  1I3H A;  1PO2 2;  1LCL A;  1RUG 2;  4XJU A;  3MIB A;  5A7Q A;  3BTX A;  2ZX3 A;  4SLI A;  2W95 A;  2QTW B;  1UZ0 A;  1RUC 2;  3IAP A;  4FPF A;  3VZL A;  2VZU A;  4PJY A;  3AMQ A;  1IZ3 A;  1XYN A;  2EXH A;  2ZHN A;  3VL9 A;  4DIN B;  5GM0 A;  2GAL A;  1PZ8 A;  1R08 3;  3VKM A;  3WP3 A;  5K8S A;  1Q8S A;  5FP9 A;  1RXF A;  1X36 A;  3H3U A;  2B9V A;  3ACG A;  1A8D A;  1O5L A;  4DB5 A;  2D6O X;  2D3S A;  5C9A C;  5FZ1 A;  1OD5 A;  2YB7 A;  1F5J A;  3LEG A;  5IUQ A;  3I7D A;  5J48 A;  4I2O A;  1I5P A;  3H1W A;  3MPP G;  2HEY F;  5FP3 A;  3LD8 A;  2JB8 A;  1O4T A;  1H0B A;  2VQA A;  3I54 A;  5LY2 A;  3ZSE A;  4AI9 A;  4IEU A;  5EIY B;  1CAW B;  1LEN A;  1PK6 C;  3GAL A;  5ACA 3;  4CEW C;  3QBQ A;  3FMG A;  1LOG A;  4XJA A;  5FLI A;  4QMA A;  5LK5 A;  2EIG A;  2IC1 A;  1H8T B;  2WT2 A;  4XUQ A;  1SPP A;  5FMO L;  1LHV A;  1CGP A;  4P08 A;  3THC A;  1OT5 A;  2P2K A;  4QKF A;  2CY6 A;  3TAY A;  5L19 A;  1RMU 3;  2VVD A;  3WG4 A;  5JDB A;  1OPM A;  5C3P A;  2VL4 A;  2XJV A;  4QPY A;  5HXV A;  3ME2 A;  4UW4 A;  2B46 X;  4AHX A;  2B5H A;  3ZXK A;  4CA9 A;  1W06 A;  4PLN A;  3VBF C;  4YGB A;  5FPZ A;  3RJR A;  4XBN A;  3RI9 A;  1UYZ A;  1V6K A;  2W68 A;  5T54 A;  1VP6 A;  4QX1 A;  3M3E A;  4C8D A;  4ASL A;  4TTG A;  4BQ1 A;  1TZO A;  5A6X A;  2DF7 A;  5K9Y A;  5FZO A;  1VAV A;  3HNB M;  3VKN A;  4KH9 A;  3AKR A;  3FJS A;  1OUX A;  1US2 A;  4JTN A;  4OFG A;  4YFZ A;  4XFG A;  2ZZJ A;  1JOP A;  3NJX A;  4EWA A;  4DQA A;  1ND2 A;  4YW5 A;  4AQ2 A;  1OXC A;  2Q1F A;  3LDK A;  4G9S B;  3OY8 B;  4I30 A;  4OI4 A;  2VCB A;  1G86 A;  2JIJ A;  2DTY A;  5F5Q A;  2ZEY A;  2ZML A;  3FBY A;  2QQM A;  4GUL A;  1NLR A;  1SLB A;  4HKO A;  4YVS B;  4QXC A;  4XUN A;  5JMC A;  2W94 A;  2EA7 A;  2QUO A;  4Y33 A;  3DYO A;  1UZW A;  1EV1 2;  1MS8 A;  1ZBE 2;  1HDK A;  2WN3 A;  4HK8 A;  4ITC A;  3MEP A;  1IHM A;  5JXI A;  4AVV A;  4CTE A;  5DAP A;  1H2M A;  3LDR A;  4QDR A;  2EXK A;  1LES A;  4YVW A;  4FFH A;  2BUK A;  3TB0 A;  2G19 A;  2MEV 2;  4NIG A;  1NXD 1;  3VLB B;  2WO2 A;  1R09 2;  1H8V A;  2E9Q A;  1ZZC A;  3TRS B;  3VHP A;  5FDB A;  3HT1 A;  3MUY 1;  2DU1 A;  3PMS A;  4HON A;  4Y5S A;  4TXW A;  3J8F 2;  1F35 A;  3SHR A;  3HOB A;  4FPO B;  4Q4W 3;  1REF A;  2LTN A;  5A7P A;  5FPL A;  4LBJ A;  1OBN A;  1UOB A;  1H1M A;  3WW1 A;  1O3R A;  2W1Q A;  1H9W A;  3A0N A;  2WZR 3;  3MW3 A;  1MVE A;  5A3P A;  3IPV B;  2QDR A;  2FMD A;  1FOD 1;  4WM7 B;  5A6Y A;  1QH6 A;  4FPY A;  1RUF 1;  1UU5 A;  2D6P A;  2JDP A;  3K2O A;  4MGZ E;  3ABZ A;  1FNY A;  3OF1 A;  4MZU A;  5BXX A;  1X50 A;  3B93 A;  4Y1V A;  3H7Y A;  3ZFG B;  2XHN A;  1HRV 1;  1C8N A;  2QZ3 A;  3DGT A;  1UNB A;  1UY3 A;  2JE8 A;  3MIE A;  4NR1 A;  4RR3 C;  5H9S A;  5HPO A;  1RUI 1;  3N35 A;  3UKN A;  1AJK A;  4XZU G;  2VJX A;  1XU1 A;  4LKS A;  2Y38 A;  1ODN A;  1OFS A;  4PHZ A;  3T0A A;  5A7O A;  3WQ0 A;  3UJO A;  3ZDV A;  2XUE A;  4I3G A;  3NV1 A;  1V6J A;  3TOJ A;  3ES1 A;  4O65 A;  3VV1 A;  3WX5 A;  2WQ4 A;  4BHP A;  4CDQ C;  2WFF 2;  4LIV A;  1LAJ A;  1XU2 A;  1WLD A;  5FAX A;  3K51 A;  2ET7 A;  2VY0 A;  3VZO A;  1NT0 A;  4YM3 A;  3OTF A;  2CGP A;  2YPD A;  4ZS3 A;  1QF3 A;  3ETQ A;  4BQX A;  1POV 1;  2Z2S B;  3D6E A;  3NKG A;  1CAV B;  1G9D A;  4NHY A;  4LKD A;  3A21 A;  1ND3 B;  1QJY 1;  3H1M A;  2Q4S A;  1ND2 C;  3WT3 A;  4MXW A;  5GAL A;  2DVF A;  4COZ A;  3WUD A;  3I2D A;  1N3O A;  4A45 A;  3H1Y A;  1SFY A;  1AX1 A;  2C6S A;  5JSR A;  3ACH A;  5C33 A;  1GLH A;  1JYC A;  4XF9 A;  3ATG A;  4FXK B;  5D8A C;  3WY6 A;  2GH2 A;  3ZR5 A;  5EHD A;  2OII A;  3PNA A;  4FPH A;  4AI3 A;  2RJ2 A;  1NCR C;  2GNM A;  4XDP A;  4YFW A;  2VZQ A;  4XAA A;  1HKD A;  1RUC 1;  1SBF A;  1ZBA 2;  3BIE A;  1NLS A;  5FUN A;  4UI9 L;  4W6W A;  5KXD A;  3RDI A;  2R04 2;  1OF3 A;  2B7Y A;  1POQ A;  1MZ5 A;  2Y6H A;  1YQ5 A;  1VBB 2;  1EYB A;  4AEM A;  2YXS A;  3ZPO A;  4P14 A;  3KHB A;  4FP3 A;  4PI2 A;  4S2D A;  4UFM A;  4AHW A;  1LOF C;  2C9A A;  5FIX A;  2E53 A;  2GMM A;  4PLO A;  4CPB A;  1PO1 3;  5CKN A;  2NN8 A;  2BU9 A;  2BZD A;  4LOS A;  5CVR A;  5C3Q A;  2TBV A;  3SCG A;  1RUH 1;  4GWN A;  5FLH A;  1E5I A;  4CCE A;  1FPN 2;  1IPJ A;  4FPL A;  1CD3 G;  3MI8 A;  1G9F A;  4IEP A;  4LBL A;  3E5X A;  5ABJ B;  3NAP A;  3D8C A;  1WW7 A;  3VBR C;  2GN7 A;  4XVH A;  1L3J A;  2G4I A;  2ZGM A;  1PX3 A;  1IS3 A;  1ULC A;  5AFE A;  4JGZ A;  2A6V A;  4CDX A;  3RFR A;  3LB9 A;  1UOJ A;  3M3C A;  4HT1 T;  5LRR A;  1DZQ A;  1W04 A;  3MLJ A;  1R1A 3;  4LXL A;  3THP A;  5A33 A;  1DQ4 A;  2A7A A;  2J1T A;  4CRQ A;  4NE9 A;  4CXY A;  4NVP A;  1HXS 2;  3ZXA C;  5LRS A;  1ACC A;  5BNO C;  4W6Y A;  1TQ5 A;  3RZH A;  1HQW A;  4ET7 A;  4ZKT B;  5BNP B;  1VRH 2;  4MUV A;  5T55 A;  1C5H A;  1DP0 A;  5FZF A;  1AYN 2;  3LDB A;  1W8N A;  4TN7 A;  1HN1 A;  1AYM 3;  1Y9G A;  1OQ1 A;  1X33 A;  5GLU A;  1V00 A;  1DF0 A;  5KXC A;  1MS1 A;  1EV1 1;  1CPN A;  2AUY A;  5K0U B;  4PLM A;  1N1V A;  2RDQ A;  1C1L A;  2VZ3 A;  4F8A A;  3RYK A;  3ZXE A;  2YC0 A;  5EYY A;  1F5F A;  3GDB A;  2PAK A;  1D0H A;  3UGG A;  2ZA9 A;  2XJR A;  5EQU A;  4PF1 A;  4W6X A;  4CP9 A;  1QOT A;  1S0I A;  3BTZ A;  1RED A;  3ILN A;  3KV9 A;  3DEM A;  2GNT A;  2DBI A;  4ATE A;  2A6W A;  1KDK A;  2Y6K A;  2JDH A;  3O1V A;  4FPC A;  1AL2 2;  2RM2 2;  4CCO A;  1LOD A;  5EFU A;  3POG A;  4UFJ A;  2C24 A;  4H14 A;  5E8A A;  3HN3 A;  4XHX A;  3WP5 A;  5GZD A;  2HWD 3;  1W9Y A;  2QQN A;  5IYY A;  3P3N A;  4X6Q B;  5FMB A;  4J1W A;  3S57 A;  4CCJ A;  4FAH A;  2WIN B;  3KLS A;  3A23 A;  3PDQ A;  1J58 A;  5FBJ A;  4JX0 A;  3BB6 A;  1HRI 1;  2BFU S;  4YM1 A;  5T5L A;  1S0B A;  3PVO A;  1LGB A;  1R64 A;  3WW4 A;  2PLV 2;  1QJX 3;  1GQP A;  2ZX0 A;  4KNC A;  4DEQ A;  1DU3 D;  4IEW A;  1XRU A;  1GFF 2;  3DKQ A;  3P6B A;  2ENR A;  5C8W A;  1TME 1;  2D40 A;  5IAT A;  3ZOI A;  3WNL A;  5DPN A;  2OVU A;  1JS9 A;  4RA0 A;  5DMY A;  3EBR A;  4HVR A;  3IZO A;  2ZS6 B;  2ZX2 A;  4IE0 A;  1WCQ A;  1UMH A;  4HN1 A;  1W6N B;  1MR5 A;  2E32 A;  4ERO A;  3IMN A;  3THD A;  4OMD A;  2JIG A;  1QJE A;  1UY2 A;  1WWY A;  1BEV 1;  2FMY A;  2VMF A;  3R4U A;  5SV5 A;  4BIS A;  3VBF B;  5LZ6 A;  3VDB A;  5ISL A;  2PN5 A;  1O8P A;  2XLF A;  5FJK A;  2OZ6 A;  1NA1 C;  2WAB A;  3OEA A;  2NMN A;  4CDX C;  5LW9 A;  3FHA A;  1EAH 3;  4NRP A;  1ENR A;  4XF3 A;  1UIJ A;  4B3N A;  4QU1 A;  5LB6 A;  3LFM A;  3KT7 A;  2X10 A;  1VBA 2;  4FPJ A;  4GA9 A;  4QX0 A;  1RUO A;  4GJZ A;  4NPR A;  3HVD A;  2YUE A;  3VL8 A;  4Z8B A;  2ZGN A;  2GSY A;  2O1Q A;  3S7E A;  1D4V B;  2EVX A;  3FUQ A;  3MFC A;  4ATF A;  4QX8 A;  2ZHM A;  2VNR A;  1Y43 B;  5DUU A;  3K3O A;  4AG4 A;  2OQ6 A;  4HET A;  3FN9 A;  4K3U A;  3KD4 A;  1NE4 A;  3I2O A;  4DRV A;  5FXX A;  4O9G A;  5ANQ A;  1FMD 3;  3WDT A;  4LOR A;  2JIC A;  2BEO A;  3OPT A;  3N9P A;  3UYJ A;  5BNN C;  2XML A;  1KGY A;  3IB3 A;  2ORZ A;  3III A;  3OGV A;  3VZM A;  1N3Q A;  1X9T A;  5D2A A;  5FPX A;  4QQP A;  3WDX A;  2ZEX A;  4FPK A;  1AL0 G;  1H2L A;  3CJI A;  4M3C F;  4C1X A;  4FI9 A;  2W3J A;  3HNY M;  1MS9 A;  3I59 A;  1KS4 A;  4XJW A;  4AVC A;  4ZXK A;  4CCD A;  3OUI A;  4QXH A;  2R1D A;  5DAW A;  1ZBA 1;  4YZ4 A;  4QXK A;  5B2G B;  2RS1 2;  4WVW A;  3ZKU A;  1IS6 A;  1YC6 1;  1K45 A;  1Z7S 3;  2DU0 A;  2CU5 A;  4HKW A;  4IL7 A;  4ZON A;  5FK8 A;  3RS6 A;  4AE2 A;  2ET1 A;  4P9L A;  2E63 A;  3ZFF C;  5BPX A;  2BWA A;  5L73 A;  2D98 A;  4CU8 A;  5F8P A;  1GKB A;  2ZX4 A;  3AFK A;  1Q8O A;  2WO1 A;  5FZ7 A;  4W50 A;  3AP7 A;  3WR0 A;  5FOB B;  3A7Q A;  1UPS A;  3C7H A;  3IDA A;  3OY8 A;  1AJO A;  1VBB 1;  3ZDS A;  4AVT A;  1V9U 2;  3I2G A;  2JDU A;  4MHR A;  5L9V A;  2FZ2 A;  3IMM A;  1OF4 A;  4URT A;  5GJ6 A;  4AFB A;  4AED C;  3IT8 A;  2BNM A;  1ULD A;  1YCI A;  1XND A;  1Y4W A;  3PU8 A;  4BA6 A;  1TMF 2;  4ONU A;  1ASJ 1;  3UKV A;  2RE9 A;  4AQT A;  1HX6 A;  1FPN 1;  2OQ7 A;  4RHV 2;  4OQ8 A;  1VBD 3;  4N9H A;  2BYV E;  4P9J A;  4RR3 B;  5C6C A;  1QY4 A;  1YQ2 A;  2VU9 A;  5A7W A;  2P34 A;  4DS0 A;  3M1H A;  4Q4X 3;  2ZOE B;  1ZRD A;  1SLC A;  4YW4 A;  3MBW A;  4A7K A;  1RUJ 2;  1FX5 A;  2XL7 A;  1GWK A;  2IWG B;  3ZYJ B;  3FBM A;  4Q4Y 1;  1W3X A;  4HAN A;  4RFR B;  2ZCW A;  2XKO A;  1A34 A;  2D6K A;  3H9A A;  2FHR A;  4RGG A;  4Q1P A;  3HEI A;  2Y0O A;  3NQH A;  5JPN B;  3IIA A;  4CDW C;  1HXS 1;  1UKR A;  5BUV A;  1AR9 3;  2HH9 A;  1C8M 3;  3NNJ A;  3NWK A;  4LHS A;  1RUN A;  1DYP A;  5LEJ A;  4LO4 B;  3PME A;  5EYX A;  4IGO A;  4MG2 A;  4CDU C;  3O1R A;  4XQ4 A;  2W1W A;  4TSV A;  3K4Z A;  4WVZ A;  5KC5 A;  4CU7 A;  5IVY A;  4NII A;  4S2G A;  3ROU A;  3VBU C;  5K0U C;  3JUU A;  1OHF A;  1OOP A;  3I8T A;  4GAL A;  3POB A;  3WDV A;  1W8O A;  2ZGO A;  3MIG A;  3K46 A;  1KS5 A;  3PTY A;  2JEM A;  2EAL A;  5DZE A;  1EP0 A;  1LJ7 A;  1NY7 2;  5GZG A;  3LZZ A;  2VEC A;  2PHR A;  2ZGQ A;  3HPN A;  1Q5O A;  5G05 L;  4BLI A;  4QM9 A;  3CJX A;  1BBT 3;  3M4F A;  4K8R B;  5D8A B;  3RWN A;  4YWA A;  2DVB A;  4Z2A A;  4XF4 A;  3TEW A;  4LBQ B;  2WKK A;  3EXU A;  4PIZ A;  4XQW A;  1NCR B;  1F15 A;  2CGN A;  1R08 2;  4LPL A;  2WSU A;  3LAG A;  4YRD A;  4OUL A;  5APA A;  3ILF A;  1AL2 1;  2FQP A;  2CDO A;  4LBO A;  1NQJ A;  1U12 A;  1SDD B;  4BXF A;  4DMI A;  2Y6L A;  3LOI A;  1LHN A;  1IS5 A;  4DXS A;  1GYK A;  4AGG A;  1WW6 A;  1FI2 A;  2DFB A;  1GNZ A;  1V70 A;  2W39 A;  3N9O A;  5KHH A;  4ASK A;  4XFF A;  5T5P A;  2WWS A;  1XE7 A;  1CAV A;  1AXY A;  2A70 A;  5ACA 2;  2XH6 A;  4QGN A;  1ND3 A;  3BCW A;  4ASM B;  5I93 A;  4ZHN A;  3NV3 A;  2D5H A;  3OUJ A;  4ISR A;  4Q2F A;  3KVA A;  4LKF A;  2PLV 1;  4AK3 A;  1JN2 P;  2G9G A;  1H2N A;  3Q9O A;  3DV8 A;  1WMF A;  2VQ0 A;  1RMU 2;  1WCD J;  4GB3 3;  1YFX A;  1Z0H A;  3N9L A;  3VHO A;  3W59 A;  1JOB A;  1RIN A;  3AYC A;  4HKL A;  4Y20 B;  3RNS A;  2JEC A;  2QFE A;  3ZYP A;  5A3L A;  2ATF A;  2Y6G A;  5FZ8 A;  3VBR B;  4LUK A;  5FYY A;  4YSF A;  2JE9 A;  1JOJ A;  4C1W A;  1RVF 1;  1NCQ B;  5DDJ 3;  2R06 3;  5JZG A;  3VBH A;  4Y22 B;  5LEK A;  2VXR A;  2VZT A;  3BAL A;  1YNA A;  3DKW A;  4NN0 A;  5FQ0 B;  4DEV A;  3UNP A;  2RHP A;  1JYV A;  1S2B A;  1GZ9 A;  2OT7 A;  4PDW C;  5FKB A;  2C9K A;  4LIT A;  1LU1 A;  4L9B A;  3JCI A;  1SG3 A;  4W65 A;  3VB9 A;  4D6R A;  1VBA 1;  5BNO B;  4B4Q A;  2QQI A;  4K40 A;  3S6P A;  5L7O B;  4P02 B;  2VOX A;  2ARC A;  5FZB A;  1RUE 3;  4MHU A;  2VNV A;  1LOA A;  3H42 B;  4OI2 A;  2XBO 3;  2YBK A;  3FFQ A;  3M7A A;  5CZK A;  4AFC A;  3WCR A;  4AI1 A;  2Y33 A;  5FYZ A;  1NQD A;  1OOP C;  3JD7 3;  4A3X A;  3UV9 A;  4N43 C;  5I0T A;  2RMU 3;  1U0A A;  2WS9 1;  5EPA A;  1PIV 3;  2K2S A;  4Y1U A;  4D6S A;  5JIU A;  3DYP A;  1AR7 3;  2QQP A;  4BME A;  4CU6 A;  2VBD A;  4OUS A;  2R07 1;  4Q4W 2;  1Y9Q A;  2J1R A;  2Y34 A;  3A0K A;  4JGY B;  2RR1 1;  4XZP A;  4D94 A;  5LCW L;  5IK5 A;  2VOT A;  2RS1 1;  2WZR 2;  3OSD A;  2ARX A;  5I8S A;  3AVR A;  1PNF A;  1O91 A;  2WFP A;  1F31 A;  2XG3 A;  1GV9 A;  2ZTN A;  1QJF A;  5L9R A;  2QQK A;  1FV2 A;  4Y5T A;  5FP7 A;  4D7T A;  1ZA4 A;  1JZ3 A;  1K12 A;  2HEV F;  1X8E A;  1W2O A;  1YJL A;  5C71 A;  4BCU A;  1YRZ A;  3GGL A;  2HWE 3;  1V9U 1;  1DIW A;  2YYO A;  4HPK A;  4QQL A;  3QD6 A;  4GAZ A;  2GC1 A;  2V4V A;  4MH0 E;  4LO8 A;  4Z07 A;  5IVE A;  2WNU C;  1JU4 A;  4A41 A;  2A73 B;  2WAA A;  4JHT A;  4XJ8 A;  4M00 A;  4NUB A;  4I3P A;  4XXP A;  1V6I A;  1OFN A;  4IE6 A;  1TMF 1;  3SCF A;  3CMG A;  4ARX A;  4XET A;  1JZ6 A;  2QCS B;  1YEW A;  1SLT A;  4JKL A;  4MOA A;  1COV 2;  4RHV 1;  5CU1 A;  5IAX A;  3I2K A;  4E2S A;  3V0B B;  4M4P A;  1V6M A;  2J7M A;  3IWZ A;  3BVC A;  3QLQ A;  3E5Q A;  4XCB A;  3H7J A;  1U5Z A;  5CB7 A;  5CG8 A;  4AHZ A;  3GZU C;  3VDD A;  1RUJ 1;  4RS5 A;  3RVH A;  1BQP A;  2PTM A;  2VE1 A;  3R4S A;  5FY9 A;  4HLT A;  4LUM A;  1DYO A;  1QOS A;  5JZG C;  2YHJ A;  1OD3 A;  2DCT A;  1UX7 A;  5FMO S;  3ZSL A;  4B7E A;  5C3O A;  5HI0 A;  2WL1 A;  2K46 A;  1JH5 A;  3VHN A;  3POJ A;  3C7O A;  3FHI B;  1F4A A;  1UU4 A;  1VJ2 A;  1SBD A;  4GIQ A;  4N7U A;  1N1S A;  1OMI A;  3B69 A;  4CCC A;  1C5I A;  3AB0 A;  5A32 B;  3OD4 A;  2X5I A;  5GZE A;  2MPF A;  1GUI A;  1HW5 A;  4N53 C;  2AEY A;  3HR9 A;  1B35 C;  3WP4 A;  2GP3 A;  1NY7 1;  3CDZ B;  4GWJ A;  4X6R B;  2A3Y A;  2PHF A;  3VKF C;  1X82 A;  2IXJ A;  4L11 A;  4NOT A;  5BNN B;  5CYY A;  3UT0 A;  3ACF A;  2XVK A;  3N9M A;  1CES A;  1MPX A;  3R05 A;  5K7P A;  5C5T A;  4LHN A;  2P37 A;  2WQ8 A;  1AR8 1;  2E6V A;  1KD7 A;  2VNG A;  4XEZ A;  4B7K A;  1R08 1;  2WAO A;  1W8W A;  1CN1 A;  2SLI A;  4OI0 A;  2LM3 A;  4QPI C;  3GM8 A;  3H8R A;  1JHN A;  4ISQ A;  2IZW A;  3O12 A;  5E89 A;  1ZRC A;  3KZ4 C;  2R30 A;  3U0Z A;  1DG6 A;  1WBL A;  4U2A A;  3WNO A;  1UZY A;  1H2K A;  3AYD A;  4HN0 A;  5I91 A;  4S2H A;  4GMP 1;  4XUO A;  3ZIX A;  4YG3 A;  3SC7 X;  3VUO A;  1GOH A;  2YY1 A;  3MGU A;  5CKQ A;  1RXG A;  4JDO A;  2WII B;  5IJR A;  3NV4 A;  4FO9 A;  3RMY A;  3VDA A;  5CKM A;  3ZFE C;  4D7Y A;  3WHT A;  2OXB A;  4LMF A;  4Q4V 3;  3WF2 A;  4AED B;  4DNY A;  3K77 A;  2VZR A;  5FRA A;  4LTA A;  1PVX A;  2EIC A;  2TUN A;  1K5M A;  4RQP A;  3MFA A;  4XIO A;  5FZ3 A;  1QU0 A;  1RMU 1;  1S1A A;  1UY4 A;  1K3I A;  3DPR C;  4FCA A;  3HD8 B;  3O1U A;  1SFP A;  2BTV C;  3LSE A;  4UFL A;  2RVA A;  3VD3 A;  1BZW A;  3X29 B;  4KWK A;  1AR6 1;  1XNT A;  3ZN6 B;  2A1X A;  4B1M A;  5A3T A;  5FO8 B;  5FMC A;  2ZAB A;  4M0H A;  4FOW A;  2BPA 2;  5KC6 A;  5LBC A;  2ILM A;  5HCB A;  3B02 A;  1YYN A;  1DZR A;  3I2J A;  2ZZQ A;  4CP1 A;  4KU8 A;  1W0N A;  2QDN A;  4PCR A;  4UW3 A;  4IV1 C;  2UYB A;  2R1B A;  4QX3 A;  4XQD A;  4CDW B;  4KI5 M;  4Q0P A;  3T2P A;  1GP4 A;  3ZSM A;  1AYM 2;  4R52 A;  2W08 A;  4XAB A;  1GIC A;  2YBS A;  2PFW A;  3I2H A;  3U78 A;  4DOU A;  4FTE A;  3THT A;  1OVP A;  4KG0 A;  4AQ6 A;  3OYW A;  3POE A;  4CDU B;  2VZP A;  3I3D A;  3POY A;  4N9I A;  3WSO A;  3ZLI A;  4AOC A;  1VPH A;  1RIT A;  1JMU B;  4PBO A;  1ZZ8 A;  1UMZ A;  1DGW A;  4L8Q A;  4L92 A;  4D8M A;  1NZI A;  4N8M A;  2GH8 A;  1H1A A;  2ZGS A;  4E4D X;  2WYF A;  3I3M A;  2JE7 A;  3C7E A;  5LAS A;  5CFD C;  3ORJ A;  4WBB A;  5EZW A;  5C8C A;  2CL2 A;  1RHI 3;  3L2Y A;  3ITQ A;  4GQ7 A;  5IT6 A;  4DY3 A;  5EV7 A;  2XWJ B;  3B5L B;  3W9A A;  1MQT A;  5HV0 A;  3WDY A;  1GAN A;  1XE0 A;  1RUD 3;  4EN9 B;  3K4D A;  3QH6 A;  1WA4 A;  2RG4 A;  1J83 A;  1W6O A;  1C3H A;  3MIF A;  4E27 A;  1NUK A;  4A3Z A;  2V5D A;  5IWF A;  4Q0S A;  2HWD 2;  2YGM A;  2EXI A;  1I5Z A;  2VG9 A;  3GCX A;  5FP8 A;  2G9F A;  4MLO A;  5B4X A;  4AVS A;  3VBO C;  1TG7 A;  1KJR A;  2PHX A;  3RI8 A;  4BE3 A;  4WM8 A;  4TYS A;  4BWO A;  3FUO A;  2BNN A;  2LAL A;  3I2I A;  3ZN4 A;  5D21 A;  5JOZ A;  3V0A B;  1QJX 2;  1HB2 A;  4IV3 C;  2P17 A;  3SEE A;  4GZ9 A;  3T1M A;  2JDN A;  2XJP A;  4E9K A;  3CKH A;  3WNN A;  4B4P A;  5DG1 A;  1PMJ X;  1WMX A;  3AKQ A;  1UY1 A;  1UU6 A;  3ZXJ A;  5J36 A;  3ASI A;  1OC1 A;  5F5A A;  2O0O A;  4NHL A;  4EWE A;  2BV4 A;  2DTW A;  3O7O A;  4GH4 A;  5DUW A;  3BPZ A;  4NAO A;  2DVA A;  1YFY A;  4TLF A;  1COV 1;  1O5U A;  4BQ5 A;  1G9C A;  4FT8 A;  4XAC A;  4LBQ A;  5LA2 A;  1CJP A;  4A7Z A;  4CCM A;  4F83 A;  4XFC A;  5AC9 3;  4EJR A;  1SMV A;  1EAH 2;  2IXI A;  2P3I A;  1MZE A;  4MGK E;  1S2K A;  2ZPX A;  1ZRR A;  5EP9 A;  3MV0 1;  2HWB 1;  1GMM A;  4QGM A;  4KQ7 A;  2RJK A;  4AVB A;  2JDY A;  2D3R A;  2ADD A;  3I49 A;  3WXP A;  3A22 A;  2CYF A;  2ZAC A;  3FX3 A;  5ERL A;  4DXT A;  3LOB A;  1VBC 1;  2IVI B;  1W8U A;  5FR3 A;  4M3C A;  2LUW A;  3AMM A;  2C0Z A;  2VUA A;  4Q8K A;  4Z1V A;  3I3B A;  2BOJ A;  3H8X A;  4R9B A;  3NNM A;  4CEY B;  5FZI A;  4J1X A;  2VW1 A;  1GZC A;  3WQ7 A;  2W92 A;  1TEI A;  1GQH A;  5E6H A;  4YGC A;  1FV3 A;  2P3K A;  5FXW A;  5FLJ A;  4LO5 B;  3KF3 A;  2HBU A;  1A6C A;  2BBV A;  3CEW A;  3O0X A;  1B09 A;  2VVF A;  1JYT A;  2RDS A;  2WRA A;  1ULF A;  3DN7 A;  4N43 B;  3BIW E;  3T2O A;  3HQR A;  2O8O A;  5AFB A;  1N3P A;  2P3J A;  1SDW A;  3K75 B;  1YLL A;  3HJR A;  3OPZ A;  4XUP A;  3SH5 A;  4WV8 A;  4GXL A;  4L0P A;  2A71 A;  5EJ1 B;  4QDQ A;  1Z7S 2;  2ZHL A;  1MQT C;  4E8C A;  1ST8 A;  1ENS A;  4BM8 A;  2A6Z A;  3SKV A;  1U5I A;  1VBE 3;  2GU9 A;  3S5Q A;  4K1Y A;  1UZZ A;  4LUL A;  1LOE A;  1SBE A;  2FZ1 A;  3SEP A;  1OQD A;  5FQ0 A;  3LQC A;  4RGA A;  4LOT A;  3DXT A;  3GHN A;  5CFC A;  3K4A A;  1YIF A;  1ONA A;  2DYC A;  4AZZ A;  3W21 A;  4BMB A;  3LIG A;  5GZC A;  4HSJ A;  5FYM A;  3PUR A;  3WG3 A;  3M3Q A;  2VMH A;  2RS3 1;  4PIY A;  4FOY A;  1FOD 3;  5FPV A;  4XMA A;  4YW3 A;  5LY1 A;  1YUD A;  3ZYR A;  2XJS A;  1CZV A;  5FYT A;  3U07 A;  1WW5 A;  4R8H A;  4P9W A;  4RYD A;  1E5S A;  1BKZ A;  1VBD 2;  1PO2 1;  1KXG A;  1RUG 1;  1DLC A;  3I3Q A;  4YVW C;  2HWF 3;  5A3W A;  4B1L A;  1LHO A;  2JG9 A;  3ZXG A;  4GWI A;  1CX1 A;  1V6N A;  5A1L A;  1O59 A;  4IDZ A;  5FOJ B;  1RUI 3;  1ZYB A;  2WSV A;  4PI0 A;  1JHJ A;  1XNB A;  2VCA A;  3NO8 A;  3ETP A;  4KGQ A;  5C4W A;  2EXJ A;  4XFI A;  2GAU A;  3M2M A;  2V09 A;  2UWA A;  3B9I A;  2A3W A;  5EWS A;  4QKN A;  1AR9 2;  1FAT A;  1C8M 2;  3AYE A;  3OEB A;  5KWR A;  1O8S A;  4JAA A;  3BI3 A;  4QGL A;  5D1I A;  3TN9 3;  4MGQ A;  4V2V A;  5FFO C;  4CUA A;  4HVQ A;  4XFA A;  2VZV A;  5KBF A;  1LED A;  2Y0I A;  1ZRF A;  3AKS A;  1PM4 A;  4OYU A;  5I8T A;  5AVP A;  4EWD A;  1R1Z A;  3VBS A;  1NZC A;  3PTR B;  3PHM A;  5TSW A;  5IHR A;  1W6Q B;  2YMZ A;  2Q1M A;  4JDM A;  4AGV A;  2AR6 A;  5KHK A;  1Q3E A;  1J59 A;  4N53 B;  4IEQ A;  2A5Z A;  2YV8 A;  2JEN A;  3LPG A;  2D43 A;  1BBT 2;  1OVS A;  1IQD C;  2NPI A;  1O6U A;  5FPU A;  4LKE A;  1D4M 3;  1QEX A;  4EN6 B;  1S2E A;  5FZD A;  3AZY A;  3V0B A;  1UOG A;  4NMI A;  5FY1 A;  3H8O A;  4XYX A;  5IVJ A;  2ZGP A;  4F7Z A;  4WZF A;  2WNV B;  1MEC 3;  4G4F A;  3POS A;  2VZS A;  1EPW A;  2HWD 1;  2PHW A;  4I0B A;  2XPJ A;  1GNH A;  3RG0 A;  2KXL A;  1W6P B;  3BGA A;  3ZKY A;  3W5N A;  2ZKL A;  3D0J A;  3CNA A;  2WUH A;  1ULG A;  5FY8 A;  3W20 A;  1J3P A;  2W1U A;  3APB A;  3HIF A;  1CAU B;  1OLR A;  2HYK A;  1HB4 A;  2JKB A;  3KMH A;  1ZBE 1;  2XL9 A;  2YU2 A;  4UW5 A;  1RJ7 A;  5CFC C;  3J7N A;  1SLA A;  5ANN A;  3GZE A;  2XQR A;  4DIQ A;  1JI6 A;  1Y9M A;  4CP2 A;  2ZGL A;  4COY A;  1G9B A;  3WUC A;  4GB3 2;  2MEV 1;  1QIQ A;  2DVD A;  2P4E A;  1W8H A;  2D6L X;  3CBN A;  3WG2 A;  3ZFE B;  4OHX A;  2E7T A;  1R09 1;  5F39 A;  4CP0 A;  2I2S A;  1PNG A;  1FNZ A;  1RUH 3;  4IEZ A;  1ZM1 A;  4W4Z A;  4FQZ A;  5FYI A;  3DPR B;  5DDJ 2;  3J8F 1;  3LEM A;  2R06 2;  3LWC A;  2JG8 A;  1XNA A;  1XPW A;  3OCP A;  3WV6 A;  3GJA A;  2P1B A;  2BRT A;  5JXG A;  1MS3 A;  4GWM A;  2JG9 C;  3HNM A;  5IVB A;  3LGR A;  2VPV A;  3PUH A;  1UXZ A;  5C9A B;  2VZO A;  3BOP A;  1UL9 A;  2P6C A;  3WLU A;  5C4W C;  2RS5 3;  3E97 A;  3NNF A;  5FZC A;  1OKO A;  1VB4 A;  5KXB A;  2TEP A;  4M3C E;  1H30 A;  2FDJ A;  1PK6 B;  1US3 A;  4IV1 B;  4WVM B;  3E6B A;  4RD7 A;  4HBN A;  4BH9 A;  4CEW B;  3WDU A;  4BQ2 A;  3BKZ A;  3MW4 A;  2F17 A;  4YW7 A;  1RUE 2;  2JKX A;  3IDB B;  5F3G A;  2IUW A;  4FBF A;  1BVV A;  2XBO 2;  3AVS A;  3TEY A;  3RRD A;  4QPG A;  4P9X A;  2WZ8 A;  3ZYG A;  1YWK A;  4N90 A;  4IW3 A;  1HQL A;  1YXW A;  3JD7 2;  4PIX A;  4LLF A;  1PM7 A;  4LE4 A;  3RPQ A;  3LSD A;  5BV6 A;  2RMU 2;  4NIA A;  1JW6 A;  5I0D A;  2NYY A;  3NAP C;  3QH7 A;  3VBS C;  2G9Z A;  2GME A;  4X8P A;  2X09 A;  1RL3 A;  3JBG 3;  1OA3 A;  2HJI A;  3D4K A;  1UMI A;  4QB2 A;  5B4N A;  1PIV 2;  2WFF 1;  4JGZ C;  2ZGU A;  4N7I A;  3BUC A;  1AR7 2;  4JHZ A;  2VQU A;  5C3R A;  3BYW A;  1GWL A;  4CUC A;  3PIJ A;  1W99 A;  1W39 A;  5A3N A;  3MW2 A;  4URA A;  2BOI A;  3NW4 A;  4YW1 A;  1AXK A;  2J42 A;  5LA1 A;  2DV9 A;  1XNC A;  2NZ9 A;  1S4C A;  2PAM A;  3ZYF A;  1PVC 3;  1CJD A;  1UYX A;  1XQN A;  3SQO A;  1RIR A;  4AI8 A;  5J7M A;  4IEO A;  1GZW B;  4OHW A;  1KFU L;  4SBV A;  1MS4 A;  3O1S A;  2AEZ A;  4UW6 A;  1URX A;  4J25 A;  3PVN A;  4BU2 A;  4UOJ A;  1CAW A;  1AX2 A;  2Q0A A;  4AFA A;  1AVB A;  2WLQ A;  2HWE 2;  1JXN A;  1H8T A;  3B3Q E;  5A1F A;  3I97 A;  3B9C A;  1O4Y A;  2PHU A;  2YFZ A;  4COU A;  1IGO A;  3VHR A;  1JZ2 A;  4JV4 A;  1HRI 3;  1W9F A;  4LLO A;  3JB4 C;  1NXM A;  3WZ1 A;  5FO7 B;  3OBT A;  2B42 B;  4CXW A;  1IPS A;  2I45 A;  1FYU A;  2J1V A;  4QQO A;  3UGF A;  1QJU 2;  3R6S A;  4LO7 A;  4R4X A;  3N9Q A;  5F5C A;  3ACI A;  1TME 3;  3BOW A;  4D3W A;  2ETE A;  1LOB A;  4JVA A;  3KGZ A;  1L7Q A;  1BHG A;  5FWE A;  5JVV A;  2CNA A;  1W03 A;  1OLM A;  1V6O A;  2HBT A;  1Q43 A;  2R04 1;  4CYD A;  1CX4 A;  1DFQ A;  2P3Y A;  5JAX A;  5CG9 A;  4AGR A;  1BEV 3;  2JG8 C;  1JZ8 A;  1VLN A;  1WGP A;  1UPI A;  3NJV A;  4H2A A;  5HV4 A;  4A4A A;  1C8M 1;  3FC0 A;  3Q8B A;  4EV0 A;  3WDW A;  2IFW A;  2WO3 A;  4YVS A;  3N4M A;  4XJZ A;  2D6M A;  2BWC A;  2X05 A;  1PX4 A;  2BQP A;  3G7D A;  1CQ9 A;  1S0G A;  2NMO A;  3VZK A;  2W0X A;  2UY9 A;  1AF9 A;  4MAD A;  2IXK A;  4L99 A;  4AVA A;  4GJY A;  1LOC A;  2VTF A;  1BCX A;  3T2Q A;  3LA3 A;  1SPP B;  2I74 A;  5L36 A;  2PA7 A;  2VUJ A;  1E57 A;  2QE3 A;  3ZXL A;  3OBR A;  2BNO A;  5FYH A;  1PGL 2;  3R0R A;  4WZC A;  1GSL A;  4PBP A;  5LA9 A;  1A8M A;  3WF0 A;  4F3J A;  5A6Q A;  1XC6 A;  4CDQ B;  4NPM A;  2PHT A;  2D6N A;  3ZSK A;  2BFU L;  3ZIW A;  3UKT A;  1SFN A;  4C91 A;  3IDE A;  3VKO A;  3UJQ A;  1LR5 A;  1W9W A;  1YQ6 A;  3EJK A;  3EYP A;  5DN2 A;  3KCY A;  4XIL A;  4JZR A;  3IPV A;  5FZO B;  4ES9 A;  2JDM A;  1VRH 1;  2QQV A;  3S7I A;  2E26 A;  4WM7 A;  3T4V A;  1ZBA 3;  4AYU A;  1AYN 1;  2QZ2 A;  5BYN A;  1H6X A;  2K0G A;  2YDE A;  3O0V A;  5C5U A;  3T0D A;  5FCC A;  1G6N A;  1ND2 B;  3UET A;  3IAQ A;  4CU9 A;  1NKG A;  3N7K A;  3ZFG A;  3AL6 A;  1LNS A;  5L9B A;  1YI9 A;  3VD7 A;  3WP6 A;  5KHI A;  4KBZ A;  5FZK A;  2TNF A;  1LGN A;  4Q4V 2;  2ZX1 A;  5FYU A;  2IFR A;  2ZBJ A;  3POI A;  3P5B A;  4I02 A;  4IEY A;  3N36 A;  3VD9 A;  3AXE A;  1DQ0 A;  4D7S A;  4B4R A;  4YAR A;  4FTS A;  5JR2 A;  4YVW B;  2XLG A;  1IS4 A;  3EO6 A;  1ASJ 3;  2RM2 1;  4AFD A;  1FPN 3;  3QOP A;  3CJI C;  3WCS A;  2CAU A;  5DDJ 1;  4OUM A;  3E6D A;  4XE9 A;  4OHZ A;  5CAZ A;  2OX0 A;  1GZT A;  5A70 A;  3RSJ A;  2EF6 A;  1W8Z A;  3T3Y A;  3ZYI B;  1HV0 A;  2VC9 A;  3ZMN A;  5GLV A;  3MZH A;  4TLG A;  1QNY A;  1ULO A;  3AK0 A;  2WWU A;  4H55 A;  3CL1 A;  3KVB A;  4Q4Y 3;  2R7E B;  2WT1 A;  3JB8 A;  5F32 A;  4O61 A;  4NWV A;  4ES8 A;  3NMB A;  2ZGK A;  1WUV A;  4EYU A;  2V73 A;  4EE2 A;  3AKP A;  3OBZ A;  4IGP A;  2CDP A;  2OS2 A;  3CF6 E;  3WNM A;  4D6Q A;  3RYP A;  4HMZ A;  3MF9 A;  2IXH A;  3FE5 A;  4P5H A;  2XR4 A;  2XBO 1;  2OYZ A;  4FFI A;  3WF1 A;  5JOX A;  5C70 A;  3ZVX A;  2VMG A;  2ZEZ A;  5IFT A;  3GXU A;  4HOO A;  3KT1 A;  1RHI 2;  1DQ5 A;  2K9Z A;  3JD7 1;  3ON7 A;  4LT5 A;  3LA2 A;  1J3R A;  3WW2 A;  2YZ4 A;  4ZY9 A;  4LBN A;  1ZRI A;  4R9C A;  3ZPY A;  5LBF A;  2GNB A;  1RUD 2;  4FFF A;  2QJV A;  5FZM A;  4BQY A;  2PHD A;  4L2N A;  1MZF A;  4CXX A;  5CIR A;  4JKM A;  4XHB A;  4H7M A;  4DY5 A;  1WA6 X;  2XHK A;  5IFP A;  1WLC A;  5A7N A;  2XKP A;  4XIK A;  3KV4 A;  1Z78 A;  5FZL A;  1OA4 A;  3AMH A;  4AI2 A;  3VZN A;  3WHU A;  5I0S A;  1AL2 3;  1DBN A;  1GU3 A;  1WME A;  3O14 A;  2Z42 A;  2XON A;  1QQP 3;  3T30 A;  5KHG A;  1CPM A;  3FFZ A;  2V4A A;  2NM1 A;  1CIW A;  3AKT A;  1VAM A;  1MS0 A;  3PVB B;  4D0Q A;  4KL1 A;  1W05 A;  3C7G A;  4S2F A;  3U37 A;  1BXH A;  2BJS A;  4V1P A;  3AX4 A;  4MXW B;  2WR9 A;  3BN6 A;  2ARE A;  1TNR A;  2Z79 A;  1W90 A;  5ABJ A;  2X29 A;  3ZFG C;  3D0S A;  1T2X A;  2OUH A;  2GMP A;  3NKT A;  1S0F A;  3UES A;  4NRO A;  3AJZ A;  4OMC A;  5LAT A;  3ZN5 A;  4BZ4 A;  4Q0U A;  3PU3 A;  2ZAH A;  1QJU 1;  1OLM E;  3GYD A;  5AC9 2;  2BGC A;  2AEN A;  4IEX A;  5CNA A;  2DCZ A;  1LEC A;  1VE0 A;  4LBQ D;  4AL9 A;  1DHK B;  3OGR A;  1J84 A;  4UFK A;  1RVF 3;  1YHF A;  2WNV A;  5BNP A;  5J98 B;  2P5B A;  2GP5 A;  2EIE A;  5F2S A;  1MVQ A;  5DZG A;  2VH9 A;  1UZV A;  3UGH A;  4K6B A;  2BW8 A;  4Q29 A;  2CWS A;  5CAD A;  2Y8K A;  4XDO A;  3RZG A;  5F2W A;  5LK7 B;  1ND3 C;  3HBK A;  1VBA 3;  3D82 A;  4FP2 A;  3EQE A;  2FBE A;  4LO6 B;  3RZM A;  1POV 0;  1IQA A;  4BK5 A;  3MYX A;  4XAE A;  4NJ4 A;  4Y4R A;  2G1M A;  3L2H A;  5FKC A;  1QNW A;  3POF A;  2DCY A;  3TEZ A;  3D3A A;  3F95 A;  3EB7 A;  3ST7 A;  4MGS A;  4JRA A;  2DVG A;  1VMJ A;  1PGL 1;  4P5Y A;  2ZKN A;  1AUY A;  3AFG A;  4DXZ A;  1BK0 A;  1NA1 B;  3USU B;  1DGR A;  1QHD A;  1S0E A;  4IND A;  4JGZ B;  4CDX B;  1HB3 A;  4ZZ8 A;  4UF0 B;  2HKX A;  3U4S A;  2DUP A;  2JB4 A;  3VBH C;  2WS9 3;  1C28 A;  1VBE 2;  2WT0 A;  2FCT A;  4QM8 A;  4FXG B;  3SIS A;  4CZS A;  5EXO A;  2R49 A;  3GNE A;  1NE6 A;  1RYY A;  2R07 3;  4NHM A;  2JDK A;  3SLI A;  4HL0 A;  4AAX A;  1ODM A;  2RR1 3;  1APN A;  2J1S A;  4QD2 A;  1UD1 A;  5G04 L;  3I2F A;  3RGB A;  4P9Y A;  4NHK A;  1PK6 A;  2VMD A;  1FOD 2;  1ULP A;  4CEW A;  1PGW 2;  3ZMO A;  3SH4 A;  3WOG A;  3WIN E;  4XDQ A;  1G9A A;  1QXP A;  4Q4V 1;  1SLI A;  1V9U 3;  2HWF 2;  4TZD A;  1NOV A;  2Y6J A;  4YZ2 A;  3O1O A;  1W6N A;  2VOK A;  3AL5 A;  1WZX A;  1TVG A;  2JD4 A;  3OGS A;  4BQW A;  2XQX A;  2R0H A;  3S5A A;  3MPB A;  3WNP A;  3VBF A;  1YO8 A;  5H9P A;  4AHY A;  1VAK A;  4MGT A;  2IVJ A;  2PHL A;  1TMF 3;  2R0F A;  5T52 A;  2EAK A;  3N9N A;  1LRH A;  1QOO A;  1C4R A;  2PXJ A;  2HEW F;  3RWK X;  1W3V A;  3ZFF B;  5F9T A;  4QWN A;  3PUS A;  4IXL A;  4YM2 A;  1D0G A;  3RZL A;  3PVE A;  5FWJ A;  2H0V A;  3TN9 2;  1PO1 2;  1TNF A;  4QX7 A;  1H4H A;  3Q8E A;  3AZZ A;  4COV A;  5ACA 1;  3VKL A;  4QQ2 A;  5M0T A;  4AXO A;  4DUX A;  4MYE A;  3U75 A;  4XFH A;  2A3X A;  3GJB A;  5J37 A;  2J1U A;  1Q8V A;  1HIX A;  4QQH A;  5I0R A;  2PQQ A;  5JR7 B;  1DYK A;  1JOD A;  1FXZ A;  1JYN A;  5FZ4 A;  1ZNP A;  5A3O A;  1R1A 2;  2J1E A;  5T5O A;  3J7M A;  3NVC A;  4QB1 A;  2RDN A;  4YGE A;  3URF A;  1QJZ A;  3BTA A;  1D4M 2;  1RHI 1;  1LTE A;  1SEF A;  2HWC 3;  3MO4 A;  2FDH A;  1GP5 A;  1JYI A;  4FFG A;  2OKX A;  1I6X A;  5AC9 1;  1H1I A;  2OA2 A;  4W8J A;  5FY0 A;  1XXN A;  3GZT B;  4R9A A;  3T08 A;  4ZZ5 A;  4KBB A;  2D5F A;  2EIB A;  3IKW A;  2VBB A;  1MEC 2;  1AXZ A;  4IQP A;  3VDD C;  5JPM B;  4RS5 C;  1N1T A;  2VO5 A;  5JOY A;  3HWJ A;  4XBL A;  4DUV A;  2JDA A;  1AR8 3;  2FCV A;  3M3O A;  4YZ3 A;  1XJA A;  4ARY A;  4UAP A;  1XSR A;  1NX9 A;  4OLL A;  1BMV 2;  1D2S A;  3SXW A;  3H3Z A;  2X53 S;  5FK7 A;  1GWM A;  2OPK A;  2PMW B;  3VBU B;  1NYW A;  1XBF A;  2KM2 A;  2XB6 C;  3FLR A;  3N3H A;  2Y64 A;  5F5I A;  1RC6 A;  3FLP A;  2H6C A;  1RB8 G;  4COW A;  3CQO A;  4GMP 3;  3O1P A;  4YZ1 A;  2X5I C;  5FXV A;  5A7S A;  3N7M A;  1UIK A;  3PJQ A;  5JI7 A;  5F37 A;  4RR3 A;  1ENQ A;  5LBE A;  1W0O A;  2A6X A;  5DXD A;  5JCT A;  1RUH 2;  1XOY A;  3NV2 A;  5A3U A;  3T2T A;  1VIW B;  2VCC A;  5GZF A;  2F4P A;  4KWU A;  1HN0 A;  2XJU A;  4HSL A;  4JC1 A;  5HCH A;  2E7A A;  3OOX A;  4Q4W 1;  3BU0 A;  1JYW A;  3FHQ A;  4M4R A;  1WW4 A;  2VW2 A;  4JQT A;  4CDQ A;  3MUZ 1;  1UX6 A;  3CJI B;  1RJ8 A;  2WZR 1;  3OJB A;  1DCS A;  1YQC A;  1H4G A;  4LK6 A;  2R32 A;  1AR6 3;  3I59 B;  3M3I A;  4XFB A;  4ORF A;  2EAA A;  1BK1 A;  5F3C A;  2RS5 2;  1W8T A;  5FPB A;  2J22 A;  1SCR A;  2WN2 A;  3MDP A;  2ZHK A;  1U5X A;  1QMJ A;  2B8M A;  2YRO A;  3CZU A;  3F2Z A;  4OUE A;  5JSO A;  3HMY A;  4IER A;  3W58 A;  4BJ0 A;  4FSJ A;  5FZ0 A;  4CUB A;  4BXS V;  2QKD A;  1CIY A;  5HCA A;  1WCK A;  3CIH A;  1IOA A;  2C26 A;  4DZG A;  5IK4 A;  5J1X A;  2CTV A;  1KDM A;  5A1A A;  1XSQ A;  4M01 A;  2GN3 A;  2R6Q A; 
#chains in the Genus database with same CATH homology
 3HEI A;  3NQH A;  1UWW A;  5JXJ A;  2YC4 A;  2PQS A;  4LHS A;  1JI6 A;  1KEX A;  1UYY A;  2W1W A;  4MO3 M;  3K4Z A;  2RV9 A;  4CU7 A;  2YC2 A;  4W4Z A;  4P00 B;  2BBA A;  1W8O A;  4BDV B;  3K46 A;  1XNA A;  1XPW A;  2JD9 A;  2YG0 A;  4A44 A;  4LQR A;  5JXG A;  3HPN A;  5G05 L;  3HNM A;  4Z2A A;  1P8J A;  1CZS A;  3PUH A;  1UXZ A;  2QQL A;  2VZO A;  4CVU A;  2EID A;  4LPL A;  4IUG A;  3VD4 A;  3C8X A;  1K42 A;  2CDO A;  1US3 A;  1SDD B;  2Y6L A;  3MV1 1;  2JKX A;  4DXS A;  2VM9 A;  2BGP A;  1JU3 A;  3VDC A;  2VMC A;  2WZ8 A;  4PQQ A;  2WBK A;  3CZJ A;  2WZE A;  5I0D A;  3I3E A;  2E31 A;  4PT6 A;  2X09 A;  4QB2 A;  2W47 A;  1UMI A;  5B4N A;  2W9X A;  4RN5 A;  2QBX A;  4JHZ A;  2VQU A;  4CUC A;  5FUI A;  1W99 A;  4QDS A;  5LA1 A;  5DQ0 A;  2Y6G A;  2ORX A;  4A6O A;  1UYX A;  2QQJ A;  2VZT A;  5JUV A;  4UOJ A;  3ZM8 A;  3WQB A;  4DEV A;  3UNP A;  2W95 A;  1UZ0 A;  3IAP A;  1JYV A;  2VZU A;  2C9K A;  3I97 A;  1SG3 A;  2YFZ A;  1JZ2 A;  2QQI A;  2B9V A;  3ACG A;  2WDB A;  4P02 B;  4XUR A;  4ZXE A;  2YB7 A;  2J1V A;  1PMH X;  3LEG A;  2L9L A;  3ACI A;  1I5P A;  5CZK A;  4A42 A;  1GOF A;  1L7Q A;  1BHG A;  5EIY B;  1UY0 A;  4XUQ A;  2W1S A;  4JKK A;  4P08 A;  3THC A;  1JZ8 A;  2VQT A;  1OT5 A;  3NJV A;  3DYP A;  4A4A A;  4CU6 A;  2J1R A;  2VL4 A;  2WO3 A;  2X05 A;  5LCW L;  1PX4 A;  2VOT A;  2J1A A;  1UYZ A;  2B4K A;  4QX1 A;  4TTG A;  5C7G A;  3DYM A;  3HNB M;  4MAD A;  3WF4 A;  2QQK A;  1US2 A;  1JZ3 A;  2VTF A;  3T2Q A;  1K12 A;  3NJX A;  1JZ4 A;  5C71 A;  3GGL A;  2W5F A;  2VCB A;  2V4V A;  2ZEY A;  3WF0 A;  1JU4 A;  1XC6 A;  4A41 A;  2WAA A;  2QQM A;  4XUN A;  2W94 A;  3CMG A;  1W9W A;  4ARX A;  1JZ6 A;  3DYO A;  3EYP A;  5DN2 A;  4MOA A;  4JKL A;  2WN3 A;  3I2K A;  5JXI A;  4M4P A;  1CZT A;  2J7M A;  4DXR A;  4QDR A;  2E26 A;  4DUX A;  1H6X A;  3T0D A;  2WO2 A;  3UET A;  3C7F A;  5JMO A;  3IAQ A;  4CU9 A;  1NKG A;  3MUY 1;  1DYO A;  1LNS A;  3NNG A;  1JZ7 A;  3VD7 A;  4TXW A;  1OD3 A;  1UXX X;  1UX7 A;  3HOB A;  1SHW B;  3SKJ E;  3C7O A;  1F4A A;  2W1Q A;  1EUT A;  3VD9 A;  1OH4 A;  5JR2 A;  1GUI A;  2LW8 A;  3ABZ A;  3LE0 A;  3NRU A;  3CDZ B;  4GWJ A;  2XHN A;  2YFU A;  1GOG A;  2VC9 A;  5CYY A;  3ACF A;  1UY3 A;  2E33 A;  2JE8 A;  1ULO A;  2XOM A;  1MPX A;  5HPO A;  2WQ8 A;  2KD7 A;  2R7E B;  2VJX A;  4LKS A;  4XZU G;  3T0A A;  3FL7 A;  2WAO A;  2DCK A;  3GM8 A;  2Z4F A;  2CDP A;  2W87 A;  3WNM A;  3WNO A;  2V72 A;  3WF1 A;  4XUO A;  5C70 A;  5IFT A;  2ZEZ A;  3GXU A;  3AC0 A;  1GOH A;  4QB6 A;  2BER A;  3VD5 A;  4ZY9 A;  5IJR A;  3A21 A;  3VDA A;  3WF2 A;  3K77 A;  2VZR A;  1JZ5 A;  2EIC A;  4JKM A;  1UY4 A;  1K3I A;  4A45 A;  2BGO A;  2RVA A;  3VD3 A;  2QQO A;  3ACH A;  5IFP A;  1XNT A;  3J7H A;  2VR4 A;  1GU3 A;  3WEZ A;  2XON A;  2RJ2 A;  2W91 A;  3I2J A;  4D0Q A;  2VZQ A;  1W0N A;  3C7G A;  3U37 A;  3E1F 1;  4QX3 A;  4HG6 B;  4DUW A;  4KI5 M;  3T2P A;  3BN6 A;  4UI9 L;  4QAW A;  3I2H A;  2C4X A;  1T2X A;  1OF3 A;  1W9T A;  2Y6H A;  2VZP A;  3I3D A;  3UES A;  4OMC A;  3WSO A;  5EJZ B;  2ZXQ A;  4YPJ A;  4D8M A;  5HXM A;  4XUT A;  3C7E A;  2BZD A;  3P1I A;  3W5M A;  3OGR A;  1J84 A;  4QX2 A;  2EIE A;  3K4D A;  2WYS A;  1J83 A;  4XVH A;  1NUK A;  4A3Z A;  2V5D A;  1PX3 A;  1W9S A;  2Y8K A;  5B4X A;  1F4H A;  1TG7 A;  3JXS A;  2J1T A;  3I2I A;  4BK5 A;  3SEE A;  1JYX A;  1D7P M;  4GZ9 A;  4ET7 A;  3D3A A;  3EB7 A;  4MGS A;  3CKH A;  3WNN A;  1DP0 A;  1PMJ X;  1W8N A;  4P5Y A;  1HN1 A;  1UY1 A;  3OG2 A;  2HYX A;  5F7U A;  4ZZ8 A;  2DDU A;  2DCJ A;  1RYY A;  5LA2 A;  5LA0 A;  3WNK A;  2VZ3 A;  4AAX A;  3GDB A;  3OBA A;  2J1S A;  4PF1 A;  5G04 L;  1EUU A;  2VME A;  3MV0 1;  3I2F A;  2VMD A;  1ULP A;  1GMM A;  2Y6K A;  3A22 A;  4DXT A;  3HN3 A;  2QQN A;  2Y6J A;  5IYY A;  1TVG A;  3I3B A;  3OGS A;  3A23 A;  2XQX A;  3WNP A;  4JX0 A;  2W92 A;  3LEK A;  2LS6 A;  1R64 A;  1GQP A;  4DEQ A;  3P6B A;  3T2O A;  3K75 B;  3WNL A;  3HJR A;  4XUP A;  1NAE A;  5DPN A;  4L0P A;  5DMY A;  5EJ1 B;  4QDQ A;  1WCQ A;  4E8C A;  1UMH A;  2E32 A;  3THD A;  3SKV A;  2W46 A;  5JXH A;  1H6Y A;  4OMD A;  2VMF A;  1UY2 A;  3SEP A;  3VDB A;  2J1U A;  3LQC A;  1O8P A;  3K4A A;  2HLE A;  2WAB A;  3OEA A;  3T09 A;  3FHA A;  1JYN A;  2J1E A;  1WKY A;  2X10 A;  4QB1 A;  1GNY A;  4QX0 A;  4E8D A;  3MO4 A;  1CZV A;  2OKX A;  2VZ1 A;  4W8J A;  3T08 A;  4RYD A;  4ZZ5 A;  1DLC A;  4AG4 A;  2EIB A;  3FN9 A;  4KMQ A;  4GWI A;  1CX1 A;  2VO5 A;  1O59 A;  1JHJ A;  4DUV A;  2JDA A;  3IB3 A;  1KGY A;  2VCA A;  2ORZ A;  3III A;  3OGV A;  1NX9 A;  3ETP A;  4UAP A;  4ARY A;  3DEC A;  3ECQ A;  2ZEX A;  3WF3 A;  2Y64 A;  4FI9 A;  2W3J A;  3HNY M;  3OEB A;  1O8S A;  3CQO A;  4QPW A;  4MGQ A;  4CUA A;  3PUI A;  1K45 A;  2VZV A;  3T0B A;  4CU8 A;  4OYU A;  2ID4 A;  2WO1 A;  4W50 A;  2VCC A;  4BK4 A;  3A7Q A;  4KWU A;  3C7H A;  3IDA A;  5IHR A;  3I2G A;  1JYW A;  3FHQ A;  4M4R A;  1OF4 A;  3MUZ 1;  3LPG A;  1IQD C;  4OZO A;  3LEI A;  2J22 A;  2ZEW A;  2WN2 A;  3F2Z A;  3CZU A;  4OUE A;  1YQ2 A;  4BJ0 A;  3LPF A;  2VZS A;  4CUB A;  1L7R A;  4BXS V;  3OB8 A;  3W5N A;  3MBW A;  3BGA A;  1CIY A;  2WUH A;  3CIH A;  2C26 A;  2W1U A;  5J1X A;  5A1A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...