3FC0A

1.8 a crystal structure of murine gitr ligand dimer expressed in drosophila melanogaster s2 cells
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
123
structure length
123
Chain Sequence
SCMVKFELSSSKWHMTSPKPHCVNTTSDGKLKILQSGTYLIYGQVIPVDKKYIKDNAPFVVQIYKKNDVLQTLMNDFQILPIGGVYELHAGDNIYLKFNSKDHIQKTNTYWGIILMPDLPFIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords GITR ligand
publication title 1.8 A structure of murine GITR ligand dimer expressed in Drosophila melanogaster S2 cells.
pubmed doi rcsb
source organism Mus musculus
total genus 26
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3fc0A00
2O0OA 1OQEA 2WNVA 1C28A 4HT1T 4QQ2A 3ALQA 2HEYF 4G3YC 5BNQA 2OIIA 2AZ5A 4MXWB 4E4SA 2TNFA 3LKJA 2Q1MA 1KXGA 2R32A 4NN0A 4QQPA 2RJLA 2HEWF 2WNUA 4MXWA 3IT8A 1OSGA 1GR3A 1JTZX 2KA3A 4J6GA 4OUMA 5CIRA 2RE9A 2ZJCA 1I9RA 1A8MA 3L9JT 4KGGA 2QE3A 2JG9C 2JG8A 3AB0A 4MXVA 1DU3D 1WCKA 3QBQA 4GIQA 1XU1A 2JG9B 4EN0A 1ALYA 1D4VB 4RSUA 4F3JA 4N90A 2R30A 5KC5A 4OUSA 1IQAA 4KG8A 3WD5A 2JG9A 3FC0A 2RJKA 5L19A 4DOUA 3TYJA 5KC6A 4QPYA 3B9IA 3MI8A 1KD7A 1RJ8A 4TSVA 2R6QA 2Q8OA 1C3HA 2QDNA 4OULA 3K51A 2ZPXA 4TWTA 2WNVC 3B94A 4DB5A 2HEVF 3QD6A 3V56A 1U5XA 5TSWA 5HBAA 4QQOA 1RJ7A 1OQDA 2WNVB 4D7YA 5KWRA 4E4DX 2Z5WA 1JH5A 1TNFA 1PK6C 1XU2A 4QQLA 1U5ZA 1TNRA 2WNUC 1PK6B 2X29A 2E7AA 3URFA 1S55A 2WNUB 1U5YA 4MSVA 1PK6A 3ME2A 4KGQA 4G4FA 3B93A 3K48A 4QQHA 2JG8C 5L36A 2TUNA 1D2QA 1D0GA 2JG8B 1O91A 1DG6A 3TWIA
chains in the Genus database with same CATH superfamily
2VMEA 2PMWB 1FYUA 3NJVA 5FMOS 1R1A2 2EAAA 3MF6A 1O3RA 3FFQA 1L7QA 4R4ZA 2GNTA 1W0NA 1PMJX 3WNMA 1CZSA 4CUAA 4FVVA 2WA3A 1AL21 3DV8A 2WIIB 4HSJA 2QQMA 3OYWB 1RUC2 1S1AA 2KXLA 5FREA 3KV6A 4W6WA 4NN0A 5FUNA 4AGRA 2HWB1 3MLJA 1QJEA 4CXWA 1IGOA 2ZMKA 1IG3A 4JCKA 4FSJA 3OOXA 1POV1 1XSQA 3NNJA 4CCOA 1Z7S2 4DEQA 5A1AA 2V5YA 1A8MA 5ISLA 1ND3A 4MG2A 3OGJA 1H2KA 5C3PA 3T08A 2EF6A 3KV9A 4CZSA 3VBSB 2BOJA 4JKLA 1ZRIA 5FZAA 1QMJA 3KM5A 2FHRA 3SMHA 2DV9A 5JLVA 4QM9A 2VBDA 1MQTC 3LFIA 4QDRA 2FDHA 3ELNA 4Q2FA 5A7PA 2ZS6B 4CEWC 1JHNA 4DMIA 2ZZQA 3ZXDA 4AHYA 4IE5A 3TBDA 1EAH2 4AHWA 1UZZA 3FJSA 4LKSA 1AYM2 4KWUA 4EZHA 4AEKA 1NYWA 5I91A 1OLMA 1SFYA 1HKDA 3SHRA 4FPEA 2VM9A 1LHWA 2VUJA 2R062 3H42B 1PO11 4ZXEA 5L9BA 1I5ZA 1MS4A 4CU8A 2WJSA 5LK5A 1UY2A 2E32A 2J1TA 2TEPA 3LIGA 3MI8A 3SISA 3DYOA 2ZGNA 4PLNA 4SLIA 3WG4A 3J8F1 3WF4A 4A6SA 2JDNA 2WS93 4AVTA 1OA2A 3B94A 2KM2A 3ORJA 3POBA 3WW4A 3V56A 4DUXA 4PIZA 5HBAA 3RDIA 2RR11 1LU1A 1J84A 2XKPA 3D6EA 4LIVA 2DYCA 4S2DA 2DCJA 5A80A 4EYUA 4OI4A 2QKDA 2ZGQA 3POEA 1HX6A 5KHKA 3N9QA 1SPPA 1VB2A 1AXYA 1V9U3 3B3QE 4MHRA 4HETA 1GSLA 2JB4A 3W5MA 3P3NA 4XQWA 2R073 2ZGLA 1U12A 3WNXA 2Y34A 2R042 2XLGA 4YGDA 1NLRA 4FBFA 2WWSA 4OYUA 3WLUA 4CCCA 3LEIA 4U36A 1WA4A 5K0UB 1XNBA 4P9WA 3UKVA 1JYCA 2JG8C 4C8DA 1I5PA 2W92A 2OUHA 3MIBA 3ZN6A 4EWEA 5DG1A 1LOGA 3DGTA 2VNGA 3C3VA 3RS6A 2D6MA 2FQPA 4L0PA 1LOFA 3M2MA 4RR3C 3GBWA 2C24A 4ZZ5A 4E2GA 1FOD1 3VZJA 3MV11 4M0HA 1EYBA 5DABA 5FPLA 3AFGA 4S2HA 1NLSA 3THCA 4D6QA 2A3YA 2YPDA 4PLOA 1NT0A 2VZRA 3VZKA 5IVFA 3LDBA 3THDA 4P9GA 2EXHA 5KXEA 2WZR1 4AE2A 5F2WA 2WT0A 4PDWB 5EYYA 2CHHA 3K4ZA 5FYMA 1UW8A 2FDJA 4AEMA 1OD5A 1CAVA 3I2GA 5DXDA 2VW1A 4LT5A 1AZDA 2X05A 1ZRFA 3SCHA 2OZJA 1A34A 5I0TA 2XKOA 3UKTA 3IT8A 2FCTA 1JTZX 4U2AA 4EZ4A 2BWAA 5IYYA 4MGYE 3VBUB 1TEIA 4K1YA 2RE9A 3WDWA 3MF9A 4A41A 4QKFA 3NVCA 1XBFA 4LE4A 4AEDB 2C6SA 4MH0E 4B8EA 1BMV2 3BU7A 3IKWA 5SV5A 2PAMA 1MEC3 5FZEA 3WP4A 1S0BA 1AUYA 2JXAA 5I0UA 3LOBA 1HRV1 1OXCA 3LF7A 1EAH3 3ACIA 3DN7A 4EWAA 5FV3A 4IEWA 2CAUA 1V6IA 1D4M3 3IPVB 5BY5A 2QVSB 1AYM3 4ISRA 2YG0A 3PVBB 2W1SA 2WO1A 4JTNA 4XMAA 1CJPA 1M4WA 3LDRA 2R063 3AP6A 4GB31 4YG0A 3TN93 5KC5A 5LK7B 3AZZA 4KG8A 2D40A 1FPN2 3FMGA 3LE0A 4LLFA 4S2GA 2JDMA 2BRTA 3BIEA 4YVSA 1CESA 1FMD1 2Y6LA 1H9PA 3WINE 2CV6A 1MS0A 3BTAA 3NV4A 5GZGA 1ENRA 2D7FA 3OD0A 1VBE3 1YWKA 3RI8A 2DUQA 1HB4A 1RJ8A 4NHXA 1T2XA 3HNMA 1W6MA 4B3NA 1EV11 2PLV3 2VMCA 3PMEA 3UKNA 4XZPA 1CVNA 5FZOA 1XYNA 1CD3G 4FAHA 4HPKB 1QJX2 3TRSB 4DPNA 4W50A 1VLNA 3KZ4C 4KBBA 5GLZA 2A71A 4META 2DWRA 4BK4A 5C4WB 4TXWA 4JDNA 4NRMA 5DDJ2 4BA6A 4CP1A 4MGQA 1VMHA 4IGOA 2ZHNA 1GU3A 1E5HA 1ULPA 2VZTA 1UPIA 1KDMA 2DF7A 4N43C 3PNAA 4GXLA 4UFKA 5JZGB 2HWC1 3TEWA 4CEYB 3ECQA 1H8TA 3MV01 4A3XA 5A33B 5L7OC 4WZCA 2WNVB 4Y3OA 1IS3A 1FV2A 2R0FA 2ARXA 2ZBJA 2VOKA 3LZZA 4PJYA 1DHKB 2QQOA 1O8SA 2BYVE 3WDUA 3K4DA 4MHUA 5FZ4A 1GQHA 4BK5A 4K3UA 3EMRA 4IXLA 1PK6B 3WF2A 3RJ2X 4QPIA 2R043 2ZACA 4UWDA 2AENA 1DBNA 4QXCA 1S55A 4URAA 2H6CA 2X53S 2AH2A 1MZEA 2G4IA 2W52A 4Y1VA 3AX4A 4QPGB 1PVC2 4QMAA 5FLJA 5CEHA 1CR7A 3CBNA 3KT1A 3HT2A 1BXHA 2ET1A 2Z79A 3CQOA 3J9SA 4HMZA 4B4PA 1VBA2 3QCWA 2W5FA 2QZ3A 1TMF1 4Y1UA 3WF1A 3OY8A 2VR4A 1DGWA 2PFWA 1O4YA 3HBKA 5KHJA 5EPAA 3N7JA 3AP5A 3M3OA 4L2NA 4AHZA 1OBNA 2DU0A 1DLLA 1OA3A 3IDAA 1WUVA 3N9PA 1GMMA 2XVLA 4XXAA 4R9BA 2QUOA 4LK6A 4XF9A 4CPBD 4YW2A 4FTEA 2ADDA 1S4CA 3WSOA 5J96B 2XJVA 2Y6JA 1VBD1 3AFKA 2J1UA 3ZXEA 1ND3C 4FXGB 2WO2A 1AL22 4WVVA 2XJPA 3W59A 3I2JA 4GAZA 1VBC3 4YZ4A 2UWBA 1YC61 5H9SA 3UNPA 1DGLA 5FP4A 2HWB2 5AC91 2W3JA 5JI9A 1OUXA 4C1XA 3HIFA 2W47A 3A4UA 2KA3A 1GBGA 2HWE1 5HPOA 4UFMA 1F31A 2A70A 1V0AA 5CBLA 4NUBA 2ZJCA 2XJTA 5E1RA 3J7HA 5FWJA 2XPJA 3E6DA 4Z2WA 4H14A 4CDWB 4JC1A 4JRLA 3I97A 3BALA 2IVIB 1BEV1 5B4XA 1XB9A 5GM0A 4EN8B 3GCWA 2WT1A 3I2HA 1W2TA 4B4QA 3AMHA 1OOPB 4CCLA 5F37A 2IVJA 1VIWB 2JG9B 2V73A 2YGLA 2ZHLA 4C0BA 2GMMA 2LUWA 5D1IA 5FYIA 5DQ0A 2ZGKA 3JXSA 3OGVA 1Y4WA 4TLFA 4QGLA 3W5NA 3VDDA 3USUA 2TBVA 2R16A 1TZOA 1O59A 2Y6KA 2YU1A 3J26N 4IUGA 5A7WB 4AI9A 3RSJA 4ARXA 5J37A 2VZUA 1WCUA 4W6YA 4FPCA 5FCCA 4CRQA 1PO12 5LRSA 1NY72 4I09A 2JX9A 5C9AA 1OLME 4A7YA 1V6NA 1W28A 2XVGA 4MGTA 4UXAA 3T2PA 1R093 2GNBA 3E5XA 5DDJ3 2QDNA 2N7GA 3J8F2 2NMOA 4QM8A 5JSOA 4PBOA 2VCMA 2J7MA 3PUIA 4GMP3 5T5JA 4P9JA 1G9CA 5JR7B 4JQTA 2C26A 2A3WA 4AVSA 3ZPOA 2Y6GA 2RR12 4LULA 3VBFB 3O1VA 4LOSA 3WOGA 5DG2A 2Z5WA 1V6OA 4S2FA 1GNZA 1GZCA 3ZFGA 2ATFA 3ES4A 2JKXA 1NCRB 2VC9A 1H1IA 1UKRA 4XABA 2WC2A 4QQLA 3UV9A 4NIDA 4XTPA 3ZXJA 1QKQA 4SBVA 4PF5A 2XHKA 1PVC3 3FL7A 3MLLA 3PIGA 5FIXA 3BTXA 1LOFC 4OHWA 5FPAA 1N47A 2CGOA 5F6KA 1QOTA 1FATA 1UMHA 5LZ6A 2Z4FA 2VZ3A 1W6PB 2GP3A 1J83A 1ZZ6A 5DUXA 3BI3A 1G9BA 1H1MA 1GQGA 1JU4A 1WCQA 2WS91 3VBOA 1O3SA 4QT6A 4RA0A 1SBFA 1LGNA 2NQYA 5LEKA 1OA4A 3UL2A 2B8MA 3X29B 2BVVA 4FP2A 2P2KA 3PU8A 4B1MA 1LNSA 4AG4A 1G7YA 4DIQA 2QQKA 1DQ0A 3TWIA 4XJ9A 5IVVA 3KMHA 2VQUA 2XB6C 1SZBA 4BHPA 5A3PA 1XNKA 3HN1A 1EP0A 5D8AA 1HB2A 1JZ2A 2QCSB 1C8M2 3ALQA 3HEIA 1A6CA 1V9U1 1X82A 3I49A 5IUQA 1CAXA 2JECA 3CZUA 4FTBA 4IW3A 3WZ1A 1N1SA 2Q1MA 2R071 2QZ2A 3NNGA 1Z78A 2WNUA 4QX3A 1UZWA 4RD7A 2BFUL 2W9XA 2VCBA 4BQ3A 5CIRA 4YNIA 3ZYHA 4UF0A 1X33A 4ISQA 2VW0A 4D7SA 3WDVA 3RQ0A 3GZUC 1Y9MA 1HQLA 2UYBA 3FLTA 1LEDA 3BCWA 2ZGTA 4O7XA 1AX1A 2RS33 1PZ9A 3Q8AA 4CCMA 3FHQA 1XE0A 2B46X 3IIAA 2JJ6A 3WDYA 5JWPA 2GC2A 1JYIA 3PVOA 5FZBA 2J1VA 3HOBA 4Q4V1 4YW5A 4HVQA 5A3OA 4RSUA 3SITA 1LHVA 1F8VA 1IQDC 1ZRDA 2UY9A 2AR6A 5IWFA 4GB32 4YVWC 3IN9A 3HWJA 1DIWA 1H6YA 3VBRC 3WD5A 4OHYA 1JZ8A 4N43B 4DOUA 1OFSA 3NJZA 1REEA 2PN5A 5CG8A 4RL7A 5FYTA 1FMD2 1F4AA 2HLEA 5CFDC 5GKAC 5J09A 1H8TC 4Q8LA 3RFRA 1BBT2 2R1BA 3J8F3 1OF4A 3ZN6B 5C3SA 3NKTA 3PL0A 1RHI3 2RS53 1EV12 3D3AA 3OTFA 5ANNA 5H9QA 2D5HA 3ZN5A 1QXPA 2ZGPA 3IBMA 3RMXA 4QU1A 2RR13 1NE4A 4PBPA 5FY9A 5FUIA 1MEC1 1GWKA 4XUQA 4HKLA 4MADA 4BE3A 1XXNA 2BVBA 4FPOB 3MW3A 2HWC2 2ARCA 1EAH1 1ZM1A 5IK5A 4M4RA 3ZN4A 3DYPA 1D4M1 2WYFA 1JUHA 1ULFA 1JH5A 1AYM1 2VNOA 4FP3A 1RMU2 4L8QA 3SH5A 3I2IA 1S0GA 3KVBA 4AFDA 1BVP1 2R061 2RS13 3CDZB 2D6OX 1WW6A 2OPWA 4QDQA 4EN9B 1IPJA 4L97A 2XWBB 2WZEA 4P9LA 4RFT0 4XFGA 3CJIC 4FFIA 5B2GB 5I0RA 3RI9A 2E6VA 4GQ7A 1IKPA 4WM8B 1CWPA 3MUY1 1Q8SA 1IS5A 1VBE1 4UFLA 1W2OA 1SCRA 4YG3A 3ITQA 3RMYA 5A1FA 2XLFA 5KHHA 3BIWE 2MHFA 2PLV1 2H0VA 3KLSA 3VZNA 1H8VA 2WLPA 3HNBM 1T6GC 1RUJ3 1TMF2 3KV5A 1NG0A 1F15A 3ZIWA 5CZKA 1SLLA 4ASMB 4I0AA 4LBKA 4QHBA 1O91A 3AJYA 2DFCA 4XMIA 4ZS3A 5KXCA 4W4ZA 1C8M3 4LQRA 3WF3A 1QXJA 1YHFA 1C28A 1H1AA 2W0XA 3AP7A 5T54A 2DFBA 2FMDA 1YNAA 3A7QA 3LD8A 4YWAA 1N3OA 1VB4A 1UYXA 1OC1A 5FK7A 3ZFFA 5GZEA 1VBD2 4COWA 3Q8FA 1W6OB 1H2NA 1LOCA 1JYTA 1PO21 1UY0A 3JCIA 5FRAA 2ZX2A 2BNNA 1COV1 4HL0A 4LBQB 2RHPA 3WNNA 1LAJA 2UWAA 5I93A 5T55A 4JAAA 1WCSA 3AMNA 3NJYA 1S0IA 1W9WA 2JE8A 2WDBA 1MZFA 5CNAA 5LA1A 3LCPA 1W8FA 3SLIA 4ASKA 4BB3A 2JWPA 2OT7A 3MIEA 1DQ1A 4LE3A 4LKDA 4AF9A 2VMDA 5JOZA 2VCCA 3WUCA 2B45X 4Q0UA 2GNMA 4XYXA 4P5HA 4QKDA 3VDDC 1JZ3A 1BEV2 2BQPA 1KITA 4RN5A 2JG8A 2J42A 4XF3A 4NE9A 2BV4A 3VLBB 4EWDA 3S5AA 3WNPA 1L7RA 4IDZA 1URXA 3T1LA 1QDCA 1EUUA 3OEBA 4RR3A 4JHZA 3OPWA 1R083 4F3JA 1MZ6A 4Z1VA 1JYXA 3I3MA 1FX5A 5J3UA 1FMD3 1IQAA 2IXJA 3NAPB 4CTEA 3OBAA 5IATA 3TEYA 1VBC1 2JDKA 5ERLA 3HPNA 1TG7A 1QJFA 1BBT3 1I3HA 5EYXA 3LIHA 1LESA 1UD1A 1EV13 4Q0SA 3RJRA 4YYOA 2WINB 2AYHA 4OHZA 2ENRA 4Y5Z0 3GALA 1BMV1 4X8NA 4JGZC 4OZXA 5FXWA 5HV0A 3ZFGC 2O14A 1Q8QA 1XNAA 4IV3A 2HWF3 2D98A 4QB1A 4EROA 2HWC3 1RUF3 4DXTA 1S2EA 3AZYA 1ZZ8A 4K8FA 4Y1XA 3WQ0A 2LRPA 4TLGA 1ZZ7A 1RMU3 2VQ0A 4QQOA 5KXDA 1MPXA 3HNYM 3AZXA 4MGKE 4D7YA 1WMXA 1GOFA 1NQDA 4N53B 4OVEA 3LAGA 1JOPA 4RS5B 1DFQA 2VAUA 1ZZ9A 5FY0A 4COZA 2WFPA 4GKXA 5HXMA 2YC0A 3ETQA 1YO8A 4XF0A 3VBOC 1CAVB 4AZZA 3IDEA 3USSA 2X29A 3RRDA 2IXIA 1S2BA 5F7UA 2XH6A 4LHNA 3WDXA 3ZFEB 4ATFA 1VMJA 2W2IA 3UT0A 2FDFA 3PMSA 1QGLA 5CFCC 2OPKA 2Y60A 4KBZA 5FXVA 3VB9A 1R091 2E7QA 3WNKA 5FFOC 5DDJ1 4JX0A 2YMZA 3B93A 1YFUA 2BGPA 3M4FA 4RYDA 1LEMA 3UGHA 4XBNA 2WS92 3OGGA 1MS5A 1WLCA 3P6BA 3ZXFA 4LNVA 4GMP1 3H0OA 2ID4A 1WD3A 4JGYA 5BPXA 3KCYA 3N7LA 4OMDA 2CY6A 2Q8CA 1Z0HA 4E8DA 1W9SA 2D3PA 4HANA 4NR1A 2E26A 2GC1A 2GC0A 1CN1A 2V4VA 2I2SA 1RUD3 3B01A 2BBAA 1VBD3 1N3QA 4KMQA 4I0WB 1RUE1 3S0MA 4QWNA 2BDRA 5L7OA 2Z2SB 4LBJA 5FQ0B 1RVF1 1V9U2 4DQAA 2GP5A 1QY4A 5A7OA 3I7DA 3RG0A 1LOBA 1PVC1 2DBNA 4QAWA 4RGAA 1PGL1 4YVSB 1NCQA 4PI2A 1SEFA 3I2DA 3MEPA 2R072 4AFCA 4YW7A 2FZ1A 2DVFA 3LA2A 3PVEA 4LO4B 1Q8VA 4NWWA 5EJ1B 5A7NA 3W20A 5ABJA 4MXWA 5CA6A 1CAUA 1PM4A 3H8UA 1OSGA 2VOTA 1S0FA 3H3ZA 4NHYA 1F35A 5FKBA 4NPMA 4A3ZA 2CWSA 1XNDA 1DZTA 5FZOB 1ZA7A 2WWJA 2YPJA 5LY1A 2I45A 2ZKLA 5IK8A 2R7EB 5EJZB 2Y64A 4YZ2A 1J1LA 1F5FA 4I0BA 4ASLA 1V70A 2ZEYA 2Z42A 1WA6X 3B9CA 3WCRA 4BXSV 3RVHA 1JOBA 3O0XA 2XVKA 4GWMA 5LBCA 4HONA 1OLQA 4Z82A 3KQRA 4NWVA 4RHV2 5AVPA 3E5UA 3TAYA 5EZWA 1W9TA 2CL2A 3ZX7A 4Q4V2 4Q26A 1ALYA 1B35A 4D7TA 4HKWA 5FZ3A 1AR83 1O8PA 3F95A 4YW6A 5IVEA 3GHMA 2RDRA 3VD7A 2Y26A 1MS9A 2RJKA 4CDXA 4QPIB 5DAPA 5DMYA 4LTAA 1YI9A 4K21A 2WKKA 1H30A 4RQPB 1QIQA 3GCXA 1XC6A 2QFEA 3DEMA 1O5LA 2Y33A 5HCFA 1UX7A 4R9CA 4O9EA 2W94A 5JSPA 2X8KA 3B00A 3D82A 5IHRA 3EYPA 3ZKUA 5JMOA 5C5UA 2RDQA 2WAAA 5LRRA 4AI1A 5CISA 5F5AA 4BIFA 3WQ1A 2BFUS 2RS31 1MEC2 1IG0A 4QD2A 3WP3A 1AYN3 2OXBA 2WZPP 5G04L 1XYPA 4XJWA 1QQP3 4FPYA 1US3A 3OJBA 3D4KA 1D4M2 4CCEA 3UGFA 4DZGA 2QQWA 4PIYA 3T0BA 3T3YA 5C71A 4H3WA 5SV8A 4HVRA 2PQSA 1NY71 2DURA 3TEXA 1BK1A 3BYWA 2YHJA 1W04A 4P9YA 1E5SA 2GSYA 1MVEA 4ZU7A 3QACA 1JYVA 1OI6A 1Y43B 4IV1C 1VBE2 2WFF2 4K1ZA 2ZEZA 1VAKA 2Q1FA 4R9AA 2GH8A 2V72A 3KVAA 1RHI1 4YFWA 3U11A 2RS51 2PLV2 3MO4A 3ACFA 2VZQA 3IAPA 4A44A 4QX1A 3IMNA 3D5OA 4B4RA 1VAMA 1PNGA 3BN6A 4OFGA 4GJYA 3IIIA 1EPZA 4AGVA 3PUHA 3ZFFC 3SEPA 4XBLA 1QJU3 4LA2A 4YM0A 1D0GA 4IESA 1VRH2 4FOVA 4D6SA 5JOYA 2E9QA 2H6BA 3DF0A 2A3XA 2A73B 3OG2A 3RYPA 3N3HA 1XJAA 2VECA 1OQEA 2WBKA 3JD73 4FFFA 2VL4A 4OQ8A 1POV0 3ZYGA 2D93A 2RS11 4B7KA 3VBHB 4AXOA 2WN2A 1GOHA 2EVXA 1C5HA 1DQ5A 2X5IA 4HBNA 5K4LA 3USUB 1OHFA 2AZ5A 1JI6A 4C0HA 1PO22 2DDUA 1C8NA 2NMNA 4ZKTB 2VY0A 1K5MC 2XGXA 4UW3A 1COV2 5C9AB 2FDIA 3W9AA 2HEWF 3IAQA 4R8HA 1W8HA 2A75A 2PHDA 3K46A 4H2AA 4MGZE 3SH3A 3DXUA 3ZIXA 4A4AA 3BU0A 5CG9A 3VHOA 4XUTA 2BOIA 2VGDA 3WEZA 1RUJ1 1UZ0A 1WWYA 3GF6A 5GLWA 3MPPG 3KGLA 4AVVA 4P9XA 1KFXL 1NA1C 3AP4A 1OLRA 2VQTA 4LOTA 1IOAA 4RHV3 5LBBA 3B69A 2EIDA 3NNLA 3OBZA 4Q4V3 3S7EA 3MPBA 1C8M1 1RIRA 3JU9A 3FLRA 3WG1A 2IZWA 4AQ2A 1OFNA 4FQ4A 1CIYA 3O1OA 1H6XA 2R49A 1RUOA 2F17A 1LHUA 1ND2B 1V6MA 2XJQA 5FY8A 4ES8A 2VZPA 2ZAAA 3C7OA 1GQPA 4I30A 5FJKA 5BNNB 1HB3A 1VBC2 2YC4A 2PHUA 3C8XA 4IV3C 3WY6A 3BKZA 2P3JA 2QNKA 5DAQA 4IEPA 5I8TA 1S2KA 1UX6A 1ZBE3 4FFGA 4R52A 2EXJA 4XJAA 5I0SA 2V09A 1JODA 1ULOA 1IKQA 2ES3A 2VMHA 4GH4C 4NHMA 4UOJA 3U1XA 3KWVA 4C90A 2JKBA 5FPBA 4E4HA 1LHOA 3ZXAC 2JIJA 1B09A 2UWCA 5BNOC 4MVTA 1C57A 4PHZA 2GU9A 5JOXA 1OPMA 1RUH3 4NHKA 4XFFA 3WCSA 4CU7A 1V6JA 5A7QA 3U75A 1RJ7A 3I3QA 1BHGA 2QQLA 4Q0QA 4NO4A 5FDBA 4D0QA 1W6QB 2D6KA 3KS7A 4H7LA 5D8AB 1O3QA 1R081 2EXIA 1AR93 1JBCA 1YIFA 4V2VA 5FYZA 1PZ7A 5FXZA 2JDHA 1HV1A 1YJLA 4NRQA 3R4UA 1CAXB 4BLIA 4HN0A 2JD9A 2WFF3 1VJ2A 3ACHA 3MDPA 1BBT1 3HD8B 4JGYC 5E6HA 2P37A 2E7AA 4FOQA 2NP0A 5JAXA 4LBQD 4YVWA 1YRZA 2CDPA 2WNUB 2WRAA 3VBRA 3ETPA 5A3NA 3U14A 4BIOA 2G1MA 3RZLA 1R092 2ORXA 2C0ZA 3OGRA 2HBUA 1CPNA 5LA2A 2OX0A 5A3TA 2FCUA 5FKCA 2HWF1 2OA2A 5CFDA 2H0BA 1VRH3 1BYHA 4AFAA 1RUF1 4EN6B 1DQ6A 1ZYBA 4MGIE 3ROUA 3AC0A 5F3CA 3U07A 3WHUA 3I3BA 3ZDSA 1IZ3A 1RMU1 1GZTA 1HRI3 4IERA 1NCQC 1ASJ1 3TNQA 4LK7A 2YU2A 2VTXJ 2A6WA 3BOPA 4GD4A 4LO6B 4MV2A 5ABJC 1ACCA 5T5PA 5CYYA 3OSDA 1DYOA 1GP4A 5I8SA 1RUE2 2NM1A 1I1EA 4Z92B 2XJSA 1CGPA 1VBB3 3TNPB 1PO23 1X7NA 2W95A 5J7MA 3MIFA 1RVF2 1PMIA 2XQXA 4G3YC 4PLMA 4AI8A 1COV3 4IGPA 1PMHX 3PDQA 4HN1A 4COYA 1PGL2 2DUPA 2P4EA 4XIKA 4P00B 4Y24A 2BERA 3JBG2 4AOCA 2J1RA 4QQPA 5JR2A 5FLIA 1S0DA 3LA3A 4ZXKA 4OLLA 2G9GA 3FN9A 3ENRA 3S7IA 2Q1ZB 2XHNA 4JZRA 1UY3A 3B7MA 3CJIA 5LA0A 2VULA 4W65A 5A1LA 3EB7A 1J3PA 1HQWA 4CCJA 4ONUA 1JZ4A 2WAOA 3AXEA 3R0RA 4IEOA 1B35C 3PTRB 2CDOA 3PURA 5F8PA 1TE1B 2D3RA 3Q9OA 4CDXC 4E8CA 1WZXA 1E5IA 4XIOA 2GC3A 1RUD1 4GIQA 2JICA 1OMIA 1OF3A 5CKQA 1CONA 2B4KA 2IFRA 3VDCA 1MQTB 2P17A 3ZMOA 3ZXGA 5FAXA 1OT5A 5FZ6A 4Y22B 4CEWB 1JUIA 5L19A 4ZHNA 2VCAA 3SEEA 5IAVA 1N1YA 3AYCA 3GZAA 5A32A 4IEZA 3NRUA 3HQXA 2PAEA 3EXUA 3M8LA 1AL0G 2PAKA 3SH4A 3O1PA 2OQ6A 5JPNB 1CX1A 3CF6E 4LITA 1W8ZA 1W0PA 1BCXA 4LO7A 4XC9A 3VKNA 3CLPA 2OVUA 4B1LA 5GZCA 5LWBA 3IDBB 4I3GA 1ZBA3 3UETA 5A6QA 3IM0A 1PX3A 2RS32 4Q4W2 2OQ7A 3QD6A 1OUSA 2B7YA 1REFA 3I2FA 5TSWA 4BLJA 3ZYFA 1W6NB 2Y6HA 4M3CF 3RGBA 4N9HA 1AJOA 3HQRA 1DYPA 4A7KA 5D21A 2ADEA 2AREA 1H4GA 3AKSA 1AR81 2ORZA 3FWEA 3HN3A 1QNWA 4UT5A 5BXXA 1OVPA 3N9LA 3ZFFB 4Y4YA 4AL9A 1ENXA 4OI0A 1K12A 4BCUA 1G86A 4F8AA 4YGEA 5C8CC 5IVBA 2LTNA 3E6CC 1ULGA 1DGRN 4A45A 3WUDA 1Y9QA 4CDQC 5CKNA 3AMMA 5FZ7A 4A6OA 5F3EA 4KU8A 4DRVA 1ZREA 1RHI2 3POFA 2RS52 4YGBA 1Q8OA 4TTGA 1MZ5A 1H2MA 1Q43A 1WBFA 3NNFA 5IFTA 4UBGA 3PHMA 2EALA 2X5IC 1W8OA 3POIA 2A5ZA 4MX3A 5FTTC 4OI1A 1AYN1 1D2QA 2CTVA 2JG8B 3APBA 4JGZA 4XQ4A 5FPVA 4CCNA 1QQP1 1DG6A 4WM7A 1RUE3 2MNGA 2X10A 3PU3A 1KQRA 4QX2A 4Z2AA 1RVF3 2LM3A 4XQDA 4RR3B 4PQQA 2RS12 1HN1A 2HYKA 4Q4X2 5KR7A 3L2YA 2WYSA 4HT1T 2FD8A 1LTEA 4XOGA 3JBG3 4JKKA 5JUVA 2VNVA 2OIIA 3HJRA 4X6QB 3WDTA 3LKJA 3BGAA 3MBWA 5JXIA 2XOMA 4DUVA 3FHIB 4HSLA 4N7UA 4XJUA 4B29A 4J1WA 4R9DA 5C3QA 2IXHA 2A6VA 3ZYIB 1NQJA 3ATGA 2WR9A 3WP5A 1X8EA 5FYSA 2VG9A 3F2ZA 1CAWA 1RUJ2 2CAVA 1QWRA 4KI5M 4NMIA 2WQ4A 3KF5A 4CDUC 5CFCA 5L73A 1KGYA 3P5BA 3U4SA 1QJU1 1RGSA 2YGMA 2SBAA 2Y0IA 2WSUA 4FPHA 3OBTA 3VBUA 1KRIA 3RZKA 4WVWA 3WW1A 3VZMA 5FMOL 3M3EA 3VUOA 2ZZJA 4D6RA 2OUJA 3N4MA 3JD71 3LFMA 5LASA 3KB5A 2CGNA 2IXLA 2Y6FA 4LHLA 3LSEA 4DY5A 4L99A 4DO0A 4DRRA 4WVZA 2BNOA 3AM2A 3FBYA 2PHRA 4ZS2A 1UYYA 3O1TA 1WLTA 4W8JA 4F7ZA 1KS5A 2P5BA 1IPKA 1S0JA 3FC0A 4M01A 3WW3A 1JMUB 1S0EA 2RDSA 3CKHA 3K75B 4H7MA 5BYNA 3OPZA 3GXUA 1CPMA 4NAMA 1N3PA 1N1TA 1ULDA 3WNOA 1KD7A 1RUI3 4ORFA 3LOIA 4Y1YA 5CADA 4Q4W3 5D2AA 4NIHA 2EAKA 4KWLA 1GUIA 4RHV1 1ODMA 3NMBA 5C8WA 2ZA9A 3LGRA 1U5XA 3L2HA 4AGGA 3QH6A 2PQQA 5FP3A 2RM23 2W46A 4Q27A 3O0VA 1C5IA 3MIHA 4XEZA 1DZRA 1G8WA 1QJY2 1H0BA 3SCGA 1R082 1LGBA 3VD5A 2XBO3 5L7OB 2JEMA 2IC1A 2D97A 4D94A 1IHMA 3ZXKA 2KR2A 3U37A 4Q8KA 4KWJA 3I4IA 1ZBE1 5F9TA 2WUHA 4CE8A 1N1VA 4LHKA 2VOVA 1P8JA 1MS1A 4QXHA 4L11A 2ZGSA 5DZFA 3H8RA 4LBLA 1PK6A 1APNA 2BWCA 3ME2A 4CVUA 3NWKA 3NQHA 2WLQA 3K48A 1DGWX 4Y20A 3IB3A 2HWF2 3CHXA 5LEJA 5IT6A 1RUF2 3Q8EA 3S57A 1SG3A 5HXVA 4TZDA 1DP0A 1RUH1 4LHSA 1HQNA 2F4LA 4FI9A 4KU7A 4DXRA 3GBFA 4BQ1A 3H7YA 2ZGRA 2RDNA 2CNAA 4PIXA 1ASJ2 4LPLA 2YBPA 4Q4X3 5IJRA 4XF1A 1ZRCA 1OKOA 3RZZA 3MIDA 2YYOA 1AR91 1SLTA 1BZWA 3PLQA 5F2SA 5F39A 1ULEA 5EQUA 2HEYF 4GKYA 4Q0PA 4XHBA 2VMIA 2WNEA 1NX9A 2WFF1 1VMFA 3KT7A 3I8TA 3PJQA 3P3PA 4XZUG 2D3SA 5FY7A 3ZYPA 2PHXA 2YB7A 3GJAA 1JW6A 1ND3B 3ZSEA 4PI0A 2P34A 3H50A 4Q4Y2 2JIGA 4XE9A 2IXCA 2P3YA 4M0NA 2G19A 2QJVA 4XDPA 4IQPA 4IV1A 1VRH1 4XF4A 3GJBA 1F9KA 4I02A 3UGGA 4DS0A 1QOSA 1TVGA 1QJZA 1HRI1 2LALA 2XUEA 4LUMA 4Y5SA 2Z69A 4AAPA 1LGCA 3ZDVA 4XCAA 1WCKA 3QBQA 3I3DA 1RUD2 3SKVA 4CDWA 3VKLA 1W05A 5FYHA 4YZ1A 1O5UA 1JYNA 4P02B 1VBB1 1OPOA 1RUNA 2E53A 1CIWA 1UU4A 3H9AA 3OEAA 1ZRRA 2VXJA 3UK9A 4BQ5A 4B7EA 1AJKA 2VUAA 2JG9A 3UJOA 3VGIA 2OS2A 3AZWA 4CU9A 4YSFA 1WBLA 2WNOA 3POJA 1KEXA 3ACGA 4AFMA 3AKTA 1W2NA 3WQ7A 3ASIA 4DY3A 5FOJB 4HVOA 2B42B 3MYXA 1DZQA 2HWD3 1W39A 2Y0OA 1K5MA 3KQ4B 4ZPIA 5C7GA 4XAAA 2Q8OA 2K2SA 3V0AA 2WO7A 1W9FA 2VE1A 1AX0A 3JB4C 4GWNA 4QX5A 1WW4A 2D6PA 2O8OA 5EFUA 5A3MA 4C1WA 3ZXLA 1FXZA 1AF9A 1QJY3 4D69A 4XUOA 2I74A 2PHFA 1SPPB 4KG0A 2YV8A 2WA4A 1NA1A 1UOFA 1SBDA 4Q29A 5K7PA 2MPFA 4JV4A 1LULA 3HQUA 1AR82 3THPA 2BBVA 2C9AA 3H8OA 5FZGA 1J58A 1ZNPA 4LO8A 4XUNA 1O4TA 1VR3A 4UYBA 1DLCA 4Z07A 4QGNA 4IEQA 2WO3A 2ZOEB 1X9PA 3J7NA 1NCRA 4HG6B 4KWKA 2QDRA 4BMEA 4WVMA 4JTOA 4C91A 2WABA 3U10A 3EO6A 1U5YA 1WW5A 1HJFA 2GAUA 3DUIA 3GYDA 4UAPA 4WM7C 4YW1A 4CA9A 3U78A 5ANQA 5FYBA 1RUG1 2RV9A 2PHTA 2VTFA 3BUCA 4HFSA 1ZBA1 3GHNA 1Q3EA 2TUNA 1ASJ3 2VMFA 5T50A 4GH4A 3AYEA 2Y38A 1AYN2 1GWMA 1XYOA 2B39A 1XNTA 3MW2A 1LR5A 2NZ9A 3K77A 2XWJB 3OCPA 4AHXA 1QQP2 1HV0A 1YYNA 2RG4A 1YFXA 5BNOA 2G9FA 2O0OA 3KV4A 1RB8G 3HAGA 1Q8PA 4PDWC 3JZVA 3TN91 1GFF2 3KSCA 5EIYB 2XJRA 1HN0A 1V6LA 5F3IA 5JVVA 4FPLA 3FLPA 3CU7A 4LBNA 1GOGA 2ILMA 5GLUA 3AP9A 2AC1A 1DGRA 4Q4Y3 5DAWA 3A0KA 2GMEA 4BM8A 3VBUC 5FZIA 1OKQA 3E1F1 2ZEWA 1H9WA 5AVAA 2ET7A 5FZDA 1BVVA 2R1DA 4FPGA 4AEDC 2HJIA 2YXSA 1WLDA 4DNYA 3ZMNA 4P5YA 4AI3A 1I9RA 2EXKA 4INDA 5KBFA 1YFYA 5F32A 3CO2A 1ZA4A 4UBHA 5DZEA 1QJU2 4QX7A 4FPKA 2QE3A 4GWJA 3VHRA 3N9NA 2EIBA 3N9MA 1PIV3 3O5SA 4XTMA 2E51A 1ONAA 4QXKA 2VZVA 1J1TA 3JD72 3ZR5A 4FFHA 2VPVA 1WMFA 3U0ZA 3V0BA 5JMCA 3O1UA 1QH7A 4HK9A 4XFAA 4XW3A 3BPZA 1D4VB 3JBG1 4MGSA 2YFZA 5A6ZA 3AXDA 3M1HA 5F5CA 3VKOA 5EWSA 4IE0A 1Y9GA 4NAOA 3K3NA 4LMFA 2BW8A 2ZX3A 1CZTA 3H1WA 3I2KA 5FBJA 3B02A 5FP8A 1W6MB 4DXZA 5FP9A 3BTZA 4YVWB 4XVHA 3VBRB 4Y33A 4ET7A 3Q8BA 2HBTA 2VUCA 3C7GA 2B9UA 1D2SA 2IUWA 2JDYA 2Q4SA 3A21A 4FPFA 2FMYA 1S0CA 5FZMA 5EXOA 1PX4A 3OUJA 1WLWA 5CFDB 4IGQA 1H8TB 5JZGC 4CCKA 5F6LB 1GZWA 4AQ6A 3POGA 3TB0A 2WNVC 2ZGMA 3CIHA 1HIXA 1QNYA 4K40A 4L9BA 5A6XA 1TME3 3GGLA 4NIAA 4OZOA 5CB7A 1AR61 5L9RA 2MEV2 1OQDA 4BQ2A 5KHIA 3POSA 4UFIA 2VOXA 1V6KA 5A3WA 1PK6C 3NL1A 3NO8A 4LKFA 1UAIA 4AVBA 1NAEA 1Y7BA 4XETA 3PIJA 3N7MA 4GMP0 1KDKA 1UMZA 4Q5OA 4BH9A 4QPGC 2ZMNA 2P6HA 1ZBE2 1M06G 1GV9A 2VZSA 1UU6A 2SLIA 1RUI1 3GM8A 3CJIB 3AKPA 1SACA 3OY8B 3POWA 5FWEA 2RMU3 1W3XA 2C1FA 4Q4W1 1CJDA 2W1QA 1DQ4A 4WM8A 3AZVA 3CEWA 4FOYA 5FYVA 3RZGA 1RUH2 4E27A 5A6YA 1UIKA 1W8WA 3ZVXA 3POYA 2WWUA 3KHCA 2RM21 1UOBA 1ZX5A 2VQAA 4I3PA 4IEVA 3RNSA 3VKMA 2ARBA 2DBIA 4UFJA 1AR92 5CU1A 2XBO1 1WGPA 3T30A 5C6CA 4NROA 5LCWL 3A0NA 4AI2A 2YC2A 4IETA 4UI9L 3PUAA 5ACA1 2A6YA 2TNFA 4OMCA 5LBFA 2A6XA 3T0AA 5A32B 1YQ2A 2ETEA 1KXGA 1E57A 4N8MA 3I59A 3ZSLA 2VO5A 1W6OA 5C8CA 1W2UA 2GALA 4XFIA 4CDWC 1RXFA 4KNCA 1GLHA 3SC7X 4CDQA 1R1ZA 2CYFA 1NXMA 4LBQA 1NUKA 1PNFA 1U0AA 4OCTA 1UZYA 3ZM8A 1OVSA 1J3RA 1Q56A 1WCDJ 1A8DA 4YRDA 1OOPC 2D5FA 1WMEA 3VZOA 2QBXA 3FBMA 4W6XA 3U4XA 2JG9C 3LWCA 3DKQA 1HRI2 3CZJA 2FCVA 2J1EA 3O1RA 4Y4RA 4Q4X1 3ZYJB 5EJ3A 1HXS3 3VDDB 1KS4A 1BLZA 3ZSKA 3VDBA 1UY4A 3DECA 1PHMA 5JDBA 1VBB2 1F5JA 3OPTA 4YARA 3VZLA 2AEZA 3FFZA 1EPWA 1QDOA 1UKGA 3HT1A 4HKOA 2PYTA 5CVRA 4BOWA 1YEWA 4KQ7A 3MHZA 3T0DA 3T2QA 4M3CA 4QX8A 4YG6A 1NZCA 2P6CA 1SDWA 2QQIA 3FUQA 3CNAA 5FZ8A 3NAPA 4YFZA 2PXJA 1UWWA 1K3IA 2VNRA 1MACA 3SQOA 5E88A 3W21A 4BYYA 5KHGA 5FMDA 2ARAA 4V1PA 1UXXX 3ZLIA 1UXZA 2LW8A 2XXZA 3K3OA 2BPA2 1XE8A 1HW5A 1AR73 1XOYA 3C7HA 4HLTA 1WW7A 3VBFC 2MEV3 2VTXA 1K5JA 1DYKA 3DYMA 4MYEA 4K9SA 4JGZB 4RGKA 4DB5A 3H3LA 5GZDA 3ZFGB 1AHSA 2DCZA 4WM7B 1RTVA 3OUHA 5EV7A 2UURA 4CDUA 1LCLA 5FK8A 1NCRC 1GKBA 5C33A 1R64A 2JDUA 1C4RA 2EA7A 2JDZA 5FO8B 5JXJA 2LROA 2XONA 1FAYA 1R1A3 4COVA 1YFWA 4CPBA 4DFSA 2E7TA 2EICA 2JDAA 3DKWA 4AI0A 2P3KA 1XSRA 3EHKA 3WG3A 1GZ9A 1OQ1A 1SHWB 2BTVC 1YLLA 5I0DA 4Z8BA 5DN2A 1TNRA 5H9PA 1W0OA 4N53A 5FPUA 4RS5A 4OHXA 1UF2C 1RUC3 3LPGA 4QU2A 5C3RA 4Q0VA 2F6BA 1YQ8A 1ST8A 2XUMA 3VBOB 1LECA 2L9LA 4FPJA 2HWD1 3QH7A 2WT2A 2D6NA 4MLOA 4CP9A 5GALA 1X8MA 4LBMA 5JCTA 4ZY9A 1CAWB 3ZFEA 1RUG2 1ZVFA 1Z7S3 3C2UA 4JQRA 3R4DB 5CFCB 1ZBA2 1T6BX 2ZX1A 4GWIA 4HOOA 1CZVA 3AKQA 4N9IA 1QJY1 3MLKA 1QEXA 3G7DA 5FLHA 3VHNA 5IK7A 2K46A 4MUVA 4YW4A 4CXYA 3ZYRA 2ZKNA 3JUUA 2XLAA 4RGGA 3NV2A 2W39A 4NIIA 3INAA 3RWKX 3BTYA 1CX4A 3QLQA 3CMGA 4TN7A 4XXPA 3TN92 3GZEA 2AEYA 4XILA 4J1XA 1JZ5A 4Y26A 5BNQA 3FHAA 1UL9A 3WV6A 4E4SA 3KCCA 4QHZA 1X36A 4PF1A 5C3OA 2GH2A 4AVAA 1RC6A 2BNMA 4PT6A 2GN7A 4UF0B 2XQRA 2WZ8A 5T52A 4A42A 1YQ6A 3GZTB 4AYUA 4D8MA 5FQ0A 1GYKA 4I2OA 4J6GA 2VVFA 3VHPA 3ZYBA 1UMIA 3WXPA 3BB6A 3O7OA 2XR4A 5IVYA 3DPRA 1YIPA 2ZX4A 1O7FA 2B5HA 4OI2A 4GZ9A 4UW4A 2VU9A 3J7LA 4X8PA 2BUKA 1BK0A 2AGSA 4P08A 1W99A 2EIGA 3VDAA 1WD4A 1MVQA 3M3IA 4R4XA 5DUVA 2JE9A 4FT8A 1UQXA 4IEYA 3DL3A 1UN1A 4PCRA 1UYPA 3T4HB 1C1FA 1YQCA 1SMVA 4WZFA 5JIAA 4ARYA 4LA3A 4NOTA 5FBZA 1PGW1 3AKRA 1VALA 4YPJA 4AFBA 3ZPYA 1GNYA 3Q8CA 4HXCA 3HBZA 1XNCA 5E16A 1OH4A 1JYWA 1G9AA 2R30A 4TYSA 4E2SA 1E5RA 4LJHA 4Q4Y1 5DAXA 1NXD1 4HZFA 1UYZA 4EJRA 2XL7A 3M3CA 3OYWA 3KCXA 3T09A 4F83A 1JZ7A 3H8XA 1UOJA 4K6BA 3KHBA 3SXWA 5LA9A 2QQJA 3V65A 3OF1A 5E8AA 5F3GA 3GDBA 3ZO0B 4H55A 2K0GA 4EQVA 4Y20B 2OYZA 4E9KA 1LENA 4I01A 1LHNA 4RQPA 3LPFA 4CUCA 2QQVA 3ST7A 1NZIA 2YBKA 2ZPXA 3J7MA 3ON7A 5FJHA 5FYYA 3VBSA 1A3KA 1RITA 1XPWA 1PIV1 2OW4A 2PTMA 1IS4A 2FBEA 3FE5A 4QHOA 3ILNA 5FYUA 1VE0A 2DVAA 2WN3A 5FZKA 5JPMB 2W1WA 1J59A 2W68A 3M3QA 1AR62 4ZZ8A 2D44A 3O12A 2RJ2A 2DVGA 3OGSA 5LBEA 2Y8KA 3T1MA 1W90A 2D43A 5HCAA 2W87A 1JS9A 1SFNA 4BQ4A 5F5QA 3RZHA 2VD7A 2AACA 3PJYA 3ZR6A 1G6NA 5IVCA 4WM8C 3T4VA 1UNBA 5FO9B 1OH3A 1FNZA 2J1AA 3N7KA 3URFA 1FNYA 5A70A 3VV1A 2FDKA 3ZSMA 1RUG3 2GNDA 1RUI2 2YROA 1G9FA 2WQZC 3R6SA 1QHDA 4G4FA 1AX2A 5FMCA 4O65A 2XMLA 1EUTA 2VJXA 3BOWA 4LXLA 3R05A 4IV1B 4QDSA 4QQHA 3SCFA 3WP6A 3TEZA 5F5IA 1PM7A 2GZWA 5JXHA 1D7PM 4FAGA 4G9SB 2JDPA 2DVBA 2XDVA 4ES9A 5BNPA 1TME1 2P3IA 5DAVA 4FO9A 4XAEA 3NV1A 1HB1A 2K9ZA 3SKJE 4ZU5A 2RM22 3RPQA 3LEGA 2ZAHA 5FP7A 3CL1A 5FZ9A 1ENSA 3AVRA 4JRAA 2XBO2 1ODNA 2YFUA 4KL1A 4IE7A 1RXGA 4OHVA 2VXRA 3FZ3A 4MZUA 4NRPA 3ABZA 5FYCA 4XBQA 5GJ6A 2BEOA 2BP6A 1SBEA 2DVDA 4YLZA 4CU6A 5ACA2 3MZHA 2YBSA 4BQWA 1FPN3 2E33A 2J22A 3E5QA 4YGCA 4GJZA 3VBHA 2ZX0A 3NV3A 3A22A 3NSTA 3UESA 4OQ9A 1W2AX 2XJUA 5FMBA 5A3LA 2VZOA 5FZLA 1PGSA 2RMU1 1K5MB 2BU9A 4DUWA 3BPSA 2VVDA 3BVCA 5K0UA 4JHTA 1LU2A 4XFHA 3V0AB 5F1RA 4EE2A 1AVBA 2XL9A 4K20A 2GN3A 1QJX3 1US2A 1QXRA 1D0HA 3ACLA 4KGGA 3M7AA 2PHLA 1LOAA 1G9DA 3H1MA 2GDFA 1W8NA 5FZHA 1XE7A 1SCSA 1REDA 1NA1B 1VRBA 2D6LX 4JKMA 5APAA 3VN4A 3NAPC 3JQWA 1Y3TA 4QX0A 5FO7B 3VD3A 4N90A 4QKNA 4A7ZA 2P1BA 5J36A 1F4HA 2VW2A 3JQXA 3E97A 4PDWA 3C7FA 2FDGA 5FZFA 1ND2A 2O8QA 2V5DA 5BNPC 1UU5A 2ZHMA 4YM2A 4WVMB 4E2QA 5DUUA 2FZ2A 3WW2A 1YCIA 4IV3B 4BJ0A 3GNEA 5BNNA 2E63A 2VMGA 4MOAA 3VD9A 4M3CE 5J98B 1YQ5A 4FOWA 4GA9A 5T5LA 1FV3A 4OULA 1VBA3 4XDQA 5G05L 1SLIA 2VVEA 2XG3A 4PQ9A 4GH4B 1AR63 4AEDA 4LLOA 2W1UA 4N53C 1HDKA 3LB9A 4RS5C 4QB6A 2IFWA 2QQNA 1HXS1 5BNOB 2HYXA 5GLVA 5KWRA 4E4DX 5HI0A 3IPVA 5IK4A 1FOD2 1K42A 1SDDB 4XACA 3T2OA 2BGCA 2ZGUA 3ZFEC 4XPVA 1SLCA 3NKGA 1LRHA 1IS6A 1W6QA 4M00A 1AL23 2Q30A 5EP9A 4UW5A 1LB2A 1UO9A 2WZR2 3NNMA 2UY8A 2NN8A 2HWB3 2HWD2 3WNLA 1OURA 2W91A 4JGYB 1W03A 4P14A 1W3VA 1POV3 2AUYA 4EN7B 3KT4A 3O0WA 2DU1A 1VAVA 3ILFA 3ZSJA 1AR71 2HKXA 4HPKA 5FY4A 4AQTA 5C4WA 2MEV1 3OB8A 4BDVB 3WVJA 2VBBA 5EHDA 3EQEA 5JOWA 5FZCA 2Q8EA 4LKEA 4JDMA 5JZGA 1BQPA 2VOWA 4CEYA 5A33A 1R1A1 3E6BA 1O4ZA 1UIJA 2WNVA 3V0BB 2ERFA 4RFRB 1MS8A 3N36A 2EIEA 5ACA3 1NCQB 2CSGA 4NPLA 1BJQA 1HRV2 3CJXA 4YVSC 3J4UH 1H4HA 3DPRC 4GALA 5ABJB 1H2LA 2QTWB 3IZOA 4MXWB 1CAUB 1LJ7A 1YJKA 2BZDA 5LATA 5BUVA 1RUC1 5C70A 2GMPA 5FY1A 1PZ8A 2ZABA 3FUOA 3H3UA 3R4SA 4UW6A 3AVSA 1PO13 4XFCA 3MICA 5JIUA 4QPGA 4OUMA 2ZEXA 4NPRA 5JI7A 1AXZA 3LA7A 2DTYA 1Z7S1 4FQZA 4ITCA 5LB6A 3PUSA 1XRUA 3H1YA 3B5LB 2B9VA 1GZWB 3AJZA 4O61A 4YZ3A 3OD4A 1HJGA 3D0JA 3S5QA 1I6XA 1X9TA 3AMPA 3IDCB 1A78A 4LEJA 2IWGB 2WL1A 4CUGA 4LORA 4HK8A 1B35B 4CYDA 1PGW2 3H7JA 3N35A 1MS3A 1X50A 1YUDA 4CDXB 1DQ2A 1ZZBA 2V4AA 3K2OA 4QPIC 3HVDA 5J1XA 3MUZ1 4LR4A 1JZ6A 5FPZA 5HCBA 1JU3A 3NJXA 4GULA 3VL9A 1K45A 5E89A 4LUKA 4RQPC 3QOPA 5L9VA 3LQCA 4FTSA 2HH9A 3TYJA 4JVAA 3VBSC 5KC6A 1UOGA 1MQTA 3MGUA 2YY1A 1SQ4A 2OKXA 3K4AA 4IEXA 2ZMLA 3WT3A 4Y22A 4CEWA 5JSRA 5DPNA 2J1SA 5IFPA 3N9OA 5AFBA 5M0TA 4IEUA 1NKGA 4YM3A 4ZONA 5DZGA 4XUPA 4QXBA 5FZ0A 3RZMA 1SLAA 4AWDA 1DF0A 3K51A 4Q1PA 4MO3M 2VUDA 4LBOA 1PIV2 2ZCWA 4E4ZA 4AK3A 1GANA 2WQ8A 4BISA 3I2OA 2VBPA 1FOD3 1OOPA 1XQNA 3UJQA 1GICA 1XU2A 3OUIA 2PHWA 3BODA 3AK0A 2NLRA 2NPIA 2QQPA 2BJSA 3I54A 1U5ZA 3RYRA 2WZR3 3RYKA 5A7SA 1W6NA 4BWOA 4WV8A 5LW9A 5A7WA 5LY2A 1W06A 2F4PA 4X6RB 3HR9A 2C9KA 2KD7A 5GLTA 5T3NA 1NLQA 3AL6A 3I59B 3VKFC 3WG2A 2CWMA 3V64A 5AFEA 3EJKA 3AYAA 5C8CB 2R041 4MSVA 4NIGA 4KGQA 4DXSA 2VH9A 3MIGA 2C5DA 5FXXA 5FUPA 4CDQB 5C5TA 4QB2A 4XURA 5AC92 2JE7A 1Q5OA 3TOJA 4OUEA 1WMDA 4Y1ZA 2W08A 3RZJA 3AYDA 1L3JA 4P9IA 5L36A 2HWE2 1NE6A 4NHLA 4CCDA 1TME2 2NYYA 2YZ4A 3WQBA 5JXGA 2JB8A 2UU8A 1O3TA 3VBHC 4AEJA 5J48A 1HRV3 2X5IB 4XHXA 1DDLA 3VBFA 1O6UA 4COUA 3EBRA 5K9YA 4Y5TA 2Q5TA 1UPSA 1W8TA 2E31A 4QQ2A 1JOJA 5K0UC 1VP6A 2ZTNA 1YI7A 5CKMA 1LODA 1STMA 1FT9A 1L7LA 1V00A 3HMYA 4GB33 4J25A 4ZU4A 5C9AC 1RL3A 3LEMA 3IMMA 1VPHA 5HCHA 4AAXA 1C1LA 1RINA 4M3CB 2R32A 1OD3A 2VZ1A 5H9RA 3AMQA 5IAXA 1IPSA 2RJLA 2A1XA 3IWZA 3PVNA 4BPZA 5KXBA 3KF3A 2JD4A 2RMU2 1J3QA 1GR3A 2A7AA 2I07B 3PUQA 4XDOA 4XFBA 5FR3A 4YZ5A 1W6PA 1UCXA 3JB8A 4CP0A 2Q0AA 3AL5A 3D8CA 3ILRA 3RWNA 1U5IA 2DUOA 3L9JT 3S30A 3T2TA 1GP6A 5BNPB 3O1MA 2OZ6A 3LEKA 2CU5A 4V2WA 3O14A 3W58A 4IE6A 1AXKA 1QH6A 4URTA 4CSWA 4DINB 3AB0A 2Q8DA 4MXVA 4D3WA 4CDUB 1DU3D 1EY2A 1ND2C 2UYAA 1RYYA 4AW7A 3ES1A 1XU1A 3C7EA 5FPXA 1JXNA 5BNNC 5FOBB 5IVJA 1UY1A 2BGOA 2LS6A 4QPWA 4EN0A 1QOOA 4IE4A 4IL7A 4XCBA 3D0SA 4NVPA 4AVCA 1FPN1 4QKBA 2DCTA 3ZKYA 4L92A 5K8SA 3G6JB 3WX5A 2IXKA 2JENA 3FX3A 3UYJA 3MFAA 4BQYA 1JHJA 3LDKA 2DTWA 4QPYA 4EV0A 2C4XA 1FI2A 2YUEA 3B9IA 1TQ5A 3WF0A 3S6PA 4A2UA 4CP9B 1W8UA 4CXXA 5CAZA 1JN2P 3THTA 3VL8A 1HLCA 1ULCA 1KJLA 4JDOA 4N7IA 4TSVA 5A3UA 2R6QA 4XJ8A 1C3HA 4K7JA 2RVAA 1ZZCA 1QJX1 1GP5A 4AR2A 4KH9A 1GNHA 4TWTA 4BZ4A 1TMF3 4XJZA 4M4PA 1WKYA 4DEVA 5HV4A 2R0HA 1MR5A 1SLBA 2X09A 5T5OA 2HEVF 4O9GA 1QF3A 5FY5A 5D8AC 4ATEA 4AQSA 1LOEA 1HXS2 1POQA 4YW3A 1SFPA 4BMBA 4BU2A 3P1IA 5B4NA 1TNFA 2O1QA 4QGMA 2ZHKA 3KGZA 2DCYA 3WR0A 3A23A 5IW0A 1F2NA 3KD4A 3MW4A 3DXTA 4LIUA 2DCKA 2ZXQA 2WNUC 5I8YA 4N43A 5C4WC 1ENQA 4CP2A 2PA7A 3WHTA 1DCSA 3MFCA 5DUWA 3OBRA 3SNMA 2ZGOA 3GBGA 3I3EA 3LSDA 3VD4A 2G9ZA 1KFUL 5AC93 5BV6A 1GWLA 4YM1A 4UFHA 1LKNA 4Q1RA 4CEYC 4WBBA 4CUBA 2HWE3 3DPRB 4LO5B 3O1SA 4NJ4A 2QQUA 2PELA 1VBA1 4BQXA 3ZOIA 1YXWA 1PVXA 1AR72 1UZVA 2A6ZA 5GZFA 2CGPA 1CQ9A 2WSVA 2YDEA 3PTYA 1BKZA 1NOVA 1QU0A 3DCQA 3M70A 4FXKB 4FCAA 5FZ1A 4BXFA 3NW4A 1W9YA 4K8RB 1BEV3 4OUSA 1KJRA
chains in the Genus database with same CATH topology
1FYUA 5FMOS 1R1A2 2EAAA 3MF6A 3FFQA 4R4ZA 2GNTA 4FVVA 2WA3A 1AL21 3DV8A 2WIIB 4HSJA 3OYWB 1RUC2 1S1AA 2KXLA 5FREA 4W6WA 4NN0A 4AGRA 2HWB1 3MLJA 1IGOA 2ZMKA 4JCKA 4FSJA 1POV1 1Z7S2 2V5YA 1A8MA 1ND3A 3OGJA 1H2KA 2EF6A 4CZSA 3VBSB 1QMJA 3KM5A 2FHRA 3SMHA 2DV9A 5JLVA 4QM9A 1MQTC 3ELNA 4Q2FA 2ZS6B 4CEWC 1JHNA 4DMIA 2ZZQA 3ZXDA 4AHYA 3TBDA 1EAH2 4AHWA 1UZZA 3FJSA 1AYM2 5I91A 4AEKA 1NYWA 1SFYA 1HKDA 3SHRA 4FPEA 2VUJA 1LHWA 2R062 1PO11 1I5ZA 1MS4A 2WJSA 5LK5A 2TEPA 3MI8A 3SISA 2ZGNA 4PLNA 4SLIA 3WG4A 3J8F1 2WS93 4AVTA 1OA2A 3B94A 2KM2A 3WW4A 3V56A 4PIZA 5HBAA 3RDIA 2RR11 1LU1A 2XKPA 3D6EA 2DYCA 4S2DA 2DCJA 4OI4A 2QKDA 2ZGQA 1HX6A 5KHKA 1VB2A 1AXYA 1V9U3 3B3QE 4HETA 1GSLA 3P3NA 4XQWA 2R073 2ZGLA 1U12A 3WNXA 4YGDA 2R042 2XLGA 1NLRA 4FBFA 2WWSA 3WLUA 4U36A 5K0UB 1WA4A 1XNBA 4P9WA 3UKVA 1JYCA 2JG8C 2OUHA 3MIBA 3ZN6A 4EWEA 5DG1A 1LOGA 3DGTA 2VNGA 3C3VA 3RS6A 2D6MA 2FQPA 1LOFA 3M2MA 4RR3C 3GBWA 4E2GA 1FOD1 3VZJA 4M0HA 1EYBA 3AFGA 4S2HA 1NLSA 2A3YA 4PLOA 3VZKA 4P9GA 2EXHA 5KXEA 2WZR1 4AE2A 2WT0A 4PDWB 5EYYA 1UW8A 4AEMA 1OD5A 1CAVA 5DXDA 2VW1A 4LT5A 1AZDA 1ZRFA 3SCHA 2OZJA 5I0TA 2XKOA 3UKTA 3IT8A 1JTZX 4U2AA 2BWAA 4MGYE 3VBUB 1TEIA 4K1YA 2RE9A 3WDWA 3MF9A 3NVCA 4LE4A 4AEDB 4MH0E 4B8EA 1BMV2 3BU7A 3IKWA 5SV5A 2PAMA 1MEC3 3WP4A 3LOBA 1S0BA 1AUYA 2JXAA 5I0UA 1HRV1 1EAH3 4EWAA 3DN7A 4IEWA 2CAUA 1V6IA 1D4M3 3IPVB 5BY5A 2QVSB 1AYM3 4ISRA 3PVBB 4JTNA 4XMAA 1CJPA 1M4WA 2R063 3AP6A 4GB31 4YG0A 5KC5A 5LK7B 3AZZA 4KG8A 2D40A 1FPN2 3FMGA 4LLFA 4S2GA 4YVSA 1CESA 1FMD1 1H9PA 3WINE 2CV6A 1MS0A 3BTAA 3NV4A 5GZGA 1ENRA 2D7FA 3OD0A 1VBE3 1YWKA 3RI8A 2DUQA 1RJ8A 4B3NA 1W6MA 1EV11 2PLV3 3PMEA 3UKNA 4XZPA 1CVNA 1XYNA 1CD3G 4FAHA 4HPKB 1QJX2 3TRSB 4DPNA 1VLNA 3KZ4C 4KBBA 5GLZA 2A71A 4META 2DWRA 5C4WB 4JDNA 5DDJ2 4BA6A 4CP1A 2ZHNA 5KBFA 1UPIA 1KDMA 2DF7A 4N43C 3PNAA 4GXLA 5JZGB 2HWC1 4CEYB 3ECQA 1H8TA 5A33B 4A3XA 5L7OC 4WZCA 2WNVB 1IS3A 1FV2A 2R0FA 2ARXA 2ZBJA 2VOKA 3LZZA 4PJYA 1DHKB 2BYVE 3WDUA 1GQHA 4K3UA 4IXLA 1PK6B 3RJ2X 4QPIA 2R043 2ZACA 2AENA 1DBNA 1S55A 2H6CA 2X53S 2AH2A 1MZEA 2G4IA 2W52A 4Y1VA 3AX4A 4QPGB 1PVC2 4QMAA 5FLJA 1CR7A 3KT1A 3HT2A 1BXHA 2ET1A 2Z79A 3J9SA 4HMZA 4B4PA 1VBA2 3QCWA 2QZ3A 1TMF1 4Y1UA 3OY8A 1DGWA 2PFWA 1O4YA 5KHJA 3N7JA 3AP5A 3M3OA 4L2NA 4AHZA 2DU0A 1DLLA 1OA3A 1WUVA 2XVLA 4XXAA 4R9BA 2QUOA 4XF9A 4YW2A 4FTEA 5J96B 2XJVA 3AFKA 1VBD1 3ZXEA 1ND3C 4FXGB 4WVVA 1AL22 2XJPA 3W59A 1VBC3 4YZ4A 2UWBA 5H9SA 1DGLA 5AC91 2HWB2 5JI9A 4C1XA 3HIFA 3A4UA 2KA3A 1GBGA 2HWE1 1F31A 2A70A 5CBLA 2ZJCA 2XJTA 5E1RA 2XPJA 3E6DA 4Z2WA 4H14A 4CDWB 4JC1A 4JRLA 3BALA 1BEV1 4EN8B 5GM0A 2WT1A 4B4QA 3AMHA 1OOPB 1VIWB 2JG9B 2V73A 2YGLA 2ZHLA 4C0BA 2GMMA 2LUWA 5D1IA 2ZGKA 4TLFA 4QGLA 3VDDA 3USUA 2TBVA 2R16A 3J26N 3RSJA 5J37A 4W6YA 4FPCA 5FCCA 4CRQA 1PO12 5LRSA 1NY72 4I09A 2JX9A 5C9AA 4A7YA 1V6NA 2XVGA 4UXAA 1R093 2GNBA 3E5XA 5DDJ3 2QDNA 2N7GA 3J8F2 2NMOA 4QM8A 5JSOA 4PBOA 4GMP3 5T5JA 4P9JA 1G9CA 5JR7B 2A3WA 4AVSA 2RR12 4LULA 3VBFB 3WOGA 5DG2A 2Z5WA 1V6OA 4S2FA 1GNZA 1GZCA 3ZFGA 2ATFA 3ES4A 1NCRB 1H1IA 1UKRA 2WC2A 4QQLA 3UV9A 4XTPA 3ZXJA 1QKQA 4SBVA 4PF5A 2XHKA 1PVC3 3MLLA 1LOFC 4OHWA 1N47A 2CGOA 5F6KA 1QOTA 1FATA 1W6PB 1ZZ6A 5DUXA 1G9BA 1H1MA 1GQGA 1O3SA 2WS91 3VBOA 4QT6A 4RA0A 1SBFA 1LGNA 2NQYA 5LEKA 1OA4A 3UL2A 2B8MA 3X29B 2BVVA 4FP2A 2P2KA 4AG4A 1G7YA 1DQ0A 3TWIA 4XJ9A 3KMHA 2XB6C 4BHPA 1XNKA 3HN1A 1EP0A 5D8AA 2QCSB 1C8M2 3ALQA 1A6CA 1V9U1 1X82A 5IUQA 1CAXA 2JECA 4FTBA 3WZ1A 1N1SA 2Q1MA 2R071 2QZ2A 1Z78A 2WNUA 4RD7A 2BFUL 5CIRA 4YNIA 1X33A 4ISQA 2VW0A 4D7SA 3WDVA 3RQ0A 3GZUC 3FLTA 1HQLA 2UYBA 1LEDA 3BCWA 2ZGTA 1AX1A 2RS33 1PZ9A 2B46X 3IIAA 2JJ6A 3WDYA 5JWPA 2GC2A 1JYIA 3PVOA 4Q4V1 4YW5A 4HVQA 4RSUA 3SITA 1LHVA 1F8VA 1ZRDA 2UY9A 2AR6A 4GB32 4YVWC 3IN9A 3HWJA 1DIWA 3VBRC 4OHYA 3WD5A 4N43B 4DOUA 1OFSA 3NJZA 1REEA 2PN5A 5CG8A 4RL7A 1FMD2 5CFDC 5GKAC 5J09A 1H8TC 4Q8LA 1BBT2 2R1BA 3J8F3 3NKTA 1RHI3 2RS53 1EV12 3OTFA 5H9QA 2D5HA 3ZN5A 1QXPA 2ZGPA 3IBMA 3RMXA 2RR13 1NE4A 4PBPA 1MEC1 4BE3A 4HKLA 1XXNA 2BVBA 4FPOB 3MW3A 2HWC2 1EAH1 1ZM1A 5IK5A 3ZN4A 1D4M1 1JUHA 1ULFA 1JH5A 1AYM1 2VNOA 4FP3A 1RMU2 4L8QA 3SH5A 1S0GA 4AFDA 1BVP1 2R061 2RS13 2D6OX 1WW6A 4EN9B 1IPJA 4L97A 2XWBB 4P9LA 4RFT0 4XFGA 3CJIC 5B2GB 5I0RA 3RI9A 2E6VA 4GQ7A 1IKPA 4WM8B 1Q8SA 1IS5A 1VBE1 1SCRA 4YG3A 3RMYA 2XLFA 5KHHA 3BIWE 2MHFA 2PLV1 2H0VA 3KLSA 3VZNA 1H8VA 2WLPA 1T6GC 1RUJ3 1TMF2 1NG0A 1SLLA 4ASMB 4I0AA 4LBKA 4QHBA 1O91A 3AJYA 2DFCA 4XMIA 5KXCA 1C8M3 1QXJA 1YHFA 1C28A 1H1AA 2W0XA 3AP7A 5T54A 2DFBA 2FMDA 1YNAA 1N3OA 1VB4A 3ZFFA 5GZEA 1VBD2 4COWA 1W6OB 1H2NA 1LOCA 1PO21 3JCIA 5FRAA 2ZX2A 2BNNA 1COV1 4HL0A 4LBQB 2RHPA 2UWAA 5I93A 5T55A 4JAAA 1WCSA 3AMNA 1S0IA 1MZFA 5CNAA 3LCPA 3SLIA 3MIEA 1DQ1A 4LE3A 4AF9A 5JOZA 3WUCA 2B45X 4Q0UA 2GNMA 4XYXA 4P5HA 3VDDC 1BEV2 2BQPA 1KITA 2JG8A 4XF3A 3VLBB 4EWDA 1URXA 3T1LA 1QDCA 4RR3A 1R083 4F3JA 1MZ6A 4Z1VA 1FX5A 5J3UA 1FMD3 1IQAA 2IXJA 3NAPB 4CTEA 1VBC1 1BBT3 1I3HA 5EYXA 1LESA 1UD1A 1EV13 4Q0SA 3RJRA 4YYOA 2WINB 2AYHA 4OHZA 2ENRA 4Y5Z0 3GALA 1BMV1 4X8NA 4JGZC 4OZXA 3ZFGC 1Q8QA 4EROA 4IV3A 2HWF3 2D98A 2HWC3 1RUF3 3AZYA 1ZZ8A 4K8FA 4Y1XA 3WQ0A 1ZZ7A 1RMU3 2VQ0A 4QQOA 5KXDA 3AZXA 4MGKE 4D7YA 1NQDA 4N53B 4OVEA 3LAGA 4RS5B 1DFQA 1ZZ9A 4COZA 2WFPA 4GKXA 2YC0A 3ETQA 1YO8A 4XF0A 3VBOC 1CAVB 3IDEA 3USSA 2X29A 3RRDA 2IXIA 1S2BA 2XH6A 4LHNA 3WDXA 3ZFEB 4ATFA 3PMSA 1QGLA 5CFCC 2OPKA 1R091 2E7QA 5FFOC 5DDJ1 2YMZA 3B93A 1YFUA 3M4FA 1LEMA 4XBNA 2WS92 3OGGA 1MS5A 1WLCA 3ZXFA 4LNVA 4GMP1 3H0OA 4JGYA 1WD3A 5BPXA 3KCYA 3N7LA 2CY6A 1Z0HA 2D3PA 4HANA 4NR1A 2GC1A 2GC0A 1CN1A 2I2SA 1RUD3 3B01A 1VBD3 1N3QA 4I0WB 1RUE1 3S0MA 5L7OA 2Z2SB 4LBJA 5FQ0B 1RVF1 1V9U2 4DQAA 1QY4A 3I7DA 3RG0A 1LOBA 1PVC1 4RGAA 1PGL1 4YVSB 1NCQA 4AFCA 1SEFA 3I2DA 3MEPA 2R072 2FZ1A 2DVFA 3LA2A 3PVEA 4LO4B 1Q8VA 4NWWA 5ABJA 1O3RA 4MXWA 5CA6A 1CAUA 3TB0A 3H8UA 1OSGA 3H3ZA 1S0FA 2CWSA 1XNDA 1DZTA 2YPJA 5IK8A 2I45A 2ZKLA 4YZ2A 1J1LA 1F5FA 4I0BA 4ASLA 1V70A 2Z42A 3B9CA 3O0XA 2XVKA 4GWMA 1OLQA 4Z82A 3KQRA 4NWVA 4RHV2 5AVPA 3E5UA 3TAYA 5EZWA 2CL2A 3ZX7A 4Q4V2 4Q26A 1ALYA 1B35A 4D7TA 4HKWA 1AR83 3GHMA 2Y26A 1MS9A 2RJKA 4CDXA 4QPIB 4LTAA 1YI9A 4K21A 2WKKA 1H30A 4RQPB 2QFEA 1O5LA 5HCFA 4R9CA 4O9EA 5JSPA 2X8KA 3B00A 3D82A 5LRRA 4AI1A 4BIFA 3WQ1A 2BFUS 2RS31 1MEC2 4QD2A 3WP3A 1AYN3 2WZPP 1XYPA 4XJWA 1QQP3 4FPYA 3OJBA 3D4KA 1D4M2 4DZGA 4PIYA 4H3WA 5SV8A 4HVRA 1NY71 2DURA 1BK1A 2YHJA 4P9YA 2GSYA 1MVEA 4ZU7A 3QACA 1OI6A 1Y43B 4IV1C 1VBE2 2WFF2 4K1ZA 1VAKA 4R9AA 2GH8A 1RHI1 4YFWA 3U11A 2RS51 2PLV2 4B4RA 3IMNA 3D5OA 1VAMA 1PNGA 4OFGA 4AGVA 1EPZA 3ZFFC 4XBLA 1QJU3 4LA2A 4YM0A 1D0GA 4IESA 1VRH2 4FOVA 5JOYA 2E9QA 2H6BA 3DF0A 2A3XA 2A73B 3RYPA 3N3HA 2VECA 3JD73 1OQEA 1POV0 3ZYGA 2D93A 2RS11 4B7KA 3VBHB 4AXOA 2EVXA 1C5HA 1DQ5A 2X5IA 4HBNA 3USUB 1OHFA 2AZ5A 4C0HA 1PO22 2NMNA 1C8NA 4ZKTB 2VY0A 1K5MC 2XGXA 4UW3A 1COV2 5C9AB 3W9AA 2HEWF 4R8HA 2A75A 2PHDA 4MGZE 3SH3A 5CG9A 3VHOA 2VGDA 1RUJ1 3GF6A 5GLWA 3MPPG 3KGLA 4AVVA 4P9XA 1KFXL 1NA1C 3AP4A 1OLRA 4RHV3 1IOAA 3B69A 4Q4V3 3S7EA 3MPBA 1C8M1 1RIRA 3JU9A 3FLRA 3WG1A 2IZWA 4AQ2A 1OFNA 4FQ4A 2R49A 1RUOA 1LHUA 1ND2B 1V6MA 2XJQA 4ES8A 2ZAAA 4I30A 5BNNB 1VBC2 4IV3C 2PHUA 3WY6A 2P3JA 2QNKA 4IEPA 5I8TA 1S2KA 1UX6A 1ZBE3 4R52A 2EXJA 4XJAA 5I0SA 2V09A 1IKQA 2ES3A 2VMHA 4GH4C 4NHMA 4C90A 2JKBA 1LHOA 3ZXAC 1B09A 2UWCA 5BNOC 4MVTA 1C57A 2GU9A 5JOXA 1OPMA 1RUH3 4NHKA 4XFFA 3WCSA 1V6JA 1RJ7A 4Q0QA 4NO4A 5FDBA 1W6QB 2D6KA 3KS7A 4H7LA 5D8AB 1O3QA 1R081 2EXIA 1AR93 1JBCA 1YIFA 1PZ7A 1HV1A 1YJLA 3R4UA 1CAXB 4BLIA 4HN0A 2WFF3 1VJ2A 3MDPA 1BBT1 3HD8B 4JGYC 2P37A 2E7AA 4FOQA 2NP0A 5JAXA 4LBQD 4YVWA 1YRZA 2WNUB 3VBRA 4BIOA 1R092 2C0ZA 1CPNA 2HWF1 2OA2A 5CFDA 2H0BA 1VRH3 1BYHA 4AFAA 1RUF1 4EN6B 1DQ6A 1ZYBA 4MGIE 3ROUA 3U07A 3WHUA 3ZDSA 1IZ3A 1RMU1 1HRI3 4IERA 1NCQC 1ASJ1 3TNQA 2A6WA 3BOPA 4MV2A 4LO6B 5ABJC 5T5PA 4Z92B 1I1EA 5I8SA 1RUE2 2NM1A 2XJSA 1CGPA 1VBB3 3TNPB 1PO23 1X7NA 5J7MA 3MIFA 1RVF2 1PMIA 4PLMA 4G3YC 4AI8A 1COV3 4HN1A 4COYA 1PGL2 2DUPA 4XIKA 4Y24A 3JBG2 4QQPA 5FLIA 1S0DA 3LA3A 4ZXKA 4OLLA 2G9GA 3ENRA 3S7IA 2Q1ZB 3B7MA 3CJIA 2VULA 4W65A 1J3PA 1HQWA 4ONUA 3AXEA 3R0RA 4IEOA 1B35C 1TE1B 2D3RA 3Q9OA 4CDXC 4XIOA 2GC3A 1RUD1 4GIQA 2JICA 1OMIA 1CONA 2IFRA 1MQTB 2P17A 3ZMOA 3ZXGA 5FAXA 4Y22B 4CEWB 1JUIA 5L19A 1N1YA 3AYCA 3GZAA 5A32A 4IEZA 3HQXA 2PAEA 3EXUA 3M8LA 1AL0G 2PAKA 3SH4A 5JPNB 3CF6E 4LO7A 1W0PA 1BCXA 3VKNA 3CLPA 2OVUA 5GZCA 3IDBB 4I3GA 1ZBA3 3IM0A 2RS32 4Q4W2 3QD6A 2B7YA 1REFA 5TSWA 4BLJA 1W6NB 4M3CF 4N9HA 1AJOA 1DYPA 4A7KA 2AREA 1H4GA 3AKSA 1AR81 3FWEA 5BXXA 3TN93 1QNWA 3ZFFB 3ZIWA 4Y4YA 4OI0A 1ENXA 4BCUA 4F8AA 1G86A 4YGEA 5C8CC 2LTNA 3E6CC 1ULGA 1DGRN 4CDQC 3WUDA 1Y9QA 3AMMA 4KU8A 4DRVA 1ZREA 1RHI2 4YGBA 2RS52 1Q8OA 1MZ5A 1H2MA 1Q43A 1WBFA 4UBGA 3PHMA 2EALA 2X5IC 4MX3A 2A5ZA 5FTTC 4OI1A 1AYN1 1D2QA 2CTVA 2JG8B 3APBA 4JGZA 4XQ4A 1QQP1 1DG6A 4WM7A 1RUE3 2MNGA 1KQRA 1RVF3 2LM3A 4XQDA 4RR3B 2RS12 2HYKA 4Q4X2 3L2YA 4HT1T 1LTEA 4XOGA 3JBG3 2OIIA 4X6QB 3WDTA 3LKJA 3FHIB 4HSLA 4N7UA 4XJUA 4B29A 4J1WA 4R9DA 2IXHA 2A6VA 3ZYIB 1NQJA 3ATGA 3WP5A 1X8EA 2VG9A 1CAWA 1RUJ2 2CAVA 1QWRA 5CFCA 2WQ4A 4CDUC 5L73A 1QJU1 1RGSA 2YGMA 2SBAA 2Y0IA 2WSUA 4FPHA 3OBTA 3VBUA 1KRIA 4WVWA 3WW1A 3VZMA 5FMOL 3M3EA 3VUOA 2ZZJA 2OUJA 3N4MA 3JD71 3KB5A 2CGNA 2IXLA 4LHLA 3LSEA 4DY5A 4L99A 4DRRA 4WVZA 2BNOA 3AM2A 3FBYA 2PHRA 1WLTA 4F7ZA 1KS5A 1IPKA 1S0JA 3FC0A 4M01A 3WW3A 1S0EA 4H7MA 5BYNA 3OPZA 1CPMA 1N3PA 1N1TA 1ULDA 1KD7A 1RUI3 4ORFA 3LOIA 4Y1YA 5CADA 4Q4W3 2EAKA 4KWLA 4RHV1 5C8WA 2ZA9A 3LGRA 1U5XA 3L2HA 4AGGA 3QH6A 2PQQA 2RM23 4Q27A 3O0VA 1C5IA 3MIHA 4XEZA 1DZRA 1G8WA 1QJY2 1H0BA 3SCGA 1R082 1LGBA 2XBO3 5L7OB 2JEMA 2IC1A 2D97A 4D94A 1IHMA 3ZXKA 4Q8KA 4KWJA 3I4IA 1ZBE1 5F9TA 1N1VA 4LHKA 2VOVA 1MS1A 4L11A 2ZGSA 5DZFA 4LBLA 1PK6A 1APNA 2BWCA 3ME2A 3NWKA 2WLQA 3K48A 1DGWX 4Y20A 2HWF2 5LEJA 5IT6A 1RUF2 5HXVA 4TZDA 1RUH1 1HQNA 4KU7A 3GBFA 4BQ1A 3H7YA 2ZGRA 2CNAA 4PIXA 1ASJ2 4Q4X3 4XF1A 1ZRCA 3RZZA 3MIDA 2YYOA 1AR91 1SLTA 1BZWA 3PLQA 1ULEA 2HEYF 4GKYA 4Q0PA 4XHBA 2VMIA 2WNEA 2WFF1 3KT7A 3I8TA 3PJQA 3P3PA 2D3SA 3ZYPA 2PHXA 1JW6A 1ND3B 3ZSEA 2P34A 3H50A 4Q4Y2 4XE9A 2IXCA 4M0NA 2QJVA 4IQPA 4IV1A 1VRH1 4XF4A 1F9KA 4I02A 4DS0A 1QOSA 1QJZA 1HRI1 2LALA 4LUMA 2Z69A 1LGCA 1WCKA 3QBQA 4CDWA 1RUD2 3VKLA 4YZ1A 1O5UA 1RUNA 1VBB1 1OPOA 2E53A 1CIWA 1UU4A 3H9AA 3UK9A 1ZRRA 4B7EA 1AJKA 2VUAA 2JG9A 3UJOA 3VGIA 3AZWA 4YSFA 1WBLA 4AFMA 3AKTA 3WQ7A 3ASIA 4DY3A 5FOJB 4HVOA 2B42B 3MYXA 1DZQA 2HWD3 1W39A 2Y0OA 1K5MA 2Q8OA 2K2SA 3V0AA 4GWNA 1AX0A 3JB4C 4QX5A 1WW4A 2D6PA 2O8OA 5EFUA 5A3MA 4C1WA 3ZXLA 1FXZA 1AF9A 1QJY3 4D69A 2I74A 2PHFA 4KG0A 2YV8A 2WA4A 1NA1A 1SBDA 4Q29A 5K7PA 2MPFA 4JV4A 1LULA 1AR82 3THPA 2BBVA 2C9AA 1J58A 1ZNPA 4LO8A 1O4TA 1VR3A 4Z07A 4QGNA 4IEQA 2ZOEB 1NCRA 4KWKA 2QDRA 4BMEA 4WVMA 4JTOA 4C91A 3U10A 3EO6A 1U5YA 1WW5A 2GAUA 3DUIA 4WM7C 3GYDA 4YW1A 3ZN6B 1RUG1 2PHTA 4HFSA 1ZBA1 3GHNA 1Q3EA 2TUNA 1ASJ3 5T50A 4GH4A 3AYEA 2Y38A 1AYN2 3MW2A 1XYOA 2B39A 3OCPA 3ZIXA 1LR5A 2NZ9A 2XWJB 4AHXA 1QQP2 1HV0A 1YYNA 1YFXA 5BNOA 2G9FA 2O0OA 1RB8G 3HAGA 1Q8PA 4PDWC 3JZVA 3TN91 1GFF2 3KSCA 2XJRA 1V6LA 5JVVA 4FPLA 3FLPA 3CU7A 4LBNA 2ILMA 5GLUA 3AP9A 1DGRA 4Q4Y3 3A0KA 2GMEA 4BM8A 3VBUC 1OKQA 1H9WA 5AVAA 2ET7A 1BVVA 2R1DA 4FPGA 4AEDC 2HJIA 2YXSA 1WLDA 4DNYA 3ZMNA 4AI3A 1I9RA 2EXKA 4INDA 1YFYA 3CO2A 1ZA4A 4UBHA 5DZEA 1QJU2 4FPKA 2QE3A 3VHRA 1PIV3 3O5SA 4XTMA 2E51A 1ONAA 4QXKA 1J1TA 3JD72 2VPVA 1WMFA 3U0ZA 3V0BA 5JMCA 1QH7A 4HK9A 4XFAA 4XW3A 3BPZA 1D4VB 3JBG1 3AXDA 3M1HA 3VKOA 5EWSA 2BW8A 2ZX3A 3H1WA 3B02A 4DXZA 1W6MB 4YVWB 3VBRB 2B9UA 1D2SA 2Q4SA 4FPFA 2FMYA 1S0CA 5EXOA 5CFDB 1WLWA 1H8TB 5JZGC 5F6LB 1GZWA 4AQ6A 2WNVC 2ZGMA 4K40A 1HIXA 1QNYA 4L9BA 1TME3 5CB7A 1AR61 2MEV2 1OQDA 5KHIA 3POSA 2VOXA 1V6KA 1PK6C 3NL1A 3NO8A 1UAIA 4AVBA 1Y7BA 4XETA 4GMP0 3N7MA 4BH9A 1KDKA 1UMZA 4QPGC 2ZMNA 1ZBE2 1M06G 1GV9A 1UU6A 2SLIA 1RUI1 3CJIB 3AKPA 1SACA 3OY8B 3POWA 2RMU3 2C1FA 4Q4W1 1CJDA 1DQ4A 4WM8A 3AZVA 3CEWA 4FOYA 1RUH2 4E27A 1UIKA 3ZVXA 3POYA 2RM21 1ZX5A 2VQAA 4I3PA 4IEVA 3RNSA 3VKMA 2ARBA 5CU1A 1AR92 2XBO1 1WGPA 5C6CA 3A0NA 4AI2A 4IETA 5ACA1 2A6YA 2TNFA 2A6XA 5A32B 2ETEA 1KXGA 1E57A 3I59A 3ZSLA 1W6OA 5C8CA 1W2UA 2GALA 4XFIA 4CDWC 4KNCA 1GLHA 4CDQA 1R1ZA 2CYFA 1NXMA 4LBQA 1PNFA 1U0AA 1UZYA 1J3RA 1Q56A 1WCDJ 1A8DA 4YRDA 1OOPC 2D5FA 1WMEA 3VZOA 3FBMA 4W6XA 3U4XA 2JG9C 3LWCA 1HRI2 4Q4X1 3ZYJB 5EJ3A 1HXS3 3VDDB 1KS4A 3ZSKA 1PHMA 5JDBA 1VBB2 1F5JA 4YARA 3VZLA 3FFZA 1EPWA 1QDOA 1UKGA 3HT1A 4HKOA 2PYTA 5CVRA 4BOWA 4KQ7A 4M3CA 4YG6A 1NZCA 1SDWA 3FUQA 3CNAA 3NAPA 4YFZA 2VNRA 5KHGA 1MACA 4BYYA 5E88A 4V1PA 2BPA2 1XE8A 1HW5A 1AR73 4HLTA 1WW7A 3VBFC 2MEV3 4MYEA 5BNPA 1DYKA 4DB5A 4K9SA 4JGZB 5GZDA 3ZFGB 1AHSA 2DCZA 4WM7B 1RTVA 5EV7A 2UURA 4CDUA 1LCLA 1NCRC 1GKBA 5C33A 1C4RA 2EA7A 2JDZA 5FO8B 4COVA 1FAYA 1R1A3 1YFWA 4DFSA 2E7TA 3DKWA 4AI0A 2P3KA 3EHKA 3WG3A 1GZ9A 1OQ1A 2BTVC 1YLLA 4Z8BA 1TNRA 5H9PA 1W0OA 4N53A 4RS5A 4OHXA 1UF2C 1RUC3 4QU2A 4Q0VA 2F6BA 2XUMA 3VBOB 1LECA 4FPJA 2HWD1 3QH7A