3FC0A

1.8 a crystal structure of murine gitr ligand dimer expressed in drosophila melanogaster s2 cells
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
123
structure length
123
Chain Sequence
b'SCMVKFELSSSKWHMTSPKPHCVNTTSDGKLKILQSGTYLIYGQVIPVDKKYIKDNAPFVVQIYKKNDVLQTLMNDFQILPIGGVYELHAGDNIYLKFNSKDHIQKTNTYWGIILMPDLPFIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GITR ligand
publication title 1.8 A structure of murine GITR ligand dimer expressed in Drosophila melanogaster S2 cells.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 26
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3fc0A00
5KC5A 3TWIA 5L19A 2WNUA 1A8MA 4G4FA 4QQOA 1IQAA 2X29A 4NN0A 2ZJCA 4QQ2A 3IT8A 3ALQA 2KA3A 2WNVB 2WNVA 3TYJA 5KWRA 2WNUC 4OUMA 2Z5WA 1D0GA 1C3HA 1DG6A 4QQHA 1XU1A 2HEWF 1XU2A 2TUNA 2Q1MA 1D2QA 2JG8B 2JG8A 2WNVC 2QE3A 1U5YA 1RJ8A 4DOUA 1WCKA 2WNUB 4EN0A 5BNQA 1PK6A 2RE9A 1OSGA 2E7AA 2JG8C 3QBQA 3URFA 4TWTA 1PK6C 1GR3A 1O91A 4G3YC 1JTZX 3ME2A 4E4SA 4GIQA 4DB5A 4N90A 4OUSA 2JG9B 4OULA 2JG9A 1RJ7A 2ZPXA 2TNFA 1ALYA 3K48A 3B9IA 3B94A 1PK6B 3K51A 2AZ5A 4KGQA 5KC6A 1OQDA 4QQPA 4RSUA 4MXVA 1DU3D 1JH5A 5HBAA 4J6GA 4D7YA 2JG9C 2O0OA 1TNRA 2QDNA 4QQLA 2RJLA 1TNFA 3B93A 3QD6A 1OQEA 2R30A 3FC0A 4KGGA 2Q8OA 2OIIA 3L9JT 5L36A 3AB0A 4QPYA 1S55A 1I9RA 3V56A 4MXWB 4MXWA 5TSWA 2R6QA 2RJKA 4KG8A 4TSVA 4E4DX 3WD5A 1KXGA 3MI8A 4MSVA 1U5ZA 2R32A 1KD7A 5CIRA 2HEVF 1C28A 4F3JA 1D4VB 2HEYF 1U5XA 4HT1T 3LKJA
chains in the Genus database with same CATH superfamily
3ILRA 1XNKA 3AKQA 1XSQA 2CDOA 4YGDA 4XJZA 5DAWA 3WNXA 1Y43B 3ZDVA 1T2XA 1YNAA 2WNUA 3HR9A 4YG0A 1PNGA 5L9BA 2WN2A 2FMDA 2XHKA 2Z4FA 2ZS6B 4NIHA 2WC2A 1CVNA 2C5DA 1QH6A 3SKVA 3GGLA 5L9VA 5FZOB 4CEWB 4DIQA 1Y3TA 2A7AA 1GBGA 1W0NA 2CDPA 2RDRA 2F17A 1NLSA 2WS92 2Z5WA 3TEXA 1AR71 4CCCA 1XSRA 4GMP1 2O8OA 3EB7A 2LRPA 1S4CA 4NRMA 5F5QA 2X05A 5GZFA 1VAKA 1LHOA 4E2QA 3RRDA 3HEIA 5C8CB 3SITA 3I2IA 3B7MA 3H42B 3H3UA 1KRIA 5JPMB 2WNOA 1IG0A 1PVXA 3PUIA 3WV6A 3TN91 3CZJA 1YFWA 2BU9A 5FO7B 4OI0A 5DUXA 4XMIA 3UKVA 2RS52 3AKRA 1O3RA 1Y9GA 5BNPC 2JECA 4NOTA 4YVSA 4CDUB 5LBCA 4ZU5A 4ARYA 3LEGA 3I2JA 4OZXA 4ORFA 2PHFA 2VXJA 4ZXKA 3J7LA 4DNYA 3ZXJA 2XPJA 3RZHA 1GQPA 1VIWB 4Q4X3 3HD8B 3VGIA 4LKDA 1U5IA 3M2MA 2P6HA 2ZGRA 1KS4A 2E63A 1XPWA 4NO4A 2EVXA 4XFGA 5CFDC 2ID4A 2JD4A 2ZXQA 4XJ9A 1MZFA 3JU9A 5JOYA 3VHNA 1YCIA 4WM7C 3BTYA 3HNYM 3I2FA 1DLLA 5EP9A 2R042 1KGYA 2Y64A 3W59A 3B9IA 4IUGA 4GA9A 1O3QA 1QOOA 2VZVA 4LORA 3U75A 3VB9A 4JKMA 3G7DA 3OY8B 1CIYA 1NCQA 1NCRA 1UWWA 3M7AA 4Y5TA 1GNZA 1UXZA 4J6GA 4CP1A 4PDWA 4AVTA 1O5UA 3ZFEA 1CPNA 1DQ2A 4BK4A 1N1YA 5JSRA 4DO0A 5K7PA 4YGEA 3VZNA 4D0QA 1AYM2 5HI0A 2XGXA 4OMDA 3H8UA 3RJRA 1EV13 3E6CC 5IAXA 5FPVA 5C4WB 1W99A 2R0HA 1VBD1 3K3NA 5IVFA 3AYAA 1PO12 4HKLA 4LO4B 3BIWE 5GLWA 3VBUC 3F95A 3GDBA 3VL8A 1JHNA 4QXHA 4BK5A 3T4HB 1DFQA 3O1SA 2BVBA 1W6QA 1VRH2 4MXWB 4Q0PA 3VBFC 2RR13 4LBOA 2MHFA 3M70A 3WDWA 1UKGA 3ZYHA 4Q29A 4TLFA 2DVFA 4TSVA 3WXPA 4AQSA 2L9LA 4XILA 3WF3A 3ZFGC 3JQWA 3PMEA 4YRDA 3NNLA 1V6NA 4Y5SA 1V70A 2HEVF 5CIRA 4YW4A 4FPYA 1RUG2 4PJYA 2XJVA 3CL1A 5T5LA 2ZA9A 3BOPA 5C8CA 2A6ZA 1QXRA 2RV9A 3OPZA 3ORJA 1CONA 2GMEA 1ONAA 2HYKA 3V65A 4PF1A 4BISA 1REFA 1EPZA 1V9U3 3TWIA 2UU8A 3JB4C 4BPZA 2W39A 2IXJA 5FZMA 4QPWA 4XFHA 3VDDA 3ZYIB 5K8SA 1CGPA 1JBCA 1I5ZA 2TEPA 3IT8A 4CE8A 4CDUA 3POEA 4ZU7A 3OBZA 3GJAA 1QNWA 1RUC2 2ZCWA 4QX5A 1OKOA 3AYDA 1MS9A 2WO7A 4NHLA 4EJRA 2HBTA 5HV4A 1D0GA 3E6DA 3ZSEA 4M3CE 2E51A 3AKSA 2NLRA 4IV3B 4H2AA 4RQPA 2UURA 3C8XA 3I2HA 1HV0A 3B01A 3FUOA 3PHMA 4ZU4A 4OVEA 4Q4Y2 1BXHA 5A1AA 1NT0A 3PMSA 2D44A 2JD9A 1W6PB 2RM23 3NJVA 3AZWA 4MGZE 1OSGA 3KV5A 3KV9A 4XAAA 4NWVA 1ZBE2 4CCLA 1ULFA 1JOPA 4QGMA 3ZXKA 5H9PA 3E1F1 4CDWA 5JOWA 3GZUC 5JXJA 2G19A 1W6OA 4GKXA 4DRRA 1IKQA 2YBSA 3E6BA 2D5FA 1WGPA 4C1WA 3M3OA 4FPKA 4AVAA 3IDCB 3IM0A 3JD73 4MOAA 5FBJA 5BNPB 2GMPA 3VBOA 3WP4A 3EQEA 1OD3A 3PVOA 1N3QA 1QWRA 1PVC3 4NMIA 1HV1A 1CAVA 4P9WA 2WT1A 3BB6A 1RJ7A 2HKXA 1HJFA 3AL5A 5EYYA 2JDHA 1ND2C 2R16A 2JX9A 2EXKA 5F3EA 5HXMA 4BQ2A 1CX4A 3LE0A 4J1WA 1OLME 4EV0A 1BZWA 1XBFA 5FP3A 5EHDA 1VRBA 2ZX4A 2SBAA 4ATFA 4WM7B 5DAQA 2FCTA 1L7LA 1N1TA 5JR7B 5DUVA 3KHCA 1TNRA 4NR1A 2BV4A 3S57A 1UYYA 5FK7A 5E1RA 3ZN4A 5A7WA 4AK3A 5J3UA 3B93A 1MQTA 2R30A 1NXMA 5EJ3A 3T09A 3ZSKA 4FPOB 3E5QA 5ERLA 4RYDA 3UKTA 2OIIA 2BWCA 2R1DA 3OJBA 4AI2A 3GNEA 3KM5A 1PO22 1XYPA 3Q8EA 4HL0A 5DXDA 4AFDA 5KXBA 2YBPA 1IPKA 3J7HA 1VBC2 4V2VA 1S0BA 5A7NA 1R64A 3D0SA 3UYJA 3WNNA 2VQAA 1JZ4A 4Q8KA 2WQ4A 5EZWA 3O1VA 1RUF2 4TTGA 4HBNA 4NHMA 2DCYA 1WW7A 2V5YA 3K4DA 2W68A 2QJVA 2W92A 3H9AA 4Q4W2 2VY0A 2WN3A 3PUAA 2WS91 2DDUA 2JEMA 5CADA 2Y26A 2GP5A 1CD3G 5FZDA 3VBFB 3LAGA 1RL3A 4XIKA 3AFGA 3WUDA 3ZR5A 1UY1A 3A0KA 2WSUA 3D82A 4LE3A 5E8AA 5FZEA 3RMYA 4H55A 3ZMOA 1KFUL 3POSA 4MGSA 1RC6A 2QQMA 3KT1A 4FPJA 3VZOA 5JLVA 5ANNA 4JKKA 5E89A 3H1WA 2E53A 2HWD3 4QGNA 4P5HA 2RS51 2XL9A 4QPIC 3MIGA 1AL22 3VHOA 2FDGA 4Y26A 5LEJA 1AZDA 2VZPA 4K7JA 2PN5A 1QQP3 3POYA 3D4KA 5EIYB 3WT3A 2D6MA 3HT1A 4RGGA 1QGLA 2LM3A 3PVBB 3WNLA 3KQRA 2MEV1 4CA9A 3HNBM 4HVRA 1VMJA 1V00A 4LBQD 5A7OA 3C2UA 4C1XA 2OUJA 1JZ2A 3T08A 3RZGA 1JUIA 4YW2A 5JWPA 4XYXA 1VBA3 1IS3A 4IERA 2G4IA 4LHLA 2IWGB 5F6LB 2VGDA 2R041 1AXKA 1FPN3 3ZMNA 4IE4A 5CFDA 5JZGC 1W9WA 4JCKA 1QJY2 1UOGA 3IIAA 3ZPOA 1N3PA 1RUH2 3WW1A 2A6YA 4IGOA 2H6BA 3N9MA 4WM7A 1SLAA 3BODA 1LODA 4QKFA 2QQUA 2Z2SB 4P9LA 4YM3A 2ORZA 3CLPA 4ET7A 1W05A 2DUPA 5F5IA 4BH9A 3UJOA 4EWDA 1BVVA 3WNMA 1YEWA 4F7ZA 1AYM1 1ENQA 3RMXA 4CUCA 2ZKNA 1C8M1 3OGGA 5A3OA 4I3PA 1LECA 5K4LA 3USUB 2W1QA 2VNGA 3CNAA 4LBQB 1UKRA 3O1PA 2ZGLA 2R1BA 4HANA 4CUGA 2LUWA 1UY3A 3OCPA 4A42A 1BHGA 2VW2A 2VOXA 3POBA 4UFJA 5A7PA 2WO1A 4DY5A 4DZGA 4DUVA 3CEWA 4BLJA 1JZ7A 1SZBA 2VCMA 2RDQA 5FZHA 3WDVA 5J96B 2JDNA 3WZ1A 3U0ZA 1QF3A 3VBUA 1O3TA 5T55A 1CR7A 2GNDA 4YZ4A 3NSTA 1CAXB 1VBB2 4QPGA 1N1VA 2A75A 2IXCA 4I01A 1OUSA 1FV3A 1H2KA 4AR2A 2VTFA 5IK4A 2B45X 4ATEA 3MIBA 3QD6A 2RS32 1QKQA 1EAH2 1QXPA 4RGKA 2X10A 4KGGA 5L9RA 4IEZA 1UF2C 1H6YA 4IEWA 1PHMA 3ZYPA 3ZFGA 4XTMA 5CFCC 1LAJA 2PHTA 4LHNA 4YLZA 3R4SA 5BV6A 2CHHA 5DABA 1O5LA 4ZKTB 4PI2A 1EP0A 1RUJ3 1SLCA 2X5IA 2XBO2 4L9BA 4YW1A 4K20A 3V56A 2PLV2 4ZXEA 5FPLA 2IVJA 5DAVA 5ABJC 3ASIA 5IUQA 3U07A 1OQ1A 1H8TB 2GH8A 2LS6A 2GALA 2VCCA 3P1IA 5LA9A 4V2WA 3EJKA 1GSLA 2MNGA 2YC2A 3UGHA 4XDQA 4UI9L 1AX1A 1RGSA 5K9YA 1U5XA 3DL3A 2W2IA 3KT7A 4Y20A 1G9DA 1VBE2 4Q4Y1 4BCUA 1WCDJ 2HWF2 3O1MA 1H4HA 2QQWA 2JIGA 4KWJA 3FHIB 5FR3A 2QQJA 3FFQA 4Y1YA 2NM1A 2BBVA 1YI9A 4HVOA 1LJ7A 4A7KA 3D8CA 1X8MA 1ND3C 1JYNA 5FPBA 1LEDA 2Q8EA 3ZDSA 1WLTA 4AAXA 1ZBE1 3RWNA 3AYCA 2XWJB 1SLTA 1GNYA 2BERA 3D6EA 4LKFA 4M3CB 3OYWA 4OZOA 1J59A 5D8AC 2KM2A 2LW8A 3RGBA 2AEYA 3CMGA 4RHV2 2CWSA 1ASJ3 1S2EA 4QPIB 1QY4A 5F8PA 3PUHA 1RUD3 2Y6LA 4LO6B 3GCWA 4CU8A 2QE3A 3KWVA 1RXFA 3Q8BA 3AP5A 4QWNA 1RUE2 4FTEA 1MVQA 2JENA 4L2NA 4Z07A 1H8VA 4MO3M 1LENA 2ZGSA 1LEMA 5FYTA 2HWE2 2B9UA 2E33A 5KBFA 1IGOA 2PXJA 2WFF3 4HK8A 3OF1A 3BTZA 1AX0A 4JGZC 4UAPA 2CNAA 4N43C 2CY6A 4LKEA 5CEHA 1HXS3 5I8TA 3RYRA 1ND2A 5L7OA 1X7NA 3AZYA 3OEAA 5FZ7A 5JIAA 2P3YA 2E9QA 5JZGB 3LOIA 2WA4A 2B9VA 4L0PA 2FDHA 1O4TA 5IVBA 3U10A 4GWIA 1MS1A 4QX7A 1REEA 4OULA 2WJSA 3JCIA 3M3QA 4Y22B 2RMU3 1PO21 1A78A 3GBWA 2OX0A 1SPPB 4BOWA 1ZBA3 5LY1A 1YQ2A 2ZMNA 1VBC1 1OT5A 1UIJA 4FOWA 4F8AA 4C90A 1OQDA 4AI8A 1UX7A 3Q8AA 4FVVA 5A33B 3BN6A 5C5UA 5HBAA 4AOCA 1SCRA 2JG9C 2GC3A 4JDNA 2DTWA 4CSWA 3WUCA 5FO9B 1RVF2 1RUOA 3KS7A 3RS6A 1MEC2 1Q8SA 1S0EA 1APNA 1HRV3 1YIPA 4YM1A 1QJU3 1Y9MA 3NRUA 4PLMA 3WR0A 1WLDA 2W1WA 3BUCA 1MPXA 1REDA 1OA3A 1R093 1GU3A 1QEXA 3DYMA 4S2HA 4JRLA 3AYEA 5FYHA 3WG4A 2K9ZA 5LATA 4A3ZA 4H7LA 2E6VA 1N1SA 4QX3A 5GLTA 2FZ2A 3AVRA 4XTPA 3U11A 1VP6A 5JXGA 1CAWA 1W9SA 3AZXA 4IEXA 5FZ1A 4M3CA 3W21A 5JPNB 3RZLA 4AG4A 5IYYA 2XLGA 3MW3A 1NOVA 3DYPA 3VBHC 4AHWA 4FAHA 1DBNA 3VZLA 1JMUB 1LOGA 2NMNA 4KWLA 4B3NA 1K5MB 3HN1A 2J7MA 2UWBA 2W1UA 4XHBA 4NAOA 1GKBA 4CCJA 2CWMA 4I02A 4UOJA 5ABJB 1CZVA 1YQ6A 4K9SA 5CG9A 4YARA 3HQRA 1AR73 4GZ9A 1OH4A 5BNOC 4GMP3 2QQIA 2DV9A 4CCEA 1KFXL 1IQAA 3FHQA 1DLCA 4FOVA 1SFNA 2QNKA 1GWMA 1QH7A 2JB8A 3AMNA 4QKBA 4YVWC 3WF1A 3QOPA 2J1SA 4LR4A 3CJIB 4BE3A 3O1OA 3PNAA 4CPBD 1RUH1 1AXZA 4O7XA 5BYNA 3TN93 1UO9A 3HOBA 4XF0A 3LIGA 1IS5A 3SCGA 3MW4A 4DEVA 2EA7A 2VJXA 4LOSA 1W6MB 4OHVA 4Q8LA 4PBPA 3V64A 1OD5A 2Q4SA 4CU9A 1J3RA 5JZGA 4CEWC 2JDAA 5F39A 1RUJ1 4NPRA 2HWC2 3T0DA 2VVEA 2VUJA 1OF4A 4CDXA 3FMGA 3OGRA 3KV6A 1FNZA 2FDIA 1DQ1A 4Y22A 1LGCA 4RD7A 1SPPA 3PUQA 1G86A 1OFNA 3AFKA 4MVTA 2C1FA 5DAPA 1AR62 3S30A 2VQ0A 1OPMA 2A3WA 3IMNA 3AVSA 4YSFA 3J26N 3VDBA 5G04L 2QVSB 2QQLA 5FLJA 3MZHA 3IDAA 3IDEA 4UFIA 1LHUA 3NAPA 4N7UA 3BTAA 3ZO0B 1NYWA 4FOQA 3WHTA 1VBB1 4BHPA 4RFRB 5IK8A 2XJUA 2BUKA 2YMZA 2PAEA 5FUIA 2J42A 1D0HA 1ZA4A 4GIQA 4FFGA 4S2GA 1PGW1 1EAH1 2P3JA 3GJBA 3VKOA 3MLLA 1CX1A 1E5SA 4KWKA 4Z1VA 5FZBA 1ODNA 3IPVB 5HPOA 3VD3A 3IB3A 3OGVA 1D4M2 4N43B 3NV3A 3SCHA 1DGWX 4I0AA 5I91A 3K51A 1NXD1 5I0UA 3ACGA 4IESA 2QQOA 2EXIA 5FYYA 4OCTA 2ZBJA 2XBO1 3FJSA 4E2GA 5FWEA 1VBD3 2HWB2 2PLV1 5IFTA 3J8F2 2VQUA 1RUD1 2AC1A 3GBGA 1G9AA 1XYOA 1BBT1 2D5HA 3A7QA 2VUAA 5CFCA 1JZ5A 5FIXA 3T2OA 3RYKA 4BQ5A 5JOZA 4WV8A 3WP6A 2XJPA 4EQVA 5FZ8A 5FUPA 1OQEA 5A3WA 1AR82 4D7SA 4EZ4A 2Q0AA 5ABJA 2VW1A 5F7UA 1WW5A 1VBE1 2HWF1 4JV4A 2H0VA 3TNPB 1PIV2 3OG2A 2ZAHA 5FAXA 2ZX1A 2YU1A 3GBFA 3N9PA 2ERFA 1XE7A 2WZR2 2GDFA 5IATA 4LLOA 4HXCA 3DEMA 3CHXA 4BQWA 5C4WC 2WWJA 4URTA 1GMMA 1QJX2 1QJEA 1YFXA 5T54A 4XCBA 3ZVXA 1R1A2 2XOMA 1U5ZA 1KD7A 3NNFA 4EWEA 1W6MA 3A21A 4N7IA 4FPEA 4W50A 5LB6A 1D4VB 3AP7A 5FXZA 2VOVA 4DXTA 1H6XA 1W8OA 1WZXA 1ZBA1 3KGZA 1ND3A 4NHKA 4YYOA 3WDXA 1FOD2 3Q8FA 1HN0A 3O14A 5J98B 1O4YA 5D8AA 1RUE1 3A0NA 2Y6HA 3WDYA 3KCXA 3MHZA 5CB7A 3VBHB 3ZXFA 1HDKA 1K12A 2BQPA 2VU9A 4YG3A 2PYTA 5GZDA 3FUQA 3VV1A 2EIEA 1GP5A 1F2NA 1R081 2D7FA 1OLRA 3POGA 4IV1C 1PMIA 4KH9A 3B3QE 5KWRA 2DYCA 3POFA 5I0DA 1YQCA 2DVDA 2VZQA 1RXGA 4OUMA 5B4XA 4CP9B 4J25A 3U4SA 5AFEA 5BNOB 2FCVA 4K1ZA 2D6KA 2C6SA 5LA2A 2ADEA 3O12A 5FP9A 3HWJA 1D2QA 1QNYA 4R9DA 2ET1A 2PMWB 3ZIXA 4DEQA 4DUWA 4IE6A 4RR3B 3HBZA 5FCCA 1L3JA 1SLIA 4JGZA 3UETA 4N43A 2B7YA 5FREA 3WDUA 3ZSMA 2A6XA 2VCBA 4J1XA 4NWWA 4IV3C 4Y4RA 1GP6A 5T3NA 5BXXA 1V6KA 2XQXA 3DXTA 3RFRA 2J1VA 1AXYA 1I3HA 3MW2A 4FCAA 4OMCA 2DU0A 4AVSA 1OLQA 4HK9A 2AGSA 4OHWA 1POV1 4FTSA 1KQRA 3AJYA 4KMQA 4IEYA 1DZQA 1XC6A 3HQUA 3VD7A 5IVEA 2VULA 3N9OA 3RPQA 2Q5TA 1JTZX 1BMV2 1S0JA 1RVF1 1K3IA 3MO4A 4RGAA 4E4SA 3ZR6A 1MEC1 3PIJA 1NA1C 2BZDA 3EXUA 3KMHA 5FZLA 4QKNA 1PX3A 1ENXA 2PHLA 3DUIA 3FWEA 1SACA 5DUWA 1JODA 1LOCA 2JG9A 3AK0A 2I74A 1DGWA 1JHJA 3ENRA 4FO9A 4GD4A 4EWAA 1E5RA 1TG7A 2WR9A 1AL0G 5JSOA 5KHIA 3N7JA 4PLNA 2JDMA 4NIDA 2EF6A 4XJAA 1MS0A 5FUNA 1GZWA 4HPKA 4MXVA 1L7QA 1C5HA 1NAEA 4CCNA 5HCHA 4XETA 2EALA 3LQCA 4COUA 4D7YA 3C3VA 3DV8A 5CBLA 1R1ZA 3EMRA 3PU8A 2WDBA 4MH0E 4XDOA 3WG3A 1UQXA 5FY1A 4DFSA 4FPLA 1SDWA 1V0AA 4LLFA 2W5FA 2VR4A 3A23A 3BU0A 2ADDA 4W8JA 5BNOA 3RI9A 3KVBA 2C4XA 4QDQA 5K0UB 2P5BA 5AC91 4B1MA 2XUEA 3MIDA 2WS93 1UAIA 4OHXA 1ZVFA 3WCRA 3GYDA 4OHZA 3W5NA 1NE4A 3D0JA 3VKFC 4WM8B 4GB31 4CCKA 5FPXA 2Y0IA 3FHAA 3NV1A 3JUUA 1RINA 4E4DX 2VMDA 5A80A 4CP9A 1GOGA 4NIIA 3NWKA 3KV4A 4ZZ8A 3LZZA 4MSVA 2R32A 3S7IA 4B7EA 5LWBA 4XW3A 2RS53 5LBFA 1U12A 4YVWA 4A7YA 4XFFA 1LRHA 2ZHNA 3RG0A 4QB2A 1SCSA 2XKPA 1DQ4A 2HWC1 3WLUA 3ZN6B 4BA6A 3NO8A 5LZ6A 2ZABA 5FK8A 4E4HA 5CZKA 4AGGA 4Y24A 2MEV3 5DDJ2 1LESA 5EYXA 2ZJCA 2PA7A 3FLTA 4RFT0 2E7QA 3G6JB 5FZOA 2KA3A 2YHJA 4CEWA 2D6OX 2W47A 4AEMA 1C3HA 2R043 3AJZA 1TME2 4W6WA 4Z2WA 1J1TA 1J3PA 2R062 2YPDA 1OURA 2CAUA 3VHRA 4XXPA 4GQ7A 1HLCA 1Q8QA 1HW5A 3CIHA 2JG8B 3NVCA 2YXSA 2XL7A 2OW4A 4IV1B 4A7ZA 4BZ4A 1NUKA 3S5QA 1QU0A 1W0OA 2BDRA 4GWMA 3MF6A 3E5UA 3U1XA 1D4M1 4HFSA 3PJQA 4XFAA 1AYM3 4FPCA 2RE9A 2NQYA 2QCSB 1WCSA 1C8M3 2NPIA 5DG2A 1Y7BA 4AQ2A 3JZVA 3NKGA 2R49A 1IS4A 4QX1A 4H7MA 3MPPG 1UZZA 4IW3A 3J8F1 4KU7A 4BWOA 3AKPA 1ZZ7A 2Q1ZB 1QDCA 1OHFA 4BQ4A 2X8KA 3MUY1 2BNOA 2WNEA 4UWDA 3SMHA 2CSGA 4KBBA 4LJHA 3SQOA 3MIFA 4AGRA 4K3UA 4N53C 3KF5A 1AR81 4XIOA 5A3PA 4TLGA 5FO8B 2Z69A 3VZKA 2ZMKA 1JYTA 3VBSC 2FZ1A 3H50A 1AUYA 2OQ7A 3HT2A 2AEZA 1ZM1A 1WD3A 4UT5A 1PIV1 2EXJA 5AFBA 4JTOA 3DKQA 1LULA 3D3AA 3WNOA 2WYFA 4IEPA 3OY8A 1NA1B 4GJZA 1T6BX 4I3GA 4UFKA 3ZM8A 4Z92B 2ZAAA 3AZVA 2WABA 4CZSA 4CDXB 1OMIA 1R1A1 1XNCA 4GXLA 1ZZBA 2VE1A 1HN1A 1B35C 3MV01 2W94A 2RJLA 2VBDA 4QQLA 5ANQA 5FYCA 1AHSA 1W9TA 2D97A 3GZTB 2BRTA 2BGCA 3AC0A 5DZFA 4Q27A 3E5XA 4AI9A 1RUC3 2SLIA 5FP4A 1H9WA 3FFZA 1FOD1 4G9SB 2VW0A 5C4WA 4EROA 1US2A 3OBAA 1QXJA 5F2SA 1M06G 2EIBA 5T5OA 5J48A 3R6SA 5JCTA 2FMYA 1W6NB 1O6UA 1OF3A 2AUYA 1J83A 1I9RA 1ENSA 2BJSA 3CJXA 3ES1A 2ZOEB 2RS12 3H1MA 3MV11 4MXWA 1YRZA 4SBVA 3H7JA 5CU1A 4Q4Y3 4CCMA 3MBWA 3WF0A 3LSEA 5FYUA 4PF5A 2GMMA 4N9HA 4FFFA 4NRQA 3LDBA 4JTNA 2Y0OA 3ZX7A 4P9GA 1VMFA 4DY3A 2VMFA 2YC4A 4IEQA 4JGYB 5HXVA 2WRAA 3P3NA 1ZBE3 3B9CA 1Z7S2 3RNSA 4XF3A 3UKNA 4OQ8A 1ZRRA 5FJKA 4IV1A 1OOPB 1GFF2 3C7EA 4XURA 3H3ZA 2A6VA 1DYPA 1H8TC 1S0GA 5FY7A 1ODMA 3LEMA 2ZGKA 2VL4A 4LBJA 2Y6JA 5JR2A 1BEV2 5DMYA 2IUWA 4LHKA 2JB4A 5JSPA 4A44A 4OYUA 3OPWA 1WMFA 5LW9A 4HSLA 1TMF2 2WWUA 4UW3A 4AEKA 5JAXA 2Y34A 1XU1A 4IV3A 3BI3A 1BMV1 1XU2A 3SCFA 5A70A 2VXRA 3H8OA 3L2HA 2AACA 4KG0A 4Y33A 3ELNA 2OZ6A 3V0AB 1GICA 1Q3EA 2JE7A 5A32B 3I2DA 5BNQA 1W6PA 2R072 1OBNA 3UT0A 1X9PA 2ZACA 4AW7A 2X09A 2FBEA 1UPIA 2RG4A 1MVEA 3U78A 1VBA2 5FRAA 3QBQA 2JDZA 1G9FA 3E97A 3RZMA 4B8EA 1W90A 1ULEA 1RUI2 1PO23 3H8RA 1GWLA 2A6WA 1XE0A 2DBNA 2QQNA 1VBC3 4FI9A 4WZFA 1PZ7A 4HSJA 4AI1A 1XYNA 4AVCA 5BNNB 3MICA 3ILNA 5BNPA 4FP3A 2QZ3A 1RYYA 1UY2A 2ETEA 3LDRA 2FDJA 1PGL2 3IZOA 2XONA 2LALA 1IPJA 1SDDB 4Q4W3 1Q5OA 1HQWA 4K6BA 1YFUA 4OFGA 2XWBB 5IHRA 3VKMA 1COV2 1YHFA 1V6LA 4A2UA 4Q2FA 3SC7X 1WA4A 2BOJA 3J9SA 3WQBA 1IG3A 2BNNA 1DU3D 3LPFA 4N53B 1W0PA 4Y1ZA 5FYVA 5HCFA 5A3MA 4W4ZA 4RA0A 3VBSB 1H1IA 1HB3A 2F6BA 5H9SA 3J7MA 1XRUA 1OKQA 1X36A 5C70A 3IDBB 4YG6A 3T1LA 4DRVA 4O65A 1VAVA 4CDQB 1GOFA 4YW7A 4UW4A 4XEZA 4XJUA 4AFAA 4COYA 3HVDA 5EJZB 5HCBA 2CU5A 5KXEA 1DHKB 2C9KA 1W03A 5A6XA 1PO11 1UYPA 4OLLA 2WZPP 2ZKLA 1B35B 1I6XA 5DDJ1 2XJTA 5F6KA 3WX5A 3O1RA 1IPSA 4NHXA 2PAMA 5FY8A 3MIHA 3AZZA 4YGCA 5HCAA 2R6QA 1VRH1 1PZ9A 5DUUA 4F83A 2RJ2A 3N9QA 1LHNA 4XUTA 3B02A 5F37A 4YW5A 4AGVA 2A73B 2QFEA 5JUVA 1KITA 2VBPA 5DZGA 3ETPA 1TME1 4KI5M 2HEYF 2R061 4K1YA 5IVYA 4CTEA 5C9AB 5F3CA 1QJY3 3VLBB 1RUG1 3VBFA 1RUH3 1H30A 3I3QA 4GJYA 1GUIA 3UGGA 3DXUA 4MUVA 5A32A 2P4EA 2ZGPA 1O8SA 1W8UA 2GC0A 1ZA7A 3LDKA 5FZ0A 2Y60A 1B09A 1BYHA 1K5MC 2W52A 1BK1A 3TYJA 1RUC1 2HBUA 1YC61 1TEIA 5H9RA 1XB9A 5F32A 3X29B 5FMDA 3NQHA 1HB1A 2XVLA 4U36A 1ULCA 1DYKA 1S0FA 1OUXA 1A3KA 2VNOA 3ZPYA 1QOSA 3CJIC 3MLJA 5C3RA 1WLWA 2WLPA 4QAWA 2BOIA 3H7YA 2YU2A 4L8QA 1LOBA 5IFPA 2IXIA 3AMHA 3MFAA 1DCSA 2YY1A 4NRPA 1VBB3 3ZYRA 4BXFA 4XFIA 1OPOA 4ZS2A 5CYYA 4MZUA 3ITQA 1CESA 2RS33 2HJIA 4Q26A 1EAH3 3LA2A 4D69A 2VECA 5D2AA 4L92A 4DINB 5IJRA 3T1MA 3ATGA 1PMHX 4GWNA 4LKSA 1LTEA 4L97A 4XFCA 5E88A 1W39A 5EWSA 1TQ5A 2D40A 2P34A 1PK6C 4FT8A 4M0HA 4Y3OA 2Y6GA 2XBO3 3WF2A 4AHXA 2B46X 4NIGA 2B4KA 1O7FA 1PM7A 2PLV3 2WZEA 3JBG2 4N90A 4R4ZA 2WFF2 2WLQA 4AHZA 2GU9A 2VO5A 3USUA 1BBT3 2ZGMA 4LBQA 4XDPA 2ZGOA 5A6ZA 5FOJB 4IDZA 1B35A 4GH4B 2DFBA 3ZXLA 1G8WA 3HAGA 3UL2A 2RS11 4KGQA 1SBDA 1UPSA 4RSUA 2PHXA 4FTBA 1RMU2 5IVCA 5IVJA 1VBE3 5C3OA 2HWF3 4HKWA 1FYUA 2OXBA 2DUOA 2RMU2 4ZHNA 1HQLA 5A1FA 2E31A 5FY0A 1UMHA 5APAA 2G1MA 1CAXA 4KU8A 2IXHA 1Q43A 5FMCA 1JZ6A 1VALA 1WCQA 2YUEA 5FP8A 1ZYBA 4LA3A 2B5HA 1Z7S1 1OFSA 1F8VA 3LWCA 3NJZA 4NROA 3K4ZA 1S0CA 4M00A 4QPYA 2ZEWA 4IEVA 2Y6KA 5DPNA 3BKZA 2AR6A 1P8JA 4L99A 4QXKA 1HRV2 5TSWA 5FZKA 4CYDA 2NP0A 2RJKA 3SH3A 1RUF1 4I30A 2A1XA 4R4XA 5FZGA 1RUE3 1XE8A 1H8TA 2D6PA 2CTVA 4TYSA 1XNAA 1LKNA 5EFUA 5BUVA 1TMF1 4JC1A 4Q4W1 1OC1A 4P14A 4QX2A 1J84A 1IHMA 2VNRA 4HONA 1R083 3GM8A 4FXKB 3MGUA 1SHWB 3P6BA 2JXAA 2O1QA 1DGLA 2A71A 3ETQA 5IVVA 3KSCA 2VTXJ 2CGOA 3BU7A 3LIHA 2ORXA 2DVBA 1LOEA 2Z79A 2VZTA 3I2OA 2C0ZA 3ZIWA 1T6GC 2CGPA 1K42A 3P5BA 5B2GB 4DUXA 5GJ6A 1AL21 4XXAA 1JI6A 1JU3A 2WNVB 2PQQA 3TEZA 1VB4A 2AENA 3OPTA 4XQDA 4S2FA 3VKLA 1QDOA 1YLLA 1RUI1 2VZRA 2JDKA 2W46A 3BIEA 2WQZC 1FT9A 4NIAA 3PURA 3V0BB 4QQHA 1LOFC 1SFPA 3NMBA 5L73A 2O14A 4QPIA 3I3EA 3K75B 4A41A 2YROA 3U4XA 4I0BA 3TN92 5GZGA 1HX6A 1KJRA 1STMA 5FFOC 1H1MA 3N36A 1POV3 1PGL1 2BFUL 4CP0A 5FXXA 4LIUA 1GWKA 2D6LX 1S2KA 2YZ4A 4YZ2A 5FZCA 2H6CA 2JE8A 1D2SA 4PHZA 1RVF3 1NE6A 1VB2A 4LBLA 1AR92 1COV1 1MEC3 2FQPA 3ACIA 3RZJA 2W3JA 2VTXA 1QJY1 3ZSLA 4LUMA 3OD0A 3LEKA 1UZYA 2I45A 4PIXA 3OOXA 4RR3C 1EUTA 3UV9A 3W58A 4XBNA 5LK7B 2OQ6A 4CXYA 2VNVA 1AYN2 1E5HA 4JAAA 4P08A 2AYHA 1RHI2 3WINE 2VAUA 3LFIA 3B00A 3T2PA 3LGRA 4TXWA 2DURA 1O91A 3R4UA 4OI2A 3RDIA 2W95A 2VCAA 3SH5A 4OQ9A 3CDZB 2D3RA 2P17A 4GULA 4OUSA 3T2QA 1L7RA 2I07B 3T0BA 3WP5A 1DYOA 1TE1B 5JXIA 1MR5A 4R8HA 1YUDA 5FQ0B 1LB2A 3K48A 2UY8A 3RYPA 3AP6A 1OLMA 1PM4A 3I59B 3OD4A 1PK6B 5FBZA 3THCA 4AEDB 4DS0A 2IVIB 4L11A 5AC93 2YFZA 4XJWA 2YYOA 4MLOA 5A33A 1C8NA 1EYBA 2DCJA 3FLPA 2ZHMA 1QJZA 3TB0A 3O5SA 3POWA 3H8XA 4B4QA 1LGNA 1XNBA 4DXSA 2ZEXA 4GB33 3DYOA 5ACA2 4LO8A 2DCZA 4M0NA 2YGLA 5AVAA 5BY5A 2CV6A 2OPWA 3FC0A 4YW6A 2ARAA 5FKBA 2RS31 5CNAA 1EUUA 2WZ8A 5CKNA 4XUPA 3ABZA 4AWDA 3IKWA 3KCYA 2WT2A 4XMAA 1S55A 2UWAA 2IXLA 2WWSA 4YWAA 2R7EB 2GC2A 4UFLA 1W2NA 2DU1A 5L7OC 2C24A 5FZAA 4LEJA 1Y9QA 4Q4V2 4CP2A 3FBYA 2HWC3 2JE9A 2VD7A 3VZJA 1LHVA 5K0UC 4R9CA 1UZVA 3WD5A 4XAEA 2P37A 3MF9A 5D21A 2E26A 2BGOA 3WNPA 3PTYA 4ZPIA 2DVAA 1HRI2 3K46A 3LD8A 3N7LA 2FDFA 2ZGUA 4BM8A 4WM8C 4K8FA 1K5MA 1MZEA 1O59A 3FLRA 3LKJA 3LF7A 1FMD2 3O7OA 4HT1T 3SLIA 4LA2A 1CIWA 5KC5A 4AQ6A 2RDSA 4TN7A 4ES9A 5JI7A 2F4LA 2OUHA 3THTA 3R05A 4XACA 2BW8A 3SISA 2QQPA 3SKJE 3ZXDA 4YGBA 1Z78A 4MYEA 1J3QA 3B69A 4DXZA 1H0BA 2JDYA 1JXNA 4IEUA 1MACA 2J1RA 1W8WA 3AMQA 3UK9A 5A1LA 3VUOA 3CJIA 2XJSA 2XH6A 2PTMA 5AVPA 2F4PA 2XVGA 4FSJA 4LIVA 4HN0A 1D4M3 1KJLA 3B5LB 4EE2A 2FCUA 5KXCA 2HEWF 2LROA 4I0WB 3APBA 3N7KA 4LO5B 3W20A 4Z8BA 4LT5A 4RHV1 3OGJA 4CCOA 4A3XA 2AREA 1POQA 2HWB3 2UY9A 3DPRC 1WKYA 3JBG1 3J8F3 3T30A 1RJ8A 2BP6A 5CISA 2IZWA 4YPJA 2JKXA 2B8MA 4CRQA 1IS6A 2FHRA 3FZ3A 3I59A 2KD7A 1PK6A 4XJ8A 2XLFA 4D8MA 3HN3A 4YVSB 1UYZA 1ZZ6A 4R9BA 4PBOA 1AR83 4R9AA 4LO7A 4N9IA 5A7SA 1W8FA 1POV0 2JG8C 4AVBA 4BQ1A 1DF0A 2VUDA 1OVPA 1RMU1 1S0IA 2ZEZA 4XUOA 1NY72 1UMIA 2HWE1 2IC1A 5E6HA 4HZFA 3I2KA 4OHYA 1ZZ9A 1PIV3 3NJYA 1YJKA 3GZAA 2P6CA 1GV9A 4CPBA 2YB7A 3UGFA 2WIIB 3M3IA 2WZR3 3H0OA 5EPAA 5JMOA 4HMZA 1ZRIA 3VD5A 4LTAA 3HQXA 5JXHA 3PUSA 1ZRCA 4QB1A 2HYXA 1UCXA 3QCWA 5GKAC 1R1A3 3IPVA 2BGPA 1URXA 1W8HA 3O0VA 3TNQA 2TNFA 3N9LA 4LBNA 3FN9A 1KS5A 1MQTC 1NQDA 3LSDA 4JDOA 4AYUA 1ULOA 1ZNPA 4RN5A 2VM9A 4JRAA 5KC6A 4ARXA 1HKDA 1NCQB 1NCRB 1W28A 1FOD3 2GZWA 5I0SA 2IFRA 4WZCA 2Q8DA 2WO2A 2HLEA 2QQVA 3K3OA 5EQUA 1JZ8A 3C7FA 1F5FA 3LA3A 4X8PA 4WVMB 5LY2A 3SEEA 3WW4A 3WCSA 4LMFA 1J1LA 1FAYA 2Y8KA 1LU1A 2VMIA 2OVUA 3LPGA 4LBKA 3NNJA 3RJ2X 3NJXA 3BOWA 3KQ4B 3FE5A 3KVAA 4FFHA 4MGKE 2EAKA 1BVP1 3ZXAC 5LCWL 4Q4X2 1UZWA 1QMJA 4NVPA 3ZYJB 3RQ0A 3AB0A 4W65A 1AF9A 1WMXA 2QTWB 3GALA 3HNMA 3MEPA 3AMMA 3OTFA 4C8DA 4AXOA 2J1UA 4BQYA 1W6QB 4B4PA 4IXLA 2ZEYA 2ZTNA 1LGBA 1NZCA 1ZREA 1NX9A 4CCDA 5HV0A 1E5IA 1VPHA 4QX8A 1YI7A 1ZZ8A 5IK5A 5L7OB 5LASA 2DVGA 3WW2A 2JKBA 2Y6FA 1IKPA 1FV2A 2BFUS 3QACA 2WBKA 4PI0A 4UFMA 1BCXA 5LA1A 3WF4A 5L19A 4XBLA 5FP7A 4X6RB 5G05L 1A8MA 3AL6A 3FL7A 4G4FA 3VKNA 3VDDB 1MS8A 1JYWA 1JU4A 1W9FA 4LPLA 3VBHA 4QKDA 1MS4A 1XJAA 1LOFA 3POIA 5FPZA 1AR91 4JGYC 1W2UA 4CUBA 1EV12 5FTTC 1H9PA 1XXNA 4MGYE 3KF3A 5T5JA 1PX4A 1WCUA 2JWPA 1OOPC 1S2BA 5DQ0A 1DZTA 4ITCA 1MS5A 1W8ZA 2MEV2 2WQ8A 3NNMA 2Q1FA 3CZUA 4A45A 1DGRN 1AYN1 1HIXA 1Z0HA 3I3BA 4RQPB 1RHI1 4Q1RA 4BIFA 4CEYC 2BPA2 3A4UA 5I8SA 2RR12 4YZ1A 1BLZA 2DCKA 4LUKA 5I0RA 4MGQA 3RSJA 2ZHKA 1LR5A 4RR3A 5SV8A 1V6OA 4Y5Z0 1G9BA 3CO2A 1KDKA 1OA4A 2VG9A 2V4VA 5FYBA 4C0HA 2XLAA 4P5YA 2A70A 4Y4YA 1PMJX 4AI0A 4YFWA 2ET7A 3GF6A 2WO3A 5EV7A 1AR61 4CDWB 3QH7A 1VLNA 1W6OB 2PHWA 3DPRB 4M3CF 1V9U2 2ZGTA 4D3WA 2K2SA 2IFWA 4WVMA 5C71A 3O1TA 1JS9A 1CJPA 3GCXA 4FP2A 4BMBA 1CJDA 2VH9A 1RB8G 4QHOA 5J36A 3KHBA 1C8M2 2JDUA 5I8YA 5ACA1 2BYVE 3VBOB 3M3CA 1W06A 1DDLA 5SV5A 4QU2A 4D94A 3LFMA 4YFZA 1CAVB 1ACCA 1UN1A 5GM0A 3OUIA 4COVA 4LULA 5C33A 4QPGC 2YG0A 2ZPXA 4M4RA 4GALA 3LB9A 2VMHA 2XMLA 1G6NA 1JOBA 3K77A 4NUBA 3INAA 4QXBA 5BNNC 3SXWA 3W9AA 4Q4V1 1UU5A 1PZ8A 1XOYA 5FDBA 4BDVB 1JH5A 4D6RA 1Q8PA 5C8WA 3GZEA 2G9ZA 2HWB1 3SH4A 1WW4A 1WA6X 4COZA 4QB6A 1PO13 4ASLA 1JOJA 2E32A 5FLIA 1NKGA 2Y33A 2RM22 4GKYA 5DDJ3 5T50A 1GYKA 2X5IC 2OS2A 1X8EA 2XVKA 5A7WB 1CWPA 1HRI1 4Y1XA 1JN2P 1GLHA 1MQTB 3WHUA 5CAZA 2UYBA 3A22A 2ZMLA 2RHPA 1FNYA 1UYXA 1TVGA 1VRH3 3GHMA 3F2ZA 3IBMA 5J7MA 2WL1A 3MIEA 1C5IA 4ZZ5A 1FMD1 2ENRA 5K0UA 2EIGA 1BKZA 5A6QA 5IAVA 1TME3 3JD72 1MZ6A 4QHZA 3AXDA 4ZS3A 3T3YA 2R063 1WWYA 3NL1A 5FY9A 4CDXC 2PHRA 4WM8A 1RUG3 3ZN5A 2ARBA 1UNBA 5B4NA 4CDQC 4BYYA 2WZR1 1PVC2 2OZJA 3I3DA 4KG8A 5F5CA 2NMOA 3RI8A 1V6MA 1J58A 2QDRA 2NN8A 3I54A 5IT6A 1QJX1 3ES4A 4BJ0A 2GAUA 2DF7A 4O9GA 4PQ9A 5GLZA 2Q8CA 1IOAA 2B42B 4F3JA 4MHRA 4JVAA 4LK6A 4UF0B 5FXWA 1F5JA 1UU6A 2XJQA 1GNHA 4QX0A 4ZONA 3PJYA 4QU1A 3AMPA 4JQTA 3WY6A 3ZN6A 1YIFA 2LTNA 4YM0A 4DXRA 1JYCA 3WQ7A 3H1YA 4MADA 2X29A 4NN0A 4R52A 4XZUG 1K45A 4QQ2A 1H1AA 3KZ4C 1N47A 5C9AC 1JZ3A 2JICA 2W9XA 2YDEA 4N8MA 3DPRA 3N7MA 2XHNA 3CBNA 4EN6B 3NW4A 1Q8VA 2ZZJA 3K4AA 4YNIA 1AVBA 1NY71 1XQNA 2V72A 4AF9A 1A6CA 3NNGA 4AEJA 4MV2A 2YC0A 1ST8A 2CAVA 4B4RA 5A7QA 1FI2A 4Q0SA 4D6SA 3TBDA 2JG8A 3MLKA 3EYPA 4XQWA 3O0WA 2YGMA 1W8NA 4AZZA 1WCKA 3DN7A 2J1AA 4HOOA 3ZKUA 2V5DA 4B7KA 2JJ6A 1UZ0A 1XNTA 5C5TA 5J1XA 4CXXA 2PQSA 1MZ5A 1YQ8A 4S2DA 4CEYB 5CFDB 5IWFA 5D1IA 2FDKA 2OPKA 1DQ5A 2VZ1A 2XXZA 4XBQA 3M4FA 4COWA 1SBEA 1JYVA 2DFCA 1PGSA 5FMBA 2DUQA 3QH6A 2VVFA 3WW3A 4P02B 4TWTA 5T5PA 3VDAA 5F9TA 1SLBA 2HWD2 4LHSA 2RS13 3ME2A 5T52A 4IE0A 1D7PM 2PAKA 2ZHLA 3PVEA 1QQP2 1UIKA 3GXUA 5FY5A 3ZLIA 2UYAA 4Q4X1 4RS5C 4C91A 1YYNA 3WDTA 4UFHA 1ALYA 1C4RA 1VJ2A 2XUMA 2FD8A 4GAZA 2AZ5A 2P3KA 2VMEA 2W87A 4XUQA 4XQ4A 4HKOA 1Z7S3 4I09A 1NA1A 1JW6A 3PDQA 4D7TA 3VBUB 1CQ9A 1YJLA 3HJRA 3LOBA 4QPGB 2O0OA 2CGNA 1SG3A 3BPZA 3L2YA 4FFIA 4NAMA 5I0TA 4BQXA 4LXLA 1TNFA 1FPN2 4GH4C 3DGTA 1UOJA 2W08A 4W6XA 1LHWA 3ZYBA 2QKDA 1IZ3A 4UF0A 2D3PA 3ON7A 1BEV3 2YPJA 1W3VA 4P9XA 1RUF3 2D93A 2Q8OA 4NJ4A 4I2OA 3MFCA 3I3MA 3BPSA 4K21A 3ZFGB 1TMF3 1YQ5A 1UY4A 4HN1A 4AVVA 1W6NA 2ATFA 2YFUA 1EY2A 4HETA 2X5IB 4TZDA 3K2OA 2QZ2A 2WAAA 2GP3A 1CZTA 1UOBA 3PTRB 3ZXGA 1EV11 1S1AA 2VOKA 1X82A 3WG1A 2W91A 4Q0VA 5F3GA 3N4MA 5FZIA 2H0BA 2GNTA 5BPXA 2R073 4LITA 1QHDA 4BMEA 4JGYA 1AL23 1W2OA 1XNDA 4RL7A 4YW3A 5A3UA 1UOFA 4Y20B 2RR11 4P9JA 3TRSB 4ASMB 5FOBB 1OOPA 2GN3A 4BQ3A 1RUI3 5A3TA 1GP4A 5GALA 3VDCA 3BVCA 4PIZA 4CEYA 3C7GA 2YBKA 3BALA 1SFYA 5F1RA 1HB2A 2EAAA 3HIFA 2WINB 3BYWA 5J37A 5CA6A 2W1SA 2XDVA 1UMZA 1VMHA 2VQTA 3OGSA 4QM8A 3ACHA 4XC9A 1UD1A 3KLSA 3OYWB 4WVZA 2VZUA 1V9U1 1F4AA 4PIYA 4C0BA 1OA2A 4FOYA 2UWCA 4JX0A 5CKQA 4AI3A 2J22A 2C26A 4B29A 4MGTA 1COV3 1RUJ2 4XOGA 4PCRA 5FMOL 2WYSA 3UNPA 2Q1MA 1I1EA 3NKTA 2WNVC 1FX5A 1IQDC 1U5YA 2KXLA 4DOUA 4CXWA 3NAPC 3M3EA 4FPHA 3V0AA 1CZSA 4EN0A 2JDPA 1K5JA 5LBEA 1VE0A 2GNBA 4P00B 3WQ1A 2A5ZA 5JI9A 1Y4WA 1F15A 1OXCA 5FXVA 4QDRA 1DP0A 2N7GA 5EXOA 3WP3A 3ILFA 5LRRA 2E7AA 5E16A 4FQZA 3KGLA 1E57A 5CKMA 3WOGA 1WUVA 1QJFA 1S0DA 2MPFA 2NZ9A 1SLLA 4IE7A 4KNCA 2BBAA 4GWJA 3T2TA 3VN4A 3HMYA 1ND2B 3M8LA 4XF4A 3USSA 4A6SA 4DPNA 3JQXA 2RM21 4G3YC 4IQPA 3ZYGA 4E9KA 1PGW2 3C7HA 5C7GA 4B1LA 5BNNA 4UW6A 5LA0A 5JMCA 3M1HA 3MDPA 5JVVA 4QDSA 1RUNA 1I5PA 4A6OA 3T4VA 3KB5A 1MS3A 2XKOA 2GH2A 1UU4A 1W8TA 2WT0A 2IXKA 3KCCA 3I4IA 5JIUA 2ZX2A 3JD71 1ASJ2 4BB3A 3HBKA 4CU6A 1RUD2 4KBZA 2DBIA 2OT7A 4IGQA 2O8QA 2CL2A 2WSVA 1F35A 1CPMA 3ZXEA 4N53A 4A4AA 1BBT2 5KR7A 1PVC1 4UYBA 4WBBA 3OUJA 3D5OA 3IIIA 3OUHA 1DZRA 3VBSA 4Q5OA 4RS5B 5FY4A 1NZIA 5KHKA 4AFBA 4E4ZA 1GZ9A 1ZX5A 2X53S 5IW0A 5JDBA 3VL9A 3ZFFC 4EN8B 5KHJA 3TEWA 5FJHA 3ECQA 2G9FA 4JZRA 1ULGA 4AEDC 5M0TA 1X33A 4EZHA 1H2NA 3ACFA 1ZRDA 1C1FA 1RIRA 4CDQA 1DGRA 3IWZA 4Z2AA 2VMGA 5L36A 3O0XA 5DN2A 3R0RA 4LQRA 4ISRA 1YXWA 3SNMA 4FAGA 5F3IA 2OA2A 1HXS2 1EPWA 3U14A 2PHUA 3EHKA 1NLRA 3WVJA 3FX3A 3WG2A 4FPFA 4JKLA 3ZOIA 3R4DB 1BJQA 1AJKA 4QXCA 1CAWB 3KT4A 3NV2A 2P1BA 1PNFA 2VPVA 4PT6A 2A3YA 4QD2A 3MI8A 4UBHA 4YM2A 3RZKA 4JHTA 2GSYA 1ZBA2 3OBTA 4MGIE 1UY0A 1U0AA 5GZCA 3RVHA 5FZ4A 1DQ0A 4DMIA 1RTVA 1LCLA 1WMEA 2V73A 5C9AA 1C1LA 2XR4A 1M4WA 5C3QA 2J1EA 3C7OA 5DG1A 2PFWA 2OYZA 1YWKA 4AHYA 3VBRC 3POJA 1O4ZA 1FXZA 1HQNA 2RVAA 1CAUB 2ZGNA 2ZX3A 3OSDA 3N3HA 2BEOA 3PIGA 5CVRA 5A3NA 3PLQA 5C6CA 3S0MA 2DWRA 1R082 3N9NA 4LNVA 4RHV3 2VZOA 2V09A 3ALQA 3DECA 3JBG3 4OI1A 3ROUA 4IETA 3BTXA 4M4PA 1QJU2 2BNMA 5CG8A 2VBBA 1BEV1 1ZRFA 3OBRA 2WNUC 3VHPA 5FZ9A 1R092 1DG6A 1W2AX 5DAXA 1GZTA 1AX2A 4JQRA 2B39A 4MG2A 2HWD1 4EYUA 2TUNA 4OUEA 3DCQA 4YZ3A 1Q56A 1ZZCA 2VC9A 3P3PA 4XZPA 1RMU3 1WLCA 2ZGQA 1GQHA 2DCTA 2BTVC 2HWE3 2Z42A 3U37A 1G9CA 1QQP1 2D43A 2QBXA 5KXDA 2DTYA 1VAMA 4AL9A 3PU3A 5H9QA 5KHHA 1W3XA 4XF9A 2R071 5F5AA 3THDA 3UJQA 3IAQA 2VMCA 4ONUA 2J1TA 4E8CA 3PVNA 1JYIA 1VBA1 3NAPB 1AR72 4H3WA 2XB6C 4RS5A 3S5AA 5FYZA 3URFA 4ASKA 3S7EA 5FYSA 3Q8CA 1GR3A 3HPNA 4M01A 4O9EA 1FPN1 4YVSC 1GZCA 3MUZ1 1WMDA 2VUCA 4WVWA 1YO8A 4QGLA 4MHUA 1ENRA 4P9YA 3N35A 3LA7A 2PHDA 2WKKA 5JOXA 2YV8A 2D98A 5KHGA 2P3IA 3B94A 4GH4A 4XCAA 3TAYA 4Q0QA 5FLHA 5A3LA 4QMAA 3SEPA 1QIQA 4IEOA 4AAPA 3EBRA 1Q8OA 1TZOA 2Y38A 4P9IA 3MYXA 4K8RB 5CFCB 2D6NA 2QDNA 3AKTA 3RZZA 3AM2A 4YZ5A 3J4UH 2EXHA 1BK0A 3O1UA 3NV4A 5AC92 3EO6A 2P2KA 4JDMA 1NCRC 1NCQC 4LBMA 3ZKYA 5IK7A 1A8DA 1DQ6A 3L9JT 2ARCA 3I7DA 1FATA 4PDWC 4W6YA 1CAUA 1H2LA 3RWKX 3ZFEC 3Q9OA 3ACLA 4FBFA 3OB8A 4GB32 3CQOA 3LCPA 3IMMA 4XPVA 3ZFFB 4XABA 4SLIA 4AFMA 4HLTA 4BXSV 3GHNA 1UW8A 1N3OA 1O3SA 3IAPA 4QM9A 1WW6A 4CU7A 4XUNA 2E7TA 3I97A 1HB4A 3UESA 2WA3A 3CF6E 1W9YA 4KQ7A 3AXEA 2XG3A 5FZFA 2BVVA 4Y1VA 5FMOS 1AR93 1NQJA 4Y1UA 1JYXA 1ND3B 3WQ0A 4BIOA 3AP9A 4X8NA 1VBD2 2R0FA 5EJ1B 4IE5A 1LNSA 4FPGA 2WFPA 2WUHA 3H3LA 5D8AB 2QQKA 1AYN3 4K40A 4QQOA 1RHI3 4D6QA 5FPUA 4X6QB 4HG6B 4BLIA 1KEXA 2GNMA 3I2GA 4PQQA 4Q0UA 1OI6A 1OVSA 2V4AA 1V6JA 5C8CC 3CU7A 4AQTA 4MX3A 2WNVA 1WBFA 4AFCA 1X9TA 4H14A 4QHBA 3T0AA 1OH3A 5FV3A 3VBRB 4CVUA 5GLVA 3VDDC 2VOTA 3BGAA 4NE9A 3V0BA 1O8PA 3DKWA 4CDUC 3JB8A 4EN7B 1GANA 1AR63 2I2SA 5I93A 3PL0A 5LBBA 4EN9B 1SMVA 2WAOA 3BCWA 4JGZB 4O61A 2BWAA 5J09A 4BU2A 2WNUB 2ARXA 3AX4A 1SEFA 4IGPA 4CUAA 4NPLA 4WVVA 2VZ3A 4LE4A 4NHYA 3TOJA 2ES3A 4LOTA 4RQPC 5ACA3 2AH2A 1AJOA 1ASJ1 2NYYA 3WEZA 1KDMA 2ZX0A 4FXGB 1F31A 3DF0A 5LRSA 3JXSA 3I8TA 2A3XA 4E27A 5LEKA 2W0XA 4HVQA 5C3PA 3OEBA 3QLQA 2JIJA 2G9GA 4U2AA 3ZSJA 4XHXA 1GOHA 4INDA 4QT6A 3THPA 2OKXA 2XJRA 4V1PA 4Q4V3 3LEIA 1NLQA 2CYFA 4DB5A 1GQGA 5FWJA 1V6IA 4CDWC 3WSOA 4ISQA 4KWUA 5GLUA 2JG9B 3VD9A 2WFF1 4FQ4A 5FQ0A 3CKHA 2Q30A 1HRI3 1HXS1 5FKCA 4UW5A 3ZFFA 2ZZQA 1GZWB 2VVDA 4AEDA 1SQ4A 4HPKB 3VBOC 4QQPA 3W5MA 5ISLA 1G7YA 2EICA 4Q1PA 4XF1A 1FMD3 5LK5A 1UXXX 2ILMA 4IL7A 5A6YA 4URAA 1JUHA 1LU2A 5FYMA 1X50A 2RDNA 4UXAA 5FPAA 4NPMA 2RMU1 3KD4A 2GC1A 5F2WA 4AE2A 3I49A 5FYIA 1F9KA 3VD4A 2C9AA 4PLOA 2PELA 1BQPA 1CN1A 2VOWA 1ULPA 1W04A 4META 4E8DA 5FZ6A 1US3A 1WD4A 3ST7A 4DQAA 1QJX3 4OI4A 1RITA 1ULDA 4XE9A 3WNKA 3SHRA 1W2TA 1SBFA 3AP4A 1H4GA 2K46A 2KR2A 3FBMA 1H2MA 1LOAA 2HH9A 4E2SA 4ES8A 1DIWA 1NG0A 1QOTA 3IN9A 1C57A 1VR3A 4GMP0 2XQRA 4KL1A 1HRV1 1YFYA 1QJU1 2K0GA 4Z82A 5FZ3A 3TEYA 3VBRA 5GZEA 1KXGA 4PDWB 3S6PA 3J7NA 1UL9A 2VZSA 2EIDA 2TBVA 1F4HA 2QUOA 3MPBA 1R091 4ZY9A 3VZMA 3ZFEB 1HJGA 4LK7A 5DZEA 5C3SA 1C28A 1WBLA 4YVWB 3ZYFA 2GN7A 4UBGA 4JHZA 1A34A 1UX6A 4XVHA 4XFBA 2D3SA
chains in the Genus database with same CATH topology
3ILRA 1XNKA 3AKQA 4YGDA 4XJZA 3WNXA 1Y43B 1YNAA 2WNUA 3HR9A 4YG0A 1PNGA 2XHKA 2FMDA 2ZS6B 2WC2A 1CVNA 2C5DA 1QH6A 4CEWB 1Y3TA 2A7AA 1GBGA 1NLSA 2WS92 2Z5WA 1AR71 4GMP1 2O8OA 5F5QA 5GZFA 1VAKA 1LHOA 4E2QA 3RRDA 5C8CB 3SITA 3B7MA 3H3UA 1KRIA 5JPMB 3WV6A 1PVXA 3TN91 1YFWA 5FO7B 4OI0A 5DUXA 4XMIA 3UKVA 2RS52 3AKRA 1O3RA 5BNPC 2JECA 4NOTA 4YVSA 4CDUB 4ZU5A 4OZXA 4ORFA 2PHFA 4DNYA 4ZXKA 2XPJA 3ZXJA 4Q4X3 1VIWB 3HD8B 3VGIA 1U5IA 3M2MA 2ZGRA 1KS4A 2E63A 4NO4A 2EVXA 4XFGA 5CFDC 2JD4A 4XJ9A 1MZFA 3JU9A 5JOYA 3VHNA 1YCIA 4WM7C 1DLLA 2R042 3W59A 3B9IA 4GA9A 1O3QA 1QOOA 3G7DA 3OY8B 1NCQA 1NCRA 3M7AA 1GNZA 4J6GA 4CP1A 4PDWA 4AVTA 1O5UA 3ZFEA 1CPNA 1DQ2A 1N1YA 5JSRA 5K7PA 4YGEA 3VZNA 5HI0A 1AYM2 2XGXA 3H8UA 3RJRA 1EV13 3E6CC 5C4WB 2R0HA 1VBD1 3AYAA 1PO12 4HKLA 4LO4B 3BIWE 5GLWA 3VBUC 3VL8A 1JHNA 1DFQA 2BVBA 1W6QA 1VRH2 4MXWB 4Q0PA 3VBFC 2RR13 4LBOA 2MHFA 3M70A 3WDWA 1UKGA 4Q29A 4TLFA 2DVFA 4TSVA 3WXPA 4AQSA 4XILA 3ZFGC 3JQWA 3PMEA 4YRDA 4YW4A 1V6NA 5CIRA 1V70A 2HEVF 4FPYA 1RUG2 4PJYA 2XJVA 3CL1A 5T5LA 2ZA9A 3BOPA 5C8CA 2A6ZA 1QXRA 3OPZA 1CONA 2GMEA 1ONAA 2HYKA 3V65A 1REFA 1EPZA 1V9U3 3TWIA 2UU8A 3JB4C 4BPZA 2W39A 2IXJA 3VDDA 4XFHA 3ZYIB 5K8SA 1CGPA 1JBCA 1I5ZA 2TEPA 3IT8A 4CDUA 4ZU7A 1QNWA 1RUC2 2ZCWA 4QX5A 3AYDA 1MS9A 4EJRA 4NHLA 1D0GA 3E6DA 3ZSEA 4M3CE 2E51A 3AKSA 2NLRA 4IV3B 4RQPA 2UURA 1HV0A 3B01A 3FUOA 3PHMA 4ZU4A 4OVEA 4Q4Y2 1BXHA 3PMSA 2D44A 1W6PB 2RM23 3AZWA 4MGZE 1OSGA 4NWVA 1ZBE2 1ULFA 4QGMA 3ZXKA 5JOWA 5H9PA 4CDWA 3GZUC 1W6OA 4GKXA 4DRRA 1IKQA 3E6BA 2D5FA 1WGPA 4C1WA 3M3OA 4FPKA 4AVAA 3IDCB 3IM0A 3JD73 5BNPB 2GMPA 3VBOA 3WP4A 3EQEA 3PVOA 1N3QA 1QWRA 1PVC3 1HV1A 1CAVA 4P9WA 2WT1A 3BB6A 1RJ7A 2HKXA 5EYYA 1ND2C 2R16A 2JX9A 2EXKA 1CX4A 4J1WA 4EV0A 1BZWA 2ZX4A 2SBAA 4ATFA 4WM7B 1N1TA 5JR7B 5DUVA 1TNRA 4NR1A 5E1RA 3ZN4A 4AK3A 5J3UA 3B93A 1MQTA 2R30A 1NXMA 5EJ3A 3ZSKA 4FPOB 3E5QA 3UKTA 2OIIA 2BWCA 2R1DA 3OJBA 4AI2A 3GNEA 3KM5A 1PO22 1XYPA 4HL0A 5DXDA 5KXBA 4AFDA 1IPKA 1VBC2 1S0BA 3D0SA 2VQAA 4Q8KA 2WQ4A 5EZWA 1RUF2 4HBNA 4NHMA 2DCYA 1WW7A 2V5YA 2W68A 2QJVA 3H9AA 4Q4W2 2VY0A 2WS91 2JEMA 5CADA 2Y26A 1CD3G 3VBFB 3LAGA 1RL3A 4XIKA 3AFGA 3WUDA 3A0KA 2WSUA 3D82A 4LE3A 5E8AA 3RMYA 4H55A 3ZMOA 1KFUL 3POSA 3VZOA 1RC6A 3KT1A 4FPJA 5JLVA 5E89A 3H1WA 2E53A 2HWD3 4QGNA 4P5HA 2RS51 2XL9A 4QPIC 3MIGA 1AL22 3VHOA 4Y26A 5LEJA 1AZDA 4K7JA 2PN5A 1QQP3 3POYA 3D4KA 3WT3A 2D6MA 3HT1A 4RGGA 1QGLA 2LM3A 3PVBB 3KQRA 2MEV1 4HVRA 4LBQD 1V00A 4C1XA 3C2UA 2OUJA 1JUIA 4YW2A 5JWPA 4XYXA 1VBA3 1IS3A 4IERA 2G4IA 4LHLA 2IWGB 5F6LB 2VGDA 2R041 1AXKA 1FPN3 3ZMNA 5CFDA 5JZGC 4JCKA 1QJY2 3IIAA 1N3PA 1RUH2 3WW1A 2A6YA 2H6BA 4WM7A 1SLAA 3BODA 1LODA 2Z2SB 4P9LA 4YM3A 3CLPA 2DUPA 4BH9A 3UJOA 4EWDA 1BVVA 4F7ZA 1AYM1 1ENQA 3RMXA 2ZKNA 1C8M1 3OGGA 4I3PA 1LECA 3USUB 2VNGA 3CNAA 4LBQB 1UKRA 2ZGLA 2R1BA 4HANA 2LUWA 3OCPA 2VW2A 2VOXA 4DY5A 4DZGA 3CEWA 4BLJA 3WDVA 5J96B 3WZ1A 3U0ZA 1QF3A 3VBUA 1O3TA 5T55A 1CR7A 2GNDA 4YZ4A 3NSTA 1CAXB 1VBB2 4QPGA 1N1VA 2A75A 2IXCA 4I01A 1FV3A 1H2KA 5IK4A 2B45X 4ATEA 3MIBA 3QD6A 2RS32 1QKQA 1EAH2 1QXPA 4KGGA 4IEZA 1UF2C 4IEWA 1PHMA 3ZYPA 3ZFGA 4XTMA 5CFCC 2PHTA 4LHNA 4YLZA 3R4SA 5BV6A 1O5LA 4ZKTB 1EP0A 1RUJ3 1SLCA 2X5IA 2XBO2 4L9BA 4YW1A 4K20A 3V56A 2PLV2 5ABJC 3ASIA 5IUQA 3U07A 1OQ1A 1H8TB 2GH8A 2GALA 3EJKA 1GSLA 2MNGA 4XDQA 1AX1A 1RGSA 5K9YA 1U5XA 3DL3A 3KT7A 4Y20A 1G9DA 1VBE2 4Q4Y1 4BCUA 1WCDJ 2HWF2 1H4HA 4KWJA 3FHIB 3FFQA 4Y1YA 2NM1A 2BBVA 1YI9A 4HVOA 1LJ7A 4A7KA 3D8CA 1X8MA 1ND3C 1LEDA 3ZDSA 1WLTA 1ZBE1 3RWNA 3AYCA 2XWJB 1SLTA 3D6EA 4M3CB 3OYWA 1J59A 5D8AC 2KM2A 4RHV2 2CWSA 1ASJ3 4QPIB 1QY4A 1RUD3 4LO6B 2QE3A 3AP5A 1RUE2 4FTEA 1MVQA 2JENA 4L2NA 4Z07A 1H8VA 1LENA 2ZGSA 1LEMA 2HWE2 2B9UA 5KBFA 1IGOA 4HK8A 2WFF3 3OF1A 1AX0A 4JGZC 2CNAA 4N43C 2CY6A 5I8TA 1HXS3 3RYRA 1ND2A 5L7OA 1X7NA 3AZYA 5JIAA 2E9QA 5JZGB 3LOIA 2WA4A 1O4TA 3U10A 1MS1A 1REEA 4OULA 2WJSA 3JCIA 3M3QA 4Y22B 2RMU3 1PO21 1A78A 3GBWA 1ZBA3 2ZMNA 4FOWA 1VBC1 1UIJA 4F8AA 4C90A 1OQDA 4AI8A 4FVVA 5A33B 5HBAA 1SCRA 2JG9C 2GC3A 4JDNA 2DTWA 3WUCA 5FO9B 1RVF2 1RUOA 3KS7A 3RS6A 1MEC2 1Q8SA 1S0EA 1APNA 1HRV3 1YIPA 4YM1A 1QJU3 3WR0A 4PLMA 1WLDA 1REDA 1OA3A 1R093 4S2HA 4JRLA 3AYEA 3WG4A 2K9ZA 4H7LA 2E6VA 1N1SA 5GLTA 2FZ2A 3U11A 4XTPA 1VP6A 1CAWA 3AZXA 4IEXA 4M3CA 5JPNB 4AG4A 2XLGA 3MW3A 1NOVA 3VBHC 4AHWA 4FAHA 1DBNA 3VZLA 1LOGA 2NMNA 4KWLA 4B3NA 1K5MB 3HN1A 2UWBA 4XHBA 1GKBA 2CWMA 4I02A 5ABJB 4K9SA 5CG9A 4YARA 1AR73 5BNOC 4GMP3 2DV9A 1KFXL 1IQAA 4FOVA 1SFNA 2QNKA 1QH7A 4YVWC 3AMNA 3QOPA 4LR4A 3CJIB 4BE3A 3PNAA 1RUH1 1AXZA 5BYNA 3TN93 4XF0A 1IS5A 3SCGA 3MW4A 2EA7A 4OHVA 1W6MB 4Q8LA 4PBPA 3V64A 1OD5A 2Q4SA 5JZGA 1J3RA 4CEWC 1RUJ1 4NPRA 2HWC2 2VVEA 2VUJA 3FMGA 1FNZA 1DQ1A 4Y22A 1LGCA 4RD7A 1G86A 1OFNA 3AFKA 4MVTA 2C1FA 1AR62 3S30A 2VQ0A 1OPMA 2A3WA 3IMNA 4YSFA 3J26N 2QVSB 5FLJA 3MZHA 3IDEA 1LHUA 3NAPA 4N7UA 3BTAA 3ZO0B 1NYWA 4FOQA 3WHTA 1VBB1 4BHPA 5IK8A 2XJUA 2BUKA 2YMZA 2PAEA 4S2GA 1D0HA 1ZA4A 4GIQA 4BOWA 5KHIA 1PGW1 1EAH1 2P3JA 3VKOA 3MLLA 4KWKA 4Z1VA 3IPVB 1D4M2 4N43B 3NV3A 3SCHA 1DGWX 4I0AA 5I91A 3K51A 1NXD1 5I0UA 4IESA 2EXIA 2ZBJA 2XBO1 3FJSA 4E2GA 1VBD3 2HWB2 2PLV1 3J8F2 1RUD1 3GBGA 1G9AA 1XYOA 1BBT1 2D5HA 2VUAA 5CFCA 3RYKA 5JOZA 4WV8A 3WP6A 2XJPA 1OQEA 1AR82 4D7SA 2Q0AA 5ABJA 2VW1A 1WW5A 1VBE1 2HWF1 4JV4A 2H0VA 3TNPB 1PIV2 2ZAHA 5FAXA 2ZX1A 3GBFA 2ERFA 1XE7A 2WZR2 2GDFA 4LLOA 5C4WC 4URTA 1QJX2 1YFXA 5T54A 3ZVXA 1R1A2 1U5ZA 1KD7A 4EWEA 1W6MA 4N7IA 4FPEA 1D4VB 3AP7A 2VOVA 1ZBA1 3KGZA 1ND3A 4NHKA 4YYOA 3WDXA 1FOD2 3O14A 5J98B 1O4YA 5D8AA 1RUE1 3A0NA 3WDYA 3KCXA 5CB7A 3VBHB 3ZXFA 1HDKA 2BQPA 2VU9A 4YG3A 2PYTA 5GZDA 3FUQA 3VV1A 1F2NA 1R081 2D7FA 1OLRA 4IV1C 1PMIA 4KH9A 3B3QE 5KWRA 2DYCA 2DVDA 5AFEA 4OUMA 5BNOB 4K1ZA 2D6KA 3O12A 3HWJA 1D2QA 1QNYA 4R9DA 2ET1A 3ZIXA 4RR3B 3HBZA 5FCCA 1L3JA 1SLIA 4JGZA 4N43A 2B7YA 5FREA 3WDUA 3ZSMA 2A6XA 4J1XA 4NWWA 4IV3C 5T3NA 5BXXA 1V6KA 1AXYA 1I3HA 3MW2A 4FCAA 4AVSA 2DU0A 1OLQA 4HK9A 2AGSA 4OHWA 1POV1 4FTSA 1KQRA 3AJYA 4IEYA 1DZQA 1BMV2 2VULA 3RPQA 2Q5TA 1JTZX 1S0JA 1RVF1 4RGAA 4E4SA 1MEC1 1NA1C 3EXUA 3KMHA 1ENXA 2PHLA 3DUIA 3FWEA 1SACA 5DUWA 2JG9A 1LOCA 3AK0A 3ENRA 2I74A 1DGWA 4CDXC 4FO9A 4EWAA 1AL0G 5JSOA 3N7JA 4PLNA 2EF6A 4XJAA 1MS0A 1GZWA 4HPKA 4MXVA 1C5HA 4XETA 2EALA 4COUA 4D7YA 3C3VA 3DV8A 5CBLA 1R1ZA 4MH0E 3WG3A 4DFSA 4FPLA 1SDWA 4LLFA 3RI9A 5K0UB 5AC91 3MIDA 2WS93 1UAIA 4OHXA 1ZVFA 3WCRA 3GYDA 4OHZA 1NE4A 3D0JA 3VKFC 4WM8B 4GB31 5FPXA 2Y0IA 3NV1A 3JUUA 1RINA 4E4DX 3NWKA 3LZZA 4MSVA 2R32A 3S7IA 4B7EA 4XW3A 2RS53 1U12A 4YVWA 4A7YA 4XFFA 1LRHA 2ZHNA 3RG0A 1SCSA 2XKPA 1DQ4A 2HWC1 3WLUA 3ZN6B 4BA6A 3NO8A 2ZABA 4AGGA 4Y24A 2MEV3 5DDJ2 1LESA 5EYXA 2ZJCA 2PA7A 3FLTA 4RFT0 2E7QA 3G6JB 4CEWA 2KA3A 2YHJA 2D6OX 4AEMA 1C3HA 2R043 3AJZA 1TME2 4W6WA 4Z2WA 1J1TA 1J3PA 2R062 2CAUA 3VHRA 4XXPA 4GQ7A 1HLCA 1Q8QA 1HW5A 2JG8B 3NVCA 2YXSA 2XL7A 2OW4A 4IV1B 4A7ZA 4BZ4A 1QU0A 1W0OA 4GWMA 3MF6A 3E5UA 1D4M1 4HFSA 3PJQA 4XFAA 1AYM3 4FPCA 2RE9A 2NQYA 2QCSB 1WCSA 1C8M3 2NPIA 5DG2A 1Y7BA 4AQ2A 3JZVA 3NKGA 2R49A 1IS4A 4H7MA 3MPPG 1UZZA 3J8F1 4KU7A 4BWOA 3AKPA 1ZZ7A 2Q1ZB 1QDCA 1OHFA 2X8KA 2BNOA 2WNEA 3SMHA 4KBBA 3MIFA 4AGRA 4K3UA 4N53C 1AR81 4XIOA 5FO8B 2Z69A 3VZKA 2ZMKA 3VBSC 2FZ1A 3H50A 1AUYA 3HT2A 1ZM1A 1WD3A 1PIV1 2EXJA 5AFBA 4JTOA 1LULA 4IEPA 3OY8A 1NA1B 4I3GA 4Z92B 2ZAAA 3AZVA 4CZSA 4CDXB 1OMIA 1R1A1 1XNCA 4GXLA 1ZZBA 1B35C 4QQLA 2RJLA 1AHSA 2D97A 3GZTB 2BGCA 5DZFA 4Q27A 3E5XA 1RUC3 2SLIA 1H9WA 3FFZA 1FOD1 4G9SB 2VW0A 5C4WA 4EROA 1M06G 1QXJA 5T5OA 5J48A 3R6SA 5JCTA 2FMYA 1W6NB 2AUYA 3CJXA 3ES1A 1I9RA 1ENSA 2ZOEB 2RS12 3H1MA 4MXWA 1YRZA 4SBVA 3H7JA 5CU1A 4Q4Y3 3LSEA 4PF5A 2GMMA 4N9HA 4JTNA 2Y0OA 3ZX7A 4P9GA 4DY3A 4IEQA 4JGYB 5HXVA 3P3NA 1ZBE3 3B9CA 1Z7S2 3RNSA 4XF3A 3UKNA 1ZRRA 4IV1A 1OOPB 1GFF2 3H3ZA 2A6VA 1DYPA 1H8TC 1S0GA 2ZGKA 4LBJA 1BEV2 4LHKA 5JSPA 1WMFA 4HSLA 1TMF2 4UW3A 4AEKA 5JAXA 1XU1A 4IV3A 1BMV1 1XU2A 3SCFA 2VXRA 3L2HA 4KG0A 3ELNA 2OZ6A 3V0AB 1GICA 1Q3EA 2JE7A 5A32B 3I2DA 5BNQA 1W6PA 2R072 2ZACA 4AW7A 2FBEA 1UPIA 1MVEA 1VBA2 5FRAA 3QBQA 2JDZA 1G9FA 3E97A 4B8EA 1ULEA 1RUI2 1PO23 2A6WA 1VBC3 4WZFA 1PZ7A 4HSJA 4AI1A 1XYNA 4AVCA 5BNNB 3MICA 3ILNA 5BNPA 4FP3A 2QZ3A 2ETEA 1PGL2 2LALA 1IPJA 4Q4W3 1Q5OA 1HQWA 4K6BA 1YFUA 4OFGA 2XWBB 3VKMA 1COV2 1YHFA 1V6LA 4A2UA 4Q2FA 1WA4A 3J9SA 2BNNA 1DU3D 4N53B 1W0PA 4Y1ZA 5HCFA 5A3MA 3VBSB 4RA0A 1H1IA 2F6BA 5H9SA 1XRUA 1OKQA 1X36A 3IDBB 4YG6A 3T1LA 4DRVA 1VAVA 4CDQB 4UW4A 4XEZA 4XJUA 4AFAA 4COYA 5HCBA 5KXEA 1DHKB 1PO11 4OLLA 2WZPP 2ZKLA 1B35B 1I6XA 5DDJ1 2XJTA 5F6KA 3WX5A 2PAMA 3MIHA 3AZZA 4YGCA 5HCAA 2R6QA 1VRH1 1PZ9A 5DUUA 4F83A 1LHNA 3B02A 4YW5A 4AGVA 2A73B 2QFEA 1KITA 5DZGA 1TME1 2HEYF 2R061 4K1YA 5C9AB 4CTEA 1QJY3 3VLBB 1RUG1 3VBFA 1RUH3 1H30A 4MUVA 5A32A 2ZGPA 2GC0A 1B09A 1BYHA 1K5MC 2W52A 1BK1A 3TYJA 1RUC1 1TEIA 5H9RA 3X29B 2XVLA 4U36A 1ULCA 1DYKA 1S0FA 1A3KA 2VNOA 3ZPYA 1QOSA 3CJIC 3MLJA 1WLWA 2WLPA 3H7YA 4L8QA 1LOBA 2IXIA 3AMHA 3MFAA 2YY1A 3ZYRA 1VBB3 4XFIA 1OPOA 4MZUA 1CESA 2RS33 2HJIA 4Q26A 1EAH3 3LA2A 4D69A 2VECA 4L92A 4DINB 3T1MA 3ATGA 4GWNA 5E88A 1LTEA 4L97A 4XFCA 1W39A 5EWSA 1TQ5A 2D40A 2P34A 1PK6C 4FT8A 4M0HA 2XBO3 4AHXA 2B46X 1O7FA 1PM7A 2PLV3 3JBG2 4N90A 4R4ZA 2WFF2 2WLQA 4AHZA 2GU9A 3USUA 1BBT3 2ZGMA 4LBQA 2ZGOA 5FOJB 1B35A 4GH4B 2DFBA 3ZXLA 1G8WA 3HAGA 3UL2A 2RS11 4KGQA 1SBDA 1UPSA 4RSUA 2PHXA 4FTBA 1RMU2 1VBE3 2HWF3 4HKWA 1FYUA 2RMU2 2DUOA 1HQLA 4KU8A 1CAXA 2IXHA 1Q43A 1VALA 2YUEA 1ZYBA 4LA3A 2B5HA 1Z7S1 1OFSA 1F8VA 3LWCA 3NJZA 1S0CA 4M00A 4QPYA 4IEVA 2AR6A 4L99A 4QXKA 1HRV2 5TSWA 4CYDA 2NP0A 2RJKA 3SH3A 1RUF1 4I30A 4R4XA 1RUE3 1XE8A 1H8TA 2D6PA 2CTVA 4TYSA 1LKNA 5EFUA 5BUVA 1TMF1 4JC1A 4Q4W1 4P14A 1IHMA 2VNRA 1R083 4FXKB 3MGUA 2JXAA 2O1QA 1DGLA 2A71A 3ETQA 3KSCA 2CGOA 3BU7A 2DVBA 1LOEA 2Z79A 2C0ZA 3ZIWA 1T6GC 2CGPA 5B2GB 5GJ6A 1AL21 4XXAA 2WNVB 2PQQA 1VB4A 2AENA 4XQDA 4S2FA 3VKLA 1QDOA 1YLLA 1RUI1 2WQZC 1FT9A 3V0BB 4QQHA 1LOFC 5L73A 4QPIA 2YROA 3U4XA 4I0BA 3TN92 5GZGA 1HX6A 1KJRA 5FFOC 1H1MA 3N36A 1POV3 1PGL1 2BFUL 4CP0A 2D6LX 1S2KA 2YZ4A 4YZ2A 2H6CA 1D2SA 1RVF3 1NE6A 1VB2A 4LBLA 1AR92 1COV1 1MEC3 2FQPA 1QJY1 3ZSLA 4LUMA 3OD0A 4RR3C 1UZYA 2I45A 4PIXA 3UV9A 3W58A 4XBNA 5LK7B 1AYN2 4JAAA 3WINE 2AYHA 1RHI2 3B00A 3LGRA 2DURA 1O91A 3R4UA 4OI2A 3RDIA 3SH5A 2D3RA 2P17A 4GULA 4OUSA 2I07B 3WP5A 1TE1B 1MR5A 4R8HA 1YUDA 5FQ0B 1LB2A 3K48A 2UY8A 3RYPA 3AP6A 3OD4A 5FBZA 3I59B 1PK6B 4AEDB 4DS0A 4L11A 5AC93 4XJWA 2YYOA 4MLOA 5A33A 1C8NA 1EYBA 2DCJA 3FLPA 2ZHMA 1QJZA 3TB0A 3O5SA 3POWA 4B4QA 1LGNA 1XNBA 5ACA2 4GB33 4LO8A 2DCZA 4M0NA 2YGLA 5AVAA 5BY5A 2CV6A 3FC0A 2RS31 5CNAA 4AWDA 3IKWA 3KCYA 2WT2A 4XMAA 1S55A 2UWAA 2IXLA 2WWSA 2GC2A 2DU1A 5L7OC 4LEJA 1Y9QA 4Q4V2 4CP2A 3FBYA 2HWC3 2JE9A 3VZJA 1LHVA 5K0UC 4R9CA 3WD5A 2P37A 3MF9A 3PTYA 2DVAA 1HRI2 3N7LA 2ZGUA 4BM8A 4WM8C 4K8FA 1K5MA 1MZEA 3O7OA 3FLRA 3LKJA 4HT1T 1FMD2 3SLIA 5KC5A 4LA2A 1CIWA 4AQ6A 4ES9A 5JI7A 2OUHA 3THTA 3R05A 2QQPA 2BW8A 3SISA 3ZXDA 4YGBA 1Z78A 4MYEA 1J3QA 3B69A 4DXZA 1H0BA 1JXNA 4IEUA 1MACA 3AMQA 3UK9A 3VUOA 3CJIA 2XJSA 2XH6A 2PTMA 5AVPA 2F4PA 2XVGA 4FSJA 4HN0A 1D4M3 1KJLA 3B5LB 5KXCA 2HEWF 4I0WB 3APBA 3N7KA 4LO5B 4Z8BA 4LT5A 4RHV1 3OGJA 4A3XA 2AREA 2HWB3 2UY9A 3JBG1 3DPRC 3J8F3 1RJ8A 2IZWA 4CRQA 2B8MA 1IS6A 2FHRA 3FZ3A 3I59A 1PK6A 4XJ8A 2XLFA 4YVSB 1ZZ6A 4R9BA 4PBOA 1AR83 4R9AA 4LO7A 4N9IA 4BQ1A 4AVBA 1POV0 2JG8C 1DF0A 1RMU1 1S0IA 1NY72 2HWE1 2IC1A 4OHYA 4HZFA 1ZZ9A 1PIV3 1YJKA 3GZAA 1GV9A 2WIIB 3M3IA 2WZR3 3H0OA 4HMZA 4LTAA 3HQXA 1ZRCA 5GKAC 1UCXA 3QCWA 1R1A3 3IPVA 3O0VA 1URXA 3TNQA 2TNFA 4LBNA 1KS5A 1MQTC 1NQDA 3LSDA 4JDOA 4AYUA 1ZNPA 5KC6A 4JRAA 1HKDA 1NCQB 1NCRB 1FOD3 2GZWA 5I0SA 2IFRA 4WZCA 1F5FA 3LA3A 4X8PA 4WVMB 3WW4A 3WCSA 1J1LA 1FAYA 1LU1A 2VMIA 2OVUA 4LBKA 3RJ2X 4MGKE 3BOWA 3FE5A 2EAKA 1BVP1 3ZXAC 4Q4X2 1QMJA 4NVPA 3ZYJB 3RQ0A 3AB0A 4W65A 1AF9A 3MEPA 3GALA 3AMMA 3OTFA 4AXOA 1W6QB 4B4PA 4IXLA 2ZTNA 1LGBA 1NZCA 1ZREA 1YI7A 1ZZ8A 5IK5A 5L7OB 2DVGA 3WW2A 2JKBA 1IKPA 1FV2A 2BFUS 3QACA 1BCXA 5L19A 4XBLA 4X6RB 1A8MA 4G4FA 3VKNA 3VDDB 1MS8A 3VBHA 1MS4A 1LOFA 5FPZA 1AR91 4JGYC 1W2UA 1EV12 5FTTC 1H9PA 1XXNA 4MGYE 5T5JA 1OOPC 1S2BA 1DZTA 4ITCA 1MS5A 2MEV2 5BNOA 1DGRN 1AYN1 1HIXA 1Z0HA 4RQPB 4BIFA 1RHI1 4Q1RA 4CEYC 2BPA2 3A4UA 5I8SA 2RR12 4YZ1A 2DCKA 4LUKA 5I0RA 3RSJA 2ZHKA 1LR5A 4RR3A 5SV8A 1V6OA 4Y5Z0 1G9BA 3CO2A 1KDKA 1OA4A 2VG9A 4C0HA 2XLAA 2A70A 4Y4YA 4AI0A 4YFWA 2ET7A 3GF6A 5EV7A 1AR61 4CDWB 3QH7A 1VLNA 1W6OB 2PHWA 3DPRB 4M3CF 1V9U2 2ZGTA 4D3WA 2K2SA 2IFWA 4WVMA 1CJPA 4BMBA 4FP2A 1CJDA 2VH9A 1RB8G 5J36A 1C8M2 5I8YA 5ACA1 2BYVE 3VBOB 3M3CA 1DDLA 5SV5A 4QU2A 4D94A 4YFZA 1CAVB 1UN1A 5GM0A 4COVA 4LULA 5C33A 4QPGC 2ZPXA 4GALA 3LB9A 2VMHA 1G6NA 3INAA 5BNNC 3SXWA 3W9AA 4Q4V1 1UU5A 1PZ8A 5FDBA 1JH5A 5C8WA 1Q8PA 2HWB1 3SH4A 1WW4A 4COZA 4ASLA 1PO13 1JOJA 5FLIA 2RM22 4GKYA 5DDJ3 5T50A 1GYKA 2X5IC 2XVKA 1X8EA 1HRI1 4Y1XA 1JN2P 1GLHA 1MQTB 3WHUA 5CAZA 2UYBA 3GHMA 2ZMLA 2RHPA 1FNYA 3IBMA 5J7MA 1VRH3 2WL1A 3MIEA 1C5IA 1FMD1 2ENRA 5K0UA 2EIGA 1BKZA 1TME3 3JD72