1UOJA

Crystal structure of pseudomonas aeruginosa lectin 1 in the calcium-free state
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
121
structure length
121
Chain Sequence
AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords PA-I GALACTOPHILIC LECTIN
publication title Structural Basis of Calcium and Galactose Recognition by the Lectin Pa-Il of Pseudomonas Aeruginosa
pubmed doi rcsb
total genus 22
structure length 121
sequence length 121
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07828 PA-IL PA-IL-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 1uojA00
3F95A 2C24A 4LKFA 1W8UA 4LKDA 4LKEA 3ZYBA 1L7LA 1V0AA 2LROA 2O14A 4BQ2A 1GWMA 1OKOA 4CPBA 1WCUA 1WMXA 4A6SA 2K46A 4BQ3A 1W8WA 4LK6A 1HN0A 1W9FA 2LRPA 4CPBD 4LK7A 1UOJA 4LJHA 3UT0A 3ZYHA 4AL9A 4BQ5A 1W8ZA 4YWAA 2JWPA 4YW6A 1GWLA 2VXJA 1W8TA 3ORJA 4CP9A 4YW7A 1WZXA 4CP9B 4BQ4A 3ZYFA 5D21A 2KR2A 2Q1FA 1OH3A 2WYFA 1W90A 1GWKA
chains in the Genus database with same CATH superfamily
2ZHNA 4UBGA 3CBNA 3ZM8A 3D0SA 2H0BA 1WMEA 3WDTA 1LEDA 2FCUA 2VUAA 2RDRA 5A80A 2ET1A 2ZKLA 4LKSA 1SLTA 3AKQA 1R082 4YW4A 3DYMA 2J1AA 4Q2FA 1J83A 4E8DA 3AYCA 1UIJA 3FBMA 3MIEA 4XJAA 3VBUA 3PUQA 2IXLA 4XHXA 3VBSA 3WCRA 3AZWA 5C3RA 4B29A 2HWB3 4NWWA 3FN9A 4HT1T 3CJIC 5FY0A 4MXWB 3P6BA 2ZACA 2WINB 5GLTA 4NIAA 1QJX3 1AR82 3P3PA 1FAYA 3N9OA 2VMHA 4XETA 1GWKA 4ZU5A 5FUNA 4X8NA 3ZDSA 1BEV1 3FWEA 4NE9A 4BMEA 4RQPC 4CDQB 5J1XA 3KZ4C 2Y6FA 4AHZA 1RC6A 1HX6A 3LEMA 3HN1A 3ZYPA 1PGL2 2BBVA 4FCAA 2QZ2A 2JDHA 1GBGA 1G9AA 2VBBA 4DNYA 5FPUA 3WF0A 2X8KA 1W8WA 1U0AA 5FZDA 3T3YA 3OJBA 1MS3A 1C8NA 1UOGA 3M1HA 5EYXA 3TRSB 4A42A 4LJHA 3IT8A 1JBCA 4XBLA 1R092 4FI9A 5F8PA 1WUVA 1W8ZA 2VOXA 1CPMA 1VMJA 1BK0A 3ON7A 4META 4Y22A 3S57A 5A6QA 2A1XA 5KHKA 1YC61 1VBE1 1DGRN 2YGLA 3WDYA 3RFRA 1SFPA 5DPNA 4GWJA 3UYJA 1XNBA 1PGSA 5FZOB 3TEWA 4MHUA 1H2NA 1W03A 3OPZA 3ALQA 3VBSC 1TE1B 3WT3A 3OBTA 5C70A 1OH4A 1PO21 4XFHA 3GDBA 5FPVA 1V6NA 3NQHA 5FY5A 5FZFA 4WM7B 1GSLA 4GH4B 5HCBA 5FREA 3A23A 4ET7A 1GV9A 2FDGA 1H6XA 1O3QA 4FPOB 1YIFA 2GDFA 1F15A 2VNVA 3E1F1 3ZFGA 5C8CA 2GU9A 3O12A 5CYYA 3MFCA 1NCQC 5D2AA 1PVC2 4I0BA 3PIJA 1Z7S3 3W20A 4LBJA 4WVZA 2ZGSA 1KEXA 3NL1A 4D7TA 1AJOA 2CDOA 4XJZA 3BYWA 3PDQA 2NN8A 4R9BA 3SLIA 1UKGA 4LBQA 4YG3A 5DG2A 3LSDA 3IDBB 1NZIA 1RUJ2 2Y64A 1DQ1A 4A44A 1HXS3 5I91A 4HK9A 4MGKE 3E6CC 4UI9L 2UWCA 2R1BA 4WVWA 4XFFA 1BQPA 4RN5A 2P3KA 3ZYGA 1C57A 4Y20B 1OLME 5FYZA 3IMNA 2QNKA 4COUA 3V0AA 1CWPA 4QPIA 5FO9B 2CDPA 4P9JA 5FZ3A 1H8TB 3VBHA 5F2WA 5IAXA 1IKPA 2YBKA 3INAA 2HLEA 2RDNA 2DVDA 3HN3A 1OF3A 1DHKB 3WUCA 4IQPA 4BMBA 3PJQA 2VQTA 4CA9A 2RS51 4OHXA 2WNVA 3E97A 4KMQA 1QOSA 1LOBA 4F83A 1GU3A 2BNNA 3O1OA 4GJZA 4RS5A 4LUMA 4IV3B 4IEZA 4JGYA 4BCUA 2Q0AA 3LD8A 3K48A 5FZ1A 2C1FA 3ZFGC 3ZIXA 4DXZA 3E6BA 5GZFA 5C8CC 4FAHA 5LZ6A 2JKXA 2ZX2A 3FLRA 5JSPA 1XJAA 3ZMNA 4MGYE 1JOBA 2ZEXA 3CZJA 1LJ7A 4Q8KA 2ILMA 2VMEA 1HJGA 1ACCA 3K75B 3DEMA 3MPPG 3PUAA 4M00A 2ID4A 4ARXA 2VNGA 3BUCA 2YDEA 3MW3A 1DG6A 4XXAA 3K4ZA 4Q0UA 4QD2A 1ENSA 1RUE3 2C9AA 3CKHA 4XBQA 4XFAA 2ZGLA 1Q8OA 4GB31 1Y9MA 2HWE3 5FO7B 1VBA3 1NY72 2KR2A 4I3PA 2D3RA 3RJ2X 4ATFA 3RZJA 2R1DA 1RUG2 4QPGC 1PX3A 2DV9A 2R16A 4DZGA 4QPIC 2C0ZA 1W9YA 3VBHC 4PF5A 1PO12 4C0HA 4AI2A 3ZXFA 4EYUA 4P9XA 3WQ0A 5FP4A 3B94A 2WNVC 3I2FA 2MEV2 2R7EB 4LBOA 4LK6A 1W2UA 1W9FA 1MS9A 4RA0A 4FFGA 5LASA 1ALYA 3RG0A 4B4QA 3GZEA 4CVUA 3VB9A 1GMMA 4XABA 2W0XA 5FXZA 1BYHA 2W1UA 2N7GA 1ZRDA 5FOBB 4UWDA 4Y1YA 2XVGA 4XJWA 3HIFA 3Q8EA 3WXPA 3AL6A 2FMDA 1UY3A 3CU7A 1VRH2 5DABA 3KLSA 1PIV1 4JKMA 4Q0PA 1XNDA 4YG6A 4LEJA 3AJYA 4IE0A 2ATFA 3UJOA 1F8VA 4CU9A 1W2AX 3RYRA 1WMDA 3MLKA 2K2SA 3ZXDA 4YRDA 1RL3A 3I3QA 2NLRA 4CPBA 1K12A 2EIBA 2NPIA 4XUQA 5C3SA 5FDBA 1CD3G 2FZ1A 3LQCA 4AWDA 1LENA 1DFQA 4LLOA 3D0JA 5DZFA 4DMIA 2WAAA 4EN6B 2VW1A 2ZOEB 3NRUA 4C91A 4IE5A 4FPJA 5BNPA 2C5DA 1E5SA 2XXZA 3WDVA 2PHDA 1REEA 1MS5A 3AMMA 4CCDA 1W8TA 3N3HA 4W6YA 1VBC3 2OVUA 4YGEA 4GD4A 1WW7A 5BUVA 2LALA 1W9WA 1RUI3 4AI9A 4MZUA 3GF6A 4YVWB 3OEBA 1ASJ3 3LSEA 2JB4A 3O5SA 2W1SA 4X6RB 2XBO3 2DWRA 5KHJA 3B93A 1L3JA 4IDZA 1O4YA 3GCWA 2Y8KA 5FZOA 1JYTA 4XURA 3WHTA 5CEHA 4PT6A 5FYTA 1YQ8A 4B7EA 4JTNA 2VECA 3KHCA 5JSOA 5JUVA 3BI3A 1STMA 3HBKA 4GH4A 5FYMA 1X8EA 1QXRA 4J6GA 4XDQA 3T2QA 1BLZA 1VE0A 1OVPA 4XQWA 1DLCA 4XUOA 4LO7A 1MEC1 4TWTA 5FQ0A 2PXJA 4AFDA 4HETA 1POQA 2PYTA 1KQRA 4HMZA 3J7NA 4OHYA 3E5QA 4LO5B 2DUOA 2ZABA 3ELNA 2AH2A 4EWDA 4MSVA 5BNPC 1OA2A 1RYYA 2XJPA 1WWYA 4AFAA 3TN93 3IIIA 5FY8A 1QJZA 2HWB2 3ACIA 3LDKA 3POGA 3FLPA 4UT5A 4MVTA 1H2MA 4HONA 3VHRA 5DUWA 1OLRA 2QQNA 1PGW1 5FUIA 4FTBA 4HBNA 4OI0A 5ACA2 3OOXA 1QJX2 1M06G 1WW4A 1RUNA 5FPBA 2WWJA 1KS5A 3VDCA 3I59A 1HV1A 3OBAA 4XEZA 2GMMA 5F6KA 4RGGA 2AZ5A 2FQPA 2HKXA 1C8M1 1RUH1 2TNFA 3JD73 4JRLA 2ARXA 5CU1A 4ZPIA 1I5ZA 3B01A 2D5HA 3HEIA 5FZEA 3ILNA 2W1QA 3GJAA 4LOSA 1K45A 3R0RA 1MACA 1HRV1 3FJSA 1BZWA 3ITQA 4BDVB 2GN7A 5F5IA 4BB3A 5BPXA 4AK3A 1NE4A 5T5PA 2D7FA 1REFA 4OUEA 3B7MA 4ASKA 4K6BA 1LRHA 2ETEA 2DFCA 5FZ6A 5FBJA 4K1ZA 5GALA 4TXWA 4LA2A 1POV3 1POV0 3MIFA 4MOAA 4OZOA 2HEYF 5FP3A 5LEJA 2JIGA 4S2HA 1RUD1 3KCYA 3ETPA 3UGGA 2YY1A 5CG8A 5D8AB 4XILA 1RJ7A 1VBB3 1QQP1 4UBHA 1QNWA 1G9DA 3ZKUA 4QHOA 4AF9A 1OURA 3D8CA 3LZZA 4QDSA 4JX0A 2PELA 2YHJA 3J7LA 3WDXA 2VZQA 3H50A 2IUWA 4ISQA 4IUGA 1RVF1 5K0UB 3RVHA 4DS0A 1QKQA 1UPIA 2VZPA 1OUSA 1S55A 4Q0SA 4H3WA 1RIRA 1Z7S2 1UY2A 3V56A 1NLQA 2K46A 1H1MA 2ZCWA 3U11A 4HLTA 5AC93 4LIUA 2LTNA 1CIYA 5A3PA 4LT5A 2Y6JA 2W2IA 1ZZ7A 3U10A 1N3PA 4J25A 4O9EA 1QJEA 4Q8LA 3VV1A 5JI7A 4A45A 1W9SA 2JG9B 2ORZA 1W6PB 2VCMA 4PCRA 1AZDA 4NHLA 2BV4A 4RHV3 1O5UA 2YC2A 5FLHA 3RS6A 3VKOA 3H1YA 3VKLA 4ZZ8A 3IAPA 4MADA 1WCQA 3MGUA 2RMU1 1SDWA 3HOBA 5FMBA 5FPAA 4KWUA 1HQWA 1ENRA 4C0BA 2O14A 2XQRA 3IN9A 3ATGA 2WNOA 5F7UA 2I45A 3WW1A 4BQYA 4WVVA 4PHZA 1WLWA 5CFDA 3MF6A 4H14A 5F37A 2R0FA 4L92A 4OUMA 2HWF3 5FV3A 3M3QA 2PLV1 3S5QA 1IS4A 4JGZB 5H9SA 1H1AA 3AZZA 2VAUA 3AX4A 4M3CE 1W39A 5DAQA 4N8MA 5CG9A 5IVYA 3LOIA 2SLIA 1EV13 4L2NA 3UKVA 2JE8A 4Y33A 5FP8A 5HXMA 2ZHKA 4HVQA 4YVWA 2RS31 4Q4V1 1ZRIA 4EV0A 4AEJA 1KJLA 2HWC1 3WP6A 1DGWA 1KGYA 1RUE2 2DFBA 2GMEA 4FFFA 2QQJA 4LMFA 4P08A 4FQZA 3VZNA 3ZYBA 2WFF1 2VC9A 1N3OA 1VBA2 2D44A 4BK4A 3ZXEA 4O9GA 5J98B 4BJ0A 1OD3A 4QX8A 1Q3EA 1AXKA 1FPN1 4QXCA 4EZ4A 1WBFA 2J1VA 1OXCA 2Z2SB 1ZBA3 5A6YA 1YFWA 2UYBA 3QACA 4FOQA 1GQHA 3AM2A 1RUC3 3WINE 3ROUA 5JDBA 1AR91 2WS91 2O8QA 1PMJX 1S0CA 3FFZA 4CXXA 4OI4A 2WJSA 3S7IA 2R073 1UAIA 4ZKTB 4BZ4A 4N9IA 3CJXA 4F7ZA 4Q4Y3 3VLBB 5DZEA 2E7QA 5CFDC 3NJVA 2JICA 4CDXB 1H2LA 1D0HA 5CKMA 3RQ0A 2D5FA 1W9TA 4QPYA 1UZWA 2WKKA 4XUTA 2WZPP 3VDDA 1B35B 5IVFA 2W95A 4XFCA 2E7AA 1LU1A 2ZGQA 3KV5A 3NAPB 4JDNA 4MHRA 4MH0E 4FPCA 4LULA 3SC7X 4A6SA 2VPVA 5JMCA 4YZ3A 2R063 3RGBA 1K5MA 2B8MA 3SNMA 5JCTA 3TBDA 3ZLIA 2CAUA 1ZZCA 2XLGA 1JZ7A 3CIHA 1NG0A 5CKQA 4LBMA 5JIUA 1KRIA 2GSYA 1S4CA 4BIFA 4NIGA 4H55A 4RGKA 2OX0A 4KG8A 4BQ1A 5I0RA 4YZ4A 3AKPA 2W92A 1Q56A 1SCRA 4JDOA 1UY4A 4ORFA 1W6NB 5DQ0A 1J59A 4JDMA 1VBC2 4PJYA 1V6KA 1KXGA 1RUI2 4KI5M 1TQ5A 3PVEA 1JHJA 4FFIA 4IW3A 4M3CB 2YG0A 3I7DA 1ASJ2 1AYM2 4OLLA 1W0NA 1OA3A 3RZKA 2JEMA 2XBO2 4LBKA 1REDA 4FPEA 4R4XA 2ZGTA 2OYZA 3VDDC 1JS9A 1UWWA 3PJYA 5LRRA 4I0WB 4MG2A 3OPWA 3HVDA 3AFKA 5D8AA 4OHZA 2UURA 2XR4A 3PVOA 4Y3OA 5FZKA 1U5IA 3WG3A 2W52A 1SCSA 4XJ9A 2AEZA 3GBWA 4KL1A 2WYFA 1J3QA 5LB6A 3TEZA 1K5MC 2GP3A 3POWA 4Y26A 4Q4W1 3H8OA 3FHIB 3ZXGA 1A34A 2J22A 1BEV3 1W6OA 5FK8A 1H9PA 3GYDA 5GLVA 4CUCA 1R1ZA 4AVAA 5FWJA 3FMGA 3CJIB 4AEDA 1UL9A 1VPHA 3MW4A 5EFUA 3U0ZA 1E57A 4AE2A 4XMIA 3VHPA 5FO8B 4BPZA 1AHSA 4W65A 3R05A 3W59A 2F4PA 3GBFA 1BBT2 1QJY1 4RQPB 3T4HB 3TN92 4RD7A 5DAWA 1XXNA 5KC6A 3JUUA 4NRMA 1AR71 2KXLA 3SXWA 3CO2A 2XJVA 3WP5A 2XOMA 3D4KA 5C3QA 3S7EA 2JG9A 2P3JA 2RDSA 1SHWB 2BVVA 2WIIB 1VBE3 2ADEA 2RJ2A 3IM0A 1CAWA 4E2GA 3ECQA 3URFA 3ZR5A 4EN0A 3JD72 3ZPOA 5JZGA 1UD1A 2ZXQA 4CDUA 4D94A 2Z69A 1PO23 3BPSA 5FZLA 2J1RA 3BTXA 3P5BA 3I2OA 1QGLA 2W47A 3PUIA 1RGSA 2W5FA 4JGZA 4R9AA 1CZVA 3KQ4B 2HBUA 4B7KA 5FXWA 3DN7A 3WCSA 2VTFA 4AEDC 4D6SA 3BU0A 1LOFA 4MGSA 3DXUA 4XIOA 3U37A 2P2KA 4YM2A 4YVSC 4QDRA 3SEPA 1OFNA 5F39A 5I0DA 1OD5A 1J58A 3U4SA 5CISA 4UW3A 1VBB2 1RHI1 1UMIA 2DVGA 1NCQB 4BQ2A 1LGBA 1NX9A 2ZHLA 2Q8CA 4Y5TA 4LHNA 1OVSA 3OUJA 1CAXA 1HJFA 1OT5A 4TN7A 5GZCA 5JOXA 4FOYA 2WZ8A 4B1MA 1O4ZA 2PHLA 1I5PA 1AR61 3IAQA 4DY5A 1FMD1 1YHFA 3AKSA 4Y22B 5JZGC 4CDUC 1BJQA 2PFWA 3I2IA 4OYUA 2RS53 3WG4A 4EN7B 2P17A 2A73B 3ES1A 4CDXA 1OI6A 5A3OA 2R49A 3T2PA 4QGLA 3BCWA 2RS11 2B5HA 2ZMKA 3AFGA 4JGZC 5FYCA 3MIGA 2P4EA 5I8TA 3O1RA 4CSWA 4KH9A 2GNMA 3FL7A 3LIHA 5E8AA 3ZFFA 4BQ3A 2OPWA 1A8DA 3WW2A 5BV6A 4FXGB 1UZYA 3DPRA 4RHV2 4ZZ5A 1JYCA 2J1TA 5FZ4A 1XSRA 2ZX3A 3IDCB 2MHFA 1GQGA 5SV8A 4U2AA 3ZX7A 3ZFGB 2ET7A 3B02A 5C8CB 2PHTA 4XTMA 4N9HA 3GHNA 2RJKA 3O7OA 4GB33 3PHMA 1UYXA 4Z92B 2DCTA 2WSUA 2HWF2 1DF0A 1D4M1 1DBNA 4QXHA 2JG8A 4CDWA 3VZKA 1HRI1 4OQ9A 3ZYRA 5KR7A 4LBQB 3MIBA 1HB2A 2XL9A 5T5LA 1SDDB 3AK0A 2WQ8A 1JZ6A 3NNLA 3FLTA 2CHHA 2PA7A 2D98A 1SPPA 4P9LA 2ZPXA 1TEIA 3WNOA 4ASLA 5A3TA 1Y4WA 2YBSA 3DL3A 5BNQA 1YLLA 3OY8A 5GLZA 1JZ4A 1UOJA 4XHBA 1ND2A 4OULA 2WZEA 4QPGB 4CDXC 1R1A2 4LA3A 3V0AB 1PM7A 2QQVA 2IFRA 4QPIB 4AGRA 5A32B 1G9CA 3VBHB 4YSFA 1G6NA 4QX1A 2FZ2A 4GALA 4QM9A 2G1MA 5JI9A 1XU1A 2RJLA 3IWZA 3NKGA 2WNVB 4M01A 3ZFFC 4AQTA 4P9GA 5C5TA 4D8MA 1ZBA2 3DPRC 4FO9A 4ES8A 4BQ4A 1I1EA 1RUC2 1UZZA 1YQCA 1C28A 4L9BA 2HYKA 3L9JT 3NJXA 1DCSA 2R072 2NYYA 4QKDA 3LA2A 4IGPA 3UKNA 1IS5A 1MPXA 3E5XA 4XPVA 4AW7A 4XF3A 4I2OA 1FOD1 5IK4A 3VD5A 4QX0A 3OEAA 4FBFA 3ZMOA 3LPFA 2JG8C 3M3EA 4CDWC 2DF7A 3O1VA 3J8F1 1RUOA 4EE2A 4BIOA 5FZGA 1ZNPA 1LODA 3HWJA 2VZRA 4WZFA 4PI0A 4NPMA 2VQAA 2QJVA 3RNSA 2DCJA 1FYUA 3NJYA 3ILFA 4TLGA 4WVMA 3RI9A 3P1IA 5E16A 4N53A 3ZR6A 2QBXA 2R062 3F2ZA 2RM21 1VAVA 1ND2C 2EIDA 1J3PA 4H7LA 3VL9A 5A3UA 5C3PA 4LQRA 4ATEA 4OQ8A 1Y3TA 3QH7A 3B3QE 2BP6A 2GNDA 2W3JA 2BU9A 4DO0A 2CGOA 1WCUA 3GZTB 4KQ7A 2XUEA 2QQUA 1GR3A 1DIWA 2ZZJA 1NT0A 1QY4A 3KGLA 4CE8A 1O6UA 5F3IA 1MZ5A 2EALA 2YBPA 1UU6A 1W05A 2C6SA 3CMGA 4Q29A 1MEC3 5GZEA 4AXOA 2WN2A 2DVAA 2ZMNA 2BRTA 3UJQA 2WL1A 3OGRA 1W8OA 5DZGA 4E4DX 1XYOA 2WA4A 3FHAA 1RMU1 1G8WA 1O5LA 3K4AA 2UY9A 3VBOA 4UFLA 4CCEA 4YFWA 1VB4A 3CL1A 5DG1A 2ZMLA 2BOJA 3PUSA 4LUKA 1NCQA 3UK9A 1AR81 4W4ZA 2BNMA 1Q8VA 2B39A 3I3MA 4N53C 2GC1A 3ZSKA 4PDWA 2E53A 2OW4A 1S0DA 3I4IA 2C4XA 3ES4A 2CV6A 3ZKYA 3THPA 4A3ZA 5A1LA 5BNPB 4UYBA 3M4FA 3JB8A 1BEV2 2IVJA 2WZR3 1GWLA 2Y34A 4JQTA 5FYVA 1CVNA 2YB7A 1NXD1 2RR11 3IDEA 3N7KA 1S2BA 4Q5OA 1R091 2WUHA 3ZXJA 4DRRA 1CESA 1C8M3 1MS1A 1R64A 1RUH3 3TOJA 4DINB 2A7AA 1YEWA 2EA7A 2ZEZA 3BGAA 2BGPA 3WG2A 5KC5A 2ARBA 2Q1ZB 1DQ6A 4MGTA 5IVBA 1ULEA 2GP5A 4RR3A 3BTZA 2VMDA 4GMP0 4GMP3 4IETA 1HRV3 3RYKA 2L9LA 3M3CA 1GZTA 1TMF1 3BPZA 1SLBA 1QDOA 4KGQA 3OCPA 4JRAA 5DAVA 5FQ0B 1VBE2 2GZWA 4IL7A 4IV1A 2IXIA 2BW8A 4AI1A 4N7UA 3UL2A 3VBOC 2WLQA 1O91A 5C6CA 1SBDA 2YPJA 4K8RB 5EWSA 1VMHA 1RUD3 4LO4B 5ERLA 4BXSV 4D7YA 1F4AA 1QQP3 3RSJA 2JD4A 3WW4A 5FYBA 3R4DB 1OH3A 4PDWC 1EUUA 3BTYA 3A0NA 4L0PA 1UU4A 5J3UA 1NYWA 5FP7A 2XJSA 1RVF3 2FDKA 2WO2A 5D1IA 2VUDA 5L9RA 4CU7A 1DZRA 1I6XA 2QQWA 4FVVA 5BXXA 3UGFA 4XBNA 4XOGA 2PMWB 3VUOA 4QPGA 1SMVA 3I59B 2ES3A 3C7EA 4Z82A 1DQ5A 5ANQA 4RR3C 5A32A 4CZSA 3LEGA 2J42A 1HN1A 4R9CA 1V00A 2D6KA 3WNXA 5FZHA 1QF3A 2J1EA 3F95A 3FBYA 4IV1C 3J7MA 3BOWA 2LS6A 3GXUA 2WT0A 5JPNB 2JD9A 2ZGPA 2PTMA 2RMU3 4ZHNA 3S5AA 3MV11 4XAEA 1X82A 3WQ7A 4UAPA 2ZKNA 1YNAA 4DIQA 3NWKA 2H6BA 1YFUA 3MPBA 5K9YA 2QDNA 3C7OA 2VQUA 1QWRA 1QJU2 4MO3M 2PLV3 2OXBA 4AZZA 2VNRA 5DMYA 5EJ1B 4D3WA 5KBFA 3P3NA 3DYOA 1ZX5A 4ZS2A 5CKNA 3POFA 4NAOA 2ZBJA 2YXSA 1SBFA 3J4UH 3NNJA 4XYXA 5E89A 2WDBA 2DCKA 2VMFA 1EP0A 4QHZA 2RS33 4BQXA 4BQWA 4DXSA 1YQ6A 2D6PA 4AGGA 1NOVA 3SCGA 1E5HA 1XQNA 2WFF3 4GB32 4NHYA 5C33A 5FMDA 4YARA 5HV4A 5FYHA 2HWD2 3H3UA 1FPN3 2HH9A 4GKYA 4XJUA 2LW8A 2GN3A 3WUDA 3T0DA 1V9U2 4NOTA 1XYNA 2WABA 2MEV1 3VKMA 3ZPYA 1BVVA 3WF4A 1LGNA 3LFIA 5FZBA 3VBFC 1AR93 3WW3A 2WS93 3WNNA 1GZWA 4NWVA 4XF0A 2WO7A 4YPJA 3USUB 3H8RA 2KM2A 2IXKA 1CJDA 1WKYA 4ISRA 4J1XA 1W8UA 1IG0A 4I09A 3S30A 3V65A 1TNRA 3U78A 1AJKA 1J84A 1N1YA 5GZDA 4CP1A 1SACA 3T1MA 1VRH1 5I0TA 2PHWA 3Q8CA 5GLUA 2EXKA 4KNCA 5CAZA 5KWRA 5CFDB 1PMIA 4E2SA 1YWKA 1UZ0A 2WAOA 3FHQA 5IAVA 5JIAA 4YZ5A 4DXTA 5F3CA 5EP9A 1XRUA 3E5UA 5DAXA 4A7YA 1PM4A 3ZSMA 3ZXAC 2WNUA 1TVGA 1X9TA 2AACA 1C3HA 1PVXA 1B09A 1C4RA 4S2GA 2DU0A 1AXYA 2XMLA 4QU2A 3IBMA 4XVHA 1GP4A 2VBPA 4MV2A 5DN2A 5F5CA 3N36A 3O0VA 1WBLA 5FPLA 3BKZA 4NUBA 3LE0A 4MLOA 2GAUA 1UOFA 2W08A 3CEWA 4TYSA 4YYOA 1AX0A 2VMGA 3BVCA 3N9QA 4AR2A 2AGSA 3RRDA 4JKLA 1ZRCA 2V4AA 3T0AA 3ABZA 3C8XA 4LK7A 3UT0A 1KJRA 4NIDA 5GM0A 4FXKB 3U07A 1O8PA 2JWPA 4BH9A 4Z8BA 2WLPA 2BDRA 2A3YA 1LR5A 2WFPA 4FPFA 4RL7A 2O0OA 3AZXA 5FY1A 3RMYA 1SFNA 1L7QA 1GANA 3I54A 1W28A 5HCFA 3KF5A 4N43C 1GOFA 3C7HA 3UNPA 3EB7A 1JHNA 1GLHA 3NKTA 3JQXA 4W8JA 4UXAA 1ULCA 1I3HA 4LHKA 4CXYA 4XF1A 4FFHA 3H8UA 3UV9A 4QB1A 2WQZC 5FMOS 3VDDB 3RI8A 1PK6A 3POIA 3PMSA 4Q4W3 2WNUC 5L73A 2XH6A 1M4WA 3Q8FA 5LWBA 1O3TA 1JUHA 2HWB1 3GNEA 4WM8C 1K5MB 1JZ3A 2W91A 5DDJ3 5T54A 3ETQA 1CONA 4CUGA 5ACA1 3PLQA 3KF3A 5T5OA 1QJY3 3ZXLA 4HVRA 1YJLA 4DUVA 2BJSA 2OZJA 2VMIA 1SEFA 4HSJA 1AR73 1PGW2 4KBZA 4QB2A 2Q1MA 4FT8A 3WQBA 3IDAA 5F32A 1IQDC 3MI8A 1UCXA 4QDQA 4UF0B 1UXXX 2WZR2 5BY5A 2CU5A 5IATA 4QGNA 3RZMA 5A1AA 1GWMA 2YYOA 1XU2A 1VJ2A 1WLDA 4BOWA 4DB5A 1D2SA 1FV3A 1C8M2 1N1VA 1RUH2 1BKZA 4XZPA 5F1RA 4YFZA 1Q8QA 4AHXA 2A6XA 1RXFA 2OQ7A 3FUQA 3PVBB 4LITA 3H1WA 3HAGA 1U5ZA 4LORA 1PX4A 4EJRA 2VE1A 2HEVF 1HRV2 1KDMA 5FWEA 1PK6C 5FUPA 2JDMA 2A71A 1HB4A 1DP0A 2IZWA 3ZYHA 1ZA4A 2MNGA 3ZXKA 4LHSA 1GOHA 3MF9A 4E4SA 1DYPA 4DFSA 2NMOA 5KXBA 4ZU7A 4FPHA 2XL7A 3WV6A 2DYCA 2EF6A 1ULFA 2BYVE 2W87A 2XGXA 3EXUA 1MVQA 5FY4A 1W6OB 1RUD2 1SLAA 3U14A 4CTEA 5IW0A 1QQP2 2X09A 4PIXA 1XE8A 4AAPA 4AEDB 4DXRA 4GAZA 2FDIA 4YVSB 4NRPA 1JXNA 4NHKA 2D6MA 1Z7S1 2WWUA 3ZN6B 4NN0A 2XONA 1O3RA 4YWAA 4Z07A 1RVF2 4PLMA 4DUWA 2RVAA 1HXS2 5FCCA 2PHRA 4B3NA 3AMNA 1CAVA 1AR63 3HT1A 1DYKA 3DKQA 1EPZA 1FMD3 1UQXA 2VZUA 2IWGB 4PI2A 3USUA 3H3LA 1NAEA 3HBZA 3BN6A 5IK8A 2MPFA 3PTYA 1CAWB 2SBAA 2GH2A 4HVOA 1VBD3 1RTVA 4LBQD 3SMHA 5A6ZA 4I02A 4L99A 5DAPA 5LBFA 1GNZA 5JZGB 3ACHA 2NP0A 4CDUB 4MGZE 1RB8G 1HN0A 1W2OA 2QQPA 3MEPA 3CZUA 4XDPA 5L19A 3NJZA 4BQ5A 2E7TA 5KHGA 2GC3A 2Y60A 1MS8A 5LA9A 4AOCA 2ADDA 5A7WA 2RMU2 3CF6E 3TAYA 1FATA 5JSRA 2JE7A 5FPZA 5BNOB 4GQ7A 2W68A 2FCVA 4XIKA 5A3MA 1WA4A 4DPNA 1K3IA 2VUJA 2A6WA 3HJRA 2ZGUA 4LKFA 5FY7A 1D4M3 1IPSA 1X33A 2PLV2 4Y4YA 3W58A 1HRI3 4O65A 2HWE2 4QGMA 2X05A 1DU3D 3VDBA 1OHFA 4AFCA 1BXHA 2XLFA 2BEOA 2XJRA 4AGVA 4C1XA 4M4RA 5FTTC 3SKVA 2D3SA 2VZTA 3NV3A 1CAXB 1ZZ9A 2RS32 1AL21 2V5YA 3MDPA 3MFAA 5A7QA 2XB6C 5FZCA 2PAMA 1LHUA 4LXLA 4G3YC 1C5HA 2X10A 2WFF2 3I3EA 3KT7A 1EYBA 2BQPA 2UYAA 1TME3 1DQ0A 4HKLA 2AENA 4CP2A 2TUNA 2YUEA 4N7IA 2C26A 2VZVA 4CXWA 1FPN2 1LEMA 1W90A 5FMOL 2BPA2 3WG1A 2BFUS 3D3AA 3VBRC 4BE3A 5LK7B 1ZREA 3BIEA 3AMPA 1HKDA 1MZ6A 3N9MA 1TNFA 3SH5A 5K7PA 2FCTA 4INDA 1AR92 5C9AA 2FHRA 1MZEA 4OZXA 3ZFFB 5FZAA 1CAUA 3DPRB 1PZ8A 1ZBE1 2YZ4A 3GCXA 5T52A 2VO5A 4ZXKA 1F35A 3IPVA 5A7NA 3OBZA 3PMEA 1JODA 2ARAA 4F3JA 5BYNA 1UN1A 2E32A 2R041 2AUYA 2X5IA 4JHTA 4R8HA 5E1RA 5EYYA 3CQOA 1E5IA 3J26N 4LNVA 4F8AA 4BXFA 3KVBA 5HPOA 1UX6A 2JG8B 3LKJA 3RJRA 4CDWB 3AL5A 1WCSA 4QQLA 4UF0A 4ZY9A 3IB3A 2RM23 2BOIA 2BUKA 1ULGA 2JDUA 2XQXA 1UXZA 4ZONA 4IESA 4NPLA 3EJKA 5C7GA 1YO8A 5EXOA 4M0NA 2Y6KA 4HOOA 4OI1A 3OBRA 5ISLA 3JQWA 1SPPB 2VVDA 2VVEA 4YM0A 5CZKA 3B9CA 3OYWA 4CPBD 3OY8B 1E5RA 1ND2B 1KITA 1RXGA 2JDKA 1CPNA 5A33A 4BHPA 1COV1 4IE7A 1JYNA 1OQEA 5EZWA 3ZSEA 4LIVA 4BA6A 4P9WA 1AYM1 4B8EA 1ULOA 5A70A 1W04A 4QHBA 5C9AC 4GULA 4I0AA 2ZZQA 2YC0A 4Q1PA 3NO8A 5LBBA 4FPLA 4HG6B 5LRSA 4DEVA 2ZEYA 3HQUA 4URTA 4GJYA 3KVAA 5FZMA 3B00A 1O59A 3UESA 4QQPA 5CNAA 4A6OA 2OT7A 3SCHA 2BVBA 3Q9OA 4SLIA 2B9UA 5APAA 1JYXA 1RMU3 3VL8A 3W21A 3I2KA 1YIPA 2P37A 4AG4A 3WEZA 4CEWA 3ME2A 1AYN1 4MXVA 2R6QA 5EJZB 3RZHA 2X5IC 1WD3A 1LHVA 4CU8A 3GHMA 4YVSA 3VHOA 4CUAA 3ZN6A 1S0IA 4QQOA 1P8JA 2OA2A 4QXBA 2BWCA 1H6YA 4Q4W2 1W2TA 4DY3A 5F2SA 4Q26A 1WZXA 5H9RA 5AVAA 2PHFA 5IYYA 3HQRA 3WDWA 2DUPA 5HXVA 4WVMB 1BBT1 4IE6A 3B5LB 4XFBA 2RR13 4J1WA 4N53B 5A3NA 4SBVA 2O8OA 1XC6A 2PQQA 2Y0OA 5DDJ2 1LCLA 3VZJA 1G9FA 5FYIA 2JECA 2DTWA 3SQOA 3AP7A 3LA7A 1AR72 1RINA 3EO6A 4AEMA 2LRPA 1OFSA 1TZOA 1TMF3 1GUIA 4BWOA 1EUTA 2WO1A 4XF9A 1OSGA 1W3VA 3PNAA 5A3WA 4AHWA 1NKGA 3DV8A 1YI7A 4P02B 3B9IA 2R30A 5B4XA 3R6SA 2AEYA 2B46X 1GNYA 1ZM1A 3ACLA 2JDPA 2VCCA 3O0WA 3WLUA 4CEWC 4RFRB 3A0KA 1JI6A 5EIYB 1IKQA 1EAH1 2GMPA 4FAGA 4CEYC 1US2A 1Z0HA 2GC2A 4LR4A 4COWA 4GZ9A 3VBOB 5BNNC 1W6MB 1W8NA 1OOPA 2LROA 4YGDA 4D6RA 4S2FA 1DZQA 4AEKA 1IPJA 3WF1A 4IEPA 1W0PA 2ARCA 3KGZA 4UW5A 4S2DA 3I2JA 4AQSA 1W3XA 4PDWB 1RJ8A 3I2DA 4KWJA 3JBG1 3N4MA 4K21A 5J96B 4AYUA 1OQDA 3APBA 4A2UA 3M2MA 4P5YA 3AMHA 2B45X 2UY8A 1VAMA 4NMIA 4AQ2A 4KGGA 3SISA 2BZDA 1H2KA 1OA4A 1UU5A 5AVPA 1BMV1 5FZIA 1SG3A 5AC92 3ENRA 3KWVA 1QXJA 4NAMA 5FZ9A 4QQHA 3WDUA 1JMUB 2CWMA 3ZVXA 1V6LA 2VD7A 2DBIA 2JDAA 3KCCA 5FYUA 4RR3B 4WZCA 4FTEA 2YPDA 2V09A 3LDRA 5LA1A 3VKFC 1WMXA 1AR62 3AJZA 1IOAA 2G9FA 3W5MA 2ZX0A 1FMD2 1W0OA 3OGJA 2Q8EA 1F31A 3AVRA 3EMRA 3KD4A 1RUF1 3Q8AA 4V2VA 3VHNA 5JOZA 1J3RA 4XZUG 5JXGA 1SLLA 4IV1B 4KWKA 2ZGNA 5CADA 1VBD2 4NVPA 1OOPC 3LFMA 4NROA 4Y1VA 5F5AA 4RHV1 4O7XA 5LA0A 1ST8A 5D21A 2QZ3A 4UFJA 4FPGA 1OLQA 3HNMA 4A3XA 5CFCA 3FZ3A 2EIGA 2WQ4A 1LOAA 1UY0A 1XBFA 4FQ4A 4AHYA 2WRAA 4QXKA 1SBEA 2A3XA 4L97A 4YM1A 5IVVA 4AVTA 4PQ9A 4LO6B 1F5JA 1UW8A 2BTVC 2QCSB 4M3CF 1EV12 5J7MA 4CCCA 4XUNA 3W9AA 3HNBM 1N1SA 3A4UA 1D4M2 1HRI2 4YW6A 5F6LB 2P5BA 4PBOA 4Z1VA 1QH6A 4AFBA 3H8XA 5IWFA 3C2UA 2RE9A 1S0JA 4QWNA 1WMFA 2MEV3 1R1A1 2XLAA 2JKBA 1DQ2A 2JDZA 1BK1A 3ZSLA 5EJ3A 2DVFA 4IEQA 1QNYA 3FX3A 4D0QA 2F17A 5ABJA 3RZGA 3NVCA 1LB2A 3WR0A 1PIV3 4YM3A 1ULPA 4NHMA 1NCRC 1UOBA 1ZBA1 3K3OA 3VBFB 1TME2 5DUXA 1W2NA 1AL0G 4LOTA 3HR9A 4Q4Y2 5FXXA 1UKRA 5HBAA 1OUXA 5CFCC 2R071 1LOEA 1A3KA 4JV4A 1H4GA 1OC1A 2VH9A 4AI8A 3MIHA 4Q4X1 5T50A 1S2EA 1XYPA 4YZ1A 1GICA 5I0SA 5L7OC 2ZX4A 2VR4A 3AYAA 5EHDA 2JJ6A 3ORJA 4CP9A 5FPXA 1RITA 2WN3A 4O61A 1DQ4A 1AF9A 1LULA 3AP9A 4BLIA 3O0XA 4RGAA 1IGOA 4GWMA 2HJIA 4UFKA 5T3NA 4YW2A 4P9IA 1JTZX 3ILRA 4UFHA 3M8LA 1GP6A 4DUXA 1NA1C 2QQOA 4AVSA 3VN4A 1A78A 2RDQA 3VGIA 1LOGA 2VGDA 1IG3A 2E63A 3I3DA 2K0GA 4W6WA 1Y7BA 5C71A 1ONAA 1G9BA 3H7YA 3S0MA 3IMMA 1VB2A 4XDOA 1YRZA 2VQ0A 1PNFA 2ZTNA 2RM22 5FJHA 5ABJC 5E88A 2VJXA 2A75A 3TYJA 1OQ1A 1R081 1SZBA 3JZVA 5JXIA 3ZYFA 1BHGA 1GZWB 3GM8A 4KWLA 3RDIA 1KS4A 3ZFEC 2WC2A 2PQSA 1LHWA 3R4UA 1V70A 1UMZA 1ZVFA 4NHXA 3LA3A 2XVLA 2ZEWA 1W6MA 3BODA 3ZYIB 4CCKA 4YZ2A 5HCAA 3CLPA 2CSGA 2QQLA 4GIQA 4N43B 2Z4FA 3HPNA 3O1PA 1Y9GA 4AVCA 5IFPA 3ZOIA 4U36A 1S0FA 3BTAA 3VDAA 1PGL1 2CWSA 2YV8A 3JB4C 3JXSA 4KG0A 4HK8A 4AI0A 4ASMB 1MVEA 1AUYA 1RMU2 3QBQA 1GP5A 4B4PA 1IS3A 2WNUB 4IEOA 5ACA3 3T1LA 2JX9A 1NXMA 3WQ1A 5FKCA 2ORXA 5LCWL 1YYNA 4P00B 4FTSA 1G7YA 4WM8B 5LBEA 5C4WA 4BU2A 4X8PA 5FFOC 1WD4A 2FDJA 3AZVA 4QB6A 5IFTA 2CY6A 3AP5A 3N9NA 5AFEA 2ZX1A 3TNPB 1UY1A 3TEYA 2IC1A 1SLIA 1MQTA 5JWPA 2WNEA 2RR12 3LAGA 4W50A 1W8HA 1GOGA 1WW5A 5IK5A 2ZAAA 5T55A 1WLTA 3OF1A 5FRAA 4YGCA 1ZZ6A 3USSA 3L2HA 2ZGRA 2ZGKA 1ND3A 2CAVA 1UX7A 3AYDA 3KV9A 2DURA 1PO22 4XXPA 4GWIA 1LOCA 1TMF2 1UNBA 2P6CA 3FUOA 3VBUC 3U4XA 1J1LA 3MZHA 1JU4A 1PVC1 1WGPA 4PF1A 3WNLA 4E4ZA 3AMQA 2VULA 4HKOA 2J7MA 1FT9A 2W46A 1PK6B 3DYPA 4E8CA 3C7FA 1U5XA 2V73A 4NRQA 1YI9A 3N7JA 5CA6A 5IK7A 3WNMA 3TEXA 1U5YA 4XUPA 1G86A 3CNAA 3FC0A 3RWKX 3AXDA 3WY6A 5JR2A 1RUJ1 5C4WC 1QEXA 2I74A 3GJBA 1ZZBA 5A6XA 1WCDJ 5FP9A 5TSWA 2K9ZA 3JCIA 3NW4A 1W6QA 3NNFA 4E9KA 4YW5A 3T30A 1MQTC 1H8VA 2OQ6A 2TBVA 2PN5A 3H9AA 4GKXA 4CCNA 4JC1A 4QKBA 3MO4A 4LHLA 4LLFA 4ONUA 4GXLA 5FKBA 1UZVA 2ZA9A 4AVVA 5JOYA 4NPRA 3PL0A 2DTYA 4ZXEA 4TZDA 1IS6A 1ND3C 5E6HA 3I2HA 3VBFA 2OZ6A 1LHOA 3LWCA 4PIZA 2VCAA 2RS52 2FMYA 4A7ZA 5IVEA 4JCKA 1O8SA 5L36A 4OFGA 2QDRA 2NMNA 1XE7A 3T2OA 4OVEA 3WNKA 4URAA 1F5FA 4Z2AA 5GZGA 4QM8A 1DZTA 1YJKA 1GFF2 2QQKA 4UW6A 2D43A 3RZZA 2D6NA 2FDFA 4HN1A 4IE4A 3OGGA 1LHNA 1NZCA 4QX7A 3KV6A 3H7JA 5J36A 1QJU1 3OPTA 4PBPA 2OPKA 4ZS3A 4TTGA 4L11A 1WW6A 3VD3A 4Q4V3 1X9PA 1UIKA 4EZHA 1NY71 2HWC3 2BWAA 4N90A 3T4VA 1UMHA 2OUHA 5A3LA 5FZ0A 1RUG1 1CZSA 1F2NA 3MLJA 4AI3A 2XHKA 2XG3A 5FLJA 1A8MA 5JAXA 2DCYA 1PO11 3HD8B 2RHPA 2GH8A 3POSA 1HQNA 1AL23 5G04L 5C5UA 2HWD1 1CAVB 3QH6A 1YCIA 2W1WA 5IVJA 2R0HA 2G9GA 4QU1A 4V1PA 1JZ2A 3D6EA 5GJ6A 1PZ9A 1V9U1 3DKWA 3H3ZA 2W39A 3AKTA 1XSQA 2Y0IA 5J09A 1KFXL 4HANA 4HZFA 2VXRA 3ZSJA 3AZYA 1LESA 1T6GC 4COZA 1PMHX 2EXJA 3ACGA 4PLOA 4YW3A 1W8FA 1S1AA 2P6HA 2UU8A 5F3GA 2VZSA 1HB3A 4N43A 1XOYA 2WT1A 4RS5C 4V2WA 4JGYC 3PTRB 3MUZ1 1X8MA 1NLRA 5LK5A 3VBRB 4Y5Z0 3RWNA 3WP3A 1PIV2 1ZBE3 2Q30A 2VXJA 2DCZA 2XWBB 1ZYBA 5A7WB 1JH5A 3WSOA 1XNCA 4MXWA 4Q0QA 5L9VA 4XQDA 5ANNA 4D6QA 2ZS6B 3PU8A 1Z78A 3JU9A 4XQ4A 4JQRA 2WR9A 2AREA 3MLLA 4R52A 3I49A 4NIHA 3LIGA 4ARYA 2H6CA 1S0GA 1F9KA 2EAKA 5JXHA 2R043 4NIIA 4CDQA 4WM8A 5CBLA 2J1SA 4GA9A 4X6QB 2JB8A 4IEYA 1EPWA 5F3EA 3OSDA 4UFMA 2DUQA 4TSVA 1QDCA 3B69A 1APNA 1AXZA 3O1SA 2XDVA 3OG2A 5J37A 3OB8A 2EIEA 4KU8A 4PIYA 5IT6A 4XTPA 3MV01 5HCHA 1MS4A 2KD7A 2CGNA 3POBA 1COV3 1GYKA 2C9KA 3VD7A 2Z5WA 3ZYJB 3AKRA 3WP4A 3IZOA 1AYM3 3KT4A 2LM3A 3GBGA 4RYDA 5LA2A 1JZ8A 3WNPA 2V4VA 3KB5A 2VNOA 2V5DA 5JLVA 1SQ4A 2VU9A 1MEC2 2KA3A 5EPAA 1HB1A 3DXTA 3KV4A 3GZAA 4JZRA 4WM7A 5C9AB 5I93A 4RSUA 4UW4A 4DRVA 1FI2A 2JXAA 5IHRA 5JXJA 2Z42A 1AYN3 2G9ZA 1CAUB 2PAEA 4RFT0 4XF4A 1V6MA 2YMZA 3G6JB 4IGQA 4GWNA 4QAWA 4CDQC 2D97A 1ZZ8A 1JW6A 2QQIA 2AC1A 2XKOA 3IPVB 4R4ZA 5FXVA 2UWBA 1UYPA 2B42B 1QJX1 1D7PM 4D7SA 2EVXA 5B4NA 1GZCA 3O1TA 1JOJA 4L8QA 2Y6LA 1N47A 3H1MA 2X5IB 2QFEA 5FLIA 3J7HA 3MHZA 2VY0A 4QQ2A 1BBT3 3OUIA 5H9PA 3A22A 4LKEA 2EICA 2VTXA 2VL4A 1QIQA 4PLNA 4EN8B 3M70A 2TEPA 4R9DA 1VP6A 2QE3A 2VW2A 1DLLA 3MICA 3A7QA 3THCA 4A7KA 5KXDA 2BNOA 4HPKB 3THDA 4Y20A 4FPYA 2WZR1 3S6PA 1FX5A 2XVKA 5IVCA 1OPOA 3OYWB 4G9SB 5T5JA 3C3VA 2I2SA 1H8TA 5A33B 4AL9A 2DDUA 1GZ9A 3NV2A 1WA6X 3SEEA 1PHMA 4OUSA 3K46A 2YC4A 4Q0VA 1OBNA 4LPLA 1QU0A 5FYYA 3D82A 1NQDA 5I0UA 4WM7C 1IPKA 1KDKA 1QOOA 4GH4C 1K42A 2DVBA 3BOPA 2Q1FA 4ITCA 4LE3A 5KXCA 1LECA 4GMP1 4IV3A 3OUHA 4Y1UA 4UOJA 1LGCA 1UF2C 1XNAA 4HXCA 2FDHA 3LEIA 1EAH3 4COYA 2VOKA 3NNGA 2GNTA 4H2AA 4EWEA 1W06A 2Y38A 2ZJCA 5F5QA 4KBBA 2VZ1A 4CEWB 4HN0A 5GLWA 1JYWA 1RHI3 3N9LA 4OMDA 3SH4A 1NE6A 4IEWA 3K4DA 4CEYB 5A7SA 4FP3A 4BISA 5BNNB 5LBCA 3PIGA 1S0BA 3HQXA 3JBG3 2BERA 4PQQA 1ENXA 1LKNA 3OGSA 4DOUA 1LU2A 5FK7A 3KSCA 4XJ8A 1CJPA 2PHXA 4BYYA 2R32A 3M3IA 3D5OA 3OTFA 1QHDA 2LUWA 1H4HA 1HXS1 3HT2A 1H8TC 4ZU4A 3LEKA 1FXZA 2WO3A 5FAXA 1L7LA 3I3BA 3UKTA 1AVBA 2W9XA 2P1BA 3WF3A 3MIDA 2J1UA 2RS13 4Y4RA 1GNHA 1JZ5A 1URXA 3I97A 1PZ7A 1OKQA 3N35A 4IV3C 2D6LX 1AX2A 3LGRA 3I8TA 3GGLA 3VBRA 2BGOA 1RUF3 1MR5A 1H1IA 1XNTA 2JENA 1S0EA 4QX3A 1QOTA 2DU1A 2RV9A 3FE5A 1QXPA 3M7AA 1O7FA 3KS7A 5LATA 5FBZA 3NSTA 4K1YA 5EQUA 3GZUC 4Y24A 4I3GA 1JUIA 3LB9A 4FP2A 1OLMA 3VKNA 3WZ1A 4NO4A 3N7LA 1VIWB 1LAJA 3KQRA 1OOPB 2EXHA 4B4RA 3AYEA 2Z79A 3VZOA 1QJFA 4E2QA 5FOJB 1IZ3A 3THTA 5FMCA 4Q1RA 3WHUA 1IHMA 4FOVA 1ZRRA 1RUE1 2E33A 5IJRA 3HNYM 5FY9A 2B4KA 2HWE1 1VBA1 1I9RA 2QKDA 3K3NA 4Q4V2 3LDBA 4CCMA 2Y33A 1US3A 1D2QA 2GC0A 2HWC2 2JIJA 2YU2A 4I30A 2VTXJ 4K8FA 1LTEA 2QQMA 1JYIA 5C8WA 4Z2WA 4K40A 3AB0A 3U1XA 4COVA 3N7MA 4TLFA 1GQPA 2NZ9A 2CL2A 2WT2A 1EY2A 1R1A3 2GNBA 2C24A 3VZLA 2A3WA 3K2OA 4LO8A 1T2XA 4EROA 3FFQA 3QLQA 1AL22 1CN1A 1Q8PA 5A7PA 4Y1XA 5FZ7A 4E4HA 1YQ5A 1ZA7A 1CX4A 4K3UA 2WS92 2D93A 3KHBA 4YW1A 5IUQA 1ODNA 1U12A 1OMIA 2Y26A 3BU7A 2A70A 3POYA 3RYPA 2F4LA 3KMHA 1BCXA 1FOD3 4IGOA 3WX5A 2Q5TA 4IEUA 4NJ4A 5LY2A 3CHXA 4Q4X3 2XJUA 2D40A 1NCRB 3J8F3 1HIXA 3SKJE 1CGPA 1BVP1 3RZLA 2VMCA 2XUMA 1GKBA 4QX5A 1JU3A 4MGIE 4WV8A 3TNQA 4HL0A 4B1LA 4M4PA 4DQAA 2X29A 5CFCB 1TG7A 3UETA 1NUKA 2VW0A 4K7JA 1OF4A 5HV0A 5J48A 5LEKA 1ZBE2 3SITA 3MBWA 5L7OB 2WA3A 3O1MA 2EAAA 3WOGA 4CCOA 1CR7A 2Y6HA 4XC9A 1Q43A 3LOBA 4YVWC 4HPKA 3L2YA 3ZN5A 1UYZA 3ZN4A 1D4VB 1YFYA 4G4FA 2R042 2WWSA 3MYXA 4P9YA 2XJQA 1JOPA 4MUVA 3AVSA 3DF0A 4CCLA 4FSJA 1VBC1 3N9PA 1VALA 1C1FA 2JDYA 2AR6A 3Q8BA 4YLZA 2D6OX 1RUI1 1VR3A 3C7GA 2BBAA 5DXDA 3IIAA 1NA1B 2X53S 2A6VA 2VOTA 1ASJ1 3RPQA 2VUCA 1N3QA 4CYDA 2YGMA 2XBO1 4P5HA 1HV0A 1R083 4LBLA 1YQ2A 5FZ8A 1XPWA 1DDLA 4QPWA 4KU7A 5ABJB 4OCTA 3U75A 3VZMA 1COV2 3DCQA 3H0OA 4A41A 2AYHA 5LY1A 2CNAA 2XWJB 3PURA 2CYFA 2B9VA 2VG9A 1VRBA 4C8DA 3ZFEB 1SLCA 3EQEA 4YNIA 2IXHA 5B2GB 1AR83 1HQLA 1NQJA 2CTVA 1MZFA 4CEYA 2ERFA 5DUUA 4UFIA 2P3IA 4Y1ZA 2ZGOA 5BNNA 2HEWF 4HSLA 1V6JA 3M3OA 5KHHA 3BALA 4CP9B 4H7MA 1O3SA 3POEA 2OKXA 4MGQA 1AYN2 2ZGMA 4MX3A 3TN91 2ENRA 3LPGA 3MUY1 1S2KA 5K0UA 1R093 1WCKA 4M0HA 4XAAA 3WF2A 2IXCA 3V64A 4K20A 4OHWA 3V0BB 5JVVA 1QJY2 3DGTA 4Q27A 3DUIA 1YFXA 1PNGA 2UWAA 1H9WA 5JR7B 5DDJ1 1CQ9A 3WVJA 4IEXA 3AXEA 3BB6A 5I8YA 4BM8A 4Y5SA 3ZIWA 3SH3A 3JD71 3KCXA 1F4HA 1L7RA 3NNMA 4YG0A 3CDZB 4XFIA 1QH7A 2A6YA 1ODMA 2E6VA 1C1LA 3DECA 1W6PA 3SHRA 4NR1A 4XACA 3TB0A 1OPMA 1N1TA 1XE0A 1KD7A 1J1TA 3ACFA 3HMYA 4W6XA 3ST7A 2WBKA 5D8AC 1C5IA 1V0AA 1CZTA 2JDNA 2QTWB 1PVC3 1V6OA 1HDKA 3NMBA 2ZHMA 3T09A 4CU6A 4HFSA 2IVIB 2HYXA 1POV1 4IXLA 5A7OA 4IEVA 3EYPA 4CCJA 1DGRA 4IERA 4AAXA 4AFMA 5K0UC 1DGLA 4XE9A 3VBUB 3X29B 1VBB1 1EAH2 3VBSB 1MS0A 2VZ3A 3NV1A 2OUJA 3PU3A 3IKWA 1RUJ3 2E31A 1O4TA 1YXWA 2XKPA 3KT1A 3O14A 3QD6A 1Q5OA 1RHI2 2QVSB 2VZOA 2D3PA 2VVFA 1XB9A 2BFUL 1D0GA 2CGPA 5BNOA 5C4WB 5M0TA 2GALA 3ASIA 4CP0A 3AP4A 3JBG2 4FOWA 3TWIA 4EWAA 5AC91 1VAKA 2E26A 2I07B 2QUOA 1XNKA 2JG9C 3POJA 1MQTB 2NM1A 2WSVA 2O1QA 2YU1A 3J9SA 5I8SA 1BMV2 5FYSA 3ZO0B 3K51A 2Q8DA 3R4SA 3BIWE 5KXEA 1ENQA 5FR3A 1AX1A 3AP6A 1DYOA 5C3OA 1CX1A 3OD0A 3VD4A 2G19A 5LW9A 4QT6A 5AFBA 4YW7A 2W94A 1ND3B 1NCRA 5K4LA 2RS12 3UGHA 4CUBA 4LE4A 3T08A 4E27A 3OGVA 2G4IA 2XHNA 2YROA 1VBD1 1JN2P 1UPSA 1X36A 1HLCA 1B35A 1RUF2 1FNZA 2XJTA 2ZAHA 4LKDA 5FIXA 1QJU3 1Q8SA 2PAKA 2VOWA 4D69A 5L7OA 3NAPA 2Q8OA 1X50A 3A21A 3K77A 1OKOA 4LBNA 2HWF1 2PHUA 4MYEA 1LOFC 3QCWA 5CB7A 2IXJA 3W5NA 4JHZA 2WYSA 1X7NA 1RUG3 5EV7A 4OI2A 5BNOC 2P3YA 5FJKA 1NLSA 5JPMB 2VCBA 1EV11 1PO13 2H0VA 4QMAA 2FD8A 4XMAA 1NA1A 1Y43B 1W6QB 2EXIA 3PVNA 2YFUA 1UO9A 4C90A 3AC0A 2VM9A 5SV5A 4JTOA 4AVBA 2HWD3 4XFGA 1HW5A 5K8SA 3MW2A 4EN9B 1UYYA 5HI0A 2A5ZA 4YGBA 2NQYA 1W6NA 3T2TA 1V9U3 4HKWA 3LF7A 4K9SA 4XW3A 4FPKA 4OMCA 4XCAA 5G05L 4AQ6A 4DEQA 1YUDA 3LCPA 1ZRFA 3O1UA 3T0BA 2Q4SA 4M3CA 1QMJA 4JVAA 1RUC1 4QKNA 1LNSA 5CIRA 3ZFEA 2V72A 3ZDVA 2OIIA 1H30A 1VRH3 2JE9A 2A6ZA 3RMXA 1CIWA 1B35C 3I2GA 4CRQA 1TME1 3NV4A 4QX2A 1Y9QA 1H0BA 1KFUL 5DUVA 4Q4Y1 3NAPC 1IQAA 1FV2A 1K5JA 4XCBA 4WBBA 3H42B 4I01A 1JYVA 1SFYA 5JMOA 2E9QA 2VBDA 4RS5B 4QKFA 3SCFA 1FOD2 2HBTA 3E6DA 4JGYB 4EQVA 1VLNA 4C1WA 5F9TA 1T6BX 3VD9A 2B7YA 1ULDA 4Q4X2 2YFZA 3EBRA 5H9QA 3J8F2 3CJIA 1W99A 2IFWA 3V0BA 3G7DA 2R061 3QOPA 5KHIA 2VOVA 4P14A 3WD5A 1FNYA 3PUHA 3KM5A 4JKKA 2FBEA 2P34A 4BLJA 4A4AA 2XPJA 4BK5A 4JAAA 3OD4A 5JOWA 5A1FA 4RQPA 4ES9A 1DGWX 2Y6GA 4OHVA 1WLCA 2BGCA 2OS2A 2DBNA 2E51A 4LTAA 5L9BA 3GALA 5GKAC 1VMFA 1V6IA 5CVRA 2F6BA 1A6CA 2RG4A 3EHKA
chains in the Genus database with same CATH topology
3F95A 2C24A 4LKFA 1W8UA 4LKDA 4LKEA 3ZYBA 1L7LA 1V0AA 2LROA 2O14A 4BQ2A 1GWMA 1OKOA 4CPBA 1WCUA 1WMXA 4A6SA 2K46A 4BQ3A 1W8WA 4LK6A 1HN0A 1W9FA 2LRPA 4CPBD 4LK7A 1UOJA 4LJHA 3UT0A 3ZYHA 4AL9A 4BQ5A 1W8ZA 4YWAA 2JWPA 4YW6A 1GWLA 2VXJA 1W8TA 3ORJA 4CP9A 4YW7A 1WZXA 4CP9B 4BQ4A 3ZYFA 5D21A 2KR2A 2Q1FA 1OH3A 2WYFA 1W90A 1GWKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F95 A;  2C24 A;  4LKF A;  1W8U A;  4LKD A;  4LKE A;  3ZYB A;  1L7L A;  1V0A A;  2LRO A;  2O14 A;  4BQ2 A;  1GWM A;  1OKO A;  4CPB A;  1WCU A;  1WMX A;  4A6S A;  2K46 A;  4BQ3 A;  1W8W A;  4LK6 A;  1HN0 A;  1W9F A;  2LRP A;  4CPB D;  4LK7 A;  1UOJ A;  4LJH A;  3UT0 A;  3ZYH A;  4AL9 A;  4BQ5 A;  1W8Z A;  4YWA A;  2JWP A;  4YW6 A;  1GWL A;  2VXJ A;  1W8T A;  3ORJ A;  4CP9 A;  4YW7 A;  1WZX A;  4CP9 B;  4BQ4 A;  3ZYF A;  5D21 A;  2KR2 A;  2Q1F A;  1OH3 A;  2WYF A;  1W90 A;  1GWK A; 
#chains in the Genus database with same CATH topology
 2ZHN A;  4UBG A;  3CBN A;  3ZM8 A;  3D0S A;  2H0B A;  1WME A;  3WDT A;  1LED A;  2FCU A;  2VUA A;  2RDR A;  5A80 A;  2ET1 A;  2ZKL A;  4LKS A;  1SLT A;  3AKQ A;  1R08 2;  4YW4 A;  3DYM A;  2J1A A;  4Q2F A;  1J83 A;  4E8D A;  3AYC A;  1UIJ A;  3FBM A;  3MIE A;  4XJA A;  3VBU A;  3PUQ A;  2IXL A;  4XHX A;  3VBS A;  3WCR A;  3AZW A;  5C3R A;  4B29 A;  2HWB 3;  4NWW A;  3FN9 A;  4HT1 T;  3CJI C;  5FY0 A;  4MXW B;  3P6B A;  2ZAC A;  2WIN B;  5GLT A;  4NIA A;  1QJX 3;  1AR8 2;  3P3P A;  1FAY A;  3N9O A;  2VMH A;  4XET A;  1GWK A;  4ZU5 A;  5FUN A;  4X8N A;  3ZDS A;  1BEV 1;  3FWE A;  4NE9 A;  4BME A;  4RQP C;  4CDQ B;  5J1X A;  3KZ4 C;  2Y6F A;  4AHZ A;  1RC6 A;  1HX6 A;  3LEM A;  3HN1 A;  3ZYP A;  1PGL 2;  2BBV A;  4FCA A;  2QZ2 A;  2JDH A;  1GBG A;  1G9A A;  2VBB A;  4DNY A;  5FPU A;  3WF0 A;  2X8K A;  1W8W A;  1U0A A;  5FZD A;  3T3Y A;  3OJB A;  1MS3 A;  1C8N A;  1UOG A;  3M1H A;  5EYX A;  3TRS B;  4A42 A;  4LJH A;  3IT8 A;  1JBC A;  4XBL A;  1R09 2;  4FI9 A;  5F8P A;  1WUV A;  1W8Z A;  2VOX A;  1CPM A;  1VMJ A;  1BK0 A;  3ON7 A;  4MET A;  4Y22 A;  3S57 A;  5A6Q A;  2A1X A;  5KHK A;  1YC6 1;  1VBE 1;  1DGR N;  2YGL A;  3WDY A;  3RFR A;  1SFP A;  5DPN A;  4GWJ A;  3UYJ A;  1XNB A;  1PGS A;  5FZO B;  3TEW A;  4MHU A;  1H2N A;  1W03 A;  3OPZ A;  3ALQ A;  3VBS C;  1TE1 B;  3WT3 A;  3OBT A;  5C70 A;  1OH4 A;  1PO2 1;  4XFH A;  3GDB A;  5FPV A;  1V6N A;  3NQH A;  5FY5 A;  5FZF A;  4WM7 B;  1GSL A;  4GH4 B;  5HCB A;  5FRE A;  3A23 A;  4ET7 A;  1GV9 A;  2FDG A;  1H6X A;  1O3Q A;  4FPO B;  1YIF A;  2GDF A;  1F15 A;  2VNV A;  3E1F 1;  3ZFG A;  5C8C A;  2GU9 A;  3O12 A;  5CYY A;  3MFC A;  1NCQ C;  5D2A A;  1PVC 2;  4I0B A;  3PIJ A;  1Z7S 3;  3W20 A;  4LBJ A;  4WVZ A;  2ZGS A;  1KEX A;  3NL1 A;  4D7T A;  1AJO A;  2CDO A;  4XJZ A;  3BYW A;  3PDQ A;  2NN8 A;  4R9B A;  3SLI A;  1UKG A;  4LBQ A;  4YG3 A;  5DG2 A;  3LSD A;  3IDB B;  1NZI A;  1RUJ 2;  2Y64 A;  1DQ1 A;  4A44 A;  1HXS 3;  5I91 A;  4HK9 A;  4MGK E;  3E6C C;  4UI9 L;  2UWC A;  2R1B A;  4WVW A;  4XFF A;  1BQP A;  4RN5 A;  2P3K A;  3ZYG A;  1C57 A;  4Y20 B;  1OLM E;  5FYZ A;  3IMN A;  2QNK A;  4COU A;  3V0A A;  1CWP A;  4QPI A;  5FO9 B;  2CDP A;  4P9J A;  5FZ3 A;  1H8T B;  3VBH A;  5F2W A;  5IAX A;  1IKP A;  2YBK A;  3INA A;  2HLE A;  2RDN A;  2DVD A;  3HN3 A;  1OF3 A;  1DHK B;  3WUC A;  4IQP A;  4BMB A;  3PJQ A;  2VQT A;  4CA9 A;  2RS5 1;  4OHX A;  2WNV A;  3E97 A;  4KMQ A;  1QOS A;  1LOB A;  4F83 A;  1GU3 A;  2BNN A;  3O1O A;  4GJZ A;  4RS5 A;  4LUM A;  4IV3 B;  4IEZ A;  4JGY A;  4BCU A;  2Q0A A;  3LD8 A;  3K48 A;  5FZ1 A;  2C1F A;  3ZFG C;  3ZIX A;  4DXZ A;  3E6B A;  5GZF A;  5C8C C;  4FAH A;  5LZ6 A;  2JKX A;  2ZX2 A;  3FLR A;  5JSP A;  1XJA A;  3ZMN A;  4MGY E;  1JOB A;  2ZEX A;  3CZJ A;  1LJ7 A;  4Q8K A;  2ILM A;  2VME A;  1HJG A;  1ACC A;  3K75 B;  3DEM A;  3MPP G;  3PUA A;  4M00 A;  2ID4 A;  4ARX A;  2VNG A;  3BUC A;  2YDE A;  3MW3 A;  1DG6 A;  4XXA A;  3K4Z A;  4Q0U A;  4QD2 A;  1ENS A;  1RUE 3;  2C9A A;  3CKH A;  4XBQ A;  4XFA A;  2ZGL A;  1Q8O A;  4GB3 1;  1Y9M A;  2HWE 3;  5FO7 B;  1VBA 3;  1NY7 2;  2KR2 A;  4I3P A;  2D3R A;  3RJ2 X;  4ATF A;  3RZJ A;  2R1D A;  1RUG 2;  4QPG C;  1PX3 A;  2DV9 A;  2R16 A;  4DZG A;  4QPI C;  2C0Z A;  1W9Y A;  3VBH C;  4PF5 A;  1PO1 2;  4C0H A;  4AI2 A;  3ZXF A;  4EYU A;  4P9X A;  3WQ0 A;  5FP4 A;  3B94 A;  2WNV C;  3I2F A;  2MEV 2;  2R7E B;  4LBO A;  4LK6 A;  1W2U A;  1W9F A;  1MS9 A;  4RA0 A;  4FFG A;  5LAS A;  1ALY A;  3RG0 A;  4B4Q A;  3GZE A;  4CVU A;  3VB9 A;  1GMM A;  4XAB A;  2W0X A;  5FXZ A;  1BYH A;  2W1U A;  2N7G A;  1ZRD A;  5FOB B;  4UWD A;  4Y1Y A;  2XVG A;  4XJW A;  3HIF A;  3Q8E A;  3WXP A;  3AL6 A;  2FMD A;  1UY3 A;  3CU7 A;  1VRH 2;  5DAB A;  3KLS A;  1PIV 1;  4JKM A;  4Q0P A;  1XND A;  4YG6 A;  4LEJ A;  3AJY A;  4IE0 A;  2ATF A;  3UJO A;  1F8V A;  4CU9 A;  1W2A X;  3RYR A;  1WMD A;  3MLK A;  2K2S A;  3ZXD A;  4YRD A;  1RL3 A;  3I3Q A;  2NLR A;  4CPB A;  1K12 A;  2EIB A;  2NPI A;  4XUQ A;  5C3S A;  5FDB A;  1CD3 G;  2FZ1 A;  3LQC A;  4AWD A;  1LEN A;  1DFQ A;  4LLO A;  3D0J A;  5DZF A;  4DMI A;  2WAA A;  4EN6 B;  2VW1 A;  2ZOE B;  3NRU A;  4C91 A;  4IE5 A;  4FPJ A;  5BNP A;  2C5D A;  1E5S A;  2XXZ A;  3WDV A;  2PHD A;  1REE A;  1MS5 A;  3AMM A;  4CCD A;  1W8T A;  3N3H A;  4W6Y A;  1VBC 3;  2OVU A;  4YGE A;  4GD4 A;  1WW7 A;  5BUV A;  2LAL A;  1W9W A;  1RUI 3;  4AI9 A;  4MZU A;  3GF6 A;  4YVW B;  3OEB A;  1ASJ 3;  3LSE A;  2JB4 A;  3O5S A;  2W1S A;  4X6R B;  2XBO 3;  2DWR A;  5KHJ A;  3B93 A;  1L3J A;  4IDZ A;  1O4Y A;  3GCW A;  2Y8K A;  5FZO A;  1JYT A;  4XUR A;  3WHT A;  5CEH A;  4PT6 A;  5FYT A;  1YQ8 A;  4B7E A;  4JTN A;  2VEC A;  3KHC A;  5JSO A;  5JUV A;  3BI3 A;  1STM A;  3HBK A;  4GH4 A;  5FYM A;  1X8E A;  1QXR A;  4J6G A;  4XDQ A;  3T2Q A;  1BLZ A;  1VE0 A;  1OVP A;  4XQW A;  1DLC A;  4XUO A;  4LO7 A;  1MEC 1;  4TWT A;  5FQ0 A;  2PXJ A;  4AFD A;  4HET A;  1POQ A;  2PYT A;  1KQR A;  4HMZ A;  3J7N A;  4OHY A;  3E5Q A;  4LO5 B;  2DUO A;  2ZAB A;  3ELN A;  2AH2 A;  4EWD A;  4MSV A;  5BNP C;  1OA2 A;  1RYY A;  2XJP A;  1WWY A;  4AFA A;  3TN9 3;  3III A;  5FY8 A;  1QJZ A;  2HWB 2;  3ACI A;  3LDK A;  3POG A;  3FLP A;  4UT5 A;  4MVT A;  1H2M A;  4HON A;  3VHR A;  5DUW A;  1OLR A;  2QQN A;  1PGW 1;  5FUI A;  4FTB A;  4HBN A;  4OI0 A;  5ACA 2;  3OOX A;  1QJX 2;  1M06 G;  1WW4 A;  1RUN A;  5FPB A;  2WWJ A;  1KS5 A;  3VDC A;  3I59 A;  1HV1 A;  3OBA A;  4XEZ A;  2GMM A;  5F6K A;  4RGG A;  2AZ5 A;  2FQP A;  2HKX A;  1C8M 1;  1RUH 1;  2TNF A;  3JD7 3;  4JRL A;  2ARX A;  5CU1 A;  4ZPI A;  1I5Z A;  3B01 A;  2D5H A;  3HEI A;  5FZE A;  3ILN A;  2W1Q A;  3GJA A;  4LOS A;  1K45 A;  3R0R A;  1MAC A;  1HRV 1;  3FJS A;  1BZW A;  3ITQ A;  4BDV B;  2GN7 A;  5F5I A;  4BB3 A;  5BPX A;  4AK3 A;  1NE4 A;  5T5P A;  2D7F A;  1REF A;  4OUE A;  3B7M A;  4ASK A;  4K6B A;  1LRH A;  2ETE A;  2DFC A;  5FZ6 A;  5FBJ A;  4K1Z A;  5GAL A;  4TXW A;  4LA2 A;  1POV 3;  1POV 0;  3MIF A;  4MOA A;  4OZO A;  2HEY F;  5FP3 A;  5LEJ A;  2JIG A;  4S2H A;  1RUD 1;  3KCY A;  3ETP A;  3UGG A;  2YY1 A;  5CG8 A;  5D8A B;  4XIL A;  1RJ7 A;  1VBB 3;  1QQP 1;  4UBH A;  1QNW A;  1G9D A;  3ZKU A;  4QHO A;  4AF9 A;  1OUR A;  3D8C A;  3LZZ A;  4QDS A;  4JX0 A;  2PEL A;  2YHJ A;  3J7L A;  3WDX A;  2VZQ A;  3H50 A;  2IUW A;  4ISQ A;  4IUG A;  1RVF 1;  5K0U B;  3RVH A;  4DS0 A;  1QKQ A;  1UPI A;  2VZP A;  1OUS A;  1S55 A;  4Q0S A;  4H3W A;  1RIR A;  1Z7S 2;  1UY2 A;  3V56 A;  1NLQ A;  2K46 A;  1H1M A;  2ZCW A;  3U11 A;  4HLT A;  5AC9 3;  4LIU A;  2LTN A;  1CIY A;  5A3P A;  4LT5 A;  2Y6J A;  2W2I A;  1ZZ7 A;  3U10 A;  1N3P A;  4J25 A;  4O9E A;  1QJE A;  4Q8L A;  3VV1 A;  5JI7 A;  4A45 A;  1W9S A;  2JG9 B;  2ORZ A;  1W6P B;  2VCM A;  4PCR A;  1AZD A;  4NHL A;  2BV4 A;  4RHV 3;  1O5U A;  2YC2 A;  5FLH A;  3RS6 A;  3VKO A;  3H1Y A;  3VKL A;  4ZZ8 A;  3IAP A;  4MAD A;  1WCQ A;  3MGU A;  2RMU 1;  1SDW A;  3HOB A;  5FMB A;  5FPA A;  4KWU A;  1HQW A;  1ENR A;  4C0B A;  2O14 A;  2XQR A;  3IN9 A;  3ATG A;  2WNO A;  5F7U A;  2I45 A;  3WW1 A;  4BQY A;  4WVV A;  4PHZ A;  1WLW A;  5CFD A;  3MF6 A;  4H14 A;  5F37 A;  2R0F A;  4L92 A;  4OUM A;  2HWF 3;  5FV3 A;  3M3Q A;  2PLV 1;  3S5Q A;  1IS4 A;  4JGZ B;  5H9S A;  1H1A A;  3AZZ A;  2VAU A;  3AX4 A;  4M3C E;  1W39 A;  5DAQ A;  4N8M A;  5CG9 A;  5IVY A;  3LOI A;  2SLI A;  1EV1 3;  4L2N A;  3UKV A;  2JE8 A;  4Y33 A;  5FP8 A;  5HXM A;  2ZHK A;  4HVQ A;  4YVW A;  2RS3 1;  4Q4V 1;  1ZRI A;  4EV0 A;  4AEJ A;  1KJL A;  2HWC 1;  3WP6 A;  1DGW A;  1KGY A;  1RUE 2;  2DFB A;  2GME A;  4FFF A;  2QQJ A;  4LMF A;  4P08 A;  4FQZ A;  3VZN A;  3ZYB A;  2WFF 1;  2VC9 A;  1N3O A;  1VBA 2;  2D44 A;  4BK4 A;  3ZXE A;  4O9G A;  5J98 B;  4BJ0 A;  1OD3 A;  4QX8 A;  1Q3E A;  1AXK A;  1FPN 1;  4QXC A;  4EZ4 A;  1WBF A;  2J1V A;  1OXC A;  2Z2S B;  1ZBA 3;  5A6Y A;  1YFW A;  2UYB A;  3QAC A;  4FOQ A;  1GQH A;  3AM2 A;  1RUC 3;  3WIN E;  3ROU A;  5JDB A;  1AR9 1;  2WS9 1;  2O8Q A;  1PMJ X;  1S0C A;  3FFZ A;  4CXX A;  4OI4 A;  2WJS A;  3S7I A;  2R07 3;  1UAI A;  4ZKT B;  4BZ4 A;  4N9I A;  3CJX A;  4F7Z A;  4Q4Y 3;  3VLB B;  5DZE A;  2E7Q A;  5CFD C;  3NJV A;  2JIC A;  4CDX B;  1H2L A;  1D0H A;  5CKM A;  3RQ0 A;  2D5F A;  1W9T A;  4QPY A;  1UZW A;  2WKK A;  4XUT A;  2WZP P;  3VDD A;  1B35 B;  5IVF A;  2W95 A;  4XFC A;  2E7A A;  1LU1 A;  2ZGQ A;  3KV5 A;  3NAP B;  4JDN A;  4MHR A;  4MH0 E;  4FPC A;  4LUL A;  3SC7 X;  4A6S A;  2VPV A;  5JMC A;  4YZ3 A;  2R06 3;  3RGB A;  1K5M A;  2B8M A;  3SNM A;  5JCT A;  3TBD A;  3ZLI A;  2CAU A;  1ZZC A;  2XLG A;  1JZ7 A;  3CIH A;  1NG0 A;  5CKQ A;  4LBM A;  5JIU A;  1KRI A;  2GSY A;  1S4C A;  4BIF A;  4NIG A;  4H55 A;  4RGK A;  2OX0 A;  4KG8 A;  4BQ1 A;  5I0R A;  4YZ4 A;  3AKP A;  2W92 A;  1Q56 A;  1SCR A;  4JDO A;  1UY4 A;  4ORF A;  1W6N B;  5DQ0 A;  1J59 A;  4JDM A;  1VBC 2;  4PJY A;  1V6K A;  1KXG A;  1RUI 2;  4KI5 M;  1TQ5 A;  3PVE A;  1JHJ A;  4FFI A;  4IW3 A;  4M3C B;  2YG0 A;  3I7D A;  1ASJ 2;  1AYM 2;  4OLL A;  1W0N A;  1OA3 A;  3RZK A;  2JEM A;  2XBO 2;  4LBK A;  1RED A;  4FPE A;  4R4X A;  2ZGT A;  2OYZ A;  3VDD C;  1JS9 A;  1UWW A;  3PJY A;  5LRR A;  4I0W B;  4MG2 A;  3OPW A;  3HVD A;  3AFK A;  5D8A A;  4OHZ A;  2UUR A;  2XR4 A;  3PVO A;  4Y3O A;  5FZK A;  1U5I A;  3WG3 A;  2W52 A;  1SCS A;  4XJ9 A;  2AEZ A;  3GBW A;  4KL1 A;  2WYF A;  1J3Q A;  5LB6 A;  3TEZ A;  1K5M C;  2GP3 A;  3POW A;  4Y26 A;  4Q4W 1;  3H8O A;  3FHI B;  3ZXG A;  1A34 A;  2J22 A;  1BEV 3;  1W6O A;  5FK8 A;  1H9P A;  3GYD A;  5GLV A;  4CUC A;  1R1Z A;  4AVA A;  5FWJ A;  3FMG A;  3CJI B;  4AED A;  1UL9 A;  1VPH A;  3MW4 A;  5EFU A;  3U0Z A;  1E57 A;  4AE2 A;  4XMI A;  3VHP A;  5FO8 B;  4BPZ A;  1AHS A;  4W65 A;  3R05 A;  3W59 A;  2F4P A;  3GBF A;  1BBT 2;  1QJY 1;  4RQP B;  3T4H B;  3TN9 2;  4RD7 A;  5DAW A;  1XXN A;  5KC6 A;  3JUU A;  4NRM A;  1AR7 1;  2KXL A;  3SXW A;  3CO2 A;  2XJV A;  3WP5 A;  2XOM A;  3D4K A;  5C3Q A;  3S7E A;  2JG9 A;  2P3J A;  2RDS A;  1SHW B;  2BVV A;  2WII B;  1VBE 3;  2ADE A;  2RJ2 A;  3IM0 A;  1CAW A;  4E2G A;  3ECQ A;  3URF A;  3ZR5 A;  4EN0 A;  3JD7 2;  3ZPO A;  5JZG A;  1UD1 A;  2ZXQ A;  4CDU A;  4D94 A;  2Z69 A;  1PO2 3;  3BPS A;  5FZL A;  2J1R A;  3BTX A;  3P5B A;  3I2O A;  1QGL A;  2W47 A;  3PUI A;  1RGS A;  2W5F A;  4JGZ A;  4R9A A;  1CZV A;  3KQ4 B;  2HBU A;  4B7K A;  5FXW A;  3DN7 A;  3WCS A;  2VTF A;  4AED C;  4D6S A;  3BU0 A;  1LOF A;  4MGS A;  3DXU A;  4XIO A;  3U37 A;  2P2K A;  4YM2 A;  4YVS C;  4QDR A;  3SEP A;  1OFN A;  5F39 A;  5I0D A;  1OD5 A;  1J58 A;  3U4S A;  5CIS A;  4UW3 A;  1VBB 2;  1RHI 1;  1UMI A;  2DVG A;  1NCQ B;  4BQ2 A;  1LGB A;  1NX9 A;  2ZHL A;  2Q8C A;  4Y5T A;  4LHN A;  1OVS A;  3OUJ A;  1CAX A;  1HJF A;  1OT5 A;  4TN7 A;  5GZC A;  5JOX A;  4FOY A;  2WZ8 A;  4B1M A;  1O4Z A;  2PHL A;  1I5P A;  1AR6 1;  3IAQ A;  4DY5 A;  1FMD 1;  1YHF A;  3AKS A;  4Y22 B;  5JZG C;  4CDU C;  1BJQ A;  2PFW A;  3I2I A;  4OYU A;  2RS5 3;  3WG4 A;  4EN7 B;  2P17 A;  2A73 B;  3ES1 A;  4CDX A;  1OI6 A;  5A3O A;  2R49 A;  3T2P A;  4QGL A;  3BCW A;  2RS1 1;  2B5H A;  2ZMK A;  3AFG A;  4JGZ C;  5FYC A;  3MIG A;  2P4E A;  5I8T A;  3O1R A;  4CSW A;  4KH9 A;  2GNM A;  3FL7 A;  3LIH A;  5E8A A;  3ZFF A;  4BQ3 A;  2OPW A;  1A8D A;  3WW2 A;  5BV6 A;  4FXG B;  1UZY A;  3DPR A;  4RHV 2;  4ZZ5 A;  1JYC A;  2J1T A;  5FZ4 A;  1XSR A;  2ZX3 A;  3IDC B;  2MHF A;  1GQG A;  5SV8 A;  4U2A A;  3ZX7 A;  3ZFG B;  2ET7 A;  3B02 A;  5C8C B;  2PHT A;  4XTM A;  4N9H A;  3GHN A;  2RJK A;  3O7O A;  4GB3 3;  3PHM A;  1UYX A;  4Z92 B;  2DCT A;  2WSU A;  2HWF 2;  1DF0 A;  1D4M 1;  1DBN A;  4QXH A;  2JG8 A;  4CDW A;  3VZK A;  1HRI 1;  4OQ9 A;  3ZYR A;  5KR7 A;  4LBQ B;  3MIB A;  1HB2 A;  2XL9 A;  5T5L A;  1SDD B;  3AK0 A;  2WQ8 A;  1JZ6 A;  3NNL A;  3FLT A;  2CHH A;  2PA7 A;  2D98 A;  1SPP A;  4P9L A;  2ZPX A;  1TEI A;  3WNO A;  4ASL A;  5A3T A;  1Y4W A;  2YBS A;  3DL3 A;  5BNQ A;  1YLL A;  3OY8 A;  5GLZ A;  1JZ4 A;  1UOJ A;  4XHB A;  1ND2 A;  4OUL A;  2WZE A;  4QPG B;  4CDX C;  1R1A 2;  4LA3 A;  3V0A B;  1PM7 A;  2QQV A;  2IFR A;  4QPI B;  4AGR A;  5A32 B;  1G9C A;  3VBH B;  4YSF A;  1G6N A;  4QX1 A;  2FZ2 A;  4GAL A;  4QM9 A;  2G1M A;  5JI9 A;  1XU1 A;  2RJL A;  3IWZ A;  3NKG A;  2WNV B;  4M01 A;  3ZFF C;  4AQT A;  4P9G A;  5C5T A;  4D8M A;  1ZBA 2;  3DPR C;  4FO9 A;  4ES8 A;  4BQ4 A;  1I1E A;  1RUC 2;  1UZZ A;  1YQC A;  1C28 A;  4L9B A;  2HYK A;  3L9J T;  3NJX A;  1DCS A;  2R07 2;  2NYY A;  4QKD A;  3LA2 A;  4IGP A;  3UKN A;  1IS5 A;  1MPX A;  3E5X A;  4XPV A;  4AW7 A;  4XF3 A;  4I2O A;  1FOD 1;  5IK4 A;  3VD5 A;  4QX0 A;  3OEA A;  4FBF A;  3ZMO A;  3LPF A;  2JG8 C;  3M3E A;  4CDW C;  2DF7 A;  3O1V A;  3J8F 1;  1RUO A;  4EE2 A;  4BIO A;  5FZG A;  1ZNP A;  1LOD A;  3HWJ A;  2VZR A;  4WZF A;  4PI0 A;  4NPM A;  2VQA A;  2QJV A;  3RNS A;  2DCJ A;  1FYU A;  3NJY A;  3ILF A;  4TLG A;  4WVM A;  3RI9 A;  3P1I A;  5E16 A;  4N53 A;  3ZR6 A;  2QBX A;  2R06 2;  3F2Z A;  2RM2 1;  1VAV A;  1ND2 C;  2EID A;  1J3P A;  4H7L A;  3VL9 A;  5A3U A;  5C3P A;  4LQR A;  4ATE A;  4OQ8 A;  1Y3T A;  3QH7 A;  3B3Q E;  2BP6 A;  2GND A;  2W3J A;  2BU9 A;  4DO0 A;  2CGO A;  1WCU A;  3GZT B;  4KQ7 A;  2XUE A;  2QQU A;  1GR3 A;  1DIW A;  2ZZJ A;  1NT0 A;  1QY4 A;  3KGL A;  4CE8 A;  1O6U A;  5F3I A;  1MZ5 A;  2EAL A;  2YBP A;  1UU6 A;  1W05 A;  2C6S A;  3CMG A;  4Q29 A;  1MEC 3;  5GZE A;  4AXO A;  2WN2 A;  2DVA A;  2ZMN A;  2BRT A;  3UJQ A;  2WL1 A;  3OGR A;  1W8O A;  5DZG A;  4E4D X;  1XYO A;  2WA4 A;  3FHA A;  1RMU 1;  1G8W A;  1O5L A;  3K4A A;  2UY9 A;  3VBO A;  4UFL A;  4CCE A;  4YFW A;  1VB4 A;  3CL1 A;  5DG1 A;  2ZML A;  2BOJ A;  3PUS A;  4LUK A;  1NCQ A;  3UK9 A;  1AR8 1;  4W4Z A;  2BNM A;  1Q8V A;  2B39 A;  3I3M A;  4N53 C;  2GC1 A;  3ZSK A;  4PDW A;  2E53 A;  2OW4 A;  1S0D A;  3I4I A;  2C4X A;  3ES4 A;  2CV6 A;  3ZKY A;  3THP A;  4A3Z A;  5A1L A;  5BNP B;  4UYB A;  3M4F A;  3JB8 A;  1BEV 2;  2IVJ A;  2WZR 3;  1GWL A;  2Y34 A;  4JQT A;  5FYV A;  1CVN A;  2YB7 A;  1NXD 1;  2RR1 1;  3IDE A;  3N7K A;  1S2B A;  4Q5O A;  1R09 1;  2WUH A;  3ZXJ A;  4DRR A;  1CES A;  1C8M 3;  1MS1 A;  1R64 A;  1RUH 3;  3TOJ A;  4DIN B;  2A7A A;  1YEW A;  2EA7 A;  2ZEZ A;  3BGA A;  2BGP A;  3WG2 A;  5KC5 A;  2ARB A;  2Q1Z B;  1DQ6 A;  4MGT A;  5IVB A;  1ULE A;  2GP5 A;  4RR3 A;  3BTZ A;  2VMD A;  4GMP 0;  4GMP 3;  4IET A;  1HRV 3;  3RYK A;  2L9L A;  3M3C A;  1GZT A;  1TMF 1;  3BPZ A;  1SLB A;  1QDO A;  4KGQ A;  3OCP A;  4JRA A;  5DAV A;  5FQ0 B;  1VBE 2;  2GZW A;  4IL7 A;  4IV1 A;  2IXI A;  2BW8 A;  4AI1 A;  4N7U A;  3UL2 A;  3VBO C;  2WLQ A;  1O91 A;  5C6C A;  1SBD A;  2YPJ A;  4K8R B;  5EWS A;  1VMH A;  1RUD 3;  4LO4 B;  5ERL A;  4BXS V;  4D7Y A;  1F4A A;  1QQP 3;  3RSJ A;  2JD4 A;  3WW4 A;  5FYB A;  3R4D B;  1OH3 A;  4PDW C;  1EUU A;  3BTY A;  3A0N A;  4L0P A;  1UU4 A;  5J3U A;  1NYW A;  5FP7 A;  2XJS A;  1RVF 3;  2FDK A;  2WO2 A;  5D1I A;  2VUD A;  5L9R A;  4CU7 A;  1DZR A;  1I6X A;  2QQW A;  4FVV A;  5BXX A;  3UGF A;  4XBN A;  4XOG A;  2PMW B;  3VUO A;  4QPG A;  1SMV A;  3I59 B;  2ES3 A;  3C7E A;  4Z82 A;  1DQ5 A;  5ANQ A;  4RR3 C;  5A32 A;  4CZS A;  3LEG A;  2J42 A;  1HN1 A;  4R9C A;  1V00 A;  2D6K A;  3WNX A;  5FZH A;  1QF3 A;  2J1E A;  3F95 A;  3FBY A;  4IV1 C;  3J7M A;  3BOW A;  2LS6 A;  3GXU A;  2WT0 A;  5JPN B;  2JD9 A;  2ZGP A;  2PTM A;  2RMU 3;  4ZHN A;  3S5A A;  3MV1 1;  4XAE A;  1X82 A;  3WQ7 A;  4UAP A;  2ZKN A;  1YNA A;  4DIQ A;  3NWK A;  2H6B A;  1YFU A;  3MPB A;  5K9Y A;  2QDN A;  3C7O A;  2VQU A;  1QWR A;  1QJU 2;  4MO3 M;  2PLV 3;  2OXB A;  4AZZ A;  2VNR A;  5DMY A;  5EJ1 B;  4D3W A;  5KBF A;  3P3N A;  3DYO A;  1ZX5 A;  4ZS2 A;  5CKN A;  3POF A;  4NAO A;  2ZBJ A;  2YXS A;  1SBF A;  3J4U H;  3NNJ A;  4XYX A;  5E89 A;  2WDB A;  2DCK A;  2VMF A;  1EP0 A;  4QHZ A;  2RS3 3;  4BQX A;  4BQW A;  4DXS A;  1YQ6 A;  2D6P A;  4AGG A;  1NOV A;  3SCG A;  1E5H A;  1XQN A;  2WFF 3;  4GB3 2;  4NHY A;  5C33 A;  5FMD A;  4YAR A;  5HV4 A;  5FYH A;  2HWD 2;  3H3U A;  1FPN 3;  2HH9 A;  4GKY A;  4XJU A;  2LW8 A;  2GN3 A;  3WUD A;  3T0D A;  1V9U 2;  4NOT A;  1XYN A;  2WAB A;  2MEV 1;  3VKM A;  3ZPY A;  1BVV A;  3WF4 A;  1LGN A;  3LFI A;  5FZB A;  3VBF C;  1AR9 3;  3WW3 A;  2WS9 3;  3WNN A;  1GZW A;  4NWV A;  4XF0 A;  2WO7 A;  4YPJ A;  3USU B;  3H8R A;  2KM2 A;  2IXK A;  1CJD A;  1WKY A;  4ISR A;  4J1X A;  1W8U A;  1IG0 A;  4I09 A;  3S30 A;  3V65 A;  1TNR A;  3U78 A;  1AJK A;  1J84 A;  1N1Y A;  5GZD A;  4CP1 A;  1SAC A;  3T1M A;  1VRH 1;  5I0T A;  2PHW A;  3Q8C A;  5GLU A;  2EXK A;  4KNC A;  5CAZ A;  5KWR A;  5CFD B;  1PMI A;  4E2S A;  1YWK A;  1UZ0 A;  2WAO A;  3FHQ A;  5IAV A;  5JIA A;  4YZ5 A;  4DXT A;  5F3C A;  5EP9 A;  1XRU A;  3E5U A;  5DAX A;  4A7Y A;  1PM4 A;  3ZSM A;  3ZXA C;  2WNU A;  1TVG A;  1X9T A;  2AAC A;  1C3H A;  1PVX A;  1B09 A;  1C4R A;  4S2G A;  2DU0 A;  1AXY A;  2XML A;  4QU2 A;  3IBM A;  4XVH A;  1GP4 A;  2VBP A;  4MV2 A;  5DN2 A;  5F5C A;  3N36 A;  3O0V A;  1WBL A;  5FPL A;  3BKZ A;  4NUB A;  3LE0 A;  4MLO A;  2GAU A;  1UOF A;  2W08 A;  3CEW A;  4TYS A;  4YYO A;  1AX0 A;  2VMG A;  3BVC A;  3N9Q A;  4AR2 A;  2AGS A;  3RRD A;  4JKL A;  1ZRC A;  2V4A A;  3T0A A;  3ABZ A;  3C8X A;  4LK7 A;  3UT0 A;  1KJR A;  4NID A;  5GM0 A;  4FXK B;  3U07 A;  1O8P A;  2JWP A;  4BH9 A;  4Z8B A;  2WLP A;  2BDR A;  2A3Y A;  1LR5 A;  2WFP A;  4FPF A;  4RL7 A;  2O0O A;  3AZX A;  5FY1 A;  3RMY A;  1SFN A;  1L7Q A;  1GAN A;  3I54 A;  1W28 A;  5HCF A;  3KF5 A;  4N43 C;  1GOF A;  3C7H A;  3UNP A;  3EB7 A;  1JHN A;  1GLH A;  3NKT A;  3JQX A;  4W8J A;  4UXA A;  1ULC A;  1I3H A;  4LHK A;  4CXY A;  4XF1 A;  4FFH A;  3H8U A;  3UV9 A;  4QB1 A;  2WQZ C;  5FMO S;  3VDD B;  3RI8 A;  1PK6 A;  3POI A;  3PMS A;  4Q4W 3;  2WNU C;  5L73 A;  2XH6 A;  1M4W A;  3Q8F A;  5LWB A;  1O3T A;  1JUH A;  2HWB 1;  3GNE A;  4WM8 C;  1K5M B;  1JZ3 A;  2W91 A;  5DDJ 3;  5T54 A;  3ETQ A;  1CON A;  4CUG A;  5ACA 1;  3PLQ A;  3KF3 A;  5T5O A;  1QJY 3;  3ZXL A;  4HVR A;  1YJL A;  4DUV A;  2BJS A;  2OZJ A;  2VMI A;  1SEF A;  4HSJ A;  1AR7 3;  1PGW 2;  4KBZ A;  4QB2 A;  2Q1M A;  4FT8 A;  3WQB A;  3IDA A;  5F32 A;  1IQD C;  3MI8 A;  1UCX A;  4QDQ A;  4UF0 B;  1UXX X;  2WZR 2;  5BY5 A;  2CU5 A;  5IAT A;  4QGN A;  3RZM A;  5A1A A;  1GWM A;  2YYO A;  1XU2 A;  1VJ2 A;  1WLD A;  4BOW A;  4DB5 A;  1D2S A;  1FV3 A;  1C8M 2;  1N1V A;  1RUH 2;  1BKZ A;  4XZP A;  5F1R A;  4YFZ A;  1Q8Q A;  4AHX A;  2A6X A;  1RXF A;  2OQ7 A;  3FUQ A;  3PVB B;  4LIT A;  3H1W A;  3HAG A;  1U5Z A;  4LOR A;  1PX4 A;  4EJR A;  2VE1 A;  2HEV F;  1HRV 2;  1KDM A;  5FWE A;  1PK6 C;  5FUP A;  2JDM A;  2A71 A;  1HB4 A;  1DP0 A;  2IZW A;  3ZYH A;  1ZA4 A;  2MNG A;  3ZXK A;  4LHS A;  1GOH A;  3MF9 A;  4E4S A;  1DYP A;  4DFS A;  2NMO A;  5KXB A;  4ZU7 A;  4FPH A;  2XL7 A;  3WV6 A;  2DYC A;  2EF6 A;  1ULF A;  2BYV E;  2W87 A;  2XGX A;  3EXU A;  1MVQ A;  5FY4 A;  1W6O B;  1RUD 2;  1SLA A;  3U14 A;  4CTE A;  5IW0 A;  1QQP 2;  2X09 A;  4PIX A;  1XE8 A;  4AAP A;  4AED B;  4DXR A;  4GAZ A;  2FDI A;  4YVS B;  4NRP A;  1JXN A;  4NHK A;  2D6M A;  1Z7S 1;  2WWU A;  3ZN6 B;  4NN0 A;  2XON A;  1O3R A;  4YWA A;  4Z07 A;  1RVF 2;  4PLM A;  4DUW A;  2RVA A;  1HXS 2;  5FCC A;  2PHR A;  4B3N A;  3AMN A;  1CAV A;  1AR6 3;  3HT1 A;  1DYK A;  3DKQ A;  1EPZ A;  1FMD 3;  1UQX A;  2VZU A;  2IWG B;  4PI2 A;  3USU A;  3H3L A;  1NAE A;  3HBZ A;  3BN6 A;  5IK8 A;  2MPF A;  3PTY A;  1CAW B;  2SBA A;  2GH2 A;  4HVO A;  1VBD 3;  1RTV A;  4LBQ D;  3SMH A;  5A6Z A;  4I02 A;  4L99 A;  5DAP A;  5LBF A;  1GNZ A;  5JZG B;  3ACH A;  2NP0 A;  4CDU B;  4MGZ E;  1RB8 G;  1HN0 A;  1W2O A;  2QQP A;  3MEP A;  3CZU A;  4XDP A;  5L19 A;  3NJZ A;  4BQ5 A;  2E7T A;  5KHG A;  2GC3 A;  2Y60 A;  1MS8 A;  5LA9 A;  4AOC A;  2ADD A;  5A7W A;  2RMU 2;  3CF6 E;  3TAY A;  1FAT A;  5JSR A;  2JE7 A;  5FPZ A;  5BNO B;  4GQ7 A;  2W68 A;  2FCV A;  4XIK A;  5A3M A;  1WA4 A;  4DPN A;  1K3I A;  2VUJ A;  2A6W A;  3HJR A;  2ZGU A;  4LKF A;  5FY7 A;  1D4M 3;  1IPS A;  1X33 A;  2PLV 2;  4Y4Y A;  3W58 A;  1HRI 3;  4O65 A;  2HWE 2;  4QGM A;  2X05 A;  1DU3 D;  3VDB A;  1OHF A;  4AFC A;  1BXH A;  2XLF A;  2BEO A;  2XJR A;  4AGV A;  4C1X A;  4M4R A;  5FTT C;  3SKV A;  2D3S A;  2VZT A;  3NV3 A;  1CAX B;  1ZZ9 A;  2RS3 2;  1AL2 1;  2V5Y A;  3MDP A;  3MFA A;  5A7Q A;  2XB6 C;  5FZC A;  2PAM A;  1LHU A;  4LXL A;  4G3Y C;  1C5H A;  2X10 A;  2WFF 2;  3I3E A;  3KT7 A;  1EYB A;  2BQP A;  2UYA A;  1TME 3;  1DQ0 A;  4HKL A;  2AEN A;  4CP2 A;  2TUN A;  2YUE A;  4N7I A;  2C26 A;  2VZV A;  4CXW A;  1FPN 2;  1LEM A;  1W90 A;  5FMO L;  2BPA 2;  3WG1 A;  2BFU S;  3D3A A;  3VBR C;  4BE3 A;  5LK7 B;  1ZRE A;  3BIE A;  3AMP A;  1HKD A;  1MZ6 A;  3N9M A;  1TNF A;  3SH5 A;  5K7P A;  2FCT A;  4IND A;  1AR9 2;  5C9A A;  2FHR A;  1MZE A;  4OZX A;  3ZFF B;  5FZA A;  1CAU A;  3DPR B;  1PZ8 A;  1ZBE 1;  2YZ4 A;  3GCX A;  5T52 A;  2VO5 A;  4ZXK A;  1F35 A;  3IPV A;  5A7N A;  3OBZ A;  3PME A;  1JOD A;  2ARA A;  4F3J A;  5BYN A;  1UN1 A;  2E32 A;  2R04 1;  2AUY A;  2X5I A;  4JHT A;  4R8H A;  5E1R A;  5EYY A;  3CQO A;  1E5I A;  3J26 N;  4LNV A;  4F8A A;  4BXF A;  3KVB A;  5HPO A;  1UX6 A;  2JG8 B;  3LKJ A;  3RJR A;  4CDW B;  3AL5 A;  1WCS A;  4QQL A;  4UF0 A;  4ZY9 A;  3IB3 A;  2RM2 3;  2BOI A;  2BUK A;  1ULG A;  2JDU A;  2XQX A;  1UXZ A;  4ZON A;  4IES A;  4NPL A;  3EJK A;  5C7G A;  1YO8 A;  5EXO A;  4M0N A;  2Y6K A;  4HOO A;  4OI1 A;  3OBR A;  5ISL A;  3JQW A;  1SPP B;  2VVD A;  2VVE A;  4YM0 A;  5CZK A;  3B9C A;  3OYW A;  4CPB D;  3OY8 B;  1E5R A;  1ND2 B;  1KIT A;  1RXG A;  2JDK A;  1CPN A;  5A33 A;  4BHP A;  1COV 1;  4IE7 A;  1JYN A;  1OQE A;  5EZW A;  3ZSE A;  4LIV A;  4BA6 A;  4P9W A;  1AYM 1;  4B8E A;  1ULO A;  5A70 A;  1W04 A;  4QHB A;  5C9A C;  4GUL A;  4I0A A;  2ZZQ A;  2YC0 A;  4Q1P A;  3NO8 A;  5LBB A;  4FPL A;  4HG6 B;  5LRS A;  4DEV A;  2ZEY A;  3HQU A;  4URT A;  4GJY A;  3KVA A;  5FZM A;  3B00 A;  1O59 A;  3UES A;  4QQP A;  5CNA A;  4A6O A;  2OT7 A;  3SCH A;  2BVB A;  3Q9O A;  4SLI A;  2B9U A;  5APA A;  1JYX A;  1RMU 3;  3VL8 A;  3W21 A;  3I2K A;  1YIP A;  2P37 A;  4AG4 A;  3WEZ A;  4CEW A;  3ME2 A;  1AYN 1;  4MXV A;  2R6Q A;  5EJZ B;  3RZH A;  2X5I C;  1WD3 A;  1LHV A;  4CU8 A;  3GHM A;  4YVS A;  3VHO A;  4CUA A;  3ZN6 A;  1S0I A;  4QQO A;  1P8J A;  2OA2 A;  4QXB A;  2BWC A;  1H6Y A;  4Q4W 2;  1W2T A;  4DY3 A;  5F2S A;  4Q26 A;  1WZX A;  5H9R A;  5AVA A;  2PHF A;  5IYY A;  3HQR A;  3WDW A;  2DUP A;  5HXV A;  4WVM B;  1BBT 1;  4IE6 A;  3B5L B;  4XFB A;  2RR1 3;  4J1W A;  4N53 B;  5A3N A;  4SBV A;  2O8O A;  1XC6 A;  2PQQ A;  2Y0O A;  5DDJ 2;  1LCL A;  3VZJ A;  1G9F A;  5FYI A;  2JEC A;  2DTW A;  3SQO A;  3AP7 A;  3LA7 A;  1AR7 2;  1RIN A;  3EO6 A;  4AEM A;  2LRP A;  1OFS A;  1TZO A;  1TMF 3;  1GUI A;  4BWO A;  1EUT A;  2WO1 A;  4XF9 A;  1OSG A;  1W3V A;  3PNA A;  5A3W A;  4AHW A;  1NKG A;  3DV8 A;  1YI7 A;  4P02 B;  3B9I A;  2R30 A;  5B4X A;  3R6S A;  2AEY A;  2B46 X;  1GNY A;  1ZM1 A;  3ACL A;  2JDP A;  2VCC A;  3O0W A;  3WLU A;  4CEW C;  4RFR B;  3A0K A;  1JI6 A;  5EIY B;  1IKQ A;  1EAH 1;  2GMP A;  4FAG A;  4CEY C;  1US2 A;  1Z0H A;  2GC2 A;  4LR4 A;  4COW A;  4GZ9 A;  3VBO B;  5BNN C;  1W6M B;  1W8N A;  1OOP A;  2LRO A;  4YGD A;  4D6R A;  4S2F A;  1DZQ A;  4AEK A;  1IPJ A;  3WF1 A;  4IEP A;  1W0P A;  2ARC A;  3KGZ A;  4UW5 A;  4S2D A;  3I2J A;  4AQS A;  1W3X A;  4PDW B;  1RJ8 A;  3I2D A;  4KWJ A;  3JBG 1;  3N4M A;  4K21 A;  5J96 B;  4AYU A;  1OQD A;  3APB A;  4A2U A;  3M2M A;  4P5Y A;  3AMH A;  2B45 X;  2UY8 A;  1VAM A;  4NMI A;  4AQ2 A;  4KGG A;  3SIS A;  2BZD A;  1H2K A;  1OA4 A;  1UU5 A;  5AVP A;  1BMV 1;  5FZI A;  1SG3 A;  5AC9 2;  3ENR A;  3KWV A;  1QXJ A;  4NAM A;  5FZ9 A;  4QQH A;  3WDU A;  1JMU B;  2CWM A;  3ZVX A;  1V6L A;  2VD7 A;  2DBI A;  2JDA A;  3KCC A;  5FYU A;  4RR3 B;  4WZC A;  4FTE A;  2YPD A;  2V09 A;  3LDR A;  5LA1 A;  3VKF C;  1WMX A;  1AR6 2;  3AJZ A;  1IOA A;  2G9F A;  3W5M A;  2ZX0 A;  1FMD 2;  1W0O A;  3OGJ A;  2Q8E A;  1F31 A;  3AVR A;  3EMR A;  3KD4 A;  1RUF 1;  3Q8A A;  4V2V A;  3VHN A;  5JOZ A;  1J3R A;  4XZU G;  5JXG A;  1SLL A;  4IV1 B;  4KWK A;  2ZGN A;  5CAD A;  1VBD 2;  4NVP A;  1OOP C;  3LFM A;  4NRO A;  4Y1V A;  5F5A A;  4RHV 1;  4O7X A;  5LA0 A;  1ST8 A;  5D21 A;  2QZ3 A;  4UFJ A;  4FPG A;  1OLQ A;  3HNM A;  4A3X A;  5CFC A;  3FZ3 A;  2EIG A;  2WQ4 A;  1LOA A;  1UY0 A;  1XBF A;  4FQ4 A;  4AHY A;  2WRA A;  4QXK A;  1SBE A;  2A3X A;  4L97 A;  4YM1 A;  5IVV A;  4AVT A;  4PQ9 A;  4LO6 B;  1F5J A;  1UW8 A;  2BTV C;  2QCS B;  4M3C F;  1EV1 2;  5J7M A;  4CCC A;  4XUN A;  3W9A A;  3HNB M;  1N1S A;  3A4U A;  1D4M 2;  1HRI 2;  4YW6 A;  5F6L B;  2P5B A;  4PBO A;  4Z1V A;  1QH6 A;  4AFB A;  3H8X A;  5IWF A;  3C2U A;  2RE9 A;  1S0J A;  4QWN A;  1WMF A;  2MEV 3;  1R1A 1;  2XLA A;  2JKB A;  1DQ2 A;  2JDZ A;  1BK1 A;  3ZSL A;  5EJ3 A;  2DVF A;  4IEQ A;  1QNY A;  3FX3 A;  4D0Q A;  2F17 A;  5ABJ A;  3RZG A;  3NVC A;  1LB2 A;  3WR0 A;  1PIV 3;  4YM3 A;  1ULP A;  4NHM A;  1NCR C;  1UOB A;  1ZBA 1;  3K3O A;  3VBF B;  1TME 2;  5DUX A;  1W2N A;  1AL0 G;  4LOT A;  3HR9 A;  4Q4Y 2;  5FXX A;  1UKR A;  5HBA A;  1OUX A;  5CFC C;  2R07 1;  1LOE A;  1A3K A;  4JV4 A;  1H4G A;  1OC1 A;  2VH9 A;  4AI8 A;  3MIH A;  4Q4X 1;  5T50 A;  1S2E A;  1XYP A;  4YZ1 A;  1GIC A;  5I0S A;  5L7O C;  2ZX4 A;  2VR4 A;  3AYA A;  5EHD A;  2JJ6 A;  3ORJ A;  4CP9 A;  5FPX A;  1RIT A;  2WN3 A;  4O61 A;  1DQ4 A;  1AF9 A;  1LUL A;  3AP9 A;  4BLI A;  3O0X A;  4RGA A;  1IGO A;  4GWM A;  2HJI A;  4UFK A;  5T3N A;  4YW2 A;  4P9I A;  1JTZ X;  3ILR A;  4UFH A;  3M8L A;  1GP6 A;  4DUX A;  1NA1 C;  2QQO A;  4AVS A;  3VN4 A;  1A78 A;  2RDQ A;  3VGI A;  1LOG A;  2VGD A;  1IG3 A;  2E63 A;  3I3D A;  2K0G A;  4W6W A;  1Y7B A;  5C71 A;  1ONA A;  1G9B A;  3H7Y A;  3S0M A;  3IMM A;  1VB2 A;  4XDO A;  1YRZ A;  2VQ0 A;  1PNF A;  2ZTN A;  2RM2 2;  5FJH A;  5ABJ C;  5E88 A;  2VJX A;  2A75 A;  3TYJ A;  1OQ1 A;  1R08 1;  1SZB A;  3JZV A;  5JXI A;  3ZYF A;  1BHG A;  1GZW B;  3GM8 A;  4KWL A;  3RDI A;  1KS4 A;  3ZFE C;  2WC2 A;  2PQS A;  1LHW A;  3R4U A;  1V70 A;  1UMZ A;  1ZVF A;  4NHX A;  3LA3 A;  2XVL A;  2ZEW A;  1W6M A;  3BOD A;  3ZYI B;  4CCK A;  4YZ2 A;  5HCA A;  3CLP A;  2CSG A;  2QQL A;  4GIQ A;  4N43 B;  2Z4F A;  3HPN A;  3O1P A;  1Y9G A;  4AVC A;  5IFP A;  3ZOI A;  4U36 A;  1S0F A;  3BTA A;  3VDA A;  1PGL 1;  2CWS A;  2YV8 A;  3JB4 C;  3JXS A;  4KG0 A;  4HK8 A;  4AI0 A;  4ASM B;  1MVE A;  1AUY A;  1RMU 2;  3QBQ A;  1GP5 A;  4B4P A;  1IS3 A;  2WNU B;  4IEO A;  5ACA 3;  3T1L A;  2JX9 A;  1NXM A;  3WQ1 A;  5FKC A;  2ORX A;  5LCW L;  1YYN A;  4P00 B;  4FTS A;  1G7Y A;  4WM8 B;  5LBE A;  5C4W A;  4BU2 A;  4X8P A;  5FFO C;  1WD4 A;  2FDJ A;  3AZV A;  4QB6 A;  5IFT A;  2CY6 A;  3AP5 A;  3N9N A;  5AFE A;  2ZX1 A;  3TNP B;  1UY1 A;  3TEY A;  2IC1 A;  1SLI A;  1MQT A;  5JWP A;  2WNE A;  2RR1 2;  3LAG A;  4W50 A;  1W8H A;  1GOG A;  1WW5 A;  5IK5 A;  2ZAA A;  5T55 A;  1WLT A;  3OF1 A;  5FRA A;  4YGC A;  1ZZ6 A;  3USS A;  3L2H A;  2ZGR A;  2ZGK A;  1ND3 A;  2CAV A;  1UX7 A;  3AYD A;  3KV9 A;  2DUR A;  1PO2 2;  4XXP A;  4GWI A;  1LOC A;  1TMF 2;  1UNB A;  2P6C A;  3FUO A;  3VBU C;  3U4X A;  1J1L A;  3MZH A;  1JU4 A;  1PVC 1;  1WGP A;  4PF1 A;  3WNL A;  4E4Z A;  3AMQ A;  2VUL A;  4HKO A;  2J7M A;  1FT9 A;  2W46 A;  1PK6 B;  3DYP A;  4E8C A;  3C7F A;  1U5X A;  2V73 A;  4NRQ A;  1YI9 A;  3N7J A;  5CA6 A;  5IK7 A;  3WNM A;  3TEX A;  1U5Y A;  4XUP A;  1G86 A;  3CNA A;  3FC0 A;  3RWK X;  3AXD A;  3WY6 A;  5JR2 A;  1RUJ 1;  5C4W C;  1QEX A;  2I74 A;  3GJB A;  1ZZB A;  5A6X A;  1WCD J;  5FP9 A;  5TSW A;  2K9Z A;  3JCI A;  3NW4 A;  1W6Q A;  3NNF A;  4E9K A;  4YW5 A;  3T30 A;  1MQT C;  1H8V A;  2OQ6 A;  2TBV A;  2PN5 A;  3H9A A;  4GKX A;  4CCN A;  4JC1 A;  4QKB A;  3MO4 A;  4LHL A;  4LLF A;  4ONU A;  4GXL A;  5FKB A;  1UZV A;  2ZA9 A;  4AVV A;  5JOY A;  4NPR A;  3PL0 A;  2DTY A;  4ZXE A;  4TZD A;  1IS6 A;  1ND3 C;  5E6H A;  3I2H A;  3VBF A;  2OZ6 A;  1LHO A;  3LWC A;  4PIZ A;  2VCA A;  2RS5 2;  2FMY A;  4A7Z A;  5IVE A;  4JCK A;  1O8S A;  5L36 A;  4OFG A;  2QDR A;  2NMN A;  1XE7 A;  3T2O A;  4OVE A;  3WNK A;  4URA A;  1F5F A;  4Z2A A;  5GZG A;  4QM8 A;  1DZT A;  1YJK A;  1GFF 2;  2QQK A;  4UW6 A;  2D43 A;  3RZZ A;  2D6N A;  2FDF A;  4HN1 A;  4IE4 A;  3OGG A;  1LHN A;  1NZC A;  4QX7 A;  3KV6 A;  3H7J A;  5J36 A;  1QJU 1;  3OPT A;  4PBP A;  2OPK A;  4ZS3 A;  4TTG A;  4L11 A;  1WW6 A;  3VD3 A;  4Q4V 3;  1X9P A;  1UIK A;  4EZH A;  1NY7 1;  2HWC 3;  2BWA A;  4N90 A;  3T4V A;  1UMH A;  2OUH A;  5A3L A;  5FZ0 A;  1RUG 1;  1CZS A;  1F2N A;  3MLJ A;  4AI3 A;  2XHK A;  2XG3 A;  5FLJ A;  1A8M A;  5JAX A;  2DCY A;  1PO1 1;  3HD8 B;  2RHP A;  2GH8 A;  3POS A;  1HQN A;  1AL2 3;  5G04 L;  5C5U A;  2HWD 1;  1CAV B;  3QH6 A;  1YCI A;  2W1W A;  5IVJ A;  2R0H A;  2G9G A;  4QU1 A;  4V1P A;  1JZ2 A;  3D6E A;  5GJ6 A;  1PZ9 A;  1V9U 1;  3DKW A;  3H3Z A;  2W39 A;  3AKT A;  1XSQ A;  2Y0I A;  5J09 A;  1KFX L;  4HAN A;  4HZF A;  2VXR A;  3ZSJ A;  3AZY A;  1LES A;  1T6G C;  4COZ A;  1PMH X;  2EXJ A;  3ACG A;  4PLO A;  4YW3 A;  1W8F A;  1S1A A;  2P6H A;  2UU8 A;  5F3G A;  2VZS A;  1HB3 A;  4N43 A;  1XOY A;  2WT1 A;  4RS5 C;  4V2W A;  4JGY C;  3PTR B;  3MUZ 1;  1X8M A;  1NLR A;  5LK5 A;  3VBR B;  4Y5Z 0;  3RWN A;  3WP3 A;  1PIV 2;  1ZBE 3;  2Q30 A;  2VXJ A;  2DCZ A;  2XWB B;  1ZYB A;  5A7W B;  1JH5 A;  3WSO A;  1XNC A;  4MXW A;  4Q0Q A;  5L9V A;  4XQD A;  5ANN A;  4D6Q A;  2ZS6 B;  3PU8 A;  1Z78 A;  3JU9 A;  4XQ4 A;  4JQR A;  2WR9 A;  2ARE A;  3MLL A;  4R52 A;  3I49 A;  4NIH A;  3LIG A;  4ARY A;  2H6C A;  1S0G A;  1F9K A;  2EAK A;  5JXH A;  2R04 3;  4NII A;  4CDQ A;  4WM8 A;  5CBL A;  2J1S A;  4GA9 A;  4X6Q B;  2JB8 A;  4IEY A;  1EPW A;  5F3E A;  3OSD A;  4UFM A;  2DUQ A;  4TSV A;  1QDC A;  3B69 A;  1APN A;  1AXZ A;  3O1S A;  2XDV A;  3OG2 A;  5J37 A;  3OB8 A;  2EIE A;  4KU8 A;  4PIY A;  5IT6 A;  4XTP A;  3MV0 1;  5HCH A;  1MS4 A;  2KD7 A;  2CGN A;  3POB A;  1COV 3;  1GYK A;  2C9K A;  3VD7 A;  2Z5W A;  3ZYJ B;  3AKR A;  3WP4 A;  3IZO A;  1AYM 3;  3KT4 A;  2LM3 A;  3GBG A;  4RYD A;  5LA2 A;  1JZ8 A;  3WNP A;  2V4V A;  3KB5 A;  2VNO A;  2V5D A;  5JLV A;  1SQ4 A;  2VU9 A;  1MEC 2;  2KA3 A;  5EPA A;  1HB1 A;  3DXT A;  3KV4 A;  3GZA A;  4JZR A;  4WM7 A;  5C9A B;  5I93 A;  4RSU A;  4UW4 A;  4DRV A;  1FI2 A;  2JXA A;  5IHR A;  5JXJ A;  2Z42 A;  1AYN 3;  2G9Z A;  1CAU B;  2PAE A;  4RFT 0;  4XF4 A;  1V6M A;  2YMZ A;  3G6J B;  4IGQ A;  4GWN A;  4QAW A;  4CDQ C;  2D97 A;  1ZZ8 A;  1JW6 A;  2QQI A;  2AC1 A;  2XKO A;  3IPV B;  4R4Z A;  5FXV A;  2UWB A;  1UYP A;  2B42 B;  1QJX 1;  1D7P M;  4D7S A;  2EVX A;  5B4N A;  1GZC A;  3O1T A;  1JOJ A;  4L8Q A;  2Y6L A;  1N47 A;  3H1M A;  2X5I B;  2QFE A;  5FLI A;  3J7H A;  3MHZ A;  2VY0 A;  4QQ2 A;  1BBT 3;  3OUI A;  5H9P A;  3A22 A;  4LKE A;  2EIC A;  2VTX A;  2VL4 A;  1QIQ A;  4PLN A;  4EN8 B;  3M70 A;  2TEP A;  4R9D A;  1VP6 A;  2QE3 A;  2VW2 A;  1DLL A;  3MIC A;  3A7Q A;  3THC A;  4A7K A;  5KXD A;  2BNO A;  4HPK B;  3THD A;  4Y20 A;  4FPY A;  2WZR 1;  3S6P A;  1FX5 A;  2XVK A;  5IVC A;  1OPO A;  3OYW B;  4G9S B;  5T5J A;  3C3V A;  2I2S A;  1H8T A;  5A33 B;  4AL9 A;  2DDU A;  1GZ9 A;  3NV2 A;  1WA6 X;  3SEE A;  1PHM A;  4OUS A;  3K46 A;  2YC4 A;  4Q0V A;  1OBN A;  4LPL A;  1QU0 A;  5FYY A;  3D82 A;  1NQD A;  5I0U A;  4WM7 C;  1IPK A;  1KDK A;  1QOO A;  4GH4 C;  1K42 A;  2DVB A;  3BOP A;  2Q1F A;  4ITC A;  4LE3 A;  5KXC A;  1LEC A;  4GMP 1;  4IV3 A;  3OUH A;  4Y1U A;  4UOJ A;  1LGC A;  1UF2 C;  1XNA A;  4HXC A;  2FDH A;  3LEI A;  1EAH 3;  4COY A;  2VOK A;  3NNG A;  2GNT A;  4H2A A;  4EWE A;  1W06 A;  2Y38 A;  2ZJC A;  5F5Q A;  4KBB A;  2VZ1 A;  4CEW B;  4HN0 A;  5GLW A;  1JYW A;  1RHI 3;  3N9L A;  4OMD A;  3SH4 A;  1NE6 A;  4IEW A;  3K4D A;  4CEY B;  5A7S A;  4FP3 A;  4BIS A;  5BNN B;  5LBC A;  3PIG A;  1S0B A;  3HQX A;  3JBG 3;  2BER A;  4PQQ A;  1ENX A;  1LKN A;  3OGS A;  4DOU A;  1LU2 A;  5FK7 A;  3KSC A;  4XJ8 A;  1CJP A;  2PHX A;  4BYY A;  2R32 A;  3M3I A;  3D5O A;  3OTF A;  1QHD A;  2LUW A;  1H4H A;  1HXS 1;  3HT2 A;  1H8T C;  4ZU4 A;  3LEK A;  1FXZ A;  2WO3 A;  5FAX A;  1L7L A;  3I3B A;  3UKT A;  1AVB A;  2W9X A;  2P1B A;  3WF3 A;  3MID A;  2J1U A;  2RS1 3;  4Y4R A;  1GNH A;  1JZ5 A;  1URX A;  3I97 A;  1PZ7 A;  1OKQ A;  3N35 A;  4IV3 C;  2D6L X;  1AX2 A;  3LGR A;  3I8T A;  3GGL A;  3VBR A;  2BGO A;  1RUF 3;  1MR5 A;  1H1I A;  1XNT A;  2JEN A;  1S0E A;  4QX3 A;  1QOT A;  2DU1 A;  2RV9 A;  3FE5 A;  1QXP A;  3M7A A;  1O7F A;  3KS7 A;  5LAT A;  5FBZ A;  3NST A;  4K1Y A;  5EQU A;  3GZU C;  4Y24 A;  4I3G A;  1JUI A;  3LB9 A;  4FP2 A;  1OLM A;  3VKN A;  3WZ1 A;  4NO4 A;  3N7L A;  1VIW B;  1LAJ A;  3KQR A;  1OOP B;  2EXH A;  4B4R A;  3AYE A;  2Z79 A;  3VZO A;  1QJF A;  4E2Q A;  5FOJ B;  1IZ3 A;  3THT A;  5FMC A;  4Q1R A;  3WHU A;  1IHM A;  4FOV A;  1ZRR A;  1RUE 1;  2E33 A;  5IJR A;  3HNY M;  5FY9 A;  2B4K A;  2HWE 1;  1VBA 1;  1I9R A;  2QKD A;  3K3N A;  4Q4V 2;  3LDB A;  4CCM A;  2Y33 A;  1US3 A;  1D2Q A;  2GC0 A;  2HWC 2;  2JIJ A;  2YU2 A;  4I30 A;  2VTX J;  4K8F A;  1LTE A;  2QQM A;  1JYI A;  5C8W A;  4Z2W A;  4K40 A;  3AB0 A;  3U1X A;  4COV A;  3N7M A;  4TLF A;  1GQP A;  2NZ9 A;  2CL2 A;  2WT2 A;  1EY2 A;  1R1A 3;  2GNB A;  2C24 A;  3VZL A;  2A3W A;  3K2O A;  4LO8 A;  1T2X A;  4ERO A;  3FFQ A;  3QLQ A;  1AL2 2;  1CN1 A;  1Q8P A;  5A7P A;  4Y1X A;  5FZ7 A;  4E4H A;  1YQ5 A;  1ZA7 A;  1CX4 A;  4K3U A;  2WS9 2;  2D93 A;  3KHB A;  4YW1 A;  5IUQ A;  1ODN A;  1U12 A;  1OMI A;  2Y26 A;  3BU7 A;  2A70 A;  3POY A;  3RYP A;  2F4L A;  3KMH A;  1BCX A;  1FOD 3;  4IGO A;  3WX5 A;  2Q5T A;  4IEU A;  4NJ4 A;  5LY2 A;  3CHX A;  4Q4X 3;  2XJU A;  2D40 A;  1NCR B;  3J8F 3;  1HIX A;  3SKJ E;  1CGP A;  1BVP 1;  3RZL A;  2VMC A;  2XUM A;  1GKB A;  4QX5 A;  1JU3 A;  4MGI E;  4WV8 A;  3TNQ A;  4HL0 A;  4B1L A;  4M4P A;  4DQA A;  2X29 A;  5CFC B;  1TG7 A;  3UET A;  1NUK A;  2VW0 A;  4K7J A;  1OF4 A;  5HV0 A;  5J48 A;  5LEK A;  1ZBE 2;  3SIT A;  3MBW A;  5L7O B;  2WA3 A;  3O1M A;  2EAA A;  3WOG A;  4CCO A;  1CR7 A;  2Y6H A;  4XC9 A;  1Q43 A;  3LOB A;  4YVW C;  4HPK A;  3L2Y A;  3ZN5 A;  1UYZ A;  3ZN4 A;  1D4V B;  1YFY A;  4G4F A;  2R04 2;  2WWS A;  3MYX A;  4P9Y A;  2XJQ A;  1JOP A;  4MUV A;  3AVS A;  3DF0 A;  4CCL A;  4FSJ A;  1VBC 1;  3N9P A;  1VAL A;  1C1F A;  2JDY A;  2AR6 A;  3Q8B A;  4YLZ A;  2D6O X;  1RUI 1;  1VR3 A;  3C7G A;  2BBA A;  5DXD A;  3IIA A;  1NA1 B;  2X53 S;  2A6V A;  2VOT A;  1ASJ 1;  3RPQ A;  2VUC A;  1N3Q A;  4CYD A;  2YGM A;  2XBO 1;  4P5H A;  1HV0 A;  1R08 3;  4LBL A;  1YQ2 A;  5FZ8 A;  1XPW A;  1DDL A;  4QPW A;  4KU7 A;  5ABJ B;  4OCT A;  3U75 A;  3VZM A;  1COV 2;  3DCQ A;  3H0O A;  4A41 A;  2AYH A;  5LY1 A;  2CNA A;  2XWJ B;  3PUR A;  2CYF A;  2B9V A;  2VG9 A;  1VRB A;  4C8D A;  3ZFE B;  1SLC A;  3EQE A;  4YNI A;  2IXH A;  5B2G B;  1AR8 3;  1HQL A;  1NQJ A;  2CTV A;  1MZF A;  4CEY A;  2ERF A;  5DUU A;  4UFI A;  2P3I A;  4Y1Z A;  2ZGO A;  5BNN A;  2HEW F;  4HSL A;  1V6J A;  3M3O A;  5KHH A;  3BAL A;  4CP9 B;  4H7M A;  1O3S A;  3POE A;  2OKX A;  4MGQ A;  1AYN 2;  2ZGM A;  4MX3 A;  3TN9 1;  2ENR A;  3LPG A;  3MUY 1;  1S2K A;  5K0U A;  1R09 3;  1WCK A;  4M0H A;  4XAA A;  3WF2 A;  2IXC A;  3V64 A;  4K20 A;  4OHW A;  3V0B B;  5JVV A;  1QJY 2;  3DGT A;  4Q27 A;  3DUI A;  1YFX A;  1PNG A;  2UWA A;  1H9W A;  5JR7 B;  5DDJ 1;  1CQ9 A;  3WVJ A;  4IEX A;  3AXE A;  3BB6 A;  5I8Y A;  4BM8 A;  4Y5S A;  3ZIW A;  3SH3 A;  3JD7 1;  3KCX A;  1F4H A;  1L7R A;  3NNM A;  4YG0 A;  3CDZ B;  4XFI A;  1QH7 A;  2A6Y A;  1ODM A;  2E6V A;  1C1L A;  3DEC A;  1W6P A;  3SHR A;  4NR1 A;  4XAC A;  3TB0 A;  1OPM A;  1N1T A;  1XE0 A;  1KD7 A;  1J1T A;  3ACF A;  3HMY A;  4W6X A;  3ST7 A;  2WBK A;  5D8A C;  1C5I A;  1V0A A;  1CZT A;  2JDN A;  2QTW B;  1PVC 3;  1V6O A;  1HDK A;  3NMB A;  2ZHM A;  3T09 A;  4CU6 A;  4HFS A;  2IVI B;  2HYX A;  1POV 1;  4IXL A;  5A7O A;  4IEV A;  3EYP A;  4CCJ A;  1DGR A;  4IER A;  4AAX A;  4AFM A;  5K0U C;  1DGL A;  4XE9 A;  3VBU B;  3X29 B;  1VBB 1;  1EAH 2;  3VBS B;  1MS0 A;  2VZ3 A;  3NV1 A;  2OUJ A;  3PU3 A;  3IKW A;  1RUJ 3;  2E31 A;  1O4T A;  1YXW A;  2XKP A;  3KT1 A;  3O14 A;  3QD6 A;  1Q5O A;  1RHI 2;  2QVS B;  2VZO A;  2D3P A;  2VVF A;  1XB9 A;  2BFU L;  1D0G A;  2CGP A;  5BNO A;  5C4W B;  5M0T A;  2GAL A;  3ASI A;  4CP0 A;  3AP4 A;  3JBG 2;  4FOW A;  3TWI A;  4EWA A;  5AC9 1;  1VAK A;  2E26 A;  2I07 B;  2QUO A;  1XNK A;  2JG9 C;  3POJ A;  1MQT B;  2NM1 A;  2WSV A;  2O1Q A;  2YU1 A;  3J9S A;  5I8S A;  1BMV 2;  5FYS A;  3ZO0 B;  3K51 A;  2Q8D A;  3R4S A;  3BIW E;  5KXE A;  1ENQ A;  5FR3 A;  1AX1 A;  3AP6 A;  1DYO A;  5C3O A;  1CX1 A;  3OD0 A;  3VD4 A;  2G19 A;  5LW9 A;  4QT6 A;  5AFB A;  4YW7 A;  2W94 A;  1ND3 B;  1NCR A;  5K4L A;  2RS1 2;  3UGH A;  4CUB A;  4LE4 A;  3T08 A;  4E27 A;  3OGV A;  2G4I A;  2XHN A;  2YRO A;  1VBD 1;  1JN2 P;  1UPS A;  1X36 A;  1HLC A;  1B35 A;  1RUF 2;  1FNZ A;  2XJT A;  2ZAH A;  4LKD A;  5FIX A;  1QJU 3;  1Q8S A;  2PAK A;  2VOW A;  4D69 A;  5L7O A;  3NAP A;  2Q8O A;  1X50 A;  3A21 A;  3K77 A;  1OKO A;  4LBN A;  2HWF 1;  2PHU A;  4MYE A;  1LOF C;  3QCW A;  5CB7 A;  2IXJ A;  3W5N A;  4JHZ A;  2WYS A;  1X7N A;  1RUG 3;  5EV7 A;  4OI2 A;  5BNO C;  2P3Y A;  5FJK A;  1NLS A;  5JPM B;  2VCB A;  1EV1 1;  1PO1 3;  2H0V A;  4QMA A;  2FD8 A;  4XMA A;  1NA1 A;  1Y43 B;  1W6Q B;  2EXI A;  3PVN A;  2YFU A;  1UO9 A;  4C90 A;  3AC0 A;  2VM9 A;  5SV5 A;  4JTO A;  4AVB A;  2HWD 3;  4XFG A;  1HW5 A;  5K8S A;  3MW2 A;  4EN9 B;  1UYY A;  5HI0 A;  2A5Z A;  4YGB A;  2NQY A;  1W6N A;  3T2T A;  1V9U 3;  4HKW A;  3LF7 A;  4K9S A;  4XW3 A;  4FPK A;  4OMC A;  4XCA A;  5G05 L;  4AQ6 A;  4DEQ A;  1YUD A;  3LCP A;  1ZRF A;  3O1U A;  3T0B A;  2Q4S A;  4M3C A;  1QMJ A;  4JVA A;  1RUC 1;  4QKN A;  1LNS A;  5CIR A;  3ZFE A;  2V72 A;  3ZDV A;  2OII A;  1H30 A;  1VRH 3;  2JE9 A;  2A6Z A;  3RMX A;  1CIW A;  1B35 C;  3I2G A;  4CRQ A;  1TME 1;  3NV4 A;  4QX2 A;  1Y9Q A;  1H0B A;  1KFU L;  5DUV A;  4Q4Y 1;  3NAP C;  1IQA A;  1FV2 A;  1K5J A;  4XCB A;  4WBB A;  3H42 B;  4I01 A;  1JYV A;  1SFY A;  5JMO A;  2E9Q A;  2VBD A;  4RS5 B;  4QKF A;  3SCF A;  1FOD 2;  2HBT A;  3E6D A;  4JGY B;  4EQV A;  1VLN A;  4C1W A;  5F9T A;  1T6B X;  3VD9 A;  2B7Y A;  1ULD A;  4Q4X 2;  2YFZ A;  3EBR A;  5H9Q A;  3J8F 2;  3CJI A;  1W99 A;  2IFW A;  3V0B A;  3G7D A;  2R06 1;  3QOP A;  5KHI A;  2VOV A;  4P14 A;  3WD5 A;  1FNY A;  3PUH A;  3KM5 A;  4JKK A;  2FBE A;  2P34 A;  4BLJ A;  4A4A A;  2XPJ A;  4BK5 A;  4JAA A;  3OD4 A;  5JOW A;  5A1F A;  4RQP A;  4ES9 A;  1DGW X;  2Y6G A;  4OHV A;  1WLC A;  2BGC A;  2OS2 A;  2DBN A;  2E51 A;  4LTA A;  5L9B A;  3GAL A;  5GKA C;  1VMF A;  1V6I A;  5CVR A;  2F6B A;  1A6C A;  2RG4 A;  3EHK A; 
#chains in the Genus database with same CATH homology
 3F95 A;  2C24 A;  4LKF A;  1W8U A;  4LKD A;  4LKE A;  3ZYB A;  1L7L A;  1V0A A;  2LRO A;  2O14 A;  4BQ2 A;  1GWM A;  1OKO A;  4CPB A;  1WCU A;  1WMX A;  4A6S A;  2K46 A;  4BQ3 A;  1W8W A;  4LK6 A;  1HN0 A;  1W9F A;  2LRP A;  4CPB D;  4LK7 A;  1UOJ A;  4LJH A;  3UT0 A;  3ZYH A;  4AL9 A;  4BQ5 A;  1W8Z A;  4YWA A;  2JWP A;  4YW6 A;  1GWL A;  2VXJ A;  1W8T A;  3ORJ A;  4CP9 A;  4YW7 A;  1WZX A;  4CP9 B;  4BQ4 A;  3ZYF A;  5D21 A;  2KR2 A;  2Q1F A;  1OH3 A;  2WYF A;  1W90 A;  1GWK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...