1UOJA

Crystal structure of pseudomonas aeruginosa lectin 1 in the calcium-free state
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
121
structure length
121
Chain Sequence
AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PA-I GALACTOPHILIC LECTIN
publication title Structural Basis of Calcium and Galactose Recognition by the Lectin Pa-Il of Pseudomonas Aeruginosa
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 22
structure length 121
sequence length 121
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07828 PA-IL PA-IL-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 1uojA00
4LK7A 4BQ5A 4LKEA 2LRPA 4YWAA 3ZYHA 1W8ZA 3F95A 4A6SA 2KR2A 2VXJA 3ZYFA 3ORJA 4LJHA 1L7LA 1WMXA 2JWPA 3UT0A 4LK6A 1GWLA 2WYFA 1W8WA 2K46A 2LROA 1GWKA 4CPBA 1OKOA 4YW7A 5D21A 3ZYBA 4CPBD 4AL9A 1WCUA 4LKFA 1HN0A 1GWMA 1W8UA 1W8TA 2Q1FA 4LKDA 1OH3A 1WZXA 4CP9A 1W90A 1W9FA 4CP9B 2C24A 4BQ4A 1UOJA 2O14A 4YW6A 4BQ3A 1V0AA 4BQ2A
chains in the Genus database with same CATH superfamily
4MVTA 3WZ1A 2LRPA 2NQYA 1ZZ6A 4FXKB 3ZMNA 2R043 3BU7A 5GJ6A 2GMPA 3GBWA 3AL6A 3SKVA 3LF7A 3ZYGA 4QKFA 4LTAA 2VE1A 2ZGLA 4QU2A 1IGOA 5H9PA 4E4SA 4Y1YA 3VDAA 4ZONA 1YIPA 4QU1A 1RUC3 4O7XA 3NVCA 1RUJ1 3NKGA 4LK6A 2VVFA 4HPKA 1ND3C 4NROA 4XHBA 3THDA 2PAMA 2YBPA 4DS0A 2WC2A 1LHNA 2A3YA 4IE7A 2GC0A 2WO3A 4DUXA 1OOPB 2R1DA 3FN9A 4Y20A 4CEYB 2EVXA 2C0ZA 4DXSA 2XDVA 2WRAA 1MEC2 1SFYA 1ZA7A 2QTWB 3MIDA 2GDFA 4ZU4A 4JGZB 5LRRA 4ZS3A 3KZ4C 4INDA 4XJWA 5C8WA 1UU4A 1J3PA 1MR5A 4JCKA 1NCRB 1W2NA 2VZTA 2Z79A 4U36A 1XPWA 3ZXFA 4XUOA 2X5IC 4RQPC 1TVGA 4Q4V2 5A1AA 5AVPA 5GLTA 3VBSB 1UN1A 1NE4A 1DGLA 3KMHA 1WLDA 4OUMA 4QPYA 2GN7A 2R7EB 4XBNA 4YSFA 1H1AA 1SQ4A 1N1TA 5JR2A 5FZ4A 3PUIA 3SXWA 5JIUA 1RHI3 2PHUA 4HK8A 3AFGA 1S4CA 2VCCA 2LW8A 2MPFA 4DQAA 4BB3A 3MO4A 2ZHLA 1BVP1 4FPYA 4CXXA 1U0AA 1OT5A 4JGYA 5AFBA 3GYDA 1TEIA 1H2MA 1W39A 2R073 1K5MA 1FATA 3B00A 2R072 1UY2A 5BNOC 1D0GA 2WLQA 4ZKTB 1X36A 2YXSA 2QUOA 5FZ8A 4AGVA 3U14A 1H8TA 3BTZA 1YFWA 4AI3A 4PI0A 4JKLA 2Q5TA 4EN6B 1GZCA 2B8MA 1ENSA 2DUPA 5C70A 4AEJA 3T4VA 3VDDB 3W20A 1OLQA 5GLWA 4Z2WA 1ULPA 3H8RA 1K12A 3B3QE 1EAH3 4M4RA 1QQP1 1GWMA 1D4VB 3N9QA 4LKDA 5IK5A 2VR4A 2ZGPA 3BPSA 2VJXA 2YC2A 5I8SA 1LGBA 1FOD1 5C8CC 4NPMA 1U5ZA 4GH4A 3OGGA 1T6BX 2OPKA 3AC0A 3F95A 3OUIA 5I0DA 2XOMA 4RHV3 3E6DA 2ZZQA 3J8F3 4CCDA 1R091 1G9BA 4YW4A 4PQ9A 4QX7A 1W6NB 5FXXA 4BQYA 4DRRA 3SITA 2F17A 5EHDA 2VOTA 5LEJA 4GD4A 2IXHA 5EV7A 2B9VA 4DXTA 1SG3A 1H0BA 4EQVA 2ZGRA 3ZR5A 2C24A 2GAUA 4XIOA 4Y5TA 3VKNA 5L7OA 3OYWA 4FO9A 2B7YA 4E4HA 4MOAA 2W1QA 3ZYIB 5JOWA 4LKEA 1CZTA 2X09A 3QOPA 3S57A 1POV1 2KD7A 4OHYA 1UMIA 5K0UC 2TNFA 1JZ6A 2AGSA 4K40A 3PURA 1MS9A 4BXFA 2XVLA 5K8SA 4L2NA 4KGGA 4I09A 4XFFA 5JOXA 4GB32 1GZTA 4LJHA 4QGMA 4XIKA 5F7UA 4JVAA 1HB2A 3UT0A 2V09A 4Q29A 4WM7B 5L19A 3SHRA 5FBZA 4ZXKA 1W2AX 3D0JA 3VD3A 3SCFA 1MZ5A 3MF9A 1W05A 1TME1 1US3A 3PTRB 3I3BA 1GSLA 1AYN3 2AEZA 3LE0A 3KT7A 3VZMA 2XUEA 2E7AA 2JKXA 4DPNA 1OA4A 1PK6A 1R092 4W4ZA 2ZGSA 4N53B 4PDWA 1HRI1 1V6JA 4IERA 4M3CF 4ZZ5A 1VBC3 2I74A 3WDXA 1N3PA 4KBBA 3WNMA 2WNUA 2D93A 1Q43A 1J59A 2VU9A 1CAWB 3WX5A 4A41A 2P6CA 4FI9A 3WG1A 1ZX5A 2P3JA 2ZS6B 2DFBA 2ZX0A 4N9HA 1WBFA 3VLBB 4AE2A 4NOTA 1BBT3 4YM3A 2VNOA 5IVFA 1GQPA 1RJ8A 3RNSA 2G9ZA 2JE7A 1NYWA 4CPBD 1AR71 3T2QA 3BUCA 4KMQA 2BTVC 1AR83 1NY72 1OMIA 3DYMA 3H8OA 2W2IA 4MUVA 3POEA 4Y5Z0 4YVWB 3O1MA 3C3VA 5F3GA 4LK7A 3W58A 4BK5A 5GZGA 5IVYA 4Q4X1 1UZ0A 5EFUA 1AXKA 2RM21 1LNSA 1SDDB 2UU8A 5HCAA 3I49A 1XNTA 2FHRA 3AZYA 1AL23 4QPWA 3RWNA 4OQ8A 1HRV3 1E5RA 1A6CA 2W3JA 4RD7A 1DHKB 4XFBA 2CSGA 3WF3A 1MZEA 2JEMA 2SLIA 3G6JB 3ZKYA 4M3CE 5K4LA 4NHLA 3ILNA 3MLLA 3AZZA 1C57A 1NOVA 1UX6A 4YG6A 1K45A 5FOBB 2G9GA 1FMD1 4CEYA 4XC9A 1WCUA 4RGKA 5JIAA 1UQXA 2RS31 2V5DA 1Q5OA 3PUSA 1UY1A 3WDTA 4AR2A 5CKMA 2J1UA 1V0AA 3J7NA 4QPGB 3NV1A 4RN5A 4Q1RA 4NWVA 3RJRA 2WDBA 4IEXA 2WZPP 4IV3B 1QOSA 4HMZA 2A6YA 4UAPA 3DPRB 1NCRA 4QHBA 4XVHA 2O1QA 4LBNA 3I7DA 4ZPIA 2HEVF 5A1LA 4IETA 1AR72 1JOJA 1Z7S3 4JGYC 1JBCA 2JIGA 3RYKA 1CQ9A 4Q8KA 1OHFA 3VBSA 2NP0A 2FDFA 2EA7A 1K5MC 3KCXA 1J3RA 2D7FA 1CESA 1CN1A 4I0WB 3W5NA 2PA7A 3VHRA 4OI0A 5DUUA 1BMV2 2WWJA 5CU1A 1CONA 3W9AA 3IZOA 3K4ZA 1QWRA 1H8TC 4Q4X2 4HN0A 1R1ZA 2YU2A 3AP5A 4IV1B 3CO2A 3I2GA 2OKXA 3WCRA 2EIEA 2RM22 4CDUB 1CX1A 3MPPG 2E7TA 1VBA1 1GV9A 4LUMA 1WBLA 1ZZ8A 2ZMLA 3A22A 4FPJA 4B1LA 2JG9B 1H9PA 5IVBA 3ZSMA 2FD8A 5DZFA 4M0HA 4D6RA 4FPCA 2VVEA 1OFSA 3OGSA 5CBLA 3KHBA 2AACA 4GWMA 1C8M3 2RDRA 5FMDA 1FMD2 1O8SA 1L7QA 1OD3A 1O4ZA 1O5UA 2BFUS 2GNMA 2RS32 4GH4C 2GMEA 2AR6A 2C9AA 3VDDA 3JZVA 1A34A 3POGA 5FY1A 5CADA 1RMU3 2DCJA 4Q27A 4YW7A 4OHWA 5FYSA 1HB1A 4XURA 3USUB 4ASKA 1JXNA 1UX7A 4M3CB 3RZMA 1JYVA 4YZ5A 3A0NA 5A1FA 1YWKA 4ZZ8A 4P08A 4DEQA 5LZ6A 3MUY1 1BK1A 2VVDA 1OLMA 2D6KA 4Q1PA 1JUHA 1FXZA 4LORA 3ZXGA 4FPFA 3OUJA 1YIFA 2K0GA 2GC1A 4NUBA 4LLFA 1RUD3 3V64A 4GXLA 1VJ2A 3C7GA 1W6NA 5KHJA 1XB9A 3MW2A 4Q0SA 1RUI1 4EN0A 3CJIA 2EICA 1VRH3 5FZCA 3WDWA 2WZR2 1VBA2 3KHCA 5FZ9A 2C6SA 4NAOA 4PLNA 2VQUA 3HJRA 3WD5A 1VE0A 2GH2A 2ZKNA 4QGLA 1R081 5A3OA 4WVMB 5IK8A 3EB7A 3M4FA 1GYKA 4XOGA 4AQSA 1DYPA 5FMOL 4BQ3A 1UF2C 2D3SA 1OSGA 2ZGOA 3WW1A 2BOIA 4NIIA 2R49A 4LBQA 3HQUA 3FE5A 2BERA 4CCEA 1QOTA 2UY9A 2CAUA 1H2KA 1RIRA 2W1WA 4AG4A 5DMYA 5JPNB 1S2KA 1Q8VA 3AMQA 2XJVA 1RUE3 3FFQA 4IE5A 2W39A 4UFIA 5CFDB 2LUWA 1PK6C 1UYPA 4PDWC 3T1LA 4HSLA 1SACA 3POBA 1XBFA 1XNBA 4I0AA 4WM7A 3S0MA 3RMYA 1EY2A 3WQ0A 2PAKA 1EPZA 2JB4A 4O9EA 3W5MA 4BOWA 4BQWA 3B94A 5H9SA 4N53A 4YZ3A 1UO9A 1YXWA 1ENXA 2ADEA 1Q8QA 2LM3A 3R4SA 1POV0 5DDJ3 4AQ2A 4BQ1A 4FFIA 4JDMA 3S7IA 1S0JA 3LOBA 1CAWA 2AENA 4HFSA 4QKNA 2QQPA 3AYDA 3HAGA 3C7HA 1YCIA 4UXAA 2F4LA 1R082 5FZ1A 3NJXA 3O1UA 4COVA 2A70A 4R9CA 1RUG1 4FOWA 2VNGA 1UU5A 4LPLA 5FXVA 3C7EA 4X8PA 5HI0A 4AQTA 2ILMA 3SH5A 1MS5A 4YW2A 5CIRA 2WFF1 1DQ4A 4Z2AA 2YY1A 5DUWA 4OHVA 4E4ZA 2B39A 1P8JA 2BP6A 1QXJA 1EYBA 2Q30A 4K1YA 2UWAA 4QM9A 4YVWA 1XSQA 4KG8A 3VKLA 1RUF3 2WINB 2QQWA 3PVNA 4BQ2A 3S6PA 1LU1A 3ILFA 4Y1ZA 1CAVB 1X9PA 2IXKA 4CEYC 1BEV1 3H3UA 3M3IA 2DVDA 2JDUA 5IT6A 4PLMA 1PNFA 4CDXB 3OUHA 3O1SA 2IUWA 2RG4A 2Z5WA 4Y4YA 1VBD3 1JODA 2HWE3 2ERFA 2MEV3 1E5SA 4CCKA 1QJY1 3K4AA 1NCRC 3M3QA 1H1IA 1NX9A 2HWC3 2MEV2 3J9SA 4AFAA 4DOUA 4XMIA 5JXIA 4OZOA 4EE2A 3R4UA 4FOVA 3VGIA 2XJSA 2OUJA 3HPNA 3VBSC 4Z8BA 5A3UA 1DIWA 2HWF2 4QPGA 3AZXA 4D7SA 4ISQA 3JBG3 1GKBA 2V5YA 4X8NA 4IV3A 4URTA 4XAEA 5A7SA 2Z69A 1PVC3 5B2GB 1IQAA 3JBG2 1W04A 2CY6A 3M8LA 4N7IA 1HB3A 1UPIA 3TBDA 2CAVA 4Y4RA 1WMDA 4IESA 1HB4A 2ZEYA 1RUH3 3OB8A 3LDRA 1NQDA 2YBSA 4D3WA 1G6NA 1RVF3 1RUH2 1VBB2 1C1FA 1X8EA 5C9AB 3LAGA 4MYEA 4RSUA 1ODMA 1BCXA 1VAKA 1JYIA 3OPWA 1W2TA 2J7MA 3K3OA 4HETA 5F5CA 1GANA 4IV1A 3U1XA 4CDUA 5FZOB 1BEV2 5IFPA 2XONA 4LNVA 1OBNA 1PZ9A 2FZ1A 3VDDC 4R8HA 2JG9A 1BK0A 5FZ0A 1GZWB 3ACIA 4HSJA 2VTXJ 5FO9B 1ZNPA 2W1UA 3ALQA 3SNMA 3POSA 1YI9A 2A7AA 2OQ7A 2ZZJA 2HH9A 3AK0A 3FFZA 4IE4A 4DUVA 1YUDA 4DXZA 2XKOA 1N1VA 3O14A 1LOAA 3PUHA 4IEPA 4LBLA 4EN8B 1A78A 2IXLA 2RE9A 1XSRA 2W68A 3USUA 3WDYA 1WA6X 3VD7A 5FY8A 4M3CA 1NUKA 3I2JA 5FWEA 3ZN5A 2VC9A 3NWKA 5GLZA 5JWPA 4PIZA 2VMFA 3T0BA 3CJIC 4EV0A 2XR4A 4ES8A 5FUIA 5L36A 4LT5A 1YJKA 4F8AA 2FCVA 3M3EA 4CCCA 2WWSA 1VAVA 3LOIA 1CWPA 4GMP1 4NRMA 1KXGA 1RUOA 4QHZA 4L92A 2A6XA 4UI9L 3I3EA 3UGFA 3GF6A 4CA9A 4FTSA 5JDBA 4BZ4A 5SV8A 5FV3A 3VD4A 4XBQA 5T5OA 1AJOA 5G05L 4M01A 2E6VA 4WVMA 3QLQA 4E9KA 2ORZA 3AP7A 2Q4SA 1YLLA 2MHFA 4C1XA 4WM7C 1YFUA 1BKZA 3KGLA 2RS11 4TLFA 1QJX1 4WVWA 3J7HA 3U37A 5LY1A 3JD73 5KXBA 1JYTA 3ZIXA 1VPHA 5F8PA 1DGRA 4XEZA 4B3NA 2A1XA 1D0HA 3AVRA 4XBLA 3HBKA 5CFDA 3RZLA 2OPWA 3D0SA 3KS7A 2J1AA 2RS53 5FP9A 4N53C 1PX3A 2YFZA 4AEKA 4CCOA 5KC6A 5HCFA 4A45A 2BNNA 2D5HA 2P3YA 2RS52 5I0SA 3ZXLA 2PLV2 2B46X 1V70A 2OS2A 2X29A 3CEWA 1VR3A 4S2GA 4AVVA 3USSA 1N3OA 2ZAHA 3IT8A 4JDOA 4K21A 5A7WA 4AL9A 3AKSA 5DG2A 4E2GA 4XPVA 1VMJA 2QQLA 2K9ZA 3OBTA 1W8HA 2ZXQA 2CDOA 2VQTA 3Q9OA 2PN5A 1ASJ3 2XVKA 1CZSA 2WFPA 4FAHA 1Q8SA 1ASJ2 2IC1A 3K48A 3LDBA 1X8MA 4ZXEA 1GU3A 3R6SA 2R16A 3BTYA 3FLRA 4M4PA 4LHLA 3UETA 3ENRA 2HYXA 4YVWC 3CZJA 1US2A 1ZBA3 2TBVA 3E6BA 3WQBA 1ZBA2 1DZTA 2RDQA 4Y1XA 1ZBE1 1F8VA 4LOSA 1X7NA 2C5DA 2RS12 1QJX2 1UCXA 1NG0A 3GBFA 4EZHA 2Z42A 3LB9A 2ARBA 4NHKA 4AEDB 4JC1A 3BI3A 3URFA 1NCQB 2TUNA 5I93A 2SBAA 4Q4Y2 3H8UA 4AF9A 5HV4A 2EIBA 5CYYA 2ZGMA 5TSWA 5IAVA 3N7MA 4P9JA 4PBOA 5J09A 3ZO0B 4CDXA 2IVIB 2WT2A 4Q4W1 5KR7A 5FLJA 4MGSA 4QPGC 4DNYA 3GM8A 2WUHA 4E4DX 2QKDA 4IV3C 1LAJA 2WQ4A 2XQXA 4QM8A 2GN3A 1PO13 3CNAA 3ZN6A 5FDBA 4Q2FA 5I8YA 1PO22 2I2SA 1OKOA 4ZHNA 4P00B 1F9KA 1FYUA 3NW4A 4AVAA 2YPJA 2FBEA 1W90A 3S5QA 1RTVA 3ACLA 3UNPA 4TSVA 5CKQA 2BWAA 2E26A 2WS93 1NA1B 2DUOA 3BVCA 2X05A 1W8OA 3WF0A 4COWA 2WS92 2XWBB 3EJKA 3IB3A 4HK9A 4HOOA 5F2WA 1ZBE2 4IV1C 1AUYA 3ZMOA 4CDUC 4E8DA 3NNFA 4CU7A 1XYPA 4NPLA 2HYKA 1PIV3 4P9XA 4C1WA 4P5YA 2VXJA 5DAPA 1AR61 5C9AA 1WGPA 4MH0E 1PIV2 2JG9C 3VHNA 2QDRA 3MEPA 1PHMA 5FY4A 1GWLA 2ZA9A 3PMSA 4P9WA 3ZFGB 5LA2A 3LA7A 2XH6A 4K3UA 1FV2A 4MGTA 3APBA 1WW5A 5DUVA 2BGOA 1ENQA 3EQEA 4IEOA 3I3MA 1LR5A 2E63A 4Q4W2 4UW3A 1AXYA 1GZWA 2WIIB 1WUVA 4GIQA 3PTYA 3PVOA 4WM8B 4AHXA 4D7TA 2E33A 3WW2A 5LB6A 4COZA 1ODNA 3T30A 5JSRA 4MLOA 1PVXA 4A6SA 1EV11 1V6NA 3KF5A 1OH4A 5K7PA 2NPIA 2A73B 3DF0A 4DMIA 4PF5A 5IAXA 1RJ7A 3CQOA 2RR12 5FZHA 2VMEA 1GFF2 4G3YC 4CUGA 2WT1A 1OA3A 2CTVA 3KV5A 4XDQA 3SEPA 5EIYB 2WSUA 1V6MA 5AC91 3LSEA 2VECA 3N7LA 4S2DA 2ET1A 2VUCA 2EF6A 1CAXB 2J42A 4W6WA 2D97A 5L9VA 4A2UA 2EXJA 5H9RA 3AP9A 2VTXA 4YGDA 3WNKA 4B8EA 5LW9A 2E51A 1JN2P 2HWB2 1QJU1 3KQRA 3POFA 3SH4A 4AK3A 4R9BA 2PFWA 4LQRA 1JU3A 2R32A 5DZEA 1W2OA 3NNLA 5T55A 4ITCA 1OQEA 2RMU1 2XBO1 4FOYA 4Y3OA 1MS4A 3RVHA 4A3ZA 1OF3A 5FYYA 5FQ0A 3MLKA 4A44A 4HVOA 4OFGA 5CKNA 1GOGA 1UKGA 1IG0A 1UY0A 4A4AA 1W6MB 2WT0A 1JYNA 2G19A 1HDKA 4YM2A 4D0QA 2CGPA 4QXCA 4HANA 3WG4A 1MEC3 1TE1B 1C1LA 1OLME 1EV12 2DCYA 1WW6A 3RWKX 5FZDA 3MI8A 4CE8A 2OQ6A 5BV6A 1LHOA 1RHI1 4P9YA 4JQRA 4ASLA 2CV6A 4HN1A 4YFZA 5FYBA 2V4VA 2JDPA 2W95A 4GMP0 4HKWA 4Q4V3 1AJKA 1NKGA 3GGLA 5AC92 1XJAA 2JIJA 2VQ0A 3VL8A 1GBGA 3PIGA 3WQ1A 5F6KA 4Z1VA 1SCSA 1I3HA 1UXZA 3Q8AA 4K6BA 1GNHA 2BFUL 2DF7A 4EROA 2FMDA 5HCHA 4L9BA 3R05A 3RZHA 4BJ0A 2OZJA 4IE0A 5CNAA 4XF9A 1ZRRA 1JZ3A 1LU2A 3U11A 1OH3A 3CF6E 4QQOA 1WCDJ 4F7ZA 4XFHA 3WP4A 3TWIA 4DB5A 5ACA1 1S1AA 1GZ9A 1U5XA 2RMU2 2XBO2 1IZ3A 1RUJ3 4B4RA 1VBE1 5T5JA 1JZ4A 1EAH1 1NXD1 2JB8A 3LEGA 1RUJ2 4GAZA 4DIQA 3BPZA 1WCSA 4COYA 3FWEA 1S0IA 4BK4A 4DXRA 5FK8A 4OMDA 1SLBA 4A7YA 3AVSA 3LEMA 4XCAA 2R0HA 3IWZA 1Q56A 2J1SA 4CEWB 3BU0A 1S0GA 4QQ2A 1FNYA 2L9LA 2K2SA 5FP8A 2ORXA 4UW6A 2W9XA 2VH9A 2K46A 3KSCA 4RHV1 4CDXC 4META 3WG3A 4CU8A 4AEDA 1NLRA 5FPAA 5FYHA 3N9NA 1S0FA 4UBHA 1NCQA 5EZWA 4CYDA 5K9YA 2IVJA 2YBKA 1WD4A 3GZTB 4D7YA 1RB8G 3OG2A 1VMHA 3O0XA 1LODA 1D4M1 1YYNA 3BN6A 2DTYA 1JUIA 5B4NA 2VMGA 3I3DA 2XGXA 5FBJA 5FMBA 1KS4A 1AVBA 1XXNA 2B9UA 1J1LA 2HBTA 3WF4A 2XQRA 4JTNA 2D98A 2C1FA 1WLTA 5FXWA 3WW4A 4XQWA 4IEQA 2WQZC 5FKBA 5EJZB 2XVGA 4BMEA 1DCSA 3FBMA 3IAPA 5ABJC 2A5ZA 5JI9A 2PTMA 3J26N 2ADDA 4C0HA 3ACFA 3VBHB 1FNZA 1WA4A 1ZZCA 1RL3A 1DDLA 4GKXA 1J83A 5FZLA 3P1IA 3ATGA 3HN1A 1GMMA 1UD1A 1NA1A 4AFDA 1VIWB 1S0DA 2VZRA 4Q5OA 1DQ0A 2P34A 2Q8EA 4A42A 2GC3A 2IWGB 3RYRA 1W3VA 3K4DA 5FCCA 3ZXKA 1AYN1 1O5LA 2ZCWA 3P3PA 3LFMA 1JYXA 1MQTB 2HEWF 2BOJA 2ZKLA 3HN3A 3KV9A 4AFMA 3THPA 4GB33 1DGWX 2RDNA 4NIHA 1F2NA 2QCSB 3UKVA 3AMMA 1ZRIA 3PU3A 1LHUA 3MV01 1LOFA 1QQP2 3ZFGA 3LPFA 4HT1T 2A71A 3UKTA 3VBRB 5F5QA 1OA2A 1FOD3 5EQUA 5F37A 3TEZA 2VPVA 1FOD2 4CU6A 3BIWE 3D4KA 1D4M2 4H3WA 4AEMA 5IYYA 3DN7A 3PJYA 2IFRA 4RS5B 3RGBA 3NJZA 1QIQA 1XNAA 3DCQA 4RR3B 3WUCA 5KWRA 1PM7A 3H1MA 1OQ1A 1R093 4D8MA 4WM8A 5JUVA 2V4AA 2VBBA 4HL0A 2OYZA 1COV1 5EYYA 3WDUA 3KWVA 1XNDA 4XDOA 4NHMA 5B4XA 4OULA 4QPIC 5LK7B 5CZKA 1QH7A 5ERLA 1YQ8A 4LE4A 3WQ7A 2VCMA 4YRDA 3VBFB 3MW3A 1XRUA 2EXIA 1A8DA 2J1TA 3CL1A 3I2FA 4K8FA 3CU7A 4MSVA 2I07B 3VB9A 3PU8A 3WHUA 5FR3A 1UOFA 4KBZA 1CAXA 1AYM1 3TB0A 4CP1A 5JMOA 5J37A 5F5IA 1NLQA 4CP9B 3N9OA 5T54A 1JI6A 2VZQA 3NAPB 3ACHA 1QKQA 3WT3A 2YU1A 3H50A 4D69A 3MGUA 3H7YA 1DFQA 2WBKA 1H6XA 2ETEA 1CPMA 4D6QA 4FAGA 1HIXA 5KC5A 4PBPA 5IK7A 3POWA 5FAXA 5DPNA 2BWCA 2W94A 2FZ2A 4MZUA 1S0BA 4DO0A 4MGQA 5I8TA 1Q3EA 1TME2 4DY5A 4OI2A 2XG3A 1LCLA 2Y6FA 2HWD1 2VOXA 1O4YA 1W6MA 1J58A 1Y4WA 1Z7S1 4MO3M 1COV2 1OOPA 1HRI2 1YO8A 2W08A 3LPGA 4YM1A 4XJ8A 3UKNA 5J1XA 1O3TA 1YJLA 2QJVA 4JGZA 1GLHA 1MVEA 2YUEA 4Y26A 2R1BA 1B35B 3AYCA 1XNCA 1JU4A 4NN0A 3SLIA 1GNYA 4LIVA 1F4AA 3M3OA 4LHNA 1CIYA 3GHMA 3ZN4A 1AR73 2VTFA 2W0XA 3O1OA 2JENA 5JOYA 1OPMA 1SBDA 2VMHA 3HR9A 3LFIA 3MW4A 4P14A 4PQQA 1Y9MA 1IS4A 2Q0AA 4LA2A 1SLTA 1A8MA 2CWMA 2OVUA 5F3IA 2ZEXA 4AI9A 2RHPA 3WINE 1Z0HA 5LA0A 1ACCA 1C8M1 2Y0IA 1LOCA 1W99A 2CWSA 2OUHA 3FUOA 2VCAA 1OF4A 4Q4X3 2YZ4A 5BNNB 2RM23 4AVBA 5M0TA 4E2SA 2B4KA 2KA3A 3VKOA 5CAZA 1RMU1 5FYMA 3POJA 1SBEA 3ECQA 2WAAA 1RUNA 4GKYA 3SKJE 4AEDC 1W6OB 2AC1A 1NCQC 2HWD2 5I0RA 4KWJA 2W92A 1X50A 1H4HA 3M1HA 4L99A 1FMD3 2XKPA 2VGDA 2OT7A 3S7EA 2G9FA 4CEWA 4A7KA 2RS33 4LO5B 3BCWA 5GLVA 3DKWA 1MS0A 1KDMA 3WW3A 3A0KA 5FYZA 1ZYBA 1XYNA 3N3HA 1QNYA 1WD3A 3H42B 4NIDA 1AR91 2BV4A 2ES3A 3ZPOA 4JRLA 4V2VA 2Q8DA 1HN0A 2WLPA 2NMOA 4XMAA 1G9FA 3OOXA 5A6QA 4FFHA 1ULFA 5LEKA 1W03A 1WWYA 3NV2A 1W6QB 4PIYA 3TAYA 1UY4A 5IVVA 3VZJA 2H6BA 3GJBA 4UFJA 4ATFA 1UMHA 2VMIA 3B7MA 2D6LX 2AEYA 4FPOB 3VN4A 1D7PM 3TRSB 1CVNA 5L7OC 4YW3A 1NA1C 4NRQA 2D40A 3TN91 5FY7A 4I3GA 2XUMA 2JDMA 2WZR3 4EZ4A 1VBA3 3OBRA 4OCTA 3AYAA 1ULEA 1LENA 1LTEA 2OIIA 3IBMA 3KT4A 4MADA 4CXWA 2XJQA 2O8OA 5L9BA 4F83A 2GMMA 2D6NA 1LOFC 1GUIA 2VY0A 2YROA 3HVDA 1PX4A 3KD4A 4HKOA 3ZFGC 3ZIWA 4CDWB 2J1RA 1LOGA 2JG8B 3C8XA 5DABA 5JLVA 3LIHA 4HKLA 4CCMA 1MQTA 5BNQA 4KQ7A 5LBEA 2ZGNA 1XC6A 4WM8C 3O1PA 3ORJA 3WY6A 2VD7A 3U75A 3VBRA 5DDJ1 4NJ4A 3K77A 4AI8A 3CIHA 1KD7A 1B09A 1UZYA 1DF0A 2LROA 4I3PA 3UJOA 2WNUC 3NQHA 5ISLA 1JOBA 1W0PA 4RS5A 3PHMA 3J7LA 4RR3A 2VZOA 1ZZ9A 4DINB 1UXXX 3AP4A 3O5SA 3TNQA 5FP4A 5LCWL 3TN92 4XTMA 1UZWA 2YPDA 4TYSA 4BQ5A 5D8AB 3MYXA 1RUI2 5LASA 5LBCA 3PVBB 3I2KA 1L3JA 4OI1A 1H2LA 3KLSA 4LO4B 1LECA 3VBFA 1R083 4YGEA 1ND2B 1H9WA 2DVFA 4K7JA 4IGPA 3QBQA 3ZM8A 5FTTC 5F1RA 1PGL1 4AHYA 5A6YA 4UOJA 1VP6A 3M7AA 2WWUA 5D2AA 1VMFA 4CPBA 3EHKA 2A3WA 1GICA 2IXCA 3GJAA 1HQWA 4LBMA 4N43B 5FLHA 3THCA 4B4PA 1UWWA 2BYVE 3T3YA 2HWE1 4CU9A 1G9DA 1HQLA 2DCTA 3BOPA 1STMA 2F4PA 3NAPA 4FPHA 4TXWA 2QQJA 2HWC1 2EXKA 4YG0A 5BUVA 2ZMNA 5FP7A 1QDCA 1PGW1 1YQ6A 3HQRA 1ZZ7A 2ZEZA 3EXUA 1OOPC 3ZDVA 3WP3A 3UK9A 3VKMA 5A80A 3FHQA 1QF3A 3E5QA 3MIEA 5IVJA 1O59A 2RJKA 3H7JA 4I30A 4HG6B 4JGZC 2J1VA 1TZOA 4RGGA 1TNRA 2VZPA 4OYUA 3ZXJA 2YMZA 3RQ0A 2E32A 2NN8A 3M3CA 4JX0A 4LO8A 3GZEA 4BH9A 1AX2A 5CVRA 4K1ZA 1BLZA 3HWJA 2ZEWA 4OI4A 5SV5A 4AAPA 5FPUA 2WO1A 1RC6A 2VW2A 4K20A 2Q8OA 3WNLA 1RVF1 3MIBA 4IQPA 1HQNA 5BNOB 4L97A 5F9TA 2HWF3 2QQKA 3NV4A 3ST7A 4JHTA 3EO6A 4EN9B 3FL7A 5C3PA 1B35A 2ZGQA 1W8FA 5FZ7A 1O91A 1OQDA 1BHGA 2WABA 1VAMA 1RUG3 3DPRA 1FPN1 1PGL2 3TYJA 1UU6A 1O8PA 3TEXA 1RUG2 2GU9A 4R4XA 1W3XA 2CL2A 1G86A 3LEKA 2E53A 2QBXA 4AVSA 4RGAA 1SLAA 1VBB3 4X6QB 4XE9A 2KM2A 2WFF2 1JHJA 2BDRA 2WR9A 3DECA 3IN9A 4MGKE 4UW5A 4WZFA 2JE8A 3BODA 4EN7B 1SPPB 5KHHA 1HXS1 1LKNA 4TLGA 1ULOA 2PAEA 2Y6KA 3HNMA 4AW7A 1PM4A 2JDHA 1M4WA 2DBIA 3AMPA 2J22A 5BNNA 3RZKA 4LKFA 1BEV3 3NKTA 4CEWC 5FOJB 3LQCA 3BKZA 1W9YA 2YB7A 3VBUB 3D82A 3MIGA 4QDSA 5FZFA 5CEHA 4FTBA 3J4UH 3OPZA 3JQWA 1BXHA 4LKSA 1QGLA 3AX4A 3VBOB 3AJYA 1H2NA 1W6OA 4QD2A 4NAMA 1QJY3 5KHIA 3NRUA 4XF3A 1OUSA 1IS6A 3EBRA 3HT2A 1QJY2 3I2HA 1OURA 2JECA 1RGSA 1Z78A 3AKPA 1JZ8A 3HNBM 2WN2A 2Y26A 4RFT0 3T09A 2BJSA 4OLLA 5LA9A 5J96B 3UESA 4XQ4A 5A6ZA 3RYPA 2ENRA 3OPTA 5C33A 4TTGA 4OVEA 2D6MA 3POIA 2VAUA 2QQIA 2BEOA 1FPN2 1SDWA 4YPJA 1Q8PA 3ES4A 4RA0A 1UOJA 3K2OA 1XU1A 1W6QA 4FT8A 4W6YA 1KITA 4E8CA 2IXJA 4UFHA 1DZQA 2P3IA 4Y22B 5F32A 2ZGKA 2ZACA 1YFYA 3ETPA 3D6EA 5LY2A 5J7MA 1HXS2 5A3PA 2EAAA 2XHNA 1GP4A 1PZ8A 4B29A 4C90A 2ZGTA 1UY3A 3JD71 3TEWA 5DG1A 2R061 2QNKA 3U78A 5FPZA 4P9LA 5FP3A 1UW8A 3WXPA 3EMRA 5KXEA 3X29B 4EYUA 2VO5A 4W50A 4K8RB 1SMVA 4G4FA 4GWNA 3VD5A 4GJZA 1NZIA 2C9KA 3I2OA 1JTZX 1CJPA 5FY9A 3CBNA 3FJSA 5IJRA 3VBRC 3ZVXA 1V9U1 1JOPA 1W06A 2A75A 4ET7A 1N47A 1CAUB 1ZZBA 4YGCA 1O7FA 3MZHA 1K42A 2RDSA 4AVCA 1PZ7A 2BZDA 3ON7A 4RS5C 1F4HA 3B69A 4RR3C 3A7QA 4XABA 1N1SA 3KVAA 1U5YA 4SBVA 2WO7A 2JWPA 4FPGA 2PLV3 4BPZA 4QX3A 2DV9A 1ULGA 4YFWA 4DEVA 4LOTA 4WVVA 1W8WA 5FZBA 5JPMB 1RINA 1Y9QA 5ANQA 3RDIA 2VZUA 3H8XA 4QXKA 1LRHA 1UIKA 4FQZA 1F5JA 2VCBA 2XL9A 3ABZA 5ANNA 2VXRA 3VBFC 3OY8B 3P3NA 2RJLA 1KFXL 3D5OA 2O14A 4GMP3 3IPVB 4P02B 2XHKA 4Q0VA 5C3QA 3O1TA 2PHXA 4LITA 3K46A 5D8AA 1V6OA 2W47A 2R062 3HBZA 5C3RA 4BIOA 5ABJB 3OBZA 4EWAA 1IHMA 3SMHA 3TEYA 2X10A 4LUKA 5JOZA 3IIIA 3ZYJB 1XOYA 3NAPC 3MDPA 2AREA 3UYJA 1ND2A 1JS9A 4W65A 1SFPA 3IDEA 1L7LA 2VBPA 1UAIA 4ONUA 2Z4FA 1DQ5A 2UWCA 5C3OA 1E5IA 2WJSA 4XTPA 2RS13 2DVGA 1QJX3 3I8TA 1OXCA 3MFAA 5JVVA 3WR0A 4N43A 1HV0A 3WCSA 4A3XA 3DEMA 4OZXA 3NSTA 4UW4A 5L9RA 4Q4Y3 1TMF1 2WZEA 2XWJB 5C6CA 1DBNA 1TG7A 2Y6GA 3WLUA 1XE7A 3C7OA 4H7LA 1CAVA 1R1A1 2ZPXA 1W2UA 3ASIA 4XJZA 1RXGA 1OPOA 4IEZA 4AI2A 1O3SA 2Y60A 1GOHA 1TNFA 2GP3A 2FDIA 4LMFA 1LB2A 3QCWA 2VOKA 2DURA 3PVEA 5CB7A 2W46A 3LGRA 5DN2A 1B35C 4PI2A 2NYYA 4Y33A 3DPRC 1PO23 4UWDA 3ZSEA 4A6OA 3VUOA 4XFAA 5IHRA 4I02A 1O4TA 1KEXA 5BNOA 4H55A 1Y9GA 4V2WA 1FT9A 2P2KA 4XXAA 2QQMA 2YV8A 4AHWA 1NT0A 2C4XA 4R9AA 3KF3A 5FZ3A 1LGCA 5H9QA 2YFUA 2ZBJA 4LE3A 2P5BA 3ZYHA 1ZBE3 5BNNC 2ZX2A 5IVCA 4XJUA 4Q0QA 3AP6A 1N1YA 3BYWA 2DVAA 2QQOA 1UYXA 4HONA 4XJ9A 2Y6LA 2HBUA 2OW4A 4KWLA 2PELA 2GZWA 4PF1A 5BYNA 4FCAA 3PJQA 3FUQA 3O1RA 1ZA4A 1SPPA 5LK5A 3T08A 5A6XA 4LR4A 3O0VA 3PIJA 5DAXA 5FYVA 3HT1A 2ATFA 1NQJA 1CGPA 2VZ3A 1T6GC 4G9SB 3M70A 4O61A 3VBUA 5FZOA 3H3ZA 4Q4W3 1UPSA 3ILRA 2Q1ZB 3VBOA 1AHSA 1GP5A 4YNIA 5GLUA 3BTXA 3VV1A 3MHZA 4KWUA 2NM1A 1GP6A 1QHDA 2XJPA 4BQ4A 2ET7A 2OXBA 3OTFA 3OCPA 3WSOA 4CXYA 2XLAA 1W0OA 2ZJCA 3WV6A 1LGNA 5CG9A 1YQ2A 1D2SA 2RR13 4IUGA 4LHSA 2PQQA 3V65A 1V00A 3ZSKA 2LALA 5FY0A 3JCIA 4UF0B 4BQXA 4BHPA 5J3UA 3E1F1 1S0CA 2R041 3U07A 5JMCA 4YZ4A 4GWIA 2GC2A 1YC61 2GSYA 3B9IA 3O12A 5HXMA 3AJZA 3SH3A 1RUC1 5F3CA 5HPOA 2R0FA 4AI0A 1UKRA 4XILA 4XCBA 4ORFA 1X33A 3B01A 1IS3A 3HEIA 1NZCA 1PGSA 1KJRA 2HWB3 2N7GA 1VLNA 1AR63 1VB2A 4KWKA 4YW1A 5T5PA 4BLIA 3SCGA 4MG2A 4Y22A 1H8VA 1AR62 4QGNA 5JSPA 4QDQA 1MEC1 3GALA 4IXLA 5FK7A 3RG0A 1Y7BA 1YHFA 5KHKA 4XZPA 2BVBA 3VL9A 2KR2A 1JZ5A 4AZZA 5GZDA 5J98B 3CZUA 4CP0A 3H3LA 2A6WA 5HXVA 4L8QA 2Y33A 1WW7A 1UL9A 4LULA 1JYCA 3CLPA 4XUTA 1DGWA 2BRTA 4FBFA 5CFDC 3HIFA 4NR1A 2YGMA 2Z2SB 3WNXA 1EV13 4E27A 3D8CA 1CAUA 3ITQA 3ZKUA 3CDZB 3IDBB 1DU3D 4FP3A 1GQHA 2YC4A 2YYOA 4L0PA 5FLIA 1JMUB 1PMIA 4J1WA 3DUIA 2R042 4XFGA 1ENRA 3N9PA 4GA9A 3MV11 3Q8BA 1XNKA 4FOQA 3WP6A 1SBFA 4AHZA 4EJRA 1UMZA 4J1XA 5AC93 4BISA 2WZ8A 3ZYFA 4UYBA 1RUC2 2R071 4FVVA 4XUQA 1WLWA 2PHFA 1D2QA 1MACA 5D8AC 5T52A 2JX9A 3KCYA 3R4DB 1XE0A 4JV4A 1KJLA 1OLRA 1ONAA 2DWRA 4HVRA 1QJU3 3SCHA 4O65A 3ZYBA 4XZUG 3E5XA 3ZFFB 3QH6A 4NO4A 5JXJA 5KXDA 1QJU2 3OY8A 1X82A 5FZMA 1ND2C 5T5LA 1IPSA 4M00A 1O3RA 3LEIA 5A70A 3IPVA 4W6XA 1UOGA 4J25A 2RMU3 1YFXA 2XBO3 3VHOA 4AFCA 2P37A 2KXLA 4ES9A 5ABJA 3K3NA 1JZ7A 3IDAA 4N43C 2WAOA 3E6CC 2X8KA 3V0AB 1GNZA 5E88A 5F6LB 1MPXA 1WMEA 1WCKA 2ZGUA 4XYXA 5DAWA 4KH9A 4XUPA 4B7EA 2CGNA 2E7QA 3BIEA 4LHKA 3ES1A 3ZYPA 5LBFA 2WYFA 4N90A 3I54A 3WNNA 3B93A 3ZR6A 2Q1MA 3J8F1 4XW3A 2W87A 3VKFC 5GALA 1RHI2 1V6LA 3PLQA 3ZSLA 1NAEA 3G7DA 4MHRA 2DUQA 2QE3A 4QXBA 3GZAA 2TEPA 5J36A 3U10A 4CUBA 3SC7X 5JXGA 2HKXA 4ARYA 2E31A 3BOWA 3PNAA 4QMAA 1CZVA 3IAQA 2YHJA 4F3JA 4XF4A 4DUWA 2WNOA 5FZGA 1KGYA 3ROUA 4FPEA 3VDBA 4CUCA 4LO6B 1MS1A 3LCPA 2ZHNA 5ACA3 1KFUL 2DDUA 1UZZA 1VB4A 4MGZE 4MXWB 1VBE3 4GB31 3N9LA 4QWNA 3AZVA 1XU2A 4Y24A 3CMGA 5ACA2 2ARCA 2DFCA 1VBE2 3KVBA 1EAH2 1O6UA 2JDAA 2ZX3A 3NJVA 4COUA 4TN7A 4MHUA 5FZAA 5C9AC 1NLSA 2AUYA 5FPBA 5FZ6A 5BNPB 2RVAA 5F5AA 4QAWA 3ZLIA 3NJYA 1NE6A 3U0ZA 4NMIA 2W1SA 1W0NA 1W8ZA 4QB1A 3GHNA 4HZFA 4WBBA 3VBUC 2GNBA 3F2ZA 2AZ5A 1XQNA 2PYTA 2Y38A 2DU0A 1LJ7A 3FMGA 2W52A 3NMBA 2JDKA 2OX0A 3J8F2 3OEAA 4RHV2 3VBOC 3TOJA 1RYYA 1QQP3 4GJYA 2WNEA 1VBC1 3CJIB 5HV0A 4XACA 1PMJX 3W21A 1OKQA 2E9QA 1D4M3 2HJIA 3I2IA 5E8AA 4NIAA 1V6KA 4YGBA 1S0EA 1HV1A 2Y6HA 1AF9A 4IDZA 1HJFA 1K3IA 3NNJA 4JQTA 5A7QA 2VZVA 4YG3A 3CHXA 5IWFA 1BBT1 4JZRA 4BLJA 2ZOEB 2ZHKA 1UOBA 4FPLA 4LBQB 4AVTA 4LBQD 3BGAA 1NY71 1YQCA 3N7JA 2BBVA 2QZ2A 4QX5A 1AR81 1SFNA 3THTA 2VUDA 5BY5A 2BVVA 5JXHA 4FTEA 1WKYA 2YDEA 3DV8A 3OD0A 3ZFEB 1MS3A 4UF0A 3K75B 1JHNA 2UYBA 2XLFA 2EIDA 2G1MA 4H7MA 5APAA 4AQ6A 3DYOA 4HLTA 1C4RA 1Y3TA 5FYIA 4Q0PA 4UT5A 2IFWA 2WNVB 1HKDA 3INAA 1AL21 2YGLA 1XYOA 1HRV1 1KRIA 3Q8EA 1I6XA 1POV3 1U5IA 1WLCA 1AYN2 5F2SA 5FPLA 4YZ1A 5JCTA 1EUTA 1DP0A 4Y5SA 2EALA 2ARAA 3O0WA 3FZ3A 5FJKA 4GULA 2VULA 5GKAC 1VBC2 5E89A 2A6ZA 3FHIB 4LBKA 3R0RA 1QJEA 1F5FA 2JD4A 5IFTA 4ATEA 4LEJA 4AXOA 4CCLA 3VHPA 4NPRA 4CTEA 1TME3 3ELNA 5FO7B 4UBGA 5DZGA 3C2UA 4QX1A 4QKDA 1BBT2 4I0BA 1CD3G 1COV3 1QEXA 5D21A 1HRI3 3I3QA 2IXIA 5LATA 4XHXA 3LKJA 1REEA 3ZXAC 4BE3A 2G4IA 5JZGB 2P1BA 1AR82 3RFRA 3DL3A 5A33B 1BMV1 4YW6A 1CX4A 5IATA 3T2PA 2FDGA 2DYCA 4IEUA 3SQOA 3KM5A 4OUEA 4Z07A 3S5AA 1APNA 3A21A 5A3NA 3ETQA 3NNMA 3AXEA 2Y6JA 3P6BA 1AL22 1W9TA 1AYM3 2BNOA 1HRV2 2P17A 3B9CA 4PJYA 4R4ZA 4XQDA 3WOGA 3T1MA 4AAXA 1AX1A 1AYM2 1I5PA 3KQ4B 2Y64A 2D6OX 3H0OA 4N8MA 3T0AA 3WF2A 1Y43B 4B1MA 2FDJA 3ZFFA 3IMMA 4BCUA 4AWDA 4H2AA 1WMFA 3GZUC 2BW8A 2GALA 2GP5A 2BPA2 3WHTA 4CDQB 5GZCA 4FFGA 3AFKA 4P9GA 4B7KA 1SLIA 2D6PA 5FRAA 3BALA 2HWD3 3V0AA 3PUAA 5FREA 1LESA 2QQNA 2F6BA 4KG0A 4XAAA 4XF1A 5DQ0A 5LA1A 3RZJA 1EPWA 2BNMA 4FP2A 3T2OA 3OBAA 1K5JA 4RFRB 5JI7A 4D6SA 1Z7S2 3MIHA 4GZ9A 4L11A 4YVSB 4FXGB 2DCKA 2EAKA 1RUD1 3IIAA 3AKQA 2WL1A 2WO2A 2I45A 2XMLA 1R64A 3FX3A 3QH7A 4KGQA 4NHXA 4BM8A 1HW5A 5E6HA 2UY8A 4FFFA 1WZXA 5FPVA 2WZR1 1REFA 2BBAA 2DTWA 3HOBA 4JKKA 1VRH1 2RJ2A 5A32B 1SZBA 5IVEA 4J6GA 5DUXA 3EYPA 5J48A 1XE8A 5A3LA 3WUDA 1AZDA 4KI5M 3FLPA 2VMCA 5T50A 1REDA 1A3KA 2HEYF 1UZVA 5E1RA 1FX5A 4ISRA 4Q26A 1HN1A 4QX0A 4QX8A 2JE9A 1C8M2 5FMCA 2WA4A 4WVZA 3FLTA 1FV3A 1J3QA 3AXDA 3ZDSA 5FO8B 3FHAA 2O8QA 3DXTA 3TNPB 4MXWA 3JU9A 3VZKA 1GWKA 2VBDA 1RMU2 2RV9A 1RUE1 2B5HA 1N3QA 2P4EA 1W8UA 1IKPA 3VBHA 1CR7A 1IS5A 1L7RA 3GCWA 3AKTA 3I4IA 5EJ1B 5BNPA 1G9AA 3SEEA 5EWSA 5A3WA 4C8DA 1DLLA 2D3RA 3WNOA 2QQVA 3H9AA 2R6QA 5CFCB 4IE6A 3VZOA 2H6CA 2Y8KA 5FXZA 3CJXA 1AR93 3AMHA 3LZZA 2ZTNA 3O7OA 1RUD2 5FWJA 1AR92 2DBNA 3WNPA 5IW0A 4H14A 5C4WB 4Q0UA 2UYAA 2WYSA 1QH6A 3RPQA 3V0BB 1EP0A 2P6HA 1VRH2 3PL0A 2FCTA 3RZZA 4HXCA 3MIFA 4D94A 3OJBA 4HBNA 3K51A 2ARXA 1S2BA 2LS6A 2XPJA 1EUUA 4KU7A 4MX3A 5KBFA 2QQUA 1AL0G 2PXJA 5G04L 3TN93 2B45X 4DZGA 1E57A 1DQ1A 1GQGA 1GR3A 2QVSB 1W6PB 4NRPA 2CDPA 4YWAA 1RUI3 2ID4A 2WN3A 4XDPA 1PNGA 5GZEA 1ND3B 4Y1VA 3B5LB 1G9CA 5EYXA 3T4HB 3ZFEA 2H0BA 2B42B 1RUF1 1RUE2 3UV9A 5AFEA 3JB8A 2ZMKA 4DFSA 4GQ7A 2PHWA 4XUNA 3U4SA 3GDBA 3VZNA 2A3XA 3JQXA 5C8CB 1PMHX 2WNVA 3KGZA 2EXHA 3AYEA 4QT6A 3MBWA 1F15A 1ULDA 4Q8LA 4BIFA 4P9IA 1QJFA 5I0UA 4I01A 2W5FA 3HD8B 2VOWA 1Q8OA 2CGOA 4QDRA 5IUQA 1QMJA 1W8TA 5A7WB 4CP9A 1VBD1 2DCZA 2A6VA 2MEV1 3IMNA 1YRZA 4IGQA 1YI7A 2X5IB 2R30A 4RQPB 4X6RB 1LEMA 4GALA 4P5HA 5EPAA 4AGGA 3N35A 5F39A 3POYA 4MGIE 3IKWA 5JR7B 2JJ6A 1IPKA 5DDJ2 2HWF1 3KV4A 2Q8CA 3LIGA 3MICA 4I2OA 2D3PA 4TZDA 3JBG1 4BU2A 1F35A 5A7NA 3WF1A 1BQPA 1WMXA 5FJHA 1PVC1 5GZFA 1DYKA 3DKQA 3P5BA 5FZIA 4YZ2A 4GWJA 4AOCA 1V6IA 3ZXEA 1RUH1 1KDKA 1VBB1 5JZGA 5C5UA 1ZRCA 1CIWA 3JUUA 4QB6A 4NE9A 3L2YA 2QDNA 3A23A 4IEYA 4WV8A 4N9IA 4XJAA 5A33A 2FDKA 5JAXA 1CJDA 1RUF2 1X9TA 5HBAA 3ZFFC 4C91A 3N7KA 4QB2A 2OA2A 2PMWB 3RSJA 5CISA 3I2DA 1SLCA 1OVPA 2HLEA 1C28A 2JDZA 3WG2A 1I1EA 2ZX4A 2P3KA 3OEBA 2MNGA 1SLLA 2WFF3 4UFLA 1WW4A 4ASMB 4PCRA 5EJ3A 5FPXA 1BYHA 3BB6A 1VBD2 2HWE2 1SCRA 4YLZA 4BYYA 2C26A 1C5HA 2ZAAA 5DAQA 3ZN6B 2O0OA 2VQAA 1C5IA 2HWC2 2BQPA 3AM2A 3S30A 4YARA 4URAA 3WDVA 1W9WA 4CP2A 1HX6A 1PGW2 2Q1FA 5LBBA 4CDQA 4DRVA 5C5TA 4QQLA 3WEZA 4YW5A 4ZU7A 2WA3A 4ARXA 3UGHA 3D3AA 1PVC2 4AFBA 4CZSA 3KCCA 5CG8A 2CYFA 4FSJA 1WCQA 1IOAA 4YVSA 2CNAA 1MS8A 1RVF2 1G7YA 3QACA 2LTNA 4TWTA 1OI6A 4PLOA 3RZGA 3PUQA 5A3TA 1JH5A 1QJZA 4CRQA 4M0NA 1FPN3 3I59B 2UURA 3MF6A 4PHZA 1M06G 5CA6A 4CUAA 3PMEA 4LIUA 5A32A 1ULCA 5K0UB 1DG6A 2X53S 5HCBA 3DXUA 4YYOA 1FAYA 4CCNA 5I0TA 1LHWA 1QY4A 1J1TA 3L9JT 4CVUA 2NZ9A 3E5UA 4LA3A 3RJ2X 1UYZA 4AYUA 1W9SA 1C8NA 3J7MA 5FUNA 3VBHC 1HXS3 1ZREA 1W28A 1QXRA 1H6YA 5BNPC 1JW6A 2JICA 4R52A 2WQ8A 2BUKA 4ZS2A 3ZOIA 4E2QA 4AI1A 4NIGA 2IZWA 4BDVB 3UGGA 2VW1A 5F3EA 3FC0A 1HLCA 4S2FA 1UYYA 2QFEA 1MQTC 2JDYA 2VG9A 1F31A 2RS51 4LO7A 3RI8A 2BU9A 2XJTA 5C71A 2PLV1 3N9MA 4QPIB 4XFIA 1C3HA 1S55A 1YNAA 1CPNA 4Y1UA 2QZ3A 4CDWA 3I97A 3RI9A 2XJUA 1DGRN 5BXXA 5CFCA 2JG8A 3UJQA 3SISA 4A7ZA 3GCXA 1H1MA 3Q8CA 4UFMA 1YEWA 1URXA 4NHYA 5A7OA 4NWWA 2ZABA 1QNWA 3LA2A 4XF0A 5C4WA 3VD9A 2V73A 1DQ2A 1ASJ1 3IM0A 4EWEA 2JKBA 3RS6A 5C7GA 4S2HA 4Z82A 3LDKA 4FQ4A 4LLOA 1MZ6A 1KQRA 3V0BA 1OUXA 3VZLA 5FQ0B 1ALYA 4N7UA 1ZM1A 2JDNA 5A7PA 4HPKB 4JHZA 1JZ2A 3ZFEC 3NNGA 5EXOA 5FIXA 5LWBA 2VMDA 1ZBA1 2DU1A 5BPXA 1RXFA 3KB5A 4Y20B 4K9SA 1DLCA 1H30A 1UNBA 4BA6A 1ZRDA 2ZX1A 4IEVA 4JDNA 3RRDA 2GNTA 2WNVC 3JB4C 4NVPA 2VNRA 1W6PA 2R063 2V72A 3MPBA 3ZXDA 1UIJA 4BWOA 5I91A 3JD72 5LRSA 1QOOA 1ND3A 2Y34A 4Q4Y1 2NMNA 1QXPA 2ZHMA 3HNYM 4MGYE 1MZFA 2XB6C 5KXCA 3T0DA 2VUJA 5L73A 2XL7A 2CU5A 4XFCA 3ZYRA 2Y0OA 2D5FA 5E16A 1V9U3 1O3QA 4XETA 1S2EA 4DY3A 3UL2A 1VALA 2EIGA 1V9U2 1OVSA 3BTAA 3OGRA 1IG3A 2YG0A 3WP5A 1LEDA 5FMOS 4O9GA 4KL1A 4PIXA 2AH2A 1QDOA 1YQ5A 2OZ6A 1AXZA 2X5IA 4MXVA 1PO21 2BGPA 3AL5A 3OF1A 3OSDA 4QQHA 4RQPA 1PO11 1DYOA 1I5ZA 4JGYB 4UFKA 1HJGA 1IPJA 5T3NA 1KS5A 2VOVA 1K5MB 3NV3A 4OQ9A 5JZGC 4WZCA 2FCUA 1IQDC 3M2MA 1ZRFA 3NO8A 3AZWA 2H0VA 5EP9A 5FY5A 2WKKA 3GXUA 2VZ1A 2PHTA 2WS91 3A4UA 1H8TB 4Z92B 4BMBA 2GNDA 1OD5A 3RMXA 1BVVA 1G8WA 1OC1A 2D43A 4JKMA 3N36A 4XXPA 2CHHA 3OD4A 1PIV1 4CCJA 3W59A 3FBYA 3B02A 4MV2A 4KNCA 2FQPA 3ME2A 3MUZ1 3CKHA 4LBJA 1LULA 2VW0A 4C0BA 2DVBA 4RYDA 3KV6A 5JSOA 4GH4B 5A3MA 5FYCA 5FYUA 2XLGA 1ST8A 4QHOA 4CDQC 4IW3A 1H4GA 2JXAA 1BZWA 1ZVFA 4QQPA 4YM0A 1J84A 3LWCA 1RITA 2PHDA 2D44A 1TMF3 1VRBA 2XJRA 3E97A 3PDQA 3O1VA 5C8CA 1TMF2 1LHVA 1PO12 3DGTA 4OHXA 5FFOC 4QXHA 5FZEA 1R1A3 2RR11 1AX0A 3HQXA 4LBOA 1MVQA 3T2TA 1W8NA 4AGRA 4QKBA 1R1A2 3ZPYA 1W9FA 2AYHA 4YVSC 3GNEA 2WSVA 4U2AA 5L7OB 3LSDA 3KT1A 3OYWB 2VM9A 4BXSV 4SLIA 4EWDA 3LD8A 3C7FA 5AVAA 5FYTA 1SEFA 2JD9A 3WVJA 3AB0A 3AKRA 5IK4A 1I9RA 5FUPA 2HWB1 4HVQA 1LOEA 1BJQA 3OGJA 4IGOA 3MFCA 4KU8A 2PHRA 1SHWB 5FZKA 2VUAA 4RL7A 1GOFA 1POQA 4QX2A 2PQSA 3IDCB 1DQ6A 4IEWA 1LOBA 5DXDA 4FPKA 3I59A 4B4QA 4JTOA 4PT6A 1IKQA 3NL1A 2GH8A 4OHZA 5GM0A 1NXMA 5K0UA 1T2XA 2FMYA 3ZSJA 5FKCA 2VZSA 4CSWA 4JAAA 3GBGA 1E5HA 3HMYA 1U12A 1PK6B 4PDWB 3H1WA 3LA3A 4IL7A 4JRAA 5DAVA 1DZRA 4ZY9A 1QU0A 4ZU5A 2WNUB 3Q8FA 2VL4A 2NLRA 4CDWC 2VNVA 2FDHA 3AMNA 5CFCC 4OMCA 1OFNA 2JG8C 3H1YA 4R9DA 3V56A 4OUSA 3VDCA 3DYPA 5D1IA 2UWBA 3ACGA 2XXZA 1FI2A 2J1EA 4W8JA 1TQ5A 2YC0A 4Q4V1 2PHLA 3OGVA 2W91A 4LXLA 5C4WC 4QPIA 3U4XA 5KHGA 3QD6A 4V1PA 3N4MA 1JYWA 3L2HA 3ZX7A 5C3SA 3JXSA 3MLJA 2BGCA
chains in the Genus database with same CATH topology
4LK7A 4BQ5A 4LKEA 2LRPA 4YWAA 3ZYHA 1W8ZA 3F95A 4A6SA 2KR2A 2VXJA 3ZYFA 3ORJA 4LJHA 1L7LA 1WMXA 2JWPA 3UT0A 4LK6A 1GWLA 2WYFA 1W8WA 2K46A 2LROA 1GWKA 4CPBA 1OKOA 4YW7A 5D21A 3ZYBA 4CPBD 4AL9A 1WCUA 4LKFA 1HN0A 1GWMA 1W8UA 1W8TA 2Q1FA 4LKDA 1OH3A 1WZXA 4CP9A 1W90A 1W9FA 4CP9B 2C24A 4BQ4A 1UOJA 2O14A 4YW6A 4BQ3A 1V0AA 4BQ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LK7 A;  4BQ5 A;  4LKE A;  2LRP A;  4YWA A;  3ZYH A;  1W8Z A;  3F95 A;  4A6S A;  2KR2 A;  2VXJ A;  3ZYF A;  3ORJ A;  4LJH A;  1L7L A;  1WMX A;  2JWP A;  3UT0 A;  4LK6 A;  1GWL A;  2WYF A;  1W8W A;  2K46 A;  2LRO A;  1GWK A;  4CPB A;  1OKO A;  4YW7 A;  5D21 A;  3ZYB A;  4CPB D;  4AL9 A;  1WCU A;  4LKF A;  1HN0 A;  1GWM A;  1W8U A;  1W8T A;  2Q1F A;  4LKD A;  1OH3 A;  1WZX A;  4CP9 A;  1W90 A;  1W9F A;  4CP9 B;  2C24 A;  4BQ4 A;  1UOJ A;  2O14 A;  4YW6 A;  4BQ3 A;  1V0A A;  4BQ2 A; 
#chains in the Genus database with same CATH topology
 4MVT A;  3WZ1 A;  2LRP A;  2NQY A;  1ZZ6 A;  4FXK B;  3ZMN A;  2R04 3;  3BU7 A;  5GJ6 A;  2GMP A;  3GBW A;  3AL6 A;  3SKV A;  3LF7 A;  3ZYG A;  4QKF A;  4LTA A;  2VE1 A;  2ZGL A;  4QU2 A;  1IGO A;  5H9P A;  4E4S A;  4Y1Y A;  3VDA A;  4ZON A;  1YIP A;  4QU1 A;  1RUC 3;  4O7X A;  3NVC A;  1RUJ 1;  3NKG A;  4LK6 A;  2VVF A;  4HPK A;  1ND3 C;  4NRO A;  4XHB A;  3THD A;  2PAM A;  2YBP A;  4DS0 A;  2WC2 A;  1LHN A;  2A3Y A;  4IE7 A;  2GC0 A;  2WO3 A;  4DUX A;  1OOP B;  2R1D A;  3FN9 A;  4Y20 A;  4CEY B;  2EVX A;  2C0Z A;  4DXS A;  2XDV A;  2WRA A;  1MEC 2;  1SFY A;  1ZA7 A;  2QTW B;  3MID A;  2GDF A;  4ZU4 A;  4JGZ B;  5LRR A;  4ZS3 A;  3KZ4 C;  4IND A;  4XJW A;  5C8W A;  1UU4 A;  1J3P A;  1MR5 A;  4JCK A;  1NCR B;  1W2N A;  2VZT A;  2Z79 A;  4U36 A;  1XPW A;  3ZXF A;  4XUO A;  2X5I C;  4RQP C;  1TVG A;  4Q4V 2;  5A1A A;  5AVP A;  5GLT A;  3VBS B;  1UN1 A;  1NE4 A;  1DGL A;  3KMH A;  1WLD A;  4OUM A;  4QPY A;  2GN7 A;  2R7E B;  4XBN A;  4YSF A;  1H1A A;  1SQ4 A;  1N1T A;  5JR2 A;  5FZ4 A;  3PUI A;  3SXW A;  5JIU A;  1RHI 3;  2PHU A;  4HK8 A;  3AFG A;  1S4C A;  2VCC A;  2LW8 A;  2MPF A;  4DQA A;  4BB3 A;  3MO4 A;  2ZHL A;  1BVP 1;  4FPY A;  4CXX A;  1U0A A;  1OT5 A;  4JGY A;  5AFB A;  3GYD A;  1TEI A;  1H2M A;  1W39 A;  2R07 3;  1K5M A;  1FAT A;  3B00 A;  2R07 2;  1UY2 A;  5BNO C;  1D0G A;  2WLQ A;  4ZKT B;  1X36 A;  2YXS A;  2QUO A;  5FZ8 A;  4AGV A;  3U14 A;  1H8T A;  3BTZ A;  1YFW A;  4AI3 A;  4PI0 A;  4JKL A;  2Q5T A;  4EN6 B;  1GZC A;  2B8M A;  1ENS A;  2DUP A;  5C70 A;  4AEJ A;  3T4V A;  3VDD B;  3W20 A;  1OLQ A;  5GLW A;  4Z2W A;  1ULP A;  3H8R A;  1K12 A;  3B3Q E;  1EAH 3;  4M4R A;  1QQP 1;  1GWM A;  1D4V B;  3N9Q A;  4LKD A;  5IK5 A;  2VR4 A;  2ZGP A;  3BPS A;  2VJX A;  2YC2 A;  5I8S A;  1LGB A;  1FOD 1;  5C8C C;  4NPM A;  1U5Z A;  4GH4 A;  3OGG A;  1T6B X;  2OPK A;  3AC0 A;  3F95 A;  3OUI A;  5I0D A;  2XOM A;  4RHV 3;  3E6D A;  2ZZQ A;  3J8F 3;  4CCD A;  1R09 1;  1G9B A;  4YW4 A;  4PQ9 A;  4QX7 A;  1W6N B;  5FXX A;  4BQY A;  4DRR A;  3SIT A;  2F17 A;  5EHD A;  2VOT A;  5LEJ A;  4GD4 A;  2IXH A;  5EV7 A;  2B9V A;  4DXT A;  1SG3 A;  1H0B A;  4EQV A;  2ZGR A;  3ZR5 A;  2C24 A;  2GAU A;  4XIO A;  4Y5T A;  3VKN A;  5L7O A;  3OYW A;  4FO9 A;  2B7Y A;  4E4H A;  4MOA A;  2W1Q A;  3ZYI B;  5JOW A;  4LKE A;  1CZT A;  2X09 A;  3QOP A;  3S57 A;  1POV 1;  2KD7 A;  4OHY A;  1UMI A;  5K0U C;  2TNF A;  1JZ6 A;  2AGS A;  4K40 A;  3PUR A;  1MS9 A;  4BXF A;  2XVL A;  5K8S A;  4L2N A;  4KGG A;  4I09 A;  4XFF A;  5JOX A;  4GB3 2;  1GZT A;  4LJH A;  4QGM A;  4XIK A;  5F7U A;  4JVA A;  1HB2 A;  3UT0 A;  2V09 A;  4Q29 A;  4WM7 B;  5L19 A;  3SHR A;  5FBZ A;  4ZXK A;  1W2A X;  3D0J A;  3VD3 A;  3SCF A;  1MZ5 A;  3MF9 A;  1W05 A;  1TME 1;  1US3 A;  3PTR B;  3I3B A;  1GSL A;  1AYN 3;  2AEZ A;  3LE0 A;  3KT7 A;  3VZM A;  2XUE A;  2E7A A;  2JKX A;  4DPN A;  1OA4 A;  1PK6 A;  1R09 2;  4W4Z A;  2ZGS A;  4N53 B;  4PDW A;  1HRI 1;  1V6J A;  4IER A;  4M3C F;  4ZZ5 A;  1VBC 3;  2I74 A;  3WDX A;  1N3P A;  4KBB A;  3WNM A;  2WNU A;  2D93 A;  1Q43 A;  1J59 A;  2VU9 A;  1CAW B;  3WX5 A;  4A41 A;  2P6C A;  4FI9 A;  3WG1 A;  1ZX5 A;  2P3J A;  2ZS6 B;  2DFB A;  2ZX0 A;  4N9H A;  1WBF A;  3VLB B;  4AE2 A;  4NOT A;  1BBT 3;  4YM3 A;  2VNO A;  5IVF A;  1GQP A;  1RJ8 A;  3RNS A;  2G9Z A;  2JE7 A;  1NYW A;  4CPB D;  1AR7 1;  3T2Q A;  3BUC A;  4KMQ A;  2BTV C;  1AR8 3;  1NY7 2;  1OMI A;  3DYM A;  3H8O A;  2W2I A;  4MUV A;  3POE A;  4Y5Z 0;  4YVW B;  3O1M A;  3C3V A;  5F3G A;  4LK7 A;  3W58 A;  4BK5 A;  5GZG A;  5IVY A;  4Q4X 1;  1UZ0 A;  5EFU A;  1AXK A;  2RM2 1;  1LNS A;  1SDD B;  2UU8 A;  5HCA A;  3I49 A;  1XNT A;  2FHR A;  3AZY A;  1AL2 3;  4QPW A;  3RWN A;  4OQ8 A;  1HRV 3;  1E5R A;  1A6C A;  2W3J A;  4RD7 A;  1DHK B;  4XFB A;  2CSG A;  3WF3 A;  1MZE A;  2JEM A;  2SLI A;  3G6J B;  3ZKY A;  4M3C E;  5K4L A;  4NHL A;  3ILN A;  3MLL A;  3AZZ A;  1C57 A;  1NOV A;  1UX6 A;  4YG6 A;  1K45 A;  5FOB B;  2G9G A;  1FMD 1;  4CEY A;  4XC9 A;  1WCU A;  4RGK A;  5JIA A;  1UQX A;  2RS3 1;  2V5D A;  1Q5O A;  3PUS A;  1UY1 A;  3WDT A;  4AR2 A;  5CKM A;  2J1U A;  1V0A A;  3J7N A;  4QPG B;  3NV1 A;  4RN5 A;  4Q1R A;  4NWV A;  3RJR A;  2WDB A;  4IEX A;  2WZP P;  4IV3 B;  1QOS A;  4HMZ A;  2A6Y A;  4UAP A;  3DPR B;  1NCR A;  4QHB A;  4XVH A;  2O1Q A;  4LBN A;  3I7D A;  4ZPI A;  2HEV F;  5A1L A;  4IET A;  1AR7 2;  1JOJ A;  1Z7S 3;  4JGY C;  1JBC A;  2JIG A;  3RYK A;  1CQ9 A;  4Q8K A;  1OHF A;  3VBS A;  2NP0 A;  2FDF A;  2EA7 A;  1K5M C;  3KCX A;  1J3R A;  2D7F A;  1CES A;  1CN1 A;  4I0W B;  3W5N A;  2PA7 A;  3VHR A;  4OI0 A;  5DUU A;  1BMV 2;  2WWJ A;  5CU1 A;  1CON A;  3W9A A;  3IZO A;  3K4Z A;  1QWR A;  1H8T C;  4Q4X 2;  4HN0 A;  1R1Z A;  2YU2 A;  3AP5 A;  4IV1 B;  3CO2 A;  3I2G A;  2OKX A;  3WCR A;  2EIE A;  2RM2 2;  4CDU B;  1CX1 A;  3MPP G;  2E7T A;  1VBA 1;  1GV9 A;  4LUM A;  1WBL A;  1ZZ8 A;  2ZML A;  3A22 A;  4FPJ A;  4B1L A;  2JG9 B;  1H9P A;  5IVB A;  3ZSM A;  2FD8 A;  5DZF A;  4M0H A;  4D6R A;  4FPC A;  2VVE A;  1OFS A;  3OGS A;  5CBL A;  3KHB A;  2AAC A;  4GWM A;  1C8M 3;  2RDR A;  5FMD A;  1FMD 2;  1O8S A;  1L7Q A;  1OD3 A;  1O4Z A;  1O5U A;  2BFU S;  2GNM A;  2RS3 2;  4GH4 C;  2GME A;  2AR6 A;  2C9A A;  3VDD A;  3JZV A;  1A34 A;  3POG A;  5FY1 A;  5CAD A;  1RMU 3;  2DCJ A;  4Q27 A;  4YW7 A;  4OHW A;  5FYS A;  1HB1 A;  4XUR A;  3USU B;  4ASK A;  1JXN A;  1UX7 A;  4M3C B;  3RZM A;  1JYV A;  4YZ5 A;  3A0N A;  5A1F A;  1YWK A;  4ZZ8 A;  4P08 A;  4DEQ A;  5LZ6 A;  3MUY 1;  1BK1 A;  2VVD A;  1OLM A;  2D6K A;  4Q1P A;  1JUH A;  1FXZ A;  4LOR A;  3ZXG A;  4FPF A;  3OUJ A;  1YIF A;  2K0G A;  2GC1 A;  4NUB A;  4LLF A;  1RUD 3;  3V64 A;  4GXL A;  1VJ2 A;  3C7G A;  1W6N A;  5KHJ A;  1XB9 A;  3MW2 A;  4Q0S A;  1RUI 1;  4EN0 A;  3CJI A;  2EIC A;  1VRH 3;  5FZC A;  3WDW A;  2WZR 2;  1VBA 2;  3KHC A;  5FZ9 A;  2C6S A;  4NAO A;  4PLN A;  2VQU A;  3HJR A;  3WD5 A;  1VE0 A;  2GH2 A;  2ZKN A;  4QGL A;  1R08 1;  5A3O A;  4WVM B;  5IK8 A;  3EB7 A;  3M4F A;  1GYK A;  4XOG A;  4AQS A;  1DYP A;  5FMO L;  4BQ3 A;  1UF2 C;  2D3S A;  1OSG A;  2ZGO A;  3WW1 A;  2BOI A;  4NII A;  2R49 A;  4LBQ A;  3HQU A;  3FE5 A;  2BER A;  4CCE A;  1QOT A;  2UY9 A;  2CAU A;  1H2K A;  1RIR A;  2W1W A;  4AG4 A;  5DMY A;  5JPN B;  1S2K A;  1Q8V A;  3AMQ A;  2XJV A;  1RUE 3;  3FFQ A;  4IE5 A;  2W39 A;  4UFI A;  5CFD B;  2LUW A;  1PK6 C;  1UYP A;  4PDW C;  3T1L A;  4HSL A;  1SAC A;  3POB A;  1XBF A;  1XNB A;  4I0A A;  4WM7 A;  3S0M A;  3RMY A;  1EY2 A;  3WQ0 A;  2PAK A;  1EPZ A;  2JB4 A;  4O9E A;  3W5M A;  4BOW A;  4BQW A;  3B94 A;  5H9S A;  4N53 A;  4YZ3 A;  1UO9 A;  1YXW A;  1ENX A;  2ADE A;  1Q8Q A;  2LM3 A;  3R4S A;  1POV 0;  5DDJ 3;  4AQ2 A;  4BQ1 A;  4FFI A;  4JDM A;  3S7I A;  1S0J A;  3LOB A;  1CAW A;  2AEN A;  4HFS A;  4QKN A;  2QQP A;  3AYD A;  3HAG A;  3C7H A;  1YCI A;  4UXA A;  2F4L A;  1R08 2;  5FZ1 A;  3NJX A;  3O1U A;  4COV A;  2A70 A;  4R9C A;  1RUG 1;  4FOW A;  2VNG A;  1UU5 A;  4LPL A;  5FXV A;  3C7E A;  4X8P A;  5HI0 A;  4AQT A;  2ILM A;  3SH5 A;  1MS5 A;  4YW2 A;  5CIR A;  2WFF 1;  1DQ4 A;  4Z2A A;  2YY1 A;  5DUW A;  4OHV A;  4E4Z A;  2B39 A;  1P8J A;  2BP6 A;  1QXJ A;  1EYB A;  2Q30 A;  4K1Y A;  2UWA A;  4QM9 A;  4YVW A;  1XSQ A;  4KG8 A;  3VKL A;  1RUF 3;  2WIN B;  2QQW A;  3PVN A;  4BQ2 A;  3S6P A;  1LU1 A;  3ILF A;  4Y1Z A;  1CAV B;  1X9P A;  2IXK A;  4CEY C;  1BEV 1;  3H3U A;  3M3I A;  2DVD A;  2JDU A;  5IT6 A;  4PLM A;  1PNF A;  4CDX B;  3OUH A;  3O1S A;  2IUW A;  2RG4 A;  2Z5W A;  4Y4Y A;  1VBD 3;  1JOD A;  2HWE 3;  2ERF A;  2MEV 3;  1E5S A;  4CCK A;  1QJY 1;  3K4A A;  1NCR C;  3M3Q A;  1H1I A;  1NX9 A;  2HWC 3;  2MEV 2;  3J9S A;  4AFA A;  4DOU A;  4XMI A;  5JXI A;  4OZO A;  4EE2 A;  3R4U A;  4FOV A;  3VGI A;  2XJS A;  2OUJ A;  3HPN A;  3VBS C;  4Z8B A;  5A3U A;  1DIW A;  2HWF 2;  4QPG A;  3AZX A;  4D7S A;  4ISQ A;  3JBG 3;  1GKB A;  2V5Y A;  4X8N A;  4IV3 A;  4URT A;  4XAE A;  5A7S A;  2Z69 A;  1PVC 3;  5B2G B;  1IQA A;  3JBG 2;  1W04 A;  2CY6 A;  3M8L A;  4N7I A;  1HB3 A;  1UPI A;  3TBD A;  2CAV A;  4Y4R A;  1WMD A;  4IES A;  1HB4 A;  2ZEY A;  1RUH 3;  3OB8 A;  3LDR A;  1NQD A;  2YBS A;  4D3W A;  1G6N A;  1RVF 3;  1RUH 2;  1VBB 2;  1C1F A;  1X8E A;  5C9A B;  3LAG A;  4MYE A;  4RSU A;  1ODM A;  1BCX A;  1VAK A;  1JYI A;  3OPW A;  1W2T A;  2J7M A;  3K3O A;  4HET A;  5F5C A;  1GAN A;  4IV1 A;  3U1X A;  4CDU A;  5FZO B;  1BEV 2;  5IFP A;  2XON A;  4LNV A;  1OBN A;  1PZ9 A;  2FZ1 A;  3VDD C;  4R8H A;  2JG9 A;  1BK0 A;  5FZ0 A;  1GZW B;  3ACI A;  4HSJ A;  2VTX J;  5FO9 B;  1ZNP A;  2W1U A;  3ALQ A;  3SNM A;  3POS A;  1YI9 A;  2A7A A;  2OQ7 A;  2ZZJ A;  2HH9 A;  3AK0 A;  3FFZ A;  4IE4 A;  4DUV A;  1YUD A;  4DXZ A;  2XKO A;  1N1V A;  3O14 A;  1LOA A;  3PUH A;  4IEP A;  4LBL A;  4EN8 B;  1A78 A;  2IXL A;  2RE9 A;  1XSR A;  2W68 A;  3USU A;  3WDY A;  1WA6 X;  3VD7 A;  5FY8 A;  4M3C A;  1NUK A;  3I2J A;  5FWE A;  3ZN5 A;  2VC9 A;  3NWK A;  5GLZ A;  5JWP A;  4PIZ A;  2VMF A;  3T0B A;  3CJI C;  4EV0 A;  2XR4 A;  4ES8 A;  5FUI A;  5L36 A;  4LT5 A;  1YJK A;  4F8A A;  2FCV A;  3M3E A;  4CCC A;  2WWS A;  1VAV A;  3LOI A;  1CWP A;  4GMP 1;  4NRM A;  1KXG A;  1RUO A;  4QHZ A;  4L92 A;  2A6X A;  4UI9 L;  3I3E A;  3UGF A;  3GF6 A;  4CA9 A;  4FTS A;  5JDB A;  4BZ4 A;  5SV8 A;  5FV3 A;  3VD4 A;  4XBQ A;  5T5O A;  1AJO A;  5G05 L;  4M01 A;  2E6V A;  4WVM A;  3QLQ A;  4E9K A;  2ORZ A;  3AP7 A;  2Q4S A;  1YLL A;  2MHF A;  4C1X A;  4WM7 C;  1YFU A;  1BKZ A;  3KGL A;  2RS1 1;  4TLF A;  1QJX 1;  4WVW A;  3J7H A;  3U37 A;  5LY1 A;  3JD7 3;  5KXB A;  1JYT A;  3ZIX A;  1VPH A;  5F8P A;  1DGR A;  4XEZ A;  4B3N A;  2A1X A;  1D0H A;  3AVR A;  4XBL A;  3HBK A;  5CFD A;  3RZL A;  2OPW A;  3D0S A;  3KS7 A;  2J1A A;  2RS5 3;  5FP9 A;  4N53 C;  1PX3 A;  2YFZ A;  4AEK A;  4CCO A;  5KC6 A;  5HCF A;  4A45 A;  2BNN A;  2D5H A;  2P3Y A;  2RS5 2;  5I0S A;  3ZXL A;  2PLV 2;  2B46 X;  1V70 A;  2OS2 A;  2X29 A;  3CEW A;  1VR3 A;  4S2G A;  4AVV A;  3USS A;  1N3O A;  2ZAH A;  3IT8 A;  4JDO A;  4K21 A;  5A7W A;  4AL9 A;  3AKS A;  5DG2 A;  4E2G A;  4XPV A;  1VMJ A;  2QQL A;  2K9Z A;  3OBT A;  1W8H A;  2ZXQ A;  2CDO A;  2VQT A;  3Q9O A;  2PN5 A;  1ASJ 3;  2XVK A;  1CZS A;  2WFP A;  4FAH A;  1Q8S A;  1ASJ 2;  2IC1 A;  3K48 A;  3LDB A;  1X8M A;  4ZXE A;  1GU3 A;  3R6S A;  2R16 A;  3BTY A;  3FLR A;  4M4P A;  4LHL A;  3UET A;  3ENR A;  2HYX A;  4YVW C;  3CZJ A;  1US2 A;  1ZBA 3;  2TBV A;  3E6B A;  3WQB A;  1ZBA 2;  1DZT A;  2RDQ A;  4Y1X A;  1ZBE 1;  1F8V A;  4LOS A;  1X7N A;  2C5D A;  2RS1 2;  1QJX 2;  1UCX A;  1NG0 A;  3GBF A;  4EZH A;  2Z42 A;  3LB9 A;  2ARB A;  4NHK A;  4AED B;  4JC1 A;  3BI3 A;  3URF A;  1NCQ B;  2TUN A;  5I93 A;  2SBA A;  4Q4Y 2;  3H8U A;  4AF9 A;  5HV4 A;  2EIB A;  5CYY A;  2ZGM A;  5TSW A;  5IAV A;  3N7M A;  4P9J A;  4PBO A;  5J09 A;  3ZO0 B;  4CDX A;  2IVI B;  2WT2 A;  4Q4W 1;  5KR7 A;  5FLJ A;  4MGS A;  4QPG C;  4DNY A;  3GM8 A;  2WUH A;  4E4D X;  2QKD A;  4IV3 C;  1LAJ A;  2WQ4 A;  2XQX A;  4QM8 A;  2GN3 A;  1PO1 3;  3CNA A;  3ZN6 A;  5FDB A;  4Q2F A;  5I8Y A;  1PO2 2;  2I2S A;  1OKO A;  4ZHN A;  4P00 B;  1F9K A;  1FYU A;  3NW4 A;  4AVA A;  2YPJ A;  2FBE A;  1W90 A;  3S5Q A;  1RTV A;  3ACL A;  3UNP A;  4TSV A;  5CKQ A;  2BWA A;  2E26 A;  2WS9 3;  1NA1 B;  2DUO A;  3BVC A;  2X05 A;  1W8O A;  3WF0 A;  4COW A;  2WS9 2;  2XWB B;  3EJK A;  3IB3 A;  4HK9 A;  4HOO A;  5F2W A;  1ZBE 2;  4IV1 C;  1AUY A;  3ZMO A;  4CDU C;  4E8D A;  3NNF A;  4CU7 A;  1XYP A;  4NPL A;  2HYK A;  1PIV 3;  4P9X A;  4C1W A;  4P5Y A;  2VXJ A;  5DAP A;  1AR6 1;  5C9A A;  1WGP A;  4MH0 E;  1PIV 2;  2JG9 C;  3VHN A;  2QDR A;  3MEP A;  1PHM A;  5FY4 A;  1GWL A;  2ZA9 A;  3PMS A;  4P9W A;  3ZFG B;  5LA2 A;  3LA7 A;  2XH6 A;  4K3U A;  1FV2 A;  4MGT A;  3APB A;  1WW5 A;  5DUV A;  2BGO A;  1ENQ A;  3EQE A;  4IEO A;  3I3M A;  1LR5 A;  2E63 A;  4Q4W 2;  4UW3 A;  1AXY A;  1GZW A;  2WII B;  1WUV A;  4GIQ A;  3PTY A;  3PVO A;  4WM8 B;  4AHX A;  4D7T A;  2E33 A;  3WW2 A;  5LB6 A;  4COZ A;  1ODN A;  3T30 A;  5JSR A;  4MLO A;  1PVX A;  4A6S A;  1EV1 1;  1V6N A;  3KF5 A;  1OH4 A;  5K7P A;  2NPI A;  2A73 B;  3DF0 A;  4DMI A;  4PF5 A;  5IAX A;  1RJ7 A;  3CQO A;  2RR1 2;  5FZH A;  2VME A;  1GFF 2;  4G3Y C;  4CUG A;  2WT1 A;  1OA3 A;  2CTV A;  3KV5 A;  4XDQ A;  3SEP A;  5EIY B;  2WSU A;  1V6M A;  5AC9 1;  3LSE A;  2VEC A;  3N7L A;  4S2D A;  2ET1 A;  2VUC A;  2EF6 A;  1CAX B;  2J42 A;  4W6W A;  2D97 A;  5L9V A;  4A2U A;  2EXJ A;  5H9R A;  3AP9 A;  2VTX A;  4YGD A;  3WNK A;  4B8E A;  5LW9 A;  2E51 A;  1JN2 P;  2HWB 2;  1QJU 1;  3KQR A;  3POF A;  3SH4 A;  4AK3 A;  4R9B A;  2PFW A;  4LQR A;  1JU3 A;  2R32 A;  5DZE A;  1W2O A;  3NNL A;  5T55 A;  4ITC A;  1OQE A;  2RMU 1;  2XBO 1;  4FOY A;  4Y3O A;  1MS4 A;  3RVH A;  4A3Z A;  1OF3 A;  5FYY A;  5FQ0 A;  3MLK A;  4A44 A;  4HVO A;  4OFG A;  5CKN A;  1GOG A;  1UKG A;  1IG0 A;  1UY0 A;  4A4A A;  1W6M B;  2WT0 A;  1JYN A;  2G19 A;  1HDK A;  4YM2 A;  4D0Q A;  2CGP A;  4QXC A;  4HAN A;  3WG4 A;  1MEC 3;  1TE1 B;  1C1L A;  1OLM E;  1EV1 2;  2DCY A;  1WW6 A;  3RWK X;  5FZD A;  3MI8 A;  4CE8 A;  2OQ6 A;  5BV6 A;  1LHO A;  1RHI 1;  4P9Y A;  4JQR A;  4ASL A;  2CV6 A;  4HN1 A;  4YFZ A;  5FYB A;  2V4V A;  2JDP A;  2W95 A;  4GMP 0;  4HKW A;  4Q4V 3;  1AJK A;  1NKG A;  3GGL A;  5AC9 2;  1XJA A;  2JIJ A;  2VQ0 A;  3VL8 A;  1GBG A;  3PIG A;  3WQ1 A;  5F6K A;  4Z1V A;  1SCS A;  1I3H A;  1UXZ A;  3Q8A A;  4K6B A;  1GNH A;  2BFU L;  2DF7 A;  4ERO A;  2FMD A;  5HCH A;  4L9B A;  3R05 A;  3RZH A;  4BJ0 A;  2OZJ A;  4IE0 A;  5CNA A;  4XF9 A;  1ZRR A;  1JZ3 A;  1LU2 A;  3U11 A;  1OH3 A;  3CF6 E;  4QQO A;  1WCD J;  4F7Z A;  4XFH A;  3WP4 A;  3TWI A;  4DB5 A;  5ACA 1;  1S1A A;  1GZ9 A;  1U5X A;  2RMU 2;  2XBO 2;  1IZ3 A;  1RUJ 3;  4B4R A;  1VBE 1;  5T5J A;  1JZ4 A;  1EAH 1;  1NXD 1;  2JB8 A;  3LEG A;  1RUJ 2;  4GAZ A;  4DIQ A;  3BPZ A;  1WCS A;  4COY A;  3FWE A;  1S0I A;  4BK4 A;  4DXR A;  5FK8 A;  4OMD A;  1SLB A;  4A7Y A;  3AVS A;  3LEM A;  4XCA A;  2R0H A;  3IWZ A;  1Q56 A;  2J1S A;  4CEW B;  3BU0 A;  1S0G A;  4QQ2 A;  1FNY A;  2L9L A;  2K2S A;  5FP8 A;  2ORX A;  4UW6 A;  2W9X A;  2VH9 A;  2K46 A;  3KSC A;  4RHV 1;  4CDX C;  4MET A;  3WG3 A;  4CU8 A;  4AED A;  1NLR A;  5FPA A;  5FYH A;  3N9N A;  1S0F A;  4UBH A;  1NCQ A;  5EZW A;  4CYD A;  5K9Y A;  2IVJ A;  2YBK A;  1WD4 A;  3GZT B;  4D7Y A;  1RB8 G;  3OG2 A;  1VMH A;  3O0X A;  1LOD A;  1D4M 1;  1YYN A;  3BN6 A;  2DTY A;  1JUI A;  5B4N A;  2VMG A;  3I3D A;  2XGX A;  5FBJ A;  5FMB A;  1KS4 A;  1AVB A;  1XXN A;  2B9U A;  1J1L A;  2HBT A;  3WF4 A;  2XQR A;  4JTN A;  2D98 A;  2C1F A;  1WLT A;  5FXW A;  3WW4 A;  4XQW A;  4IEQ A;  2WQZ C;  5FKB A;  5EJZ B;  2XVG A;  4BME A;  1DCS A;  3FBM A;  3IAP A;  5ABJ C;  2A5Z A;  5JI9 A;  2PTM A;  3J26 N;  2ADD A;  4C0H A;  3ACF A;  3VBH B;  1FNZ A;  1WA4 A;  1ZZC A;  1RL3 A;  1DDL A;  4GKX A;  1J83 A;  5FZL A;  3P1I A;  3ATG A;  3HN1 A;  1GMM A;  1UD1 A;  1NA1 A;  4AFD A;  1VIW B;  1S0D A;  2VZR A;  4Q5O A;  1DQ0 A;  2P34 A;  2Q8E A;  4A42 A;  2GC3 A;  2IWG B;  3RYR A;  1W3V A;  3K4D A;  5FCC A;  3ZXK A;  1AYN 1;  1O5L A;  2ZCW A;  3P3P A;  3LFM A;  1JYX A;  1MQT B;  2HEW F;  2BOJ A;  2ZKL A;  3HN3 A;  3KV9 A;  4AFM A;  3THP A;  4GB3 3;  1DGW X;  2RDN A;  4NIH A;  1F2N A;  2QCS B;  3UKV A;  3AMM A;  1ZRI A;  3PU3 A;  1LHU A;  3MV0 1;  1LOF A;  1QQP 2;  3ZFG A;  3LPF A;  4HT1 T;  2A71 A;  3UKT A;  3VBR B;  5F5Q A;  1OA2 A;  1FOD 3;  5EQU A;  5F37 A;  3TEZ A;  2VPV A;  1FOD 2;  4CU6 A;  3BIW E;  3D4K A;  1D4M 2;  4H3W A;  4AEM A;  5IYY A;  3DN7 A;  3PJY A;  2IFR A;  4RS5 B;  3RGB A;  3NJZ A;  1QIQ A;  1XNA A;  3DCQ A;  4RR3 B;  3WUC A;  5KWR A;  1PM7 A;  3H1M A;  1OQ1 A;  1R09 3;  4D8M A;  4WM8 A;  5JUV A;  2V4A A;  2VBB A;  4HL0 A;  2OYZ A;  1COV 1;  5EYY A;  3WDU A;  3KWV A;  1XND A;  4XDO A;  4NHM A;  5B4X A;  4OUL A;  4QPI C;  5LK7 B;  5CZK A;  1QH7 A;  5ERL A;  1YQ8 A;  4LE4 A;  3WQ7 A;  2VCM A;  4YRD A;  3VBF B;  3MW3 A;  1XRU A;  2EXI A;  1A8D A;  2J1T A;  3CL1 A;  3I2F A;  4K8F A;  3CU7 A;  4MSV A;  2I07 B;  3VB9 A;  3PU8 A;  3WHU A;  5FR3 A;  1UOF A;  4KBZ A;  1CAX A;  1AYM 1;  3TB0 A;  4CP1 A;  5JMO A;  5J37 A;  5F5I A;  1NLQ A;  4CP9 B;  3N9O A;  5T54 A;  1JI6 A;  2VZQ A;  3NAP B;  3ACH A;  1QKQ A;  3WT3 A;  2YU1 A;  3H50 A;  4D69 A;  3MGU A;  3H7Y A;  1DFQ A;  2WBK A;  1H6X A;  2ETE A;  1CPM A;  4D6Q A;  4FAG A;  1HIX A;  5KC5 A;  4PBP A;  5IK7 A;  3POW A;  5FAX A;  5DPN A;  2BWC A;  2W94 A;  2FZ2 A;  4MZU A;  1S0B A;  4DO0 A;  4MGQ A;  5I8T A;  1Q3E A;  1TME 2;  4DY5 A;  4OI2 A;  2XG3 A;  1LCL A;  2Y6F A;  2HWD 1;  2VOX A;  1O4Y A;  1W6M A;  1J58 A;  1Y4W A;  1Z7S 1;  4MO3 M;  1COV 2;  1OOP A;  1HRI 2;  1YO8 A;  2W08 A;  3LPG A;  4YM1 A;  4XJ8 A;  3UKN A;  5J1X A;  1O3T A;  1YJL A;  2QJV A;  4JGZ A;  1GLH A;  1MVE A;  2YUE A;  4Y26 A;  2R1B A;  1B35 B;  3AYC A;  1XNC A;  1JU4 A;  4NN0 A;  3SLI A;  1GNY A;  4LIV A;  1F4A A;  3M3O A;  4LHN A;  1CIY A;  3GHM A;  3ZN4 A;  1AR7 3;  2VTF A;  2W0X A;  3O1O A;  2JEN A;  5JOY A;  1OPM A;  1SBD A;  2VMH A;  3HR9 A;  3LFI A;  3MW4 A;  4P14 A;  4PQQ A;  1Y9M A;  1IS4 A;  2Q0A A;  4LA2 A;  1SLT A;  1A8M A;  2CWM A;  2OVU A;  5F3I A;  2ZEX A;  4AI9 A;  2RHP A;  3WIN E;  1Z0H A;  5LA0 A;  1ACC A;  1C8M 1;  2Y0I A;  1LOC A;  1W99 A;  2CWS A;  2OUH A;  3FUO A;  2VCA A;  1OF4 A;  4Q4X 3;  2YZ4 A;  5BNN B;  2RM2 3;  4AVB A;  5M0T A;  4E2S A;  2B4K A;  2KA3 A;  3VKO A;  5CAZ A;  1RMU 1;  5FYM A;  3POJ A;  1SBE A;  3ECQ A;  2WAA A;  1RUN A;  4GKY A;  3SKJ E;  4AED C;  1W6O B;  2AC1 A;  1NCQ C;  2HWD 2;  5I0R A;  4KWJ A;  2W92 A;  1X50 A;  1H4H A;  3M1H A;  4L99 A;  1FMD 3;  2XKP A;  2VGD A;  2OT7 A;  3S7E A;  2G9F A;  4CEW A;  4A7K A;  2RS3 3;  4LO5 B;  3BCW A;  5GLV A;  3DKW A;  1MS0 A;  1KDM A;  3WW3 A;  3A0K A;  5FYZ A;  1ZYB A;  1XYN A;  3N3H A;  1QNY A;  1WD3 A;  3H42 B;  4NID A;  1AR9 1;  2BV4 A;  2ES3 A;  3ZPO A;  4JRL A;  4V2V A;  2Q8D A;  1HN0 A;  2WLP A;  2NMO A;  4XMA A;  1G9F A;  3OOX A;  5A6Q A;  4FFH A;  1ULF A;  5LEK A;  1W03 A;  1WWY A;  3NV2 A;  1W6Q B;  4PIY A;  3TAY A;  1UY4 A;  5IVV A;  3VZJ A;  2H6B A;  3GJB A;  4UFJ A;  4ATF A;  1UMH A;  2VMI A;  3B7M A;  2D6L X;  2AEY A;  4FPO B;  3VN4 A;  1D7P M;  3TRS B;  1CVN A;  5L7O C;  4YW3 A;  1NA1 C;  4NRQ A;  2D40 A;  3TN9 1;  5FY7 A;  4I3G A;  2XUM A;  2JDM A;  2WZR 3;  4EZ4 A;  1VBA 3;  3OBR A;  4OCT A;  3AYA A;  1ULE A;  1LEN A;  1LTE A;  2OII A;  3IBM A;  3KT4 A;  4MAD A;  4CXW A;  2XJQ A;  2O8O A;  5L9B A;  4F83 A;  2GMM A;  2D6N A;  1LOF C;  1GUI A;  2VY0 A;  2YRO A;  3HVD A;  1PX4 A;  3KD4 A;  4HKO A;  3ZFG C;  3ZIW A;  4CDW B;  2J1R A;  1LOG A;  2JG8 B;  3C8X A;  5DAB A;  5JLV A;  3LIH A;  4HKL A;  4CCM A;  1MQT A;  5BNQ A;  4KQ7 A;  5LBE A;  2ZGN A;  1XC6 A;  4WM8 C;  3O1P A;  3ORJ A;  3WY6 A;  2VD7 A;  3U75 A;  3VBR A;  5DDJ 1;  4NJ4 A;  3K77 A;  4AI8 A;  3CIH A;  1KD7 A;  1B09 A;  1UZY A;  1DF0 A;  2LRO A;  4I3P A;  3UJO A;  2WNU C;  3NQH A;  5ISL A;  1JOB A;  1W0P A;  4RS5 A;  3PHM A;  3J7L A;  4RR3 A;  2VZO A;  1ZZ9 A;  4DIN B;  1UXX X;  3AP4 A;  3O5S A;  3TNQ A;  5FP4 A;  5LCW L;  3TN9 2;  4XTM A;  1UZW A;  2YPD A;  4TYS A;  4BQ5 A;  5D8A B;  3MYX A;  1RUI 2;  5LAS A;  5LBC A;  3PVB B;  3I2K A;  1L3J A;  4OI1 A;  1H2L A;  3KLS A;  4LO4 B;  1LEC A;  3VBF A;  1R08 3;  4YGE A;  1ND2 B;  1H9W A;  2DVF A;  4K7J A;  4IGP A;  3QBQ A;  3ZM8 A;  5FTT C;  5F1R A;  1PGL 1;  4AHY A;  5A6Y A;  4UOJ A;  1VP6 A;  3M7A A;  2WWU A;  5D2A A;  1VMF A;  4CPB A;  3EHK A;  2A3W A;  1GIC A;  2IXC A;  3GJA A;  1HQW A;  4LBM A;  4N43 B;  5FLH A;  3THC A;  4B4P A;  1UWW A;  2BYV E;  3T3Y A;  2HWE 1;  4CU9 A;  1G9D A;  1HQL A;  2DCT A;  3BOP A;  1STM A;  2F4P A;  3NAP A;  4FPH A;  4TXW A;  2QQJ A;  2HWC 1;  2EXK A;  4YG0 A;  5BUV A;  2ZMN A;  5FP7 A;  1QDC A;  1PGW 1;  1YQ6 A;  3HQR A;  1ZZ7 A;  2ZEZ A;  3EXU A;  1OOP C;  3ZDV A;  3WP3 A;  3UK9 A;  3VKM A;  5A80 A;  3FHQ A;  1QF3 A;  3E5Q A;  3MIE A;  5IVJ A;  1O59 A;  2RJK A;  3H7J A;  4I30 A;  4HG6 B;  4JGZ C;  2J1V A;  1TZO A;  4RGG A;  1TNR A;  2VZP A;  4OYU A;  3ZXJ A;  2YMZ A;  3RQ0 A;  2E32 A;  2NN8 A;  3M3C A;  4JX0 A;  4LO8 A;  3GZE A;  4BH9 A;  1AX2 A;  5CVR A;  4K1Z A;  1BLZ A;  3HWJ A;  2ZEW A;  4OI4 A;  5SV5 A;  4AAP A;  5FPU A;  2WO1 A;  1RC6 A;  2VW2 A;  4K20 A;  2Q8O A;  3WNL A;  1RVF 1;  3MIB A;  4IQP A;  1HQN A;  5BNO B;  4L97 A;  5F9T A;  2HWF 3;  2QQK A;  3NV4 A;  3ST7 A;  4JHT A;  3EO6 A;  4EN9 B;  3FL7 A;  5C3P A;  1B35 A;  2ZGQ A;  1W8F A;  5FZ7 A;  1O91 A;  1OQD A;  1BHG A;  2WAB A;  1VAM A;  1RUG 3;  3DPR A;  1FPN 1;  1PGL 2;  3TYJ A;  1UU6 A;  1O8P A;  3TEX A;  1RUG 2;  2GU9 A;  4R4X A;  1W3X A;  2CL2 A;  1G86 A;  3LEK A;  2E53 A;  2QBX A;  4AVS A;  4RGA A;  1SLA A;  1VBB 3;  4X6Q B;  4XE9 A;  2KM2 A;  2WFF 2;  1JHJ A;  2BDR A;  2WR9 A;  3DEC A;  3IN9 A;  4MGK E;  4UW5 A;  4WZF A;  2JE8 A;  3BOD A;  4EN7 B;  1SPP B;  5KHH A;  1HXS 1;  1LKN A;  4TLG A;  1ULO A;  2PAE A;  2Y6K A;  3HNM A;  4AW7 A;  1PM4 A;  2JDH A;  1M4W A;  2DBI A;  3AMP A;  2J22 A;  5BNN A;  3RZK A;  4LKF A;  1BEV 3;  3NKT A;  4CEW C;  5FOJ B;  3LQC A;  3BKZ A;  1W9Y A;  2YB7 A;  3VBU B;  3D82 A;  3MIG A;  4QDS A;  5FZF A;  5CEH A;  4FTB A;  3J4U H;  3OPZ A;  3JQW A;  1BXH A;  4LKS A;  1QGL A;  3AX4 A;  3VBO B;  3AJY A;  1H2N A;  1W6O A;  4QD2 A;  4NAM A;  1QJY 3;  5KHI A;  3NRU A;  4XF3 A;  1OUS A;  1IS6 A;  3EBR A;  3HT2 A;  1QJY 2;  3I2H A;  1OUR A;  2JEC A;  1RGS A;  1Z78 A;  3AKP A;  1JZ8 A;  3HNB M;  2WN2 A;  2Y26 A;  4RFT 0;  3T09 A;  2BJS A;  4OLL A;  5LA9 A;  5J96 B;  3UES A;  4XQ4 A;  5A6Z A;  3RYP A;  2ENR A;  3OPT A;  5C33 A;  4TTG A;  4OVE A;  2D6M A;  3POI A;  2VAU A;  2QQI A;  2BEO A;  1FPN 2;  1SDW A;  4YPJ A;  1Q8P A;  3ES4 A;  4RA0 A;  1UOJ A;  3K2O A;  1XU1 A;  1W6Q A;  4FT8 A;  4W6Y A;  1KIT A;  4E8C A;  2IXJ A;  4UFH A;  1DZQ A;  2P3I A;  4Y22 B;  5F32 A;  2ZGK A;  2ZAC A;  1YFY A;  3ETP A;  3D6E A;  5LY2 A;  5J7M A;  1HXS 2;  5A3P A;  2EAA A;  2XHN A;  1GP4 A;  1PZ8 A;  4B29 A;  4C90 A;  2ZGT A;  1UY3 A;  3JD7 1;  3TEW A;  5DG1 A;  2R06 1;  2QNK A;  3U78 A;  5FPZ A;  4P9L A;  5FP3 A;  1UW8 A;  3WXP A;  3EMR A;  5KXE A;  3X29 B;  4EYU A;  2VO5 A;  4W50 A;  4K8R B;  1SMV A;  4G4F A;  4GWN A;  3VD5 A;  4GJZ A;  1NZI A;  2C9K A;  3I2O A;  1JTZ X;  1CJP A;  5FY9 A;  3CBN A;  3FJS A;  5IJR A;  3VBR C;  3ZVX A;  1V9U 1;  1JOP A;  1W06 A;  2A75 A;  4ET7 A;  1N47 A;  1CAU B;  1ZZB A;  4YGC A;  1O7F A;  3MZH A;  1K42 A;  2RDS A;  4AVC A;  1PZ7 A;  2BZD A;  3ON7 A;  4RS5 C;  1F4H A;  3B69 A;  4RR3 C;  3A7Q A;  4XAB A;  1N1S A;  3KVA A;  1U5Y A;  4SBV A;  2WO7 A;  2JWP A;  4FPG A;  2PLV 3;  4BPZ A;  4QX3 A;  2DV9 A;  1ULG A;  4YFW A;  4DEV A;  4LOT A;  4WVV A;  1W8W A;  5FZB A;  5JPM B;  1RIN A;  1Y9Q A;  5ANQ A;  3RDI A;  2VZU A;  3H8X A;  4QXK A;  1LRH A;  1UIK A;  4FQZ A;  1F5J A;  2VCB A;  2XL9 A;  3ABZ A;  5ANN A;  2VXR A;  3VBF C;  3OY8 B;  3P3N A;  2RJL A;  1KFX L;  3D5O A;  2O14 A;  4GMP 3;  3IPV B;  4P02 B;  2XHK A;  4Q0V A;  5C3Q A;  3O1T A;  2PHX A;  4LIT A;  3K46 A;  5D8A A;  1V6O A;  2W47 A;  2R06 2;  3HBZ A;  5C3R A;  4BIO A;  5ABJ B;  3OBZ A;  4EWA A;  1IHM A;  3SMH A;  3TEY A;  2X10 A;  4LUK A;  5JOZ A;  3III A;  3ZYJ B;  1XOY A;  3NAP C;  3MDP A;  2ARE A;  3UYJ A;  1ND2 A;  1JS9 A;  4W65 A;  1SFP A;  3IDE A;  1L7L A;  2VBP A;  1UAI A;  4ONU A;  2Z4F A;  1DQ5 A;  2UWC A;  5C3O A;  1E5I A;  2WJS A;  4XTP A;  2RS1 3;  2DVG A;  1QJX 3;  3I8T A;  1OXC A;  3MFA A;  5JVV A;  3WR0 A;  4N43 A;  1HV0 A;  3WCS A;  4A3X A;  3DEM A;  4OZX A;  3NST A;  4UW4 A;  5L9R A;  4Q4Y 3;  1TMF 1;  2WZE A;  2XWJ B;  5C6C A;  1DBN A;  1TG7 A;  2Y6G A;  3WLU A;  1XE7 A;  3C7O A;  4H7L A;  1CAV A;  1R1A 1;  2ZPX A;  1W2U A;  3ASI A;  4XJZ A;  1RXG A;  1OPO A;  4IEZ A;  4AI2 A;  1O3S A;  2Y60 A;  1GOH A;  1TNF A;  2GP3 A;  2FDI A;  4LMF A;  1LB2 A;  3QCW A;  2VOK A;  2DUR A;  3PVE A;  5CB7 A;  2W46 A;  3LGR A;  5DN2 A;  1B35 C;  4PI2 A;  2NYY A;  4Y33 A;  3DPR C;  1PO2 3;  4UWD A;  3ZSE A;  4A6O A;  3VUO A;  4XFA A;  5IHR A;  4I02 A;  1O4T A;  1KEX A;  5BNO A;  4H55 A;  1Y9G A;  4V2W A;  1FT9 A;  2P2K A;  4XXA A;  2QQM A;  2YV8 A;  4AHW A;  1NT0 A;  2C4X A;  4R9A A;  3KF3 A;  5FZ3 A;  1LGC A;  5H9Q A;  2YFU A;  2ZBJ A;  4LE3 A;  2P5B A;  3ZYH A;  1ZBE 3;  5BNN C;  2ZX2 A;  5IVC A;  4XJU A;  4Q0Q A;  3AP6 A;  1N1Y A;  3BYW A;  2DVA A;  2QQO A;  1UYX A;  4HON A;  4XJ9 A;  2Y6L A;  2HBU A;  2OW4 A;  4KWL A;  2PEL A;  2GZW A;  4PF1 A;  5BYN A;  4FCA A;  3PJQ A;  3FUQ A;  3O1R A;  1ZA4 A;  1SPP A;  5LK5 A;  3T08 A;  5A6X A;  4LR4 A;  3O0V A;  3PIJ A;  5DAX A;  5FYV A;  3HT1 A;  2ATF A;  1NQJ A;  1CGP A;  2VZ3 A;  1T6G C;  4G9S B;  3M70 A;  4O61 A;  3VBU A;  5FZO A;  3H3Z A;  4Q4W 3;  1UPS A;  3ILR A;  2Q1Z B;  3VBO A;  1AHS A;  1GP5 A;  4YNI A;  5GLU A;  3BTX A;  3VV1 A;  3MHZ A;  4KWU A;  2NM1 A;  1GP6 A;  1QHD A;  2XJP A;  4BQ4 A;  2ET7 A;  2OXB A;  3OTF A;  3OCP A;  3WSO A;  4CXY A;  2XLA A;  1W0O A;  2ZJC A;  3WV6 A;  1LGN A;  5CG9 A;  1YQ2 A;  1D2S A;  2RR1 3;  4IUG A;  4LHS A;  2PQQ A;  3V65 A;  1V00 A;  3ZSK A;  2LAL A;  5FY0 A;  3JCI A;  4UF0 B;  4BQX A;  4BHP A;  5J3U A;  3E1F 1;  1S0C A;  2R04 1;  3U07 A;  5JMC A;  4YZ4 A;  4GWI A;  2GC2 A;  1YC6 1;  2GSY A;  3B9I A;  3O12 A;  5HXM A;  3AJZ A;  3SH3 A;  1RUC 1;  5F3C A;  5HPO A;  2R0F A;  4AI0 A;  1UKR A;  4XIL A;  4XCB A;  4ORF A;  1X33 A;  3B01 A;  1IS3 A;  3HEI A;  1NZC A;  1PGS A;  1KJR A;  2HWB 3;  2N7G A;  1VLN A;  1AR6 3;  1VB2 A;  4KWK A;  4YW1 A;  5T5P A;  4BLI A;  3SCG A;  4MG2 A;  4Y22 A;  1H8V A;  1AR6 2;  4QGN A;  5JSP A;  4QDQ A;  1MEC 1;  3GAL A;  4IXL A;  5FK7 A;  3RG0 A;  1Y7B A;  1YHF A;  5KHK A;  4XZP A;  2BVB A;  3VL9 A;  2KR2 A;  1JZ5 A;  4AZZ A;  5GZD A;  5J98 B;  3CZU A;  4CP0 A;  3H3L A;  2A6W A;  5HXV A;  4L8Q A;  2Y33 A;  1WW7 A;  1UL9 A;  4LUL A;  1JYC A;  3CLP A;  4XUT A;  1DGW A;  2BRT A;  4FBF A;  5CFD C;  3HIF A;  4NR1 A;  2YGM A;  2Z2S B;  3WNX A;  1EV1 3;  4E27 A;  3D8C A;  1CAU A;  3ITQ A;  3ZKU A;  3CDZ B;  3IDB B;  1DU3 D;  4FP3 A;  1GQH A;  2YC4 A;  2YYO A;  4L0P A;  5FLI A;  1JMU B;  1PMI A;  4J1W A;  3DUI A;  2R04 2;  4XFG A;  1ENR A;  3N9P A;  4GA9 A;  3MV1 1;  3Q8B A;  1XNK A;  4FOQ A;  3WP6 A;  1SBF A;  4AHZ A;  4EJR A;  1UMZ A;  4J1X A;  5AC9 3;  4BIS A;  2WZ8 A;  3ZYF A;  4UYB A;  1RUC 2;  2R07 1;  4FVV A;  4XUQ A;  1WLW A;  2PHF A;  1D2Q A;  1MAC A;  5D8A C;  5T52 A;  2JX9 A;  3KCY A;  3R4D B;  1XE0 A;  4JV4 A;  1KJL A;  1OLR A;  1ONA A;  2DWR A;  4HVR A;  1QJU 3;  3SCH A;  4O65 A;  3ZYB A;  4XZU G;  3E5X A;  3ZFF B;  3QH6 A;  4NO4 A;  5JXJ A;  5KXD A;  1QJU 2;  3OY8 A;  1X82 A;  5FZM A;  1ND2 C;  5T5L A;  1IPS A;  4M00 A;  1O3R A;  3LEI A;  5A70 A;  3IPV A;  4W6X A;  1UOG A;  4J25 A;  2RMU 3;  1YFX A;  2XBO 3;  3VHO A;  4AFC A;  2P37 A;  2KXL A;  4ES9 A;  5ABJ A;  3K3N A;  1JZ7 A;  3IDA A;  4N43 C;  2WAO A;  3E6C C;  2X8K A;  3V0A B;  1GNZ A;  5E88 A;  5F6L B;  1MPX A;  1WME A;  1WCK A;  2ZGU A;  4XYX A;  5DAW A;  4KH9 A;  4XUP A;  4B7E A;  2CGN A;  2E7Q A;  3BIE A;  4LHK A;  3ES1 A;  3ZYP A;  5LBF A;  2WYF A;  4N90 A;  3I54 A;  3WNN A;  3B93 A;  3ZR6 A;  2Q1M A;  3J8F 1;  4XW3 A;  2W87 A;  3VKF C;  5GAL A;  1RHI 2;  1V6L A;  3PLQ A;  3ZSL A;  1NAE A;  3G7D A;  4MHR A;  2DUQ A;  2QE3 A;  4QXB A;  3GZA A;  2TEP A;  5J36 A;  3U10 A;  4CUB A;  3SC7 X;  5JXG A;  2HKX A;  4ARY A;  2E31 A;  3BOW A;  3PNA A;  4QMA A;  1CZV A;  3IAQ A;  2YHJ A;  4F3J A;  4XF4 A;  4DUW A;  2WNO A;  5FZG A;  1KGY A;  3ROU A;  4FPE A;  3VDB A;  4CUC A;  4LO6 B;  1MS1 A;  3LCP A;  2ZHN A;  5ACA 3;  1KFU L;  2DDU A;  1UZZ A;  1VB4 A;  4MGZ E;  4MXW B;  1VBE 3;  4GB3 1;  3N9L A;  4QWN A;  3AZV A;  1XU2 A;  4Y24 A;  3CMG A;  5ACA 2;  2ARC A;  2DFC A;  1VBE 2;  3KVB A;  1EAH 2;  1O6U A;  2JDA A;  2ZX3 A;  3NJV A;  4COU A;  4TN7 A;  4MHU A;  5FZA A;  5C9A C;  1NLS A;  2AUY A;  5FPB A;  5FZ6 A;  5BNP B;  2RVA A;  5F5A A;  4QAW A;  3ZLI A;  3NJY A;  1NE6 A;  3U0Z A;  4NMI A;  2W1S A;  1W0N A;  1W8Z A;  4QB1 A;  3GHN A;  4HZF A;  4WBB A;  3VBU C;  2GNB A;  3F2Z A;  2AZ5 A;  1XQN A;  2PYT A;  2Y38 A;  2DU0 A;  1LJ7 A;  3FMG A;  2W52 A;  3NMB A;  2JDK A;  2OX0 A;  3J8F 2;  3OEA A;  4RHV 2;  3VBO C;  3TOJ A;  1RYY A;  1QQP 3;  4GJY A;  2WNE A;  1VBC 1;  3CJI B;  5HV0 A;  4XAC A;  1PMJ X;  3W21 A;  1OKQ A;  2E9Q A;  1D4M 3;  2HJI A;  3I2I A;  5E8A A;  4NIA A;  1V6K A;  4YGB A;  1S0E A;  1HV1 A;  2Y6H A;  1AF9 A;  4IDZ A;  1HJF A;  1K3I A;  3NNJ A;  4JQT A;  5A7Q A;  2VZV A;  4YG3 A;  3CHX A;  5IWF A;  1BBT 1;  4JZR A;  4BLJ A;  2ZOE B;  2ZHK A;  1UOB A;  4FPL A;  4LBQ B;  4AVT A;  4LBQ D;  3BGA A;  1NY7 1;  1YQC A;  3N7J A;  2BBV A;  2QZ2 A;  4QX5 A;  1AR8 1;  1SFN A;  3THT A;  2VUD A;  5BY5 A;  2BVV A;  5JXH A;  4FTE A;  1WKY A;  2YDE A;  3DV8 A;  3OD0 A;  3ZFE B;  1MS3 A;  4UF0 A;  3K75 B;  1JHN A;  2UYB A;  2XLF A;  2EID A;  2G1M A;  4H7M A;  5APA A;  4AQ6 A;  3DYO A;  4HLT A;  1C4R A;  1Y3T A;  5FYI A;  4Q0P A;  4UT5 A;  2IFW A;  2WNV B;  1HKD A;  3INA A;  1AL2 1;  2YGL A;  1XYO A;  1HRV 1;  1KRI A;  3Q8E A;  1I6X A;  1POV 3;  1U5I A;  1WLC A;  1AYN 2;  5F2S A;  5FPL A;  4YZ1 A;  5JCT A;  1EUT A;  1DP0 A;  4Y5S A;  2EAL A;  2ARA A;  3O0W A;  3FZ3 A;  5FJK A;  4GUL A;  2VUL A;  5GKA C;  1VBC 2;  5E89 A;  2A6Z A;  3FHI B;  4LBK A;  3R0R A;  1QJE A;  1F5F A;  2JD4 A;  5IFT A;  4ATE A;  4LEJ A;  4AXO A;  4CCL A;  3VHP A;  4NPR A;  4CTE A;  1TME 3;  3ELN A;  5FO7 B;  4UBG A;  5DZG A;  3C2U A;  4QX1 A;  4QKD A;  1BBT 2;  4I0B A;  1CD3 G;  1COV 3;  1QEX A;  5D21 A;  1HRI 3;  3I3Q A;  2IXI A;  5LAT A;  4XHX A;  3LKJ A;  1REE A;  3ZXA C;  4BE3 A;  2G4I A;  5JZG B;  2P1B A;  1AR8 2;  3RFR A;  3DL3 A;  5A33 B;  1BMV 1;  4YW6 A;  1CX4 A;  5IAT A;  3T2P A;  2FDG A;  2DYC A;  4IEU A;  3SQO A;  3KM5 A;  4OUE A;  4Z07 A;  3S5A A;  1APN A;  3A21 A;  5A3N A;  3ETQ A;  3NNM A;  3AXE A;  2Y6J A;  3P6B A;  1AL2 2;  1W9T A;  1AYM 3;  2BNO A;  1HRV 2;  2P17 A;  3B9C A;  4PJY A;  4R4Z A;  4XQD A;  3WOG A;  3T1M A;  4AAX A;  1AX1 A;  1AYM 2;  1I5P A;  3KQ4 B;  2Y64 A;  2D6O X;  3H0O A;  4N8M A;  3T0A A;  3WF2 A;  1Y43 B;  4B1M A;  2FDJ A;  3ZFF A;  3IMM A;  4BCU A;  4AWD A;  4H2A A;  1WMF A;  3GZU C;  2BW8 A;  2GAL A;  2GP5 A;  2BPA 2;  3WHT A;  4CDQ B;  5GZC A;  4FFG A;  3AFK A;  4P9G A;  4B7K A;  1SLI A;  2D6P A;  5FRA A;  3BAL A;  2HWD 3;  3V0A A;  3PUA A;  5FRE A;  1LES A;  2QQN A;  2F6B A;  4KG0 A;  4XAA A;  4XF1 A;  5DQ0 A;  5LA1 A;  3RZJ A;  1EPW A;  2BNM A;  4FP2 A;  3T2O A;  3OBA A;  1K5J A;  4RFR B;  5JI7 A;  4D6S A;  1Z7S 2;  3MIH A;  4GZ9 A;  4L11 A;  4YVS B;  4FXG B;  2DCK A;  2EAK A;  1RUD 1;  3IIA A;  3AKQ A;  2WL1 A;  2WO2 A;  2I45 A;  2XML A;  1R64 A;  3FX3 A;  3QH7 A;  4KGQ A;  4NHX A;  4BM8 A;  1HW5 A;  5E6H A;  2UY8 A;  4FFF A;  1WZX A;  5FPV A;  2WZR 1;  1REF A;  2BBA A;  2DTW A;  3HOB A;  4JKK A;  1VRH 1;  2RJ2 A;  5A32 B;  1SZB A;  5IVE A;  4J6G A;  5DUX A;  3EYP A;  5J48 A;  1XE8 A;  5A3L A;  3WUD A;  1AZD A;  4KI5 M;  3FLP A;  2VMC A;  5T50 A;  1RED A;  1A3K A;  2HEY F;  1UZV A;  5E1R A;  1FX5 A;  4ISR A;  4Q26 A;  1HN1 A;  4QX0 A;  4QX8 A;  2JE9 A;  1C8M 2;  5FMC A;  2WA4 A;  4WVZ A;  3FLT A;  1FV3 A;  1J3Q A;  3AXD A;  3ZDS A;  5FO8 B;  3FHA A;  2O8Q A;  3DXT A;  3TNP B;  4MXW A;  3JU9 A;  3VZK A;  1GWK A;  2VBD A;  1RMU 2;  2RV9 A;  1RUE 1;  2B5H A;  1N3Q A;  2P4E A;  1W8U A;  1IKP A;  3VBH A;  1CR7 A;  1IS5 A;  1L7R A;  3GCW A;  3AKT A;  3I4I A;  5EJ1 B;  5BNP A;  1G9A A;  3SEE A;  5EWS A;  5A3W A;  4C8D A;  1DLL A;  2D3R A;  3WNO A;  2QQV A;  3H9A A;  2R6Q A;  5CFC B;  4IE6 A;  3VZO A;  2H6C A;  2Y8K A;  5FXZ A;  3CJX A;  1AR9 3;  3AMH A;  3LZZ A;  2ZTN A;  3O7O A;  1RUD 2;  5FWJ A;  1AR9 2;  2DBN A;  3WNP A;  5IW0 A;  4H14 A;  5C4W B;  4Q0U A;  2UYA A;  2WYS A;  1QH6 A;  3RPQ A;  3V0B B;  1EP0 A;  2P6H A;  1VRH 2;  3PL0 A;  2FCT A;  3RZZ A;  4HXC A;  3MIF A;  4D94 A;  3OJB A;  4HBN A;  3K51 A;  2ARX A;  1S2B A;  2LS6 A;  2XPJ A;  1EUU A;  4KU7 A;  4MX3 A;  5KBF A;  2QQU A;  1AL0 G;  2PXJ A;  5G04 L;  3TN9 3;  2B45 X;  4DZG A;  1E57 A;  1DQ1 A;  1GQG A;  1GR3 A;  2QVS B;  1W6P B;  4NRP A;  2CDP A;  4YWA A;  1RUI 3;  2ID4 A;  2WN3 A;  4XDP A;  1PNG A;  5GZE A;  1ND3 B;  4Y1V A;  3B5L B;  1G9C A;  5EYX A;  3T4H B;  3ZFE A;  2H0B A;  2B42 B;  1RUF 1;  1RUE 2;  3UV9 A;  5AFE A;  3JB8 A;  2ZMK A;  4DFS A;  4GQ7 A;  2PHW A;  4XUN A;  3U4S A;  3GDB A;  3VZN A;  2A3X A;  3JQX A;  5C8C B;  1PMH X;  2WNV A;  3KGZ A;  2EXH A;  3AYE A;  4QT6 A;  3MBW A;  1F15 A;  1ULD A;  4Q8L A;  4BIF A;  4P9I A;  1QJF A;  5I0U A;  4I01 A;  2W5F A;  3HD8 B;  2VOW A;  1Q8O A;  2CGO A;  4QDR A;  5IUQ A;  1QMJ A;  1W8T A;  5A7W B;  4CP9 A;  1VBD 1;  2DCZ A;  2A6V A;  2MEV 1;  3IMN A;  1YRZ A;  4IGQ A;  1YI7 A;  2X5I B;  2R30 A;  4RQP B;  4X6R B;  1LEM A;  4GAL A;  4P5H A;  5EPA A;  4AGG A;  3N35 A;  5F39 A;  3POY A;  4MGI E;  3IKW A;  5JR7 B;  2JJ6 A;  1IPK A;  5DDJ 2;  2HWF 1;  3KV4 A;  2Q8C A;  3LIG A;  3MIC A;  4I2O A;  2D3P A;  4TZD A;  3JBG 1;  4BU2 A;  1F35 A;  5A7N A;  3WF1 A;  1BQP A;  1WMX A;  5FJH A;  1PVC 1;  5GZF A;  1DYK A;  3DKQ A;  3P5B A;  5FZI A;  4YZ2 A;  4GWJ A;  4AOC A;  1V6I A;  3ZXE A;  1RUH 1;  1KDK A;  1VBB 1;  5JZG A;  5C5U A;  1ZRC A;  1CIW A;  3JUU A;  4QB6 A;  4NE9 A;  3L2Y A;  2QDN A;  3A23 A;  4IEY A;  4WV8 A;  4N9I A;  4XJA A;  5A33 A;  2FDK A;  5JAX A;  1CJD A;  1RUF 2;  1X9T A;  5HBA A;  3ZFF C;  4C91 A;  3N7K A;  4QB2 A;  2OA2 A;  2PMW B;  3RSJ A;  5CIS A;  3I2D A;  1SLC A;  1OVP A;  2HLE A;  1C28 A;  2JDZ A;  3WG2 A;  1I1E A;  2ZX4 A;  2P3K A;  3OEB A;  2MNG A;  1SLL A;  2WFF 3;  4UFL A;  1WW4 A;  4ASM B;  4PCR A;  5EJ3 A;  5FPX A;  1BYH A;  3BB6 A;  1VBD 2;  2HWE 2;  1SCR A;  4YLZ A;  4BYY A;  2C26 A;  1C5H A;  2ZAA A;  5DAQ A;  3ZN6 B;  2O0O A;  2VQA A;  1C5I A;  2HWC 2;  2BQP A;  3AM2 A;  3S30 A;  4YAR A;  4URA A;  3WDV A;  1W9W A;  4CP2 A;  1HX6 A;  1PGW 2;  2Q1F A;  5LBB A;  4CDQ A;  4DRV A;  5C5T A;  4QQL A;  3WEZ A;  4YW5 A;  4ZU7 A;  2WA3 A;  4ARX A;  3UGH A;  3D3A A;  1PVC 2;  4AFB A;  4CZS A;  3KCC A;  5CG8 A;  2CYF A;  4FSJ A;  1WCQ A;  1IOA A;  4YVS A;  2CNA A;  1MS8 A;  1RVF 2;  1G7Y A;  3QAC A;  2LTN A;  4TWT A;  1OI6 A;  4PLO A;  3RZG A;  3PUQ A;  5A3T A;  1JH5 A;  1QJZ A;  4CRQ A;  4M0N A;  1FPN 3;  3I59 B;  2UUR A;  3MF6 A;  4PHZ A;  1M06 G;  5CA6 A;  4CUA A;  3PME A;  4LIU A;  5A32 A;  1ULC A;  5K0U B;  1DG6 A;  2X53 S;  5HCB A;  3DXU A;  4YYO A;  1FAY A;  4CCN A;  5I0T A;  1LHW A;  1QY4 A;  1J1T A;  3L9J T;  4CVU A;  2NZ9 A;  3E5U A;  4LA3 A;  3RJ2 X;  1UYZ A;  4AYU A;  1W9S A;  1C8N A;  3J7M A;  5FUN A;  3VBH C;  1HXS 3;  1ZRE A;  1W28 A;  1QXR A;  1H6Y A;  5BNP C;  1JW6 A;  2JIC A;  4R52 A;  2WQ8 A;  2BUK A;  4ZS2 A;  3ZOI A;  4E2Q A;  4AI1 A;  4NIG A;  2IZW A;  4BDV B;  3UGG A;  2VW1 A;  5F3E A;  3FC0 A;  1HLC A;  4S2F A;  1UYY A;  2QFE A;  1MQT C;  2JDY A;  2VG9 A;  1F31 A;  2RS5 1;  4LO7 A;  3RI8 A;  2BU9 A;  2XJT A;  5C71 A;  2PLV 1;  3N9M A;  4QPI B;  4XFI A;  1C3H A;  1S55 A;  1YNA A;  1CPN A;  4Y1U A;  2QZ3 A;  4CDW A;  3I97 A;  3RI9 A;  2XJU A;  1DGR N;  5BXX A;  5CFC A;  2JG8 A;  3UJQ A;  3SIS A;  4A7Z A;  3GCX A;  1H1M A;  3Q8C A;  4UFM A;  1YEW A;  1URX A;  4NHY A;  5A7O A;  4NWW A;  2ZAB A;  1QNW A;  3LA2 A;  4XF0 A;  5C4W A;  3VD9 A;  2V73 A;  1DQ2 A;  1ASJ 1;  3IM0 A;  4EWE A;  2JKB A;  3RS6 A;  5C7G A;  4S2H A;  4Z82 A;  3LDK A;  4FQ4 A;  4LLO A;  1MZ6 A;  1KQR A;  3V0B A;  1OUX A;  3VZL A;  5FQ0 B;  1ALY A;  4N7U A;  1ZM1 A;  2JDN A;  5A7P A;  4HPK B;  4JHZ A;  1JZ2 A;  3ZFE C;  3NNG A;  5EXO A;  5FIX A;  5LWB A;  2VMD A;  1ZBA 1;  2DU1 A;  5BPX A;  1RXF A;  3KB5 A;  4Y20 B;  4K9S A;  1DLC A;  1H30 A;  1UNB A;  4BA6 A;  1ZRD A;  2ZX1 A;  4IEV A;  4JDN A;  3RRD A;  2GNT A;  2WNV C;  3JB4 C;  4NVP A;  2VNR A;  1W6P A;  2R06 3;  2V72 A;  3MPB A;  3ZXD A;  1UIJ A;  4BWO A;  5I91 A;  3JD7 2;  5LRS A;  1QOO A;  1ND3 A;  2Y34 A;  4Q4Y 1;  2NMN A;  1QXP A;  2ZHM A;  3HNY M;  4MGY E;  1MZF A;  2XB6 C;  5KXC A;  3T0D A;  2VUJ A;  5L73 A;  2XL7 A;  2CU5 A;  4XFC A;  3ZYR A;  2Y0O A;  2D5F A;  5E16 A;  1V9U 3;  1O3Q A;  4XET A;  1S2E A;  4DY3 A;  3UL2 A;  1VAL A;  2EIG A;  1V9U 2;  1OVS A;  3BTA A;  3OGR A;  1IG3 A;  2YG0 A;  3WP5 A;  1LED A;  5FMO S;  4O9G A;  4KL1 A;  4PIX A;  2AH2 A;  1QDO A;  1YQ5 A;  2OZ6 A;  1AXZ A;  2X5I A;  4MXV A;  1PO2 1;  2BGP A;  3AL5 A;  3OF1 A;  3OSD A;  4QQH A;  4RQP A;  1PO1 1;  1DYO A;  1I5Z A;  4JGY B;  4UFK A;  1HJG A;  1IPJ A;  5T3N A;  1KS5 A;  2VOV A;  1K5M B;  3NV3 A;  4OQ9 A;  5JZG C;  4WZC A;  2FCU A;  1IQD C;  3M2M A;  1ZRF A;  3NO8 A;  3AZW A;  2H0V A;  5EP9 A;  5FY5 A;  2WKK A;  3GXU A;  2VZ1 A;  2PHT A;  2WS9 1;  3A4U A;  1H8T B;  4Z92 B;  4BMB A;  2GND A;  1OD5 A;  3RMX A;  1BVV A;  1G8W A;  1OC1 A;  2D43 A;  4JKM A;  3N36 A;  4XXP A;  2CHH A;  3OD4 A;  1PIV 1;  4CCJ A;  3W59 A;  3FBY A;  3B02 A;  4MV2 A;  4KNC A;  2FQP A;  3ME2 A;  3MUZ 1;  3CKH A;  4LBJ A;  1LUL A;  2VW0 A;  4C0B A;  2DVB A;  4RYD A;  3KV6 A;  5JSO A;  4GH4 B;  5A3M A;  5FYC A;  5FYU A;  2XLG A;  1ST8 A;  4QHO A;  4CDQ C;  4IW3 A;  1H4G A;  2JXA A;  1BZW A;  1ZVF A;  4QQP A;  4YM0 A;  1J84 A;  3LWC A;  1RIT A;  2PHD A;  2D44 A;  1TMF 3;  1VRB A;  2XJR A;  3E97 A;  3PDQ A;  3O1V A;  5C8C A;  1TMF 2;  1LHV A;  1PO1 2;  3DGT A;  4OHX A;  5FFO C;  4QXH A;  5FZE A;  1R1A 3;  2RR1 1;  1AX0 A;  3HQX A;  4LBO A;  1MVQ A;  3T2T A;  1W8N A;  4AGR A;  4QKB A;  1R1A 2;  3ZPY A;  1W9F A;  2AYH A;  4YVS C;  3GNE A;  2WSV A;  4U2A A;  5L7O B;  3LSD A;  3KT1 A;  3OYW B;  2VM9 A;  4BXS V;  4SLI A;  4EWD A;  3LD8 A;  3C7F A;  5AVA A;  5FYT A;  1SEF A;  2JD9 A;  3WVJ A;  3AB0 A;  3AKR A;  5IK4 A;  1I9R A;  5FUP A;  2HWB 1;  4HVQ A;  1LOE A;  1BJQ A;  3OGJ A;  4IGO A;  3MFC A;  4KU8 A;  2PHR A;  1SHW B;  5FZK A;  2VUA A;  4RL7 A;  1GOF A;  1POQ A;  4QX2 A;  2PQS A;  3IDC B;  1DQ6 A;  4IEW A;  1LOB A;  5DXD A;  4FPK A;  3I59 A;  4B4Q A;  4JTO A;  4PT6 A;  1IKQ A;  3NL1 A;  2GH8 A;  4OHZ A;  5GM0 A;  1NXM A;  5K0U A;  1T2X A;  2FMY A;  3ZSJ A;  5FKC A;  2VZS A;  4CSW A;  4JAA A;  3GBG A;  1E5H A;  3HMY A;  1U12 A;  1PK6 B;  4PDW B;  3H1W A;  3LA3 A;  4IL7 A;  4JRA A;  5DAV A;  1DZR A;  4ZY9 A;  1QU0 A;  4ZU5 A;  2WNU B;  3Q8F A;  2VL4 A;  2NLR A;  4CDW C;  2VNV A;  2FDH A;  3AMN A;  5CFC C;  4OMC A;  1OFN A;  2JG8 C;  3H1Y A;  4R9D A;  3V56 A;  4OUS A;  3VDC A;  3DYP A;  5D1I A;  2UWB A;  3ACG A;  2XXZ A;  1FI2 A;  2J1E A;  4W8J A;  1TQ5 A;  2YC0 A;  4Q4V 1;  2PHL A;  3OGV A;  2W91 A;  4LXL A;  5C4W C;  4QPI A;  3U4X A;  5KHG A;  3QD6 A;  4V1P A;  3N4M A;  1JYW A;  3L2H A;  3ZX7 A;  5C3S A;  3JXS A;  3MLJ A;  2BGC A; 
#chains in the Genus database with same CATH homology
 4LK7 A;  4BQ5 A;  4LKE A;  2LRP A;  4YWA A;  3ZYH A;  1W8Z A;  3F95 A;  4A6S A;  2KR2 A;  2VXJ A;  3ZYF A;  3ORJ A;  4LJH A;  1L7L A;  1WMX A;  2JWP A;  3UT0 A;  4LK6 A;  1GWL A;  2WYF A;  1W8W A;  2K46 A;  2LRO A;  1GWK A;  4CPB A;  1OKO A;  4YW7 A;  5D21 A;  3ZYB A;  4CPB D;  4AL9 A;  1WCU A;  4LKF A;  1HN0 A;  1GWM A;  1W8U A;  1W8T A;  2Q1F A;  4LKD A;  1OH3 A;  1WZX A;  4CP9 A;  1W90 A;  1W9F A;  4CP9 B;  2C24 A;  4BQ4 A;  1UOJ A;  2O14 A;  4YW6 A;  4BQ3 A;  1V0A A;  4BQ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...