1UOJA

Crystal structure of pseudomonas aeruginosa lectin 1 in the calcium-free state
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
121
structure length
121
Chain Sequence
AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Calcium and Galactose Recognition by the Lectin Pa-Il of Pseudomonas Aeruginosa
pubmed doi rcsb
molecule tags Sugar binding protein
molecule keywords PA-I GALACTOPHILIC LECTIN
total genus 22
structure length 121
sequence length 121
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07828 PA-IL PA-IL-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 1uojA00
1HN0A 2LRPA 1W8WA 4LKEA 2WYFA 4BQ5A 2LROA 3ZYFA 1W8UA 2KR2A 1UOJA 1OH3A 4LK6A 2VXJA 4A6SA 3ZYHA 2C24A 1W8ZA 4CPBA 1GWMA 1WCUA 1W8TA 1L7LA 1V0AA 3UT0A 4YWAA 2JWPA 4LK7A 2O14A 1WMXA 3F95A 1GWKA 3ORJA 2Q1FA 4YW7A 1OKOA 4BQ4A 2K46A 3ZYBA 4CP9B 4YW6A 4LJHA 4LKFA 4LKDA 5D21A 1GWLA 4BQ2A 4CP9A 4BQ3A 1W9FA 4AL9A 1W90A 4CPBD 1WZXA
chains in the Genus database with same CATH superfamily
2W1QA 1APNA 4LHSA 3M3OA 3UYJA 4DXSA 2P4EA 4LHNA 1LHVA 3JB4C 2RHPA 3LD8A 4K1YA 2FMYA 4Y3OA 1C1LA 1CN1A 4N9HA 4AQSA 4FTEA 2CU5A 3C7OA 1F2NA 3HIFA 1XRUA 2ZCWA 3O1RA 3DPRC 4PDWC 2PELA 3WW1A 5EYXA 4DRRA 3LPGA 1AX1A 3OD0A 4F83A 1LCLA 3OYWB 1SMVA 5LRRA 2Z79A 1W6NA 4TZDA 3ZYIB 1JHNA 4V2WA 3KV9A 3EXUA 2CSGA 3BVCA 3I2GA 4IV3C 5I8TA 5FPLA 3G6JB 1FNYA 3NJXA 1AYN3 1W6QA 3FN9A 4XVHA 5CYYA 5H9SA 3PU8A 5D8AC 1W2NA 1VE0A 2EF6A 2OKXA 1OSGA 1PGSA 3I2KA 3K51A 5LBFA 3RDIA 2O8QA 5LA0A 5EHDA 1Q8PA 3WP3A 3DXTA 4GKYA 5DUWA 4XJWA 3ZVXA 1FI2A 2WZR2 1RB8G 2X05A 3VD4A 4P14A 4M3CB 4COUA 3GHMA 1LOEA 4IEZA 1ULCA 4QX7A 1UYZA 5I0TA 4A6OA 4ZXEA 5A3MA 2RJLA 1H8TB 2WFF2 2YPJA 3ZYPA 1RUH3 3MF6A 5A32B 3TOJA 1I9RA 4D3WA 3HN3A 3VV1A 2VBPA 4Q0UA 5C70A 5IVEA 1CD3G 2Y6FA 1RUC3 2QQVA 4BDVB 3ZOIA 4QPIC 1ND2B 1FOD1 2SLIA 2ENRA 2GC1A 3AMMA 3JU9A 2IC1A 2VZ3A 4LOTA 1ULPA 2CNAA 4Z92B 1J3PA 1VB4A 2VNGA 2ZGNA 2SBAA 4DY5A 3IM0A 2VCCA 2VVFA 3GHNA 4QM9A 3P1IA 5LB6A 5JSPA 4XJ9A 5KWRA 2XBO2 3W21A 2JDKA 4MH0E 3VZJA 4PHZA 3WP5A 4MHUA 2HWF1 2EICA 1HJFA 1HDKA 1RC6A 3KF3A 4JQRA 2ZGUA 3T0BA 4EYUA 2F6BA 3ZDSA 3V0AB 2XVGA 5ABJA 1IQDC 1WD4A 1WMXA 3EBRA 1QEXA 1LOGA 1FMD1 3NNFA 4LORA 4TSVA 4XIKA 5GZDA 4CP9B 3MW3A 2J1TA 3MGUA 1HRI3 4QB6A 1HQNA 3MBWA 4DNYA 4XF1A 2R063 2WO1A 3AMHA 1MACA 3I54A 4E2SA 4QU2A 1H4HA 2C4XA 4Q4V3 3BALA 4HKOA 1XXNA 3ZDVA 3RZGA 4FO9A 4O7XA 1NZIA 1G86A 2VC9A 1YNAA 4EJRA 5JMOA 2Z5WA 1JUIA 1K5MC 1BQPA 1Z0HA 1PO21 3MFCA 4QX5A 2ID4A 3D3AA 3M3CA 5DXDA 5AC91 4M0NA 1W9SA 2VMFA 3POSA 3UJQA 2Z42A 3IZOA 1G9CA 4HSJA 2E51A 2NMOA 3F95A 1DQ1A 3Q8EA 3LEKA 2ZZQA 4GWIA 1RUH1 1UXXX 3VZMA 3JB8A 5FXWA 2XGXA 4AYUA 1RHI2 2PYTA 2XG3A 4QPWA 1PVC2 4X6QB 4HETA 1LECA 3WX5A 1GOGA 4Y1ZA 3C7GA 1IG0A 1Q8SA 5J98B 3VKLA 3WSOA 2VZQA 3BTYA 1D0HA 1OT5A 5A6YA 1XC6A 1WWYA 1O4YA 1YFWA 3W9AA 2PHDA 1FNZA 3J7NA 1CIYA 3K3OA 3KQ4B 3POWA 2ZGMA 1DIWA 5A7QA 5CG8A 5DDJ1 2ARXA 1UY4A 5FY4A 1UU6A 1L7LA 2RJ2A 1LOAA 4S2FA 2CAUA 1JTZX 3U75A 3HN1A 4IGPA 3NL1A 4AI1A 3WHTA 2P34A 4AZZA 1AR91 4DXZA 1REEA 4QWNA 2K46A 2KA3A 1AXZA 4LQRA 5FYYA 1DGWX 2R042 4XFIA 5GLUA 1BK0A 2ZGLA 4CUAA 1XPWA 5LEJA 3FE5A 5FYIA 4ET7A 2HLEA 4XAAA 1DQ2A 3LDBA 1GMMA 3WW2A 5BNNC 2BNOA 1PM4A 1PK6C 1F4AA 1B09A 2N7GA 4BB3A 4IGQA 1JHJA 4GMP3 2AEYA 4NN0A 3SKVA 5DDJ2 4W8JA 2JKXA 4XZUG 3VHNA 1UY1A 5IK4A 2WL1A 1UY2A 1ALYA 4LMFA 1RUI3 4Q2FA 4EE2A 1CIWA 1Q8VA 2J7MA 5JIAA 5JWPA 1TME2 4NE9A 5JR7B 3FHQA 2F4PA 1HX6A 1ZBA3 4O65A 5C4WB 1W6OA 4AFCA 4EROA 2R6QA 1LHNA 3H9AA 3HNBM 1NCQC 1AYM3 4OZOA 3O0WA 1UZVA 2WYSA 3SCFA 3POGA 3VBFA 4Z8BA 1KDMA 1H2KA 1YJKA 4QGMA 3LIHA 2FZ2A 2BNNA 2IUWA 1JZ4A 1FV2A 2HEVF 2WT1A 4Y20B 5T5JA 2BVVA 4CEWC 3OCPA 3AVSA 3B9IA 1RUJ1 2DUOA 4L92A 1R64A 3SC7X 5J3UA 3NNGA 2I74A 4MADA 4QDRA 3MFAA 1V00A 2Y6LA 1DHKB 1BVVA 2WWSA 2YC2A 3LKJA 4MHRA 4Z1VA 3WNXA 3M7AA 4Q4X1 2AGSA 4XAEA 4LIUA 2DVGA 4QPGC 1DQ5A 1OOPA 2JG8B 4LEJA 4DQAA 2ADEA 3WNLA 4YM3A 4N9IA 3H8XA 4O9EA 1ENXA 4Y5Z0 4GALA 2DBIA 4QXBA 4Y4RA 1EPWA 3PL0A 1XB9A 3RQ0A 4XF3A 3B7MA 3POBA 3S57A 2B45X 3WF2A 1DP0A 1W05A 4ATFA 3WUDA 3ZSLA 2W3JA 1QNWA 5FY8A 3IDBB 3CJXA 4FQZA 5A7WA 4A2UA 4Y26A 5D1IA 1IPJA 1W8WA 2GN7A 4MSVA 5K9YA 4C0HA 1RJ7A 1WA4A 1MVEA 3OGRA 3PNAA 4A45A 4Q4V1 3WQ0A 5BNOC 4D69A 3ES4A 2RDNA 3RRDA 3AXDA 3U1XA 1AR92 2JKBA 2XJRA 3B02A 1O91A 3DF0A 1ULEA 3E5XA 4GWMA 4DOUA 2K0GA 1F8VA 2X8KA 2WBKA 3IIIA 1WBLA 2RS12 2DWRA 2J42A 2IXIA 4EN9B 1HB2A 2VCBA 4IGOA 3BTZA 2A3WA 1F31A 1JH5A 2Q8DA 1LGNA 2XVLA 4QQOA 4ZKTB 4PLNA 4BXFA 1JYNA 2ZGOA 3RI9A 4YFZA 4QHBA 3T4VA 2ZBJA 3I3MA 2BNMA 1CX1A 3TEYA 1UL9A 1HV0A 3PVOA 5EP9A 2HEYF 4MGQA 4F3JA 2XHNA 3M3EA 4N7UA 4A7KA 2TNFA 4Y1UA 4A3ZA 3NV3A 2QBXA 3DUIA 4QX8A 5FMOS 5TSWA 2VGDA 3WQ7A 3WXPA 2HKXA 2PXJA 5FZMA 3FZ3A 4Q4X3 2PA7A 4M4PA 5CFCA 4AHXA 2IVJA 5IAXA 1QF3A 1IKPA 4BJ0A 1YFYA 3T1MA 2HWE1 4I0AA 4W6YA 5C7GA 1XNCA 1PIV2 1WMFA 5JXJA 2CAVA 3OUIA 4ZY9A 1RXGA 2RR13 4E4SA 2UYBA 5B2GB 5IHRA 4H14A 2EIEA 2ZKLA 1ND2A 4GZ9A 3X29B 1J83A 1O6UA 2QQNA 3JD73 3VBHA 4OI4A 3WDYA 3VUOA 4MG2A 3MDPA 4CDWC 2YC0A 2ZJCA 4OMDA 2YB7A 1I1EA 1UMZA 1OI6A 1QKQA 1NZCA 2C24A 2VTFA 4DUXA 3ACHA 1PHMA 2RJKA 5A1LA 5BNPB 1UOBA 4H55A 1ZZ6A 2HWD1 5BYNA 3NNMA 2R043 4CCNA 4PLOA 4SLIA 4BQYA 1Y3TA 2NP0A 1MPXA 5DZEA 4BQ4A 3WDUA 1W6OB 1AZDA 2NLRA 3NV4A 1LGBA 5BPXA 1UYYA 3WEZA 5C8WA 3RZHA 1LOCA 1MQTB 2WAOA 5LZ6A 1WW5A 4URTA 4COWA 5F7UA 3B00A 3FLRA 4Z2AA 2ZEZA 3GZTB 4AGVA 1X9PA 3KCYA 3FJSA 4C0BA 2J1EA 5CEHA 1ODMA 3VDDB 2PAKA 3MICA 3A23A 2WZEA 3U10A 2Q8EA 2C9KA 2X29A 2Y6JA 1SBFA 1T2XA 1RGSA 2JIGA 2ZGSA 1RYYA 1U5IA 2AENA 3HBZA 4NPMA 4GWNA 4D6RA 3RWKX 4Y33A 3BU0A 1UOGA 1FYUA 3DXUA 3Q8BA 4N43A 4GIQA 4HT1T 1DFQA 1XYNA 2WNEA 3BCWA 4YZ1A 4R9AA 4RS5C 4Y20A 5JR2A 4FTSA 2PHXA 3LPFA 3CIHA 5ANQA 3N3HA 3MV11 4LBQD 4B3NA 5HCAA 1JU3A 2YY1A 4BH9A 4P9IA 4W4ZA 5H9RA 4Q4V2 1RUI1 2X5IB 5JOWA 5KXBA 4ES9A 5BNNA 2EALA 1KJRA 4O61A 2QQPA 2FCUA 2DFCA 2ILMA 1MZFA 2R0FA 1GV9A 2OW4A 3AMNA 2BFUS 3LGRA 4IE7A 4FPLA 5L73A 4H2AA 2IXJA 4Q5OA 4RHV3 4YVWB 3V64A 4JGZA 4H7MA 3VDDA 4HZFA 3ZSJA 2YHJA 4BISA 3CJIB 4QQPA 2KD7A 4FPJA 2JDHA 4MGKE 5A6QA 1RHI3 4OLLA 3T2QA 1VPHA 1JZ3A 4LBQB 5L19A 3MLKA 3AFKA 5A7OA 3ZR5A 4ASKA 1NCRA 5FKBA 5CG9A 5F8PA 5CFDB 1VRBA 2XKPA 4LK6A 4UWDA 2BQPA 2RMU1 3JD72 3RMYA 3GYDA 1X9TA 5FZEA 4LA3A 3ZYHA 3EYPA 4NJ4A 3HT2A 2R1DA 4N53A 4N7IA 2GDFA 4V1PA 1PNFA 4C8DA 4C91A 4NPLA 1UU5A 5FLIA 1DF0A 5F5IA 2Y34A 4YGEA 5JAXA 3EJKA 4JRLA 1H0BA 1CAXA 1ONAA 1UWWA 1NY72 4NROA 2A73B 3FC0A 1V6OA 4QMAA 1F5JA 2HWE2 3B69A 5FZ8A 4DINB 2CY6A 4WBBA 5A7PA 1PVC3 2HYKA 1WW7A 3ECQA 3OUJA 2P37A 4FPHA 4PJYA 3ZMNA 2DF7A 3M4FA 1BBT1 1LB2A 4HKLA 5JPMB 4AI2A 4XQDA 3VHPA 1W6PB 4J1WA 3AL6A 5E8AA 4D8MA 5K7PA 2BOJA 4D7YA 3ILNA 4IERA 2ZAHA 4DO0A 3I4IA 5FP3A 2VXRA 3HOBA 3LFMA 4LBQA 5EV7A 5LRSA 1Q5OA 4CA9A 2AH2A 5FYTA 5FO7B 3I3BA 2JICA 3BPZA 4GB31 4CCEA 4D6QA 3RZMA 1QJFA 3CU7A 2IFWA 1TME3 4DY3A 3OY8B 1J3RA 3WV6A 2HWC1 2D6PA 1LOBA 1H8TA 1SLIA 4HBNA 5D21A 2ARCA 2P3IA 3VD5A 4AHYA 4E9KA 3E6BA 3IMMA 1D4M3 3HJRA 4LT5A 2JIJA 2AUYA 1BMV1 2DCZA 3A21A 4J1XA 1DGRN 1UCXA 4YVSC 5ABJB 3L9JT 1FXZA 4JGYB 4S2GA 4XEZA 4L8QA 1CAWB 1HV1A 4M3CF 4ZZ5A 3KWVA 3VBSA 2DBNA 2A6XA 4IEYA 3LE0A 3C7FA 3AP9A 2PHTA 2TUNA 4OZXA 3WP6A 5IVJA 4BMBA 4QB1A 2VQUA 1OLQA 2WT2A 4Q8LA 4AVVA 1EY2A 4MO3M 2JE7A 5FZ1A 3A4UA 3JBG2 3QH6A 4PT6A 3IMNA 2XDVA 2WNUA 4XXAA 5A7WB 4AFAA 1CAUA 2BTVC 2QZ2A 4URAA 2RE9A 2YXSA 1PIV3 5DAQA 3WF3A 5CAZA 5A70A 2WQZC 4FPCA 1NQDA 5GLVA 2V09A 3VBOC 4CEWB 2GAUA 1F9KA 1VBD3 5JZGC 2IVIB 3APBA 3ZXAC 5C3SA 4KWLA 1JBCA 4PDWB 5FYUA 4QPGB 1LEMA 5FZHA 1NCQB 4CSWA 4E2GA 3U78A 3QBQA 1N3QA 4J25A 2V73A 2B42B 1MEC3 2ZX2A 4LHLA 2JG9C 1TME1 2C6SA 2B8MA 2YGMA 4QB2A 4ZU4A 4DXTA 2JDZA 2XHKA 5L9RA 4XUTA 4OUMA 2XUEA 4W65A 3I3QA 5DG2A 4CPBD 1AF9A 3NAPC 2GU9A 5FCCA 2A1XA 1UYXA 4AOCA 1JOPA 1LENA 5C4WA 3POEA 5LA2A 3K2OA 3CZJA 3CZUA 3KT7A 4NVPA 4QKDA 4RHV2 5F5AA 4D7TA 3AJYA 1MZ5A 2VO5A 1ASJ1 3PVEA 3AZXA 2GNDA 1AR93 2UWCA 3UK9A 4XXPA 4CDQC 3EB7A 3FBMA 3PHMA 4ISQA 2DU0A 4CVUA 5IATA 2ZMLA 1OQDA 3VKMA 4DEQA 4CDXB 5FZIA 3WF0A 2QE3A 4BPZA 1PGW2 3N4MA 5HPOA 1W3VA 1ZZ7A 2LTNA 2CGNA 2ZEYA 4YLZA 3RS6A 3FUOA 4O9GA 4AR2A 4OHVA 2G9GA 3VBUC 5DUVA 2B46X 3THTA 1TMF3 1SDWA 1OHFA 1T6GC 4CTEA 5ACA1 1UOJA 4YRDA 1I3HA 2JJ6A 1K12A 1ZRIA 3M1HA 4K1ZA 5FXVA 3N36A 5C9AB 2BBVA 1ZREA 1U5YA 4WM7B 4HXCA 3LEGA 5I8SA 1JU4A 4TTGA 4LK7A 1O59A 1XSQA 1HIXA 3PUQA 5JDBA 1GZ9A 4JQTA 5DZGA 4KNCA 2OUHA 2VMCA 5IT6A 4OUSA 3L2HA 3W20A 1HRI2 2FBEA 3WNMA 3UL2A 4INDA 3V56A 3WINE 2VOTA 5BV6A 2CWSA 1F15A 1JYWA 4LBNA 1AYM1 1D4M1 5A3PA 1PGL2 2XLGA 2QDNA 5M0TA 1V6JA 1LOFC 1GFF2 4FPYA 4CXXA 3CNAA 1WUVA 4IV1B 2VU9A 2A70A 4ZONA 1XNDA 4WVZA 2DTWA 3ZFFB 1IS4A 2YU2A 2OYZA 1ZRRA 2UY8A 3JQWA 5CNAA 1CAWA 4CEYA 5CA6A 2BV4A 1H9WA 1G7YA 4A44A 2PTMA 1QQP2 4JAAA 1WW4A 1K5MB 4YZ2A 2WA3A 1NYWA 2ZGPA 3Q8CA 4BQWA 5DUUA 2VJXA 1AJKA 5FZCA 2ORZA 2EXJA 1KITA 1VBA3 4LXLA 2LALA 1IPKA 1GU3A 4LO4B 3BU7A 5DABA 1XYOA 1KQRA 3ZXFA 4QGNA 2P3YA 2LS6A 3SNMA 5A1FA 2YFUA 4KBBA 2JDUA 3ZN4A 4QPYA 4SBVA 3PTYA 5L7OC 1DYOA 2OA2A 3MIEA 3C8XA 1HN1A 3V0AA 1PZ8A 2D6NA 4CPBA 1RMU1 1RUF1 3WG2A 2XOMA 1UMIA 3W5NA 3OD4A 3KB5A 5FBZA 3AP5A 3ZFFC 4LO8A 5B4NA 3FHAA 1CONA 4FCAA 2QQUA 2WRAA 3WT3A 2DCYA 2IXCA 1ZBA2 2VMIA 3ZIXA 4KU8A 4BXSV 3GBGA 1SZBA 3LDRA 1UN1A 3I2JA 5BNQA 3AKSA 2VW1A 1YRZA 5FYZA 2W1SA 3AKTA 1S2EA 1S0DA 4ZXKA 5FWJA 2VMEA 2PQQA 5IW0A 2WYFA 1U0AA 1GLHA 1JZ2A 4CCLA 2ZA9A 2DCTA 5GKAC 3I49A 1TMF2 2YBKA 3NSTA 1ZX5A 4UFKA 4D0QA 4E27A 5LK7B 2VUAA 1ASJ3 1S0CA 3QLQA 5CKNA 1J84A 1MS0A 1W3XA 3O1SA 1RUG1 3PMEA 5DAVA 5F3CA 1G9DA 1RUD3 2DVFA 4CDUA 1C5IA 2X5IC 4XFBA 4UFIA 5JIUA 3USUB 1WMDA 3I59A 4D7SA 4EWDA 4ZS2A 3AZZA 2GN3A 3MO4A 4HL0A 3MI8A 4PI2A 4CDXA 3DPRB 3MPPG 2B4KA 2VOVA 3M70A 1JN2P 4YVWC 1O5UA 4NHXA 2Q30A 2JD9A 1DU3D 3UKTA 5C3PA 3LA3A 5GLZA 2YYOA 4QPIB 1HRV3 1LNSA 2DV9A 5H9PA 4QXCA 3CJIC 5CIRA 1FPN2 2C9AA 2WDBA 3U14A 3RYPA 5IVFA 3CHXA 5F3IA 3QACA 4YNIA 2XJVA 2XR4A 4G4FA 4DIQA 3IDCB 2V4AA 3POFA 5FP8A 4FXGB 5FQ0B 4WM8C 3INAA 1C8NA 1W8OA 4XTMA 3T0AA 5AFEA 4YZ3A 1MQTA 4LHKA 5C9AC 1E57A 4GH4A 3UKNA 4YG6A 4KG8A 4DFSA 2R16A 5J09A 2Q4SA 5D8AB 1OF4A 4JCKA 5CZKA 4EN7B 1JODA 5JVVA 4AFMA 1MEC2 4IV3A 3PUAA 2WO2A 2PLV1 4DB5A 4NRQA 5D8AA 3TAYA 5KR7A 3N9LA 3AP7A 2HBTA 5FY5A 1OBNA 1BEV1 4YGBA 1D7PM 2VBBA 1YEWA 3ES1A 1LU2A 3PJYA 4JDMA 5ANNA 4GA9A 3VBRB 1NA1A 5K0UA 3ZMOA 1GOHA 1A6CA 1N3PA 3KV5A 4FP2A 1OFSA 1U12A 3KCXA 1RVF1 1UO9A 1IS5A 3THCA 4AHWA 5T54A 3DV8A 1MS8A 2Y8KA 4GQ7A 4NAMA 3VBHB 1RUG3 1ZZCA 4P5HA 4LUMA 2Z69A 2WA4A 2VVDA 3GZUC 4CU6A 5A1AA 1SLTA 5FY0A 4LKFA 1RTVA 3C7HA 3AP6A 4Q1PA 1Z7S3 1REDA 2XLAA 3BTAA 4YSFA 4XJAA 2D3RA 5FYCA 1QGLA 3N9OA 4HN0A 4IV1A 4FPEA 1JZ7A 4I01A 5F3GA 4NHLA 1U5ZA 3AZVA 1PX3A 3E97A 4JRAA 1KDKA 1VAMA 1FX5A 3KM5A 4YGDA 3WY6A 1AR62 2VZ1A 2Y6HA 1GZWA 1AR72 5IYYA 1KJLA 1QJU3 3VBSB 1ASJ2 3WNPA 4DUWA 4YM2A 4UYBA 3WQ1A 1BXHA 4P9GA 3ELNA 1RUE2 1UZWA 4FPGA 5ABJC 5FO8B 4LO7A 3HAGA 1DGLA 4JHTA 1RHI1 4FOYA 3AK0A 1K5JA 2R062 4KG0A 5I0UA 4AEDC 4LITA 2YU1A 1BHGA 3PUIA 1UKRA 3LQCA 1K3IA 2QCSB 4U2AA 2D43A 4Z82A 1VBB3 1RUOA 1ND3B 4XUOA 4NRMA 3SCHA 5IUQA 2OVUA 2DVDA 5FDBA 2HWB2 1FPN3 3E6CC 2DVAA 1BVP1 1O7FA 4RR3A 5F5QA 3M2MA 5BNPC 1GICA 4HLTA 4QQ2A 4KGQA 3AB0A 3J26N 2EXKA 1ZBE3 3O7OA 4BK4A 2D3SA 2A3XA 2W2IA 3S5QA 1O4ZA 1R093 1XYPA 2H0BA 2OQ7A 1HRI1 2EXHA 2Q5TA 4CCMA 4CUGA 3V65A 4AK3A 1HB4A 3U4XA 5IK8A 4BQ3A 5FYMA 5A32A 3D0JA 2AZ5A 3LAGA 1AL23 4H3WA 1SLBA 3BUCA 4QM8A 2XJPA 2ZX0A 5J36A 3RVHA 2FDJA 2VL4A 5FFOC 2A5ZA 3VBRA 2BVBA 1CAVB 4JDOA 2XQRA 5FMOL 5AC93 4IEQA 3T30A 4R9CA 3NAPB 5FZOB 4AWDA 1WA6X 5BNNB 2E6VA 1G9BA 4IESA 5FK7A 4YW2A 3W58A 3THDA 1AX0A 4YWAA 3AL5A 3AYAA 4HFSA 3USUA 5KC6A 1NE4A 1N1SA 2QNKA 3KQRA 1ENSA 1GQHA 2VW2A 3IT8A 3MW2A 4E4ZA 1HW5A 2OZJA 4YZ5A 2LUWA 1BK1A 4I09A 5AVPA 1W2UA 4JV4A 1W99A 3GJAA 3VBFB 2MEV3 1GSLA 3DL3A 3P6BA 4HVRA 3ATGA 4NWWA 4OVEA 4BMEA 5JXGA 3R4SA 3W5MA 1H30A 4FFIA 5A3UA 2FDGA 2OIIA 4OHZA 2Y64A 4NIDA 2VAUA 1QU0A 2MNGA 3J7LA 4LBOA 5HCBA 1NX9A 1OH3A 3CBNA 4Q1RA 1BEV2 1ZA7A 3E5UA 5FYHA 3OTFA 5A33B 1OOPB 2JG8A 5FPBA 4Q4Y2 2WFF1 5JI9A 3AYEA 1RUD1 4BWOA 5I0RA 4XACA 3UETA 2Z4FA 4META 1QJZA 2WZ8A 1QJU2 1OA4A 2DCKA 3ZFGA 1QJX3 2JE8A 2W94A 2J1RA 4XTPA 2IXLA 4X8NA 1NT0A 3VBUB 2V4VA 4MV2A 1PIV1 5F1RA 3ZFEC 1W8NA 4WM8B 3VBFC 1FMD2 1WCKA 5ISLA 1FV3A 4R4XA 2QQJA 5F6LB 2PFWA 2R7EB 1B35B 4W6WA 4JX0A 4NRPA 2D3PA 2BP6A 5ACA3 4NHKA 1HLCA 4AEKA 2ZTNA 3AX4A 2JDMA 1QJY2 3MEPA 3ZYRA 1O3SA 1XU1A 3UT0A 3WG4A 3WP4A 2QKDA 5I8YA 3IBMA 1OOPC 5IK5A 5F2SA 2BUKA 5J96B 4Z07A 3ZPOA 3UGHA 4S2HA 1UYPA 1YQ2A 2UWBA 3CKHA 3VDAA 4QD2A 1H6XA 1US3A 2WS92 2Y26A 2RDSA 4ASMB 4E4DX 3S0MA 1QOOA 2D6LX 2HH9A 2JX9A 3DGTA 4LKEA 3T09A 4DRVA 2VCAA 4XW3A 4YW5A 4MXWB 2XBO3 4Y4YA 5FUIA 4YG0A 3MF9A 3ZKUA 2CV6A 2Q1MA 4XF0A 1R082 5G04L 2R073 1ND3A 2JECA 2A75A 2WN2A 1VRH2 2NPIA 3POIA 3LA2A 4JTOA 5SV8A 3UESA 1YCIA 4L99A 4CUCA 1OURA 2D44A 1Q3EA 4JGYC 1GNZA 2BBAA 3J8F3 1V6LA 4KWKA 3A7QA 2D97A 2JDNA 2C26A 1EAH1 2RS32 4MUVA 2A71A 4RGAA 3SH4A 4Q8KA 5I93A 2GH8A 1ZBE1 1OA2A 3B93A 1UMHA 3J7MA 3QD6A 4CU8A 2W39A 1R091 1Z78A 2G9ZA 3NJVA 2GALA 1UF2C 1DQ4A 3NKGA 4Q0PA 2OT7A 2MEV2 2NQYA 2Y33A 1W8HA 1R081 2QQMA 2MHFA 4RQPA 5FYBA 4BOWA 1UZYA 4RA0A 2VZPA 1LESA 5E6HA 2EXIA 3USSA 1SLAA 1XNBA 5HCFA 3N7MA 4CU9A 5J7MA 3TRSB 4E2QA 1ZVFA 2VZOA 2FDHA 3GF6A 3Q8FA 2AEZA 5L36A 4GD4A 5CU1A 4EV0A 1X33A 1UIKA 4M4RA 5CFCC 1GWKA 4FI9A 3WVJA 2WNVA 1KGYA 1M4WA 3RZZA 4NR1A 1H2MA 5C6CA 3BTXA 4LE4A 4M01A 3HEIA 1XJAA 5F3EA 3LB9A 3OBZA 4FPKA 1RXFA 1NLSA 3N35A 3SXWA 1XNKA 4XFCA 4C1WA 2XJQA 3RZJA 2E7QA 2VZTA 1DZTA 2BDRA 3FL7A 4F8AA 2ZEXA 2ARBA 1ND2C 3E6DA 1B35A 1HRV2 2FCVA 1N1YA 3AJZA 5T52A 3RNSA 1TEIA 4CDWA 3U37A 1RUH2 3VN4A 3H1YA 2WUHA 4FAHA 2UU8A 1GBGA 4KL1A 5FKCA 1UY0A 3O14A 4K6BA 2XWBB 2PQSA 1EUUA 2A6WA 1OC1A 1EV13 1VBA1 1RUG2 4CDQB 1TZOA 2WJSA 2UYAA 1JUHA 2I2SA 3I2DA 2ET7A 1HJGA 2R061 4BYYA 1YI9A 1VBE3 1UU4A 5IK7A 3BOWA 3O0XA 2QTWB 4IEWA 5JLVA 1NAEA 5GZEA 2R49A 4UFJA 4AI0A 5FMBA 2QZ3A 4HMZA 4LA2A 2UURA 5FRAA 2DU1A 3DPRA 2VM9A 1ULOA 3ZX7A 3TN92 3FFZA 1AR63 2ATFA 4UW3A 1Y9QA 4NHYA 3EMRA 2D5HA 1R1ZA 4JKMA 3T2TA 1N47A 2E26A 5DAWA 2MEV1 4F7ZA 1ODNA 5CFDC 1C4RA 4Q0VA 1W6QB 5FP9A 1UPSA 4YW1A 2RV9A 4UOJA 3OG2A 4CCOA 3TEWA 3DKQA 4NIIA 1AR81 4CE8A 5JOZA 4LBMA 2WZPP 4B4PA 1YQ8A 2VMDA 2BWCA 4HG6B 2ZABA 3H3UA 5DN2A 5A3TA 4AQ2A 1V6NA 4IEVA 5FZFA 1X7NA 1AXKA 3ZSEA 2WNVB 2FZ1A 3CMGA 1VP6A 3MIGA 3K4AA 4TN7A 4K20A 4XDQA 4LPLA 3WDXA 2ZX3A 1QH7A 3N9MA 3JXSA 4QPIA 1POQA 4AVTA 5F5CA 1ZBE2 2VOWA 3WQBA 4BQ2A 2C0ZA 2O0OA 2WFPA 3H7JA 3K4ZA 1DGRA 1BBT3 2JXAA 2VECA 1W06A 2VZVA 3AMPA 3NJZA 3UV9A 4P00B 2F17A 3U4SA 4CP1A 1PVC1 3AP4A 2V5YA 5FZLA 3B5LB 3GBWA 3LEIA 5A3NA 2QDRA 1VRH3 4AF9A 3KGZA 1PO22 2IZWA 3PJQA 1PO11 4CDWB 2HWD2 2ZGKA 3H0OA 4X8PA 4GXLA 1VBB2 1O5LA 3TEXA 1KEXA 1H4GA 5FJKA 2QQOA 5EXOA 5FREA 5FPZA 5DPNA 1VBC1 1O3RA 4PDWA 1URXA 4K8RB 3WOGA 4BK5A 2XKOA 4S2DA 3IIAA 4CCKA 4PF5A 4HN1A 1SBEA 1QMJA 2LW8A 3ZXLA 3GDBA 1XNAA 1YQCA 5FP4A 1IZ3A 1RINA 3AYDA 3P3NA 4D6SA 3MUZ1 1DBNA 3BIEA 1COV3 4L9BA 4XFFA 2E31A 5HBAA 3Q8AA 2X53S 4YW3A 1ACCA 1D0GA 2ZEWA 2VNVA 3D0SA 3I2IA 5EJ3A 4OI1A 1O3TA 1BLZA 2MPFA 4AG4A 3IB3A 2F4LA 4QHZA 3NWKA 4ES8A 4RSUA 5EWSA 1FPN1 4A7YA 4Q4W1 3FLPA 3PLQA 3WF1A 1PZ9A 1QOSA 2YDEA 4BIOA 5FY7A 5JXHA 2Z2SB 4PCRA 4AEDB 1N3OA 1YO8A 3AYCA 5C3RA 4ZZ8A 1QH6A 3TN93 3URFA 1M06G 4CXYA 1QDCA 2IXKA 1E5SA 4TLGA 4UF0B 3WG1A 5CBLA 1OF3A 4AFDA 4CP9A 5E89A 1T6BX 3ETPA 1H8TC 1HKDA 2C1FA 3BPSA 1X50A 1Z7S1 3IAQA 2HYXA 3W59A 3T0DA 4XUNA 4K21A 3P5BA 4UF0A 3WZ1A 2ERFA 2HWC2 4GMP1 1KFUL 2BYVE 5A7NA 1ZZBA 1GQGA 2G1MA 3E5QA 2ZGTA 4CXWA 3HPNA 2DFBA 4AQTA 2YFZA 1C57A 5FZDA 2D7FA 2YPDA 2WZR1 1X82A 3RSJA 2WLQA 4FT8A 4YZ4A 2JWPA 2E63A 2P6HA 1NLRA 2QQKA 4A41A 4XDPA 1GNHA 1VBC2 2Y0OA 2PMWB 2JENA 4RN5A 1NY71 1BJQA 1OUSA 1MEC1 3OBRA 1SPPA 2W1WA 4LIVA 2NYYA 1CPNA 3TBDA 4MLOA 3BN6A 2W08A 3BGAA 2ZHLA 4WM7C 1E5IA 1PK6A 3C3VA 3JZVA 2EVXA 4FPOB 2GP3A 4UW4A 4XBNA 4Y5SA 4MGIE 4RYDA 1PX4A 1ZZ9A 2HWB1 2OS2A 1OLRA 3VBOA 3VZNA 4YM0A 2YG0A 4B8EA 2XQXA 3IKWA 3MLJA 4JTNA 1QJY1 1TNRA 1YQ5A 3SEPA 5HI0A 1UX7A 1JZ6A 4ITCA 4M3CA 4CEYB 1QDOA 1MR5A 2JDAA 4YFWA 1NCQA 1WLCA 1NXMA 1ZRDA 1TE1B 1LEDA 1VLNA 4GJYA 1Y4WA 4YPJA 1G6NA 1YUDA 3HVDA 3WCRA 4LKDA 2G4IA 2JG9A 3I3EA 4LUKA 1HXS1 4XYXA 1QHDA 2NMNA 1CAVA 3OF1A 5FMCA 1S2BA 4A3XA 4CEWA 3SLIA 1AYN1 1W0PA 2V5DA 5LA9A 2D6OX 2LM3A 4UFHA 5H9QA 4YM1A 5FZ9A 3BKZA 2W5FA 3ITQA 2VXJA 5ERLA 1QXJA 5B4XA 1AR71 5FUPA 4HANA 3CQOA 4QXHA 2WO7A 1E5RA 2R072 3LSDA 3TYJA 3RZLA 3R0RA 1JS9A 1RUI2 4ARXA 4ZU7A 2BW8A 1Y9GA 2WZR3 2VPVA 2GC0A 4IL7A 1BKZA 5LY1A 2R041 3Q9OA 4I0WB 5D2AA 4EWAA 1OMIA 5KHKA 1RUE3 3UKVA 3G7DA 3ZN6B 1X8MA 2RS13 3OPZA 4XDOA 3GM8A 5DQ0A 4AL9A 4I02A 3HQUA 1LKNA 3JCIA 1EUTA 2ZKNA 3KV4A 5FY9A 3WF4A 1Y9MA 1IPSA 1Q43A 3VHOA 4IEPA 1OD3A 1GP5A 3B01A 2OQ6A 3ON7A 4PI0A 4GULA 2VH9A 4FXKB 2Q8OA 1MZEA 3KLSA 3KZ4C 2ZXQA 4GJZA 4AHZA 1YFUA 2VZRA 3HNYM 4UT5A 2VE1A 4K3UA 1SACA 2P17A 5FAXA 1F5FA 3IDEA 3RI8A 2DDUA 3MIBA 1QJX1 1QOTA 1LJ7A 2VCMA 1LRHA 3ALQA 3N9PA 3SH5A 1FATA 1ZYBA 2VZUA 4LOSA 4IETA 1JZ5A 1DCSA 1NUKA 3N9NA 4XIOA 2B39A 3H42B 4U36A 4XFHA 4AI3A 1NLQA 4NIHA 1F35A 4LO5B 5LW9A 3H8RA 5FY1A 1LHUA 1HRV1 1LOFA 2GH2A 4IEXA 3WG3A 3EHKA 2YGLA 3R4UA 3VDCA 4EN6B 4QKBA 5KC5A 1R1A3 1RMU3 1JYCA 5FPUA 5T50A 2RS31 3FMGA 4DXRA 1LGCA 5FK8A 5AC92 4BE3A 1CZSA 3HBKA 5FO9B 1V9U2 2WLPA 1G9FA 2VULA 2Y6KA 3H1WA 3VD7A 4LBKA 4AVCA 3WD5A 1WGPA 4K7JA 4PIYA 5C8CC 5LBEA 4YGCA 1W8FA 2W91A 2ADDA 2FMDA 2HWC3 3HNMA 2VUDA 1GNYA 2VR4A 1PMHX 1QXPA 3ACFA 4RGGA 4YG3A 2WQ4A 1NXD1 5CKQA 3LIGA 4PF1A 5C3QA 1A78A 1W2TA 3CEWA 2DCJA 4QKNA 5CKMA 3S5AA 1W39A 2O1QA 1GZTA 4YW4A 2FD8A 1CZVA 4Q4Y1 4CYDA 5BNOA 1A34A 1SBDA 1PGW1 2VQAA 2XUMA 4E4HA 2P5BA 3JUUA 1EPZA 4UFLA 1BYHA 1EAH2 1W6PA 4Y22A 5BNOB 3IDAA 2BGPA 2Q1FA 3LSEA 5HCHA 4Q27A 1BMV2 5FZGA 2ET1A 2VTXJ 3KS7A 4HK9A 5C8CB 1V6KA 4AXOA 3PIJA 4M00A 1YJLA 1FOD2 5J37A 1C3HA 4NMIA 4PBOA 3KCCA 4WVVA 2L9LA 1JW6A 1OUXA 1KS4A 3VGIA 2E53A 3S6PA 2E33A 2E7TA 3R6SA 1JOBA 5LBCA 4QX2A 4ZU5A 2ZMNA 2YBSA 3M8LA 3WW3A 1QWRA 1RVF2 2BOIA 4NIGA 4BZ4A 1OD5A 2OPWA 1OPOA 1QQP3 5KHHA 4TWTA 3T3YA 1AVBA 2I45A 5CB7A 3HQRA 4Q0QA 1UAIA 1ZBA1 4RS5B 3PUSA 2CDOA 3DYPA 5FZ3A 3T1LA 4CUBA 1GZWB 4WV8A 2ARAA 2RS51 4IE5A 5GM0A 1WBFA 4KU7A 2WKKA 1DLCA 1UPIA 1JXNA 5LK5A 1OH4A 3WLUA 2ES3A 5JSRA 3CO2A 4AFBA 3ZFEB 4OCTA 3D4KA 5HV4A 1HN0A 2XONA 3IPVA 4QGLA 3LOIA 2EA7A 4XUQA 3VHRA 1FT9A 3ZYJB 3KMHA 1W6NB 2Q0AA 4EN0A 3VBHC 4A6SA 1QJY3 1RUJ3 3IPVB 4B4RA 2RDRA 3LCPA 5F2WA 5LCWL 5AFBA 4AVSA 2CL2A 5GALA 3HMYA 1YC61 4XBLA 3OPTA 4QDQA 4WVMB 5GLWA 1ZA4A 5LASA 3OJBA 1TVGA 3OB8A 1VIWB 4WM8A 1J59A 3EQEA 4J6GA 1D2SA 1V9U3 4LBJA 1PNGA 4XE9A 3O1OA 5JSOA 5FZ4A 4GH4C 3AC0A 1PMIA 1CPMA 3QCWA 1W9TA 1WCSA 2WWJA 1ENQA 3ETQA 1YI7A 5A3OA 4ASLA 2XLFA 5C5TA 4XILA 4A4AA 3V0BA 3MW4A 1IS3A 1NCRC 2RM21 2HBUA 4MGSA 3AM2A 4OHWA 1C8M1 4L97A 4A7ZA 4CDUB 3WUCA 5A33A 5FZ7A 2PHFA 4N53C 5FBJA 1R1A1 4AI9A 1UD1A 2VMGA 3J8F2 1AR61 1ULDA 1NA1C 4ZPIA 5FYSA 5K0UC 4JGZB 5GJ6A 4OULA 4CRQA 1GP4A 1V6IA 1HB1A 2WNUB 2K2SA 2VUCA 1OKOA 1Q8OA 4XHXA 3WDWA 2BJSA 3NNJA 1IQAA 4Z2WA 5CFCB 3MIFA 2JE9A 3ROUA 2VUJA 1RUC1 4FFHA 3O0VA 2P2KA 4OHXA 5EYYA 4COVA 5T5PA 4LULA 3ACGA 2OXBA 2XB6C 4FOWA 3WNNA 4C90A 4E8CA 2PHUA 1O8PA 1W2OA 1XOYA 4R9BA 1REFA 1SG3A 4IV1C 3O5SA 1WCDJ 4JHZA 5C3OA 1RUF2 4LBLA 4CP2A 2BFUL 3NV1A 5KHIA 1RVF3 3VL9A 2K9ZA 4L2NA 4XJZA 3ZO0B 1VB2A 3OOXA 4BHPA 3ZM8A 5F37A 1I6XA 4QT6A 5JUVA 1ULGA 4XOGA 3RYRA 2DVBA 2HWE3 4AVAA 4OI0A 4JKKA 3VDDC 2WINB 1OA3A 3AKPA 5FZBA 4B29A 1POV0 1C5HA 4ATEA 3LA7A 5DUXA 1W6MB 3FHIB 1JYIA 2JB4A 4Q0SA 4AEDA 5DMYA 1GR3A 4OQ8A 3LOBA 2RG4A 4G3YC 1VRH1 2WWUA 3OGJA 3DN7A 3KT4A 2VQ0A 1KFXL 3ZXGA 1GUIA 4OFGA 4UFMA 3ZXDA 1R1A2 3AVRA 1S0GA 4RR3C 3N7KA 3MLLA 1N1VA 5IFTA 3KSCA 3JQXA 1QNYA 4QU1A 3ACIA 4P5YA 2RM22 3KF5A 2JDYA 1J1TA 1TG7A 1D4M2 2FCTA 2LRPA 2A6ZA 3EO6A 3UJOA 1S0IA 2VTXA 4QQLA 4CCCA 4BQ5A 4OMCA 3SCGA 2V72A 2OUJA 1W8UA 1K5MA 4RFT0 1YIPA 2X10A 2XBO1 1UW8A 4AEMA 5I91A 3ACLA 1UXZA 2DTYA 2BEOA 3MYXA 1OVPA 2HWF2 5C5UA 2GNMA 4XQ4A 4N8MA 5DDJ3 2DUPA 2JD4A 4IV3B 3SKJE 1VAVA 2EIDA 4B1LA 1V9U1 4TYSA 2YBPA 2ORXA 2EAKA 3ZR6A 4GKXA 3BYWA 4QX3A 1DQ0A 2VNOA 1CGPA 5FP7A 2A6VA 2E32A 1DYKA 1SDDB 4K40A 5FJHA 1AL21 3LF7A 5HXMA 3N7LA 3C7EA 3VZKA 3FLTA 3IAPA 2RR12 2J1SA 5I0SA 1OLME 2H6CA 2ZACA 4RGKA 5L9BA 2WSUA 2W92A 3DEMA 5IJRA 1WCQA 3POJA 5K8SA 1RITA 5DZFA 1C8M3 3AXEA 2VW0A 4KBZA 3VD3A 5EIYB 1W03A 1CESA 3SMHA 4YVSA 4UAPA 1SCSA 2VG9A 4RHV1 5E88A 4CDQA 1RUF3 3LFIA 3VB9A 3AMQA 1MZ6A 1POV3 4N53B 1Q8QA 1H2NA 4Q4W2 4IDZA 2O8OA 2WC2A 3NVCA 2YUEA 4ZHNA 1GYKA 3R05A 2ZGQA 3OBAA 1KXGA 4MX3A 3ZFGC 1BBT2 1C28A 4IQPA 1LULA 3TNPB 3KHCA 2XL9A 4LLFA 4KQ7A 1K45A 2RS11 2WT0A 4GMP0 4HPKB 4NHMA 5IAVA 3A0KA 3RYKA 3SH3A 3VBUA 4A42A 1PZ7A 5FIXA 1WLDA 2KR2A 1S0EA 2QVSB 2NN8A 2RMU3 2ZGRA 4Y1XA 4C1XA 1KRIA 1HQLA 4DZGA 1W04A 4B7EA 1PK6B 4FPFA 4XCAA 1S1AA 1XNTA 1SHWB 1C8M2 2A3YA 2I07B 3JBG3 3ABZA 2DUQA 5FUNA 3TWIA 2GMEA 5BY5A 4IW3A 3SEEA 4MXVA 5HXVA 3RWNA 5JPNB 1AL0G 2VBDA 3ASIA 2AR6A 5F32A 4GWJA 1EAH3 4IE0A 1SLLA 3WDTA 4NPRA 4BU2A 4P9JA 1PVXA 1O3QA 5DAXA 3T2OA 1GKBA 3MHZA 4KH9A 2TBVA 3HT1A 2VMHA 4M3CE 1K42A 3NAPA 5FZOA 1A8MA 1CQ9A 2JG9B 1IOAA 1ENRA 1UIJA 2CYFA 1W28A 1DQ6A 3O1UA 1DDLA 3GALA 5C4WC 4IEOA 2VY0A 3I97A 1P8JA 2ZHKA 4MGYE 1AHSA 3R4DB 2QFEA 4QPGA 1UX6A 3UNPA 1VMJA 1RIRA 1VR3A 4AW7A 2DURA 4IUGA 2YZ4A 3ZXKA 1IS6A 1OFNA 2O14A 5FXZA 2X09A 2DYCA 3ZKYA 5EJZB 5FZAA 3VBOB 4KMQA 4FBFA 3POYA 3WHUA 5KXCA 2D5FA 2A6YA 4V2VA 1RUE1 2FHRA 4N90A 4OHYA 1W90A 4K9SA 4LE3A 2IXHA 1I5ZA 2R30A 1SFNA 4MVTA 1ZM1A 5ACA2 4HSLA 3FFQA 3VDBA 3C2UA 5J48A 2HWB3 4B1MA 1CAUB 1DLLA 3GXUA 3GZAA 3O1MA 1E5HA 3MZHA 3KVAA 3OGVA 4DS0A 1DGWA 2D40A 1MS4A 5IVCA 3SITA 5FLJA 1XSRA 2IWGB 4P02B 4FOQA 4RD7A 1J58A 1DZRA 1UKGA 5EFUA 2YV8A 1VMHA 1WD3A 1XBFA 3ZXJA 4XUPA 2WS93 3H8UA 1OXCA 1EV11 3ZLIA 3MUY1 3QOPA 5A80A 5A3LA 2HEWF 2XPJA 2UY9A 4M0HA 1HXS2 4IE4A 4HVQA 4XBQA 1RUC2 2JB8A 4FFGA 1R083 3IN9A 5EPAA 3GCWA 1UQXA 1W9WA 2XVKA 4LR4A 3BOPA 4NAOA 2ZOEB 3T08A 5LEKA 1AX2A 5E16A 1SEFA 1B35C 1W2AX 4QXKA 1L7QA 3SHRA 5F9TA 1IGOA 2ZS6B 4MXWA 3NV2A 5A6XA 4LO6B 1QQP1 3A0NA 2AYHA 2ZHMA 1S0FA 4YYOA 1TNFA 1JYXA 4PQ9A 2E9QA 4AAXA 5CADA 4UBHA 4XABA 1JZ8A 4P08A 4CDXC 2W0XA 1A3KA 4GH4B 4KWJA 5IWFA 4YVWA 3DKWA 2XJUA 1ULFA 1DG6A 2ZMKA 3NW4A 3CJIA 2R0HA 2R32A 3AKQA 3SISA 1BEV3 4JC1A 2PHWA 3O1TA 2FQPA 4I0BA 4JZRA 5SV5A 4WVWA 2WNOA 1YHFA 2P1BA 1YLLA 3CL1A 4DEVA 2ZZJA 4BLJA 2PAEA 2PAMA 2G19A 2Q8CA 2XMLA 5FLHA 1XE8A 4KWUA 5C9AA 1S55A 1H6YA 3IWZA 1D4VB 1NA1B 1S0JA 3D5OA 5K0UB 2AACA 3I2HA 5FOJB 5LY2A 1ST8A 3FX3A 3I59B 3PUHA 4E8DA 3K3NA 4XMIA 5EQUA 5G05L 1RUD2 4Y1YA 4YW6A 5JCTA 2CGOA 4OYUA 1XE7A 4RL7A 2CTVA 5I0DA 1WLWA 2Y0IA 1GQPA 2ETEA 3LZZA 1MS5A 5T5LA 1BCXA 2CDPA 3WW4A 1GZCA 3E1F1 2D98A 5LATA 1SQ4A 3WNKA 3RMXA 1Z7S2 2LROA 4UBGA 4B7KA 1STMA 3I3DA 3OEAA 2PLV2 4EWEA 2BRTA 3THPA 5BUVA 3KV6A 2IFRA 3BIWE 1PO13 5HV0A 2W1UA 1VBD2 5JXIA 1DZQA 1AR82 5T5OA 3TB0A 1POV1 1O4TA 4LLOA 4AGRA 1V0AA 2P3KA 2RS53 4XFAA 1PM7A 2VNRA 4KI5M 3ORJA 4N43C 3U0ZA 3VLBB 1JMUB 5KBFA 3ME2A 4CDUC 1VBE2 1S4CA 1CZTA 1V6MA 2PHLA 3I2FA 3CDZB 4RS5A 4XHBA 2C5DA 5CVRA 3OEBA 3ZPYA 1LR5A 3J7HA 4AE2A 1ZRFA 1CWPA 2RDQA 1MS1A 1WLTA 3DYOA 5C33A 1W9YA 3VZOA 4XF4A 4HONA 3AZWA 3KT1A 1RMU2 1X36A 3O1VA 4MYEA 2Y60A 4Q29A 1OPMA 4Q4Y3 4AQ6A 2J1AA 4ZS3A 1GWMA 4XMAA 1UZZA 2OZ6A 2Y6GA 3MIDA 3MV01 1H9PA 5EJ1B 1SCRA 4JGZC 4AGGA 4IE6A 5FQ0A 5K4LA 3TN91 1PO12 1D2QA 3FWEA 2GNBA 2G9FA 3K77A 1MQTC 4IEUA 5T3NA 3I7DA 3T4HB 4HOOA 4COZA 5GLTA 4BA6A 3HD8B 5L9VA 5JI7A 2QQIA 3ZIWA 4CP0A 1LODA 3OUHA 2RM23 2GC3A 4I2OA 1WZXA 4MGTA 1HB3A 1TMF1 1WW6A 2UWAA 2HJIA 4HVOA 3GBFA 4HPKA 4R9DA 1TQ5A 2GSYA 2J1VA 4L11A 2B5HA 4XJ8A 3WDVA 4BCUA 1JYVA 2W95A 1WMEA 4XQWA 4FP3A 1PGL1 2EAAA 5APAA 4KGGA 4R8HA 4RR3B 5AVAA 5BNPA 1N1TA 3H50A 4W50A 5FR3A 2W87A 1QJX2 3U11A 1W6MA 1CJDA 2Y38A 1GANA 3DYMA 3UGFA 3QH7A 1EP0A 2D6KA 1AYM2 1EYBA 2BU9A 4QQHA 5FPAA 3TNQA 3UGGA 1JOJA 2R1BA 4BLIA 1LAJA 1FOD3 1IHMA 3OY8A 5GZGA 2GZWA 2XXZA 1S2KA 2VQTA 1MVQA 3AZYA 1VMFA 3CF6E 4TLFA 1JI6A 1UNBA 2QQLA 2JDPA 3VBRC 1BZWA 2E7AA 3GNEA 1G8WA 4FFFA 4Y22B 1YIFA 2QQWA 1L7RA 2XJTA 4GB32 2WR9A 1AXYA 3N7JA 3GGLA 4XETA 4Y1VA 5A6ZA 5LA1A 1ZRCA 1RUNA 5FPXA 1LTEA 1YXWA 3OPWA 4XPVA 4OQ9A 3PDQA 5FZKA 1WCUA 3WNOA 3H8OA 3KHBA 4XFGA 3ENRA 3L2YA 3B9CA 3LWCA 5DG1A 4PLMA 1AUYA 5FZ0A 4PIXA 3J8F1 1Y7BA 5EZWA 4DPNA 3VL8A 2W52A 2WABA 1GWLA 1Q56A 2KXLA 2JEMA 5F39A 1VBA2 4WM7A 5FYVA 1SFYA 1HXS3 4QHOA 4XZPA 1KD7A 1AL22 4BQ1A 4I3PA 5LBBA 1PMJX 5FXXA 1W0NA 3BB6A 1NG0A 1AR73 3FUQA 3KVBA 1VJ2A 3NQHA 4MZUA 2XWJB 1LHWA 1UZ0A 3A22A 1QY4A 2YROA 4FQ4A 3O12A 4IXLA 4QKFA 4LNVA 2B9VA 1IG3A 3VBSC 1OKQA 2RS33 2W68A 4GB33 3WR0A 1CX4A 1X8EA 4AAPA 3T2PA 3HQXA 2WAAA 3S30A 3ZFGB 5JOYA 4OUEA 4OI2A 4YARA 2WNUC 4R4ZA 3ZN6A 2B7YA 3S7IA 3J9SA 1FAYA 2TEPA 1SFPA 1XQNA 2NZ9A 2CHHA 3K46A 3RJRA 3OBTA 4NUBA 2PLV3 4WVMA 4EZHA 3PTRB 3OGSA 2QUOA 3I8TA 4MOAA 3O1PA 5JZGA 1W0OA 4NIAA 1AR83 2BERA 4XC9A 1NQJA 1VBB1 3GCXA 3HR9A 5FTTC 3RG0A 4CCJA 4CCDA 2BGCA 4CU7A 3K75B 4Y5TA 3K4DA 3H3ZA 4QX1A 1W8TA 4JDNA 5C71A 2A7AA 2W46A 2BZDA 1A8DA 3DECA 3V0BB 2D93A 1UY3A 1QIQA 1I5PA 5A3WA 4X6RB 4BM8A 2XJSA 4EZ4A 1J3QA 2AREA 2PN5A 4FOVA 1ZZ8A 2ZHNA 4EQVA 5KHGA 1H8VA 3I2OA 4LKSA 5F6KA 3GJBA 1G9AA 1GP6A 2FDFA 2P3JA 2XH6A 4HK8A 3VZLA 2RR11 3LDKA 1VBE1 4YVSB 4HKWA 5CISA 1VBD1 3NRUA 3NO8A 1LU1A 1ND3C 5DAPA 4D94A 3TEZA 4N43B 5L7OB 4UXAA 3KGLA 1O8SA 3NKTA 1NOVA 1GOFA 1NKGA 2W9XA 1H1AA 2JG8C 2J1UA 4JKLA 4RFRB 1SPPB 1CVNA 4UW6A 3PIGA 3D8CA 4NWVA 1H1MA 5JZGB 3PMSA 1XU2A 4ISRA 4NO4A 2FDIA 3ZYGA 2FDKA 3OGGA 2VOXA 2XL7A 4LTAA 4XURA 5BXXA 3SQOA 5J1XA 1HQWA 2B9UA 2P6CA 1CR7A 1L3JA 1OQ1A 2GC2A 2WIIB 3HWJA 1R092 4W6XA 2GMPA 2GP5A 4CZSA 3M3IA 3S7EA 5GZFA 1US2A 3ZFEA 5A7SA 4FTBA 4RQPC 2H6BA 2KM2A 2ZX4A 2BGOA 4K8FA 4ONUA 3FBYA 1OQEA 4MGZE 3GZEA 2Q1ZB 1NE6A 1YFXA 3D82A 1H2LA 4P9LA 5FV3A 3RJ2X 2H0VA 3ZN5A 1RL3A 1DYPA 4AEJA 5KXEA 1VAKA 4FSJA 4P9YA 4PIZA 1WKYA 4DMIA 2HWF3 3H1MA 2VOKA 1V70A 3AFGA 3JBG1 2NM1A 3J4UH 4QDSA 2WS91 2ZX1A 5C8CA 4L0PA 1AJOA 4LJHA 1FMD3 4ORFA 1RJ8A 2CGPA 1ZNPA 3NNLA 4NOTA 2CWMA 2EIGA 2ZPXA 1H1IA 3ZXEA 3MIHA 2RVAA 3PVNA 4XF9A 3RPQA 2OX0A 3ZYFA 3M3QA 3KD4A 1Y43B 4GAZA 4RQPB 3MPBA 3N9QA 1MS3A 4WZFA 5FZ6A 3B3QE 4COYA 4CEYC 3ILFA 4G9SB 1YWKA 3F2ZA 1QJU1 3ILRA 1S0BA 4FAGA 2GMMA 3PURA 5FPVA 1QJEA 4JGYA 1CJPA 2RS52 4YW7A 1COV2 5IVBA 4Q26A 1XE0A 2YC4A 2PHRA 3VKOA 3CLPA 4EN8B 1JYTA 1YQ6A 3D6EA 3RZKA 4Y24A 1W9FA 1MS9A 1U5XA 4XJUA 3OSDA 4UW5A 3P3PA 2W47A 4BIFA 1F4HA 2OPKA 4I30A 3U07A 4JVAA 5L7OA 2BPA2 4WZCA 2GNTA 1QXRA 1KS5A 2WO3A 4AI8A 5IVYA 1OVSA 2R071 3LEMA 5FMDA 2WFF3 2VVEA 3H3LA 3RGBA 4PQQA 3ZFFA 4Q4W3 3ZSKA 4ARYA 4DUVA 5JOXA 5KHJA 3ZSMA 1EV12 2D6MA 4P9WA 5E1RA 5FWEA 5CFDA 5T55A 2YMZA 3ZYBA 2WNVC 5KXDA 5GZCA 5JMCA 3BI3A 5IVVA 4PBPA 4UI9L 4XCBA 3ST7A 2RMU2 3JD71 3PU3A 1UOFA 2WSVA 2WQ8A 1C1FA 4QX0A 4P9XA 3AKRA 3RFRA 1RUJ2 1SLCA 1YYNA 2WN3A 3NJYA 3OYWA 4I3GA 2EIBA 3K48A 3WCSA 2AC1A 3VD9A 1CAXB 3VKFC 5IFPA 4AVBA 3DCQA 4Q4X2 1W8ZA 5LWBA 1PO23 1LHOA 2BWAA 2J22A 2HWD3 2ZAAA 1VBC3 4BQXA 1OLMA 3VKNA 1J1LA 2QJVA 1VALA 2X5IA 4H7LA 4TXWA 3PVBB 1AYN2 3B94A 3NMBA 1NCRB 2VD7A 1COV1 4R52A 4B4QA 5FOBB 3H7YA 4QAWA 2VZSA 4FVVA 3BODA 1IKQA
chains in the Genus database with same CATH topology
1HN0A 2LRPA 1W8WA 4LKEA 2WYFA 4BQ5A 2LROA 3ZYFA 1W8UA 2KR2A 1UOJA 1OH3A 4LK6A 2VXJA 4A6SA 3ZYHA 2C24A 1W8ZA 4CPBA 1GWMA 1WCUA 1W8TA 1L7LA 1V0AA 3UT0A 4YWAA 2JWPA 4LK7A 2O14A 1WMXA 3F95A 1GWKA 3ORJA 2Q1FA 4YW7A 1OKOA 4BQ4A 2K46A 3ZYBA 4CP9B 4YW6A 4LJHA 4LKFA 4LKDA 5D21A 1GWLA 4BQ2A 4CP9A 4BQ3A 1W9FA 4AL9A 1W90A 4CPBD 1WZXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HN0 A;  2LRP A;  1W8W A;  4LKE A;  2WYF A;  4BQ5 A;  2LRO A;  3ZYF A;  1W8U A;  2KR2 A;  1UOJ A;  1OH3 A;  4LK6 A;  2VXJ A;  4A6S A;  3ZYH A;  2C24 A;  1W8Z A;  4CPB A;  1GWM A;  1WCU A;  1W8T A;  1L7L A;  1V0A A;  3UT0 A;  4YWA A;  2JWP A;  4LK7 A;  2O14 A;  1WMX A;  3F95 A;  1GWK A;  3ORJ A;  2Q1F A;  4YW7 A;  1OKO A;  4BQ4 A;  2K46 A;  3ZYB A;  4CP9 B;  4YW6 A;  4LJH A;  4LKF A;  4LKD A;  5D21 A;  1GWL A;  4BQ2 A;  4CP9 A;  4BQ3 A;  1W9F A;  4AL9 A;  1W90 A;  4CPB D;  1WZX A; 
#chains in the Genus database with same CATH topology
 2W1Q A;  1APN A;  4LHS A;  3M3O A;  3UYJ A;  4DXS A;  2P4E A;  4LHN A;  1LHV A;  3JB4 C;  2RHP A;  3LD8 A;  4K1Y A;  2FMY A;  4Y3O A;  1C1L A;  1CN1 A;  4N9H A;  4AQS A;  4FTE A;  2CU5 A;  3C7O A;  1F2N A;  3HIF A;  1XRU A;  2ZCW A;  3O1R A;  3DPR C;  4PDW C;  2PEL A;  3WW1 A;  5EYX A;  4DRR A;  3LPG A;  1AX1 A;  3OD0 A;  4F83 A;  1LCL A;  3OYW B;  1SMV A;  5LRR A;  2Z79 A;  1W6N A;  4TZD A;  3ZYI B;  1JHN A;  4V2W A;  3KV9 A;  3EXU A;  2CSG A;  3BVC A;  3I2G A;  4IV3 C;  5I8T A;  5FPL A;  3G6J B;  1FNY A;  3NJX A;  1AYN 3;  1W6Q A;  3FN9 A;  4XVH A;  5CYY A;  5H9S A;  3PU8 A;  5D8A C;  1W2N A;  1VE0 A;  2EF6 A;  2OKX A;  1OSG A;  1PGS A;  3I2K A;  3K51 A;  5LBF A;  3RDI A;  2O8Q A;  5LA0 A;  5EHD A;  1Q8P A;  3WP3 A;  3DXT A;  4GKY A;  5DUW A;  4XJW A;  3ZVX A;  1FI2 A;  2WZR 2;  1RB8 G;  2X05 A;  3VD4 A;  4P14 A;  4M3C B;  4COU A;  3GHM A;  1LOE A;  4IEZ A;  1ULC A;  4QX7 A;  1UYZ A;  5I0T A;  4A6O A;  4ZXE A;  5A3M A;  2RJL A;  1H8T B;  2WFF 2;  2YPJ A;  3ZYP A;  1RUH 3;  3MF6 A;  5A32 B;  3TOJ A;  1I9R A;  4D3W A;  3HN3 A;  3VV1 A;  2VBP A;  4Q0U A;  5C70 A;  5IVE A;  1CD3 G;  2Y6F A;  1RUC 3;  2QQV A;  4BDV B;  3ZOI A;  4QPI C;  1ND2 B;  1FOD 1;  2SLI A;  2ENR A;  2GC1 A;  3AMM A;  3JU9 A;  2IC1 A;  2VZ3 A;  4LOT A;  1ULP A;  2CNA A;  4Z92 B;  1J3P A;  1VB4 A;  2VNG A;  2ZGN A;  2SBA A;  4DY5 A;  3IM0 A;  2VCC A;  2VVF A;  3GHN A;  4QM9 A;  3P1I A;  5LB6 A;  5JSP A;  4XJ9 A;  5KWR A;  2XBO 2;  3W21 A;  2JDK A;  4MH0 E;  3VZJ A;  4PHZ A;  3WP5 A;  4MHU A;  2HWF 1;  2EIC A;  1HJF A;  1HDK A;  1RC6 A;  3KF3 A;  4JQR A;  2ZGU A;  3T0B A;  4EYU A;  2F6B A;  3ZDS A;  3V0A B;  2XVG A;  5ABJ A;  1IQD C;  1WD4 A;  1WMX A;  3EBR A;  1QEX A;  1LOG A;  1FMD 1;  3NNF A;  4LOR A;  4TSV A;  4XIK A;  5GZD A;  4CP9 B;  3MW3 A;  2J1T A;  3MGU A;  1HRI 3;  4QB6 A;  1HQN A;  3MBW A;  4DNY A;  4XF1 A;  2R06 3;  2WO1 A;  3AMH A;  1MAC A;  3I54 A;  4E2S A;  4QU2 A;  1H4H A;  2C4X A;  4Q4V 3;  3BAL A;  4HKO A;  1XXN A;  3ZDV A;  3RZG A;  4FO9 A;  4O7X A;  1NZI A;  1G86 A;  2VC9 A;  1YNA A;  4EJR A;  5JMO A;  2Z5W A;  1JUI A;  1K5M C;  1BQP A;  1Z0H A;  1PO2 1;  3MFC A;  4QX5 A;  2ID4 A;  3D3A A;  3M3C A;  5DXD A;  5AC9 1;  4M0N A;  1W9S A;  2VMF A;  3POS A;  3UJQ A;  2Z42 A;  3IZO A;  1G9C A;  4HSJ A;  2E51 A;  2NMO A;  3F95 A;  1DQ1 A;  3Q8E A;  3LEK A;  2ZZQ A;  4GWI A;  1RUH 1;  1UXX X;  3VZM A;  3JB8 A;  5FXW A;  2XGX A;  4AYU A;  1RHI 2;  2PYT A;  2XG3 A;  4QPW A;  1PVC 2;  4X6Q B;  4HET A;  1LEC A;  3WX5 A;  1GOG A;  4Y1Z A;  3C7G A;  1IG0 A;  1Q8S A;  5J98 B;  3VKL A;  3WSO A;  2VZQ A;  3BTY A;  1D0H A;  1OT5 A;  5A6Y A;  1XC6 A;  1WWY A;  1O4Y A;  1YFW A;  3W9A A;  2PHD A;  1FNZ A;  3J7N A;  1CIY A;  3K3O A;  3KQ4 B;  3POW A;  2ZGM A;  1DIW A;  5A7Q A;  5CG8 A;  5DDJ 1;  2ARX A;  1UY4 A;  5FY4 A;  1UU6 A;  1L7L A;  2RJ2 A;  1LOA A;  4S2F A;  2CAU A;  1JTZ X;  3U75 A;  3HN1 A;  4IGP A;  3NL1 A;  4AI1 A;  3WHT A;  2P34 A;  4AZZ A;  1AR9 1;  4DXZ A;  1REE A;  4QWN A;  2K46 A;  2KA3 A;  1AXZ A;  4LQR A;  5FYY A;  1DGW X;  2R04 2;  4XFI A;  5GLU A;  1BK0 A;  2ZGL A;  4CUA A;  1XPW A;  5LEJ A;  3FE5 A;  5FYI A;  4ET7 A;  2HLE A;  4XAA A;  1DQ2 A;  3LDB A;  1GMM A;  3WW2 A;  5BNN C;  2BNO A;  1PM4 A;  1PK6 C;  1F4A A;  1B09 A;  2N7G A;  4BB3 A;  4IGQ A;  1JHJ A;  4GMP 3;  2AEY A;  4NN0 A;  3SKV A;  5DDJ 2;  4W8J A;  2JKX A;  4XZU G;  3VHN A;  1UY1 A;  5IK4 A;  2WL1 A;  1UY2 A;  1ALY A;  4LMF A;  1RUI 3;  4Q2F A;  4EE2 A;  1CIW A;  1Q8V A;  2J7M A;  5JIA A;  5JWP A;  1TME 2;  4NE9 A;  5JR7 B;  3FHQ A;  2F4P A;  1HX6 A;  1ZBA 3;  4O65 A;  5C4W B;  1W6O A;  4AFC A;  4ERO A;  2R6Q A;  1LHN A;  3H9A A;  3HNB M;  1NCQ C;  1AYM 3;  4OZO A;  3O0W A;  1UZV A;  2WYS A;  3SCF A;  3POG A;  3VBF A;  4Z8B A;  1KDM A;  1H2K A;  1YJK A;  4QGM A;  3LIH A;  2FZ2 A;  2BNN A;  2IUW A;  1JZ4 A;  1FV2 A;  2HEV F;  2WT1 A;  4Y20 B;  5T5J A;  2BVV A;  4CEW C;  3OCP A;  3AVS A;  3B9I A;  1RUJ 1;  2DUO A;  4L92 A;  1R64 A;  3SC7 X;  5J3U A;  3NNG A;  2I74 A;  4MAD A;  4QDR A;  3MFA A;  1V00 A;  2Y6L A;  1DHK B;  1BVV A;  2WWS A;  2YC2 A;  3LKJ A;  4MHR A;  4Z1V A;  3WNX A;  3M7A A;  4Q4X 1;  2AGS A;  4XAE A;  4LIU A;  2DVG A;  4QPG C;  1DQ5 A;  1OOP A;  2JG8 B;  4LEJ A;  4DQA A;  2ADE A;  3WNL A;  4YM3 A;  4N9I A;  3H8X A;  4O9E A;  1ENX A;  4Y5Z 0;  4GAL A;  2DBI A;  4QXB A;  4Y4R A;  1EPW A;  3PL0 A;  1XB9 A;  3RQ0 A;  4XF3 A;  3B7M A;  3POB A;  3S57 A;  2B45 X;  3WF2 A;  1DP0 A;  1W05 A;  4ATF A;  3WUD A;  3ZSL A;  2W3J A;  1QNW A;  5FY8 A;  3IDB B;  3CJX A;  4FQZ A;  5A7W A;  4A2U A;  4Y26 A;  5D1I A;  1IPJ A;  1W8W A;  2GN7 A;  4MSV A;  5K9Y A;  4C0H A;  1RJ7 A;  1WA4 A;  1MVE A;  3OGR A;  3PNA A;  4A45 A;  4Q4V 1;  3WQ0 A;  5BNO C;  4D69 A;  3ES4 A;  2RDN A;  3RRD A;  3AXD A;  3U1X A;  1AR9 2;  2JKB A;  2XJR A;  3B02 A;  1O91 A;  3DF0 A;  1ULE A;  3E5X A;  4GWM A;  4DOU A;  2K0G A;  1F8V A;  2X8K A;  2WBK A;  3III A;  1WBL A;  2RS1 2;  2DWR A;  2J42 A;  2IXI A;  4EN9 B;  1HB2 A;  2VCB A;  4IGO A;  3BTZ A;  2A3W A;  1F31 A;  1JH5 A;  2Q8D A;  1LGN A;  2XVL A;  4QQO A;  4ZKT B;  4PLN A;  4BXF A;  1JYN A;  2ZGO A;  3RI9 A;  4YFZ A;  4QHB A;  3T4V A;  2ZBJ A;  3I3M A;  2BNM A;  1CX1 A;  3TEY A;  1UL9 A;  1HV0 A;  3PVO A;  5EP9 A;  2HEY F;  4MGQ A;  4F3J A;  2XHN A;  3M3E A;  4N7U A;  4A7K A;  2TNF A;  4Y1U A;  4A3Z A;  3NV3 A;  2QBX A;  3DUI A;  4QX8 A;  5FMO S;  5TSW A;  2VGD A;  3WQ7 A;  3WXP A;  2HKX A;  2PXJ A;  5FZM A;  3FZ3 A;  4Q4X 3;  2PA7 A;  4M4P A;  5CFC A;  4AHX A;  2IVJ A;  5IAX A;  1QF3 A;  1IKP A;  4BJ0 A;  1YFY A;  3T1M A;  2HWE 1;  4I0A A;  4W6Y A;  5C7G A;  1XNC A;  1PIV 2;  1WMF A;  5JXJ A;  2CAV A;  3OUI A;  4ZY9 A;  1RXG A;  2RR1 3;  4E4S A;  2UYB A;  5B2G B;  5IHR A;  4H14 A;  2EIE A;  2ZKL A;  1ND2 A;  4GZ9 A;  3X29 B;  1J83 A;  1O6U A;  2QQN A;  3JD7 3;  3VBH A;  4OI4 A;  3WDY A;  3VUO A;  4MG2 A;  3MDP A;  4CDW C;  2YC0 A;  2ZJC A;  4OMD A;  2YB7 A;  1I1E A;  1UMZ A;  1OI6 A;  1QKQ A;  1NZC A;  2C24 A;  2VTF A;  4DUX A;  3ACH A;  1PHM A;  2RJK A;  5A1L A;  5BNP B;  1UOB A;  4H55 A;  1ZZ6 A;  2HWD 1;  5BYN A;  3NNM A;  2R04 3;  4CCN A;  4PLO A;  4SLI A;  4BQY A;  1Y3T A;  2NP0 A;  1MPX A;  5DZE A;  4BQ4 A;  3WDU A;  1W6O B;  1AZD A;  2NLR A;  3NV4 A;  1LGB A;  5BPX A;  1UYY A;  3WEZ A;  5C8W A;  3RZH A;  1LOC A;  1MQT B;  2WAO A;  5LZ6 A;  1WW5 A;  4URT A;  4COW A;  5F7U A;  3B00 A;  3FLR A;  4Z2A A;  2ZEZ A;  3GZT B;  4AGV A;  1X9P A;  3KCY A;  3FJS A;  4C0B A;  2J1E A;  5CEH A;  1ODM A;  3VDD B;  2PAK A;  3MIC A;  3A23 A;  2WZE A;  3U10 A;  2Q8E A;  2C9K A;  2X29 A;  2Y6J A;  1SBF A;  1T2X A;  1RGS A;  2JIG A;  2ZGS A;  1RYY A;  1U5I A;  2AEN A;  3HBZ A;  4NPM A;  4GWN A;  4D6R A;  3RWK X;  4Y33 A;  3BU0 A;  1UOG A;  1FYU A;  3DXU A;  3Q8B A;  4N43 A;  4GIQ A;  4HT1 T;  1DFQ A;  1XYN A;  2WNE A;  3BCW A;  4YZ1 A;  4R9A A;  4RS5 C;  4Y20 A;  5JR2 A;  4FTS A;  2PHX A;  3LPF A;  3CIH A;  5ANQ A;  3N3H A;  3MV1 1;  4LBQ D;  4B3N A;  5HCA A;  1JU3 A;  2YY1 A;  4BH9 A;  4P9I A;  4W4Z A;  5H9R A;  4Q4V 2;  1RUI 1;  2X5I B;  5JOW A;  5KXB A;  4ES9 A;  5BNN A;  2EAL A;  1KJR A;  4O61 A;  2QQP A;  2FCU A;  2DFC A;  2ILM A;  1MZF A;  2R0F A;  1GV9 A;  2OW4 A;  3AMN A;  2BFU S;  3LGR A;  4IE7 A;  4FPL A;  5L73 A;  4H2A A;  2IXJ A;  4Q5O A;  4RHV 3;  4YVW B;  3V64 A;  4JGZ A;  4H7M A;  3VDD A;  4HZF A;  3ZSJ A;  2YHJ A;  4BIS A;  3CJI B;  4QQP A;  2KD7 A;  4FPJ A;  2JDH A;  4MGK E;  5A6Q A;  1RHI 3;  4OLL A;  3T2Q A;  1VPH A;  1JZ3 A;  4LBQ B;  5L19 A;  3MLK A;  3AFK A;  5A7O A;  3ZR5 A;  4ASK A;  1NCR A;  5FKB A;  5CG9 A;  5F8P A;  5CFD B;  1VRB A;  2XKP A;  4LK6 A;  4UWD A;  2BQP A;  2RMU 1;  3JD7 2;  3RMY A;  3GYD A;  1X9T A;  5FZE A;  4LA3 A;  3ZYH A;  3EYP A;  4NJ4 A;  3HT2 A;  2R1D A;  4N53 A;  4N7I A;  2GDF A;  4V1P A;  1PNF A;  4C8D A;  4C91 A;  4NPL A;  1UU5 A;  5FLI A;  1DF0 A;  5F5I A;  2Y34 A;  4YGE A;  5JAX A;  3EJK A;  4JRL A;  1H0B A;  1CAX A;  1ONA A;  1UWW A;  1NY7 2;  4NRO A;  2A73 B;  3FC0 A;  1V6O A;  4QMA A;  1F5J A;  2HWE 2;  3B69 A;  5FZ8 A;  4DIN B;  2CY6 A;  4WBB A;  5A7P A;  1PVC 3;  2HYK A;  1WW7 A;  3ECQ A;  3OUJ A;  2P37 A;  4FPH A;  4PJY A;  3ZMN A;  2DF7 A;  3M4F A;  1BBT 1;  1LB2 A;  4HKL A;  5JPM B;  4AI2 A;  4XQD A;  3VHP A;  1W6P B;  4J1W A;  3AL6 A;  5E8A A;  4D8M A;  5K7P A;  2BOJ A;  4D7Y A;  3ILN A;  4IER A;  2ZAH A;  4DO0 A;  3I4I A;  5FP3 A;  2VXR A;  3HOB A;  3LFM A;  4LBQ A;  5EV7 A;  5LRS A;  1Q5O A;  4CA9 A;  2AH2 A;  5FYT A;  5FO7 B;  3I3B A;  2JIC A;  3BPZ A;  4GB3 1;  4CCE A;  4D6Q A;  3RZM A;  1QJF A;  3CU7 A;  2IFW A;  1TME 3;  4DY3 A;  3OY8 B;  1J3R A;  3WV6 A;  2HWC 1;  2D6P A;  1LOB A;  1H8T A;  1SLI A;  4HBN A;  5D21 A;  2ARC A;  2P3I A;  3VD5 A;  4AHY A;  4E9K A;  3E6B A;  3IMM A;  1D4M 3;  3HJR A;  4LT5 A;  2JIJ A;  2AUY A;  1BMV 1;  2DCZ A;  3A21 A;  4J1X A;  1DGR N;  1UCX A;  4YVS C;  5ABJ B;  3L9J T;  1FXZ A;  4JGY B;  4S2G A;  4XEZ A;  4L8Q A;  1CAW B;  1HV1 A;  4M3C F;  4ZZ5 A;  3KWV A;  3VBS A;  2DBN A;  2A6X A;  4IEY A;  3LE0 A;  3C7F A;  3AP9 A;  2PHT A;  2TUN A;  4OZX A;  3WP6 A;  5IVJ A;  4BMB A;  4QB1 A;  2VQU A;  1OLQ A;  2WT2 A;  4Q8L A;  4AVV A;  1EY2 A;  4MO3 M;  2JE7 A;  5FZ1 A;  3A4U A;  3JBG 2;  3QH6 A;  4PT6 A;  3IMN A;  2XDV A;  2WNU A;  4XXA A;  5A7W B;  4AFA A;  1CAU A;  2BTV C;  2QZ2 A;  4URA A;  2RE9 A;  2YXS A;  1PIV 3;  5DAQ A;  3WF3 A;  5CAZ A;  5A70 A;  2WQZ C;  4FPC A;  1NQD A;  5GLV A;  2V09 A;  3VBO C;  4CEW B;  2GAU A;  1F9K A;  1VBD 3;  5JZG C;  2IVI B;  3APB A;  3ZXA C;  5C3S A;  4KWL A;  1JBC A;  4PDW B;  5FYU A;  4QPG B;  1LEM A;  5FZH A;  1NCQ B;  4CSW A;  4E2G A;  3U78 A;  3QBQ A;  1N3Q A;  4J25 A;  2V73 A;  2B42 B;  1MEC 3;  2ZX2 A;  4LHL A;  2JG9 C;  1TME 1;  2C6S A;  2B8M A;  2YGM A;  4QB2 A;  4ZU4 A;  4DXT A;  2JDZ A;  2XHK A;  5L9R A;  4XUT A;  4OUM A;  2XUE A;  4W65 A;  3I3Q A;  5DG2 A;  4CPB D;  1AF9 A;  3NAP C;  2GU9 A;  5FCC A;  2A1X A;  1UYX A;  4AOC A;  1JOP A;  1LEN A;  5C4W A;  3POE A;  5LA2 A;  3K2O A;  3CZJ A;  3CZU A;  3KT7 A;  4NVP A;  4QKD A;  4RHV 2;  5F5A A;  4D7T A;  3AJY A;  1MZ5 A;  2VO5 A;  1ASJ 1;  3PVE A;  3AZX A;  2GND A;  1AR9 3;  2UWC A;  3UK9 A;  4XXP A;  4CDQ C;  3EB7 A;  3FBM A;  3PHM A;  4ISQ A;  2DU0 A;  4CVU A;  5IAT A;  2ZML A;  1OQD A;  3VKM A;  4DEQ A;  4CDX B;  5FZI A;  3WF0 A;  2QE3 A;  4BPZ A;  1PGW 2;  3N4M A;  5HPO A;  1W3V A;  1ZZ7 A;  2LTN A;  2CGN A;  2ZEY A;  4YLZ A;  3RS6 A;  3FUO A;  4O9G A;  4AR2 A;  4OHV A;  2G9G A;  3VBU C;  5DUV A;  2B46 X;  3THT A;  1TMF 3;  1SDW A;  1OHF A;  1T6G C;  4CTE A;  5ACA 1;  1UOJ A;  4YRD A;  1I3H A;  2JJ6 A;  1K12 A;  1ZRI A;  3M1H A;  4K1Z A;  5FXV A;  3N36 A;  5C9A B;  2BBV A;  1ZRE A;  1U5Y A;  4WM7 B;  4HXC A;  3LEG A;  5I8S A;  1JU4 A;  4TTG A;  4LK7 A;  1O59 A;  1XSQ A;  1HIX A;  3PUQ A;  5JDB A;  1GZ9 A;  4JQT A;  5DZG A;  4KNC A;  2OUH A;  2VMC A;  5IT6 A;  4OUS A;  3L2H A;  3W20 A;  1HRI 2;  2FBE A;  3WNM A;  3UL2 A;  4IND A;  3V56 A;  3WIN E;  2VOT A;  5BV6 A;  2CWS A;  1F15 A;  1JYW A;  4LBN A;  1AYM 1;  1D4M 1;  5A3P A;  1PGL 2;  2XLG A;  2QDN A;  5M0T A;  1V6J A;  1LOF C;  1GFF 2;  4FPY A;  4CXX A;  3CNA A;  1WUV A;  4IV1 B;  2VU9 A;  2A70 A;  4ZON A;  1XND A;  4WVZ A;  2DTW A;  3ZFF B;  1IS4 A;  2YU2 A;  2OYZ A;  1ZRR A;  2UY8 A;  3JQW A;  5CNA A;  1CAW A;  4CEY A;  5CA6 A;  2BV4 A;  1H9W A;  1G7Y A;  4A44 A;  2PTM A;  1QQP 2;  4JAA A;  1WW4 A;  1K5M B;  4YZ2 A;  2WA3 A;  1NYW A;  2ZGP A;  3Q8C A;  4BQW A;  5DUU A;  2VJX A;  1AJK A;  5FZC A;  2ORZ A;  2EXJ A;  1KIT A;  1VBA 3;  4LXL A;  2LAL A;  1IPK A;  1GU3 A;  4LO4 B;  3BU7 A;  5DAB A;  1XYO A;  1KQR A;  3ZXF A;  4QGN A;  2P3Y A;  2LS6 A;  3SNM A;  5A1F A;  2YFU A;  4KBB A;  2JDU A;  3ZN4 A;  4QPY A;  4SBV A;  3PTY A;  5L7O C;  1DYO A;  2OA2 A;  3MIE A;  3C8X A;  1HN1 A;  3V0A A;  1PZ8 A;  2D6N A;  4CPB A;  1RMU 1;  1RUF 1;  3WG2 A;  2XOM A;  1UMI A;  3W5N A;  3OD4 A;  3KB5 A;  5FBZ A;  3AP5 A;  3ZFF C;  4LO8 A;  5B4N A;  3FHA A;  1CON A;  4FCA A;  2QQU A;  2WRA A;  3WT3 A;  2DCY A;  2IXC A;  1ZBA 2;  2VMI A;  3ZIX A;  4KU8 A;  4BXS V;  3GBG A;  1SZB A;  3LDR A;  1UN1 A;  3I2J A;  5BNQ A;  3AKS A;  2VW1 A;  1YRZ A;  5FYZ A;  2W1S A;  3AKT A;  1S2E A;  1S0D A;  4ZXK A;  5FWJ A;  2VME A;  2PQQ A;  5IW0 A;  2WYF A;  1U0A A;  1GLH A;  1JZ2 A;  4CCL A;  2ZA9 A;  2DCT A;  5GKA C;  3I49 A;  1TMF 2;  2YBK A;  3NST A;  1ZX5 A;  4UFK A;  4D0Q A;  4E27 A;  5LK7 B;  2VUA A;  1ASJ 3;  1S0C A;  3QLQ A;  5CKN A;  1J84 A;  1MS0 A;  1W3X A;  3O1S A;  1RUG 1;  3PME A;  5DAV A;  5F3C A;  1G9D A;  1RUD 3;  2DVF A;  4CDU A;  1C5I A;  2X5I C;  4XFB A;  4UFI A;  5JIU A;  3USU B;  1WMD A;  3I59 A;  4D7S A;  4EWD A;  4ZS2 A;  3AZZ A;  2GN3 A;  3MO4 A;  4HL0 A;  3MI8 A;  4PI2 A;  4CDX A;  3DPR B;  3MPP G;  2B4K A;  2VOV A;  3M70 A;  1JN2 P;  4YVW C;  1O5U A;  4NHX A;  2Q30 A;  2JD9 A;  1DU3 D;  3UKT A;  5C3P A;  3LA3 A;  5GLZ A;  2YYO A;  4QPI B;  1HRV 3;  1LNS A;  2DV9 A;  5H9P A;  4QXC A;  3CJI C;  5CIR A;  1FPN 2;  2C9A A;  2WDB A;  3U14 A;  3RYP A;  5IVF A;  3CHX A;  5F3I A;  3QAC A;  4YNI A;  2XJV A;  2XR4 A;  4G4F A;  4DIQ A;  3IDC B;  2V4A A;  3POF A;  5FP8 A;  4FXG B;  5FQ0 B;  4WM8 C;  3INA A;  1C8N A;  1W8O A;  4XTM A;  3T0A A;  5AFE A;  4YZ3 A;  1MQT A;  4LHK A;  5C9A C;  1E57 A;  4GH4 A;  3UKN A;  4YG6 A;  4KG8 A;  4DFS A;  2R16 A;  5J09 A;  2Q4S A;  5D8A B;  1OF4 A;  4JCK A;  5CZK A;  4EN7 B;  1JOD A;  5JVV A;  4AFM A;  1MEC 2;  4IV3 A;  3PUA A;  2WO2 A;  2PLV 1;  4DB5 A;  4NRQ A;  5D8A A;  3TAY A;  5KR7 A;  3N9L A;  3AP7 A;  2HBT A;  5FY5 A;  1OBN A;  1BEV 1;  4YGB A;  1D7P M;  2VBB A;  1YEW A;  3ES1 A;  1LU2 A;  3PJY A;  4JDM A;  5ANN A;  4GA9 A;  3VBR B;  1NA1 A;  5K0U A;  3ZMO A;  1GOH A;  1A6C A;  1N3P A;  3KV5 A;  4FP2 A;  1OFS A;  1U12 A;  3KCX A;  1RVF 1;  1UO9 A;  1IS5 A;  3THC A;  4AHW A;  5T54 A;  3DV8 A;  1MS8 A;  2Y8K A;  4GQ7 A;  4NAM A;  3VBH B;  1RUG 3;  1ZZC A;  4P5H A;  4LUM A;  2Z69 A;  2WA4 A;  2VVD A;  3GZU C;  4CU6 A;  5A1A A;  1SLT A;  5FY0 A;  4LKF A;  1RTV A;  3C7H A;  3AP6 A;  4Q1P A;  1Z7S 3;  1RED A;  2XLA A;  3BTA A;  4YSF A;  4XJA A;  2D3R A;  5FYC A;  1QGL A;  3N9O A;  4HN0 A;  4IV1 A;  4FPE A;  1JZ7 A;  4I01 A;  5F3G A;  4NHL A;  1U5Z A;  3AZV A;  1PX3 A;  3E97 A;  4JRA A;  1KDK A;  1VAM A;  1FX5 A;  3KM5 A;  4YGD A;  3WY6 A;  1AR6 2;  2VZ1 A;  2Y6H A;  1GZW A;  1AR7 2;  5IYY A;  1KJL A;  1QJU 3;  3VBS B;  1ASJ 2;  3WNP A;  4DUW A;  4YM2 A;  4UYB A;  3WQ1 A;  1BXH A;  4P9G A;  3ELN A;  1RUE 2;  1UZW A;  4FPG A;  5ABJ C;  5FO8 B;  4LO7 A;  3HAG A;  1DGL A;  4JHT A;  1RHI 1;  4FOY A;  3AK0 A;  1K5J A;  2R06 2;  4KG0 A;  5I0U A;  4AED C;  4LIT A;  2YU1 A;  1BHG A;  3PUI A;  1UKR A;  3LQC A;  1K3I A;  2QCS B;  4U2A A;  2D43 A;  4Z82 A;  1VBB 3;  1RUO A;  1ND3 B;  4XUO A;  4NRM A;  3SCH A;  5IUQ A;  2OVU A;  2DVD A;  5FDB A;  2HWB 2;  1FPN 3;  3E6C C;  2DVA A;  1BVP 1;  1O7F A;  4RR3 A;  5F5Q A;  3M2M A;  5BNP C;  1GIC A;  4HLT A;  4QQ2 A;  4KGQ A;  3AB0 A;  3J26 N;  2EXK A;  1ZBE 3;  3O7O A;  4BK4 A;  2D3S A;  2A3X A;  2W2I A;  3S5Q A;  1O4Z A;  1R09 3;  1XYP A;  2H0B A;  2OQ7 A;  1HRI 1;  2EXH A;  2Q5T A;  4CCM A;  4CUG A;  3V65 A;  4AK3 A;  1HB4 A;  3U4X A;  5IK8 A;  4BQ3 A;  5FYM A;  5A32 A;  3D0J A;  2AZ5 A;  3LAG A;  1AL2 3;  4H3W A;  1SLB A;  3BUC A;  4QM8 A;  2XJP A;  2ZX0 A;  5J36 A;  3RVH A;  2FDJ A;  2VL4 A;  5FFO C;  2A5Z A;  3VBR A;  2BVB A;  1CAV B;  4JDO A;  2XQR A;  5FMO L;  5AC9 3;  4IEQ A;  3T30 A;  4R9C A;  3NAP B;  5FZO B;  4AWD A;  1WA6 X;  5BNN B;  2E6V A;  1G9B A;  4IES A;  5FK7 A;  4YW2 A;  3W58 A;  3THD A;  1AX0 A;  4YWA A;  3AL5 A;  3AYA A;  4HFS A;  3USU A;  5KC6 A;  1NE4 A;  1N1S A;  2QNK A;  3KQR A;  1ENS A;  1GQH A;  2VW2 A;  3IT8 A;  3MW2 A;  4E4Z A;  1HW5 A;  2OZJ A;  4YZ5 A;  2LUW A;  1BK1 A;  4I09 A;  5AVP A;  1W2U A;  4JV4 A;  1W99 A;  3GJA A;  3VBF B;  2MEV 3;  1GSL A;  3DL3 A;  3P6B A;  4HVR A;  3ATG A;  4NWW A;  4OVE A;  4BME A;  5JXG A;  3R4S A;  3W5M A;  1H30 A;  4FFI A;  5A3U A;  2FDG A;  2OII A;  4OHZ A;  2Y64 A;  4NID A;  2VAU A;  1QU0 A;  2MNG A;  3J7L A;  4LBO A;  5HCB A;  1NX9 A;  1OH3 A;  3CBN A;  4Q1R A;  1BEV 2;  1ZA7 A;  3E5U A;  5FYH A;  3OTF A;  5A33 B;  1OOP B;  2JG8 A;  5FPB A;  4Q4Y 2;  2WFF 1;  5JI9 A;  3AYE A;  1RUD 1;  4BWO A;  5I0R A;  4XAC A;  3UET A;  2Z4F A;  4MET A;  1QJZ A;  2WZ8 A;  1QJU 2;  1OA4 A;  2DCK A;  3ZFG A;  1QJX 3;  2JE8 A;  2W94 A;  2J1R A;  4XTP A;  2IXL A;  4X8N A;  1NT0 A;  3VBU B;  2V4V A;  4MV2 A;  1PIV 1;  5F1R A;  3ZFE C;  1W8N A;  4WM8 B;  3VBF C;  1FMD 2;  1WCK A;  5ISL A;  1FV3 A;  4R4X A;  2QQJ A;  5F6L B;  2PFW A;  2R7E B;  1B35 B;  4W6W A;  4JX0 A;  4NRP A;  2D3P A;  2BP6 A;  5ACA 3;  4NHK A;  1HLC A;  4AEK A;  2ZTN A;  3AX4 A;  2JDM A;  1QJY 2;  3MEP A;  3ZYR A;  1O3S A;  1XU1 A;  3UT0 A;  3WG4 A;  3WP4 A;  2QKD A;  5I8Y A;  3IBM A;  1OOP C;  5IK5 A;  5F2S A;  2BUK A;  5J96 B;  4Z07 A;  3ZPO A;  3UGH A;  4S2H A;  1UYP A;  1YQ2 A;  2UWB A;  3CKH A;  3VDA A;  4QD2 A;  1H6X A;  1US3 A;  2WS9 2;  2Y26 A;  2RDS A;  4ASM B;  4E4D X;  3S0M A;  1QOO A;  2D6L X;  2HH9 A;  2JX9 A;  3DGT A;  4LKE A;  3T09 A;  4DRV A;  2VCA A;  4XW3 A;  4YW5 A;  4MXW B;  2XBO 3;  4Y4Y A;  5FUI A;  4YG0 A;  3MF9 A;  3ZKU A;  2CV6 A;  2Q1M A;  4XF0 A;  1R08 2;  5G04 L;  2R07 3;  1ND3 A;  2JEC A;  2A75 A;  2WN2 A;  1VRH 2;  2NPI A;  3POI A;  3LA2 A;  4JTO A;  5SV8 A;  3UES A;  1YCI A;  4L99 A;  4CUC A;  1OUR A;  2D44 A;  1Q3E A;  4JGY C;  1GNZ A;  2BBA A;  3J8F 3;  1V6L A;  4KWK A;  3A7Q A;  2D97 A;  2JDN A;  2C26 A;  1EAH 1;  2RS3 2;  4MUV A;  2A71 A;  4RGA A;  3SH4 A;  4Q8K A;  5I93 A;  2GH8 A;  1ZBE 1;  1OA2 A;  3B93 A;  1UMH A;  3J7M A;  3QD6 A;  4CU8 A;  2W39 A;  1R09 1;  1Z78 A;  2G9Z A;  3NJV A;  2GAL A;  1UF2 C;  1DQ4 A;  3NKG A;  4Q0P A;  2OT7 A;  2MEV 2;  2NQY A;  2Y33 A;  1W8H A;  1R08 1;  2QQM A;  2MHF A;  4RQP A;  5FYB A;  4BOW A;  1UZY A;  4RA0 A;  2VZP A;  1LES A;  5E6H A;  2EXI A;  3USS A;  1SLA A;  1XNB A;  5HCF A;  3N7M A;  4CU9 A;  5J7M A;  3TRS B;  4E2Q A;  1ZVF A;  2VZO A;  2FDH A;  3GF6 A;  3Q8F A;  2AEZ A;  5L36 A;  4GD4 A;  5CU1 A;  4EV0 A;  1X33 A;  1UIK A;  4M4R A;  5CFC C;  1GWK A;  4FI9 A;  3WVJ A;  2WNV A;  1KGY A;  1M4W A;  3RZZ A;  4NR1 A;  1H2M A;  5C6C A;  3BTX A;  4LE4 A;  4M01 A;  3HEI A;  1XJA A;  5F3E A;  3LB9 A;  3OBZ A;  4FPK A;  1RXF A;  1NLS A;  3N35 A;  3SXW A;  1XNK A;  4XFC A;  4C1W A;  2XJQ A;  3RZJ A;  2E7Q A;  2VZT A;  1DZT A;  2BDR A;  3FL7 A;  4F8A A;  2ZEX A;  2ARB A;  1ND2 C;  3E6D A;  1B35 A;  1HRV 2;  2FCV A;  1N1Y A;  3AJZ A;  5T52 A;  3RNS A;  1TEI A;  4CDW A;  3U37 A;  1RUH 2;  3VN4 A;  3H1Y A;  2WUH A;  4FAH A;  2UU8 A;  1GBG A;  4KL1 A;  5FKC A;  1UY0 A;  3O14 A;  4K6B A;  2XWB B;  2PQS A;  1EUU A;  2A6W A;  1OC1 A;  1EV1 3;  1VBA 1;  1RUG 2;  4CDQ B;  1TZO A;  2WJS A;  2UYA A;  1JUH A;  2I2S A;  3I2D A;  2ET7 A;  1HJG A;  2R06 1;  4BYY A;  1YI9 A;  1VBE 3;  1UU4 A;  5IK7 A;  3BOW A;  3O0X A;  2QTW B;  4IEW A;  5JLV A;  1NAE A;  5GZE A;  2R49 A;  4UFJ A;  4AI0 A;  5FMB A;  2QZ3 A;  4HMZ A;  4LA2 A;  2UUR A;  5FRA A;  2DU1 A;  3DPR A;  2VM9 A;  1ULO A;  3ZX7 A;  3TN9 2;  3FFZ A;  1AR6 3;  2ATF A;  4UW3 A;  1Y9Q A;  4NHY A;  3EMR A;  2D5H A;  1R1Z A;  4JKM A;  3T2T A;  1N47 A;  2E26 A;  5DAW A;  2MEV 1;  4F7Z A;  1ODN A;  5CFD C;  1C4R A;  4Q0V A;  1W6Q B;  5FP9 A;  1UPS A;  4YW1 A;  2RV9 A;  4UOJ A;  3OG2 A;  4CCO A;  3TEW A;  3DKQ A;  4NII A;  1AR8 1;  4CE8 A;  5JOZ A;  4LBM A;  2WZP P;  4B4P A;  1YQ8 A;  2VMD A;  2BWC A;  4HG6 B;  2ZAB A;  3H3U A;  5DN2 A;  5A3T A;  4AQ2 A;  1V6N A;  4IEV A;  5FZF A;  1X7N A;  1AXK A;  3ZSE A;  2WNV B;  2FZ1 A;  3CMG A;  1VP6 A;  3MIG A;  3K4A A;  4TN7 A;  4K20 A;  4XDQ A;  4LPL A;  3WDX A;  2ZX3 A;  1QH7 A;  3N9M A;  3JXS A;  4QPI A;  1POQ A;  4AVT A;  5F5C A;  1ZBE 2;  2VOW A;  3WQB A;  4BQ2 A;  2C0Z A;  2O0O A;  2WFP A;  3H7J A;  3K4Z A;  1DGR A;  1BBT 3;  2JXA A;  2VEC A;  1W06 A;  2VZV A;  3AMP A;  3NJZ A;  3UV9 A;  4P00 B;  2F17 A;  3U4S A;  4CP1 A;  1PVC 1;  3AP4 A;  2V5Y A;  5FZL A;  3B5L B;  3GBW A;  3LEI A;  5A3N A;  2QDR A;  1VRH 3;  4AF9 A;  3KGZ A;  1PO2 2;  2IZW A;  3PJQ A;  1PO1 1;  4CDW B;  2HWD 2;  2ZGK A;  3H0O A;  4X8P A;  4GXL A;  1VBB 2;  1O5L A;  3TEX A;  1KEX A;  1H4G A;  5FJK A;  2QQO A;  5EXO A;  5FRE A;  5FPZ A;  5DPN A;  1VBC 1;  1O3R A;  4PDW A;  1URX A;  4K8R B;  3WOG A;  4BK5 A;  2XKO A;  4S2D A;  3IIA A;  4CCK A;  4PF5 A;  4HN1 A;  1SBE A;  1QMJ A;  2LW8 A;  3ZXL A;  3GDB A;  1XNA A;  1YQC A;  5FP4 A;  1IZ3 A;  1RIN A;  3AYD A;  3P3N A;  4D6S A;  3MUZ 1;  1DBN A;  3BIE A;  1COV 3;  4L9B A;  4XFF A;  2E31 A;  5HBA A;  3Q8A A;  2X53 S;  4YW3 A;  1ACC A;  1D0G A;  2ZEW A;  2VNV A;  3D0S A;  3I2I A;  5EJ3 A;  4OI1 A;  1O3T A;  1BLZ A;  2MPF A;  4AG4 A;  3IB3 A;  2F4L A;  4QHZ A;  3NWK A;  4ES8 A;  4RSU A;  5EWS A;  1FPN 1;  4A7Y A;  4Q4W 1;  3FLP A;  3PLQ A;  3WF1 A;  1PZ9 A;  1QOS A;  2YDE A;  4BIO A;  5FY7 A;  5JXH A;  2Z2S B;  4PCR A;  4AED B;  1N3O A;  1YO8 A;  3AYC A;  5C3R A;  4ZZ8 A;  1QH6 A;  3TN9 3;  3URF A;  1M06 G;  4CXY A;  1QDC A;  2IXK A;  1E5S A;  4TLG A;  4UF0 B;  3WG1 A;  5CBL A;  1OF3 A;  4AFD A;  4CP9 A;  5E89 A;  1T6B X;  3ETP A;  1H8T C;  1HKD A;  2C1F A;  3BPS A;  1X50 A;  1Z7S 1;  3IAQ A;  2HYX A;  3W59 A;  3T0D A;  4XUN A;  4K21 A;  3P5B A;  4UF0 A;  3WZ1 A;  2ERF A;  2HWC 2;  4GMP 1;  1KFU L;  2BYV E;  5A7N A;  1ZZB A;  1GQG A;  2G1M A;  3E5Q A;  2ZGT A;  4CXW A;  3HPN A;  2DFB A;  4AQT A;  2YFZ A;  1C57 A;  5FZD A;  2D7F A;  2YPD A;  2WZR 1;  1X82 A;  3RSJ A;  2WLQ A;  4FT8 A;  4YZ4 A;  2JWP A;  2E63 A;  2P6H A;  1NLR A;  2QQK A;  4A41 A;  4XDP A;  1GNH A;  1VBC 2;  2Y0O A;  2PMW B;  2JEN A;  4RN5 A;  1NY7 1;  1BJQ A;  1OUS A;  1MEC 1;  3OBR A;  1SPP A;  2W1W A;  4LIV A;  2NYY A;  1CPN A;  3TBD A;  4MLO A;  3BN6 A;  2W08 A;  3BGA A;  2ZHL A;  4WM7 C;  1E5I A;  1PK6 A;  3C3V A;  3JZV A;  2EVX A;  4FPO B;  2GP3 A;  4UW4 A;  4XBN A;  4Y5S A;  4MGI E;  4RYD A;  1PX4 A;  1ZZ9 A;  2HWB 1;  2OS2 A;  1OLR A;  3VBO A;  3VZN A;  4YM0 A;  2YG0 A;  4B8E A;  2XQX A;  3IKW A;  3MLJ A;  4JTN A;  1QJY 1;  1TNR A;  1YQ5 A;  3SEP A;  5HI0 A;  1UX7 A;  1JZ6 A;  4ITC A;  4M3C A;  4CEY B;  1QDO A;  1MR5 A;  2JDA A;  4YFW A;  1NCQ A;  1WLC A;  1NXM A;  1ZRD A;  1TE1 B;  1LED A;  1VLN A;  4GJY A;  1Y4W A;  4YPJ A;  1G6N A;  1YUD A;  3HVD A;  3WCR A;  4LKD A;  2G4I A;  2JG9 A;  3I3E A;  4LUK A;  1HXS 1;  4XYX A;  1QHD A;  2NMN A;  1CAV A;  3OF1 A;  5FMC A;  1S2B A;  4A3X A;  4CEW A;  3SLI A;  1AYN 1;  1W0P A;  2V5D A;  5LA9 A;  2D6O X;  2LM3 A;  4UFH A;  5H9Q A;  4YM1 A;  5FZ9 A;  3BKZ A;  2W5F A;  3ITQ A;  2VXJ A;  5ERL A;  1QXJ A;  5B4X A;  1AR7 1;  5FUP A;  4HAN A;  3CQO A;  4QXH A;  2WO7 A;  1E5R A;  2R07 2;  3LSD A;  3TYJ A;  3RZL A;  3R0R A;  1JS9 A;  1RUI 2;  4ARX A;  4ZU7 A;  2BW8 A;  1Y9G A;  2WZR 3;  2VPV A;  2GC0 A;  4IL7 A;  1BKZ A;  5LY1 A;  2R04 1;  3Q9O A;  4I0W B;  5D2A A;  4EWA A;  1OMI A;  5KHK A;  1RUE 3;  3UKV A;  3G7D A;  3ZN6 B;  1X8M A;  2RS1 3;  3OPZ A;  4XDO A;  3GM8 A;  5DQ0 A;  4AL9 A;  4I02 A;  3HQU A;  1LKN A;  3JCI A;  1EUT A;  2ZKN A;  3KV4 A;  5FY9 A;  3WF4 A;  1Y9M A;  1IPS A;  1Q43 A;  3VHO A;  4IEP A;  1OD3 A;  1GP5 A;  3B01 A;  2OQ6 A;  3ON7 A;  4PI0 A;  4GUL A;  2VH9 A;  4FXK B;  2Q8O A;  1MZE A;  3KLS A;  3KZ4 C;  2ZXQ A;  4GJZ A;  4AHZ A;  1YFU A;  2VZR A;  3HNY M;  4UT5 A;  2VE1 A;  4K3U A;  1SAC A;  2P17 A;  5FAX A;  1F5F A;  3IDE A;  3RI8 A;  2DDU A;  3MIB A;  1QJX 1;  1QOT A;  1LJ7 A;  2VCM A;  1LRH A;  3ALQ A;  3N9P A;  3SH5 A;  1FAT A;  1ZYB A;  2VZU A;  4LOS A;  4IET A;  1JZ5 A;  1DCS A;  1NUK A;  3N9N A;  4XIO A;  2B39 A;  3H42 B;  4U36 A;  4XFH A;  4AI3 A;  1NLQ A;  4NIH A;  1F35 A;  4LO5 B;  5LW9 A;  3H8R A;  5FY1 A;  1LHU A;  1HRV 1;  1LOF A;  2GH2 A;  4IEX A;  3WG3 A;  3EHK A;  2YGL A;  3R4U A;  3VDC A;  4EN6 B;  4QKB A;  5KC5 A;  1R1A 3;  1RMU 3;  1JYC A;  5FPU A;  5T50 A;  2RS3 1;  3FMG A;  4DXR A;  1LGC A;  5FK8 A;  5AC9 2;  4BE3 A;  1CZS A;  3HBK A;  5FO9 B;  1V9U 2;  2WLP A;  1G9F A;  2VUL A;  2Y6K A;  3H1W A;  3VD7 A;  4LBK A;  4AVC A;  3WD5 A;  1WGP A;  4K7J A;  4PIY A;  5C8C C;  5LBE A;  4YGC A;  1W8F A;  2W91 A;  2ADD A;  2FMD A;  2HWC 3;  3HNM A;  2VUD A;  1GNY A;  2VR4 A;  1PMH X;  1QXP A;  3ACF A;  4RGG A;  4YG3 A;  2WQ4 A;  1NXD 1;  5CKQ A;  3LIG A;  4PF1 A;  5C3Q A;  1A78 A;  1W2T A;  3CEW A;  2DCJ A;  4QKN A;  5CKM A;  3S5A A;  1W39 A;  2O1Q A;  1GZT A;  4YW4 A;  2FD8 A;  1CZV A;  4Q4Y 1;  4CYD A;  5BNO A;  1A34 A;  1SBD A;  1PGW 1;  2VQA A;  2XUM A;  4E4H A;  2P5B A;  3JUU A;  1EPZ A;  4UFL A;  1BYH A;  1EAH 2;  1W6P A;  4Y22 A;  5BNO B;  3IDA A;  2BGP A;  2Q1F A;  3LSE A;  5HCH A;  4Q27 A;  1BMV 2;  5FZG A;  2ET1 A;  2VTX J;  3KS7 A;  4HK9 A;  5C8C B;  1V6K A;  4AXO A;  3PIJ A;  4M00 A;  1YJL A;  1FOD 2;  5J37 A;  1C3H A;  4NMI A;  4PBO A;  3KCC A;  4WVV A;  2L9L A;  1JW6 A;  1OUX A;  1KS4 A;  3VGI A;  2E53 A;  3S6P A;  2E33 A;  2E7T A;  3R6S A;  1JOB A;  5LBC A;  4QX2 A;  4ZU5 A;  2ZMN A;  2YBS A;  3M8L A;  3WW3 A;  1QWR A;  1RVF 2;  2BOI A;  4NIG A;  4BZ4 A;  1OD5 A;  2OPW A;  1OPO A;  1QQP 3;  5KHH A;  4TWT A;  3T3Y A;  1AVB A;  2I45 A;  5CB7 A;  3HQR A;  4Q0Q A;  1UAI A;  1ZBA 1;  4RS5 B;  3PUS A;  2CDO A;  3DYP A;  5FZ3 A;  3T1L A;  4CUB A;  1GZW B;  4WV8 A;  2ARA A;  2RS5 1;  4IE5 A;  5GM0 A;  1WBF A;  4KU7 A;  2WKK A;  1DLC A;  1UPI A;  1JXN A;  5LK5 A;  1OH4 A;  3WLU A;  2ES3 A;  5JSR A;  3CO2 A;  4AFB A;  3ZFE B;  4OCT A;  3D4K A;  5HV4 A;  1HN0 A;  2XON A;  3IPV A;  4QGL A;  3LOI A;  2EA7 A;  4XUQ A;  3VHR A;  1FT9 A;  3ZYJ B;  3KMH A;  1W6N B;  2Q0A A;  4EN0 A;  3VBH C;  4A6S A;  1QJY 3;  1RUJ 3;  3IPV B;  4B4R A;  2RDR A;  3LCP A;  5F2W A;  5LCW L;  5AFB A;  4AVS A;  2CL2 A;  5GAL A;  3HMY A;  1YC6 1;  4XBL A;  3OPT A;  4QDQ A;  4WVM B;  5GLW A;  1ZA4 A;  5LAS A;  3OJB A;  1TVG A;  3OB8 A;  1VIW B;  4WM8 A;  1J59 A;  3EQE A;  4J6G A;  1D2S A;  1V9U 3;  4LBJ A;  1PNG A;  4XE9 A;  3O1O A;  5JSO A;  5FZ4 A;  4GH4 C;  3AC0 A;  1PMI A;  1CPM A;  3QCW A;  1W9T A;  1WCS A;  2WWJ A;  1ENQ A;  3ETQ A;  1YI7 A;  5A3O A;  4ASL A;  2XLF A;  5C5T A;  4XIL A;  4A4A A;  3V0B A;  3MW4 A;  1IS3 A;  1NCR C;  2RM2 1;  2HBU A;  4MGS A;  3AM2 A;  4OHW A;  1C8M 1;  4L97 A;  4A7Z A;  4CDU B;  3WUC A;  5A33 A;  5FZ7 A;  2PHF A;  4N53 C;  5FBJ A;  1R1A 1;  4AI9 A;  1UD1 A;  2VMG A;  3J8F 2;  1AR6 1;  1ULD A;  1NA1 C;  4ZPI A;  5FYS A;  5K0U C;  4JGZ B;  5GJ6 A;  4OUL A;  4CRQ A;  1GP4 A;  1V6I A;  1HB1 A;  2WNU B;  2K2S A;  2VUC A;  1OKO A;  1Q8O A;  4XHX A;  3WDW A;  2BJS A;  3NNJ A;  1IQA A;  4Z2W A;  5CFC B;  3MIF A;  2JE9 A;  3ROU A;  2VUJ A;  1RUC 1;  4FFH A;  3O0V A;  2P2K A;  4OHX A;  5EYY A;  4COV A;  5T5P A;  4LUL A;  3ACG A;  2OXB A;  2XB6 C;  4FOW A;  3WNN A;  4C90 A;  4E8C A;  2PHU A;  1O8P A;  1W2O A;  1XOY A;  4R9B A;  1REF A;  1SG3 A;  4IV1 C;  3O5S A;  1WCD J;  4JHZ A;  5C3O A;  1RUF 2;  4LBL A;  4CP2 A;  2BFU L;  3NV1 A;  5KHI A;  1RVF 3;  3VL9 A;  2K9Z A;  4L2N A;  4XJZ A;  3ZO0 B;  1VB2 A;  3OOX A;  4BHP A;  3ZM8 A;  5F37 A;  1I6X A;  4QT6 A;  5JUV A;  1ULG A;  4XOG A;  3RYR A;  2DVB A;  2HWE 3;  4AVA A;  4OI0 A;  4JKK A;  3VDD C;  2WIN B;  1OA3 A;  3AKP A;  5FZB A;  4B29 A;  1POV 0;  1C5H A;  4ATE A;  3LA7 A;  5DUX A;  1W6M B;  3FHI B;  1JYI A;  2JB4 A;  4Q0S A;  4AED A;  5DMY A;  1GR3 A;  4OQ8 A;  3LOB A;  2RG4 A;  4G3Y C;  1VRH 1;  2WWU A;  3OGJ A;  3DN7 A;  3KT4 A;  2VQ0 A;  1KFX L;  3ZXG A;  1GUI A;  4OFG A;  4UFM A;  3ZXD A;  1R1A 2;  3AVR A;  1S0G A;  4RR3 C;  3N7K A;  3MLL A;  1N1V A;  5IFT A;  3KSC A;  3JQX A;  1QNY A;  4QU1 A;  3ACI A;  4P5Y A;  2RM2 2;  3KF5 A;  2JDY A;  1J1T A;  1TG7 A;  1D4M 2;  2FCT A;  2LRP A;  2A6Z A;  3EO6 A;  3UJO A;  1S0I A;  2VTX A;  4QQL A;  4CCC A;  4BQ5 A;  4OMC A;  3SCG A;  2V72 A;  2OUJ A;  1W8U A;  1K5M A;  4RFT 0;  1YIP A;  2X10 A;  2XBO 1;  1UW8 A;  4AEM A;  5I91 A;  3ACL A;  1UXZ A;  2DTY A;  2BEO A;  3MYX A;  1OVP A;  2HWF 2;  5C5U A;  2GNM A;  4XQ4 A;  4N8M A;  5DDJ 3;  2DUP A;  2JD4 A;  4IV3 B;  3SKJ E;  1VAV A;  2EID A;  4B1L A;  1V9U 1;  4TYS A;  2YBP A;  2ORX A;  2EAK A;  3ZR6 A;  4GKX A;  3BYW A;  4QX3 A;  1DQ0 A;  2VNO A;  1CGP A;  5FP7 A;  2A6V A;  2E32 A;  1DYK A;  1SDD B;  4K40 A;  5FJH A;  1AL2 1;  3LF7 A;  5HXM A;  3N7L A;  3C7E A;  3VZK A;  3FLT A;  3IAP A;  2RR1 2;  2J1S A;  5I0S A;  1OLM E;  2H6C A;  2ZAC A;  4RGK A;  5L9B A;  2WSU A;  2W92 A;  3DEM A;  5IJR A;  1WCQ A;  3POJ A;  5K8S A;  1RIT A;  5DZF A;  1C8M 3;  3AXE A;  2VW0 A;  4KBZ A;  3VD3 A;  5EIY B;  1W03 A;  1CES A;  3SMH A;  4YVS A;  4UAP A;  1SCS A;  2VG9 A;  4RHV 1;  5E88 A;  4CDQ A;  1RUF 3;  3LFI A;  3VB9 A;  3AMQ A;  1MZ6 A;  1POV 3;  4N53 B;  1Q8Q A;  1H2N A;  4Q4W 2;  4IDZ A;  2O8O A;  2WC2 A;  3NVC A;  2YUE A;  4ZHN A;  1GYK A;  3R05 A;  2ZGQ A;  3OBA A;  1KXG A;  4MX3 A;  3ZFG C;  1BBT 2;  1C28 A;  4IQP A;  1LUL A;  3TNP B;  3KHC A;  2XL9 A;  4LLF A;  4KQ7 A;  1K45 A;  2RS1 1;  2WT0 A;  4GMP 0;  4HPK B;  4NHM A;  5IAV A;  3A0K A;  3RYK A;  3SH3 A;  3VBU A;  4A42 A;  1PZ7 A;  5FIX A;  1WLD A;  2KR2 A;  1S0E A;  2QVS B;  2NN8 A;  2RMU 3;  2ZGR A;  4Y1X A;  4C1X A;  1KRI A;  1HQL A;  4DZG A;  1W04 A;  4B7E A;  1PK6 B;  4FPF A;  4XCA A;  1S1A A;  1XNT A;  1SHW B;  1C8M 2;  2A3Y A;  2I07 B;  3JBG 3;  3ABZ A;  2DUQ A;  5FUN A;  3TWI A;  2GME A;  5BY5 A;  4IW3 A;  3SEE A;  4MXV A;  5HXV A;  3RWN A;  5JPN B;  1AL0 G;  2VBD A;  3ASI A;  2AR6 A;  5F32 A;  4GWJ A;  1EAH 3;  4IE0 A;  1SLL A;  3WDT A;  4NPR A;  4BU2 A;  4P9J A;  1PVX A;  1O3Q A;  5DAX A;  3T2O A;  1GKB A;  3MHZ A;  4KH9 A;  2TBV A;  3HT1 A;  2VMH A;  4M3C E;  1K42 A;  3NAP A;  5FZO A;  1A8M A;  1CQ9 A;  2JG9 B;  1IOA A;  1ENR A;  1UIJ A;  2CYF A;  1W28 A;  1DQ6 A;  3O1U A;  1DDL A;  3GAL A;  5C4W C;  4IEO A;  2VY0 A;  3I97 A;  1P8J A;  2ZHK A;  4MGY E;  1AHS A;  3R4D B;  2QFE A;  4QPG A;  1UX6 A;  3UNP A;  1VMJ A;  1RIR A;  1VR3 A;  4AW7 A;  2DUR A;  4IUG A;  2YZ4 A;  3ZXK A;  1IS6 A;  1OFN A;  2O14 A;  5FXZ A;  2X09 A;  2DYC A;  3ZKY A;  5EJZ B;  5FZA A;  3VBO B;  4KMQ A;  4FBF A;  3POY A;  3WHU A;  5KXC A;  2D5F A;  2A6Y A;  4V2V A;  1RUE 1;  2FHR A;  4N90 A;  4OHY A;  1W90 A;  4K9S A;  4LE3 A;  2IXH A;  1I5Z A;  2R30 A;  1SFN A;  4MVT A;  1ZM1 A;  5ACA 2;  4HSL A;  3FFQ A;  3VDB A;  3C2U A;  5J48 A;  2HWB 3;  4B1M A;  1CAU B;  1DLL A;  3GXU A;  3GZA A;  3O1M A;  1E5H A;  3MZH A;  3KVA A;  3OGV A;  4DS0 A;  1DGW A;  2D40 A;  1MS4 A;  5IVC A;  3SIT A;  5FLJ A;  1XSR A;  2IWG B;  4P02 B;  4FOQ A;  4RD7 A;  1J58 A;  1DZR A;  1UKG A;  5EFU A;  2YV8 A;  1VMH A;  1WD3 A;  1XBF A;  3ZXJ A;  4XUP A;  2WS9 3;  3H8U A;  1OXC A;  1EV1 1;  3ZLI A;  3MUY 1;  3QOP A;  5A80 A;  5A3L A;  2HEW F;  2XPJ A;  2UY9 A;  4M0H A;  1HXS 2;  4IE4 A;  4HVQ A;  4XBQ A;  1RUC 2;  2JB8 A;  4FFG A;  1R08 3;  3IN9 A;  5EPA A;  3GCW A;  1UQX A;  1W9W A;  2XVK A;  4LR4 A;  3BOP A;  4NAO A;  2ZOE B;  3T08 A;  5LEK A;  1AX2 A;  5E16 A;  1SEF A;  1B35 C;  1W2A X;  4QXK A;  1L7Q A;  3SHR A;  5F9T A;  1IGO A;  2ZS6 B;  4MXW A;  3NV2 A;  5A6X A;  4LO6 B;  1QQP 1;  3A0N A;  2AYH A;  2ZHM A;  1S0F A;  4YYO A;  1TNF A;  1JYX A;  4PQ9 A;  2E9Q A;  4AAX A;  5CAD A;  4UBH A;  4XAB A;  1JZ8 A;  4P08 A;  4CDX C;  2W0X A;  1A3K A;  4GH4 B;  4KWJ A;  5IWF A;  4YVW A;  3DKW A;  2XJU A;  1ULF A;  1DG6 A;  2ZMK A;  3NW4 A;  3CJI A;  2R0H A;  2R32 A;  3AKQ A;  3SIS A;  1BEV 3;  4JC1 A;  2PHW A;  3O1T A;  2FQP A;  4I0B A;  4JZR A;  5SV5 A;  4WVW A;  2WNO A;  1YHF A;  2P1B A;  1YLL A;  3CL1 A;  4DEV A;  2ZZJ A;  4BLJ A;  2PAE A;  2PAM A;  2G19 A;  2Q8C A;  2XML A;  5FLH A;  1XE8 A;  4KWU A;  5C9A A;  1S55 A;  1H6Y A;  3IWZ A;  1D4V B;  1NA1 B;  1S0J A;  3D5O A;  5K0U B;  2AAC A;  3I2H A;  5FOJ B;  5LY2 A;  1ST8 A;  3FX3 A;  3I59 B;  3PUH A;  4E8D A;  3K3N A;  4XMI A;  5EQU A;  5G05 L;  1RUD 2;  4Y1Y A;  4YW6 A;  5JCT A;  2CGO A;  4OYU A;  1XE7 A;  4RL7 A;  2CTV A;  5I0D A;  1WLW A;  2Y0I A;  1GQP A;  2ETE A;  3LZZ A;  1MS5 A;  5T5L A;  1BCX A;  2CDP A;  3WW4 A;  1GZC A;  3E1F 1;  2D98 A;  5LAT A;  1SQ4 A;  3WNK A;  3RMX A;  1Z7S 2;  2LRO A;  4UBG A;  4B7K A;  1STM A;  3I3D A;  3OEA A;  2PLV 2;  4EWE A;  2BRT A;  3THP A;  5BUV A;  3KV6 A;  2IFR A;  3BIW E;  1PO1 3;  5HV0 A;  2W1U A;  1VBD 2;  5JXI A;  1DZQ A;  1AR8 2;  5T5O A;  3TB0 A;  1POV 1;  1O4T A;  4LLO A;  4AGR A;  1V0A A;  2P3K A;  2RS5 3;  4XFA A;  1PM7 A;  2VNR A;  4KI5 M;  3ORJ A;  4N43 C;  3U0Z A;  3VLB B;  1JMU B;  5KBF A;  3ME2 A;  4CDU C;  1VBE 2;  1S4C A;  1CZT A;  1V6M A;  2PHL A;  3I2F A;  3CDZ B;  4RS5 A;  4XHB A;  2C5D A;  5CVR A;  3OEB A;  3ZPY A;  1LR5 A;  3J7H A;  4AE2 A;  1ZRF A;  1CWP A;  2RDQ A;  1MS1 A;  1WLT A;  3DYO A;  5C33 A;  1W9Y A;  3VZO A;  4XF4 A;  4HON A;  3AZW A;  3KT1 A;  1RMU 2;  1X36 A;  3O1V A;  4MYE A;  2Y60 A;  4Q29 A;  1OPM A;  4Q4Y 3;  4AQ6 A;  2J1A A;  4ZS3 A;  1GWM A;  4XMA A;  1UZZ A;  2OZ6 A;  2Y6G A;  3MID A;  3MV0 1;  1H9P A;  5EJ1 B;  1SCR A;  4JGZ C;  4AGG A;  4IE6 A;  5FQ0 A;  5K4L A;  3TN9 1;  1PO1 2;  1D2Q A;  3FWE A;  2GNB A;  2G9F A;  3K77 A;  1MQT C;  4IEU A;  5T3N A;  3I7D A;  3T4H B;  4HOO A;  4COZ A;  5GLT A;  4BA6 A;  3HD8 B;  5L9V A;  5JI7 A;  2QQI A;  3ZIW A;  4CP0 A;  1LOD A;  3OUH A;  2RM2 3;  2GC3 A;  4I2O A;  1WZX A;  4MGT A;  1HB3 A;  1TMF 1;  1WW6 A;  2UWA A;  2HJI A;  4HVO A;  3GBF A;  4HPK A;  4R9D A;  1TQ5 A;  2GSY A;  2J1V A;  4L11 A;  2B5H A;  4XJ8 A;  3WDV A;  4BCU A;  1JYV A;  2W95 A;  1WME A;  4XQW A;  4FP3 A;  1PGL 1;  2EAA A;  5APA A;  4KGG A;  4R8H A;  4RR3 B;  5AVA A;  5BNP A;  1N1T A;  3H50 A;  4W50 A;  5FR3 A;  2W87 A;  1QJX 2;  3U11 A;  1W6M A;  1CJD A;  2Y38 A;  1GAN A;  3DYM A;  3UGF A;  3QH7 A;  1EP0 A;  2D6K A;  1AYM 2;  1EYB A;  2BU9 A;  4QQH A;  5FPA A;  3TNQ A;  3UGG A;  1JOJ A;  2R1B A;  4BLI A;  1LAJ A;  1FOD 3;  1IHM A;  3OY8 A;  5GZG A;  2GZW A;  2XXZ A;  1S2K A;  2VQT A;  1MVQ A;  3AZY A;  1VMF A;  3CF6 E;  4TLF A;  1JI6 A;  1UNB A;  2QQL A;  2JDP A;  3VBR C;  1BZW A;  2E7A A;  3GNE A;  1G8W A;  4FFF A;  4Y22 B;  1YIF A;  2QQW A;  1L7R A;  2XJT A;  4GB3 2;  2WR9 A;  1AXY A;  3N7J A;  3GGL A;  4XET A;  4Y1V A;  5A6Z A;  5LA1 A;  1ZRC A;  1RUN A;  5FPX A;  1LTE A;  1YXW A;  3OPW A;  4XPV A;  4OQ9 A;  3PDQ A;  5FZK A;  1WCU A;  3WNO A;  3H8O A;  3KHB A;  4XFG A;  3ENR A;  3L2Y A;  3B9C A;  3LWC A;  5DG1 A;  4PLM A;  1AUY A;  5FZ0 A;  4PIX A;  3J8F 1;  1Y7B A;  5EZW A;  4DPN A;  3VL8 A;  2W52 A;  2WAB A;  1GWL A;  1Q56 A;  2KXL A;  2JEM A;  5F39 A;  1VBA 2;  4WM7 A;  5FYV A;  1SFY A;  1HXS 3;  4QHO A;  4XZP A;  1KD7 A;  1AL2 2;  4BQ1 A;  4I3P A;  5LBB A;  1PMJ X;  5FXX A;  1W0N A;  3BB6 A;  1NG0 A;  1AR7 3;  3FUQ A;  3KVB A;  1VJ2 A;  3NQH A;  4MZU A;  2XWJ B;  1LHW A;  1UZ0 A;  3A22 A;  1QY4 A;  2YRO A;  4FQ4 A;  3O12 A;  4IXL A;  4QKF A;  4LNV A;  2B9V A;  1IG3 A;  3VBS C;  1OKQ A;  2RS3 3;  2W68 A;  4GB3 3;  3WR0 A;  1CX4 A;  1X8E A;  4AAP A;  3T2P A;  3HQX A;  2WAA A;  3S30 A;  3ZFG B;  5JOY A;  4OUE A;  4OI2 A;  4YAR A;  2WNU C;  4R4Z A;  3ZN6 A;  2B7Y A;  3S7I A;  3J9S A;  1FAY A;  2TEP A;  1SFP A;  1XQN A;  2NZ9 A;  2CHH A;  3K46 A;  3RJR A;  3OBT A;  4NUB A;  2PLV 3;  4WVM A;  4EZH A;  3PTR B;  3OGS A;  2QUO A;  3I8T A;  4MOA A;  3O1P A;  5JZG A;  1W0O A;  4NIA A;  1AR8 3;  2BER A;  4XC9 A;  1NQJ A;  1VBB 1;  3GCX A;  3HR9 A;  5FTT C;  3RG0 A;  4CCJ A;  4CCD A;  2BGC A;  4CU7 A;  3K75 B;  4Y5T A;  3K4D A;  3H3Z A;  4QX1 A;  1W8T A;  4JDN A;  5C71 A;  2A7A A;  2W46 A;  2BZD A;  1A8D A;  3DEC A;  3V0B B;  2D93 A;  1UY3 A;  1QIQ A;  1I5P A;  5A3W A;  4X6R B;  4BM8 A;  2XJS A;  4EZ4 A;  1J3Q A;  2ARE A;  2PN5 A;  4FOV A;  1ZZ8 A;  2ZHN A;  4EQV A;  5KHG A;  1H8V A;  3I2O A;  4LKS A;  5F6K A;  3GJB A;  1G9A A;  1GP6 A;  2FDF A;  2P3J A;  2XH6 A;  4HK8 A;  3VZL A;  2RR1 1;  3LDK A;  1VBE 1;  4YVS B;  4HKW A;  5CIS A;  1VBD 1;  3NRU A;  3NO8 A;  1LU1 A;  1ND3 C;  5DAP A;  4D94 A;  3TEZ A;  4N43 B;  5L7O B;  4UXA A;  3KGL A;  1O8S A;  3NKT A;  1NOV A;  1GOF A;  1NKG A;  2W9X A;  1H1A A;  2JG8 C;  2J1U A;  4JKL A;  4RFR B;  1SPP B;  1CVN A;  4UW6 A;  3PIG A;  3D8C A;  4NWV A;  1H1M A;  5JZG B;  3PMS A;  1XU2 A;  4ISR A;  4NO4 A;  2FDI A;  3ZYG A;  2FDK A;  3OGG A;  2VOX A;  2XL7 A;  4LTA A;  4XUR A;  5BXX A;  3SQO A;  5J1X A;  1HQW A;  2B9U A;  2P6C A;  1CR7 A;  1L3J A;  1OQ1 A;  2GC2 A;  2WII B;  3HWJ A;  1R09 2;  4W6X A;  2GMP A;  2GP5 A;  4CZS A;  3M3I A;  3S7E A;  5GZF A;  1US2 A;  3ZFE A;  5A7S A;  4FTB A;  4RQP C;  2H6B A;  2KM2 A;  2ZX4 A;  2BGO A;  4K8F A;  4ONU A;  3FBY A;  1OQE A;  4MGZ E;  3GZE A;  2Q1Z B;  1NE6 A;  1YFX A;  3D82 A;  1H2L A;  4P9L A;  5FV3 A;  3RJ2 X;  2H0V A;  3ZN5 A;  1RL3 A;  1DYP A;  4AEJ A;  5KXE A;  1VAK A;  4FSJ A;  4P9Y A;  4PIZ A;  1WKY A;  4DMI A;  2HWF 3;  3H1M A;  2VOK A;  1V70 A;  3AFG A;  3JBG 1;  2NM1 A;  3J4U H;  4QDS A;  2WS9 1;  2ZX1 A;  5C8C A;  4L0P A;  1AJO A;  4LJH A;  1FMD 3;  4ORF A;  1RJ8 A;  2CGP A;  1ZNP A;  3NNL A;  4NOT A;  2CWM A;  2EIG A;  2ZPX A;  1H1I A;  3ZXE A;  3MIH A;  2RVA A;  3PVN A;  4XF9 A;  3RPQ A;  2OX0 A;  3ZYF A;  3M3Q A;  3KD4 A;  1Y43 B;  4GAZ A;  4RQP B;  3MPB A;  3N9Q A;  1MS3 A;  4WZF A;  5FZ6 A;  3B3Q E;  4COY A;  4CEY C;  3ILF A;  4G9S B;  1YWK A;  3F2Z A;  1QJU 1;  3ILR A;  1S0B A;  4FAG A;  2GMM A;  3PUR A;  5FPV A;  1QJE A;  4JGY A;  1CJP A;  2RS5 2;  4YW7 A;  1COV 2;  5IVB A;  4Q26 A;  1XE0 A;  2YC4 A;  2PHR A;  3VKO A;  3CLP A;  4EN8 B;  1JYT A;  1YQ6 A;  3D6E A;  3RZK A;  4Y24 A;  1W9F A;  1MS9 A;  1U5X A;  4XJU A;  3OSD A;  4UW5 A;  3P3P A;  2W47 A;  4BIF A;  1F4H A;  2OPK A;  4I30 A;  3U07 A;  4JVA A;  5L7O A;  2BPA 2;  4WZC A;  2GNT A;  1QXR A;  1KS5 A;  2WO3 A;  4AI8 A;  5IVY A;  1OVS A;  2R07 1;  3LEM A;  5FMD A;  2WFF 3;  2VVE A;  3H3L A;  3RGB A;  4PQQ A;  3ZFF A;  4Q4W 3;  3ZSK A;  4ARY A;  4DUV A;  5JOX A;  5KHJ A;  3ZSM A;  1EV1 2;  2D6M A;  4P9W A;  5E1R A;  5FWE A;  5CFD A;  5T55 A;  2YMZ A;  3ZYB A;  2WNV C;  5KXD A;  5GZC A;  5JMC A;  3BI3 A;  5IVV A;  4PBP A;  4UI9 L;  4XCB A;  3ST7 A;  2RMU 2;  3JD7 1;  3PU3 A;  1UOF A;  2WSV A;  2WQ8 A;  1C1F A;  4QX0 A;  4P9X A;  3AKR A;  3RFR A;  1RUJ 2;  1SLC A;  1YYN A;  2WN3 A;  3NJY A;  3OYW A;  4I3G A;  2EIB A;  3K48 A;  3WCS A;  2AC1 A;  3VD9 A;  1CAX B;  3VKF C;  5IFP A;  4AVB A;  3DCQ A;  4Q4X 2;  1W8Z A;  5LWB A;  1PO2 3;  1LHO A;  2BWA A;  2J22 A;  2HWD 3;  2ZAA A;  1VBC 3;  4BQX A;  1OLM A;  3VKN A;  1J1L A;  2QJV A;  1VAL A;  2X5I A;  4H7L A;  4TXW A;  3PVB B;  1AYN 2;  3B94 A;  3NMB A;  1NCR B;  2VD7 A;  1COV 1;  4R52 A;  4B4Q A;  5FOB B;  3H7Y A;  4QAW A;  2VZS A;  4FVV A;  3BOD A;  1IKQ A; 
#chains in the Genus database with same CATH homology
 1HN0 A;  2LRP A;  1W8W A;  4LKE A;  2WYF A;  4BQ5 A;  2LRO A;  3ZYF A;  1W8U A;  2KR2 A;  1UOJ A;  1OH3 A;  4LK6 A;  2VXJ A;  4A6S A;  3ZYH A;  2C24 A;  1W8Z A;  4CPB A;  1GWM A;  1WCU A;  1W8T A;  1L7L A;  1V0A A;  3UT0 A;  4YWA A;  2JWP A;  4LK7 A;  2O14 A;  1WMX A;  3F95 A;  1GWK A;  3ORJ A;  2Q1F A;  4YW7 A;  1OKO A;  4BQ4 A;  2K46 A;  3ZYB A;  4CP9 B;  4YW6 A;  4LJH A;  4LKF A;  4LKD A;  5D21 A;  1GWL A;  4BQ2 A;  4CP9 A;  4BQ3 A;  1W9F A;  4AL9 A;  1W90 A;  4CPB D;  1WZX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...