1UOJA

Crystal structure of pseudomonas aeruginosa lectin 1 in the calcium-free state
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
121
structure length
121
Chain Sequence
AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Calcium and Galactose Recognition by the Lectin Pa-Il of Pseudomonas Aeruginosa
pubmed doi rcsb
molecule tags Sugar binding protein
molecule keywords PA-I GALACTOPHILIC LECTIN
total genus 22
structure length 121
sequence length 121
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07828 PA-IL PA-IL-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 1uojA00
3ZYFA 2K46A 4LKEA 4LKFA 4BQ2A 3UT0A 1W90A 4CPBD 4BQ5A 1W9FA 4YW6A 2JWPA 1W8ZA 2WYFA 1HN0A 3ORJA 1W8TA 1WZXA 4CP9B 4BQ4A 2KR2A 3ZYBA 4LK7A 4A6SA 2O14A 1V0AA 3F95A 2LRPA 4LKDA 4YW7A 4LK6A 4AL9A 4BQ3A 2C24A 2VXJA 1L7LA 2Q1FA 1W8WA 1WCUA 3ZYHA 1OKOA 4LJHA 1OH3A 1GWMA 5D21A 2LROA 1UOJA 1GWLA 4CP9A 1GWKA 4YWAA 1W8UA 1WMXA 4CPBA
chains in the Genus database with same CATH superfamily
3PUIA 5FYVA 4I2OA 4Q4Y3 2W47A 4LKFA 1RUG3 2PTMA 3CZUA 4Q27A 5FAXA 1PO12 3I8TA 3IDEA 4NE9A 3ZYPA 5LW9A 3RZLA 2J7MA 2JE7A 1AYM2 3X29B 4DEVA 5J96B 2PHXA 5L7OB 4MXVA 1S55A 4XABA 2RHPA 4GKYA 1KEXA 1ASJ1 4Y3OA 5F37A 2NM1A 4DY5A 4IV3C 1V6LA 1ZM1A 3LIGA 4XAAA 3J8F3 3PUHA 3LEMA 5GJ6A 2YFUA 1WD4A 5IAVA 2RJ2A 2QDRA 3N9OA 2DCTA 3POBA 3ZXEA 2VAUA 4HVRA 3I2FA 4A42A 4JKLA 1HXS2 3LIHA 4QKNA 4ISQA 3TB0A 1OOPB 2OZJA 2ZHNA 4INDA 4CCJA 1UU5A 2XBO2 5FOBB 2QNKA 2UWCA 1WW7A 1MPXA 2Y38A 4XYXA 3ME2A 3NV1A 4P9JA 4AG4A 1YNAA 2HWB1 1APNA 2Q1ZB 2YC2A 1X33A 3OB8A 4XF9A 4YGCA 5FJKA 2TBVA 4PDWC 2NYYA 3DKQA 3RYPA 3T2TA 3WCSA 3WQ7A 5F5CA 4QQLA 5A7WA 2CSGA 4BYYA 5JAXA 1FMD1 1CAXB 2XJRA 3UKVA 4AW7A 3LSDA 5FYIA 3HBZA 5KHHA 3HD8B 2A3WA 2RM23 1FPN2 3PVBB 4P9WA 4BU2A 2DUPA 3DL3A 4XF3A 4AQ6A 1MQTC 1RUJ1 2BYVE 4C1WA 2EXJA 5JPMB 1RUG1 3ROUA 3MIHA 3WG2A 1IPSA 2OA2A 1VB2A 4JTNA 2B7YA 5GM0A 3ZN6A 1QJU1 1VAKA 3BODA 3M70A 1E5SA 1FI2A 2VQ0A 3PVNA 4UAPA 2TNFA 2GMMA 1PIV3 4ZZ8A 1VBD3 5EJ3A 2O8QA 2X5IC 2AZ5A 2OYZA 2IXHA 1DYOA 2A71A 1LODA 1NE6A 2Y6LA 2XVKA 1AX2A 1QH7A 3B02A 3Q8EA 3ZM8A 4EQVA 2BGCA 5K7PA 4AI1A 2AREA 4XCAA 1PZ9A 1AR73 1RUF2 2ZEWA 1ND3B 5D8AB 4TXWA 4UYBA 3ES4A 4COVA 2BPA2 3BTXA 1IG3A 4XBLA 4IEUA 2G4IA 2RVAA 4HKWA 1UZYA 2Y6GA 3AK0A 2ZZQA 1YFUA 3J8F2 4R4XA 4TYSA 3ZFFC 1AHSA 2HWD3 4NWVA 2OIIA 4Y4YA 5A7PA 3WDUA 1JYIA 3AZXA 5C4WA 5IVVA 1TE1B 3POGA 1VPHA 4CDWA 5IVEA 2RE9A 4W65A 1DDLA 3MLLA 2C9KA 2WZ8A 3OGSA 1PVC3 3THPA 3LEIA 4ASMB 1Y9MA 3S57A 1NXD1 1H1AA 5HV4A 3ZYRA 3OPZA 5JOXA 2VZQA 2CGOA 2YBSA 3TBDA 4AI3A 1JN2P 2BQPA 2WNEA 3L2HA 5JI7A 4OQ9A 4FPHA 2WC2A 3TNQA 3E5QA 1IG0A 3OEBA 4OVEA 3VZKA 4AVSA 2BDRA 3H7YA 4IESA 2RDRA 5CBLA 1GZCA 4B7EA 1G86A 3O14A 4Y33A 3R4DB 5I8SA 3H8UA 3BPZA 2VQUA 3FMGA 1DGWX 3BU7A 4G4FA 4YVSC 3VBOA 3W5MA 3ZPYA 1COV3 1R083 1QXPA 3A23A 4UOJA 4AVCA 4JDOA 4COYA 1RC6A 1D7PM 2K9ZA 1W6OB 2LW8A 3ZDVA 4ZS3A 2JDMA 4FPYA 4XDQA 1OA2A 1A8DA 4E8DA 3KQ4B 5T5JA 5T5PA 3KWVA 5J3UA 2O0OA 1FOD2 2R0FA 3JD72 3VBOC 2BU9A 2JEMA 2W08A 1W9WA 2VW0A 5IFTA 1NY71 1SPPA 5FXWA 3FWEA 2QFEA 1U5ZA 4YPJA 3ATGA 3VZJA 2G19A 5J1XA 2WNUB 1H8TC 2DWRA 2A73B 4HT1T 4QPYA 4AI2A 1D4VB 3H0OA 2ZS6B 4AE2A 1RHI2 3K46A 1QF3A 3RRDA 4C90A 5EV7A 2IWGB 1UYZA 5A3MA 1WW6A 4FQZA 3M3EA 1R093 2J1AA 1I9RA 2VW1A 4RA0A 3N3HA 3NNGA 3LPGA 1UIJA 3VBSC 1HB1A 2VZOA 3WUDA 4YGBA 4CU7A 3SH4A 4FQ4A 1O4YA 1IGOA 3C7EA 5K8SA 4D7TA 3RZMA 1JU3A 3AZVA 2B8MA 4FAHA 4CEYC 4FOYA 2GP5A 5EHDA 1LNSA 1UY0A 3W21A 5JXJA 5FZHA 1RUNA 4O7XA 4XFGA 5E8AA 2WNVB 3QD6A 2Y60A 2YY1A 1V00A 5F3GA 3T2OA 5A7NA 3CHXA 3E1F1 4HBNA 1U5XA 1NA1B 4LO6B 1JUIA 3KLSA 5JI9A 5FPVA 3H3ZA 3SNMA 4ATFA 2OKXA 4AVVA 1S0EA 3MW2A 1XPWA 3MI8A 4YM3A 3B9CA 1FAYA 2YGMA 4RQPA 4YW2A 1NY72 4XIKA 1EV13 1F4HA 4NHKA 4YW1A 1UOGA 4FFHA 1JOPA 3ILRA 2BTVC 1RHI1 3K4AA 3POIA 1F4AA 5FZDA 1R091 2NP0A 5A1AA 2R062 3WW1A 1DBNA 2F4LA 4FPOB 5FRAA 1Q5OA 3K4DA 1PK6B 5T54A 2JKXA 1CAWB 3BYWA 3ZMOA 3ACLA 3ZXKA 3NKTA 3I3EA 1C5HA 2J1UA 2Q0AA 5FY8A 1MR5A 1UMZA 1WD3A 3H1YA 3PVOA 2WZEA 3SQOA 3ZFEC 4GH4C 1H6XA 1VBC2 4UBHA 1POV3 4NIIA 1V6JA 5FZLA 3HNYM 3MUY1 5GZCA 4AAXA 3RNSA 4LBQD 3WT3A 4AHXA 3J7NA 1HIXA 4E8CA 2ZCWA 3TEXA 4NIAA 1MS3A 3VDCA 3IN9A 2JG9C 1AR61 2QQLA 2UU8A 3KZ4C 1XC6A 4DEQA 4EN8B 3JZVA 1AR82 2XHKA 3KMHA 1LEDA 5BYNA 1W03A 4XMAA 2OW4A 1IZ3A 5FXXA 2FD8A 1Q3EA 3MIGA 3ITQA 4FPGA 2XJVA 3HT2A 2V09A 5FUPA 1DQ4A 2HH9A 3GGLA 1DP0A 1PGSA 4M0HA 1OA4A 4OZOA 1O3QA 5FMOL 3NNFA 2VULA 4HKOA 5FBZA 4XFCA 2D6KA 1KITA 2ATFA 3I3BA 3MF9A 5FZ3A 4ZS2A 4EN9B 1O3TA 2P6HA 4MGQA 2FMYA 2ZX3A 4DUVA 4NRPA 4MGTA 4MZUA 4LUMA 4JKMA 3AX4A 2B9UA 2VMIA 5L73A 1SLIA 3WG3A 2BBAA 4GMP0 3S6PA 3VBHB 4NHXA 4L8QA 1OMIA 3MF6A 1ULGA 4FOWA 4CPBA 1NKGA 1VJ2A 3EHKA 4JVAA 5H9PA 2JDNA 2ZZJA 3CJIA 3AP9A 2A1XA 5A3TA 2JIGA 1SFPA 1LOAA 5C3RA 3VDAA 4JV4A 3SCGA 3ECQA 1AR63 2J1EA 1O3RA 5DUVA 4LJHA 1HXS1 1RJ7A 5JCTA 1IQAA 5LBFA 4XFHA 1BEV2 1RXFA 2XBO1 4Q0UA 1DGRN 4Q1PA 3GZUC 5DDJ2 1UO9A 1AR81 2VNOA 5FO7B 2QQVA 4LA3A 4P00B 2ZGKA 4NHLA 4AFDA 1IOAA 1R1A1 3MGUA 5CFDA 2A7AA 5FY9A 4KGGA 3OPWA 4CVUA 1LOGA 2CWSA 1OURA 2PLV1 2WA3A 3AM2A 1E5RA 4TZDA 2HKXA 4P9IA 1TMF2 2XUEA 1FPN3 5HBAA 1VAVA 1LAJA 1W6PA 2E7AA 4N53A 1BBT3 5B2GB 5E88A 4Q4V3 3AFKA 3TYJA 2R0HA 4Q4W1 4NWWA 1WMEA 4HN1A 3UNPA 1RUJ2 1FMD3 3V65A 4ZONA 1VP6A 4E27A 1OPOA 2G1MA 1MZ6A 3GZTB 3MPPG 1OD5A 4XQDA 1LRHA 2XWJB 2AUYA 4Y1XA 2QQOA 3JB4C 4HG6B 3NWKA 2PHUA 4ZHNA 2WZR1 4XILA 4RHV3 1IPJA 3ACHA 4LXLA 4FP3A 4XZUG 2ZGLA 3SHRA 3PDQA 2DUQA 2CGNA 2LS6A 3UGGA 4ET7A 1VBA2 3AMHA 5FYBA 1AVBA 5DQ0A 1CAUB 2RJKA 2W52A 1GR3A 2Z5WA 4NPLA 2MEV3 5ERLA 3J8F1 5K0UC 1AX0A 3HBKA 4O9GA 3OY8A 1BEV1 4WV8A 5A7OA 3ZN5A 2ZBJA 3N36A 3RMXA 4EZHA 3VHOA 3O1MA 3V0AB 1U12A 2WO2A 4CUBA 2EF6A 2ARXA 4QPIA 4UXAA 4DRVA 4FPCA 5SV8A 5FWEA 1NCRC 4EYUA 1VBB1 3O1TA 2D40A 3VDDC 2XJQA 4FO9A 5FYUA 1GNHA 4KMQA 5C4WB 1NA1C 4LR4A 4M4RA 3HAGA 5F3IA 3RYKA 4Q4W3 5GKAC 5A3NA 4QX1A 1KRIA 1S0BA 1WLDA 3NNMA 4OYUA 2W0XA 2WABA 2UYAA 4ZU7A 1J84A 3NAPA 4RGKA 4Z82A 1C1FA 4CEYB 4IERA 2IUWA 4XFBA 1O3SA 2HYXA 1YYNA 3IWZA 1REDA 4YVWB 4QXKA 2FDJA 5FYTA 3HQRA 1KJRA 3PTRB 4GB31 4D8MA 3RI9A 4DXRA 1JMUB 5SV5A 4YWAA 5AVAA 1XE8A 3UT0A 1LGNA 1FOD1 5LATA 4YW6A 1FNYA 2VMEA 5FZOB 4ATEA 3ACGA 1VBA3 3TAYA 3AL5A 4TWTA 1D0HA 1HN0A 1LU2A 2YGLA 1HJGA 3AKQA 3N9NA 1S0GA 4PHZA 3O0WA 1JZ5A 1PM7A 1RMU1 4PQQA 4HN0A 5FYCA 5LWBA 3ILNA 2D6OX 2R16A 1CAXA 3U78A 1ENXA 1WW5A 4MHUA 3O1PA 1V6MA 2R49A 2YC0A 1NA1A 5DN2A 2E9QA 1P8JA 2WWSA 4DUWA 2HWD1 2E7QA 4H7MA 3GBWA 3WSOA 1B09A 1ENQA 1POV1 3DUIA 3I2HA 4AVTA 4BB3A 3R05A 2IZWA 3A7QA 3PVEA 1W2AX 4ARYA 1LR5A 2BVVA 2BW8A 2EVXA 2NQYA 4Q2FA 3LA7A 3VBUC 2Y6KA 3AKTA 1S0IA 2LUWA 4XDPA 2CHHA 2HEWF 4A7KA 3GCXA 3O7OA 4YZ2A 5C9AC 5LY1A 2HLEA 5FZGA 1V9U2 3USSA 3P5BA 1EPZA 2YV8A 3KGZA 2QQWA 3WG1A 4KWJA 1I6XA 5L9RA 4XUOA 4CUGA 1PO23 4E4ZA 4GALA 3U14A 2BJSA 2JX9A 1AXKA 3NJXA 2W94A 4YRDA 5I0UA 1W9SA 5FCCA 1VBE2 3HNBM 4OHVA 5LBCA 5A6ZA 1M06G 1J3RA 5K4LA 3NJZA 2BFUS 4BQWA 4CP9A 1MACA 1OKQA 4XFFA 4A7YA 1TEIA 2Q8CA 3BVCA 3SCHA 1BJQA 1SFNA 1PM4A 2IC1A 1CX4A 2VMCA 2ZEZA 2RS13 3MIFA 4UW5A 2PQQA 5DUXA 5A7QA 1AR91 4BJ0A 3POWA 3BPSA 1OH4A 1RMU2 4DFSA 3FJSA 1RUOA 5BNPA 3JXSA 2XJTA 5E6HA 4QXCA 1N3PA 2RM21 2JKBA 1O8PA 4QM9A 2VL4A 2XGXA 3I2KA 2H0BA 5DAWA 1H2LA 4JGYC 4YG0A 1WCKA 5FWJA 5I91A 4AL9A 5KBFA 1NZCA 2X5IB 3CMGA 5CFDC 2VW2A 4XW3A 1O91A 3FHQA 2QCSB 3FX3A 4AWDA 4DUXA 1V6IA 5FZ1A 1GP6A 4CUAA 1RYYA 2BP6A 1SLCA 3KGLA 5JXGA 3IB3A 2QQMA 5C5TA 2JD4A 4X8PA 5CFDB 2K0GA 2X29A 4EWDA 4I02A 4AFBA 4E4HA 5FZBA 2RDSA 1PZ8A 1VRH2 5IWFA 4Z2WA 4CUCA 3H8XA 3ENRA 4UW6A 1ZYBA 4D69A 2E6VA 1XSQA 2A6ZA 2DUOA 1AXYA 1UPIA 2KM2A 5FZCA 4BQ4A 1NLSA 2VQTA 3CIHA 5FMDA 4P9XA 4B3NA 4A3ZA 1K5MC 4JQRA 5F39A 5LB6A 3ZYJB 1QGLA 4BLJA 4XQWA 5C9AB 3RMYA 5CFCC 2RS52 1LHVA 2PXJA 3MIBA 5ABJA 2VZTA 3GZAA 4AVBA 1UQXA 2WT1A 1Y4WA 3BGAA 4Y22B 3UJQA 2VTXA 4BMEA 1DQ2A 4ZY9A 2RR12 4WM8C 5FYHA 4AAPA 2W9XA 1VBC3 1RVF3 1SBEA 4FFIA 2IXJA 2RS12 2QQUA 5CG8A 4OHYA 2DURA 2J1SA 5DZGA 2FDIA 3FUQA 4AFMA 1B35C 1XYPA 2JECA 4HSJA 4DQAA 1S1AA 4CXWA 4Q1RA 1D4M1 4FXGB 1DQ1A 2HBUA 1W6MA 3UESA 3AFGA 3DXUA 1QOTA 3R4SA 3ZYBA 2R063 3E6BA 1WLTA 3IDBB 3VBUB 3WUCA 4EROA 3AVRA 5IK7A 2XR4A 4NPMA 5IK8A 1ZRRA 3H3UA 4BWOA 4IE4A 1KDKA 2HWE3 5BV6A 3NVCA 5DPNA 1SLTA 3OUJA 2Z2SB 1VE0A 4LHSA 1C1LA 2W91A 2VBPA 5LCWL 3U75A 4QPGB 4TLGA 2XG3A 1AUYA 4QX3A 1TME1 5F6LB 1LOBA 4K40A 2ZX4A 1QMJA 1T6BX 3FN9A 3B01A 5IVYA 5C70A 3C8XA 3H1WA 4WM8A 2XL9A 3KS7A 1E5HA 1OHFA 2DCZA 2WIIB 1H9PA 4L99A 1I3HA 2GNTA 4QM8A 1O7FA 1PZ7A 2ID4A 2R042 1HV1A 4YM1A 4CA9A 2ZJCA 3N7MA 5GLVA 4AGVA 4A3XA 5IVCA 1X9TA 4NHMA 4AHYA 1KS5A 2WT0A 1HB2A 1H1MA 4QX8A 1QJEA 3APBA 3WHTA 4DXZA 1ZRCA 2XWBB 2ZEXA 5IFPA 1KJLA 3KV6A 3UETA 4LO7A 2KXLA 4KU7A 3NMBA 4Q4V2 2JWPA 3AYEA 4JTOA 2QJVA 5CA6A 1JHJA 1FXZA 4AEDB 1T6GC 3VZLA 1W0NA 5KHGA 3UGFA 3OGRA 4CP9B 3OBRA 4LTAA 1J1TA 1GUIA 1SBDA 1OLRA 1Y3TA 1GP5A 3MBWA 5FY0A 1QJU2 3S5QA 1EAH1 3D0JA 3DPRA 1XOYA 2SBAA 3D5OA 4YVSA 1JYCA 3WF1A 1POQA 4RHV1 1A34A 1W05A 4L92A 1AYN2 1RXGA 2PYTA 2WFF2 4N53B 5FZAA 1WMDA 1RUD1 3RPQA 3W9AA 1OD3A 4LKEA 4HOOA 3WNLA 2VJXA 5FXVA 4FCAA 2PELA 1Q8PA 4BK4A 1AYN3 4NOTA 4Q0PA 4XTMA 1ZBA2 4AGGA 4MSVA 1RUI3 4FAGA 3NNLA 2W2IA 1QOOA 2J1VA 1TNRA 1GYKA 3GXUA 3ASIA 2CV6A 1UZWA 3M3OA 1YC61 4R4ZA 4RGGA 1RUH3 4QD2A 5D8AA 2VU9A 1FX5A 3T2QA 2D6NA 1AL23 3LE0A 5FLJA 1LGCA 5LA0A 2BZDA 3IAPA 4Q4V1 1OLME 2R30A 2VMFA 3J7HA 5LA9A 4IE0A 1KS4A 3RZJA 4N7UA 3WD5A 2GNBA 3K77A 4QKFA 4WVMB 3SLIA 4DS0A 4JQTA 3NV4A 4MGKE 4CDQB 1W0PA 5J37A 1PX3A 1EAH2 4H3WA 3U4SA 4LBNA 1RVF1 5DG2A 2GNMA 2FZ1A 2X05A 5FMOS 4RHV2 2OPWA 5JIAA 1K12A 3LDRA 4LBJA 1RUC3 4RR3A 2WQ8A 2D93A 2QTWB 1TNFA 5C4WC 2P17A 1RMU3 5FZ4A 1XRUA 3UKTA 1VBD2 1PX4A 5GLUA 1JYTA 1CJPA 1JODA 2CAVA 2J42A 2RG4A 4I30A 1ZBA1 2R071 2W1SA 5CVRA 5FZKA 4Z1VA 1LHWA 5FOJB 4WM7B 3RZZA 1MS8A 1QKQA 5KXBA 4R9BA 2P6CA 1ODMA 1BVVA 4Y1VA 4OHZA 3VZNA 3AKRA 3LSEA 4C8DA 1AL21 1F9KA 2KR2A 2VZSA 4QU2A 5IK4A 1NAEA 3V0AA 3Q8FA 1BZWA 5CU1A 4UFIA 4HZFA 4V1PA 2RMU1 4P9YA 5F7UA 1BMV2 3LOIA 3WNMA 1BK1A 4AFAA 4BXSV 4LITA 5FUIA 3SKJE 2QQPA 1TG7A 4KU8A 2GN7A 2HJIA 1HRI3 1ND2C 3RFRA 4M3CE 4CU6A 5A3UA 1QXJA 1DYPA 4Q26A 1KD7A 2C1FA 2P2KA 2Q4SA 3GJAA 1ZZBA 1PGW2 1PK6C 1UN1A 2WYFA 3BOPA 2KD7A 3N7JA 4JHTA 4KL1A 4YW5A 5EWSA 5FPAA 1C28A 1KFUL 4BLIA 2JG9B 3KM5A 5FUNA 3C7FA 1C4RA 2XDVA 4H14A 3VDDA 5CKMA 5K9YA 4XJUA 3O1RA 3J4UH 1YFXA 3AP7A 1VMJA 2NPIA 1WUVA 4GH4B 5ABJC 4NRMA 3WZ1A 3O5SA 1VMHA 1OKOA 1W6PB 4KBBA 4O9EA 2ORXA 4ZPIA 1XB9A 3ZYFA 3QACA 2WQZC 5A7SA 3H9AA 3H1MA 2V72A 1AL22 2WO7A 3HT1A 5JIUA 1W6NA 3I3QA 2O8OA 3OCPA 3OYWB 3T4HB 3ZXJA 1ZNPA 1DFQA 4YGEA 4I3PA 4YFZA 4YLZA 3THTA 4LE3A 4QHZA 4Y4RA 2N7GA 2WNVC 1WGPA 1LOEA 1UW8A 1NT0A 2C24A 3GF6A 1NZIA 3VBRB 3OUIA 3HQXA 1SG3A 3FFZA 4W50A 1QWRA 5F8PA 2ERFA 5F6KA 4EJRA 3E5UA 3P3NA 5A3WA 4Z07A 3CNAA 5GLTA 1QJU3 3I4IA 1OVPA 3PUAA 4HVOA 1G9FA 1CZSA 1OUSA 1PGW1 1QQP3 2D98A 1MZ5A 4LBOA 4DO0A 2A6XA 4FPLA 2WZPP 1DGRA 1YO8A 3D82A 3POYA 4FPJA 4LBQB 4OMDA 4F3JA 5IAXA 5LRSA 1V6NA 4QAWA 2CGPA 2A70A 3DPRB 2HBTA 5JSRA 1J1LA 2QQNA 4XJWA 1H8TB 2VUAA 4CCDA 1JS9A 4MGSA 4V2VA 1OXCA 1DCSA 2QVSB 4META 5EZWA 4LBQA 2VBBA 3OF1A 1CIYA 5F3CA 3ZYIB 4CDXC 1RB8G 4BDVB 3BUCA 3GHNA 1HW5A 2JJ6A 4XCBA 3OSDA 1EYBA 2WLQA 2VTXJ 1GWMA 4IETA 4QQ2A 1OFSA 2IFRA 2WR9A 1D4M3 4K3UA 5C3PA 2TUNA 4CEYA 2DVDA 5I0DA 5HCAA 4Q0QA 4HFSA 3VBFB 3TEYA 3N7KA 2WNUC 4MGIE 5A80A 2EAKA 4NMIA 1QNYA 2ZGSA 1U0AA 4AQ2A 3DYPA 4XE9A 3VKMA 1VR3A 4EN6B 2X53S 2PHFA 3O1VA 4HK9A 1AXZA 5FY5A 1W6NB 4AEKA 1LHUA 3TN91 5DDJ1 4Q4Y2 4BIOA 4XEZA 2QZ3A 1L7RA 2XJUA 2BWAA 3BIWE 2ZGUA 4BH9A 5J09A 5DXDA 3CZJA 3H42B 4PLOA 3AYCA 2P3KA 4GWIA 4FVVA 1CX1A 1LTEA 4ASLA 3GNEA 4AR2A 1QH6A 3PLQA 3T0AA 3KT1A 3WP3A 3MW3A 1CGPA 5JDBA 3WHUA 4CPBD 1PNGA 2F4PA 4XF0A 2Y6HA 2GZWA 2VECA 2WZR3 1YFYA 4QKDA 5FY7A 3ZFFB 2Q1MA 3QH7A 1HB4A 4UWDA 1COV2 3NNJA 1XNTA 2RS32 1H2MA 1XYOA 5I0SA 1W04A 2GH2A 2QQJA 4Y5Z0 2BOIA 4GXLA 1DZTA 3KD4A 1DU3D 1FOD3 4LKDA 4OI2A 3WNPA 4IGPA 4QDRA 4M01A 4FSJA 2A5ZA 1QDOA 3I2JA 1H2NA 1ZA4A 3ZFEA 3Q8CA 1BEV3 1LENA 1CESA 5I8TA 1AYN1 4YVWA 2GP3A 4YM2A 3WF2A 2VGDA 1YQ8A 2ZHLA 1GZWA 1W2UA 2UY9A 4ZXKA 3SKVA 3W5NA 2FCTA 5FYZA 3T0BA 4XVHA 4CXXA 2VUCA 1ND3C 4LO8A 4F7ZA 1DIWA 4XQ4A 1WW4A 5DAVA 2IFWA 3WW2A 4NN0A 2RDNA 4E2QA 1Q56A 5DUWA 4RS5C 3OOXA 4CE8A 1POV0 4OI1A 2PA7A 1JYVA 4BQ3A 3T09A 1I1EA 4LO5B 1SFYA 3AMQA 4XF1A 3VL8A 2DVAA 4XMIA 4NIHA 1IKQA 4IEQA 2ILMA 2AACA 1ST8A 1VBB2 2C5DA 4OUMA 4QKBA 1ALYA 1PO21 4JZRA 4JX0A 2DDUA 4FTBA 2W1WA 5DABA 2TEPA 1OOPC 2X5IA 5T3NA 1RUI2 2ZAAA 2BFUL 3IZOA 1C3HA 4IE6A 1FPN1 3EB7A 3WNXA 4XOGA 1UY3A 2D7FA 2ORZA 2R6QA 5CG9A 2PHLA 1UL9A 3RVHA 2RS33 5FPLA 1G9CA 2H6BA 1UNBA 4AHWA 2ZGNA 3GZEA 2MPFA 1UZ0A 2HWB3 3HR9A 1RL3A 4OUEA 3ZO0B 1Z7S3 5L7OC 1X36A 1GZ9A 1W2NA 1CWPA 3SCFA 3HN3A 4CP1A 1MEC3 4Q29A 1F5FA 1RUF1 2OVUA 4NVPA 4UW3A 1O4TA 4YGDA 5DUUA 5BPXA 2IXCA 4CDXB 1Y7BA 3ZXDA 2AC1A 5LRRA 5G04L 1W8FA 4EE2A 3DCQA 4LA2A 1AZDA 3EMRA 4C0BA 2Y8KA 4DNYA 4MADA 2E31A 2VOKA 5LK7B 5HV0A 1ASJ3 3C7HA 4RS5B 5BNPC 3B5LB 2Q8EA 2I45A 1D2SA 3B9IA 2YDEA 1SCSA 2EXKA 4WVZA 1XBFA 4HVQA 5LY2A 4QX2A 1OF4A 4E4SA 1UOBA 4QGMA 3JB8A 1RUI1 4PIYA 5FO8B 1VIWB 2DV9A 2D6LX 3C3VA 3U37A 1V9U1 5FJHA 2B4KA 3T3YA 3TNPB 2ARAA 3FBMA 1W90A 1SMVA 2A6VA 2VZ3A 3OBTA 4K1ZA 1ZRDA 3DXTA 4CCNA 1TVGA 2X8KA 3UKNA 4OI0A 1MQTB 1PVC1 4Y1YA 3MICA 2XUMA 2VNGA 4W6YA 2VG9A 3MDPA 2NN8A 2ZMNA 1EUTA 2WN2A 1W6OA 2PHRA 4Q0VA 1KGYA 1DF0A 2JXAA 3M2MA 1JYWA 3WP5A 1I5ZA 2XJSA 3EO6A 1JZ2A 3CL1A 1HQWA 2ZMLA 2XONA 3B93A 4CRQA 5A3OA 1UIKA 2W39A 2DFBA 3NL1A 3BOWA 5DAXA 3A22A 3WW4A 4K6BA 1L7LA 2C0ZA 4M0NA 3CO2A 1E5IA 5H9RA 1LHOA 3AYAA 3BN6A 3ON7A 2WAOA 4IV1C 3DECA 4ZZ5A 2A6YA 2VUJA 5FIXA 3GCWA 5I0TA 3WF3A 4R9CA 3ZFFA 1ZBA3 1Z7S2 3FFQA 3BKZA 1UMIA 3FHIB 3T1LA 4HONA 5KWRA 2BGOA 1Z0HA 4RQPC 3BI3A 4DIQA 4FOQA 4MYEA 1OOPA 4JGYA 5JSPA 1PMHX 4XF4A 3W20A 3VBFC 5JXHA 5FXZA 3VD5A 2VXJA 4D7SA 1GQHA 1URXA 5F2WA 2PFWA 1JBCA 3OBZA 4ES9A 3THCA 4HL0A 3U1XA 3QOPA 4NRQA 2W46A 4IE7A 1OT5A 4H55A 2VMHA 5FPZA 2ZTNA 2W1QA 3CJXA 3VB9A 4U36A 2MHFA 3CBNA 4GJYA 2VVDA 2BOJA 1RGSA 2C6SA 1JZ8A 4PBOA 3M3CA 3H3LA 2V4AA 3SISA 2EXIA 3KF5A 2YPJA 4LOSA 1QNWA 4P9GA 1W28A 3VL9A 1EP0A 4B4RA 3VBSA 4WM7C 4DINB 2IVJA 2P3IA 4BIFA 1LOFA 1ZZ6A 3KT4A 1QJY1 2JG8C 2Y33A 2YZ4A 4NROA 2G9ZA 4NO4A 4PCRA 4RGAA 3URFA 1MS1A 4XUNA 5BY5A 4L9BA 2XLAA 2RS11 4IL7A 1W6QB 2JB4A 3P3PA 3H50A 3VGIA 3Q9OA 4LEJA 4BCUA 1DLLA 1MZEA 1H8TA 4UFMA 4LBKA 1Z7S1 5E1RA 4CDUC 3B7MA 1WMXA 1Q8QA 4TN7A 1OQ1A 1PIV2 2Q8OA 2LALA 2EAAA 3NJYA 3O12A 2DU1A 4Q4X2 4UFHA 4JRLA 1AL0G 5H9QA 4O61A 2BNOA 1KXGA 4XUPA 1L7QA 1RUD3 1EV11 2YPDA 1WLCA 4E2GA 2VOWA 1ZVFA 1K42A 1ND2A 3GHMA 5FZ6A 3KCCA 5GZDA 3ILFA 1LGBA 4MOAA 1GOFA 3NO8A 3OGVA 3WNOA 1AR62 3TN92 1ZA7A 4KGQA 1WCQA 3VKFC 3WX5A 5J36A 2LTNA 1JU4A 3K3OA 1UY1A 4XZPA 4CP2A 3JBG2 1XNDA 2CDOA 3VZOA 3LDKA 3RYRA 1ND2B 2P37A 3BB6A 4YNIA 1GSLA 4UW4A 2I74A 5IJRA 4NUBA 2HEVF 2ZACA 5DDJ3 5F1RA 2XB6C 1GFF2 1GP4A 2ARCA 2GC2A 2IVIB 2DVBA 3MUZ1 4XHBA 2D44A 3GM8A 5FZIA 5HCFA 4COUA 3IPVB 2B5HA 2E33A 5FPXA 3C7GA 5KHKA 2EIGA 1RUE3 1COV1 3LQCA 2RS31 4IEOA 4LNVA 2GH8A 5FZ9A 2VUDA 1WKYA 1H6YA 2ZHMA 1YEWA 2XXZA 5LBEA 4KI5M 1GICA 1NCRA 3MYXA 1DQ6A 1K45A 1OSGA 1W9TA 3SXWA 1WCUA 2GC3A 4RR3C 2PHTA 3PU3A 4QWNA 3K2OA 2A75A 4NHYA 5FMBA 5D21A 2ES3A 2B9VA 4E4DX 1HQLA 1PMJX 3A21A 5HCBA 3E6DA 5FP9A 4RYDA 2J22A 1JHNA 4FTEA 5KHJA 1T2XA 2XL7A 2VZ1A 3AC0A 5EJZB 4K1YA 5BUVA 1GOGA 3EXUA 2D5HA 4ARXA 1NUKA 3TEZA 4Y22A 1ENSA 5GZEA 4TSVA 1S0JA 4EN7B 5FY1A 3ZSEA 1D0GA 5A1LA 1AJKA 2PMWB 3NAPC 4KWKA 3UYJA 4B4QA 2VMDA 4AHZA 5JMOA 1CAVB 1R1A2 5JVVA 1K3IA 3KB5A 4DB5A 3C2UA 3WV6A 3OYWA 4HMZA 4IV3A 1IS5A 4QQOA 4BQYA 1IPKA 1HRV3 1SCRA 4J25A 4XETA 1CQ9A 1CAWA 1UOJA 2WFF3 2JDYA 1MVQA 4QDSA 3ZXAC 3HQUA 4QPWA 3KV5A 5LZ6A 4FTSA 4Q4W2 1REFA 3SH5A 3ZVXA 1X8EA 3WVJA 2GMEA 3TEWA 3NV2A 3SITA 5IATA 2B39A 3WLUA 3JQWA 4EN0A 1X50A 5FBJA 5F9TA 4M3CA 2VCMA 2WZR2 3LGRA 4PLMA 4QQHA 5FZOA 5GLWA 4KWLA 4FFGA 4CEWC 3EJKA 1MZFA 1VBE3 4R9DA 4SLIA 5DMYA 2Y0IA 1VBA1 4XXPA 1OPMA 2UY8A 4Q8KA 4WVMA 3O1UA 3L9JT 5APAA 4Q4X3 5FK7A 2R1DA 3HN1A 1RUC2 1O6UA 4XC9A 5F2SA 1UY4A 5FP4A 3M1HA 4S2HA 3RZHA 5LA2A 5AFEA 2XVLA 3CEWA 4YW4A 3NV3A 1Q8VA 4LQRA 3JU9A 4PI2A 1EAH3 2CYFA 1NCQA 4AI8A 4AZZA 2IXIA 2YC4A 3N7LA 4A41A 1PGL2 1PO11 3I59B 2ZAHA 4W6XA 4AEDC 3I3MA 4AQTA 2WN3A 3AB0A 3H8RA 4IV1B 4FOVA 1ASJ2 5CADA 2ADEA 2BNNA 4CCCA 3ZSJA 4AF9A 2LROA 1LOFC 3MIDA 5BNNA 5CFCB 1R1ZA 2VTFA 3PJYA 4WM7A 5G05L 5A33A 3VKNA 3VV1A 5JPNB 4YM0A 1C5IA 2ZA9A 2KA3A 4Z2AA 5I8YA 1DZRA 3KT7A 4MO3M 3T30A 3FBYA 1WCDJ 4BE3A 4A6OA 3CJIB 3VD4A 2ZEYA 4PBPA 4YZ3A 1LECA 3VKOA 3ZOIA 1QHDA 5IVFA 1H4GA 4LK7A 2D3SA 1J59A 4GWJA 4CDUA 3LEKA 5H9SA 1HRV2 1NOVA 2HWB2 1EUUA 4UFJA 1KDMA 1R081 1X9PA 2H6CA 2HWF2 2WT2A 3PUQA 4I3GA 2D3PA 1UY2A 2WYSA 4Y26A 5A6QA 3JUUA 3VD7A 4Z8BA 4FFFA 2BNMA 2VCBA 2ARBA 1AR71 1L3JA 4UF0A 1CVNA 4PLNA 2RR13 2VOTA 4UT5A 5A32B 5FYYA 3I54A 3P6BA 3G6JB 2PHDA 3WNKA 1O5UA 1UMHA 3RG0A 1DYKA 3Q8BA 3PIJA 4CDWC 3LWCA 4K9SA 4IW3A 5FZEA 5L9VA 3M3IA 1PGL1 4YZ5A 4CXYA 2RDQA 3ZFGC 1RITA 4R8HA 4PF5A 3UGHA 4JDMA 5IHRA 4AOCA 4Y1ZA 3BALA 5JZGB 5JOZA 1JUHA 2SLIA 4C0HA 5BNQA 2XOMA 5BNOB 2DU0A 2FCVA 2ZGPA 2CAUA 4OCTA 1VRH3 2W3JA 3LD8A 3J26N 4IE5A 1YFWA 5EJ1B 1N47A 4CZSA 5CNAA 1X8MA 4ORFA 1C57A 5HPOA 5FMCA 1UWWA 2R7EB 4B8EA 2X10A 3T2PA 1DGWA 5A70A 1ENRA 4WM8B 3UJOA 1RUH1 5FLHA 2R043 2PAMA 4B1MA 1DQ0A 1X7NA 2XMLA 4L11A 1NCQB 3I2DA 3PUSA 4LHLA 4QPGA 2Q5TA 2V5DA 5FPBA 3CF6E 2WRAA 3HVDA 3N9PA 3WDVA 4A44A 2AENA 1HRV1 1PHMA 2J1RA 3ZX7A 5GALA 1B35B 4KH9A 2O14A 4OUSA 1OF3A 1NCQC 4GA9A 2GC1A 1QJY2 2VE1A 5C8CB 4QB2A 4UI9L 1XU1A 5CIRA 2WJSA 1S0CA 2W92A 3HPNA 1AR72 1RUF3 2JDHA 5T55A 2XQRA 4DRRA 1RUJ3 2C4XA 3IAQA 1WWYA 1UKGA 3CQOA 2AGSA 5FZ7A 1LESA 5LA1A 1V6KA 2RM22 5JMCA 3OEAA 3OPTA 1ZX5A 5EYXA 3UL2A 4Y1UA 3TRSB 1CZTA 4E2SA 3R0RA 5ANQA 1TMF3 3PHMA 3POEA 4YZ1A 1PIV1 1YJLA 3M3QA 4D7YA 4Q4X1 3LAGA 4JCKA 3VHPA 5JZGC 3EBRA 4N9IA 1JYNA 2CWMA 4K21A 4Q8LA 1MEC2 4MG2A 2CY6A 1UYYA 1S0FA 1WA6X 1CIWA 4Q5OA 1EV12 2UWBA 4OI4A 2CU5A 4H2AA 1RINA 1ZBE1 2R1BA 4IEXA 1LJ7A 1AF9A 1VRBA 2VOVA 3PL0A 4X6RB 1KFXL 2WS92 3RWKX 2Q8DA 3OGJA 1W8NA 4JHZA 2GC0A 3LFIA 4QDQA 5FY4A 1OA3A 1QJZA 3JBG1 4NAMA 2VO5A 3WF0A 2RS53 2WKKA 3F2ZA 3HJRA 1SLLA 2ZPXA 1Y43B 4BPZA 3IMMA 2W68A 4JGYB 4CYDA 1O4ZA 2RS51 4S2GA 5CYYA 1HXS3 1Q8OA 1HB3A 1W2TA 2E63A 3N9MA 4NPRA 4RSUA 1JZ6A 2DVFA 3TOJA 2G9GA 4W4ZA 1HX6A 4URTA 2ZGMA 3KVBA 5KC5A 1H9WA 4FXKB 2WAAA 3RZGA 4M4PA 1SHWB 2JDUA 1JW6A 3U0ZA 1JOJA 5FO9B 2VZUA 4PIZA 1SLBA 2WWJA 4L2NA 4OLLA 1D4M2 5C71A 4M3CF 3N4MA 2VD7A 3LOBA 4HPKB 4X8NA 3OJBA 5K0UB 1LB2A 1AR93 2GU9A 2HWE1 3OGGA 4GMP1 4K7JA 3I3DA 3V0BB 1XE7A 2JD9A 1NYWA 4BQ5A 1WA4A 3VKLA 4LHNA 4ZU4A 2X09A 1NQJA 5DG1A 2JENA 4LORA 4M00A 4FP2A 3FZ3A 5F5QA 1WZXA 4QGLA 4D3WA 4Y24A 1JYXA 4ITCA 4YG3A 2QQIA 3LPFA 1US3A 2WS91 4A6SA 4Z92B 3A0NA 2DBNA 1JZ4A 4IEWA 4XIOA 1ZZCA 1BQPA 1YIPA 4YSFA 2VNRA 3WQ1A 3WDTA 1DHKB 4IGQA 1IHMA 2NMNA 2R061 5EXOA 2HWC2 3K4ZA 2E7TA 1H30A 2XH6A 2GSYA 2AR6A 3DF0A 3DKWA 3AKPA 3FLRA 4ISRA 3ZIWA 4GWMA 3ZXFA 4IV1A 2O1QA 4CCLA 4BQ2A 1N1TA 2V5YA 3LF7A 2XQXA 2Q30A 4DY3A 3N9QA 4AEMA 3ETQA 2R041 2R073 1UU4A 2PAKA 1W8ZA 3OD0A 2FZ2A 5F5IA 4Q0SA 3O1OA 3MLKA 5A6XA 3OBAA 1J83A 3AZYA 5FZFA 1WLWA 4AXOA 3DPRC 3K3NA 3ETPA 2DTWA 4QU1A 5JSOA 4QMAA 3MEPA 3AMMA 3AMNA 5JOYA 1SPPB 4YG6A 2VCAA 3GJBA 2VZVA 4CCEA 1XNKA 3N35A 4OHXA 1IS6A 4W6WA 3VDDB 3PU8A 1DZQA 2DYCA 4YARA 4YVWC 4GH4A 5EP9A 1V6OA 1UZZA 3VZMA 3POSA 4OHWA 2IXKA 2WSUA 1BBT2 4LE4A 2WS93 3D4KA 3OD4A 1OQDA 4GZ9A 2ZGQA 3VBRC 3PURA 2Y0OA 3VBHC 1G8WA 5FPUA 4M3CB 4KBZA 3NQHA 4QQPA 4C1XA 5C7GA 1VLNA 5FQ0B 3E97A 5CKQA 3AP5A 2D6PA 3IIAA 2VZRA 2ENRA 2GMPA 1CD3G 3USUA 3NRUA 2QE3A 2HWC1 1W8WA 1YUDA 3POJA 5I0RA 4XBQA 3D6EA 1Z78A 1FATA 1SDWA 3LDBA 3PMSA 5TSWA 1WBLA 3J7LA 5FK8A 2V73A 3VD9A 4GAZA 1F8VA 4XJ8A 3MFCA 5T50A 1GWKA 2BRTA 2WBKA 1F5JA 3B94A 1QU0A 3LA2A 4AI9A 2XLFA 4IEVA 1HKDA 4I0AA 1YQ5A 2FMDA 1EY2A 3RWNA 4Y5SA 3B69A 2NMOA 3VD3A 4RFT0 4E9KA 2YU1A 4N43C 3WCRA 1EPWA 2D5FA 3VBFA 3DEMA 1V0AA 4K8RB 5CKNA 1S4CA 1QY4A 3WOGA 1GZWB 1O59A 5JZGA 1QXRA 1W0OA 1R082 2FHRA 1BXHA 1OLQA 2FCUA 2HWF1 3KQRA 4EV0A 5A3PA 1R1A3 2ZXQA 4D6QA 4OULA 2OQ7A 1RVF2 2ZGTA 3U07A 5A3LA 1TMF1 4QX5A 2OZ6A 1H8VA 1GBGA 1SEFA 1LULA 5T52A 1GANA 1ONAA 3KV9A 2PHWA 1K5JA 4N43B 1QIQA 2IXLA 2V4VA 1G6NA 2OUJA 2OXBA 5FP3A 4FI9A 4D94A 4I09A 3EYPA 1CR7A 2GDFA 2XLGA 1LKNA 2ZGRA 5KXCA 4MGZE 4ES8A 3M4FA 3AL6A 3RSJA 5LASA 1F15A 2R072 5KR7A 1MQTA 1UCXA 5IW0A 1HJFA 1PMIA 4CU9A 2I07B 4BOWA 3ALQA 5C6CA 4XFAA 3KF3A 3G7DA 1HV0A 2Z42A 4FPFA 2XKPA 2ZX0A 2UWAA 1Q8SA 2YBKA 1H1IA 1NXMA 4LOTA 5EFUA 3DN7A 3AKSA 4CSWA 4KNCA 4HANA 1RUH2 5HXVA 2FDHA 3HMYA 1AR83 4KQ7A 1QJX1 4XUQA 3VN4A 4P9LA 5FYSA 5C8WA 4W8JA 3AYDA 3C7OA 2VMGA 1REEA 4AGRA 1F35A 3AZWA 3V64A 1OQEA 4XUTA 3ZFGA 1YJKA 4ZKTB 2VNVA 3AXDA 1XXNA 3RJ2X 2H0VA 2WO1A 5HCHA 4XJZA 4AQSA 5GLZA 2WINB 2ZX1A 1FT9A 3TN93 3VBHA 2WNUA 3NKGA 3DGTA 1V9U3 4GIQA 1J3QA 1CONA 1W39A 3LB9A 2R32A 4HSLA 1V70A 3FLPA 3ZKYA 3ZPOA 3RQ0A 5FR3A 1H4HA 2I2SA 2C9AA 3ZFEB 2L9LA 3GALA 3UV9A 1PNFA 1GMMA 5HXMA 3KHBA 4HPKA 1IQDC 1UZVA 4Y20A 1NX9A 1UX6A 4HK8A 5C5UA 1GKBA 1W99A 4IGOA 1WCSA 4GB32 3WP6A 1MEC1 2WWUA 4PIXA 4QHBA 4DMIA 4DZGA 3VBOB 5JWPA 4A2UA 5JXIA 1PVXA 1UD1A 2EALA 2YFZA 1QEXA 3ACIA 3BTAA 1ZBE2 2GALA 1IS3A 4LULA 3ZSKA 4CEWA 2B42B 1XSRA 3H7JA 4L0PA 4OFGA 1A78A 2YU2A 1FNZA 3T1MA 3UK9A 3HWJA 2Z4FA 1A3KA 5ACA2 1GWLA 3D8CA 4N53C 2HEYF 1YQ6A 3MHZA 5AC93 3HEIA 1US2A 5BXXA 1GLHA 1MS0A 1N1VA 4Y5TA 3ZIXA 1ZBE3 2D97A 1ULOA 3AJZA 4J1XA 2XKOA 3MV11 1AYM3 1E57A 2Z79A 3O0XA 4XJ9A 5IK5A 5LBBA 4MVTA 4K8FA 1QQP1 2VY0A 3INAA 4XBNA 1UYPA 2ZX2A 5ANNA 3QLQA 4LBMA 1A6CA 1YQ2A 4WZFA 1XYNA 1ZRIA 1MS4A 1ODNA 2XHNA 2VH9A 1JI6A 3AZZA 1Q43A 3MLJA 4LBLA 5A6YA 1C8M2 2GAUA 2VOXA 3VDBA 5KXDA 4J6GA 3S30A 3PTYA 1ND3A 3ZYHA 3WP4A 1S2EA 1CAUA 2QUOA 4FT8A 3S7IA 2FDGA 3LCPA 3S5AA 4NIGA 4GWNA 5F3EA 5IUQA 4D6RA 3ZYGA 2HWF3 2HWE2 4AYUA 3VBUA 1BLZA 1QJY3 1VBE1 5FQ0A 4QT6A 4TTGA 3QBQA 1ZZ8A 2JG9A 3AP6A 4GKXA 4OQ8A 1QOSA 1W8TA 2QKDA 1GZTA 4GQ7A 2W1UA 4UF0B 2J1TA 1YCIA 1O8SA 2UYBA 1UF2C 3KCYA 3M7AA 1MVEA 1VALA 1JXNA 4CCKA 1AR92 1B35A 4XJAA 5GZGA 4GMP3 1TQ5A 1S2BA 1YQCA 2DFCA 4URAA 4MXWB 4ZXEA 2Y64A 5C8CA 4P5YA 1CJDA 4JAAA 1BCXA 1CN1A 3LEGA 3WG4A 1STMA 2AEYA 4NIDA 3IBMA 4IEYA 3BTYA 3GYDA 1QDCA 4HETA 5FLIA 5AC92 2MEV2 4LMFA 4PDWA 5J7MA 4RL7A 4PJYA 4Q4Y1 1YI9A 2JDAA 4G3YC 1NLQA 4QX0A 4I0BA 3HOBA 4HKLA 1W06A 3T0DA 4JRAA 1OUXA 5BNOA 5LEKA 3I2OA 1ZZ9A 2Z69A 4QB6A 3MO4A 2DCKA 1UU6A 1VRH1 3NJVA 5L7OA 4A4AA 2ETEA 2G9FA 2WUHA 4GB33 4YFWA 1AJOA 2WO3A 4LIUA 4XURA 1GNZA 4YVSB 2ET7A 4NR1A 1IKPA 2VM9A 1G7YA 1RUE2 3D3AA 3POFA 5IVJA 2NZ9A 1HRI2 1Y9QA 3RS6A 3PIGA 1GNYA 3R6SA 4NJ4A 3IIIA 1JZ3A 2OUHA 1BBT1 3WDWA 4KWUA 3BCWA 1F2NA 1GU3A 3BIEA 5FP7A 1K5MB 4CDXA 2ZKLA 4HLTA 3V0BA 1YHFA 2BGPA 5E16A 2RR11 5D2AA 4ONUA 4N43A 1WMFA 2Y6JA 3FE5A 4AFCA 1M4WA 4N9HA 1R64A 2VC9A 4LKSA 1XQNA 2QDNA 3I2IA 1J58A 3AMPA 1RUC1 1DLCA 1U5IA 4DXSA 1YRZA 1VAMA 4A45A 4N7IA 2JB8A 3IMNA 3IDAA 1SDDB 5BNOC 1HDKA 3U10A 5DAQA 3MPBA 1UX7A 3KHCA 2A3YA 1JTZX 2VQAA 3ABZA 3ZDSA 5KHIA 5EYYA 3ZFGB 1JOBA 2D6MA 4MV2A 4MX3A 3RZKA 4BHPA 5D8AC 1PO22 1HLCA 2ZOEB 4CDWB 4N8MA 1N1YA 5A33B 4P02B 5DZEA 1JH5A 1QJFA 1XNCA 2BERA 2PN5A 3CJIC 4B4PA 3Q8AA 2VXRA 1TME2 4S2FA 5LEJA 4DOUA 2BVBA 1VBB3 2VBDA 2YUEA 4SBVA 1PO13 2C26A 1RJ8A 1DGLA 1HQNA 1RUE1 4PDWB 4PI0A 3RGBA 5B4NA 5CAZA 1VMFA 3WR0A 5L19A 1TZOA 4FPEA 4IXLA 4BM8A 4BZ4A 5KC6A 5EIYB 3MV01 4A7ZA 4B7KA 5FTTC 1OLMA 3USUB 3VLBB 2RV9A 3FL7A 5FFOC 2ZGOA 5FKCA 4IEZA 3K48A 3W59A 3VHRA 1DG6A 3WDYA 3VHNA 5IVBA 4NAOA 5C8CC 4JGZB 2EA7A 3K75B 4CP0A 3RDIA 1SACA 2YROA 3JQXA 4QHOA 1RIRA 3LZZA 5FDBA 4QB1A 1G9AA 4G9SB 3ELNA 4JKKA 2E26A 4LK6A 2YBPA 3WEZA 4HXCA 3JD73 4JC1A 4LHKA 3FC0A 1YI7A 3CKHA 2HWC3 2VPVA 3D0SA 1UXZA 5JOWA 3RI8A 2K2SA 2E32A 3F95A 3T4VA 3W58A 1DQ5A 4XACA 4D6SA 3U11A 5HI0A 4BQ1A 4GD4A 2P5BA 3T08A 4KG0A 3IKWA 1AYM1 4P14A 4XPVA 5FZMA 4UBGA 1U5YA 1QJX2 2OPKA 3P1IA 4YW3A 2JICA 4IV3B 4RFRB 1W8OA 1G9DA 2F6BA 1BK0A 2WDBA 3IT8A 4I01A 4CCOA 2WFF1 1RUD2 1UAIA 3DYMA 5JR2A 3KSCA 1X82A 1W2OA 1LCLA 4COZA 3A0KA 2YB7A 4BMBA 2BV4A 2PLV2 1XJAA 2GN3A 2VR4A 3BU0A 1LHNA 2YHJA 2UURA 5D1IA 4WZCA 4LLFA 4BQXA 4QXHA 1PVC2 1PK6A 2XBO3 5CEHA 4CEWB 4QPIC 2DBIA 1OVSA 3N9LA 4F83A 3OUHA 1D2QA 5L9BA 3IDCB 4MHRA 3WINE 3ACFA 1FV3A 4I0WB 3VUOA 2DVGA 2CTVA 3AXEA 2ZABA 2PLV3 2ZKNA 3MFAA 3ST7A 2OT7A 2NLRA 3MZHA 5LK5A 1GQGA 1ZRFA 1W6MB 3PNAA 1MS9A 3RJRA 1FMD2 1XE0A 4AI0A 1SQ4A 3FHAA 2FDKA 2BWCA 2JE8A 3SEEA 3ZN6B 2CNAA 2CDPA 4J1WA 4BA6A 1AX1A 3QCWA 5K0UA 4FPKA 1RUG2 4XDOA 2AH2A 3SMHA 3ZSLA 5M0TA 5DZFA 3WQBA 3WXPA 1NCRB 4IEPA 3IPVA 4KG8A 1OH3A 2YMZA 1CPNA 5ACA1 5ABJB 1G9BA 4H7LA 5KXEA 2K46A 5CZKA 4XTPA 3I49A 4L97A 3MW4A 2P1BA 2WNVA 1JZ7A 4PQ9A 1ACCA 3PJQA 3ZKUA 5C3SA 2YYOA 4IUGA 3VBRA 4S2DA 1SLAA 4O65A 1QJX3 1UKRA 2EICA 3GBFA 2WQ4A 1N1SA 1VBD1 1RHI3 1W8HA 4WVWA 4CCMA 4P5HA 3QH6A 1OBNA 1UPSA 2Y26A 3WNNA 1QQP2 3CU7A 4C91A 3ZMNA 2WL1A 2OS2A 2JE9A 3EQEA 1YXWA 1NLRA 3LA3A 3JCIA 2LM3A 2W5FA 2BBVA 3KVAA 1C8M1 1S2KA 2DTYA 5BNNB 5CFCA 4ZU5A 3ZR6A 4UFLA 4FBFA 4MGYE 1ULFA 2FDFA 5JR7B 2EIDA 4RS5A 5EPAA 1W8UA 3ZLIA 2CL2A 4AK3A 4WVVA 5C33A 2E51A 2WSVA 4B29A 2YXSA 2RMU2 1BMV1 3MIEA 2EIEA 4X6QB 4OZXA 2W95A 2QQKA 3AVSA 1W6QA 1GQPA 1YLLA 5FZ8A 5A32A 4DXTA 1W9YA 2VZPA 3IM0A 1ULEA 2A6WA 3DV8A 4LPLA 3HIFA 4RD7A 3S7EA 1A8MA 1CPMA 4AEDA 1CZVA 4LIVA 4MLOA 1UOFA 2AEZA 3J9SA 3B00A 3H8OA 4JGZA 1LEMA 3E6CC 1W3VA 5FYMA 1BYHA 4YZ4A 4CDUB 1UXXX 1NG0A 4K20A 3SEPA 1RTVA 2HWD2 3JD71 2D43A 4P08A 4QGNA 4TLFA 5AC91 2D3RA 2MEV1 4R9AA 3THDA 3AP4A 5ISLA 2JG8B 3K51A 4LLOA 5F5AA 2JDKA 3ORJA 1C8NA 3R4UA 4EWAA 3KCXA 3NAPB 4R52A 2Y34A 3WW3A 3B3QE 4CDQC 5E89A 1ULDA 1LOCA 3OG2A 2RJLA 3ES1A 2XPJA 2FBEA 3U4XA 3ZR5A 4QPIB 2EXHA 2JDPA 1F31A 2OX0A 3FLTA 1OI6A 2B45X 1J3PA 1H0BA 3I59A 3JBG3 4GULA 4V2WA 5AVPA 1ULCA 1XU2A 5T5LA 3ZSMA 2AYHA 3OTFA 3OY8B 4QXBA 5IT6A 2P4EA 4XXAA 1LU1A 1CAVA 3O0VA 2VVEA 2E53A 3HNMA 1HRI1 2JG8A 1I5PA 2VCCA 4MXWA 4RR3B 2PAEA 5GZFA 5FP8A 4BXFA 3WY6A 2DCYA 3CDZB 2VVFA 4D0QA 3GDBA 1GOHA 3TWIA 4LO4B 3WF4A 2FQPA 4RN5A 4F8AA 2WFPA 4RQPB 1ULPA 4MUVA 4AVAA 4BISA 1MS5A 1HN1A 1O5LA 4PF1A 5AFBA 4ASKA 5C3OA 1BVP1 1N3OA 3CLPA 4Y20B 2JDZA 4CTEA 3E5XA 2WNOA 3LFMA 4JDNA 2F17A 3BTZA 5EQUA 3WDXA 1GV9A 1YWKA 2GNDA 2P34A 2XJPA 1WBFA 3A4UA 5FZ0A 4CDQA 5BNNC 4CU8A 1BHGA 1FYUA 3AJYA 3DYOA 2JIJA 3M8LA 3NSTA 2QZ2A 5A7WB 5CISA 5B4XA 2DCJA 5I93A 3S0MA 5CB7A 1IS4A 2ADDA 2P3JA 2HYKA 4JGZC 3ZXGA 4B1LA 5C9AA 1R092 4QX7A 5L36A 1XNAA 1BKZA 2Y6FA 1XNBA 4EZ4A 4XAEA 3I7DA 3V56A 5J98B 1KQRA 1Y9GA 3LKJA 2RMU3 2QBXA 5J48A 4UFKA 5JLVA 5F32A 3ZN4A 3SH3A 5DAPA 2Q1FA 4XFIA 4OMCA 4AEJA 3KV4A 5FREA 3NW4A 4DPNA 1OC1A 2YG0A 1UYXA 2DF7A 1VBC1 1YIFA 5A1FA 1NE4A 1S0DA 4GJZA 2OQ6A 1NQDA 5JUVA 3I97A 2EIBA 2ET1A 4EWEA 1W3XA 2XVGA 5C3QA 1C8M3 4MH0E 1VB4A 3PMEA 2PQSA 1W9FA 5FV3A 1SZBA 2B46X 2WLPA 4IQPA 3J7MA 3ZXLA 4U2AA 2P3YA 4BK5A 5T5OA 1H2KA 4N90A 5IYYA 1SBFA 4YYOA 3L2YA 1ZREA 2MNGA 2LRPA 2WA4A 3I2GA 4YW7A 2BUKA 1K5MA 4WBBA 5FKBA 4COWA 2BEOA 1ZZ7A 2A3XA 2ZHKA 4LUKA 5BNPB 3O1SA 1N3QA 1OFNA 4QPGC 4PT6A 3FUOA 1FV2A 4IDZA 3WQ0A 5ACA3 2W87A 3GBGA 4XHXA 3VBSB 3SC7X 2ZMKA 1TME3 4LT5A
chains in the Genus database with same CATH topology
3ZYFA 2K46A 4LKEA 4LKFA 4BQ2A 3UT0A 1W90A 4CPBD 4BQ5A 1W9FA 4YW6A 2JWPA 1W8ZA 2WYFA 1HN0A 3ORJA 1W8TA 1WZXA 4CP9B 4BQ4A 2KR2A 3ZYBA 4LK7A 4A6SA 2O14A 1V0AA 3F95A 2LRPA 4LKDA 4YW7A 4LK6A 4AL9A 4BQ3A 2C24A 2VXJA 1L7LA 2Q1FA 1W8WA 1WCUA 3ZYHA 1OKOA 4LJHA 1OH3A 1GWMA 5D21A 2LROA 1UOJA 1GWLA 4CP9A 1GWKA 4YWAA 1W8UA 1WMXA 4CPBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZYF A;  2K46 A;  4LKE A;  4LKF A;  4BQ2 A;  3UT0 A;  1W90 A;  4CPB D;  4BQ5 A;  1W9F A;  4YW6 A;  2JWP A;  1W8Z A;  2WYF A;  1HN0 A;  3ORJ A;  1W8T A;  1WZX A;  4CP9 B;  4BQ4 A;  2KR2 A;  3ZYB A;  4LK7 A;  4A6S A;  2O14 A;  1V0A A;  3F95 A;  2LRP A;  4LKD A;  4YW7 A;  4LK6 A;  4AL9 A;  4BQ3 A;  2C24 A;  2VXJ A;  1L7L A;  2Q1F A;  1W8W A;  1WCU A;  3ZYH A;  1OKO A;  4LJH A;  1OH3 A;  1GWM A;  5D21 A;  2LRO A;  1UOJ A;  1GWL A;  4CP9 A;  1GWK A;  4YWA A;  1W8U A;  1WMX A;  4CPB A; 
#chains in the Genus database with same CATH topology
 3PUI A;  5FYV A;  4I2O A;  4Q4Y 3;  2W47 A;  4LKF A;  1RUG 3;  2PTM A;  3CZU A;  4Q27 A;  5FAX A;  1PO1 2;  3I8T A;  3IDE A;  4NE9 A;  3ZYP A;  5LW9 A;  3RZL A;  2J7M A;  2JE7 A;  1AYM 2;  3X29 B;  4DEV A;  5J96 B;  2PHX A;  5L7O B;  4MXV A;  1S55 A;  4XAB A;  2RHP A;  4GKY A;  1KEX A;  1ASJ 1;  4Y3O A;  5F37 A;  2NM1 A;  4DY5 A;  4IV3 C;  1V6L A;  1ZM1 A;  3LIG A;  4XAA A;  3J8F 3;  3PUH A;  3LEM A;  5GJ6 A;  2YFU A;  1WD4 A;  5IAV A;  2RJ2 A;  2QDR A;  3N9O A;  2DCT A;  3POB A;  3ZXE A;  2VAU A;  4HVR A;  3I2F A;  4A42 A;  4JKL A;  1HXS 2;  3LIH A;  4QKN A;  4ISQ A;  3TB0 A;  1OOP B;  2OZJ A;  2ZHN A;  4IND A;  4CCJ A;  1UU5 A;  2XBO 2;  5FOB B;  2QNK A;  2UWC A;  1WW7 A;  1MPX A;  2Y38 A;  4XYX A;  3ME2 A;  3NV1 A;  4P9J A;  4AG4 A;  1YNA A;  2HWB 1;  1APN A;  2Q1Z B;  2YC2 A;  1X33 A;  3OB8 A;  4XF9 A;  4YGC A;  5FJK A;  2TBV A;  4PDW C;  2NYY A;  3DKQ A;  3RYP A;  3T2T A;  3WCS A;  3WQ7 A;  5F5C A;  4QQL A;  5A7W A;  2CSG A;  4BYY A;  5JAX A;  1FMD 1;  1CAX B;  2XJR A;  3UKV A;  4AW7 A;  3LSD A;  5FYI A;  3HBZ A;  5KHH A;  3HD8 B;  2A3W A;  2RM2 3;  1FPN 2;  3PVB B;  4P9W A;  4BU2 A;  2DUP A;  3DL3 A;  4XF3 A;  4AQ6 A;  1MQT C;  1RUJ 1;  2BYV E;  4C1W A;  2EXJ A;  5JPM B;  1RUG 1;  3ROU A;  3MIH A;  3WG2 A;  1IPS A;  2OA2 A;  1VB2 A;  4JTN A;  2B7Y A;  5GM0 A;  3ZN6 A;  1QJU 1;  1VAK A;  3BOD A;  3M70 A;  1E5S A;  1FI2 A;  2VQ0 A;  3PVN A;  4UAP A;  2TNF A;  2GMM A;  1PIV 3;  4ZZ8 A;  1VBD 3;  5EJ3 A;  2O8Q A;  2X5I C;  2AZ5 A;  2OYZ A;  2IXH A;  1DYO A;  2A71 A;  1LOD A;  1NE6 A;  2Y6L A;  2XVK A;  1AX2 A;  1QH7 A;  3B02 A;  3Q8E A;  3ZM8 A;  4EQV A;  2BGC A;  5K7P A;  4AI1 A;  2ARE A;  4XCA A;  1PZ9 A;  1AR7 3;  1RUF 2;  2ZEW A;  1ND3 B;  5D8A B;  4TXW A;  4UYB A;  3ES4 A;  4COV A;  2BPA 2;  3BTX A;  1IG3 A;  4XBL A;  4IEU A;  2G4I A;  2RVA A;  4HKW A;  1UZY A;  2Y6G A;  3AK0 A;  2ZZQ A;  1YFU A;  3J8F 2;  4R4X A;  4TYS A;  3ZFF C;  1AHS A;  2HWD 3;  4NWV A;  2OII A;  4Y4Y A;  5A7P A;  3WDU A;  1JYI A;  3AZX A;  5C4W A;  5IVV A;  1TE1 B;  3POG A;  1VPH A;  4CDW A;  5IVE A;  2RE9 A;  4W65 A;  1DDL A;  3MLL A;  2C9K A;  2WZ8 A;  3OGS A;  1PVC 3;  3THP A;  3LEI A;  4ASM B;  1Y9M A;  3S57 A;  1NXD 1;  1H1A A;  5HV4 A;  3ZYR A;  3OPZ A;  5JOX A;  2VZQ A;  2CGO A;  2YBS A;  3TBD A;  4AI3 A;  1JN2 P;  2BQP A;  2WNE A;  3L2H A;  5JI7 A;  4OQ9 A;  4FPH A;  2WC2 A;  3TNQ A;  3E5Q A;  1IG0 A;  3OEB A;  4OVE A;  3VZK A;  4AVS A;  2BDR A;  3H7Y A;  4IES A;  2RDR A;  5CBL A;  1GZC A;  4B7E A;  1G86 A;  3O14 A;  4Y33 A;  3R4D B;  5I8S A;  3H8U A;  3BPZ A;  2VQU A;  3FMG A;  1DGW X;  3BU7 A;  4G4F A;  4YVS C;  3VBO A;  3W5M A;  3ZPY A;  1COV 3;  1R08 3;  1QXP A;  3A23 A;  4UOJ A;  4AVC A;  4JDO A;  4COY A;  1RC6 A;  1D7P M;  2K9Z A;  1W6O B;  2LW8 A;  3ZDV A;  4ZS3 A;  2JDM A;  4FPY A;  4XDQ A;  1OA2 A;  1A8D A;  4E8D A;  3KQ4 B;  5T5J A;  5T5P A;  3KWV A;  5J3U A;  2O0O A;  1FOD 2;  2R0F A;  3JD7 2;  3VBO C;  2BU9 A;  2JEM A;  2W08 A;  1W9W A;  2VW0 A;  5IFT A;  1NY7 1;  1SPP A;  5FXW A;  3FWE A;  2QFE A;  1U5Z A;  4YPJ A;  3ATG A;  3VZJ A;  2G19 A;  5J1X A;  2WNU B;  1H8T C;  2DWR A;  2A73 B;  4HT1 T;  4QPY A;  4AI2 A;  1D4V B;  3H0O A;  2ZS6 B;  4AE2 A;  1RHI 2;  3K46 A;  1QF3 A;  3RRD A;  4C90 A;  5EV7 A;  2IWG B;  1UYZ A;  5A3M A;  1WW6 A;  4FQZ A;  3M3E A;  1R09 3;  2J1A A;  1I9R A;  2VW1 A;  4RA0 A;  3N3H A;  3NNG A;  3LPG A;  1UIJ A;  3VBS C;  1HB1 A;  2VZO A;  3WUD A;  4YGB A;  4CU7 A;  3SH4 A;  4FQ4 A;  1O4Y A;  1IGO A;  3C7E A;  5K8S A;  4D7T A;  3RZM A;  1JU3 A;  3AZV A;  2B8M A;  4FAH A;  4CEY C;  4FOY A;  2GP5 A;  5EHD A;  1LNS A;  1UY0 A;  3W21 A;  5JXJ A;  5FZH A;  1RUN A;  4O7X A;  4XFG A;  5E8A A;  2WNV B;  3QD6 A;  2Y60 A;  2YY1 A;  1V00 A;  5F3G A;  3T2O A;  5A7N A;  3CHX A;  3E1F 1;  4HBN A;  1U5X A;  1NA1 B;  4LO6 B;  1JUI A;  3KLS A;  5JI9 A;  5FPV A;  3H3Z A;  3SNM A;  4ATF A;  2OKX A;  4AVV A;  1S0E A;  3MW2 A;  1XPW A;  3MI8 A;  4YM3 A;  3B9C A;  1FAY A;  2YGM A;  4RQP A;  4YW2 A;  1NY7 2;  4XIK A;  1EV1 3;  1F4H A;  4NHK A;  4YW1 A;  1UOG A;  4FFH A;  1JOP A;  3ILR A;  2BTV C;  1RHI 1;  3K4A A;  3POI A;  1F4A A;  5FZD A;  1R09 1;  2NP0 A;  5A1A A;  2R06 2;  3WW1 A;  1DBN A;  2F4L A;  4FPO B;  5FRA A;  1Q5O A;  3K4D A;  1PK6 B;  5T54 A;  2JKX A;  1CAW B;  3BYW A;  3ZMO A;  3ACL A;  3ZXK A;  3NKT A;  3I3E A;  1C5H A;  2J1U A;  2Q0A A;  5FY8 A;  1MR5 A;  1UMZ A;  1WD3 A;  3H1Y A;  3PVO A;  2WZE A;  3SQO A;  3ZFE C;  4GH4 C;  1H6X A;  1VBC 2;  4UBH A;  1POV 3;  4NII A;  1V6J A;  5FZL A;  3HNY M;  3MUY 1;  5GZC A;  4AAX A;  3RNS A;  4LBQ D;  3WT3 A;  4AHX A;  3J7N A;  1HIX A;  4E8C A;  2ZCW A;  3TEX A;  4NIA A;  1MS3 A;  3VDC A;  3IN9 A;  2JG9 C;  1AR6 1;  2QQL A;  2UU8 A;  3KZ4 C;  1XC6 A;  4DEQ A;  4EN8 B;  3JZV A;  1AR8 2;  2XHK A;  3KMH A;  1LED A;  5BYN A;  1W03 A;  4XMA A;  2OW4 A;  1IZ3 A;  5FXX A;  2FD8 A;  1Q3E A;  3MIG A;  3ITQ A;  4FPG A;  2XJV A;  3HT2 A;  2V09 A;  5FUP A;  1DQ4 A;  2HH9 A;  3GGL A;  1DP0 A;  1PGS A;  4M0H A;  1OA4 A;  4OZO A;  1O3Q A;  5FMO L;  3NNF A;  2VUL A;  4HKO A;  5FBZ A;  4XFC A;  2D6K A;  1KIT A;  2ATF A;  3I3B A;  3MF9 A;  5FZ3 A;  4ZS2 A;  4EN9 B;  1O3T A;  2P6H A;  4MGQ A;  2FMY A;  2ZX3 A;  4DUV A;  4NRP A;  4MGT A;  4MZU A;  4LUM A;  4JKM A;  3AX4 A;  2B9U A;  2VMI A;  5L73 A;  1SLI A;  3WG3 A;  2BBA A;  4GMP 0;  3S6P A;  3VBH B;  4NHX A;  4L8Q A;  1OMI A;  3MF6 A;  1ULG A;  4FOW A;  4CPB A;  1NKG A;  1VJ2 A;  3EHK A;  4JVA A;  5H9P A;  2JDN A;  2ZZJ A;  3CJI A;  3AP9 A;  2A1X A;  5A3T A;  2JIG A;  1SFP A;  1LOA A;  5C3R A;  3VDA A;  4JV4 A;  3SCG A;  3ECQ A;  1AR6 3;  2J1E A;  1O3R A;  5DUV A;  4LJH A;  1HXS 1;  1RJ7 A;  5JCT A;  1IQA A;  5LBF A;  4XFH A;  1BEV 2;  1RXF A;  2XBO 1;  4Q0U A;  1DGR N;  4Q1P A;  3GZU C;  5DDJ 2;  1UO9 A;  1AR8 1;  2VNO A;  5FO7 B;  2QQV A;  4LA3 A;  4P00 B;  2ZGK A;  4NHL A;  4AFD A;  1IOA A;  1R1A 1;  3MGU A;  5CFD A;  2A7A A;  5FY9 A;  4KGG A;  3OPW A;  4CVU A;  1LOG A;  2CWS A;  1OUR A;  2PLV 1;  2WA3 A;  3AM2 A;  1E5R A;  4TZD A;  2HKX A;  4P9I A;  1TMF 2;  2XUE A;  1FPN 3;  5HBA A;  1VAV A;  1LAJ A;  1W6P A;  2E7A A;  4N53 A;  1BBT 3;  5B2G B;  5E88 A;  4Q4V 3;  3AFK A;  3TYJ A;  2R0H A;  4Q4W 1;  4NWW A;  1WME A;  4HN1 A;  3UNP A;  1RUJ 2;  1FMD 3;  3V65 A;  4ZON A;  1VP6 A;  4E27 A;  1OPO A;  2G1M A;  1MZ6 A;  3GZT B;  3MPP G;  1OD5 A;  4XQD A;  1LRH A;  2XWJ B;  2AUY A;  4Y1X A;  2QQO A;  3JB4 C;  4HG6 B;  3NWK A;  2PHU A;  4ZHN A;  2WZR 1;  4XIL A;  4RHV 3;  1IPJ A;  3ACH A;  4LXL A;  4FP3 A;  4XZU G;  2ZGL A;  3SHR A;  3PDQ A;  2DUQ A;  2CGN A;  2LS6 A;  3UGG A;  4ET7 A;  1VBA 2;  3AMH A;  5FYB A;  1AVB A;  5DQ0 A;  1CAU B;  2RJK A;  2W52 A;  1GR3 A;  2Z5W A;  4NPL A;  2MEV 3;  5ERL A;  3J8F 1;  5K0U C;  1AX0 A;  3HBK A;  4O9G A;  3OY8 A;  1BEV 1;  4WV8 A;  5A7O A;  3ZN5 A;  2ZBJ A;  3N36 A;  3RMX A;  4EZH A;  3VHO A;  3O1M A;  3V0A B;  1U12 A;  2WO2 A;  4CUB A;  2EF6 A;  2ARX A;  4QPI A;  4UXA A;  4DRV A;  4FPC A;  5SV8 A;  5FWE A;  1NCR C;  4EYU A;  1VBB 1;  3O1T A;  2D40 A;  3VDD C;  2XJQ A;  4FO9 A;  5FYU A;  1GNH A;  4KMQ A;  5C4W B;  1NA1 C;  4LR4 A;  4M4R A;  3HAG A;  5F3I A;  3RYK A;  4Q4W 3;  5GKA C;  5A3N A;  4QX1 A;  1KRI A;  1S0B A;  1WLD A;  3NNM A;  4OYU A;  2W0X A;  2WAB A;  2UYA A;  4ZU7 A;  1J84 A;  3NAP A;  4RGK A;  4Z82 A;  1C1F A;  4CEY B;  4IER A;  2IUW A;  4XFB A;  1O3S A;  2HYX A;  1YYN A;  3IWZ A;  1RED A;  4YVW B;  4QXK A;  2FDJ A;  5FYT A;  3HQR A;  1KJR A;  3PTR B;  4GB3 1;  4D8M A;  3RI9 A;  4DXR A;  1JMU B;  5SV5 A;  4YWA A;  5AVA A;  1XE8 A;  3UT0 A;  1LGN A;  1FOD 1;  5LAT A;  4YW6 A;  1FNY A;  2VME A;  5FZO B;  4ATE A;  3ACG A;  1VBA 3;  3TAY A;  3AL5 A;  4TWT A;  1D0H A;  1HN0 A;  1LU2 A;  2YGL A;  1HJG A;  3AKQ A;  3N9N A;  1S0G A;  4PHZ A;  3O0W A;  1JZ5 A;  1PM7 A;  1RMU 1;  4PQQ A;  4HN0 A;  5FYC A;  5LWB A;  3ILN A;  2D6O X;  2R16 A;  1CAX A;  3U78 A;  1ENX A;  1WW5 A;  4MHU A;  3O1P A;  1V6M A;  2R49 A;  2YC0 A;  1NA1 A;  5DN2 A;  2E9Q A;  1P8J A;  2WWS A;  4DUW A;  2HWD 1;  2E7Q A;  4H7M A;  3GBW A;  3WSO A;  1B09 A;  1ENQ A;  1POV 1;  3DUI A;  3I2H A;  4AVT A;  4BB3 A;  3R05 A;  2IZW A;  3A7Q A;  3PVE A;  1W2A X;  4ARY A;  1LR5 A;  2BVV A;  2BW8 A;  2EVX A;  2NQY A;  4Q2F A;  3LA7 A;  3VBU C;  2Y6K A;  3AKT A;  1S0I A;  2LUW A;  4XDP A;  2CHH A;  2HEW F;  4A7K A;  3GCX A;  3O7O A;  4YZ2 A;  5C9A C;  5LY1 A;  2HLE A;  5FZG A;  1V9U 2;  3USS A;  3P5B A;  1EPZ A;  2YV8 A;  3KGZ A;  2QQW A;  3WG1 A;  4KWJ A;  1I6X A;  5L9R A;  4XUO A;  4CUG A;  1PO2 3;  4E4Z A;  4GAL A;  3U14 A;  2BJS A;  2JX9 A;  1AXK A;  3NJX A;  2W94 A;  4YRD A;  5I0U A;  1W9S A;  5FCC A;  1VBE 2;  3HNB M;  4OHV A;  5LBC A;  5A6Z A;  1M06 G;  1J3R A;  5K4L A;  3NJZ A;  2BFU S;  4BQW A;  4CP9 A;  1MAC A;  1OKQ A;  4XFF A;  4A7Y A;  1TEI A;  2Q8C A;  3BVC A;  3SCH A;  1BJQ A;  1SFN A;  1PM4 A;  2IC1 A;  1CX4 A;  2VMC A;  2ZEZ A;  2RS1 3;  3MIF A;  4UW5 A;  2PQQ A;  5DUX A;  5A7Q A;  1AR9 1;  4BJ0 A;  3POW A;  3BPS A;  1OH4 A;  1RMU 2;  4DFS A;  3FJS A;  1RUO A;  5BNP A;  3JXS A;  2XJT A;  5E6H A;  4QXC A;  1N3P A;  2RM2 1;  2JKB A;  1O8P A;  4QM9 A;  2VL4 A;  2XGX A;  3I2K A;  2H0B A;  5DAW A;  1H2L A;  4JGY C;  4YG0 A;  1WCK A;  5FWJ A;  5I91 A;  4AL9 A;  5KBF A;  1NZC A;  2X5I B;  3CMG A;  5CFD C;  2VW2 A;  4XW3 A;  1O91 A;  3FHQ A;  2QCS B;  3FX3 A;  4AWD A;  4DUX A;  1V6I A;  5FZ1 A;  1GP6 A;  4CUA A;  1RYY A;  2BP6 A;  1SLC A;  3KGL A;  5JXG A;  3IB3 A;  2QQM A;  5C5T A;  2JD4 A;  4X8P A;  5CFD B;  2K0G A;  2X29 A;  4EWD A;  4I02 A;  4AFB A;  4E4H A;  5FZB A;  2RDS A;  1PZ8 A;  1VRH 2;  5IWF A;  4Z2W A;  4CUC A;  3H8X A;  3ENR A;  4UW6 A;  1ZYB A;  4D69 A;  2E6V A;  1XSQ A;  2A6Z A;  2DUO A;  1AXY A;  1UPI A;  2KM2 A;  5FZC A;  4BQ4 A;  1NLS A;  2VQT A;  3CIH A;  5FMD A;  4P9X A;  4B3N A;  4A3Z A;  1K5M C;  4JQR A;  5F39 A;  5LB6 A;  3ZYJ B;  1QGL A;  4BLJ A;  4XQW A;  5C9A B;  3RMY A;  5CFC C;  2RS5 2;  1LHV A;  2PXJ A;  3MIB A;  5ABJ A;  2VZT A;  3GZA A;  4AVB A;  1UQX A;  2WT1 A;  1Y4W A;  3BGA A;  4Y22 B;  3UJQ A;  2VTX A;  4BME A;  1DQ2 A;  4ZY9 A;  2RR1 2;  4WM8 C;  5FYH A;  4AAP A;  2W9X A;  1VBC 3;  1RVF 3;  1SBE A;  4FFI A;  2IXJ A;  2RS1 2;  2QQU A;  5CG8 A;  4OHY A;  2DUR A;  2J1S A;  5DZG A;  2FDI A;  3FUQ A;  4AFM A;  1B35 C;  1XYP A;  2JEC A;  4HSJ A;  4DQA A;  1S1A A;  4CXW A;  4Q1R A;  1D4M 1;  4FXG B;  1DQ1 A;  2HBU A;  1W6M A;  3UES A;  3AFG A;  3DXU A;  1QOT A;  3R4S A;  3ZYB A;  2R06 3;  3E6B A;  1WLT A;  3IDB B;  3VBU B;  3WUC A;  4ERO A;  3AVR A;  5IK7 A;  2XR4 A;  4NPM A;  5IK8 A;  1ZRR A;  3H3U A;  4BWO A;  4IE4 A;  1KDK A;  2HWE 3;  5BV6 A;  3NVC A;  5DPN A;  1SLT A;  3OUJ A;  2Z2S B;  1VE0 A;  4LHS A;  1C1L A;  2W91 A;  2VBP A;  5LCW L;  3U75 A;  4QPG B;  4TLG A;  2XG3 A;  1AUY A;  4QX3 A;  1TME 1;  5F6L B;  1LOB A;  4K40 A;  2ZX4 A;  1QMJ A;  1T6B X;  3FN9 A;  3B01 A;  5IVY A;  5C70 A;  3C8X A;  3H1W A;  4WM8 A;  2XL9 A;  3KS7 A;  1E5H A;  1OHF A;  2DCZ A;  2WII B;  1H9P A;  4L99 A;  1I3H A;  2GNT A;  4QM8 A;  1O7F A;  1PZ7 A;  2ID4 A;  2R04 2;  1HV1 A;  4YM1 A;  4CA9 A;  2ZJC A;  3N7M A;  5GLV A;  4AGV A;  4A3X A;  5IVC A;  1X9T A;  4NHM A;  4AHY A;  1KS5 A;  2WT0 A;  1HB2 A;  1H1M A;  4QX8 A;  1QJE A;  3APB A;  3WHT A;  4DXZ A;  1ZRC A;  2XWB B;  2ZEX A;  5IFP A;  1KJL A;  3KV6 A;  3UET A;  4LO7 A;  2KXL A;  4KU7 A;  3NMB A;  4Q4V 2;  2JWP A;  3AYE A;  4JTO A;  2QJV A;  5CA6 A;  1JHJ A;  1FXZ A;  4AED B;  1T6G C;  3VZL A;  1W0N A;  5KHG A;  3UGF A;  3OGR A;  4CP9 B;  3OBR A;  4LTA A;  1J1T A;  1GUI A;  1SBD A;  1OLR A;  1Y3T A;  1GP5 A;  3MBW A;  5FY0 A;  1QJU 2;  3S5Q A;  1EAH 1;  3D0J A;  3DPR A;  1XOY A;  2SBA A;  3D5O A;  4YVS A;  1JYC A;  3WF1 A;  1POQ A;  4RHV 1;  1A34 A;  1W05 A;  4L92 A;  1AYN 2;  1RXG A;  2PYT A;  2WFF 2;  4N53 B;  5FZA A;  1WMD A;  1RUD 1;  3RPQ A;  3W9A A;  1OD3 A;  4LKE A;  4HOO A;  3WNL A;  2VJX A;  5FXV A;  4FCA A;  2PEL A;  1Q8P A;  4BK4 A;  1AYN 3;  4NOT A;  4Q0P A;  4XTM A;  1ZBA 2;  4AGG A;  4MSV A;  1RUI 3;  4FAG A;  3NNL A;  2W2I A;  1QOO A;  2J1V A;  1TNR A;  1GYK A;  3GXU A;  3ASI A;  2CV6 A;  1UZW A;  3M3O A;  1YC6 1;  4R4Z A;  4RGG A;  1RUH 3;  4QD2 A;  5D8A A;  2VU9 A;  1FX5 A;  3T2Q A;  2D6N A;  1AL2 3;  3LE0 A;  5FLJ A;  1LGC A;  5LA0 A;  2BZD A;  3IAP A;  4Q4V 1;  1OLM E;  2R30 A;  2VMF A;  3J7H A;  5LA9 A;  4IE0 A;  1KS4 A;  3RZJ A;  4N7U A;  3WD5 A;  2GNB A;  3K77 A;  4QKF A;  4WVM B;  3SLI A;  4DS0 A;  4JQT A;  3NV4 A;  4MGK E;  4CDQ B;  1W0P A;  5J37 A;  1PX3 A;  1EAH 2;  4H3W A;  3U4S A;  4LBN A;  1RVF 1;  5DG2 A;  2GNM A;  2FZ1 A;  2X05 A;  5FMO S;  4RHV 2;  2OPW A;  5JIA A;  1K12 A;  3LDR A;  4LBJ A;  1RUC 3;  4RR3 A;  2WQ8 A;  2D93 A;  2QTW B;  1TNF A;  5C4W C;  2P17 A;  1RMU 3;  5FZ4 A;  1XRU A;  3UKT A;  1VBD 2;  1PX4 A;  5GLU A;  1JYT A;  1CJP A;  1JOD A;  2CAV A;  2J42 A;  2RG4 A;  4I30 A;  1ZBA 1;  2R07 1;  2W1S A;  5CVR A;  5FZK A;  4Z1V A;  1LHW A;  5FOJ B;  4WM7 B;  3RZZ A;  1MS8 A;  1QKQ A;  5KXB A;  4R9B A;  2P6C A;  1ODM A;  1BVV A;  4Y1V A;  4OHZ A;  3VZN A;  3AKR A;  3LSE A;  4C8D A;  1AL2 1;  1F9K A;  2KR2 A;  2VZS A;  4QU2 A;  5IK4 A;  1NAE A;  3V0A A;  3Q8F A;  1BZW A;  5CU1 A;  4UFI A;  4HZF A;  4V1P A;  2RMU 1;  4P9Y A;  5F7U A;  1BMV 2;  3LOI A;  3WNM A;  1BK1 A;  4AFA A;  4BXS V;  4LIT A;  5FUI A;  3SKJ E;  2QQP A;  1TG7 A;  4KU8 A;  2GN7 A;  2HJI A;  1HRI 3;  1ND2 C;  3RFR A;  4M3C E;  4CU6 A;  5A3U A;  1QXJ A;  1DYP A;  4Q26 A;  1KD7 A;  2C1F A;  2P2K A;  2Q4S A;  3GJA A;  1ZZB A;  1PGW 2;  1PK6 C;  1UN1 A;  2WYF A;  3BOP A;  2KD7 A;  3N7J A;  4JHT A;  4KL1 A;  4YW5 A;  5EWS A;  5FPA A;  1C28 A;  1KFU L;  4BLI A;  2JG9 B;  3KM5 A;  5FUN A;  3C7F A;  1C4R A;  2XDV A;  4H14 A;  3VDD A;  5CKM A;  5K9Y A;  4XJU A;  3O1R A;  3J4U H;  1YFX A;  3AP7 A;  1VMJ A;  2NPI A;  1WUV A;  4GH4 B;  5ABJ C;  4NRM A;  3WZ1 A;  3O5S A;  1VMH A;  1OKO A;  1W6P B;  4KBB A;  4O9E A;  2ORX A;  4ZPI A;  1XB9 A;  3ZYF A;  3QAC A;  2WQZ C;  5A7S A;  3H9A A;  3H1M A;  2V72 A;  1AL2 2;  2WO7 A;  3HT1 A;  5JIU A;  1W6N A;  3I3Q A;  2O8O A;  3OCP A;  3OYW B;  3T4H B;  3ZXJ A;  1ZNP A;  1DFQ A;  4YGE A;  4I3P A;  4YFZ A;  4YLZ A;  3THT A;  4LE3 A;  4QHZ A;  4Y4R A;  2N7G A;  2WNV C;  1WGP A;  1LOE A;  1UW8 A;  1NT0 A;  2C24 A;  3GF6 A;  1NZI A;  3VBR B;  3OUI A;  3HQX A;  1SG3 A;  3FFZ A;  4W50 A;  1QWR A;  5F8P A;  2ERF A;  5F6K A;  4EJR A;  3E5U A;  3P3N A;  5A3W A;  4Z07 A;  3CNA A;  5GLT A;  1QJU 3;  3I4I A;  1OVP A;  3PUA A;  4HVO A;  1G9F A;  1CZS A;  1OUS A;  1PGW 1;  1QQP 3;  2D98 A;  1MZ5 A;  4LBO A;  4DO0 A;  2A6X A;  4FPL A;  2WZP P;  1DGR A;  1YO8 A;  3D82 A;  3POY A;  4FPJ A;  4LBQ B;  4OMD A;  4F3J A;  5IAX A;  5LRS A;  1V6N A;  4QAW A;  2CGP A;  2A70 A;  3DPR B;  2HBT A;  5JSR A;  1J1L A;  2QQN A;  4XJW A;  1H8T B;  2VUA A;  4CCD A;  1JS9 A;  4MGS A;  4V2V A;  1OXC A;  1DCS A;  2QVS B;  4MET A;  5EZW A;  4LBQ A;  2VBB A;  3OF1 A;  1CIY A;  5F3C A;  3ZYI B;  4CDX C;  1RB8 G;  4BDV B;  3BUC A;  3GHN A;  1HW5 A;  2JJ6 A;  4XCB A;  3OSD A;  1EYB A;  2WLQ A;  2VTX J;  1GWM A;  4IET A;  4QQ2 A;  1OFS A;  2IFR A;  2WR9 A;  1D4M 3;  4K3U A;  5C3P A;  2TUN A;  4CEY A;  2DVD A;  5I0D A;  5HCA A;  4Q0Q A;  4HFS A;  3VBF B;  3TEY A;  3N7K A;  2WNU C;  4MGI E;  5A80 A;  2EAK A;  4NMI A;  1QNY A;  2ZGS A;  1U0A A;  4AQ2 A;  3DYP A;  4XE9 A;  3VKM A;  1VR3 A;  4EN6 B;  2X53 S;  2PHF A;  3O1V A;  4HK9 A;  1AXZ A;  5FY5 A;  1W6N B;  4AEK A;  1LHU A;  3TN9 1;  5DDJ 1;  4Q4Y 2;  4BIO A;  4XEZ A;  2QZ3 A;  1L7R A;  2XJU A;  2BWA A;  3BIW E;  2ZGU A;  4BH9 A;  5J09 A;  5DXD A;  3CZJ A;  3H42 B;  4PLO A;  3AYC A;  2P3K A;  4GWI A;  4FVV A;  1CX1 A;  1LTE A;  4ASL A;  3GNE A;  4AR2 A;  1QH6 A;  3PLQ A;  3T0A A;  3KT1 A;  3WP3 A;  3MW3 A;  1CGP A;  5JDB A;  3WHU A;  4CPB D;  1PNG A;  2F4P A;  4XF0 A;  2Y6H A;  2GZW A;  2VEC A;  2WZR 3;  1YFY A;  4QKD A;  5FY7 A;  3ZFF B;  2Q1M A;  3QH7 A;  1HB4 A;  4UWD A;  1COV 2;  3NNJ A;  1XNT A;  2RS3 2;  1H2M A;  1XYO A;  5I0S A;  1W04 A;  2GH2 A;  2QQJ A;  4Y5Z 0;  2BOI A;  4GXL A;  1DZT A;  3KD4 A;  1DU3 D;  1FOD 3;  4LKD A;  4OI2 A;  3WNP A;  4IGP A;  4QDR A;  4M01 A;  4FSJ A;  2A5Z A;  1QDO A;  3I2J A;  1H2N A;  1ZA4 A;  3ZFE A;  3Q8C A;  1BEV 3;  1LEN A;  1CES A;  5I8T A;  1AYN 1;  4YVW A;  2GP3 A;  4YM2 A;  3WF2 A;  2VGD A;  1YQ8 A;  2ZHL A;  1GZW A;  1W2U A;  2UY9 A;  4ZXK A;  3SKV A;  3W5N A;  2FCT A;  5FYZ A;  3T0B A;  4XVH A;  4CXX A;  2VUC A;  1ND3 C;  4LO8 A;  4F7Z A;  1DIW A;  4XQ4 A;  1WW4 A;  5DAV A;  2IFW A;  3WW2 A;  4NN0 A;  2RDN A;  4E2Q A;  1Q56 A;  5DUW A;  4RS5 C;  3OOX A;  4CE8 A;  1POV 0;  4OI1 A;  2PA7 A;  1JYV A;  4BQ3 A;  3T09 A;  1I1E A;  4LO5 B;  1SFY A;  3AMQ A;  4XF1 A;  3VL8 A;  2DVA A;  4XMI A;  4NIH A;  1IKQ A;  4IEQ A;  2ILM A;  2AAC A;  1ST8 A;  1VBB 2;  2C5D A;  4OUM A;  4QKB A;  1ALY A;  1PO2 1;  4JZR A;  4JX0 A;  2DDU A;  4FTB A;  2W1W A;  5DAB A;  2TEP A;  1OOP C;  2X5I A;  5T3N A;  1RUI 2;  2ZAA A;  2BFU L;  3IZO A;  1C3H A;  4IE6 A;  1FPN 1;  3EB7 A;  3WNX A;  4XOG A;  1UY3 A;  2D7F A;  2ORZ A;  2R6Q A;  5CG9 A;  2PHL A;  1UL9 A;  3RVH A;  2RS3 3;  5FPL A;  1G9C A;  2H6B A;  1UNB A;  4AHW A;  2ZGN A;  3GZE A;  2MPF A;  1UZ0 A;  2HWB 3;  3HR9 A;  1RL3 A;  4OUE A;  3ZO0 B;  1Z7S 3;  5L7O C;  1X36 A;  1GZ9 A;  1W2N A;  1CWP A;  3SCF A;  3HN3 A;  4CP1 A;  1MEC 3;  4Q29 A;  1F5F A;  1RUF 1;  2OVU A;  4NVP A;  4UW3 A;  1O4T A;  4YGD A;  5DUU A;  5BPX A;  2IXC A;  4CDX B;  1Y7B A;  3ZXD A;  2AC1 A;  5LRR A;  5G04 L;  1W8F A;  4EE2 A;  3DCQ A;  4LA2 A;  1AZD A;  3EMR A;  4C0B A;  2Y8K A;  4DNY A;  4MAD A;  2E31 A;  2VOK A;  5LK7 B;  5HV0 A;  1ASJ 3;  3C7H A;  4RS5 B;  5BNP C;  3B5L B;  2Q8E A;  2I45 A;  1D2S A;  3B9I A;  2YDE A;  1SCS A;  2EXK A;  4WVZ A;  1XBF A;  4HVQ A;  5LY2 A;  4QX2 A;  1OF4 A;  4E4S A;  1UOB A;  4QGM A;  3JB8 A;  1RUI 1;  4PIY A;  5FO8 B;  1VIW B;  2DV9 A;  2D6L X;  3C3V A;  3U37 A;  1V9U 1;  5FJH A;  2B4K A;  3T3Y A;  3TNP B;  2ARA A;  3FBM A;  1W90 A;  1SMV A;  2A6V A;  2VZ3 A;  3OBT A;  4K1Z A;  1ZRD A;  3DXT A;  4CCN A;  1TVG A;  2X8K A;  3UKN A;  4OI0 A;  1MQT B;  1PVC 1;  4Y1Y A;  3MIC A;  2XUM A;  2VNG A;  4W6Y A;  2VG9 A;  3MDP A;  2NN8 A;  2ZMN A;  1EUT A;  2WN2 A;  1W6O A;  2PHR A;  4Q0V A;  1KGY A;  1DF0 A;  2JXA A;  3M2M A;  1JYW A;  3WP5 A;  1I5Z A;  2XJS A;  3EO6 A;  1JZ2 A;  3CL1 A;  1HQW A;  2ZML A;  2XON A;  3B93 A;  4CRQ A;  5A3O A;  1UIK A;  2W39 A;  2DFB A;  3NL1 A;  3BOW A;  5DAX A;  3A22 A;  3WW4 A;  4K6B A;  1L7L A;  2C0Z A;  4M0N A;  3CO2 A;  1E5I A;  5H9R A;  1LHO A;  3AYA A;  3BN6 A;  3ON7 A;  2WAO A;  4IV1 C;  3DEC A;  4ZZ5 A;  2A6Y A;  2VUJ A;  5FIX A;  3GCW A;  5I0T A;  3WF3 A;  4R9C A;  3ZFF A;  1ZBA 3;  1Z7S 2;  3FFQ A;  3BKZ A;  1UMI A;  3FHI B;  3T1L A;  4HON A;  5KWR A;  2BGO A;  1Z0H A;  4RQP C;  3BI3 A;  4DIQ A;  4FOQ A;  4MYE A;  1OOP A;  4JGY A;  5JSP A;  1PMH X;  4XF4 A;  3W20 A;  3VBF C;  5JXH A;  5FXZ A;  3VD5 A;  2VXJ A;  4D7S A;  1GQH A;  1URX A;  5F2W A;  2PFW A;  1JBC A;  3OBZ A;  4ES9 A;  3THC A;  4HL0 A;  3U1X A;  3QOP A;  4NRQ A;  2W46 A;  4IE7 A;  1OT5 A;  4H55 A;  2VMH A;  5FPZ A;  2ZTN A;  2W1Q A;  3CJX A;  3VB9 A;  4U36 A;  2MHF A;  3CBN A;  4GJY A;  2VVD A;  2BOJ A;  1RGS A;  2C6S A;  1JZ8 A;  4PBO A;  3M3C A;  3H3L A;  2V4A A;  3SIS A;  2EXI A;  3KF5 A;  2YPJ A;  4LOS A;  1QNW A;  4P9G A;  1W28 A;  3VL9 A;  1EP0 A;  4B4R A;  3VBS A;  4WM7 C;  4DIN B;  2IVJ A;  2P3I A;  4BIF A;  1LOF A;  1ZZ6 A;  3KT4 A;  1QJY 1;  2JG8 C;  2Y33 A;  2YZ4 A;  4NRO A;  2G9Z A;  4NO4 A;  4PCR A;  4RGA A;  3URF A;  1MS1 A;  4XUN A;  5BY5 A;  4L9B A;  2XLA A;  2RS1 1;  4IL7 A;  1W6Q B;  2JB4 A;  3P3P A;  3H50 A;  3VGI A;  3Q9O A;  4LEJ A;  4BCU A;  1DLL A;  1MZE A;  1H8T A;  4UFM A;  4LBK A;  1Z7S 1;  5E1R A;  4CDU C;  3B7M A;  1WMX A;  1Q8Q A;  4TN7 A;  1OQ1 A;  1PIV 2;  2Q8O A;  2LAL A;  2EAA A;  3NJY A;  3O12 A;  2DU1 A;  4Q4X 2;  4UFH A;  4JRL A;  1AL0 G;  5H9Q A;  4O61 A;  2BNO A;  1KXG A;  4XUP A;  1L7Q A;  1RUD 3;  1EV1 1;  2YPD A;  1WLC A;  4E2G A;  2VOW A;  1ZVF A;  1K42 A;  1ND2 A;  3GHM A;  5FZ6 A;  3KCC A;  5GZD A;  3ILF A;  1LGB A;  4MOA A;  1GOF A;  3NO8 A;  3OGV A;  3WNO A;  1AR6 2;  3TN9 2;  1ZA7 A;  4KGQ A;  1WCQ A;  3VKF C;  3WX5 A;  5J36 A;  2LTN A;  1JU4 A;  3K3O A;  1UY1 A;  4XZP A;  4CP2 A;  3JBG 2;  1XND A;  2CDO A;  3VZO A;  3LDK A;  3RYR A;  1ND2 B;  2P37 A;  3BB6 A;  4YNI A;  1GSL A;  4UW4 A;  2I74 A;  5IJR A;  4NUB A;  2HEV F;  2ZAC A;  5DDJ 3;  5F1R A;  2XB6 C;  1GFF 2;  1GP4 A;  2ARC A;  2GC2 A;  2IVI B;  2DVB A;  3MUZ 1;  4XHB A;  2D44 A;  3GM8 A;  5FZI A;  5HCF A;  4COU A;  3IPV B;  2B5H A;  2E33 A;  5FPX A;  3C7G A;  5KHK A;  2EIG A;  1RUE 3;  1COV 1;  3LQC A;  2RS3 1;  4IEO A;  4LNV A;  2GH8 A;  5FZ9 A;  2VUD A;  1WKY A;  1H6Y A;  2ZHM A;  1YEW A;  2XXZ A;  5LBE A;  4KI5 M;  1GIC A;  1NCR A;  3MYX A;  1DQ6 A;  1K45 A;  1OSG A;  1W9T A;  3SXW A;  1WCU A;  2GC3 A;  4RR3 C;  2PHT A;  3PU3 A;  4QWN A;  3K2O A;  2A75 A;  4NHY A;  5FMB A;  5D21 A;  2ES3 A;  2B9V A;  4E4D X;  1HQL A;  1PMJ X;  3A21 A;  5HCB A;  3E6D A;  5FP9 A;  4RYD A;  2J22 A;  1JHN A;  4FTE A;  5KHJ A;  1T2X A;  2XL7 A;  2VZ1 A;  3AC0 A;  5EJZ B;  4K1Y A;  5BUV A;  1GOG A;  3EXU A;  2D5H A;  4ARX A;  1NUK A;  3TEZ A;  4Y22 A;  1ENS A;  5GZE A;  4TSV A;  1S0J A;  4EN7 B;  5FY1 A;  3ZSE A;  1D0G A;  5A1L A;  1AJK A;  2PMW B;  3NAP C;  4KWK A;  3UYJ A;  4B4Q A;  2VMD A;  4AHZ A;  5JMO A;  1CAV B;  1R1A 2;  5JVV A;  1K3I A;  3KB5 A;  4DB5 A;  3C2U A;  3WV6 A;  3OYW A;  4HMZ A;  4IV3 A;  1IS5 A;  4QQO A;  4BQY A;  1IPK A;  1HRV 3;  1SCR A;  4J25 A;  4XET A;  1CQ9 A;  1CAW A;  1UOJ A;  2WFF 3;  2JDY A;  1MVQ A;  4QDS A;  3ZXA C;  3HQU A;  4QPW A;  3KV5 A;  5LZ6 A;  4FTS A;  4Q4W 2;  1REF A;  3SH5 A;  3ZVX A;  1X8E A;  3WVJ A;  2GME A;  3TEW A;  3NV2 A;  3SIT A;  5IAT A;  2B39 A;  3WLU A;  3JQW A;  4EN0 A;  1X50 A;  5FBJ A;  5F9T A;  4M3C A;  2VCM A;  2WZR 2;  3LGR A;  4PLM A;  4QQH A;  5FZO A;  5GLW A;  4KWL A;  4FFG A;  4CEW C;  3EJK A;  1MZF A;  1VBE 3;  4R9D A;  4SLI A;  5DMY A;  2Y0I A;  1VBA 1;  4XXP A;  1OPM A;  2UY8 A;  4Q8K A;  4WVM A;  3O1U A;  3L9J T;  5APA A;  4Q4X 3;  5FK7 A;  2R1D A;  3HN1 A;  1RUC 2;  1O6U A;  4XC9 A;  5F2S A;  1UY4 A;  5FP4 A;  3M1H A;  4S2H A;  3RZH A;  5LA2 A;  5AFE A;  2XVL A;  3CEW A;  4YW4 A;  3NV3 A;  1Q8V A;  4LQR A;  3JU9 A;  4PI2 A;  1EAH 3;  2CYF A;  1NCQ A;  4AI8 A;  4AZZ A;  2IXI A;  2YC4 A;  3N7L A;  4A41 A;  1PGL 2;  1PO1 1;  3I59 B;  2ZAH A;  4W6X A;  4AED C;  3I3M A;  4AQT A;  2WN3 A;  3AB0 A;  3H8R A;  4IV1 B;  4FOV A;  1ASJ 2;  5CAD A;  2ADE A;  2BNN A;  4CCC A;  3ZSJ A;  4AF9 A;  2LRO A;  1LOF C;  3MID A;  5BNN A;  5CFC B;  1R1Z A;  2VTF A;  3PJY A;  4WM7 A;  5G05 L;  5A33 A;  3VKN A;  3VV1 A;  5JPN B;  4YM0 A;  1C5I A;  2ZA9 A;  2KA3 A;  4Z2A A;  5I8Y A;  1DZR A;  3KT7 A;  4MO3 M;  3T30 A;  3FBY A;  1WCD J;  4BE3 A;  4A6O A;  3CJI B;  3VD4 A;  2ZEY A;  4PBP A;  4YZ3 A;  1LEC A;  3VKO A;  3ZOI A;  1QHD A;  5IVF A;  1H4G A;  4LK7 A;  2D3S A;  1J59 A;  4GWJ A;  4CDU A;  3LEK A;  5H9S A;  1HRV 2;  1NOV A;  2HWB 2;  1EUU A;  4UFJ A;  1KDM A;  1R08 1;  1X9P A;  2H6C A;  2HWF 2;  2WT2 A;  3PUQ A;  4I3G A;  2D3P A;  1UY2 A;  2WYS A;  4Y26 A;  5A6Q A;  3JUU A;  3VD7 A;  4Z8B A;  4FFF A;  2BNM A;  2VCB A;  2ARB A;  1AR7 1;  1L3J A;  4UF0 A;  1CVN A;  4PLN A;  2RR1 3;  2VOT A;  4UT5 A;  5A32 B;  5FYY A;  3I54 A;  3P6B A;  3G6J B;  2PHD A;  3WNK A;  1O5U A;  1UMH A;  3RG0 A;  1DYK A;  3Q8B A;  3PIJ A;  4CDW C;  3LWC A;  4K9S A;  4IW3 A;  5FZE A;  5L9V A;  3M3I A;  1PGL 1;  4YZ5 A;  4CXY A;  2RDQ A;  3ZFG C;  1RIT A;  4R8H A;  4PF5 A;  3UGH A;  4JDM A;  5IHR A;  4AOC A;  4Y1Z A;  3BAL A;  5JZG B;  5JOZ A;  1JUH A;  2SLI A;  4C0H A;  5BNQ A;  2XOM A;  5BNO B;  2DU0 A;  2FCV A;  2ZGP A;  2CAU A;  4OCT A;  1VRH 3;  2W3J A;  3LD8 A;  3J26 N;  4IE5 A;  1YFW A;  5EJ1 B;  1N47 A;  4CZS A;  5CNA A;  1X8M A;  4ORF A;  1C57 A;  5HPO A;  5FMC A;  1UWW A;  2R7E B;  4B8E A;  2X10 A;  3T2P A;  1DGW A;  5A70 A;  1ENR A;  4WM8 B;  3UJO A;  1RUH 1;  5FLH A;  2R04 3;  2PAM A;  4B1M A;  1DQ0 A;  1X7N A;  2XML A;  4L11 A;  1NCQ B;  3I2D A;  3PUS A;  4LHL A;  4QPG A;  2Q5T A;  2V5D A;  5FPB A;  3CF6 E;  2WRA A;  3HVD A;  3N9P A;  3WDV A;  4A44 A;  2AEN A;  1HRV 1;  1PHM A;  2J1R A;  3ZX7 A;  5GAL A;  1B35 B;  4KH9 A;  2O14 A;  4OUS A;  1OF3 A;  1NCQ C;  4GA9 A;  2GC1 A;  1QJY 2;  2VE1 A;  5C8C B;  4QB2 A;  4UI9 L;  1XU1 A;  5CIR A;  2WJS A;  1S0C A;  2W92 A;  3HPN A;  1AR7 2;  1RUF 3;  2JDH A;  5T55 A;  2XQR A;  4DRR A;  1RUJ 3;  2C4X A;  3IAQ A;  1WWY A;  1UKG A;  3CQO A;  2AGS A;  5FZ7 A;  1LES A;  5LA1 A;  1V6K A;  2RM2 2;  5JMC A;  3OEA A;  3OPT A;  1ZX5 A;  5EYX A;  3UL2 A;  4Y1U A;  3TRS B;  1CZT A;  4E2S A;  3R0R A;  5ANQ A;  1TMF 3;  3PHM A;  3POE A;  4YZ1 A;  1PIV 1;  1YJL A;  3M3Q A;  4D7Y A;  4Q4X 1;  3LAG A;  4JCK A;  3VHP A;  5JZG C;  3EBR A;  4N9I A;  1JYN A;  2CWM A;  4K21 A;  4Q8L A;  1MEC 2;  4MG2 A;  2CY6 A;  1UYY A;  1S0F A;  1WA6 X;  1CIW A;  4Q5O A;  1EV1 2;  2UWB A;  4OI4 A;  2CU5 A;  4H2A A;  1RIN A;  1ZBE 1;  2R1B A;  4IEX A;  1LJ7 A;  1AF9 A;  1VRB A;  2VOV A;  3PL0 A;  4X6R B;  1KFX L;  2WS9 2;  3RWK X;  2Q8D A;  3OGJ A;  1W8N A;  4JHZ A;  2GC0 A;  3LFI A;  4QDQ A;  5FY4 A;  1OA3 A;  1QJZ A;  3JBG 1;  4NAM A;  2VO5 A;  3WF0 A;  2RS5 3;  2WKK A;  3F2Z A;  3HJR A;  1SLL A;  2ZPX A;  1Y43 B;  4BPZ A;  3IMM A;  2W68 A;  4JGY B;  4CYD A;  1O4Z A;  2RS5 1;  4S2G A;  5CYY A;  1HXS 3;  1Q8O A;  1HB3 A;  1W2T A;  2E63 A;  3N9M A;  4NPR A;  4RSU A;  1JZ6 A;  2DVF A;  3TOJ A;  2G9G A;  4W4Z A;  1HX6 A;  4URT A;  2ZGM A;  3KVB A;  5KC5 A;  1H9W A;  4FXK B;  2WAA A;  3RZG A;  4M4P A;  1SHW B;  2JDU A;  1JW6 A;  3U0Z A;  1JOJ A;  5FO9 B;  2VZU A;  4PIZ A;  1SLB A;  2WWJ A;  4L2N A;  4OLL A;  1D4M 2;  5C71 A;  4M3C F;  3N4M A;  2VD7 A;  3LOB A;  4HPK B;  4X8N A;  3OJB A;  5K0U B;  1LB2 A;  1AR9 3;  2GU9 A;  2HWE 1;  3OGG A;  4GMP 1;  4K7J A;  3I3D A;  3V0B B;  1XE7 A;  2JD9 A;  1NYW A;  4BQ5 A;  1WA4 A;  3VKL A;  4LHN A;  4ZU4 A;  2X09 A;  1NQJ A;  5DG1 A;  2JEN A;  4LOR A;  4M00 A;  4FP2 A;  3FZ3 A;  5F5Q A;  1WZX A;  4QGL A;  4D3W A;  4Y24 A;  1JYX A;  4ITC A;  4YG3 A;  2QQI A;  3LPF A;  1US3 A;  2WS9 1;  4A6S A;  4Z92 B;  3A0N A;  2DBN A;  1JZ4 A;  4IEW A;  4XIO A;  1ZZC A;  1BQP A;  1YIP A;  4YSF A;  2VNR A;  3WQ1 A;  3WDT A;  1DHK B;  4IGQ A;  1IHM A;  2NMN A;  2R06 1;  5EXO A;  2HWC 2;  3K4Z A;  2E7T A;  1H30 A;  2XH6 A;  2GSY A;  2AR6 A;  3DF0 A;  3DKW A;  3AKP A;  3FLR A;  4ISR A;  3ZIW A;  4GWM A;  3ZXF A;  4IV1 A;  2O1Q A;  4CCL A;  4BQ2 A;  1N1T A;  2V5Y A;  3LF7 A;  2XQX A;  2Q30 A;  4DY3 A;  3N9Q A;  4AEM A;  3ETQ A;  2R04 1;  2R07 3;  1UU4 A;  2PAK A;  1W8Z A;  3OD0 A;  2FZ2 A;  5F5I A;  4Q0S A;  3O1O A;  3MLK A;  5A6X A;  3OBA A;  1J83 A;  3AZY A;  5FZF A;  1WLW A;  4AXO A;  3DPR C;  3K3N A;  3ETP A;  2DTW A;  4QU1 A;  5JSO A;  4QMA A;  3MEP A;  3AMM A;  3AMN A;  5JOY A;  1SPP B;  4YG6 A;  2VCA A;  3GJB A;  2VZV A;  4CCE A;  1XNK A;  3N35 A;  4OHX A;  1IS6 A;  4W6W A;  3VDD B;  3PU8 A;  1DZQ A;  2DYC A;  4YAR A;  4YVW C;  4GH4 A;  5EP9 A;  1V6O A;  1UZZ A;  3VZM A;  3POS A;  4OHW A;  2IXK A;  2WSU A;  1BBT 2;  4LE4 A;  2WS9 3;  3D4K A;  3OD4 A;  1OQD A;  4GZ9 A;  2ZGQ A;  3VBR C;  3PUR A;  2Y0O A;  3VBH C;  1G8W A;  5FPU A;  4M3C B;  4KBZ A;  3NQH A;  4QQP A;  4C1X A;  5C7G A;  1VLN A;  5FQ0 B;  3E97 A;  5CKQ A;  3AP5 A;  2D6P A;  3IIA A;  2VZR A;  2ENR A;  2GMP A;  1CD3 G;  3USU A;  3NRU A;  2QE3 A;  2HWC 1;  1W8W A;  1YUD A;  3POJ A;  5I0R A;  4XBQ A;  3D6E A;  1Z78 A;  1FAT A;  1SDW A;  3LDB A;  3PMS A;  5TSW A;  1WBL A;  3J7L A;  5FK8 A;  2V73 A;  3VD9 A;  4GAZ A;  1F8V A;  4XJ8 A;  3MFC A;  5T50 A;  1GWK A;  2BRT A;  2WBK A;  1F5J A;  3B94 A;  1QU0 A;  3LA2 A;  4AI9 A;  2XLF A;  4IEV A;  1HKD A;  4I0A A;  1YQ5 A;  2FMD A;  1EY2 A;  3RWN A;  4Y5S A;  3B69 A;  2NMO A;  3VD3 A;  4RFT 0;  4E9K A;  2YU1 A;  4N43 C;  3WCR A;  1EPW A;  2D5F A;  3VBF A;  3DEM A;  1V0A A;  4K8R B;  5CKN A;  1S4C A;  1QY4 A;  3WOG A;  1GZW B;  1O59 A;  5JZG A;  1QXR A;  1W0O A;  1R08 2;  2FHR A;  1BXH A;  1OLQ A;  2FCU A;  2HWF 1;  3KQR A;  4EV0 A;  5A3P A;  1R1A 3;  2ZXQ A;  4D6Q A;  4OUL A;  2OQ7 A;  1RVF 2;  2ZGT A;  3U07 A;  5A3L A;  1TMF 1;  4QX5 A;  2OZ6 A;  1H8V A;  1GBG A;  1SEF A;  1LUL A;  5T52 A;  1GAN A;  1ONA A;  3KV9 A;  2PHW A;  1K5J A;  4N43 B;  1QIQ A;  2IXL A;  2V4V A;  1G6N A;  2OUJ A;  2OXB A;  5FP3 A;  4FI9 A;  4D94 A;  4I09 A;  3EYP A;  1CR7 A;  2GDF A;  2XLG A;  1LKN A;  2ZGR A;  5KXC A;  4MGZ E;  4ES8 A;  3M4F A;  3AL6 A;  3RSJ A;  5LAS A;  1F15 A;  2R07 2;  5KR7 A;  1MQT A;  1UCX A;  5IW0 A;  1HJF A;  1PMI A;  4CU9 A;  2I07 B;  4BOW A;  3ALQ A;  5C6C A;  4XFA A;  3KF3 A;  3G7D A;  1HV0 A;  2Z42 A;  4FPF A;  2XKP A;  2ZX0 A;  2UWA A;  1Q8S A;  2YBK A;  1H1I A;  1NXM A;  4LOT A;  5EFU A;  3DN7 A;  3AKS A;  4CSW A;  4KNC A;  4HAN A;  1RUH 2;  5HXV A;  2FDH A;  3HMY A;  1AR8 3;  4KQ7 A;  1QJX 1;  4XUQ A;  3VN4 A;  4P9L A;  5FYS A;  5C8W A;  4W8J A;  3AYD A;  3C7O A;  2VMG A;  1REE A;  4AGR A;  1F35 A;  3AZW A;  3V64 A;  1OQE A;  4XUT A;  3ZFG A;  1YJK A;  4ZKT B;  2VNV A;  3AXD A;  1XXN A;  3RJ2 X;  2H0V A;  2WO1 A;  5HCH A;  4XJZ A;  4AQS A;  5GLZ A;  2WIN B;  2ZX1 A;  1FT9 A;  3TN9 3;  3VBH A;  2WNU A;  3NKG A;  3DGT A;  1V9U 3;  4GIQ A;  1J3Q A;  1CON A;  1W39 A;  3LB9 A;  2R32 A;  4HSL A;  1V70 A;  3FLP A;  3ZKY A;  3ZPO A;  3RQ0 A;  5FR3 A;  1H4H A;  2I2S A;  2C9A A;  3ZFE B;  2L9L A;  3GAL A;  3UV9 A;  1PNF A;  1GMM A;  5HXM A;  3KHB A;  4HPK A;  1IQD C;  1UZV A;  4Y20 A;  1NX9 A;  1UX6 A;  4HK8 A;  5C5U A;  1GKB A;  1W99 A;  4IGO A;  1WCS A;  4GB3 2;  3WP6 A;  1MEC 1;  2WWU A;  4PIX A;  4QHB A;  4DMI A;  4DZG A;  3VBO B;  5JWP A;  4A2U A;  5JXI A;  1PVX A;  1UD1 A;  2EAL A;  2YFZ A;  1QEX A;  3ACI A;  3BTA A;  1ZBE 2;  2GAL A;  1IS3 A;  4LUL A;  3ZSK A;  4CEW A;  2B42 B;  1XSR A;  3H7J A;  4L0P A;  4OFG A;  1A78 A;  2YU2 A;  1FNZ A;  3T1M A;  3UK9 A;  3HWJ A;  2Z4F A;  1A3K A;  5ACA 2;  1GWL A;  3D8C A;  4N53 C;  2HEY F;  1YQ6 A;  3MHZ A;  5AC9 3;  3HEI A;  1US2 A;  5BXX A;  1GLH A;  1MS0 A;  1N1V A;  4Y5T A;  3ZIX A;  1ZBE 3;  2D97 A;  1ULO A;  3AJZ A;  4J1X A;  2XKO A;  3MV1 1;  1AYM 3;  1E57 A;  2Z79 A;  3O0X A;  4XJ9 A;  5IK5 A;  5LBB A;  4MVT A;  4K8F A;  1QQP 1;  2VY0 A;  3INA A;  4XBN A;  1UYP A;  2ZX2 A;  5ANN A;  3QLQ A;  4LBM A;  1A6C A;  1YQ2 A;  4WZF A;  1XYN A;  1ZRI A;  1MS4 A;  1ODN A;  2XHN A;  2VH9 A;  1JI6 A;  3AZZ A;  1Q43 A;  3MLJ A;  4LBL A;  5A6Y A;  1C8M 2;  2GAU A;  2VOX A;  3VDB A;  5KXD A;  4J6G A;  3S30 A;  3PTY A;  1ND3 A;  3ZYH A;  3WP4 A;  1S2E A;  1CAU A;  2QUO A;  4FT8 A;  3S7I A;  2FDG A;  3LCP A;  3S5A A;  4NIG A;  4GWN A;  5F3E A;  5IUQ A;  4D6R A;  3ZYG A;  2HWF 3;  2HWE 2;  4AYU A;  3VBU A;  1BLZ A;  1QJY 3;  1VBE 1;  5FQ0 A;  4QT6 A;  4TTG A;  3QBQ A;  1ZZ8 A;  2JG9 A;  3AP6 A;  4GKX A;  4OQ8 A;  1QOS A;  1W8T A;  2QKD A;  1GZT A;  4GQ7 A;  2W1U A;  4UF0 B;  2J1T A;  1YCI A;  1O8S A;  2UYB A;  1UF2 C;  3KCY A;  3M7A A;  1MVE A;  1VAL A;  1JXN A;  4CCK A;  1AR9 2;  1B35 A;  4XJA A;  5GZG A;  4GMP 3;  1TQ5 A;  1S2B A;  1YQC A;  2DFC A;  4URA A;  4MXW B;  4ZXE A;  2Y64 A;  5C8C A;  4P5Y A;  1CJD A;  4JAA A;  1BCX A;  1CN1 A;  3LEG A;  3WG4 A;  1STM A;  2AEY A;  4NID A;  3IBM A;  4IEY A;  3BTY A;  3GYD A;  1QDC A;  4HET A;  5FLI A;  5AC9 2;  2MEV 2;  4LMF A;  4PDW A;  5J7M A;  4RL7 A;  4PJY A;  4Q4Y 1;  1YI9 A;  2JDA A;  4G3Y C;  1NLQ A;  4QX0 A;  4I0B A;  3HOB A;  4HKL A;  1W06 A;  3T0D A;  4JRA A;  1OUX A;  5BNO A;  5LEK A;  3I2O A;  1ZZ9 A;  2Z69 A;  4QB6 A;  3MO4 A;  2DCK A;  1UU6 A;  1VRH 1;  3NJV A;  5L7O A;  4A4A A;  2ETE A;  2G9F A;  2WUH A;  4GB3 3;  4YFW A;  1AJO A;  2WO3 A;  4LIU A;  4XUR A;  1GNZ A;  4YVS B;  2ET7 A;  4NR1 A;  1IKP A;  2VM9 A;  1G7Y A;  1RUE 2;  3D3A A;  3POF A;  5IVJ A;  2NZ9 A;  1HRI 2;  1Y9Q A;  3RS6 A;  3PIG A;  1GNY A;  3R6S A;  4NJ4 A;  3III A;  1JZ3 A;  2OUH A;  1BBT 1;  3WDW A;  4KWU A;  3BCW A;  1F2N A;  1GU3 A;  3BIE A;  5FP7 A;  1K5M B;  4CDX A;  2ZKL A;  4HLT A;  3V0B A;  1YHF A;  2BGP A;  5E16 A;  2RR1 1;  5D2A A;  4ONU A;  4N43 A;  1WMF A;  2Y6J A;  3FE5 A;  4AFC A;  1M4W A;  4N9H A;  1R64 A;  2VC9 A;  4LKS A;  1XQN A;  2QDN A;  3I2I A;  1J58 A;  3AMP A;  1RUC 1;  1DLC A;  1U5I A;  4DXS A;  1YRZ A;  1VAM A;  4A45 A;  4N7I A;  2JB8 A;  3IMN A;  3IDA A;  1SDD B;  5BNO C;  1HDK A;  3U10 A;  5DAQ A;  3MPB A;  1UX7 A;  3KHC A;  2A3Y A;  1JTZ X;  2VQA A;  3ABZ A;  3ZDS A;  5KHI A;  5EYY A;  3ZFG B;  1JOB A;  2D6M A;  4MV2 A;  4MX3 A;  3RZK A;  4BHP A;  5D8A C;  1PO2 2;  1HLC A;  2ZOE B;  4CDW B;  4N8M A;  1N1Y A;  5A33 B;  4P02 B;  5DZE A;  1JH5 A;  1QJF A;  1XNC A;  2BER A;  2PN5 A;  3CJI C;  4B4P A;  3Q8A A;  2VXR A;  1TME 2;  4S2F A;  5LEJ A;  4DOU A;  2BVB A;  1VBB 3;  2VBD A;  2YUE A;  4SBV A;  1PO1 3;  2C26 A;  1RJ8 A;  1DGL A;  1HQN A;  1RUE 1;  4PDW B;  4PI0 A;  3RGB A;  5B4N A;  5CAZ A;  1VMF A;  3WR0 A;  5L19 A;  1TZO A;  4FPE A;  4IXL A;  4BM8 A;  4BZ4 A;  5KC6 A;  5EIY B;  3MV0 1;  4A7Z A;  4B7K A;  5FTT C;  1OLM A;  3USU B;  3VLB B;  2RV9 A;  3FL7 A;  5FFO C;  2ZGO A;  5FKC A;  4IEZ A;  3K48 A;  3W59 A;  3VHR A;  1DG6 A;  3WDY A;  3VHN A;  5IVB A;  4NAO A;  5C8C C;  4JGZ B;  2EA7 A;  3K75 B;  4CP0 A;  3RDI A;  1SAC A;  2YRO A;  3JQX A;  4QHO A;  1RIR A;  3LZZ A;  5FDB A;  4QB1 A;  1G9A A;  4G9S B;  3ELN A;  4JKK A;  2E26 A;  4LK6 A;  2YBP A;  3WEZ A;  4HXC A;  3JD7 3;  4JC1 A;  4LHK A;  3FC0 A;  1YI7 A;  3CKH A;  2HWC 3;  2VPV A;  3D0S A;  1UXZ A;  5JOW A;  3RI8 A;  2K2S A;  2E32 A;  3F95 A;  3T4V A;  3W58 A;  1DQ5 A;  4XAC A;  4D6S A;  3U11 A;  5HI0 A;  4BQ1 A;  4GD4 A;  2P5B A;  3T08 A;  4KG0 A;  3IKW A;  1AYM 1;  4P14 A;  4XPV A;  5FZM A;  4UBG A;  1U5Y A;  1QJX 2;  2OPK A;  3P1I A;  4YW3 A;  2JIC A;  4IV3 B;  4RFR B;  1W8O A;  1G9D A;  2F6B A;  1BK0 A;  2WDB A;  3IT8 A;  4I01 A;  4CCO A;  2WFF 1;  1RUD 2;  1UAI A;  3DYM A;  5JR2 A;  3KSC A;  1X82 A;  1W2O A;  1LCL A;  4COZ A;  3A0K A;  2YB7 A;  4BMB A;  2BV4 A;  2PLV 2;  1XJA A;  2GN3 A;  2VR4 A;  3BU0 A;  1LHN A;  2YHJ A;  2UUR A;  5D1I A;  4WZC A;  4LLF A;  4BQX A;  4QXH A;  1PVC 2;  1PK6 A;  2XBO 3;  5CEH A;  4CEW B;  4QPI C;  2DBI A;  1OVS A;  3N9L A;  4F83 A;  3OUH A;  1D2Q A;  5L9B A;  3IDC B;  4MHR A;  3WIN E;  3ACF A;  1FV3 A;  4I0W B;  3VUO A;  2DVG A;  2CTV A;  3AXE A;  2ZAB A;  2PLV 3;  2ZKN A;  3MFA A;  3ST7 A;  2OT7 A;  2NLR A;  3MZH A;  5LK5 A;  1GQG A;  1ZRF A;  1W6M B;  3PNA A;  1MS9 A;  3RJR A;  1FMD 2;  1XE0 A;  4AI0 A;  1SQ4 A;  3FHA A;  2FDK A;  2BWC A;  2JE8 A;  3SEE A;  3ZN6 B;  2CNA A;  2CDP A;  4J1W A;  4BA6 A;  1AX1 A;  3QCW A;  5K0U A;  4FPK A;  1RUG 2;  4XDO A;  2AH2 A;  3SMH A;  3ZSL A;  5M0T A;  5DZF A;  3WQB A;  3WXP A;  1NCR B;  4IEP A;  3IPV A;  4KG8 A;  1OH3 A;  2YMZ A;  1CPN A;  5ACA 1;  5ABJ B;  1G9B A;  4H7L A;  5KXE A;  2K46 A;  5CZK A;  4XTP A;  3I49 A;  4L97 A;  3MW4 A;  2P1B A;  2WNV A;  1JZ7 A;  4PQ9 A;  1ACC A;  3PJQ A;  3ZKU A;  5C3S A;  2YYO A;  4IUG A;  3VBR A;  4S2D A;  1SLA A;  4O65 A;  1QJX 3;  1UKR A;  2EIC A;  3GBF A;  2WQ4 A;  1N1S A;  1VBD 1;  1RHI 3;  1W8H A;  4WVW A;  4CCM A;  4P5H A;  3QH6 A;  1OBN A;  1UPS A;  2Y26 A;  3WNN A;  1QQP 2;  3CU7 A;  4C91 A;  3ZMN A;  2WL1 A;  2OS2 A;  2JE9 A;  3EQE A;  1YXW A;  1NLR A;  3LA3 A;  3JCI A;  2LM3 A;  2W5F A;  2BBV A;  3KVA A;  1C8M 1;  1S2K A;  2DTY A;  5BNN B;  5CFC A;  4ZU5 A;  3ZR6 A;  4UFL A;  4FBF A;  4MGY E;  1ULF A;  2FDF A;  5JR7 B;  2EID A;  4RS5 A;  5EPA A;  1W8U A;  3ZLI A;  2CL2 A;  4AK3 A;  4WVV A;  5C33 A;  2E51 A;  2WSV A;  4B29 A;  2YXS A;  2RMU 2;  1BMV 1;  3MIE A;  2EIE A;  4X6Q B;  4OZX A;  2W95 A;  2QQK A;  3AVS A;  1W6Q A;  1GQP A;  1YLL A;  5FZ8 A;  5A32 A;  4DXT A;  1W9Y A;  2VZP A;  3IM0 A;  1ULE A;  2A6W A;  3DV8 A;  4LPL A;  3HIF A;  4RD7 A;  3S7E A;  1A8M A;  1CPM A;  4AED A;  1CZV A;  4LIV A;  4MLO A;  1UOF A;  2AEZ A;  3J9S A;  3B00 A;  3H8O A;  4JGZ A;  1LEM A;  3E6C C;  1W3V A;  5FYM A;  1BYH A;  4YZ4 A;  4CDU B;  1UXX X;  1NG0 A;  4K20 A;  3SEP A;  1RTV A;  2HWD 2;  3JD7 1;  2D43 A;  4P08 A;  4QGN A;  4TLF A;  5AC9 1;  2D3R A;  2MEV 1;  4R9A A;  3THD A;  3AP4 A;  5ISL A;  2JG8 B;  3K51 A;  4LLO A;  5F5A A;  2JDK A;  3ORJ A;  1C8N A;  3R4U A;  4EWA A;  3KCX A;  3NAP B;  4R52 A;  2Y34 A;  3WW3 A;  3B3Q E;  4CDQ C;  5E89 A;  1ULD A;  1LOC A;  3OG2 A;  2RJL A;  3ES1 A;  2XPJ A;  2FBE A;  3U4X A;  3ZR5 A;  4QPI B;  2EXH A;  2JDP A;  1F31 A;  2OX0 A;  3FLT A;  1OI6 A;  2B45 X;  1J3P A;  1H0B A;  3I59 A;  3JBG 3;  4GUL A;  4V2W A;  5AVP A;  1ULC A;  1XU2 A;  5T5L A;  3ZSM A;  2AYH A;  3OTF A;  3OY8 B;  4QXB A;  5IT6 A;  2P4E A;  4XXA A;  1LU1 A;  1CAV A;  3O0V A;  2VVE A;  2E53 A;  3HNM A;  1HRI 1;  2JG8 A;  1I5P A;  2VCC A;  4MXW A;  4RR3 B;  2PAE A;  5GZF A;  5FP8 A;  4BXF A;  3WY6 A;  2DCY A;  3CDZ B;  2VVF A;  4D0Q A;  3GDB A;  1GOH A;  3TWI A;  4LO4 B;  3WF4 A;  2FQP A;  4RN5 A;  4F8A A;  2WFP A;  4RQP B;  1ULP A;  4MUV A;  4AVA A;  4BIS A;  1MS5 A;  1HN1 A;  1O5L A;  4PF1 A;  5AFB A;  4ASK A;  5C3O A;  1BVP 1;  1N3O A;  3CLP A;  4Y20 B;  2JDZ A;  4CTE A;  3E5X A;  2WNO A;  3LFM A;  4JDN A;  2F17 A;  3BTZ A;  5EQU A;  3WDX A;  1GV9 A;  1YWK A;  2GND A;  2P34 A;  2XJP A;  1WBF A;  3A4U A;  5FZ0 A;  4CDQ A;  5BNN C;  4CU8 A;  1BHG A;  1FYU A;  3AJY A;  3DYO A;  2JIJ A;  3M8L A;  3NST A;  2QZ2 A;  5A7W B;  5CIS A;  5B4X A;  2DCJ A;  5I93 A;  3S0M A;  5CB7 A;  1IS4 A;  2ADD A;  2P3J A;  2HYK A;  4JGZ C;  3ZXG A;  4B1L A;  5C9A A;  1R09 2;  4QX7 A;  5L36 A;  1XNA A;  1BKZ A;  2Y6F A;  1XNB A;  4EZ4 A;  4XAE A;  3I7D A;  3V56 A;  5J98 B;  1KQR A;  1Y9G A;  3LKJ A;  2RMU 3;  2QBX A;  5J48 A;  4UFK A;  5JLV A;  5F32 A;  3ZN4 A;  3SH3 A;  5DAP A;  2Q1F A;  4XFI A;  4OMC A;  4AEJ A;  3KV4 A;  5FRE A;  3NW4 A;  4DPN A;  1OC1 A;  2YG0 A;  1UYX A;  2DF7 A;  1VBC 1;  1YIF A;  5A1F A;  1NE4 A;  1S0D A;  4GJZ A;  2OQ6 A;  1NQD A;  5JUV A;  3I97 A;  2EIB A;  2ET1 A;  4EWE A;  1W3X A;  2XVG A;  5C3Q A;  1C8M 3;  4MH0 E;  1VB4 A;  3PME A;  2PQS A;  1W9F A;  5FV3 A;  1SZB A;  2B46 X;  2WLP A;  4IQP A;  3J7M A;  3ZXL A;  4U2A A;  2P3Y A;  4BK5 A;  5T5O A;  1H2K A;  4N90 A;  5IYY A;  1SBF A;  4YYO A;  3L2Y A;  1ZRE A;  2MNG A;  2LRP A;  2WA4 A;  3I2G A;  4YW7 A;  2BUK A;  1K5M A;  4WBB A;  5FKB A;  4COW A;  2BEO A;  1ZZ7 A;  2A3X A;  2ZHK A;  4LUK A;  5BNP B;  3O1S A;  1N3Q A;  1OFN A;  4QPG C;  4PT6 A;  3FUO A;  1FV2 A;  4IDZ A;  3WQ0 A;  5ACA 3;  2W87 A;  3GBG A;  4XHX A;  3VBS B;  3SC7 X;  2ZMK A;  1TME 3;  4LT5 A; 
#chains in the Genus database with same CATH homology
 3ZYF A;  2K46 A;  4LKE A;  4LKF A;  4BQ2 A;  3UT0 A;  1W90 A;  4CPB D;  4BQ5 A;  1W9F A;  4YW6 A;  2JWP A;  1W8Z A;  2WYF A;  1HN0 A;  3ORJ A;  1W8T A;  1WZX A;  4CP9 B;  4BQ4 A;  2KR2 A;  3ZYB A;  4LK7 A;  4A6S A;  2O14 A;  1V0A A;  3F95 A;  2LRP A;  4LKD A;  4YW7 A;  4LK6 A;  4AL9 A;  4BQ3 A;  2C24 A;  2VXJ A;  1L7L A;  2Q1F A;  1W8W A;  1WCU A;  3ZYH A;  1OKO A;  4LJH A;  1OH3 A;  1GWM A;  5D21 A;  2LRO A;  1UOJ A;  1GWL A;  4CP9 A;  1GWK A;  4YWA A;  1W8U A;  1WMX A;  4CPB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...