1UOJA

Crystal structure of pseudomonas aeruginosa lectin 1 in the calcium-free state
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
121
structure length
121
Chain Sequence
b'AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PA-I GALACTOPHILIC LECTIN
publication title Structural Basis of Calcium and Galactose Recognition by the Lectin Pa-Il of Pseudomonas Aeruginosa
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 22
structure length 121
sequence length 121
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07828 PA-IL PA-IL-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 1uojA00
4LK7A 4LKEA 1W8TA 3ZYBA 4AL9A 1WZXA 1UOJA 4LK6A 1W8UA 2K46A 1GWMA 2LRPA 2WYFA 3ZYFA 1W8WA 4BQ4A 2JWPA 1WCUA 4CP9B 2VXJA 4LJHA 4BQ3A 4BQ2A 2LROA 3ORJA 4A6SA 4BQ5A 1OKOA 1W8ZA 4YW6A 1GWLA 4CPBA 4LKDA 1HN0A 2C24A 4LKFA 4YW7A 3UT0A 3F95A 5D21A 1GWKA 1L7LA 1WMXA 4CPBD 1V0AA 2KR2A 2O14A 2Q1FA 4CP9A 4YWAA 1W90A 3ZYHA 1OH3A 1W9FA
chains in the Genus database with same CATH superfamily
1HRI2 3KM5A 5KBFA 4XHXA 4CEWA 3PVOA 4QPGB 4UBGA 1K5MC 1UYPA 3J9SA 4EJRA 4G4FA 5FZEA 3UKTA 4Y1UA 4WZCA 4XCBA 3W59A 3B01A 4JDNA 3LEMA 4D6RA 1AL0G 4HVQA 2IZWA 1O59A 4O9EA 3RMYA 1HN0A 2K2SA 4A42A 3MPPG 2E7QA 3NNFA 4YARA 2ZKLA 4QT6A 3ZSJA 2D6PA 2WWSA 4XF1A 5JI7A 2D97A 3AP7A 3HD8B 2HWC2 4AEDB 3K2OA 2O14A 1UY3A 1U5XA 1AX2A 3EBRA 5T55A 4OHYA 4HSJA 3O1SA 1OA4A 2DTYA 3IT8A 3CDZB 1RUD2 1UAIA 4Q4X1 3N36A 2VTFA 4CEYB 3KCCA 3ZFGC 2C1FA 4YFZA 1XSQA 3LDKA 1WMDA 1NZCA 5FYBA 3RFRA 5LWBA 2DCKA 2WZ8A 1FPN2 4DY3A 2PLV1 2D3RA 1QGLA 3NJVA 1EPWA 3FUOA 5JMCA 4M3CB 5A6ZA 5LK7B 1WW5A 3AMMA 3LD8A 3DPRC 3MHZA 2HWD2 1MS5A 3S30A 3OGSA 5K7PA 2D43A 2NP0A 1DZQA 3MIGA 3S5QA 3OPZA 4TLFA 2R042 2D3SA 1G6NA 2BGPA 1UZ0A 3AP9A 4HXCA 4Q4Y3 1RUF1 2VZ3A 1COV3 2DF7A 5HXMA 4XBLA 3GBWA 2QNKA 4YGCA 4UW6A 3WVJA 2VR4A 5BNPA 1K3IA 1YJLA 4AQSA 2WFF3 1RUNA 4MLOA 5H9PA 1NA1B 3D4KA 4JCKA 3VZKA 1RUC1 3VKMA 5ACA1 4LT5A 3BU7A 5EJ3A 2IUWA 3UKNA 4AF9A 5IFPA 3PVBB 4O65A 1XU1A 2LALA 1R1A3 2WL1A 4Z92B 3N9QA 1YLLA 1RUJ3 3BOPA 4R4XA 4YM3A 3WDVA 4CEWC 3J7NA 1GKBA 1CAWB 4N43B 4XDQA 1DQ4A 5CB7A 4CDWA 1ZBE1 4Z07A 4FBFA 4NUBA 5J7MA 3FHAA 4XTMA 4CP9A 1BHGA 1N1VA 1W90A 3C7EA 1AYM1 2G9ZA 1NKGA 4CU9A 4Y1YA 3ZYBA 4BMEA 1FMD3 4I3PA 2XLAA 5I8YA 1EV11 1REFA 2I74A 4C90A 2V72A 1W06A 3PJYA 2BTVC 3U07A 1UN1A 4Q2FA 4CXWA 2P4EA 5CAZA 5A33B 5A3WA 5ANQA 5C4WA 4FPOB 5K0UB 3A7QA 1OQEA 3AJZA 3N3HA 3U78A 3ZDSA 4B7EA 4D7TA 1W03A 2BZDA 5B4NA 3TNQA 4OI4A 2Q1ZB 2D3PA 4QHBA 4ZONA 2QVSB 4UFHA 3ACLA 3NL1A 3H1WA 2VVFA 3IBMA 4A45A 4AHZA 4BISA 1JZ4A 3WG3A 1PO23 1CPMA 5LBEA 4CVUA 3VBSA 1MPXA 3H50A 1E5SA 4B1MA 5JOZA 4IV1A 3FZ3A 1J3PA 2VW1A 1BK1A 2WJSA 2WKKA 5JR2A 3LFMA 1LRHA 4H3WA 1ENQA 1VBD3 3NO8A 3MV01 3QBQA 4P9LA 5JAXA 4LOSA 2WNUA 3I2DA 5F7UA 5FQ0B 5L7OC 1GNYA 4PHZA 3HQRA 3WW1A 1EP0A 4FXKB 5LEJA 2VMDA 1UKRA 2AACA 3U4SA 5B4XA 1VJ2A 2N7GA 2I45A 2A3WA 2HWB2 1ZREA 2P2KA 3OUIA 1CWPA 3IPVA 3KQ4B 3MI8A 3U14A 3H8RA 5FMBA 3WSOA 1NCQB 2Q8OA 1HRV1 2R062 3C7GA 4R8HA 1REEA 1QOSA 1W9FA 1Q3EA 1UIJA 2XKPA 2YU1A 5FMDA 3SCFA 5FP4A 1T6GC 5F6LB 2P1BA 1VBB1 1UQXA 1RVF2 1AR93 4RHV3 3ZYGA 4ASLA 1JZ2A 3DYOA 1YCIA 1S2BA 3THCA 3LF7A 5LATA 3NSTA 2W1UA 2BNMA 2UWCA 1AZDA 4U2AA 3NAPA 1Q8QA 3MUY1 1ULGA 2ZACA 3I2HA 3JCIA 4INDA 2R6QA 4Q4Y1 1PX3A 1COV1 3T1LA 5BNPC 4IUGA 5F3GA 2ZEXA 1LOBA 2WNEA 3VKOA 1AR61 1NQDA 4FPGA 4A6OA 1VRH2 2WFF1 4COUA 2ZGMA 2ET7A 4BOWA 1GYKA 4C1XA 4PBOA 4QKBA 3G6JB 2XUEA 4LKEA 1TMF1 2BGOA 4CXXA 1R092 3HPNA 1AHSA 3BALA 4RQPC 4P5YA 1JOJA 2CSGA 3KGZA 5D2AA 1B09A 4JGYC 5A7NA 5C8CB 1R1A1 3LA3A 5I8TA 1XNCA 4MGTA 5IVCA 1RUJ1 5A6QA 4XJ9A 3U10A 3N7MA 4MHRA 2R16A 2MNGA 1JXNA 4BQ1A 4HVRA 4X8NA 4I02A 3ZN6A 1D2QA 1X82A 2WAOA 1UX7A 2VGDA 4JRAA 1CJDA 4XIKA 1FMD1 1DQ6A 3W58A 1MR5A 1LOEA 3WNNA 5GKAC 4AGVA 4FPEA 1NAEA 3OBZA 1LKNA 4L9BA 2W0XA 3ZYHA 1XJAA 2RDRA 1W05A 3WDWA 3ATGA 3CL1A 5CKNA 5JZGA 4XMIA 4GH4A 2PAEA 4MXWB 5LCWL 4NAOA 3PUAA 2EXJA 3O0VA 4KWUA 4QX1A 5L9BA 3IKWA 1QDOA 2VW2A 4PLMA 4AHYA 2PTMA 4CDUA 1OKOA 4I0AA 4Y5TA 4K8RB 4XFGA 2VD7A 1RL3A 4DXZA 1W6PA 1PO21 2QQUA 3BTAA 2VTXA 1HKDA 2BW8A 2WIIB 2ENRA 2GC2A 1OLRA 2B9UA 2BVVA 4Q8KA 4KWJA 5CFCC 4H14A 3G7DA 4XXPA 1VB4A 4JGZA 4BHPA 3AKTA 2F4PA 2HYXA 2AZ5A 2HWE3 1W9SA 2RMU3 4MX3A 1G8WA 1WLWA 3B9CA 2ZX3A 4LIVA 2TEPA 3K75B 3PHMA 5FZ9A 1ND2B 5A7QA 3T0DA 2EF6A 1Y9QA 5HV0A 5LASA 5A3NA 5HCAA 1O3QA 1VRBA 4QDRA 2DVFA 1W6QA 1W3XA 1XE0A 4COYA 5FJHA 3RS6A 1NZIA 4KGQA 5LRRA 5HV4A 4KWKA 5LEKA 2QQPA 4ZU4A 1AR82 2VOXA 2I2SA 2JG8B 3D0JA 5D21A 2ZGNA 2QQMA 4YZ5A 4NHYA 2ATFA 5EJZB 3ZIXA 1AR91 2B46X 2GMPA 3M70A 4RHV1 3ZFFC 3ZVXA 4IDZA 2RS12 1ODMA 1BVP1 2PELA 1J1LA 2Y8KA 1LHWA 3RRDA 3UGHA 3ZXGA 2A6WA 1LGCA 1LGBA 1SBEA 1RMU2 2Z5WA 4PLOA 2Q8CA 1XE7A 3VBOA 5ABJC 3GCWA 2DVBA 1SLLA 2JDUA 1MVEA 3AX4A 5CYYA 2OUJA 3KCYA 2W46A 4Z2WA 5FXZA 3KHCA 4IEXA 2RS33 5EV7A 1CAUA 2BOJA 5KC6A 4QGNA 3OBTA 1RUE2 1CX1A 4OUSA 1S2KA 3VDDB 5J1XA 2ZGQA 3V65A 4BQXA 3V56A 1YJKA 2HJIA 4YRDA 1RC6A 3WX5A 4Y4RA 4TTGA 2CWSA 4W65A 4B4PA 4RFT0 1YQ5A 2WS92 1H9WA 4P9YA 1D7PM 3N9NA 3SH4A 1TNFA 4EN6B 3W21A 3E6BA 5FMOS 2AYHA 4OMDA 3KVBA 2JDYA 4D6SA 5DUVA 3DYPA 3L2HA 1OLQA 3I4IA 2IFRA 3SQOA 3VD7A 4AFBA 3AXDA 1OD3A 4QB2A 5KHKA 1UU5A 1MEC2 3MZHA 4E4ZA 4RA0A 5BNOA 1POV3 3P1IA 4XF3A 3AKPA 2WWJA 4FPHA 4N9HA 4Q8LA 4BLIA 5J37A 5LBBA 2W91A 3P6BA 4JRLA 4K9SA 4BCUA 2YUEA 1QJU3 1ZZ6A 1H2MA 5EIYB 2A1XA 4I0WB 2XWBB 3P5BA 1U5IA 5FZ6A 1EUTA 3GJAA 4JDMA 1QU0A 1T2XA 1Y9MA 2HEVF 1GQPA 5C9AC 1NY72 3E6CC 3CHXA 1F5JA 1KS5A 3HBKA 4YZ3A 2ADEA 4OHVA 3ZLIA 1UL9A 3Q8AA 4AEJA 1MQTC 4FFFA 3MDPA 5EYXA 3I54A 4DUXA 2WYFA 4KBZA 5LW9A 3K46A 1QOTA 3B5LB 3NJZA 5FPBA 4PIXA 4X6RB 5A7WA 2KD7A 2NPIA 4FPJA 3Q9OA 3J7MA 4IEQA 5FAXA 3EYPA 1LCLA 5FZLA 2R7EB 3MO4A 3Q8CA 3WZ1A 1AJOA 1DLCA 4CDXC 4ZKTB 3PUSA 1YFXA 4I0BA 1LU1A 4XUPA 5F6KA 2A3YA 4NPRA 2G4IA 3QLQA 5EWSA 3OY8A 1HJFA 2H6BA 1C5HA 1QHDA 4QXCA 3RVHA 1UY4A 3UK9A 3VHPA 2HWE1 4KGGA 2EXHA 2PA7A 3SH5A 1H8TC 4KNCA 4M00A 2XR4A 4ARXA 3OG2A 5FYHA 1I5PA 1URXA 3A0NA 1OH3A 2ZHLA 2HYKA 2VNRA 1GFF2 2VOKA 3T4HB 2WZR1 3HQXA 4WM7B 1SCRA 2WDBA 4Q4V3 2I07B 1Q56A 3WDYA 5ACA2 2P5BA 5T54A 3WW3A 1H8VA 3AMQA 3ETPA 4QMAA 3OJBA 2WAAA 4QDSA 4CPBA 1DQ1A 2TNFA 4Q0VA 4ET7A 3VUOA 1ZBE2 1S0EA 3WY6A 4CYDA 4IEZA 5CADA 3QD6A 2X5IB 4ES9A 2Y6LA 5IK7A 2A7AA 3WEZA 3DV8A 3IAQA 1H30A 1L7LA 2J1AA 3LSEA 4IEWA 4AG4A 5F37A 4E9KA 1DYOA 5J48A 2NQYA 2HBUA 1QQP3 2RJKA 3WT3A 1I6XA 1CAXB 4V2VA 5K0UA 2RS31 4MVTA 1UYXA 2HEYF 1C8M3 5L36A 1ASJ2 3AZXA 4IEYA 5FXXA 1PHMA 3N7JA 1I9RA 4EZ4A 3V0AB 2Q5TA 3EB7A 3L2YA 2W68A 2W94A 2XVGA 1EAH2 2E51A 1PZ7A 1SLBA 2AR6A 3O7OA 1DU3D 2VAUA 4L97A 1JBCA 2DUOA 4XF4A 4LE4A 2OYZA 1D0HA 2UWBA 3ZFEA 2Y34A 2GMEA 4XDPA 2DBIA 1OOPA 4XABA 4AQ2A 3T08A 3UT0A 1D2SA 3LEIA 2D44A 3N35A 4P9IA 1H1MA 5A1FA 5C7GA 4CPBD 3TN93 1UX6A 4XAEA 5AFEA 1XNBA 3MIDA 3Q8BA 4WZFA 1POV1 4NHLA 1LJ7A 4FTSA 1UZWA 1DFQA 3VL9A 1BBT2 4XURA 1W2OA 5FZMA 3T09A 5FUPA 1ND3C 3JD72 3ZPOA 5IK5A 1QJU1 2Y64A 3FHIB 3E5UA 2X05A 4JKKA 5KXBA 4YM1A 1DZRA 4GD4A 2OVUA 3DL3A 3S5AA 2FQPA 4FPYA 5JR7B 2ZJCA 1DF0A 1GUIA 2C0ZA 1R1ZA 3LOBA 3HT1A 1MZEA 3OGVA 4ZS2A 3SHRA 1HRV2 2XLGA 5FZBA 4D6QA 2WINB 1FOD2 1PGW2 1N3QA 3IIAA 4QPYA 2VCAA 2XJPA 3AB0A 5JWPA 4AE2A 3NMBA 2FDHA 1VBB2 4UF0B 1DQ2A 1ZZ8A 5JOXA 1G9BA 2VL4A 1XYNA 2DYCA 2EIBA 2WZPP 4TSVA 4PDWB 4CP0A 5HBAA 1YQCA 2JWPA 3AM2A 1AYN3 2W52A 4YGDA 3KVAA 3MLJA 2PAKA 3VBRB 4IGOA 1W0PA 4RS5C 4UWDA 4HN0A 1LU2A 5FK8A 5IW0A 3RJRA 3VKFC 3KHBA 4Q4Y2 1STMA 3WDXA 2QQOA 2QQNA 4K3UA 4LKDA 3PTYA 5L73A 5FP3A 4ATFA 4AFDA 3NNMA 4DB5A 1ZBA2 1AR62 1POQA 2PN5A 3VBHB 5T5PA 4BMBA 1D4M2 1NCRA 2ZZJA 1QJEA 3NJYA 5C8CA 1TMF2 4LO4B 4LXLA 1YYNA 1W8FA 2VBBA 5GJ6A 4AVBA 1JH5A 5LRSA 1CX4A 2PHXA 2VQAA 2C5DA 3GZEA 3H3ZA 1KFUL 2QZ2A 4OI1A 1V6NA 4ZPIA 3OUHA 1GR3A 3RWNA 2OA2A 4E27A 3JQWA 2DCZA 3KT1A 3HEIA 4PI2A 1Y43B 3EMRA 4N53A 1QXJA 4H2AA 4QHZA 3CJIA 4YVSA 3WNMA 3PU8A 4YW4A 2HWF2 4M4PA 4WM8C 5KXDA 4IE5A 1JTZX 4UOJA 1K5MB 3KLSA 3VL8A 2J1VA 1XYPA 5JMOA 3RWKX 1QQP1 4E2QA 5C71A 4NPMA 1WW4A 1LOFC 4UW3A 3TB0A 5IUQA 1P8JA 2JG9C 3GJBA 3SXWA 3ZYRA 1C8M1 4QXBA 4EN7B 5EZWA 4GJYA 3I59A 1OF4A 4TYSA 2W1WA 3ASIA 3AZVA 1QJY3 3ILNA 3VBFC 1QNWA 4IW3A 1OURA 1VMHA 1I5ZA 1PM7A 3FHQA 1W04A 3NWKA 4BPZA 3JQXA 2GU9A 1B35A 1OKQA 2DCYA 3BIWE 4LBMA 4CXYA 4GWMA 1RGSA 4KQ7A 3RZHA 1SLIA 1UWWA 4HK9A 1QJFA 1RTVA 4NOTA 3GZUC 2EAAA 3K3NA 2WUHA 2XVKA 1LGNA 2CV6A 3TN91 3ZFGB 1VAMA 2YBSA 4NVPA 3LCPA 4DMIA 3RMXA 5A3TA 1ULEA 3AC0A 2BFUS 2QFEA 3FJSA 2PAMA 4DUWA 3O0XA 3I2OA 3BB6A 1XSRA 2YXSA 3LB9A 1W6NA 2XL7A 3APBA 5GLWA 3ECQA 5LY2A 4TWTA 1UXZA 5EPAA 5KHIA 1UY0A 4G9SB 4FXGB 4EQVA 4FTBA 4OHWA 2QE3A 5FZ3A 1GZWB 3FX3A 3H7YA 3WF1A 5AVAA 4D7YA 4P9GA 5B2GB 4AYUA 3TNPB 2WNVC 4AZZA 4JTOA 3M8LA 3VDCA 3OYWA 3IMMA 5C5UA 1PNGA 3PNAA 5IYYA 2XUMA 2RR13 4FOYA 2P3YA 4BYYA 5JI9A 2JX9A 3OPWA 5DZGA 4TXWA 1NYWA 3N9MA 4AEMA 4GJZA 4UW4A 2ZCWA 2JDHA 2PQSA 3DEMA 2Y33A 4AVSA 1BK0A 1K45A 4R52A 2R073 5CFDA 3E1F1 2ZPXA 1AYN1 2JIGA 1IQDC 1PIV2 2NM1A 2AEZA 3I2JA 4EWDA 2GC3A 5CNAA 4JZRA 1IKPA 4CEWB 5FZCA 3SEEA 1H4HA 5BNPB 4BXSV 4ASMB 3HJRA 4KG0A 4L8QA 3AP5A 1UZYA 3AVRA 1CD3G 1UMHA 5K8SA 2EAKA 2BQPA 5DDJ2 3UKVA 3ZXFA 2XJRA 5KXCA 1JUIA 2EIDA 3O14A 1PMJX 2R1BA 3CKHA 2FDIA 5T3NA 1G9AA 3ZXEA 5FBZA 4QU2A 3BIEA 3MIFA 4UFLA 4CDWC 3USSA 1W0NA 3PDQA 4RFRB 2TBVA 4PDWC 5A1AA 4AEKA 1OSGA 4AAXA 2Y38A 3THPA 4YZ2A 1MS0A 1NUKA 1QDCA 1CONA 1O91A 3NV4A 1QOOA 2CHHA 2H0VA 3IDEA 1A8MA 2XKOA 1ODNA 4IEVA 4BDVB 4Q0UA 1PK6C 4Q4W2 1GMMA 5FZ8A 4JKMA 3N4MA 3VZNA 1F35A 3WCRA 3K3OA 4LBQB 3RYKA 2WBKA 4XE9A 3TBDA 1EY2A 2D98A 2R32A 3AKSA 3WDUA 5C4WC 3VZLA 1LHUA 4FPLA 2LUWA 5BXXA 3WNPA 3JZVA 4YG0A 4L99A 2ORZA 1FX5A 4NROA 1UU6A 3AJYA 3AYDA 2BOIA 3JB4C 3EXUA 3THDA 3OPTA 5JPMB 5L7OB 1YXWA 1YQ6A 4OMCA 1DQ5A 1QKQA 4XVHA 3MFCA 3T2QA 3U1XA 1ULDA 5FZOB 3VZJA 3MIBA 3VBSC 2GDFA 2VUAA 3DGTA 1C8NA 1W9WA 4W6XA 3P3PA 1K5JA 5FPLA 4LIUA 3ZYFA 4CP2A 4LITA 3KB5A 2JD9A 1WCKA 1V6OA 2YFZA 2P34A 5I0SA 5FFOC 1TME3 1LEMA 2ZGLA 1QF3A 4CDQC 5DAXA 4LA2A 4IV3A 3I49A 1GANA 5FZAA 1JS9A 4WM7A 1AL22 2A6ZA 5JIUA 4AFAA 2HKXA 4P00B 4ARYA 3IDAA 3RZLA 2WZR2 4Y4YA 1IS4A 3ETQA 4RR3C 1W39A 2ZGOA 5EYYA 4L2NA 4DINB 1DBNA 4E4SA 1DGWA 1CIYA 1E57A 1Z7S3 2QQKA 5G05L 1ACCA 2D6OX 5GLTA 1GU3A 2X5IA 1H6YA 1W8OA 2OIIA 4BQ2A 4FPKA 5LA9A 1CZTA 1KEXA 1OBNA 1XU2A 1CAVA 4RQPB 2VNGA 3WG4A 1ULPA 3NAPC 2R071 4J1WA 3WF4A 5I0DA 3T0AA 4KWLA 3TAYA 4JGYB 5AC91 1O4ZA 2BJSA 4A44A 2XQRA 5FYZA 4QKNA 3MICA 4FPCA 1CIWA 2DVDA 3IMNA 5CISA 2Y60A 4NRPA 2MPFA 5E88A 2WLPA 4AHWA 4V1PA 5FY1A 1W28A 5JSOA 4YM0A 3AMHA 1SCSA 5LB6A 1XNAA 2AC1A 4L11A 2E9QA 2VECA 3AZZA 3AFGA 4PJYA 4LBLA 2H0BA 1WMFA 5L19A 1HQLA 2BV4A 3U0ZA 4HPKA 1ONAA 1H2LA 4P14A 2YZ4A 3ZXJA 1HX6A 3CF6E 3ZR6A 1QIQA 1JYNA 3VBUA 4AK3A 4FVVA 1AR72 1NE4A 1UNBA 4GWJA 4A7YA 1CZVA 1DCSA 1WWYA 2X8KA 4OCTA 2ZGTA 1JZ5A 4ZS3A 5J3UA 3VKLA 2QDNA 1UPIA 3DN7A 4YVWA 5FYMA 4YW1A 1HXS3 2G9FA 1X36A 3DF0A 5JZGC 4W6YA 4IE6A 4GH4C 1YO8A 2DV9A 4URTA 2JJ6A 5FKCA 2ARAA 4K40A 3L9JT 5EXOA 5CFCB 3OOXA 1K42A 4FI9A 2Z2SB 3I2FA 2V09A 2CNAA 3WCSA 2IVIB 1J3QA 4CDUC 4TZDA 3RDIA 2VU9A 1VBE3 1A3KA 4QX8A 1WBFA 1W99A 4GWNA 1GOGA 3DKQA 4XQDA 4LO8A 2C24A 4QQPA 1BEV3 3N7LA 4LHKA 1VBC2 5IK8A 5EHDA 1JYCA 3JXSA 2CAUA 3LDRA 3MF6A 1J59A 4UFJA 4X8PA 5A1LA 4IGPA 3GZTB 1KDKA 1FAYA 4PQQA 4XACA 1YIFA 3K4ZA 1YNAA 4EWAA 4UAPA 4NMIA 4JVAA 4YW3A 2CDOA 2D6KA 1TME1 1C4RA 1HB1A 1XE8A 3INAA 4XXAA 2K46A 2VM9A 1VALA 1QJX2 1UYZA 2FCVA 3A0KA 3ZFFB 1J58A 3FFZA 4AQTA 4C91A 4Z2AA 4QXHA 1H4GA 1V70A 4MGQA 1LNSA 3LA2A 5ABJB 1OMIA 3VKNA 2OZ6A 4QKFA 1XPWA 4UBHA 1LR5A 4N8MA 2ZGKA 3A22A 3FC0A 5C6CA 3MW4A 4HKWA 1Z7S1 2OPKA 2Q1FA 3J4UH 3POIA 4FQZA 4P02B 4C0BA 2WO1A 1XOYA 1ZRIA 4Q1RA 4PBPA 5K9YA 1DGRN 2VMIA 4LK6A 4Y22A 3WHTA 4CU7A 1QH6A 4TN7A 3VBOC 3E5QA 3AP6A 5A80A 1QEXA 1ULFA 2QBXA 2GNBA 1F4AA 3KQRA 1VR3A 1RUG3 5A3OA 1SDWA 2XHNA 2ZMKA 2RDSA 4LNVA 4UT5A 2VMGA 4F83A 1O8SA 2VTXJ 1VLNA 3WQBA 1C8M2 4HBNA 1DP0A 1MS3A 4B1LA 5AFBA 4GMP0 2DCTA 5DUUA 5CIRA 4DXSA 5JDBA 4A7ZA 1YFUA 4GB33 4OZOA 1GNZA 4QX0A 5M0TA 3MFAA 2B42B 2PHWA 2GALA 4COZA 1R64A 2RJ2A 5DG1A 2OPWA 3SMHA 4PIZA 2ZTNA 2ZX4A 3QOPA 3VHRA 5FWJA 2VJXA 2BWAA 4QPIA 5C9AB 4PF5A 3ZO0B 4JQRA 4DRVA 4QGLA 1S0GA 1OLMA 2VCMA 2VO5A 5D8AA 5BNNC 4HKOA 4QAWA 3KS7A 4J25A 3V0BB 1MQTB 5BNOC 1WBLA 4XYXA 1BJQA 5AVPA 4LR4A 3RZGA 2WA4A 5FP7A 2WQ8A 1F4HA 2ZMNA 3O0WA 3DUIA 2JD4A 4IL7A 3VZMA 2UURA 3DPRA 1HXS1 5FZ7A 3C8XA 4CDXB 1NLQA 4XF0A 3RNSA 1GZWA 1REDA 1UXXX 1OT5A 3H1MA 2CU5A 4O9GA 2Z42A 4WVWA 3R6SA 1JYWA 2C26A 4PQ9A 3OTFA 3IM0A 3POYA 2B7YA 1H0BA 1PO13 1Q8VA 4IGQA 3SC7X 3M1HA 2CYFA 1LB2A 3VHOA 2V4AA 3N9LA 5DAVA 1SPPA 2E7TA 4CCLA 4YZ1A 1LESA 5J09A 2D40A 2O8OA 1NLSA 1H8TB 1JOBA 1H2KA 1V9U2 1X8MA 4E8DA 1VBA2 1BEV1 1WA6X 2JDPA 4BA6A 1CGPA 3WF0A 2Q8DA 1RJ7A 1MACA 2GNMA 2W3JA 3WW4A 2QQVA 4BE3A 3HN3A 1LODA 5JXHA 4LO7A 4JV4A 2VCBA 2J22A 1NXD1 4AVCA 1RHI3 2RS52 4H55A 3BGAA 5IVJA 3QH6A 5IATA 3H42B 2GNDA 1US3A 1S0DA 1IQAA 2JE8A 5CEHA 2FD8A 2EIEA 4ATEA 1KJLA 1VBD1 2OQ6A 2QQWA 2WWUA 4XZPA 3VD4A 3FL7A 3PJQA 1PVC2 2ZMLA 4FAGA 4YGEA 2ERFA 1H1IA 1PGL1 2IWGB 2JIJA 1IPSA 3PU3A 1BLZA 1ULOA 3BI3A 3PTRB 4FPFA 4XILA 5DN2A 3SKJE 3HQUA 1ZRRA 2RDNA 2RM23 5F5AA 1FNZA 1HRI3 3LWCA 2YPDA 4BH9A 1AXZA 4NR1A 2GAUA 4LUKA 4GZ9A 3T2OA 4ONUA 4QQHA 2D93A 1CQ9A 4JHZA 3H8UA 2F6BA 4A7KA 3AKQA 5FK7A 1FV3A 2ES3A 1NE6A 3WQ0A 1A34A 4LBKA 2FDKA 2WSUA 2MEV3 2WQ4A 1O3RA 1JODA 1KDMA 3RJ2X 1RUG1 3UV9A 4XIOA 3LSDA 3KT4A 1Z78A 2DU1A 1O3SA 2EXIA 2VXJA 4YGBA 2HWC3 3K48A 3PIJA 3BVCA 4OUMA 2RVAA 5T50A 5LY1A 1SACA 2E63A 2VZVA 4MH0E 4QQLA 4GB31 4WVMA 4XJUA 1ND3B 4AFMA 4HZFA 3ILFA 1WKYA 1RUD3 1UOFA 4JC1A 3T2PA 1A8DA 3A4UA 3FUQA 3ZFEC 4CCKA 1V6LA 2JDAA 1OOPC 3BPZA 3U75A 2UWAA 1GOHA 4QPGA 5FZGA 1ZRCA 1FPN3 1Y4WA 3OB8A 2Y6JA 5T5JA 2VMEA 1Y9GA 1DYPA 3C7HA 3EHKA 5FOJB 1JYXA 2YB7A 2JB4A 4LMFA 5I93A 1SBFA 2HWD3 4NWWA 4GQ7A 5FZFA 1N1TA 4FT8A 2HEWF 3TEXA 1VIWB 2Y6HA 1KS4A 2W5FA 4LBQD 2EIGA 5DAQA 5DPNA 2OKXA 2ZBJA 4ZZ5A 3MEPA 4XOGA 1LENA 4AEDA 1UIKA 3FWEA 5A32B 4EROA 1JYTA 1BKZA 2PHFA 1YIPA 1W2AX 1PO11 3KF5A 5FPZA 4P08A 1WUVA 3AZWA 1JZ3A 4Y5Z0 2VBPA 5LA2A 2JKXA 4RS5B 1KJRA 1ZYBA 3AMPA 4CEYA 1MZ6A 2JDKA 4FAHA 3KV4A 3DECA 2ZS6B 4HONA 5JPNB 4MGKE 4Q4X2 1GQHA 4RYDA 4RSUA 4BIFA 1UOGA 3O1TA 1RB8G 1HV1A 1ZX5A 4KH9A 1UOJA 1UW8A 3ZSKA 1Q43A 3VD5A 4M3CA 4JGYA 3H3LA 3MW3A 5FWEA 3WQ7A 3WG2A 2XPJA 4XEZA 2PLV2 2YGMA 2VQTA 3ZKYA 4DPNA 2YC2A 3CU7A 3CIHA 3M4FA 5AC92 1GNHA 4AI3A 1JHNA 1IPKA 2NN8A 4YLZA 5KHHA 3E97A 1D0GA 4TLGA 4IEPA 5FZIA 3NVCA 1CR7A 4N7IA 2O1QA 3JUUA 1FT9A 1NCRC 3GBGA 3I2KA 3R4DB 4RGKA 2RMU1 4WM8B 1RUF2 3SITA 3PUQA 3MF9A 4MSVA 5FXWA 5FV3A 1NA1A 3LZZA 1ALYA 4ZZ8A 3SISA 5JXIA 2O8QA 1CVNA 3EO6A 2XJSA 2SBAA 2RM21 2JG9B 3VD9A 2IC1A 1HRI1 3BODA 3ST7A 2J1EA 3USUB 1RUC2 3LOIA 4E2GA 2UU8A 3M7AA 3VBFB 3TEZA 4N43A 4N53C 1CAWA 5FYIA 3WNKA 4XAAA 3HMYA 3CJIC 4FQ4A 2E6VA 3NQHA 4ITCA 5CZKA 4YVSC 3UJOA 1BVVA 1OXCA 4QU1A 1JZ8A 2R0FA 3O5SA 1XYOA 5F5IA 2RJLA 4YG3A 1JYVA 2K0GA 4DOUA 2MEV1 3CNAA 1IS6A 5JLVA 3C2UA 1RXGA 3LQCA 3J8F3 1AYM2 5CFCA 2DVGA 2BBAA 1NLRA 1LOAA 4UYBA 3VV1A 5E8AA 5F9TA 3MW2A 2Q30A 1EV12 2CGNA 5A33A 3GALA 1SFNA 3NNLA 1LHNA 3FBMA 4F3JA 2JKBA 1B35C 4K7JA 2BNNA 3LEKA 1N3OA 1RUD1 4PI0A 3C3VA 5KC5A 2HWB3 3CQOA 3IN9A 3WP3A 3ZOIA 1MS4A 3FLTA 1SLCA 3FLPA 2YDEA 3C7OA 4R9AA 3ZXLA 1C3HA 4IQPA 2R063 1EPZA 4IE0A 1KRIA 1FPN1 1N47A 2VZTA 4H7MA 1MZ5A 5C5TA 1NG0A 4XW3A 5F2WA 1X8EA 2JE7A 4E2SA 3U11A 4CZSA 2ARBA 1WMEA 2WNVB 1OPOA 2YGLA 1IOAA 5FCCA 1RVF3 1OA3A 2VZOA 5FPXA 3U4XA 1O5UA 2VH9A 1W6OB 2XB6C 4ZU5A 2R0HA 3ZFFA 2H6CA 4HETA 1Q8OA 1HQNA 3GGLA 3WNLA 4W8JA 1W9TA 4IXLA 1SZBA 1W8TA 3PUHA 4W4ZA 5FQ0A 4Q26A 2TUNA 1OQ1A 3ELNA 2IVJA 3WF2A 1WLTA 3OGRA 3DYMA 4HKLA 1R083 1VRH3 4W50A 4WV8A 1JMUB 1UY2A 3S0MA 2NYYA 5HCFA 1R093 1GWLA 1NCQA 1RJ8A 2D5FA 3KD4A 4NPLA 2P3KA 4YFWA 4BB3A 5FPAA 5J36A 1A6CA 5LBFA 4XBNA 3BU0A 3SKVA 2X29A 3D3AA 5IK4A 3R4SA 1CN1A 5CFDC 2EVXA 3HOBA 4YWAA 4AWDA 3T3YA 4SLIA 5C3OA 1GP6A 4K1ZA 4R9DA 2CDPA 1Y3TA 2QCSB 2ZX1A 4KU7A 2XLFA 4CDWB 2J1TA 3POBA 4CCEA 1MS9A 3CBNA 4D94A 1QNYA 3H8XA 2WN3A 2Y26A 4QKDA 4GA9A 3TOJA 1KQRA 4CP9B 1XNDA 1XXNA 3PURA 2A71A 4S2DA 4AI0A 2R30A 1AX1A 3GXUA 4IERA 3GHMA 4YPJA 5A7SA 2Q0AA 2NMOA 1COV2 1IHMA 5GLZA 1OC1A 2WZEA 1ZA7A 1PK6B 4BJ0A 2L9LA 1O3TA 1G9CA 2ZGUA 1E5IA 1GICA 1OUXA 1TVGA 1WW7A 2WFF2 3D6EA 3UL2A 5C4WB 4I01A 5GALA 3H8OA 4DXRA 2VMFA 4FP3A 1T6BX 3ACGA 1V6MA 2WO2A 3POFA 4Q4V1 1S0BA 5ANNA 2OQ7A 1JUHA 3B00A 5FZKA 3BKZA 1PGSA 4FFGA 3U37A 4LQRA 4E4DX 2E53A 3WD5A 1R1A2 3UYJA 5E16A 4S2GA 5DG2A 1RUJ2 4QB6A 2P37A 4DZGA 4OHXA 2EICA 2X53S 4LUMA 3VBSB 5FY0A 5LA1A 3UJQA 4DQAA 1PVXA 2QUOA 5DQ0A 4BQ5A 5FO9B 5HPOA 4LBOA 3J8F1 2J1SA 1RYYA 4AOCA 4BM8A 5BNQA 1JZ6A 4R9CA 1FMD2 3JBG3 4JHTA 3WR0A 3LPGA 5KHGA 1LHOA 1O8PA 1GZ9A 5FLIA 4MXWA 4Y26A 3B02A 1EUUA 3R0RA 1AVBA 4QX2A 4EV0A 5FYTA 2D5HA 2FMDA 5EJ1B 1W9YA 1H9PA 1ZZCA 3FMGA 3K77A 1FXZA 2VZPA 3MLKA 5FJKA 4CDQB 2R061 1BQPA 2AUYA 2GN3A 4XUQA 2LTNA 1WCQA 2BPA2 3ENRA 5GM0A 4J6GA 1LTEA 1UCXA 2LM3A 3IPVB 5JVVA 3WXPA 4A2UA 2FCTA 2BBVA 1X7NA 1UKGA 4NIIA 2ZEYA 4Q0PA 5FP9A 4CTEA 2W08A 4RR3B 1RVF1 5CBLA 1PO22 3ME2A 2RS13 1LECA 3ACFA 1L3JA 5FBJA 5F2SA 2CL2A 1RMU3 4O61A 4LPLA 2DURA 2VUDA 4IV3C 2E33A 5A3PA 3K51A 3BPSA 5IAXA 1AX0A 3N7KA 2R49A 1VBD2 3S7EA 1F31A 1FATA 3NAPB 1OI6A 1F5FA 2GH2A 5GLUA 1RUE3 1R081 1ND2A 2GH8A 2VOTA 3ON7A 4UFKA 3RZJA 2DVAA 2WA3A 1OD5A 5J96B 2PHTA 3MV11 3PL0A 1YHFA 4HK8A 3LFIA 3IWZA 3QACA 2WS93 2VZUA 1O6UA 2B9VA 5KHJA 2JEMA 2XG3A 3T2TA 1G9DA 2IXKA 2JG8A 4RGAA 2UY8A 3M3IA 2DFCA 4ZY9A 4CCCA 4GMP3 3ZXKA 4D8MA 5FY9A 4AQ6A 4EZHA 2A6XA 4BIOA 1X33A 3ZKUA 1MEC3 3K4DA 5A6YA 2ZOEB 1AR92 3JU9A 4RHV2 2CWMA 2G9GA 2WT2A 2WFPA 2WC2A 3A21A 1OFNA 4LA3A 4XDOA 4BK4A 5L9VA 3O12A 4KBBA 1N1SA 3WHUA 3F2ZA 3AXEA 3AVSA 2LS6A 1WZXA 2WRAA 2J7MA 4PF1A 5F5CA 4BU2A 1ZA4A 1WW6A 1XBFA 4RN5A 3VDDA 2CTVA 4A3XA 2FDGA 5H9RA 1UMZA 2R1DA 4BLJA 1E5RA 1HQWA 3J7LA 3H3UA 4XUOA 3RYRA 4AW7A 2QQLA 4A41A 5JZGB 4GH4B 4Q27A 5FO7B 2ZGSA 3IDCB 5FZHA 4IESA 5FTTC 3VBUC 2ADDA 4ASKA 1SBDA 2GN7A 1NQJA 3RYPA 3AFKA 4CDUB 1ZM1A 3BN6A 3Q8FA 2YU2A 5FYVA 1BCXA 1WA4A 4Y1XA 1O4YA 3IIIA 1W6PB 3S57A 3MIHA 4YW2A 3A23A 4OQ9A 3ZYIB 2PHUA 3MYXA 3SCGA 2DBNA 3WP6A 5A32A 4XETA 5FY7A 4CA9A 1S0JA 4QX3A 3JBG1 1U12A 4AVVA 5I91A 1KGYA 1YC61 3KV6A 2V5DA 2VXRA 5FUIA 2J1UA 1QMJA 1W8ZA 3VB9A 1QY4A 4E4HA 4M3CF 4OQ8A 2W2IA 3FFQA 1TQ5A 3ZDVA 3O1VA 1APNA 1SLAA 3AP4A 1QJY1 4L92A 2DTWA 3RZZA 5ACA3 2A75A 2A6YA 2XBO3 3CEWA 1I1EA 5IHRA 1PZ9A 3QCWA 1J1TA 4YW5A 3I3MA 3RI8A 1J83A 1W6QB 2VZRA 3NKTA 2A3XA 1SG3A 1ZBE3 5E6HA 4EN9B 3KZ4C 2FDFA 2PFWA 4K6BA 2RS11 4IV1C 3M3EA 5CG9A 1US2A 3V64A 3WUDA 3W5MA 4DEQA 1C5IA 4MHUA 4D7SA 2DUPA 3GCXA 4D69A 2WNUC 2YPJA 2GP3A 2JDZA 3VBOB 4FOWA 3BTYA 4Y3OA 1ASJ3 2HWE2 1LOFA 1RUE1 4FFHA 2RMU2 2RHPA 1Q5OA 2JG9A 1TNRA 4HMZA 1CAUB 4GAZA 2GNTA 4KMQA 2ORXA 2V5YA 1EAH3 4CE8A 1KFXL 1OF3A 1F8VA 2QJVA 2WR9A 4K20A 2WS91 4XHBA 4CCOA 1LHVA 1NXMA 2XJTA 3AYCA 4HN1A 5T5OA 2LRPA 4GMP1 4MGYE 2VOVA 1W6MB 2RR11 2C6SA 2WABA 3SCHA 4CUAA 1MEC1 2LROA 1HV0A 3KSCA 2V4VA 1W2NA 5DMYA 3BYWA 2BU9A 1OVPA 2MEV2 1BBT3 4LLFA 1W0OA 2HLEA 4GWIA 3WG1A 1LOCA 3JD73 4XJWA 4CRQA 1VMFA 2C9KA 5BNNB 1CAXA 5BNOB 1WLDA 5APAA 1ENSA 1LOGA 5HCBA 4NN0A 3I8TA 1W3VA 3KWVA 3EJKA 4AI8A 3NNGA 4MZUA 5BV6A 4LHNA 4J1XA 4CUBA 1NY71 1O4TA 2RS32 4FOQA 3V0AA 2FZ1A 4GULA 4M0NA 5LA0A 1IG3A 3I3BA 4Y1ZA 3WLUA 2JECA 1RUI3 2D6MA 2OX0A 4QPIC 4QPWA 4CUGA 2P6HA 4K1YA 3GNEA 1FNYA 3POEA 1UZZA 4WBBA 1HRV3 2ZXQA 3KT7A 5D8AC 5HXVA 2WNVA 2IXCA 4XZUG 4LULA 4AFCA 1PX4A 5BPXA 1FOD3 5BUVA 4LHSA 1S4CA 1W6OA 2VQUA 2PQQA 1E5HA 4Y20B 1WLCA 2OUHA 3SLIA 5A7WB 1DQ0A 1VBB3 2NZ9A 1ZNPA 1OLME 3J26N 4JQTA 2EXKA 4YW7A 5DUWA 2VZQA 2ZHKA 3ZX7A 1BYHA 3WV6A 4CU6A 2GP5A 1JI6A 2JICA 3M2MA 3MUZ1 4HLTA 5FYUA 3FE5A 1BMV1 3OY8B 3VHNA 1C1FA 1CPNA 2BVBA 2XQXA 1SFYA 3D5OA 3O1PA 2LW8A 4OZXA 1QJU2 4QGMA 4QQ2A 1ZBA3 1AR63 2WYSA 3P3NA 1PMHX 2VVEA 4F7ZA 5EP9A 1D4M3 2ZAHA 5GZGA 4I09A 4YSFA 1GQGA 4KI5M 4Q5OA 1TMF3 1AUYA 4Y1VA 4AGRA 1JHJA 3WINE 3GDBA 4BXFA 5IVBA 3I97A 4ZU7A 3LDBA 2JE9A 2XBO1 1W8NA 5JSPA 3LKJA 5DZEA 4XUNA 2P17A 1X9PA 2ETEA 4NRQA 4UF0A 3AYEA 3FBYA 4FCAA 3TEYA 1OQDA 4PDWA 4DEVA 1DDLA 3CO2A 2KR2A 3H0OA 2Q8EA 5KR7A 2OT7A 5F39A 1W8HA 2HWF3 3VBRA 1NT0A 4AL9A 4JGZC 4HFSA 4XCAA 2BNOA 1LAJA 2XONA 2FBEA 3EQEA 1PK6A 4K8FA 3ILRA 1ASJ1 4S2FA 3PVEA 5CA6A 3HIFA 3VBHA 2BYVE 5DAPA 2WT0A 1SDDB 5FPVA 4NIAA 1UF2C 1LEDA 1SQ4A 1EAH1 3NW4A 5IVYA 4ES8A 5FUNA 3OD0A 2XDVA 3OEAA 5T52A 3ZXAC 4N90A 3LEGA 3VD3A 4K21A 4Q4V2 3RGBA 3I2IA 1WMXA 1V0AA 1G7YA 1MS8A 4HL0A 2W1QA 2ZKNA 2F17A 4A6SA 3PMEA 4JX0A 4KU8A 3ZFEB 3HWJA 5F5QA 1OOPB 4YG6A 4FSJA 1BBT1 2YMZA 4COWA 4FP2A 1K5MA 1W8WA 2E32A 2AREA 2VUJA 3JD71 1TEIA 1XC6A 1AXYA 1IS3A 3J8F2 3OCPA 4QQOA 3WNOA 3ZR5A 2ZGRA 4CU8A 5FDBA 1YRZA 1YUDA 2GZWA 2XH6A 1L7QA 5FYSA 5KWRA 3KGLA 1H6XA 1QQP2 3WUCA 4R4ZA 4CDQA 4NHKA 4SBVA 3GHNA 1OVSA 2WQZC 1PMIA 4DIQA 1RUI1 4QPGC 4MGZE 1Q8SA 5CKMA 1LULA 5H9SA 4OI2A 5FYCA 4GXLA 3B69A 2PHLA 4RR3A 5CVRA 2XVLA 5FKBA 1FOD1 1PGW1 1YWKA 3POJA 2BEOA 2VVDA 1RUH3 3T1MA 1DLLA 3DXUA 1G9FA 1G86A 2FDJA 1KD7A 2V73A 3NV2A 3WOGA 1GBGA 3ZFGA 3BUCA 1S0FA 4HVOA 4DO0A 1M06G 2WNOA 4BQ3A 5FMOL 4IE7A 1PIV3 1GLHA 2ZEWA 3TN92 2Y6GA 4AEDC 1WCDJ 3ACHA 4AVAA 3RG0A 4ISRA 3T4VA 4NAMA 3SNMA 2JDMA 2B4KA 4HT1T 1JU3A 5SV8A 3O1UA 4E8CA 2AH2A 1WGPA 4CEYC 1JZ7A 1ZBA1 1R082 2YV8A 5DDJ3 1D4M1 4LKSA 3D0SA 5C3QA 3NV3A 2NLRA 5LK5A 3PUIA 2WT1A 5C3RA 2B8MA 4I30A 5ERLA 1QXPA 3T0BA 4CCJA 4ORFA 3TEWA 3OSDA 3NKGA 1NCRB 3HBZA 1VBE1 4P5HA 5LZ6A 1BXHA 1U5YA 4D3WA 4UXAA 1A78A 2G1MA 3C7FA 2QDRA 1RITA 4QX7A 1GZTA 5HI0A 4HANA 1C28A 2IXHA 5JUVA 3AYAA 5JXGA 5GZEA 4M3CE 4NWVA 2C9AA 2HWF1 2YC4A 4Y33A 4COVA 2YFUA 4XFCA 5FY8A 4OULA 1N3PA 4N53B 4Q4W3 3RQ0A 3POSA 4QDQA 4YVSB 3CJIB 1AYN2 3VZOA 1VAKA 3ZSEA 5BY5A 1YFYA 3N9PA 3Q8EA 3QH7A 2YROA 2PXJA 2XGXA 3UETA 1NA1C 2BDRA 2CY6A 2D6LX 1KITA 3R4UA 1ZZBA 1MS1A 4NE9A 2ZZQA 4M01A 3WQ1A 5C70A 4NIDA 1HLCA 3E6DA 3TYJA 3K4AA 3I59B 1WCUA 2UYBA 3KF3A 1DG6A 1J3RA 2XL9A 4GKYA 1M4WA 4N43C 5GZCA 1UOBA 5LBCA 5I8SA 1OA2A 1B35B 3AKRA 2VBDA 1DIWA 1JN2P 4PT6A 1QH7A 2Y6FA 3I2GA 5GLVA 4H7LA 3O1RA 1DGRA 2CGPA 4JDOA 5DAWA 4CSWA 1ZVFA 2KA3A 3DXTA 1TG7A 5EQUA 3I3QA 4N7UA 4UW5A 2P6CA 5DXDA 4LBQA 1GZCA 1F15A 1RIRA 1YFWA 2XHKA 3NJXA 3WP4A 5CU1A 2XMLA 3JBG2 4MO3M 2P3JA 3LPFA 5K0UC 5JIAA 5FOBB 1H1AA 2VQ0A 1W6NB 3WNXA 1FI2A 1AL23 1C1LA 4LORA 4PCRA 4QXKA 1OUSA 1GP4A 4V2WA 4Y5SA 3T30A 5L7OA 2WZR3 1PNFA 2B5HA 2OS2A 1QJY2 3DKWA 3ZMOA 5C8WA 3MBWA 4QD2A 4XFAA 3SH3A 5FZOA 1N1YA 4Z82A 1XQNA 1UMIA 5F1RA 5F8PA 2QZ3A 3GF6A 3RSJA 1RUH1 1AJKA 3OYWB 1AXKA 2RG4A 3I7DA 5FIXA 3WF3A 2B39A 3WW2A 3HR9A 4PIYA 1S55A 3OUJA 4GIQA 5DUXA 5KXEA 2WSVA 3IB3A 2WO7A 4LTAA 2IXIA 3FLRA 4ZXKA 3S7IA 1PIV1 1IGOA 2Y6KA 1IZ3A 2VE1A 4XFIA 5L9RA 3ZYPA 4M0HA 4WVVA 5CFDB 5FO8B 1VP6A 5A7PA 4B7KA 2BP6A 3AK0A 2XXZA 2R043 2W39A 3DCQA 2D6NA 2GC1A 1NCQC 1SFPA 3BCWA 5DDJ1 3ROUA 4EWEA 5K4LA 1ZRDA 1YEWA 2VPVA 2BWCA 4LKFA 5FZ1A 5GZFA 3OBAA 1TE1B 3CZUA 3AMNA 3CJXA 3RZMA 2FZ2A 2ZX0A 1W6MA 4G3YC 2FCUA 5C33A 1Z0HA 2A6VA 4YM2A 3KV9A 1ENRA 3M3QA 4RD7A 2RR12 1UD1A 1AR73 2ZHMA 4RQPA 3OBRA 4Q1PA 1GWMA 5BNNA 3GBFA 3JB8A 2VG9A 4LHLA 4C1WA 1ZRFA 1S0CA 1J84A 2Z69A 5FREA 1DHKB 5FR3A 5I0UA 3IZOA 4Q4W1 2QTWB 2R072 3PLQA 4FO9A 2A70A 2QQJA 3HNBM 5FP8A 1XNKA 3KCXA 4L0PA 2HH9A 1RHI1 4HG6B 4DRRA 2VUCA 1K12A 1RINA 4EN0A 2QQIA 4EN8B 3SEPA 2Y0IA 1Y7BA 5F3CA 2VC9A 4M4RA 1VPHA 2E26A 3H1YA 1YQ8A 5CKQA 4EYUA 5C8CC 2Q1MA 5JCTA 2DWRA 3MLLA 5TSWA 3WP5A 2EA7A 4QM8A 5BYNA 4ZXEA 1ST8A 2YY1A 4Y20A 4OHZA 1PM4A 4BQWA 5F3IA 5FYYA 4Z1VA 1VBC3 3AZYA 1SMVA 2VOWA 1RUOA 4NIHA 4ISQA 4NO4A 4MUVA 5A6XA 1UYYA 1SHWB 4FOVA 1S2EA 3B94A 1VB2A 5H9QA 1QJX3 2MHFA 1BMV2 5IAVA 2JENA 1PZ8A 1AL21 1GV9A 1HB4A 2UYAA 2HWC1 3CMGA 4IV3B 2W95A 4CP1A 4F8AA 1YI7A 2E7AA 3IDBB 5A7OA 2SLIA 2XBO2 3KMHA 4XTPA 1O5LA 4BWOA 2Y0OA 4HOOA 2W87A 5FXVA 4CCNA 2VMHA 1YI9A 1ZZ9A 3O1OA 5IVVA 2YBKA 3RI9A 3HNYM 4YYOA 2VCCA 4LOTA 2HWD1 1CAVB 3H7JA 4QB1A 4U36A 3UGFA 4DUVA 1IPJA 3ZIWA 3B9IA 1TME2 1ND2C 3ZN4A 4Q29A 1ULCA 2BFUL 5IJRA 3ZPYA 3RZKA 2R041 3OEBA 5FZDA 5G04L 2AGSA 2ZGPA 2Z79A 3W9AA 3MIEA 5ABJA 4R9BA 5F3EA 4WVZA 3ES1A 5E1RA 2YC0A 3ORJA 2BGCA 5IWFA 5IFTA 3M3CA 1HN1A 1X50A 2ILMA 2JG8C 2ZEZA 4LO5B 4XUTA 3FN9A 3ES4A 3GYDA 1NOVA 4MV2A 4IEUA 1IS5A 3X29B 3UNPA 4HPKB 5FLJA 1Z7S2 1AR71 3POWA 3F95A 2DFBA 4C8DA 1JW6A 1W2TA 2J1RA 3VBUB 3NRUA 4XFBA 4RL7A 2ARXA 3ZN5A 1GSLA 1IG0A 1QWRA 2RE9A 2CGOA 1O7FA 5I0TA 4DFSA 4ZHNA 4P9JA 3VDDC 4P9XA 4BQ4A 2W47A 4YVWB 4B4RA 1L7RA 2ARCA 3B93A 2IXJA 4NHXA 4AGGA 2W9XA 2ZX2A 3KV5A 1X9TA 3PVNA 4YZ4A 1RUI2 4PLNA 5D1IA 4Q0QA 5A3MA 4MYEA 3ZSMA 3MPBA 1V9U3 3E5XA 2B45X 3HT2A 5FY5A 1VBA3 4DNYA 5SV5A 1RXFA 1VBC1 3ZYJB 5C9AA 3VDBA 2YG0A 4QM9A 3IAPA 3V0BA 1SLTA 1MQTA 4GALA 4META 4NRMA 2PHDA 4NHMA 3VGIA 2WLQA 2XJUA 2VNOA 2Q4SA 4BZ4A 3I3DA 3POGA 4QWNA 4NIGA 2DUQA 2UY9A 3ZSLA 2RS53 4LLOA 1DYKA 4XJZA 4CDXA 2A73B 5JSRA 1QJX1 1V00A 2P3IA 5C3PA 3BTZA 4KL1A 3PMSA 4FFIA 3LA7A 3WDTA 1HXS2 1YQ2A 3TWIA 1V6IA 3NNJA 4D0QA 3MGUA 3H9AA 4MGIE 4IV1B 1PVC3 1W2UA 2WO3A 3ACIA 1CESA 3HAGA 1CJPA 2YBPA 4Y24A 5FZ4A 2D7FA 3GM8A 4LBNA 4XPVA 2XJQA 1CZSA 1H8TA 2WNUB 4QHOA 5IT6A 1C57A 3ALQA 5E89A 2HWB1 4LK7A 1VBE2 1V6JA 1W8UA 3RPQA 1BEV2 2GMMA 2VZ1A 4AXOA 1OH4A 1UO9A 2K9ZA 3LAGA 2KM2A 4OVEA 4B4QA 4AI2A 3W20A 1AR83 5GZDA 2VY0A 1XRUA 1VE0A 4GKXA 4Y22B 5FLHA 4MADA 2JB8A 4XF9A 1DZTA 2FMYA 1UU4A 1DGWX 2O0OA 3I3EA 2PHRA 3LE0A 4IETA 4AAPA 4CCDA 5IVFA 4JAAA 5JOWA 1NX9A 4I2OA 4MGSA 4BK5A 3TRSB 5A3UA 5DZFA 1VMJA 4OLLA 4WM7C 1GWKA 5JXJA 2DCJA 1D4VB 1FV2A 2OZJA 3VLBB 1H2NA 4UFIA 2IXLA 1F2NA 1HDKA 1VRH1 4RGGA 1PGL2 3OGGA 2BERA 4KG8A 2GC0A 2W92A 4OFGA 1WD4A 1R091 1HIXA 1TZOA 1UY1A 2RDQA 1BZWA 3LIHA 4JKLA 4O7XA 2JXAA 3ZMNA 4LJHA 3VN4A 1XNTA 2X5IC 3BOWA 2NMNA 4UFMA 2F4LA 4QPIB 4A4AA 4AVTA 1V6KA 5D8AB 5A70A 2PYTA 5FPUA 4AI9A 1GOFA 2OW4A 2RV9A 3OGJA 2YHJA 3AL6A 4XJAA 1I3HA 2VNVA 2JDNA 1ZZ7A 4P9WA 4UI9L 3THTA 2ID4A 2J42A 1RUG2 3DPRB 3LGRA 4B8EA 4A3ZA 4IEOA 3ITQA 3ZN6B 2ET1A 3ZM8A 5IVEA 1HW5A 1ND3A 1S1AA 3PIGA 1Q8PA 4CUCA 2OXBA 3LIGA 4JTNA 2ZHNA 2AENA 4CCMA 4C0HA 2W1SA 4S2HA 4OUEA 4GB32 1U5ZA 4X6QB 5FZ0A 1V9U1 5ISLA 4Q4X3 1VBA1 1F9KA 4MOAA 3UESA 1POV0 2IFWA 1SPPB 2HBTA 3R05A 2C4XA 2XWJB 4XQ4A 4YW6A 4URAA 4XFHA 1RUH2 2FHRA 1MVQA 1OPMA 4Z8BA 1KXGA 1DGLA 2VULA 4Q0SA 2XJVA 4AHXA 2PLV3 2ZAAA 2CAVA 4EE2A 1GP5A 4N9IA 3UGGA 4DY5A 3HN1A 4DS0A 5FRAA 4OI0A 3W5NA 3OD4A 1VAVA 1EYBA 5AC93 4LBJA 2VZSA 3ABZA 4YVWC 2RS51 3D82A 1HB2A 2AEYA 1XB9A 1QXRA 3HVDA 4XC9A 5A3LA 5EFUA 4XQWA 1PVC1 4HSLA 2PMWB 1ENXA 1HB3A 1MZFA 1HJGA 5DABA 3O1MA 5C3SA 1WD3A 1RUF3 2X09A 2A5ZA 4LE3A 4RS5A 5FMCA 4YNIA 4JGZB 2E31A 1FYUA 1PO12 2EALA 2ZA9A 2GSYA 5F32A 4MXVA 5J98B 4B3NA 4XBQA 3B3QE 3D8CA 1RUC3 2DU0A 4LEJA 3CLPA 2QKDA 3NV1A 3B7MA 2XOMA 4QX5A 2BRTA 2WN2A 3VDAA 1WCSA 1JYIA 4B29A 1UPSA 4XMAA 2X10A 1AR81 3VBRC 1IKQA 5FY4A 1SEFA 4XJ8A 3URFA 1S0IA 4XFFA 5JOYA 4IE4A 5HCHA 3CZJA 3S6PA 4OYUA 3AL5A 4AI1A 4I3GA 2YYOA 4FTEA 1U0AA 1AYM3 1OFSA 1JU4A 1RHI2 1RMU1 4MG2A 3VBHC 4LO6B 2Z4FA 4NJ4A 5T5LA 1EV13 2ZABA 4WM8A 2BUKA 2G19A 4AR2A 4DXTA 2KXLA 2VMCA 3M3OA 1QJZA 5CG8A 1UZVA 3OF1A 5I0RA 3J7HA 4BQYA 4WVMB 1JOPA 3ZXDA 3USUA 2VW0A 4W6WA 1OHFA 3HNMA 1AF9A 3N9OA 3BTXA 3VBFA 3GZAA 2RM22 2DDUA
chains in the Genus database with same CATH topology
4LK7A 4LKEA 1W8TA 3ZYBA 4AL9A 1WZXA 1UOJA 4LK6A 1W8UA 2K46A 1GWMA 2LRPA 2WYFA 3ZYFA 1W8WA 4BQ4A 2JWPA 1WCUA 4CP9B 2VXJA 4LJHA 4BQ3A 4BQ2A 2LROA 3ORJA 4A6SA 4BQ5A 1OKOA 1W8ZA 4YW6A 1GWLA 4CPBA 4LKDA 1HN0A 2C24A 4LKFA 4YW7A 3UT0A 3F95A 5D21A 1GWKA 1L7LA 1WMXA 4CPBD 1V0AA 2KR2A 2O14A 2Q1FA 4CP9A 4YWAA 1W90A 3ZYHA 1OH3A 1W9FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LK7 A;  4LKE A;  1W8T A;  3ZYB A;  4AL9 A;  1WZX A;  1UOJ A;  4LK6 A;  1W8U A;  2K46 A;  1GWM A;  2LRP A;  2WYF A;  3ZYF A;  1W8W A;  4BQ4 A;  2JWP A;  1WCU A;  4CP9 B;  2VXJ A;  4LJH A;  4BQ3 A;  4BQ2 A;  2LRO A;  3ORJ A;  4A6S A;  4BQ5 A;  1OKO A;  1W8Z A;  4YW6 A;  1GWL A;  4CPB A;  4LKD A;  1HN0 A;  2C24 A;  4LKF A;  4YW7 A;  3UT0 A;  3F95 A;  5D21 A;  1GWK A;  1L7L A;  1WMX A;  4CPB D;  1V0A A;  2KR2 A;  2O14 A;  2Q1F A;  4CP9 A;  4YWA A;  1W90 A;  3ZYH A;  1OH3 A;  1W9F A; 
#chains in the Genus database with same CATH topology
 1HRI 2;  3KM5 A;  5KBF A;  4XHX A;  4CEW A;  3PVO A;  4QPG B;  4UBG A;  1K5M C;  1UYP A;  3J9S A;  4EJR A;  4G4F A;  5FZE A;  3UKT A;  4Y1U A;  4WZC A;  4XCB A;  3W59 A;  3B01 A;  4JDN A;  3LEM A;  4D6R A;  1AL0 G;  4HVQ A;  2IZW A;  1O59 A;  4O9E A;  3RMY A;  1HN0 A;  2K2S A;  4A42 A;  3MPP G;  2E7Q A;  3NNF A;  4YAR A;  2ZKL A;  4QT6 A;  3ZSJ A;  2D6P A;  2WWS A;  4XF1 A;  5JI7 A;  2D97 A;  3AP7 A;  3HD8 B;  2HWC 2;  4AED B;  3K2O A;  2O14 A;  1UY3 A;  1U5X A;  1AX2 A;  3EBR A;  5T55 A;  4OHY A;  4HSJ A;  3O1S A;  1OA4 A;  2DTY A;  3IT8 A;  3CDZ B;  1RUD 2;  1UAI A;  4Q4X 1;  3N36 A;  2VTF A;  4CEY B;  3KCC A;  3ZFG C;  2C1F A;  4YFZ A;  1XSQ A;  3LDK A;  1WMD A;  1NZC A;  5FYB A;  3RFR A;  5LWB A;  2DCK A;  2WZ8 A;  1FPN 2;  4DY3 A;  2PLV 1;  2D3R A;  1QGL A;  3NJV A;  1EPW A;  3FUO A;  5JMC A;  4M3C B;  5A6Z A;  5LK7 B;  1WW5 A;  3AMM A;  3LD8 A;  3DPR C;  3MHZ A;  2HWD 2;  1MS5 A;  3S30 A;  3OGS A;  5K7P A;  2D43 A;  2NP0 A;  1DZQ A;  3MIG A;  3S5Q A;  3OPZ A;  4TLF A;  2R04 2;  2D3S A;  1G6N A;  2BGP A;  1UZ0 A;  3AP9 A;  4HXC A;  4Q4Y 3;  1RUF 1;  2VZ3 A;  1COV 3;  2DF7 A;  5HXM A;  4XBL A;  3GBW A;  2QNK A;  4YGC A;  4UW6 A;  3WVJ A;  2VR4 A;  5BNP A;  1K3I A;  1YJL A;  4AQS A;  2WFF 3;  1RUN A;  4MLO A;  5H9P A;  1NA1 B;  3D4K A;  4JCK A;  3VZK A;  1RUC 1;  3VKM A;  5ACA 1;  4LT5 A;  3BU7 A;  5EJ3 A;  2IUW A;  3UKN A;  4AF9 A;  5IFP A;  3PVB B;  4O65 A;  1XU1 A;  2LAL A;  1R1A 3;  2WL1 A;  4Z92 B;  3N9Q A;  1YLL A;  1RUJ 3;  3BOP A;  4R4X A;  4YM3 A;  3WDV A;  4CEW C;  3J7N A;  1GKB A;  1CAW B;  4N43 B;  4XDQ A;  1DQ4 A;  5CB7 A;  4CDW A;  1ZBE 1;  4Z07 A;  4FBF A;  4NUB A;  5J7M A;  3FHA A;  4XTM A;  4CP9 A;  1BHG A;  1N1V A;  1W90 A;  3C7E A;  1AYM 1;  2G9Z A;  1NKG A;  4CU9 A;  4Y1Y A;  3ZYB A;  4BME A;  1FMD 3;  4I3P A;  2XLA A;  5I8Y A;  1EV1 1;  1REF A;  2I74 A;  4C90 A;  2V72 A;  1W06 A;  3PJY A;  2BTV C;  3U07 A;  1UN1 A;  4Q2F A;  4CXW A;  2P4E A;  5CAZ A;  5A33 B;  5A3W A;  5ANQ A;  5C4W A;  4FPO B;  5K0U B;  3A7Q A;  1OQE A;  3AJZ A;  3N3H A;  3U78 A;  3ZDS A;  4B7E A;  4D7T A;  1W03 A;  2BZD A;  5B4N A;  3TNQ A;  4OI4 A;  2Q1Z B;  2D3P A;  4QHB A;  4ZON A;  2QVS B;  4UFH A;  3ACL A;  3NL1 A;  3H1W A;  2VVF A;  3IBM A;  4A45 A;  4AHZ A;  4BIS A;  1JZ4 A;  3WG3 A;  1PO2 3;  1CPM A;  5LBE A;  4CVU A;  3VBS A;  1MPX A;  3H50 A;  1E5S A;  4B1M A;  5JOZ A;  4IV1 A;  3FZ3 A;  1J3P A;  2VW1 A;  1BK1 A;  2WJS A;  2WKK A;  5JR2 A;  3LFM A;  1LRH A;  4H3W A;  1ENQ A;  1VBD 3;  3NO8 A;  3MV0 1;  3QBQ A;  4P9L A;  5JAX A;  4LOS A;  2WNU A;  3I2D A;  5F7U A;  5FQ0 B;  5L7O C;  1GNY A;  4PHZ A;  3HQR A;  3WW1 A;  1EP0 A;  4FXK B;  5LEJ A;  2VMD A;  1UKR A;  2AAC A;  3U4S A;  5B4X A;  1VJ2 A;  2N7G A;  2I45 A;  2A3W A;  2HWB 2;  1ZRE A;  2P2K A;  3OUI A;  1CWP A;  3IPV A;  3KQ4 B;  3MI8 A;  3U14 A;  3H8R A;  5FMB A;  3WSO A;  1NCQ B;  2Q8O A;  1HRV 1;  2R06 2;  3C7G A;  4R8H A;  1REE A;  1QOS A;  1W9F A;  1Q3E A;  1UIJ A;  2XKP A;  2YU1 A;  5FMD A;  3SCF A;  5FP4 A;  1T6G C;  5F6L B;  2P1B A;  1VBB 1;  1UQX A;  1RVF 2;  1AR9 3;  4RHV 3;  3ZYG A;  4ASL A;  1JZ2 A;  3DYO A;  1YCI A;  1S2B A;  3THC A;  3LF7 A;  5LAT A;  3NST A;  2W1U A;  2BNM A;  2UWC A;  1AZD A;  4U2A A;  3NAP A;  1Q8Q A;  3MUY 1;  1ULG A;  2ZAC A;  3I2H A;  3JCI A;  4IND A;  2R6Q A;  4Q4Y 1;  1PX3 A;  1COV 1;  3T1L A;  5BNP C;  4IUG A;  5F3G A;  2ZEX A;  1LOB A;  2WNE A;  3VKO A;  1AR6 1;  1NQD A;  4FPG A;  4A6O A;  1VRH 2;  2WFF 1;  4COU A;  2ZGM A;  2ET7 A;  4BOW A;  1GYK A;  4C1X A;  4PBO A;  4QKB A;  3G6J B;  2XUE A;  4LKE A;  1TMF 1;  2BGO A;  4CXX A;  1R09 2;  3HPN A;  1AHS A;  3BAL A;  4RQP C;  4P5Y A;  1JOJ A;  2CSG A;  3KGZ A;  5D2A A;  1B09 A;  4JGY C;  5A7N A;  5C8C B;  1R1A 1;  3LA3 A;  5I8T A;  1XNC A;  4MGT A;  5IVC A;  1RUJ 1;  5A6Q A;  4XJ9 A;  3U10 A;  3N7M A;  4MHR A;  2R16 A;  2MNG A;  1JXN A;  4BQ1 A;  4HVR A;  4X8N A;  4I02 A;  3ZN6 A;  1D2Q A;  1X82 A;  2WAO A;  1UX7 A;  2VGD A;  4JRA A;  1CJD A;  4XIK A;  1FMD 1;  1DQ6 A;  3W58 A;  1MR5 A;  1LOE A;  3WNN A;  5GKA C;  4AGV A;  4FPE A;  1NAE A;  3OBZ A;  1LKN A;  4L9B A;  2W0X A;  3ZYH A;  1XJA A;  2RDR A;  1W05 A;  3WDW A;  3ATG A;  3CL1 A;  5CKN A;  5JZG A;  4XMI A;  4GH4 A;  2PAE A;  4MXW B;  5LCW L;  4NAO A;  3PUA A;  2EXJ A;  3O0V A;  4KWU A;  4QX1 A;  5L9B A;  3IKW A;  1QDO A;  2VW2 A;  4PLM A;  4AHY A;  2PTM A;  4CDU A;  1OKO A;  4I0A A;  4Y5T A;  4K8R B;  4XFG A;  2VD7 A;  1RL3 A;  4DXZ A;  1W6P A;  1PO2 1;  2QQU A;  3BTA A;  2VTX A;  1HKD A;  2BW8 A;  2WII B;  2ENR A;  2GC2 A;  1OLR A;  2B9U A;  2BVV A;  4Q8K A;  4KWJ A;  5CFC C;  4H14 A;  3G7D A;  4XXP A;  1VB4 A;  4JGZ A;  4BHP A;  3AKT A;  2F4P A;  2HYX A;  2AZ5 A;  2HWE 3;  1W9S A;  2RMU 3;  4MX3 A;  1G8W A;  1WLW A;  3B9C A;  2ZX3 A;  4LIV A;  2TEP A;  3K75 B;  3PHM A;  5FZ9 A;  1ND2 B;  5A7Q A;  3T0D A;  2EF6 A;  1Y9Q A;  5HV0 A;  5LAS A;  5A3N A;  5HCA A;  1O3Q A;  1VRB A;  4QDR A;  2DVF A;  1W6Q A;  1W3X A;  1XE0 A;  4COY A;  5FJH A;  3RS6 A;  1NZI A;  4KGQ A;  5LRR A;  5HV4 A;  4KWK A;  5LEK A;  2QQP A;  4ZU4 A;  1AR8 2;  2VOX A;  2I2S A;  2JG8 B;  3D0J A;  5D21 A;  2ZGN A;  2QQM A;  4YZ5 A;  4NHY A;  2ATF A;  5EJZ B;  3ZIX A;  1AR9 1;  2B46 X;  2GMP A;  3M70 A;  4RHV 1;  3ZFF C;  3ZVX A;  4IDZ A;  2RS1 2;  1ODM A;  1BVP 1;  2PEL A;  1J1L A;  2Y8K A;  1LHW A;  3RRD A;  3UGH A;  3ZXG A;  2A6W A;  1LGC A;  1LGB A;  1SBE A;  1RMU 2;  2Z5W A;  4PLO A;  2Q8C A;  1XE7 A;  3VBO A;  5ABJ C;  3GCW A;  2DVB A;  1SLL A;  2JDU A;  1MVE A;  3AX4 A;  5CYY A;  2OUJ A;  3KCY A;  2W46 A;  4Z2W A;  5FXZ A;  3KHC A;  4IEX A;  2RS3 3;  5EV7 A;  1CAU A;  2BOJ A;  5KC6 A;  4QGN A;  3OBT A;  1RUE 2;  1CX1 A;  4OUS A;  1S2K A;  3VDD B;  5J1X A;  2ZGQ A;  3V65 A;  4BQX A;  3V56 A;  1YJK A;  2HJI A;  4YRD A;  1RC6 A;  3WX5 A;  4Y4R A;  4TTG A;  2CWS A;  4W65 A;  4B4P A;  4RFT 0;  1YQ5 A;  2WS9 2;  1H9W A;  4P9Y A;  1D7P M;  3N9N A;  3SH4 A;  1TNF A;  4EN6 B;  3W21 A;  3E6B A;  5FMO S;  2AYH A;  4OMD A;  3KVB A;  2JDY A;  4D6S A;  5DUV A;  3DYP A;  3L2H A;  1OLQ A;  3I4I A;  2IFR A;  3SQO A;  3VD7 A;  4AFB A;  3AXD A;  1OD3 A;  4QB2 A;  5KHK A;  1UU5 A;  1MEC 2;  3MZH A;  4E4Z A;  4RA0 A;  5BNO A;  1POV 3;  3P1I A;  4XF3 A;  3AKP A;  2WWJ A;  4FPH A;  4N9H A;  4Q8L A;  4BLI A;  5J37 A;  5LBB A;  2W91 A;  3P6B A;  4JRL A;  4K9S A;  4BCU A;  2YUE A;  1QJU 3;  1ZZ6 A;  1H2M A;  5EIY B;  2A1X A;  4I0W B;  2XWB B;  3P5B A;  1U5I A;  5FZ6 A;  1EUT A;  3GJA A;  4JDM A;  1QU0 A;  1T2X A;  1Y9M A;  2HEV F;  1GQP A;  5C9A C;  1NY7 2;  3E6C C;  3CHX A;  1F5J A;  1KS5 A;  3HBK A;  4YZ3 A;  2ADE A;  4OHV A;  3ZLI A;  1UL9 A;  3Q8A A;  4AEJ A;  1MQT C;  4FFF A;  3MDP A;  5EYX A;  3I54 A;  4DUX A;  2WYF A;  4KBZ A;  5LW9 A;  3K46 A;  1QOT A;  3B5L B;  3NJZ A;  5FPB A;  4PIX A;  4X6R B;  5A7W A;  2KD7 A;  2NPI A;  4FPJ A;  3Q9O A;  3J7M A;  4IEQ A;  5FAX A;  3EYP A;  1LCL A;  5FZL A;  2R7E B;  3MO4 A;  3Q8C A;  3WZ1 A;  1AJO A;  1DLC A;  4CDX C;  4ZKT B;  3PUS A;  1YFX A;  4I0B A;  1LU1 A;  4XUP A;  5F6K A;  2A3Y A;  4NPR A;  2G4I A;  3QLQ A;  5EWS A;  3OY8 A;  1HJF A;  2H6B A;  1C5H A;  1QHD A;  4QXC A;  3RVH A;  1UY4 A;  3UK9 A;  3VHP A;  2HWE 1;  4KGG A;  2EXH A;  2PA7 A;  3SH5 A;  1H8T C;  4KNC A;  4M00 A;  2XR4 A;  4ARX A;  3OG2 A;  5FYH A;  1I5P A;  1URX A;  3A0N A;  1OH3 A;  2ZHL A;  2HYK A;  2VNR A;  1GFF 2;  2VOK A;  3T4H B;  2WZR 1;  3HQX A;  4WM7 B;  1SCR A;  2WDB A;  4Q4V 3;  2I07 B;  1Q56 A;  3WDY A;  5ACA 2;  2P5B A;  5T54 A;  3WW3 A;  1H8V A;  3AMQ A;  3ETP A;  4QMA A;  3OJB A;  2WAA A;  4QDS A;  4CPB A;  1DQ1 A;  2TNF A;  4Q0V A;  4ET7 A;  3VUO A;  1ZBE 2;  1S0E A;  3WY6 A;  4CYD A;  4IEZ A;  5CAD A;  3QD6 A;  2X5I B;  4ES9 A;  2Y6L A;  5IK7 A;  2A7A A;  3WEZ A;  3DV8 A;  3IAQ A;  1H30 A;  1L7L A;  2J1A A;  3LSE A;  4IEW A;  4AG4 A;  5F37 A;  4E9K A;  1DYO A;  5J48 A;  2NQY A;  2HBU A;  1QQP 3;  2RJK A;  3WT3 A;  1I6X A;  1CAX B;  4V2V A;  5K0U A;  2RS3 1;  4MVT A;  1UYX A;  2HEY F;  1C8M 3;  5L36 A;  1ASJ 2;  3AZX A;  4IEY A;  5FXX A;  1PHM A;  3N7J A;  1I9R A;  4EZ4 A;  3V0A B;  2Q5T A;  3EB7 A;  3L2Y A;  2W68 A;  2W94 A;  2XVG A;  1EAH 2;  2E51 A;  1PZ7 A;  1SLB A;  2AR6 A;  3O7O A;  1DU3 D;  2VAU A;  4L97 A;  1JBC A;  2DUO A;  4XF4 A;  4LE4 A;  2OYZ A;  1D0H A;  2UWB A;  3ZFE A;  2Y34 A;  2GME A;  4XDP A;  2DBI A;  1OOP A;  4XAB A;  4AQ2 A;  3T08 A;  3UT0 A;  1D2S A;  3LEI A;  2D44 A;  3N35 A;  4P9I A;  1H1M A;  5A1F A;  5C7G A;  4CPB D;  3TN9 3;  1UX6 A;  4XAE A;  5AFE A;  1XNB A;  3MID A;  3Q8B A;  4WZF A;  1POV 1;  4NHL A;  1LJ7 A;  4FTS A;  1UZW A;  1DFQ A;  3VL9 A;  1BBT 2;  4XUR A;  1W2O A;  5FZM A;  3T09 A;  5FUP A;  1ND3 C;  3JD7 2;  3ZPO A;  5IK5 A;  1QJU 1;  2Y64 A;  3FHI B;  3E5U A;  2X05 A;  4JKK A;  5KXB A;  4YM1 A;  1DZR A;  4GD4 A;  2OVU A;  3DL3 A;  3S5A A;  2FQP A;  4FPY A;  5JR7 B;  2ZJC A;  1DF0 A;  1GUI A;  2C0Z A;  1R1Z A;  3LOB A;  3HT1 A;  1MZE A;  3OGV A;  4ZS2 A;  3SHR A;  1HRV 2;  2XLG A;  5FZB A;  4D6Q A;  2WIN B;  1FOD 2;  1PGW 2;  1N3Q A;  3IIA A;  4QPY A;  2VCA A;  2XJP A;  3AB0 A;  5JWP A;  4AE2 A;  3NMB A;  2FDH A;  1VBB 2;  4UF0 B;  1DQ2 A;  1ZZ8 A;  5JOX A;  1G9B A;  2VL4 A;  1XYN A;  2DYC A;  2EIB A;  2WZP P;  4TSV A;  4PDW B;  4CP0 A;  5HBA A;  1YQC A;  2JWP A;  3AM2 A;  1AYN 3;  2W52 A;  4YGD A;  3KVA A;  3MLJ A;  2PAK A;  3VBR B;  4IGO A;  1W0P A;  4RS5 C;  4UWD A;  4HN0 A;  1LU2 A;  5FK8 A;  5IW0 A;  3RJR A;  3VKF C;  3KHB A;  4Q4Y 2;  1STM A;  3WDX A;  2QQO A;  2QQN A;  4K3U A;  4LKD A;  3PTY A;  5L73 A;  5FP3 A;  4ATF A;  4AFD A;  3NNM A;  4DB5 A;  1ZBA 2;  1AR6 2;  1POQ A;  2PN5 A;  3VBH B;  5T5P A;  4BMB A;  1D4M 2;  1NCR A;  2ZZJ A;  1QJE A;  3NJY A;  5C8C A;  1TMF 2;  4LO4 B;  4LXL A;  1YYN A;  1W8F A;  2VBB A;  5GJ6 A;  4AVB A;  1JH5 A;  5LRS A;  1CX4 A;  2PHX A;  2VQA A;  2C5D A;  3GZE A;  3H3Z A;  1KFU L;  2QZ2 A;  4OI1 A;  1V6N A;  4ZPI A;  3OUH A;  1GR3 A;  3RWN A;  2OA2 A;  4E27 A;  3JQW A;  2DCZ A;  3KT1 A;  3HEI A;  4PI2 A;  1Y43 B;  3EMR A;  4N53 A;  1QXJ A;  4H2A A;  4QHZ A;  3CJI A;  4YVS A;  3WNM A;  3PU8 A;  4YW4 A;  2HWF 2;  4M4P A;  4WM8 C;  5KXD A;  4IE5 A;  1JTZ X;  4UOJ A;  1K5M B;  3KLS A;  3VL8 A;  2J1V A;  1XYP A;  5JMO A;  3RWK X;  1QQP 1;  4E2Q A;  5C71 A;  4NPM A;  1WW4 A;  1LOF C;  4UW3 A;  3TB0 A;  5IUQ A;  1P8J A;  2JG9 C;  3GJB A;  3SXW A;  3ZYR A;  1C8M 1;  4QXB A;  4EN7 B;  5EZW A;  4GJY A;  3I59 A;  1OF4 A;  4TYS A;  2W1W A;  3ASI A;  3AZV A;  1QJY 3;  3ILN A;  3VBF C;  1QNW A;  4IW3 A;  1OUR A;  1VMH A;  1I5Z A;  1PM7 A;  3FHQ A;  1W04 A;  3NWK A;  4BPZ A;  3JQX A;  2GU9 A;  1B35 A;  1OKQ A;  2DCY A;  3BIW E;  4LBM A;  4CXY A;  4GWM A;  1RGS A;  4KQ7 A;  3RZH A;  1SLI A;  1UWW A;  4HK9 A;  1QJF A;  1RTV A;  4NOT A;  3GZU C;  2EAA A;  3K3N A;  2WUH A;  2XVK A;  1LGN A;  2CV6 A;  3TN9 1;  3ZFG B;  1VAM A;  2YBS A;  4NVP A;  3LCP A;  4DMI A;  3RMX A;  5A3T A;  1ULE A;  3AC0 A;  2BFU S;  2QFE A;  3FJS A;  2PAM A;  4DUW A;  3O0X A;  3I2O A;  3BB6 A;  1XSR A;  2YXS A;  3LB9 A;  1W6N A;  2XL7 A;  3APB A;  5GLW A;  3ECQ A;  5LY2 A;  4TWT A;  1UXZ A;  5EPA A;  5KHI A;  1UY0 A;  4G9S B;  4FXG B;  4EQV A;  4FTB A;  4OHW A;  2QE3 A;  5FZ3 A;  1GZW B;  3FX3 A;  3H7Y A;  3WF1 A;  5AVA A;  4D7Y A;  4P9G A;  5B2G B;  4AYU A;  3TNP B;  2WNV C;  4AZZ A;  4JTO A;  3M8L A;  3VDC A;  3OYW A;  3IMM A;  5C5U A;  1PNG A;  3PNA A;  5IYY A;  2XUM A;  2RR1 3;  4FOY A;  2P3Y A;  4BYY A;  5JI9 A;  2JX9 A;  3OPW A;  5DZG A;  4TXW A;  1NYW A;  3N9M A;  4AEM A;  4GJZ A;  4UW4 A;  2ZCW A;  2JDH A;  2PQS A;  3DEM A;  2Y33 A;  4AVS A;  1BK0 A;  1K45 A;  4R52 A;  2R07 3;  5CFD A;  3E1F 1;  2ZPX A;  1AYN 1;  2JIG A;  1IQD C;  1PIV 2;  2NM1 A;  2AEZ A;  3I2J A;  4EWD A;  2GC3 A;  5CNA A;  4JZR A;  1IKP A;  4CEW B;  5FZC A;  3SEE A;  1H4H A;  5BNP B;  4BXS V;  4ASM B;  3HJR A;  4KG0 A;  4L8Q A;  3AP5 A;  1UZY A;  3AVR A;  1CD3 G;  1UMH A;  5K8S A;  2EAK A;  2BQP A;  5DDJ 2;  3UKV A;  3ZXF A;  2XJR A;  5KXC A;  1JUI A;  2EID A;  3O14 A;  1PMJ X;  2R1B A;  3CKH A;  2FDI A;  5T3N A;  1G9A A;  3ZXE A;  5FBZ A;  4QU2 A;  3BIE A;  3MIF A;  4UFL A;  4CDW C;  3USS A;  1W0N A;  3PDQ A;  4RFR B;  2TBV A;  4PDW C;  5A1A A;  4AEK A;  1OSG A;  4AAX A;  2Y38 A;  3THP A;  4YZ2 A;  1MS0 A;  1NUK A;  1QDC A;  1CON A;  1O91 A;  3NV4 A;  1QOO A;  2CHH A;  2H0V A;  3IDE A;  1A8M A;  2XKO A;  1ODN A;  4IEV A;  4BDV B;  4Q0U A;  1PK6 C;  4Q4W 2;  1GMM A;  5FZ8 A;  4JKM A;  3N4M A;  3VZN A;  1F35 A;  3WCR A;  3K3O A;  4LBQ B;  3RYK A;  2WBK A;  4XE9 A;  3TBD A;  1EY2 A;  2D98 A;  2R32 A;  3AKS A;  3WDU A;  5C4W C;  3VZL A;  1LHU A;  4FPL A;  2LUW A;  5BXX A;  3WNP A;  3JZV A;  4YG0 A;  4L99 A;  2ORZ A;  1FX5 A;  4NRO A;  1UU6 A;  3AJY A;  3AYD A;  2BOI A;  3JB4 C;  3EXU A;  3THD A;  3OPT A;  5JPM B;  5L7O B;  1YXW A;  1YQ6 A;  4OMC A;  1DQ5 A;  1QKQ A;  4XVH A;  3MFC A;  3T2Q A;  3U1X A;  1ULD A;  5FZO B;  3VZJ A;  3MIB A;  3VBS C;  2GDF A;  2VUA A;  3DGT A;  1C8N A;  1W9W A;  4W6X A;  3P3P A;  1K5J A;  5FPL A;  4LIU A;  3ZYF A;  4CP2 A;  4LIT A;  3KB5 A;  2JD9 A;  1WCK A;  1V6O A;  2YFZ A;  2P34 A;  5I0S A;  5FFO C;  1TME 3;  1LEM A;  2ZGL A;  1QF3 A;  4CDQ C;  5DAX A;  4LA2 A;  4IV3 A;  3I49 A;  1GAN A;  5FZA A;  1JS9 A;  4WM7 A;  1AL2 2;  2A6Z A;  5JIU A;  4AFA A;  2HKX A;  4P00 B;  4ARY A;  3IDA A;  3RZL A;  2WZR 2;  4Y4Y A;  1IS4 A;  3ETQ A;  4RR3 C;  1W39 A;  2ZGO A;  5EYY A;  4L2N A;  4DIN B;  1DBN A;  4E4S A;  1DGW A;  1CIY A;  1E57 A;  1Z7S 3;  2QQK A;  5G05 L;  1ACC A;  2D6O X;  5GLT A;  1GU3 A;  2X5I A;  1H6Y A;  1W8O A;  2OII A;  4BQ2 A;  4FPK A;  5LA9 A;  1CZT A;  1KEX A;  1OBN A;  1XU2 A;  1CAV A;  4RQP B;  2VNG A;  3WG4 A;  1ULP A;  3NAP C;  2R07 1;  4J1W A;  3WF4 A;  5I0D A;  3T0A A;  4KWL A;  3TAY A;  4JGY B;  5AC9 1;  1O4Z A;  2BJS A;  4A44 A;  2XQR A;  5FYZ A;  4QKN A;  3MIC A;  4FPC A;  1CIW A;  2DVD A;  3IMN A;  5CIS A;  2Y60 A;  4NRP A;  2MPF A;  5E88 A;  2WLP A;  4AHW A;  4V1P A;  5FY1 A;  1W28 A;  5JSO A;  4YM0 A;  3AMH A;  1SCS A;  5LB6 A;  1XNA A;  2AC1 A;  4L11 A;  2E9Q A;  2VEC A;  3AZZ A;  3AFG A;  4PJY A;  4LBL A;  2H0B A;  1WMF A;  5L19 A;  1HQL A;  2BV4 A;  3U0Z A;  4HPK A;  1ONA A;  1H2L A;  4P14 A;  2YZ4 A;  3ZXJ A;  1HX6 A;  3CF6 E;  3ZR6 A;  1QIQ A;  1JYN A;  3VBU A;  4AK3 A;  4FVV A;  1AR7 2;  1NE4 A;  1UNB A;  4GWJ A;  4A7Y A;  1CZV A;  1DCS A;  1WWY A;  2X8K A;  4OCT A;  2ZGT A;  1JZ5 A;  4ZS3 A;  5J3U A;  3VKL A;  2QDN A;  1UPI A;  3DN7 A;  4YVW A;  5FYM A;  4YW1 A;  1HXS 3;  2G9F A;  1X36 A;  3DF0 A;  5JZG C;  4W6Y A;  4IE6 A;  4GH4 C;  1YO8 A;  2DV9 A;  4URT A;  2JJ6 A;  5FKC A;  2ARA A;  4K40 A;  3L9J T;  5EXO A;  5CFC B;  3OOX A;  1K42 A;  4FI9 A;  2Z2S B;  3I2F A;  2V09 A;  2CNA A;  3WCS A;  2IVI B;  1J3Q A;  4CDU C;  4TZD A;  3RDI A;  2VU9 A;  1VBE 3;  1A3K A;  4QX8 A;  1WBF A;  1W99 A;  4GWN A;  1GOG A;  3DKQ A;  4XQD A;  4LO8 A;  2C24 A;  4QQP A;  1BEV 3;  3N7L A;  4LHK A;  1VBC 2;  5IK8 A;  5EHD A;  1JYC A;  3JXS A;  2CAU A;  3LDR A;  3MF6 A;  1J59 A;  4UFJ A;  4X8P A;  5A1L A;  4IGP A;  3GZT B;  1KDK A;  1FAY A;  4PQQ A;  4XAC A;  1YIF A;  3K4Z A;  1YNA A;  4EWA A;  4UAP A;  4NMI A;  4JVA A;  4YW3 A;  2CDO A;  2D6K A;  1TME 1;  1C4R A;  1HB1 A;  1XE8 A;  3INA A;  4XXA A;  2K46 A;  2VM9 A;  1VAL A;  1QJX 2;  1UYZ A;  2FCV A;  3A0K A;  3ZFF B;  1J58 A;  3FFZ A;  4AQT A;  4C91 A;  4Z2A A;  4QXH A;  1H4G A;  1V70 A;  4MGQ A;  1LNS A;  3LA2 A;  5ABJ B;  1OMI A;  3VKN A;  2OZ6 A;  4QKF A;  1XPW A;  4UBH A;  1LR5 A;  4N8M A;  2ZGK A;  3A22 A;  3FC0 A;  5C6C A;  3MW4 A;  4HKW A;  1Z7S 1;  2OPK A;  2Q1F A;  3J4U H;  3POI A;  4FQZ A;  4P02 B;  4C0B A;  2WO1 A;  1XOY A;  1ZRI A;  4Q1R A;  4PBP A;  5K9Y A;  1DGR N;  2VMI A;  4LK6 A;  4Y22 A;  3WHT A;  4CU7 A;  1QH6 A;  4TN7 A;  3VBO C;  3E5Q A;  3AP6 A;  5A80 A;  1QEX A;  1ULF A;  2QBX A;  2GNB A;  1F4A A;  3KQR A;  1VR3 A;  1RUG 3;  5A3O A;  1SDW A;  2XHN A;  2ZMK A;  2RDS A;  4LNV A;  4UT5 A;  2VMG A;  4F83 A;  1O8S A;  2VTX J;  1VLN A;  3WQB A;  1C8M 2;  4HBN A;  1DP0 A;  1MS3 A;  4B1L A;  5AFB A;  4GMP 0;  2DCT A;  5DUU A;  5CIR A;  4DXS A;  5JDB A;  4A7Z A;  1YFU A;  4GB3 3;  4OZO A;  1GNZ A;  4QX0 A;  5M0T A;  3MFA A;  2B42 B;  2PHW A;  2GAL A;  4COZ A;  1R64 A;  2RJ2 A;  5DG1 A;  2OPW A;  3SMH A;  4PIZ A;  2ZTN A;  2ZX4 A;  3QOP A;  3VHR A;  5FWJ A;  2VJX A;  2BWA A;  4QPI A;  5C9A B;  4PF5 A;  3ZO0 B;  4JQR A;  4DRV A;  4QGL A;  1S0G A;  1OLM A;  2VCM A;  2VO5 A;  5D8A A;  5BNN C;  4HKO A;  4QAW A;  3KS7 A;  4J25 A;  3V0B B;  1MQT B;  5BNO C;  1WBL A;  4XYX A;  1BJQ A;  5AVP A;  4LR4 A;  3RZG A;  2WA4 A;  5FP7 A;  2WQ8 A;  1F4H A;  2ZMN A;  3O0W A;  3DUI A;  2JD4 A;  4IL7 A;  3VZM A;  2UUR A;  3DPR A;  1HXS 1;  5FZ7 A;  3C8X A;  4CDX B;  1NLQ A;  4XF0 A;  3RNS A;  1GZW A;  1RED A;  1UXX X;  1OT5 A;  3H1M A;  2CU5 A;  4O9G A;  2Z42 A;  4WVW A;  3R6S A;  1JYW A;  2C26 A;  4PQ9 A;  3OTF A;  3IM0 A;  3POY A;  2B7Y A;  1H0B A;  1PO1 3;  1Q8V A;  4IGQ A;  3SC7 X;  3M1H A;  2CYF A;  1LB2 A;  3VHO A;  2V4A A;  3N9L A;  5DAV A;  1SPP A;  2E7T A;  4CCL A;  4YZ1 A;  1LES A;  5J09 A;  2D40 A;  2O8O A;  1NLS A;  1H8T B;  1JOB A;  1H2K A;  1V9U 2;  1X8M A;  4E8D A;  1VBA 2;  1BEV 1;  1WA6 X;  2JDP A;  4BA6 A;  1CGP A;  3WF0 A;  2Q8D A;  1RJ7 A;  1MAC A;  2GNM A;  2W3J A;  3WW4 A;  2QQV A;  4BE3 A;  3HN3 A;  1LOD A;  5JXH A;  4LO7 A;  4JV4 A;  2VCB A;  2J22 A;  1NXD 1;  4AVC A;  1RHI 3;  2RS5 2;  4H55 A;  3BGA A;  5IVJ A;  3QH6 A;  5IAT A;  3H42 B;  2GND A;  1US3 A;  1S0D A;  1IQA A;  2JE8 A;  5CEH A;  2FD8 A;  2EIE A;  4ATE A;  1KJL A;  1VBD 1;  2OQ6 A;  2QQW A;  2WWU A;  4XZP A;  3VD4 A;  3FL7 A;  3PJQ A;  1PVC 2;  2ZML A;  4FAG A;  4YGE A;  2ERF A;  1H1I A;  1PGL 1;  2IWG B;  2JIJ A;  1IPS A;  3PU3 A;  1BLZ A;  1ULO A;  3BI3 A;  3PTR B;  4FPF A;  4XIL A;  5DN2 A;  3SKJ E;  3HQU A;  1ZRR A;  2RDN A;  2RM2 3;  5F5A A;  1FNZ A;  1HRI 3;  3LWC A;  2YPD A;  4BH9 A;  1AXZ A;  4NR1 A;  2GAU A;  4LUK A;  4GZ9 A;  3T2O A;  4ONU A;  4QQH A;  2D93 A;  1CQ9 A;  4JHZ A;  3H8U A;  2F6B A;  4A7K A;  3AKQ A;  5FK7 A;  1FV3 A;  2ES3 A;  1NE6 A;  3WQ0 A;  1A34 A;  4LBK A;  2FDK A;  2WSU A;  2MEV 3;  2WQ4 A;  1O3R A;  1JOD A;  1KDM A;  3RJ2 X;  1RUG 1;  3UV9 A;  4XIO A;  3LSD A;  3KT4 A;  1Z78 A;  2DU1 A;  1O3S A;  2EXI A;  2VXJ A;  4YGB A;  2HWC 3;  3K48 A;  3PIJ A;  3BVC A;  4OUM A;  2RVA A;  5T50 A;  5LY1 A;  1SAC A;  2E63 A;  2VZV A;  4MH0 E;  4QQL A;  4GB3 1;  4WVM A;  4XJU A;  1ND3 B;  4AFM A;  4HZF A;  3ILF A;  1WKY A;  1RUD 3;  1UOF A;  4JC1 A;  3T2P A;  1A8D A;  3A4U A;  3FUQ A;  3ZFE C;  4CCK A;  1V6L A;  2JDA A;  1OOP C;  3BPZ A;  3U75 A;  2UWA A;  1GOH A;  4QPG A;  5FZG A;  1ZRC A;  1FPN 3;  1Y4W A;  3OB8 A;  2Y6J A;  5T5J A;  2VME A;  1Y9G A;  1DYP A;  3C7H A;  3EHK A;  5FOJ B;  1JYX A;  2YB7 A;  2JB4 A;  4LMF A;  5I93 A;  1SBF A;  2HWD 3;  4NWW A;  4GQ7 A;  5FZF A;  1N1T A;  4FT8 A;  2HEW F;  3TEX A;  1VIW B;  2Y6H A;  1KS4 A;  2W5F A;  4LBQ D;  2EIG A;  5DAQ A;  5DPN A;  2OKX A;  2ZBJ A;  4ZZ5 A;  3MEP A;  4XOG A;  1LEN A;  4AED A;  1UIK A;  3FWE A;  5A32 B;  4ERO A;  1JYT A;  1BKZ A;  2PHF A;  1YIP A;  1W2A X;  1PO1 1;  3KF5 A;  5FPZ A;  4P08 A;  1WUV A;  3AZW A;  1JZ3 A;  4Y5Z 0;  2VBP A;  5LA2 A;  2JKX A;  4RS5 B;  1KJR A;  1ZYB A;  3AMP A;  4CEY A;  1MZ6 A;  2JDK A;  4FAH A;  3KV4 A;  3DEC A;  2ZS6 B;  4HON A;  5JPN B;  4MGK E;  4Q4X 2;  1GQH A;  4RYD A;  4RSU A;  4BIF A;  1UOG A;  3O1T A;  1RB8 G;  1HV1 A;  1ZX5 A;  4KH9 A;  1UOJ A;  1UW8 A;  3ZSK A;  1Q43 A;  3VD5 A;  4M3C A;  4JGY A;  3H3L A;  3MW3 A;  5FWE A;  3WQ7 A;  3WG2 A;  2XPJ A;  4XEZ A;  2PLV 2;  2YGM A;  2VQT A;  3ZKY A;  4DPN A;  2YC2 A;  3CU7 A;  3CIH A;  3M4F A;  5AC9 2;  1GNH A;  4AI3 A;  1JHN A;  1IPK A;  2NN8 A;  4YLZ A;  5KHH A;  3E97 A;  1D0G A;  4TLG A;  4IEP A;  5FZI A;  3NVC A;  1CR7 A;  4N7I A;  2O1Q A;  3JUU A;  1FT9 A;  1NCR C;  3GBG A;  3I2K A;  3R4D B;  4RGK A;  2RMU 1;  4WM8 B;  1RUF 2;  3SIT A;  3PUQ A;  3MF9 A;  4MSV A;  5FXW A;  5FV3 A;  1NA1 A;  3LZZ A;  1ALY A;  4ZZ8 A;  3SIS A;  5JXI A;  2O8Q A;  1CVN A;  3EO6 A;  2XJS A;  2SBA A;  2RM2 1;  2JG9 B;  3VD9 A;  2IC1 A;  1HRI 1;  3BOD A;  3ST7 A;  2J1E A;  3USU B;  1RUC 2;  3LOI A;  4E2G A;  2UU8 A;  3M7A A;  3VBF B;  3TEZ A;  4N43 A;  4N53 C;  1CAW A;  5FYI A;  3WNK A;  4XAA A;  3HMY A;  3CJI C;  4FQ4 A;  2E6V A;  3NQH A;  4ITC A;  5CZK A;  4YVS C;  3UJO A;  1BVV A;  1OXC A;  4QU1 A;  1JZ8 A;  2R0F A;  3O5S A;  1XYO A;  5F5I A;  2RJL A;  4YG3 A;  1JYV A;  2K0G A;  4DOU A;  2MEV 1;  3CNA A;  1IS6 A;  5JLV A;  3C2U A;  1RXG A;  3LQC A;  3J8F 3;  1AYM 2;  5CFC A;  2DVG A;  2BBA A;  1NLR A;  1LOA A;  4UYB A;  3VV1 A;  5E8A A;  5F9T A;  3MW2 A;  2Q30 A;  1EV1 2;  2CGN A;  5A33 A;  3GAL A;  1SFN A;  3NNL A;  1LHN A;  3FBM A;  4F3J A;  2JKB A;  1B35 C;  4K7J A;  2BNN A;  3LEK A;  1N3O A;  1RUD 1;  4PI0 A;  3C3V A;  5KC5 A;  2HWB 3;  3CQO A;  3IN9 A;  3WP3 A;  3ZOI A;  1MS4 A;  3FLT A;  1SLC A;  3FLP A;  2YDE A;  3C7O A;  4R9A A;  3ZXL A;  1C3H A;  4IQP A;  2R06 3;  1EPZ A;  4IE0 A;  1KRI A;  1FPN 1;  1N47 A;  2VZT A;  4H7M A;  1MZ5 A;  5C5T A;  1NG0 A;  4XW3 A;  5F2W A;  1X8E A;  2JE7 A;  4E2S A;  3U11 A;  4CZS A;  2ARB A;  1WME A;  2WNV B;  1OPO A;  2YGL A;  1IOA A;  5FCC A;  1RVF 3;  1OA3 A;  2VZO A;  5FPX A;  3U4X A;  1O5U A;  2VH9 A;  1W6O B;  2XB6 C;  4ZU5 A;  2R0H A;  3ZFF A;  2H6C A;  4HET A;  1Q8O A;  1HQN A;  3GGL A;  3WNL A;  4W8J A;  1W9T A;  4IXL A;  1SZB A;  1W8T A;  3PUH A;  4W4Z A;  5FQ0 A;  4Q26 A;  2TUN A;  1OQ1 A;  3ELN A;  2IVJ A;  3WF2 A;  1WLT A;  3OGR A;  3DYM A;  4HKL A;  1R08 3;  1VRH 3;  4W50 A;  4WV8 A;  1JMU B;  1UY2 A;  3S0M A;  2NYY A;  5HCF A;  1R09 3;  1GWL A;  1NCQ A;  1RJ8 A;  2D5F A;  3KD4 A;  4NPL A;  2P3K A;  4YFW A;  4BB3 A;  5FPA A;  5J36 A;  1A6C A;  5LBF A;  4XBN A;  3BU0 A;  3SKV A;  2X29 A;  3D3A A;  5IK4 A;  3R4S A;  1CN1 A;  5CFD C;  2EVX A;  3HOB A;  4YWA A;  4AWD A;  3T3Y A;  4SLI A;  5C3O A;  1GP6 A;  4K1Z A;  4R9D A;  2CDP A;  1Y3T A;  2QCS B;  2ZX1 A;  4KU7 A;  2XLF A;  4CDW B;  2J1T A;  3POB A;  4CCE A;  1MS9 A;  3CBN A;  4D94 A;  1QNY A;  3H8X A;  2WN3 A;  2Y26 A;  4QKD A;  4GA9 A;  3TOJ A;  1KQR A;  4CP9 B;  1XND A;  1XXN A;  3PUR A;  2A71 A;  4S2D A;  4AI0 A;  2R30 A;  1AX1 A;  3GXU A;  4IER A;  3GHM A;  4YPJ A;  5A7S A;  2Q0A A;  2NMO A;  1COV 2;  1IHM A;  5GLZ A;  1OC1 A;  2WZE A;  1ZA7 A;  1PK6 B;  4BJ0 A;  2L9L A;  1O3T A;  1G9C A;  2ZGU A;  1E5I A;  1GIC A;  1OUX A;  1TVG A;  1WW7 A;  2WFF 2;  3D6E A;  3UL2 A;  5C4W B;  4I01 A;  5GAL A;  3H8O A;  4DXR A;  2VMF A;  4FP3 A;  1T6B X;  3ACG A;  1V6M A;  2WO2 A;  3POF A;  4Q4V 1;  1S0B A;  5ANN A;  2OQ7 A;  1JUH A;  3B00 A;  5FZK A;  3BKZ A;  1PGS A;  4FFG A;  3U37 A;  4LQR A;  4E4D X;  2E53 A;  3WD5 A;  1R1A 2;  3UYJ A;  5E16 A;  4S2G A;  5DG2 A;  1RUJ 2;  4QB6 A;  2P37 A;  4DZG A;  4OHX A;  2EIC A;  2X53 S;  4LUM A;  3VBS B;  5FY0 A;  5LA1 A;  3UJQ A;  4DQA A;  1PVX A;  2QUO A;  5DQ0 A;  4BQ5 A;  5FO9 B;  5HPO A;  4LBO A;  3J8F 1;  2J1S A;  1RYY A;  4AOC A;  4BM8 A;  5BNQ A;  1JZ6 A;  4R9C A;  1FMD 2;  3JBG 3;  4JHT A;  3WR0 A;  3LPG A;  5KHG A;  1LHO A;  1O8P A;  1GZ9 A;  5FLI A;  4MXW A;  4Y26 A;  3B02 A;  1EUU A;  3R0R A;  1AVB A;  4QX2 A;  4EV0 A;  5FYT A;  2D5H A;  2FMD A;  5EJ1 B;  1W9Y A;  1H9P A;  1ZZC A;  3FMG A;  3K77 A;  1FXZ A;  2VZP A;  3MLK A;  5FJK A;  4CDQ B;  2R06 1;  1BQP A;  2AUY A;  2GN3 A;  4XUQ A;  2LTN A;  1WCQ A;  2BPA 2;  3ENR A;  5GM0 A;  4J6G A;  1LTE A;  1UCX A;  2LM3 A;  3IPV B;  5JVV A;  3WXP A;  4A2U A;  2FCT A;  2BBV A;  1X7N A;  1UKG A;  4NII A;  2ZEY A;  4Q0P A;  5FP9 A;  4CTE A;  2W08 A;  4RR3 B;  1RVF 1;  5CBL A;  1PO2 2;  3ME2 A;  2RS1 3;  1LEC A;  3ACF A;  1L3J A;  5FBJ A;  5F2S A;  2CL2 A;  1RMU 3;  4O61 A;  4LPL A;  2DUR A;  2VUD A;  4IV3 C;  2E33 A;  5A3P A;  3K51 A;  3BPS A;  5IAX A;  1AX0 A;  3N7K A;  2R49 A;  1VBD 2;  3S7E A;  1F31 A;  1FAT A;  3NAP B;  1OI6 A;  1F5F A;  2GH2 A;  5GLU A;  1RUE 3;  1R08 1;  1ND2 A;  2GH8 A;  2VOT A;  3ON7 A;  4UFK A;  3RZJ A;  2DVA A;  2WA3 A;  1OD5 A;  5J96 B;  2PHT A;  3MV1 1;  3PL0 A;  1YHF A;  4HK8 A;  3LFI A;  3IWZ A;  3QAC A;  2WS9 3;  2VZU A;  1O6U A;  2B9V A;  5KHJ A;  2JEM A;  2XG3 A;  3T2T A;  1G9D A;  2IXK A;  2JG8 A;  4RGA A;  2UY8 A;  3M3I A;  2DFC A;  4ZY9 A;  4CCC A;  4GMP 3;  3ZXK A;  4D8M A;  5FY9 A;  4AQ6 A;  4EZH A;  2A6X A;  4BIO A;  1X33 A;  3ZKU A;  1MEC 3;  3K4D A;  5A6Y A;  2ZOE B;  1AR9 2;  3JU9 A;  4RHV 2;  2CWM A;  2G9G A;  2WT2 A;  2WFP A;  2WC2 A;  3A21 A;  1OFN A;  4LA3 A;  4XDO A;  4BK4 A;  5L9V A;  3O12 A;  4KBB A;  1N1S A;  3WHU A;  3F2Z A;  3AXE A;  3AVS A;  2LS6 A;  1WZX A;  2WRA A;  2J7M A;  4PF1 A;  5F5C A;  4BU2 A;  1ZA4 A;  1WW6 A;  1XBF A;  4RN5 A;  3VDD A;  2CTV A;  4A3X A;  2FDG A;  5H9R A;  1UMZ A;  2R1D A;  4BLJ A;  1E5R A;  1HQW A;  3J7L A;  3H3U A;  4XUO A;  3RYR A;  4AW7 A;  2QQL A;  4A41 A;  5JZG B;  4GH4 B;  4Q27 A;  5FO7 B;  2ZGS A;  3IDC B;  5FZH A;  4IES A;  5FTT C;  3VBU C;  2ADD A;  4ASK A;  1SBD A;  2GN7 A;  1NQJ A;  3RYP A;  3AFK A;  4CDU B;  1ZM1 A;  3BN6 A;  3Q8F A;  2YU2 A;  5FYV A;  1BCX A;  1WA4 A;  4Y1X A;  1O4Y A;  3III A;  1W6P B;  3S57 A;  3MIH A;  4YW2 A;  3A23 A;  4OQ9 A;  3ZYI B;  2PHU A;  3MYX A;  3SCG A;  2DBN A;  3WP6 A;  5A32 A;  4XET A;  5FY7 A;  4CA9 A;  1S0J A;  4QX3 A;  3JBG 1;  1U12 A;  4AVV A;  5I91 A;  1KGY A;  1YC6 1;  3KV6 A;  2V5D A;  2VXR A;  5FUI A;  2J1U A;  1QMJ A;  1W8Z A;  3VB9 A;  1QY4 A;  4E4H A;  4M3C F;  4OQ8 A;  2W2I A;  3FFQ A;  1TQ5 A;  3ZDV A;  3O1V A;  1APN A;  1SLA A;  3AP4 A;  1QJY 1;  4L92 A;  2DTW A;  3RZZ A;  5ACA 3;  2A75 A;  2A6Y A;  2XBO 3;  3CEW A;  1I1E A;  5IHR A;  1PZ9 A;  3QCW A;  1J1T A;  4YW5 A;  3I3M A;  3RI8 A;  1J83 A;  1W6Q B;  2VZR A;  3NKT A;  2A3X A;  1SG3 A;  1ZBE 3;  5E6H A;  4EN9 B;  3KZ4 C;  2FDF A;  2PFW A;  4K6B A;  2RS1 1;  4IV1 C;  3M3E A;  5CG9 A;  1US2 A;  3V64 A;  3WUD A;  3W5M A;  4DEQ A;  1C5I A;  4MHU A;  4D7S A;  2DUP A;  3GCX A;  4D69 A;  2WNU C;  2YPJ A;  2GP3 A;  2JDZ A;  3VBO B;  4FOW A;  3BTY A;  4Y3O A;  1ASJ 3;  2HWE 2;  1LOF A;  1RUE 1;  4FFH A;  2RMU 2;  2RHP A;  1Q5O A;  2JG9 A;  1TNR A;  4HMZ A;  1CAU B;  4GAZ A;  2GNT A;  4KMQ A;  2ORX A;  2V5Y A;  1EAH 3;  4CE8 A;  1KFX L;  1OF3 A;  1F8V A;  2QJV A;  2WR9 A;  4K20 A;  2WS9 1;  4XHB A;  4CCO A;  1LHV A;  1NXM A;  2XJT A;  3AYC A;  4HN1 A;  5T5O A;  2LRP A;  4GMP 1;  4MGY E;  2VOV A;  1W6M B;  2RR1 1;  2C6S A;  2WAB A;  3SCH A;  4CUA A;  1MEC 1;  2LRO A;  1HV0 A;  3KSC A;  2V4V A;  1W2N A;  5DMY A;  3BYW A;  2BU9 A;  1OVP A;  2MEV 2;  1BBT 3;  4LLF A;  1W0O A;  2HLE A;  4GWI A;  3WG1 A;  1LOC A;  3JD7 3;  4XJW A;  4CRQ A;  1VMF A;  2C9K A;  5BNN B;  1CAX A;  5BNO B;  1WLD A;  5APA A;  1ENS A;  1LOG A;  5HCB A;  4NN0 A;  3I8T A;  1W3V A;  3KWV A;  3EJK A;  4AI8 A;  3NNG A;  4MZU A;  5BV6 A;  4LHN A;  4J1X A;  4CUB A;  1NY7 1;  1O4T A;  2RS3 2;  4FOQ A;  3V0A A;  2FZ1 A;  4GUL A;  4M0N A;  5LA0 A;  1IG3 A;  3I3B A;  4Y1Z A;  3WLU A;  2JEC A;  1RUI 3;  2D6M A;  2OX0 A;  4QPI C;  4QPW A;  4CUG A;  2P6H A;  4K1Y A;  3GNE A;  1FNY A;  3POE A;  1UZZ A;  4WBB A;  1HRV 3;  2ZXQ A;  3KT7 A;  5D8A C;  5HXV A;  2WNV A;  2IXC A;  4XZU G;  4LUL A;  4AFC A;  1PX4 A;  5BPX A;  1FOD 3;  5BUV A;  4LHS A;  1S4C A;  1W6O A;  2VQU A;  2PQQ A;  1E5H A;  4Y20 B;  1WLC A;  2OUH A;  3SLI A;  5A7W B;  1DQ0 A;  1VBB 3;  2NZ9 A;  1ZNP A;  1OLM E;  3J26 N;  4JQT A;  2EXK A;  4YW7 A;  5DUW A;  2VZQ A;  2ZHK A;  3ZX7 A;  1BYH A;  3WV6 A;  4CU6 A;  2GP5 A;  1JI6 A;  2JIC A;  3M2M A;  3MUZ 1;  4HLT A;  5FYU A;  3FE5 A;  1BMV 1;  3OY8 B;  3VHN A;  1C1F A;  1CPN A;  2BVB A;  2XQX A;  1SFY A;  3D5O A;  3O1P A;  2LW8 A;  4OZX A;  1QJU 2;  4QGM A;  4QQ2 A;  1ZBA 3;  1AR6 3;  2WYS A;  3P3N A;  1PMH X;  2VVE A;  4F7Z A;  5EP9 A;  1D4M 3;  2ZAH A;  5GZG A;  4I09 A;  4YSF A;  1GQG A;  4KI5 M;  4Q5O A;  1TMF 3;  1AUY A;  4Y1V A;  4AGR A;  1JHJ A;  3WIN E;  3GDB A;  4BXF A;  5IVB A;  3I97 A;  4ZU7 A;  3LDB A;  2JE9 A;  2XBO 1;  1W8N A;  5JSP A;  3LKJ A;  5DZE A;  4XUN A;  2P17 A;  1X9P A;  2ETE A;  4NRQ A;  4UF0 A;  3AYE A;  3FBY A;  4FCA A;  3TEY A;  1OQD A;  4PDW A;  4DEV A;  1DDL A;  3CO2 A;  2KR2 A;  3H0O A;  2Q8E A;  5KR7 A;  2OT7 A;  5F39 A;  1W8H A;  2HWF 3;  3VBR A;  1NT0 A;  4AL9 A;  4JGZ C;  4HFS A;  4XCA A;  2BNO A;  1LAJ A;  2XON A;  2FBE A;  3EQE A;  1PK6 A;  4K8F A;  3ILR A;  1ASJ 1;  4S2F A;  3PVE A;  5CA6 A;  3HIF A;  3VBH A;  2BYV E;  5DAP A;  2WT0 A;  1SDD B;  5FPV A;  4NIA A;  1UF2 C;  1LED A;  1SQ4 A;  1EAH 1;  3NW4 A;  5IVY A;  4ES8 A;  5FUN A;  3OD0 A;  2XDV A;  3OEA A;  5T52 A;  3ZXA C;  4N90 A;  3LEG A;  3VD3 A;  4K21 A;  4Q4V 2;  3RGB A;  3I2I A;  1WMX A;  1V0A A;  1G7Y A;  1MS8 A;  4HL0 A;  2W1Q A;  2ZKN A;  2F17 A;  4A6S A;  3PME A;  4JX0 A;  4KU8 A;  3ZFE B;  3HWJ A;  5F5Q A;  1OOP B;  4YG6 A;  4FSJ A;  1BBT 1;  2YMZ A;  4COW A;  4FP2 A;  1K5M A;  1W8W A;  2E32 A;  2ARE A;  2VUJ A;  3JD7 1;  1TEI A;  1XC6 A;  1AXY A;  1IS3 A;  3J8F 2;  3OCP A;  4QQO A;  3WNO A;  3ZR5 A;  2ZGR A;  4CU8 A;  5FDB A;  1YRZ A;  1YUD A;  2GZW A;  2XH6 A;  1L7Q A;  5FYS A;  5KWR A;  3KGL A;  1H6X A;  1QQP 2;  3WUC A;  4R4Z A;  4CDQ A;  4NHK A;  4SBV A;  3GHN A;  1OVS A;  2WQZ C;  1PMI A;  4DIQ A;  1RUI 1;  4QPG C;  4MGZ E;  1Q8S A;  5CKM A;  1LUL A;  5H9S A;  4OI2 A;  5FYC A;  4GXL A;  3B69 A;  2PHL A;  4RR3 A;  5CVR A;  2XVL A;  5FKB A;  1FOD 1;  1PGW 1;  1YWK A;  3POJ A;  2BEO A;  2VVD A;  1RUH 3;  3T1M A;  1DLL A;  3DXU A;  1G9F A;  1G86 A;  2FDJ A;  1KD7 A;  2V73 A;  3NV2 A;  3WOG A;  1GBG A;  3ZFG A;  3BUC A;  1S0F A;  4HVO A;  4DO0 A;  1M06 G;  2WNO A;  4BQ3 A;  5FMO L;  4IE7 A;  1PIV 3;  1GLH A;  2ZEW A;  3TN9 2;  2Y6G A;  4AED C;  1WCD J;  3ACH A;  4AVA A;  3RG0 A;  4ISR A;  3T4V A;  4NAM A;  3SNM A;  2JDM A;  2B4K A;  4HT1 T;  1JU3 A;  5SV8 A;  3O1U A;  4E8C A;  2AH2 A;  1WGP A;  4CEY C;  1JZ7 A;  1ZBA 1;  1R08 2;  2YV8 A;  5DDJ 3;  1D4M 1;  4LKS A;  3D0S A;  5C3Q A;  3NV3 A;  2NLR A;  5LK5 A;  3PUI A;  2WT1 A;  5C3R A;  2B8M A;  4I30 A;  5ERL A;  1QXP A;  3T0B A;  4CCJ A;  4ORF A;  3TEW A;  3OSD A;  3NKG A;  1NCR B;  3HBZ A;  1VBE 1;  4P5H A;  5LZ6 A;  1BXH A;  1U5Y A;  4D3W A;  4UXA A;  1A78 A;  2G1M A;  3C7F A;  2QDR A;  1RIT A;  4QX7 A;  1GZT A;  5HI0 A;  4HAN A;  1C28 A;  2IXH A;  5JUV A;  3AYA A;  5JXG A;  5GZE A;  4M3C E;  4NWV A;  2C9A A;  2HWF 1;  2YC4 A;  4Y33 A;  4COV A;  2YFU A;  4XFC A;  5FY8 A;  4OUL A;  1N3P A;  4N53 B;  4Q4W 3;  3RQ0 A;  3POS A;  4QDQ A;  4YVS B;  3CJI B;  1AYN 2;  3VZO A;  1VAK A;  3ZSE A;  5BY5 A;  1YFY A;  3N9P A;  3Q8E A;  3QH7 A;  2YRO A;  2PXJ A;  2XGX A;  3UET A;  1NA1 C;  2BDR A;  2CY6 A;  2D6L X;  1KIT A;  3R4U A;  1ZZB A;  1MS1 A;  4NE9 A;  2ZZQ A;  4M01 A;  3WQ1 A;  5C70 A;  4NID A;  1HLC A;  3E6D A;  3TYJ A;  3K4A A;  3I59 B;  1WCU A;  2UYB A;  3KF3 A;  1DG6 A;  1J3R A;  2XL9 A;  4GKY A;  1M4W A;  4N43 C;  5GZC A;  1UOB A;  5LBC A;  5I8S A;  1OA2 A;  1B35 B;  3AKR A;  2VBD A;  1DIW A;  1JN2 P;  4PT6 A;  1QH7 A;  2Y6F A;  3I2G A;  5GLV A;  4H7L A;  3O1R A;  1DGR A;  2CGP A;  4JDO A;  5DAW A;  4CSW A;  1ZVF A;  2KA3 A;  3DXT A;  1TG7 A;  5EQU A;  3I3Q A;  4N7U A;  4UW5 A;  2P6C A;  5DXD A;  4LBQ A;  1GZC A;  1F15 A;  1RIR A;  1YFW A;  2XHK A;  3NJX A;  3WP4 A;  5CU1 A;  2XML A;  3JBG 2;  4MO3 M;  2P3J A;  3LPF A;  5K0U C;  5JIA A;  5FOB B;  1H1A A;  2VQ0 A;  1W6N B;  3WNX A;  1FI2 A;  1AL2 3;  1C1L A;  4LOR A;  4PCR A;  4QXK A;  1OUS A;  1GP4 A;  4V2W A;  4Y5S A;  3T30 A;  5L7O A;  2WZR 3;  1PNF A;  2B5H A;  2OS2 A;  1QJY 2;  3DKW A;  3ZMO A;  5C8W A;  3MBW A;  4QD2 A;  4XFA A;  3SH3 A;  5FZO A;  1N1Y A;  4Z82 A;  1XQN A;  1UMI A;  5F1R A;  5F8P A;  2QZ3 A;  3GF6 A;  3RSJ A;  1RUH 1;  1AJK A;  3OYW B;  1AXK A;  2RG4 A;  3I7D A;  5FIX A;  3WF3 A;  2B39 A;  3WW2 A;  3HR9 A;  4PIY A;  1S55 A;  3OUJ A;  4GIQ A;  5DUX A;  5KXE A;  2WSV A;  3IB3 A;  2WO7 A;  4LTA A;  2IXI A;  3FLR A;  4ZXK A;  3S7I A;  1PIV 1;  1IGO A;  2Y6K A;  1IZ3 A;  2VE1 A;  4XFI A;  5L9R A;  3ZYP A;  4M0H A;  4WVV A;  5CFD B;  5FO8 B;  1VP6 A;  5A7P A;  4B7K A;  2BP6 A;  3AK0 A;  2XXZ A;  2R04 3;  2W39 A;  3DCQ A;  2D6N A;  2GC1 A;  1NCQ C;  1SFP A;  3BCW A;  5DDJ 1;  3ROU A;  4EWE A;  5K4L A;  1ZRD A;  1YEW A;  2VPV A;  2BWC A;  4LKF A;  5FZ1 A;  5GZF A;  3OBA A;  1TE1 B;  3CZU A;  3AMN A;  3CJX A;  3RZM A;  2FZ2 A;  2ZX0 A;  1W6M A;  4G3Y C;  2FCU A;  5C33 A;  1Z0H A;  2A6V A;  4YM2 A;  3KV9 A;  1ENR A;  3M3Q A;  4RD7 A;  2RR1 2;  1UD1 A;  1AR7 3;  2ZHM A;  4RQP A;  3OBR A;  4Q1P A;  1GWM A;  5BNN A;  3GBF A;  3JB8 A;  2VG9 A;  4LHL A;  4C1W A;  1ZRF A;  1S0C A;  1J84 A;  2Z69 A;  5FRE A;  1DHK B;  5FR3 A;  5I0U A;  3IZO A;  4Q4W 1;  2QTW B;  2R07 2;  3PLQ A;  4FO9 A;  2A70 A;  2QQJ A;  3HNB M;  5FP8 A;  1XNK A;  3KCX A;  4L0P A;  2HH9 A;  1RHI 1;  4HG6 B;  4DRR A;  2VUC A;  1K12 A;  1RIN A;  4EN0 A;  2QQI A;  4EN8 B;  3SEP A;  2Y0I A;  1Y7B A;  5F3C A;  2VC9 A;  4M4R A;  1VPH A;  2E26 A;  3H1Y A;  1YQ8 A;  5CKQ A;  4EYU A;  5C8C C;  2Q1M A;  5JCT A;  2DWR A;  3MLL A;  5TSW A;  3WP5 A;  2EA7 A;  4QM8 A;  5BYN A;  4ZXE A;  1ST8 A;  2YY1 A;  4Y20 A;  4OHZ A;  1PM4 A;  4BQW A;  5F3I A;  5FYY A;  4Z1V A;  1VBC 3;  3AZY A;  1SMV A;  2VOW A;  1RUO A;  4NIH A;  4ISQ A;  4NO4 A;  4MUV A;  5A6X A;  1UYY A;  1SHW B;  4FOV A;  1S2E A;  3B94 A;  1VB2 A;  5H9Q A;  1QJX 3;  2MHF A;  1BMV 2;  5IAV A;  2JEN A;  1PZ8 A;  1AL2 1;  1GV9 A;  1HB4 A;  2UYA A;  2HWC 1;  3CMG A;  4IV3 B;  2W95 A;  4CP1 A;  4F8A A;  1YI7 A;  2E7A A;  3IDB B;  5A7O A;  2SLI A;  2XBO 2;  3KMH A;  4XTP A;  1O5L A;  4BWO A;  2Y0O A;  4HOO A;  2W87 A;  5FXV A;  4CCN A;  2VMH A;  1YI9 A;  1ZZ9 A;  3O1O A;  5IVV A;  2YBK A;  3RI9 A;  3HNY M;  4YYO A;  2VCC A;  4LOT A;  2HWD 1;  1CAV B;  3H7J A;  4QB1 A;  4U36 A;  3UGF A;  4DUV A;  1IPJ A;  3ZIW A;  3B9I A;  1TME 2;  1ND2 C;  3ZN4 A;  4Q29 A;  1ULC A;  2BFU L;  5IJR A;  3ZPY A;  3RZK A;  2R04 1;  3OEB A;  5FZD A;  5G04 L;  2AGS A;  2ZGP A;  2Z79 A;  3W9A A;  3MIE A;  5ABJ A;  4R9B A;  5F3E A;  4WVZ A;  3ES1 A;  5E1R A;  2YC0 A;  3ORJ A;  2BGC A;  5IWF A;  5IFT A;  3M3C A;  1HN1 A;  1X50 A;  2ILM A;  2JG8 C;  2ZEZ A;  4LO5 B;  4XUT A;  3FN9 A;  3ES4 A;  3GYD A;  1NOV A;  4MV2 A;  4IEU A;  1IS5 A;  3X29 B;  3UNP A;  4HPK B;  5FLJ A;  1Z7S 2;  1AR7 1;  3POW A;  3F95 A;  2DFB A;  4C8D A;  1JW6 A;  1W2T A;  2J1R A;  3VBU B;  3NRU A;  4XFB A;  4RL7 A;  2ARX A;  3ZN5 A;  1GSL A;  1IG0 A;  1QWR A;  2RE9 A;  2CGO A;  1O7F A;  5I0T A;  4DFS A;  4ZHN A;  4P9J A;  3VDD C;  4P9X A;  4BQ4 A;  2W47 A;  4YVW B;  4B4R A;  1L7R A;  2ARC A;  3B93 A;  2IXJ A;  4NHX A;  4AGG A;  2W9X A;  2ZX2 A;  3KV5 A;  1X9T A;  3PVN A;  4YZ4 A;  1RUI 2;  4PLN A;  5D1I A;  4Q0Q A;  5A3M A;  4MYE A;  3ZSM A;  3MPB A;  1V9U 3;  3E5X A;  2B45 X;  3HT2 A;  5FY5 A;  1VBA 3;  4DNY A;  5SV5 A;  1RXF A;  1VBC 1;  3ZYJ B;  5C9A A;  3VDB A;  2YG0 A;  4QM9 A;  3IAP A;  3V0B A;  1SLT A;  1MQT A;  4GAL A;  4MET A;  4NRM A;  2PHD A;  4NHM A;  3VGI A;  2WLQ A;  2XJU A;  2VNO A;  2Q4S A;  4BZ4 A;  3I3D A;  3POG A;  4QWN A;  4NIG A;  2DUQ A;  2UY9 A;  3ZSL A;  2RS5 3;  4LLO A;  1DYK A;  4XJZ A;  4CDX A;  2A73 B;  5JSR A;  1QJX 1;  1V00 A;  2P3I A;  5C3P A;  3BTZ A;  4KL1 A;  3PMS A;  4FFI A;  3LA7 A;  3WDT A;  1HXS 2;  1YQ2 A;  3TWI A;  1V6I A;  3NNJ A;  4D0Q A;  3MGU A;  3H9A A;  4MGI E;  4IV1 B;  1PVC 3;  1W2U A;  2WO3 A;  3ACI A;  1CES A;  3HAG A;  1CJP A;  2YBP A;  4Y24 A;  5FZ4 A;  2D7F A;  3GM8 A;  4LBN A;  4XPV A;  2XJQ A;  1CZS A;  1H8T A;  2WNU B;  4QHO A;  5IT6 A;  1C57 A;  3ALQ A;  5E89 A;  2HWB 1;  4LK7 A;  1VBE 2;  1V6J A;  1W8U A;  3RPQ A;  1BEV 2;  2GMM A;  2VZ1 A;  4AXO A;  1OH4 A;  1UO9 A;  2K9Z A;  3LAG A;  2KM2 A;  4OVE A;  4B4Q A;  4AI2 A;  3W20 A;  1AR8 3;  5GZD A;  2VY0 A;  1XRU A;  1VE0 A;  4GKX A;  4Y22 B;  5FLH A;  4MAD A;  2JB8 A;  4XF9 A;  1DZT A;  2FMY A;  1UU4 A;  1DGW X;  2O0O A;  3I3E A;  2PHR A;  3LE0 A;  4IET A;  4AAP A;  4CCD A;  5IVF A;  4JAA A;  5JOW A;  1NX9 A;  4I2O A;  4MGS A;  4BK5 A;  3TRS B;  5A3U A;  5DZF A;  1VMJ A;  4OLL A;  4WM7 C;  1GWK A;  5JXJ A;  2DCJ A;  1D4V B;  1FV2 A;  2OZJ A;  3VLB B;  1H2N A;  4UFI A;  2IXL A;  1F2N A;  1HDK A;  1VRH 1;  4RGG A;  1PGL 2;  3OGG A;  2BER A;  4KG8 A;  2GC0 A;  2W92 A;  4OFG A;  1WD4 A;  1R09 1;  1HIX A;  1TZO A;  1UY1 A;  2RDQ A;  1BZW A;  3LIH A;  4JKL A;  4O7X A;  2JXA A;  3ZMN A;  4LJH A;  3VN4 A;  1XNT A;  2X5I C;  3BOW A;  2NMN A;  4UFM A;  2F4L A;  4QPI B;  4A4A A;  4AVT A;  1V6K A;  5D8A B;  5A70 A;  2PYT A;  5FPU A;  4AI9 A;  1GOF A;  2OW4 A;  2RV9 A;  3OGJ A;  2YHJ A;  3AL6 A;  4XJA A;  1I3H A;  2VNV A;  2JDN A;  1ZZ7 A;  4P9W A;  4UI9 L;  3THT A;  2ID4 A;  2J42 A;  1RUG 2;  3DPR B;  3LGR A;  4B8E A;  4A3Z A;  4IEO A;  3ITQ A;  3ZN6 B;  2ET1 A;  3ZM8 A;  5IVE A;  1HW5 A;  1ND3 A;  1S1A A;  3PIG A;  1Q8P A;  4CUC A;  2OXB A;  3LIG A;  4JTN A;  2ZHN A;  2AEN A;  4CCM A;  4C0H A;  2W1S A;  4S2H A;  4OUE A;  4GB3 2;  1U5Z A;  4X6Q B;  5FZ0 A;  1V9U 1;  5ISL A;  4Q4X 3;  1VBA 1;  1F9K A;  4MOA A;  3UES A;  1POV 0;  2IFW A;  1SPP B;  2HBT A;  3R05 A;  2C4X A;  2XWJ B;  4XQ4 A;  4YW6 A;  4URA A;  4XFH A;  1RUH 2;  2FHR A;  1MVQ A;  1OPM A;  4Z8B A;  1KXG A;  1DGL A;  2VUL A;  4Q0S A;  2XJV A;  4AHX A;  2PLV 3;  2ZAA A;  2CAV A;  4EE2 A;  1GP5 A;  4N9I A;  3UGG A;  4DY5 A;  3HN1 A;  4DS0 A;  5FRA A;  4OI0 A;  3W5N A;  3OD4 A;  1VAV A;  1EYB A;  5AC9 3;  4LBJ A;  2VZS A;  3ABZ A;  4YVW C;  2RS5 1;  3D82 A;  1HB2 A;  2AEY A;  1XB9 A;  1QXR A;  3HVD A;  4XC9 A;  5A3L A;  5EFU A;  4XQW A;  1PVC 1;  4HSL A;  2PMW B;  1ENX A;  1HB3 A;  1MZF A;  1HJG A;  5DAB A;  3O1M A;  5C3S A;  1WD3 A;  1RUF 3;  2X09 A;  2A5Z A;  4LE3 A;  4RS5 A;  5FMC A;  4YNI A;  4JGZ B;  2E31 A;  1FYU A;  1PO1 2;  2EAL A;  2ZA9 A;  2GSY A;  5F32 A;  4MXV A;  5J98 B;  4B3N A;  4XBQ A;  3B3Q E;  3D8C A;  1RUC 3;  2DU0 A;  4LEJ A;  3CLP A;  2QKD A;  3NV1 A;  3B7M A;  2XOM A;  4QX5 A;  2BRT A;  2WN2 A;  3VDA A;  1WCS A;  1JYI A;  4B29 A;  1UPS A;  4XMA A;  2X10 A;  1AR8 1;  3VBR C;  1IKQ A;  5FY4 A;  1SEF A;  4XJ8 A;  3URF A;  1S0I A;  4XFF A;  5JOY A;  4IE4 A;  5HCH A;  3CZJ A;  3S6P A;  4OYU A;  3AL5 A;  4AI1 A;  4I3G A;  2YYO A;  4FTE A;  1U0A A;  1AYM 3;  1OFS A;  1JU4 A;  1RHI 2;  1RMU 1;  4MG2 A;  3VBH C;  4LO6 B;  2Z4F A;  4NJ4 A;  5T5L A;  1EV1 3;  2ZAB A;  4WM8 A;  2BUK A;  2G19 A;  4AR2 A;  4DXT A;  2KXL A;  2VMC A;  3M3O A;  1QJZ A;  5CG8 A;  1UZV A;  3OF1 A;  5I0R A;  3J7H A;  4BQY A;  4WVM B;  1JOP A;  3ZXD A;  3USU A;  2VW0 A;  4W6W A;  1OHF A;  3HNM A;  1AF9 A;  3N9O A;  3BTX A;  3VBF A;  3GZA A;  2RM2 2;  2DDU A; 
#chains in the Genus database with same CATH homology
 4LK7 A;  4LKE A;  1W8T A;  3ZYB A;  4AL9 A;  1WZX A;  1UOJ A;  4LK6 A;  1W8U A;  2K46 A;  1GWM A;  2LRP A;  2WYF A;  3ZYF A;  1W8W A;  4BQ4 A;  2JWP A;  1WCU A;  4CP9 B;  2VXJ A;  4LJH A;  4BQ3 A;  4BQ2 A;  2LRO A;  3ORJ A;  4A6S A;  4BQ5 A;  1OKO A;  1W8Z A;  4YW6 A;  1GWL A;  4CPB A;  4LKD A;  1HN0 A;  2C24 A;  4LKF A;  4YW7 A;  3UT0 A;  3F95 A;  5D21 A;  1GWK A;  1L7L A;  1WMX A;  4CPB D;  1V0A A;  2KR2 A;  2O14 A;  2Q1F A;  4CP9 A;  4YWA A;  1W90 A;  3ZYH A;  1OH3 A;  1W9F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...