1UOJA

Crystal structure of pseudomonas aeruginosa lectin 1 in the calcium-free state
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
121
structure length
121
Chain Sequence
AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PA-I GALACTOPHILIC LECTIN
publication title Structural Basis of Calcium and Galactose Recognition by the Lectin Pa-Il of Pseudomonas Aeruginosa
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 22
structure length 121
sequence length 121
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07828 PA-IL PA-IL-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 1uojA00
4BQ3A 1GWKA 1V0AA 3ORJA 4CPBD 4BQ2A 4CPBA 1OKOA 4BQ4A 2K46A 2LROA 2O14A 1WCUA 4BQ5A 1W8TA 2JWPA 4CP9A 1HN0A 2WYFA 3F95A 1WMXA 4YWAA 1W90A 1GWLA 4LK7A 4LK6A 1GWMA 4CP9B 4LJHA 4LKDA 4YW7A 1W9FA 1W8ZA 1WZXA 2KR2A 4LKFA 4A6SA 3UT0A 1OH3A 2LRPA 1W8WA 3ZYFA 2Q1FA 2VXJA 4AL9A 5D21A 4YW6A 4LKEA 3ZYHA 1W8UA 3ZYBA 2C24A 1L7LA 1UOJA
chains in the Genus database with same CATH superfamily
2BBAA 4LO5B 4UWDA 1AR82 5IYYA 2FCTA 2LROA 2QDNA 4O7XA 3ZN5A 4MVTA 4FI9A 2W1UA 1AX1A 2VO5A 3NNFA 5ABJA 2FDJA 3DEMA 3SQOA 3UGFA 1CZTA 4RL7A 4LBOA 4K3UA 4S2FA 2ZGNA 4A3XA 4A41A 1QJY3 3I2FA 4IEXA 5EJ3A 3JBG2 4GKXA 5HCHA 3UT0A 1LHVA 1VBB1 4HPKB 2WQZC 1SPPA 4UW5A 3X29B 4CDWA 3RNSA 4TLGA 4AQ2A 1WCKA 1QQP1 4FOVA 4BQYA 2WKKA 1I5ZA 2ZABA 4F3JA 1ND3C 5H9RA 2WNVC 1W6QB 1RIRA 1E5HA 2WYSA 3J7LA 3KQ4B 4PCRA 3J9SA 3NW4A 4AVTA 2QZ3A 1GP5A 2F17A 2P3YA 4H7LA 4QQ2A 1AL0G 1Q8SA 5L9VA 1AYM1 4QM9A 4YPJA 4E4ZA 3RPQA 2D6PA 4S2GA 3BODA 2ZHKA 3T2TA 5LY1A 2RDNA 4KGGA 2UYAA 1KITA 1TE1B 1XBFA 4YVWA 4M3CA 3ETQA 5J98B 5J96B 4QPGA 3EYPA 4ZU7A 2E53A 2OYZA 1OLRA 4K7JA 4NMIA 5JLVA 1CAWB 3I2KA 1E5RA 3RYRA 4QHBA 4AHXA 1VB4A 4QKFA 4BMEA 3VKOA 1S2BA 1ZZCA 1OURA 5A1AA 4JC1A 3AP7A 4E2QA 1ULCA 1J3RA 1HKDA 5FP9A 5FMDA 2B39A 2EICA 2WZPP 1NCRA 1TMF1 4RS5B 5F3IA 1H6YA 3S6PA 5IK5A 3POSA 1ST8A 1SBDA 3ZFGC 5FZ3A 3Q8FA 4M3CE 3AZWA 4XF4A 2IXIA 2C9AA 2K2SA 2R1DA 1OPMA 2BOJA 2HWC3 3VBUB 5A3LA 5CISA 1F2NA 4QPGC 4WBBA 3K46A 5JPMB 1QKQA 1RINA 2EAAA 3QOPA 1LOGA 3KV9A 3P1IA 3AP6A 4V2VA 1BBT1 1HV0A 3WD5A 3IBMA 1O59A 1PMJX 2VZPA 1NAEA 4XYXA 4B4RA 2JE8A 3IIIA 1BHGA 2O0OA 1Y7BA 3HAGA 4EN0A 3KVBA 5C8CB 3NJZA 1ASJ3 2B9VA 5A6ZA 3HEIA 4A7KA 1O5LA 3FHQA 1KDKA 1ZBE2 2Q8EA 4A6OA 2FMYA 2CV6A 4MXVA 3VBFA 4YM1A 4ZZ8A 4LK6A 2HKXA 4E4DX 3PHMA 4C0BA 4ZPIA 5FLJA 1R1A1 1FPN3 1RUI3 2RDRA 1SQ4A 3VD5A 3NAPB 1SLAA 4S2HA 1YHFA 3PIJA 5FK7A 1GOFA 3GGLA 3C7GA 1F35A 3BYWA 4R9CA 1CJPA 4Z92B 2WAOA 4GXLA 2ZCWA 4YLZA 1ZRCA 1RYYA 1NT0A 3I54A 4CUAA 3KMHA 2VOVA 1SFYA 4DOUA 1PIV2 1SHWB 4YGCA 3T4HB 3ZR6A 4CEWA 3VKNA 3VDAA 5A33A 3IIAA 4META 2WA4A 1EAH3 1VBD3 3GBGA 1POQA 1YQ6A 2VCAA 1CX4A 4U36A 2AGSA 3VBUC 1QJX2 1W0NA 3T4VA 3H0OA 4YW7A 4B1LA 3FLTA 5K4LA 4W6WA 1GZCA 5ACA3 2WZR2 4MX3A 4B29A 2JG9B 4LE4A 1QF3A 2YHJA 3WNXA 5IVEA 1QJEA 4YZ2A 4B1MA 1G9DA 4AEKA 3PMEA 3FE5A 1QWRA 1NY72 2R071 5JSOA 3TN93 4FFFA 3A23A 4R4XA 1AYN2 5KWRA 5C8CC 2RS11 3N9OA 4LE3A 4Q4X2 1XXNA 2YMZA 4IV3B 5JVVA 1C57A 1RITA 4HONA 4HSJA 2QKDA 2E7AA 2WFF1 4Q0UA 3N7LA 4NAMA 3IDEA 3D3AA 1GWLA 2GMMA 4K40A 3A4UA 3I2GA 4Q4V2 2BJSA 1GUIA 1RVF2 4OUMA 1QMJA 1YEWA 4NHKA 3RVHA 4CCEA 4Q8KA 3CDZB 3RZJA 3RI8A 1I3HA 2EAKA 1LGCA 2GH2A 3OSDA 2OVUA 3MPPG 2QQIA 4YZ4A 1O5UA 1OHFA 2VQTA 3LEKA 1RUOA 5DDJ3 5FYHA 1GQPA 2HWB3 4IEUA 4D7YA 1JZ4A 1X8MA 4DUWA 1JZ2A 3JQWA 4B3NA 2F6BA 2H6CA 3THDA 3QD6A 2V72A 3APBA 2QQVA 4JGZA 4OHZA 4DPNA 4F7ZA 2CAUA 1JYIA 1UOFA 2TBVA 4XFIA 5A32A 4BQ1A 2CWSA 3THCA 4IEYA 1CONA 1WMFA 1H4HA 1JZ8A 3J8F2 5APAA 2AENA 4QX5A 2JD9A 4Y3OA 1DQ1A 3HQRA 5I0TA 4NIDA 2QQKA 2YFUA 3MW2A 4E8CA 5KR7A 2VC9A 4PLNA 3MHZA 4OFGA 3D82A 3QACA 3WDWA 3UETA 1UKGA 2D6MA 4XXAA 5GZFA 1RUNA 3OD0A 3WNMA 2RM21 5FYVA 5JXGA 2W5FA 3D0JA 2AH2A 5EXOA 4AG4A 3FHIB 2Y64A 1UF2C 3MV01 3CJXA 4CCMA 1DQ2A 4FFIA 1H30A 1YFYA 2VAUA 3K4ZA 3NV2A 4MGKE 2ZPXA 1AL22 4IV3C 3WCSA 4OHWA 2XPJA 3KT1A 4BIFA 3MUY1 2A7AA 1W8OA 3PVOA 4P5HA 2RDSA 4JQTA 3AFKA 5HPOA 1J59A 3FC0A 1TEIA 3HBKA 3KT4A 1AR91 1PGL1 1D4M2 3OBRA 4FP2A 5FXWA 3UJQA 1XNTA 3AP5A 4DXRA 5L7OB 3O1VA 4NWVA 2NP0A 1WCDJ 3IZOA 1QJZA 1VBC3 5FYZA 4X8PA 2PHLA 1U5XA 5F5QA 1HRI3 1FMD1 4GZ9A 1W8NA 5FPBA 3ZFFA 4CDQB 5IFTA 4ZS2A 1AXYA 1NZCA 4XFFA 5BNOB 3RZKA 3DECA 3BALA 3MEPA 1QOTA 5IVYA 4N7IA 1FOD2 4UOJA 3N7KA 1H8VA 4LQRA 4QDQA 3KCCA 1YNAA 5DG1A 3ZFEA 4Q8LA 1HIXA 4MH0E 4O9GA 3C7HA 3U4XA 4MGZE 5CB7A 1ULPA 1O4ZA 2V5YA 4KG8A 4PIZA 3MLLA 4OHXA 5E8AA 2Z4FA 4UFIA 1VRBA 4LLOA 3ROUA 3WUDA 5F3CA 1PMIA 3JB8A 5FTTC 1NQDA 2BFUL 4N8MA 1T6BX 5EJ1B 4HL0A 5JIAA 2IVJA 3RJ2X 1CVNA 2DVBA 4BQXA 2GAUA 4W50A 2OUJA 2XJQA 3NNMA 2VZOA 4RHV1 5FUNA 4C90A 5KXEA 2VZRA 2ZGPA 4D6QA 1WW4A 2OPWA 3H1WA 3KCYA 4I0WB 1MPXA 3K4AA 3U75A 2WLQA 3K77A 5JR2A 3PNAA 2WA3A 5IVCA 2A6XA 5JZGA 1YCIA 1Q43A 2ZGQA 1CR7A 5A3MA 1OA4A 3OBAA 2GNBA 4XBLA 1Z7S1 4FVVA 2XJSA 2IXHA 4IERA 4DEVA 1ZBA1 4K6BA 5JUVA 1DQ4A 3KLSA 3E5QA 1N3PA 2VW1A 1QDCA 3OGGA 1AR72 1HB3A 1W9YA 4L11A 5GM0A 5C33A 1RUE2 1A8DA 1US3A 1KFXL 2GC3A 3ZXGA 2R0FA 1W6NB 4TWTA 4OI4A 2WS93 1PGW1 1V6LA 3H1MA 1O3SA 5GLUA 1SLIA 4WM7A 1YFWA 5GZDA 2ARXA 5BNOC 1HRV2 3EQEA 3VKLA 5FPUA 4WM8C 5FKBA 5JAXA 5C4WA 4AWDA 4YG0A 4JHTA 5D8AB 3ORJA 1OBNA 3C3VA 2XLAA 1QOOA 1L7QA 1HW5A 3VHOA 5HCFA 3AP4A 4YW2A 2K46A 1VBE1 1CIYA 2YG0A 4BK5A 4UW6A 3SEPA 3W20A 2VOKA 3WR0A 4JRAA 1YYNA 3VD9A 1RJ8A 3VBRA 3GZAA 4M00A 4P9IA 3E6CC 3BI3A 3VHPA 1VP6A 4CP1A 4LBMA 2RR12 2P6HA 3DL3A 1OVSA 3LGRA 1W06A 1ZZ7A 2KD7A 3VL8A 4Q1RA 4IGQA 4AL9A 5KXBA 1YJKA 2DCKA 2ES3A 4EWDA 3VKMA 3VZMA 1B35A 4UAPA 4N43B 1R1ZA 2HWE1 2JDAA 2W46A 2W92A 2HJIA 2XG3A 4XCBA 4JTNA 4BCUA 3WZ1A 1OVPA 1QXPA 4RFRB 2CWMA 1ODNA 2W91A 1PK6C 4TTGA 1VRH2 4Z2AA 1VMJA 2DUOA 4IQPA 1M06G 3H3LA 2VR4A 2XVGA 1W6PB 3THTA 3RMYA 2WNUA 3ZXDA 4XABA 3POEA 3OEAA 2WNOA 4A4AA 2ZGUA 2JG8B 3WHUA 2UY9A 4BXFA 3LWCA 2ZGSA 3UL2A 5FZCA 3GZUC 5K8SA 2DVGA 2HWD3 2FCVA 1RMU3 5FMCA 4DFSA 5CFDB 2VD7A 4YM0A 3AJZA 3A0NA 2XDVA 4IDZA 5CKMA 4P9WA 1NCQA 2ZHNA 1BEV2 3FX3A 2WQ8A 4M0NA 1KXGA 3PMSA 4I3GA 5D8AC 4KBZA 3OBTA 2EXJA 1R082 3ON7A 4A7ZA 4AI8A 5HXMA 5JWPA 1H0BA 1EPZA 1ZRRA 3FBMA 1TME1 3ZPOA 1Q8PA 4L99A 5I91A 4AYUA 1QIQA 4YNIA 3LKJA 1CZSA 3M3CA 4HVOA 1BK0A 4HVRA 4EQVA 1RHI1 2EVXA 4XW3A 1BVP1 2D7FA 2BGCA 3KCXA 4E4SA 1ONAA 1UY2A 4GMP0 1U5YA 2DVAA 3WNOA 4XZUG 2XBO2 3U11A 5KHGA 2J1RA 1CAUB 3N7MA 2HEYF 3UNPA 2DWRA 2QDRA 4XEZA 2JIGA 2WWJA 4RQPC 1AR61 4FO9A 2XJRA 2DFBA 4I0AA 4CA9A 1UY0A 5BV6A 3AYAA 3WSOA 5FYSA 4Y4RA 1A3KA 2XUEA 1BKZA 4OZXA 2X5IB 1AX0A 1VBB3 4P9JA 2FZ2A 1QQP3 1PMHX 5ISLA 3ZIXA 3MYXA 2B45X 3O12A 2P6CA 4FXKB 4K9SA 2WFPA 1C1LA 5LK5A 1AYM3 3RYKA 3ZYHA 1KGYA 2OZJA 4CCKA 4LULA 1LOFA 4KU8A 4QXBA 1OPOA 2RV9A 2RS51 2XWJB 5F3GA 1AX2A 1GU3A 1JYVA 2CNAA 3AZVA 3E97A 2HBUA 2J22A 1XE0A 2ZX1A 1WLCA 4NRQA 5DZEA 1H1AA 3WQBA 2VZ1A 4BDVB 1HN0A 3JCIA 5ANNA 1FXZA 5F6KA 2WRAA 1W39A 1X9TA 4LA2A 1PO13 3SCHA 1XNCA 3H7YA 4FSJA 1W6OA 3IAPA 4LBQD 4NVPA 4QXHA 1GQGA 2PQQA 4XXPA 1A78A 2JJ6A 3PURA 3CJIC 1ZA4A 2CYFA 3E1F1 2VTXJ 1W04A 2WO2A 3LDBA 3MIDA 1TMF3 2I2SA 3M4FA 4UYBA 2EXHA 3CU7A 4QU2A 3HMYA 4CEYB 2SBAA 2UY8A 1N1VA 4QGNA 1YWKA 4PI2A 1RUJ1 5FYUA 3MLJA 3USUA 2Q30A 2IWGB 4B7EA 3EB7A 1FX5A 5A7NA 1ASJ2 2ZX0A 5FYYA 2YU2A 1BBT3 3BTAA 4GAZA 2JD4A 1HB1A 1QH6A 3NNJA 4HN1A 4JGYA 1W6MA 4LKFA 1KS4A 2Y26A 1UMZA 4UXAA 2VTFA 3P6BA 1GNYA 3C7FA 3N3HA 3PVEA 1FYUA 3USSA 1OKQA 2VOTA 3LEMA 5CIRA 1EV11 3ZYGA 1GSLA 2PQSA 4CDXB 3WG2A 3H8UA 4AK3A 1HV1A 1MS8A 1XRUA 1G9FA 2BQPA 1SCSA 2GNDA 2WR9A 2ZGKA 3NNLA 4O9EA 2RJLA 5C9AB 1R1A3 1BYHA 1LTEA 5FPZA 5IVBA 1G9BA 2VTXA 3GZEA 3FL7A 1JYTA 2WSUA 2EA7A 5C3RA 2VNRA 3KSCA 4IE5A 1OLMA 3UKNA 2BYVE 2RS31 3P3PA 2RHPA 4N53B 3SCGA 5C3QA 1DGRA 4LA3A 5FY0A 3ZM8A 3WP4A 5JOXA 5FO9B 1ZRDA 1VBD2 2UWBA 1HXS1 4NHLA 3UYJA 1MQTA 3J7HA 4DINB 4Q4Y1 2JDNA 2XOMA 2JDZA 1CQ9A 3O1UA 1UZZA 2IXJA 1BJQA 3D8CA 2EXKA 1SBEA 2YFZA 5ERLA 3ZYBA 5M0TA 1UZ0A 1WMDA 2BOIA 2GALA 3JQXA 2PLV1 3I2JA 3V56A 3OGSA 3OCPA 5FIXA 2PTMA 3TN92 4ARXA 2QFEA 5FZ0A 4YRDA 2BPA2 3ZDVA 3MFCA 1UU4A 3HD8B 1AVBA 4P9GA 5A6YA 4YWAA 4EE2A 1JU4A 1WLDA 1D2SA 3CKHA 4QB1A 3I8TA 1AJKA 3IPVA 4COZA 1YC61 2R073 2A71A 4HSLA 4KNCA 4PDWA 3VBOB 1IS3A 1E57A 3J7NA 2RS13 4JDOA 5K0UA 1BMV2 4H2AA 5FLHA 2BBVA 3WQ1A 4CDUB 4WZFA 5DDJ2 1IG3A 1US2A 2WFF3 2C24A 4XFHA 4DY3A 1GNHA 1ZM1A 5T52A 1MZ5A 3I2OA 3BU0A 4GA9A 5C9AC 4AXOA 3LPFA 1IGOA 3VLBB 4EYUA 1IHMA 2WS91 3RI9A 1ENQA 1REDA 2ZMNA 3LAGA 2JE9A 4QT6A 2VUJA 1G6NA 5A1LA 1ZRIA 4FPKA 2MEV1 1H2KA 2VQAA 2XQXA 3AFGA 1MS4A 1WW6A 2WO1A 4IEPA 5BPXA 5JR7B 1PZ7A 2AC1A 2AR6A 5A7OA 5F37A 4YFZA 2VUCA 1H2MA 2ZHMA 5HI0A 1OOPB 2QVSB 1ND2B 1OQ1A 1QJFA 1UY1A 4GH4A 1Q8VA 1OF4A 2VZTA 5T5OA 2MHFA 5FRAA 1F5JA 1PVC2 1W8TA 4IEZA 5LBCA 5F2SA 2E31A 4FQ4A 4LEJA 3WF2A 4D94A 1V0AA 1MVEA 2ZKNA 2QQMA 2YUEA 1LHWA 3B7MA 3FBYA 3POJA 4D6SA 1GOGA 1J1TA 2Y0OA 4AGRA 2VVFA 5JOWA 2FDHA 2VY0A 4GKYA 2RM23 3PU3A 2VXRA 4PBOA 3DF0A 2ZX3A 5E6HA 3RMXA 3KM5A 3V0AA 4LO8A 3WG4A 5C6CA 5CFCA 3K3OA 3N9LA 2KM2A 3VBOC 2WZEA 4MGIE 4ATEA 1JODA 3AKQA 2F4LA 1PVXA 5BNPA 5C8WA 2WT1A 4GJZA 1RTVA 4LKEA 1QJU2 5DQ0A 3UGGA 5F1RA 2DBNA 4ES9A 1VBC2 5FZ9A 1N3QA 4MGSA 1VB2A 1CGPA 2E51A 3WX5A 1AR93 1HRI2 1EY2A 2PHRA 3RG0A 2P17A 2WNVB 5EIYB 5FZKA 5LRRA 5FREA 5BYNA 2CSGA 4YZ5A 1N1TA 1WMXA 2MNGA 2VMIA 2ZBJA 2P34A 3DPRC 4OUSA 3FLPA 1K5MC 4LK7A 3IB3A 3POBA 1FMD3 3O1RA 1UW8A 2XXZA 2ZACA 4YGEA 5DAQA 2ARCA 2KR2A 4Y20A 3SXWA 1Q8QA 1ND2C 2ADDA 1V6MA 2VZUA 1PM7A 3GZTB 4CP2A 5BNPC 2CDPA 3LE0A 1NQJA 1W0PA 2VZ3A 1O91A 2UU8A 2BGPA 3O7OA 2ZEWA 1UPIA 1POV1 4HK8A 3AXEA 2VNOA 3RSJA 1OXCA 1UYZA 4AAXA 1PNGA 4PIYA 1SLLA 2AUYA 4WVMA 2ZMKA 3DXTA 4XMIA 1QU0A 4XBNA 3GBWA 4A2UA 4N7UA 3TOJA 3WW3A 5FDBA 5CADA 3ACFA 1JYCA 4RHV3 2VUAA 2BV4A 3PVNA 1MZFA 1PO21 2BFUS 5F6LB 3ZXKA 1DZRA 2GC2A 5T5PA 3ZFGB 2QCSB 1PNFA 1MEC1 3NMBA 4KBBA 4Q5OA 3O1MA 5EYXA 4M3CB 2VL4A 4W6XA 4IV1C 1LAJA 2RVAA 4QPGB 1X7NA 2WJSA 2G1MA 2VPVA 4HETA 3IDAA 3JXSA 4KU7A 4QX0A 1OMIA 1Z7S3 2YZ4A 3QH7A 3LA7A 4MADA 4RYDA 3CQOA 5FYBA 4AW7A 4OHYA 1ZBA3 4OMDA 2PA7A 1RL3A 4Q4W2 2D93A 3NV1A 2VOXA 4BA6A 1TNFA 4QX2A 5DG2A 4J1WA 2XMLA 4IE0A 4ZXKA 3QLQA 1DF0A 4BQ4A 1ULOA 4BQ5A 5CKQA 5L73A 1UIJA 1PIV1 3AX4A 4QX1A 4QQHA 5ABJC 4YGBA 4LOTA 4GB31 3ZO0B 4R9AA 1SACA 1XNKA 5IVVA 1STMA 4LNVA 1WZXA 3H8OA 3BTXA 4HFSA 5ANQA 5IUQA 3SH3A 1CESA 3OUHA 5BNNA 2H0VA 2CTVA 4BB3A 1OUSA 2OXBA 5A3WA 4CDWC 5KC6A 3E6DA 3U10A 3WV6A 1UPSA 2YU1A 1VBE3 2D3RA 3I3EA 4ARYA 5C3OA 4FTEA 2QTWB 5FJHA 4BQWA 5IK7A 1W2NA 1SEFA 3AM2A 3EO6A 1A6CA 4FQZA 2CDOA 4NHMA 5DAPA 1PO11 3WQ7A 4AGVA 1NY71 4BLIA 3MF9A 4PLOA 4UBHA 3Q9OA 1AYN1 1NE4A 1UU6A 3MIBA 4Q4X1 5CNAA 5JXJA 4OVEA 1I9RA 5FZ8A 4CYDA 2DU0A 1NA1A 5L36A 1XQNA 4HPKA 3QBQA 2AACA 1F4HA 1H9WA 4ZZ5A 3VBFB 2HWE3 2VBDA 4YVWC 4ZKTB 4SBVA 1OH3A 3W5NA 2VW0A 4H3WA 2QJVA 1IPKA 2VXJA 3OGRA 1C1FA 4QKNA 5IT6A 2HWD2 3D4KA 4XILA 4BMBA 1MVQA 4ZU5A 1W8UA 3ACIA 3D5OA 1GP6A 4EN9B 3IKWA 4BE3A 1YQ2A 4XF1A 1AUYA 4X6RB 1DQ5A 1IS4A 1MS3A 4NHYA 3LFMA 3UK9A 1TNRA 4WVVA 2VMGA 4RN5A 3GBFA 3IDCB 3WVJA 3SKVA 1GZTA 4CEWB 1S0BA 2GC1A 5HBAA 1NCRC 3LZZA 5FY8A 1NA1C 2QE3A 1S4CA 1W2TA 1YUDA 2PMWB 2J1EA 3C2UA 3J8F1 3K75B 3THPA 2HEWF 4NIGA 1CWPA 2GN7A 2PHUA 5FPXA 4NRMA 5J09A 4HKOA 1MS0A 2NM1A 3NJVA 3GF6A 2V5DA 2W9XA 4XURA 1TME3 1UIKA 1V6OA 4IE6A 1H8TA 3OF1A 5A1FA 3URFA 4Q0PA 4XBQA 4QAWA 2ARAA 3ELNA 4YVSA 2A6ZA 5GZGA 1CZVA 2WABA 5KXCA 1Q8OA 4XHBA 4AI0A 1RHI3 4BIOA 4CCNA 4RS5A 5LATA 3PJQA 3KGLA 2FMDA 2WIIB 3FFQA 3S0MA 5FLIA 5BY5A 5C5TA 5LEJA 1NLRA 2W47A 4LBJA 1RUC1 1UKRA 3VBFC 4D7TA 4K8FA 3ATGA 1HQWA 4XDOA 4PIXA 1AR63 1RJ7A 1W3XA 2LRPA 1LKNA 2PXJA 1O3TA 4O61A 3DYMA 2XONA 2W1WA 4Y4YA 4CCOA 2CL2A 4NUBA 4SLIA 1COV1 3LOIA 1AYM2 1YIPA 5GALA 4GIQA 5EPAA 4NOTA 2DTYA 4KL1A 4CPBD 3RS6A 2RMU1 2V4VA 5FFOC 3UGHA 3HVDA 3WY6A 3I3MA 4CEWC 1BVVA 2JE7A 2VBPA 1S55A 1PX4A 1WCSA 3B94A 3DYPA 4CU6A 4CCLA 3JD73 3NAPA 1DG6A 4XUPA 5L9RA 4QQPA 1CPNA 4RR3A 5F9TA 5J36A 4URTA 1YIFA 1V70A 4FPFA 1MS9A 2RS53 1GKBA 4TZDA 1JOPA 4PQQA 1WW5A 2Y6LA 3H7JA 4IE4A 4YZ1A 1C5HA 4BWOA 2WO7A 3POYA 3SNMA 3ENRA 2UWCA 4KWLA 2B46X 1C8M2 1TMF2 2XKPA 3GJBA 3HN3A 4L2NA 4XUQA 4XJAA 2X05A 3ZMNA 4BU2A 1OT5A 2BVVA 2Q8CA 3AB0A 4OLLA 3B69A 2R16A 5A7PA 1KD7A 4COUA 4M4RA 1JH5A 3SKJE 3ZSKA 2G9GA 4WVWA 1GMMA 3H42B 4UFJA 4XVHA 2JG9A 3AKRA 4IE7A 4A7YA 5LA1A 1OF3A 4RFT0 4RR3C 2GNTA 4LUKA 4PBPA 1BBT2 4P5YA 5JMCA 4DS0A 2A6VA 1JZ7A 4I2OA 2Q1FA 1RUJ3 4CXXA 5FP3A 2XUMA 3BN6A 1RUE1 3KV4A 2PAMA 2VG9A 4Q29A 3VBSA 2JICA 1I1EA 2OUHA 3AVSA 4E27A 4XQ4A 3TWIA 3B01A 1DLLA 5IATA 1DIWA 3I49A 3AMHA 4Y33A 4JGZC 1HRV1 2C1FA 2SLIA 2VZSA 3RZGA 1R64A 4IUGA 1DGWA 4TXWA 3J4UH 2GC0A 5FZIA 1X9PA 3OPZA 4OZOA 5DAWA 1ACCA 3GDBA 3PU8A 1NUKA 3TNPB 1LENA 2B7YA 1R1A2 5GLTA 4QPWA 4FP3A 5JDBA 1CAXB 1CPMA 3ZFEB 4E9KA 2I07B 1GZWB 3A21A 3DCQA 4CE8A 1EV13 1IQDC 1WD4A 2ORXA 5DABA 3ETPA 5TSWA 5A3PA 5B2GB 5IFPA 4A6SA 4CVUA 3BIEA 1WA6X 2R7EB 4XFCA 5JMOA 2D6OX 3SH5A 5FZHA 3UKVA 2ZEXA 3WP6A 1SLCA 1WGPA 3AXDA 2ZZQA 4Q1PA 3LIGA 2A1XA 1QNYA 2RS33 4UF0B 4UFHA 4NN0A 4BLJA 4WM8B 2BVBA 4C1XA 5JSPA 2R32A 5FZBA 2BUKA 1OI6A 3I3DA 4RA0A 3WDTA 1HXS3 4XIKA 4EN8B 1LECA 2DBIA 1ENXA 4Q4Y3 3FZ3A 4YG3A 3RGBA 4BM8A 5AFBA 3AYEA 4AVSA 3BPSA 4AFMA 3CMGA 2ZGLA 1W90A 4C1WA 2R042 2LM3A 2VM9A 2W68A 1K42A 3O5SA 2IFWA 2PLV3 4PF5A 3ILNA 2JIJA 3E6BA 4OULA 4LBQA 3ABZA 5FZDA 4R4ZA 2Z69A 2J1SA 3ILFA 1VALA 2XL9A 2PHDA 1HDKA 3ZFFC 1R091 2ET7A 1BEV1 3GCWA 1GWKA 1VAKA 3T0AA 2B5HA 4FTBA 2W87A 1YFXA 2OZ6A 3HNBM 4COWA 1JMUB 1R081 3SCFA 4FFGA 1PZ8A 1D0GA 3ZFEC 5KXDA 1PK6B 3V0BA 1RUD1 1K3IA 5L7OA 1LB2A 4HANA 3DKWA 4HOOA 4QU1A 3RZHA 1X36A 1ZRFA 4LJHA 1C28A 1DLCA 1HB2A 5JOYA 4P9LA 3N9NA 2E6VA 1XYOA 5HXVA 5KHJA 4XQWA 4CDQA 4QDRA 4YARA 2CGPA 4JHZA 4PF1A 2JXAA 2QBXA 2ZXQA 2VULA 4JKLA 1XYNA 5FPVA 3ZYJB 4QPIA 3CEWA 2E63A 5IVFA 3BOPA 3A22A 1B35B 2C5DA 1RUG2 1KS5A 2MEV3 5K7PA 4GULA 4MLOA 3W58A 5JZGC 5DUXA 2V09A 3FUQA 5A80A 3MLKA 3KZ4C 1X82A 5LCWL 2VE1A 1LOCA 4PJYA 1CD3G 2PHXA 3M70A 4QHOA 4YZ3A 3WHTA 2RM22 2A3WA 3B93A 3NRUA 4C8DA 3VV1A 3T3YA 3VD3A 5A7QA 2LS6A 1OLQA 2RJKA 3MV11 4P08A 1ODMA 5A7WB 4M4PA 4ATFA 4FPEA 2J1AA 4UI9L 3O1SA 2H6BA 5FP4A 3T0DA 4WM7C 5JCTA 4EV0A 2VCCA 4QPIC 1XYPA 3I59A 2BEOA 5C4WC 3AC0A 2YC4A 3IM0A 2LTNA 4OHVA 4RQPB 1UMIA 4PI0A 5L9BA 1AR92 1C3HA 1F4AA 2ZA9A 4GJYA 4DXZA 1JYXA 4AR2A 2FDIA 5C70A 1J83A 1NXD1 3POIA 4J6GA 3T1LA 1F9KA 4BHPA 3DXUA 1W6NA 3SHRA 3VBRC 4YFWA 3VUOA 2OX0A 3R05A 1NZIA 2ZMLA 1WLTA 3RJRA 3M3IA 1FMD2 1NLQA 1U5IA 1YLLA 3OY8B 2NLRA 3MO4A 5J7MA 2Q8OA 4FAGA 2C26A 3I2HA 2W1QA 3OG2A 2FDFA 3JZVA 4FBFA 1RUH1 2DV9A 4LHKA 1YFUA 3VD4A 2DCJA 3DKQA 5JIUA 4K8RB 3JUUA 1DQ6A 1B35C 1XSRA 1UOJA 3ZOIA 1UXZA 2JDYA 3WXPA 1O4TA 3SISA 4IGOA 4D0QA 2GH8A 4TLFA 1S0DA 4R52A 4YG6A 5CYYA 5CKNA 2GZWA 2DCZA 2JKXA 1PM4A 4GALA 5F5CA 1GICA 5FOBB 1Y9QA 3WLUA 4AFDA 2VCMA 1V9U1 1S0IA 1IKQA 2P3JA 2WL1A 3NJXA 2WNUC 5AC91 1SBFA 4YSFA 1POV3 4H7MA 5T5LA 1W03A 1NKGA 1OD3A 1GFF2 4LHNA 3I3QA 2ZJCA 2H0BA 3OJBA 5FZOB 3WF3A 4YYOA 1QJY2 4CZSA 4DZGA 2XGXA 4XIOA 3WDYA 4HBNA 1CAVA 4N43A 4NIIA 2Z5WA 3MI8A 4ZHNA 3OYWB 1ZZ8A 4V1PA 1NCQC 3WNNA 1UMHA 4B4QA 2YBKA 1REEA 1TZOA 4OQ9A 3AMMA 1H4GA 1PX3A 3CJIB 3RWNA 1WLWA 3JB4C 2B42B 3MUZ1 1RUF1 1PO23 4CUCA 1ZBA2 5DUUA 3BCWA 4YM2A 3ZX7A 5BUVA 1J3PA 4HN0A 3WUCA 3NV4A 1MEC3 1UU5A 3E5UA 3ZPYA 2JG8A 1AZDA 5FWJA 3T0BA 3GXUA 3I2IA 3LCPA 4FXGB 3RDIA 1PGW2 2P4EA 5CFDA 4XHXA 4MG2A 2W3JA 2FBEA 2ZKLA 3F2ZA 4Q0SA 4XF0A 1DGLA 5AVPA 4BISA 3GNEA 2GN3A 3PTRB 3R6SA 3GYDA 1S0JA 4AZZA 3LFIA 3JD71 5FY4A 3ZYIB 3WOGA 3TEZA 2X53S 4AEMA 1PIV3 5A7SA 3VBHA 3ZSEA 1L7LA 5GLWA 1VBE2 4JDMA 2HWF1 3VL9A 4GWIA 2ZX2A 4GB33 2GMPA 3M3OA 2YXSA 3ZYRA 4QGMA 2O14A 1UY3A 4GQ7A 2WINB 3USUB 5KHIA 4B4PA 1FI2A 4UFLA 3KS7A 1VBA1 3M2MA 1S0EA 2ZZJA 5J48A 1W8ZA 5LASA 4AE2A 5IAXA 3RZMA 2HYKA 4FOYA 5LEKA 3TEXA 1KQRA 4C91A 2HWE2 3ZN6B 4AHYA 5LK7B 1O3QA 2HWC2 4JGYB 5BXXA 3MZHA 2R1BA 3B9IA 1AYN3 5FY9A 5EHDA 3OUIA 4Q4X3 3ME2A 3VBHC 2A75A 3I7DA 1UY4A 1YJLA 1F5FA 1LOFC 2UYBA 4K1ZA 2X5IA 3WG3A 5C71A 2VUDA 3R4SA 5LW9A 2GP5A 1E5IA 2FDKA 5LBEA 4JQRA 4DXSA 1S0CA 4LXLA 3Q8BA 3MBWA 1SFNA 1MS5A 1RVF3 3HNMA 3S5QA 2IXCA 4DUVA 5FZFA 3GJAA 1QOSA 2TEPA 4XDPA 4A42A 1SCRA 2R061 3FFZA 3M7AA 3N9PA 5DUVA 2K0GA 1UOBA 3ZSLA 4AEDA 1OUXA 3HR9A 1W9TA 5E1RA 2AREA 2ZEZA 5B4NA 2CHHA 4DRRA 2CGOA 1MQTB 1FPN2 1RUI2 4K21A 4XJWA 5FQ0B 1P8JA 4FOQA 3KT7A 1YI7A 4JAAA 5FZLA 1UX7A 1TME2 2EXIA 3O1PA 4X6QB 5F5IA 3N36A 4FPYA 2PELA 3OEBA 4AQTA 5LBBA 4YGDA 4BQ2A 3J8F3 3K2OA 5A6QA 2WDBA 1DBNA 1XB9A 3VN4A 3LF7A 1H6XA 4ZY9A 3PUSA 3U1XA 4KWUA 4UW4A 1EAH2 3KB5A 4AEDC 4YW3A 5KBFA 2VQ0A 5LB6A 4RGAA 3WEZA 3IPVB 4JGYC 4JRLA 3S7EA 3T30A 3DUIA 1XE8A 3WDVA 1AR62 1HJGA 1IZ3A 4QDSA 4CEYA 4HG6B 5ACA2 2E26A 4JVAA 1AL23 4JKMA 3SH4A 1QJU1 1XU2A 3VKFC 3ASIA 1I5PA 3C7OA 1RUC3 2J1VA 3KGZA 5F2WA 3N4MA 4NRPA 1M4WA 3H50A 4FT8A 4FPOB 1OLME 2ET1A 4QB6A 2JDHA 4QXCA 4XTMA 1MR5A 3F95A 5FY1A 4YW1A 2WC2A 5FZMA 3H9AA 1UO9A 3IT8A 4GD4A 4EN6B 1JOJA 4XJ8A 4LBNA 1COV3 3LSEA 4QM8A 3WG1A 5C3SA 4XDQA 4I30A 2R49A 1XNAA 1MQTC 1WBFA 4LO7A 5F8PA 2RMU3 4ET7A 4M0HA 2Q1MA 1G9CA 2JB8A 3ECQA 2VU9A 4Y26A 1UX6A 2V73A 5FZ1A 4Z1VA 4QX3A 5CBLA 2QQOA 2K9ZA 2HWB2 4XJ9A 1B09A 3WP3A 5J1XA 1W2AX 3AMPA 3OTFA 2B9UA 2DUPA 2HYXA 5T55A 4AF9A 4LKSA 4N53A 3GCXA 1H1IA 2FD8A 4LIUA 1RB8G 2E7QA 2ZGTA 5FYMA 2HLEA 3SC7X 2D3SA 1AR81 2YV8A 4LBKA 2GNMA 1QDOA 2D3PA 3DPRB 5FZEA 3O0XA 4EJRA 1K5MB 1LHNA 4XFGA 1O8PA 4Y5Z0 5CFCB 5CZKA 5A6XA 4QQLA 5DXDA 4PDWC 5K0UC 3JBG1 4P14A 3VZLA 3RRDA 3PUQA 5BNPB 1AF9A 3WNPA 2PHTA 3KF3A 3Q8AA 1CX1A 1EP0A 2VVEA 1TVGA 2Y38A 3R4DB 4HK9A 4Q4W1 3POFA 3QCWA 3AK0A 1J1LA 3D0SA 3LA3A 5H9QA 4JZRA 3U0ZA 4IEVA 4MXWA 4DO0A 1RUE3 2GP3A 3W21A 2DURA 4KMQA 3FMGA 4DB5A 4BXSV 4LUMA 1C5IA 2Y0IA 4CDUA 2YB7A 2IVIB 1HRV3 4P9YA 3CIHA 3WW1A 1J84A 4A3ZA 3GHMA 2WLPA 2BTVC 3VDDA 4GH4C 1YXWA 1W0OA 5A3TA 1DGRN 3FWEA 3OD4A 4IV1B 5FYIA 3I97A 2X8KA 4S2DA 4FOWA 3RQ0A 1N47A 2RS32 3VD7A 4CPBA 1LOAA 2J1UA 3NKGA 3BB6A 4XOGA 4KWJA 2XVKA 3ZSMA 3MDPA 3AZYA 4CP9A 5GLVA 3H3UA 2W94A 4Q4Y2 3WDUA 4FPJA 2YBPA 2Z42A 4YW5A 4CXYA 5FXVA 3S5AA 5ABJB 4Q0VA 5CFCC 4Y22A 1JXNA 5FZ7A 4AQSA 2PLV2 5FP7A 5LA2A 5G05L 4URAA 2NZ9A 3Q8CA 1XC6A 2A6WA 1SPPB 1VJ2A 3PVBB 4CDWB 4NROA 4LMFA 1IPSA 2DUQA 4LO4B 3BU7A 3U78A 4ZXEA 1CN1A 2AYHA 1UL9A 2FCUA 1T6GC 1YO8A 1WUVA 3M8LA 4XUOA 2GDFA 4AVAA 3AKPA 2Y6GA 3WF0A 3ZXJA 2G19A 5C3PA 1OFSA 1OH4A 3AP9A 5FOJB 1QXRA 1C8NA 1QNWA 4BYYA 1ZBE1 4INDA 1R093 5D2AA 1BEV3 4NR1A 1UYXA 5FZ6A 5T50A 4L0PA 1MZ6A 5LZ6A 4YVWB 1BLZA 2WAAA 3POGA 1JZ3A 1R083 2CU5A 1OA2A 1ND3A 3VGIA 1JN2P 2D6KA 4LOSA 2GSYA 2WS92 2WNVA 4NJ4A 1WBLA 3HNYM 4CP0A 1RUD3 3AKTA 1JUIA 2Y34A 1AJOA 3HJRA 4AI3A 2I45A 4TYSA 2ADEA 2FQPA 2MEV2 3J7MA 4Q2FA 2BU9A 4XCAA 1GBGA 3M3EA 3V65A 1W28A 5LRSA 2YROA 3HBZA 2W52A 2XHNA 2X09A 4NIHA 4DNYA 1OQEA 2WO3A 3OPTA 5FMOL 1WW7A 1IKPA 2DYCA 3PTYA 1JZ6A 2XBO3 3E5XA 3WP5A 5AFEA 1DU3D 1NCRB 1W05A 1NA1B 2VECA 3BVCA 4D6RA 3OPWA 4HT1T 3S57A 3BTZA 3A7QA 2DU1A 2VMDA 1QJX1 2JKBA 4ZONA 4D8MA 5JXHA 3LB9A 2ID4A 2WZR1 3H8RA 1V6KA 3NNGA 3LEIA 4AAPA 5IAVA 3AL5A 4MZUA 4DRVA 1RXGA 4COYA 4M3CF 4UFKA 4HKLA 3VDCA 1F8VA 5A3NA 2JWPA 1LOEA 2D43A 2VZVA 1SMVA 3ZFGA 4Y5SA 4P00B 3T2QA 2DTWA 3KD4A 3U4SA 1NE6A 1DP0A 2OS2A 1S0FA 3M3QA 3PDQA 3R0RA 3ZXEA 3HT2A 3I2DA 3O1OA 2BP6A 4Q4V1 2Y8KA 4Z2WA 5JSRA 1RVF1 5A70A 2Y6HA 5FXZA 4EN7B 3L2HA 5EZWA 1AXZA 2DF7A 5BNNC 2ERFA 1W6QA 4HLTA 5G04L 3ZKYA 1RMU2 5GKAC 3W9AA 3MIEA 1ZA7A 1URXA 3HOBA 2D6NA 4ZS3A 3MPBA 5LY2A 3WDXA 1JYNA 1H8TB 1WMEA 4X8NA 2CGNA 2X29A 4HMZA 4YVSB 1W9SA 1N1SA 1V00A 3TYJA 4DUXA 3AMQA 4FPGA 3CF6E 1MS1A 1C8M1 5SV5A 2VQUA 2XLGA 1XPWA 3TBDA 1T2XA 2BNMA 4DQAA 1D0HA 4CXWA 4AQ6A 2A70A 1RUH3 3AYDA 5T54A 5A33B 1Q56A 4H14A 2VMFA 1DHKB 1CAWA 1ZVFA 5HCBA 4OYUA 2DVDA 2Q1ZB 3O0VA 2BNOA 4WVZA 5F7UA 2IZWA 2D44A 3AZZA 3I3BA 1LEDA 4XTPA 1IS6A 3WCRA 4JCKA 1HJFA 1V9U3 3NV3A 5AC93 4LLFA 1UQXA 1JUHA 5FPAA 3KV5A 3KHBA 1XSQA 3UKTA 3VZJA 1PO22 4UW3A 2E7TA 3D6EA 2WYFA 1AL21 1HN1A 1MEC2 3VBUA 2WN3A 2EF6A 4HVQA 1BCXA 1VBB2 1LRHA 3H3ZA 4Z07A 1LGNA 2OQ6A 2ZOEB 1QQP2 4PQ9A 1OA3A 1NG0A 1RUF3 1D4M1 4I3PA 2IXKA 4RR3B 4CSWA 4JKKA 5IW0A 3EMRA 4XC9A 2DVFA 3INAA 1H8TC 5CG9A 2WNEA 1LODA 4AHZA 2B4KA 2DFCA 2VNVA 2F4PA 3IDBB 3K48A 4YVSC 5C8CA 5JOZA 1Y4WA 1RC6A 4PHZA 5FO7B 1VE0A 3KV6A 4JGZB 4GB32 3AJYA 4RS5C 3PJYA 3RYPA 1KJLA 2D97A 2YBSA 1J58A 1FOD1 1WWYA 3MF6A 5EJZB 2I74A 5A32B 4KGQA 3FHAA 4L92A 3LEGA 5GZCA 4LIVA 3DV8A 1W9FA 2N7GA 4DEQA 5JXIA 1MACA 2HWF3 4QPYA 3CBNA 2KXLA 2R041 4ASKA 2X10A 4E4HA 1FV2A 1PO12 4NAOA 2QQUA 1SFPA 5H9PA 3DN7A 1LULA 2XLFA 3LD8A 3VBSB 1QY4A 3ES4A 5HV0A 1D2QA 3TAYA 1EYBA 2ARBA 3ZKUA 3MIHA 2ZS6B 3R4UA 1KEXA 1VBA3 5LA9A 3VHNA 4AOCA 5DPNA 1SLTA 3L2YA 4K1YA 1LEMA 4UT5A 3TB0A 4AVBA 1LU1A 2QQPA 4MGTA 4Z82A 4FTSA 2VZQA 1G86A 4NIAA 4OMCA 3QH6A 5DZGA 2EIBA 3U14A 3NAPC 2IXLA 1WKYA 3W59A 1UZYA 3ITQA 4CRQA 4W65A 3LOBA 2NN8A 3ZYFA 2C6SA 3ACHA 2JENA 3OOXA 4EWAA 4FPHA 2XVLA 2JDMA 1AR71 2W08A 3KHCA 1GNZA 4XAEA 3OBZA 3OUJA 4JDNA 5FUIA 3ZMOA 1U5ZA 1WA4A 2R063 4IV3A 5GJ6A 3HQXA 4XZPA 3ZFFB 3TEWA 1H2NA 3NWKA 1Q3EA 1RUG1 1RXFA 2J7MA 3ST7A 3PL0A 2R30A 3K4DA 1LJ7A 3MW3A 1GWMA 1JI6A 3EHKA 3ILRA 3O0WA 5EWSA 1G7YA 2XWBB 4A45A 4CCJA 2ZAAA 2JG9C 1YQ8A 4G4FA 5I0DA 1BQPA 5DZFA 4XE9A 4XJZA 3ZYPA 1Y9MA 5DMYA 3ZVXA 2A3YA 3C8XA 2RE9A 1JS9A 3BPZA 4EROA 1PVC3 4RSUA 5FCCA 3WF1A 1L7RA 3MICA 3T08A 3VBSC 4LBQB 1SDWA 5E88A 2RR11 3UJOA 3T09A 2YPDA 1W8HA 3BKZA 1S0GA 4LHSA 4QD2A 3MIGA 5LWBA 3W5MA 1ULDA 1Y3TA 5IK8A 3O1TA 1APNA 3RWKX 1K12A 1RUC2 4XFBA 2XQRA 3JU9A 2WUHA 1GP4A 5JZGB 4BJ0A 4LHLA 1FAYA 5I0UA 4BOWA 4QKDA 2ZEYA 4M01A 1DZQA 1VRH1 3PLQA 2R0HA 4NPMA 1IPJA 2ORZA 4IESA 2CY6A 3FLRA 4NHXA 5GZEA 1JZ5A 3V0BB 1BZWA 4UFMA 1VPHA 2YDEA 1QJU3 1XOYA 4Z8BA 3B00A 1FATA 2A3XA 2VVDA 2HEVF 4GMP3 1COV2 2Y6JA 4KH9A 5FV3A 5GLZA 5I8SA 3U07A 1SZBA 2R072 3VDBA 4FCAA 3AVRA 2RMU2 3HN1A 1W9WA 3KVAA 2RS12 2WSVA 4XACA 5E16A 4DIQA 3AZXA 4K20A 4WM7B 5EYYA 4D69A 3LDRA 4IGPA 1ALYA 4QPIB 2WFF2 5C4WB 4Y1YA 3T1MA 1CAXA 4AI9A 1JHNA 2W1SA 3NO8A 3IWZA 4ASMB 2C9KA 2OPKA 2VW2A 1GZWA 2BDRA 2QQJA 2LALA 2WT2A 4DY5A 1I6XA 1ULEA 4NPRA 4Y1XA 4CCCA 2VJXA 1QHDA 3FN9A 3GALA 2E33A 1QEXA 1RGSA 3VBRB 3N7JA 4KI5M 2VGDA 2VCBA 4Y1UA 4UF0A 2Z79A 1TQ5A 5BNOA 1S2KA 1Z78A 3H1YA 1DDLA 4N9IA 1UWWA 4WM8A 1GV9A 1QJY1 2JDKA 4XAAA 1O7FA 5FWEA 2XBO1 2YC2A 4Q26A 2RDQA 1AR83 3BIWE 3B9CA 2JDUA 2P5BA 2VNGA 3IMMA 5FYCA 5JI9A 3I59B 2QNKA 2D40A 1LU2A 2Z2SB 4P02B 4Q0QA 3UV9A 2FDGA 1S2EA 2QQNA 5IVJA 3RZLA 1ULGA 2UWAA 2WWSA 3FJSA 3ES1A 1YQCA 5FZGA 3VZOA 4UBGA 3JBG3 3WW4A 5L7OC 5HCAA 4MO3M 1GOHA 1SDDB 1F31A 3S7IA 3ACGA 2WNUB 4JV4A 3WT3A 4YM3A 2DDUA 4QX7A 4I0BA 3T2PA 1REFA 2HBTA 1Z0HA 4IEOA 4CDQC 4Q4W3 1WD3A 4ISQA 1XJAA 4AHWA 3WNLA 3WQ0A 1PZ9A 2V4AA 1NCQB 1WCQA 5LA0A 2Q0AA 2Y33A 3DYOA 4CCDA 1PK6A 5IJRA 5C7GA 4OUEA 4WV8A 4AFBA 1PGL2 4XUTA 3ZLIA 3DGTA 5AVAA 3ZN4A 2WWUA 1C4RA 3B02A 4XQDA 4E2SA 1X33A 4Y1ZA 1GQHA 1H1MA 2XR4A 3Q8EA 1NOVA 5L19A 3BTYA 1KRIA 4B7KA 1QXJA 3HPNA 4N90A 5FAXA 1D4VB 1F15A 2OA2A 3P5BA 2BWCA 1UOGA 5D8AA 4CUGA 1DQ0A 1CAVB 1ZZ9A 3MFAA 4RGKA 1V6IA 3U37A 2HWC1 5CEHA 4COVA 4RD7A 5FK8A 5FBZA 3WNKA 1LESA 1KDMA 5FUPA 3LQCA 2JDPA 3SLIA 1JW6A 4ISRA 3CZUA 4HXCA 4F83A 1UD1A 1Q5OA 1WCUA 3SEEA 4AFAA 4IEWA 5FZAA 3EBRA 4MSVA 3VZNA 4EZHA 1IG0A 3S30A 1PHMA 4QGLA 2D5FA 5A7WA 3CNAA 4MOAA 1VMFA 5A3OA 4QB2A 2G9ZA 2Y6KA 4W4ZA 3ALQA 3LDKA 4C0HA 3BUCA 1ASJ1 5HV4A 4RHV2 2D98A 1W8FA 4XFAA 3WINE 2XL7A 2ZAHA 2ZGOA 4OI2A 1R092 1QGLA 3CHXA 5F39A 5FZ4A 2OQ7A 4LORA 3H8XA 1ZX5A 2JECA 3HWJA 5FO8B 2NQYA 4RQPA 5CAZA 1RUI1 1FPN1 4HZFA 3LIHA 5FJKA 4BQ3A 4NO4A 3VBHB 1Z7S2 1RUD2 1OKOA 4I02A 1ZBE3 4MUVA 4BK4A 2MPFA 2QUOA 1W6PA 1H9PA 2JB4A 1ZZ6A 1ENSA 4R9DA 1XNDA 2EALA 4QKBA 4Y5TA 2OIIA 4R9BA 2ILMA 3OY8A 5I8YA 2VOWA 2XJTA 3ZXFA 4QXKA 3WW2A 3IAQA 1A8MA 1VAVA 2AEZA 2Q8DA 5F5AA 5LBFA 1HQLA 3VZKA 4CU8A 1KJRA 4OCTA 3HT1A 3T2OA 3VB9A 1EAH1 1EUTA 1VBD1 2OW4A 5J37A 1LGBA 4N43C 5CG8A 4ZU4A 1W6OB 4AGGA 3POWA 4Y1VA 4LR4A 4I09A 2G9FA 3L9JT 2ENRA 2BNNA 5ACA1 3TNQA 4DXTA 2XJPA 1DGWX 4GWJA 2AEYA 1DZTA 3G6JB 1O3RA 1UXXX 2WN2A 2ETEA 2VH9A 5FMOS 4J1XA 4AFCA 1QJX3 3ZR5A 5CA6A 2JG8C 4GWNA 3TN91 2GU9A 4RGGA 5DUWA 5FZOA 2WZR3 3N35A 4XF3A 4KWKA 5CFDC 3NSTA 2VMCA 4PT6A 3OYWA 2IC1A 1CAUA 2YGLA 4AEDB 1S1AA 3PUIA 1XNBA 3CJIA 3KF5A 1D7PM 4ES8A 1W6MB 2BWAA 4GWMA 5IHRA 1BMV1 1GZ9A 4FFHA 1DCSA 4LITA 2A5ZA 4OI0A 4HKWA 5D1IA 2PAEA 2P1BA 2QQWA 5DDJ1 1VIWB 4JTOA 2HWB1 4AEJA 4J25A 4Q4V3 1G9AA 3BOWA 5FMBA 1AXKA 1YRZA 1HLCA 4DMIA 4YW4A 4JX0A 3B5LB 2O8OA 1O8SA 1VMHA 3IN9A 1LOBA 1RUH2 1W2UA 1AHSA 2PAKA 5SV8A 1FV3A 2WQ4A 1EUUA 2G4IA 4LBLA 4B8EA 3P3NA 5H9SA 1LHOA 2PYTA 4LO6B 1GLHA 4QHZA 5DAXA 5FY5A 5BNQA 1V6NA 3ZXLA 4KG0A 1NXMA 5EP9A 1C8M3 1E5SA 3NJYA 1HQNA 1UAIA 3MIFA 4QMAA 1IQAA 4H55A 4G3YC 3OGJA 1BXHA 2ATFA 2X5IC 1OD5A 1V9U2 1ULFA 2NYYA 1PVC1 5AC92 1ZNPA 2WT0A 2ZHLA 2YPJA 4IL7A 1FNZA 4AVCA 4EWEA 2PFWA 1RHI2 3C7EA 2EIEA 4QWNA 1YQ5A 1ZYBA 1U12A 3UESA 2ZX4A 1JBCA 3CZJA 1U0AA 3EJKA 3IMNA 3LSDA 3ZN6A 2E32A 4MGYE 3A0KA 3SMHA 1UYYA 5FY7A 1IOAA 4N9HA 1ZREA 3PIGA 3ZSJA 5DAVA 2VBBA 2PHFA 3SITA 1UNBA 3EXUA 2JEMA 1RUF2 1UZWA 1TG7A 2FHRA 1LHUA 2FZ1A 2TNFA 4PDWB 1GANA 4XF9A 4AI2A 2L9LA 4A44A 5I0RA 1GR3A 5K0UB 2EIGA 2EIDA 2UURA 2Y60A 4FAHA 3RFRA 3CO2A 2NPIA 5JI7A 4IETA 3WF4A 4W8JA 3CLPA 1VBC1 4GMP1 3FUOA 3LPGA 2XJVA 4FPCA 1EPWA 4NE9A 3G7DA 1HRI1 2VMHA 1D4M3 2W2IA 4CUBA 2IUWA 5EV7A 5JPNB 3NL1A 1POV0 2ZGRA 2WBKA 1CJDA 5FQ0A 2TUNA 1IS5A 2PHWA 3JD72 2Q4SA 4ASLA 5F3EA 2BW8A 2P37A 2J1TA 5FR3A 5FBJA 2XHKA 2HWF2 3VHRA 4CDXA 2RS52 3ZDSA 3ZIWA 4Q27A 4CEYC 1FOD3 4GH4B 2XJUA 3N9QA 5C9AA 1VAMA 1X8EA 2YC0A 4OQ8A 4L8QA 2OKXA 4BZ4A 4TSVA 3J26N 1JHJA 1O6UA 4MHRA 1OC1A 4XMAA 4O65A 2AZ5A 1BK1A 1VBA2 1YI9A 1ZZBA 2R043 5E89A 4BH9A 1G8WA 4MV2A 1O4YA 4G9SB 2JX9A 1PGSA 1LNSA 2NMNA 2R6QA 2D6LX 1UCXA 2RG4A 4MXWB 1HB4A 5EFUA 1SLBA 1UN1A 4CTEA 3KWVA 5IK4A 4CU7A 4FPLA 1NLSA 2PN5A 5FKCA 3V0AB 1JOBA 5T5JA 3HQUA 1GYKA 1L3JA 1JTZX 5EQUA 1NX9A 4CDXC 3N9MA 1RUJ2 2QZ2A 3VDDB 4F8AA 2J42A 1XE7A 1HX6A 4MYEA 5FP8A 4WZCA 4L9BA 5FPLA 3RZZA 1K45A 4ONUA 2Q5TA 2R062 1DYKA 2DCYA 4N53C 4LPLA 4D7SA 5T3NA 3MGUA 3V64A 2O8QA 1N1YA 4E8DA 4CU9A 1AR73 1OSGA 5KC5A 3MW4A 4CP9B 1W99A 4BPZA 1QH7A 4XPVA 3VBOA 4I01A 3O14A 2P2KA 1FNYA 4ITCA 2W95A 4IXLA 5I0SA 2ZTNA 1W8WA 3HIFA 2GMEA 2RJ2A 5KHKA 1EV12 3PUHA 4ORFA 4Y22B 2E9QA 5J3UA 1A34A 4Y20B 3B3QE 3LA2A 2XH6A 1MZEA 1RUG3 1LCLA 1NYWA 2BRTA 2OT7A 4IEQA 2CAVA 2IFRA 2KA3A 2QQLA 3AL6A 4EZ4A 4YW6A 4P9XA 3ACLA 2YY1A 3TEYA 3NVCA 3AMNA 3OGVA 4XJUA 5IWFA 4AI1A 4LT5A 1X50A 2XKOA 1CIWA 1ENRA 1FT9A 2BERA 2DCTA 4WVMB 3DPRA 2BZDA 3PUAA 4PLMA 1HXS2 1K5MA 4XETA 5FYTA 2VMEA 5FXXA 3I4IA 2O1QA 2RR13 4LKDA 1OOPA 1UYPA 5I93A 1JU3A 3K3NA 1DYPA 1ND2A 2LUWA 1J3QA 5A3UA 4KQ7A 3BGAA 5K9YA 4MHUA 4W6YA 4CDUC 4LTAA 4D3WA 4MGQA 3TRSB 3NKTA 4IW3A 4U2AA 5I8TA 3VDDC 1SG3A 2YGMA 3M1HA 3NQHA 2LW8A 1OFNA 5D21A 2HH9A 2NMOA 1ND3B 2C4XA 5B4XA 1KFUL 2HWD1 2W39A 1RMU1 1VRH3 2A73B 2P3KA 2BGOA 1DFQA 4NWWA 5DN2A 3ZXAC 2ZGMA 4R8HA 4E2GA 1VLNA 2B8MA 3AYCA 4AVVA 2P3IA 1V6JA 4QX8A 5C5UA 5KHHA 4Y24A 3GM8A 4L97A 4NPLA 1Y43B 5F32A 1JYWA 1Y9GA 3KQRA 4QQOA 3GHNA 1VR3A 4OI1A 1OOPC 1OQDA 3K51A 1N3OA 5CU1A 2WZ8A 2W0XA 1K5JA 5CVRA 1W2OA 1UZVA 2XB6C 4IV1A 1XU1A 2Y6FA 2D5HA 3CL1A 4XUNA 4TN7A 2YYOA 1W3VA 3AKSA 1H2LA 1DYOA 5BNNB 2C0ZA 3OB8A 1LR5A 2A6YA 4V2WA
chains in the Genus database with same CATH topology
4BQ3A 1GWKA 1V0AA 3ORJA 4CPBD 4BQ2A 4CPBA 1OKOA 4BQ4A 2K46A 2LROA 2O14A 1WCUA 4BQ5A 1W8TA 2JWPA 4CP9A 1HN0A 2WYFA 3F95A 1WMXA 4YWAA 1W90A 1GWLA 4LK7A 4LK6A 1GWMA 4CP9B 4LJHA 4LKDA 4YW7A 1W9FA 1W8ZA 1WZXA 2KR2A 4LKFA 4A6SA 3UT0A 1OH3A 2LRPA 1W8WA 3ZYFA 2Q1FA 2VXJA 4AL9A 5D21A 4YW6A 4LKEA 3ZYHA 1W8UA 3ZYBA 2C24A 1L7LA 1UOJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BQ3 A;  1GWK A;  1V0A A;  3ORJ A;  4CPB D;  4BQ2 A;  4CPB A;  1OKO A;  4BQ4 A;  2K46 A;  2LRO A;  2O14 A;  1WCU A;  4BQ5 A;  1W8T A;  2JWP A;  4CP9 A;  1HN0 A;  2WYF A;  3F95 A;  1WMX A;  4YWA A;  1W90 A;  1GWL A;  4LK7 A;  4LK6 A;  1GWM A;  4CP9 B;  4LJH A;  4LKD A;  4YW7 A;  1W9F A;  1W8Z A;  1WZX A;  2KR2 A;  4LKF A;  4A6S A;  3UT0 A;  1OH3 A;  2LRP A;  1W8W A;  3ZYF A;  2Q1F A;  2VXJ A;  4AL9 A;  5D21 A;  4YW6 A;  4LKE A;  3ZYH A;  1W8U A;  3ZYB A;  2C24 A;  1L7L A;  1UOJ A; 
#chains in the Genus database with same CATH topology
 2BBA A;  4LO5 B;  4UWD A;  1AR8 2;  5IYY A;  2FCT A;  2LRO A;  2QDN A;  4O7X A;  3ZN5 A;  4MVT A;  4FI9 A;  2W1U A;  1AX1 A;  2VO5 A;  3NNF A;  5ABJ A;  2FDJ A;  3DEM A;  3SQO A;  3UGF A;  1CZT A;  4RL7 A;  4LBO A;  4K3U A;  4S2F A;  2ZGN A;  4A3X A;  4A41 A;  1QJY 3;  3I2F A;  4IEX A;  5EJ3 A;  3JBG 2;  4GKX A;  5HCH A;  3UT0 A;  1LHV A;  1VBB 1;  4HPK B;  2WQZ C;  1SPP A;  4UW5 A;  3X29 B;  4CDW A;  3RNS A;  4TLG A;  4AQ2 A;  1WCK A;  1QQP 1;  4FOV A;  4BQY A;  2WKK A;  1I5Z A;  2ZAB A;  4F3J A;  1ND3 C;  5H9R A;  2WNV C;  1W6Q B;  1RIR A;  1E5H A;  2WYS A;  3J7L A;  3KQ4 B;  4PCR A;  3J9S A;  3NW4 A;  4AVT A;  2QZ3 A;  1GP5 A;  2F17 A;  2P3Y A;  4H7L A;  4QQ2 A;  1AL0 G;  1Q8S A;  5L9V A;  1AYM 1;  4QM9 A;  4YPJ A;  4E4Z A;  3RPQ A;  2D6P A;  4S2G A;  3BOD A;  2ZHK A;  3T2T A;  5LY1 A;  2RDN A;  4KGG A;  2UYA A;  1KIT A;  1TE1 B;  1XBF A;  4YVW A;  4M3C A;  3ETQ A;  5J98 B;  5J96 B;  4QPG A;  3EYP A;  4ZU7 A;  2E53 A;  2OYZ A;  1OLR A;  4K7J A;  4NMI A;  5JLV A;  1CAW B;  3I2K A;  1E5R A;  3RYR A;  4QHB A;  4AHX A;  1VB4 A;  4QKF A;  4BME A;  3VKO A;  1S2B A;  1ZZC A;  1OUR A;  5A1A A;  4JC1 A;  3AP7 A;  4E2Q A;  1ULC A;  1J3R A;  1HKD A;  5FP9 A;  5FMD A;  2B39 A;  2EIC A;  2WZP P;  1NCR A;  1TMF 1;  4RS5 B;  5F3I A;  1H6Y A;  3S6P A;  5IK5 A;  3POS A;  1ST8 A;  1SBD A;  3ZFG C;  5FZ3 A;  3Q8F A;  4M3C E;  3AZW A;  4XF4 A;  2IXI A;  2C9A A;  2K2S A;  2R1D A;  1OPM A;  2BOJ A;  2HWC 3;  3VBU B;  5A3L A;  5CIS A;  1F2N A;  4QPG C;  4WBB A;  3K46 A;  5JPM B;  1QKQ A;  1RIN A;  2EAA A;  3QOP A;  1LOG A;  3KV9 A;  3P1I A;  3AP6 A;  4V2V A;  1BBT 1;  1HV0 A;  3WD5 A;  3IBM A;  1O59 A;  1PMJ X;  2VZP A;  1NAE A;  4XYX A;  4B4R A;  2JE8 A;  3III A;  1BHG A;  2O0O A;  1Y7B A;  3HAG A;  4EN0 A;  3KVB A;  5C8C B;  3NJZ A;  1ASJ 3;  2B9V A;  5A6Z A;  3HEI A;  4A7K A;  1O5L A;  3FHQ A;  1KDK A;  1ZBE 2;  2Q8E A;  4A6O A;  2FMY A;  2CV6 A;  4MXV A;  3VBF A;  4YM1 A;  4ZZ8 A;  4LK6 A;  2HKX A;  4E4D X;  3PHM A;  4C0B A;  4ZPI A;  5FLJ A;  1R1A 1;  1FPN 3;  1RUI 3;  2RDR A;  1SQ4 A;  3VD5 A;  3NAP B;  1SLA A;  4S2H A;  1YHF A;  3PIJ A;  5FK7 A;  1GOF A;  3GGL A;  3C7G A;  1F35 A;  3BYW A;  4R9C A;  1CJP A;  4Z92 B;  2WAO A;  4GXL A;  2ZCW A;  4YLZ A;  1ZRC A;  1RYY A;  1NT0 A;  3I54 A;  4CUA A;  3KMH A;  2VOV A;  1SFY A;  4DOU A;  1PIV 2;  1SHW B;  4YGC A;  3T4H B;  3ZR6 A;  4CEW A;  3VKN A;  3VDA A;  5A33 A;  3IIA A;  4MET A;  2WA4 A;  1EAH 3;  1VBD 3;  3GBG A;  1POQ A;  1YQ6 A;  2VCA A;  1CX4 A;  4U36 A;  2AGS A;  3VBU C;  1QJX 2;  1W0N A;  3T4V A;  3H0O A;  4YW7 A;  4B1L A;  3FLT A;  5K4L A;  4W6W A;  1GZC A;  5ACA 3;  2WZR 2;  4MX3 A;  4B29 A;  2JG9 B;  4LE4 A;  1QF3 A;  2YHJ A;  3WNX A;  5IVE A;  1QJE A;  4YZ2 A;  4B1M A;  1G9D A;  4AEK A;  3PME A;  3FE5 A;  1QWR A;  1NY7 2;  2R07 1;  5JSO A;  3TN9 3;  4FFF A;  3A23 A;  4R4X A;  1AYN 2;  5KWR A;  5C8C C;  2RS1 1;  3N9O A;  4LE3 A;  4Q4X 2;  1XXN A;  2YMZ A;  4IV3 B;  5JVV A;  1C57 A;  1RIT A;  4HON A;  4HSJ A;  2QKD A;  2E7A A;  2WFF 1;  4Q0U A;  3N7L A;  4NAM A;  3IDE A;  3D3A A;  1GWL A;  2GMM A;  4K40 A;  3A4U A;  3I2G A;  4Q4V 2;  2BJS A;  1GUI A;  1RVF 2;  4OUM A;  1QMJ A;  1YEW A;  4NHK A;  3RVH A;  4CCE A;  4Q8K A;  3CDZ B;  3RZJ A;  3RI8 A;  1I3H A;  2EAK A;  1LGC A;  2GH2 A;  3OSD A;  2OVU A;  3MPP G;  2QQI A;  4YZ4 A;  1O5U A;  1OHF A;  2VQT A;  3LEK A;  1RUO A;  5DDJ 3;  5FYH A;  1GQP A;  2HWB 3;  4IEU A;  4D7Y A;  1JZ4 A;  1X8M A;  4DUW A;  1JZ2 A;  3JQW A;  4B3N A;  2F6B A;  2H6C A;  3THD A;  3QD6 A;  2V72 A;  3APB A;  2QQV A;  4JGZ A;  4OHZ A;  4DPN A;  4F7Z A;  2CAU A;  1JYI A;  1UOF A;  2TBV A;  4XFI A;  5A32 A;  4BQ1 A;  2CWS A;  3THC A;  4IEY A;  1CON A;  1WMF A;  1H4H A;  1JZ8 A;  3J8F 2;  5APA A;  2AEN A;  4QX5 A;  2JD9 A;  4Y3O A;  1DQ1 A;  3HQR A;  5I0T A;  4NID A;  2QQK A;  2YFU A;  3MW2 A;  4E8C A;  5KR7 A;  2VC9 A;  4PLN A;  3MHZ A;  4OFG A;  3D82 A;  3QAC A;  3WDW A;  3UET A;  1UKG A;  2D6M A;  4XXA A;  5GZF A;  1RUN A;  3OD0 A;  3WNM A;  2RM2 1;  5FYV A;  5JXG A;  2W5F A;  3D0J A;  2AH2 A;  5EXO A;  4AG4 A;  3FHI B;  2Y64 A;  1UF2 C;  3MV0 1;  3CJX A;  4CCM A;  1DQ2 A;  4FFI A;  1H30 A;  1YFY A;  2VAU A;  3K4Z A;  3NV2 A;  4MGK E;  2ZPX A;  1AL2 2;  4IV3 C;  3WCS A;  4OHW A;  2XPJ A;  3KT1 A;  4BIF A;  3MUY 1;  2A7A A;  1W8O A;  3PVO A;  4P5H A;  2RDS A;  4JQT A;  3AFK A;  5HPO A;  1J59 A;  3FC0 A;  1TEI A;  3HBK A;  3KT4 A;  1AR9 1;  1PGL 1;  1D4M 2;  3OBR A;  4FP2 A;  5FXW A;  3UJQ A;  1XNT A;  3AP5 A;  4DXR A;  5L7O B;  3O1V A;  4NWV A;  2NP0 A;  1WCD J;  3IZO A;  1QJZ A;  1VBC 3;  5FYZ A;  4X8P A;  2PHL A;  1U5X A;  5F5Q A;  1HRI 3;  1FMD 1;  4GZ9 A;  1W8N A;  5FPB A;  3ZFF A;  4CDQ B;  5IFT A;  4ZS2 A;  1AXY A;  1NZC A;  4XFF A;  5BNO B;  3RZK A;  3DEC A;  3BAL A;  3MEP A;  1QOT A;  5IVY A;  4N7I A;  1FOD 2;  4UOJ A;  3N7K A;  1H8V A;  4LQR A;  4QDQ A;  3KCC A;  1YNA A;  5DG1 A;  3ZFE A;  4Q8L A;  1HIX A;  4MH0 E;  4O9G A;  3C7H A;  3U4X A;  4MGZ E;  5CB7 A;  1ULP A;  1O4Z A;  2V5Y A;  4KG8 A;  4PIZ A;  3MLL A;  4OHX A;  5E8A A;  2Z4F A;  4UFI A;  1VRB A;  4LLO A;  3ROU A;  3WUD A;  5F3C A;  1PMI A;  3JB8 A;  5FTT C;  1NQD A;  2BFU L;  4N8M A;  1T6B X;  5EJ1 B;  4HL0 A;  5JIA A;  2IVJ A;  3RJ2 X;  1CVN A;  2DVB A;  4BQX A;  2GAU A;  4W50 A;  2OUJ A;  2XJQ A;  3NNM A;  2VZO A;  4RHV 1;  5FUN A;  4C90 A;  5KXE A;  2VZR A;  2ZGP A;  4D6Q A;  1WW4 A;  2OPW A;  3H1W A;  3KCY A;  4I0W B;  1MPX A;  3K4A A;  3U75 A;  2WLQ A;  3K77 A;  5JR2 A;  3PNA A;  2WA3 A;  5IVC A;  2A6X A;  5JZG A;  1YCI A;  1Q43 A;  2ZGQ A;  1CR7 A;  5A3M A;  1OA4 A;  3OBA A;  2GNB A;  4XBL A;  1Z7S 1;  4FVV A;  2XJS A;  2IXH A;  4IER A;  4DEV A;  1ZBA 1;  4K6B A;  5JUV A;  1DQ4 A;  3KLS A;  3E5Q A;  1N3P A;  2VW1 A;  1QDC A;  3OGG A;  1AR7 2;  1HB3 A;  1W9Y A;  4L11 A;  5GM0 A;  5C33 A;  1RUE 2;  1A8D A;  1US3 A;  1KFX L;  2GC3 A;  3ZXG A;  2R0F A;  1W6N B;  4TWT A;  4OI4 A;  2WS9 3;  1PGW 1;  1V6L A;  3H1M A;  1O3S A;  5GLU A;  1SLI A;  4WM7 A;  1YFW A;  5GZD A;  2ARX A;  5BNO C;  1HRV 2;  3EQE A;  3VKL A;  5FPU A;  4WM8 C;  5FKB A;  5JAX A;  5C4W A;  4AWD A;  4YG0 A;  4JHT A;  5D8A B;  3ORJ A;  1OBN A;  3C3V A;  2XLA A;  1QOO A;  1L7Q A;  1HW5 A;  3VHO A;  5HCF A;  3AP4 A;  4YW2 A;  2K46 A;  1VBE 1;  1CIY A;  2YG0 A;  4BK5 A;  4UW6 A;  3SEP A;  3W20 A;  2VOK A;  3WR0 A;  4JRA A;  1YYN A;  3VD9 A;  1RJ8 A;  3VBR A;  3GZA A;  4M00 A;  4P9I A;  3E6C C;  3BI3 A;  3VHP A;  1VP6 A;  4CP1 A;  4LBM A;  2RR1 2;  2P6H A;  3DL3 A;  1OVS A;  3LGR A;  1W06 A;  1ZZ7 A;  2KD7 A;  3VL8 A;  4Q1R A;  4IGQ A;  4AL9 A;  5KXB A;  1YJK A;  2DCK A;  2ES3 A;  4EWD A;  3VKM A;  3VZM A;  1B35 A;  4UAP A;  4N43 B;  1R1Z A;  2HWE 1;  2JDA A;  2W46 A;  2W92 A;  2HJI A;  2XG3 A;  4XCB A;  4JTN A;  4BCU A;  3WZ1 A;  1OVP A;  1QXP A;  4RFR B;  2CWM A;  1ODN A;  2W91 A;  1PK6 C;  4TTG A;  1VRH 2;  4Z2A A;  1VMJ A;  2DUO A;  4IQP A;  1M06 G;  3H3L A;  2VR4 A;  2XVG A;  1W6P B;  3THT A;  3RMY A;  2WNU A;  3ZXD A;  4XAB A;  3POE A;  3OEA A;  2WNO A;  4A4A A;  2ZGU A;  2JG8 B;  3WHU A;  2UY9 A;  4BXF A;  3LWC A;  2ZGS A;  3UL2 A;  5FZC A;  3GZU C;  5K8S A;  2DVG A;  2HWD 3;  2FCV A;  1RMU 3;  5FMC A;  4DFS A;  5CFD B;  2VD7 A;  4YM0 A;  3AJZ A;  3A0N A;  2XDV A;  4IDZ A;  5CKM A;  4P9W A;  1NCQ A;  2ZHN A;  1BEV 2;  3FX3 A;  2WQ8 A;  4M0N A;  1KXG A;  3PMS A;  4I3G A;  5D8A C;  4KBZ A;  3OBT A;  2EXJ A;  1R08 2;  3ON7 A;  4A7Z A;  4AI8 A;  5HXM A;  5JWP A;  1H0B A;  1EPZ A;  1ZRR A;  3FBM A;  1TME 1;  3ZPO A;  1Q8P A;  4L99 A;  5I91 A;  4AYU A;  1QIQ A;  4YNI A;  3LKJ A;  1CZS A;  3M3C A;  4HVO A;  1BK0 A;  4HVR A;  4EQV A;  1RHI 1;  2EVX A;  4XW3 A;  1BVP 1;  2D7F A;  2BGC A;  3KCX A;  4E4S A;  1ONA A;  1UY2 A;  4GMP 0;  1U5Y A;  2DVA A;  3WNO A;  4XZU G;  2XBO 2;  3U11 A;  5KHG A;  2J1R A;  1CAU B;  3N7M A;  2HEY F;  3UNP A;  2DWR A;  2QDR A;  4XEZ A;  2JIG A;  2WWJ A;  4RQP C;  1AR6 1;  4FO9 A;  2XJR A;  2DFB A;  4I0A A;  4CA9 A;  1UY0 A;  5BV6 A;  3AYA A;  3WSO A;  5FYS A;  4Y4R A;  1A3K A;  2XUE A;  1BKZ A;  4OZX A;  2X5I B;  1AX0 A;  1VBB 3;  4P9J A;  2FZ2 A;  1QQP 3;  1PMH X;  5ISL A;  3ZIX A;  3MYX A;  2B45 X;  3O12 A;  2P6C A;  4FXK B;  4K9S A;  2WFP A;  1C1L A;  5LK5 A;  1AYM 3;  3RYK A;  3ZYH A;  1KGY A;  2OZJ A;  4CCK A;  4LUL A;  1LOF A;  4KU8 A;  4QXB A;  1OPO A;  2RV9 A;  2RS5 1;  2XWJ B;  5F3G A;  1AX2 A;  1GU3 A;  1JYV A;  2CNA A;  3AZV A;  3E97 A;  2HBU A;  2J22 A;  1XE0 A;  2ZX1 A;  1WLC A;  4NRQ A;  5DZE A;  1H1A A;  3WQB A;  2VZ1 A;  4BDV B;  1HN0 A;  3JCI A;  5ANN A;  1FXZ A;  5F6K A;  2WRA A;  1W39 A;  1X9T A;  4LA2 A;  1PO1 3;  3SCH A;  1XNC A;  3H7Y A;  4FSJ A;  1W6O A;  3IAP A;  4LBQ D;  4NVP A;  4QXH A;  1GQG A;  2PQQ A;  4XXP A;  1A78 A;  2JJ6 A;  3PUR A;  3CJI C;  1ZA4 A;  2CYF A;  3E1F 1;  2VTX J;  1W04 A;  2WO2 A;  3LDB A;  3MID A;  1TMF 3;  2I2S A;  3M4F A;  4UYB A;  2EXH A;  3CU7 A;  4QU2 A;  3HMY A;  4CEY B;  2SBA A;  2UY8 A;  1N1V A;  4QGN A;  1YWK A;  4PI2 A;  1RUJ 1;  5FYU A;  3MLJ A;  3USU A;  2Q30 A;  2IWG B;  4B7E A;  3EB7 A;  1FX5 A;  5A7N A;  1ASJ 2;  2ZX0 A;  5FYY A;  2YU2 A;  1BBT 3;  3BTA A;  4GAZ A;  2JD4 A;  1HB1 A;  1QH6 A;  3NNJ A;  4HN1 A;  4JGY A;  1W6M A;  4LKF A;  1KS4 A;  2Y26 A;  1UMZ A;  4UXA A;  2VTF A;  3P6B A;  1GNY A;  3C7F A;  3N3H A;  3PVE A;  1FYU A;  3USS A;  1OKQ A;  2VOT A;  3LEM A;  5CIR A;  1EV1 1;  3ZYG A;  1GSL A;  2PQS A;  4CDX B;  3WG2 A;  3H8U A;  4AK3 A;  1HV1 A;  1MS8 A;  1XRU A;  1G9F A;  2BQP A;  1SCS A;  2GND A;  2WR9 A;  2ZGK A;  3NNL A;  4O9E A;  2RJL A;  5C9A B;  1R1A 3;  1BYH A;  1LTE A;  5FPZ A;  5IVB A;  1G9B A;  2VTX A;  3GZE A;  3FL7 A;  1JYT A;  2WSU A;  2EA7 A;  5C3R A;  2VNR A;  3KSC A;  4IE5 A;  1OLM A;  3UKN A;  2BYV E;  2RS3 1;  3P3P A;  2RHP A;  4N53 B;  3SCG A;  5C3Q A;  1DGR A;  4LA3 A;  5FY0 A;  3ZM8 A;  3WP4 A;  5JOX A;  5FO9 B;  1ZRD A;  1VBD 2;  2UWB A;  1HXS 1;  4NHL A;  3UYJ A;  1MQT A;  3J7H A;  4DIN B;  4Q4Y 1;  2JDN A;  2XOM A;  2JDZ A;  1CQ9 A;  3O1U A;  1UZZ A;  2IXJ A;  1BJQ A;  3D8C A;  2EXK A;  1SBE A;  2YFZ A;  5ERL A;  3ZYB A;  5M0T A;  1UZ0 A;  1WMD A;  2BOI A;  2GAL A;  3JQX A;  2PLV 1;  3I2J A;  3V56 A;  3OGS A;  3OCP A;  5FIX A;  2PTM A;  3TN9 2;  4ARX A;  2QFE A;  5FZ0 A;  4YRD A;  2BPA 2;  3ZDV A;  3MFC A;  1UU4 A;  3HD8 B;  1AVB A;  4P9G A;  5A6Y A;  4YWA A;  4EE2 A;  1JU4 A;  1WLD A;  1D2S A;  3CKH A;  4QB1 A;  3I8T A;  1AJK A;  3IPV A;  4COZ A;  1YC6 1;  2R07 3;  2A71 A;  4HSL A;  4KNC A;  4PDW A;  3VBO B;  1IS3 A;  1E57 A;  3J7N A;  2RS1 3;  4JDO A;  5K0U A;  1BMV 2;  4H2A A;  5FLH A;  2BBV A;  3WQ1 A;  4CDU B;  4WZF A;  5DDJ 2;  1IG3 A;  1US2 A;  2WFF 3;  2C24 A;  4XFH A;  4DY3 A;  1GNH A;  1ZM1 A;  5T52 A;  1MZ5 A;  3I2O A;  3BU0 A;  4GA9 A;  5C9A C;  4AXO A;  3LPF A;  1IGO A;  3VLB B;  4EYU A;  1IHM A;  2WS9 1;  3RI9 A;  1ENQ A;  1RED A;  2ZMN A;  3LAG A;  2JE9 A;  4QT6 A;  2VUJ A;  1G6N A;  5A1L A;  1ZRI A;  4FPK A;  2MEV 1;  1H2K A;  2VQA A;  2XQX A;  3AFG A;  1MS4 A;  1WW6 A;  2WO1 A;  4IEP A;  5BPX A;  5JR7 B;  1PZ7 A;  2AC1 A;  2AR6 A;  5A7O A;  5F37 A;  4YFZ A;  2VUC A;  1H2M A;  2ZHM A;  5HI0 A;  1OOP B;  2QVS B;  1ND2 B;  1OQ1 A;  1QJF A;  1UY1 A;  4GH4 A;  1Q8V A;  1OF4 A;  2VZT A;  5T5O A;  2MHF A;  5FRA A;  1F5J A;  1PVC 2;  1W8T A;  4IEZ A;  5LBC A;  5F2S A;  2E31 A;  4FQ4 A;  4LEJ A;  3WF2 A;  4D94 A;  1V0A A;  1MVE A;  2ZKN A;  2QQM A;  2YUE A;  1LHW A;  3B7M A;  3FBY A;  3POJ A;  4D6S A;  1GOG A;  1J1T A;  2Y0O A;  4AGR A;  2VVF A;  5JOW A;  2FDH A;  2VY0 A;  4GKY A;  2RM2 3;  3PU3 A;  2VXR A;  4PBO A;  3DF0 A;  2ZX3 A;  5E6H A;  3RMX A;  3KM5 A;  3V0A A;  4LO8 A;  3WG4 A;  5C6C A;  5CFC A;  3K3O A;  3N9L A;  2KM2 A;  3VBO C;  2WZE A;  4MGI E;  4ATE A;  1JOD A;  3AKQ A;  2F4L A;  1PVX A;  5BNP A;  5C8W A;  2WT1 A;  4GJZ A;  1RTV A;  4LKE A;  1QJU 2;  5DQ0 A;  3UGG A;  5F1R A;  2DBN A;  4ES9 A;  1VBC 2;  5FZ9 A;  1N3Q A;  4MGS A;  1VB2 A;  1CGP A;  2E51 A;  3WX5 A;  1AR9 3;  1HRI 2;  1EY2 A;  2PHR A;  3RG0 A;  2P17 A;  2WNV B;  5EIY B;  5FZK A;  5LRR A;  5FRE A;  5BYN A;  2CSG A;  4YZ5 A;  1N1T A;  1WMX A;  2MNG A;  2VMI A;  2ZBJ A;  2P34 A;  3DPR C;  4OUS A;  3FLP A;  1K5M C;  4LK7 A;  3IB3 A;  3POB A;  1FMD 3;  3O1R A;  1UW8 A;  2XXZ A;  2ZAC A;  4YGE A;  5DAQ A;  2ARC A;  2KR2 A;  4Y20 A;  3SXW A;  1Q8Q A;  1ND2 C;  2ADD A;  1V6M A;  2VZU A;  1PM7 A;  3GZT B;  4CP2 A;  5BNP C;  2CDP A;  3LE0 A;  1NQJ A;  1W0P A;  2VZ3 A;  1O91 A;  2UU8 A;  2BGP A;  3O7O A;  2ZEW A;  1UPI A;  1POV 1;  4HK8 A;  3AXE A;  2VNO A;  3RSJ A;  1OXC A;  1UYZ A;  4AAX A;  1PNG A;  4PIY A;  1SLL A;  2AUY A;  4WVM A;  2ZMK A;  3DXT A;  4XMI A;  1QU0 A;  4XBN A;  3GBW A;  4A2U A;  4N7U A;  3TOJ A;  3WW3 A;  5FDB A;  5CAD A;  3ACF A;  1JYC A;  4RHV 3;  2VUA A;  2BV4 A;  3PVN A;  1MZF A;  1PO2 1;  2BFU S;  5F6L B;  3ZXK A;  1DZR A;  2GC2 A;  5T5P A;  3ZFG B;  2QCS B;  1PNF A;  1MEC 1;  3NMB A;  4KBB A;  4Q5O A;  3O1M A;  5EYX A;  4M3C B;  2VL4 A;  4W6X A;  4IV1 C;  1LAJ A;  2RVA A;  4QPG B;  1X7N A;  2WJS A;  2G1M A;  2VPV A;  4HET A;  3IDA A;  3JXS A;  4KU7 A;  4QX0 A;  1OMI A;  1Z7S 3;  2YZ4 A;  3QH7 A;  3LA7 A;  4MAD A;  4RYD A;  3CQO A;  5FYB A;  4AW7 A;  4OHY A;  1ZBA 3;  4OMD A;  2PA7 A;  1RL3 A;  4Q4W 2;  2D93 A;  3NV1 A;  2VOX A;  4BA6 A;  1TNF A;  4QX2 A;  5DG2 A;  4J1W A;  2XML A;  4IE0 A;  4ZXK A;  3QLQ A;  1DF0 A;  4BQ4 A;  1ULO A;  4BQ5 A;  5CKQ A;  5L73 A;  1UIJ A;  1PIV 1;  3AX4 A;  4QX1 A;  4QQH A;  5ABJ C;  4YGB A;  4LOT A;  4GB3 1;  3ZO0 B;  4R9A A;  1SAC A;  1XNK A;  5IVV A;  1STM A;  4LNV A;  1WZX A;  3H8O A;  3BTX A;  4HFS A;  5ANQ A;  5IUQ A;  3SH3 A;  1CES A;  3OUH A;  5BNN A;  2H0V A;  2CTV A;  4BB3 A;  1OUS A;  2OXB A;  5A3W A;  4CDW C;  5KC6 A;  3E6D A;  3U10 A;  3WV6 A;  1UPS A;  2YU1 A;  1VBE 3;  2D3R A;  3I3E A;  4ARY A;  5C3O A;  4FTE A;  2QTW B;  5FJH A;  4BQW A;  5IK7 A;  1W2N A;  1SEF A;  3AM2 A;  3EO6 A;  1A6C A;  4FQZ A;  2CDO A;  4NHM A;  5DAP A;  1PO1 1;  3WQ7 A;  4AGV A;  1NY7 1;  4BLI A;  3MF9 A;  4PLO A;  4UBH A;  3Q9O A;  1AYN 1;  1NE4 A;  1UU6 A;  3MIB A;  4Q4X 1;  5CNA A;  5JXJ A;  4OVE A;  1I9R A;  5FZ8 A;  4CYD A;  2DU0 A;  1NA1 A;  5L36 A;  1XQN A;  4HPK A;  3QBQ A;  2AAC A;  1F4H A;  1H9W A;  4ZZ5 A;  3VBF B;  2HWE 3;  2VBD A;  4YVW C;  4ZKT B;  4SBV A;  1OH3 A;  3W5N A;  2VW0 A;  4H3W A;  2QJV A;  1IPK A;  2VXJ A;  3OGR A;  1C1F A;  4QKN A;  5IT6 A;  2HWD 2;  3D4K A;  4XIL A;  4BMB A;  1MVQ A;  4ZU5 A;  1W8U A;  3ACI A;  3D5O A;  1GP6 A;  4EN9 B;  3IKW A;  4BE3 A;  1YQ2 A;  4XF1 A;  1AUY A;  4X6R B;  1DQ5 A;  1IS4 A;  1MS3 A;  4NHY A;  3LFM A;  3UK9 A;  1TNR A;  4WVV A;  2VMG A;  4RN5 A;  3GBF A;  3IDC B;  3WVJ A;  3SKV A;  1GZT A;  4CEW B;  1S0B A;  2GC1 A;  5HBA A;  1NCR C;  3LZZ A;  5FY8 A;  1NA1 C;  2QE3 A;  1S4C A;  1W2T A;  1YUD A;  2PMW B;  2J1E A;  3C2U A;  3J8F 1;  3K75 B;  3THP A;  2HEW F;  4NIG A;  1CWP A;  2GN7 A;  2PHU A;  5FPX A;  4NRM A;  5J09 A;  4HKO A;  1MS0 A;  2NM1 A;  3NJV A;  3GF6 A;  2V5D A;  2W9X A;  4XUR A;  1TME 3;  1UIK A;  1V6O A;  4IE6 A;  1H8T A;  3OF1 A;  5A1F A;  3URF A;  4Q0P A;  4XBQ A;  4QAW A;  2ARA A;  3ELN A;  4YVS A;  2A6Z A;  5GZG A;  1CZV A;  2WAB A;  5KXC A;  1Q8O A;  4XHB A;  4AI0 A;  1RHI 3;  4BIO A;  4CCN A;  4RS5 A;  5LAT A;  3PJQ A;  3KGL A;  2FMD A;  2WII B;  3FFQ A;  3S0M A;  5FLI A;  5BY5 A;  5C5T A;  5LEJ A;  1NLR A;  2W47 A;  4LBJ A;  1RUC 1;  1UKR A;  3VBF C;  4D7T A;  4K8F A;  3ATG A;  1HQW A;  4XDO A;  4PIX A;  1AR6 3;  1RJ7 A;  1W3X A;  2LRP A;  1LKN A;  2PXJ A;  1O3T A;  4O61 A;  3DYM A;  2XON A;  2W1W A;  4Y4Y A;  4CCO A;  2CL2 A;  4NUB A;  4SLI A;  1COV 1;  3LOI A;  1AYM 2;  1YIP A;  5GAL A;  4GIQ A;  5EPA A;  4NOT A;  2DTY A;  4KL1 A;  4CPB D;  3RS6 A;  2RMU 1;  2V4V A;  5FFO C;  3UGH A;  3HVD A;  3WY6 A;  3I3M A;  4CEW C;  1BVV A;  2JE7 A;  2VBP A;  1S55 A;  1PX4 A;  1WCS A;  3B94 A;  3DYP A;  4CU6 A;  4CCL A;  3JD7 3;  3NAP A;  1DG6 A;  4XUP A;  5L9R A;  4QQP A;  1CPN A;  4RR3 A;  5F9T A;  5J36 A;  4URT A;  1YIF A;  1V70 A;  4FPF A;  1MS9 A;  2RS5 3;  1GKB A;  4TZD A;  1JOP A;  4PQQ A;  1WW5 A;  2Y6L A;  3H7J A;  4IE4 A;  4YZ1 A;  1C5H A;  4BWO A;  2WO7 A;  3POY A;  3SNM A;  3ENR A;  2UWC A;  4KWL A;  2B46 X;  1C8M 2;  1TMF 2;  2XKP A;  3GJB A;  3HN3 A;  4L2N A;  4XUQ A;  4XJA A;  2X05 A;  3ZMN A;  4BU2 A;  1OT5 A;  2BVV A;  2Q8C A;  3AB0 A;  4OLL A;  3B69 A;  2R16 A;  5A7P A;  1KD7 A;  4COU A;  4M4R A;  1JH5 A;  3SKJ E;  3ZSK A;  2G9G A;  4WVW A;  1GMM A;  3H42 B;  4UFJ A;  4XVH A;  2JG9 A;  3AKR A;  4IE7 A;  4A7Y A;  5LA1 A;  1OF3 A;  4RFT 0;  4RR3 C;  2GNT A;  4LUK A;  4PBP A;  1BBT 2;  4P5Y A;  5JMC A;  4DS0 A;  2A6V A;  1JZ7 A;  4I2O A;  2Q1F A;  1RUJ 3;  4CXX A;  5FP3 A;  2XUM A;  3BN6 A;  1RUE 1;  3KV4 A;  2PAM A;  2VG9 A;  4Q29 A;  3VBS A;  2JIC A;  1I1E A;  2OUH A;  3AVS A;  4E27 A;  4XQ4 A;  3TWI A;  3B01 A;  1DLL A;  5IAT A;  1DIW A;  3I49 A;  3AMH A;  4Y33 A;  4JGZ C;  1HRV 1;  2C1F A;  2SLI A;  2VZS A;  3RZG A;  1R64 A;  4IUG A;  1DGW A;  4TXW A;  3J4U H;  2GC0 A;  5FZI A;  1X9P A;  3OPZ A;  4OZO A;  5DAW A;  1ACC A;  3GDB A;  3PU8 A;  1NUK A;  3TNP B;  1LEN A;  2B7Y A;  1R1A 2;  5GLT A;  4QPW A;  4FP3 A;  5JDB A;  1CAX B;  1CPM A;  3ZFE B;  4E9K A;  2I07 B;  1GZW B;  3A21 A;  3DCQ A;  4CE8 A;  1EV1 3;  1IQD C;  1WD4 A;  2ORX A;  5DAB A;  3ETP A;  5TSW A;  5A3P A;  5B2G B;  5IFP A;  4A6S A;  4CVU A;  3BIE A;  1WA6 X;  2R7E B;  4XFC A;  5JMO A;  2D6O X;  3SH5 A;  5FZH A;  3UKV A;  2ZEX A;  3WP6 A;  1SLC A;  1WGP A;  3AXD A;  2ZZQ A;  4Q1P A;  3LIG A;  2A1X A;  1QNY A;  2RS3 3;  4UF0 B;  4UFH A;  4NN0 A;  4BLJ A;  4WM8 B;  2BVB A;  4C1X A;  5JSP A;  2R32 A;  5FZB A;  2BUK A;  1OI6 A;  3I3D A;  4RA0 A;  3WDT A;  1HXS 3;  4XIK A;  4EN8 B;  1LEC A;  2DBI A;  1ENX A;  4Q4Y 3;  3FZ3 A;  4YG3 A;  3RGB A;  4BM8 A;  5AFB A;  3AYE A;  4AVS A;  3BPS A;  4AFM A;  3CMG A;  2ZGL A;  1W90 A;  4C1W A;  2R04 2;  2LM3 A;  2VM9 A;  2W68 A;  1K42 A;  3O5S A;  2IFW A;  2PLV 3;  4PF5 A;  3ILN A;  2JIJ A;  3E6B A;  4OUL A;  4LBQ A;  3ABZ A;  5FZD A;  4R4Z A;  2Z69 A;  2J1S A;  3ILF A;  1VAL A;  2XL9 A;  2PHD A;  1HDK A;  3ZFF C;  1R09 1;  2ET7 A;  1BEV 1;  3GCW A;  1GWK A;  1VAK A;  3T0A A;  2B5H A;  4FTB A;  2W87 A;  1YFX A;  2OZ6 A;  3HNB M;  4COW A;  1JMU B;  1R08 1;  3SCF A;  4FFG A;  1PZ8 A;  1D0G A;  3ZFE C;  5KXD A;  1PK6 B;  3V0B A;  1RUD 1;  1K3I A;  5L7O A;  1LB2 A;  4HAN A;  3DKW A;  4HOO A;  4QU1 A;  3RZH A;  1X36 A;  1ZRF A;  4LJH A;  1C28 A;  1DLC A;  1HB2 A;  5JOY A;  4P9L A;  3N9N A;  2E6V A;  1XYO A;  5HXV A;  5KHJ A;  4XQW A;  4CDQ A;  4QDR A;  4YAR A;  2CGP A;  4JHZ A;  4PF1 A;  2JXA A;  2QBX A;  2ZXQ A;  2VUL A;  4JKL A;  1XYN A;  5FPV A;  3ZYJ B;  4QPI A;  3CEW A;  2E63 A;  5IVF A;  3BOP A;  3A22 A;  1B35 B;  2C5D A;  1RUG 2;  1KS5 A;  2MEV 3;  5K7P A;  4GUL A;  4MLO A;  3W58 A;  5JZG C;  5DUX A;  2V09 A;  3FUQ A;  5A80 A;  3MLK A;  3KZ4 C;  1X82 A;  5LCW L;  2VE1 A;  1LOC A;  4PJY A;  1CD3 G;  2PHX A;  3M70 A;  4QHO A;  4YZ3 A;  3WHT A;  2RM2 2;  2A3W A;  3B93 A;  3NRU A;  4C8D A;  3VV1 A;  3T3Y A;  3VD3 A;  5A7Q A;  2LS6 A;  1OLQ A;  2RJK A;  3MV1 1;  4P08 A;  1ODM A;  5A7W B;  4M4P A;  4ATF A;  4FPE A;  2J1A A;  4UI9 L;  3O1S A;  2H6B A;  5FP4 A;  3T0D A;  4WM7 C;  5JCT A;  4EV0 A;  2VCC A;  4QPI C;  1XYP A;  3I59 A;  2BEO A;  5C4W C;  3AC0 A;  2YC4 A;  3IM0 A;  2LTN A;  4OHV A;  4RQP B;  1UMI A;  4PI0 A;  5L9B A;  1AR9 2;  1C3H A;  1F4A A;  2ZA9 A;  4GJY A;  4DXZ A;  1JYX A;  4AR2 A;  2FDI A;  5C70 A;  1J83 A;  1NXD 1;  3POI A;  4J6G A;  3T1L A;  1F9K A;  4BHP A;  3DXU A;  1W6N A;  3SHR A;  3VBR C;  4YFW A;  3VUO A;  2OX0 A;  3R05 A;  1NZI A;  2ZML A;  1WLT A;  3RJR A;  3M3I A;  1FMD 2;  1NLQ A;  1U5I A;  1YLL A;  3OY8 B;  2NLR A;  3MO4 A;  5J7M A;  2Q8O A;  4FAG A;  2C26 A;  3I2H A;  2W1Q A;  3OG2 A;  2FDF A;  3JZV A;  4FBF A;  1RUH 1;  2DV9 A;  4LHK A;  1YFU A;  3VD4 A;  2DCJ A;  3DKQ A;  5JIU A;  4K8R B;  3JUU A;  1DQ6 A;  1B35 C;  1XSR A;  1UOJ A;  3ZOI A;  1UXZ A;  2JDY A;  3WXP A;  1O4T A;  3SIS A;  4IGO A;  4D0Q A;  2GH8 A;  4TLF A;  1S0D A;  4R52 A;  4YG6 A;  5CYY A;  5CKN A;  2GZW A;  2DCZ A;  2JKX A;  1PM4 A;  4GAL A;  5F5C A;  1GIC A;  5FOB B;  1Y9Q A;  3WLU A;  4AFD A;  2VCM A;  1V9U 1;  1S0I A;  1IKQ A;  2P3J A;  2WL1 A;  3NJX A;  2WNU C;  5AC9 1;  1SBF A;  4YSF A;  1POV 3;  4H7M A;  5T5L A;  1W03 A;  1NKG A;  1OD3 A;  1GFF 2;  4LHN A;  3I3Q A;  2ZJC A;  2H0B A;  3OJB A;  5FZO B;  3WF3 A;  4YYO A;  1QJY 2;  4CZS A;  4DZG A;  2XGX A;  4XIO A;  3WDY A;  4HBN A;  1CAV A;  4N43 A;  4NII A;  2Z5W A;  3MI8 A;  4ZHN A;  3OYW B;  1ZZ8 A;  4V1P A;  1NCQ C;  3WNN A;  1UMH A;  4B4Q A;  2YBK A;  1REE A;  1TZO A;  4OQ9 A;  3AMM A;  1H4G A;  1PX3 A;  3CJI B;  3RWN A;  1WLW A;  3JB4 C;  2B42 B;  3MUZ 1;  1RUF 1;  1PO2 3;  4CUC A;  1ZBA 2;  5DUU A;  3BCW A;  4YM2 A;  3ZX7 A;  5BUV A;  1J3P A;  4HN0 A;  3WUC A;  3NV4 A;  1MEC 3;  1UU5 A;  3E5U A;  3ZPY A;  2JG8 A;  1AZD A;  5FWJ A;  3T0B A;  3GXU A;  3I2I A;  3LCP A;  4FXG B;  3RDI A;  1PGW 2;  2P4E A;  5CFD A;  4XHX A;  4MG2 A;  2W3J A;  2FBE A;  2ZKL A;  3F2Z A;  4Q0S A;  4XF0 A;  1DGL A;  5AVP A;  4BIS A;  3GNE A;  2GN3 A;  3PTR B;  3R6S A;  3GYD A;  1S0J A;  4AZZ A;  3LFI A;  3JD7 1;  5FY4 A;  3ZYI B;  3WOG A;  3TEZ A;  2X53 S;  4AEM A;  1PIV 3;  5A7S A;  3VBH A;  3ZSE A;  1L7L A;  5GLW A;  1VBE 2;  4JDM A;  2HWF 1;  3VL9 A;  4GWI A;  2ZX2 A;  4GB3 3;  2GMP A;  3M3O A;  2YXS A;  3ZYR A;  4QGM A;  2O14 A;  1UY3 A;  4GQ7 A;  2WIN B;  3USU B;  5KHI A;  4B4P A;  1FI2 A;  4UFL A;  3KS7 A;  1VBA 1;  3M2M A;  1S0E A;  2ZZJ A;  5J48 A;  1W8Z A;  5LAS A;  4AE2 A;  5IAX A;  3RZM A;  2HYK A;  4FOY A;  5LEK A;  3TEX A;  1KQR A;  4C91 A;  2HWE 2;  3ZN6 B;  4AHY A;  5LK7 B;  1O3Q A;  2HWC 2;  4JGY B;  5BXX A;  3MZH A;  2R1B A;  3B9I A;  1AYN 3;  5FY9 A;  5EHD A;  3OUI A;  4Q4X 3;  3ME2 A;  3VBH C;  2A75 A;  3I7D A;  1UY4 A;  1YJL A;  1F5F A;  1LOF C;  2UYB A;  4K1Z A;  2X5I A;  3WG3 A;  5C71 A;  2VUD A;  3R4S A;  5LW9 A;  2GP5 A;  1E5I A;  2FDK A;  5LBE A;  4JQR A;  4DXS A;  1S0C A;  4LXL A;  3Q8B A;  3MBW A;  1SFN A;  1MS5 A;  1RVF 3;  3HNM A;  3S5Q A;  2IXC A;  4DUV A;  5FZF A;  3GJA A;  1QOS A;  2TEP A;  4XDP A;  4A42 A;  1SCR A;  2R06 1;  3FFZ A;  3M7A A;  3N9P A;  5DUV A;  2K0G A;  1UOB A;  3ZSL A;  4AED A;  1OUX A;  3HR9 A;  1W9T A;  5E1R A;  2ARE A;  2ZEZ A;  5B4N A;  2CHH A;  4DRR A;  2CGO A;  1MQT B;  1FPN 2;  1RUI 2;  4K21 A;  4XJW A;  5FQ0 B;  1P8J A;  4FOQ A;  3KT7 A;  1YI7 A;  4JAA A;  5FZL A;  1UX7 A;  1TME 2;  2EXI A;  3O1P A;  4X6Q B;  5F5I A;  3N36 A;  4FPY A;  2PEL A;  3OEB A;  4AQT A;  5LBB A;  4YGD A;  4BQ2 A;  3J8F 3;  3K2O A;  5A6Q A;  2WDB A;  1DBN A;  1XB9 A;  3VN4 A;  3LF7 A;  1H6X A;  4ZY9 A;  3PUS A;  3U1X A;  4KWU A;  4UW4 A;  1EAH 2;  3KB5 A;  4AED C;  4YW3 A;  5KBF A;  2VQ0 A;  5LB6 A;  4RGA A;  3WEZ A;  3IPV B;  4JGY C;  4JRL A;  3S7E A;  3T30 A;  3DUI A;  1XE8 A;  3WDV A;  1AR6 2;  1HJG A;  1IZ3 A;  4QDS A;  4CEY A;  4HG6 B;  5ACA 2;  2E26 A;  4JVA A;  1AL2 3;  4JKM A;  3SH4 A;  1QJU 1;  1XU2 A;  3VKF C;  3ASI A;  1I5P A;  3C7O A;  1RUC 3;  2J1V A;  3KGZ A;  5F2W A;  3N4M A;  4NRP A;  1M4W A;  3H50 A;  4FT8 A;  4FPO B;  1OLM E;  2ET1 A;  4QB6 A;  2JDH A;  4QXC A;  4XTM A;  1MR5 A;  3F95 A;  5FY1 A;  4YW1 A;  2WC2 A;  5FZM A;  3H9A A;  1UO9 A;  3IT8 A;  4GD4 A;  4EN6 B;  1JOJ A;  4XJ8 A;  4LBN A;  1COV 3;  3LSE A;  4QM8 A;  3WG1 A;  5C3S A;  4XDQ A;  4I30 A;  2R49 A;  1XNA A;  1MQT C;  1WBF A;  4LO7 A;  5F8P A;  2RMU 3;  4ET7 A;  4M0H A;  2Q1M A;  1G9C A;  2JB8 A;  3ECQ A;  2VU9 A;  4Y26 A;  1UX6 A;  2V73 A;  5FZ1 A;  4Z1V A;  4QX3 A;  5CBL A;  2QQO A;  2K9Z A;  2HWB 2;  4XJ9 A;  1B09 A;  3WP3 A;  5J1X A;  1W2A X;  3AMP A;  3OTF A;  2B9U A;  2DUP A;  2HYX A;  5T55 A;  4AF9 A;  4LKS A;  4N53 A;  3GCX A;  1H1I A;  2FD8 A;  4LIU A;  1RB8 G;  2E7Q A;  2ZGT A;  5FYM A;  2HLE A;  3SC7 X;  2D3S A;  1AR8 1;  2YV8 A;  4LBK A;  2GNM A;  1QDO A;  2D3P A;  3DPR B;  5FZE A;  3O0X A;  4EJR A;  1K5M B;  1LHN A;  4XFG A;  1O8P A;  4Y5Z 0;  5CFC B;  5CZK A;  5A6X A;  4QQL A;  5DXD A;  4PDW C;  5K0U C;  3JBG 1;  4P14 A;  3VZL A;  3RRD A;  3PUQ A;  5BNP B;  1AF9 A;  3WNP A;  2PHT A;  3KF3 A;  3Q8A A;  1CX1 A;  1EP0 A;  2VVE A;  1TVG A;  2Y38 A;  3R4D B;  4HK9 A;  4Q4W 1;  3POF A;  3QCW A;  3AK0 A;  1J1L A;  3D0S A;  3LA3 A;  5H9Q A;  4JZR A;  3U0Z A;  4IEV A;  4MXW A;  4DO0 A;  1RUE 3;  2GP3 A;  3W21 A;  2DUR A;  4KMQ A;  3FMG A;  4DB5 A;  4BXS V;  4LUM A;  1C5I A;  2Y0I A;  4CDU A;  2YB7 A;  2IVI B;  1HRV 3;  4P9Y A;  3CIH A;  3WW1 A;  1J84 A;  4A3Z A;  3GHM A;  2WLP A;  2BTV C;  3VDD A;  4GH4 C;  1YXW A;  1W0O A;  5A3T A;  1DGR N;  3FWE A;  3OD4 A;  4IV1 B;  5FYI A;  3I97 A;  2X8K A;  4S2D A;  4FOW A;  3RQ0 A;  1N47 A;  2RS3 2;  3VD7 A;  4CPB A;  1LOA A;  2J1U A;  3NKG A;  3BB6 A;  4XOG A;  4KWJ A;  2XVK A;  3ZSM A;  3MDP A;  3AZY A;  4CP9 A;  5GLV A;  3H3U A;  2W94 A;  4Q4Y 2;  3WDU A;  4FPJ A;  2YBP A;  2Z42 A;  4YW5 A;  4CXY A;  5FXV A;  3S5A A;  5ABJ B;  4Q0V A;  5CFC C;  4Y22 A;  1JXN A;  5FZ7 A;  4AQS A;  2PLV 2;  5FP7 A;  5LA2 A;  5G05 L;  4URA A;  2NZ9 A;  3Q8C A;  1XC6 A;  2A6W A;  1SPP B;  1VJ2 A;  3PVB B;  4CDW B;  4NRO A;  4LMF A;  1IPS A;  2DUQ A;  4LO4 B;  3BU7 A;  3U78 A;  4ZXE A;  1CN1 A;  2AYH A;  1UL9 A;  2FCU A;  1T6G C;  1YO8 A;  1WUV A;  3M8L A;  4XUO A;  2GDF A;  4AVA A;  3AKP A;  2Y6G A;  3WF0 A;  3ZXJ A;  2G19 A;  5C3P A;  1OFS A;  1OH4 A;  3AP9 A;  5FOJ B;  1QXR A;  1C8N A;  1QNW A;  4BYY A;  1ZBE 1;  4IND A;  1R09 3;  5D2A A;  1BEV 3;  4NR1 A;  1UYX A;  5FZ6 A;  5T50 A;  4L0P A;  1MZ6 A;  5LZ6 A;  4YVW B;  1BLZ A;  2WAA A;  3POG A;  1JZ3 A;  1R08 3;  2CU5 A;  1OA2 A;  1ND3 A;  3VGI A;  1JN2 P;  2D6K A;  4LOS A;  2GSY A;  2WS9 2;  2WNV A;  4NJ4 A;  1WBL A;  3HNY M;  4CP0 A;  1RUD 3;  3AKT A;  1JUI A;  2Y34 A;  1AJO A;  3HJR A;  4AI3 A;  2I45 A;  4TYS A;  2ADE A;  2FQP A;  2MEV 2;  3J7M A;  4Q2F A;  2BU9 A;  4XCA A;  1GBG A;  3M3E A;  3V65 A;  1W28 A;  5LRS A;  2YRO A;  3HBZ A;  2W52 A;  2XHN A;  2X09 A;  4NIH A;  4DNY A;  1OQE A;  2WO3 A;  3OPT A;  5FMO L;  1WW7 A;  1IKP A;  2DYC A;  3PTY A;  1JZ6 A;  2XBO 3;  3E5X A;  3WP5 A;  5AFE A;  1DU3 D;  1NCR B;  1W05 A;  1NA1 B;  2VEC A;  3BVC A;  4D6R A;  3OPW A;  4HT1 T;  3S57 A;  3BTZ A;  3A7Q A;  2DU1 A;  2VMD A;  1QJX 1;  2JKB A;  4ZON A;  4D8M A;  5JXH A;  3LB9 A;  2ID4 A;  2WZR 1;  3H8R A;  1V6K A;  3NNG A;  3LEI A;  4AAP A;  5IAV A;  3AL5 A;  4MZU A;  4DRV A;  1RXG A;  4COY A;  4M3C F;  4UFK A;  4HKL A;  3VDC A;  1F8V A;  5A3N A;  2JWP A;  1LOE A;  2D43 A;  2VZV A;  1SMV A;  3ZFG A;  4Y5S A;  4P00 B;  3T2Q A;  2DTW A;  3KD4 A;  3U4S A;  1NE6 A;  1DP0 A;  2OS2 A;  1S0F A;  3M3Q A;  3PDQ A;  3R0R A;  3ZXE A;  3HT2 A;  3I2D A;  3O1O A;  2BP6 A;  4Q4V 1;  2Y8K A;  4Z2W A;  5JSR A;  1RVF 1;  5A70 A;  2Y6H A;  5FXZ A;  4EN7 B;  3L2H A;  5EZW A;  1AXZ A;  2DF7 A;  5BNN C;  2ERF A;  1W6Q A;  4HLT A;  5G04 L;  3ZKY A;  1RMU 2;  5GKA C;  3W9A A;  3MIE A;  1ZA7 A;  1URX A;  3HOB A;  2D6N A;  4ZS3 A;  3MPB A;  5LY2 A;  3WDX A;  1JYN A;  1H8T B;  1WME A;  4X8N A;  2CGN A;  2X29 A;  4HMZ A;  4YVS B;  1W9S A;  1N1S A;  1V00 A;  3TYJ A;  4DUX A;  3AMQ A;  4FPG A;  3CF6 E;  1MS1 A;  1C8M 1;  5SV5 A;  2VQU A;  2XLG A;  1XPW A;  3TBD A;  1T2X A;  2BNM A;  4DQA A;  1D0H A;  4CXW A;  4AQ6 A;  2A70 A;  1RUH 3;  3AYD A;  5T54 A;  5A33 B;  1Q56 A;  4H14 A;  2VMF A;  1DHK B;  1CAW A;  1ZVF A;  5HCB A;  4OYU A;  2DVD A;  2Q1Z B;  3O0V A;  2BNO A;  4WVZ A;  5F7U A;  2IZW A;  2D44 A;  3AZZ A;  3I3B A;  1LED A;  4XTP A;  1IS6 A;  3WCR A;  4JCK A;  1HJF A;  1V9U 3;  3NV3 A;  5AC9 3;  4LLF A;  1UQX A;  1JUH A;  5FPA A;  3KV5 A;  3KHB A;  1XSQ A;  3UKT A;  3VZJ A;  1PO2 2;  4UW3 A;  2E7T A;  3D6E A;  2WYF A;  1AL2 1;  1HN1 A;  1MEC 2;  3VBU A;  2WN3 A;  2EF6 A;  4HVQ A;  1BCX A;  1VBB 2;  1LRH A;  3H3Z A;  4Z07 A;  1LGN A;  2OQ6 A;  2ZOE B;  1QQP 2;  4PQ9 A;  1OA3 A;  1NG0 A;  1RUF 3;  1D4M 1;  4I3P A;  2IXK A;  4RR3 B;  4CSW A;  4JKK A;  5IW0 A;  3EMR A;  4XC9 A;  2DVF A;  3INA A;  1H8T C;  5CG9 A;  2WNE A;  1LOD A;  4AHZ A;  2B4K A;  2DFC A;  2VNV A;  2F4P A;  3IDB B;  3K48 A;  4YVS C;  5C8C A;  5JOZ A;  1Y4W A;  1RC6 A;  4PHZ A;  5FO7 B;  1VE0 A;  3KV6 A;  4JGZ B;  4GB3 2;  3AJY A;  4RS5 C;  3PJY A;  3RYP A;  1KJL A;  2D97 A;  2YBS A;  1J58 A;  1FOD 1;  1WWY A;  3MF6 A;  5EJZ B;  2I74 A;  5A32 B;  4KGQ A;  3FHA A;  4L92 A;  3LEG A;  5GZC A;  4LIV A;  3DV8 A;  1W9F A;  2N7G A;  4DEQ A;  5JXI A;  1MAC A;  2HWF 3;  4QPY A;  3CBN A;  2KXL A;  2R04 1;  4ASK A;  2X10 A;  4E4H A;  1FV2 A;  1PO1 2;  4NAO A;  2QQU A;  1SFP A;  5H9P A;  3DN7 A;  1LUL A;  2XLF A;  3LD8 A;  3VBS B;  1QY4 A;  3ES4 A;  5HV0 A;  1D2Q A;  3TAY A;  1EYB A;  2ARB A;  3ZKU A;  3MIH A;  2ZS6 B;  3R4U A;  1KEX A;  1VBA 3;  5LA9 A;  3VHN A;  4AOC A;  5DPN A;  1SLT A;  3L2Y A;  4K1Y A;  1LEM A;  4UT5 A;  3TB0 A;  4AVB A;  1LU1 A;  2QQP A;  4MGT A;  4Z82 A;  4FTS A;  2VZQ A;  1G86 A;  4NIA A;  4OMC A;  3QH6 A;  5DZG A;  2EIB A;  3U14 A;  3NAP C;  2IXL A;  1WKY A;  3W59 A;  1UZY A;  3ITQ A;  4CRQ A;  4W65 A;  3LOB A;  2NN8 A;  3ZYF A;  2C6S A;  3ACH A;  2JEN A;  3OOX A;  4EWA A;  4FPH A;  2XVL A;  2JDM A;  1AR7 1;  2W08 A;  3KHC A;  1GNZ A;  4XAE A;  3OBZ A;  3OUJ A;  4JDN A;  5FUI A;  3ZMO A;  1U5Z A;  1WA4 A;  2R06 3;  4IV3 A;  5GJ6 A;  3HQX A;  4XZP A;  3ZFF B;  3TEW A;  1H2N A;  3NWK A;  1Q3E A;  1RUG 1;  1RXF A;  2J7M A;  3ST7 A;  3PL0 A;  2R30 A;  3K4D A;  1LJ7 A;  3MW3 A;  1GWM A;  1JI6 A;  3EHK A;  3ILR A;  3O0W A;  5EWS A;  1G7Y A;  2XWB B;  4A45 A;  4CCJ A;  2ZAA A;  2JG9 C;  1YQ8 A;  4G4F A;  5I0D A;  1BQP A;  5DZF A;  4XE9 A;  4XJZ A;  3ZYP A;  1Y9M A;  5DMY A;  3ZVX A;  2A3Y A;  3C8X A;  2RE9 A;  1JS9 A;  3BPZ A;  4ERO A;  1PVC 3;  4RSU A;  5FCC A;  3WF1 A;  1L7R A;  3MIC A;  3T08 A;  3VBS C;  4LBQ B;  1SDW A;  5E88 A;  2RR1 1;  3UJO A;  3T09 A;  2YPD A;  1W8H A;  3BKZ A;  1S0G A;  4LHS A;  4QD2 A;  3MIG A;  5LWB A;  3W5M A;  1ULD A;  1Y3T A;  5IK8 A;  3O1T A;  1APN A;  3RWK X;  1K12 A;  1RUC 2;  4XFB A;  2XQR A;  3JU9 A;  2WUH A;  1GP4 A;  5JZG B;  4BJ0 A;  4LHL A;  1FAY A;  5I0U A;  4BOW A;  4QKD A;  2ZEY A;  4M01 A;  1DZQ A;  1VRH 1;  3PLQ A;  2R0H A;  4NPM A;  1IPJ A;  2ORZ A;  4IES A;  2CY6 A;  3FLR A;  4NHX A;  5GZE A;  1JZ5 A;  3V0B B;  1BZW A;  4UFM A;  1VPH A;  2YDE A;  1QJU 3;  1XOY A;  4Z8B A;  3B00 A;  1FAT A;  2A3X A;  2VVD A;  2HEV F;  4GMP 3;  1COV 2;  2Y6J A;  4KH9 A;  5FV3 A;  5GLZ A;  5I8S A;  3U07 A;  1SZB A;  2R07 2;  3VDB A;  4FCA A;  3AVR A;  2RMU 2;  3HN1 A;  1W9W A;  3KVA A;  2RS1 2;  2WSV A;  4XAC A;  5E16 A;  4DIQ A;  3AZX A;  4K20 A;  4WM7 B;  5EYY A;  4D69 A;  3LDR A;  4IGP A;  1ALY A;  4QPI B;  2WFF 2;  5C4W B;  4Y1Y A;  3T1M A;  1CAX A;  4AI9 A;  1JHN A;  2W1S A;  3NO8 A;  3IWZ A;  4ASM B;  2C9K A;  2OPK A;  2VW2 A;  1GZW A;  2BDR A;  2QQJ A;  2LAL A;  2WT2 A;  4DY5 A;  1I6X A;  1ULE A;  4NPR A;  4Y1X A;  4CCC A;  2VJX A;  1QHD A;  3FN9 A;  3GAL A;  2E33 A;  1QEX A;  1RGS A;  3VBR B;  3N7J A;  4KI5 M;  2VGD A;  2VCB A;  4Y1U A;  4UF0 A;  2Z79 A;  1TQ5 A;  5BNO A;  1S2K A;  1Z78 A;  3H1Y A;  1DDL A;  4N9I A;  1UWW A;  4WM8 A;  1GV9 A;  1QJY 1;  2JDK A;  4XAA A;  1O7F A;  5FWE A;  2XBO 1;  2YC2 A;  4Q26 A;  2RDQ A;  1AR8 3;  3BIW E;  3B9C A;  2JDU A;  2P5B A;  2VNG A;  3IMM A;  5FYC A;  5JI9 A;  3I59 B;  2QNK A;  2D40 A;  1LU2 A;  2Z2S B;  4P02 B;  4Q0Q A;  3UV9 A;  2FDG A;  1S2E A;  2QQN A;  5IVJ A;  3RZL A;  1ULG A;  2UWA A;  2WWS A;  3FJS A;  3ES1 A;  1YQC A;  5FZG A;  3VZO A;  4UBG A;  3JBG 3;  3WW4 A;  5L7O C;  5HCA A;  4MO3 M;  1GOH A;  1SDD B;  1F31 A;  3S7I A;  3ACG A;  2WNU B;  4JV4 A;  3WT3 A;  4YM3 A;  2DDU A;  4QX7 A;  4I0B A;  3T2P A;  1REF A;  2HBT A;  1Z0H A;  4IEO A;  4CDQ C;  4Q4W 3;  1WD3 A;  4ISQ A;  1XJA A;  4AHW A;  3WNL A;  3WQ0 A;  1PZ9 A;  2V4A A;  1NCQ B;  1WCQ A;  5LA0 A;  2Q0A A;  2Y33 A;  3DYO A;  4CCD A;  1PK6 A;  5IJR A;  5C7G A;  4OUE A;  4WV8 A;  4AFB A;  1PGL 2;  4XUT A;  3ZLI A;  3DGT A;  5AVA A;  3ZN4 A;  2WWU A;  1C4R A;  3B02 A;  4XQD A;  4E2S A;  1X33 A;  4Y1Z A;  1GQH A;  1H1M A;  2XR4 A;  3Q8E A;  1NOV A;  5L19 A;  3BTY A;  1KRI A;  4B7K A;  1QXJ A;  3HPN A;  4N90 A;  5FAX A;  1D4V B;  1F15 A;  2OA2 A;  3P5B A;  2BWC A;  1UOG A;  5D8A A;  4CUG A;  1DQ0 A;  1CAV B;  1ZZ9 A;  3MFA A;  4RGK A;  1V6I A;  3U37 A;  2HWC 1;  5CEH A;  4COV A;  4RD7 A;  5FK8 A;  5FBZ A;  3WNK A;  1LES A;  1KDM A;  5FUP A;  3LQC A;  2JDP A;  3SLI A;  1JW6 A;  4ISR A;  3CZU A;  4HXC A;  4F83 A;  1UD1 A;  1Q5O A;  1WCU A;  3SEE A;  4AFA A;  4IEW A;  5FZA A;  3EBR A;  4MSV A;  3VZN A;  4EZH A;  1IG0 A;  3S30 A;  1PHM A;  4QGL A;  2D5F A;  5A7W A;  3CNA A;  4MOA A;  1VMF A;  5A3O A;  4QB2 A;  2G9Z A;  2Y6K A;  4W4Z A;  3ALQ A;  3LDK A;  4C0H A;  3BUC A;  1ASJ 1;  5HV4 A;  4RHV 2;  2D98 A;  1W8F A;  4XFA A;  3WIN E;  2XL7 A;  2ZAH A;  2ZGO A;  4OI2 A;  1R09 2;  1QGL A;  3CHX A;  5F39 A;  5FZ4 A;  2OQ7 A;  4LOR A;  3H8X A;  1ZX5 A;  2JEC A;  3HWJ A;  5FO8 B;  2NQY A;  4RQP A;  5CAZ A;  1RUI 1;  1FPN 1;  4HZF A;  3LIH A;  5FJK A;  4BQ3 A;  4NO4 A;  3VBH B;  1Z7S 2;  1RUD 2;  1OKO A;  4I02 A;  1ZBE 3;  4MUV A;  4BK4 A;  2MPF A;  2QUO A;  1W6P A;  1H9P A;  2JB4 A;  1ZZ6 A;  1ENS A;  4R9D A;  1XND A;  2EAL A;  4QKB A;  4Y5T A;  2OII A;  4R9B A;  2ILM A;  3OY8 A;  5I8Y A;  2VOW A;  2XJT A;  3ZXF A;  4QXK A;  3WW2 A;  3IAQ A;  1A8M A;  1VAV A;  2AEZ A;  2Q8D A;  5F5A A;  5LBF A;  1HQL A;  3VZK A;  4CU8 A;  1KJR A;  4OCT A;  3HT1 A;  3T2O A;  3VB9 A;  1EAH 1;  1EUT A;  1VBD 1;  2OW4 A;  5J37 A;  1LGB A;  4N43 C;  5CG8 A;  4ZU4 A;  1W6O B;  4AGG A;  3POW A;  4Y1V A;  4LR4 A;  4I09 A;  2G9F A;  3L9J T;  2ENR A;  2BNN A;  5ACA 1;  3TNQ A;  4DXT A;  2XJP A;  1DGW X;  4GWJ A;  2AEY A;  1DZT A;  3G6J B;  1O3R A;  1UXX X;  2WN2 A;  2ETE A;  2VH9 A;  5FMO S;  4J1X A;  4AFC A;  1QJX 3;  3ZR5 A;  5CA6 A;  2JG8 C;  4GWN A;  3TN9 1;  2GU9 A;  4RGG A;  5DUW A;  5FZO A;  2WZR 3;  3N35 A;  4XF3 A;  4KWK A;  5CFD C;  3NST A;  2VMC A;  4PT6 A;  3OYW A;  2IC1 A;  1CAU A;  2YGL A;  4AED B;  1S1A A;  3PUI A;  1XNB A;  3CJI A;  3KF5 A;  1D7P M;  4ES8 A;  1W6M B;  2BWA A;  4GWM A;  5IHR A;  1BMV 1;  1GZ9 A;  4FFH A;  1DCS A;  4LIT A;  2A5Z A;  4OI0 A;  4HKW A;  5D1I A;  2PAE A;  2P1B A;  2QQW A;  5DDJ 1;  1VIW B;  4JTO A;  2HWB 1;  4AEJ A;  4J25 A;  4Q4V 3;  1G9A A;  3BOW A;  5FMB A;  1AXK A;  1YRZ A;  1HLC A;  4DMI A;  4YW4 A;  4JX0 A;  3B5L B;  2O8O A;  1O8S A;  1VMH A;  3IN9 A;  1LOB A;  1RUH 2;  1W2U A;  1AHS A;  2PAK A;  5SV8 A;  1FV3 A;  2WQ4 A;  1EUU A;  2G4I A;  4LBL A;  4B8E A;  3P3N A;  5H9S A;  1LHO A;  2PYT A;  4LO6 B;  1GLH A;  4QHZ A;  5DAX A;  5FY5 A;  5BNQ A;  1V6N A;  3ZXL A;  4KG0 A;  1NXM A;  5EP9 A;  1C8M 3;  1E5S A;  3NJY A;  1HQN A;  1UAI A;  3MIF A;  4QMA A;  1IQA A;  4H55 A;  4G3Y C;  3OGJ A;  1BXH A;  2ATF A;  2X5I C;  1OD5 A;  1V9U 2;  1ULF A;  2NYY A;  1PVC 1;  5AC9 2;  1ZNP A;  2WT0 A;  2ZHL A;  2YPJ A;  4IL7 A;  1FNZ A;  4AVC A;  4EWE A;  2PFW A;  1RHI 2;  3C7E A;  2EIE A;  4QWN A;  1YQ5 A;  1ZYB A;  1U12 A;  3UES A;  2ZX4 A;  1JBC A;  3CZJ A;  1U0A A;  3EJK A;  3IMN A;  3LSD A;  3ZN6 A;  2E32 A;  4MGY E;  3A0K A;  3SMH A;  1UYY A;  5FY7 A;  1IOA A;  4N9H A;  1ZRE A;  3PIG A;  3ZSJ A;  5DAV A;  2VBB A;  2PHF A;  3SIT A;  1UNB A;  3EXU A;  2JEM A;  1RUF 2;  1UZW A;  1TG7 A;  2FHR A;  1LHU A;  2FZ1 A;  2TNF A;  4PDW B;  1GAN A;  4XF9 A;  4AI2 A;  2L9L A;  4A44 A;  5I0R A;  1GR3 A;  5K0U B;  2EIG A;  2EID A;  2UUR A;  2Y60 A;  4FAH A;  3RFR A;  3CO2 A;  2NPI A;  5JI7 A;  4IET A;  3WF4 A;  4W8J A;  3CLP A;  1VBC 1;  4GMP 1;  3FUO A;  3LPG A;  2XJV A;  4FPC A;  1EPW A;  4NE9 A;  3G7D A;  1HRI 1;  2VMH A;  1D4M 3;  2W2I A;  4CUB A;  2IUW A;  5EV7 A;  5JPN B;  3NL1 A;  1POV 0;  2ZGR A;  2WBK A;  1CJD A;  5FQ0 A;  2TUN A;  1IS5 A;  2PHW A;  3JD7 2;  2Q4S A;  4ASL A;  5F3E A;  2BW8 A;  2P37 A;  2J1T A;  5FR3 A;  5FBJ A;  2XHK A;  2HWF 2;  3VHR A;  4CDX A;  2RS5 2;  3ZDS A;  3ZIW A;  4Q27 A;  4CEY C;  1FOD 3;  4GH4 B;  2XJU A;  3N9Q A;  5C9A A;  1VAM A;  1X8E A;  2YC0 A;  4OQ8 A;  4L8Q A;  2OKX A;  4BZ4 A;  4TSV A;  3J26 N;  1JHJ A;  1O6U A;  4MHR A;  1OC1 A;  4XMA A;  4O65 A;  2AZ5 A;  1BK1 A;  1VBA 2;  1YI9 A;  1ZZB A;  2R04 3;  5E89 A;  4BH9 A;  1G8W A;  4MV2 A;  1O4Y A;  4G9S B;  2JX9 A;  1PGS A;  1LNS A;  2NMN A;  2R6Q A;  2D6L X;  1UCX A;  2RG4 A;  4MXW B;  1HB4 A;  5EFU A;  1SLB A;  1UN1 A;  4CTE A;  3KWV A;  5IK4 A;  4CU7 A;  4FPL A;  1NLS A;  2PN5 A;  5FKC A;  3V0A B;  1JOB A;  5T5J A;  3HQU A;  1GYK A;  1L3J A;  1JTZ X;  5EQU A;  1NX9 A;  4CDX C;  3N9M A;  1RUJ 2;  2QZ2 A;  3VDD B;  4F8A A;  2J42 A;  1XE7 A;  1HX6 A;  4MYE A;  5FP8 A;  4WZC A;  4L9B A;  5FPL A;  3RZZ A;  1K45 A;  4ONU A;  2Q5T A;  2R06 2;  1DYK A;  2DCY A;  4N53 C;  4LPL A;  4D7S A;  5T3N A;  3MGU A;  3V64 A;  2O8Q A;  1N1Y A;  4E8D A;  4CU9 A;  1AR7 3;  1OSG A;  5KC5 A;  3MW4 A;  4CP9 B;  1W99 A;  4BPZ A;  1QH7 A;  4XPV A;  3VBO A;  4I01 A;  3O14 A;  2P2K A;  1FNY A;  4ITC A;  2W95 A;  4IXL A;  5I0S A;  2ZTN A;  1W8W A;  3HIF A;  2GME A;  2RJ2 A;  5KHK A;  1EV1 2;  3PUH A;  4ORF A;  4Y22 B;  2E9Q A;  5J3U A;  1A34 A;  4Y20 B;  3B3Q E;  3LA2 A;  2XH6 A;  1MZE A;  1RUG 3;  1LCL A;  1NYW A;  2BRT A;  2OT7 A;  4IEQ A;  2CAV A;  2IFR A;  2KA3 A;  2QQL A;  3AL6 A;  4EZ4 A;  4YW6 A;  4P9X A;  3ACL A;  2YY1 A;  3TEY A;  3NVC A;  3AMN A;  3OGV A;  4XJU A;  5IWF A;  4AI1 A;  4LT5 A;  1X50 A;  2XKO A;  1CIW A;  1ENR A;  1FT9 A;  2BER A;  2DCT A;  4WVM B;  3DPR A;  2BZD A;  3PUA A;  4PLM A;  1HXS 2;  1K5M A;  4XET A;  5FYT A;  2VME A;  5FXX A;  3I4I A;  2O1Q A;  2RR1 3;  4LKD A;  1OOP A;  1UYP A;  5I93 A;  1JU3 A;  3K3N A;  1DYP A;  1ND2 A;  2LUW A;  1J3Q A;  5A3U A;  4KQ7 A;  3BGA A;  5K9Y A;  4MHU A;  4W6Y A;  4CDU C;  4LTA A;  4D3W A;  4MGQ A;  3TRS B;  3NKT A;  4IW3 A;  4U2A A;  5I8T A;  3VDD C;  1SG3 A;  2YGM A;  3M1H A;  3NQH A;  2LW8 A;  1OFN A;  5D21 A;  2HH9 A;  2NMO A;  1ND3 B;  2C4X A;  5B4X A;  1KFU L;  2HWD 1;  2W39 A;  1RMU 1;  1VRH 3;  2A73 B;  2P3K A;  2BGO A;  1DFQ A;  4NWW A;  5DN2 A;  3ZXA C;  2ZGM A;  4R8H A;  4E2G A;  1VLN A;  2B8M A;  3AYC A;  4AVV A;  2P3I A;  1V6J A;  4QX8 A;  5C5U A;  5KHH A;  4Y24 A;  3GM8 A;  4L97 A;  4NPL A;  1Y43 B;  5F32 A;  1JYW A;  1Y9G A;  3KQR A;  4QQO A;  3GHN A;  1VR3 A;  4OI1 A;  1OOP C;  1OQD A;  3K51 A;  1N3O A;  5CU1 A;  2WZ8 A;  2W0X A;  1K5J A;  5CVR A;  1W2O A;  1UZV A;  2XB6 C;  4IV1 A;  1XU1 A;  2Y6F A;  2D5H A;  3CL1 A;  4XUN A;  4TN7 A;  2YYO A;  1W3V A;  3AKS A;  1H2L A;  1DYO A;  5BNN B;  2C0Z A;  3OB8 A;  1LR5 A;  2A6Y A;  4V2W A; 
#chains in the Genus database with same CATH homology
 4BQ3 A;  1GWK A;  1V0A A;  3ORJ A;  4CPB D;  4BQ2 A;  4CPB A;  1OKO A;  4BQ4 A;  2K46 A;  2LRO A;  2O14 A;  1WCU A;  4BQ5 A;  1W8T A;  2JWP A;  4CP9 A;  1HN0 A;  2WYF A;  3F95 A;  1WMX A;  4YWA A;  1W90 A;  1GWL A;  4LK7 A;  4LK6 A;  1GWM A;  4CP9 B;  4LJH A;  4LKD A;  4YW7 A;  1W9F A;  1W8Z A;  1WZX A;  2KR2 A;  4LKF A;  4A6S A;  3UT0 A;  1OH3 A;  2LRP A;  1W8W A;  3ZYF A;  2Q1F A;  2VXJ A;  4AL9 A;  5D21 A;  4YW6 A;  4LKE A;  3ZYH A;  1W8U A;  3ZYB A;  2C24 A;  1L7L A;  1UOJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...