2FDFA

Crystal structure of alkb in complex with co(ii), 2-oxoglutarate, and methylated trinucleotide t-mea-t
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
199
structure length
199
Chain Sequence
LAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLSLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(P*TP*(MA7)P*T)-3'
publication title Crystal structures of catalytic complexes of the oxidative DNA/RNA repair enzyme AlkB.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Oxidoreductase/dna
total genus 50
structure length 199
sequence length 199
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2005-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 2fdfA00
4ZHNA 4QKBA 4NRPA 4IE6A 4QKNA 3O1TA 3T3YA 3S57A 2FDIA 2FDHA 4CXYA 5F8PA 3O1OA 4NRQA 4CXWA 3O1RA 2IUWA 3T4VA 3H8RA 4NPLA 3RZLA 3O1SA 4NIIA 4NRMA 3BU0A 4JHTA 4NPMA 4IDZA 3I2OA 4CXXA 3I49A 2FDFA 2FDJA 3KHCA 4NIGA 3BI3A 4IE7A 3O1MA 3BUCA 3BKZA 3BTYA 3RZHA 2FD8A 3H8XA 5DABA 3I3QA 4O7XA 4NJ4A 4IE0A 2FDGA 4ZS2A 4NIHA 4QKFA 3S5AA 4OCTA 3KHBA 3I3MA 3RZMA 4QKDA 3O1UA 4QHOA 3H8OA 3LFMA 3O1PA 3RZKA 4ZS3A 4MGTA 4NIDA 3RZGA 3O1VA 2FDKA 4MG2A 3BTXA 3BIEA 4O61A 4NROA 4IE5A 4RFRB 4IE4A 3RZJA 3T4HB 3BTZA
chains in the Genus database with same CATH superfamily
1RUOA 1U5IA 1ZBA3 3ZFGB 5C6CA 3T0DA 3GYDA 1NKGA 3ZOIA 3WF1A 4BLJA 5IK7A 4LO8A 1RUJ3 2ZX0A 2GMMA 1JTZX 1EUTA 4H7LA 4HANA 5CEHA 3MICA 4BWOA 5EJ3A 5A32B 2PMWB 1V6OA 1WMDA 2ZACA 4Q4W3 5ISLA 4OI2A 1SDWA 1ULOA 3WNMA 4Y1UA 2GNDA 4CXYA 4IQPA 3ZYBA 3U78A 1F4AA 3HQUA 4YW7A 3HN1A 4H7MA 2WFPA 3PTYA 3K46A 1VRH2 3PUAA 3GBWA 5JPNB 5J3UA 5LY1A 1RUI3 1ODMA 1YO8A 1LB2A 1OOPC 4Q4V2 4LORA 5EZWA 3CKHA 3F2ZA 3OPTA 3KV4A 4TXWA 1W9YA 2X53S 1LOFC 1VBE3 3OPWA 5KR7A 4LKDA 2FCVA 4PF1A 4QM8A 2QQWA 4LLFA 3VBFA 3IM0A 1EV13 5F7UA 5F3IA 1FI2A 1JU4A 4HBNA 3PVEA 2VBDA 3WEZA 2BGPA 4O65A 2A7AA 4NRMA 4XJUA 5C71A 2A70A 3PUQA 1V6NA 3PUSA 4XIKA 1BJQA 4LUMA 2E33A 4Y24A 1PO11 2VCBA 4A42A 2BNMA 2WT0A 1KRIA 4KGGA 3VZOA 3C7FA 5CBLA 5EHDA 1IKQA 3ZFFB 5ABJA 4YSFA 3I2DA 4S2HA 4QPYA 1QU0A 1JODA 2AEYA 3ZN6A 3AP4A 4NHXA 5GLWA 1VBA2 5CNAA 3N9QA 3MUZ1 1JZ5A 1AL22 5DAQA 2WABA 5F5AA 4ZKTB 1VIWB 5C5UA 4HSLA 3IIAA 4F83A 2O8QA 5F3CA 2RJLA 2HWE2 1T6BX 2R041 4UFIA 3HNMA 5KC5A 5APAA 2ZGKA 1EPZA 3C3VA 3VD9A 4OMCA 2YC0A 4ZXEA 4XZPA 1HQNA 1OFNA 3AMHA 1J1TA 4MGIE 5CG9A 1M4WA 2BFUL 3OEBA 5DUXA 3N9NA 2WZEA 4YRDA 3B01A 3S5AA 5EJZB 5IK4A 3J4UH 4IEXA 4QHBA 5KXBA 3DYPA 3RPQA 3MPBA 2WNEA 4LE3A 3UGFA 5A1FA 1H4GA 1COV3 1PO21 4E2GA 1GUIA 2DCTA 2E32A 2XUMA 4UW3A 1RUC3 1XE7A 4PIXA 3JB8A 1PMIA 4ASLA 4CZSA 3ELNA 1TG7A 4FPFA 1ULFA 4LPLA 3U75A 5IVVA 4YVSA 5F3GA 1C3HA 1Q8QA 3LEKA 4ZU7A 2QJVA 2RR11 3FL7A 4IV3C 1KFXL 3OUJA 1GQHA 4JCKA 4CRQA 3RZGA 2J1TA 3OGSA 1YFUA 1S2BA 2VQ0A 4GKYA 1WCSA 1TME2 3ZFGA 1UU4A 4AVCA 1N47A 1I6XA 5D8AB 1WW5A 3NL1A 1XOYA 2Q8EA 2OX0A 4HL0A 4CCLA 4Q27A 5HV4A 1NCQB 1U5ZA 1SBDA 5HV0A 5JLVA 3RZJA 2FMYA 2PAKA 5JOWA 5LASA 2VJXA 3MHZA 2OKXA 1VBB1 3M3IA 1PGSA 4DQAA 4IE6A 4ES9A 4PJYA 2H6CA 4WVVA 3SEEA 1JYWA 1BBT1 3JQXA 3H7JA 4QKNA 3ME2A 1MEC3 3ZPOA 4AK3A 1IQAA 2WS93 4WM7B 3UKTA 1ASJ1 2QQLA 2WRAA 2HWD2 4JDOA 2GSYA 3VZMA 2Q1ZB 4JX0A 2JDAA 3NNFA 2JG9B 2NMNA 3GM8A 1JI6A 1ND2B 3KCXA 4A44A 2I45A 3VBUA 4OHZA 5CKQA 2ID4A 3OGJA 3DYMA 4AVAA 4AI2A 1XSRA 4M00A 4XPVA 4M4RA 3VZLA 3WLUA 3V0AB 2BBAA 3OBRA 1F2NA 1AYM1 4IEVA 4DY3A 1J83A 1TVGA 3K4AA 2XUEA 1VMJA 3WQ0A 3QACA 1V00A 3ZFFA 2EALA 1FYUA 1GZWB 5D21A 5F2WA 1LKNA 1O4TA 2VBPA 1EUUA 2VZ3A 2PN5A 5F37A 1ZA4A 1S4CA 5BNQA 4X6RB 2QNKA 2W1QA 1REFA 4XFAA 1DZTA 1NQDA 5JWPA 5CA6A 4AGVA 2XVKA 4IE7A 5JDBA 4YFZA 4LBMA 2ZX1A 4N43C 4PIYA 2NMOA 3WDTA 2YGLA 3BUCA 5B4XA 2VH9A 4NWWA 2O8OA 4TSVA 1G7YA 4INDA 4PLOA 4RHV2 2KA3A 5C33A 3K4ZA 3BPZA 5T5LA 2AGSA 4LHLA 2A75A 2W91A 3ZIWA 1QXPA 4FPHA 1RHI3 3CDZB 4K9SA 4XOGA 1H6XA 3GDBA 1ODNA 3OF1A 4HK8A 4ARYA 3VKOA 2RDSA 1ACCA 1S0FA 4LBQD 4LR4A 5A3PA 2XJUA 1DYOA 4LUKA 3ZN5A 2BJSA 2JD9A 4RQPB 2P2KA 4HVQA 1M06G 3B02A 3AYEA 4QQ2A 2G9GA 2VQUA 2FBEA 4D8MA 5CZKA 4NHYA 4P5HA 4L99A 5CFDC 2R073 2NZ9A 1BEV2 2JG8A 4ISQA 1WLDA 1X82A 3M8LA 1AX1A 4EN7B 2EIGA 5LA0A 1B35C 1GLHA 4AHYA 1RUF1 2DFCA 2Q30A 4K3UA 3ZX7A 2VZRA 5D8AA 4YG3A 4B7KA 1H0BA 1FATA 5LCWL 2MNGA 4CA9A 3POBA 2QQKA 1GR3A 4XW3A 5FLIA 1HJGA 3ZO0B 4Z8BA 4B8EA 1QOTA 1TZOA 2R061 3PIJA 2DCJA 3TNPB 3CLPA 1FOD3 1SZBA 4MLOA 4EQVA 2RS11 3I2HA 5IFPA 4JRAA 5A80A 5FZ3A 3VBSC 5FZBA 4CDXB 2VCAA 4HN0A 3IN9A 4WM7A 3MW2A 3RFRA 1FX5A 3WQ7A 5A3UA 2ZGTA 5T5OA 2IC1A 4BB3A 4XILA 4LO5B 4Q4Y2 1KJLA 1CAVB 2XONA 2BVVA 4AAXA 1LHWA 1AUYA 4LULA 1ND2A 1CAUB 1VJ2A 3EB7A 1SCRA 3FLRA 3GGLA 3MF9A 1NZIA 4KG8A 2F17A 3KS7A 5KHJA 1LAJA 3RYRA 2ENRA 1K5JA 3ZN4A 3D6EA 3Q8EA 1K5MB 1ZX5A 3KCCA 4QGLA 2VNRA 4A6SA 1OH4A 4P14A 1C1FA 1LR5A 1G9BA 2X5IB 2VY0A 5E8AA 1F8VA 4Q0SA 1RTVA 4E8DA 2AH2A 2Y33A 2R6QA 3J8F1 1UKGA 2XGXA 4XDPA 3AZWA 1W2NA 1LHOA 3K4DA 3OPZA 2ZXQA 5JOZA 4BHPA 2W5FA 1NLSA 3KGLA 3PU8A 3MIDA 2E7QA 5FYCA 2ZMLA 3OYWB 2BV4A 1GZWA 4J25A 4QDRA 4OI1A 4YVWA 1JYIA 1YWKA 2GP5A 1FMD2 2DVFA 4DIQA 3TRSB 4J6GA 1DZQA 1MVEA 4MUVA 1FPN2 3ACIA 2QQIA 4IGPA 1W9TA 2RM22 4LBQB 3GBFA 3LSDA 4MO3M 3NNMA 4AEDB 4CDUB 2RVAA 1ZBA2 5JZGA 4GKXA 1BHGA 1WW4A 3VHOA 1RUJ2 1WMXA 3NKTA 3MV11 4J1XA 4I3GA 2D98A 2BOJA 3HD8B 2W1WA 1S0GA 3AP7A 4Q4W2 1ULDA 1Y3TA 4H3WA 1VRBA 4B29A 2DU1A 2YY1A 2WINB 4UW4A 1YUDA 3VBFC 5K8SA 3ATGA 5BUVA 2Q5TA 3AKQA 4DINB 1O4ZA 2QQJA 2VOVA 3ST7A 1RUI2 1VMHA 2KXLA 4YZ1A 3ROUA 3UJQA 5DXDA 1SHWB 4B4QA 5A1AA 1VBE2 3N3HA 4IEWA 4RQPA 3OEAA 4CCCA 5DAWA 2H6BA 1EV12 2QCSB 1PMHX 4YPJA 2ZAAA 2UYAA 3A4UA 2QQUA 3C7OA 2PHXA 3KWVA 3POWA 2DTYA 3LIGA 5ABJC 1KDMA 1IS3A 4ORFA 4I01A 3T0BA 5FYMA 4DXTA 5IK5A 4HK9A 2PHUA 1EPWA 3E5XA 3W5NA 4YGBA 1ZRIA 2QDNA 4WZCA 4YG0A 4BH9A 1VP6A 4FXGB 1VRH1 3PVOA 2D97A 3ZDVA 1ALYA 4Q4V1 2CWMA 5EXOA 1S55A 1CPNA 1LOGA 3CJXA 3MIGA 4HG6B 4XFHA 4DS0A 3M3QA 3WG3A 2HEVF 3F95A 1X9PA 4QX2A 2FZ1A 4Z2WA 3CZUA 1G6NA 2XXZA 1UPSA 1UY3A 4FQ4A 4AZZA 4C1XA 5C8WA 1OVPA 1J3PA 1JHNA 1RUD3 1KXGA 4MXWA 4Q5OA 2E53A 2LRPA 4JTNA 4L9BA 3ILRA 5CADA 4OMDA 1HXS3 4KBZA 4RSUA 1W9WA 2VE1A 3OG2A 4E9KA 1OUXA 1N1TA 4OI0A 3UETA 1UMZA 1PGW2 1WD4A 3OY8B 4Q26A 4W4ZA 1Q43A 1BXHA 1BKZA 4QM9A 4Y5TA 5EPAA 5C5TA 3I2JA 4YVSC 1J59A 3PMSA 4H55A 1JXNA 3AYCA 3LE0A 1VBA1 4UF0B 2BNOA 1YRZA 2X5IA 5E88A 1VE0A 1COV2 3W5MA 4N90A 5FYVA 4DRRA 3ZFGC 2ZOEB 1W2AX 1RUC2 2VNVA 5BNPB 1UU5A 4P5YA 1BYHA 2HWE1 2XJVA 4HN1A 2YB7A 2VZOA 2BQPA 4ZY9A 3WNLA 2J42A 3OYWA 5JR7B 1NCRB 3FMGA 2JB4A 3WHUA 1Y7BA 1NE6A 1YIPA 3KT1A 3ZXFA 3WW2A 3ZXDA 2RS33 1O59A 1OQEA 1S0EA 4W6YA 4XMAA 4AEKA 2IXKA 3BGAA 1ZBE3 4MOAA 4NRQA 4YM3A 1SLAA 4RL7A 1LHVA 1VAMA 1ZYBA 3USUB 4E4ZA 5DMYA 1W8TA 1XJAA 2CNAA 1GP4A 4RGAA 1PM4A 5I0UA 4TTGA 1PK6B 4YWAA 1GZ9A 1HV1A 3CU7A 1TE1B 1N1VA 4JHTA 1RUG3 2YBPA 2ZGSA 1DCSA 4G4FA 3O7OA 4GA9A 1MEC2 4XF4A 3VBUC 3VDDB 3ZKUA 5HCBA 1E57A 2WNUB 5FPAA 4I30A 2D6LX 2ZHKA 3ENRA 1WA6X 1J84A 2DTWA 1W99A 3CIHA 1L7LA 4XFCA 1TME1 1UU6A 4P08A 1K3IA 1HRV1 4QPIB 4XQDA 3FFZA 1WCQA 5C9AB 5I0DA 2E7AA 2OQ6A 2B46X 3T2QA 4G3YC 2AENA 1UY2A 3WF0A 3ZFFC 4F3JA 4K20A 1SACA 4XYXA 4JHZA 4XJWA 4KI5M 4KL1A 4NAOA 1MS0A 4XUQA 4AGGA 1QJFA 1STMA 2CDPA 2LM3A 3NVCA 4O7XA 5FBZA 4NHLA 5FUIA 1YJKA 3VV1A 2IXCA 2V4AA 2OA2A 5JSRA 1KS4A 2HWD1 5FZ4A 3IT8A 1ENQA 4N7IA 1AR91 3MO4A 3WP4A 4DXZA 2VCCA 1ZZBA 1Y9QA 4KMQA 1KQRA 5T52A 4FTSA 1UXXX 4XJZA 3BCWA 4P00B 4PLNA 4LBNA 5GZGA 1YCIA 4XF1A 2V5YA 1UOGA 2XHKA 4CEYB 2BBVA 1Z7S3 2W68A 4M3CB 2JE7A 4QHOA 3ZSKA 4HETA 1A3KA 1ZRDA 4KWUA 2A6WA 4WM8A 1V6IA 3APBA 1ZREA 5HXMA 5A3NA 4EV0A 1SLCA 4GIQA 2R7EB 4XXAA 4YG6A 5DQ0A 3SISA 4LEJA 1QJX3 1IPKA 4P9JA 3VL8A 1W39A 4AHXA 5KXCA 5KC6A 1YJLA 4QPGB 5FAXA 1LULA 1YYNA 2VOTA 2ZGPA 4YM1A 3VZJA 4MZUA 4MG2A 2HEYF 1POV3 2C0ZA 3AMMA 5FZIA 3CEWA 1RHI2 3WW4A 2Q4SA 2VXRA 2QFEA 2W0XA 1REEA 2J7MA 3KSCA 5CAZA 3WNNA 2NP0A 2JG8C 4GWMA 5D1IA 5FDBA 1AL0G 1GKBA 2JDUA 3LZZA 1XQNA 2JD4A 4BMBA 1W8NA 5IW0A 5D8AC 1XE0A 3ACLA 3PNAA 1OQ1A 5DN2A 3ZVXA 1ZZCA 3R4UA 5FKCA 4FVVA 1H2MA 2R1DA 2R072 4DUVA 4FOYA 5A7NA 2FQPA 5KHGA 1CAWA 5L73A 4D3WA 4X6QB 2P17A 3USUA 1V70A 1CAXA 1S1AA 4D6SA 1DGWA 3NAPB 4JKMA 2OUJA 3E5UA 4WM7C 3SC7X 3RZZA 1LRHA 3LQCA 1QJZA 1Z78A 1FOD2 2WAAA 2WNVB 5FXWA 1ND2C 3AB0A 4Q0PA 3KCYA 2HWC3 2JDNA 4L8QA 1GZTA 4Z82A 5FMDA 1LGBA 4BK4A 3ZIXA 3KT4A 4D94A 3LEMA 4CCOA 5DAVA 2WNUA 1IS4A 4R9AA 1CESA 1BEV1 1XNDA 5FQ0A 1U5YA 3INAA 4OZOA 5K4LA 2P3IA 1WCUA 3UK9A 3AXDA 4AVBA 5C3RA 4ATFA 2BRTA 4QPIA 2EXHA 2B9VA 4IDZA 1GP5A 4E4SA 3FHAA 1XYOA 3ZSJA 3HIFA 1OLRA 1DLCA 2WZ8A 2Z42A 1JS9A 3AX4A 3TEXA 1WMFA 2A1XA 2ZEXA 3BOPA 3VHNA 2EIBA 3IIIA 3NO8A 5IT6A 5FKBA 4YARA 1WLWA 2JIGA 1SLTA 2Y38A 1QOSA 1PX4A 1H9WA 3IMMA 4YVWC 1N3OA 1KITA 3ZSLA 5A6YA 1AR83 2D6KA 5FY5A 1PZ7A 1W6OB 5FZKA 3UL2A 4BQ3A 1VB4A 2OQ7A 3E97A 2H0BA 1QNWA 4S2DA 2YZ4A 5FO8B 1WCKA 1L3JA 2WYSA 1QJEA 4XJAA 4DEQA 3MW3A 4XXPA 1W8HA 5C3SA 1REDA 4GB32 1Q8SA 5JZGC 5FZOA 2WWJA 3N4MA 1PIV3 3NJXA 4Q4Y1 1HDKA 4EN8B 5CFCB 2DWRA 1XB9A 3N9OA 2DCKA 3J7LA 3DYOA 5GALA 5LA9A 3VDCA 5L9VA 5JXGA 4CEYA 1O3QA 4OUEA 4EWDA 1C8M3 3IAQA 2RDRA 2W08A 5EV7A 3AP6A 5JIUA 1W90A 2UWAA 3WXPA 1PNFA 3HMYA 4A2UA 1UX7A 3NMBA 1HQWA 1WBLA 1EAH3 2YROA 1LNSA 2XVLA 1OFSA 1SLIA 4R9DA 2XL9A 2OS2A 5FP3A 2HWB3 3FFQA 3M3EA 1E5RA 4XFFA 1RB8G 3IPVB 3TNQA 5J1XA 4J1WA 4QPGA 3B00A 4RQPC 3MPPG 1OA3A 3IWZA 2EIDA 3JQWA 3VBRA 1W03A 2W47A 1FPN1 1WUVA 1R1ZA 2RM21 2YPDA 3LD8A 1GOFA 1OSGA 2GC1A 4PQ9A 1ZBA1 3AZXA 4Y5SA 3ZFEB 1O6UA 2B45X 4FPCA 3WF4A 2JB8A 1W8ZA 4TN7A 1RUJ1 4GH4A 4FFIA 4GZ9A 1D4M3 4IEOA 2Z79A 3MF6A 1ND3B 3LAGA 3ON7A 4Q4W1 5IAVA 1YNAA 2AREA 3I4IA 1JHJA 1LOBA 4L92A 1HIXA 4SBVA 5F5IA 3UESA 4HPKB 1ZZ6A 2A3WA 3BYWA 5LRRA 3SITA 5DAXA 3MIBA 4A4AA 4NO4A 3L2YA 3VBSA 5BNNB 2RMU1 1RUI1 3NAPA 1YFYA 1MZFA 2B42B 1XYPA 4AW7A 1MZEA 1PZ8A 3ZMOA 1MZ5A 1ZRFA 2W87A 1HB1A 3H42B 3LCPA 1VBE1 5E89A 5FMOS 3WT3A 4HKLA 2IZWA 1DQ2A 2BUKA 5FJHA 3VBHB 2BFUS 2F4LA 2VUAA 2WNVA 1EV11 1GQGA 1VBC3 4OUMA 2ZZJA 3FHQA 4UFKA 1NZCA 4ZZ5A 5A7OA 1IZ3A 2ZHLA 4OVEA 3CF6E 3A22A 2ARXA 1RUD2 4Q1RA 4N7UA 5JSOA 1H8TB 2ZEZA 2X5IC 4YZ5A 2ZKNA 1BCXA 4FP2A 1DG6A 1GNHA 2VUJA 1IG0A 1W3XA 3Q9OA 1JZ6A 3BTAA 3RZLA 1V6KA 3QCWA 4M3CE 2NLRA 1ZVFA 2IXJA 3O1SA 1Q5OA 1JOPA 4Q1PA 1VALA 1RJ7A 1RUH2 4EYUA 1BLZA 3DUIA 4CP9A 5GLTA 4XF0A 3RDIA 4XE9A 5F5CA 5H9PA 2UU8A 1UZWA 4RN5A 3JD73 5IVEA 2OVUA 5J36A 3WX5A 3AK0A 1BVP1 4AEDC 5IHRA 5F6KA 3VL9A 4C0BA 1G9DA 4RR3B 3USSA 2Y6FA 2TUNA 1LHUA 2WBKA 5FZDA 2G4IA 3ZYJB 1BVVA 5CFCA 1GBGA 2K2SA 4ZU5A 4P9WA 1JU3A 1SEFA 1Y9GA 5FZHA 1UOJA 4AI1A 1H2NA 1PGW1 1I1EA 3P3NA 3WNXA 1QKQA 2RS32 3KD4A 2WZPP 1SPPA 3O5SA 3BTYA 1DF0A 1ZBE2 3I7DA 3PJQA 4UAPA 2LALA 1EYBA 4Y1XA 5DABA 2FZ2A 5HBAA 3AM2A 3PIGA 4YW5A 3C7HA 1COV1 4FXKB 4CCKA 1A78A 1XC6A 2ILMA 4WVMB 3PUHA 5BYNA 4TYSA 1RUC1 1V6MA 2XBO3 2E51A 3H0OA 3P6BA 5FWJA 4YGCA 2BTVC 3HR9A 3IPVA 2VW0A 1RUG2 1DQ5A 2G9ZA 4XCBA 3LPGA 4P9YA 3WDYA 5FP4A 4QU2A 3THTA 1CX4A 1HW5A 4FOVA 1QJY3 1DQ0A 5A3WA 2WQ8A 2QQNA 2QUOA 4FAHA 4QKDA 1RUE3 4URAA 5KHIA 5ANQA 2RS53 2K0GA 4NHMA 4LK7A 4YW1A 3ZFEA 1HN0A 1H9PA 5LBCA 2PLV3 1Q8PA 2ADDA 3IMNA 4AVTA 4NOTA 1V9U2 3N36A 3N35A 1LOEA 4META 5C8CB 3AKSA 1HRI3 1CQ9A 1UYPA 5GLVA 2OYZA 4FPEA 5FMOL 3WG4A 5T3NA 3NKGA 2XJPA 4D6QA 4D69A 1MEC1 4CDQB 4XUOA 3WDUA 1OA2A 1YQ8A 3KB5A 2P5BA 2BGCA 2VC9A 4IV1B 3RG0A 4QHZA 2YC2A 2XMLA 5BNNA 2VW2A 1HB2A 1SMVA 4WM8C 1ULGA 4P9GA 2ETEA 4LO4B 5FREA 5EWSA 3POGA 1KFUL 1QJU3 1WZXA 4BJ0A 1W8FA 2EIEA 3AP9A 2YPJA 5IVYA 1O3SA 2WWUA 1R1A1 3I8TA 1Z7S2 2ZZQA 4IL7A 3VD7A 3MLLA 5A7PA 3HBKA 5C3OA 3BALA 2AEZA 2JXAA 3GHNA 5AC91 1H30A 4CCJA 4CTEA 2FDIA 1NA1B 1BMV2 5B2GB 2VTXJ 4QAWA 2WWSA 4JGYA 3DKWA 1C1LA 1LENA 2RHPA 3O12A 2ADEA 2C9KA 1LGCA 1RL3A 2WO1A 3G6JB 4GWIA 4URTA 4AI0A 5A3TA 1QJX2 3WHTA 1SDDB 1JUHA 4EN0A 3O1OA 2XQXA 1JYNA 1CVNA 2CSGA 4UWDA 1YXWA 1NY72 1DLLA 2LROA 4MHUA 5FUNA 3VKNA 5A32A 4UOJA 2QZ2A 5FPBA 2GMEA 3T4VA 3G7DA 1PO13 3KMHA 5FP9A 4YGEA 5J98B 4FFFA 1XRUA 3TYJA 4Q8KA 3RRDA 5JXHA 1YQ5A 4RR3A 3HBZA 1XU1A 1W6QB 4IEQA 4COUA 3O1RA 2WO3A 1MS3A 2ES3A 5FXVA 4XDQA 5LWBA 3C7EA 5T54A 2TBVA 3RMXA 5L7OB 4NVPA 1K12A 5FY4A 3J9SA 1LCLA 1OHFA 2XWJB 3ZSMA 3RNSA 3VDDC 3D5OA 5FYTA 2ZEYA 2AC1A 1PM7A 2WNUC 2Y60A 3AJYA 1ZNPA 1BK0A 2XDVA 3ASIA 3FLPA 3ZXGA 1VB2A 4B7EA 4CDWB 4WVMA 4MH0E 5G05L 4M0NA 1CONA 4QPIC 5GJ6A 3THCA 4LOTA 5FMCA 4RS5B 2HWC2 3MEPA 4YZ2A 5FPUA 2RG4A 2GAUA 4NAMA 2J22A 2VNOA 4DEVA 1HV0A 1WW6A 2R071 1DQ6A 1W8OA 4L0PA 1G86A 4ZS2A 5ERLA 2C26A 5FY9A 1HB4A 1JYTA 2HYXA 5JXIA 1C8NA 4CPBA 4BCUA 3ZKYA 3RZMA 1X33A 4QX7A 3AP5A 1FOD1 4K1ZA 1Q8OA 3KGZA 2CV6A 2W9XA 4XBLA 3SNMA 4LBOA 4PBOA 5FZFA 5EJ1B 1AR82 2GNBA 4CEYC 1W0PA 4FFHA 3C2UA 2YG0A 4AL9A 2FCTA 2DVAA 4FFGA 1AR63 4IV1A 4GULA 4BQ5A 3H9AA 1MACA 4HONA 3WR0A 2UY9A 5EYXA 5FUPA 4ASMB 5FPXA 1UO9A 2JEMA 1X9TA 4LBLA 1PIV2 2NQYA 3MW4A 3SKJE 1G9CA 5FZLA 5SV8A 4NE9A 4O61A 4CVUA 2Y64A 4JZRA 1JZ2A 3AKPA 2O0OA 2A71A 3OJBA 5FZ9A 1R093 1GNZA 5FY8A 3ZMNA 4H2AA 4N53B 1W06A 4QGNA 4QPGC 1A8DA 1C8M2 1ENRA 1DU3D 4QXHA 3BODA 4K1YA 4HXCA 3K51A 1NA1A 4XC9A 3ZXJA 3VBRC 5A33B 2DBIA 1ONAA 4DMIA 1CZVA 1UY4A 3B3QE 2VUDA 3H3ZA 4PHZA 1AHSA 2BZDA 1SFNA 1OQDA 1PX3A 3DCQA 1EAH2 3ZR6A 3WP5A 3AVRA 5KBFA 3MV01 3MUY1 3JXSA 4GB31 4ZU4A 3SMHA 3TWIA 4FPYA 5IK8A 4ATEA 3S57A 2CHHA 4GH4C 1LESA 2YV8A 4ARXA 4MGZE 5JI7A 1NCQA 2VMGA 2ORZA 3VKLA 2Y0OA 2JJ6A 3ZPYA 1GV9A 1J1LA 1V0AA 5FY7A 3UNPA 3CBNA 2AZ5A 4JKKA 3MDPA 4BOWA 4XMIA 1W28A 2AR6A 2WT2A 3HN3A 1S0DA 5CKMA 2GALA 3NAPC 3O0XA 5CB7A 1W6QA 1D4M2 1DQ1A 3WDXA 4AFCA 2VMEA 1PMJX 3OD4A 4TLGA 4QGMA 4XFBA 2ZA9A 2QKDA 3JBG3 3KM5A 5TSWA 5IVBA 2EF6A 2JG9A 2FHRA 2XJQA 3JZVA 2WNVC 1U12A 4LLOA 1Q3EA 4Q4X1 2HLEA 1HN1A 1QXJA 3BPSA 3I2OA 4DXRA 3D0SA 2YUEA 3L9JT 1YFWA 1QQP3 3V0AA 2VMIA 5FY0A 5FYZA 1AXZA 1UMHA 3K3OA 1O5UA 4OUSA 2WFF3 1CIYA 3GZAA 1WLCA 3MZHA 4HVOA 1ZRRA 1JUIA 1ZZ8A 1VBC2 5LEKA 3RWNA 3R4DB 2VR4A 4KWJA 1VPHA 1ZRCA 5GZFA 3MBWA 3T2OA 2MPFA 4D0QA 4AVVA 3K77A 2UURA 1TEIA 4GQ7A 1YC61 3IZOA 1O91A 5LATA 1GWLA 1RVF3 2J1UA 5GZCA 2W2IA 4YNIA 2WNOA 5KHHA 4COVA 3GF6A 5AFBA 4QXBA 4XVHA 3EYPA 2EXKA 2E63A 4X8NA 3WG2A 5FYIA 3NV1A 4UFHA 1VLNA 5CFCC 3OSDA 3ETPA 4AQTA 1IS6A 1MZ6A 3AZZA 5I8SA 3WVJA 3KV5A 5JOYA 4FPOB 3GCXA 5GLZA 5FYUA 4QQHA 1RUD1 2VZ1A 4QD2A 1WW7A 4MVTA 1RJ8A 2CL2A 5DG2A 1OKQA 4DXSA 3PU3A 2KD7A 3MIEA 1X7NA 2VMDA 1Y43B 3LGRA 2CDOA 3D82A 3CMGA 4KWKA 2D6MA 4MGTA 2VMFA 3H3UA 1RGSA 4NWVA 4UXAA 4EROA 4Q0VA 1OKOA 4N53A 1OOPB 4LE4A 5FBJA 1RUH1 1ENSA 1R083 2PHDA 4WVZA 1JZ8A 3A0KA 4E4HA 4MSVA 2W94A 4XAAA 3BTXA 5G04L 2BGOA 5CIRA 2ZAHA 2W46A 4I2OA 2PTMA 1V6LA 1BQPA 2XBO2 3A21A 3ZFEC 1E5HA 4KNCA 3ZSEA 4UFLA 3TEYA 5HCFA 4AI8A 4I3PA 3N7KA 1XNAA 1PGL2 5ANNA 5LK7B 1QJY2 5FZAA 2QBXA 3AL6A 4CE8A 3TEWA 1KEXA 1UXZA 2RS31 3RMYA 5AVAA 1DGWX 3OTFA 2D93A 1ZBE1 2RS52 3L2HA 2ZMKA 1R64A 5A7WB 2D5HA 4CDXA 3Q8CA 2PLV2 4QXKA 5BNNC 4V2WA 5A6QA 3WDWA 1DDLA 3UT0A 4YLZA 3W20A 5FK7A 2Y34A 1T2XA 1CAVA 1HRI2 3SH4A 3S6PA 4CP0A 1RUG1 3VBHC 1CAUA 2XPJA 3E6DA 5FYBA 1L7QA 2IWGB 2XKPA 4OQ9A 5HCAA 3KF3A 5F9TA 5H9RA 1O7FA 2K9ZA 3N7MA 1K5MA 3PURA 2IXLA 4SLIA 4GMP3 3ECQA 3M3CA 4JGYC 1AL21 2GC3A 2MEV3 3M2MA 3WD5A 4AEMA 3NNGA 1QJU2 1N3QA 1S0CA 5IYYA 4CXXA 1V9U1 3ZXKA 1JYVA 1CPMA 2W52A 2IXIA 1W6NB 1CZTA 3AFGA 2R16A 1RMU3 4MGKE 2VMHA 1WMEA 3UV9A 4NR1A 2KR2A 4DPNA 3N9MA 4LBQA 2PHWA 4AEDA 1HRI1 2P37A 2G9FA 4CDUA 4K8FA 1J3QA 1QDOA 4IV3B 5DDJ3 2GU9A 2P6HA 4Y33A 2VGDA 2Q8DA 3AFKA 1QIQA 4RR3C 5ACA3 3BKZA 1CX1A 3QH6A 1ULCA 2YC4A 2FD8A 2QQMA 2GMPA 2GN7A 3FUOA 3GNEA 2YU1A 5K0UB 1Z7S1 4LBKA 4L11A 3J7HA 1PO12 5A3LA 4Y20B 4Q4V3 4ZONA 1C5HA 4BIOA 3WCRA 1QY4A 1LEDA 3VB9A 2CGOA 1O5LA 4PIZA 3X29B 4I0AA 1BMV1 5CVRA 2WS92 2BVBA 3POJA 4Q0UA 2ZGLA 2VMCA 3OOXA 3T1LA 4CYDA 2YDEA 2YBSA 3ZYGA 1QJX1 3PL0A 3VDAA 1BK1A 1D2SA 4XBQA 3UKVA 1YHFA 2XKOA 3O1UA 3H8OA 3NJZA 1ENXA 1DGLA 3W21A 2DURA 2OZJA 3FE5A 3U10A 1JOJA 2B5HA 5HPOA 5C70A 3FN9A 2NN8A 4DUWA 2GP3A 4FTEA 1SLBA 3PVBB 1HLCA 1RIRA 1W0NA 4YYOA 3O1VA 2PHTA 3RSJA 5FZ8A 2W1SA 2O14A 4B4RA 4LO6B 5C8CC 4MYEA 3S0MA 5JSPA 4BK5A 3POSA 1EP0A 4IE4A 5EYYA 3KT7A 2ARCA 2VOXA 1RINA 2HWE3 3A7QA 4QPWA 4BA6A 2VXJA 4FP3A 3OGVA 2WLQA 4NRPA 1NXD1 2D44A 4IV1C 4UYBA 1I5PA 2ZPXA 3VN4A 4DZGA 3ZXAC 4I02A 3H3LA 4CUAA 1DIWA 4AQ6A 4TLFA 4UT5A 5E16A 4FPJA 4LO7A 3T3YA 4KWLA 5T55A 2LS6A 1YQ6A 1TMF3 4H14A 2HWC1 4QMAA 3MYXA 3D0JA 3WNOA 1LOCA 2R32A 2WQZC 3OY8A 4LKSA 1YEWA 4FAGA 3ZR5A 2I2SA 4RYDA 3DV8A 1AR62 1F31A 1NA1C 3ABZA 3NJYA 1W6MB 2D3PA 4UI9L 2PYTA 4YW2A 5LRSA 4UF0A 2PFWA 4Y5Z0 1UYXA 2Y26A 2PQSA 2BWAA 2D43A 3I3BA 5FP8A 2DFBA 2D7FA 4CXWA 4BQ4A 1SQ4A 4FOQA 4A3XA 5BNPA 1R092 5J7MA 1OBNA 2A6ZA 4ONUA 2CGNA 2W3JA 1NCRA 1NCQC 4AFAA 1B09A 1W6NA 1HRV3 3VZNA 1AR81 4R4ZA 4AFBA 4RHV1 4QX0A 4Y1VA 4IEPA 4OHYA 1LOAA 1UY1A 3SCHA 3AMNA 3AC0A 1W2TA 3TAYA 5LA1A 1JH5A 2FDJA 3ZYIB 5CFDB 3EXUA 1NE4A 5FZ7A 4BQWA 1PIV1 1WGPA 2EVXA 3WOGA 2GZWA 2VNGA 4XUPA 4AE2A 4ZXKA 1QWRA 4YZ4A 2VOWA 2CU5A 1PK6A 2V5DA 4JAAA 4B4PA 5CISA 3VUOA 2C6SA 3CJIB 3FWEA 3O0WA 4PF5A 2NPIA 3N7LA 2GC2A 1C8M1 2EXIA 2JG9C 3PJYA 4LK6A 1MS9A 1UZZA 2E6VA 2VVDA 2DUOA 2WIIB 1YIFA 1AR93 4S2GA 4F7ZA 5I8TA 2JE9A 2YGMA 4F8AA 3VDDA 5FPVA 1F15A 4RFT0 2P4EA 5A3MA 3OBAA 1DBNA 1KD7A 2XHNA 4C0HA 3UJOA 4EN6B 3DL3A 2VW1A 1EAH1 4XQWA 5DZGA 5JIAA 4GAZA 4CDWC 1KS5A 1FV3A 3JBG2 3J7NA 5L19A 2PXJA 5FOJB 5C9AA 5GZDA 2IXHA 2RDQA 3DF0A 1QNYA 3LA3A 5JXJA 1OLME 1FV2A 2WAOA 5H9QA 4P9XA 5H9SA 4Q2FA 3N7JA 3W58A 4R4XA 1UYZA 4KU8A 1LHNA 1VBD3 2QZ3A 3HQXA 3IDEA 4AAPA 1ZZ9A 1QQP2 3KHBA 2JENA 5F1RA 4QQPA 1F35A 5F32A 3U0ZA 3LA7A 2WFF2 3I3EA 5EFUA 5FZMA 5FY1A 1D4M1 4BDVB 2A3YA 2ORXA 2A6VA 5A6XA 5IVFA 4NIDA 3B7MA 2JDHA 4BPZA 3ZYPA 2RJKA 3MGUA 5DZFA 2RE9A 1K45A 4M3CA 3THPA 5JMOA 3GBGA 4W50A 1RVF2 2XJRA 1OF3A 5I0TA 4W8JA 1UAIA 5GLUA 3TB0A 1X8EA 1SFPA 2E9QA 4IE5A 1H1MA 3VD5A 1LJ7A 3U4SA 2ZGMA 3CNAA 1UW8A 3LDKA 4YFWA 2ATFA 2ZX4A 5HXVA 3S30A 4EE2A 1UY0A 2WQ4A 3POYA 1VBC1 4K40A 1CN1A 4N53C 1OT5A 4KBBA 2DCYA 1JN2P 5C7GA 3HT1A 4P9LA 1FMD1 1HQLA 3SLIA 4UBGA 2PHRA 1E5SA 1W6MA 2EXJA 4LITA 5FMBA 4QQOA 4Y3OA 1W2OA 2GDFA 3VBFB 2ARBA 3KV9A 2QVSB 3TN93 3VKFC 2TEPA 1Y4WA 1QXRA 4XJ9A 3ZYRA 1K42A 1CD3G 3PVNA 2XJTA 1BEV3 1H6YA 2VZPA 1W9SA 3LWCA 5FR3A 1R082 5JMCA 1OXCA 2QQVA 4HLTA 3J26N 1XNTA 5KHKA 2A5ZA 4LT5A 2WKKA 4KQ7A 5FZCA 4CCDA 3VKMA 4JRLA 1S0BA 4CCEA 4HFSA 5ABJB 1JMUB 1AZDA 1DQ4A 4CDXC 3VBOB 4QX3A 1D0GA 5IVJA 1O8SA 3WSOA 3ZN6B 4E27A 1JYXA 1W05A 3B93A 4U2AA 1AJOA 4BMEA 4PDWB 3ZDSA 2Y6GA 3CJIA 2WL1A 3AZVA 4EWEA 3IDCB 2ZGRA 4PBPA 4Q4Y3 3KLSA 1PVC3 3UKNA 5DUWA 3W59A 1K5MC 1OC1A 4XBNA 2HJIA 2DUPA 1HXS2 4M4PA 2XBO1 4MXVA 1AYN3 5FO9B 2KM2A 1LEMA 5JUVA 3ZYHA 2V4VA 1UOBA 3IBMA 3RGBA 2JX9A 1AJKA 3WUDA 1US2A 2WO7A 2B4KA 4XFGA 3POIA 1PGL1 2Y6LA 3H8XA 2OT7A 2VBBA 5E1RA 1NXMA 1QJY1 1AXYA 3ORJA 3K48A 2XOMA 4R9CA 2Z4FA 5LZ6A 5CU1A 4E2QA 2AACA 2RS51 1W6OA 5DG1A 1A34A 2MEV2 5F39A 4BQ1A 2PLV1 5HI0A 3AYAA 4YVSB 3LDBA 5DUUA 4PCRA 3V65A 4CDUC 5BY5A 5FZ0A 2J1VA 3SKVA 5BPXA 2IFWA 3DPRB 2UYBA 2UWBA 3M7AA 3NV3A 4LHNA 4DO0A 3NWKA 2J1EA 4PI2A 4FPKA 4MGQA 5C4WB 1RMU2 1OPMA 2WZR3 4JC1A 1MS4A 2RDNA 2V72A 3GCWA 2JECA 5FLHA 2N7GA 3RYKA 4LTAA 5DDJ2 3N9PA 2NYYA 3EHKA 3THDA 1XNKA 5AFEA 5CKNA 5E6HA 5ACA2 1SG3A 2DU0A 2Y6HA 1LU2A 1QJU1 3BIWE 4LMFA 1VR3A 3H1WA 2HWF3 2FDKA 5T50A 3AJZA 1AXKA 2Q8CA 1UN1A 1H8VA 1MR5A 4N9IA 4NROA 2W92A 2RMU3 4YM0A 4BQXA 3BB6A 4IEUA 4AI3A 1HKDA 4DOUA 2EICA 1IPJA 4L97A 3HWJA 2B7YA 3T4HB 2ZJCA 3PDQA 4L2NA 3ZLIA 4BISA 2JIJA 4QKBA 4AWDA 1UF2C 3VBUB 1HX6A 1NUKA 2JICA 1J3RA 4XACA 1UKRA 5F2SA 3VLBB 3WCSA 5A70A 3TEZA 1D7PM 4AGRA 1CJPA 2AUYA 2JWPA 1VMFA 2JE8A 1A6CA 2PA7A 1AR73 4XQ4A 4LHSA 5KXDA 5F6LB 4IGOA 3GXUA 1OI6A 1ND3A 2WSVA 3WQBA 4AFDA 2QDRA 4XIOA 3S5QA 1JZ3A 3SCGA 2EA7A 2Q8OA 3T09A 4D7TA 4HPKA 2D5FA 1C28A 4RGKA 3ZXLA 4A3ZA 4OQ8A 2WS91 3DEMA 4BQ2A 4FSJA 2WYFA 3VBOA 1H1AA 1QF3A 3WW3A 2SBAA 2YFZA 1I9RA 4PDWA 3K2OA 4AVSA 3EMRA 1GMMA 1ULEA 3HT2A 3HVDA 4PLMA 2ARAA 3VBHA 1CGPA 3KVBA 3QBQA 3VD4A 3I59B 3H7YA 4XTPA 4I09A 4LOSA 1GOGA 1YI7A 1W6PB 3EO6A 4JVAA 5CYYA 2VTFA 4B3NA 1H8TA 3DXTA 3LB9A 5JR2A 4IEYA 1LECA 4K6BA 2GN3A 1HJFA 5FK8A 3W9AA 5A7QA 4M0HA 2V09A 1T6GC 1TMF2 1CZSA 1CJDA 1OMIA 1SBFA 2LUWA 5BNPC 4Q29A 2ZEWA 4OYUA 2XL7A 4Y26A 2H0VA 4UW5A 1NCRC 1NOVA 1OPOA 2WA4A 1KJRA 4FT8A 2BPA2 4NMIA 1H1IA 2XR4A 5I8YA 2LW8A 2R30A 4CP2A 1N1YA 2HBTA 1F5FA 3HPNA 1YQCA 3M1HA 1RC6A 4I0WB 2OZ6A 4DUXA 2JDMA 1PZ9A 4WVWA 2HKXA 1DZRA 4FOWA 4YW3A 3DPRA 2X8KA 2VD7A 4NJ4A 4CEWB 2JG8B 2BWCA 2ZBJA 5LB6A 1QOOA 1HRV2 1PK6C 5C4WA 3WV6A 1OH3A 2ZGNA 5K0UC 3QLQA 1UWWA 2J1SA 3P3PA 3RI9A 5A7SA 3HJRA 1AR61 4ZPIA 4YM2A 3GZEA 3P5BA 4AF9A 2R043 1RHI1 3KQ4B 2E7TA 3O0VA 4JDMA 4NPRA 4AYUA 1OVSA 2Z5WA 4GMP0 4COZA 2YU2A 5FO7B 5I0SA 5FRAA 3TOJA 2P34A 5A6ZA 4EZ4A 3OUIA 4JGZB 4LA2A 3SH3A 1GZCA 4NUBA 1R091 4QX5A 4HSJA 3SXWA 5C9AC 4FPLA 2Y8KA 1TQ5A 3IKWA 1LU1A 4P02B 3T1MA 1AR92 4C90A 3CL1A 5C3PA 2I07B 4LHKA 1PO23 4PT6A 4UBHA 3LA2A 4XUTA 2CWSA 1R1A3 5L9BA 1MQTB 2G1MA 3IB3A 4GALA 1MPXA 3GZUC 1KDKA 3WG1A 3GJBA 5AC93 2DV9A 2EAAA 2WUHA 3I2IA 4A7KA 4OLLA 2RR13 5IAXA 1LGNA 4ZHNA 3WQ1A 4CUBA 5C8CA 4RA0A 1YLLA 2ZMNA 3M4FA 1ST8A 4KU7A 2ET1A 2VTXA 1VBD2 2DVDA 5D2AA 4CDQA 2D3RA 2GH8A 2QQPA 4X8PA 3MI8A 2OIIA 3LSEA 1UOFA 5DAPA 1AX0A 2E31A 3PTRB 4YVWB 3U11A 4EN9B 1NAEA 4FPGA 1VBB3 4QX8A 1IG3A 4AHWA 4G9SB 4BQYA 3JBG1 4OZXA 1BBT3 2P3JA 5JZGB 4QX1A 3NV2A 1QGLA 1E5IA 1FT9A 4K7JA 4Y1YA 4AQ2A 4CU7A 1X50A 3I59A 5JAXA 1ASJ3 1QHDA 2WSUA 4Q8LA 3ZXEA 2IUWA 2I74A 1RXFA 3FBYA 1QQP1 1W6PA 4LQRA 4NPLA 1Y9MA 2BP6A 2WFF1 2ZHMA 5FLJA 1V6JA 4A6OA 5JPMB 1ZZ7A 2A3XA 2HWB2 1O8PA 4XURA 3ZM8A 1WKYA 4D7SA 2C1FA 3OUHA 5LA2A 5BNOB 3I49A 3U14A 1W04A 3CZJA 4OULA 2VL4A 1AYM3 4ASKA 2BNNA 1SLLA 1RVF1 3HNBM 3VHPA 4RGGA 1URXA 4NIGA 3T2TA 1JZ4A 3RWKX 3S7IA 3TN92 3O1MA 2WN3A 4AI9A 2OPWA 1IGOA 4Q0QA 4Z1VA 4CEWA 2DF7A 1W2UA 1AX2A 2DYCA 3K75B 4XFIA 1YI9A 3POEA 5FFOC 3RZHA 3FX3A 3CJIC 4A7ZA 1UYYA 1CWPA 3I97A 5KWRA 3EBRA 1XNCA 3CQOA 3VD3A 2UWCA 5F5QA 5L7OA 1POV0 1OA4A 2VZTA 1OUSA 1XXNA 4E4DX 4COWA 4HZFA 2OPKA 2ZS6B 4LJHA 1G9AA 4NIHA 3URFA 5JVVA 2SLIA 4QKFA 5FP7A 3KQRA 2HBUA 3OD0A 4JGZA 4BE3A 3Q8FA 5LY2A 4CDWA 4D6RA 3NRUA 2HYKA 1S0JA 4GJZA 4MXWB 5BV6A 4M3CF 3K3NA 4IERA 4RD7A 1R081 4RS5A 1UD1A 2W95A 2R0HA 3H1YA 3IAPA 4B1LA 4CSWA 3T2PA 2R49A 3LFMA 4AHZA 1PVC2 2PHFA 3O1PA 4R9BA 4EZHA 2P3YA 2A6YA 3E5QA 2C24A 2GNTA 1JYCA 1MQTA 3FZ3A 4NIAA 5IFTA 1AYN2 3WY6A 3DECA 5T5PA 2OUHA 5IUQA 2WT1A 1N1SA 2ZTNA 4JQRA 1XBFA 2DVGA 4E2SA 5FIXA 2JKBA 3H1MA 2PAEA 3MFAA 2XLGA 3WP6A 4MV2A 3KV6A 4YW4A 3UGGA 2MHFA 3RVHA 2YXSA 1LODA 4GB33 1DHKB 3O14A 5T5JA 5DZEA 5FWEA 3R6SA 1RUF3 4CU6A 2D6PA 3JD72 3LDRA 1UZYA 3MFCA 5IWFA 2YYOA 4KG0A 3D3AA 4FI9A 2VPVA 2PAMA 3FHIB 4AG4A 3VHRA 1U5XA 1JZ7A 3ITQA 2R063 3FLTA 1HXS1 1W9FA 3LEGA 4LIUA 3JB4C 2Y6JA 3M70A 4OHXA 2ZABA 3DKQA 2RS13 1JBCA 4AOCA 5J96B 2FDHA 1DFQA 3BVCA 2WZR2 4OI4A 3OBZA 4M01A 2WDBA 2XQRA 3VGIA 1G9FA 1WLTA 4AEJA 4BZ4A 1Q56A 2WA3A 3B9CA 4JDNA 5A33A 4GMP1 1GWKA 1X8MA 4O9GA 1AVBA 3T30A 2MEV1 3Q8AA 3NQHA 2WR9A 3DN7A 1DYKA 4IESA 5A1LA 2GC0A 1AF9A 2ZGUA 2HWF2 2R1BA 3AKTA 3ILNA 4Q4X3 5J09A 1O3RA 2F6BA 1APNA 4XF9A 4MGYE 2RMU2 2D40A 4IGQA 3N9LA 4U36A 3H8RA 1UIKA 3I2FA 5BNOA 3U4XA 5GM0A 3I2GA 1ND3C 1Z0HA 1RMU1 2VVFA 5FJKA 3RYPA 3PMEA 2GNMA 3J8F3 3LPFA 5FPZA 4COYA 4XHXA 4EWAA 1RUE2 2TNFA 2ZX2A 3KF5A 2JDYA 2ZCWA 4HOOA 2D3SA 1GYKA 1W3VA 5DDJ1 2YHJA 1S0IA 4IETA 5FXZA 1POQA 3WNPA 3WZ1A 4BIFA 4E8CA 5I93A 3VBOC 5ACA1 1O4YA 1AR72 5BXXA 3D4KA 1GWMA 2VECA 2B8MA 2WC2A 3V56A 3JUUA 1YQ2A 2A6XA 2X10A 3J7MA 4MGSA 4PDWC 3LF7A 4DNYA 4CU9A 1PVXA 2NM1A 1QH7A 3BI3A 3ALQA 1UZVA 2P1BA 2WLPA 2ZX3A 4ITCA 4BYYA 4A41A 3UGHA 3E1F1 2F4PA 4EJRA 2AYHA 3JU9A 1GANA 2YBKA 1S2EA 3PHMA 4NN0A 5DUVA 1DP0A 3EJKA 4GJYA 2VCMA 4MX3A 1SBEA 5FZ1A 4D7YA 2XH6A 1OD3A 2BDRA 4LNVA 4W65A 1H8TC 4Z07A 2CTVA 3KVAA 5FCCA 4CUGA 4DB5A 1ZM1A 2FDGA 1XPWA 3WP3A 4WM8B 3WUCA 5FYHA 4OFGA 4XABA 4K21A 4Y4RA 3HNYM 4BM8A 3ZYFA 1KGYA 3RS6A 3NV4A 3ACFA 4Y22B 1XU2A 1DYPA 1QH6A 3D8CA 1MS8A 4Y1ZA 1NYWA 4ISRA 3RQ0A 5M0TA 1SFYA 3B69A 1QEXA 4C1WA 5IATA 4W6XA 1RUH3 1IPSA 1Q8VA 1NG0A 2VZUA 2P6CA 2EAKA 5AVPA 3V0BB 4BU2A 3MIHA 2VM9A 2X05A 3R05A 4QWNA 2LTNA 2Y6KA 3DPRC 3H50A 3DGTA 3AZYA 4V1PA 4ZS3A 4PI0A 3U1XA 3IDBB 4GXLA 3RZKA 2QTWB 4Y4YA 3U37A 1RUNA 3AMQA 1VRH3 1W8WA 3MIFA 4JV4A 5C4WC 3WNKA 2W39A 4JKLA 4BXSV 1TNRA 4XTMA 2XWBB 5FYYA 2PQQA 3LIHA 4KGQA 1GU3A 4YZ3A 4LIVA 2W1UA 2VQTA 5GKAC 1CAWB 1TMF1 4LKEA 1JOBA 1F9KA 2XB6C 2Z69A 1CAXB 3GALA 1GQPA 3QH7A 1NX9A 1OOPA 4JTOA 2A73B 2HH9A 1BZWA 1POV1 1NY71 1FNYA 1UIJA 4K8RB 1NLRA 2R042 1LOFA 4HKWA 4WBBA 3DXUA 2J1AA 2CAVA 2FCUA 2WN2A 3MLJA 1GSLA 3PUIA 5EQUA 5LW9A 2Q1MA 4GWJA 4CCNA 5L36A 4XETA 2Z2SB 1EY2A 1PNGA 3BOWA 2VU9A 3RI8A 1UZ0A 1WD3A 5FQ0B 4IUGA 5F8PA 2L9LA 2R0FA 1C5IA 1VBA3 2JKXA 2VULA 3NSTA 1AL23 3VZKA 2CAUA 1GICA 1HB3A 4UW6A 1PO22 2BOIA 2Y0IA 1D0HA 1WCDJ 3A0NA 3LEIA 4LA3A 4YW6A 1JW6A 4QU1A 3FUQA 1R1A2 1QMJA 1V9U3 1WBFA 2B9UA 3OGRA 4TZDA 2OW4A 1OLMA 4CDQC 5A7WA 5FOBB 3OBTA 1IOAA 5AC92 4QT6A 3RJRA 3PLQA 3SEPA 4A7YA 5I91A 2RR12 5LK5A 4NIIA 5FZ6A 1IHMA 1P8JA 1SCSA 3ETQA 4BXFA 4DRVA 4HVRA 3T0AA 4LKFA 5JCTA 3AL5A 3CHXA 2G19A 4FTBA 5FZOB 1XYNA 4N43B 2J1RA 3I54A 2DUQA 1US3A 4QXCA 3UYJA 3ES4A 1VBB2 2RV9A 3GHMA 1RITA 2JDPA 5B4NA 1MS1A 3ES1A 3CO2A 4C91A 2XLFA 5K9YA 1BBT2 1UL9A 3HEIA 3AXEA 2WO2A 1OD5A 4Z2AA 3AYDA 3AKRA 4AR2A 4XHBA 2XVGA 1YFXA 3A23A 3E6BA 4W6WA 1ASJ2 1TME3 3C8XA 4Y22A 1VBD1 3MLKA 3B5LB 4GD4A 2ZKLA 2C5DA 2QE3A 4ET7A 2ERFA 4UFJA 4IE0A 3SH5A 3POFA 1FXZA 2PELA 4MHRA 3NNJA 3VBRB 3V0BA 4IV3A 3ACHA 4WV8A 3WINE 5IVCA 2ET7A 4CEWC 4QQLA 3S7EA 2VZVA 3R0RA 4R52A 4XJ8A 1B35B 3B9IA 3I3MA 5K0UA 1AYM2 5IJRA 4GH4B 2VAUA 4XUNA 1F5JA 2UY8A 4ES8A 5JI9A 4Y20A 2HWD3 3GZTB 5L7OC 1L7RA 2YMZA 3WF2A 5LBBA 4FBFA 2VO5A 2WJSA 3RJ2X 1NQJA 1X36A 2D6OX 4IEZA 4ZZ8A 3EQEA 2E26A 1I3HA 4R8HA 4JGZC 4XZUG 2HWB1 3TBDA 3VBSB 3JCIA 5FXXA 5EIYB 2V73A 2QQOA 2ZHNA 3SCFA 2FMDA 4RS5C 3QOPA 1XSQA 4XAEA 4YGDA 4DFSA 2IFRA 4RFRB 3H8UA 5FYSA 4S2FA 4QB6A 1GNYA 3BU7A 3NJVA 4AQSA 1IQDC 3BTZA 1D4VB 3FBMA 3TN91 3LKJA 4CP1A 4IXLA 1ULPA 5SV5A 1MQTC 3ACGA 5EP9A 5HCHA 5A3OA 5L9RA 1XE8A 1U0AA 1CIWA 3O1TA 1OLQA 4Z92B 4GWNA 2VVEA 1UNBA 1UX6A 5CG8A 2ZGOA 2JDZA 3HOBA 1UMIA 3KZ4C 3M3OA 3ILFA 1QDCA 1UPIA 1TNFA 1GOHA 4QDQA 5F3EA 2IVIB 4A45A 4CP9B 1OURA 2IVJA 4CUCA 1W8UA 1IS5A 1F4HA 1UCXA 2CY6A 5FV3A 4BLIA 1DGRN 3HQRA 1OF4A 3LFIA 3P1IA 5FZEA 4RHV3 4I0BA 4FQZA 5K7PA 4QB2A 2Q0AA 3E6CC 1H2LA 1RUF2 3WW1A 1VAKA 4N43A 3OCPA 4MADA 1PVC1 1W0OA 3GJAA 3BU0A 5J48A 1H2KA 3U07A 4CCMA 4NPMA 2R062 1GFF2 1AYN1 3HAGA 1LTEA 2GH2A 2VG9A 4QB1A 1SPPB 2RS12 2DCZA 2FDFA 3WF3A 3NW4A 3IDAA 1MS5A 3OGGA 3KHCA 4PQQA 1G8WA 3V64A 5LBFA 3BN6A 2DVBA 4JQTA 3B94A 3LOIA 5BNOC 1MVQA 3QD6A 1S2KA 2VOKA 3T08A 1NT0A 3JD71 1WWYA 1RXGA 2C9AA 3FC0A 4CU8A 4Q4X2 2ZGQA 2BU9A 3LOBA 1NLQA 1H4HA 1DGRA 2OXBA 5CFDA 2O1QA 2K46A 5JOXA 2YFUA 3I3QA 4V2VA 4XEZA 5DPNA 5LEJA 2P3KA 2VQAA 1RYYA 4IW3A 3Q8BA 5I0RA 2VZSA 1B35A 3AMPA 3VDBA 4HMZA 5FZGA 4XF3A 2WZR1 3J8F2 1A8MA 4XDOA 1N3PA 3FJSA 5GZEA 3WDVA 4NHKA 3I2KA 3C7GA 4HKOA 5LBEA 5C3QA 2X09A 4O9EA 1FNZA 4AFMA 2BW8A 5J37A 4FCAA 1ZA7A 4OCTA 1O3TA 1C57A 2C4XA 4XCAA 2BERA 1PHMA 3NNLA 1WA4A 4B1MA 2HWF1 4AXOA 5FTTC 1C4RA 3SQOA 3R4SA 4WZFA 4LBJA 1XNBA 1J58A 4DY5A 2PHLA 1CR7A 4QDSA 1UQXA 4LXLA 3SHRA 4KH9A 1GP6A 2XG3A 4FO9A 4HT1T 2RJ2A 4N9HA 1D2QA 1FAYA 2DBNA 5FPLA 4CPBD 2VZQA 1IKPA 1RUE1 2BEOA 2X29A 4OHWA 2Q1FA 4TWTA 3BIEA 1VAVA 2DDUA 2VUCA 2HEWF 3AVSA 4OHVA 5KXEA 4UFMA 4P9IA 2JDKA 2XLAA 1AR71 1FMD3 2D6NA 2BYVE 3OB8A 4N8MA 2CGPA 4JGYB 1FPN3 4C8DA 3I3DA 2B39A 2RM23 2XJSA 1I5ZA 2CYFA
chains in the Genus database with same CATH topology
4ZHNA 4QKBA 4NRPA 4IE6A 4QKNA 3O1TA 3T3YA 3S57A 2FDIA 2FDHA 4CXYA 5F8PA 3O1OA 4NRQA 4CXWA 3O1RA 2IUWA 3T4VA 3H8RA 4NPLA 3RZLA 3O1SA 4NIIA 4NRMA 3BU0A 4JHTA 4NPMA 4IDZA 3I2OA 4CXXA 3I49A 2FDFA 2FDJA 3KHCA 4NIGA 3BI3A 4IE7A 3O1MA 3BUCA 3BKZA 3BTYA 3RZHA 2FD8A 3H8XA 5DABA 3I3QA 4O7XA 4NJ4A 4IE0A 2FDGA 4ZS2A 4NIHA 4QKFA 3S5AA 4OCTA 3KHBA 3I3MA 3RZMA 4QKDA 3O1UA 4QHOA 3H8OA 3LFMA 3O1PA 3RZKA 4ZS3A 4MGTA 4NIDA 3RZGA 3O1VA 2FDKA 4MG2A 3BTXA 3BIEA 4O61A 4NROA 4IE5A 4RFRB 4IE4A 3RZJA 3T4HB 3BTZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZHN A;  4QKB A;  4NRP A;  4IE6 A;  4QKN A;  3O1T A;  3T3Y A;  3S57 A;  2FDI A;  2FDH A;  4CXY A;  5F8P A;  3O1O A;  4NRQ A;  4CXW A;  3O1R A;  2IUW A;  3T4V A;  3H8R A;  4NPL A;  3RZL A;  3O1S A;  4NII A;  4NRM A;  3BU0 A;  4JHT A;  4NPM A;  4IDZ A;  3I2O A;  4CXX A;  3I49 A;  2FDF A;  2FDJ A;  3KHC A;  4NIG A;  3BI3 A;  4IE7 A;  3O1M A;  3BUC A;  3BKZ A;  3BTY A;  3RZH A;  2FD8 A;  3H8X A;  5DAB A;  3I3Q A;  4O7X A;  4NJ4 A;  4IE0 A;  2FDG A;  4ZS2 A;  4NIH A;  4QKF A;  3S5A A;  4OCT A;  3KHB A;  3I3M A;  3RZM A;  4QKD A;  3O1U A;  4QHO A;  3H8O A;  3LFM A;  3O1P A;  3RZK A;  4ZS3 A;  4MGT A;  4NID A;  3RZG A;  3O1V A;  2FDK A;  4MG2 A;  3BTX A;  3BIE A;  4O61 A;  4NRO A;  4IE5 A;  4RFR B;  4IE4 A;  3RZJ A;  3T4H B;  3BTZ A; 
#chains in the Genus database with same CATH topology
 1RUO A;  1U5I A;  1ZBA 3;  3ZFG B;  5C6C A;  3T0D A;  3GYD A;  1NKG A;  3ZOI A;  3WF1 A;  4BLJ A;  5IK7 A;  4LO8 A;  1RUJ 3;  2ZX0 A;  2GMM A;  1JTZ X;  1EUT A;  4H7L A;  4HAN A;  5CEH A;  3MIC A;  4BWO A;  5EJ3 A;  5A32 B;  2PMW B;  1V6O A;  1WMD A;  2ZAC A;  4Q4W 3;  5ISL A;  4OI2 A;  1SDW A;  1ULO A;  3WNM A;  4Y1U A;  2GND A;  4CXY A;  4IQP A;  3ZYB A;  3U78 A;  1F4A A;  3HQU A;  4YW7 A;  3HN1 A;  4H7M A;  2WFP A;  3PTY A;  3K46 A;  1VRH 2;  3PUA A;  3GBW A;  5JPN B;  5J3U A;  5LY1 A;  1RUI 3;  1ODM A;  1YO8 A;  1LB2 A;  1OOP C;  4Q4V 2;  4LOR A;  5EZW A;  3CKH A;  3F2Z A;  3OPT A;  3KV4 A;  4TXW A;  1W9Y A;  2X53 S;  1LOF C;  1VBE 3;  3OPW A;  5KR7 A;  4LKD A;  2FCV A;  4PF1 A;  4QM8 A;  2QQW A;  4LLF A;  3VBF A;  3IM0 A;  1EV1 3;  5F7U A;  5F3I A;  1FI2 A;  1JU4 A;  4HBN A;  3PVE A;  2VBD A;  3WEZ A;  2BGP A;  4O65 A;  2A7A A;  4NRM A;  4XJU A;  5C71 A;  2A70 A;  3PUQ A;  1V6N A;  3PUS A;  4XIK A;  1BJQ A;  4LUM A;  2E33 A;  4Y24 A;  1PO1 1;  2VCB A;  4A42 A;  2BNM A;  2WT0 A;  1KRI A;  4KGG A;  3VZO A;  3C7F A;  5CBL A;  5EHD A;  1IKQ A;  3ZFF B;  5ABJ A;  4YSF A;  3I2D A;  4S2H A;  4QPY A;  1QU0 A;  1JOD A;  2AEY A;  3ZN6 A;  3AP4 A;  4NHX A;  5GLW A;  1VBA 2;  5CNA A;  3N9Q A;  3MUZ 1;  1JZ5 A;  1AL2 2;  5DAQ A;  2WAB A;  5F5A A;  4ZKT B;  1VIW B;  5C5U A;  4HSL A;  3IIA A;  4F83 A;  2O8Q A;  5F3C A;  2RJL A;  2HWE 2;  1T6B X;  2R04 1;  4UFI A;  3HNM A;  5KC5 A;  5APA A;  2ZGK A;  1EPZ A;  3C3V A;  3VD9 A;  4OMC A;  2YC0 A;  4ZXE A;  4XZP A;  1HQN A;  1OFN A;  3AMH A;  1J1T A;  4MGI E;  5CG9 A;  1M4W A;  2BFU L;  3OEB A;  5DUX A;  3N9N A;  2WZE A;  4YRD A;  3B01 A;  3S5A A;  5EJZ B;  5IK4 A;  3J4U H;  4IEX A;  4QHB A;  5KXB A;  3DYP A;  3RPQ A;  3MPB A;  2WNE A;  4LE3 A;  3UGF A;  5A1F A;  1H4G A;  1COV 3;  1PO2 1;  4E2G A;  1GUI A;  2DCT A;  2E32 A;  2XUM A;  4UW3 A;  1RUC 3;  1XE7 A;  4PIX A;  3JB8 A;  1PMI A;  4ASL A;  4CZS A;  3ELN A;  1TG7 A;  4FPF A;  1ULF A;  4LPL A;  3U75 A;  5IVV A;  4YVS A;  5F3G A;  1C3H A;  1Q8Q A;  3LEK A;  4ZU7 A;  2QJV A;  2RR1 1;  3FL7 A;  4IV3 C;  1KFX L;  3OUJ A;  1GQH A;  4JCK A;  4CRQ A;  3RZG A;  2J1T A;  3OGS A;  1YFU A;  1S2B A;  2VQ0 A;  4GKY A;  1WCS A;  1TME 2;  3ZFG A;  1UU4 A;  4AVC A;  1N47 A;  1I6X A;  5D8A B;  1WW5 A;  3NL1 A;  1XOY A;  2Q8E A;  2OX0 A;  4HL0 A;  4CCL A;  4Q27 A;  5HV4 A;  1NCQ B;  1U5Z A;  1SBD A;  5HV0 A;  5JLV A;  3RZJ A;  2FMY A;  2PAK A;  5JOW A;  5LAS A;  2VJX A;  3MHZ A;  2OKX A;  1VBB 1;  3M3I A;  1PGS A;  4DQA A;  4IE6 A;  4ES9 A;  4PJY A;  2H6C A;  4WVV A;  3SEE A;  1JYW A;  1BBT 1;  3JQX A;  3H7J A;  4QKN A;  3ME2 A;  1MEC 3;  3ZPO A;  4AK3 A;  1IQA A;  2WS9 3;  4WM7 B;  3UKT A;  1ASJ 1;  2QQL A;  2WRA A;  2HWD 2;  4JDO A;  2GSY A;  3VZM A;  2Q1Z B;  4JX0 A;  2JDA A;  3NNF A;  2JG9 B;  2NMN A;  3GM8 A;  1JI6 A;  1ND2 B;  3KCX A;  4A44 A;  2I45 A;  3VBU A;  4OHZ A;  5CKQ A;  2ID4 A;  3OGJ A;  3DYM A;  4AVA A;  4AI2 A;  1XSR A;  4M00 A;  4XPV A;  4M4R A;  3VZL A;  3WLU A;  3V0A B;  2BBA A;  3OBR A;  1F2N A;  1AYM 1;  4IEV A;  4DY3 A;  1J83 A;  1TVG A;  3K4A A;  2XUE A;  1VMJ A;  3WQ0 A;  3QAC A;  1V00 A;  3ZFF A;  2EAL A;  1FYU A;  1GZW B;  5D21 A;  5F2W A;  1LKN A;  1O4T A;  2VBP A;  1EUU A;  2VZ3 A;  2PN5 A;  5F37 A;  1ZA4 A;  1S4C A;  5BNQ A;  4X6R B;  2QNK A;  2W1Q A;  1REF A;  4XFA A;  1DZT A;  1NQD A;  5JWP A;  5CA6 A;  4AGV A;  2XVK A;  4IE7 A;  5JDB A;  4YFZ A;  4LBM A;  2ZX1 A;  4N43 C;  4PIY A;  2NMO A;  3WDT A;  2YGL A;  3BUC A;  5B4X A;  2VH9 A;  4NWW A;  2O8O A;  4TSV A;  1G7Y A;  4IND A;  4PLO A;  4RHV 2;  2KA3 A;  5C33 A;  3K4Z A;  3BPZ A;  5T5L A;  2AGS A;  4LHL A;  2A75 A;  2W91 A;  3ZIW A;  1QXP A;  4FPH A;  1RHI 3;  3CDZ B;  4K9S A;  4XOG A;  1H6X A;  3GDB A;  1ODN A;  3OF1 A;  4HK8 A;  4ARY A;  3VKO A;  2RDS A;  1ACC A;  1S0F A;  4LBQ D;  4LR4 A;  5A3P A;  2XJU A;  1DYO A;  4LUK A;  3ZN5 A;  2BJS A;  2JD9 A;  4RQP B;  2P2K A;  4HVQ A;  1M06 G;  3B02 A;  3AYE A;  4QQ2 A;  2G9G A;  2VQU A;  2FBE A;  4D8M A;  5CZK A;  4NHY A;  4P5H A;  4L99 A;  5CFD C;  2R07 3;  2NZ9 A;  1BEV 2;  2JG8 A;  4ISQ A;  1WLD A;  1X82 A;  3M8L A;  1AX1 A;  4EN7 B;  2EIG A;  5LA0 A;  1B35 C;  1GLH A;  4AHY A;  1RUF 1;  2DFC A;  2Q30 A;  4K3U A;  3ZX7 A;  2VZR A;  5D8A A;  4YG3 A;  4B7K A;  1H0B A;  1FAT A;  5LCW L;  2MNG A;  4CA9 A;  3POB A;  2QQK A;  1GR3 A;  4XW3 A;  5FLI A;  1HJG A;  3ZO0 B;  4Z8B A;  4B8E A;  1QOT A;  1TZO A;  2R06 1;  3PIJ A;  2DCJ A;  3TNP B;  3CLP A;  1FOD 3;  1SZB A;  4MLO A;  4EQV A;  2RS1 1;  3I2H A;  5IFP A;  4JRA A;  5A80 A;  5FZ3 A;  3VBS C;  5FZB A;  4CDX B;  2VCA A;  4HN0 A;  3IN9 A;  4WM7 A;  3MW2 A;  3RFR A;  1FX5 A;  3WQ7 A;  5A3U A;  2ZGT A;  5T5O A;  2IC1 A;  4BB3 A;  4XIL A;  4LO5 B;  4Q4Y 2;  1KJL A;  1CAV B;  2XON A;  2BVV A;  4AAX A;  1LHW A;  1AUY A;  4LUL A;  1ND2 A;  1CAU B;  1VJ2 A;  3EB7 A;  1SCR A;  3FLR A;  3GGL A;  3MF9 A;  1NZI A;  4KG8 A;  2F17 A;  3KS7 A;  5KHJ A;  1LAJ A;  3RYR A;  2ENR A;  1K5J A;  3ZN4 A;  3D6E A;  3Q8E A;  1K5M B;  1ZX5 A;  3KCC A;  4QGL A;  2VNR A;  4A6S A;  1OH4 A;  4P14 A;  1C1F A;  1LR5 A;  1G9B A;  2X5I B;  2VY0 A;  5E8A A;  1F8V A;  4Q0S A;  1RTV A;  4E8D A;  2AH2 A;  2Y33 A;  2R6Q A;  3J8F 1;  1UKG A;  2XGX A;  4XDP A;  3AZW A;  1W2N A;  1LHO A;  3K4D A;  3OPZ A;  2ZXQ A;  5JOZ A;  4BHP A;  2W5F A;  1NLS A;  3KGL A;  3PU8 A;  3MID A;  2E7Q A;  5FYC A;  2ZML A;  3OYW B;  2BV4 A;  1GZW A;  4J25 A;  4QDR A;  4OI1 A;  4YVW A;  1JYI A;  1YWK A;  2GP5 A;  1FMD 2;  2DVF A;  4DIQ A;  3TRS B;  4J6G A;  1DZQ A;  1MVE A;  4MUV A;  1FPN 2;  3ACI A;  2QQI A;  4IGP A;  1W9T A;  2RM2 2;  4LBQ B;  3GBF A;  3LSD A;  4MO3 M;  3NNM A;  4AED B;  4CDU B;  2RVA A;  1ZBA 2;  5JZG A;  4GKX A;  1BHG A;  1WW4 A;  3VHO A;  1RUJ 2;  1WMX A;  3NKT A;  3MV1 1;  4J1X A;  4I3G A;  2D98 A;  2BOJ A;  3HD8 B;  2W1W A;  1S0G A;  3AP7 A;  4Q4W 2;  1ULD A;  1Y3T A;  4H3W A;  1VRB A;  4B29 A;  2DU1 A;  2YY1 A;  2WIN B;  4UW4 A;  1YUD A;  3VBF C;  5K8S A;  3ATG A;  5BUV A;  2Q5T A;  3AKQ A;  4DIN B;  1O4Z A;  2QQJ A;  2VOV A;  3ST7 A;  1RUI 2;  1VMH A;  2KXL A;  4YZ1 A;  3ROU A;  3UJQ A;  5DXD A;  1SHW B;  4B4Q A;  5A1A A;  1VBE 2;  3N3H A;  4IEW A;  4RQP A;  3OEA A;  4CCC A;  5DAW A;  2H6B A;  1EV1 2;  2QCS B;  1PMH X;  4YPJ A;  2ZAA A;  2UYA A;  3A4U A;  2QQU A;  3C7O A;  2PHX A;  3KWV A;  3POW A;  2DTY A;  3LIG A;  5ABJ C;  1KDM A;  1IS3 A;  4ORF A;  4I01 A;  3T0B A;  5FYM A;  4DXT A;  5IK5 A;  4HK9 A;  2PHU A;  1EPW A;  3E5X A;  3W5N A;  4YGB A;  1ZRI A;  2QDN A;  4WZC A;  4YG0 A;  4BH9 A;  1VP6 A;  4FXG B;  1VRH 1;  3PVO A;  2D97 A;  3ZDV A;  1ALY A;  4Q4V 1;  2CWM A;  5EXO A;  1S55 A;  1CPN A;  1LOG A;  3CJX A;  3MIG A;  4HG6 B;  4XFH A;  4DS0 A;  3M3Q A;  3WG3 A;  2HEV F;  3F95 A;  1X9P A;  4QX2 A;  2FZ1 A;  4Z2W A;  3CZU A;  1G6N A;  2XXZ A;  1UPS A;  1UY3 A;  4FQ4 A;  4AZZ A;  4C1X A;  5C8W A;  1OVP A;  1J3P A;  1JHN A;  1RUD 3;  1KXG A;  4MXW A;  4Q5O A;  2E53 A;  2LRP A;  4JTN A;  4L9B A;  3ILR A;  5CAD A;  4OMD A;  1HXS 3;  4KBZ A;  4RSU A;  1W9W A;  2VE1 A;  3OG2 A;  4E9K A;  1OUX A;  1N1T A;  4OI0 A;  3UET A;  1UMZ A;  1PGW 2;  1WD4 A;  3OY8 B;  4Q26 A;  4W4Z A;  1Q43 A;  1BXH A;  1BKZ A;  4QM9 A;  4Y5T A;  5EPA A;  5C5T A;  3I2J A;  4YVS C;  1J59 A;  3PMS A;  4H55 A;  1JXN A;  3AYC A;  3LE0 A;  1VBA 1;  4UF0 B;  2BNO A;  1YRZ A;  2X5I A;  5E88 A;  1VE0 A;  1COV 2;  3W5M A;  4N90 A;  5FYV A;  4DRR A;  3ZFG C;  2ZOE B;  1W2A X;  1RUC 2;  2VNV A;  5BNP B;  1UU5 A;  4P5Y A;  1BYH A;  2HWE 1;  2XJV A;  4HN1 A;  2YB7 A;  2VZO A;  2BQP A;  4ZY9 A;  3WNL A;  2J42 A;  3OYW A;  5JR7 B;  1NCR B;  3FMG A;  2JB4 A;  3WHU A;  1Y7B A;  1NE6 A;  1YIP A;  3KT1 A;  3ZXF A;  3WW2 A;  3ZXD A;  2RS3 3;  1O59 A;  1OQE A;  1S0E A;  4W6Y A;  4XMA A;  4AEK A;  2IXK A;  3BGA A;  1ZBE 3;  4MOA A;  4NRQ A;  4YM3 A;  1SLA A;  4RL7 A;  1LHV A;  1VAM A;  1ZYB A;  3USU B;  4E4Z A;  5DMY A;  1W8T A;  1XJA A;  2CNA A;  1GP4 A;  4RGA A;  1PM4 A;  5I0U A;  4TTG A;  1PK6 B;  4YWA A;  1GZ9 A;  1HV1 A;  3CU7 A;  1TE1 B;  1N1V A;  4JHT A;  1RUG 3;  2YBP A;  2ZGS A;  1DCS A;  4G4F A;  3O7O A;  4GA9 A;  1MEC 2;  4XF4 A;  3VBU C;  3VDD B;  3ZKU A;  5HCB A;  1E57 A;  2WNU B;  5FPA A;  4I30 A;  2D6L X;  2ZHK A;  3ENR A;  1WA6 X;  1J84 A;  2DTW A;  1W99 A;  3CIH A;  1L7L A;  4XFC A;  1TME 1;  1UU6 A;  4P08 A;  1K3I A;  1HRV 1;  4QPI B;  4XQD A;  3FFZ A;  1WCQ A;  5C9A B;  5I0D A;  2E7A A;  2OQ6 A;  2B46 X;  3T2Q A;  4G3Y C;  2AEN A;  1UY2 A;  3WF0 A;  3ZFF C;  4F3J A;  4K20 A;  1SAC A;  4XYX A;  4JHZ A;  4XJW A;  4KI5 M;  4KL1 A;  4NAO A;  1MS0 A;  4XUQ A;  4AGG A;  1QJF A;  1STM A;  2CDP A;  2LM3 A;  3NVC A;  4O7X A;  5FBZ A;  4NHL A;  5FUI A;  1YJK A;  3VV1 A;  2IXC A;  2V4A A;  2OA2 A;  5JSR A;  1KS4 A;  2HWD 1;  5FZ4 A;  3IT8 A;  1ENQ A;  4N7I A;  1AR9 1;  3MO4 A;  3WP4 A;  4DXZ A;  2VCC A;  1ZZB A;  1Y9Q A;  4KMQ A;  1KQR A;  5T52 A;  4FTS A;  1UXX X;  4XJZ A;  3BCW A;  4P00 B;  4PLN A;  4LBN A;  5GZG A;  1YCI A;  4XF1 A;  2V5Y A;  1UOG A;  2XHK A;  4CEY B;  2BBV A;  1Z7S 3;  2W68 A;  4M3C B;  2JE7 A;  4QHO A;  3ZSK A;  4HET A;  1A3K A;  1ZRD A;  4KWU A;  2A6W A;  4WM8 A;  1V6I A;  3APB A;  1ZRE A;  5HXM A;  5A3N A;  4EV0 A;  1SLC A;  4GIQ A;  2R7E B;  4XXA A;  4YG6 A;  5DQ0 A;  3SIS A;  4LEJ A;  1QJX 3;  1IPK A;  4P9J A;  3VL8 A;  1W39 A;  4AHX A;  5KXC A;  5KC6 A;  1YJL A;  4QPG B;  5FAX A;  1LUL A;  1YYN A;  2VOT A;  2ZGP A;  4YM1 A;  3VZJ A;  4MZU A;  4MG2 A;  2HEY F;  1POV 3;  2C0Z A;  3AMM A;  5FZI A;  3CEW A;  1RHI 2;  3WW4 A;  2Q4S A;  2VXR A;  2QFE A;  2W0X A;  1REE A;  2J7M A;  3KSC A;  5CAZ A;  3WNN A;  2NP0 A;  2JG8 C;  4GWM A;  5D1I A;  5FDB A;  1AL0 G;  1GKB A;  2JDU A;  3LZZ A;  1XQN A;  2JD4 A;  4BMB A;  1W8N A;  5IW0 A;  5D8A C;  1XE0 A;  3ACL A;  3PNA A;  1OQ1 A;  5DN2 A;  3ZVX A;  1ZZC A;  3R4U A;  5FKC A;  4FVV A;  1H2M A;  2R1D A;  2R07 2;  4DUV A;  4FOY A;  5A7N A;  2FQP A;  5KHG A;  1CAW A;  5L73 A;  4D3W A;  4X6Q B;  2P17 A;  3USU A;  1V70 A;  1CAX A;  1S1A A;  4D6S A;  1DGW A;  3NAP B;  4JKM A;  2OUJ A;  3E5U A;  4WM7 C;  3SC7 X;  3RZZ A;  1LRH A;  3LQC A;  1QJZ A;  1Z78 A;  1FOD 2;  2WAA A;  2WNV B;  5FXW A;  1ND2 C;  3AB0 A;  4Q0P A;  3KCY A;  2HWC 3;  2JDN A;  4L8Q A;  1GZT A;  4Z82 A;  5FMD A;  1LGB A;  4BK4 A;  3ZIX A;  3KT4 A;  4D94 A;  3LEM A;  4CCO A;  5DAV A;  2WNU A;  1IS4 A;  4R9A A;  1CES A;  1BEV 1;  1XND A;  5FQ0 A;  1U5Y A;  3INA A;  4OZO A;  5K4L A;  2P3I A;  1WCU A;  3UK9 A;  3AXD A;  4AVB A;  5C3R A;  4ATF A;  2BRT A;  4QPI A;  2EXH A;  2B9V A;  4IDZ A;  1GP5 A;  4E4S A;  3FHA A;  1XYO A;  3ZSJ A;  3HIF A;  1OLR A;  1DLC A;  2WZ8 A;  2Z42 A;  1JS9 A;  3AX4 A;  3TEX A;  1WMF A;  2A1X A;  2ZEX A;  3BOP A;  3VHN A;  2EIB A;  3III A;  3NO8 A;  5IT6 A;  5FKB A;  4YAR A;  1WLW A;  2JIG A;  1SLT A;  2Y38 A;  1QOS A;  1PX4 A;  1H9W A;  3IMM A;  4YVW C;  1N3O A;  1KIT A;  3ZSL A;  5A6Y A;  1AR8 3;  2D6K A;  5FY5 A;  1PZ7 A;  1W6O B;  5FZK A;  3UL2 A;  4BQ3 A;  1VB4 A;  2OQ7 A;  3E97 A;  2H0B A;  1QNW A;  4S2D A;  2YZ4 A;  5FO8 B;  1WCK A;  1L3J A;  2WYS A;  1QJE A;  4XJA A;  4DEQ A;  3MW3 A;  4XXP A;  1W8H A;  5C3S A;  1RED A;  4GB3 2;  1Q8S A;  5JZG C;  5FZO A;  2WWJ A;  3N4M A;  1PIV 3;  3NJX A;  4Q4Y 1;  1HDK A;  4EN8 B;  5CFC B;  2DWR A;  1XB9 A;  3N9O A;  2DCK A;  3J7L A;  3DYO A;  5GAL A;  5LA9 A;  3VDC A;  5L9V A;  5JXG A;  4CEY A;  1O3Q A;  4OUE A;  4EWD A;  1C8M 3;  3IAQ A;  2RDR A;  2W08 A;  5EV7 A;  3AP6 A;  5JIU A;  1W90 A;  2UWA A;  3WXP A;  1PNF A;  3HMY A;  4A2U A;  1UX7 A;  3NMB A;  1HQW A;  1WBL A;  1EAH 3;  2YRO A;  1LNS A;  2XVL A;  1OFS A;  1SLI A;  4R9D A;  2XL9 A;  2OS2 A;  5FP3 A;  2HWB 3;  3FFQ A;  3M3E A;  1E5R A;  4XFF A;  1RB8 G;  3IPV B;  3TNQ A;  5J1X A;  4J1W A;  4QPG A;  3B00 A;  4RQP C;  3MPP G;  1OA3 A;  3IWZ A;  2EID A;  3JQW A;  3VBR A;  1W03 A;  2W47 A;  1FPN 1;  1WUV A;  1R1Z A;  2RM2 1;  2YPD A;  3LD8 A;  1GOF A;  1OSG A;  2GC1 A;  4PQ9 A;  1ZBA 1;  3AZX A;  4Y5S A;  3ZFE B;  1O6U A;  2B45 X;  4FPC A;  3WF4 A;  2JB8 A;  1W8Z A;  4TN7 A;  1RUJ 1;  4GH4 A;  4FFI A;  4GZ9 A;  1D4M 3;  4IEO A;  2Z79 A;  3MF6 A;  1ND3 B;  3LAG A;  3ON7 A;  4Q4W 1;  5IAV A;  1YNA A;  2ARE A;  3I4I A;  1JHJ A;  1LOB A;  4L92 A;  1HIX A;  4SBV A;  5F5I A;  3UES A;  4HPK B;  1ZZ6 A;  2A3W A;  3BYW A;  5LRR A;  3SIT A;  5DAX A;  3MIB A;  4A4A A;  4NO4 A;  3L2Y A;  3VBS A;  5BNN B;  2RMU 1;  1RUI 1;  3NAP A;  1YFY A;  1MZF A;  2B42 B;  1XYP A;  4AW7 A;  1MZE A;  1PZ8 A;  3ZMO A;  1MZ5 A;  1ZRF A;  2W87 A;  1HB1 A;  3H42 B;  3LCP A;  1VBE 1;  5E89 A;  5FMO S;  3WT3 A;  4HKL A;  2IZW A;  1DQ2 A;  2BUK A;  5FJH A;  3VBH B;  2BFU S;  2F4L A;  2VUA A;  2WNV A;  1EV1 1;  1GQG A;  1VBC 3;  4OUM A;  2ZZJ A;  3FHQ A;  4UFK A;  1NZC A;  4ZZ5 A;  5A7O A;  1IZ3 A;  2ZHL A;  4OVE A;  3CF6 E;  3A22 A;  2ARX A;  1RUD 2;  4Q1R A;  4N7U A;  5JSO A;  1H8T B;  2ZEZ A;  2X5I C;  4YZ5 A;  2ZKN A;  1BCX A;  4FP2 A;  1DG6 A;  1GNH A;  2VUJ A;  1IG0 A;  1W3X A;  3Q9O A;  1JZ6 A;  3BTA A;  3RZL A;  1V6K A;  3QCW A;  4M3C E;  2NLR A;  1ZVF A;  2IXJ A;  3O1S A;  1Q5O A;  1JOP A;  4Q1P A;  1VAL A;  1RJ7 A;  1RUH 2;  4EYU A;  1BLZ A;  3DUI A;  4CP9 A;  5GLT A;  4XF0 A;  3RDI A;  4XE9 A;  5F5C A;  5H9P A;  2UU8 A;  1UZW A;  4RN5 A;  3JD7 3;  5IVE A;  2OVU A;  5J36 A;  3WX5 A;  3AK0 A;  1BVP 1;  4AED C;  5IHR A;  5F6K A;  3VL9 A;  4C0B A;  1G9D A;  4RR3 B;  3USS A;  2Y6F A;  2TUN A;  1LHU A;  2WBK A;  5FZD A;  2G4I A;  3ZYJ B;  1BVV A;  5CFC A;  1GBG A;  2K2S A;  4ZU5 A;  4P9W A;  1JU3 A;  1SEF A;  1Y9G A;  5FZH A;  1UOJ A;  4AI1 A;  1H2N A;  1PGW 1;  1I1E A;  3P3N A;  3WNX A;  1QKQ A;  2RS3 2;  3KD4 A;  2WZP P;  1SPP A;  3O5S A;  3BTY A;  1DF0 A;  1ZBE 2;  3I7D A;  3PJQ A;  4UAP A;  2LAL A;  1EYB A;  4Y1X A;  5DAB A;  2FZ2 A;  5HBA A;  3AM2 A;  3PIG A;  4YW5 A;  3C7H A;  1COV 1;  4FXK B;  4CCK A;  1A78 A;  1XC6 A;  2ILM A;  4WVM B;  3PUH A;  5BYN A;  4TYS A;  1RUC 1;  1V6M A;  2XBO 3;  2E51 A;  3H0O A;  3P6B A;  5FWJ A;  4YGC A;  2BTV C;  3HR9 A;  3IPV A;  2VW0 A;  1RUG 2;  1DQ5 A;  2G9Z A;  4XCB A;  3LPG A;  4P9Y A;  3WDY A;  5FP4 A;  4QU2 A;  3THT A;  1CX4 A;  1HW5 A;  4FOV A;  1QJY 3;  1DQ0 A;  5A3W A;  2WQ8 A;  2QQN A;  2QUO A;  4FAH A;  4QKD A;  1RUE 3;  4URA A;  5KHI A;  5ANQ A;  2RS5 3;  2K0G A;  4NHM A;  4LK7 A;  4YW1 A;  3ZFE A;  1HN0 A;  1H9P A;  5LBC A;  2PLV 3;  1Q8P A;  2ADD A;  3IMN A;  4AVT A;  4NOT A;  1V9U 2;  3N36 A;  3N35 A;  1LOE A;  4MET A;  5C8C B;  3AKS A;  1HRI 3;  1CQ9 A;  1UYP A;  5GLV A;  2OYZ A;  4FPE A;  5FMO L;  3WG4 A;  5T3N A;  3NKG A;  2XJP A;  4D6Q A;  4D69 A;  1MEC 1;  4CDQ B;  4XUO A;  3WDU A;  1OA2 A;  1YQ8 A;  3KB5 A;  2P5B A;  2BGC A;  2VC9 A;  4IV1 B;  3RG0 A;  4QHZ A;  2YC2 A;  2XML A;  5BNN A;  2VW2 A;  1HB2 A;  1SMV A;  4WM8 C;  1ULG A;  4P9G A;  2ETE A;  4LO4 B;  5FRE A;  5EWS A;  3POG A;  1KFU L;  1QJU 3;  1WZX A;  4BJ0 A;  1W8F A;  2EIE A;  3AP9 A;  2YPJ A;  5IVY A;  1O3S A;  2WWU A;  1R1A 1;  3I8T A;  1Z7S 2;  2ZZQ A;  4IL7 A;  3VD7 A;  3MLL A;  5A7P A;  3HBK A;  5C3O A;  3BAL A;  2AEZ A;  2JXA A;  3GHN A;  5AC9 1;  1H30 A;  4CCJ A;  4CTE A;  2FDI A;  1NA1 B;  1BMV 2;  5B2G B;  2VTX J;  4QAW A;  2WWS A;  4JGY A;  3DKW A;  1C1L A;  1LEN A;  2RHP A;  3O12 A;  2ADE A;  2C9K A;  1LGC A;  1RL3 A;  2WO1 A;  3G6J B;  4GWI A;  4URT A;  4AI0 A;  5A3T A;  1QJX 2;  3WHT A;  1SDD B;  1JUH A;  4EN0 A;  3O1O A;  2XQX A;  1JYN A;  1CVN A;  2CSG A;  4UWD A;  1YXW A;  1NY7 2;  1DLL A;  2LRO A;  4MHU A;  5FUN A;  3VKN A;  5A32 A;  4UOJ A;  2QZ2 A;  5FPB A;  2GME A;  3T4V A;  3G7D A;  1PO1 3;  3KMH A;  5FP9 A;  4YGE A;  5J98 B;  4FFF A;  1XRU A;  3TYJ A;  4Q8K A;  3RRD A;  5JXH A;  1YQ5 A;  4RR3 A;  3HBZ A;  1XU1 A;  1W6Q B;  4IEQ A;  4COU A;  3O1R A;  2WO3 A;  1MS3 A;  2ES3 A;  5FXV A;  4XDQ A;  5LWB A;  3C7E A;  5T54 A;  2TBV A;  3RMX A;  5L7O B;  4NVP A;  1K12 A;  5FY4 A;  3J9S A;  1LCL A;  1OHF A;  2XWJ B;  3ZSM A;  3RNS A;  3VDD C;  3D5O A;  5FYT A;  2ZEY A;  2AC1 A;  1PM7 A;  2WNU C;  2Y60 A;  3AJY A;  1ZNP A;  1BK0 A;  2XDV A;  3ASI A;  3FLP A;  3ZXG A;  1VB2 A;  4B7E A;  4CDW B;  4WVM A;  4MH0 E;  5G05 L;  4M0N A;  1CON A;  4QPI C;  5GJ6 A;  3THC A;  4LOT A;  5FMC A;  4RS5 B;  2HWC 2;  3MEP A;  4YZ2 A;  5FPU A;  2RG4 A;  2GAU A;  4NAM A;  2J22 A;  2VNO A;  4DEV A;  1HV0 A;  1WW6 A;  2R07 1;  1DQ6 A;  1W8O A;  4L0P A;  1G86 A;  4ZS2 A;  5ERL A;  2C26 A;  5FY9 A;  1HB4 A;  1JYT A;  2HYX A;  5JXI A;  1C8N A;  4CPB A;  4BCU A;  3ZKY A;  3RZM A;  1X33 A;  4QX7 A;  3AP5 A;  1FOD 1;  4K1Z A;  1Q8O A;  3KGZ A;  2CV6 A;  2W9X A;  4XBL A;  3SNM A;  4LBO A;  4PBO A;  5FZF A;  5EJ1 B;  1AR8 2;  2GNB A;  4CEY C;  1W0P A;  4FFH A;  3C2U A;  2YG0 A;  4AL9 A;  2FCT A;  2DVA A;  4FFG A;  1AR6 3;  4IV1 A;  4GUL A;  4BQ5 A;  3H9A A;  1MAC A;  4HON A;  3WR0 A;  2UY9 A;  5EYX A;  5FUP A;  4ASM B;  5FPX A;  1UO9 A;  2JEM A;  1X9T A;  4LBL A;  1PIV 2;  2NQY A;  3MW4 A;  3SKJ E;  1G9C A;  5FZL A;  5SV8 A;  4NE9 A;  4O61 A;  4CVU A;  2Y64 A;  4JZR A;  1JZ2 A;  3AKP A;  2O0O A;  2A71 A;  3OJB A;  5FZ9 A;  1R09 3;  1GNZ A;  5FY8 A;  3ZMN A;  4H2A A;  4N53 B;  1W06 A;  4QGN A;  4QPG C;  1A8D A;  1C8M 2;  1ENR A;  1DU3 D;  4QXH A;  3BOD A;  4K1Y A;  4HXC A;  3K51 A;  1NA1 A;  4XC9 A;  3ZXJ A;  3VBR C;  5A33 B;  2DBI A;  1ONA A;  4DMI A;  1CZV A;  1UY4 A;  3B3Q E;  2VUD A;  3H3Z A;  4PHZ A;  1AHS A;  2BZD A;  1SFN A;  1OQD A;  1PX3 A;  3DCQ A;  1EAH 2;  3ZR6 A;  3WP5 A;  3AVR A;  5KBF A;  3MV0 1;  3MUY 1;  3JXS A;  4GB3 1;  4ZU4 A;  3SMH A;  3TWI A;  4FPY A;  5IK8 A;  4ATE A;  3S57 A;  2CHH A;  4GH4 C;  1LES A;  2YV8 A;  4ARX A;  4MGZ E;  5JI7 A;  1NCQ A;  2VMG A;  2ORZ A;  3VKL A;  2Y0O A;  2JJ6 A;  3ZPY A;  1GV9 A;  1J1L A;  1V0A A;  5FY7 A;  3UNP A;  3CBN A;  2AZ5 A;  4JKK A;  3MDP A;  4BOW A;  4XMI A;  1W28 A;  2AR6 A;  2WT2 A;  3HN3 A;  1S0D A;  5CKM A;  2GAL A;  3NAP C;  3O0X A;  5CB7 A;  1W6Q A;  1D4M 2;  1DQ1 A;  3WDX A;  4AFC A;  2VME A;  1PMJ X;  3OD4 A;  4TLG A;  4QGM A;  4XFB A;  2ZA9 A;  2QKD A;  3JBG 3;  3KM5 A;  5TSW A;  5IVB A;  2EF6 A;  2JG9 A;  2FHR A;  2XJQ A;  3JZV A;  2WNV C;  1U12 A;  4LLO A;  1Q3E A;  4Q4X 1;  2HLE A;  1HN1 A;  1QXJ A;  3BPS A;  3I2O A;  4DXR A;  3D0S A;  2YUE A;  3L9J T;  1YFW A;  1QQP 3;  3V0A A;  2VMI A;  5FY0 A;  5FYZ A;  1AXZ A;  1UMH A;  3K3O A;  1O5U A;  4OUS A;  2WFF 3;  1CIY A;  3GZA A;  1WLC A;  3MZH A;  4HVO A;  1ZRR A;  1JUI A;  1ZZ8 A;  1VBC 2;  5LEK A;  3RWN A;  3R4D B;  2VR4 A;  4KWJ A;  1VPH A;  1ZRC A;  5GZF A;  3MBW A;  3T2O A;  2MPF A;  4D0Q A;  4AVV A;  3K77 A;  2UUR A;  1TEI A;  4GQ7 A;  1YC6 1;  3IZO A;  1O91 A;  5LAT A;  1GWL A;  1RVF 3;  2J1U A;  5GZC A;  2W2I A;  4YNI A;  2WNO A;  5KHH A;  4COV A;  3GF6 A;  5AFB A;  4QXB A;  4XVH A;  3EYP A;  2EXK A;  2E63 A;  4X8N A;  3WG2 A;  5FYI A;  3NV1 A;  4UFH A;  1VLN A;  5CFC C;  3OSD A;  3ETP A;  4AQT A;  1IS6 A;  1MZ6 A;  3AZZ A;  5I8S A;  3WVJ A;  3KV5 A;  5JOY A;  4FPO B;  3GCX A;  5GLZ A;  5FYU A;  4QQH A;  1RUD 1;  2VZ1 A;  4QD2 A;  1WW7 A;  4MVT A;  1RJ8 A;  2CL2 A;  5DG2 A;  1OKQ A;  4DXS A;  3PU3 A;  2KD7 A;  3MIE A;  1X7N A;  2VMD A;  1Y43 B;  3LGR A;  2CDO A;  3D82 A;  3CMG A;  4KWK A;  2D6M A;  4MGT A;  2VMF A;  3H3U A;  1RGS A;  4NWV A;  4UXA A;  4ERO A;  4Q0V A;  1OKO A;  4N53 A;  1OOP B;  4LE4 A;  5FBJ A;  1RUH 1;  1ENS A;  1R08 3;  2PHD A;  4WVZ A;  1JZ8 A;  3A0K A;  4E4H A;  4MSV A;  2W94 A;  4XAA A;  3BTX A;  5G04 L;  2BGO A;  5CIR A;  2ZAH A;  2W46 A;  4I2O A;  2PTM A;  1V6L A;  1BQP A;  2XBO 2;  3A21 A;  3ZFE C;  1E5H A;  4KNC A;  3ZSE A;  4UFL A;  3TEY A;  5HCF A;  4AI8 A;  4I3P A;  3N7K A;  1XNA A;  1PGL 2;  5ANN A;  5LK7 B;  1QJY 2;  5FZA A;  2QBX A;  3AL6 A;  4CE8 A;  3TEW A;  1KEX A;  1UXZ A;  2RS3 1;  3RMY A;  5AVA A;  1DGW X;  3OTF A;  2D93 A;  1ZBE 1;  2RS5 2;  3L2H A;  2ZMK A;  1R64 A;  5A7W B;  2D5H A;  4CDX A;  3Q8C A;  2PLV 2;  4QXK A;  5BNN C;  4V2W A;  5A6Q A;  3WDW A;  1DDL A;  3UT0 A;  4YLZ A;  3W20 A;  5FK7 A;  2Y34 A;  1T2X A;  1CAV A;  1HRI 2;  3SH4 A;  3S6P A;  4CP0 A;  1RUG 1;  3VBH C;  1CAU A;  2XPJ A;  3E6D A;  5FYB A;  1L7Q A;  2IWG B;  2XKP A;  4OQ9 A;  5HCA A;  3KF3 A;  5F9T A;  5H9R A;  1O7F A;  2K9Z A;  3N7M A;  1K5M A;  3PUR A;  2IXL A;  4SLI A;  4GMP 3;  3ECQ A;  3M3C A;  4JGY C;  1AL2 1;  2GC3 A;  2MEV 3;  3M2M A;  3WD5 A;  4AEM A;  3NNG A;  1QJU 2;  1N3Q A;  1S0C A;  5IYY A;  4CXX A;  1V9U 1;  3ZXK A;  1JYV A;  1CPM A;  2W52 A;  2IXI A;  1W6N B;  1CZT A;  3AFG A;  2R16 A;  1RMU 3;  4MGK E;  2VMH A;  1WME A;  3UV9 A;  4NR1 A;  2KR2 A;  4DPN A;  3N9M A;  4LBQ A;  2PHW A;  4AED A;  1HRI 1;  2P37 A;  2G9F A;  4CDU A;  4K8F A;  1J3Q A;  1QDO A;  4IV3 B;  5DDJ 3;  2GU9 A;  2P6H A;  4Y33 A;  2VGD A;  2Q8D A;  3AFK A;  1QIQ A;  4RR3 C;  5ACA 3;  3BKZ A;  1CX1 A;  3QH6 A;  1ULC A;  2YC4 A;  2FD8 A;  2QQM A;  2GMP A;  2GN7 A;  3FUO A;  3GNE A;  2YU1 A;  5K0U B;  1Z7S 1;  4LBK A;  4L11 A;  3J7H A;  1PO1 2;  5A3L A;  4Y20 B;  4Q4V 3;  4ZON A;  1C5H A;  4BIO A;  3WCR A;  1QY4 A;  1LED A;  3VB9 A;  2CGO A;  1O5L A;  4PIZ A;  3X29 B;  4I0A A;  1BMV 1;  5CVR A;  2WS9 2;  2BVB A;  3POJ A;  4Q0U A;  2ZGL A;  2VMC A;  3OOX A;  3T1L A;  4CYD A;  2YDE A;  2YBS A;  3ZYG A;  1QJX 1;  3PL0 A;  3VDA A;  1BK1 A;  1D2S A;  4XBQ A;  3UKV A;  1YHF A;  2XKO A;  3O1U A;  3H8O A;  3NJZ A;  1ENX A;  1DGL A;  3W21 A;  2DUR A;  2OZJ A;  3FE5 A;  3U10 A;  1JOJ A;  2B5H A;  5HPO A;  5C70 A;  3FN9 A;  2NN8 A;  4DUW A;  2GP3 A;  4FTE A;  1SLB A;  3PVB B;  1HLC A;  1RIR A;  1W0N A;  4YYO A;  3O1V A;  2PHT A;  3RSJ A;  5FZ8 A;  2W1S A;  2O14 A;  4B4R A;  4LO6 B;  5C8C C;  4MYE A;  3S0M A;  5JSP A;  4BK5 A;  3POS A;  1EP0 A;  4IE4 A;  5EYY A;  3KT7 A;  2ARC A;  2VOX A;  1RIN A;  2HWE 3;  3A7Q A;  4QPW A;  4BA6 A;  2VXJ A;  4FP3 A;  3OGV A;  2WLQ A;  4NRP A;  1NXD 1;  2D44 A;  4IV1 C;  4UYB A;  1I5P A;  2ZPX A;  3VN4 A;  4DZG A;  3ZXA C;  4I02 A;  3H3L A;  4CUA A;  1DIW A;  4AQ6 A;  4TLF A;  4UT5 A;  5E16 A;  4FPJ A;  4LO7 A;  3T3Y A;  4KWL A;  5T55 A;  2LS6 A;  1YQ6 A;  1TMF 3;  4H14 A;  2HWC 1;  4QMA A;  3MYX A;  3D0J A;  3WNO A;  1LOC A;  2R32 A;  2WQZ C;  3OY8 A;  4LKS A;  1YEW A;  4FAG A;  3ZR5 A;  2I2S A;  4RYD A;  3DV8 A;  1AR6 2;  1F31 A;  1NA1 C;  3ABZ A;  3NJY A;  1W6M B;  2D3P A;  4UI9 L;  2PYT A;  4YW2 A;  5LRS A;  4UF0 A;  2PFW A;  4Y5Z 0;  1UYX A;  2Y26 A;  2PQS A;  2BWA A;  2D43 A;  3I3B A;  5FP8 A;  2DFB A;  2D7F A;  4CXW A;  4BQ4 A;  1SQ4 A;  4FOQ A;  4A3X A;  5BNP A;  1R09 2;  5J7M A;  1OBN A;  2A6Z A;  4ONU A;  2CGN A;  2W3J A;  1NCR A;  1NCQ C;  4AFA A;  1B09 A;  1W6N A;  1HRV 3;  3VZN A;  1AR8 1;  4R4Z A;  4AFB A;  4RHV 1;  4QX0 A;  4Y1V A;  4IEP A;  4OHY A;  1LOA A;  1UY1 A;  3SCH A;  3AMN A;  3AC0 A;  1W2T A;  3TAY A;  5LA1 A;  1JH5 A;  2FDJ A;  3ZYI B;  5CFD B;  3EXU A;  1NE4 A;  5FZ7 A;  4BQW A;  1PIV 1;  1WGP A;  2EVX A;  3WOG A;  2GZW A;  2VNG A;  4XUP A;  4AE2 A;  4ZXK A;  1QWR A;  4YZ4 A;  2VOW A;  2CU5 A;  1PK6 A;  2V5D A;  4JAA A;  4B4P A;  5CIS A;  3VUO A;  2C6S A;  3CJI B;  3FWE A;  3O0W A;  4PF5 A;  2NPI A;  3N7L A;  2GC2 A;  1C8M 1;  2EXI A;  2JG9 C;  3PJY A;  4LK6 A;  1MS9 A;  1UZZ A;  2E6V A;  2VVD A;  2DUO A;  2WII B;  1YIF A;  1AR9 3;  4S2G A;  4F7Z A;  5I8T A;  2JE9 A;  2YGM A;  4F8A A;  3VDD A;  5FPV A;  1F15 A;  4RFT 0;  2P4E A;  5A3M A;  3OBA A;  1DBN A;  1KD7 A;  2XHN A;  4C0H A;  3UJO A;  4EN6 B;  3DL3 A;  2VW1 A;  1EAH 1;  4XQW A;  5DZG A;  5JIA A;  4GAZ A;  4CDW C;  1KS5 A;  1FV3 A;  3JBG 2;  3J7N A;  5L19 A;  2PXJ A;  5FOJ B;  5C9A A;  5GZD A;  2IXH A;  2RDQ A;  3DF0 A;  1QNY A;  3LA3 A;  5JXJ A;  1OLM E;  1FV2 A;  2WAO A;  5H9Q A;  4P9X A;  5H9S A;  4Q2F A;  3N7J A;  3W58 A;  4R4X A;  1UYZ A;  4KU8 A;  1LHN A;  1VBD 3;  2QZ3 A;  3HQX A;  3IDE A;  4AAP A;  1ZZ9 A;  1QQP 2;  3KHB A;  2JEN A;  5F1R A;  4QQP A;  1F35 A;  5F32 A;  3U0Z A;  3LA7 A;  2WFF 2;  3I3E A;  5EFU A;  5FZM A;  5FY1 A;  1D4M 1;  4BDV B;  2A3Y A;  2ORX A;  2A6V A;  5A6X A;  5IVF A;  4NID A;  3B7M A;  2JDH A;  4BPZ A;  3ZYP A;  2RJK A;  3MGU A;  5DZF A;  2RE9 A;  1K45 A;  4M3C A;  3THP A;  5JMO A;  3GBG A;  4W50 A;  1RVF 2;  2XJR A;  1OF3 A;  5I0T A;  4W8J A;  1UAI A;  5GLU A;  3TB0 A;  1X8E A;  1SFP A;  2E9Q A;  4IE5 A;  1H1M A;  3VD5 A;  1LJ7 A;  3U4S A;  2ZGM A;  3CNA A;  1UW8 A;  3LDK A;  4YFW A;  2ATF A;  2ZX4 A;  5HXV A;  3S30 A;  4EE2 A;  1UY0 A;  2WQ4 A;  3POY A;  1VBC 1;  4K40 A;  1CN1 A;  4N53 C;  1OT5 A;  4KBB A;  2DCY A;  1JN2 P;  5C7G A;  3HT1 A;  4P9L A;  1FMD 1;  1HQL A;  3SLI A;  4UBG A;  2PHR A;  1E5S A;  1W6M A;  2EXJ A;  4LIT A;  5FMB A;  4QQO A;  4Y3O A;  1W2O A;  2GDF A;  3VBF B;  2ARB A;  3KV9 A;  2QVS B;  3TN9 3;  3VKF C;  2TEP A;  1Y4W A;  1QXR A;  4XJ9 A;  3ZYR A;  1K42 A;  1CD3 G;  3PVN A;  2XJT A;  1BEV 3;  1H6Y A;  2VZP A;  1W9S A;  3LWC A;  5FR3 A;  1R08 2;  5JMC A;  1OXC A;  2QQV A;  4HLT A;  3J26 N;  1XNT A;  5KHK A;  2A5Z A;  4LT5 A;  2WKK A;  4KQ7 A;  5FZC A;  4CCD A;  3VKM A;  4JRL A;  1S0B A;  4CCE A;  4HFS A;  5ABJ B;  1JMU B;  1AZD A;  1DQ4 A;  4CDX C;  3VBO B;  4QX3 A;  1D0G A;  5IVJ A;  1O8S A;  3WSO A;  3ZN6 B;  4E27 A;  1JYX A;  1W05 A;  3B93 A;  4U2A A;  1AJO A;  4BME A;  4PDW B;  3ZDS A;  2Y6G A;  3CJI A;  2WL1 A;  3AZV A;  4EWE A;  3IDC B;  2ZGR A;  4PBP A;  4Q4Y 3;  3KLS A;  1PVC 3;  3UKN A;  5DUW A;  3W59 A;  1K5M C;  1OC1 A;  4XBN A;  2HJI A;  2DUP A;  1HXS 2;  4M4P A;  2XBO 1;  4MXV A;  1AYN 3;  5FO9 B;  2KM2 A;  1LEM A;  5JUV A;  3ZYH A;  2V4V A;  1UOB A;  3IBM A;  3RGB A;  2JX9 A;  1AJK A;  3WUD A;  1US2 A;  2WO7 A;  2B4K A;  4XFG A;  3POI A;  1PGL 1;  2Y6L A;  3H8X A;  2OT7 A;  2VBB A;  5E1R A;  1NXM A;  1QJY 1;  1AXY A;  3ORJ A;  3K48 A;  2XOM A;  4R9C A;  2Z4F A;  5LZ6 A;  5CU1 A;  4E2Q A;  2AAC A;  2RS5 1;  1W6O A;  5DG1 A;  1A34 A;  2MEV 2;  5F39 A;  4BQ1 A;  2PLV 1;  5HI0 A;  3AYA A;  4YVS B;  3LDB A;  5DUU A;  4PCR A;  3V65 A;  4CDU C;  5BY5 A;  5FZ0 A;  2J1V A;  3SKV A;  5BPX A;  2IFW A;  3DPR B;  2UYB A;  2UWB A;  3M7A A;  3NV3 A;  4LHN A;  4DO0 A;  3NWK A;  2J1E A;  4PI2 A;  4FPK A;  4MGQ A;  5C4W B;  1RMU 2;  1OPM A;  2WZR 3;  4JC1 A;  1MS4 A;  2RDN A;  2V72 A;  3GCW A;  2JEC A;  5FLH A;  2N7G A;  3RYK A;  4LTA A;  5DDJ 2;  3N9P A;  2NYY A;  3EHK A;  3THD A;  1XNK A;  5AFE A;  5CKN A;  5E6H A;  5ACA 2;  1SG3 A;  2DU0 A;  2Y6H A;  1LU2 A;  1QJU 1;  3BIW E;  4LMF A;  1VR3 A;  3H1W A;  2HWF 3;  2FDK A;  5T50 A;  3AJZ A;  1AXK A;  2Q8C A;  1UN1 A;  1H8V A;  1MR5 A;  4N9I A;  4NRO A;  2W92 A;  2RMU 3;  4YM0 A;  4BQX A;  3BB6 A;  4IEU A;  4AI3 A;  1HKD A;  4DOU A;  2EIC A;  1IPJ A;  4L97 A;  3HWJ A;  2B7Y A;  3T4H B;  2ZJC A;  3PDQ A;  4L2N A;  3ZLI A;  4BIS A;  2JIJ A;  4QKB A;  4AWD A;  1UF2 C;  3VBU B;  1HX6 A;  1NUK A;  2JIC A;  1J3R A;  4XAC A;  1UKR A;  5F2S A;  3VLB B;  3WCS A;  5A70 A;  3TEZ A;  1D7P M;  4AGR A;  1CJP A;  2AUY A;  2JWP A;  1VMF A;  2JE8 A;  1A6C A;  2PA7 A;  1AR7 3;  4XQ4 A;  4LHS A;  5KXD A;  5F6L B;  4IGO A;  3GXU A;  1OI6 A;  1ND3 A;  2WSV A;  3WQB A;  4AFD A;  2QDR A;  4XIO A;  3S5Q A;  1JZ3 A;  3SCG A;  2EA7 A;  2Q8O A;  3T09 A;  4D7T A;  4HPK A;  2D5F A;  1C28 A;  4RGK A;  3ZXL A;  4A3Z A;  4OQ8 A;  2WS9 1;  3DEM A;  4BQ2 A;  4FSJ A;  2WYF A;  3VBO A;  1H1A A;  1QF3 A;  3WW3 A;  2SBA A;  2YFZ A;  1I9R A;  4PDW A;  3K2O A;  4AVS A;  3EMR A;  1GMM A;  1ULE A;  3HT2 A;  3HVD A;  4PLM A;  2ARA A;  3VBH A;  1CGP A;  3KVB A;  3QBQ A;  3VD4 A;  3I59 B;  3H7Y A;  4XTP A;  4I09 A;  4LOS A;  1GOG A;  1YI7 A;  1W6P B;  3EO6 A;  4JVA A;  5CYY A;  2VTF A;  4B3N A;  1H8T A;  3DXT A;  3LB9 A;  5JR2 A;  4IEY A;  1LEC A;  4K6B A;  2GN3 A;  1HJF A;  5FK8 A;  3W9A A;  5A7Q A;  4M0H A;  2V09 A;  1T6G C;  1TMF 2;  1CZS A;  1CJD A;  1OMI A;  1SBF A;  2LUW A;  5BNP C;  4Q29 A;  2ZEW A;  4OYU A;  2XL7 A;  4Y26 A;  2H0V A;  4UW5 A;  1NCR C;  1NOV A;  1OPO A;  2WA4 A;  1KJR A;  4FT8 A;  2BPA 2;  4NMI A;  1H1I A;  2XR4 A;  5I8Y A;  2LW8 A;  2R30 A;  4CP2 A;  1N1Y A;  2HBT A;  1F5F A;  3HPN A;  1YQC A;  3M1H A;  1RC6 A;  4I0W B;  2OZ6 A;  4DUX A;  2JDM A;  1PZ9 A;  4WVW A;  2HKX A;  1DZR A;  4FOW A;  4YW3 A;  3DPR A;  2X8K A;  2VD7 A;  4NJ4 A;  4CEW B;  2JG8 B;  2BWC A;  2ZBJ A;  5LB6 A;  1QOO A;  1HRV 2;  1PK6 C;  5C4W A;  3WV6 A;  1OH3 A;  2ZGN A;  5K0U C;  3QLQ A;  1UWW A;  2J1S A;  3P3P A;  3RI9 A;  5A7S A;  3HJR A;  1AR6 1;  4ZPI A;  4YM2 A;  3GZE A;  3P5B A;  4AF9 A;  2R04 3;  1RHI 1;  3KQ4 B;  2E7T A;  3O0V A;  4JDM A;  4NPR A;  4AYU A;  1OVS A;  2Z5W A;  4GMP 0;  4COZ A;  2YU2 A;  5FO7 B;  5I0S A;  5FRA A;  3TOJ A;  2P34 A;  5A6Z A;  4EZ4 A;  3OUI A;  4JGZ B;  4LA2 A;  3SH3 A;  1GZC A;  4NUB A;  1R09 1;  4QX5 A;  4HSJ A;  3SXW A;  5C9A C;  4FPL A;  2Y8K A;  1TQ5 A;  3IKW A;  1LU1 A;  4P02 B;  3T1M A;  1AR9 2;  4C90 A;  3CL1 A;  5C3P A;  2I07 B;  4LHK A;  1PO2 3;  4PT6 A;  4UBH A;  3LA2 A;  4XUT A;  2CWS A;  1R1A 3;  5L9B A;  1MQT B;  2G1M A;  3IB3 A;  4GAL A;  1MPX A;  3GZU C;  1KDK A;  3WG1 A;  3GJB A;  5AC9 3;  2DV9 A;  2EAA A;  2WUH A;  3I2I A;  4A7K A;  4OLL A;  2RR1 3;  5IAX A;  1LGN A;  4ZHN A;  3WQ1 A;  4CUB A;  5C8C A;  4RA0 A;  1YLL A;  2ZMN A;  3M4F A;  1ST8 A;  4KU7 A;  2ET1 A;  2VTX A;  1VBD 2;  2DVD A;  5D2A A;  4CDQ A;  2D3R A;  2GH8 A;  2QQP A;  4X8P A;  3MI8 A;  2OII A;  3LSE A;  1UOF A;  5DAP A;  1AX0 A;  2E31 A;  3PTR B;  4YVW B;  3U11 A;  4EN9 B;  1NAE A;  4FPG A;  1VBB 3;  4QX8 A;  1IG3 A;  4AHW A;  4G9S B;  4BQY A;  3JBG 1;  4OZX A;  1BBT 3;  2P3J A;  5JZG B;  4QX1 A;  3NV2 A;  1QGL A;  1E5I A;  1FT9 A;  4K7J A;  4Y1Y A;  4AQ2 A;  4CU7 A;  1X50 A;  3I59 A;  5JAX A;  1ASJ 3;  1QHD A;  2WSU A;  4Q8L A;  3ZXE A;  2IUW A;  2I74 A;  1RXF A;  3FBY A;  1QQP 1;  1W6P A;  4LQR A;  4NPL A;  1Y9M A;  2BP6 A;  2WFF 1;  2ZHM A;  5FLJ A;  1V6J A;  4A6O A;  5JPM B;  1ZZ7 A;  2A3X A;  2HWB 2;  1O8P A;  4XUR A;  3ZM8 A;  1WKY A;  4D7S A;  2C1F A;  3OUH A;  5LA2 A;  5BNO B;  3I49 A;  3U14 A;  1W04 A;  3CZJ A;  4OUL A;  2VL4 A;  1AYM 3;  4ASK A;  2BNN A;  1SLL A;  1RVF 1;  3HNB M;  3VHP A;  4RGG A;  1URX A;  4NIG A;  3T2T A;  1JZ4 A;  3RWK X;  3S7I A;  3TN9 2;  3O1M A;  2WN3 A;  4AI9 A;  2OPW A;  1IGO A;  4Q0Q A;  4Z1V A;  4CEW A;  2DF7 A;  1W2U A;  1AX2 A;  2DYC A;  3K75 B;  4XFI A;  1YI9 A;  3POE A;  5FFO C;  3RZH A;  3FX3 A;  3CJI C;  4A7Z A;  1UYY A;  1CWP A;  3I97 A;  5KWR A;  3EBR A;  1XNC A;  3CQO A;  3VD3 A;  2UWC A;  5F5Q A;  5L7O A;  1POV 0;  1OA4 A;  2VZT A;  1OUS A;  1XXN A;  4E4D X;  4COW A;  4HZF A;  2OPK A;  2ZS6 B;  4LJH A;  1G9A A;  4NIH A;  3URF A;  5JVV A;  2SLI A;  4QKF A;  5FP7 A;  3KQR A;  2HBU A;  3OD0 A;  4JGZ A;  4BE3 A;  3Q8F A;  5LY2 A;  4CDW A;  4D6R A;  3NRU A;  2HYK A;  1S0J A;  4GJZ A;  4MXW B;  5BV6 A;  4M3C F;  3K3N A;  4IER A;  4RD7 A;  1R08 1;  4RS5 A;  1UD1 A;  2W95 A;  2R0H A;  3H1Y A;  3IAP A;  4B1L A;  4CSW A;  3T2P A;  2R49 A;  3LFM A;  4AHZ A;  1PVC 2;  2PHF A;  3O1P A;  4R9B A;  4EZH A;  2P3Y A;  2A6Y A;  3E5Q A;  2C24 A;  2GNT A;  1JYC A;  1MQT A;  3FZ3 A;  4NIA A;  5IFT A;  1AYN 2;  3WY6 A;  3DEC A;  5T5P A;  2OUH A;  5IUQ A;  2WT1 A;  1N1S A;  2ZTN A;  4JQR A;  1XBF A;  2DVG A;  4E2S A;  5FIX A;  2JKB A;  3H1M A;  2PAE A;  3MFA A;  2XLG A;  3WP6 A;  4MV2 A;  3KV6 A;  4YW4 A;  3UGG A;  2MHF A;  3RVH A;  2YXS A;  1LOD A;  4GB3 3;  1DHK B;  3O14 A;  5T5J A;  5DZE A;  5FWE A;  3R6S A;  1RUF 3;  4CU6 A;  2D6P A;  3JD7 2;  3LDR A;  1UZY A;  3MFC A;  5IWF A;  2YYO A;  4KG0 A;  3D3A A;  4FI9 A;  2VPV A;  2PAM A;  3FHI B;  4AG4 A;  3VHR A;  1U5X A;  1JZ7 A;  3ITQ A;  2R06 3;  3FLT A;  1HXS 1;  1W9F A;  3LEG A;  4LIU A;  3JB4 C;  2Y6J A;  3M70 A;  4OHX A;  2ZAB A;  3DKQ A;  2RS1 3;  1JBC A;  4AOC A;  5J96 B;  2FDH A;  1DFQ A;  3BVC A;  2WZR 2;  4OI4 A;  3OBZ A;  4M01 A;  2WDB A;  2XQR A;  3VGI A;  1G9F A;  1WLT A;  4AEJ A;  4BZ4 A;  1Q56 A;  2WA3 A;  3B9C A;  4JDN A;  5A33 A;  4GMP 1;  1GWK A;  1X8M A;  4O9G A;  1AVB A;  3T30 A;  2MEV 1;  3Q8A A;  3NQH A;  2WR9 A;  3DN7 A;  1DYK A;  4IES A;  5A1L A;  2GC0 A;  1AF9 A;  2ZGU A;  2HWF 2;  2R1B A;  3AKT A;  3ILN A;  4Q4X 3;  5J09 A;  1O3R A;  2F6B A;  1APN A;  4XF9 A;  4MGY E;  2RMU 2;  2D40 A;  4IGQ A;  3N9L A;  4U36 A;  3H8R A;  1UIK A;  3I2F A;  5BNO A;  3U4X A;  5GM0 A;  3I2G A;  1ND3 C;  1Z0H A;  1RMU 1;  2VVF A;  5FJK A;  3RYP A;  3PME A;  2GNM A;  3J8F 3;  3LPF A;  5FPZ A;  4COY A;  4XHX A;  4EWA A;  1RUE 2;  2TNF A;  2ZX2 A;  3KF5 A;  2JDY A;  2ZCW A;  4HOO A;  2D3S A;  1GYK A;  1W3V A;  5DDJ 1;  2YHJ A;  1S0I A;  4IET A;  5FXZ A;  1POQ A;  3WNP A;  3WZ1 A;  4BIF A;  4E8C A;  5I93 A;  3VBO C;  5ACA 1;  1O4Y A;  1AR7 2;  5BXX A;  3D4K A;  1GWM A;  2VEC A;  2B8M A;  2WC2 A;  3V56 A;  3JUU A;  1YQ2 A;  2A6X A;  2X10 A;  3J7M A;  4MGS A;  4PDW C;  3LF7 A;  4DNY A;  4CU9 A;  1PVX A;  2NM1 A;  1QH7 A;  3BI3 A;  3ALQ A;  1UZV A;  2P1B A;  2WLP A;  2ZX3 A;  4ITC A;  4BYY A;  4A41 A;  3UGH A;  3E1F 1;  2F4P A;  4EJR A;  2AYH A;  3JU9 A;  1GAN A;  2YBK A;  1S2E A;  3PHM A;  4NN0 A;  5DUV A;  1DP0 A;  3EJK A;  4GJY A;  2VCM A;  4MX3 A;  1SBE A;  5FZ1 A;  4D7Y A;  2XH6 A;  1OD3 A;  2BDR A;  4LNV A;  4W65 A;  1H8T C;  4Z07 A;  2CTV A;  3KVA A;  5FCC A;  4CUG A;  4DB5 A;  1ZM1 A;  2FDG A;  1XPW A;  3WP3 A;  4WM8 B;  3WUC A;  5FYH A;  4OFG A;  4XAB A;  4K21 A;  4Y4R A;  3HNY M;  4BM8 A;  3ZYF A;  1KGY A;  3RS6 A;  3NV4 A;  3ACF A;  4Y22 B;  1XU2 A;  1DYP A;  1QH6 A;  3D8C A;  1MS8 A;  4Y1Z A;  1NYW A;  4ISR A;  3RQ0 A;  5M0T A;  1SFY A;  3B69 A;  1QEX A;  4C1W A;  5IAT A;  4W6X A;  1RUH 3;  1IPS A;  1Q8V A;  1NG0 A;  2VZU A;  2P6C A;  2EAK A;  5AVP A;  3V0B B;  4BU2 A;  3MIH A;  2VM9 A;  2X05 A;  3R05 A;  4QWN A;  2LTN A;  2Y6K A;  3DPR C;  3H50 A;  3DGT A;  3AZY A;  4V1P A;  4ZS3 A;  4PI0 A;  3U1X A;  3IDB B;  4GXL A;  3RZK A;  2QTW B;  4Y4Y A;  3U37 A;  1RUN A;  3AMQ A;  1VRH 3;  1W8W A;  3MIF A;  4JV4 A;  5C4W C;  3WNK A;  2W39 A;  4JKL A;  4BXS V;  1TNR A;  4XTM A;  2XWB B;  5FYY A;  2PQQ A;  3LIH A;  4KGQ A;  1GU3 A;  4YZ3 A;  4LIV A;  2W1U A;  2VQT A;  5GKA C;  1CAW B;  1TMF 1;  4LKE A;  1JOB A;  1F9K A;  2XB6 C;  2Z69 A;  1CAX B;  3GAL A;  1GQP A;  3QH7 A;  1NX9 A;  1OOP A;  4JTO A;  2A73 B;  2HH9 A;  1BZW A;  1POV 1;  1NY7 1;  1FNY A;  1UIJ A;  4K8R B;  1NLR A;  2R04 2;  1LOF A;  4HKW A;  4WBB A;  3DXU A;  2J1A A;  2CAV A;  2FCU A;  2WN2 A;  3MLJ A;  1GSL A;  3PUI A;  5EQU A;  5LW9 A;  2Q1M A;  4GWJ A;  4CCN A;  5L36 A;  4XET A;  2Z2S B;  1EY2 A;  1PNG A;  3BOW A;  2VU9 A;  3RI8 A;  1UZ0 A;  1WD3 A;  5FQ0 B;  4IUG A;  5F8P A;  2L9L A;  2R0F A;  1C5I A;  1VBA 3;  2JKX A;  2VUL A;  3NST A;  1AL2 3;  3VZK A;  2CAU A;  1GIC A;  1HB3 A;  4UW6 A;  1PO2 2;  2BOI A;  2Y0I A;  1D0H A;  1WCD J;  3A0N A;  3LEI A;  4LA3 A;  4YW6 A;  1JW6 A;  4QU1 A;  3FUQ A;  1R1A 2;  1QMJ A;  1V9U 3;  1WBF A;  2B9U A;  3OGR A;  4TZD A;  2OW4 A;  1OLM A;  4CDQ C;  5A7W A;  5FOB B;  3OBT A;  1IOA A;  5AC9 2;  4QT6 A;  3RJR A;  3PLQ A;  3SEP A;  4A7Y A;  5I91 A;  2RR1 2;  5LK5 A;  4NII A;  5FZ6 A;  1IHM A;  1P8J A;  1SCS A;  3ETQ A;  4BXF A;  4DRV A;  4HVR A;  3T0A A;  4LKF A;  5JCT A;  3AL5 A;  3CHX A;  2G19 A;  4FTB A;  5FZO B;  1XYN A;  4N43 B;  2J1R A;  3I54 A;  2DUQ A;  1US3 A;  4QXC A;  3UYJ A;  3ES4 A;  1VBB 2;  2RV9 A;  3GHM A;  1RIT A;  2JDP A;  5B4N A;  1MS1 A;  3ES1 A;  3CO2 A;  4C91 A;  2XLF A;  5K9Y A;  1BBT 2;  1UL9 A;  3HEI A;  3AXE A;  2WO2 A;  1OD5 A;  4Z2A A;  3AYD A;  3AKR A;  4AR2 A;  4XHB A;  2XVG A;  1YFX A;  3A23 A;  3E6B A;  4W6W A;  1ASJ 2;  1TME 3;  3C8X A;  4Y22 A;  1VBD 1;  3MLK A;  3B5L B;  4GD4 A;  2ZKL A;  2C5D A;  2QE3 A;  4ET7 A;  2ERF A;  4UFJ A;  4IE0 A;  3SH5 A;  3POF A;  1FXZ A;  2PEL A;  4MHR A;  3NNJ A;  3VBR B;  3V0B A;  4IV3 A;  3ACH A;  4WV8 A;  3WIN E;  5IVC A;  2ET7 A;  4CEW C;  4QQL A;  3S7E A;  2VZV A;  3R0R A;  4R52 A;  4XJ8 A;  1B35 B;  3B9I A;  3I3M A;  5K0U A;  1AYM 2;  5IJR A;  4GH4 B;  2VAU A;  4XUN A;  1F5J A;  2UY8 A;  4ES8 A;  5JI9 A;  4Y20 A;  2HWD 3;  3GZT B;  5L7O C;  1L7R A;  2YMZ A;  3WF2 A;  5LBB A;  4FBF A;  2VO5 A;  2WJS A;  3RJ2 X;  1NQJ A;  1X36 A;  2D6O X;  4IEZ A;  4ZZ8 A;  3EQE A;  2E26 A;  1I3H A;  4R8H A;  4JGZ C;  4XZU G;  2HWB 1;  3TBD A;  3VBS B;  3JCI A;  5FXX A;  5EIY B;  2V73 A;  2QQO A;  2ZHN A;  3SCF A;  2FMD A;  4RS5 C;  3QOP A;  1XSQ A;  4XAE A;  4YGD A;  4DFS A;  2IFR A;  4RFR B;  3H8U A;  5FYS A;  4S2F A;  4QB6 A;  1GNY A;  3BU7 A;  3NJV A;  4AQS A;  1IQD C;  3BTZ A;  1D4V B;  3FBM A;  3TN9 1;  3LKJ A;  4CP1 A;  4IXL A;  1ULP A;  5SV5 A;  1MQT C;  3ACG A;  5EP9 A;  5HCH A;  5A3O A;  5L9R A;  1XE8 A;  1U0A A;  1CIW A;  3O1T A;  1OLQ A;  4Z92 B;  4GWN A;  2VVE A;  1UNB A;  1UX6 A;  5CG8 A;  2ZGO A;  2JDZ A;  3HOB A;  1UMI A;  3KZ4 C;  3M3O A;  3ILF A;  1QDC A;  1UPI A;  1TNF A;  1GOH A;  4QDQ A;  5F3E A;  2IVI B;  4A45 A;  4CP9 B;  1OUR A;  2IVJ A;  4CUC A;  1W8U A;  1IS5 A;  1F4H A;  1UCX A;  2CY6 A;  5FV3 A;  4BLI A;  1DGR N;  3HQR A;  1OF4 A;  3LFI A;  3P1I A;  5FZE A;  4RHV 3;  4I0B A;  4FQZ A;  5K7P A;  4QB2 A;  2Q0A A;  3E6C C;  1H2L A;  1RUF 2;  3WW1 A;  1VAK A;  4N43 A;  3OCP A;  4MAD A;  1PVC 1;  1W0O A;  3GJA A;  3BU0 A;  5J48 A;  1H2K A;  3U07 A;  4CCM A;  4NPM A;  2R06 2;  1GFF 2;  1AYN 1;  3HAG A;  1LTE A;  2GH2 A;  2VG9 A;  4QB1 A;  1SPP B;  2RS1 2;  2DCZ A;  2FDF A;  3WF3 A;  3NW4 A;  3IDA A;  1MS5 A;  3OGG A;  3KHC A;  4PQQ A;  1G8W A;  3V64 A;  5LBF A;  3BN6 A;  2DVB A;  4JQT A;  3B94 A;  3LOI A;  5BNO C;  1MVQ A;  3QD6 A;  1S2K A;  2VOK A;  3T08 A;  1NT0 A;  3JD7 1;  1WWY A;  1RXG A;  2C9A A;  3FC0 A;  4CU8 A;  4Q4X 2;  2ZGQ A;  2BU9 A;  3LOB A;  1NLQ A;  1H4H A;  1DGR A;  2OXB A;  5CFD A;  2O1Q A;  2K46 A;  5JOX A;  2YFU A;  3I3Q A;  4V2V A;  4XEZ A;  5DPN A;  5LEJ A;  2P3K A;  2VQA A;  1RYY A;  4IW3 A;  3Q8B A;  5I0R A;  2VZS A;  1B35 A;  3AMP A;  3VDB A;  4HMZ A;  5FZG A;  4XF3 A;  2WZR 1;  3J8F 2;  1A8M A;  4XDO A;  1N3P A;  3FJS A;  5GZE A;  3WDV A;  4NHK A;  3I2K A;  3C7G A;  4HKO A;  5LBE A;  5C3Q A;  2X09 A;  4O9E A;  1FNZ A;  4AFM A;  2BW8 A;  5J37 A;  4FCA A;  1ZA7 A;  4OCT A;  1O3T A;  1C57 A;  2C4X A;  4XCA A;  2BER A;  1PHM A;  3NNL A;  1WA4 A;  4B1M A;  2HWF 1;  4AXO A;  5FTT C;  1C4R A;  3SQO A;  3R4S A;  4WZF A;  4LBJ A;  1XNB A;  1J58 A;  4DY5 A;  2PHL A;  1CR7 A;  4QDS A;  1UQX A;  4LXL A;  3SHR A;  4KH9 A;  1GP6 A;  2XG3 A;  4FO9 A;  4HT1 T;  2RJ2 A;  4N9H A;  1D2Q A;  1FAY A;  2DBN A;  5FPL A;  4CPB D;  2VZQ A;  1IKP A;  1RUE 1;  2BEO A;  2X29 A;  4OHW A;  2Q1F A;  4TWT A;  3BIE A;  1VAV A;  2DDU A;  2VUC A;  2HEW F;  3AVS A;  4OHV A;  5KXE A;  4UFM A;  4P9I A;  2JDK A;  2XLA A;  1AR7 1;  1FMD 3;  2D6N A;  2BYV E;  3OB8 A;  4N8M A;  2CGP A;  4JGY B;  1FPN 3;  4C8D A;  3I3D A;  2B39 A;  2RM2 3;  2XJS A;  1I5Z A;  2CYF A; 
#chains in the Genus database with same CATH homology
 4ZHN A;  4QKB A;  4NRP A;  4IE6 A;  4QKN A;  3O1T A;  3T3Y A;  3S57 A;  2FDI A;  2FDH A;  4CXY A;  5F8P A;  3O1O A;  4NRQ A;  4CXW A;  3O1R A;  2IUW A;  3T4V A;  3H8R A;  4NPL A;  3RZL A;  3O1S A;  4NII A;  4NRM A;  3BU0 A;  4JHT A;  4NPM A;  4IDZ A;  3I2O A;  4CXX A;  3I49 A;  2FDF A;  2FDJ A;  3KHC A;  4NIG A;  3BI3 A;  4IE7 A;  3O1M A;  3BUC A;  3BKZ A;  3BTY A;  3RZH A;  2FD8 A;  3H8X A;  5DAB A;  3I3Q A;  4O7X A;  4NJ4 A;  4IE0 A;  2FDG A;  4ZS2 A;  4NIH A;  4QKF A;  3S5A A;  4OCT A;  3KHB A;  3I3M A;  3RZM A;  4QKD A;  3O1U A;  4QHO A;  3H8O A;  3LFM A;  3O1P A;  3RZK A;  4ZS3 A;  4MGT A;  4NID A;  3RZG A;  3O1V A;  2FDK A;  4MG2 A;  3BTX A;  3BIE A;  4O61 A;  4NRO A;  4IE5 A;  4RFR B;  4IE4 A;  3RZJ A;  3T4H B;  3BTZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...