2FDFA

Crystal structure of alkb in complex with co(ii), 2-oxoglutarate, and methylated trinucleotide t-mea-t
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
199
structure length
199
Chain Sequence
LAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLSLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of catalytic complexes of the oxidative DNA/RNA repair enzyme AlkB.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Oxidoreductase/dna
molecule keywords 5'-D(P*TP*(MA7)P*T)-3'
total genus 50
structure length 199
sequence length 199
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2005-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 2fdfA00
4O7XA 3T3YA 4QKDA 4JHTA 4NROA 4IE6A 4IE4A 3KHCA 3RZMA 4QKBA 3BU0A 3BTZA 3RZHA 4IE5A 4NRQA 4NIIA 3RZKA 5DABA 3H8XA 2FDFA 4NPLA 4NRPA 3T4VA 4MG2A 4IDZA 3I3QA 2FDHA 3H8OA 3BIEA 4OCTA 4ZS2A 3RZLA 3O1SA 3O1TA 3BKZA 4ZHNA 3O1PA 4NRMA 3I2OA 3S5AA 3O1RA 3LFMA 3BUCA 3O1VA 2FDJA 4CXXA 3I49A 2FD8A 2IUWA 4IE7A 4O61A 2FDKA 3RZJA 3I3MA 4NPMA 4CXWA 3BTYA 4QKNA 3O1MA 4QKFA 3H8RA 3RZGA 2FDIA 3KHBA 4RFRB 4CXYA 3O1OA 2FDGA 3BI3A 4IE0A 4ZS3A 3S57A 4NJ4A 4QHOA 3T4HB 3O1UA 3BTXA 4MGTA 4NIHA 4NIDA 5F8PA 4NIGA
chains in the Genus database with same CATH superfamily
1D7PM 1D4M3 1ZBA2 2ID4A 5JI9A 3IDBB 4MSVA 1JU3A 4ZU7A 5HI0A 2BTVC 2FCTA 5KWRA 5K7PA 4IW3A 4QPGB 1MPXA 4M00A 2E51A 4PI2A 4CCJA 3P1IA 4TXWA 1JYIA 2ZEZA 4IV3B 4CU7A 2D6KA 5C9AB 2R062 1DG6A 4AHZA 5FK8A 1W6PB 4Y22A 5C3RA 1NY71 5DUWA 5F7UA 2WQZC 4XOGA 5JOXA 2RM23 2WN3A 1AR62 2BV4A 4BM8A 1ULEA 4TLFA 2VNOA 2ZHMA 5C4WA 2XJSA 1OC1A 1RUJ2 2UU8A 3BCWA 3UKNA 2IXKA 2P3KA 5M0TA 1FOD2 1J1LA 1MS9A 3N3HA 2IXJA 2OQ7A 1J83A 3LWCA 3KSCA 2DCYA 3FHQA 1S2BA 2HWE3 3AYCA 5GLTA 4Q4X1 3VBRA 1ASJ1 1BK0A 3SH4A 3V0AB 3NKGA 1QJY3 3HAGA 5FO7B 4E9KA 3AP6A 3MFAA 1HXS3 3K3OA 1YQ8A 1W99A 4JVAA 4D69A 2NQYA 1O7FA 5A33B 4XF4A 5FJKA 2BRTA 4E2GA 5CFDB 5GLVA 5C3PA 2WNVC 3WG1A 3FL7A 3KGZA 3TWIA 3VL8A 3MW3A 5FYSA 4QMAA 2WC2A 1L3JA 1N1SA 4PQ9A 5AFBA 1OHFA 1FPN3 2HWB1 1SBDA 4R9BA 4P9XA 1OI6A 5FYYA 5EIYB 4XUQA 5FPVA 4YM1A 2DYCA 1SBEA 3KWVA 2W91A 1UX7A 1POV0 1PIV3 2JDYA 4IEQA 4FPFA 1E5HA 1F5FA 1JOJA 2GC1A 4PF1A 2WR9A 2WRAA 2CAVA 1AR63 2RM22 3JB4C 1KEXA 4IGPA 4C8DA 4HVQA 3MICA 5A80A 3OJBA 2A3XA 5T3NA 4BQ5A 4DXRA 1MACA 3PHMA 5EJ3A 1E5RA 1V6NA 4AQTA 2DU0A 1G9BA 5F8PA 1UO9A 2ZHKA 4LTAA 4CCKA 2PTMA 2HBUA 4FOVA 1VPHA 1F4HA 1SDWA 4XURA 2ARAA 4BIFA 1JZ2A 1I5PA 2C4XA 3DPRA 1UIJA 2UWBA 2XG3A 4IL7A 4Q0QA 1LEMA 3BIEA 2QQJA 5F6KA 3H3LA 1R64A 3LDRA 1POV3 4NAOA 1J58A 3RJRA 1WCDJ 1YQ5A 2Y8KA 1ENXA 3B3QE 4P9YA 2HYXA 1NXD1 3FFQA 1FPN1 2HWB3 5T5JA 1XE0A 1BEV2 1RB8G 5FCCA 1XU2A 5FZEA 1O5UA 2ZACA 3K2OA 3OB8A 4Y20A 3MI8A 4MOAA 4XIOA 4GQ7A 5L7OB 4L8QA 5ACA2 3V0BA 3O5SA 5FP3A 2PLV3 3OBRA 1MEC1 1W6NA 4I01A 4XBLA 1IOAA 2D5HA 3IPVA 4N90A 1LCLA 2ZOEB 2WYSA 4OZOA 2CV6A 3KV6A 1Y9GA 3ZPYA 3LA2A 3N7LA 4BJ0A 1ENRA 2CTVA 2XGXA 4BQWA 3SH3A 1K42A 2WWUA 1E5SA 2Y6KA 3CJXA 2Q30A 1LU1A 4NN0A 2E6VA 4AHWA 4ET7A 4Q1PA 5FYVA 3VHPA 1Y9QA 2W47A 2B9UA 3LF7A 3LE0A 5F6LB 4HFSA 4CP1A 1XOYA 1R1ZA 4W8JA 3WXPA 2VOWA 1ALYA 4XFBA 1HB1A 5BNOA 1LB2A 2R071 2EXKA 5FZ0A 3VB9A 4YW6A 2NM1A 4MXVA 1ULOA 4HVOA 5IFPA 3O7OA 1STMA 1NA1A 3GGLA 3DECA 4FSJA 3MV01 1IG0A 1DGRA 3BPZA 3KLSA 1OT5A 4XCAA 3CHXA 4UYBA 3ACLA 1V9U2 4QKBA 1PVC3 2G9ZA 5FYTA 5A7WA 3RI8A 4BXSV 5FZMA 3A21A 3EO6A 3VKNA 4NE9A 2ZX0A 4XUOA 2RJLA 3RZLA 5I8SA 4LPLA 1RVF1 3POGA 4GULA 4YVSC 2R1BA 4F8AA 5C70A 4RA0A 3N9QA 2FZ2A 1C5HA 5DUVA 5A3OA 1I3HA 3VKMA 1O3TA 4AEDA 4J1WA 5CISA 3BUCA 3AYAA 4MHUA 1YI9A 3AKRA 2FMDA 5FOJB 5DDJ3 1BZWA 1QOOA 4LQRA 3RVHA 4LO7A 4CCEA 2GSYA 5K0UC 3LDKA 2ZX2A 4AOCA 1RUD3 5HV0A 2QQNA 4JGYC 5FPZA 1LOFA 4JHTA 2LRPA 2DUQA 4QPIA 1XYNA 3BTAA 4BDVB 1EUUA 2GNDA 2W94A 4LHKA 4NPLA 2P1BA 1JW6A 2CWMA 4BWOA 5JSPA 3Q8EA 3ZXKA 4B4PA 2E32A 4BQ2A 1KFUL 5A7NA 3H1YA 3L2YA 3AP9A 4XHBA 4LT5A 1JHJA 4XQWA 1MVQA 1SFNA 3P5BA 2OYZA 3TN92 3ZKUA 2V72A 2LS6A 5C4WC 1WW5A 1HXS2 4GD4A 3LEMA 2WNUC 5J1XA 3SEPA 3W5MA 2DBNA 3G6JB 1QJX2 4LIVA 4COUA 4ES9A 4E4ZA 1EPWA 2W92A 3V64A 4HKLA 4YNIA 1LHNA 4AAPA 1O3QA 2YB7A 3HN1A 3VBHB 1RUH3 4XJZA 3SITA 4DQAA 5IVYA 3JU9A 4N53A 5IJRA 4AEMA 2P3IA 2ADEA 5BPXA 4XHXA 1YQ2A 4TZDA 3OUHA 2VCAA 2G4IA 3OGSA 3ACFA 1C5IA 1RUG3 4UW5A 4NPMA 5HCFA 2CYFA 1NUKA 5A7OA 2BGOA 2EIEA 3C8XA 3DGTA 3ZXJA 4CVUA 1BKZA 1CAVB 4EROA 1FV3A 4META 4JKKA 2HWF1 2QJVA 4LNVA 1VMJA 4AF9A 1IZ3A 3AXDA 4HKWA 3VD4A 2UWAA 3WY6A 1CGPA 1OPOA 3PJQA 5LCWL 2CDPA 3KHCA 4ARXA 1U5XA 2DU1A 1AYN1 1BK1A 4H3WA 4RS5A 5LASA 4G9SB 3AKSA 1LOBA 3TRSB 3V56A 1EV11 1EYBA 2VR4A 4D7TA 5K4LA 4ZKTB 2VUDA 2AH2A 1SEFA 4O65A 5FQ0B 1CZSA 2EAAA 3ATGA 5FJHA 3AC0A 3NW4A 4A6OA 1ODNA 4XF9A 4YLZA 1DGWA 1O4ZA 3AMQA 5FY9A 3T2OA 2R16A 4FPYA 2IUWA 4MGQA 4YWAA 2PYTA 1SPPB 2UURA 3J7LA 4MGKE 1EP0A 4CA9A 2DTYA 1F2NA 4M0HA 5KXEA 4AVVA 3OEBA 1DGLA 1ZRFA 2XPJA 2GH8A 3H7JA 3NAPB 3H1MA 5BNPB 2GN3A 1BBT2 3LIHA 1VLNA 4LITA 5FY4A 2ARXA 4YZ1A 1LKNA 1W2TA 2JDZA 1NKGA 4GWIA 4QKDA 4TSVA 3DEMA 2HWB2 4YZ3A 1BCXA 4P5YA 4ISRA 5FFOC 1AYN2 1H2NA 1MS5A 4Q26A 1H4GA 3T2PA 1HXS1 3Q9OA 2WSVA 1AZDA 3GHNA 3WNNA 1XNTA 3S6PA 4AEDC 1L7LA 4OFGA 1ZX5A 2ZMKA 4JGZA 4DEQA 3N7JA 4N53C 1W9TA 2HBTA 3WZ1A 1Q43A 2VBDA 4QXKA 1ASJ3 5KC5A 5LZ6A 2FMYA 2I07B 1T6GC 2QNKA 3LZZA 1GFF2 3KV5A 4UW4A 2DWRA 2PXJA 4CDXB 1OBNA 4MV2A 4GH4B 4N43A 3C7EA 1FX5A 3IT8A 2XWBB 1DQ0A 3KCYA 1R082 4FPLA 1Q8PA 3KB5A 4R4ZA 4Z2WA 1IPKA 2VQTA 3OD4A 3B9CA 1UD1A 2D43A 2H6BA 5DDJ1 4UFKA 3OGGA 1WUVA 3KT4A 4HPKB 3OY8A 4QHZA 1ZZ8A 4TLGA 5FOBB 2IXIA 2EICA 1PMIA 4A6SA 1TEIA 4RQPA 2VULA 3TBDA 3VHRA 2D3RA 4OI4A 4P08A 5EQUA 5JXHA 2B8MA 1T6BX 2HWC1 3JD73 4HBNA 1SLLA 4CEWC 5IATA 5IHRA 2B7YA 4IE7A 2R072 1WD4A 4QAWA 5C7GA 4Z82A 4Y5SA 1UOGA 1PIV2 5FPBA 3OPTA 2XBO1 4Y5TA 4HONA 2OW4A 2VZVA 2DUPA 1FT9A 4W6XA 4NHYA 2R7EB 1QOTA 5GALA 5C6CA 1RUF1 2A1XA 5BNNB 2XKOA 4ZU5A 4K9SA 1C57A 2WBKA 3AMPA 2YBPA 1YQ6A 3OYWB 5C8CB 1W8ZA 1VBA3 2GH2A 1DZQA 1YEWA 3E5XA 3WDTA 1H2KA 5GJ6A 2WLPA 4IEPA 2DFCA 5IVFA 4AAXA 2VO5A 3LEIA 2JEMA 4LORA 3VBUB 4CE8A 2RE9A 2DV9A 3ETQA 3ZYHA 4LBQA 3RMXA 3ZXFA 5LBCA 2R30A 2W46A 2XMLA 5FRAA 3WG2A 1LRHA 1VBD1 4YYOA 2CDOA 5EHDA 5L19A 5A1LA 4QM8A 3ZX7A 4INDA 5KHHA 4Z07A 4COZA 5JXGA 2R061 5DAXA 5ABJC 1TMF1 2HWE2 1SLBA 2XJQA 4PDWA 2JG8A 4XJ8A 3NVCA 2NMOA 4L11A 3TOJA 3HQRA 5E88A 3DKWA 3E1F1 5L9VA 4JDOA 1UMHA 3PNAA 3M3IA 5DAVA 1XC6A 1SFPA 2J1UA 2EAKA 3NL1A 4KWKA 1X9PA 4YPJA 4EYUA 5LWBA 5ACA1 3S5QA 3M3QA 3PVOA 1OMIA 3HPNA 4YW7A 3HD8B 5FXXA 2G1MA 4AI3A 4HN1A 4W4ZA 2RS53 1MQTB 1IHMA 4PLOA 5DAWA 4AEKA 4H2AA 4GZ9A 4A7KA 2FDIA 1RXFA 2D6PA 1TME1 2VL4A 4MX3A 1FMD1 5A6YA 1NT0A 4FO9A 1FOD3 4ZS3A 3R4UA 4JRAA 4XFIA 4JGYB 4BIOA 5KXBA 1XB9A 4QB1A 3D0SA 3J9SA 4NIGA 2YGMA 3EBRA 4XFAA 1WMEA 5FWJA 2YXSA 3TEXA 1UZWA 2FQPA 1DYPA 2QQIA 3RGBA 1XQNA 1PNGA 4LEJA 2PHFA 2VZRA 1CN1A 1Y9MA 4P9WA 5FBZA 3O0VA 5JR7B 1RC6A 5FTTC 4L2NA 1GZCA 2G9FA 1NLQA 5FPUA 3AVRA 2R063 3ZYRA 4IEVA 2VPVA 1N47A 1QQP2 3F2ZA 4FPCA 4CCMA 2JB8A 2PQQA 5JCTA 2BZDA 1X8EA 4MO3M 2CGNA 1PK6C 2BWAA 2VU9A 1UOFA 2VZUA 2XH6A 1NCQC 4TYSA 4XDOA 4XMIA 3O1MA 3H8RA 1K12A 3OBAA 4GB31 4OVEA 4QX8A 5KC6A 4TN7A 1REDA 1PO22 4AQSA 4N9IA 2P3JA 4EJRA 2C26A 1MQTA 3H50A 2W1WA 5F39A 3FHAA 1VRH3 5ABJA 1E5IA 1OQDA 1R091 2K46A 2FZ1A 2R043 3WSOA 2VVDA 2V4AA 2WN2A 4GWJA 5C5UA 4QPIC 3K46A 5A1AA 1W3VA 2JG9A 3ZFEC 3KVAA 1GYKA 4Y24A 3KV9A 4AVSA 4UAPA 3ES4A 3T1LA 2PLV2 5JSOA 4Q4Y2 2UY8A 3HBKA 2VD7A 3ZDSA 1QH7A 1YO8A 2JG8B 3GCXA 1GOHA 4IEWA 2CHHA 1ZRIA 5LRRA 4HK9A 3D0JA 4UBHA 4QKFA 5FBJA 4Z1VA 1JUIA 2AEZA 4CXYA 4P9GA 4KH9A 3VKOA 4YGCA 2WL1A 1J84A 1B09A 1CQ9A 2BYVE 1H9PA 1WW6A 4PIZA 2JKBA 5I93A 2HYKA 1UOBA 1UQXA 4NO4A 3VBUA 3BTZA 4FT8A 3VBUC 2VE1A 3AMNA 5CEHA 1GANA 2HEYF 2J1AA 4XJUA 1KJRA 4A4AA 5K8SA 2A73B 1RUC2 1I1EA 4D94A 4QWNA 4DNYA 4EZ4A 3UESA 2WWSA 4BHPA 1OVPA 2ZJCA 1DQ4A 2E31A 2WO1A 2RS51 1U0AA 3AZZA 1RUG1 3EYPA 1PGW1 5J09A 3LQCA 4GMP3 1PK6A 3ZXAC 1OA4A 1ND3C 4E8CA 1G7YA 3GZTB 4BOWA 5DQ0A 1JODA 5BNNC 5KXCA 1TNRA 3PIJA 4E2SA 3LEKA 1GLHA 1CAUB 1Q3EA 3H7YA 2VQ0A 3ELNA 3HT2A 2DCTA 4V2VA 2B45X 4EWEA 1W6MB 3RWKX 1LECA 2HWD2 4UI9L 1I5ZA 1ZRRA 2DVDA 3KMHA 1QXPA 2X05A 5C71A 3WW1A 3PUIA 5LA2A 3OY8B 4HPKA 1PHMA 1UZYA 1X8MA 5FMBA 5LA0A 1JYXA 4JRLA 2JE9A 5JMOA 3WQBA 4BMEA 4QX7A 5E8AA 4Y1XA 5GZFA 1H6YA 1TNFA 3IKWA 5T5LA 1NG0A 2D93A 3NV1A 3FWEA 3JBG2 5H9QA 5A32B 4D6QA 3D82A 1UZVA 2YGLA 3EQEA 3MYXA 4QQHA 1W0OA 1SBFA 1RYYA 3DXTA 4JDNA 4Y1ZA 5FYCA 2ENRA 2IVJA 4Y3OA 3NV3A 3UT0A 2TNFA 1KGYA 4IUGA 2WUHA 1I9RA 3A4UA 4PBPA 4AW7A 3MLKA 5A6XA 4HMZA 5CFDC 4Q2FA 3ZN5A 3TN93 3VBSB 3USSA 5A3TA 5A3LA 1RUF3 3WG3A 3LKJA 2W95A 2EVXA 4EWAA 2NP0A 4GB32 3DV8A 1CIYA 1V70A 2DVAA 1MEC2 4DY3A 1BLZA 1NLRA 4K1ZA 2XVKA 5FY0A 2TBVA 2VOKA 3WF4A 4B1MA 3VBFC 2C24A 1TME3 1JUHA 3I49A 1UU5A 1X7NA 3ZR5A 1S0IA 2E26A 2WWJA 3J8F1 1RINA 4M3CA 2RR12 4N7IA 5FZHA 5BNPA 1CWPA 1D2SA 5T55A 4AL9A 3PUAA 1ASJ2 4Y5Z0 2FDGA 1COV3 4LO6B 4KWUA 2GP5A 2J22A 4HK8A 1ND3A 1WWYA 4WVZA 1RVF3 3WF2A 1FNYA 3ILFA 2PHLA 4I0AA 4SLIA 3ZYGA 1CAXB 1LULA 1GKBA 2DVBA 2VQAA 4RS5C 1W06A 3HMYA 3WP4A 1PVC1 2QQWA 2W68A 1MS4A 3BU7A 4URAA 1W8HA 1H6XA 1UY4A 4NHXA 4DOUA 4DRRA 4DXZA 1FMD2 1VB4A 2HEVF 3TEYA 3R4SA 3A0KA 5J98B 1DQ5A 1IS4A 3I2DA 2I74A 2Y6GA 3E5UA 3AYDA 4H14A 5K9YA 4XTPA 1OFNA 5FZBA 1BEV1 3O1VA 1SLIA 1VBD3 2YPJA 3ZFGB 4IV3C 2E63A 1US3A 5AVPA 2R073 4YVWB 3U07A 4QKNA 3NNLA 4CYDA 2J1VA 4G4FA 4QPGC 1J1TA 1AVBA 4XIKA 1LJ7A 1VB2A 1D2QA 4OQ8A 1NZCA 4MLOA 1POQA 4DZGA 1NA1C 5DZFA 1O91A 3NRUA 5CU1A 4KWJA 1OLMA 2ADDA 2R6QA 1F8VA 3UYJA 1VMHA 1VBD2 3O1TA 1QQP3 1MEC3 1NLSA 3RYRA 1UW8A 4ASMB 2AZ5A 3K51A 4MUVA 4XFHA 1OOPC 3BODA 2F17A 3PUSA 3I59B 1R1A3 3THDA 4QX1A 4NMIA 1PZ9A 1NQDA 2VTFA 1JS9A 4QX5A 1BBT1 2ARCA 1AYN3 1MZEA 4GIQA 5CFCB 2AGSA 1W6QA 1YWKA 2VGDA 5I0SA 1JOBA 1RUH2 4YG6A 2VQUA 1Z78A 4CSWA 1AXYA 1ZZ7A 3UV9A 1W03A 2JD4A 3B7MA 4IDZA 3EMRA 5LB6A 3U0ZA 2WAOA 1GWMA 2ZGTA 1U5YA 4NRMA 4PHZA 4OHWA 1X9TA 4G3YC 1CAXA 5DUUA 3DCQA 3H42B 1N3OA 4FOQA 1Z7S1 2Q8DA 2RMU1 1VR3A 5AFEA 5FPLA 4XFFA 1GSLA 2P2KA 3AB0A 1W9YA 2D5FA 3T30A 5FXVA 4YARA 3VGIA 3PMEA 2NMNA 2DVGA 4Q4X2 3VL9A 2JD9A 3TYJA 1DHKB 3UGHA 4BQXA 1G9AA 5JLVA 4FOWA 3POWA 4TTGA 2Y6LA 3VZOA 1GZWA 4LA3A 3VDCA 3I2IA 4CDQB 5FPXA 1HX6A 1X82A 4CUBA 5K0UB 2D6MA 3HJRA 4YZ5A 2OVUA 2QBXA 5D1IA 1JHNA 1S0CA 4A45A 3AKTA 2BOJA 1S2KA 4MYEA 2OX0A 5F3CA 3VBSA 1HLCA 4AVBA 5FO9B 2VM9A 4XAAA 1AL23 5FZ4A 1IS3A 1LOAA 2LALA 1SMVA 3AVSA 4CXXA 1RHI2 3AZWA 2IXHA 5FLJA 4WM7B 4CUAA 4MGIE 2A5ZA 2VZSA 2ZGUA 2J1EA 2PQSA 4CPBA 4D6RA 4CDWC 4L99A 2IXCA 2CAUA 2QDNA 1H30A 3I2KA 4A7ZA 2BGPA 4JKLA 5E89A 4WZCA 4XMAA 3WG4A 4AHYA 2RDQA 3MIGA 5FY1A 3FN9A 5HPOA 1NCRC 2R0FA 4COVA 3QBQA 5LEKA 4AFMA 4CEWA 2CGOA 2GNBA 1CAUA 3ZFGC 1UWWA 4AGGA 1AL0G 2IWGB 3E6CC 1AXZA 1SACA 4GH4A 1H1AA 2AACA 3B00A 4LKFA 4N43B 3RZGA 3H9AA 4WM7C 4E4SA 4NHKA 3ZSMA 4WM7A 3B94A 4QDRA 1NZIA 3LEGA 1AX1A 4JAAA 4ZXEA 3VZKA 1RJ8A 5D8AC 3OBTA 3BOWA 4HL0A 4FXKB 4B3NA 4HVRA 5AC91 2VMDA 1L7QA 2RJ2A 3PL0A 4P14A 4QXHA 4B7EA 3MHZA 4K6BA 4XACA 3ZYJB 2QUOA 3SQOA 1H9WA 1DFQA 3IIAA 2XXZA 3MIBA 1NOVA 2DBIA 1XYPA 1WW7A 3CIHA 3RYPA 1LHUA 2D98A 5F3GA 2VMFA 1KS5A 1QQP1 4JGZC 1V0AA 1MS0A 3NAPA 3NSTA 2VZQA 5DZGA 5FP7A 1MS3A 3ACHA 1KXGA 3TNQA 4CCDA 1QNWA 2FCVA 3UJOA 1UPSA 3N35A 3WINE 2A7AA 4CCCA 4NIHA 4JKMA 5FY7A 2BVBA 3WCSA 4E4DX 1IKQA 3UJQA 4X8PA 3JBG1 3K4ZA 4PF5A 1W2NA 2RHPA 4XEZA 2XVLA 4DPNA 3PMSA 2PLV1 3PVEA 1JZ5A 3N36A 2EA7A 4UOJA 4XILA 2YDEA 2PA7A 1JTZX 2SBAA 2ORZA 4PQQA 1W6QB 4J6GA 3CJIC 5FMCA 5ABJB 5CFCA 4A3ZA 4PJYA 3WQ7A 3U14A 3E6BA 1GQPA 4LBMA 1O4TA 1UU6A 3WD5A 2YFZA 4UW3A 1FI2A 4DY5A 2ZKLA 5BV6A 2YBKA 2CU5A 1LOEA 2VOVA 4FPHA 2RVAA 4K40A 1GOFA 1HN1A 4QQPA 1VJ2A 3SHRA 2O8QA 4AVTA 1GU3A 4O9EA 4N53B 1O5LA 3M1HA 4FI9A 4QGNA 3SEEA 3KM5A 3R05A 5ANQA 2O0OA 4PT6A 3VZNA 4XUNA 4BCUA 3POSA 5JIUA 3T2TA 1F35A 3LPFA 2VCCA 3HT1A 1WCKA 4LK7A 3FFZA 1VE0A 2C9AA 1AF9A 1NCQA 4LXLA 4ZZ8A 3SC7X 5BNPC 2OUJA 2RS12 1C8M2 4LMFA 4KBBA 2QDRA 3EJKA 1UN1A 3KS7A 4QU2A 1VMFA 1ND2A 2FBEA 4CUGA 2X29A 4YVWA 1UIKA 2PMWB 5DAPA 5K0UA 2VNRA 3O1UA 1QJX3 1G9CA 2A6XA 4HSJA 1GZWB 4FP2A 3M8LA 4FAHA 3DKQA 5FYIA 1KFXL 4PDWC 5T5OA 4NHMA 4EWDA 4QX3A 1ULPA 3VDDB 1CIWA 1DU3D 5FAXA 1REFA 2XBO2 2ZZQA 4KG8A 4YZ2A 4AGRA 2RDNA 4I3GA 2XLGA 2GNTA 3ST7A 3VHOA 3ZSJA 1BMV1 4XDPA 2QQOA 4ZXKA 5C9AC 1PVC2 4URTA 2QE3A 3MO4A 1HIXA 4MGYE 4OQ9A 1JN2P 3OUIA 3OGRA 3J7NA 4S2HA 1Q56A 2GAUA 2XLFA 5D21A 2YC4A 3VDDA 3EXUA 4KBZA 3WW3A 4I30A 2MEV3 4Z92B 4LBQB 5JUVA 1A8MA 4O7XA 5G04L 4AEDB 4CCOA 1CZTA 1OSGA 2QKDA 1ZRDA 2DCKA 3VBSC 2PAKA 2I2SA 1UL9A 4OHYA 4M4PA 3KVBA 5DMYA 2ET7A 1NCQB 2OT7A 2XL9A 4XFCA 1UY2A 3ILNA 3QACA 4QGLA 4DUVA 2YC0A 4XAEA 4E8DA 1TVGA 3RG0A 4YM3A 1QKQA 4FQ4A 5BYNA 4NR1A 5F5AA 2XB6C 3A7QA 2VJXA 1AR83 3FUOA 3ES1A 1XNBA 2JDNA 3V65A 2ZCWA 3GALA 2WIIB 2WZEA 3O0WA 3WOGA 4BMBA 3N9LA 4JCKA 5LEJA 3C2UA 1EY2A 2PAMA 1OH3A 1MZ6A 5FZ9A 1LEDA 3ZPOA 3I3EA 4B8EA 4CDQC 4JGYA 2O14A 3GBGA 2GC0A 2JDMA 1UKRA 1VRH2 4NRPA 4B4QA 5I0DA 3D8CA 1ZRCA 4HETA 1LGNA 5GLZA 5CG9A 4DXSA 5GZEA 2Q1ZB 2WO7A 2CGPA 1LHVA 2GU9A 2ZEXA 2VVFA 1LOCA 1WLTA 1QJEA 3ZFGA 5H9RA 4YGBA 2VVEA 5DZEA 5GLWA 4WVVA 1PO12 4KNCA 3USUB 4BQYA 3B93A 2DCZA 4TWTA 3BI3A 1R093 1DQ6A 2EALA 2ZGSA 3FZ3A 4Y20B 5EXOA 4LLOA 5HCHA 4P02B 2ZS6B 5IUQA 1A6CA 4LBOA 2JJ6A 5IK5A 1OVSA 1RUG2 3UGFA 2ZA9A 1S2EA 1YFYA 1YXWA 4OHVA 1A78A 4ZY9A 4YGDA 1BHGA 5EP9A 1BJQA 1XJAA 2ZGMA 1BEV3 3ZOIA 3GBFA 5JR2A 3O1SA 2ET1A 4HSLA 4KGQA 2LM3A 2BFUS 2PAEA 5KBFA 2NZ9A 4ASLA 4LBJA 4Q4V3 3KF5A 2VUCA 1ZM1A 4PIXA 2GMMA 2BBAA 1CPNA 2VTXA 3FMGA 2KA3A 3JQXA 4RFRB 1CD3G 5C8CA 3S0MA 5FZ1A 4RSUA 5ERLA 3IN9A 5F5IA 2JG8C 1AR73 5A7PA 3CF6E 1FOD1 4MHRA 1JZ7A 4F7ZA 3DYOA 3GNEA 2VOXA 2E7TA 1D0HA 3G7DA 3ZFEB 4MG2A 1PNFA 1QDOA 2AREA 4XQDA 2VTXJ 5J37A 3FBYA 2XJTA 4PBOA 5A32A 1VBE3 3GYDA 1Q8OA 2MEV1 3VD5A 1YLLA 1SLAA 4CEWB 2CWSA 3CZUA 2WT0A 3MZHA 2XJUA 3ZN4A 5I0RA 5CKMA 4XCBA 1AR72 5FWEA 2X8KA 1ULCA 2PHXA 1RMU2 3VKLA 5LRSA 1OA3A 5C5TA 5HBAA 5JIAA 1W6MA 4BA6A 2OPWA 3I7DA 2PFWA 4GA9A 4AHXA 4ATFA 1VBB1 1UMIA 2A75A 3ZFFC 1QU0A 2W9XA 1S0JA 3APBA 1AR92 1WCSA 4HKOA 1A8DA 1UKGA 2BWCA 5FZLA 4CPBD 1IG3A 5J7MA 2A6WA 2P34A 2W3JA 5L73A 3HQUA 3N4MA 1LHWA 3POEA 2IXLA 4FFFA 4I0BA 4CU6A 2QZ2A 5E1RA 1G6NA 5JPNB 3S57A 2QQUA 2A3YA 3T0BA 1FAYA 3OD0A 1S0BA 3WNKA 4FCAA 4XETA 5JVVA 4Y22B 5A7QA 4CDQA 5FPAA 1DQ2A 1RUI1 1QHDA 5FMOL 4AFBA 5EV7A 4HT1T 3KT7A 2ZAAA 4QPWA 5FV3A 3ZIWA 1W2UA 3LD8A 1AYM2 1Q8SA 2RJKA 1JYWA 1M06G 2DDUA 4JV4A 2JECA 4YSFA 2ZX1A 3LOBA 4PDWB 1YNAA 3AXEA 5E6HA 5EYYA 3NNGA 3ASIA 1XE7A 4FFGA 1V6MA 3H3UA 4XXPA 1GOGA 4Y1UA 5L7OC 1IS6A 2HWD3 1PM7A 4QPYA 5EJ1B 5J48A 1RGSA 1D4M2 3HIFA 3KCCA 3MDPA 4RS5B 3CLPA 4I02A 4N9HA 3KGLA 5C3OA 1L7RA 4RHV3 1ST8A 4Q4W1 4IV1C 5IYYA 4ONUA 2V5DA 1J59A 2OZJA 4BU2A 1RJ7A 5BY5A 5DG1A 1ND2B 3VBRC 1W6OA 1YC61 2YG0A 4QDSA 1O3SA 3AZXA 1W8TA 2J7MA 4CU8A 3OYWA 1RUNA 2ZABA 3WNPA 3K48A 3MIDA 2JDHA 2ZHNA 3OBZA 1JZ4A 4M01A 2P37A 4EN6B 4IXLA 3FC0A 4HN0A 4QB6A 2EF6A 4LK6A 1F5JA 1SFYA 4FAGA 5EFUA 5IVVA 4AI0A 3I2FA 4LE3A 4HOOA 4QD2A 2WO2A 1BXHA 1GNYA 3OCPA 3MW4A 1F9KA 2VNVA 5IWFA 1N3PA 2VCMA 2JICA 1JI6A 4LE4A 4OI1A 3RS6A 1UY3A 3POJA 4GB33 4GKXA 3OF1A 4LBQD 1BMV2 4NROA 4D8MA 2GNMA 2V4VA 4RQPC 1XNCA 5A3UA 1N3QA 4LO8A 5F5CA 2F6BA 1JBCA 3BN6A 4RQPB 3DYMA 3U78A 4J25A 4EN0A 1FATA 1UX6A 2RG4A 2X09A 3E6DA 3IMMA 1DBNA 1POV1 2YBSA 1F31A 1PVXA 4NHLA 1C4RA 3S5AA 2XR4A 2CSGA 5T5PA 3IPVB 1W6NB 2D7FA 4FXGB 3AL6A 4XABA 1JH5A 3MF6A 2BDRA 3LOIA 3WP5A 3KHBA 2XJRA 1C8M1 1W9SA 1WA6X 2A70A 4Q0PA 3T0AA 2HWF3 1SQ4A 3FUQA 4NJ4A 4NWVA 1TMF2 4M4RA 4QPIB 1LGCA 4P9LA 1WMDA 3SCHA 1C8M3 2D3SA 2XWJB 2UY9A 4I0WB 1PMHX 3LSDA 2DUOA 2RS52 3AK0A 4CP2A 1C8NA 1GNHA 1ND3B 2WZR2 4Q4W3 1JOPA 1LAJA 4U36A 3OTFA 1A34A 3NNMA 1UNBA 2Y6HA 4NPRA 2MNGA 4KWLA 1ZREA 4C91A 4R8HA 3PURA 2LW8A 3HWJA 3KD4A 4M3CB 1V6IA 2VZPA 3CZJA 2W2IA 1IPJA 5FZAA 1G86A 4GWMA 2GN7A 3R4DB 2WFF1 5JDBA 4XBNA 2L9LA 2RR13 4OMDA 3FLRA 5FKBA 2FDKA 4OI0A 5DG2A 4O9GA 4AI9A 1BQPA 4XUPA 4D3WA 3MIHA 1OUSA 2WS91 5GZCA 1F15A 1W8OA 2JKXA 2J1TA 4MVTA 3SCGA 1EUTA 3BTYA 3GZAA 1RUE2 5A7WB 3TNPB 3GHMA 1AL21 4QU1A 4KQ7A 2Y0IA 2JIJA 4A41A 2ZGLA 2RS33 2MPFA 1S4CA 4FVVA 2ZGPA 1UXXX 2W0XA 2Y26A 1OUXA 1UPIA 3A23A 4H55A 4NIIA 4A42A 5FQ0A 2Y0OA 1IQDC 3PTYA 1HDKA 2Q5TA 1YYNA 2IC1A 1WKYA 4IEXA 1O59A 3W58A 5JWPA 1GQHA 2BJSA 1OH4A 1HB2A 1RMU3 2HWE1 1VBA1 4BH9A 4QT6A 3PUQA 5KR7A 2VMCA 2XHNA 1GWKA 2UYAA 4D0QA 2B42B 1ZBA3 2PHWA 3B02A 2G19A 3B5LB 4W6YA 2EXIA 4LUMA 4OUSA 1CAVA 1BVP1 2W52A 2YU2A 2RS32 4NUBA 1Q8QA 2HWF2 3M3EA 4KU7A 4FFHA 1UY1A 1OLRA 1JYNA 1RUD1 4NIDA 1Y3TA 2V73A 3VBOC 2WQ4A 4EQVA 2XOMA 2Z79A 4X6RB 3RZHA 2Q8EA 3KZ4C 1GBGA 1QF3A 1HQWA 4R9CA 5FZ6A 3VBHC 1PK6B 3DPRC 2IZWA 5A3NA 3THCA 3VBHA 1LOGA 1UF2C 5FYZA 2QCSB 3NV2A 5CB7A 2BPA2 1URXA 2CNAA 3SMHA 3VD3A 1G8WA 4ZU4A 1VBA2 2UYBA 4XW3A 3POBA 4ZONA 3ECQA 1PGSA 3RJ2X 5C4WB 5IFTA 4RL7A 3IDEA 2VOTA 4NAMA 3W21A 5KHGA 4S2GA 2EIDA 4ITCA 4ZPIA 2FCUA 5GKAC 3HQXA 3MPBA 1NQJA 5HV4A 3BTXA 3H3ZA 5F37A 2BOIA 2XDVA 2BBVA 3TN91 4OUEA 5EWSA 4IE5A 1QJZA 1REEA 3RDIA 5B2GB 4XE9A 2X53S 4Q8LA 4Q4Y3 4WV8A 5FZ3A 1VAKA 3I2OA 1CAWA 2W1UA 5EYXA 4DFSA 1ODMA 3W20A 2WFF2 3GZUC 3RSJA 2BERA 4KMQA 2VZ3A 4BQ4A 3WDYA 5JOWA 3I97A 2JG9B 1RITA 2JWPA 2ZX3A 2K0GA 3NNFA 1SCRA 2WA4A 4W50A 4XJWA 4Q0UA 2QQPA 4ATEA 3M2MA 1HN0A 4PI0A 5FO8B 2RR11 3MFCA 4UBGA 1LGBA 1QJU1 2CY6A 5AC93 1GQGA 4QXCA 2WFPA 3Q8AA 1EPZA 2NLRA 4JTNA 4K20A 2WINB 4QM9A 1AYM3 2WFF3 2ZPXA 3I59A 1U5ZA 4MGZE 5IVBA 1M4WA 2OA2A 3ZSEA 3WW2A 1JXNA 1WA4A 5I0TA 2VXRA 1HB3A 1CZVA 1PZ8A 3MBWA 1AR82 3GJAA 3GJBA 3T09A 2RMU3 4K8RB 5CYYA 4BK4A 1W8UA 5H9SA 5I0UA 5C8CC 2ZEYA 4XF0A 3J8F3 1O3RA 2HEWF 2BNOA 1TQ5A 4RR3B 2J1RA 1UU4A 1AX0A 2Y6JA 4EE2A 4C1XA 4DO0A 1WW4A 1WZXA 2WT2A 2VUJA 4QHOA 3PTRB 4XDQA 4BK5A 1DGRN 5FZCA 2W39A 2B9VA 1W2AX 1WGPA 1LOFC 1W2OA 2WABA 4HZFA 3FX3A 3SLIA 3ZYFA 1AR61 2Y33A 4F83A 1UYPA 4AFCA 1YJLA 2HJIA 3P3NA 3S7IA 1AL22 3IWZA 4AEJA 3WVJA 1XPWA 2WJSA 4K8FA 1W6PA 1PO13 2XQXA 5FP8A 4LIUA 3WV6A 3VHNA 3IIIA 3M3OA 1V00A 4C0BA 5BXXA 5ISLA 2P17A 3ACIA 1JYCA 3PIGA 3V0BB 2IFRA 2VCBA 4AYUA 5L7OA 5IK8A 4MH0E 4QPGA 2WZ8A 4XJ9A 1YCIA 5JI7A 3LFIA 1AX2A 1MS8A 3U75A 1SZBA 2XLAA 2XUMA 4CDXC 1Q8VA 3VBFB 5AC92 4WZFA 3K75B 1VRH1 3JB8A 3FE5A 4MGSA 5AVAA 5EZWA 5F9TA 1CX1A 4K7JA 5IW0A 4NWWA 2VY0A 1ZBE2 1PZ7A 2X5IB 3I4IA 3K4AA 1W90A 1J3QA 2JXAA 3MLJA 4UF0A 5G05L 2XHKA 4GAZA 1DP0A 3OGJA 3M70A 3BALA 3OPWA 4OLLA 5H9PA 2A6YA 2VW2A 4YW4A 4ES8A 1U5IA 3OUJA 4LOSA 2JE8A 1SLTA 5BNNA 3NMBA 5I91A 1JYVA 5CG8A 4ISQA 1V6OA 2CL2A 4Z8BA 2WZR3 4Q4W2 3ZSKA 4NRQA 3AP5A 2HWD1 4OYUA 5FUNA 4L0PA 1Z0HA 2FDHA 5LW9A 4Q5OA 4A3XA 2LTNA 4AI1A 4KG0A 1COV1 1BBT3 3ON7A 3BKZA 3CL1A 5JOZA 1APNA 5L36A 1CPMA 2P6CA 1TG7A 1O8PA 2ATFA 1JZ8A 5JSRA 1BYHA 3M4FA 2RDSA 4LHNA 4YG3A 1R083 4EN9B 4HXCA 3O1OA 1YHFA 4AG4A 1PO21 1YIPA 4HG6B 1COV2 4CRQA 4OI2A 2AC1A 3GF6A 2GC2A 2NPIA 2ZAHA 3E97A 4YW2A 1SG3A 1IKPA 3N7MA 3N9PA 4L9BA 1W8NA 1ULDA 3KCXA 4CDXA 3F95A 3VBRB 1GUIA 3DL3A 5E16A 2PHTA 1RMU1 4YVSA 3JD72 4ZS2A 4ASKA 1CONA 3NKTA 2Z69A 1RXGA 3THPA 1RUF2 2RS13 4LUKA 1GZ9A 1ZZ6A 1KDMA 5FYUA 4DINB 1WCQA 2RS11 4SBVA 4IEUA 2ES3A 1RUOA 1OXCA 2B46X 3DPRB 3R6SA 3NV4A 2B4KA 2O1QA 3W59A 1HB4A 3WT3A 4JDMA 5IVJA 4LHLA 3WHUA 5F2SA 4N43C 3ZR6A 3BOPA 3NJXA 1CVNA 4BYYA 2OPKA 2WAAA 4XUTA 2WS93 4CDWA 3I54A 4XYXA 5LK5A 2R1DA 4Q27A 4IE6A 3P6BA 4AR2A 3POFA 1H8VA 2JG9C 2ZXQA 3I2HA 5CADA 1YRZA 4Q8KA 3SH5A 5FKCA 3D6EA 5F5QA 5FP9A 1SPPA 1X33A 3C7GA 3N9OA 1PO23 5FZGA 1VBB2 2BEOA 4M0NA 2PN5A 2ERFA 3LFMA 1KITA 5SV8A 1R081 2WDBA 1AJOA 1Y43B 5CIRA 1JZ6A 1V6KA 3AJYA 2ZGRA 1AR71 3AP7A 4GJYA 2HWC3 4UFIA 2WO3A 3KQ4B 2P3YA 5DN2A 3H0OA 4FBFA 4B29A 2Y60A 2C9KA 5DUXA 1D0GA 4NIAA 5A70A 5C33A 1PGL1 1ZVFA 4Q4V1 5ACA3 1KQRA 4WVWA 3ZFFA 1AR91 3RWNA 5CKQA 3LPGA 2E9QA 2DCJA 4EN8B 1VP6A 1CJPA 2HLEA 5LA1A 2JDPA 4Q29A 5A33A 3O1PA 1TMF3 4OHXA 2NYYA 2EIGA 4JQRA 2J42A 5IVCA 4IGQA 3V0AA 3I3MA 1NXMA 5FP4A 2VBBA 2OIIA 1KD7A 1ZZCA 1OLME 4ORFA 4GWNA 4MXWB 5LATA 1MVEA 5FK7A 3ITQA 3OSDA 4LKSA 3T1MA 3AJZA 2MEV2 4XC9A 5J36A 5TSWA 1VAMA 4YG0A 3WP6A 1RUJ1 3NJVA 3D5OA 3UKVA 3AM2A 4FFIA 2E53A 2R041 1DGWX 1XE8A 4KL1A 1LU2A 2WT1A 2VZ1A 3WLUA 3GBWA 4S2FA 3ABZA 4RFT0 1QDCA 4W65A 1EV12 4Y1YA 3AX4A 1MS1A 2VAUA 1RUE3 1DQ1A 2KR2A 4IETA 4LBNA 4LO5B 5FZOB 5A6QA 1JYTA 3BB6A 4Q4X3 4XF3A 4YGEA 1QH6A 5A6ZA 3OOXA 4BISA 4KGGA 3DN7A 1RIRA 1CX4A 2F4PA 1XRUA 3I3BA 4QX2A 4R9AA 1PO11 1WBFA 3J7MA 2F4LA 4YW1A 1C3HA 1KS4A 3VDBA 4Z2AA 1VBE2 4AVCA 2BVVA 3IAPA 3CO2A 3VDDC 2ZTNA 3ZVXA 2B39A 5C3SA 1EV13 4M3CF 2BNNA 2WQ8A 4LJHA 1UYXA 3RPQA 2R0HA 1W04A 3NWKA 1H8TC 2VZTA 4C90A 5JZGA 3ETPA 1O4YA 3O0XA 2WS92 4M3CE 4Y1VA 3W9AA 1DDLA 1S0FA 5CKNA 1GZTA 2P6HA 4ZZ5A 1IGOA 4IGOA 2D44A 4UXAA 2KM2A 3VLBB 1Z7S2 2K2SA 4CP9B 3WX5A 3C7OA 3T2QA 1G9FA 4E4HA 4AI8A 5F3IA 2VW0A 1UMZA 3ZLIA 3MEPA 4WVMA 3TB0A 1ND2C 2WSUA 4EV0A 1VBC2 2WNVA 3IZOA 1XBFA 4Q0SA 3WEZA 3H8UA 3CKHA 1XSQA 2C0ZA 3WQ0A 4AFAA 1QJU3 4QGMA 3AFKA 1K5MA 3C7FA 5DDJ2 3NNJA 3WF1A 5FY8A 1DLLA 1SDDB 2OXBA 1J3RA 1DCSA 3ZYIB 5LY1A 1EAH2 4WM8C 5BNOB 3JUUA 4QQOA 1B35B 2VG9A 4WM8A 4XVHA 3BIWE 3POIA 5FREA 3RQ0A 3FBMA 1PM4A 3RZJA 5FYBA 3B9IA 1N1VA 3O14A 4YZ4A 4A7YA 4IEOA 4UW6A 1JU4A 4OHZA 4Y33A 1YUDA 1MZFA 4YRDA 1VBC3 1KJLA 3ENRA 3ZN6A 4CP9A 2QZ3A 4Q4Y1 4AQ2A 1MR5A 1NAEA 3WP3A 3KT1A 1W8WA 2QQKA 3RZZA 3RZKA 5D8AA 1AR93 4P9IA 4JZRA 3HNYM 4AK3A 3Q8FA 4QQLA 3O12A 2W87A 4H7LA 2TUNA 3RFRA 4L92A 2LROA 2Q8OA 2X5IC 3VUOA 4LBKA 4RN5A 2BFUL 3BVCA 3HNBM 5GZGA 4JGZB 1RTVA 2ZEWA 5C8WA 3HEIA 4BLIA 3VKFC 5BNQA 4E27A 1K3IA 4K3UA 2YFUA 3JQWA 3WQ1A 1WD3A 2BW8A 4QQ2A 4QX0A 1YFWA 4W6WA 4YW5A 5FY5A 1Y7BA 5GZDA 4FQZA 4CCLA 1UYYA 1ZBE1 1O8SA 3BPSA 4BPZA 1V6LA 4JTOA 3T4HB 3UGGA 4XZPA 5L9RA 2D3PA 1R1A1 2ZGOA 3B69A 4LKDA 3P3PA 3UL2A 4D6SA 2WZR1 4B1LA 3RZMA 1C1LA 1OF3A 5FZOA 3HOBA 4YFZA 4X8NA 5IK7A 1RUH1 1U12A 1QXJA 4EN7B 4UFLA 1IS5A 1UZ0A 1VIWB 4GXLA 4UWDA 3RRDA 1W9WA 2JDAA 2VBPA 4DIQA 4ZHNA 3FJSA 2IFWA 5A3MA 1DIWA 5FDBA 2YMZA 4AXOA 3ME2A 2VMGA 4Y4RA 3PLQA 5JPMB 4CDUB 1ZBA1 3KQRA 3J4UH 4COYA 5FZIA 2VZOA 3OEAA 4DS0A 5FUIA 3AMHA 4MXWA 1HW5A 1N1TA 3MGUA 1GP5A 4RYDA 1PMJX 2R32A 3Q8CA 3RNSA 1FPN2 3OG2A 3MIEA 4UT5A 2OUHA 1SLCA 2VH9A 4RGAA 1HJFA 2DTWA 3WDVA 4IERA 2GDFA 1ACCA 2BQPA 3FLTA 5CFDA 4B4RA 5J96B 3QH7A 5HCBA 1W0NA 1RVF2 3UKTA 5A1FA 1V6JA 5C3QA 5IT6A 4XBQA 5T52A 2VC9A 2J1SA 2OKXA 1W28A 3NJZA 5CAZA 2XBO3 4RD7A 3VZMA 2JIGA 4OZXA 3HNMA 2V5YA 1TZOA 3FLPA 1GMMA 3JD71 1ZZ9A 4BLJA 1AUYA 1GICA 4DUWA 2WNUB 1QMJA 2H6CA 3SKVA 2XJVA 1ZBE3 2ZMNA 1B35C 1RUC3 3WHTA 1FXZA 1WMXA 1T2XA 4LHSA 3MLLA 3RYKA 1CAWB 1Q5OA 5FR3A 1OD5A 2Z4FA 4OMCA 4A2UA 3JCIA 3PU8A 1ULFA 5SV5A 3ZIXA 4BXFA 3UNPA 3I3QA 1G9DA 2VECA 3A22A 1XNDA 4QHBA 2YPDA 2Y34A 3T0DA 4HANA 1HRI1 5FLHA 3WNXA 1WCUA 3DYPA 3LDBA 2YROA 3ORJA 3MIFA 1WBLA 4L97A 5C9AA 4KI5M 1PIV1 1WMFA 2VNGA 3ZM8A 4QB2A 5IAVA 4LO4B 4BQ3A 1AYM1 1LHOA 4PLNA 4XJAA 3GM8A 1IQAA 3HN3A 3I2JA 3LB9A 2ETEA 3N7KA 4IV1A 2R49A 4GKYA 1NE4A 5JXJA 4YM2A 5DABA 1HRV2 2YU1A 3WF0A 4YVSB 1OKOA 3CDZB 1S0GA 3LAGA 3QH6A 2A6ZA 1LNSA 1OA2A 5D8AB 2W1SA 1XYOA 4PIYA 1US2A 4Y26A 1H1IA 1BVVA 2AUYA 3OPZA 3VBOB 1OLQA 3ZN6B 4FPOB 4CXWA 1NYWA 2ILMA 4X6QB 2RDRA 5FLIA 1QNYA 2JB4A 3WF3A 4IE0A 1X36A 5DAQA 3WDUA 1HJGA 1HQLA 3WCRA 3CEWA 2VMEA 1O6UA 2XQRA 3RMYA 1WLCA 1CJDA 3ZYBA 1MQTC 1B35A 2SLIA 3E5QA 4GMP0 1KDKA 1UAIA 1NA1B 4NVPA 2PELA 1HRV3 2Q4SA 4QXBA 1YQCA 2LUWA 3A0NA 1QOSA 1ONAA 4OCTA 5FZFA 1Z7S3 2NN8A 4AZZA 4RHV1 3PDQA 5CNAA 1HKDA 1HRI3 1OD3A 2XUEA 4OULA 4V1PA 4CCNA 2AR6A 3WDWA 3SXWA 5KHJA 2H0VA 2XVGA 3WNMA 3ZXLA 1ZA4A 1D4VB 3D4KA 4IEYA 4WVMB 1DF0A 3MV11 2JENA 3SNMA 3ACGA 4E2QA 4F3JA 5IAXA 4FTBA 2YUEA 2IVIB 3QD6A 4XXAA 3U1XA 1E57A 3IAQA 1QJY2 1DZRA 4K21A 3VBOA 1RUC1 4MGTA 3M7AA 4UF0B 4DB5A 2Q8CA 3T3YA 3UK9A 1NE6A 3KF3A 1P8JA 1QXRA 2D6NA 4RGKA 5EJZB 5ANNA 2AENA 1TME2 1ZA7A 2Z2SB 5CZKA 3H8XA 1RUE1 5L9BA 4AI2A 3D3AA 5CBLA 1W05A 3GXUA 2N7GA 4R52A 4FPKA 4CP0A 5F32A 4CEYC 3JBG3 1RHI3 3PUHA 2WYFA 1UY0A 1DZTA 2K9ZA 2C1FA 5T54A 5FZKA 2EIBA 2WKKA 5LY2A 1RUD2 2JDUA 3IBMA 2PHUA 3PVNA 2HWC2 1QJY1 3BYWA 1H1MA 2X10A 2W1QA 5JXIA 3I3DA 1NY72 1HV1A 5EPAA 1ENQA 1GV9A 3MF9A 3QLQA 4N8MA 2D6LX 4QDQA 3MW2A 1VBB3 4P9JA 5A3WA 1K5MC 1FV2A 3SISA 1YJKA 2EXHA 3I2GA 4YM0A 4I3PA 3JXSA 2O8OA 3ZXEA 5CFCC 2A3WA 4C1WA 3WDXA 2AYHA 5GLUA 5F2WA 3J8F2 5FIXA 2FDJA 2D40A 5I8YA 1MZ5A 4B7KA 3ROUA 3CJIB 3R0RA 5T50A 4AFDA 3QOPA 5BNOC 4DEVA 2WNUA 1SCSA 3CBNA 4JQTA 1ZYBA 3DF0A 1PGL2 2TEPA 1K5MB 4COWA 2Y64A 2ZGQA 4AVAA 2WA3A 2EXJA 1YFUA 2AEYA 2QFEA 3OGVA 1GP4A 2A71A 4FP3A 2WNVB 5JAXA 3BU0A 3WNLA 2GZWA 4BB3A 1H2MA 2YC2A 2FHRA 1LODA 4WBBA 1GNZA 1UZZA 4UFHA 5HXVA 2C6SA 3ILRA 5GM0A 3DXUA 3CU7A 1RUI3 4FOYA 5FZDA 3HBZA 5FXZA 3S7EA 5KHIA 5CA6A 4BE3A 2JX9A 2OS2A 1A3KA 5LA9A 2YHJA 3AKQA 1ENSA 2QQVA 1PGW2 2BP6A 3TEZA 3NO8A 1HRV1 2H0BA 3FHIB 3ZXGA 2OZ6A 1OQEA 2PHDA 3IM0A 3L2HA 4A44A 3CMGA 4YVWC 5HXMA 3K4DA 1QY4A 1H8TB 4YFWA 4CUCA 4IV1B 3MPPG 4XF1A 1XNAA 2WNOA 5DPNA 3AMMA 3ZMOA 2GP3A 4C0HA 1UOJA 2RV9A 3PJYA 5LK7B 1LESA 2Q1FA 3L9JT 2RS31 2JE7A 3AYEA 3NJYA 2Z42A 2XONA 2D97A 1H2LA 5FZ7A 1HRI2 4XFGA 1HQNA 3POYA 4Q0VA 2ZGKA 4LBLA 4AE2A 1YFXA 3GCWA 3M3CA 4GH4C 4O61A 1W3XA 2HH9A 4DRVA 2RMU2 1DYKA 4IV3A 5FUPA 1PX3A 5LBEA 1UYZA 2QQMA 3C7HA 4FTSA 4LLFA 3ZDVA 1K5JA 1EAH3 2E33A 3GDBA 4GMP1 4IQPA 3X29B 2KXLA 2YV8A 2DURA 3UETA 3VDAA 1H8TA 2ZBJA 2VMIA 4XQ4A 4CTEA 4DUXA 1ULGA 4CU9A 3T08A 5JZGC 4OUMA 2FDFA 1V9U1 2P4EA 4GALA 3H1WA 2G9GA 2ORXA 2ZZJA 3ALQA 4FPJA 2DVFA 4CEYB 3GZEA 2QVSB 3JZVA 3ZYPA 3QCWA 4R4XA 2BU9A 3NQHA 1OKQA 3NAPC 4JX0A 1S0DA 4LA2A 3WUDA 3PU3A 3VZLA 2VMHA 4JC1A 1OOPA 4I09A 3U4XA 4FPEA 3VV1A 2Q1MA 2QTWB 1RL3A 2ZKNA 3B01A 1W8FA 4XPVA 5LBFA 1W0PA 1CR7A 2OQ6A 3J7HA 2DF7A 1JZ3A 5APAA 1LTEA 4YW3A 3ZFFB 2ZX4A 2ARBA 4CZSA 1NX9A 2UWCA 2BUKA 4WM8B 3TAYA 1DLCA 1R092 2A6VA 5IK4A 4KU8A 3DUIA 3W5NA 1AJKA 5D2AA 5BUVA 1QGLA 1TE1B 3IMNA 1XXNA 3MUY1 3K77A 4RHV2 4LOTA 3ZFEA 4AWDA 3CJIA 5B4XA 5KHKA 1UXZA 4Y4YA 3AZYA 4CDUA 3O1RA 4P00B 2GMPA 4LKEA 3S30A 3J26N 3ZKYA 2BGCA 1S1AA 1NCRB 4HLTA 2Y38A 4RR3C 1AXKA 3AZVA 1QIQA 4ARYA 4AGVA 1VRBA 4BQ1A 3IB3A 4DMIA 5IVEA 3MUZ1 3WR0A 2XJPA 4S2DA 3SKJE 4J1XA 1UCXA 2YY1A 4D7SA 5HCAA 5F3EA 2PHRA 1RUJ3 3C3VA 3K3NA 3LA7A 4EZHA 5J3UA 4K1YA 1JMUB 4CDWB 1QJFA 1QEXA 2QQLA 2YYOA 3WW4A 4GJZA 1LR5A 3TEWA 1VAVA 1GR3A 1C1FA 3AKPA 3RI9A 1YI7A 3T4VA 3VZJA 1GP6A 1X50A 4H7MA 5FMOS 3I8TA 2V09A 3VBFA 1DYOA 1Y4WA 2KD7A 4LULA 2D6OX 5CVRA 4UFMA 3U4SA 1XU1A 2HKXA 4RGGA 5A3PA 1AR81 1I6XA 1FNZA 2RM21 3HR9A 4NOTA 3LGRA 5FZ8A 3ZXDA 4XTMA 3BGAA 4D7YA 1W9FA 3EHKA 1VBE1 2VXJA 3USUA 1FYUA 1F4AA 2I45A 3LIGA 5F1RA 4AQ6A 3N9MA 2Y6FA 1ZZBA 3INAA 4JHZA 1N1YA 1QWRA 3KV4A 4BZ4A 4R9DA 3N9NA 2VUAA 1C28A 1FMD3 3EB7A 4FTEA 5I8TA 3ZMNA 2ZHLA 4Q1RA 1V9U3 1D4M1 2MHFA 1KRIA 5JOYA 2W08A 2GALA 4V2WA 1XNKA 3LA3A 2C5DA 2W5FA 2Z5WA 3AFGA 2ZGNA 4U2AA 3URFA 1EAH1 1NCRA 1R1A2 1PX4A 1WLWA 4CDUC 2FD8A 5FYHA 4IESA 2R042 5B4NA 3PVBB 3AL5A 5DXDA 2XKPA 1VALA 2Q0AA 4RR3A 2E7AA 4MZUA 2E7QA 3ZSLA 1J3PA 1K45A 3SCFA 1IPSA 2WZPP 3U10A 1VBC1 2WNEA 1OF4A 4P5HA 3U11A 1RUI2 1H4HA 1OQ1A 3THTA 2GC3A 4FPGA 5KXDA 4IE4A 4UFJA 1S55A 3IDAA 5LBBA 4DXTA 1WLDA 1OPMA 1AHSA 3LCPA 4PCRA 5FYMA 3H8OA 1W39A 2GMEA 1W6OB 3CQOA 1XSRA 5FXWA 4PLMA 1OOPB 4N7UA 1H0BA 1QJX1 1GWLA 2YZ4A 3Q8BA 3WUCA 4IEZA 3WNOA 3VD7A 2DFBA 1QJU2 1YIFA 2JDKA 2X5IA 3LSEA 3CNAA 3AP4A 1LENA 4Q4V2 1RHI1 2P5BA 5A7SA 3VN4A 1S0EA 2WLQA 4CEYA 1SHWB 2XL7A 2B5HA 2ZMLA 2BNMA 3HVDA 3IDCB 3ZO0B 2VW1A 1OFSA 4I2OA 4LR4A 5JZGB 4MADA 1CESA 1ZNPA 1HV0A 3U37A 1OURA 5JMCA 4XZUG 5FMDA 3VD9A
chains in the Genus database with same CATH topology
4O7XA 3T3YA 4QKDA 4JHTA 4NROA 4IE6A 4IE4A 3KHCA 3RZMA 4QKBA 3BU0A 3BTZA 3RZHA 4IE5A 4NRQA 4NIIA 3RZKA 5DABA 3H8XA 2FDFA 4NPLA 4NRPA 3T4VA 4MG2A 4IDZA 3I3QA 2FDHA 3H8OA 3BIEA 4OCTA 4ZS2A 3RZLA 3O1SA 3O1TA 3BKZA 4ZHNA 3O1PA 4NRMA 3I2OA 3S5AA 3O1RA 3LFMA 3BUCA 3O1VA 2FDJA 4CXXA 3I49A 2FD8A 2IUWA 4IE7A 4O61A 2FDKA 3RZJA 3I3MA 4NPMA 4CXWA 3BTYA 4QKNA 3O1MA 4QKFA 3H8RA 3RZGA 2FDIA 3KHBA 4RFRB 4CXYA 3O1OA 2FDGA 3BI3A 4IE0A 4ZS3A 3S57A 4NJ4A 4QHOA 3T4HB 3O1UA 3BTXA 4MGTA 4NIHA 4NIDA 5F8PA 4NIGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O7X A;  3T3Y A;  4QKD A;  4JHT A;  4NRO A;  4IE6 A;  4IE4 A;  3KHC A;  3RZM A;  4QKB A;  3BU0 A;  3BTZ A;  3RZH A;  4IE5 A;  4NRQ A;  4NII A;  3RZK A;  5DAB A;  3H8X A;  2FDF A;  4NPL A;  4NRP A;  3T4V A;  4MG2 A;  4IDZ A;  3I3Q A;  2FDH A;  3H8O A;  3BIE A;  4OCT A;  4ZS2 A;  3RZL A;  3O1S A;  3O1T A;  3BKZ A;  4ZHN A;  3O1P A;  4NRM A;  3I2O A;  3S5A A;  3O1R A;  3LFM A;  3BUC A;  3O1V A;  2FDJ A;  4CXX A;  3I49 A;  2FD8 A;  2IUW A;  4IE7 A;  4O61 A;  2FDK A;  3RZJ A;  3I3M A;  4NPM A;  4CXW A;  3BTY A;  4QKN A;  3O1M A;  4QKF A;  3H8R A;  3RZG A;  2FDI A;  3KHB A;  4RFR B;  4CXY A;  3O1O A;  2FDG A;  3BI3 A;  4IE0 A;  4ZS3 A;  3S57 A;  4NJ4 A;  4QHO A;  3T4H B;  3O1U A;  3BTX A;  4MGT A;  4NIH A;  4NID A;  5F8P A;  4NIG A; 
#chains in the Genus database with same CATH topology
 1D7P M;  1D4M 3;  1ZBA 2;  2ID4 A;  5JI9 A;  3IDB B;  4MSV A;  1JU3 A;  4ZU7 A;  5HI0 A;  2BTV C;  2FCT A;  5KWR A;  5K7P A;  4IW3 A;  4QPG B;  1MPX A;  4M00 A;  2E51 A;  4PI2 A;  4CCJ A;  3P1I A;  4TXW A;  1JYI A;  2ZEZ A;  4IV3 B;  4CU7 A;  2D6K A;  5C9A B;  2R06 2;  1DG6 A;  4AHZ A;  5FK8 A;  1W6P B;  4Y22 A;  5C3R A;  1NY7 1;  5DUW A;  5F7U A;  2WQZ C;  4XOG A;  5JOX A;  2RM2 3;  2WN3 A;  1AR6 2;  2BV4 A;  4BM8 A;  1ULE A;  4TLF A;  2VNO A;  2ZHM A;  5C4W A;  2XJS A;  1OC1 A;  1RUJ 2;  2UU8 A;  3BCW A;  3UKN A;  2IXK A;  2P3K A;  5M0T A;  1FOD 2;  1J1L A;  1MS9 A;  3N3H A;  2IXJ A;  2OQ7 A;  1J83 A;  3LWC A;  3KSC A;  2DCY A;  3FHQ A;  1S2B A;  2HWE 3;  3AYC A;  5GLT A;  4Q4X 1;  3VBR A;  1ASJ 1;  1BK0 A;  3SH4 A;  3V0A B;  3NKG A;  1QJY 3;  3HAG A;  5FO7 B;  4E9K A;  3AP6 A;  3MFA A;  1HXS 3;  3K3O A;  1YQ8 A;  1W99 A;  4JVA A;  4D69 A;  2NQY A;  1O7F A;  5A33 B;  4XF4 A;  5FJK A;  2BRT A;  4E2G A;  5CFD B;  5GLV A;  5C3P A;  2WNV C;  3WG1 A;  3FL7 A;  3KGZ A;  3TWI A;  3VL8 A;  3MW3 A;  5FYS A;  4QMA A;  2WC2 A;  1L3J A;  1N1S A;  4PQ9 A;  5AFB A;  1OHF A;  1FPN 3;  2HWB 1;  1SBD A;  4R9B A;  4P9X A;  1OI6 A;  5FYY A;  5EIY B;  4XUQ A;  5FPV A;  4YM1 A;  2DYC A;  1SBE A;  3KWV A;  2W91 A;  1UX7 A;  1POV 0;  1PIV 3;  2JDY A;  4IEQ A;  4FPF A;  1E5H A;  1F5F A;  1JOJ A;  2GC1 A;  4PF1 A;  2WR9 A;  2WRA A;  2CAV A;  1AR6 3;  2RM2 2;  3JB4 C;  1KEX A;  4IGP A;  4C8D A;  4HVQ A;  3MIC A;  5A80 A;  3OJB A;  2A3X A;  5T3N A;  4BQ5 A;  4DXR A;  1MAC A;  3PHM A;  5EJ3 A;  1E5R A;  1V6N A;  4AQT A;  2DU0 A;  1G9B A;  5F8P A;  1UO9 A;  2ZHK A;  4LTA A;  4CCK A;  2PTM A;  2HBU A;  4FOV A;  1VPH A;  1F4H A;  1SDW A;  4XUR A;  2ARA A;  4BIF A;  1JZ2 A;  1I5P A;  2C4X A;  3DPR A;  1UIJ A;  2UWB A;  2XG3 A;  4IL7 A;  4Q0Q A;  1LEM A;  3BIE A;  2QQJ A;  5F6K A;  3H3L A;  1R64 A;  3LDR A;  1POV 3;  4NAO A;  1J58 A;  3RJR A;  1WCD J;  1YQ5 A;  2Y8K A;  1ENX A;  3B3Q E;  4P9Y A;  2HYX A;  1NXD 1;  3FFQ A;  1FPN 1;  2HWB 3;  5T5J A;  1XE0 A;  1BEV 2;  1RB8 G;  5FCC A;  1XU2 A;  5FZE A;  1O5U A;  2ZAC A;  3K2O A;  3OB8 A;  4Y20 A;  3MI8 A;  4MOA A;  4XIO A;  4GQ7 A;  5L7O B;  4L8Q A;  5ACA 2;  3V0B A;  3O5S A;  5FP3 A;  2PLV 3;  3OBR A;  1MEC 1;  1W6N A;  4I01 A;  4XBL A;  1IOA A;  2D5H A;  3IPV A;  4N90 A;  1LCL A;  2ZOE B;  2WYS A;  4OZO A;  2CV6 A;  3KV6 A;  1Y9G A;  3ZPY A;  3LA2 A;  3N7L A;  4BJ0 A;  1ENR A;  2CTV A;  2XGX A;  4BQW A;  3SH3 A;  1K42 A;  2WWU A;  1E5S A;  2Y6K A;  3CJX A;  2Q30 A;  1LU1 A;  4NN0 A;  2E6V A;  4AHW A;  4ET7 A;  4Q1P A;  5FYV A;  3VHP A;  1Y9Q A;  2W47 A;  2B9U A;  3LF7 A;  3LE0 A;  5F6L B;  4HFS A;  4CP1 A;  1XOY A;  1R1Z A;  4W8J A;  3WXP A;  2VOW A;  1ALY A;  4XFB A;  1HB1 A;  5BNO A;  1LB2 A;  2R07 1;  2EXK A;  5FZ0 A;  3VB9 A;  4YW6 A;  2NM1 A;  4MXV A;  1ULO A;  4HVO A;  5IFP A;  3O7O A;  1STM A;  1NA1 A;  3GGL A;  3DEC A;  4FSJ A;  3MV0 1;  1IG0 A;  1DGR A;  3BPZ A;  3KLS A;  1OT5 A;  4XCA A;  3CHX A;  4UYB A;  3ACL A;  1V9U 2;  4QKB A;  1PVC 3;  2G9Z A;  5FYT A;  5A7W A;  3RI8 A;  4BXS V;  5FZM A;  3A21 A;  3EO6 A;  3VKN A;  4NE9 A;  2ZX0 A;  4XUO A;  2RJL A;  3RZL A;  5I8S A;  4LPL A;  1RVF 1;  3POG A;  4GUL A;  4YVS C;  2R1B A;  4F8A A;  5C70 A;  4RA0 A;  3N9Q A;  2FZ2 A;  1C5H A;  5DUV A;  5A3O A;  1I3H A;  3VKM A;  1O3T A;  4AED A;  4J1W A;  5CIS A;  3BUC A;  3AYA A;  4MHU A;  1YI9 A;  3AKR A;  2FMD A;  5FOJ B;  5DDJ 3;  1BZW A;  1QOO A;  4LQR A;  3RVH A;  4LO7 A;  4CCE A;  2GSY A;  5K0U C;  3LDK A;  2ZX2 A;  4AOC A;  1RUD 3;  5HV0 A;  2QQN A;  4JGY C;  5FPZ A;  1LOF A;  4JHT A;  2LRP A;  2DUQ A;  4QPI A;  1XYN A;  3BTA A;  4BDV B;  1EUU A;  2GND A;  2W94 A;  4LHK A;  4NPL A;  2P1B A;  1JW6 A;  2CWM A;  4BWO A;  5JSP A;  3Q8E A;  3ZXK A;  4B4P A;  2E32 A;  4BQ2 A;  1KFU L;  5A7N A;  3H1Y A;  3L2Y A;  3AP9 A;  4XHB A;  4LT5 A;  1JHJ A;  4XQW A;  1MVQ A;  1SFN A;  3P5B A;  2OYZ A;  3TN9 2;  3ZKU A;  2V72 A;  2LS6 A;  5C4W C;  1WW5 A;  1HXS 2;  4GD4 A;  3LEM A;  2WNU C;  5J1X A;  3SEP A;  3W5M A;  2DBN A;  3G6J B;  1QJX 2;  4LIV A;  4COU A;  4ES9 A;  4E4Z A;  1EPW A;  2W92 A;  3V64 A;  4HKL A;  4YNI A;  1LHN A;  4AAP A;  1O3Q A;  2YB7 A;  3HN1 A;  3VBH B;  1RUH 3;  4XJZ A;  3SIT A;  4DQA A;  5IVY A;  3JU9 A;  4N53 A;  5IJR A;  4AEM A;  2P3I A;  2ADE A;  5BPX A;  4XHX A;  1YQ2 A;  4TZD A;  3OUH A;  2VCA A;  2G4I A;  3OGS A;  3ACF A;  1C5I A;  1RUG 3;  4UW5 A;  4NPM A;  5HCF A;  2CYF A;  1NUK A;  5A7O A;  2BGO A;  2EIE A;  3C8X A;  3DGT A;  3ZXJ A;  4CVU A;  1BKZ A;  1CAV B;  4ERO A;  1FV3 A;  4MET A;  4JKK A;  2HWF 1;  2QJV A;  4LNV A;  1VMJ A;  4AF9 A;  1IZ3 A;  3AXD A;  4HKW A;  3VD4 A;  2UWA A;  3WY6 A;  1CGP A;  1OPO A;  3PJQ A;  5LCW L;  2CDP A;  3KHC A;  4ARX A;  1U5X A;  2DU1 A;  1AYN 1;  1BK1 A;  4H3W A;  4RS5 A;  5LAS A;  4G9S B;  3AKS A;  1LOB A;  3TRS B;  3V56 A;  1EV1 1;  1EYB A;  2VR4 A;  4D7T A;  5K4L A;  4ZKT B;  2VUD A;  2AH2 A;  1SEF A;  4O65 A;  5FQ0 B;  1CZS A;  2EAA A;  3ATG A;  5FJH A;  3AC0 A;  3NW4 A;  4A6O A;  1ODN A;  4XF9 A;  4YLZ A;  1DGW A;  1O4Z A;  3AMQ A;  5FY9 A;  3T2O A;  2R16 A;  4FPY A;  2IUW A;  4MGQ A;  4YWA A;  2PYT A;  1SPP B;  2UUR A;  3J7L A;  4MGK E;  1EP0 A;  4CA9 A;  2DTY A;  1F2N A;  4M0H A;  5KXE A;  4AVV A;  3OEB A;  1DGL A;  1ZRF A;  2XPJ A;  2GH8 A;  3H7J A;  3NAP B;  3H1M A;  5BNP B;  2GN3 A;  1BBT 2;  3LIH A;  1VLN A;  4LIT A;  5FY4 A;  2ARX A;  4YZ1 A;  1LKN A;  1W2T A;  2JDZ A;  1NKG A;  4GWI A;  4QKD A;  4TSV A;  3DEM A;  2HWB 2;  4YZ3 A;  1BCX A;  4P5Y A;  4ISR A;  5FFO C;  1AYN 2;  1H2N A;  1MS5 A;  4Q26 A;  1H4G A;  3T2P A;  1HXS 1;  3Q9O A;  2WSV A;  1AZD A;  3GHN A;  3WNN A;  1XNT A;  3S6P A;  4AED C;  1L7L A;  4OFG A;  1ZX5 A;  2ZMK A;  4JGZ A;  4DEQ A;  3N7J A;  4N53 C;  1W9T A;  2HBT A;  3WZ1 A;  1Q43 A;  2VBD A;  4QXK A;  1ASJ 3;  5KC5 A;  5LZ6 A;  2FMY A;  2I07 B;  1T6G C;  2QNK A;  3LZZ A;  1GFF 2;  3KV5 A;  4UW4 A;  2DWR A;  2PXJ A;  4CDX B;  1OBN A;  4MV2 A;  4GH4 B;  4N43 A;  3C7E A;  1FX5 A;  3IT8 A;  2XWB B;  1DQ0 A;  3KCY A;  1R08 2;  4FPL A;  1Q8P A;  3KB5 A;  4R4Z A;  4Z2W A;  1IPK A;  2VQT A;  3OD4 A;  3B9C A;  1UD1 A;  2D43 A;  2H6B A;  5DDJ 1;  4UFK A;  3OGG A;  1WUV A;  3KT4 A;  4HPK B;  3OY8 A;  4QHZ A;  1ZZ8 A;  4TLG A;  5FOB B;  2IXI A;  2EIC A;  1PMI A;  4A6S A;  1TEI A;  4RQP A;  2VUL A;  3TBD A;  3VHR A;  2D3R A;  4OI4 A;  4P08 A;  5EQU A;  5JXH A;  2B8M A;  1T6B X;  2HWC 1;  3JD7 3;  4HBN A;  1SLL A;  4CEW C;  5IAT A;  5IHR A;  2B7Y A;  4IE7 A;  2R07 2;  1WD4 A;  4QAW A;  5C7G A;  4Z82 A;  4Y5S A;  1UOG A;  1PIV 2;  5FPB A;  3OPT A;  2XBO 1;  4Y5T A;  4HON A;  2OW4 A;  2VZV A;  2DUP A;  1FT9 A;  4W6X A;  4NHY A;  2R7E B;  1QOT A;  5GAL A;  5C6C A;  1RUF 1;  2A1X A;  5BNN B;  2XKO A;  4ZU5 A;  4K9S A;  1C57 A;  2WBK A;  3AMP A;  2YBP A;  1YQ6 A;  3OYW B;  5C8C B;  1W8Z A;  1VBA 3;  2GH2 A;  1DZQ A;  1YEW A;  3E5X A;  3WDT A;  1H2K A;  5GJ6 A;  2WLP A;  4IEP A;  2DFC A;  5IVF A;  4AAX A;  2VO5 A;  3LEI A;  2JEM A;  4LOR A;  3VBU B;  4CE8 A;  2RE9 A;  2DV9 A;  3ETQ A;  3ZYH A;  4LBQ A;  3RMX A;  3ZXF A;  5LBC A;  2R30 A;  2W46 A;  2XML A;  5FRA A;  3WG2 A;  1LRH A;  1VBD 1;  4YYO A;  2CDO A;  5EHD A;  5L19 A;  5A1L A;  4QM8 A;  3ZX7 A;  4IND A;  5KHH A;  4Z07 A;  4COZ A;  5JXG A;  2R06 1;  5DAX A;  5ABJ C;  1TMF 1;  2HWE 2;  1SLB A;  2XJQ A;  4PDW A;  2JG8 A;  4XJ8 A;  3NVC A;  2NMO A;  4L11 A;  3TOJ A;  3HQR A;  5E88 A;  3DKW A;  3E1F 1;  5L9V A;  4JDO A;  1UMH A;  3PNA A;  3M3I A;  5DAV A;  1XC6 A;  1SFP A;  2J1U A;  2EAK A;  3NL1 A;  4KWK A;  1X9P A;  4YPJ A;  4EYU A;  5LWB A;  5ACA 1;  3S5Q A;  3M3Q A;  3PVO A;  1OMI A;  3HPN A;  4YW7 A;  3HD8 B;  5FXX A;  2G1M A;  4AI3 A;  4HN1 A;  4W4Z A;  2RS5 3;  1MQT B;  1IHM A;  4PLO A;  5DAW A;  4AEK A;  4H2A A;  4GZ9 A;  4A7K A;  2FDI A;  1RXF A;  2D6P A;  1TME 1;  2VL4 A;  4MX3 A;  1FMD 1;  5A6Y A;  1NT0 A;  4FO9 A;  1FOD 3;  4ZS3 A;  3R4U A;  4JRA A;  4XFI A;  4JGY B;  4BIO A;  5KXB A;  1XB9 A;  4QB1 A;  3D0S A;  3J9S A;  4NIG A;  2YGM A;  3EBR A;  4XFA A;  1WME A;  5FWJ A;  2YXS A;  3TEX A;  1UZW A;  2FQP A;  1DYP A;  2QQI A;  3RGB A;  1XQN A;  1PNG A;  4LEJ A;  2PHF A;  2VZR A;  1CN1 A;  1Y9M A;  4P9W A;  5FBZ A;  3O0V A;  5JR7 B;  1RC6 A;  5FTT C;  4L2N A;  1GZC A;  2G9F A;  1NLQ A;  5FPU A;  3AVR A;  2R06 3;  3ZYR A;  4IEV A;  2VPV A;  1N47 A;  1QQP 2;  3F2Z A;  4FPC A;  4CCM A;  2JB8 A;  2PQQ A;  5JCT A;  2BZD A;  1X8E A;  4MO3 M;  2CGN A;  1PK6 C;  2BWA A;  2VU9 A;  1UOF A;  2VZU A;  2XH6 A;  1NCQ C;  4TYS A;  4XDO A;  4XMI A;  3O1M A;  3H8R A;  1K12 A;  3OBA A;  4GB3 1;  4OVE A;  4QX8 A;  5KC6 A;  4TN7 A;  1RED A;  1PO2 2;  4AQS A;  4N9I A;  2P3J A;  4EJR A;  2C26 A;  1MQT A;  3H50 A;  2W1W A;  5F39 A;  3FHA A;  1VRH 3;  5ABJ A;  1E5I A;  1OQD A;  1R09 1;  2K46 A;  2FZ1 A;  2R04 3;  3WSO A;  2VVD A;  2V4A A;  2WN2 A;  4GWJ A;  5C5U A;  4QPI C;  3K46 A;  5A1A A;  1W3V A;  2JG9 A;  3ZFE C;  3KVA A;  1GYK A;  4Y24 A;  3KV9 A;  4AVS A;  4UAP A;  3ES4 A;  3T1L A;  2PLV 2;  5JSO A;  4Q4Y 2;  2UY8 A;  3HBK A;  2VD7 A;  3ZDS A;  1QH7 A;  1YO8 A;  2JG8 B;  3GCX A;  1GOH A;  4IEW A;  2CHH A;  1ZRI A;  5LRR A;  4HK9 A;  3D0J A;  4UBH A;  4QKF A;  5FBJ A;  4Z1V A;  1JUI A;  2AEZ A;  4CXY A;  4P9G A;  4KH9 A;  3VKO A;  4YGC A;  2WL1 A;  1J84 A;  1B09 A;  1CQ9 A;  2BYV E;  1H9P A;  1WW6 A;  4PIZ A;  2JKB A;  5I93 A;  2HYK A;  1UOB A;  1UQX A;  4NO4 A;  3VBU A;  3BTZ A;  4FT8 A;  3VBU C;  2VE1 A;  3AMN A;  5CEH A;  1GAN A;  2HEY F;  2J1A A;  4XJU A;  1KJR A;  4A4A A;  5K8S A;  2A73 B;  1RUC 2;  1I1E A;  4D94 A;  4QWN A;  4DNY A;  4EZ4 A;  3UES A;  2WWS A;  4BHP A;  1OVP A;  2ZJC A;  1DQ4 A;  2E31 A;  2WO1 A;  2RS5 1;  1U0A A;  3AZZ A;  1RUG 1;  3EYP A;  1PGW 1;  5J09 A;  3LQC A;  4GMP 3;  1PK6 A;  3ZXA C;  1OA4 A;  1ND3 C;  4E8C A;  1G7Y A;  3GZT B;  4BOW A;  5DQ0 A;  1JOD A;  5BNN C;  5KXC A;  1TNR A;  3PIJ A;  4E2S A;  3LEK A;  1GLH A;  1CAU B;  1Q3E A;  3H7Y A;  2VQ0 A;  3ELN A;  3HT2 A;  2DCT A;  4V2V A;  2B45 X;  4EWE A;  1W6M B;  3RWK X;  1LEC A;  2HWD 2;  4UI9 L;  1I5Z A;  1ZRR A;  2DVD A;  3KMH A;  1QXP A;  2X05 A;  5C71 A;  3WW1 A;  3PUI A;  5LA2 A;  3OY8 B;  4HPK A;  1PHM A;  1UZY A;  1X8M A;  5FMB A;  5LA0 A;  1JYX A;  4JRL A;  2JE9 A;  5JMO A;  3WQB A;  4BME A;  4QX7 A;  5E8A A;  4Y1X A;  5GZF A;  1H6Y A;  1TNF A;  3IKW A;  5T5L A;  1NG0 A;  2D93 A;  3NV1 A;  3FWE A;  3JBG 2;  5H9Q A;  5A32 B;  4D6Q A;  3D82 A;  1UZV A;  2YGL A;  3EQE A;  3MYX A;  4QQH A;  1W0O A;  1SBF A;  1RYY A;  3DXT A;  4JDN A;  4Y1Z A;  5FYC A;  2ENR A;  2IVJ A;  4Y3O A;  3NV3 A;  3UT0 A;  2TNF A;  1KGY A;  4IUG A;  2WUH A;  1I9R A;  3A4U A;  4PBP A;  4AW7 A;  3MLK A;  5A6X A;  4HMZ A;  5CFD C;  4Q2F A;  3ZN5 A;  3TN9 3;  3VBS B;  3USS A;  5A3T A;  5A3L A;  1RUF 3;  3WG3 A;  3LKJ A;  2W95 A;  2EVX A;  4EWA A;  2NP0 A;  4GB3 2;  3DV8 A;  1CIY A;  1V70 A;  2DVA A;  1MEC 2;  4DY3 A;  1BLZ A;  1NLR A;  4K1Z A;  2XVK A;  5FY0 A;  2TBV A;  2VOK A;  3WF4 A;  4B1M A;  3VBF C;  2C24 A;  1TME 3;  1JUH A;  3I49 A;  1UU5 A;  1X7N A;  3ZR5 A;  1S0I A;  2E26 A;  2WWJ A;  3J8F 1;  1RIN A;  4M3C A;  2RR1 2;  4N7I A;  5FZH A;  5BNP A;  1CWP A;  1D2S A;  5T55 A;  4AL9 A;  3PUA A;  1ASJ 2;  4Y5Z 0;  2FDG A;  1COV 3;  4LO6 B;  4KWU A;  2GP5 A;  2J22 A;  4HK8 A;  1ND3 A;  1WWY A;  4WVZ A;  1RVF 3;  3WF2 A;  1FNY A;  3ILF A;  2PHL A;  4I0A A;  4SLI A;  3ZYG A;  1CAX B;  1LUL A;  1GKB A;  2DVB A;  2VQA A;  4RS5 C;  1W06 A;  3HMY A;  3WP4 A;  1PVC 1;  2QQW A;  2W68 A;  1MS4 A;  3BU7 A;  4URA A;  1W8H A;  1H6X A;  1UY4 A;  4NHX A;  4DOU A;  4DRR A;  4DXZ A;  1FMD 2;  1VB4 A;  2HEV F;  3TEY A;  3R4S A;  3A0K A;  5J98 B;  1DQ5 A;  1IS4 A;  3I2D A;  2I74 A;  2Y6G A;  3E5U A;  3AYD A;  4H14 A;  5K9Y A;  4XTP A;  1OFN A;  5FZB A;  1BEV 1;  3O1V A;  1SLI A;  1VBD 3;  2YPJ A;  3ZFG B;  4IV3 C;  2E63 A;  1US3 A;  5AVP A;  2R07 3;  4YVW B;  3U07 A;  4QKN A;  3NNL A;  4CYD A;  2J1V A;  4G4F A;  4QPG C;  1J1T A;  1AVB A;  4XIK A;  1LJ7 A;  1VB2 A;  1D2Q A;  4OQ8 A;  1NZC A;  4MLO A;  1POQ A;  4DZG A;  1NA1 C;  5DZF A;  1O91 A;  3NRU A;  5CU1 A;  4KWJ A;  1OLM A;  2ADD A;  2R6Q A;  1F8V A;  3UYJ A;  1VMH A;  1VBD 2;  3O1T A;  1QQP 3;  1MEC 3;  1NLS A;  3RYR A;  1UW8 A;  4ASM B;  2AZ5 A;  3K51 A;  4MUV A;  4XFH A;  1OOP C;  3BOD A;  2F17 A;  3PUS A;  3I59 B;  1R1A 3;  3THD A;  4QX1 A;  4NMI A;  1PZ9 A;  1NQD A;  2VTF A;  1JS9 A;  4QX5 A;  1BBT 1;  2ARC A;  1AYN 3;  1MZE A;  4GIQ A;  5CFC B;  2AGS A;  1W6Q A;  1YWK A;  2VGD A;  5I0S A;  1JOB A;  1RUH 2;  4YG6 A;  2VQU A;  1Z78 A;  4CSW A;  1AXY A;  1ZZ7 A;  3UV9 A;  1W03 A;  2JD4 A;  3B7M A;  4IDZ A;  3EMR A;  5LB6 A;  3U0Z A;  2WAO A;  1GWM A;  2ZGT A;  1U5Y A;  4NRM A;  4PHZ A;  4OHW A;  1X9T A;  4G3Y C;  1CAX A;  5DUU A;  3DCQ A;  3H42 B;  1N3O A;  4FOQ A;  1Z7S 1;  2Q8D A;  2RMU 1;  1VR3 A;  5AFE A;  5FPL A;  4XFF A;  1GSL A;  2P2K A;  3AB0 A;  1W9Y A;  2D5F A;  3T30 A;  5FXV A;  4YAR A;  3VGI A;  3PME A;  2NMN A;  2DVG A;  4Q4X 2;  3VL9 A;  2JD9 A;  3TYJ A;  1DHK B;  3UGH A;  4BQX A;  1G9A A;  5JLV A;  4FOW A;  3POW A;  4TTG A;  2Y6L A;  3VZO A;  1GZW A;  4LA3 A;  3VDC A;  3I2I A;  4CDQ B;  5FPX A;  1HX6 A;  1X82 A;  4CUB A;  5K0U B;  2D6M A;  3HJR A;  4YZ5 A;  2OVU A;  2QBX A;  5D1I A;  1JHN A;  1S0C A;  4A45 A;  3AKT A;  2BOJ A;  1S2K A;  4MYE A;  2OX0 A;  5F3C A;  3VBS A;  1HLC A;  4AVB A;  5FO9 B;  2VM9 A;  4XAA A;  1AL2 3;  5FZ4 A;  1IS3 A;  1LOA A;  2LAL A;  1SMV A;  3AVS A;  4CXX A;  1RHI 2;  3AZW A;  2IXH A;  5FLJ A;  4WM7 B;  4CUA A;  4MGI E;  2A5Z A;  2VZS A;  2ZGU A;  2J1E A;  2PQS A;  4CPB A;  4D6R A;  4CDW C;  4L99 A;  2IXC A;  2CAU A;  2QDN A;  1H30 A;  3I2K A;  4A7Z A;  2BGP A;  4JKL A;  5E89 A;  4WZC A;  4XMA A;  3WG4 A;  4AHY A;  2RDQ A;  3MIG A;  5FY1 A;  3FN9 A;  5HPO A;  1NCR C;  2R0F A;  4COV A;  3QBQ A;  5LEK A;  4AFM A;  4CEW A;  2CGO A;  2GNB A;  1CAU A;  3ZFG C;  1UWW A;  4AGG A;  1AL0 G;  2IWG B;  3E6C C;  1AXZ A;  1SAC A;  4GH4 A;  1H1A A;  2AAC A;  3B00 A;  4LKF A;  4N43 B;  3RZG A;  3H9A A;  4WM7 C;  4E4S A;  4NHK A;  3ZSM A;  4WM7 A;  3B94 A;  4QDR A;  1NZI A;  3LEG A;  1AX1 A;  4JAA A;  4ZXE A;  3VZK A;  1RJ8 A;  5D8A C;  3OBT A;  3BOW A;  4HL0 A;  4FXK B;  4B3N A;  4HVR A;  5AC9 1;  2VMD A;  1L7Q A;  2RJ2 A;  3PL0 A;  4P14 A;  4QXH A;  4B7E A;  3MHZ A;  4K6B A;  4XAC A;  3ZYJ B;  2QUO A;  3SQO A;  1H9W A;  1DFQ A;  3IIA A;  2XXZ A;  3MIB A;  1NOV A;  2DBI A;  1XYP A;  1WW7 A;  3CIH A;  3RYP A;  1LHU A;  2D98 A;  5F3G A;  2VMF A;  1KS5 A;  1QQP 1;  4JGZ C;  1V0A A;  1MS0 A;  3NAP A;  3NST A;  2VZQ A;  5DZG A;  5FP7 A;  1MS3 A;  3ACH A;  1KXG A;  3TNQ A;  4CCD A;  1QNW A;  2FCV A;  3UJO A;  1UPS A;  3N35 A;  3WIN E;  2A7A A;  4CCC A;  4NIH A;  4JKM A;  5FY7 A;  2BVB A;  3WCS A;  4E4D X;  1IKQ A;  3UJQ A;  4X8P A;  3JBG 1;  3K4Z A;  4PF5 A;  1W2N A;  2RHP A;  4XEZ A;  2XVL A;  4DPN A;  3PMS A;  2PLV 1;  3PVE A;  1JZ5 A;  3N36 A;  2EA7 A;  4UOJ A;  4XIL A;  2YDE A;  2PA7 A;  1JTZ X;  2SBA A;  2ORZ A;  4PQQ A;  1W6Q B;  4J6G A;  3CJI C;  5FMC A;  5ABJ B;  5CFC A;  4A3Z A;  4PJY A;  3WQ7 A;  3U14 A;  3E6B A;  1GQP A;  4LBM A;  1O4T A;  1UU6 A;  3WD5 A;  2YFZ A;  4UW3 A;  1FI2 A;  4DY5 A;  2ZKL A;  5BV6 A;  2YBK A;  2CU5 A;  1LOE A;  2VOV A;  4FPH A;  2RVA A;  4K40 A;  1GOF A;  1HN1 A;  4QQP A;  1VJ2 A;  3SHR A;  2O8Q A;  4AVT A;  1GU3 A;  4O9E A;  4N53 B;  1O5L A;  3M1H A;  4FI9 A;  4QGN A;  3SEE A;  3KM5 A;  3R05 A;  5ANQ A;  2O0O A;  4PT6 A;  3VZN A;  4XUN A;  4BCU A;  3POS A;  5JIU A;  3T2T A;  1F35 A;  3LPF A;  2VCC A;  3HT1 A;  1WCK A;  4LK7 A;  3FFZ A;  1VE0 A;  2C9A A;  1AF9 A;  1NCQ A;  4LXL A;  4ZZ8 A;  3SC7 X;  5BNP C;  2OUJ A;  2RS1 2;  1C8M 2;  4LMF A;  4KBB A;  2QDR A;  3EJK A;  1UN1 A;  3KS7 A;  4QU2 A;  1VMF A;  1ND2 A;  2FBE A;  4CUG A;  2X29 A;  4YVW A;  1UIK A;  2PMW B;  5DAP A;  5K0U A;  2VNR A;  3O1U A;  1QJX 3;  1G9C A;  2A6X A;  4HSJ A;  1GZW B;  4FP2 A;  3M8L A;  4FAH A;  3DKQ A;  5FYI A;  1KFX L;  4PDW C;  5T5O A;  4NHM A;  4EWD A;  4QX3 A;  1ULP A;  3VDD B;  1CIW A;  1DU3 D;  5FAX A;  1REF A;  2XBO 2;  2ZZQ A;  4KG8 A;  4YZ2 A;  4AGR A;  2RDN A;  4I3G A;  2XLG A;  2GNT A;  3ST7 A;  3VHO A;  3ZSJ A;  1BMV 1;  4XDP A;  2QQO A;  4ZXK A;  5C9A C;  1PVC 2;  4URT A;  2QE3 A;  3MO4 A;  1HIX A;  4MGY E;  4OQ9 A;  1JN2 P;  3OUI A;  3OGR A;  3J7N A;  4S2H A;  1Q56 A;  2GAU A;  2XLF A;  5D21 A;  2YC4 A;  3VDD A;  3EXU A;  4KBZ A;  3WW3 A;  4I30 A;  2MEV 3;  4Z92 B;  4LBQ B;  5JUV A;  1A8M A;  4O7X A;  5G04 L;  4AED B;  4CCO A;  1CZT A;  1OSG A;  2QKD A;  1ZRD A;  2DCK A;  3VBS C;  2PAK A;  2I2S A;  1UL9 A;  4OHY A;  4M4P A;  3KVB A;  5DMY A;  2ET7 A;  1NCQ B;  2OT7 A;  2XL9 A;  4XFC A;  1UY2 A;  3ILN A;  3QAC A;  4QGL A;  4DUV A;  2YC0 A;  4XAE A;  4E8D A;  1TVG A;  3RG0 A;  4YM3 A;  1QKQ A;  4FQ4 A;  5BYN A;  4NR1 A;  5F5A A;  2XB6 C;  3A7Q A;  2VJX A;  1AR8 3;  3FUO A;  3ES1 A;  1XNB A;  2JDN A;  3V65 A;  2ZCW A;  3GAL A;  2WII B;  2WZE A;  3O0W A;  3WOG A;  4BMB A;  3N9L A;  4JCK A;  5LEJ A;  3C2U A;  1EY2 A;  2PAM A;  1OH3 A;  1MZ6 A;  5FZ9 A;  1LED A;  3ZPO A;  3I3E A;  4B8E A;  4CDQ C;  4JGY A;  2O14 A;  3GBG A;  2GC0 A;  2JDM A;  1UKR A;  1VRH 2;  4NRP A;  4B4Q A;  5I0D A;  3D8C A;  1ZRC A;  4HET A;  1LGN A;  5GLZ A;  5CG9 A;  4DXS A;  5GZE A;  2Q1Z B;  2WO7 A;  2CGP A;  1LHV A;  2GU9 A;  2ZEX A;  2VVF A;  1LOC A;  1WLT A;  1QJE A;  3ZFG A;  5H9R A;  4YGB A;  2VVE A;  5DZE A;  5GLW A;  4WVV A;  1PO1 2;  4KNC A;  3USU B;  4BQY A;  3B93 A;  2DCZ A;  4TWT A;  3BI3 A;  1R09 3;  1DQ6 A;  2EAL A;  2ZGS A;  3FZ3 A;  4Y20 B;  5EXO A;  4LLO A;  5HCH A;  4P02 B;  2ZS6 B;  5IUQ A;  1A6C A;  4LBO A;  2JJ6 A;  5IK5 A;  1OVS A;  1RUG 2;  3UGF A;  2ZA9 A;  1S2E A;  1YFY A;  1YXW A;  4OHV A;  1A78 A;  4ZY9 A;  4YGD A;  1BHG A;  5EP9 A;  1BJQ A;  1XJA A;  2ZGM A;  1BEV 3;  3ZOI A;  3GBF A;  5JR2 A;  3O1S A;  2ET1 A;  4HSL A;  4KGQ A;  2LM3 A;  2BFU S;  2PAE A;  5KBF A;  2NZ9 A;  4ASL A;  4LBJ A;  4Q4V 3;  3KF5 A;  2VUC A;  1ZM1 A;  4PIX A;  2GMM A;  2BBA A;  1CPN A;  2VTX A;  3FMG A;  2KA3 A;  3JQX A;  4RFR B;  1CD3 G;  5C8C A;  3S0M A;  5FZ1 A;  4RSU A;  5ERL A;  3IN9 A;  5F5I A;  2JG8 C;  1AR7 3;  5A7P A;  3CF6 E;  1FOD 1;  4MHR A;  1JZ7 A;  4F7Z A;  3DYO A;  3GNE A;  2VOX A;  2E7T A;  1D0H A;  3G7D A;  3ZFE B;  4MG2 A;  1PNF A;  1QDO A;  2ARE A;  4XQD A;  2VTX J;  5J37 A;  3FBY A;  2XJT A;  4PBO A;  5A32 A;  1VBE 3;  3GYD A;  1Q8O A;  2MEV 1;  3VD5 A;  1YLL A;  1SLA A;  4CEW B;  2CWS A;  3CZU A;  2WT0 A;  3MZH A;  2XJU A;  3ZN4 A;  5I0R A;  5CKM A;  4XCB A;  1AR7 2;  5FWE A;  2X8K A;  1ULC A;  2PHX A;  1RMU 2;  3VKL A;  5LRS A;  1OA3 A;  5C5T A;  5HBA A;  5JIA A;  1W6M A;  4BA6 A;  2OPW A;  3I7D A;  2PFW A;  4GA9 A;  4AHX A;  4ATF A;  1VBB 1;  1UMI A;  2A75 A;  3ZFF C;  1QU0 A;  2W9X A;  1S0J A;  3APB A;  1AR9 2;  1WCS A;  4HKO A;  1A8D A;  1UKG A;  2BWC A;  5FZL A;  4CPB D;  1IG3 A;  5J7M A;  2A6W A;  2P34 A;  2W3J A;  5L73 A;  3HQU A;  3N4M A;  1LHW A;  3POE A;  2IXL A;  4FFF A;  4I0B A;  4CU6 A;  2QZ2 A;  5E1R A;  1G6N A;  5JPN B;  3S57 A;  2QQU A;  2A3Y A;  3T0B A;  1FAY A;  3OD0 A;  1S0B A;  3WNK A;  4FCA A;  4XET A;  5JVV A;  4Y22 B;  5A7Q A;  4CDQ A;  5FPA A;  1DQ2 A;  1RUI 1;  1QHD A;  5FMO L;  4AFB A;  5EV7 A;  4HT1 T;  3KT7 A;  2ZAA A;  4QPW A;  5FV3 A;  3ZIW A;  1W2U A;  3LD8 A;  1AYM 2;  1Q8S A;  2RJK A;  1JYW A;  1M06 G;  2DDU A;  4JV4 A;  2JEC A;  4YSF A;  2ZX1 A;  3LOB A;  4PDW B;  1YNA A;  3AXE A;  5E6H A;  5EYY A;  3NNG A;  3ASI A;  1XE7 A;  4FFG A;  1V6M A;  3H3U A;  4XXP A;  1GOG A;  4Y1U A;  5L7O C;  1IS6 A;  2HWD 3;  1PM7 A;  4QPY A;  5EJ1 B;  5J48 A;  1RGS A;  1D4M 2;  3HIF A;  3KCC A;  3MDP A;  4RS5 B;  3CLP A;  4I02 A;  4N9H A;  3KGL A;  5C3O A;  1L7R A;  4RHV 3;  1ST8 A;  4Q4W 1;  4IV1 C;  5IYY A;  4ONU A;  2V5D A;  1J59 A;  2OZJ A;  4BU2 A;  1RJ7 A;  5BY5 A;  5DG1 A;  1ND2 B;  3VBR C;  1W6O A;  1YC6 1;  2YG0 A;  4QDS A;  1O3S A;  3AZX A;  1W8T A;  2J7M A;  4CU8 A;  3OYW A;  1RUN A;  2ZAB A;  3WNP A;  3K48 A;  3MID A;  2JDH A;  2ZHN A;  3OBZ A;  1JZ4 A;  4M01 A;  2P37 A;  4EN6 B;  4IXL A;  3FC0 A;  4HN0 A;  4QB6 A;  2EF6 A;  4LK6 A;  1F5J A;  1SFY A;  4FAG A;  5EFU A;  5IVV A;  4AI0 A;  3I2F A;  4LE3 A;  4HOO A;  4QD2 A;  2WO2 A;  1BXH A;  1GNY A;  3OCP A;  3MW4 A;  1F9K A;  2VNV A;  5IWF A;  1N3P A;  2VCM A;  2JIC A;  1JI6 A;  4LE4 A;  4OI1 A;  3RS6 A;  1UY3 A;  3POJ A;  4GB3 3;  4GKX A;  3OF1 A;  4LBQ D;  1BMV 2;  4NRO A;  4D8M A;  2GNM A;  2V4V A;  4RQP C;  1XNC A;  5A3U A;  1N3Q A;  4LO8 A;  5F5C A;  2F6B A;  1JBC A;  3BN6 A;  4RQP B;  3DYM A;  3U78 A;  4J25 A;  4EN0 A;  1FAT A;  1UX6 A;  2RG4 A;  2X09 A;  3E6D A;  3IMM A;  1DBN A;  1POV 1;  2YBS A;  1F31 A;  1PVX A;  4NHL A;  1C4R A;  3S5A A;  2XR4 A;  2CSG A;  5T5P A;  3IPV B;  1W6N B;  2D7F A;  4FXG B;  3AL6 A;  4XAB A;  1JH5 A;  3MF6 A;  2BDR A;  3LOI A;  3WP5 A;  3KHB A;  2XJR A;  1C8M 1;  1W9S A;  1WA6 X;  2A70 A;  4Q0P A;  3T0A A;  2HWF 3;  1SQ4 A;  3FUQ A;  4NJ4 A;  4NWV A;  1TMF 2;  4M4R A;  4QPI B;  1LGC A;  4P9L A;  1WMD A;  3SCH A;  1C8M 3;  2D3S A;  2XWJ B;  2UY9 A;  4I0W B;  1PMH X;  3LSD A;  2DUO A;  2RS5 2;  3AK0 A;  4CP2 A;  1C8N A;  1GNH A;  1ND3 B;  2WZR 2;  4Q4W 3;  1JOP A;  1LAJ A;  4U36 A;  3OTF A;  1A34 A;  3NNM A;  1UNB A;  2Y6H A;  4NPR A;  2MNG A;  4KWL A;  1ZRE A;  4C91 A;  4R8H A;  3PUR A;  2LW8 A;  3HWJ A;  3KD4 A;  4M3C B;  1V6I A;  2VZP A;  3CZJ A;  2W2I A;  1IPJ A;  5FZA A;  1G86 A;  4GWM A;  2GN7 A;  3R4D B;  2WFF 1;  5JDB A;  4XBN A;  2L9L A;  2RR1 3;  4OMD A;  3FLR A;  5FKB A;  2FDK A;  4OI0 A;  5DG2 A;  4O9G A;  4AI9 A;  1BQP A;  4XUP A;  4D3W A;  3MIH A;  1OUS A;  2WS9 1;  5GZC A;  1F15 A;  1W8O A;  2JKX A;  2J1T A;  4MVT A;  3SCG A;  1EUT A;  3BTY A;  3GZA A;  1RUE 2;  5A7W B;  3TNP B;  3GHM A;  1AL2 1;  4QU1 A;  4KQ7 A;  2Y0I A;  2JIJ A;  4A41 A;  2ZGL A;  2RS3 3;  2MPF A;  1S4C A;  4FVV A;  2ZGP A;  1UXX X;  2W0X A;  2Y26 A;  1OUX A;  1UPI A;  3A23 A;  4H55 A;  4NII A;  4A42 A;  5FQ0 A;  2Y0O A;  1IQD C;  3PTY A;  1HDK A;  2Q5T A;  1YYN A;  2IC1 A;  1WKY A;  4IEX A;  1O59 A;  3W58 A;  5JWP A;  1GQH A;  2BJS A;  1OH4 A;  1HB2 A;  1RMU 3;  2HWE 1;  1VBA 1;  4BH9 A;  4QT6 A;  3PUQ A;  5KR7 A;  2VMC A;  2XHN A;  1GWK A;  2UYA A;  4D0Q A;  2B42 B;  1ZBA 3;  2PHW A;  3B02 A;  2G19 A;  3B5L B;  4W6Y A;  2EXI A;  4LUM A;  4OUS A;  1CAV A;  1BVP 1;  2W52 A;  2YU2 A;  2RS3 2;  4NUB A;  1Q8Q A;  2HWF 2;  3M3E A;  4KU7 A;  4FFH A;  1UY1 A;  1OLR A;  1JYN A;  1RUD 1;  4NID A;  1Y3T A;  2V73 A;  3VBO C;  2WQ4 A;  4EQV A;  2XOM A;  2Z79 A;  4X6R B;  3RZH A;  2Q8E A;  3KZ4 C;  1GBG A;  1QF3 A;  1HQW A;  4R9C A;  5FZ6 A;  3VBH C;  1PK6 B;  3DPR C;  2IZW A;  5A3N A;  3THC A;  3VBH A;  1LOG A;  1UF2 C;  5FYZ A;  2QCS B;  3NV2 A;  5CB7 A;  2BPA 2;  1URX A;  2CNA A;  3SMH A;  3VD3 A;  1G8W A;  4ZU4 A;  1VBA 2;  2UYB A;  4XW3 A;  3POB A;  4ZON A;  3ECQ A;  1PGS A;  3RJ2 X;  5C4W B;  5IFT A;  4RL7 A;  3IDE A;  2VOT A;  4NAM A;  3W21 A;  5KHG A;  4S2G A;  2EID A;  4ITC A;  4ZPI A;  2FCU A;  5GKA C;  3HQX A;  3MPB A;  1NQJ A;  5HV4 A;  3BTX A;  3H3Z A;  5F37 A;  2BOI A;  2XDV A;  2BBV A;  3TN9 1;  4OUE A;  5EWS A;  4IE5 A;  1QJZ A;  1REE A;  3RDI A;  5B2G B;  4XE9 A;  2X53 S;  4Q8L A;  4Q4Y 3;  4WV8 A;  5FZ3 A;  1VAK A;  3I2O A;  1CAW A;  2W1U A;  5EYX A;  4DFS A;  1ODM A;  3W20 A;  2WFF 2;  3GZU C;  3RSJ A;  2BER A;  4KMQ A;  2VZ3 A;  4BQ4 A;  3WDY A;  5JOW A;  3I97 A;  2JG9 B;  1RIT A;  2JWP A;  2ZX3 A;  2K0G A;  3NNF A;  1SCR A;  2WA4 A;  4W50 A;  4XJW A;  4Q0U A;  2QQP A;  4ATE A;  3M2M A;  1HN0 A;  4PI0 A;  5FO8 B;  2RR1 1;  3MFC A;  4UBG A;  1LGB A;  1QJU 1;  2CY6 A;  5AC9 3;  1GQG A;  4QXC A;  2WFP A;  3Q8A A;  1EPZ A;  2NLR A;  4JTN A;  4K20 A;  2WIN B;  4QM9 A;  1AYM 3;  2WFF 3;  2ZPX A;  3I59 A;  1U5Z A;  4MGZ E;  5IVB A;  1M4W A;  2OA2 A;  3ZSE A;  3WW2 A;  1JXN A;  1WA4 A;  5I0T A;  2VXR A;  1HB3 A;  1CZV A;  1PZ8 A;  3MBW A;  1AR8 2;  3GJA A;  3GJB A;  3T09 A;  2RMU 3;  4K8R B;  5CYY A;  4BK4 A;  1W8U A;  5H9S A;  5I0U A;  5C8C C;  2ZEY A;  4XF0 A;  3J8F 3;  1O3R A;  2HEW F;  2BNO A;  1TQ5 A;  4RR3 B;  2J1R A;  1UU4 A;  1AX0 A;  2Y6J A;  4EE2 A;  4C1X A;  4DO0 A;  1WW4 A;  1WZX A;  2WT2 A;  2VUJ A;  4QHO A;  3PTR B;  4XDQ A;  4BK5 A;  1DGR N;  5FZC A;  2W39 A;  2B9V A;  1W2A X;  1WGP A;  1LOF C;  1W2O A;  2WAB A;  4HZF A;  3FX3 A;  3SLI A;  3ZYF A;  1AR6 1;  2Y33 A;  4F83 A;  1UYP A;  4AFC A;  1YJL A;  2HJI A;  3P3N A;  3S7I A;  1AL2 2;  3IWZ A;  4AEJ A;  3WVJ A;  1XPW A;  2WJS A;  4K8F A;  1W6P A;  1PO1 3;  2XQX A;  5FP8 A;  4LIU A;  3WV6 A;  3VHN A;  3III A;  3M3O A;  1V00 A;  4C0B A;  5BXX A;  5ISL A;  2P17 A;  3ACI A;  1JYC A;  3PIG A;  3V0B B;  2IFR A;  2VCB A;  4AYU A;  5L7O A;  5IK8 A;  4MH0 E;  4QPG A;  2WZ8 A;  4XJ9 A;  1YCI A;  5JI7 A;  3LFI A;  1AX2 A;  1MS8 A;  3U75 A;  1SZB A;  2XLA A;  2XUM A;  4CDX C;  1Q8V A;  3VBF B;  5AC9 2;  4WZF A;  3K75 B;  1VRH 1;  3JB8 A;  3FE5 A;  4MGS A;  5AVA A;  5EZW A;  5F9T A;  1CX1 A;  4K7J A;  5IW0 A;  4NWW A;  2VY0 A;  1ZBE 2;  1PZ7 A;  2X5I B;  3I4I A;  3K4A A;  1W90 A;  1J3Q A;  2JXA A;  3MLJ A;  4UF0 A;  5G05 L;  2XHK A;  4GAZ A;  1DP0 A;  3OGJ A;  3M70 A;  3BAL A;  3OPW A;  4OLL A;  5H9P A;  2A6Y A;  2VW2 A;  4YW4 A;  4ES8 A;  1U5I A;  3OUJ A;  4LOS A;  2JE8 A;  1SLT A;  5BNN A;  3NMB A;  5I91 A;  1JYV A;  5CG8 A;  4ISQ A;  1V6O A;  2CL2 A;  4Z8B A;  2WZR 3;  4Q4W 2;  3ZSK A;  4NRQ A;  3AP5 A;  2HWD 1;  4OYU A;  5FUN A;  4L0P A;  1Z0H A;  2FDH A;  5LW9 A;  4Q5O A;  4A3X A;  2LTN A;  4AI1 A;  4KG0 A;  1COV 1;  1BBT 3;  3ON7 A;  3BKZ A;  3CL1 A;  5JOZ A;  1APN A;  5L36 A;  1CPM A;  2P6C A;  1TG7 A;  1O8P A;  2ATF A;  1JZ8 A;  5JSR A;  1BYH A;  3M4F A;  2RDS A;  4LHN A;  4YG3 A;  1R08 3;  4EN9 B;  4HXC A;  3O1O A;  1YHF A;  4AG4 A;  1PO2 1;  1YIP A;  4HG6 B;  1COV 2;  4CRQ A;  4OI2 A;  2AC1 A;  3GF6 A;  2GC2 A;  2NPI A;  2ZAH A;  3E97 A;  4YW2 A;  1SG3 A;  1IKP A;  3N7M A;  3N9P A;  4L9B A;  1W8N A;  1ULD A;  3KCX A;  4CDX A;  3F95 A;  3VBR B;  1GUI A;  3DL3 A;  5E16 A;  2PHT A;  1RMU 1;  4YVS A;  3JD7 2;  4ZS2 A;  4ASK A;  1CON A;  3NKT A;  2Z69 A;  1RXG A;  3THP A;  1RUF 2;  2RS1 3;  4LUK A;  1GZ9 A;  1ZZ6 A;  1KDM A;  5FYU A;  4DIN B;  1WCQ A;  2RS1 1;  4SBV A;  4IEU A;  2ES3 A;  1RUO A;  1OXC A;  2B46 X;  3DPR B;  3R6S A;  3NV4 A;  2B4K A;  2O1Q A;  3W59 A;  1HB4 A;  3WT3 A;  4JDM A;  5IVJ A;  4LHL A;  3WHU A;  5F2S A;  4N43 C;  3ZR6 A;  3BOP A;  3NJX A;  1CVN A;  4BYY A;  2OPK A;  2WAA A;  4XUT A;  2WS9 3;  4CDW A;  3I54 A;  4XYX A;  5LK5 A;  2R1D A;  4Q27 A;  4IE6 A;  3P6B A;  4AR2 A;  3POF A;  1H8V A;  2JG9 C;  2ZXQ A;  3I2H A;  5CAD A;  1YRZ A;  4Q8K A;  3SH5 A;  5FKC A;  3D6E A;  5F5Q A;  5FP9 A;  1SPP A;  1X33 A;  3C7G A;  3N9O A;  1PO2 3;  5FZG A;  1VBB 2;  2BEO A;  4M0N A;  2PN5 A;  2ERF A;  3LFM A;  1KIT A;  5SV8 A;  1R08 1;  2WDB A;  1AJO A;  1Y43 B;  5CIR A;  1JZ6 A;  1V6K A;  3AJY A;  2ZGR A;  1AR7 1;  3AP7 A;  4GJY A;  2HWC 3;  4UFI A;  2WO3 A;  3KQ4 B;  2P3Y A;  5DN2 A;  3H0O A;  4FBF A;  4B29 A;  2Y60 A;  2C9K A;  5DUX A;  1D0G A;  4NIA A;  5A70 A;  5C33 A;  1PGL 1;  1ZVF A;  4Q4V 1;  5ACA 3;  1KQR A;  4WVW A;  3ZFF A;  1AR9 1;  3RWN A;  5CKQ A;  3LPG A;  2E9Q A;  2DCJ A;  4EN8 B;  1VP6 A;  1CJP A;  2HLE A;  5LA1 A;  2JDP A;  4Q29 A;  5A33 A;  3O1P A;  1TMF 3;  4OHX A;  2NYY A;  2EIG A;  4JQR A;  2J42 A;  5IVC A;  4IGQ A;  3V0A A;  3I3M A;  1NXM A;  5FP4 A;  2VBB A;  2OII A;  1KD7 A;  1ZZC A;  1OLM E;  4ORF A;  4GWN A;  4MXW B;  5LAT A;  1MVE A;  5FK7 A;  3ITQ A;  3OSD A;  4LKS A;  3T1M A;  3AJZ A;  2MEV 2;  4XC9 A;  5J36 A;  5TSW A;  1VAM A;  4YG0 A;  3WP6 A;  1RUJ 1;  3NJV A;  3D5O A;  3UKV A;  3AM2 A;  4FFI A;  2E53 A;  2R04 1;  1DGW X;  1XE8 A;  4KL1 A;  1LU2 A;  2WT1 A;  2VZ1 A;  3WLU A;  3GBW A;  4S2F A;  3ABZ A;  4RFT 0;  1QDC A;  4W65 A;  1EV1 2;  4Y1Y A;  3AX4 A;  1MS1 A;  2VAU A;  1RUE 3;  1DQ1 A;  2KR2 A;  4IET A;  4LBN A;  4LO5 B;  5FZO B;  5A6Q A;  1JYT A;  3BB6 A;  4Q4X 3;  4XF3 A;  4YGE A;  1QH6 A;  5A6Z A;  3OOX A;  4BIS A;  4KGG A;  3DN7 A;  1RIR A;  1CX4 A;  2F4P A;  1XRU A;  3I3B A;  4QX2 A;  4R9A A;  1PO1 1;  1WBF A;  3J7M A;  2F4L A;  4YW1 A;  1C3H A;  1KS4 A;  3VDB A;  4Z2A A;  1VBE 2;  4AVC A;  2BVV A;  3IAP A;  3CO2 A;  3VDD C;  2ZTN A;  3ZVX A;  2B39 A;  5C3S A;  1EV1 3;  4M3C F;  2BNN A;  2WQ8 A;  4LJH A;  1UYX A;  3RPQ A;  2R0H A;  1W04 A;  3NWK A;  1H8T C;  2VZT A;  4C90 A;  5JZG A;  3ETP A;  1O4Y A;  3O0X A;  2WS9 2;  4M3C E;  4Y1V A;  3W9A A;  1DDL A;  1S0F A;  5CKN A;  1GZT A;  2P6H A;  4ZZ5 A;  1IGO A;  4IGO A;  2D44 A;  4UXA A;  2KM2 A;  3VLB B;  1Z7S 2;  2K2S A;  4CP9 B;  3WX5 A;  3C7O A;  3T2Q A;  1G9F A;  4E4H A;  4AI8 A;  5F3I A;  2VW0 A;  1UMZ A;  3ZLI A;  3MEP A;  4WVM A;  3TB0 A;  1ND2 C;  2WSU A;  4EV0 A;  1VBC 2;  2WNV A;  3IZO A;  1XBF A;  4Q0S A;  3WEZ A;  3H8U A;  3CKH A;  1XSQ A;  2C0Z A;  3WQ0 A;  4AFA A;  1QJU 3;  4QGM A;  3AFK A;  1K5M A;  3C7F A;  5DDJ 2;  3NNJ A;  3WF1 A;  5FY8 A;  1DLL A;  1SDD B;  2OXB A;  1J3R A;  1DCS A;  3ZYI B;  5LY1 A;  1EAH 2;  4WM8 C;  5BNO B;  3JUU A;  4QQO A;  1B35 B;  2VG9 A;  4WM8 A;  4XVH A;  3BIW E;  3POI A;  5FRE A;  3RQ0 A;  3FBM A;  1PM4 A;  3RZJ A;  5FYB A;  3B9I A;  1N1V A;  3O14 A;  4YZ4 A;  4A7Y A;  4IEO A;  4UW6 A;  1JU4 A;  4OHZ A;  4Y33 A;  1YUD A;  1MZF A;  4YRD A;  1VBC 3;  1KJL A;  3ENR A;  3ZN6 A;  4CP9 A;  2QZ3 A;  4Q4Y 1;  4AQ2 A;  1MR5 A;  1NAE A;  3WP3 A;  3KT1 A;  1W8W A;  2QQK A;  3RZZ A;  3RZK A;  5D8A A;  1AR9 3;  4P9I A;  4JZR A;  3HNY M;  4AK3 A;  3Q8F A;  4QQL A;  3O12 A;  2W87 A;  4H7L A;  2TUN A;  3RFR A;  4L92 A;  2LRO A;  2Q8O A;  2X5I C;  3VUO A;  4LBK A;  4RN5 A;  2BFU L;  3BVC A;  3HNB M;  5GZG A;  4JGZ B;  1RTV A;  2ZEW A;  5C8W A;  3HEI A;  4BLI A;  3VKF C;  5BNQ A;  4E27 A;  1K3I A;  4K3U A;  2YFU A;  3JQW A;  3WQ1 A;  1WD3 A;  2BW8 A;  4QQ2 A;  4QX0 A;  1YFW A;  4W6W A;  4YW5 A;  5FY5 A;  1Y7B A;  5GZD A;  4FQZ A;  4CCL A;  1UYY A;  1ZBE 1;  1O8S A;  3BPS A;  4BPZ A;  1V6L A;  4JTO A;  3T4H B;  3UGG A;  4XZP A;  5L9R A;  2D3P A;  1R1A 1;  2ZGO A;  3B69 A;  4LKD A;  3P3P A;  3UL2 A;  4D6S A;  2WZR 1;  4B1L A;  3RZM A;  1C1L A;  1OF3 A;  5FZO A;  3HOB A;  4YFZ A;  4X8N A;  5IK7 A;  1RUH 1;  1U12 A;  1QXJ A;  4EN7 B;  4UFL A;  1IS5 A;  1UZ0 A;  1VIW B;  4GXL A;  4UWD A;  3RRD A;  1W9W A;  2JDA A;  2VBP A;  4DIQ A;  4ZHN A;  3FJS A;  2IFW A;  5A3M A;  1DIW A;  5FDB A;  2YMZ A;  4AXO A;  3ME2 A;  2VMG A;  4Y4R A;  3PLQ A;  5JPM B;  4CDU B;  1ZBA 1;  3KQR A;  3J4U H;  4COY A;  5FZI A;  2VZO A;  3OEA A;  4DS0 A;  5FUI A;  3AMH A;  4MXW A;  1HW5 A;  1N1T A;  3MGU A;  1GP5 A;  4RYD A;  1PMJ X;  2R32 A;  3Q8C A;  3RNS A;  1FPN 2;  3OG2 A;  3MIE A;  4UT5 A;  2OUH A;  1SLC A;  2VH9 A;  4RGA A;  1HJF A;  2DTW A;  3WDV A;  4IER A;  2GDF A;  1ACC A;  2BQP A;  3FLT A;  5CFD A;  4B4R A;  5J96 B;  3QH7 A;  5HCB A;  1W0N A;  1RVF 2;  3UKT A;  5A1F A;  1V6J A;  5C3Q A;  5IT6 A;  4XBQ A;  5T52 A;  2VC9 A;  2J1S A;  2OKX A;  1W28 A;  3NJZ A;  5CAZ A;  2XBO 3;  4RD7 A;  3VZM A;  2JIG A;  4OZX A;  3HNM A;  2V5Y A;  1TZO A;  3FLP A;  1GMM A;  3JD7 1;  1ZZ9 A;  4BLJ A;  1AUY A;  1GIC A;  4DUW A;  2WNU B;  1QMJ A;  2H6C A;  3SKV A;  2XJV A;  1ZBE 3;  2ZMN A;  1B35 C;  1RUC 3;  3WHT A;  1FXZ A;  1WMX A;  1T2X A;  4LHS A;  3MLL A;  3RYK A;  1CAW B;  1Q5O A;  5FR3 A;  1OD5 A;  2Z4F A;  4OMC A;  4A2U A;  3JCI A;  3PU8 A;  1ULF A;  5SV5 A;  3ZIX A;  4BXF A;  3UNP A;  3I3Q A;  1G9D A;  2VEC A;  3A22 A;  1XND A;  4QHB A;  2YPD A;  2Y34 A;  3T0D A;  4HAN A;  1HRI 1;  5FLH A;  3WNX A;  1WCU A;  3DYP A;  3LDB A;  2YRO A;  3ORJ A;  3MIF A;  1WBL A;  4L97 A;  5C9A A;  4KI5 M;  1PIV 1;  1WMF A;  2VNG A;  3ZM8 A;  4QB2 A;  5IAV A;  4LO4 B;  4BQ3 A;  1AYM 1;  1LHO A;  4PLN A;  4XJA A;  3GM8 A;  1IQA A;  3HN3 A;  3I2J A;  3LB9 A;  2ETE A;  3N7K A;  4IV1 A;  2R49 A;  4GKY A;  1NE4 A;  5JXJ A;  4YM2 A;  5DAB A;  1HRV 2;  2YU1 A;  3WF0 A;  4YVS B;  1OKO A;  3CDZ B;  1S0G A;  3LAG A;  3QH6 A;  2A6Z A;  1LNS A;  1OA2 A;  5D8A B;  2W1S A;  1XYO A;  4PIY A;  1US2 A;  4Y26 A;  1H1I A;  1BVV A;  2AUY A;  3OPZ A;  3VBO B;  1OLQ A;  3ZN6 B;  4FPO B;  4CXW A;  1NYW A;  2ILM A;  4X6Q B;  2RDR A;  5FLI A;  1QNY A;  2JB4 A;  3WF3 A;  4IE0 A;  1X36 A;  5DAQ A;  3WDU A;  1HJG A;  1HQL A;  3WCR A;  3CEW A;  2VME A;  1O6U A;  2XQR A;  3RMY A;  1WLC A;  1CJD A;  3ZYB A;  1MQT C;  1B35 A;  2SLI A;  3E5Q A;  4GMP 0;  1KDK A;  1UAI A;  1NA1 B;  4NVP A;  2PEL A;  1HRV 3;  2Q4S A;  4QXB A;  1YQC A;  2LUW A;  3A0N A;  1QOS A;  1ONA A;  4OCT A;  5FZF A;  1Z7S 3;  2NN8 A;  4AZZ A;  4RHV 1;  3PDQ A;  5CNA A;  1HKD A;  1HRI 3;  1OD3 A;  2XUE A;  4OUL A;  4V1P A;  4CCN A;  2AR6 A;  3WDW A;  3SXW A;  5KHJ A;  2H0V A;  2XVG A;  3WNM A;  3ZXL A;  1ZA4 A;  1D4V B;  3D4K A;  4IEY A;  4WVM B;  1DF0 A;  3MV1 1;  2JEN A;  3SNM A;  3ACG A;  4E2Q A;  4F3J A;  5IAX A;  4FTB A;  2YUE A;  2IVI B;  3QD6 A;  4XXA A;  3U1X A;  1E57 A;  3IAQ A;  1QJY 2;  1DZR A;  4K21 A;  3VBO A;  1RUC 1;  4MGT A;  3M7A A;  4UF0 B;  4DB5 A;  2Q8C A;  3T3Y A;  3UK9 A;  1NE6 A;  3KF3 A;  1P8J A;  1QXR A;  2D6N A;  4RGK A;  5EJZ B;  5ANN A;  2AEN A;  1TME 2;  1ZA7 A;  2Z2S B;  5CZK A;  3H8X A;  1RUE 1;  5L9B A;  4AI2 A;  3D3A A;  5CBL A;  1W05 A;  3GXU A;  2N7G A;  4R52 A;  4FPK A;  4CP0 A;  5F32 A;  4CEY C;  3JBG 3;  1RHI 3;  3PUH A;  2WYF A;  1UY0 A;  1DZT A;  2K9Z A;  2C1F A;  5T54 A;  5FZK A;  2EIB A;  2WKK A;  5LY2 A;  1RUD 2;  2JDU A;  3IBM A;  2PHU A;  3PVN A;  2HWC 2;  1QJY 1;  3BYW A;  1H1M A;  2X10 A;  2W1Q A;  5JXI A;  3I3D A;  1NY7 2;  1HV1 A;  5EPA A;  1ENQ A;  1GV9 A;  3MF9 A;  3QLQ A;  4N8M A;  2D6L X;  4QDQ A;  3MW2 A;  1VBB 3;  4P9J A;  5A3W A;  1K5M C;  1FV2 A;  3SIS A;  1YJK A;  2EXH A;  3I2G A;  4YM0 A;  4I3P A;  3JXS A;  2O8O A;  3ZXE A;  5CFC C;  2A3W A;  4C1W A;  3WDX A;  2AYH A;  5GLU A;  5F2W A;  3J8F 2;  5FIX A;  2FDJ A;  2D40 A;  5I8Y A;  1MZ5 A;  4B7K A;  3ROU A;  3CJI B;  3R0R A;  5T50 A;  4AFD A;  3QOP A;  5BNO C;  4DEV A;  2WNU A;  1SCS A;  3CBN A;  4JQT A;  1ZYB A;  3DF0 A;  1PGL 2;  2TEP A;  1K5M B;  4COW A;  2Y64 A;  2ZGQ A;  4AVA A;  2WA3 A;  2EXJ A;  1YFU A;  2AEY A;  2QFE A;  3OGV A;  1GP4 A;  2A71 A;  4FP3 A;  2WNV B;  5JAX A;  3BU0 A;  3WNL A;  2GZW A;  4BB3 A;  1H2M A;  2YC2 A;  2FHR A;  1LOD A;  4WBB A;  1GNZ A;  1UZZ A;  4UFH A;  5HXV A;  2C6S A;  3ILR A;  5GM0 A;  3DXU A;  3CU7 A;  1RUI 3;  4FOY A;  5FZD A;  3HBZ A;  5FXZ A;  3S7E A;  5KHI A;  5CA6 A;  4BE3 A;  2JX9 A;  2OS2 A;  1A3K A;  5LA9 A;  2YHJ A;  3AKQ A;  1ENS A;  2QQV A;  1PGW 2;  2BP6 A;  3TEZ A;  3NO8 A;  1HRV 1;  2H0B A;  3FHI B;  3ZXG A;  2OZ6 A;  1OQE A;  2PHD A;  3IM0 A;  3L2H A;  4A44 A;  3CMG A;  4YVW C;  5HXM A;  3K4D A;  1QY4 A;  1H8T B;  4YFW A;  4CUC A;  4IV1 B;  3MPP G;  4XF1 A;  1XNA A;  2WNO A;  5DPN A;  3AMM A;  3ZMO A;  2GP3 A;  4C0H A;  1UOJ A;  2RV9 A;  3PJY A;  5LK7 B;  1LES A;  2Q1F A;  3L9J T;  2RS3 1;  2JE7 A;  3AYE A;  3NJY A;  2Z42 A;  2XON A;  2D97 A;  1H2L A;  5FZ7 A;  1HRI 2;  4XFG A;  1HQN A;  3POY A;  4Q0V A;  2ZGK A;  4LBL A;  4AE2 A;  1YFX A;  3GCW A;  3M3C A;  4GH4 C;  4O61 A;  1W3X A;  2HH9 A;  4DRV A;  2RMU 2;  1DYK A;  4IV3 A;  5FUP A;  1PX3 A;  5LBE A;  1UYZ A;  2QQM A;  3C7H A;  4FTS A;  4LLF A;  3ZDV A;  1K5J A;  1EAH 3;  2E33 A;  3GDB A;  4GMP 1;  4IQP A;  3X29 B;  2KXL A;  2YV8 A;  2DUR A;  3UET A;  3VDA A;  1H8T A;  2ZBJ A;  2VMI A;  4XQ4 A;  4CTE A;  4DUX A;  1ULG A;  4CU9 A;  3T08 A;  5JZG C;  4OUM A;  2FDF A;  1V9U 1;  2P4E A;  4GAL A;  3H1W A;  2G9G A;  2ORX A;  2ZZJ A;  3ALQ A;  4FPJ A;  2DVF A;  4CEY B;  3GZE A;  2QVS B;  3JZV A;  3ZYP A;  3QCW A;  4R4X A;  2BU9 A;  3NQH A;  1OKQ A;  3NAP C;  4JX0 A;  1S0D A;  4LA2 A;  3WUD A;  3PU3 A;  3VZL A;  2VMH A;  4JC1 A;  1OOP A;  4I09 A;  3U4X A;  4FPE A;  3VV1 A;  2Q1M A;  2QTW B;  1RL3 A;  2ZKN A;  3B01 A;  1W8F A;  4XPV A;  5LBF A;  1W0P A;  1CR7 A;  2OQ6 A;  3J7H A;  2DF7 A;  1JZ3 A;  5APA A;  1LTE A;  4YW3 A;  3ZFF B;  2ZX4 A;  2ARB A;  4CZS A;  1NX9 A;  2UWC A;  2BUK A;  4WM8 B;  3TAY A;  1DLC A;  1R09 2;  2A6V A;  5IK4 A;  4KU8 A;  3DUI A;  3W5N A;  1AJK A;  5D2A A;  5BUV A;  1QGL A;  1TE1 B;  3IMN A;  1XXN A;  3MUY 1;  3K77 A;  4RHV 2;  4LOT A;  3ZFE A;  4AWD A;  3CJI A;  5B4X A;  5KHK A;  1UXZ A;  4Y4Y A;  3AZY A;  4CDU A;  3O1R A;  4P00 B;  2GMP A;  4LKE A;  3S30 A;  3J26 N;  3ZKY A;  2BGC A;  1S1A A;  1NCR B;  4HLT A;  2Y38 A;  4RR3 C;  1AXK A;  3AZV A;  1QIQ A;  4ARY A;  4AGV A;  1VRB A;  4BQ1 A;  3IB3 A;  4DMI A;  5IVE A;  3MUZ 1;  3WR0 A;  2XJP A;  4S2D A;  3SKJ E;  4J1X A;  1UCX A;  2YY1 A;  4D7S A;  5HCA A;  5F3E A;  2PHR A;  1RUJ 3;  3C3V A;  3K3N A;  3LA7 A;  4EZH A;  5J3U A;  4K1Y A;  1JMU B;  4CDW B;  1QJF A;  1QEX A;  2QQL A;  2YYO A;  3WW4 A;  4GJZ A;  1LR5 A;  3TEW A;  1VAV A;  1GR3 A;  1C1F A;  3AKP A;  3RI9 A;  1YI7 A;  3T4V A;  3VZJ A;  1GP6 A;  1X50 A;  4H7M A;  5FMO S;  3I8T A;  2V09 A;  3VBF A;  1DYO A;  1Y4W A;  2KD7 A;  4LUL A;  2D6O X;  5CVR A;  4UFM A;  3U4S A;  1XU1 A;  2HKX A;  4RGG A;  5A3P A;  1AR8 1;  1I6X A;  1FNZ A;  2RM2 1;  3HR9 A;  4NOT A;  3LGR A;  5FZ8 A;  3ZXD A;  4XTM A;  3BGA A;  4D7Y A;  1W9F A;  3EHK A;  1VBE 1;  2VXJ A;  3USU A;  1FYU A;  1F4A A;  2I45 A;  3LIG A;  5F1R A;  4AQ6 A;  3N9M A;  2Y6F A;  1ZZB A;  3INA A;  4JHZ A;  1N1Y A;  1QWR A;  3KV4 A;  4BZ4 A;  4R9D A;  3N9N A;  2VUA A;  1C28 A;  1FMD 3;  3EB7 A;  4FTE A;  5I8T A;  3ZMN A;  2ZHL A;  4Q1R A;  1V9U 3;  1D4M 1;  2MHF A;  1KRI A;  5JOY A;  2W08 A;  2GAL A;  4V2W A;  1XNK A;  3LA3 A;  2C5D A;  2W5F A;  2Z5W A;  3AFG A;  2ZGN A;  4U2A A;  3URF A;  1EAH 1;  1NCR A;  1R1A 2;  1PX4 A;  1WLW A;  4CDU C;  2FD8 A;  5FYH A;  4IES A;  2R04 2;  5B4N A;  3PVB B;  3AL5 A;  5DXD A;  2XKP A;  1VAL A;  2Q0A A;  4RR3 A;  2E7A A;  4MZU A;  2E7Q A;  3ZSL A;  1J3P A;  1K45 A;  3SCF A;  1IPS A;  2WZP P;  3U10 A;  1VBC 1;  2WNE A;  1OF4 A;  4P5H A;  3U11 A;  1RUI 2;  1H4H A;  1OQ1 A;  3THT A;  2GC3 A;  4FPG A;  5KXD A;  4IE4 A;  4UFJ A;  1S55 A;  3IDA A;  5LBB A;  4DXT A;  1WLD A;  1OPM A;  1AHS A;  3LCP A;  4PCR A;  5FYM A;  3H8O A;  1W39 A;  2GME A;  1W6O B;  3CQO A;  1XSR A;  5FXW A;  4PLM A;  1OOP B;  4N7U A;  1H0B A;  1QJX 1;  1GWL A;  2YZ4 A;  3Q8B A;  3WUC A;  4IEZ A;  3WNO A;  3VD7 A;  2DFB A;  1QJU 2;  1YIF A;  2JDK A;  2X5I A;  3LSE A;  3CNA A;  3AP4 A;  1LEN A;  4Q4V 2;  1RHI 1;  2P5B A;  5A7S A;  3VN4 A;  1S0E A;  2WLQ A;  4CEY A;  1SHW B;  2XL7 A;  2B5H A;  2ZML A;  2BNM A;  3HVD A;  3IDC B;  3ZO0 B;  2VW1 A;  1OFS A;  4I2O A;  4LR4 A;  5JZG B;  4MAD A;  1CES A;  1ZNP A;  1HV0 A;  3U37 A;  1OUR A;  5JMC A;  4XZU G;  5FMD A;  3VD9 A; 
#chains in the Genus database with same CATH homology
 4O7X A;  3T3Y A;  4QKD A;  4JHT A;  4NRO A;  4IE6 A;  4IE4 A;  3KHC A;  3RZM A;  4QKB A;  3BU0 A;  3BTZ A;  3RZH A;  4IE5 A;  4NRQ A;  4NII A;  3RZK A;  5DAB A;  3H8X A;  2FDF A;  4NPL A;  4NRP A;  3T4V A;  4MG2 A;  4IDZ A;  3I3Q A;  2FDH A;  3H8O A;  3BIE A;  4OCT A;  4ZS2 A;  3RZL A;  3O1S A;  3O1T A;  3BKZ A;  4ZHN A;  3O1P A;  4NRM A;  3I2O A;  3S5A A;  3O1R A;  3LFM A;  3BUC A;  3O1V A;  2FDJ A;  4CXX A;  3I49 A;  2FD8 A;  2IUW A;  4IE7 A;  4O61 A;  2FDK A;  3RZJ A;  3I3M A;  4NPM A;  4CXW A;  3BTY A;  4QKN A;  3O1M A;  4QKF A;  3H8R A;  3RZG A;  2FDI A;  3KHB A;  4RFR B;  4CXY A;  3O1O A;  2FDG A;  3BI3 A;  4IE0 A;  4ZS3 A;  3S57 A;  4NJ4 A;  4QHO A;  3T4H B;  3O1U A;  3BTX A;  4MGT A;  4NIH A;  4NID A;  5F8P A;  4NIG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...