4HPKB

Crystal structure of clostridium histolyticum colg collagenase collagen-binding domain 3b at 1.35 angstrom resolution in presence of calcium nitrate
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
118
structure length
113
Chain Sequence
IPGNEKLKEKENNDSSDKATVIPNFNTTMQGSLLGDDSRDYYSFEVKEEGEVNIELDKKDEFGVTWTLHPESITYGQVDGNKVSNKVKLRPGKYYLLVYKYSGSGNYELRVNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Collagenase
publication title Structural Comparison of ColH and ColG Collagen-Binding Domains from Clostridium histolyticum.
pubmed doi rcsb
source organism Clostridium histolyticum
total genus 31
structure length 113
sequence length 118
ec nomenclature ec 3.4.24.3: Microbial collagenase.
pdb deposition date 2012-10-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.380 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4hpkB00
4DZGA 2O8OA 5FBZA 1NQDA 4DXZA 4I3GA 4DY5A 4DY3A 1NQJA 3JQXA 1WMDA 3JQWA 1WMEA 1KFXL 2XVKA 5FAXA 1U5IA 1WMFA 3BOWA 1DF0A 2QFEA 2XVGA 4HPKA 2XVLA 3AFGA 4HPKB 1KFUL 2LUWA 4G9SB 1QXPA 3DF0A 5SV5A
chains in the Genus database with same CATH superfamily
3KZ4C 2HJIA 3WY6A 4YGBA 4DPNA 3ABZA 3ILRA 2YBSA 1US3A 2BFUL 4V1PA 4FOVA 1SCRA 4LT5A 4UF0B 1W6NB 1HRV1 4FFFA 5A1LA 3WV6A 4B8EA 4FQZA 1ODMA 4XBLA 4XEZA 5BNNB 5JR7B 1VMHA 3LWCA 4UFHA 5IAVA 3O1PA 2CL2A 4YVSA 1CAVA 4K1YA 4PIXA 3DKQA 3DPRC 4M4PA 2MEV1 2P3IA 4QWNA 4YPJA 3AFGA 4ZXKA 3HBZA 5JXGA 2XBO3 4FFHA 2P6HA 4WVWA 2Y8KA 1STMA 2OUJA 2YFZA 3LEIA 3NAPA 2GMMA 1BYHA 1XRUA 1OA2A 2VW0A 4AHXA 4XJAA 2D6LX 4I3GA 3ST7A 2ZGNA 3HT2A 3MUZ1 5GZCA 2JDYA 4GH4A 5DDJ3 2E63A 1JS9A 3PUHA 3J8F1 1PMJX 3RZGA 4CCMA 1GZTA 4XW3A 1ZRRA 1VPHA 4GB33 4M4RA 5EHDA 2VY0A 2PHUA 1NOVA 4HT1T 5EQUA 2VC9A 2FQPA 3AK0A 3ILFA 2A70A 3AP9A 1CJDA 1I6XA 3KT7A 2L9LA 3APBA 4NJ4A 4CDUB 2RR12 1XC6A 1MPXA 1QJZA 1S2BA 1KS5A 3EB7A 1CPNA 2ETEA 4K8RB 2VZTA 1OOPB 5CNAA 5CEHA 1V6MA 2O8OA 2WS91 3DYMA 4I0WB 1REFA 4LE4A 2Q0AA 3VBFA 2BBAA 4XJWA 3T1MA 4TTGA 2R30A 4KU7A 5M0TA 5D8AC 3VLBB 4NO4A 4QB1A 1LGNA 2PHTA 4YGEA 3GJBA 4Y1XA 4INDA 1TMF3 3W5NA 4QX1A 3HMYA 1PK6A 4NN0A 1V9U3 4IE0A 1UL9A 2D6PA 3VBRB 3ZMNA 1QHDA 2OUHA 5LASA 4AYUA 2FMYA 3V0AB 3TEZA 3TNPB 2PAEA 2BVVA 5KC5A 2HWC3 5CFDB 5C3SA 2XVGA 5DABA 3PTRB 1ND3A 5K0UB 4AOCA 2KA3A 1AR61 1HDKA 4YSFA 1PNFA 1NLSA 1LOFC 2AENA 2QQWA 2ZJCA 4QDSA 1PHMA 3BPSA 5JPNB 3LIHA 3FHQA 4XHXA 3HNYM 4JVAA 1EAH2 3NAPC 4QQ2A 4LBNA 4CPBD 4TLGA 3NQHA 1GP6A 2FCUA 4JQRA 3C3VA 4LKSA 4BOWA 1JU3A 2VGDA 3ES4A 1RUI1 2XJTA 1UPSA 3EMRA 1NAEA 3MI8A 2DCYA 4FSJA 2IC1A 3I2FA 4COUA 2DFBA 4NAMA 1G7YA 1MQTA 1UZZA 3HVDA 4ZKTB 3RYRA 2Q8DA 1JYCA 2B4KA 3TYJA 4ARYA 3BOWA 1ZRDA 1NCQB 2HYKA 4WM7A 5FPBA 3IAPA 4BE3A 3GZUC 4XJ9A 4A44A 1KS4A 3BB6A 3NWKA 4GQ7A 4MSVA 2X53S 2VL4A 1H2NA 4ZU5A 2WFF2 4OQ9A 4J6GA 1GZCA 1PVC3 3CJXA 3W59A 3WF0A 4DNYA 1HN1A 4Q4W2 1JOBA 4UI9L 4RFRB 3CU7A 4YLZA 1FOD3 3NL1A 1GYKA 3A4UA 3OD4A 1MR5A 2ZA9A 2R7EB 3JQWA 5APAA 5GLTA 2YU2A 3ZFFA 4ONUA 5BPXA 1C5HA 1PO13 3AC0A 1UYZA 2ERFA 1EUTA 2V5DA 3ACIA 2PELA 4UBHA 3H8OA 3VBUC 2VE1A 2D5HA 3WF4A 1RUE3 4AEJA 1DLCA 4MGSA 2R063 3MIHA 4MGQA 3U11A 1QMJA 4LOSA 3R0RA 4DXRA 4IV3A 2X05A 3T0BA 3IM0A 4M3CE 1EY2A 4DS0A 2BQPA 1VB2A 4LORA 4W4ZA 3Q8EA 4FPKA 3OY8B 2DUOA 2OPKA 5FZ9A 1UY0A 3RZJA 4CPBA 3E6DA 5T5OA 4XURA 2BRTA 4RQPC 1W0PA 4COVA 4MGKE 1RMU2 3RJ2X 2HWF2 3OBRA 2EXJA 1HX6A 1IS3A 1YXWA 1CAUB 2HLEA 2JDMA 3ZSEA 4XF0A 3PL0A 4LO4B 4Q5OA 1OH4A 2YFUA 4K8FA 3E5UA 4YGCA 1SLTA 4BQWA 1AL0G 4IGPA 1K3IA 2XHNA 4XC9A 2RM23 3ES1A 5JVVA 1A6CA 2W1SA 3OTFA 5HBAA 4YW4A 4EWDA 2FDGA 4OUMA 5A1FA 1GNYA 1W2NA 5J7MA 3WNPA 1VALA 3NRUA 2GP3A 2VTXJ 3LAGA 4IEYA 2XBO1 5KHHA 5SV8A 5CKMA 1W3XA 3O0WA 5G04L 5IK4A 2LROA 5C71A 1R092 1F31A 4BLJA 1D2QA 5CIRA 3DCQA 1CX1A 5FO9B 5FZ6A 1KXGA 3WG3A 2VVEA 4XFHA 3FLTA 3POYA 4N90A 2VNGA 2JKBA 5DDJ1 5GZEA 1JZ6A 3I3QA 3RI9A 2FDFA 2CNAA 5ABJA 1ASJ2 5A7SA 3S7IA 5J98B 2UU8A 1C1FA 4QKBA 4K21A 5H9RA 3ZIWA 3ZXLA 1CAVB 2G4IA 3JD72 2B46X 3AFKA 4OVEA 3S6PA 3SH3A 5I8TA 3RZZA 4OI1A 4M01A 5IK7A 2WKKA 3BIWE 1JW6A 3I97A 1RIRA 5FZHA 4FBFA 4YW1A 5LBBA 1SEFA 4Q0PA 1LODA 2JDPA 2GZWA 2A3XA 4PLOA 1RGSA 1XU2A 3OUIA 2FBEA 4NROA 5A6XA 4GH4B 4AQ6A 1D7PM 1NZIA 3EXUA 1TMF1 1QJX1 2IXJA 3ZYFA 5FOJB 1JYTA 1V9U1 2JWPA 4NHLA 2WQ8A 4R9DA 4BU2A 1IG3A 3DYPA 4QX8A 1V6JA 4B4RA 1BMV2 4QPIC 4LIUA 5C8WA 1L7LA 2VOTA 4OHXA 4UT5A 1WBLA 5C4WA 2CTVA 2HWC1 3KT4A 4KGGA 1RUF1 1F15A 1CJPA 4YG0A 3C7FA 2JG9C 5JDBA 1JHNA 1GUIA 3HIFA 1W28A 4XUNA 2ADEA 1JZ2A 1VAVA 1XNBA 1JN2P 1QOOA 3MIDA 5D1IA 4EN0A 4CP9A 1NY71 2BUKA 1W9FA 4N43C 2PTMA 5ACA3 2VUCA 4A6OA 4AAXA 5K7PA 1PK6B 4Q4Y1 2WAOA 3DEMA 1VBC3 3D5OA 2W68A 2J1AA 3KWVA 4COWA 5ANNA 4C1WA 2ZMNA 5F2WA 2ZGLA 2CYFA 1SLIA 3OGJA 4IEPA 3RYPA 2X5IA 3F95A 1H4HA 4HG6B 3ZMOA 5A6YA 5C3PA 5IAXA 1CN1A 5JZGB 1QEXA 2VOXA 2BNNA 5JSRA 5F3CA 1GWMA 1MZ6A 1ND3B 1XOYA 1R1A3 1UD1A 1XU1A 2O14A 4YWAA 2PMWB 5KXEA 3D0JA 4DEQA 3NV4A 2D5FA 1BEV1 2A7AA 1ZBE2 3QCWA 5T54A 5HXVA 5FMOS 2ZABA 4PBOA 2VZ3A 4Y5SA 4UFKA 5F37A 1FOD1 1RUH1 2K2SA 1O4YA 5JMCA 2QTWB 1RUG2 3MV01 1RUC3 2XKOA 4NR1A 1MQTB 1OD3A 2CDPA 3O12A 4Q8LA 5EIYB 1W8UA 3CJIA 1ODNA 4ZHNA 3GZEA 3K4DA 4OI2A 2GALA 1PO11 1UU6A 4WM7B 1TNRA 5FK7A 3TRSB 3WG1A 2YC2A 1POQA 4LJHA 1C8NA 5FJHA 4AI0A 5FTTC 1JZ8A 5C8CC 1DIWA 3WP6A 2R061 3AYAA 2WO1A 1FV2A 4E8CA 4CU8A 3B5LB 3MHZA 1CAXA 3HQUA 2AACA 4OYUA 3ZXGA 1ND2A 4XDQA 4YZ4A 1CESA 5JAXA 3UV9A 3U1XA 3S5AA 3U4XA 2RHPA 5J1XA 2GDFA 3LF7A 4Q4V3 1GFF2 3ZFFB 1JUHA 1GP5A 4NRQA 1G9BA 3ZVXA 2A6WA 4Y5TA 2WIIB 4LUKA 3OF1A 4AI3A 4XUOA 3I2GA 1UXXX 2RS12 3T0DA 1YFYA 3B02A 3T4VA 4KBZA 5A1AA 1AL23 3IMMA 3V65A 2DDUA 1UW8A 2BBVA 1RHI3 1S0BA 1TQ5A 5FZCA 5T5PA 4I01A 1ACCA 1DHKB 2VOKA 3CEWA 4BQ5A 5LCWL 2RM21 1KDKA 1G9AA 5LBCA 1URXA 2GMEA 3B7MA 4JQTA 1HXS3 4D7YA 3MPBA 3NJXA 5CFCC 3H8XA 3HOBA 3ZR6A 3MW2A 1OLMA 1SPPB 1FMD3 4A41A 1PNGA 2HWB3 4IEQA 1IGOA 2OW4A 3KQ4B 4XF1A 1D4M3 3M3QA 1VE0A 5L7OB 3K77A 1H9WA 3VZKA 1QGLA 4NRMA 4ASKA 1AYN2 2ENRA 2XJUA 3N7LA 5FZBA 1T6GC 4CU7A 1HRV2 1OBNA 3WHTA 4AVCA 5JXHA 3CHXA 5IW0A 2VR4A 4AVVA 1B35C 1YFWA 1OI6A 5JLVA 1XBFA 4XFIA 1H2MA 5FO8B 4MXWA 3CO2A 2YPDA 4MGIE 2QUOA 4BWOA 4GULA 2MEV2 1RL3A 3VDCA 3E5QA 2ZGPA 4XQ4A 2X10A 5JPMB 2Q8OA 1P8JA 1WD3A 5I0TA 1I3HA 3KD4A 5FLIA 3SHRA 4FXKB 1ND2C 5FMCA 1GQHA 1JYWA 1H6YA 3KLSA 3CDZB 2E7TA 4BJ0A 1HQNA 3QLQA 3T2OA 1UIKA 5FZ8A 3USSA 1NUKA 4AQTA 3O1UA 1VBE3 3U0ZA 5T55A 2I74A 3I8TA 2ZX4A 4QAWA 2D98A 4QU2A 4BMEA 4BXFA 5ABJB 2PAKA 3PMSA 2PA7A 1W8TA 3J8F2 4CEYC 4ZZ8A 3KF3A 1OXCA 2Y26A 2ZBJA 3GZAA 4AVTA 2WC2A 1Y43B 4CZSA 4P9LA 5C9AC 4DIQA 4QKDA 5DN2A 4JC1A 3ASIA 3VD7A 3T2PA 1SQ4A 1WCSA 1W06A 2JE8A 4D6SA 5LA1A 1NKGA 2GC2A 1J58A 3AL6A 4GAZA 4K1ZA 5FP4A 3ZFGB 4CCOA 2WS92 3RS6A 3M8LA 3RYKA 2X8KA 3I49A 5FP3A 4BIFA 5ACA1 1UYXA 2JXAA 2ZTNA 3R4SA 2BGOA 1LOBA 4R4ZA 2B39A 2VBDA 4QX2A 3GZTB 1Z7S3 2DVAA 4XF9A 4GXLA 1V6LA 2BNOA 1WBFA 4N53A 4QM8A 2JE9A 3UGGA 4EN8B 2Z69A 1WLCA 5F2SA 2E26A 4EE2A 2FZ1A 2WSUA 5L36A 2WNVC 2O0OA 2OPWA 4LLFA 5LY2A 3OYWA 5FXZA 4IUGA 5C4WB 2XXZA 2JB8A 1H8TA 4IETA 3ELNA 1NE4A 1R1A1 4LULA 4RHV3 2QVSB 4ZY9A 4LHLA 2ADDA 3ON7A 3T08A 2O8QA 1Q8OA 2GN7A 1COV2 1UIJA 2WT0A 3J7HA 4AI2A 4CP9B 3FLPA 3VBSA 2A75A 1SHWB 1K5MC 3H7YA 3WP3A 1LU2A 2R073 3SH5A 3VD9A 2BGCA 1YQCA 3GF6A 2ZGOA 1RUI2 2W52A 4LK7A 1RUC1 4UYBA 2X5IB 4CEWC 3PDQA 4H14A 1ZRCA 1RC6A 1SBEA 2ZX1A 1WCKA 4QB6A 5AFBA 3K3NA 5A6QA 3T30A 4Q8KA 4JKLA 4JRAA 2ARCA 2ZHMA 2RMU2 1O3SA 1E5HA 4I0BA 1LCLA 3SEEA 4V2WA 4CCEA 2CV6A 3KSCA 4FOWA 2LALA 3VD4A 4UF0A 2EIGA 1XNKA 1W6NA 3N9MA 3AMQA 1AR81 4LTAA 1H8VA 1XXNA 1Q56A 2ET1A 2MPFA 2R16A 2YMZA 3POEA 3F2ZA 3PVOA 3VD3A 5F3EA 3ZYBA 2VNOA 4GZ9A 5BNNA 4CCJA 4W6WA 5CG9A 2EICA 2QBXA 2NMOA 3GM8A 2V4AA 1HJGA 1YJKA 3K4ZA 1GOGA 1L7QA 1MS8A 1OQEA 2YPJA 5FJKA 4AF9A 4COZA 4E27A 3BI3A 4P5HA 1ONAA 4Q4V1 3O0XA 5JWPA 2B8MA 5FPLA 1XB9A 5KXDA 1GOFA 2Y6GA 3CBNA 4NPMA 2D6MA 2IVIB 4HK8A 3AMPA 4PLMA 2EXKA 1Z0HA 3WDTA 2QCSB 2FMDA 2WR9A 2Z4FA 4CXXA 1YUDA 1LOAA 2XDVA 2WO7A 2NZ9A 1JZ4A 1VIWB 2VNVA 1AL21 1GSLA 2RS31 3MF6A 2X09A 2HYXA 2WZPP 3KGZA 5FDBA 3WDXA 1ZZ6A 1RHI1 2QDRA 1W90A 1CAXB 3TEYA 3POWA 3LSEA 2PHXA 1DCSA 1FXZA 3ECQA 1UU4A 2F6BA 4KG8A 2GH8A 2W91A 2XJSA 1WA6X 2ATFA 1HXS1 3AXDA 1CIYA 1UWWA 2P3YA 3ACHA 4PI0A 2A73B 4SBVA 5FFOC 3NJVA 5FYMA 3VBSC 4EZ4A 3U14A 3LFMA 4H2AA 1KQRA 1VRH3 2HWB1 1YO8A 2GAUA 2HEWF 2VZPA 1PIV1 1D4M1 2WFPA 4CDUA 5F5AA 5BNOB 2DV9A 1OOPA 2K0GA 2XKPA 2ZZQA 4HETA 4AWDA 3OGVA 1RUJ1 4N8MA 4RR3A 2EXIA 3W58A 1DQ0A 4XABA 3POJA 3U07A 3WW3A 4A7KA 1NG0A 4LLOA 4D0QA 1HV0A 2ZEZA 1W0OA 4LOTA 3O1MA 2W5FA 1GBGA 2DCTA 4Z2WA 5BY5A 3VBRA 3USUB 1OLME 2QE3A 3POFA 2WQ4A 3EHKA 2UY9A 1ULCA 2XBO2 3ORJA 5A7WA 4EZHA 5BNNC 2Y0OA 3OPZA 2WNUA 3KMHA 2VOVA 1FT9A 2SBAA 2EALA 5CFDA 4A6SA 5DMYA 1EP0A 1MVQA 2ZPXA 5K0UA 3VZMA 1LNSA 3WF1A 5BNPA 1VBE1 2BU9A 4HFSA 1HQWA 4XCAA 1GOHA 1H9PA 2UY8A 2QQIA 2VCCA 2YC0A 4JV4A 3OEAA 5A70A 2N7GA 3ILNA 4IEOA 4MXWB 2R043 4XHBA 2BZDA 5EJZB 4C91A 1IG0A 3NNGA 2VG9A 1DBNA 4AVSA 3I7DA 1D0GA 1C4RA 4FFGA 2XH6A 4NIAA 5FZIA 5A3PA 1L3JA 1TEIA 5FK8A 1HQLA 1UYPA 1WW7A 4KH9A 2QQMA 2VXJA 1U5YA 5DG1A 2WJSA 1NCQA 1S0FA 3KS7A 1YYNA 3AP6A 2VOWA 5LK7B 1W8ZA 1DDLA 2VMHA 3MV11 2C26A 3SMHA 1MZEA 5JOYA 1BCXA 1TMF2 1QJX2 1H1IA 2WLQA 1ZZBA 4ASLA 5LEKA 1V9U2 3PVBB 4JZRA 1F5FA 3KHBA 3VN4A 4AFBA 1R082 1PVXA 4YGDA 1W8NA 3LDRA 2W47A 4QQOA 3MLKA 5FUIA 1RUF2 4UAPA 2HWE3 3WW4A 4DEVA 2UYAA 2VUDA 3VBRC 1Y9QA 2E6VA 3H9AA 1DP0A 4K9SA 4NHMA 1WWYA 4MHRA 4QU1A 1GU3A 4UFIA 2D6NA 5HXMA 5LY1A 5CFDC 2C1FA 4Q4Y2 2R071 5FLJA 2VMCA 3LSDA 4FOYA 3UL2A 4OHVA 4N53B 1QNYA 2XONA 5DPNA 4YYOA 1X36A 3UJOA 1LHWA 5A3OA 1H2LA 1LJ7A 4CDXA 3OY8A 3OYWB 2IUWA 1QXJA 2PHFA 1Y9MA 2WYFA 3KCYA 3Q8CA 4DY3A 1O3TA 4UW6A 4DXSA 5T52A 4H3WA 1WGPA 4XBQA 3T4HB 1DU3D 2DVDA 3ZXKA 5K8SA 1VBB3 1RVF3 3KHCA 2P3KA 1CAUA 3S30A 4QXCA 1C8M3 4UWDA 1MS4A 1BEV2 3VDDB 1NT0A 4OHZA 1VJ2A 2ZS6B 2YROA 1RXFA 4AGGA 2P34A 4I3PA 3ZKYA 1NCQC 1RUH2 2QZ3A 3SKJE 4IGQA 4QXKA 3W20A 4BZ4A 2B45X 3AYEA 3UESA 1AXYA 3LDKA 1J1TA 2QZ2A 5CYYA 2WAAA 4XJZA 4OCTA 4EQVA 4HN0A 3GGLA 3MW3A 4A7ZA 1PGL1 1PO22 2K9ZA 1XPWA 4AXOA 1RUD1 1W2UA 5I0DA 4N7IA 4HSJA 2DVFA 1UOFA 4BISA 1TNFA 3N7JA 3CLPA 2WA4A 3FMGA 4DUVA 4XZUG 1I5ZA 3I2OA 4OUEA 2PQSA 5A80A 3AVRA 2WZ8A 2D6KA 5FZFA 1FNZA 4BH9A 5AC93 1NYWA 4LBMA 1Y3TA 1JYVA 4Y20A 2NYYA 3K51A 1RYYA 1XE8A 2GNMA 1MS9A 5A32A 2KXLA 1IQAA 1J3RA 2VECA 1VRH1 5JXIA 4M0NA 2WNEA 1EYBA 3UKNA 1CWPA 1S55A 4BQXA 3RFRA 1ZNPA 4LKDA 2A3YA 3AZZA 3N9PA 5JI7A 3WQ0A 2IWGB 4NHKA 4CU6A 4JRLA 4OHYA 4Y3OA 3OEBA 5FY0A 1DGRN 4DMIA 1KEXA 1KJRA 2EAAA 5LEJA 5FWEA 5DUUA 1NXD1 3VKNA 2ARXA 1M4WA 2Z2SB 4NIGA 3QH7A 4ISQA 4UOJA 1S0IA 2W39A 3MDPA 4YZ5A 2EVXA 2JD4A 4HVQA 1NCRB 4IV1A 3OSDA 3J7LA 2RE9A 1QOSA 3VL9A 4ITCA 4AG4A 1XSRA 4PIZA 2C4XA 2C6SA 2UWAA 5FYBA 1W6MB 5BXXA 5JOZA 5BNQA 4Z07A 2P4EA 4D69A 1BQPA 2JKXA 2QQOA 3LE0A 4Z1VA 3BU0A 1N1SA 2WRAA 1PZ7A 2UYBA 2HEYF 2JIGA 4YW2A 4IL7A 4NWWA 3J26N 4RR3B 1IZ3A 1OPOA 3KQRA 3RI8A 2D40A 4Q29A 4TLFA 1V6NA 1JODA 2R041 5IVBA 1ZZ7A 2CDOA 4EYUA 4B7EA 3VBHB 5C7GA 4FO9A 5FZOB 2JB4A 3AJZA 2ZKLA 5A7WB 1SFPA 2OVUA 5FZ4A 3ETQA 2WNUB 5C6CA 2R1BA 4YVWB 5JZGA 2ZGSA 1J3PA 3OD0A 1MACA 5FZ1A 5IVFA 4YVSC 1LOGA 3Q8AA 1VR3A 2GU9A 3FBMA 3N4MA 1I9RA 1H1MA 5BNPB 1U12A 4F8AA 4BM8A 4Z2AA 5CISA 3LA7A 3U4SA 3C7GA 3I3EA 4UFMA 3KVBA 1QU0A 2DF7A 1N47A 3AJYA 4ISRA 1ENRA 4KL1A 4X6QB 3U78A 4YRDA 2TBVA 2Y38A 3UYJA 3SCGA 4ATFA 1WUVA 2BOJA 4R9BA 4WV8A 4GH4C 4QGMA 1NZCA 3SCFA 3H8RA 1JYXA 1OD5A 2E32A 3DXUA 4FTBA 3VBOB 1UY4A 5DAPA 3NJZA 4AI8A 1W9SA 5GALA 4FPEA 3AZXA 4JGYB 2R6QA 1T6BX 3AKPA 2Q1MA 1KFUL 2GNTA 3ETPA 4N7UA 3PTYA 2VJXA 5FKBA 5F8PA 5ACA2 4B29A 5LBFA 1F8VA 1DLLA 1QWRA 1YI9A 1ZX5A 5FYTA 5LATA 3VBFC 4AZZA 2XQXA 4GWMA 3Q9OA 4JKMA 3PNAA 2C5DA 3HJRA 1OA4A 4PIYA 3LA3A 3VZLA 1W9TA 4A4AA 4ATEA 4XBNA 4XXPA 2KD7A 3B00A 5GJ6A 1AX1A 1PK6C 3IBMA 4AEDB 3A22A 1ZBA3 4QX7A 1YFUA 2D93A 2VU9A 4AL9A 4AQSA 1VBB1 1RVF1 3MGUA 4IEWA 2W95A 3WUDA 4PQ9A 4CP2A 1E5SA 1C8M1 4OZXA 2LS6A 3OGSA 1TZOA 5JZGC 1AXKA 1U0AA 3N9QA 2MNGA 3M1HA 4D8MA 1ND3C 1IS4A 1SACA 4FXGB 2J42A 2WO3A 1NQDA 3D0SA 1W03A 1RUC2 1KGYA 4CDXB 2FD8A 1IS5A 1W39A 1R64A 3AZVA 3SH4A 4CDQB 4F83A 5JXJA 4BHPA 1PGSA 5KR7A 1SPPA 3ZXDA 3BN6A 2VVDA 3AM2A 1JHJA 3JU9A 4XMAA 4EN7B 2WWSA 4IE4A 2BGPA 5L7OA 3IB3A 5FZ3A 1HRI3 4CXYA 1WW6A 1MQTC 3DPRB 3H1YA 1AR82 4K40A 1JOJA 1VBA2 1VMJA 2ARAA 5G05L 4L97A 4WM7C 3MFAA 4NIHA 1OQ1A 2V4VA 1V0AA 4PF1A 4X8NA 3LB9A 3L2HA 4E4ZA 4H7LA 5J09A 2VZSA 2E31A 1EUUA 3ZKUA 1SLBA 4Q4V2 1UU5A 3VZOA 2G9ZA 5FOBB 1V6KA 1UY3A 1OLQA 2IXKA 3ZR5A 4LBLA 4PI2A 4JHZA 5IVVA 4PDWB 1QQP3 2CGOA 4K7JA 1AXZA 1UQXA 1C3HA 3C7HA 3P6BA 2RS32 3P3PA 1W6OB 2RDSA 3P3NA 3ZFFC 4GD4A 4H55A 5JUVA 2EXHA 3N7KA 3TOJA 4B4QA 2A1XA 4HL0A 4WZCA 2G9GA 4URTA 3IZOA 1GZWB 4LIVA 4PBPA 4PLNA 5L9VA 4Y20B 2VH9A 3O0VA 1HXS2 3EQEA 4GB31 1W6QA 5A32B 3GALA 2DCZA 2WINB 4DQAA 1WKYA 2QJVA 4Q4X2 3WCRA 3TN92 1A8DA 2OZJA 3FN9A 3N9NA 1YQ2A 3ENRA 1L7RA 3IPVB 4IV3C 3JXSA 5JIAA 4Y1VA 1O4TA 2CAVA 2ZAAA 1VAMA 4AHWA 1PIV2 5C5TA 4NAOA 2C24A 4BQYA 3KF5A 3FFQA 1X9PA 5FO7B 1IQDC 2XJPA 3HD8B 3ZFGA 2P37A 4JGZA 5IK8A 5CG8A 5KC6A 4IXLA 4QQPA 4BQ3A 3LOBA 2Y6HA 3A0NA 1RUJ2 5IFTA 3J4UH 2YGMA 3KM5A 5BUVA 2PLV3 3NVCA 4GIQA 3VUOA 2J1SA 2ZMKA 2GC3A 2OX0A 3VV1A 5L7OC 3GBGA 1W2TA 2Y6JA 3LGRA 4QHBA 4IV1B 2EAKA 1G8WA 2JDZA 4IESA 3B9IA 4IQPA 3RQ0A 3T3YA 1AYM2 2YV8A 5E88A 3FZ3A 3CZJA 4EN6B 2IXHA 3C7EA 4ES8A 1UKGA 1XE0A 2W1QA 3VB9A 1N3PA 3B3QE 1MEC2 3JUUA 3IAQA 1OHFA 3VZNA 2VXRA 3WW2A 4DXZA 3IDAA 2IXIA 3MW4A 2ZHKA 4M3CF 3WDVA 2XOMA 1HB4A 1VBD2 4RS5A 2CAUA 4EROA 1EAH3 1OF3A 2R49A 4CDWB 4O9GA 3VKFC 4FFIA 3WP4A 2OKXA 2B7YA 2ZACA 4OULA 2ES3A 2E53A 1XQNA 5CU1A 1G9FA 2W87A 5ABJC 2QQKA 4WBBA 4QB2A 2LTNA 4G9SB 1X7NA 1MZ5A 4MGZE 3NMBA 3BPZA 4PCRA 3ZXAC 1GNHA 1DGWA 1KITA 1SLAA 1ZRIA 4GJZA 2WT2A 1BK1A 3CQOA 3VGIA 4Q2FA 2GNDA 3MIBA 2D3SA 2F4LA 1LR5A 2O1QA 4KWKA 5C5UA 1PVC1 2WFF3 5GLUA 1MS0A 2NN8A 3A0KA 1AX2A 1GNZA 1HW5A 2XB6C 4Q4W3 3ZFGC 1Q8QA 2DUPA 5CKQA 4E2SA 5D21A 3I4IA 4HSLA 5I0SA 2VNRA 5I0UA 2PFWA 3HPNA 5HCBA 3KGLA 4L92A 4HVOA 4QGLA 1ZM1A 3EJKA 4LE3A 3I3DA 1BKZA 1RUE1 2RG4A 4R9AA 2P5BA 5ISLA 3RGBA 1NE6A 2ZEWA 1MZFA 3GYDA 3MPPG 4IW3A 5C4WC 2R072 4YARA 4XFBA 4LEJA 4W6XA 3R4UA 5A3UA 4I02A 2A6VA 3PUIA 3E6BA 2VMEA 1UX6A 1H2KA 4JDNA 1CD3G 3DYOA 3R05A 4R52A 5KXCA 2BVBA 3LA2A 2W2IA 1WD4A 4WM8B 5DUVA 1RMU3 3NKTA 1PZ8A 2HWF3 3OBAA 4FCAA 4ZU7A 4C8DA 2YG0A 4MG2A 3AXEA 1HRI1 3HT1A 4L8QA 3H42B 2X5IC 3ZSKA 5BNOA 1UZWA 3MIGA 2CHHA 2WZR2 4META 5E89A 1A78A 5A3LA 4QXHA 1F9KA 5E6HA 3PHMA 4Y5Z0 4RGAA 4IEVA 1Q5OA 1RITA 2XLGA 4XDOA 3S0MA 4CCKA 4D3WA 1AR92 2IXCA 3USUA 1PGL2 3D82A 1GMMA 4CSWA 5HCHA 3LPGA 4HANA 4LHSA 5HI0A 2E7QA 4LHKA 1RUD2 1QQP1 3RPQA 1R093 1UYYA 2YBPA 3BODA 2YUEA 3OGGA 1G9CA 5EJ3A 5FKCA 2DYCA 4OMDA 3O1VA 5KXBA 3CJIC 3OPTA 4FTEA 1E5IA 3BOPA 3GHNA 4C1XA 2NP0A 2GSYA 3DF0A 3KV6A 1HV1A 3ZYRA 4CP1A 1VRBA 3POIA 3WHUA 5IK5A 4QPGA 2DTYA 1RXGA 4FPLA 3JD73 4UFLA 1W8FA 5HV0A 4P9YA 3K75B 1LGBA 3CKHA 3JB8A 3RJRA 4CXWA 3JQXA 5A33B 5JSPA 2CGNA 3AYCA 3CIHA 4CYDA 3CZUA 1Y9GA 4CRQA 4ET7A 2JDNA 1JYIA 1WCQA 2P3JA 2K46A 2W92A 2ZAHA 4AK3A 4BQ4A 4O65A 3PJQA 1H1AA 2PLV1 3IKWA 2VAUA 5FZ7A 3H50A 2VQAA 3VHNA 1CX4A 3H1MA 2JG9B 1SDDB 2V73A 1W6QB 1OF4A 1H0BA 2VO5A 4I09A 5FBZA 3BU7A 2UWBA 4R8HA 1I1EA 3OBZA 2QQVA 1AR73 3ZFEA 4CCLA 4N43B 1EPZA 1CR7A 2ZGUA 3TNQA 4AAPA 4Q0VA 3VKOA 4H7MA 1DQ1A 1OH3A 3N36A 3OJBA 4JGZB 1JUIA 1UZYA 2WSVA 3KV5A 4FPYA 4AR2A 4YM3A 5B4NA 4Y33A 1W3VA 1KFXL 4HBNA 5IHRA 1J59A 5FMBA 3ZYPA 4S2FA 1FV3A 3NSTA 4P9IA 3AKRA 2J1EA 3ZYGA 1EAH1 4GA9A 1VBC1 3S5QA 2R042 4NOTA 4A3ZA 3URFA 3TEWA 4NE9A 4FPOB 4XUTA 2YDEA 1GWLA 5CA6A 4KQ7A 1K45A 2BW8A 1VMFA 4JTNA 1DG6A 5HCAA 4YW6A 3M3OA 4FPFA 2BWAA 2WLPA 3FE5A 3KVAA 4Y26A 2VW2A 3FX3A 4FP2A 4O7XA 5C33A 5F1RA 4U36A 4QPWA 1ENXA 3EBRA 5IVCA 2EIEA 3MFCA 3AKSA 3PMEA 1CZVA 3UK9A 1AR62 2H0BA 2YHJA 5L19A 3O1OA 1LENA 4TN7A 5DUXA 1OMIA 2XUEA 3G7DA 2QNKA 4KI5M 2WFF1 4RS5B 2XG3A 5T5JA 3RMYA 2WN2A 3VDDA 4W65A 3WF2A 1OPMA 3I59B 4L9BA 4XDPA 4M0HA 4PQQA 2YC4A 4DFSA 4JAAA 1RUG3 1WA4A 2JX9A 3AMHA 4HK9A 5F6KA 4AE2A 4GMP0 3JB4C 1DYOA 2AR6A 5FZGA 1K42A 5AVAA 2ZEYA 5FMOL 2AC1A 3B93A 2QQJA 1UF2C 3PIGA 4DY5A 2ARBA 4BXSV 5F9TA 1U5XA 2BWCA 2NPIA 1WW4A 1BHGA 1WMEA 1YQ6A 3WNOA 1PGW1 1O59A 3NJYA 4D94A 1YNAA 5FYHA 2A5ZA 1QIQA 1S0EA 2DFCA 4QHZA 5AFEA 5EWSA 5ANQA 2XL9A 5K4LA 4QQHA 1REDA 2BOIA 1US2A 4XJUA 1PM4A 3M3EA 1DQ4A 2DWRA 3PUQA 1YIPA 4PF5A 1PMHX 5FPVA 3PJYA 1SMVA 1WLTA 2W3JA 2RVAA 3POBA 2HWD3 3B69A 3UGHA 3NV3A 1O3RA 2W1UA 1JMUB 4N53C 5LBEA 1VBB2 4XIKA 2RS13 2JEMA 4E2QA 1ZRFA 1CONA 2DCKA 1ULPA 2YZ4A 2XJRA 3HN1A 4LR4A 3WCSA 1C8M2 3ZOIA 3VKMA 4HN1A 2VZQA 2AEYA 1H8TC 3E5XA 1BVVA 1YC61 4KNCA 1S4CA 3WP5A 3K48A 3DXTA 1DYPA 5FYZA 2OYZA 3TBDA 4XXAA 4IE7A 1F5JA 1CZTA 2E7AA 4AI1A 2C9AA 3ROUA 5CKNA 1NCRA 1OVSA 3VDDC 4NRPA 4QDRA 4LKEA 2WWJA 1IPKA 5JOWA 4JDOA 1FMD1 1UKRA 1B35B 2JICA 4MGYE 3SC7X 4Y4RA 4NHXA 4KWJA 2Q1ZB 1OUSA 1W6MA 3Q8BA 2XUMA 2VPVA 1NA1B 4AFCA 1AYN3 3GBWA 4QMAA 4NPLA 4XZPA 2BP6A 1LEDA 1LU1A 1QH7A 4CUGA 4CUCA 3N9LA 4UW3A 3IWZA 1K12A 3UNPA 1WLWA 1W8OA 3ZO0B 1QKQA 1ULGA 3LQCA 5EXOA 2H6CA 3BKZA 4FPGA 1UOJA 1OKQA 1ZZ8A 3FHIB 3JD71 4P08A 2ZZJA 3G6JB 2WNOA 3VBHA 2I07B 2D7FA 5F6LB 1N1YA 1C28A 5FZOA 5L9RA 1LESA 4RFT0 3OG2A 1EV13 2J7MA 4BMBA 3INAA 1ZVFA 3KCCA 1W8WA 4YVWA 4EWAA 2PHRA 4CEYB 2W0XA 5LA0A 3FUOA 3RG0A 2P2KA 1CAWA 3WT3A 1QJU3 3AYDA 3ZN5A 2AGSA 2F4PA 5DDJ2 5FUNA 1LECA 2CWSA 4D7SA 3RMXA 1QJY3 4QPGB 3ACGA 3J8F3 4XPVA 4QD2A 4PJYA 3AL5A 3O1RA 1OC1A 4GB32 3HAGA 3VKLA 3RWNA 4C90A 2ZXQA 2AYHA 4HZFA 3VHOA 2VZRA 1G86A 1BMV1 1GQGA 4XFGA 1AR71 2MHFA 2SLIA 3P5BA 2OIIA 2Q1FA 1ENSA 4XYXA 2XLFA 4Z92B 3VBOA 2Q30A 3WSOA 4L99A 1V70A 1UX7A 4JGYA 2WS93 1NCRC 1BBT3 3MLLA 3FWEA 4GKYA 1FPN3 1LAJA 1UPIA 5EYXA 4CDUC 1O8SA 3N9OA 4LXLA 4Q1RA 2VCAA 1A8MA 4KU8A 4EV0A 1OOPC 1Z7S1 2GMPA 3WG2A 1DZQA 5FPAA 3WXPA 1QOTA 1XNCA 2NLRA 3OUJA 1N3OA 2ZCWA 3W5MA 4RR3C 4FTSA 4IERA 1POV0 3WINE 3ZFEB 3LCPA 1DZTA 5FZKA 3ZYHA 2DTWA 2HWC2 4HKLA 4B1LA 5FCCA 4WVMB 4YM0A 4AEDA 4RHV1 2RV9A 3JBG3 3VBHC 2VBPA 1V00A 4S2GA 4CEWB 1COV3 1YQ5A 2FDJA 4CE8A 1HN0A 1NY72 1S0JA 2WNUC 1OFSA 4HMZA 3WQ1A 1KDMA 4X8PA 3GHMA 2WT1A 4XFCA 3AVSA 5FYVA 2WO2A 4GWNA 5K0UC 1AHSA 4XVHA 1RUI3 3POGA 5BNPC 1AVBA 1RUG1 2BEOA 4Y22A 5F39A 5FPZA 5I93A 1J83A 4B3NA 2YBKA 1DGRA 4QM9A 2ZMLA 1AJKA 1GKBA 3CNAA 2EA7A 5FPUA 5IVEA 3BTYA 1GQPA 1DZRA 2R0FA 4FOQA 2RMU3 3WNNA 4CDQA 1TME3 2NM1A 5A3WA 1S2EA 3CL1A 1ULOA 5EFUA 3THCA 5IVJA 5KHGA 5DZGA 1LRHA 4C0BA 5JSOA 5FZEA 1S1AA 3DPRA 2ZX2A 2VBBA 4XILA 3VBOC 3WDWA 1PVC2 1K5JA 2ZEXA 3BTAA 1F4HA 1HB2A 1DQ2A 1RUOA 2HKXA 3AX4A 1FOD2 2XVLA 5IWFA 4XTMA 1W04A 1SG3A 4LBQB 5K9YA 5B4XA 1BXHA 4ZONA 3SKVA 4Y1ZA 2OS2A 4F3JA 2HWD1 1E57A 1GICA 1W8HA 1UAIA 4UW4A 5F3IA 1PO12 1UCXA 4NIIA 5FYUA 4QKNA 2RS11 4PDWA 3UGFA 1RUE2 4ZU4A 3H3LA 4I0AA 2R062 1W6OA 2IZWA 1UMIA 2TNFA 3ZLIA 4TXWA 4JHTA 4CUAA 2FHRA 3AMNA 4QX3A 5BV6A 3ZN6B 2OT7A 4RD7A 2VMDA 2P17A 1GZWA 4QPYA 2XWBB 2DU0A 4XACA 4XUQA 2ZOEB 3J7MA 2IFRA 2XWJB 4ORFA 5FP8A 4Z8BA 4IEZA 4JX0A 4P9XA 3IPVA 3BVCA 3LEGA 4LBKA 5D8AA 1XJAA 2AZ5A 1WLDA 5FREA 3ZSJA 4AFAA 2BPA2 2YYOA 1IS6A 3ZYIB 1AYN1 3DN7A 1HRI2 4CDXC 1SBDA 1AX0A 3AMMA 3WX5A 1S2KA 2XMLA 3SLIA 4CDQC 2OXBA 3A23A 3M4FA 2CSGA 3D6EA 4AI9A 1SFNA 4YW7A 2RM22 5FXWA 1ENQA 2BNMA 3RWKX 3PLQA 5CADA 1LOEA 2VULA 5FY9A 5JR2A 4Q0UA 1NLQA 4EWEA 4M00A 1DF0A 2QFEA 2RDNA 1LOFA 2Y6LA 4FI9A 5J96B 4NIDA 4XAEA 2JDKA 2D44A 2LUWA 1HKDA 1EV11 4MGTA 3GCXA 1QQP2 4Q26A 4HKWA 1F4AA 4KBBA 1W0NA 2PAMA 5JIUA 3WLUA 3I2JA 4AEMA 5EZWA 5A3TA 4YFWA 3LIGA 3KV9A 2HH9A 2JG8B 2WBKA 3AP5A 1QJU1 3P1IA 2XLAA 4LO5B 4ZS3A 5FQ0B 3SISA 1FATA 5DUWA 3UETA 4IDZA 3V0BB 1O91A 4XAAA 3TEXA 3ACLA 1QJY1 4BQ2A 2A6XA 4MHUA 4PDWC 2HBUA 3LDBA 1MVEA 3MLJA 3B94A 4CDWA 3BTXA 4P9JA 5HPOA 4BK4A 3ME2A 5FUPA 1Q8SA 2CU5A 2E33A 4MADA 5IUQA 3VZJA 2GNBA 4QX5A 3FC0A 3M7AA 5JI9A 1WZXA 4A45A 2TUNA 4OHWA 5I8YA 1F2NA 3RZHA 2FDHA 1XE7A 1O5UA 1DQ5A 4XQWA 2X29A 1KD7A 1SDWA 4I2OA 3ZSLA 1QXPA 5L73A 1CAWB 2I2SA 1UOGA 4MV2A 3WG4A 4B7KA 4DRRA 3ZSMA 1BBT1 5AVPA 4DINB 1FPN1 1TE1B 1QJEA 2PLV2 2JE7A 1Y7BA 3ZDSA 3IT8A 1QJX3 2CGPA 3WDUA 3SNMA 2VW1A 5FY4A 4X6RB 2ORZA 2W1WA 2J1UA 1R083 5FMDA 3SITA 5FXXA 4MX3A 3VBUA 3VL8A 4WZFA 3WNXA 2OQ7A 1JZ5A 3KB5A 4FP3A 4JCKA 2B42B 5FAXA 4PT6A 3H8UA 2WUHA 2Y6KA 2AREA 1RUF3 1G6NA 2HWE1 4LBOA 3O1SA 1W6PB 3JBG1 4W50A 2WWUA 4IV1C 3RDIA 3ZIXA 4URAA 1COV1 4CA9A 2JDHA 3ZPOA 4UFJA 5H9PA 4CCDA 4D6QA 3MIEA 2PHDA 2J1VA 2RJ2A 4K3UA 5FV3A 4Q4Y3 4LO8A 1VBC2 4RQPA 4OQ8A 3JZVA 4YNIA 5FBJA 4A7YA 5J48A 2Z5WA 2BV4A 3V64A 3M3CA 3EYPA 3FHAA 2RS53 1X9TA 2A6ZA 2VZOA 3WUCA 1O8PA 2OA2A 2LRPA 2RMU1 5IJRA 1TME1 3ZXJA 4CDWC 1R1A2 4MH0E 4WM8A 3O1TA 5LB6A 3I3MA 3MBWA 1UNBA 2WYSA 1J84A 4BCUA 2ZX3A 4RA0A 5C3OA 3SCHA 4AQ2A 4AEKA 1IKQA 3RSJA 5KHIA 3OB8A 2TEPA 3ITQA 1BEV3 4BLIA 2NMNA 1T2XA 4D6RA 1XNTA 2YU1A 4P9GA 3OBTA 4V2VA 1RUH3 1SCSA 1GLHA 4Y22B 3ZN4A 3RZKA 3PU8A 1REEA 5FY5A 5KWRA 1NQJA 1UXZA 2VMFA 5I0RA 1KRIA 3OOXA 3HQRA 1ALYA 2WL1A 5GZGA 5DZFA 2IXLA 2W46A 4MZUA 1PO23 3QOPA 4RYDA 4XF4A 5KHKA 2WABA 4SLIA 3TWIA 1LULA 1U5IA 2VZUA 3I2DA 3WZ1A 4XTPA 4GWJA 1PGW2 5TSWA 3MIFA 4ZZ5A 4LITA 4LHNA 4C0HA 4OMCA 3UKVA 5AC91 3PU3A 2H0VA 2XJQA 5LRSA 4M3CB 3U75A 4UW5A 3L2YA 4LPLA 1CVNA 2IVJA 2JD9A 2ZHNA 4DXTA 1BK0A 4FAHA 4OLLA 2Y64A 4XMIA 3FFZA 4BQ1A 1NX9A 5A33A 4MUVA 1JXNA 1CGPA 3E97A 3OGRA 4HKOA 5FR3A 1Z78A 5DZEA 2VUAA 5IT6A 1JTZX 1AL22 1SLCA 3ACFA 3IIAA 1W2OA 3N7MA 4Q0QA 1RHI2 1W99A 2PQQA 1H4GA 1OQDA 1YHFA 4QDQA 4UBGA 4QPIA 4NPRA 3MEPA 1PX4A 4WM8C 2XQRA 3QACA 4HPKA 4DUWA 2DU1A 4WVVA 2DCJA 2JG9A 1QJFA 1X8MA 1XYPA 1PMIA 4OI4A 1FMD2 2IFWA 5D8AB 2HWB2 3IN9A 2LM3A 2WDBA 4RGKA 2RR13 4W6YA 4N43A 5JOXA 1D4M2 1OVPA 1EPWA 1X82A 3LD8A 4XJ8A 3I2HA 2QQLA 4QQLA 4DRVA 3U37A 3NO8A 3BTZA 5EPAA 4XCBA 4IGOA 5FY7A 4E4DX 1CQ9A 3KV4A 4AFDA 1YI7A 1LGCA 4Y1YA 2VQTA 3LKJA 2B5HA 4E2GA 2ILMA 3OUHA 1J1LA 4FT8A 1JZ3A 3SXWA 4YVSB 3M70A 1CIWA 1JU4A 3KCXA 3DKWA 2VVFA 1QDCA 2D97A 1XYNA 1O3QA 2VZVA 5FYIA 1OUXA 4HXCA 1BVP1 3NAPB 3THDA 1CPMA 4BPZA 2DURA 4CTEA 5C3QA 4PHZA 5FLHA 4ZS2A 5HCFA 5D2AA 3FBYA 2EIDA 1DQ6A 3Q8FA 3B01A 4GJYA 1WMDA 5A7OA 1VBE2 5F5CA 2ID4A 4AW7A 3WD5A 4GMP3 5E16A 4DO0A 5CBLA 4Q1PA 5GM0A 2GC0A 3MF9A 4B4PA 3MZHA 1BLZA 1X8EA 2YB7A 3AZWA 4RSUA 5LA9A 3WNKA 2D3RA 2A71A 2XVKA 1H30A 5J36A 3I59A 4D7TA 3NNJA 1HB1A 1ZA7A 2RJLA 4RN5A 1R081 2CY6A 4J1XA 2ZX0A 3K3OA 5C8CA 1AR72 3VHPA 1ZREA 2D6OX 1FNYA 3QD6A 3T0AA 2XL7A 1ULDA 3VBFB 5FXVA 5CB7A 3NNMA 3LEKA 3CF6E 1AZDA 4ZXEA 5F7UA 2D43A 3H7JA 2G1MA 5EJ1B 2RDRA 5DAWA 2R0HA 3I2KA 2UURA 2BTVC 5DAXA 3GDBA 3NNLA 3AKTA 1Z7S2 4XFFA 2VTFA 4JGZC 5FY8A 5DXDA 4MYEA 3VBUB 4U2AA 5A7QA 1LB2A 5LZ6A 4DOUA 1Y4WA 2RS51 4L0PA 3W21A 1RB8G 1BJQA 3BYWA 1RUNA 5LW9A 3U10A 4YZ3A 1ZBA1 1MS5A 4RHV2 5SV5A 5FZLA 2AUYA 3NKGA 3R4DB 1AJOA 5LRRA 5GZFA 1NLRA 2YXSA 4QX0A 4YG6A 4BIOA 1GZ9A 3A7QA 4HVRA 5CFCA 1IPJA 3W9AA 3WNLA 4RQPB 2ZGQA 2GC1A 2V72A 2G19A 3HNBM 4NMIA 1ZYBA 2Q8EA 4CU9A 5H9QA 3BGAA 4QT6A 1N1VA 3DL3A 4Y1UA 2W94A 4YM1A 2AH2A 2PYTA 1W2AX 1LHUA 1Q3EA 5ERLA 5HV4A 4RS5C 4XFAA 5GLVA 2I45A 3M3IA 4BB3A 1PO21 4DB5A 1B35A 4LMFA 2OQ6A 1YRZA 2VD7A 4BA6A 2V09A 1F35A 1NA1A 4XUPA 5FPXA 4J1WA 4TWTA 2VQ0A 1AR83 4JKKA 3DGTA 1IOAA 1VBA3 2E9QA 5KBFA 3OCPA 5I91A 3SEPA 2QQUA 1YWKA 2BYVE 2P6CA 3CMGA 4O61A 4E4SA 2R32A 4AVAA 1M06G 3E1F1 3LOIA 2JENA 5LA2A 4LNVA 2XPJA 4CP0A 2YGLA 1N1TA 2V5YA 5FP9A 2VMIA 1LOCA 1AUYA 2HWD2 3PUSA 2W9XA 1ST8A 3WEZA 4EN9B 1PM7A 1A34A 4KG0A 5FRAA 4BYYA 1LHNA 3N3HA 2PHLA 4R9CA 3AB0A 3FLRA 3I54A 4CEYA 3NV2A 2ZHLA 3THPA 2RS33 4IE5A 2PXJA 4GKXA 1S0GA 5BYNA 3IDCB 1O5LA 4IV3B 5C9AA 4A2UA 1KJLA 4BDVB 4JTOA 1ASJ3 1VAKA 2ZGKA 2ORXA 1TG7A 5J3UA 1E5RA 3UJQA 1VB4A 4P9WA 2VCMA 2QQPA 1U5ZA 3H0OA 4Q4X3 4FQ4A 2DUQA 4AFMA 3TN93 4Q0SA 1VRH2 1N3QA 5T3NA 2RR11 2JJ6A 2ZGRA 3V56A 1PIV3 4QKFA 5E1RA 5LK5A 4AVBA 2A6YA 1HJFA 2C0ZA 2J1TA 4LQRA 1POV3 3MICA 3GXUA 1DFQA 1RUJ3 4QPIB 2EIBA 1R1ZA 3AZYA 1XSQA 1Q43A 3OPWA 3K4AA 4HPKB 2WNVA 4LBQD 3WQ7A 3RVHA 3HBKA 4FPCA 1NA1C 5C70A 3QBQA 3R6SA 5BNOC 3BUCA 5GLWA 1WMXA 4HOOA 5DG2A 1YJLA 1AYM3 2Y6FA 2C9KA 1EV12 2FZ2A 4JDMA 2ZKNA 1IKPA 5T50A 1K5MA 1X33A 1MEC3 1LHVA 2UWCA 3HQXA 1I5PA 4WVMA 1OFNA 1ZZ9A 1OKOA 1QJU2 1UZVA 3C7OA 4R4XA 4IEXA 1NXMA 4GMP1 4WVZA 2A3WA 3T2QA 4CEWA 3PIJA 4TZDA 4KWUA 1QJY2 2FCTA 1VBD3 3VDBA 5FYCA 3K46A 3BCWA 5F3GA 1OSGA 5GKAC 1UN1A 1RJ8A 3ATGA 3HR9A 1V6IA 3ZXEA 2VCBA 1OA3A 4OI0A 5F5IA 5IVYA 1LKNA 3ZM8A 5A3NA 3B9CA 2GP5A 4XQDA 1TVGA 4Q27A 4QPGC 5F32A 4CUBA 5T5LA 1QF3A 5B2GB 1FAYA 2B9UA 4QGNA 1BBT2 3QH6A 1FPN2 4LUMA 4W8JA 3RRDA 3ZYJB 4QXBA 4EJRA 2XR4A 5CVRA 5DQ0A 1AF9A 3O7OA 1YQ8A 1ZBE3 3NNFA 1UOBA 4CVUA 2PN5A 3AP4A 4LO6B 4Q4W1 2XHKA 5GZDA 2WN3A 3ZPYA 4LBQA 5C8CB 4L2NA 1YEWA 5C3RA 3T09A 2ET7A 4L11A 4FAGA 2JIJA 3MO4A 5FZ0A 2HWE2 2DVGA 2VZ1A 3D3AA 4LA2A 2J1RA 1YFXA 3JBG2 1JOPA 2F17A 1UZ0A 3IDEA 3X29B 4YZ2A 1S0DA 1XNAA 5FYYA 4G4FA 1MS3A 3GNEA 3ZFEC 1D4VB 1O6UA 1ULEA 3FL7A 3LFIA 1FI2A 2WQZC 3IDBB 1XYOA 4RL7A 2Q5TA 4E4HA 1QY4A 2D3PA 1UY1A 4AHYA 3ZN6A 1JZ7A 3RZMA 4MO3M 3J9SA 4YM2A 2OZ6A 1OLRA 3HEIA 4HONA 4NVPA 2RDQA 2J22A 1Q8PA 4AGVA 1JH5A 2WZEA 1FYUA 1TME2 1GV9A 3BALA 1ULFA 4RGGA 4AHZA 1RMU1 2HWF1 4NHYA 4P5YA 3JCIA 1RVF2 4IE6A 5CFCB 3WNMA 2WZR3 3H1WA 2EF6A 3UKTA 1VBA1 3I2IA 3ZXFA 4XE9A 2BFUS 2YY1A 1H6XA 3EO6A 4P14A 4YZ1A 3HWJA 1C5IA 3POSA 1AR93 1DGWX 3CJIB 4ES9A 2AEZA 3GBFA 1CZSA 2WA3A 1RJ7A 2B9VA 1YLLA 3ALQA 5F5QA 1R091 1RUD3 2Y34A 3NV1A 2JDUA 4MLOA 1PZ9A 5FZAA 1QH6A 3S7EA 4DZGA 2ZGMA 3N35A 2VM9A 1HRV3 1GP4A 2JG8A 2BDRA 3H3UA 5CAZA 5FQ0A 1VLNA 5IFPA 4TYSA 5KHJA 2Y0IA 3LPFA 1DGLA 1UMZA 3V0BA 5AC92 2HBTA 1ND2B 4LA3A 1ASJ1 4S2HA 3VHRA 3VD5A 4Y24A 1SBFA 3KT1A 3LZZA 4MVTA 2BJSA 3L9JT 1HIXA 1YIFA 4Q4X1 3T2TA 2Z42A 2MEV3 3TN91 1QDOA 4COYA 3HN3A 4O9EA 4XOGA 2E51A 4OZOA 1W9WA 4YFZA 2DBIA 4N9IA 2JECA 1APNA 3PURA 5E8AA 1POV1 1QXRA 3DUIA 4G3YC 1MS1A 4UXAA 3WF3A 5C9AB 3E6CC 4MXVA 4E9KA 1PX3A 5CZKA 1O7FA 4Y4YA 5DAVA 2DVBA 2VMGA 1D0HA 1SZBA 1WCDJ 5LWBA 2Y60A 3BIEA 1DYKA 4OUSA 3C8XA 5IATA 2BERA 1RTVA 3MUY1 1AYM1 1V6OA 1LEMA 2P1BA 4IEUA 3V0AA 2CWMA 1HLCA 2Q8CA 2RJKA 2HEVF 1MEC1 3RNSA 2VUJA 3H3ZA 1W6PA 3O5SA 5FWJA 1J3QA 3DECA 1GR3A 3A21A 2WNVB 2GN3A 2H6BA 1JBCA 3HNMA 4XIOA 1VBD1 4K20A 1WW5A 2Q4SA 5L9BA 5A7PA 1UY2A 1UMHA 3FJSA 4CCNA 2KM2A 4TSVA 4LO7A 4A42A 2JG8C 1IPSA 2NQYA 2XJVA 2Y33A 5H9SA 4FPHA 5EYYA 3ZX7A 3PVNA 1B09A 1WCUA 1K5MB 5FZMA 3I3BA 4DUXA 1GANA 4MOAA 1SLLA 5EV7A 1AR63 1D2SA 4QHOA 3WQBA 4XF3A 3UT0A 3AKQA 4A3XA 2Z79A 3WOGA 2FDIA 1YCIA 1LTEA 1ZBE1 4YVWC 3C2UA 2KR2A 5A3MA 5A6ZA 3LEMA 4NWVA 1C57A 4B1MA 4J25A 3TAYA 3IIIA 1FX5A 1VP6A 1W05A 2W08A 3O14A 3NW4A 4HLTA 3J7NA 3M2MA 4ASMB 4ARXA 3AP7A 4KWLA 1XNDA 3T1LA 2FDKA 4E8DA 4AGRA 2QKDA 3GCWA 1C1LA 3K2OA 3WR0A 5FIXA 3GJAA 5IYYA 1G9DA 1IHMA 4YW3A 2VTXA 1ZA4A 4FPJA 3WW1A 4LBJA 5I8SA 1X50A 3WDYA 5FY1A 4OFGA 1ZZCA 5FYSA 5A7NA 3IMNA 5JMOA 3WVJA 5GLZA 2VQUA 1BZWA 1OT5A 2DBNA 2JDAA 3S57A 5EP9A 5JCTA 1LHOA 4FVVA 4LK6A 4K6BA 4JGYC 4LKFA 4P00B 4M3CA 4Z82A 4GWIA 2LW8A 3D8CA 4KGQA 3VDAA 2RS52 3D4KA 4BK5A 3TB0A 1H8TB 1JYNA 5FP7A 2R1DA 5J37A 2PHWA 1ZBA2 4KMQA 3PVEA 2ZGTA 1HB3A 3THTA 2QQNA 1W9YA 1UO9A 1O4ZA 3MYXA 4YW5A 1QNWA 1OURA 1RINA 1A3KA 4F7ZA 2XGXA 3VBSB 2WZR1 4N9HA 4ZPIA 3SQOA 4S2DA 2FCVA 3FUQA 3DV8A 4P02B 4YG3A 1WMFA 1Q8VA 5FZDA 3ZDVA 2GH2A 4AEDC 4CCCA 2G9FA 2QDNA 4GALA 1JI6A 3PUAA 4NUBA 3RZLA 4XETA 5DAQA 4I30A 1S0CA 1AR91 1SFYA 1GWKA
chains in the Genus database with same CATH topology
3KZ4C 2HJIA 3WY6A 4YGBA 4DPNA 3ILRA 2BFUL 4V1PA 4FOVA 1SCRA 4LT5A 1W6NB 1HRV1 3WV6A 4B8EA 4FQZA 4XBLA 4XEZA 5BNNB 5JR7B 3LWCA 2CL2A 4YVSA 1CAVA 4K1YA 4PIXA 3DPRC 2MEV1 2P3IA 3AFGA 4ZXKA 3HBZA 2XBO3 4WVWA 2OUJA 3NAPA 2GMMA 1BYHA 1XRUA 1OA2A 2VW0A 4AHXA 4XJAA 2D6LX 4I3GA 3ST7A 2ZGNA 3HT2A 5GZCA 4GH4A 5DDJ3 2E63A 3J8F1 4XW3A 1ZRRA 4GB33 2VY0A 2PHUA 1NOVA 4HT1T 2FQPA 3AK0A 3ILFA 2A70A 3AP9A 1CJDA 1I6XA 3KT7A 3APBA 3WT3A 4CDUB 2RR12 1QJZA 1S2BA 1KS5A 1CPNA 2ETEA 1OOPB 5CNAA 1V6MA 2O8OA 2WS91 4I0WB 4LE4A 1REFA 3VBFA 2Q0AA 4XJWA 3T1MA 2R30A 4KU7A 5D8AC 3VLBB 4NO4A 1LGNA 2PHTA 4YGEA 4Y1XA 4INDA 1TMF3 3HMYA 1PK6A 4NN0A 1V9U3 1UL9A 2D6PA 3VBRB 3ZMNA 1QHDA 2OUHA 4AYUA 2FMYA 3V0AB 3TNPB 2PAEA 2BVVA 5KC5A 2HWC3 5CFDB 2XVGA 1ND3A 5K0UB 2KA3A 1AR61 1HDKA 4YSFA 1PNFA 1NLSA 1LOFC 2AENA 2ZJCA 1PHMA 5JPNB 4XHXA 4JVAA 1EAH2 3NAPC 4QQ2A 4LBNA 4BOWA 4JQRA 3C3VA 2VGDA 3ES4A 1RUI1 2XJTA 1UPSA 3MI8A 2DCYA 4FSJA 2IC1A 4COUA 2DFBA 1G7YA 1MQTA 1UZZA 4ZKTB 3RYRA 1JYCA 3TYJA 3BOWA 1ZRDA 1NCQB 2HYKA 4WM7A 4BE3A 3GZUC 4XJ9A 1KS4A 3BB6A 3NWKA 4GQ7A 4MSVA 2X53S 1H2NA 4ZU5A 2WFF2 4J6GA 1GZCA 1PVC3 3CJXA 3W59A 4DNYA 4Q4W2 4YLZA 3CU7A 1FOD3 3NL1A 1GYKA 3A4UA 3OD4A 1MR5A 2ZA9A 3JQWA 5GLTA 3ZFFA 4ONUA 5BPXA 1C5HA 1PO13 2ERFA 4UBHA 2PELA 3VBUC 2D5HA 1RUE3 4AEJA 2R063 3MIHA 3U11A 1QMJA 3R0RA 4IV3A 3IM0A 4M3CE 1EY2A 4DS0A 2BQPA 1VB2A 4FPKA 3OY8B 2DUOA 2OPKA 3E6DA 5T5OA 4RQPC 1W0PA 4COVA 4MGKE 1RMU2 3RJ2X 2HWF2 3OBRA 2EXJA 1HX6A 1IS3A 1YXWA 1CAUB 3ZSEA 4XF0A 4LO4B 4K8FA 3E5UA 4YGCA 1SLTA 1AL0G 2RM23 3ES1A 5JVVA 1A6CA 3OTFA 5HBAA 4YW4A 4EWDA 4OUMA 5J7MA 1VALA 3LAGA 4IEYA 2XBO1 5KHHA 5SV8A 3O0WA 5IK4A 1R092 1F31A 4BLJA 1D2QA 5CIRA 5FO9B 1KXGA 3WG3A 2VVEA 4XFHA 3FLTA 3POYA 4N90A 2VNGA 2JKBA 5DDJ1 5GZEA 3RI9A 2CNAA 5ABJA 1ASJ2 3S7IA 5J98B 2UU8A 1C1FA 4K21A 5H9RA 3ZIWA 3ZXLA 1CAVB 2G4IA 3JD72 2B46X 3AFKA 4OVEA 3S6PA 3SH3A 5I8TA 3RZZA 4OI1A 4M01A 5IK7A 2WKKA 3BIWE 1JW6A 4FBFA 1RIRA 4YW1A 1SEFA 4Q0PA 1LODA 2GZWA 2A3XA 4PLOA 1RGSA 1XU2A 2FBEA 4GH4B 4AQ6A 3EXUA 1TMF1 1QJX1 2IXJA 5FOJB 1V9U1 4NHLA 4R9DA 4B4RA 1V6JA 1BMV2 4QPIC 5C8WA 4OHXA 1WBLA 5C4WA 2CTVA 2HWC1 3KT4A 4KGGA 1RUF1 4YG0A 1CJPA 2JG9C 5JDBA 1JHNA 3HIFA 1VAVA 1XNBA 1JN2P 1QOOA 3MIDA 5D1IA 4EN0A 1NY71 2BUKA 4N43C 5ACA3 2PTMA 5K7PA 1PK6B 4Q4Y1 1VBC3 3D5OA 2W68A 4COWA 4C1WA 2ZMNA 2ZGLA 2CYFA 1SLIA 3OGJA 4IEPA 3RYPA 2X5IA 3ZMOA 1H4HA 5JZGB 1CN1A 2VOXA 2BNNA 5JSRA 1ND3B 1MZ6A 1R1A3 1UD1A 1XU1A 5KXEA 3D0JA 3NV4A 2D5FA 1BEV1 2A7AA 1ZBE2 3QCWA 5T54A 5HXVA 5FMOS 2ZABA 4PBOA 1FOD1 1RUH1 2K2SA 1O4YA 5JMCA 1RUG2 1RUC3 2XKOA 4NR1A 1MQTB 4Q8LA 3O12A 3CJIA 4OI2A 2GALA 1PO11 1UU6A 4WM7B 1TNRA 3TRSB 3WG1A 1C8NA 4AI0A 5FTTC 5C8CC 1DIWA 3WP6A 2R061 3AYAA 1FV2A 3B5LB 1CAXA 3ZXGA 5JAXA 1ND2A 4XDQA 4YZ4A 1CESA 3UV9A 3U4XA 2RHPA 2GDFA 4Q4V3 1GFF2 3ZFFB 1JUHA 1G9BA 3ZVXA 2A6WA 2WIIB 4LUKA 3OF1A 4AI3A 2RS12 1YFYA 3B02A 1AL23 3V65A 1UW8A 2BBVA 1RHI3 1S0BA 1TQ5A 5T5PA 4I01A 1DHKB 2VOKA 3CEWA 2RM21 1KDKA 1G9AA 1URXA 2GMEA 3B7MA 1HXS3 4D7YA 3MPBA 5CFCC 3MW2A 1FMD3 1PNGA 2HWB3 4IEQA 1IGOA 2OW4A 4XF1A 1D4M3 3M3QA 5L7OB 1H9WA 3VZKA 1QGLA 1AYN2 2ENRA 2XJUA 3N7LA 1T6GC 1HRV2 3WHTA 4AVCA 4AVVA 1B35C 1YFWA 1OI6A 5JLVA 5FO8B 4XFIA 1H2MA 4MXWA 3CO2A 4MGIE 2QUOA 4BWOA 4GULA 2MEV2 1RL3A 3E5QA 2ZGPA 4XQ4A 5JPMB 2Q8OA 5I0TA 1WD3A 1I3HA 3KD4A 5FLIA 3SHRA 4FXKB 1ND2C 1GQHA 3KLSA 2E7TA 1HQNA 3QLQA 3USSA 1UIKA 4AQTA 1VBE3 3U0ZA 5T55A 2I74A 3I8TA 2ZX4A 4BMEA 2D98A 4QU2A 5ABJB 2PAKA 3PMSA 2PA7A 3J8F2 4CEYC 2Y26A 2ZBJA 3GZAA 4AVTA 4CZSA 2WC2A 1Y43B 4P9LA 5C9AC 4JC1A 3ASIA 1SQ4A 1WCSA 2GC2A 1J58A 3ZFGB 4K1ZA 2WS92 3RS6A 3M8LA 3RYKA 2X8KA 4BIFA 5ACA1 2JXAA 2ZTNA 3R4SA 1LOBA 4R4ZA 2B39A 3GZTB 1Z7S3 2DVAA 4XF9A 4GXLA 1V6LA 2BNOA 1WBFA 4N53A 4QM8A 2JE9A 4EN8B 2Z69A 1WLCA 5L36A 2FZ1A 2WSUA 2WNVC 2O0OA 4LLFA 5C4WB 3OYWA 4IETA 1H8TA 3ELNA 1NE4A 1R1A1 4LULA 4RHV3 2QVSB 4LHLA 2O8QA 1Q8OA 2GN7A 1COV2 1UIJA 2WT0A 4AI2A 3FLPA 3VBSA 2A75A 1K5MC 3H7YA 3WP3A 1LU2A 2R073 3SH5A 2BGCA 3GF6A 2ZGOA 1RUI2 2W52A 1RUC1 2X5IB 4CEWC 1ZRCA 4H14A 1RC6A 1SBEA 2ZX1A 1WCKA 5AFBA 4Q8KA 4JRAA 2ZHMA 2RMU2 1O3SA 4I0BA 1LCLA 2CV6A 3KSCA 4FOWA 2LALA 2EIGA 1XNKA 1W6NA 3AMQA 1AR81 4LTAA 1H8VA 1XXNA 1Q56A 2ET1A 2MPFA 2R16A 2YMZA 3PVOA 2VNOA 5BNNA 5CG9A 4W6WA 2NMOA 1YJKA 4AF9A 1MS8A 2YPJA 1OQEA 4COZA 4E27A 4P5HA 1ONAA 4Q4V1 3O0XA 5JWPA 2B8MA 5KXDA 2D6MA 4HK8A 3AMPA 4PLMA 2EXKA 1Z0HA 3WDTA 2QCSB 2FMDA 1YUDA 1LOAA 2NZ9A 1VIWB 1AL21 1GSLA 2RS31 3MF6A 2WZPP 3KGZA 5FDBA 3WDXA 1ZZ6A 1RHI1 2QDRA 1CAXB 3POWA 3LSEA 2PHXA 1FXZA 3ECQA 1UU4A 2F6BA 4KG8A 2GH8A 2XJSA 2ATFA 1HXS1 3AXDA 4SBVA 5FFOC 2A73B 3VBSC 1KQRA 1VRH3 2HWB1 1YO8A 2GAUA 2HEWF 1PIV1 1D4M1 2WFPA 4CDUA 5BNOB 2DV9A 1OOPA 2K0GA 2XKPA 2ZZQA 4HETA 4AWDA 1RUJ1 4RR3A 2EXIA 3W58A 1DQ0A 3U07A 3WW3A 4A7KA 1NG0A 4LLOA 1HV0A 1W0OA 1GBGA 2DCTA 4Z2WA 5BY5A 3VBRA 3USUB 2QE3A 2WQ4A 3EHKA 2UY9A 1ULCA 2XBO2 5BNNC 2Y0OA 3OPZA 2WNUA 3KMHA 2VOVA 1FT9A 2SBAA 2EALA 5CFDA 1EP0A 1MVQA 2ZPXA 5K0UA 3VZMA 5BNPA 1VBE1 4HFSA 1HQWA 1H9PA 2UY8A 2YC0A 4JV4A 2N7GA 3ILNA 4IEOA 4MXWB 2R043 4XHBA 4C91A 2VG9A 1DBNA 4AVSA 3I7DA 1D0GA 1C4RA 2XH6A 1L3JA 1TEIA 1HQLA 1WW7A 4KH9A 1U5YA 5DG1A 2WJSA 1NCQA 1S0FA 3KS7A 1YYNA 3AP6A 2VOWA 5LK7B 1DDLA 2VMHA 3SMHA 1MZEA 5JOYA 1BCXA 1TMF2 1QJX2 1H1IA 2WLQA 1ZZBA 4ASLA 5LEKA 1V9U2 3PVBB 1F5FA 3VN4A 4AFBA 1R082 1PVXA 4YGDA 4QQOA 3MLKA 1RUF2 2HWE3 3WW4A 2UYAA 3VBRC 1Y9QA 2E6VA 3H9AA 4K9SA 4NHMA 2D6NA 5CFDC 2C1FA 4Q4Y2 2R071 5FLJA 3LSDA 4FOYA 3UL2A 4OHVA 4N53B 1QNYA 4YYOA 1X36A 3UJOA 1LHWA 4CDXA 1H2LA 1LJ7A 3OY8A 3OYWB 2PHFA 1QXJA 3KCYA 4DY3A 1O3TA 4UW6A 5T52A 4H3WA 1WGPA 4XBQA 3ZXKA 1DU3D 2DVDA 5K8SA 1VBB3 1RVF3 2P3KA 1CAUA 3S30A 1C8M3 1MS4A 1BEV2 3VDDB 4OHZA 1VJ2A 2ZS6B 2YROA 4AGGA 2P34A 4I3PA 1NCQC 1RUH2 2QZ3A 4QXKA 4BZ4A 2B45X 3AYEA 1AXYA 1J1TA 2QZ2A 4XJZA 1PGL1 4HN0A 3MW3A 4A7ZA 1PO22 2K9ZA 4AXOA 1RUD1 1W2UA 4N7IA 4HSJA 2DVFA 1TNFA 3N7JA 3CLPA 2WA4A 3FMGA 1I5ZA 4BH9A 2D6KA 1FNZA 5AC93 1NYWA 4LBMA 1Y3TA 4Y20A 2NYYA 3K51A 1XE8A 2GNMA 1MS9A 5A32A 2KXLA 1IQAA 1J3RA 2VECA 1VRH1 4M0NA 2WNEA 1EYBA 3UKNA 1S55A 1ZNPA 2A3YA 3AZZA 5JI7A 3WQ0A 2IWGB 4NHKA 4OHYA 4JRLA 1DGRN 4DMIA 1KJRA 2EAAA 5LEJA 5DUUA 1NXD1 3VKNA 2ARXA 1M4WA 2Z2SB 3QH7A 4ISQA 1S0IA 2W39A 3MDPA 4YZ5A 2EVXA 2JD4A 4HVQA 1NCRB 4IV1A 2RE9A 1QOSA 3VL9A 4ITCA 4AG4A 4PIZA 2UWAA 1W6MB 5BXXA 5JOZA 5BNQA 4Z07A 4D69A 1BQPA 4Z1VA 1N1SA 1PZ7A 2UYBA 2HEYF 4YW2A 4IL7A 4NWWA 3J26N 4RR3B 1IZ3A 1OPOA 3KQRA 3RI8A 2D40A 4Q29A 4TLFA 1V6NA 2R041 1ZZ7A 4B7EA 3VBHB 4FO9A 3AJZA 2ZKLA 2OVUA 3ETQA 2WNUB 5C6CA 2R1BA 4YVWB 5JZGA 2ZGSA 1J3PA 3OD0A 1MACA 4YVSC 1LOGA 1VR3A 2GU9A 3FBMA 3N4MA 1I9RA 1H1MA 5BNPB 1U12A 4F8AA 4BM8A 3LA7A 1QU0A 2DF7A 1N47A 3AJYA 4ISRA 1ENRA 4KL1A 4X6QB 4YRDA 2TBVA 2Y38A 3SCGA 4ATFA 1WUVA 4R9BA 4WV8A 4GH4C 4QGMA 1NZCA 3SCFA 1OD5A 4FTBA 3VBOB 4AI8A 3NJZA 5GALA 4FPEA 3AZXA 4JGYB 2R6QA 3AKPA 2Q1MA 1KFUL 2GNTA 4N7UA 3PTYA 5ACA2 4B29A 1F8VA 1DLLA 1QWRA 1YI9A 1ZX5A 3VBFC 4GWMA 3Q9OA 3PNAA 2C5DA 1OA4A 4PIYA 3LA3A 3VZLA 4ATEA 4XBNA 4XXPA 3B00A 5GJ6A 1AX1A 1PK6C 3IBMA 4AEDB 1ZBA3 1YFUA 2D93A 2VU9A 4AQSA 1VBB1 1RVF1 3MGUA 4IEWA 3WUDA 4PQ9A 4CP2A 1C8M1 4OZXA 5JZGC 1AXKA 1U0AA 2MNGA 3M1HA 1ND3C 1IS4A 1SACA 4FXGB 1NQDA 3D0SA 4CDXB 1RUC2 1IS5A 1W39A 3SH4A 3AZVA 4CDQB 4F83A 4BHPA 1PGSA 3ZXDA 2VVDA 3AM2A 3JU9A 4XMAA 4EN7B 2WWSA 5L7OA 1HRI3 1WW6A 1MQTC 3DPRB 3H1YA 1AR82 4K40A 1JOJA 1VBA2 4L97A 4WM7C 3MFAA 1OQ1A 4X8NA 3LB9A 3L2HA 4E4ZA 4H7LA 5J09A 1SLBA 4Q4V2 1UU5A 3VZOA 5FOBB 1V6KA 1OLQA 2IXKA 4LBLA 4PDWB 1QQP3 2CGOA 4K7JA 1AXZA 1C3HA 2RS32 3P3PA 1W6OB 3P3NA 3ZFFC 4H55A 2EXHA 3N7KA 3TOJA 4B4QA 4HL0A 4WZCA 2G9GA 4URTA 1GZWB 4PBPA 4PLNA 4Y20B 2VH9A 3O0VA 1HXS2 3EQEA 4GB31 1W6QA 5A32B 3GALA 2DCZA 2WINB 4DQAA 2QJVA 4Q4X2 3WCRA 3TN92 1A8DA 2OZJA 3ENRA 3IPVB 4IV3C 5JIAA 4Y1VA 1O4TA 2CAVA 2ZAAA 1VAMA 4AHWA 1PIV2 3FFQA 5FO7B 2XJPA 3HD8B 3ZFGA 2P37A 4JGZA 5IK8A 5CG8A 5KC6A 4IXLA 4QQPA 3LOBA 3A0NA 1RUJ2 3J4UH 2YGMA 3KM5A 5BUVA 2PLV3 3NVCA 4GIQA 3VUOA 2ZMKA 3VV1A 2GC3A 5L7OC 3GBGA 3LGRA 4QHBA 4IV1B 2EAKA 1G8WA 2JDZA 4IESA 3B9IA 4IQPA 3RQ0A 1AYM2 2YV8A 5E88A 3FZ3A 4EN6B 2IXHA 4ES8A 1UKGA 1N3PA 3B3QE 1MEC2 3JUUA 1OHFA 3VZNA 2VXRA 3WW2A 4DXZA 2IXIA 3MW4A 2ZHKA 4M3CF 3WDVA 1VBD2 4RS5A 2CAUA 4EROA 1EAH3 2R49A 4CDWB 4O9GA 3VKFC 3WP4A 2B7YA 2ZACA 4OULA 2ES3A 2E53A 1XQNA 5CU1A 1G9FA 5ABJC 4WBBA 2LTNA 4G9SB 1X7NA 1MZ5A 4MGZE 4PCRA 3BPZA 3ZXAC 1KITA 1DGWA 1GNHA 1SLAA 2WT2A 1BK1A 3VGIA 4Q2FA 2GNDA 3MIBA 2D3SA 2O1QA 1LR5A 4KWKA 1PVC1 2WFF3 5GLUA 1MS0A 2NN8A 3A0KA 1AX2A 1GNZA 1HW5A 2XB6C 4Q4W3 3ZFGC 1Q8QA 2DUPA 4E2SA 3I4IA 4HSLA 5I0SA 2VNRA 5I0UA 2PFWA 5HCBA 3KGLA 4L92A 4HVOA 4QGLA 1ZM1A 3EJKA 4LE3A 1BKZA 1RUE1 4R9AA 1NE6A 1MZFA 3GYDA 3MPPG 5C4WC 2R072 4YARA 4XFBA 4LEJA 4W6XA 3R4UA 4I02A 2A6VA 3E6BA 1UX6A 1H2KA 4JDNA 1CD3G 3R05A 4R52A 5KXCA 2BVBA 3LA2A 1WD4A 4WM8B 5DUVA 1RMU3 3NKTA 1PZ8A 2HWF3 4FCAA 4ZU7A 3AXEA 1HRI1 3HT1A 4L8QA 5BNOA 2X5IC 3ZSKA 5E89A 3MIGA 2WZR2 4META 5A3LA 1A78A 1F9KA 3PHMA 4Y5Z0 4RGAA 4IEVA 1Q5OA 1RITA 2XLGA 3S0MA 4D3WA 1AR92 2IXCA 3USUA 1PGL2 3D82A 4HANA 5HI0A 2E7QA 4LHKA 1RUD2 1QQP1 3RPQA 1R093 3BODA 2YUEA 3OGGA 1G9CA 5EJ3A 2DYCA 5KXBA 3CJIC 4FTEA 3BOPA 3GHNA 4C1XA 2NP0A 2GSYA 3DF0A 1HV1A 3ZYRA 4CP1A 3WHUA 5IK5A 4QPGA 2DTYA 4FPLA 3JD73 4P9YA 1LGBA 3RJRA 3JB8A 3JQXA 5A33B 5JSPA 2CGNA 3AYCA 4CYDA 4CRQA 1JYIA 2P3JA 4AK3A 2ZAHA 3PJQA 1H1AA 2PLV1 3IKWA 3H50A 2VQAA 3VHNA 1CX4A 3H1MA 2JG9B 2V73A 1W6QB 1H0BA 4I09A 5FBZA 3BU7A 2UWBA 4R8HA 1I1EA 1AR73 3ZFEA 4N43B 1EPZA 1CR7A 2ZGUA 3TNQA 4Q0VA 3VKOA 4H7MA 1DQ1A 3N36A 4JGZB 3OJBA 1JUIA 1UZYA 2WSVA 4FPYA 4YM3A 1KFXL 4HBNA 1J59A 3ZYPA 4S2FA 1FV3A 3NSTA 4P9IA 3AKRA 3ZYGA 1EAH1 4GA9A 1VBC1 2R042 4NOTA 3URFA 4FPOB 2YDEA 5CA6A 4KQ7A 2BW8A 4JTNA 5HCAA 1DG6A 3M3OA 4FPFA 2BWAA 2WLPA 3FE5A 4Y26A 2VW2A 3FX3A 4FP2A 5C33A 5F1RA 4U36A 1ENXA 3EBRA 3MFCA 3AKSA 3PMEA 1AR62 3UK9A 2H0BA 2YHJA 5L19A 1LENA 5DUXA 1OMIA 3G7DA 2QNKA 4RS5B 2WFF1 3RMYA 2XG3A 5T5JA 3VDDA 4W65A 1OPMA 3I59B 4L9BA 4M0HA 4DFSA 4JAAA 1RUG3 1WA4A 2JX9A 3AMHA 4HK9A 5F6KA 4AE2A 4GMP0 3JB4C 2AR6A 5AVAA 5FMOL 3B93A 1UF2C 4DY5A 2ARBA 5F9TA 1U5XA 2BWCA 2NPIA 1WW4A 1WMEA 1PGW1 4D94A 1YNAA 2A5ZA 1S0EA 2DFCA 5AFEA 5EWSA 2XL9A 4QQHA 1REDA 4XJUA 3M3EA 1DQ4A 2DWRA 1YIPA 4PF5A 3PJYA 1SMVA 1WLTA 2HWD3 3B69A 3NV3A 1O3RA 4N53C 1VBB2 4XIKA 2RS13 2JEMA 4E2QA 1ZRFA 1CONA 2DCKA 2YZ4A 3HN1A 2XJRA 4LR4A 3WCSA 1C8M2 3VKMA 4HN1A 1H8TC 3E5XA 1BVVA 4KNCA 3WP5A 3K48A 3TBDA 1DYPA 2OYZA 4XXAA 1F5JA 2E7AA 4AI1A 2C9AA 3ROUA 1NCRA 3VDDC 1IPKA 5JOWA 4JDOA 1FMD1 1UKRA 1B35B 2JICA 4MGYE 4KWJA 2Q1ZB 1W6MA 2XUMA 2VPVA 1NA1B 4AFCA 1AYN3 3GBWA 4QMAA 4XZPA 1LEDA 1LU1A 1QH7A 4UW3A 3IWZA 1WLWA 3ZO0B 1QKQA 1ULGA 5EXOA 2H6CA 4FPGA 1ZZ8A 1OKQA 3FHIB 3JD71 2ZZJA 3G6JB 3VBHA 2I07B 2D7FA 5F6LB 1N1YA 1C28A 1LESA 4RFT0 1EV13 4BMBA 3INAA 1ZVFA 3KCCA 4EWAA 4YVWA 2PHRA 4CEYB 2W0XA 3FUOA 3RG0A 2P2KA 1CAWA 1QJU3 3AYDA 3ZN5A 2AGSA 2F4PA 5DDJ2 1LECA 2CWSA 4D7SA 3RMXA 1QJY3 4QPGB 3J8F3 4XPVA 4QD2A 4PJYA 4GB32 3HAGA 3VKLA 3RWNA 4C90A 2AYHA 4HZFA 3VHOA 1BMV1 1G86A 1GQGA 4XFGA 1AR71 2MHFA 2SLIA 2OIIA 4XYXA 1ENSA 4Z92B 2XLFA 3VBOA 2Q30A 4L99A 1V70A 4JGYA 2WS93 1NCRC 1BBT3 3MLLA 3FWEA 4GKYA 1FPN3 1UPIA 5EYXA 4CDUC 4Q1RA 1A8MA 4KU8A 4EV0A 1OOPC 1Z7S1 2GMPA 3WG2A 1DZQA 3WXPA 1QOTA 1XNCA 2NLRA 1N3OA 2ZCWA 4RR3C 4FTSA 4IERA 1POV0 3WINE 3ZFEB 3LCPA 1DZTA 2DTWA 2HWC2 4HKLA 5FCCA 4WVMB 4YM0A 4AEDA 4RHV1 3JBG3 3VBHC 1V00A 4S2GA 4CEWB 1COV3 1NY72 1S0JA 2WNUC 1OFSA 4HMZA 3WQ1A 1KDMA 4X8PA 3GHMA 2WT1A 4XFCA 4GWNA 5K0UC 1AHSA 1RUI3 5BNPC 1AVBA 1RUG1 2BEOA 4Y22A 5FPZA 5I93A 4B3NA 1DGRA 4QM9A 2ZMLA 1AJKA 1GKBA 3CNAA 2EA7A 1DZRA 2R0FA 4FOQA 2RMU3 4CDQA 1TME3 2NM1A 3CL1A 5EFUA 5KHGA 5DZGA 1LRHA 4C0BA 5JSOA 1S1AA 3DPRA 2ZX2A 4XILA 3VBOC 3WDWA 1PVC2 3BTAA 1DQ2A 1RUOA 2HKXA 3AX4A 1FOD2 2XVLA 4XTMA 4LBQB 5K9YA 1BXHA 4Y1ZA 4F3JA 2HWD1 1E57A 1GICA 4UW4A 1UAIA 1PO12 1UCXA 2RS11 4PDWA 1RUE2 4ZU4A 4I0AA 2R062 1W6OA 2IZWA 2TNFA 2FHRA 3AMNA 5BV6A 3ZN6B 4RD7A 2P17A 1GZWA 4QPYA 2XWBB 2DU0A 2ZOEB 2IFRA 2XWJB 4ORFA 4Z8BA 4IEZA 4P9XA 3IPVA 4LBKA 5D8AA 5FREA 2AZ5A 1WLDA 3ZSJA 4AFAA 2BPA2 2YYOA 1IS6A 3ZYIB 1AYN1 3DN7A 1HRI2 4CDXC 1SBDA 1AX0A 3AMMA 3WX5A 1S2KA 3SLIA 4CDQC 3M4FA 3D6EA 1SFNA 2RM22 1ENQA 2BNMA 3PLQA 5CADA 1LOEA 2VULA 4Q0UA 4EWEA 4M00A 1DF0A 2QFEA 1LOFA 5J96B 2D44A 2LUWA 1HKDA 1EV11 1QQP2 4Q26A 4HKWA 4KBBA 2PAMA 5JIUA 3WLUA 4AEMA 5EZWA 4YFWA 4LO5B 2JG8B 3AP5A 1QJU1 5FQ0B 2XLAA 3SISA 1FATA 5DUWA 3V0BB 1O91A 3ACLA 1QJY1 2A6XA 4PDWC 1MVEA 3MLJA 3B94A 4CDWA 4P9JA 3ME2A 3VZJA 1Q8SA 5IUQA 2GNBA 4QX5A 3FC0A 3M7AA 5JI9A 5I8YA 2TUNA 4OHWA 1F2NA 1XE7A 1O5UA 1DQ5A 4XQWA 2X29A 1KD7A 1SDWA 4I2OA 1QXPA 5L73A 1CAWB 2I2SA 4MV2A 3WG4A 4B7KA 4DRRA 3ZSMA 1BBT1 5AVPA 4DINB 1FPN1 1TE1B 2PLV2 2JE7A 1Y7BA 3ZDSA 3IT8A 1QJX3 2CGPA 3WDUA 3SNMA 2VW1A 4X6RB 1R083 3SITA 3VBUA 3WNXA 4MX3A 3VL8A 4WZFA 3KB5A 4FP3A 4JCKA 2B42B 5FAXA 3H8UA 2AREA 1RUF3 1G6NA 2HWE1 4LBOA 1W6PB 3JBG1 4IV1C 3RDIA 3ZIXA 1COV1 5H9PA 3MIEA 2PHDA 4K3UA 4Q4Y3 4LO8A 1VBC2 4RQPA 3JZVA 4YNIA 4A7YA 5J48A 2Z5WA 3V64A 3M3CA 2RS53 2A6ZA 3WUCA 2OA2A 2RMU1 1TME1 3ZXJA 4CDWC 1R1A2 4MH0E 4WM8A 4BCUA 2ZX3A 4RA0A 3SCHA 4AQ2A 4AEKA 1IKQA 3RSJA 5KHIA 2TEPA 1BEV3 4BLIA 2NMNA 4P9GA 3OBTA 1RUH3 1SCSA 1GLHA 4Y22B 3ZN4A 1REEA 5KWRA 1NQJA 5I0RA 1KRIA 1ALYA 2WL1A 5GZGA 5DZFA 2IXLA 4MZUA 1PO23 3QOPA 4XF4A 5KHKA 4SLIA 3TWIA 1LULA 1U5IA 3I2DA 3WZ1A 4XTPA 1PGW2 5TSWA 3MIFA 4LHNA 4C0HA 3UKVA 5AC91 5LRSA 2H0VA 2XJQA 4M3CB 4UW5A 3L2YA 1CVNA 2ZHNA 4FAHA 4OLLA 4XMIA 3FFZA 4BQ1A 5A33A 4MUVA 1JXNA 1CGPA 3E97A 4HKOA 1Z78A 5DZEA 2VUAA 5IT6A 1JTZX 1AL22 1SLCA 3IIAA 3N7MA 4Q0QA 1RHI2 2PQQA 1H4GA 1OQDA 1YHFA 4UBGA 4QPIA 4NPRA 3MEPA 4WM8C 3QACA 4HPKA 2DU1A 4WVVA 2DCJA 2JG9A 1X8MA 1XYPA