4HPKB

Crystal structure of clostridium histolyticum colg collagenase collagen-binding domain 3b at 1.35 angstrom resolution in presence of calcium nitrate
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
118
structure length
113
Chain Sequence
IPGNEKLKEKENNDSSDKATVIPNFNTTMQGSLLGDDSRDYYSFEVKEEGEVNIELDKKDEFGVTWTLHPESITYGQVDGNKVSNKVKLRPGKYYLLVYKYSGSGNYELRVNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Collagenase
publication title Structural Comparison of ColH and ColG Collagen-Binding Domains from Clostridium histolyticum.
pubmed doi rcsb
source organism Clostridium histolyticum
molecule tags Protein binding
total genus 31
structure length 113
sequence length 118
ec nomenclature ec 3.4.24.3: Microbial collagenase.
pdb deposition date 2012-10-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.380 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4hpkB00
1QXPA 3DF0A 5SV5A 5FBZA 3BOWA 2XVLA 4DZGA 2XVGA 1NQJA 3AFGA 1U5IA 1WMEA 1NQDA 4DY3A 2LUWA 4G9SB 4DXZA 3JQXA 2QFEA 4HPKA 5FAXA 1KFXL 1WMDA 1DF0A 4DY5A 3JQWA 2O8OA 2XVKA 4HPKB 4I3GA 1KFUL 1WMFA
chains in the Genus database with same CATH superfamily
4WM8C 1S0CA 5BNOA 3NNFA 4D0QA 1GZTA 5C5UA 1GOHA 5FQ0A 4QKBA 4BMEA 5L9BA 1OQEA 1Y9QA 5EIYB 1ZRDA 2W47A 2ZOEB 3KM5A 1X9TA 3I3MA 1X33A 1VIWB 2WQ8A 5H9SA 3VBFA 4A41A 4FI9A 4YG3A 4IV3C 1S0FA 3IM0A 2R16A 1W04A 1AL0G 3E6BA 1WW6A 1LHUA 3O5SA 3QACA 4OZOA 2QVSB 2CYFA 3KV4A 1PNFA 3RVHA 2BVVA 2TEPA 5LCWL 2HWB3 3G7DA 1RTVA 4YYOA 3WW3A 1UYPA 2JG8C 3ZFEA 4FT8A 1BBT2 5FLIA 3ZSJA 3DPRC 2UY8A 3S7IA 5DN2A 1RHI3 2D6OX 2W1QA 3JBG2 4UXAA 4Y22B 3VBUC 1PZ9A 1AR83 2TUNA 2V73A 5GJ6A 5ANNA 3G6JB 1W9SA 2VOWA 3ZPYA 4CDQB 1S0GA 3HPNA 1RJ7A 4YZ5A 2UWBA 4H3WA 1JU3A 2K46A 2DBNA 4LJHA 4QAWA 2ZGSA 5FJKA 1DLCA 5GZCA 5L7OC 2RS13 1RUNA 1VBD1 4JRAA 5BNPC 3TEWA 4XF3A 1VRH3 1POV1 4M3CE 4E27A 1O4YA 1MACA 1W9WA 2Y0OA 1MZ6A 4QPWA 3RJRA 1BMV2 5F3IA 4CEWA 4NE9A 5JDBA 1RITA 4DMIA 2V4AA 1OHFA 3KLSA 4E8DA 2WZR1 4IV3B 3UJOA 4WBBA 2OW4A 3CLPA 3T3YA 5AFBA 1UPSA 5JXJA 2VUDA 3O1PA 1JS9A 3APBA 3K4AA 3MHZA 3M8LA 3U4SA 2WNUA 4UFJA 1RMU1 5JR7B 1PO11 3ZYIB 4EN6B 2GH8A 1AYN1 2A75A 1W8WA 3DPRB 3LDRA 3BOPA 1YO8A 3NV4A 3LEKA 1RUF3 1W6MB 2FDJA 2LALA 2JE8A 4XIKA 5T50A 1VMFA 1MPXA 2DCYA 3WSOA 1AJOA 3ZDSA 1ZYBA 4BIFA 4HMZA 1W8HA 2BQPA 1OFNA 3I3EA 3M2MA 3UGHA 2NLRA 2GDFA 2VMFA 3WXPA 1JOJA 2JIGA 5BNPB 4GJZA 4NIIA 1PMJX 2D3SA 5CYYA 2RS31 3RRDA 1R081 3V56A 3LFMA 1S0BA 2GMEA 3IMMA 5FLJA 5FDBA 4YGCA 1K5MC 4BA6A 3NNGA 3RDIA 2C26A 4MXVA 1SBDA 2YG0A 4LK7A 4XZPA 3RZZA 4F83A 4AFMA 4XIOA 2VBPA 2DVBA 3VGIA 1DQ6A 4XW3A 1AYM3 4I2OA 1N3PA 1LU2A 3FFQA 1AX2A 1EUUA 4URTA 4CRQA 2P3YA 3ILRA 5E8AA 5EWSA 1RVF1 1QMJA 2G4IA 5JLVA 4N90A 3M4FA 3CKHA 1CPNA 1NLQA 2HBTA 2VVDA 1GSLA 2ZGQA 1BQPA 2WR9A 3KB5A 1JZ7A 4WM7A 3WNLA 3FFZA 1TMF1 4BMBA 1W8FA 4NVPA 3OSDA 2A70A 2RM21 2PTMA 3P1IA 4OI0A 4AVTA 5A3PA 1S2BA 2EIEA 5CFCC 5FZ0A 5KWRA 2HWB2 5B4XA 3T4HB 2FCUA 5FZ7A 5LASA 2X10A 2Q1ZB 1IS5A 1SDDB 2ET1A 2VOVA 2VZ1A 5CB7A 1H4GA 1RXGA 3LZZA 1YQ2A 2WYSA 1K5MB 1VBE1 1RHI2 2FCTA 2YU1A 2VZOA 2R7EB 4LKDA 2QQUA 1NXD1 2Y6GA 1SPPA 3ZPOA 5JOXA 5AVAA 5K9YA 2A6YA 5LATA 5CU1A 3IBMA 4CP0A 1MS3A 1PIV1 4JDNA 4QQ2A 4GH4A 3WCSA 3E97A 5FZBA 1XU1A 2DCZA 2PHRA 3FLRA 5K8SA 4HXCA 3K46A 5BNOB 1VRH2 2EALA 2HEWF 1ZZ6A 5ACA3 1QJFA 2BRTA 1QHDA 5FQ0B 4Q1RA 4CDUA 1JYWA 1HRV3 1UZ0A 2JWPA 3LEGA 2DVAA 1MVEA 1XNBA 1LENA 3M3IA 3NJZA 1VAMA 4IE4A 5DG2A 4ZXKA 4AOCA 1JMUB 1O6UA 4Q4V3 1S55A 4RHV1 3MV01 2R071 1T2XA 3WR0A 4LR4A 2XG3A 4YGEA 2Q8EA 2RR11 1W9FA 5CFCB 3Q8BA 2WRAA 3AYAA 4FPJA 3B00A 3M3QA 4AQSA 4HK8A 5FZ9A 3ZFEB 4AWDA 1UAIA 2P17A 2JB4A 3LA3A 3OGJA 1RUF2 2CAVA 5FZGA 4MHUA 5FYCA 4AW7A 2W3JA 3R4DB 4H14A 4DEQA 4LO4B 1W2UA 2D6KA 4TXWA 3MW4A 2IXHA 1JZ3A 2JXAA 2PAMA 3MLKA 3E5QA 4JQTA 1ULFA 4OI4A 4UOJA 5LK7B 4IUGA 1GR3A 4TTGA 3PNAA 3RZMA 1QOSA 5LEKA 1COV1 1VB4A 3TBDA 2GU9A 2P34A 3HIFA 4PF5A 3VZOA 1Z0HA 2LROA 2Y8KA 1ZZ7A 2ZGOA 4Q8KA 1S0DA 5FZ4A 1ZZ8A 2YBSA 1OQDA 4AVVA 3OY8A 4LXLA 4QB6A 3B93A 5F7UA 4AAPA 2HWE3 2NN8A 1YJLA 2ZGKA 2ZZQA 3KQ4B 5EPAA 2XUEA 5IK4A 4XMAA 3AJYA 2I74A 3THPA 3GYDA 3WT3A 1AYM2 5A3TA 1HB2A 2WNUB 2YB7A 1D7PM 2X5IA 4A44A 3AP5A 2OPWA 1O3QA 1UZYA 1YCIA 3AP4A 1GBGA 1DGLA 4LBOA 2GC3A 1ULOA 2GNBA 3BALA 4N7UA 3WP3A 3AKSA 3RG0A 1ULPA 2ZMLA 3POYA 5DZGA 4DIQA 1DFQA 2ZEYA 3D3AA 3VDDA 5E16A 4D6QA 5T3NA 1OKQA 3NVCA 2RS53 2UWCA 3BOWA 2ZGTA 1MS8A 1VBB1 1V6LA 3SLIA 1QNYA 3KD4A 3TWIA 2MEV1 3OGVA 1UW8A 4IEZA 4YM1A 2RVAA 1H1MA 5F5IA 4A7ZA 1DG6A 5I0RA 2RJ2A 4M4RA 1CR7A 5F5CA 1JZ2A 3C2UA 2LS6A 4XFFA 5KXCA 1XE0A 1MS0A 4HPKA 1VP6A 1OT5A 3OBRA 1UYZA 2JE9A 2HBUA 2W52A 4H7LA 2ZABA 4X6RB 3SH3A 1UX6A 3CNAA 4Q0VA 4DNYA 3FN9A 4C1XA 3ZXLA 2VCBA 1CQ9A 2ZHLA 5IVFA 2XLAA 4XDOA 4JQRA 3ST7A 2YYOA 1EV12 1K5JA 1Y9GA 3AZVA 3T2TA 2VC9A 2FZ1A 1C3HA 3HN1A 2EF6A 4GA9A 4YFWA 4GH4C 3T4VA 3VZKA 2R49A 5A1LA 1J84A 2R32A 5ACA2 1WCSA 1UN1A 3CU7A 1V6NA 1HRV2 2QQIA 1F4HA 2P5BA 4JV4A 5DAPA 4OULA 5FZIA 5FZCA 3CHXA 5L9RA 1GNYA 2JICA 3POGA 2WFF3 4BQ5A 3LPGA 1UKRA 1HV1A 2CL2A 4GB33 1SLBA 2FD8A 2YROA 4RN5A 3RWKX 5DQ0A 1W6PA 3LIHA 1LGCA 2D40A 1B35A 1W9YA 1YFXA 2ARXA 1DZQA 2XWJB 1J3PA 1QWRA 4BB3A 1WCQA 1LEDA 3PHMA 4OHYA 4X6QB 4A7YA 1H9WA 1QDOA 3WZ1A 2C4XA 2EIDA 4L9BA 3ZXGA 2FHRA 1D4M1 1OVPA 3I2IA 1RUE1 4COZA 3NKTA 2ID4A 5A6YA 3RNSA 4NHYA 1JYNA 1AR71 1H2NA 1W8ZA 4HN1A 4UF0A 4CCMA 3S5AA 4GH4B 4Q4Y1 4XAAA 1DP0A 1N1YA 1QF3A 1W8OA 2IXLA 3K2OA 4Y5SA 2WO1A 1W0NA 5K4LA 3SMHA 2Y34A 2QQNA 2ZTNA 5FO7B 4CDUB 1PO21 2BERA 4FFFA 3VBRA 3ZSMA 4SLIA 3B9IA 1N1TA 3HD8B 1UU4A 1C28A 2P3KA 2VW0A 5EP9A 3VZMA 1NCRA 1C4RA 3BVCA 3W5MA 5FK8A 1ZBA1 2H6CA 1UXZA 1TME1 2HWE2 2VBDA 3AMMA 3NNJA 4TLGA 5GLTA 1XJAA 3P3NA 3OTFA 5LBCA 3VBOA 4NIDA 4GWMA 1YC61 4MGIE 1C5HA 1A3KA 2O8QA 2VM9A 1JHNA 1WD3A 1SFYA 2KD7A 2X5IC 1HQLA 1T6GC 2QFEA 4GD4A 1WW7A 4XUPA 2LW8A 2ZEZA 5JMCA 3TNPB 3BUCA 3JD71 5BUVA 1U5XA 2ZCWA 3K51A 4JAAA 1KFXL 1WWYA 3ECQA 3MUY1 5JWPA 4E4ZA 2RDNA 1IS3A 1H1IA 1UKGA 5IUQA 3UNPA 4XFHA 5G04L 3VDDC 1MVQA 2HWF1 2TNFA 4B1LA 2EAAA 2RS52 4UT5A 2Q30A 1AZDA 2XUMA 1LB2A 2EICA 1UD1A 2YBPA 2BFUL 3T1MA 4MV2A 1QKQA 1UYYA 1AXKA 2WLPA 5FPXA 1NG0A 4P9XA 3WOGA 2OZ6A 4JDOA 1G7YA 3UGFA 4PIZA 4HOOA 3CDZB 3FHAA 4IDZA 3R4SA 2AR6A 5JOZA 3DGTA 3Q8AA 4MO3M 4PDWC 3RMYA 1KJRA 1ODNA 2P1BA 2PHUA 1NY71 3DYPA 4HT1T 2NYYA 3OY8B 4L11A 4S2FA 2VMCA 4F7ZA 2OYZA 1D0HA 3KV9A 5FFOC 5HCAA 2YFZA 4P9GA 5C7GA 4RYDA 2I2SA 2H6BA 2A3XA 4M0NA 3IN9A 3VUOA 2X5IB 1DQ0A 4W8JA 2JDNA 1OVSA 1GWMA 3EB7A 4XZUG 4META 4N9IA 5APAA 2W94A 5LA2A 2R1BA 1VAVA 3SHRA 3Q9OA 3N9PA 5DAVA 2B9VA 3POWA 2RMU3 3C7HA 1IQAA 5FUNA 2VNOA 4Y1XA 1S1AA 2PLV3 1PGL1 4CPBA 5FPZA 2ARBA 1W05A 3VDDB 1GZ9A 3NMBA 1ZVFA 2IXJA 5FZ1A 1JYCA 2E7TA 4LO8A 4RFRB 2WFF2 1AR61 3N7KA 2LTNA 2UWAA 4M3CA 4ZY9A 3UKVA 1I3HA 4MGKE 4P00B 4GB32 1OA4A 5FIXA 4EN7B 2ZHKA 1UY2A 3DYMA 3ZIXA 3WNNA 3E5XA 1F4AA 5CG9A 1B35C 2DVGA 1A8MA 1LHOA 2O8OA 4HPKB 4E2QA 1PGSA 4J1WA 4PDWB 4Q4X3 2QQLA 2E33A 4QX5A 1HB1A 5FRAA 3H3UA 4NRMA 1AUYA 4QT6A 2IZWA 4YNIA 5FMOL 3IPVA 1RUJ3 4JGZC 2HEVF 4ARYA 3EO6A 1CD3G 1CN1A 1X36A 1RUC3 3OGGA 1CIYA 3BU7A 3HWJA 2Y6JA 4EZHA 1BVP1 4LLFA 4PI2A 4AAXA 4F3JA 5F2SA 4COUA 2GZWA 5HV4A 2ZAAA 1DGWA 5C5TA 4BXSV 1BK0A 2HH9A 1HQNA 2XLGA 3ACIA 1WBFA 3CJIA 1OURA 1GWKA 4R52A 3ZYGA 5BY5A 5FY8A 4LT5A 1XYPA 3K3OA 3VBHA 5JSOA 4WVWA 3BU0A 4BLIA 2W87A 1NCRC 3A0KA 4K3UA 1CESA 2XJPA 1ZZBA 4AFBA 4YVSC 2RV9A 1HIXA 2WN3A 3VBOC 4KWKA 4QXCA 1W6PB 3CEWA 1B35B 1H6XA 5H9QA 3UKTA 5FYSA 1CAWB 3B02A 2W1SA 1F5FA 3HNMA 4GMP3 4U2AA 2JDUA 1NLRA 1NT0A 2ZACA 3GF6A 2GNDA 3WLUA 3FMGA 1Q8PA 1CPMA 3KZ4C 3EHKA 1R64A 1OOPC 4CEYA 4Y1ZA 1RUG3 1FOD1 4XILA 3LDBA 5FYYA 1OI6A 1RJ8A 5FP7A 4AE2A 1ZREA 1VE0A 2E6VA 1RUI3 2D3PA 4UF0B 1FNYA 4DO0A 1IKQA 2QQMA 4QGLA 2R6QA 3D0SA 4QX8A 3V65A 4UW6A 3RPQA 1ZRRA 2ZGRA 1AR81 4FPGA 4NRQA 1MQTC 5GZEA 4BH9A 2DFBA 1UIKA 2W68A 3N7JA 1ZA7A 3ENRA 5I8YA 2ZS6B 3MIGA 1RUH3 5DAWA 2W2IA 1NCRB 5CAZA 3AJZA 3J8F1 4B29A 1HXS2 4YVSB 2WKKA 5FAXA 3PMEA 4C8DA 3Q8FA 4B4PA 3VBOB 3LAGA 4Z2AA 5F3CA 4FPYA 4DXTA 1W2AX 4CDQA 1UOJA 4R9BA 5BNNA 1DYPA 5FPAA 2P37A 5C3QA 4NRPA 2VZTA 2RMU2 4IQPA 1OOPB 2MNGA 2QBXA 2PLV2 3D4KA 4WM8A 3LF7A 5EJ1B 5T55A 4HN0A 4D6SA 2UU8A 2IXCA 1YXWA 4UYBA 3MDPA 4COVA 2VZPA 1J58A 2HYXA 2ERFA 3FZ3A 5JMOA 1G9CA 3SISA 3I54A 2JX9A 1PNGA 1XE7A 3GALA 1ENXA 5A7SA 4ZHNA 3PUQA 1H1AA 3T0BA 4IV3A 3WW4A 4L8QA 4GAZA 1MQTB 5FREA 1WMXA 1ZNPA 4Q4X2 3T1LA 5FZDA 1R1A1 1AXZA 1K42A 5KC6A 3OEAA 1PX3A 4W6WA 2JG8A 1SLTA 1RUJ2 3PMSA 5IT6A 2C1FA 3DPRA 2VTFA 5FZOA 2Q5TA 3IKWA 2R0HA 2ZGMA 1RUC2 1XNDA 3VBUA 5FLHA 1H8TA 1NE4A 2KA3A 4IEXA 2CDPA 2HWD3 2VZUA 1N1SA 1YFWA 4ZZ5A 3S5QA 4K40A 4CU6A 4RGAA 3VKNA 5A32B 1YIPA 1HB4A 4KWLA 1AJKA 2HWC1 2OXBA 2SBAA 1OXCA 4WVZA 5L7OA 3BPZA 3LIGA 5BNPA 2VG9A 3I3BA 1CZSA 1SBFA 2E7AA 2W39A 2ZZJA 5ANQA 1JXNA 4DRVA 1REFA 4N43C 3VBHC 2MEV2 4AYUA 1EPZA 1IG0A 1ASJ3 1CJDA 3CZUA 3IDAA 1VBC3 2WBKA 3POIA 3E5UA 4UFIA 3I2GA 4JGYA 3SQOA 3AYDA 2CTVA 1G9DA 1O8PA 2WN2A 5FK7A 3WUDA 3VLBB 1S0JA 5DZEA 4E2SA 4Q4W3 2R0FA 4KI5M 2XBO1 3HQXA 1SHWB 1JZ4A 1HLCA 4CP2A 3ILFA 5DDJ3 4ATFA 4CEYC 1W0PA 3HQUA 4K8FA 4M00A 4MX3A 3IPVB 5JIUA 4QDQA 3QH6A 2FDFA 1RUI2 1CAVB 1LEMA 3IMNA 4GXLA 4QX0A 1GP6A 4KGGA 1V6MA 4HETA 3OCPA 4JC1A 3AKPA 2DV9A 4BE3A 2ETEA 3VKMA 2Z2SB 2VQTA 2R30A 1EAH1 1GP5A 1WMFA 2A3WA 2QDRA 5FOBB 2G9GA 4C90A 1VPHA 2BGPA 3OB8A 3RS6A 5FYBA 4FSJA 5FP4A 3PVOA 3VZJA 3TOJA 1RUOA 1HJFA 1RUH2 4N43B 3VBHB 2EXJA 2R041 3LDKA 1ND2C 3LOIA 4QX3A 1L7QA 3ZYPA 3U4XA 4XOGA 4N53A 1F5JA 4YLZA 3HVDA 2DUOA 4UFKA 1QJX3 1E57A 1TG7A 4XTPA 5IK8A 1KDKA 2RDQA 3V0AA 4Y24A 5BNNC 2XH6A 2AYHA 2V5YA 2CHHA 3H7YA 1PVC1 4A42A 4FQZA 2PMWB 1VRBA 4CEYB 4AFDA 2QCSB 2QDNA 4Y26A 4UBHA 3VHRA 4XJZA 3UT0A 1PM7A 4QDRA 2JIJA 3I97A 4FPLA 2FQPA 2VXJA 3OEBA 1S0EA 4DUXA 2XJUA 1GQGA 4OVEA 4LKFA 3HMYA 1FT9A 1ULEA 5JUVA 3AB0A 4Y20B 3AZZA 2BOIA 3TN92 4ES8A 1MS5A 3AXEA 1QJU1 4YW1A 4P5YA 3RI9A 2ZX0A 5CFCA 4BQXA 4DXRA 2WO7A 1RINA 1LKNA 2PFWA 4XABA 5B2GB 1ND2B 4EWDA 1OMIA 4Y4RA 3L9JT 2XHKA 2BTVC 4JHZA 1W6QA 3WW2A 4CUAA 1LNSA 1NKGA 4XE9A 2HWD2 1AR93 1H8TC 3PJYA 3H1YA 2WZ8A 3THTA 5BNNB 4XMIA 3SCFA 5A6QA 4NR1A 1U5IA 4B4RA 3J7NA 3MLLA 4XFCA 3WNOA 1Q8QA 1HRI1 2JKXA 2CAUA 4OLLA 5DAXA 2WS93 3PU8A 4WM8B 1AX0A 5EV7A 2VJXA 4CZSA 1QOTA 1CAXA 1QU0A 3AP6A 3N7LA 4A45A 1YUDA 5GLUA 1ASJ2 2VZSA 3VL8A 2XL9A 1VBC2 1Y7BA 4JTNA 4JGYC 3U1XA 3LB9A 1FATA 3O0WA 4XHBA 3UYJA 4XETA 5IWFA 2VMIA 2QZ3A 3ZN4A 2FDGA 4MSVA 4OI2A 4Q4W2 3O1TA 1QXPA 1MEC1 3GHMA 3WINE 3NV1A 4DFSA 3ZOIA 2BEOA 1GWLA 3THDA 3MIBA 2DCTA 2VL4A 3ES1A 1L3JA 1C1LA 1F31A 3AFGA 3K75B 1O7FA 2ZX4A 3KGZA 3AC0A 5IK5A 1LCLA 2JD4A 2VMGA 4NHMA 2JG8B 4CTEA 1V6JA 5FZOB 5KR7A 5EJ3A 5IVYA 4CCKA 1PZ8A 3I3DA 4HK9A 3VBUB 1H8TB 3BTAA 4AGGA 2A7AA 2UY9A 3CO2A 1ULGA 2ARCA 3TEYA 1WD4A 1NXMA 1US2A 1PZ7A 2IUWA 1OD3A 1YYNA 3JXSA 4M3CF 3ZMOA 3NW4A 5ISLA 1C8M3 1Q8SA 4UBGA 4S2HA 4LE4A 5L7OB 4AVBA 1T6BX 1CX4A 5CZKA 1QNWA 1D4VB 2E9QA 2VOKA 3SCGA 5FP3A 1O91A 1IKPA 1LODA 4WZFA 4FCAA 4JVAA 4JGYB 3WQBA 5K0UC 4N53C 1QJX2 4B7KA 3FLTA 1FXZA 1LRHA 2F6BA 1L7LA 1J3RA 2A73B 5LBEA 5A7PA 4E4SA 2ZGLA 3OYWA 1YHFA 1OQ1A 2JJ6A 1JHJA 1GUIA 4IEWA 5FYTA 2BBAA 3IAQA 2D44A 3QD6A 2VQAA 5A3UA 4B8EA 2DWRA 1K45A 2WZEA 3DF0A 1PGW2 3AYCA 4KWJA 3GJBA 4LIUA 4OZXA 2BNOA 1ACCA 4JHTA 2FDIA 4QPYA 5H9RA 3LFIA 3NSTA 1CJPA 3KV5A 4FPKA 3N9MA 1VB2A 3WQ7A 2TBVA 2VQUA 2QQOA 3GBFA 3TEXA 1SFPA 2ORXA 4LTAA 5FY4A 4AGVA 4I0WB 4BWOA 5HCBA 3VBFC 2PHTA 2XWBB 4IE5A 2IFRA 1FPN3 5K0UB 5LW9A 2IVIB 2Z79A 4KU8A 2G9FA 4N53B 2EXHA 1AR92 3DYOA 3HN3A 3OGRA 3RQ0A 4OCTA 4AQ6A 4ISQA 5E89A 5AC93 3V0AB 2IWGB 3GDBA 2VD7A 1RYYA 1S4CA 2X8KA 3NJYA 1UMHA 4I0BA 4I3PA 3UK9A 1OLQA 1EV13 4O9GA 2BDRA 1X9PA 1QQP1 1QOOA 1YRZA 5F39A 2WS92 2OUJA 1UX7A 1QH7A 3MBWA 4LHNA 4XUQA 4OMDA 4Q0SA 4ZU4A 1HQWA 1XXNA 4IW3A 3WDWA 4X8PA 3DN7A 1OLME 3V64A 2YC4A 5LA9A 5A6ZA 1DDLA 1O4TA 4OUEA 1XQNA 5LEJA 4Z8BA 1JN2P 2CGPA 3I4IA 4GZ9A 5EZWA 4CDWA 5BV6A 1A8DA 1V0AA 3OF1A 1ZBE3 4MGTA 3VD3A 4NWWA 5IW0A 5I0DA 5I8TA 2VMDA 2VNRA 2E32A 1LHVA 2QKDA 4I3GA 3JB8A 3ZMNA 1QJY3 1GOFA 5KHHA 4OHWA 3L2HA 1SLLA 4ONUA 4PLOA 3VD5A 5CFDC 4CXYA 2AGSA 3CQOA 1IGOA 1Q8OA 1YEWA 5BXXA 1LULA 3ZX7A 3EJKA 4KBBA 2R061 2D6LX 2RJLA 1JODA 4CP9A 5A3WA 2BV4A 3IWZA 5C3SA 1NX9A 1W6QB 3D5OA 2YFUA 4DUVA 2ZKLA 3FBMA 1IZ3A 3INAA 4L0PA 3VB9A 3ILNA 2WC2A 1Q56A 4XJ9A 1C8M2 4KMQA 2WO2A 3DXTA 3FUQA 4P9IA 4Q26A 3OPWA 3J7HA 4IEPA 5CKNA 3O1RA 3ZSEA 1VR3A 2O14A 4E9KA 4LBNA 2FMDA 4L99A 3WQ0A 4IE6A 1CAXB 2VUCA 3RWNA 2YGMA 5C4WC 4MVTA 4QX1A 3EBRA 2PQSA 3H3LA 3OPZA 2B5HA 4AI9A 1US3A 3OUIA 5FZKA 1UZVA 5FUPA 2B7YA 5A3NA 4Y4YA 4YZ2A 1MS1A 4D69A 5LRSA 4Y3OA 1L7RA 5KXDA 4LULA 5CFDB 4IL7A 2WWSA 2Y6FA 4MXWB 1XSRA 3QH7A 4FAHA 4KWUA 3USSA 1LOFA 2R1DA 1R091 2A71A 5A33A 5HI0A 3GCXA 1MS9A 2B46X 5AVPA 3ZYFA 4BZ4A 1UMZA 2P6CA 3GZUC 3AKTA 1XU2A 4QQHA 1S2EA 2Q1FA 5J36A 5FBJA 5F2WA 1FMD1 4Y1VA 4CVUA 1J1LA 3MUZ1 1ND3C 2OT7A 2WAOA 3DCQA 3CMGA 4MADA 3WP4A 3ACLA 3U10A 1VBA1 2L9LA 4YW2A 2DUPA 2KR2A 4FPCA 4ITCA 4OHXA 5DDJ2 4FVVA 1CVNA 1WA6X 1VALA 1F2NA 1W8NA 4HKLA 1U12A 1O3RA 1POV3 2W5FA 1V9U1 5J48A 5C4WB 4EV0A 3VDCA 3LEIA 4DOUA 4LEJA 4AGRA 5A7NA 4QX2A 1J59A 5DZFA 4K9SA 1D2QA 4PDWA 4Q1PA 4YZ1A 1FPN2 1WLWA 2WZR3 5LBBA 4JCKA 3HQRA 3NO8A 4I30A 4D7SA 5AC92 1UZWA 5IK7A 1BEV1 3POBA 2W91A 3ZFGA 4CE8A 1HN0A 3I2OA 1W3XA 2GALA 1KS5A 1RMU3 3NAPC 1PO13 3TEZA 2IXIA 2B45X 3OYWB 4HVRA 5FYMA 2VQ0A 4XJ8A 4HSJA 1RUD1 1W39A 2AZ5A 2XONA 3EXUA 4PF1A 1KDMA 2GH2A 2BW8A 4CUCA 5J7MA 1CIWA 1ZM1A 4PQQA 4JZRA 1HV0A 1Z7S1 1LTEA 1UOBA 2C0ZA 4DXZA 2E26A 2J1RA 1ND3B 1ENQA 1W3VA 1ZBE2 4CDWC 2YGLA 5FUIA 1JZ6A 3P3PA 2Q8CA 3R0RA 2PN5A 5C8CA 3USUB 5CNAA 2BVBA 3C7FA 3IT8A 3M1HA 1QJY2 1XBFA 4GMP0 4XVHA 2RS33 1SCRA 1R083 5KHIA 3AFKA 4H2AA 5FYIA 4CCDA 2WL1A 4XF1A 2NQYA 1D0GA 1CAWA 1V6OA 3LA7A 4LO5B 5JSRA 1DLLA 1G9BA 3GXUA 1WLDA 5FPLA 2DURA 3PIJA 4I0AA 1AL21 1W8UA 3N36A 4JGZA 4AK3A 2QZ2A 1CZVA 1C57A 3NAPB 2AREA 4FOWA 4UW4A 5JI7A 4W6XA 2CSGA 5IFPA 3Q8CA 3WF3A 5IYYA 1RVF3 4K6BA 1ODMA 4HL0A 1OF3A 3PVNA 3SC7X 1M06G 4XFGA 1XSQA 1O5UA 5H9PA 1W28A 1ALYA 1HB3A 4CDWB 1TMF3 3PUSA 4NJ4A 5JR2A 4LUMA 4NIAA 2RM23 4D6RA 3OBTA 2VO5A 5LRRA 4YVSA 1Z78A 4XQWA 4KQ7A 4PIYA 4O61A 4YWAA 5F9TA 2ZHMA 4PIXA 2AEYA 4IGPA 5C6CA 5A3LA 1LOFC 2WIIB 2ORZA 5IVBA 1D2SA 4GWNA 3WD5A 1X7NA 2WO3A 3MF6A 4QHOA 2Q8OA 1JYTA 1GMMA 4XJWA 4AQ2A 4ZS2A 4CP9B 1N3QA 4RFT0 2DVFA 3U0ZA 4W6YA 3OJBA 3ETQA 1OOPA 1W0OA 4U36A 5EYXA 4HSLA 2HYKA 4AVCA 3POSA 2JB8A 2JEMA 4BHPA 1PIV3 1HRI2 3QLQA 4BIOA 4EN8B 2NPIA 3SH4A 3ZM8A 4FPEA 1NLSA 4FQ4A 1VBD2 5HXMA 2Y6KA 1SLCA 3ZXJA 3KF5A 4UFLA 3KHBA 4LBQA 1KRIA 1VAKA 2J1AA 3BPSA 4RS5C 2VGDA 3VHOA 3ZIWA 1BBT1 5GLVA 3M3EA 1O3SA 4YM0A 3PUAA 4I09A 1U0AA 1TNFA 2VW2A 1OF4A 1W2OA 1W2TA 3JBG1 1MQTA 4QXBA 5L73A 3PVEA 2JKBA 3O0XA 3RYRA 1E5SA 4COYA 2YC0A 1DU3D 1RL3A 2WZR2 2BNMA 3U75A 5A3OA 3ZYHA 4LOTA 1N47A 1DF0A 4RHV3 1W9TA 2R073 1GOGA 4QPIB 1HXS3 3ZFGC 5FY5A 1RMU2 2RR13 1PO12 5FXVA 4HVQA 5D8AC 2XKPA 5FY1A 1AYN2 2DU0A 5A33B 4HG6B 2WQZC 1TQ5A 1KITA 2ZAHA 3EMRA 4PLMA 4Q2FA 1BMV1 3WW1A 2XGXA 5A32A 2WSVA 1YQCA 3DXUA 2FDKA 3H1WA 5DUWA 5C3PA 4EQVA 4LE3A 1GLHA 1IS4A 1ZZCA 5JSPA 1REDA 3H3ZA 4UFHA 3QOPA 2Y33A 4G9SB 1H9PA 3A21A 3WF1A 1NUKA 4BQYA 4DUWA 1SEFA 5C8CC 1AHSA 2VMHA 2RS32 1R082 2OZJA 4RS5B 3WV6A 1ONAA 2D93A 4GULA 1JOPA 4LUKA 3MI8A 4LITA 1WLCA 4WVVA 2GC2A 4D7YA 3U78A 5F5AA 4YW3A 1TNRA 4FP2A 4N7IA 2RE9A 5C9AA 1FAYA 4CPBD 2VTXJ 2BUKA 3R6SA 3ZFGB 4G4FA 4LHKA 3ZR5A 3LEMA 1CAVA 4PCRA 5FPUA 5D8AB 3O1VA 1JYIA 5J96B 4MH0E 2F4PA 4FXKB 3MPBA 1RVF2 1AX1A 2WA4A 3ASIA 5JI9A 3GZTB 3KVBA 2X53S 3HBKA 4LA3A 1OD5A 1LJ7A 5I91A 4J1XA 4NOTA 4P9WA 3VV1A 4URAA 1TMF2 3M3OA 4TN7A 1V6KA 4BOWA 4N43A 1VBB3 2RM22 4H55A 2MEV3 5C8CB 1LHWA 2XQXA 1YQ6A 3JB4C 4JDMA 1XNKA 4TWTA 3PL0A 3VHPA 2WINB 4Q29A 1W90A 4CUGA 3O1UA 5ABJC 1V6IA 3RI8A 1QXRA 2H0VA 2ATFA 1U5YA 3VKOA 1IPSA 2WT1A 3FX3A 4XF9A 3W59A 3ZXKA 4EN9B 3O1MA 1VBE2 3S57A 4RR3A 4FBFA 1VMJA 2BWCA 2P6HA 2VCMA 1SCSA 1K3IA 1PX4A 2CNAA 4CU9A 2DF7A 5AFEA 1ZRCA 5JPMB 4YG0A 1H8VA 1PIV2 4JGZB 4ZPIA 4YVWC 3ZLIA 2ADEA 3ON7A 5LK5A 1DZRA 5I8SA 5C33A 3MYXA 4KGQA 3BIWE 3HR9A 2HWB1 3VN4A 3MO4A 3VDBA 3MF9A 3WDYA 4YARA 1IS6A 4Y20A 1UY4A 3OUJA 5IAVA 1RHI1 3SXWA 1APNA 1CONA 3GBWA 4RGKA 5DAQA 3FLPA 4QKDA 4CCEA 3THCA 2EIGA 2O0OA 3FHIB 3J7MA 3BODA 4KBZA 2IXKA 5FCCA 3B5LB 2Q1MA 4JKKA 4S2GA 3RSJA 3UJQA 1YFUA 5EXOA 4EROA 4RHV2 1ND2A 5A1AA 4QGMA 2R072 4RL7A 4A3XA 2RS11 2RR12 3ZYRA 2PELA 1QJZA 2D98A 3FE5A 3V0BA 1VRH1 3H1MA 4AI2A 2FDHA 4R4ZA 1Q3EA 2QQKA 4QPGA 4UWDA 3Q8EA 4N9HA 2VZVA 2ZPXA 3I3QA 5A1FA 2XMLA 1UIJA 2VZ3A 1JOBA 4B1MA 2JDKA 1RUE3 1JZ8A 3T2OA 1CWPA 2XXZA 5F3EA 5FY0A 4XUNA 2EAKA 3RYKA 2KM2A 3LOBA 5FO8B 1NA1C 1OLMA 1DIWA 4DY3A 4Q4Y3 4YW4A 3ZXAC 4B4QA 3CL1A 1WLTA 2AACA 4GKXA 1COV2 4LBQB 2B39A 3I2HA 3O12A 4XUTA 1V70A 5DUVA 2WLQA 3C7GA 4D8MA 1PO23 4XBQA 3X29B 1RUF1 3W58A 2CWMA 3FHQA 5GALA 4BXFA 5DUUA 1OPMA 2O1QA 1H30A 4KG8A 3TN93 3WHUA 5T5OA 4DS0A 3UETA 4OHVA 5LB6A 3U37A 3A23A 2VMEA 5GZGA 1CX1A 1EYBA 1ZBA3 4NHKA 3R4UA 1TME3 5C9AC 3E6DA 2YPJA 4QQLA 2QUOA 4DB5A 4C0BA 1O5LA 5FBZA 2PAEA 3KT1A 4MGZE 3ACHA 1W06A 3S30A 4AEMA 2V72A 3I2JA 4NHLA 3F2ZA 5G05L 2B4KA 1O4ZA 4CP1A 1ZRFA 5KHKA 3KT4A 2YXSA 1DYKA 2XJTA 3DEMA 3JD73 1I5ZA 3N9NA 4K1ZA 4XTMA 4YPJA 2V4VA 5BYNA 2ZMNA 3JQXA 4NIGA 4XCAA 3LGRA 1SDWA 4YW5A 4NHXA 4QQPA 2OQ6A 2E53A 4LMFA 1VBA2 2HWF3 2D7FA 4L97A 4D94A 1UY1A 3PTRB 1VBB2 1LOGA 1XOYA 4XDPA 5A6XA 5L19A 3H9AA 4N8MA 4MYEA 1AYM1 3K3NA 1WCUA 4CYDA 3ABZA 5FYHA 4CUBA 1MZFA 1XNAA 5FZ3A 2E31A 4XHXA 4LOSA 1BJQA 1M4WA 2RDSA 4Z92B 1H2KA 1NE6A 3VKLA 2GNMA 1QDCA 1SG3A 4RR3C 2GP5A 3CBNA 2GSYA 1VJ2A 4XF4A 2D6NA 2VZRA 1A78A 4FOYA 1NYWA 1UOFA 3WG2A 5FWEA 5C9AB 3C8XA 2DYCA 5FMBA 1HJGA 1W6NB 3OPTA 5F3GA 1HDKA 3JUUA 3IDEA 3NJXA 4IEVA 1OPOA 3AZWA 1F35A 3H42B 3DKQA 5A7OA 5HXVA 1JYXA 4AFCA 2BJSA 4XJAA 3WUCA 2VOTA 4CU7A 3LKJA 1GQPA 1PHMA 3DKWA 5FKCA 1BK1A 1SLAA 5DPNA 2IFWA 2JG9A 4DQAA 5LWBA 2VE1A 2XKOA 1AR63 1DGRA 2GNTA 3ZYJB 4A6OA 1EV11 4NAOA 2VAUA 3WDVA 5FY9A 5KXEA 3MZHA 1RGSA 3WP6A 1W99A 1KJLA 2C9AA 5CISA 3J26N 5K0UA 1BHGA 1G6NA 3ZN5A 5ACA1 5CBLA 3EYPA 1UU6A 3N7MA 3EQEA 3LE0A 3O14A 3LQCA 1HRV1 4IGOA 4P9YA 4QPGC 3VHNA 4RR3B 4INDA 5I0TA 1D4M2 3M7AA 4HANA 1RUE2 3WF2A 5FO9B 1YFYA 4QU1A 4OQ8A 4KL1A 2CGOA 2RG4A 3E6CC 2PA7A 1JBCA 2ZXQA 3O7OA 4BM8A 4FXGB 2WT2A 1AR72 4Q4V1 3WHTA 3RZJA 3B69A 3MICA 3ACFA 2BPA2 2J22A 2K2SA 4Q4Y2 5E1RA 2UYAA 3VD7A 4XDQA 4FP3A 2W46A 1LGBA 4LQRA 5CKQA 3A22A 4BQWA 4JTOA 3AKQA 1DQ1A 3AVRA 3W21A 1PO22 3J7LA 3KV6A 2VVFA 5GZFA 1F8VA 4HKWA 4B3NA 2Z69A 3AX4A 1NAEA 4QHZA 4OYUA 4AZZA 5FWJA 1WCKA 1KXGA 3H0OA 1ZBA2 5FXZA 1TME2 1LECA 1WZXA 3AL6A 1EUTA 2W0XA 4UI9L 5L9VA 1OC1A 2D6MA 3KCCA 3LA2A 1WGPA 2W1UA 2PQQA 4XC9A 3V0BB 5JZGA 2VU9A 4IEOA 5F1RA 3JD72 4QPGB 1IPJA 3LD8A 2XJSA 4Z82A 4FAGA 4CXWA 5C8WA 4P9JA 2ZX3A 5T54A 1FOD3 4ES9A 3T2QA 2HWF2 1UY3A 3BTXA 3WDXA 1ENSA 2AENA 2HWE1 3I49A 1KQRA 4J25A 2YZ4A 3IDCB 3P5BA 3RZKA 5FZLA 3OOXA 1Y4WA 3FL7A 3IAPA 5EJZB 1ZA4A 2XJQA 3AYEA 2B8MA 3H8RA 1UF2C 2AUYA 2QQJA 5A70A 1OA2A 2BFUS 5LA1A 3LCPA 1VLNA 5CFDA 1QGLA 2JDZA 3PTYA 4MXWA 4EN0A 5IVVA 1WW4A 1NY72 4FFGA 3OBZA 3TNQA 5EQUA 2RS51 1UO9A 3J8F3 3BN6A 3ETPA 1NOVA 5SV8A 3OGSA 2J7MA 4PI0A 3KQRA 5FJHA 3GZAA 1GZCA 2A6ZA 1TZOA 3WG4A 4Z2WA 2HKXA 1FYUA 2GN7A 1ZZ9A 3VZLA 4ZS3A 4OMCA 1OA3A 3ZFFA 3H8OA 2DFCA 4A4AA 2VR4A 1SACA 1S2KA 1O59A 1POV0 5JOYA 5KHGA 4R8HA 1PGL2 2E7QA 3MW2A 3NV2A 3BCWA 3N9LA 1LAJA 2OQ7A 2WZPP 2VUJA 1P8JA 4NIHA 1AR62 2ES3A 4NUBA 2JG9C 1TEIA 5C4WA 3BTYA 1SLIA 5F6KA 3N3HA 3BTZA 1POQA 1W6OB 2EXIA 5CG8A 4PBOA 5FZ6A 2C6SA 2FMYA 2IVJA 3A4UA 1FV2A 4MGQA 1OUXA 1GZWA 2A3YA 2PAKA 5FZ8A 5GM0A 2D97A 1I1EA 2JE7A 3PJQA 4XQ4A 2WNVA 4CCJA 4YM3A 1R1A3 5B4NA 2BP6A 2Y26A 3NKGA 2VVEA 5GKAC 4DY5A 3JQWA 1STMA 4QPIC 4ZZ8A 5I0SA 4B7EA 2WYFA 4K7JA 4BYYA 2WFF1 4AL9A 2OPKA 3PDQA 4DEVA 3RZLA 4GB31 3WNMA 5FMDA 1G86A 2AC1A 3BI3A 4W50A 4IE7A 1BKZA 5FMOS 3TRSB 4CDXC 4F8AA 4MHRA 1ND3A 3WQ1A 2DVDA 4BK5A 4JKLA 4ET7A 2HWC3 1BVVA 4LKEA 3USUA 3MIHA 2EXKA 5F8PA 2Q8DA 2I07B 4AG4A 3ORJA 2PHFA 2YBKA 4QM9A 1C5IA 2JG9B 1EP0A 1CGPA 3O0VA 3T0DA 3S6PA 5FV3A 3ZXFA 3U07A 1UWWA 4QMAA 1DBNA 1A6CA 5BNOC 4OHZA 5J09A 2P3IA 4WVMA 1J1TA 1AXYA 2YPDA 4QXKA 5JZGC 1BXHA 1RB8G 2GC0A 5KHJA 2XBO3 2Y6LA 5HBAA 1DQ5A 1KEXA 3PIGA 1C1FA 2X09A 2XVLA 1XNCA 2VECA 1G8WA 1LESA 1XB9A 3GBGA 3I2FA 1LOAA 1N1VA 1UXXX 4GALA 1FOD2 3ELNA 3SKJE 5A3MA 2G1MA 3T2PA 3VKFC 4JX0A 4GQ7A 4AEKA 4AVAA 1YWKA 2J1SA 1YI9A 2NMNA 1J83A 3E1F1 2VUAA 3B01A 4CDXB 1WW5A 5IHRA 1I6XA 4BQ3A 1EAH3 3ZFEC 2BBVA 1O3TA 4HVOA 1F9KA 4AI8A 2P3JA 4EE2A 2XOMA 5IAXA 4MG2A 1AR82 3KHCA 4ASLA 3ATGA 4BPZA 1OUSA 4IETA 2ZGNA 4AHZA 4RQPA 4CXXA 2R043 3J8F2 3O1OA 2QE3A 2RS12 4GWJA 3IIAA 1Q8VA 1UZZA 2ZX2A 1OFSA 4JRLA 3ZSLA 4EJRA 3HJRA 5FPVA 4CCLA 2NMOA 4XURA 4Z1VA 1WMEA 2A6VA 3AM2A 2ZA9A 3OD0A 5FYVA 2LUWA 4BK4A 3BGAA 4YG6A 5JZGB 4JKMA 1PM4A 1F15A 3ZFFC 1FNZA 4CEWC 3CIHA 2WNEA 3WNKA 2VPVA 4CCNA 1SMVA 4XBNA 1VMHA 1XC6A 3KT7A 3VBFB 1PVC3 4XQDA 4CU8A 5CADA 1LOBA 2G9ZA 3JZVA 3LSEA 4LBMA 4MGSA 4LHLA 3RGBA 2MPFA 3POFA 4XJUA 4PHZA 2GP3A 1HXS1 3ZO0B 5JPNB 1V00A 2FCVA 5JXHA 2WNUC 1QEXA 4CSWA 2LRPA 4GWIA 5DXDA 3AP9A 5E6HA 2Q4SA 1DZTA 1LGNA 3MV11 2W1WA 2VW1A 4AHYA 2VNGA 4BU2A 3M3CA 4IE0A 5FZMA 5JXGA 3DV8A 3W5NA 4HKOA 4NO4A 4BQ2A 4EYUA 5L36A 4NPRA 4MOAA 2RMU1 4IGQA 4AI1A 3B7MA 2NM1A 1QJU3 1R1A2 2J1EA 2PLV1 2D3RA 1YIFA 2WNVC 2WUHA 1B09A 2DCJA 1UY0A 2D6PA 1EY2A 3IDBB 5T52A 3S7EA 2WWUA 3MFCA 2XPJA 1IG3A 2QTWB 3ZSKA 1W03A 4XPVA 4DXSA 1RXFA 3VD9A 3AP7A 3ZYBA 2DU1A 1X82A 2V5DA 4AHWA 4CCCA 1GQHA 3ZFFB 1TVGA 4CEWB 2AEZA 1XYNA 5F6LB 4Z07A 2WABA 2HWC2 4Q4X1 1IHMA 5F37A 1HRI3 2E51A 1HW5A 1QXJA 1H2LA 4AI3A 2JDYA 3FWEA 4HBNA 1VBD3 2GAUA 4UFMA 3RFRA 2CDOA 1DCSA 1XYOA 2NZ9A 1Q5OA 3ZXDA 4L2NA 4RS5A 4KNCA 1RUJ1 1JUIA 2ZEXA 3PUHA 1RUC1 2GC1A 3I2KA 4XFBA 2YMZA 1REEA 3IB3A 3KF3A 4IV1A 3NJVA 3IIIA 1GZWB 2JECA 4V2WA 4Q8LA 1WA4A 3I59A 1MEC3 5DG1A 3O1SA 5CEHA 2XBO2 2ZJCA 1PK6A 2WNVB 4WM7C 4ZXEA 5D8AA 3U11A 3VDAA 4YGDA 3NRUA 3T08A 5SV5A 2A6XA 5KC5A 1AYN3 4NN0A 2VTXA 1UCXA 2N7GA 1LU1A 4AEDA 5J1XA 3ROUA 5FXWA 2JDHA 1NQDA 2P2KA 2DTYA 4V1PA 3VL9A 1LOCA 3IZOA 2HJIA 1Y3TA 1Y43B 4CCOA 4QX7A 4YZ3A 1EAH2 4XBLA 1YJKA 4RGGA 5EHDA 1K12A 4BCUA 3NAPA 4GMP1 3WNXA 4I02A 4COWA 2CGNA 3WG3A 3AMQA 1UNBA 2WT0A 3K48A 2BWAA 3LSDA 1GICA 3NWKA 4Q0PA 1QIQA 5FP8A 3ZDVA 2ET7A 4D7TA 4IERA 2XB6C 1RUG1 1URXA 4K20A 3UV9A 4AI0A 5IFTA 4NPMA 2W95A 2YU2A 2VNVA 2R042 4RQPC 1RUI1 3DECA 4K21A 5FY7A 4XXPA 2ARAA 4RD7A 1J3QA 1KS4A 3OBAA 4K1YA 4O7XA 3SITA 1PVXA 1YLLA 1JU4A 3RYPA 4WVMB 4PLNA 4BQ1A 3N4MA 4IEQA 1UQXA 3U14A 4CDUC 1ULDA 2J1TA 2JDPA 2K0GA 4Y33A 4C91A 5C71A 5FZHA 4WM7B 5E88A 5LY1A 5CIRA 1A34A 1PVC2 4Q0QA 1RUH1 1FV3A 1X50A 4Q4V2 5IVCA 3BYWA 5JCTA 4YW6A 4MGYE 3M70A 4E8CA 2BZDA 2XDVA 3UL2A 2ENRA 2PHDA 3ACGA 2JDMA 2HLEA 2BGOA 2HEYF 3TB0A 3HNYM 4DRRA 2G19A 4A2UA 4ASKA 3C7OA 5CKMA 3CZJA 2VXRA 2WNOA 5GZDA 5JVVA 4C1WA 1XPWA 3QBQA 3AXDA 3GJAA 4MUVA 3FUOA 1SPPB 1OKOA 5JOWA 1QJU2 2WA3A 1E5RA 4I01A 3B3QE 4QHBA 5ABJA 1WKYA 2KXLA 2FZ2A 2UYBA 2Y64A 4RQPB 3AMNA 4SBVA 3I2DA 1RIRA 2VCCA 4C0HA 4XCBA 4QGNA 5LY2A 2BU9A 3PUIA 2VULA 3N35A 3UGGA 1VBE3 4AHXA 2XJVA 2I45A 3WVJA 4Y1YA 3WNPA 2PXJA 2XVKA 4LBJA 2YDEA 3HNBM 4ZU5A 3OUHA 5FMCA 3AVSA 4A7KA 4YVWA 3CF6E 4AR2A 3TN91 2OUHA 2CU5A 1QQP3 1HKDA 3RJ2X 3WX5A 1SQ4A 2BOJA 4DZGA 1E5HA 5FKBA 3LPFA 4HONA 4R4XA 3J4UH 2WWJA 4UW3A 1UPIA 5TSWA 2QJVA 1GFF2 5J37A 3T30A 1XNTA 2Y60A 1KD7A 2C5DA 4R9AA 1ZRIA 2HWD1 3KWVA 3SH5A 4AQTA 2MHFA 2J1UA 4YSFA 3PU3A 4IV1C 1UU5A 1QJEA 4ZKTB 3RZHA 3MPPG 3OD4A 5M0TA 1MEC2 3FC0A 3SEPA 1GKBA 4NROA 3WDUA 3TAYA 3R05A 4O9EA 5A7QA 4LHSA 3C7EA 5JXIA 1PK6C 3K4DA 3H8UA 1KFUL 3ITQA 4XYXA 5KBFA 4GJYA 2PHLA 2B42B 2R063 3GHNA 1ASJ1 3HT2A 4LBQD 4BISA 1VBC1 1SFNA 2Y0IA 3WF4A 3B9CA 3VBSA 4AEDC 3NNMA 4NAMA 4NWVA 1BZWA 4PBPA 3JCIA 2EIBA 2VH9A 2H0BA 3WP5A 2JDAA 4FTSA 1O8SA 4Q5OA 1GP4A 2XL7A 1JW6A 2VZQA 4Q4W1 4Y5TA 1CAUA 2VCAA 2WJSA 5HPOA 4OFGA 5LZ6A 1NA1A 3AK0A 4M01A 5DDJ1 2Z5WA 3HOBA 2Y38A 2BNNA 3C3VA 1COV3 1GNZA 2UURA 2VBBA 3NL1A 3WF0A 4EZ4A 1UOGA 2F4LA 1UYXA 2D43A 3GNEA 3N9OA 3PLQA 5GLZA 5J98B 1N3OA 4XAEA 4IV1B 4YRDA 4Y5Z0 3ALQA 4J6GA 1IQDC 2WSUA 1NCQA 3I59B 1NQJA 1E5IA 2SLIA 3BB6A 3W20A 4LKSA 2C9KA 2YC2A 3WG1A 1G9FA 1PK6B 1W6NA 1R093 4FPOB 4W65A 3NNLA 3PVBB 3SEEA 2IC1A 2XR4A 3URFA 3ZXEA 4FTEA 1GU3A 4QB2A 5A7WA 1JYVA 2EA7A 3I7DA 2DTWA 3MLJA 3NQHA 4RSUA 5D1IA 1UMIA 1ZX5A 4YZ4A 1WCDJ 5HCFA 3DUIA 4AEDB 1FMD3 1HN1A 3FJSA 3KMHA 3MIDA 4A3ZA 4FFIA 1XRUA 5CVRA 1BLZA 1G9AA 1QJX1 2E63A 3WDTA 3ZKYA 3N9QA 1MR5A 1VBA3 4P08A 5JIAA 4D3WA 4HLTA 5J3UA 5C3RA 2C24A 1GNHA 2VY0A 3BIEA 2ZKNA 4ZONA 4YW7A 1DGRN 4ARXA 5IATA 5FP9A 4PT6A 5DABA 4IEUA 1V9U3 5GLWA 3H7JA 4TLFA 4XFIA 5EFUA 4L92A 4XFAA 4EWEA 3MFAA 2NP0A 3KVAA 1PGW1 4XXAA 3ZN6A 5IVJA 4QDSA 1W2NA 4P14A 1BEV3 4KU7A 2ILMA 3VBRC 2VOXA 5LBFA 3MGUA 1LR5A 1QQP2 1SZBA 3POEA 2JENA 5IJRA 3HEIA 1PMIA 4AF9A 1OBNA 1RUD3 4NPLA 5FYZA 4FPHA 4EWAA 5C70A 4P9LA 4K8RB 2ZEWA 3MEPA 2D5FA 5FOJB 3HT1A 4V2VA 4M0HA 1H0BA 5DMYA 1Z7S3 3KS7A 4E4DX 3FBYA 2OA2A 3S0MA 4QKNA 1AR91 5A80A 3AZXA 3AKRA 3AMPA 4LNVA 4W4ZA 2A5ZA 3CJXA 2ZMKA 4LO6B 4E4HA 4XACA 2DBIA 2V09A 3KGLA 4UAPA 2WS91 1IOAA 2RHPA 2LM3A 4DPNA 3QCWA 2D5HA 3KCYA 4FOQA 5T5JA 5ABJB 2Z4FA 4XEZA 4P5HA 4QQOA 2R062 4OQ9A 4E2GA 4BJ0A 1Y9MA 2YHJA 2BGCA 1FX5A 1MZEA 1YQ5A 3MIFA 3VBSC 1U5ZA 1AL23 1D4M3 1JUHA 1LOEA 3K77A 3H8XA 1YNAA 3UKNA 1ENRA 3D8CA 2ZGUA 5D2AA 3KCXA 2XVGA 2QQVA 4H7MA 3PURA 3VBRB 4QB1A 5KXBA 1AR73 4OI1A 4YVWB 4DINB 1SBEA 5T5PA 4R9CA 1MS4A 4WV8A 4AXOA 1W8TA 5CA6A 5LA0A 2K9ZA 1DYOA 1C8NA 1FI2A 4FTBA 2CV6A 4QD2A 1H6YA 3ES4A 4PQ9A 4WZCA 3SCHA 1YI7A 2XQRA 3MW3A 4ORFA 1WBLA 4Y22A 4YGBA 1UL9A 3I8TA 1Q43A 2OVUA 2RDRA 5F5QA 1XE8A 2BYVE 3LWCA 3ME2A 2YV8A 3T0AA 5FTTC 3P6BA 3RMXA 3ZR6A 1OH4A 2A1XA 1AVBA 3NV3A 5DUXA 1HX6A 1C8M1 1NCQC 4GKYA 2X05A 4KH9A 1R1ZA 2WQ4A 3AZYA 1EPWA 1OSGA 1R092 4ZU7A 3A7QA 2AH2A 3A0NA 4Q0UA 3AMHA 5FPBA 4LO7A 3D0JA 1MZ5A 5BPXA 5I93A 4RA0A 2A6WA 2DDUA 2QQPA 2OX0A 4P02B 4R9DA 1FMD2 4XF0A 1ULCA 4AEJA 3VBSB 4BQ4A 5HCHA 5FYUA 1WUVA 2X29A 3L2YA 4MLOA 2B9UA 2RJKA 4G3YC 2PHWA 2WDBA 4HFSA 1H4HA 1YQ8A 3BKZA 3UESA 3JU9A 1CAUB 2FBEA 1H2MA 4OUSA 1NA1B 1W6OA 1JZ5A 2ADDA 1V9U2 3WEZA 1BBT3 2DCKA 4LORA 3J9SA 4IEYA 1AF9A 1W6MA 2OS2A 2WFPA 1QH6A 3JBG3 4FPFA 4IESA 4KG0A 4ATEA 2YUEA 3VZNA 3WY6A 5FR3A 2ZGPA 5HV0A 5BNQA 2GMPA 1JTZX 1BEV2 1IPKA 1BCXA 1NZCA 1KGYA 3D6EA 1NCQB 4FO9A 1GYKA 3KSCA 3CJIC 4Q27A 4LPLA 1WMDA 2OKXA 1LHNA 4TSVA 4CA9A 4XUOA 3T09A 5JAXA 5K7PA 1RUD2 4TZDA 2ZHNA 3DL3A 2XLFA 4M3CB 2PHXA 3AL5A 4Y1UA 4IXLA 3SNMA 5A7WB 2EVXA 2XHNA 2J42A 1DHKB 4OUMA 4ASMB 2ZBJA 3GZEA 2GMMA 3WCRA 1Z7S2 1FPN1 2DUQA 2F17A 3SKVA 3OG2A 1CZTA 5AC91 1NZIA 4AFAA 4BDVB 2Y6HA 4BLJA 1S0IA 5D21A 5FXXA 1DGWX 4NMIA 4X8NA 1RUG2 2QQWA 5IVEA 2OIIA 1DQ2A 2Q0AA 1X8MA 1TE1B 2W9XA 4A6SA 3ZVXA 4TYSA 4S2DA 3POJA 1OH3A 1GV9A 1ST8A 5T5LA 4QWNA 3H50A 3MIEA 3HBZA 4YM2A 3HAGA 5I0UA 4QPIA 3ZN6B 3F95A 1ZBE1 1AL22 2GN3A 4UW5A 4YFZA 2CWSA 2JD9A 1QY4A 2WAAA 4FFHA 4O65A 5FZAA 2W08A 3RZGA 3TYJA 2CY6A 3CJIB 1QJY1 3GM8A 4ISRA 4LBKA 4QU2A 5ERLA 2QNKA 5C3OA 3W9AA 4CDXA 4HZFA 4PJYA 2P4EA 2Z42A 1BYHA 4QKFA 4MZUA 2W92A 4QXHA 2PYTA 5F32A 3D82A 1JI6A 1K5MA 4GIQA 4M4PA 3VD4A 4LBLA 3GCWA 1PMHX 3B94A 3GGLA 4LK6A 4QM8A 2ZX1A 4LA2A 1I5PA 2J1VA 3K4ZA 4CDQC 1X8EA 5FZFA 4LIVA 1RC6A 2YY1A 4LLOA 5EYYA 3ZKUA 1GANA 1OLRA 5FZEA 4FOVA 1I9RA 1DQ4A 1JH5A 4AVSA 2XJRA
chains in the Genus database with same CATH topology
4WM8C 1S0CA 5BNOA 5FQ0A 4BMEA 1OQEA 1Y9QA 1ZRDA 2ZOEB 3KM5A 1X33A 1VIWB 5H9SA 3VBFA 4YG3A 4IV3C 1S0FA 3IM0A 2R16A 3E6BA 1AL0G 1WW6A 1LHUA 3O5SA 3QACA 5CA6A 2QVSB 2CYFA 1PNFA 2BVVA 2TEPA 2HWB3 3G7DA 1RTVA 4YYOA 3WW3A 2JG8C 3ZFEA 4FT8A 1BBT2 5FLIA 3ZSJA 3DPRC 2UY8A 3S7IA 1RHI3 2D6OX 3JBG2 4UXAA 4Y22B 3VBUC 1PZ9A 1AR83 2TUNA 2V73A 5GJ6A 4CDQB 3G6JB 2VOWA 3ZPYA 1S0GA 1RJ7A 4YZ5A 2UWBA 4H3WA 2ZGSA 5GZCA 5L7OC 1RUNA 2RS13 1VBD1 4JRAA 5BNPC 4XF3A 1VRH3 1POV1 4M3CE 4E27A 1O4YA 1MACA 2Y0OA 1MZ6A 3RJRA 1BMV2 4CEWA 5JDBA 1RITA 4DMIA 1OHFA 3KLSA 2WZR1 4IV3B 3UJOA 4WBBA 2OW4A 3CLPA 5AFBA 1UPSA 3APBA 3M8LA 2WNUA 5JR7B 1RMU1 3ZYIB 1PO11 4EN6B 2GH8A 1AYN1 2A75A 3DPRB 3BOPA 1YO8A 3NV4A 1RUF3 1W6MB 2LALA 4XIKA 5T50A 2DCYA 3ZDSA 1AJOA 1ZYBA 4BIFA 4HMZA 2BQPA 3M2MA 1OFNA 2NLRA 2GDFA 3WXPA 1JOJA 5BNPB 2D3SA 2RS31 3RRDA 1R081 3V56A 1S0BA 2GMEA 5FLJA 5FDBA 4YGCA 1K5MC 4BA6A 3RDIA 4MXVA 1SBDA 4XZPA 3RZZA 4F83A 4AFMA 4XIOA 2DVBA 3VGIA 1DQ6A 4XW3A 1AYM3 4I2OA 1N3PA 1LU2A 3FFQA 1AX2A 4URTA 4CRQA 3ILRA 5E8AA 5EWSA 1RVF1 1QMJA 2G4IA 5JLVA 4N90A 3M4FA 1CPNA 2VVDA 1GSLA 2ZGQA 1BQPA 3KB5A 4WM7A 3FFZA 1TMF1 4BMBA 4NVPA 2A70A 2RM21 2PTMA 4OI0A 4AVTA 1S2BA 5CFCC 5KWRA 2HWB2 2Q1ZB 1IS5A 2VOVA 2ET1A 5CB7A 1H4GA 3LZZA 1K5MB 1VBE1 1RHI2 1NXD1 5JOXA 5AVAA 5K9YA 2A6YA 5CU1A 3IBMA 4CP0A 1MS3A 1PIV1 4JDNA 4QQ2A 4GH4A 3WCSA 3E97A 1XU1A 2DCZA 2PHRA 3FLRA 5K8SA 5BNOB 1VRH2 2EALA 2HEWF 1ZZ6A 5ACA3 1QHDA 5FQ0B 4Q1RA 4CDUA 1HRV3 2DVAA 1MVEA 1XNBA 1LENA 3M3IA 3NJZA 1VAMA 5DG2A 4ZXKA 4Q4V3 1S55A 4RHV1 2R071 3WR0A 4LR4A 2XG3A 4YGEA 2RR11 5CFCB 3AYAA 4FPJA 3B00A 3M3QA 4AQSA 4HK8A 3ZFEB 4AWDA 1UAIA 2P17A 3LA3A 3OGJA 1RUF2 2CAVA 4AW7A 3R4DB 4H14A 4LO4B 1W2UA 2D6KA 3MW4A 2IXHA 2JXAA 2PAMA 3MLKA 3E5QA 4OI4A 1ULFA 5LK7B 1GR3A 3PNAA 1QOSA 5LEKA 1COV1 1VB4A 3TBDA 2GU9A 2P34A 3HIFA 4PF5A 3VZOA 1Z0HA 1ZZ7A 2ZGOA 4Q8KA 1S0DA 1ZZ8A 1OQDA 4AVVA 3OY8A 3B93A 2HWE3 2NN8A 1YJLA 2ZGKA 2ZZQA 5IK4A 4XMAA 3AJYA 2I74A 3THPA 3GYDA 3WT3A 1AYM2 2WNUB 2X5IA 3AP5A 1O3QA 1UZYA 1YCIA 3AP4A 1GBGA 1DGLA 4LBOA 2GC3A 3BALA 2GNBA 4N7UA 3WP3A 3AKSA 3RG0A 2ZMLA 3POYA 5DZGA 1DFQA 3VDDA 5E16A 5T3NA 1OKQA 3NVCA 2RS53 2UWCA 3BOWA 2ZGTA 1MS8A 1VBB1 1V6LA 3SLIA 1QNYA 3KD4A 3TWIA 2MEV1 1UW8A 4IEZA 4YM1A 1H1MA 4A7ZA 1DG6A 5I0RA 1CR7A 3C2UA 4XFFA 5KXCA 1MS0A 4HPKA 1VP6A 3OBRA 2JE9A 2W52A 4H7LA 2ZABA 4X6RB 3SH3A 1UX6A 3CNAA 4Q0VA 4DNYA 4C1XA 3ZXLA 1CQ9A 2ZHLA 2XLAA 4JQRA 3ST7A 2YYOA 1EV12 3AZVA 3T2TA 2FZ1A 1C3HA 3HN1A 2EF6A 4GA9A 4YFWA 4GH4C 3VZKA 2R49A 2R32A 5ACA2 1WCSA 1UN1A 3CU7A 1V6NA 1HRV2 4JV4A 4OULA 2JICA 2WFF3 1UKRA 1HV1A 2CL2A 4GB33 1SLBA 2YROA 1W6PA 1LGCA 2D40A 1B35A 1YFXA 2ARXA 1DZQA 2XWJB 1J3PA 1QWRA 4OHYA 1LEDA 3PHMA 4X6QB 4A7YA 1H9WA 1QDOA 3WZ1A 4L9BA 3ZXGA 2FHRA 1D4M1 4COZA 1RUE1 3NKTA 3RNSA 1AR71 1H2NA 4HN1A 4GH4B 4Q4Y1 1N1YA 1QF3A 2IXLA 3SMHA 2ZTNA 5FO7B 4CDUB 1PO21 3ZSMA 3VBRA 4SLIA 3B9IA 1N1TA 3HD8B 1UU4A 1C28A 2P3KA 2VW0A 3VZMA 1NCRA 1C4RA 1ZBA1 2H6CA 2HWE2 1TME1 3AMMA 5GLTA 3P3NA 3OTFA 3VBOA 4GWMA 4MGIE 1C5HA 1A3KA 2O8QA 1JHNA 1WD3A 1SFYA 2X5IC 1HQLA 1T6GC 2QFEA 5JMCA 1WW7A 3TNPB 3JD71 5BUVA 1U5XA 2ZCWA 3K51A 4JAAA 1KFXL 3ECQA 5JWPA 1IS3A 1H1IA 1UKGA 5IUQA 4XFHA 3VDDC 1MVQA 2HWF1 2TNFA 2EAAA 2RS52 2Q30A 1AZDA 2XUMA 1LB2A 1UD1A 2BFUL 3T1MA 4MV2A 1QKQA 2WLPA 1AXKA 5FPXA 1NG0A 4P9XA 3WOGA 2OZ6A 4JDOA 1G7YA 4PIZA 3R4SA 2AR6A 5JOZA 3DGTA 4PDWC 3RMYA 1KJRA 2PHUA 4HT1T 1NY71 4F7ZA 2NYYA 3OY8B 4L11A 4S2FA 2OYZA 1D0HA 5FFOC 5HCAA 4P9GA 2I2SA 2H6BA 2A3XA 4M0NA 3IN9A 3VUOA 2X5IB 1DQ0A 4META 4N9IA 2R1BA 1VAVA 3SHRA 3Q9OA 3POWA 2RMU3 1IQAA 2VNOA 4Y1XA 1S1AA 2PLV3 1PGL1 5FPZA 2ARBA 3VDDB 1GZ9A 1ZVFA 2IXJA 1JYCA 2E7TA 4LO8A 3UKVA 2WFF2 1AR61 3N7KA 2LTNA 2UWAA 4M3CA 5B2GB 1I3HA 4MGKE 4GB32 1OA4A 4EN7B 2ZHKA 3ZIXA 3E5XA 5CG9A 1B35C 2DVGA 1A8MA 1LHOA 2O8OA 4HPKB 4E2QA 1PGSA 4J1WA 4PDWB 4Q4X3 4QX5A 5FRAA 3H3UA 1AUYA 4QT6A 2IZWA 4YNIA 5FMOL 3IPVA 1RUJ3 4JGZC 2HEVF 3EO6A 1CD3G 1CN1A 1X36A 1RUC3 3OGGA 3BU7A 3HWJA 1BVP1 4LLFA 4F3JA 4COUA 2GZWA 2ZAAA 1DGWA 1HQNA 2XLGA 1WBFA 3CJIA 4R52A 3ZYGA 5BY5A 4LT5A 1XYPA 3VBHA 5JSOA 4WVWA 4BLIA 4AFBA 1NCRC 3A0KA 4K3UA 1CESA 2XJPA 1ZZBA 4YVSC 1HIXA 3VBOC 4KWKA 1W6PB 3CEWA 1B35B 5H9QA 3UKTA 1CAWB 3B02A 1F5FA 4GMP3 4U2AA 1NLRA 3GF6A 2ZACA 2GNDA 3WLUA 3FMGA 1Q8PA 1CPMA 3KZ4C 3EHKA 4CEYA 1OOPC 4Y1ZA 1RUG3 1FOD1 4XILA 1OI6A 1RJ8A 4AE2A 1ZREA 2E6VA 1RUI3 2D3PA 1FNYA 1IKQA 4QGLA 2R6QA 3D0SA 3V65A 4UW6A 3RPQA 1ZRRA 2ZGRA 1AR81 4FPGA 4BH9A 1MQTC 5GZEA 2DFBA 1UIKA 2W68A 3N7JA 3ENRA 5I8YA 2ZS6B 3MIGA 1RUH3 1NCRB 5CAZA 3AJZA 3J8F1 4B29A 1HXS2 4YVSB 2WKKA 5FAXA 3PMEA 4B4PA 3VBOB 3LAGA 4FPYA 4CDQA 4R9BA 5BNNA 1DYPA 2P37A 2RMU2 4IQPA 1OOPB 2MNGA 2PLV2 3D4KA 4WM8A 5T55A 4HN0A 2UU8A 2IXCA 1YXWA 3MDPA 4COVA 1J58A 2ERFA 3FZ3A 1G9CA 3SISA 3I54A 2JX9A 1PNGA 1XE7A 3GALA 1ENXA 1H1AA 4IV3A 3WW4A 4L8QA 1MQTB 5FREA 1ZNPA 4Q4X2 3T1LA 1R1A1 1AXZA 5KC6A 4W6WA 2JG8A 1SLTA 1RUJ2 3PMSA 5IT6A 2C1FA 3DPRA 2Q5TA 3IKWA 2R0HA 2ZGMA 1RUC2 1XNDA 3VBUA 5FLHA 1H8TA 1NE4A 2KA3A 4IEXA 2HWD3 1N1SA 1YFWA 4K40A 4RGAA 3VKNA 5A32B 1YIPA 4KWLA 1AJKA 2HWC1 2SBAA 4WVZA 5L7OA 3BPZA 5BNPA 2VG9A 1SBFA 2E7AA 2W39A 2ZZJA 1JXNA 4DRVA 1REFA 4N43C 3VBHC 2MEV2 4AYUA 1EPZA 1ASJ3 1CJDA 1VBC3 3E5UA 4JGYA 3AYDA 2CTVA 1G9DA 3WUDA 3VLBB 1S0JA 5DZEA 4E2SA 4Q4W3 2R0FA 2XBO1 3HQXA 1HLCA 4CP2A 3ILFA 5DDJ3 4ATFA 4CEYC 1W0PA 4K8FA 4M00A 4MX3A 3IPVB 5JIUA 3QH6A 1RUI2 1CAVB 1LEMA 3IMNA 4GXLA 4KGGA 1V6MA 4HETA 3OCPA 4JC1A 3AKPA 2DV9A 4BE3A 2ETEA 3VKMA 2Z2SB 2R30A 1EAH1 1WMFA 2A3WA 2QDRA 5FOBB 2G9GA 4C90A 3RS6A 4FSJA 3PVOA 3VZJA 3TOJA 1RUOA 1RUH2 4N43B 3VBHB 2EXJA 2R041 3LOIA 1ND2C 3ZYPA 3U4XA 4XOGA 4N53A 1F5JA 4YLZA 2DUOA 4XTPA 1QJX3 1E57A 5IK8A 1KDKA 3V0AA 4Y24A 5BNNC 2XH6A 2AYHA 2V5YA 3H7YA 1PVC1 4FQZA 4CEYB 4AFDA 2QCSB 2QDNA 4Y26A 4UBHA 3VHRA 4XJZA 1PM7A 4FPLA 2FQPA 1S0EA 2XJUA 1GQGA 4OVEA 3HMYA 1FT9A 1ULEA 3AB0A 4Y20B 3AZZA 3TN92 4ES8A 1MS5A 3AXEA 1QJU1 4YW1A 3RI9A 2ZX0A 5CFCA 1RINA 1LKNA 2PFWA 1ND2B 4EWDA 1OMIA 3L9JT 2XHKA 2BTVC 1W6QA 3WW2A 4XE9A 2HWD2 1AR93 1H8TC 3PJYA 3H1YA 3THTA 5BNNB 4XMIA 3SCFA 4NR1A 1U5IA 4B4RA 3MLLA 4XFCA 1Q8QA 1HRI1 2CAUA 4OLLA 2WS93 4WM8B 1AX0A 5EV7A 4CZSA 1QOTA 1CAXA 1QU0A 3AP6A 3N7LA 1YUDA 5GLUA 1ASJ2 3VL8A 2XL9A 1VBC2 1Y7BA 4JTNA 4JGYC 3LB9A 1FATA 3O0WA 4XHBA 4XETA 2VMIA 2QZ3A 3ZN4A 4MSVA 4OI2A 4Q4W2 1QXPA 1MEC1 3GHMA 3WINE 3NV1A 4DFSA 2BEOA 3MIBA 2DCTA 3ES1A 3KGZA 1L3JA 1C1LA 1F31A 3AFGA 5DDJ2 1O7FA 2ZX4A 5IK5A 1LCLA 2JD4A 2VMGA 4NHMA 2JG8B 4CTEA 1V6JA 5EJ3A 1PZ8A 4HK9A 3VBUB 1H8TB 3BTAA 4AGGA 2A7AA 2UY9A 3CO2A 1ULGA 1WD4A 1NXMA 1PZ7A 1YYNA 4M3CF 3ZMOA 3NW4A 1C8M3 1Q8SA 4UBGA 4S2HA 4LE4A 5L7OB 4AVBA 1CX4A 1QNWA 1D4VB 2E9QA 2VOKA 3SCGA 1O91A 1IKPA 1LODA 4WZFA 4FCAA 4JVAA 4JGYB 5K0UC 4N53C 1QJX2 4B7KA 3FLTA 1FXZA 1LRHA 2F6BA 1J3RA 2A73B 4E4SA 2ZGLA 3OYWA 1YHFA 1OQ1A 2JJ6A 4IEWA 2D44A 3QD6A 2VQAA 4B8EA 2DWRA 3DF0A 1PGW2 3AYCA 4KWJA 4OZXA 2BNOA 4QPYA 5H9RA 3NSTA 1CJPA 4FPKA 1VB2A 3WQ7A 2TBVA 3GBFA 4LTAA 4AGVA 4I0WB 4BWOA 5HCBA 2PHTA 2XWBB 2IFRA 1FPN3 5K0UB 2Z79A 4KU8A 4N53B 2G9FA 2EXHA 1AR92 3RQ0A 4AQ6A 4ISQA 5E89A 5AC93 3V0AB 2IWGB 4I0BA 2X8KA 4I3PA 3UK9A 1OLQA 1EV13 4O9GA 1QQP1 1QOOA 1YRZA 2WS92 2OUJA 1QH7A 4LHNA 4ZU4A 4Q0SA 1HQWA 1XXNA 3WDWA 4X8PA 3DN7A 3V64A 1DDLA 1O4TA 1XQNA 5LEJA 4Z8BA 1JN2P 2CGPA 3I4IA 5EZWA 4CDWA 5BV6A 1A8DA 3OF1A 1ZBE3 4NWWA 5I8TA 2VNRA 2QKDA 1LHVA 3ZMNA 4I3GA 3JB8A 1QJY3 5KHHA 4OHWA 3L2HA 1SLLA 4ONUA 4PLOA 5CFDC 2AGSA 1IGOA 1Q8OA 5BXXA 1LULA 3ZX7A 3EJKA 4KBBA 2R061 2D6LX 2RJLA 3IWZA 1W6QB 3D5OA 2ZKLA 3FBMA 1IZ3A 3INAA 3ILNA 2WC2A 1Q56A 4XJ9A 1C8M2 3FUQA 4P9IA 4Q26A 4IEPA 3ZSEA 1VR3A 4E9KA 4LBNA 2FMDA 4L99A 3WQ0A 1CAXB 3RWNA 2YGMA 5C4WC 4MVTA 3EBRA 3OPZA 2B5HA 2B7YA 4Y4YA 4YZ2A 1MS1A 4D69A 5LRSA 5KXDA 4LULA 5CFDB 4IL7A 2WWSA 4FAHA 4MXWB 3QH7A 3USSA 1LOFA 2R1DA 1R091 2A71A 5A33A 5HI0A 1MS9A 2B46X 5AVPA 4BZ4A 1UMZA 3GZUC 3AKTA 1XU2A 4QQHA 5J36A 1FMD1 4Y1VA 1J1LA 1ND3C 3WP4A 3ACLA 3U10A 1VBA1 4YW2A 2DUPA 4FPCA 4ITCA 4OHXA 4FVVA 1CVNA 1VALA 1F2NA 4HKLA 1O3RA 1U12A 1POV3 1V9U1 5J48A 5C4WB 4EV0A 4DOUA 4LEJA 4AGRA 1J59A 5DZFA 4K9SA 1D2QA 4PDWA 4Q1PA 4YZ1A 1FPN2 1WLWA 2WZR3 4JCKA 3NO8A 4I30A 4D7SA 5AC92 5IK7A 1BEV1 3ZFGA 2GALA 1KS5A 1RMU3 3NAPC 1PO13 2IXIA 2B45X 3OYWB 4HVRA 2VQ0A 4XJ8A 4HSJA 1RUD1 1W39A 2AZ5A 3EXUA 1KDMA 2GH2A 2BW8A 5J7MA 1CIWA 1ZM1A 1HV0A 1Z7S1 1LTEA 2C0ZA 4DXZA 1ND3B 1ENQA 1ZBE2 4CDWC 2YGLA 3P3PA 3R0RA 2PN5A 5C8CA 3USUB 5CNAA 2BVBA 3IT8A 3M1HA 1QJY2 4GMP0 2RS33 1SCRA 1R083 5KHIA 3AFKA 2WL1A 4XF1A 2NQYA 1D0GA 1CAWA 1V6OA 3LA7A 4LO5B 5JSRA 1DLLA 1G9BA 1WLDA 2DURA 4I0AA 1AL21 3N36A 4JGZA 4AK3A 2QZ2A 1C57A 3NAPB 2AREA 4FOWA 4UW4A 5JI7A 4W6XA 1RVF3 4K6BA 4HL0A 3PVNA 1M06G 4XFGA 1O5UA 5H9PA 1ALYA 4CDWB 1TMF3 4LUMA 2RM23 3OBTA 5LRRA 4YVSA 1Z78A 4XQWA 4KQ7A 4PIYA 5F9TA 2ZHMA 4PIXA 5C6CA 5A3LA 1LOFC 2WIIB 1D2SA 4GWNA 3WD5A 1X7NA 3MF6A 2Q8OA 4XJWA 4AQ2A 1N3QA 4RFT0 2DVFA 4W6YA 3OJBA 3ETQA 1OOPA 1W0OA 4U36A 5EYXA 4HSLA 2HYKA 4AVCA 3POSA 2JEMA 4BHPA 1PIV3 1HRI2 3QLQA 4BIOA 4EN8B 2NPIA 3SH4A 4FPEA 1NLSA 4FQ4A 1VBD2 1SLCA 3ZXJA 4LBQA 1KRIA 1VAKA 4RS5C 2VGDA 3VHOA 3ZIWA 1BBT1 1O3SA 3M3EA 4YM0A 4I09A 1U0AA 1TNFA 2VW2A 3JBG1 5L73A 1MQTA 3RYRA 4COYA 3PVEA 2JKBA 3O0XA 2YC0A 1DU3D 1RL3A 2WZR2 2BNMA 1N47A 1DF0A 4RHV3 2R073 1HXS3 3ZFGC 1RMU2 2RR13 1PO12 4HVQA 5D8AC 2XKPA 1AYN2 2DU0A 5A33B 2WQZC 1TQ5A 1KITA 2ZAHA 4PLMA 4Q2FA 1BMV1 3WW1A 2XGXA 5A32A 2WSVA 3H1WA 5DUWA 4LE3A 1GLHA 1IS4A 1ZZCA 5JSPA 1REDA 3H3ZA 3QOPA 4G9SB 1H9PA 1SEFA 5C8CC 1AHSA 2VMHA 2RS32 1R082 2OZJA 4RS5B 3WV6A 1ONAA 2D93A 4GULA 4LUKA 3MI8A 1WLCA 4WVVA 2GC2A 4D7YA 4YW3A 1TNRA 4FP2A 4N7IA 2RE9A 5C9AA 1FAYA 2BUKA 3R6SA 3ZFGB 4G4FA 4LHKA 1CAVA 4PCRA 5D8AB 1JYIA 5J96B 4MH0E 2F4PA 4FXKB 3MPBA 1RVF2 1AX1A 2WA4A 3ASIA 5JI9A 3GZTB 2X53S 4LA3A 1OD5A 1LJ7A 5I91A 4J1XA 4NOTA 4P9WA 3VV1A 1TMF2 3M3OA 1V6KA 4BOWA 4N43A 1VBB3 2RM22 4H55A 2MEV3 5C8CB 1LHWA 3JB4C 4JDMA 1XNKA 4TWTA 3VHPA 2WINB 4Q29A 5ABJC 1V6IA 3RI8A 1QXRA 2H0VA 2ATFA 1U5YA 3VKOA 2WT1A 3FX3A 4XF9A 3W59A 4EN9B 3ZXKA 1VBE2 4RR3A 4FBFA 2BWCA 1SCSA 2CNAA 2DF7A 5AFEA 1ZRCA 5JPMB 4YG0A 1H8VA 1PIV2 4JGZB 4YVWC 5LK5A 1DZRA 5I8SA 5C33A 3MYXA 4KGQA 3BIWE 3HR9A 2HWB1 3VN4A 3MF9A 3WDYA 4YARA 1IS6A 4Y20A 3SXWA 1RHI1 1APNA 1CONA 3GBWA 3FLPA 2EIGA 2O0OA 3FHIB 3BODA 2IXKA 5FCCA 3B5LB 2Q1MA 3RSJA 4S2GA 3UJQA 1YFUA 5EXOA 4EROA 4RHV2 1ND2A 4QGMA 2R072 4RL7A 4A3XA 2RS11 2RR12 3ZYRA 2PELA 1QJZA 2D98A 3FE5A 3V0BA 1VRH1 3H1MA 4AI2A 4R4ZA 1Q3EA 4QPGA 4N9HA 2ZPXA 1UIJA 1RUE3 2EAKA 3RYKA 2KM2A 3LOBA 5FO8B 1NA1C 1DIWA 4DY3A 4Q4Y3 4YW4A 3ZXAC 4B4QA 3CL1A 1WLTA 4GKXA 1COV2 4LBQB 2B39A 3O12A 1V70A 5DUVA 2WLQA 1PO23 4XBQA 3X29B 1RUF1 3W58A 2CWMA 5GALA 5DUUA 1OPMA 2O1QA 1H30A 4KG8A 3TN93 3WHUA 5T5OA 4DS0A 4OHVA 5GZGA 1EYBA 1ZBA3 4NHKA 3R4UA 1TME3 5C9AC 3E6DA 2YPJA 4QQLA 2QUOA 4DB5A 4C0BA 1O5LA 5FBZA 2PAEA 3KT1A 4MGZE 4AEMA 3S30A 4NHLA 1ZRFA 1O4ZA 4CP1A 3KT4A 2YXSA 1DYKA 2XJTA 3JD73 4XTMA 1I5ZA 4K1ZA 5BYNA 2ZMNA 3JQXA 3LGRA 1SDWA 4YW5A 4QQPA 2E53A 1VBA2 2HWF3 2D7FA 4L97A 4D94A 1VBB2 1LOGA 5L19A 3H9AA 4MYEA 1AYM1 4CYDA 1MZFA 4XHXA 1BJQA 1M4WA 4Z92B 1H2KA 1NE6A 3VKLA 2GNMA 1QDCA 4RR3C 2GSYA 1VJ2A 4XF4A 2D6NA 4FOYA 1A78A 3WG2A 1NYWA 5C9AB 2DYCA 1W6NB 1HDKA 3JUUA 3IDEA 4IEVA 1OPOA 3AZWA 5HXVA 4AFCA 4XJAA 3WUCA 3LKJA 1PHMA 3DKWA 1BK1A 1SLAA 2IFWA 2JG9A 4DQAA 2XKOA 1AR63 1DGRA 2GNTA 3ZYJB 1EV11 3WDVA 5KXEA 3MZHA 1RGSA 3WP6A 1KJLA 2C9AA 3J26N 5K0UA 1G6NA 3ZN5A 5ACA1 5CBLA 1UU6A 3N7MA 3EQEA 3O14A 1HRV1 4P9YA 4QPGC 3VHNA 4RR3B 4INDA 5I0TA 1D4M2 3M7AA 4HANA 1RUE2 5FO9B 1YFYA 4KL1A 2CGOA 3E6CC 2PA7A 1JBCA 3O7OA 4BM8A 4FXGB 2WT2A 1AR72 4Q4V1 3WHTA 3B69A 3MICA 2BPA2 2K2SA 4Q4Y2 5E1RA 2UYAA 4XDQA 4FP3A 1LGBA 4JTOA 3AKQA 1DQ1A 1PO22 2VVFA 5GZFA 1F8VA 4HKWA 4B3NA 2Z69A 3AX4A 1WCKA 1KXGA 3H0OA 1ZBA2 1TME2 1LECA 2W0XA 2D6MA 3KCCA 3LA2A 1WGPA 2PQQA 3V0BB 5JZGA 2VU9A 4IEOA 5F1RA 3JD72 4QPGB 1IPJA 4FAGA 2XJSA 4Z82A 5C8WA 4P9JA 2ZX3A 5T54A 1FOD3 4ES9A 2HWF2 3WDXA 1ENSA 2AENA 2HWE1 1KQRA 2YZ4A 3IDCB 1ZA4A 2XJQA 3AYEA 2B8MA 1UF2C 2AUYA 1OA2A 2BFUS 3LCPA 1VLNA 5CFDA 1QGLA 2JDZA 3PTYA 4MXWA 4EN0A 1WW4A 1NY72 3TNQA 2RS51 3J8F3 5SV8A 1NOVA 3KQRA 3GZAA 1GZCA 2A6ZA 3WG4A 4Z2WA 2HKXA 1FYUA 2GN7A 1ZZ9A 3VZLA 3ZFFA 1OA3A 2DFCA 1SACA 1S2KA 1POV0 5JOYA 5KHGA 4R8HA 1PGL2 2E7QA 3MW2A 3NV2A 3BCWA 2WZPP 2VUJA 1AR62 2ES3A 2JG9C 1TEIA 5C4WA 1SLIA 5F6KA 3N3HA 1W6OB 2EXIA 5CG8A 4PBOA 2FMYA 3A4UA 1FV2A 1GZWA 2A3YA 2PAKA 5GM0A 2D97A 1I1EA 2JE7A 3PJQA 4XQ4A 2WNVA 4YM3A 1R1A3 2Y26A 3NKGA 2VVEA 5GKAC 4DY5A 3JQWA 4QPIC 5I0SA 4B7EA 4BYYA 4K7JA 2WFF1 2OPKA 4GB31 1G86A 4F8AA 3TRSB 1BKZA 5FMOS 4CDXC 1ND3A 3WQ1A 2DVDA 2HWC3 1BVVA 3USUA 3MIHA 2EXKA 4AG4A 2I07B 2PHFA 4QM9A 1C5IA 2JG9B 1EP0A 1CGPA 3O0VA 3S6PA 3ZXFA 3U07A 4QMAA 1DBNA 1A6CA 5BNOC 4OHZA 5J09A 2P3IA 4WVMA 1J1TA 1AXYA 4QXKA 5JZGC 1BXHA 1RB8G 2GC0A 5KHJA 2XBO3 5HBAA 1DQ5A 1C1FA 3NAPA 2XVLA 1XNCA 2VECA 1G8WA 1LESA 3GBGA 4QPIB 3VBFC 1LOAA 1N1VA 4GALA 4E4ZA 1FOD2 3ELNA 5A3MA 3VKFC 4GQ7A 4AEKA 4AVAA 1YWKA 1YI9A 2NMNA 4CDXB 2VUAA 3B01A 1WW5A 1I6XA 1EAH3 3ZFEC 2BBVA 1O3TA 4HVOA 1F9KA 4AI8A 2P3JA 1AR82 4ASLA 3ATGA 4BPZA 4IETA 2ZGNA 4AHZA 4RQPA 2R043 3J8F2 2QE3A 2RS12 3IIAA 1Q8VA 1UZZA 2ZX2A 1OFSA 4JRLA 3ZSLA 4EJRA 4Z1VA 2NMOA 1WMEA 2A6VA 3AM2A 2ZA9A 3OD0A 2LUWA 4YG6A 5JZGB 3ZFFC 1FNZA 4CEWC 2WNEA 2VPVA 1SMVA 4XBNA 3KT7A 3VBFB 1PVC3 4XQDA 5CADA 1LOBA 3JZVA 3LSEA 4LBMA 4LHLA 2MPFA 4XJUA 1HXS1 3ZO0B 5JPNB 1V00A 2WNUC 5DXDA 3AP9A 2Q4SA 1DZTA 1LGNA 2VW1A 4AHYA 2VNGA 3M3CA 3DV8A 4HKOA 4NO4A 5L36A 4NPRA 2RMU1 4AI1A 3B7MA 2NM1A 1QJU3 1R1A2 2PLV1 2D3RA 1YIFA 2WNVC 5GLVA 1B09A 2DCJA 2D6PA 3IDBB 1EY2A 3S7EA 5T52A 3MFCA 2XPJA 3ZSKA 4XPVA 3AP7A 2DU1A 1X82A 4AHWA 1GQHA 3ZFFB 4CEWB 1XYNA 5F6LB 4Z07A 2HWC2 4Q4X1 1IHMA 1HRI3