1AYM3

Human rhinovirus 16 coat protein at high resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
238
structure length
238
Chain Sequence
GLPVYVTPGSGQFMTTDDMQSPCALPWYHPTKEIFIPGEVKNLIEMCQVDTLIPINSTQSNIGNVSMYTVTLSPQTKLAEEIFAIKVDIASHPLATTLIGEIASYFTHWTGSLRFSFMFCGTANTTLKVLLAYTPPGIGKPRSRKEAMLGTHVVWDVGLQSTVSLVVPWISASQYRFTTPDTYSSAGYITCWYQTNFVVPPNTPNTAEMLCFVSGCKDFCLRMARDTDLHKQTGPITQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The refined structure of human rhinovirus 16 at 2.15 A resolution: implications for the viral life cycle.
pubmed doi rcsb
source organism Human rhinovirus sp.
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 16 COAT PROTEIN
total genus 40
structure length 238
sequence length 238
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1aym300
2HWF1 4YVWC 5AC92 1QQP2 4CDWA 4CDUA 1MEC3 1ASJ2 4CDWB 4CEWB 4WM8C 1RUI1 1ASJ1 2RS53 1PIV3 2R063 1B35C 3JBG2 5CFCA 4NWWA 4Q4W2 5BNNA 4IV3B 5ACA1 1PGW1 1RUG1 5BNPC 4GB31 1H8TB 5AC93 3VBRC 1PGW2 1HRV2 1Z7S1 4N53B 1PO23 1R093 3DPRC 1FPN3 1F8VA 2WZR3 3NAPA 3NAPB 1AYN2 2GH8A 1RUH2 1NG0A 1NCQA 1ND2C 1RHI1 2HWE2 3ZFFB 1HRV3 1RUE1 3LOBA 4CDWC 1PO22 1R092 4SBVA 4GMP1 4CDXA 2WZR2 2WS92 2R073 3J8F3 1COV1 2RR11 1RVF2 4JGZB 1HRI3 2RS32 5K0UC 1RB8G 4JGYC 4Q4W1 1VRH3 4CEWA 1FMD3 3ZFFA 1HXS1 4LLFA 2BFUS 1D4M1 2RS12 5ABJB 4RHV1 3VBHB 5JZGA 1QJX3 1A6CA 4Q4X2 1OOPA 1AR61 4YVSA 2HWD1 1AL0G 5DDJ3 4Q4V2 4YVWB 1VRH2 4QPGB 1RUI2 5CFDB 3JB4C 4Q4Y2 2RM22 4RQPA 4CDUC 2BFUL 2XPJA 4IV3A 1BBT2 1HRV1 1K5MB 2WLPA 1VBB3 2FZ1A 2FZ2A 1RUG2 1OOPB 1VBD1 1H8TA 1NCQC 2WFF3 3VBOA 1ZBE3 1CD3G 1D4M3 1F2NA 4Q4Y3 1QJU1 3TN92 3NAPC 1X36A 1ZBA3 4RQPB 5C4WB 1SMVA 3JD71 2HWE1 1AR93 5K0UB 1BMV1 1QJY1 1RMU2 4JGZC 3VBRA 5A33B 2X5IB 1RUC1 1RUC3 5A33A 3VBRB 5D8AC 1RUH1 2QQPA 2HWB1 1AYN1 1RMU1 4IV1C 3VBSC 1RVF1 4AEDA 1QJZA 5FMOL 3ZFGC 1TMF3 1V9U2 2PLV3 5FMOS 5BNNC 2WFF1 4Y4YA 5CFCB 2HWC2 1BEV3 1RVF3 1B35A 2HWF3 1RMU3 5CFCC 1EAH2 2PLV1 5FOJB 1TMF1 4IV1B 2X5IC 3VBSB 3M8LA 2R041 1AYN3 4RQPC 2HWB3 1RUF2 1R082 1QJU3 1RUH3 4Q4Y1 2MEV2 4IV3C 1AR63 2HWE3 1RUD2 3JD73 2HWD2 1B35B 5A32A 2MEV1 4Q4V3 1NCQB 5ACA2 4RHV3 5LK7B 1RUI3 4WM7A 3VDDA 4CEYC 1TME3 2Y26A 1MEC1 1NA1C 1K5MC 3J8F2 5J96B 4RS5B 1HXS2 1VRH1 5D8AA 4WM7C 1VBB2 1VBD3 1ND3B 5DDJ1 1RUD3 3JD72 4CDUB 1HRI1 4YVSB 4QPIC 3VDDC 2HWC1 4CEYA 5BNOA 1C8M3 1MEC2 4WM7B 4RS5C 1HXS3 1NCRB 1TME1 1RUE3 2R062 5ABJC 3CJIB 1VBD2 1AR73 1AR92 5C8CC 3CJIC 5DDJ2 1MQTA 1C8NA 4CDXC 3VBUB 2RMU2 1AL21 2RR13 4RFT0 1VBA2 1GFF2 1OPOA 1FMD1 1PVC2 2R071 1VB4A 5BNOC 4RR3C 2PLV2 3DPRA 1BEV2 1RUG3 2BBVA 1ND3A 1AR82 2WWSA 3HAGA 3VBFB 1NA1B 1COV3 1QQP3 1D4M2 4AEDB 1ND2B 1RUJ3 1NOVA 1BEV1 1PIV1 1PGL1 4CEYB 3ZFFC 1R1A2 5L7OB 3VBFC 2R072 1PIV2 2RM21 4Q4W3 4GMP0 1Z7S3 2VQ0A 3DPRB 5AC91 4RR3B 3ZFEB 4Q4X1 1HX6A 1VBE1 1QJY3 3ZFEC 5BNPB 3JBG1 1X33A 4PDWA 3VBUA 3J8F1 1FPN2 1TME2 2R061 5C4WC 1H8TC 3VBUC 1ZBA1 4CDXB 1FOD2 1VBE2 2RMU1 4CDQC 1NY71 4N43C 1ZBE1 2HWF2 4GB32 1NCRC 4AEDC 2RS31 4WM8B 1QJY2 3IDEA 1OOPC 3ZFGB 1NY72 3VBFA 1VBB1 1FOD1 3VDDB 2WS93 2WS91 4YVSC 4GH4B 5L7OA 5D8AB 1BBT3 1AR81 1RUE2 1ND3C 1HQNA 4Z92B 5CFDC 1HRI2 2RS33 2XBO3 1M06G 2HWD3 1E57A 3VBOC 1AR91 4RR3A 2IZWA 4EJRA 5J98B 2RMU3 1FMD2 1PVC1 3JB8A 1QJX1 2DF7A 4WM8A 1ASJ3 1VBA1 2RS51 4CDQA 5C8CB 3VBHC 5C9AC 1AYM3 4CDQB 5C8CA 1PVC3 2RS13 4GH4A 1PGL2 1AUYA 3JBG3 2X5IA 4PDWC 2XBO2 3ZFEA 5C9AA 1EAH1 4BCUA 1ND2A 1AR83 1EV11 1VBC1 1R081 1COV2 4FSJA 1C8M2 2R042 2RM23 1PO12 2BUKA 1AYM2 1R1A3 1V9U3 1AL22 5JZGC 2ZZQA 5L7OC 1QQP1 4Y5Z0 1AR72 1EV12 1VBC2 3ZXAC 5BNNB 4NWVA 5BNPA 4N43B 1RHI3 3ZFGA 1MQTB 1NA1A 1RUF1 1DDLA 2ZTNA 4IV1A 3VBSA 1PO13 1V9U1 4QPGA 3TN93 1ZBA2 1POV0 1AL23 1FPN1 4JGYA 2TBVA 1VBE3 3TN91 1R083 1QJU2 1IHMA 5C4WA 1RUC2 3S6PA 1RHI2 4FTEA 4N43A 3FBMA 5ACA3 1RUJ2 1MQTC 1TMF2 4GMP3 1RUJ1 3CJIA 4RS5A 3VBHA 5JZGB 1C8M1 2HWC3 1Z7S2 1QJX2 1BMV2 5GKAC 1EAH3 5BNOB 5A32B 1BBT1 5CFDA 1W39A 1OHFA 4N53C 4QPIA 4QPGC 2WZR1 4PDWB 1K5MA 2RS11 1PO21 1POV3 1FOD3 1R091 1PO11 2HWB2 1RUF3 2MEV3 4Q4V1 4GB33 5C9AB 4JGZA 1CJDA 2ZAHA 1AR62 1AR71 1VAKA 4YVWA 3VBOB 4N53A 4RHV2 2WFF2 1ZBE2 4CEWC 4FTBA 4FTSA 2R043 1AYM1 2RR12 1VBA3 1R1A1 4JGYB 1POV1 1NCRA 2BPA2 2RS52 4QPIB 5K0UA 5ABJA 4GH4C 2GSYA 1RUD1 4Q4X3 1EV13 1VBC3 1VB2A 1WCDJ 2XBO1
chains in the Genus database with same CATH superfamily
2A3WA 3ZXJA 4YVWC 2JD4A 2VAUA 2ATFA 4CDWA 2PHXA 1CAXA 2ZKNA 4WVWA 1ASJ2 2WAAA 2N7GA 2PAKA 3OTFA 4JRLA 3AKSA 3N4MA 4QHOA 3OBTA 2KA3A 4WM8C 1S2KA 4COUA 4R4XA 2V73A 1ASJ1 2R063 1DQ1A 3JBG2 3N7KA 4AFAA 2G19A 1GP4A 4GA9A 2LROA 5A6QA 2W39A 4QMAA 3WCSA 4D3WA 5L9BA 3MBWA 5G04L 5F39A 4L97A 2NN8A 2JIJA 1OLRA 3LEMA 5T5LA 2VZTA 2Q8OA 3ROUA 1XU1A 3M7AA 3OBAA 4S2FA 3ZYPA 2JKXA 2ZGRA 3CO2A 4YG0A 1TEIA 1PO23 2J1EA 3PIJA 3DPRC 4KWKA 4N53B 3VKOA 4AI9A 2PAMA 1JZ8A 3ZYJB 3SHRA 1UU6A 5GLTA 2Q1FA 4OHZA 3ZDSA 5DMYA 4JHZA 5FV3A 2VW2A 3KV6A 3NJYA 4HETA 4LKFA 3UKTA 3AZYA 1PNGA 1YRZA 2ZX2A 1V6MA 3KMHA 2P5BA 3OEBA 3I2GA 1NG0A 1NCQA 3ILNA 5FYTA 1ULPA 2Z4FA 1ND2C 2HWE2 1KDKA 2D98A 3O0WA 4OZXA 4GXLA 4FBFA 1YWKA 1HRV3 2SBAA 4H2AA 1PZ8A 1DQ5A 3RRDA 5IAVA 3WR0A 4D6SA 1MZ5A 1UIJA 4GD4A 4AHWA 2P3KA 2JDNA 4BLJA 1S0BA 2WS92 1S0DA 1H4HA 3WLUA 3VZMA 4CUCA 5AFBA 4YGCA 1COV1 4XBQA 4NHLA 2RG4A 3OEAA 4CP2A 3AFKA 3M2MA 1IZ3A 1HRI3 2RS32 5K0UC 5CU1A 4A3XA 1RB8G 4AHZA 4AVSA 1W8OA 1GOFA 5LBFA 4CUAA 4HN0A 3UGHA 5E89A 1ZZBA 1CZVA 4XJZA 3M1HA 3WG2A 1W6MB 1OSGA 1VRH3 1J3PA 4IW3A 4PF5A 5IW0A 2E9QA 3RPQA 3ZFFA 1KFUL 1F15A 2DWRA 1C1FA 3HT2A 2XJVA 1PGSA 4LLFA 5DXDA 3VZJA 4AW7A 3LA3A 1KITA 1MR5A 5ABJB 3SC7X 2DTWA 4X8NA 3WY6A 4RHV1 1GLHA 3FUQA 4BHPA 2VOKA 1S0GA 3SMHA 2QQNA 2XXZA 1C5HA 4E8CA 3AKRA 5LEJA 1OOPA 5CIRA 1GWLA 1SACA 2QFEA 2XB6C 1AR61 3BIWE 3LA7A 3A0NA 3P5BA 4SLIA 3PUHA 2ARAA 4Q4V2 2WT0A 5FUNA 5EQUA 4UFLA 1VRH2 3GBFA 3SXWA 3M3OA 1RUI2 1D2SA 3JB4C 1GZWA 4HKOA 4Q4Y2 3VUOA 4AI2A 2NPIA 4E4DX 5JMOA 2BWCA 3OGVA 2JG9A 4HK9A 3WOGA 3J7NA 4LUKA 1VRBA 3QLQA 4M3CA 3KVBA 4K1ZA 1BBT2 4Y1XA 3Q8BA 3CZUA 3BKZA 2WLPA 4X6RB 1VBB3 2ZPXA 3VKMA 1QDOA 1BVP1 3T2QA 2PQSA 1OLQA 2J7MA 1RUG2 4GWJA 2AENA 3ZYBA 5M0TA 2WO2A 1DZRA 3GDBA 1VBD1 2WO7A 5FZ7A 2AYHA 2K9ZA 4WBBA 2F6BA 2BVVA 3RZKA 2ZAAA 2ZA9A 4CXWA 4OZOA 4AAPA 2DBIA 3K51A 4JC1A 4PIXA 4P9XA 3PU8A 4BM8A 4LHLA 3TN92 1XYNA 3I3DA 3FFQA 5B4NA 3MI8A 2VQUA 4Y22B 3F95A 1PHMA 4IEOA 4TN7A 3POFA 4CPBD 3OYWB 1ACCA 4YM0A 1XYPA 1QJY1 5A33B 1GSLA 1GZTA 5HCFA 1OC1A 2TEPA 2R49A 1HKDA 1AVBA 3MIFA 1O91A 4AWDA 3PVNA 5J1XA 3DKWA 5FZBA 1RVF1 1CVNA 2JB8A 3VN4A 1SZBA 3PIGA 4LA3A 2WL1A 1XB9A 3SH4A 3CIHA 5T55A 5JOWA 3AZXA 1G9CA 1TMF3 1ZRRA 1PM7A 4LUMA 4XIOA 2GNBA 2DURA 3C7OA 2PLV3 3OPZA 2FHRA 3RYRA 3JUUA 1BEV3 1JYTA 4CU6A 4FFIA 1NLRA 2HWF3 4G4FA 4Z1VA 2WLQA 1SBFA 3MW4A 3O0VA 2ZABA 3CJXA 3TAYA 2D40A 1LRHA 1DFQA 4NN0A 3K3NA 1H30A 2QQUA 3MICA 4HONA 1JODA 1H1MA 4IETA 5FOJB 2J1RA 1HJFA 2X5IC 3PVOA 3M8LA 1L7QA 4XJWA 3AC0A 3QBQA 4FPFA 5E16A 4FPCA 2GDFA 2LALA 1ZVFA 2OYZA 5LB6A 1HJGA 3ZXKA 1AYN3 3VKFC 4LR4A 1L3JA 3O12A 3O1PA 2R0HA 2XDVA 2MEV2 2HYKA 1JYNA 4IV3C 2J1UA 2DUQA 2QZ3A 1AR63 3D0JA 4GJYA 4RA0A 2HWE3 4DINB 5IHRA 2HWD2 3ZN5A 5A1LA 1B35B 2MEV1 5FOBB 4CCNA 4RHV3 1IPSA 1EPZA 4WM7A 5FZFA 2PHRA 3I97A 3VDDA 3IAQA 4E2QA 3I3BA 5FZ6A 3UJQA 4FAGA 2EA7A 5LY2A 3LEGA 2CSGA 5IK4A 5J96B 3QH7A 1OQ1A 5H9SA 4BQ5A 1W3XA 1VRH1 2EXJA 1DYPA 2E31A 1J84A 3B93A 1ENXA 2XHNA 1ND3B 4D7SA 1O3TA 2QDNA 2BTVC 3I2JA 1O8PA 3K75B 5A3PA 3NMBA 4EYUA 5JI9A 1HN0A 1ZRDA 1ZM1A 5IJRA 5BNOA 3O1MA 1MVQA 2BQPA 4AF9A 5KBFA 3VD3A 4B4RA 3PUQA 3ZSLA 5FYUA 4COVA 1QNWA 4MGSA 3RJRA 2HH9A 2B4KA 1WMFA 4IGOA 4NJ4A 1NCRB 2CDOA 2R062 4R9BA 2IXCA 2YPJA 5F8PA 1ULCA 1AXKA 4XCBA 1LGCA 4UOJA 1VLNA 3NW4A 2VXJA 3M3QA 5LRRA 3WNLA 4UW4A 2BGOA 2V09A 1G6NA 3FN9A 4BOWA 2CWSA 3CKHA 3HN1A 4CSWA 4DRRA 1F4AA 5F1RA 3OPTA 3UKNA 3HNBM 4XQWA 1EUTA 5FWEA 2GN3A 4RFT0 3K48A 4BK4A 2WNEA 1GFF2 5CVRA 5JR2A 2J42A 2JG9B 2W68A 3CDZB 1F35A 2R071 2Y6LA 4QB6A 4QX2A 1VB4A 3VHRA 3SQOA 4RR3C 2Y6FA 3BYWA 5CB7A 3LDRA 2W87A 2GNMA 4WV8A 1NXMA 2DTYA 5A6YA 2WN3A 3T0AA 2JX9A 4BJ0A 1MZFA 1ND3A 1AR82 2WWSA 3HAGA 4UFHA 3FX3A 4JV4A 1UYZA 3KT4A 1QQP3 3ITQA 1MS1A 1RUOA 1SDWA 5DAQA 4MSVA 3ZXFA 1NOVA 1BEV1 1PIV1 3NNLA 2A70A 4HKWA 4MGZE 4QX0A 4D6RA 2OW4A 3ZFFC 3UKVA 5EYYA 3MHZA 1KXGA 3RZJA 3S30A 1PIV2 5DZFA 4W50A 4AQ6A 3WDXA 2DFBA 1SLBA 1UF2C 2VD7A 1ALYA 1IGOA 2W1UA 3AKQA 4NE9A 1HB3A 1CX4A 3IAPA 2VOWA 3DPRB 3LAGA 5IUQA 4FXKB 3RYKA 3ACIA 4CP9B 3OUJA 4BQYA 1QJY3 2DVGA 3ZFEC 2IUWA 3V0AB 4FP2A 4PDWA 3EO6A 5T54A 2IXLA 3WDWA 1FPN2 4AG4A 4MVTA 1DGRA 1YLLA 4V2VA 4MXWA 4GULA 1KEXA 4YW3A 4A41A 1VBE2 2ZMLA 5LA2A 4QGLA 5FZOB 4Q0VA 4CDQC 5LWBA 2JDAA 2NLRA 1ZBE1 2HWF2 5FY4A 3EYPA 2XLFA 3INAA 1NCRC 1REFA 5D21A 5F32A 2RV9A 3V64A 2AZ5A 4AEDC 3VD9A 5L19A 3AP9A 4WM8B 3WG1A 2W52A 1QJY2 1C4RA 3IDEA 2QQMA 2JJ6A 4Q1PA 1UAIA 1NY72 2JE8A 4L92A 1QU0A 1GZWB 1FOD1 2Q1MA 5ISLA 1SCSA 1KFXL 4MGTA 1LEMA 1OKOA 1U5XA 5F5CA 4IE0A 5HXMA 5FY7A 4DY3A 4YFWA 3IPVA 1JOPA 3R4DB 4W6YA 1S55A 3G7DA 1ND3C 4URAA 1UZYA 3H7YA 3ZKYA 1WKYA 3MFCA 3VD5A 2DU0A 4AHXA 1W8HA 1ZRIA 2HWD3 1GQHA 1J1TA 1DQ4A 2IFRA 3ENRA 3O0XA 4R52A 3BALA 5FBJA 3UGFA 4ZZ5A 1FMD2 1PVC1 2DF7A 1JS9A 2P3JA 2VNVA 4M0HA 1ASJ3 2W2IA 3LF7A 4R9CA 3T30A 3DXTA 3VBHC 3WNNA 4BH9A 1AYM3 1N3PA 5FWJA 4HSLA 4KG0A 1MS0A 1LHVA 1ULFA 3DV8A 4GH4A 4UXAA 1PGL2 2P4EA 3JBG3 4MLOA 4FPOB 4XUNA 5F5AA 2WN2A 2P6HA 4PDWC 4URTA 5J36A 1S1AA 2WR9A 3ZFEA 1F5JA 5FPLA 1W2AX 1BVVA 2JKBA 2VECA 3LB9A 2LRPA 4PCRA 3WSOA 4BCUA 1GOGA 1ND2A 3PUAA 1V6IA 4LBLA 4IEZA 1UWWA 2PELA 2QDRA 4MV2A 1UY3A 1R081 1COV2 4N7IA 5GZFA 3ORJA 3VD7A 4AR2A 4FSJA 2YFZA 3LPGA 4YGDA 4JKKA 5CA6A 2BUKA 3LSEA 1AYM2 3VHOA 1FV3A 4RGAA 1W8TA 4LULA 1CGPA 3AKTA 1QOTA 4DQAA 1BXHA 3RZHA 4B29A 5A7SA 2VBDA 1AL22 1LOAA 1TZOA 1WW6A 1MS5A 2A6WA 3HNYM 5L7OC 1QQP1 4NHXA 4Y5Z0 2E7TA 4Y26A 1VBC2 3THDA 4YW5A 5CG8A 1LGNA 2PFWA 4HFSA 1O4TA 4XDQA 4LTAA 5FTTC 5BNNB 2WJSA 2OQ6A 4DPNA 5KXCA 2ZGKA 1O6UA 3B9IA 1RUF1 3HBKA 3SH5A 5L36A 2ZTNA 1DHKB 3W21A 5DAPA 4DEQA 3O1VA 1ZBA2 2J1AA 4XW3A 5T5JA 3MV11 3U11A 4JGYA 1GICA 1WBFA 4MGQA 2K2SA 4IE6A 1Q3EA 2A7AA 5F5QA 1QIQA 3P3NA 5C4WA 3U4XA 2YGMA 1HN1A 1YJLA 1RHI2 2A73B 5FXZA 3ACLA 3WNOA 4B7KA 3ZYFA 1V70A 4FFFA 3NKGA 4IEUA 4Q0QA 2YBSA 2OS2A 1PMHX 4ATFA 3KT1A 3R05A 1CR7A 2DVBA 4WVVA 1Y9QA 1MQTC 3ZSMA 1QHDA 2QNKA 4GMP3 4E8DA 3JZVA 2FMDA 2YROA 3I54A 4OMDA 3VHPA 5DUWA 1I6XA 5C3SA 2D5HA 5K4LA 1RIRA 1H2KA 3PTYA 4E2SA 3V65A 5FO7B 4R8HA 4Y1UA 3LEIA 2WT1A 4N7UA 2OZ6A 3PNAA 3NNMA 5BNOB 1AJOA 2HLEA 2KM2A 2FQPA 2VCBA 1K12A 1V00A 2WRAA 4KWUA 4KU7A 4XUTA 2C1FA 4ZU5A 4NIAA 2WZR1 2A75A 2DU1A 2D44A 4LHNA 4MADA 4QU1A 1POV3 4IQPA 1PO11 3IB3A 1QEXA 3U0ZA 2D6NA 4P9JA 2XH6A 2XVLA 3IIAA 4LBQB 4Q4V1 4YZ3A 5GALA 4AL9A 5KC5A 4QQOA 2PMWB 4IDZA 5LBEA 3RYPA 4YPJA 2X09A 1VAKA 3IDAA 1M4WA 3B00A 3GZEA 4Q2FA 4CXYA 4PI2A 3VBOB 4YFZA 3H8XA 1FNZA 5KHGA 1W03A 4DXSA 1AYM1 2VMCA 2ZGQA 4Q1RA 4QXCA 1XE0A 4BQXA 1R1A1 4I02A 2WA4A 3RJ2X 2RJ2A 2XUEA 2RE9A 4CZSA 1S4CA 2C4XA 2A6XA 2XJUA 2ZGSA 4GH4C 2WNUB 2W47A 1LR5A 1Q8VA 3MGUA 5H9QA 3AK0A 4Q4X3 3JQXA 1EV13 2YZ4A 2IVJA 1E5RA 1VB2A 5KHJA 1GZ9A 3MPBA 4FOVA 1JZ2A 1LTEA 4R9AA 2HWF1 1WW4A 2ZACA 3M4FA 3OSDA 4AEKA 4I09A 1E5SA 1QQP2 3J7MA 3AJZA 3SKJE 4CDUA 4LJHA 3MW3A 4Y33A 4LXLA 1EUUA 4QB2A 2W08A 5A6ZA 1NE4A 4ISRA 3BTYA 3PHMA 4TSVA 4ZS2A 1B35C 2D5FA 3KGLA 5FKCA 2JDZA 1UZ0A 1XJAA 3J7HA 3I2KA 1W8NA 4Q4W2 5FLIA 4BISA 5JSPA 5A3WA 1UNBA 4IV3B 1HV0A 4AI0A 4Q8KA 5BNNA 4KU8A 2ZGLA 2UWBA 2BOJA 4Q0UA 4LO8A 2R1BA 1BQPA 1RUG1 3AFGA 4IE5A 1H8TB 4LORA 3H8RA 1ENRA 3IWZA 4QX1A 2Q8DA 2WABA 4WZFA 3FBYA 3ECQA 4XJUA 5BPXA 3OY8B 1FPN3 4LBMA 1UW8A 5FP4A 1LOBA 1F8VA 1Q5OA 2BNOA 4ZONA 1JYIA 3NAPA 4IEYA 4A7KA 1JZ4A 4Q8LA 1LULA 1AYN2 3N35A 1W28A 2VPVA 1JU4A 3PDQA 4QXKA 2GH8A 3RS6A 2AREA 1RUH2 2VE1A 3HEIA 3NKTA 3S57A 3SITA 2AH2A 3WQBA 1OH4A 3OUHA 3POGA 4Y24A 3TNQA 1DYKA 1RHI1 2NMNA 4HG6B 5FXWA 4G9SB 2TUNA 4GALA 1H4GA 2NM1A 4XOGA 1G8WA 2W94A 2ZZJA 3DYMA 3QD6A 4XILA 1PO22 2QZ2A 4KH9A 2PHWA 4SBVA 4GMP1 4XXAA 2VUCA 3WG4A 4AVCA 2FDJA 5GZCA 5KWRA 4FPKA 3BI3A 3MF9A 1OPMA 4XTMA 4KMQA 1W8ZA 2JG8A 3MIHA 3LIHA 2X05A 3HWJA 3AVSA 3C7GA 1JYWA 2IXIA 5KHKA 4JGZB 4KI5M 1SLAA 2BU9A 3MLKA 3U14A 5BXXA 3ZMOA 2XHKA 5FP3A 1JXNA 1UKGA 4PLNA 1LOFA 3AP5A 2ZHKA 1YQ6A 1L7LA 5FYSA 4Q4W1 2EALA 4CEWA 3FJSA 1XNTA 1V6JA 2ARBA 3N9QA 4LO4B 1MVEA 3W59A 1GU3A 3LGRA 1J59A 1NAEA 3FWEA 3KSCA 4EN9B 2OA2A 2BFUS 3PTRB 4YZ4A 1YIFA 3MDPA 4ASLA 2P6CA 2IFWA 1U0AA 3O5SA 1QJX3 4BQ2A 1A6CA 1Q8OA 4Z8BA 5FPZA 4WVMB 3KHCA 1UO9A 4YW1A 4LLOA 2XJTA 1XC6A 4CCDA 3OCPA 3I2IA 1US3A 1JYXA 4YGEA 1K5JA 5FZKA 3GZAA 1VR3A 4FOQA 4UAPA 3DGTA 3IN9A 4XJ9A 1CJPA 2QQLA 5FIXA 1U12A 1OVSA 3C7HA 2BFUL 1FATA 1WZXA 2Y6KA 3QACA 2ZHNA 1HRV1 3M3IA 1J3RA 3L9JT 2ID4A 3K4ZA 1QJEA 1UY2A 5K9YA 1OOPB 4IGQA 2VMGA 4COWA 3LDKA 3AP4A 4ES8A 4P9WA 5FBZA 1NCQC 4Z07A 2WFF3 3VBOA 4EQVA 1CD3G 1D4M3 4Q4Y3 2DUOA 3LDBA 3POIA 2PAEA 4KNCA 3A22A 3PJYA 2E53A 2QQJA 1UZZA 1PK6C 2Y0IA 2QUOA 3EB7A 1YYNA 3PMEA 1XBFA 2HWE1 2VULA 4RD7A 3VDAA 1H9PA 5KR7A 5FZHA 4CP9A 1VAVA 4LT5A 1RUC1 1RUC3 3H8UA 5E6HA 4LBNA 5EWSA 3USSA 1W9FA 1YQ2A 2B42B 1CONA 5D8AC 5FZLA 3VBRB 4ET7A 1MS9A 2HWB1 2WYFA 4NHYA 3S7IA 1AYN1 4AGVA 4IV1C 1WLWA 2HBUA 1SFNA 2ZCWA 5G05L 4YZ1A 1W3VA 1ULGA 2VTFA 1XNCA 1JBCA 4AEDA 2B9VA 3DCQA 4OUEA 4GKXA 1DP0A 5BUVA 1QJZA 2QQOA 3T0DA 3OG2A 2ORXA 1QOOA 2D43A 2J1TA 4FQ4A 2X10A 5KXDA 5FMDA 2WFF1 4UF0A 2ETEA 2HWC2 2VNRA 1WA6X 3NNJA 2YU1A 3ZVXA 3EBRA 1FI2A 1Y9MA 3H1WA 4HVQA 4QX3A 1UOBA 3T2TA 3KQRA 1OXCA 4H14A 4PQ9A 3O7OA 5JUVA 3ZIXA 1S0EA 3BPSA 4OMCA 1BZWA 5KHIA 4OYUA 5DAWA 2XKPA 4HSJA 3ZPOA 3MYXA 5EXOA 3WNKA 4IV1B 4M3CE 3WD5A 4BMBA 3C8XA 1ZNPA 1HLCA 4XCAA 4UFIA 2R1DA 4AEJA 2I07B 1CESA 2LTNA 3JCIA 3NWKA 5JAXA 3CU7A 3WF0A 2G9GA 5EIYB 2JDYA 1RUF2 1R082 2Z5WA 4LA2A 3FHIB 1RUH3 2VGDA 3VKLA 1Q8SA 4QGNA 2XJRA 5JIUA 3KLSA 5C71A 3B01A 1RUD2 3JD73 1UQXA 1GYKA 4LIVA 5A32A 2VZPA 5F6KA 5HV0A 5LK7B 1RUI3 1SLIA 2FCUA 1W9YA 1FNYA 4CEYC 1TME3 4JQRA 4M4RA 4PBOA 3WNXA 3IZOA 3ZR5A 4U36A 3VD4A 1LOCA 4RFRB 1MEC1 1NA1C 1QMJA 3HQUA 4V2WA 1WMEA 4FFHA 4XZUG 5LRSA 2PQQA 5FZ1A 5D8AA 4WM7C 1X7NA 1VBD3 1LHUA 4A6OA 1I9RA 2E32A 2BBAA 3NQHA 4PIZA 3VDCA 1VAMA 2QE3A 2WDBA 1RUD3 3JD72 1KJLA 4KWLA 4CDUB 5J3UA 2BV4A 2ZEZA 5ERLA 4B7EA 1UCXA 1ZZ6A 4OLLA 2HWC1 1W0PA 3VDDC 3O1OA 2OQ7A 2Y34A 3ELNA 4P00B 4D7YA 2VOTA 1XNDA 2HBTA 4Z2AA 4RS5C 4ZS3A 1BHGA 4ATEA 2XWJB 4F7ZA 3FE5A 4QKNA 3PUIA 5FZDA 1OA4A 3AYAA 4IE7A 2YHJA 4CVUA 4JVAA 3FHQA 1VMJA 1VBD2 1IOAA 5A1FA 1AR92 1UYXA 2ZGOA 3D82A 2Q1ZB 1WD3A 3GF6A 3AP6A 1YC61 4A42A 1MS3A 4HXCA 4FPHA 1K42A 1MQTA 1C8NA 3ETQA 3VBUB 1V0AA 2L9LA 5APAA 2EIGA 2RMU2 3T09A 1D0HA 5JXIA 2A3XA 5F3EA 3SH3A 4HBNA 4OCTA 4LK7A 1AL21 2QQWA 4XACA 4YM3A 3E6CC 1XXNA 1VBA2 2X53S 1N3QA 4E4SA 3KB5A 1QWRA 1FMD1 1PVC2 3FLTA 2R0FA 3ZXGA 4QHZA 2B8MA 1RUNA 3DYOA 4HPKB 2PLV2 3JXSA 3ZKUA 3K2OA 2EVXA 4XDPA 3AZZA 3I8TA 4BQ4A 1YQ8A 1BEV2 1BJQA 3HMYA 1KDMA 3DUIA 2BBVA 1O3QA 2B9UA 4QU2A 2BDRA 3UNPA 2OIIA 4QDSA 5F3IA 5L73A 3VBFB 1NA1B 1UU5A 4GWIA 4A44A 1D4M2 2P37A 1CAWB 2EIEA 4JKLA 1CPNA 2QTWB 4M4PA 2WZEA 4AEDB 3NJXA 4AOCA 1PGL1 1KRIA 2GNTA 2VW1A 3ZMNA 1R1A2 4B4PA 5L7OB 1OFSA 2ZHLA 3BOPA 1UMZA 5FY8A 1J1LA 1XSQA 2AC1A 4AZZA 4W6WA 1ZA7A 5DAXA 4B1LA 4GMP0 4OVEA 3O1RA 1TQ5A 4AI1A 3ZO0B 1WCQA 4C1WA 5JPMB 2F4LA 2WBKA 1MZ6A 5DAVA 3ZFEB 4Q4X1 1URXA 1VBE1 2PYTA 5EV7A 4NRQA 4E9KA 3QH6A 3RWNA 5BNPB 2BGCA 1J58A 1MPXA 1X33A 3ABZA 1LU2A 2RDSA 4NR1A 3VBUA 2GP3A 3V0AA 3J8F1 4AGRA 2JE7A 1APNA 1H8TC 5C4WC 5JLVA 3VBUC 5FYZA 3NSTA 1BCXA 2H0VA 4O65A 4XHBA 3RNSA 2RMU1 1NY71 4N43C 2UU8A 5GLVA 4EN6B 4CCMA 1UY0A 1B09A 4BMEA 4XUQA 1HQWA 1X9TA 3U10A 2VCMA 4MGKE 3WV6A 3WUCA 3LFIA 2H0BA 5JPNB 1CZTA 2VMFA 4LBJA 2JDHA 4XFHA 2D6PA 5FPAA 3VDDB 3POEA 3KF3A 4YVSC 2XUMA 2D3SA 5L7OA 5LZ6A 5D8AB 4BA6A 1BBT3 1W6OB 3CEWA 3MUZ1 1RUE2 4TWTA 5C3OA 1LAJA 1HQNA 1H0BA 4D8MA 2RJLA 4Z92B 1UU4A 3ZYGA 1QY4A 4M0NA 4DUVA 2YGLA 2ZJCA 4AVVA 4KGQA 4B1MA 3R0RA 2Y60A 3I59A 1M06G 3B02A 2NQYA 4EZ4A 2J1SA 3GCWA 1E5HA 4XHXA 4NIIA 4QM9A 5IFPA 3KV5A 1AHSA 3P6BA 2YBKA 3OGJA 3K4AA 1VBA1 3AMMA 3TRSB 4YSFA 4KBBA 1KS5A 3ES4A 3SCHA 4CDQB 5BNQA 5C8CA 5FLHA 5I0RA 4RYDA 3ZSKA 4MG2A 4LE3A 1AZDA 1GNHA 3V56A 3N7LA 4JHTA 1VJ2A 1VMFA 3KD4A 5EJ1B 5FAXA 5FZAA 2NZ9A 1CWPA 1W05A 2O14A 5F3CA 1F4HA 1US2A 2XR4A 2YB7A 3HQRA 1NX9A 1SBDA 4ASKA 5FPUA 2DCKA 4XDOA 1EV11 2A6VA 2CU5A 3VZNA 3LOIA 1GKBA 2Q8EA 4I01A 4YZ2A 4AGGA 2R042 1WGPA 2W0XA 4QGMA 2RM23 4XIKA 5K8SA 1PO12 4NIHA 5SV5A 4HT1T 1UYYA 1KQRA 4QWNA 5SV8A 3R4SA 5FP9A 1CZSA 2D3PA 4HPKA 1PX3A 4ZXEA 1P8JA 1YO8A 4BYYA 2ZZQA 4Y1YA 4UF0B 5DPNA 2Q4SA 4HVOA 1DF0A 1ZYBA 2XOMA 4JDOA 3DL3A 1ULDA 4N43B 3ZFGA 1W04A 1RXFA 5FP8A 2D6LX 1MQTB 3PMSA 1CAWA 4ZXKA 3O1UA 1NA1A 3RWKX 1DDLA 4W6XA 4IV1A 4F8AA 3BUCA 1PO13 4UWDA 1Q8QA 4AFCA 4XXPA 3T2OA 1Q43A 2OZJA 3K46A 5JOYA 5IK8A 1J83A 1POV0 1XE8A 1AL23 1H8VA 3B7MA 1FPN1 4K8RB 2TBVA 2WZ8A 4YRDA 3TN91 3ZPYA 4AXOA 1DG6A 5A3MA 1R083 1UN1A 4L99A 5FY5A 4DUWA 1IHMA 4NAMA 4UFKA 4LKDA 4HOOA 1O59A 2AUYA 3AYCA 5EFUA 3SLIA 5L9VA 5JR7B 4LIUA 5FJHA 5JVVA 4AK3A 3WDTA 5CADA 1LU1A 2V72A 2BOIA 1UPSA 4OHXA 1AX2A 1U5YA 2DCYA 2VMEA 4ONUA 4XBLA 3BU0A 4E27A 2YBPA 1DLCA 3FL7A 2KR2A 4R9DA 2W95A 5BYNA 3VBHA 5JZGB 2FDGA 1YFXA 2ZBJA 5E1RA 5C3RA 4IEPA 1TNFA 3AMNA 3M3CA 3RMXA 1QJX2 2XONA 2MPFA 1LESA 3E6BA 3AJYA 3GBGA 4XF4A 1GR3A 1CIWA 4OQ9A 1UD1A 1BMV2 1W8FA 1EAH3 1W6PB 2ZS6B 4NO4A 5A32B 2WNVB 4XVHA 2ENRA 3VZOA 4QDRA 3R4UA 1C3HA 5CFDA 3DF0A 5FY9A 3SEPA 4Q5OA 4QPIA 4PF1A 1QH7A 4QPGC 2VVDA 2G4IA 4H7LA 5CKMA 1UXXX 1K5MA 1XNAA 2BVBA 2VZSA 1WCSA 3AXDA 1PO21 1FOD3 4XFCA 3HD8B 3K3OA 2HWB2 1IG3A 1PK6A 2C26A 4J25A 3T1LA 4UYBA 2VVFA 1O4YA 2OVUA 2UWCA 3MV01 5C9AB 1CJDA 4IESA 1TE1B 2P2KA 1AR71 1S0CA 5FZ0A 5FZGA 4YVWA 1A78A 5CYYA 5LA1A 4P9LA 2WFF2 3WNMA 1ZBE2 3MPPG 1A8DA 1SG3A 4FTBA 2WQ4A 2PHLA 1ODNA 2E6VA 4UW5A 5HV4A 1VBA3 4K7JA 2CGOA 3I2HA 3H1YA 1DGWX 4A3ZA 5ABJA 5KXBA 5T3NA 1Y4WA 3HNMA 3AMQA 1G9FA 2ZGNA 4ES9A 1VBC3 3GBWA 3ZIWA 4O9EA 2DVFA 1XNBA 5GZDA 4AI3A 2ZGPA 4YGBA 3WP3A 4XURA 2ARXA 5J48A 2YDEA 5JCTA 3LWCA 2K46A 5AC92 1UX6A 1O8SA 4TYSA 4UFMA 4CDWB 4S2GA 1FT9A 3DKQA 4CEWB 5FZEA 2NMOA 1XRUA 1JHJA 1BK1A 2GNDA 1PIV3 2G9ZA 3U4SA 4NVPA 4Y4RA 4YLZA 3E5UA 5CFCA 4GWNA 2Y38A 1GANA 2VW0A 2WUHA 4AFBA 4CCCA 2P3IA 4XAEA 5IAXA 1CAVA 5ACA1 5CEHA 1DZQA 4OHVA 3HPNA 4GB31 5AC93 2UYAA 1FX5A 2R32A 3V0BA 3ZX7A 3A4UA 4LITA 1Z7S1 4EE2A 3LA2A 1ULEA 1R093 1Z0HA 3W9AA 2OXBA 1CAXB 3OPWA 1HB4A 3T4HB 4DB5A 1OBNA 1OKQA 3ES1A 1VPHA 2VBPA 2XL9A 3CBNA 4XF3A 3TWIA 2EAAA 3ME2A 1FYUA 4BU2A 1NUKA 2CV6A 1RITA 3ON7A 5EPAA 2XWBB 4P9GA 1UMIA 1W6QB 1Y9GA 4KQ7A 3L2YA 1MS8A 1Q8PA 3WQ1A 3ZFFB 1JUIA 2RJKA 4P5YA 3U1XA 5C5TA 3LOBA 3N9LA 1UMHA 2JDMA 4XF1A 4CDXA 3IPVB 4LOSA 2YG0A 5HCBA 2WSUA 2VR4A 3WQ0A 4U2AA 1T2XA 1BYHA 1OQEA 2W46A 1RVF2 4DEVA 4F3JA 3UETA 1K3IA 4AQ2A 5CISA 4YNIA 5C6CA 2WSVA 2A1XA 2JG9C 1JOJA 1XPWA 3GM8A 4QDQA 3AMPA 4F83A 3WF4A 5IVCA 2P17A 2MHFA 1FMD3 3UL2A 4LHKA 2DYCA 2HEVF 4Q26A 2JDKA 3DECA 2G9FA 1DQ6A 2JG8B 3FZ3A 3OUIA 4KWJA 1Y3TA 1YEWA 5GZEA 5FYMA 3MLJA 3TEXA 4YVSA 2HWD1 2VXRA 1AL0G 1WWYA 3I3QA 1EPWA 2OX0A 1S2EA 4FQZA 2WT2A 5DDJ3 4YVWB 3U07A 2EF6A 4HZFA 5JXGA 4ORFA 4LNVA 1OI6A 4IERA 4RQPA 3N9MA 2BWAA 2BERA 2IC1A 2WO1A 4FXGB 5F6LB 5F37A 4FT8A 3C2UA 1K5MB 3POBA 4RSUA 3FC0A 2B39A 4L8QA 2FZ2A 2GMEA 3VKNA 4LBQA 4QX7A 4Z82A 4MHUA 5FK7A 5A7QA 4BQ1A 2WFPA 4GQ7A 5EYXA 2BGPA 4A7ZA 3OD0A 3Q8AA 3WDYA 1H8TA 1OH3A 1O3SA 1QDCA 3AL5A 1G7YA 1ZBE3 2VL4A 1F2NA 1YFWA 2K0GA 1W90A 5EJ3A 2JB4A 1SDDB 5CZKA 3ZSJA 4AVBA 1MACA 5DABA 3UT0A 2VJXA 4FCAA 2ET1A 2O0OA 2YC4A 4O7XA 3THCA 1S0IA 1ZBA3 1JZ6A 1H2NA 4EV0A 5C4WB 3KS7A 3WCRA 3POWA 4LO6B 2AGSA 2WQZC 3JD71 2OT7A 4XYXA 1EP0A 1BMV1 1OMIA 4JGZC 2HEWF 1RMU2 2Q0AA 3N9PA 2X5IB 3PJQA 4HKLA 3T3YA 4DO0A 5A33A 1RUH1 1H2LA 5JIAA 3DEMA 4S2HA 4C0BA 3KQ4B 1RMU1 4YW7A 3IM0A 1MS4A 1ZZCA 2ES3A 3RQ0A 4D69A 1HDKA 3KM5A 3WDVA 1BKZA 4JKMA 2BYVE 3ZYHA 1DCSA 5FMOL 4UBHA 3ZFGC 2WKKA 4DZGA 1V9U2 3S0MA 1HW5A 5A3TA 5TSWA 4JDMA 3VZKA 2C6SA 2JECA 4I3PA 4CUGA 5BNNC 2CAVA 2QCSB 5HI0A 3AZVA 5I0DA 1UPIA 3SKVA 4BZ4A 2WNOA 3CHXA 1NLQA 4ZU7A 1B35A 3ILRA 3Q8EA 1WCKA 4N9HA 2WA3A 5HBAA 3VB9A 3AP7A 3IDCB 4GIQA 3C7EA 4H3WA 1NKGA 4N8MA 3ZXLA 4YARA 1W0NA 2ZXQA 4I30A 4HVRA 1LOGA 1LENA 3ZDVA 2RDRA 3OBZA 1AJKA 1RJ7A 3URFA 3WUDA 3CLPA 5ANNA 4BIFA 1IS4A 3OY8A 4NHKA 2E63A 3GJBA 3RZGA 5T5PA 1IS5A 1XSRA 1RXGA 2ZX4A 3M3EA 4XJAA 2HWB3 3ACGA 4QPYA 4LO7A 1QJU3 4YZ5A 1KD7A 1WLCA 1OD3A 1CQ9A 2XLAA 4Q4Y1 1GQGA 1TG7A 4D7TA 1IS6A 1OQDA 4JZRA 3NJVA 4EN0A 4KGGA 1OA2A 4Q4V3 1UOFA 4IUGA 2GMPA 5ACA2 1JU3A 4PT6A 3WXPA 1GWMA 5FQ0A 3VV1A 3SNMA 5FP7A 5A80A 4Y20A 5DZEA 1W9SA 4NRMA 2LW8A 3B69A 1K5MC 3J8F2 2IXJA 4RS5B 1HXS2 4RL7A 3IMMA 3P3PA 4QXBA 2Q30A 1VBB2 1QNYA 1UZVA 5IVBA 2EXHA 1XQNA 2VCAA 4M3CF 4HANA 4OI4A 1HRI1 1Q56A 3EJKA 4CEYA 2E7AA 1O4ZA 4WM7B 2BNMA 2JENA 3BCWA 4DS0A 3POJA 3PLQA 1CN1A 2VZUA 4HL0A 3C7FA 3ZXDA 4MOAA 1HXS3 1GOHA 1OF3A 5ABJC 3PVEA 5I93A 1AR73 1GNYA 1SFPA 4XQDA 3T1MA 1NXD1 2GC0A 5FZOA 5C8CC 1UL9A 2W91A 2ZEXA 5IVVA 1LJ7A 2R30A 4Q0PA 3I2OA 5DDJ2 2B7YA 4CDXC 3G6JB 4BXFA 1HB2A 3WW3A 5DG2A 4XBNA 3O1TA 2ZGMA 3QOPA 5JXJA 4FPGA 1S2BA 2RR13 4L2NA 4IGPA 5I0UA 3B5LB 2JICA 3S5AA 3IKWA 1WD4A 2VM9A 5A6XA 2O8QA 1RL3A 2DCZA 2VC9A 5BNOC 3DPRA 4DOUA 5J7MA 3GGLA 5FDBA 3UK9A 4LMFA 5JI7A 3N3HA 2BW8A 1JI6A 1AXYA 2HYXA 1XOYA 2XG3A 3CF6E 3GJAA 3MIEA 3NV4A 2WWJA 1OLME 2WNVA 1SLCA 4K20A 5FUIA 5I91A 4JQTA 5FREA 2YU2A 1GBGA 4EWAA 5IATA 1ND2B 2PXJA 5T52A 5GZGA 1D0GA 4FPEA 1LB2A 1OA3A 1Y43B 5BV6A 3H8OA 4INDA 3AXEA 1JZ3A 5JOZA 3RGBA 3AB0A 4AQTA 1L7RA 1D2QA 5A3LA 3RZLA 1UYPA 4RR3B 4JX0A 4QM8A 3PU3A 4YW6A 2O8OA 5FYYA 3H50A 3WHTA 3JBG1 1WMXA 3H3UA 4DXZA 3LSDA 4YWAA 3JU9A 1VIWB 4FO9A 4XF0A 4PLOA 3O1SA 3VDBA 5FZ8A 1TME2 4A4AA 1SPPA 2GAUA 2DDUA 2ZMKA 4AE2A 4D0QA 1ZBA1 1YXWA 2E51A 4CDXB 3TEZA 5IVEA 2QJVA 4AHYA 2R16A 3GHNA 1FOD2 1AX0A 4BQWA 2BNNA 3MUY1 3AX4A 1JYCA 4JAAA 1D4VB 4A45A 5I8YA 5F2SA 3A7QA 2VNGA 3M70A 3B3QE 3GNEA 3HJRA 4I2OA 4PIYA 4CCOA 5I8TA 1OURA 5FYIA 3NNFA 3GXUA 1OOPC 3TB0A 2ADDA 4AYUA 3ZFGB 3ZOIA 3VBFA 1C57A 1YFYA 1UOGA 1VBB1 4NPRA 4UT5A 5AVAA 1T6GC 2V5DA 3BB6A 4P9IA 2WS93 2WS91 4JCKA 3ZM8A 5FPXA 2PA7A 4PI0A 4NIDA 4Q27A 4MXWB 2JE9A 3UESA 3ASIA 5CFDC 3JQWA 2VMDA 5C8WA 1PMJX 2W3JA 1WW5A 2FCVA 4QAWA 5IK5A 1DYOA 1E57A 1AR91 4CCEA 3I59B 2AEZA 4RR3A 2IZWA 4M01A 3ETPA 1DBNA 3NJZA 2YMZA 4WM8A 2BZDA 5A3NA 1LECA 1SLTA 5C9AC 3MW2A 2FBEA 3I3EA 2FCTA 4QHBA 4J1XA 1LCLA 2C24A 1H1IA 1NQJA 2RS13 2UY9A 3OJBA 3AMHA 2PN5A 2CTVA 1WLDA 5AVPA 3HVDA 1AUYA 5FUPA 2QQKA 4DUXA 4XMAA 4CU8A 4COZA 3ZN6B 1JHNA 4EN8B 5KXEA 1AR83 1VBC1 5J09A 4PQQA 1ZZ7A 1XYOA 1IG0A 1Z78A 1WBLA 3F2ZA 3MIGA 1YQCA 5F5IA 2VTXA 3WP4A 1LHWA 1IS3A 2DV9A 5A7WB 1SFYA 2ZGUA 3HR9A 3Q8CA 3WZ1A 2CNAA 3TEWA 4XEZA 3ZN4A 2DVAA 2ORZA 2YV8A 5GLWA 3WW4A 2CHHA 5GJ6A 1JUHA 3AZWA 3KHBA 3WW2A 5JZGC 1JZ7A 2AEYA 1AR72 4GZ9A 1E5IA 5D2AA 5DUUA 3LD8A 4J6GA 3Q8FA 4BE3A 3GALA 4XUOA 5BNPA 5EHDA 4C0HA 1ZX5A 4V1PA 2VU9A 3LQCA 4W8JA 2A71A 2B45X 3WNPA 2RDQA 1UY1A 4MGYE 1YUDA 3FUOA 5A7NA 2P1BA 4Y5SA 4IEQA 4XTPA 5FYCA 1V9U1 4QPGA 3WW1A 3NO8A 5FZIA 4MXVA 1JH5A 1GWKA 4DNYA 4MYEA 3MEPA 4FAHA 2FMYA 2XLGA 1T6BX 5FMCA 1QF3A 1VBE3 1X8MA 2VY0A 4HK8A 4C8DA 2RHPA 3LCPA 2JDUA 1N1YA 1O7FA 3FLRA 1XE7A 3HN3A 3K77A 2XQXA 3NV3A 4FFGA 3UJOA 3OBRA 4CA9A 1S0FA 2EICA 4QX8A 5A70A 3USUB 2A5ZA 3WT3A 3CNAA 3UV9A 4FTEA 3RI8A 4DXRA 2I2SA 4IXLA 3PL0A 4ZY9A 3VHNA 5ACA3 1YQ5A 1J3QA 1RUJ2 2A6ZA 2GN7A 4QX5A 1DIWA 1QXRA 2WWUA 4FP3A 4HMZA 1GQPA 2CL2A 1TMF2 4P08A 4NIGA 1AXZA 1RUJ1 2ZGTA 1V6LA 5JWPA 4RS5A 1RYYA 1WA4A 3ST7A 3WX5A 3WF3A 2ZX0A 2LS6A 5C3PA 2VNOA 4DFSA 3I7DA 4Z2WA 3T2PA 4O9GA 5C7GA 3ZYRA 3OB8A 3KF5A 4QQPA 1FXZA 3AYEA 5DN2A 3KCXA 5J37A 4NUBA 1BBT1 5CKQA 1W39A 2EXKA 2VH9A 5I8SA 3L2HA 4N53C 2WNUC 4OUMA 4E4ZA 2VQTA 4GWMA 3UYJA 2RS11 3EXUA 1OF4A 1VALA 2D97A 3POYA 1DZTA 1XU2A 3W20A 1YI9A 1RGSA 3FLPA 5B4XA 4NHMA 5KC6A 4OFGA 2B5HA 2MEV3 2Y6GA 3T4VA 4JGZA 2ZAHA 4K9SA 5FCCA 4M00A 4XE9A 2WZPP 3THTA 4ZPIA 3TBDA 2Q5TA 3VLBB 5A7OA 3WG3A 5FZMA 1HQLA 5IVYA 4EWEA 4CEWC 4FTSA 3ACHA 5A7PA 2VUJA 2LUWA 3AKPA 5KHHA 1I5ZA 1SLLA 4QQ2A 1OT5A 1F31A 4UW6A 2BPA2 2RS52 5K0UA 3C3VA 3AM2A 3Q9OA 4P5HA 4XC9A 4FI9A 4HLTA 3RZMA 2GSYA 1RUD1 1UXZA 1JOBA 1IQDC 4MX3A 5EP9A 5BY5A 1N1TA 1WCDJ 1VE0A 2GC3A 1G9AA 5A3UA 5FFOC 5LW9A 3TOJA 3N7JA 1UZWA 4LQRA 4C1XA 3H9AA 2CAUA 1MEC3 1W8UA 4ITCA 4MH0E 2ILMA 1DGRN 1W9WA 1MZEA 1RUI1 1YJKA 5FY0A 3PVBB 1A34A 2RS53 4XZPA 2V5YA 1DGLA 4LO5B 4BPZA 1GV9A 2YFUA 4NWWA 4UI9L 3IIIA 4B8EA 5FO9B 2D3RA 1TVGA 1FAYA 4Q29A 1XNKA 1PGW1 2VMIA 2YYOA 3T0BA 4QQHA 2FDKA 1IQAA 5BNPC 3I3MA 3H3LA 3VBRC 2R7EB 5GLZA 1PGW2 3WP5A 1DQ0A 1HRV2 2WAOA 2XQRA 4TXWA 4UFJA 5IFTA 3FFZA 1W8WA 1SPPB 2OUHA 1QJFA 3KT7A 2JDPA 2WNVC 2WZR3 4GJZA 2WC2A 4FPJA 3VZLA 3RI9A 1ULOA 3ZLIA 3NAPB 4W4ZA 2UURA 5IT6A 4XETA 4Y22A 4OHYA 4X8PA 3I49A 4B4QA 1PMIA 5FZ9A 2KXLA 1CX1A 2CWMA 1UX7A 2E26A 1YHFA 4NPMA 5IVFA 2FDHA 1W6MA 2ARCA 1JW6A 2JEMA 2VUAA 2WYSA 4QB1A 3TEYA 5HCHA 4J1WA 4OQ8A 1RUE1 4CYDA 3THPA 5FK8A 5CBLA 2AACA 4CDWC 1R092 1U5ZA 1PZ7A 3HBZA 4LPLA 1I1EA 2WZR2 3D5OA 5FR3A 1IPJA 1QXJA 2R073 2XGXA 3J8F3 1ZREA 3EMRA 1DQ2A 2RR11 5LCWL 1W99A 1GP6A 2Q8CA 4DY5A 3S5QA 1LHOA 2GC2A 1REDA 4Y1VA 4P9YA 1N47A 5FXXA 5FO8B 2Z2SB 3E97A 1UIKA 1LOEA 4FOYA 5AFEA 4JGYC 5IYYA 2VUDA 1W6PA 1JYVA 3CMGA 4AFDA 1HXS1 1QXPA 3LKJA 1GNZA 4K3UA 4K6BA 2EIDA 1D4M1 3QCWA 4GKYA 2RS12 2VCCA 4K40A 4EWDA 2WO3A 3VBHB 2Y8KA 5JZGA 4RGKA 5JDBA 1UOJA 4Q4X2 3KGZA 1ENQA 1NYWA 2ET7A 3HQXA 1H6YA 4WVMA 1W6QA 2JXAA 3AYDA 4QPGB 2ERFA 4XMIA 5CFDB 3RMYA 4CPBA 2RM22 1GUIA 1QH6A 4BWOA 5E8AA 1LOFC 3A23A 3U37A 4CDUC 3KCYA 2XPJA 4IV3A 2QBXA 4XFFA 4CU9A 4CU7A 4ZHNA 2GU9A 2GH2A 3LEKA 2FZ1A 3SEEA 2XVKA 3USUA 2J22A 1FV2A 2YUEA 3VL8A 4N9IA 5H9RA 4C90A 4YG6A 4LBQD 5CNAA 4AI8A 4TLGA 2YC0A 3BODA 4IE4A 2HKXA 4IL7A 4A6SA 4TZDA 4KL1A 1N3OA 1QJU1 2VZVA 4NMIA 3NAPC 1R1ZA 1YNAA 3E6DA 1X36A 2H6CA 3BTXA 3TYJA 2VMHA 3E1F1 4RQPB 4CRQA 1JN2P 2I45A 2OUJA 1SMVA 4ISQA 5FRAA 1X9PA 1AR93 2PHDA 2SLIA 3H3ZA 5CG9A 5K0UB 2PHTA 1AX1A 1UY4A 2E33A 3VBRA 3ZSEA 3VL9A 2Z42A 4AVTA 4XFBA 4I3GA 3T08A 2QQPA 4LBOA 3NRUA 3VBSC 4ZKTB 1ZRFA 3I2DA 2W92A 5JXHA 4PBPA 3H0OA 4KG8A 4XAAA 3WP6A 3NV2A 2VZ1A 3OGRA 3BTZA 1ZRCA 2V4AA 1CPMA 3D8CA 5FMOS 1I5PA 2QVSB 3CQOA 4Y4YA 5DG1A 4QPWA 5CFCB 5JMCA 4D6QA 4QKBA 3H1MA 1RVF3 1ZZ8A 1CAUA 3WF2A 5CFCC 1RMU3 2ZEWA 4K21A 3AL6A 5IK7A 3MFAA 4BIOA 1EAH2 2PLV1 3E5QA 3KV4A 4RN5A 4YM2A 3B94A 4EROA 1TMF1 3GHMA 5DUVA 5F2WA 3VBSB 1ENSA 5LATA 3OF1A 2CY6A 4QT6A 5FZ4A 2PHFA 1YI7A 4YW2A 2R041 1PK6B 3OOXA 3MLLA 4RQPC 4ZZ8A 4QXHA 3NNGA 4LOTA 3J26N 3LZZA 2GP5A 5C70A 4LBKA 4P14A 3RZZA 5FPBA 4AVAA 1OVPA 2G1MA 5IVJA 2XJSA 1UKRA 1JMUB 1VMHA 1NCQB 2HJIA 1W2OA 4IEXA 1REEA 3X29B 1N1VA 5D1IA 5HXVA 1V6NA 3RDIA 3PUSA 3SCGA 5C5UA 4DXTA 2Y26A 2C5DA 5CKNA 4FVVA 2C0ZA 2YY1A 2XL7A 4QD2A 5K7PA 5LK5A 1NQDA 2GALA 4C91A 2CGPA 3D3AA 4NAOA 3GYDA 1W6NB 3H42B 1HV1A 4MGIE 3SCFA 4AQSA 1LEDA 4IEVA 2UWAA 3MIDA 3OGGA 2X8KA 1PM4A 5DDJ1 5FYVA 4OUSA 2VBBA 3D4KA 4YVSB 1H1AA 4QPIC 4NRPA 3KVAA 5FPVA 5JSRA 1POQA 2Y6HA 4JTOA 4OI1A 1C8M3 2DCJA 2XJQA 4W65A 1MEC2 2EXIA 3OGSA 2GZWA 1WCUA 5FLJA 5FZCA 4BXSV 2X29A 4Y20B 1H6XA 3RFRA 4JRAA 3K4DA 1O5UA 1TME1 1RUE3 4JTNA 2VG9A 1G9BA 3CJIB 5E88A 1G9DA 4MUVA 1QOSA 3O14A 4PLMA 5ANQA 3CJIC 3KWVA 3D6EA 1NLSA 3E5XA 4YG3A 1PVXA 2VO5A 4BDVB 2BRTA 5FYBA 5T5OA 1CIYA 4BLIA 5FMBA 3N9OA 5FKBA 1LHNA 5I0SA 5L9RA 2IXHA 4OI2A 1W2NA 3KV9A 1K45A 1OPOA 1STMA 1V6OA 2EIBA 1W0OA 4AFMA 1C1LA 4N90A 4XABA 3NV1A 4XFGA 1LODA 1PNFA 2VZOA 4DIQA 2PHUA 1RUG3 3I2FA 1ST8A 4NPLA 1C5IA 5F3GA 4CTEA 1WLTA 4UW3A 2BP6A 2IWGB 2WNUA 2C9KA 4META 1W6NA 5F7UA 1U5IA 1ZZ9A 3WQ7A 2JIGA 3LPFA 1COV3 2QQIA 5LA0A 3IBMA 1RUJ3 5I0TA 2DCTA 4S2DA 1W2TA 4CEYB 3MF6A 5T50A 4P02B 2NYYA 2FDIA 2VZ3A 3VBFC 2R072 2RM21 4MZUA 4QKDA 4K8FA 2CGNA 4Q4W3 4Y3OA 2CYFA 4E2GA 4COYA 1Z7S3 2VQ0A 4E4HA 4LK6A 2VTXJ 1EY2A 4Y5TA 4MO3M 5AC91 1TNRA 4I0BA 4XFAA 3RG0A 1LNSA 1HX6A 3LE0A 3BN6A 3HOBA 1V6KA 1NZCA 5H9PA 2DFCA 3POSA 3CZJA 1ODMA 5FQ0B 4OI0A 2IVIB 1EYBA 2R061 4BQ3A 1YCIA 4CE8A 1W6OA 1D7PM 3N7MA 2B46X 3WVJA 1IKQA 1OFNA 2O1QA 2Y33A 4EZHA 2HEYF 4CCJA 2XVGA 4L0PA 1SQ4A 1N1SA 4LE4A 4QKFA 4X6QB 1RINA 4GB32 1WUVA 1NZIA 3AVRA 1OUSA 1RC6A 4PHZA 2RS31 3D0SA 4YW4A 1X50A 4XUPA 1Y7BA 1DGWA 3N9NA 2W5FA 3I4IA 4K1YA 4FPLA 1A3KA 4MHRA 3OD4A 5HPOA 3BOWA 2W9XA 4L9BA 2QQVA 4LHSA 4GH4B 2OPWA 3ZYIB 2DBNA 1QGLA 4Y1ZA 1SBEA 3CL1A 3J9SA 1YIPA 1AR81 2UYBA 1OLMA 1SHWB 1H9WA 1WMDA 1HRI2 2RS33 3KZ4C 2XBO3 4XJ8A 1GP5A 1RJ8A 5EJZB 3VBOC 4HN1A 1BK0A 1DU3D 4DRVA 3N36A 4EJRA 1O3RA 2CDPA 1A8MA 3EQEA 5J98B 2RMU3 3FHAA 3DN7A 2W1WA 3HT1A 3JB8A 1QJX1 2JWPA 3HIFA 3NVCA 2RS51 2LM3A 4OULA 4CDQA 5C8CB 1O5LA 2XJPA 2JG8C 2IXKA 2TNFA 5FXVA 2A3YA 1PVC3 2ZMNA 3EHKA 5GM0A 3GCXA 5LBBA 1F5FA 4XF9A 4A7YA 2X5IA 3BU7A 2F17A 5F9TA 4QQLA 4RGGA 2XKOA 1PZ9A 3SISA 3H7JA 2I74A 4NOTA 2XBO2 2VQAA 2J1VA 5C9AA 1EAH1 1OD5A 2P3YA 2FD8A 5GLUA 3WF1A 2WQ8A 2D7FA 2Y64A 1C8M2 1OUXA 1QKQA 3KCCA 1X8EA 3BGAA 4WVZA 2NP0A 2BJSA 1GMMA 5A7WA 3WDUA 3B9CA 1R1A3 4KBZA 4TLFA 5HCAA 5FJKA 1JTZX 1V9U3 2H6BA 1CAUB 5EZWA 2R6QA 3J4UH 4CP1A 4B3NA 2ZX3A 1HB1A 1SEFA 1ZA4A 1EV12 2VOVA 2D6OX 3WINE 3ZXAC 5LY1A 4NWVA 2E7QA 1RHI3 2VZRA 3LIGA 2DUPA 4BB3A 3A0KA 1F9KA 1YFUA 4R4ZA 3BPZA 1SCRA 3ALQA 3VBSA 2GC1A 2XMLA 2Y6JA 2Z69A 1W2UA 2D6KA 3GZTB 5FZ3A 3TN93 4LEJA 1WW7A 2BEOA 3A21A 3ATGA 2C9AA 5C33A 5LBCA 5A3OA 2PTMA 2KD7A 5LEKA 2RVAA 1G86A 4NROA 3IMNA 1ONAA 4PJYA 1KJRA 1QJU2 3APBA 3PURA 3UGGA 3ZXEA 4CCLA 4H55A 2YC2A 1IPKA 4JDNA 3BTAA 4YM1A 1RUC2 4EN7B 2JD9A 2EAKA 1I3HA 3BVCA 4Q0SA 3S6PA 5FY1A 3U75A 4N43A 3FBMA 1HIXA 1CAVB 1NT0A 4GAZA 4IEWA 4FPYA 5DQ0A 2Y0OA 4CCKA 3J7LA 5JSOA 2RDNA 4WZCA 1KS4A 1H2MA 2ZOEB 5B2GB 1JZ5A 1X82A 3BIEA 4ARXA 1GZCA 1DLLA 3CJIA 3ZR6A 4LKSA 4CP0A 4H7MA 1C8M1 2ZEYA 2HWC3 3RVHA 4O61A 5DUXA 2ADEA 1Z7S2 4XFIA 3U78A 4BK5A 3W5MA 2VOXA 4ZU4A 5FYHA 3DXUA 5IWFA 3S7EA 3NL1A 1W9TA 2AR6A 5CAZA 3W5NA 4AAXA 3ILFA 4TTGA 3MZHA 5GKAC 2W1QA 2GMMA 2VZQA 3DYPA 4I0AA 1OHFA 3V0BB 4I0WB 4DMIA 3TNPB 3W58A 2D6MA 5LA9A 1R64A 4XQ4A 3GZUC 4PDWB 1AF9A 1R091 3MIBA 4CUBA 4M3CB 1S0JA 2ZHMA 3OYWA 4XPVA 5LASA 1RUF3 1PX4A 2OKXA 4OHWA 3P1IA 5DZGA 2QKDA 2Z79A 4UBGA 2UY8A 4GB33 2OPKA 2FDFA 3VGIA 1VP6A 2P34A 4ASMB 1AR62 2YXSA 4AEMA 1W06A 3LFMA 3RSJA 2VVEA 1RTVA 1KGYA 4N53A 4RHV2 3FMGA 2D93A 3MO4A 2MNGA 4CXXA 2R043 1BLZA 2ZKLA 3IDBB 4FOWA 4G3YC 5JOXA 2A6YA 2RR12 2WIIB 4JGYB 1POV1 3R6SA 1NE6A 3WEZA 1NCRA 2DVDA 4QPIB 1LKNA 3IT8A 1IKPA 5A1AA 3ACFA 4L11A 1C28A 1LGBA 4ARYA 4D94A 3WHUA 4LKEA 5C3QA 2F4PA 4A2UA 2ZX1A 2W1SA 2XBO1 3ZN6A 2V4VA 2YPDA 4YYOA 2WINB
chains in the Genus database with same CATH topology
2A3WA 3ZXJA 4YVWC 2JD4A 2ATFA 4CDWA 2PHXA 1CAXA 2ZKNA 4WVWA 1ASJ2 2N7GA 2PAKA 3OTFA 4JRLA 3AKSA 3N4MA 3OBTA 2KA3A 4WM8C 1S2KA 4COUA 4R4XA 2V73A 1ASJ1 2R063 1DQ1A 3JBG2 3N7KA 4AFAA 4GA9A 2W39A 4QMAA 3WCSA 4D3WA 4L97A 2NN8A 5T5LA 1OLRA 2Q8OA 3ROUA 1XU1A 3M7AA 4S2FA 3ZYPA 2ZGRA 3CO2A 4YG0A 3VZLA 1TEIA 1PO23 4N53B 5JI9A 3DPRC 4KWKA 3VKOA 2PAMA 3ZYJB 1UU6A 5GLTA 4OHZA 3ZDSA 2VW2A 3UKTA 4HETA 3AZYA 1PNGA 1YRZA 2ZX2A 1V6MA 3KMHA 1NG0A 1NCQA 3ILNA 1ND2C 2HWE2 1KDKA 2D98A 3O0WA 4OZXA 4GXLA 4FBFA 1YWKA 1HRV3 2SBAA 1PZ8A 1DQ5A 3RRDA 3WR0A 1MZ5A 1UIJA 4AHWA 2P3KA 4BLJA 1S0BA 2WS92 1S0DA 1H4HA 3WLUA 3VZMA 5AFBA 4YGCA 1COV1 4XBQA 4NHLA 4CP2A 3AFKA 3M2MA 1IZ3A 1HRI3 2RS32 5K0UC 5CU1A 4A3XA 1RB8G 4AHZA 4AVSA 4HN0A 5E89A 1ZZBA 4XJZA 3M1HA 3WG2A 1W6MB 1OSGA 1VRH3 1J3PA 4PF5A 2E9QA 3ZFFA 1KFUL 2DWRA 1C1FA 3HT2A 2XJVA 1PGSA 4LLFA 5DXDA 3VZJA 4AW7A 3LA3A 1KITA 1MR5A 5ABJB 2DTWA 4X8NA 3WY6A 4RHV1 1GLHA 3FUQA 4BHPA 2VOKA 1S0GA 3SMHA 1C5HA 3AKRA 5LEJA 1OOPA 5CIRA 3RJRA 1SACA 2QFEA 2XB6C 1AR61 3BIWE 3LA7A 3A0NA 4SLIA 4Q4V2 2WT0A 1VRH2 3GBFA 3SXWA 3M3OA 1RUI2 1D2SA 3JB4C 1GZWA 4HKOA 4Q4Y2 3VUOA 4AI2A 2NPIA 4E4DX 2BWCA 2JG9A 4HK9A 3WOGA 4LUKA 3QLQA 4M3CA 4K1ZA 1BBT2 4Y1XA 2WLPA 4X6RB 1VBB3 2ZPXA 3VKMA 1QDOA 1BVP1 1OLQA 1RUG2 2AENA 1DZRA 1VBD1 2AYHA 2K9ZA 4WBBA 2F6BA 2BVVA 2ZAAA 2ZA9A 3K51A 4JC1A 4PIXA 4P9XA 4BM8A 4LHLA 3TN92 1XYNA 3FFQA 3MI8A 4Y22B 1PHMA 4IEOA 3OYWB 4YM0A 1XYPA 1QJY1 5A33B 1GSLA 5HCFA 2TEPA 2R49A 1HKDA 1AVBA 3MIFA 1O91A 4AWDA 3PVNA 3DKWA 1RVF1 1CVNA 3VN4A 4LA3A 3SH4A 2WL1A 5T55A 5JOWA 3AZXA 1G9CA 1TMF3 1ZRRA 1PM7A 4LUMA 4XIOA 2GNBA 2DURA 2PLV3 3OPZA 2FHRA 3RYRA 3JUUA 1BEV3 1NLRA 2HWF3 4G4FA 4Z1VA 2WLQA 1SBFA 3MW4A 3O0VA 2ZABA 3CJXA 3TAYA 2D40A 1LRHA 1DFQA 4NN0A 4IETA 1H30A 3MICA 1H1MA 5FOJB 2X5IC 3PVOA 3M8LA 4XJWA 3QBQA 4FPFA 5E16A 4FPCA 2GDFA 2LALA 1ZVFA 2OYZA 3ZXKA 1AYN3 3VKFC 4LR4A 1L3JA 3O12A 2R0HA 2MEV2 2HYKA 4IV3C 2DUQA 2QZ3A 1AR63 3D0JA 4RA0A 2HWE3 4DINB 2HWD2 3ZN5A 1B35B 2MEV1 5FOBB 4RHV3 1EPZA 4WM7A 2PHRA 3VDDA 4E2QA 4FAGA 3UJQA 2EA7A 5IK4A 5J96B 3QH7A 1OQ1A 5H9SA 1VRH1 2EXJA 1DYPA 3B93A 1ENXA 4D7SA 1ND3B 1O3TA 2QDNA 2BTVC 1ZRDA 1ZM1A 5BNOA 1MVQA 2BQPA 4AF9A 5KBFA 4B4RA 3ZSLA 4COVA 1QNWA 1WMFA 1NCRB 2R062 4R9BA 2IXCA 2YPJA 1ULCA 1AXKA 1LGCA 1VLNA 3NW4A 3M3QA 5LRRA 4UW4A 2V09A 1G6NA 4BOWA 2CWSA 3HN1A 4DRRA 5F1RA 3UKNA 4XQWA 2GN3A 4RFT0 3K48A 2WNEA 1GFF2 5CVRA 2JG9B 2W68A 3WQ0A 2R071 3VHRA 1VB4A 4RR3C 5CB7A 2GNMA 4WV8A 1NXMA 2DTYA 2JX9A 1MZFA 1ND3A 1AR82 2WWSA 3HAGA 3FX3A 4JV4A 3KT4A 1QQP3 1MS1A 1RUOA 1SDWA 4MSVA 3ZXFA 1NOVA 1BEV1 1PIV1 4HKWA 2A70A 4MGZE 2OW4A 3ZFFC 3UKVA 5EYYA 1KXGA 3S30A 1PIV2 5DZFA 4AQ6A 3WDXA 2DFBA 1SLBA 1UF2C 1ALYA 1IGOA 3AKQA 1CX4A 2VOWA 3DPRB 3LAGA 5IUQA 4FXKB 3RYKA 1QJY3 2DVGA 3ZFEC 3V0AB 4FP2A 4PDWA 3EO6A 5T54A 2IXLA 3WDWA 1FPN2 4AG4A 4MVTA 1DGRA 1YLLA 4MXWA 4GULA 4YW3A 1VBE2 2ZMLA 4QGLA 4CDQC 4Q0VA 2NLRA 1ZBE1 2HWF2 2XLFA 3INAA 1NCRC 1REFA 3V64A 4AEDC 2AZ5A 5L19A 3AP9A 4WM8B 3WG1A 2W52A 1QJY2 1C4RA 3IDEA 2JJ6A 4Q1PA 1UAIA 1NY72 4L92A 1QU0A 1GZWB 1FOD1 2Q1MA 1SCSA 1KFXL 1LEMA 1U5XA 4DY3A 4YFWA 3IPVA 4W6YA 3R4DB 1S55A 3G7DA 1ND3C 1UZYA 3H7YA 3MFCA 2DU0A 4AHXA 2IFRA 2HWD3 3ENRA 1GQHA 1J1TA 1DQ4A 4DQAA 3O0XA 4R52A 3BALA 1FMD2 1PVC1 2DF7A 4M0HA 2P3JA 4R9CA 1ASJ3 4BH9A 3VBHC 1AYM3 1N3PA 4HSLA 4KG0A 1MS0A 1LHVA 1ULFA 3DV8A 4GH4A 4UXAA 1PGL2 3JBG3 4MLOA 4FPOB 4PDWC 4URTA 5J36A 1S1AA 3ZFEA 1F5JA 2VECA 1BVVA 2JKBA 4BCUA 3LB9A 4PCRA 1ND2A 1V6IA 4LBLA 4IEZA 2PELA 2QDRA 4N7IA 4MV2A 1R081 1COV2 4FSJA 5GZFA 4YGDA 5CA6A 2BUKA 3LSEA 1AYM2 3VHOA 1FV3A 4RGAA 4LULA 1CGPA 3AKTA 1QOTA 1BXHA 4B29A 1AL22 1LOAA 1WW6A 1MS5A 2A6WA 5L7OC 1QQP1 4Y5Z0 4Y26A 2E7TA 1VBC2 4YW5A 5CG8A 1LGNA 2PFWA 4HFSA 1O4TA 4XDQA 4LTAA 5FTTC 5BNNB 2WJSA 4DPNA 5KXCA 2ZGKA 3B9IA 1RUF1 3SH5A 5L36A 2ZTNA 1DHKB 1ZBA2 4XW3A 5T5JA 3U11A 4JGYA 1GICA 1WBFA 2K2SA 5F5QA 1Q3EA 2A7AA 3P3NA 5C4WA 3U4XA 2YGMA 1YJLA 1RHI2 2A73B 3ACLA 4B7KA 1V70A 3NKGA 4IEUA 4Q0QA 4ATFA 3KT1A 3R05A 1CR7A 2DVBA 4WVVA 1Y9QA 1MQTC 3ZSMA 1QHDA 2QNKA 4GMP3 3JZVA 2FMDA 2YROA 3I54A 3VHPA 5DUWA 1I6XA 2D5HA 1RIRA 1H2KA 3PTYA 4E2SA 3V65A 5FO7B 4R8HA 4Y1UA 2WT1A 4N7UA 2OZ6A 3PNAA 5BNOB 1AJOA 2KM2A 2FQPA 1V00A 4KU7A 2C1FA 4ZU5A 2WZR1 2A75A 2D44A 2DU1A 4LHNA 1POV3 4IQPA 1PO11 3U0ZA 2D6NA 4P9JA 2XH6A 2XVLA 3IIAA 4LBQB 4Q4V1 4YZ3A 5GALA 5KC5A 4QQOA 3RYPA 1VAKA 1M4WA 3B00A 4Q2FA 3VBOB 4YFZA 1FNZA 5KHGA 1AYM1 2ZGQA 4Q1RA 1R1A1 4I02A 2WA4A 3RJ2X 2RE9A 4CZSA 2A6XA 2XJUA 2ZGSA 4GH4C 2WNUB 3MGUA 1LR5A 1Q8VA 5H9QA 3AK0A 4Q4X3 3JQXA 1EV13 2YZ4A 5KHJA 1VB2A 1GZ9A 3MPBA 4FOVA 1LTEA 4R9AA 2HWF1 1WW4A 2ZACA 3M4FA 4AEKA 4I09A 1QQP2 4CDUA 3AJZA 3MW3A 2W08A 1NE4A 4ISRA 3PHMA 4TSVA 1B35C 2D5FA 3KGLA 2JDZA 4Q4W2 5JSPA 5FLIA 5BNNA 4IV3B 1HV0A 4AI0A 4Q8KA 4KU8A 2ZGLA 2UWBA 4Q0UA 4LO8A 2R1BA 1BQPA 1RUG1 3AFGA 1H8TB 1ENRA 3IWZA 4WZFA 4XJUA 3FBYA 3ECQA 5BPXA 3OY8B 1FPN3 4LBMA 1UW8A 1F8VA 1LOBA 1Q5OA 2BNOA 1JYIA 3NAPA 4IEYA 4A7KA 4Q8LA 1LULA 1AYN2 3N35A 2VPVA 4QXKA 2GH8A 3RS6A 2AREA 1RUH2 3NKTA 3SITA 2AH2A 4Y24A 3TNQA 1DYKA 1RHI1 2NMNA 4G9SB 2TUNA 4GALA 1H4GA 2NM1A 4XOGA 1G8WA 2ZZJA 3QD6A 4XILA 1PO22 2QZ2A 4KH9A 2PHWA 4SBVA 4GMP1 4XXAA 5KWRA 3WG4A 4AVCA 5GZCA 4FPKA 3MF9A 1OPMA 4XTMA 2JG8A 3MIHA 3HWJA 2IXIA 5KHKA 4JGZB 1SLAA 3MLKA 5BXXA 3ZMOA 2XHKA 1JXNA 1UKGA 4PLNA 1LOFA 3AP5A 2ZHKA 4Q4W1 2EALA 4CEWA 3FJSA 3W59A 1V6JA 2ARBA 4LO4B 1MVEA 3LGRA 1J59A 3FWEA 3KSCA 2OA2A 2BFUS 4YZ4A 1YIFA 3MDPA 4ASLA 2IFWA 1U0AA 3O5SA 1QJX3 1A6CA 1Q8OA 4Z8BA 5FPZA 4WVMB 4YW1A 4LLOA 2XJTA 3OCPA 4YGEA 5I93A 3GZAA 1VR3A 4FOQA 4XJ9A 3DGTA 3IN9A 1CJPA 1U12A 2BFUL 1FATA 3QACA 2ZHNA 1HRV1 3M3IA 1J3RA 3L9JT 5K9YA 1OOPB 2VMGA 4COWA 3AP4A 4ES8A 4P9WA 5FBZA 1NCQC 4Z07A 2WFF3 3VBOA 1CD3G 1D4M3 4Q4Y3 2DUOA 2PAEA 4KNCA 3PJYA 2E53A 1UZZA 1PK6C 2Y0IA 2QUOA 1YYNA 3PMEA 4RD7A 2HWE1 2VULA 1H9PA 1VAVA 4LT5A 1RUC1 1RUC3 3H8UA 3USSA 4LBNA 5EWSA 3VBRB 5D8AC 2B42B 1CONA 1MS9A 2HWB1 3S7IA 1AYN1 4AGVA 4IV1C 1WLWA 1SFNA 2ZCWA 4YZ1A 1ULGA 4AEDA 1XNCA 1JBCA 5BUVA 4GKXA 1QJZA 1QOOA 2D43A 4FQ4A 5KXDA 2WFF1 2ETEA 2HWC2 2VNRA 3ZVXA 3EBRA 1FI2A 3H1WA 4HVQA 3T2TA 3KQRA 4H14A 4PQ9A 3O7OA 3ZIXA 1S0EA 1BZWA 5KHIA 2XKPA 4HSJA 3MYXA 5EXOA 4IV1B 4M3CE 3WD5A 4BMBA 1ZNPA 1HLCA 2R1DA 4AEJA 2I07B 1CESA 2LTNA 3JCIA 3NWKA 5JAXA 3CU7A 2G9GA 2Z5WA 1RUF2 1R082 4LA2A 3FHIB 1RUH3 2VGDA 3VKLA 1Q8SA 4QGNA 2XJRA 5JIUA 3KLSA 3B01A 1RUD2 3JD73 1GYKA 5A32A 5F6KA 5LK7B 1RUI3 1SLIA 1FNYA 4CEYC 1TME3 4JQRA 4PBOA 3WNXA 4U36A 1LOCA 1MEC1 1NA1C 1QMJA 1WMEA 5LRSA 2PQQA 5D8AA 4WM7C 1X7NA 1VBD3 1LHUA 1I9RA 4PIZA 1VAMA 2QE3A 4KWLA 1RUD3 3JD72 1KJLA 4CDUB 5J3UA 4B7EA 1UCXA 1ZZ6A 4OLLA 2HWC1 1W0PA 3VDDC 3ELNA 4D7YA 1XNDA 4RS5C 4ATEA 2XWJB 4F7ZA 3FE5A 1OA4A 3AYAA 2YHJA 4JVAA 1IOAA 1VBD2 1AR92 2ZGOA 3D82A 2Q1ZB 1WD3A 3GF6A 3AP6A 1MS3A 4FPHA 1MQTA 1C8NA 3ETQA 3VBUB 2EIGA 2RMU2 1D0HA 2A3XA 3SH3A 4HBNA 1AL21 3E6CC 1XXNA 1VBA2 2X53S 1N3QA 4E4SA 3KB5A 1QWRA 1FMD1 1PVC2 3FLTA 2R0FA 3ZXGA 2B8MA 1RUNA 4HPKB 2PLV2 2EVXA 3AZZA 3I8TA 3HMYA 1BEV2 1BJQA 1KDMA 3DUIA 2BBVA 1O3QA 2B9UA 4QU2A 2OIIA 3VBFB 5L73A 1NA1B 1UU5A 1D4M2 1CAWB 2P37A 4AEDB 1CPNA 1PGL1 1KRIA 2GNTA 2VW1A 3ZMNA 1R1A2 4B4PA 5L7OB 1OFSA 2ZHLA 3BOPA 1UMZA 1J1LA 4W6WA 4GMP0 4OVEA 1TQ5A 4AI1A 3ZO0B 4C1WA 5JPMB 1MZ6A 3ZFEB 4Q4X1 1URXA 1VBE1 2PYTA 5EV7A 4E9KA 3QH6A 3RWNA 5BNPB 2BGCA 1J58A 1X33A 3V0AA 1LU2A 4NR1A 3VBUA 3J8F1 4AGRA 2JE7A 1APNA 1H8TC 5C4WC 5JLVA 3VBUC 3NSTA 1BCXA 2H0VA 3RNSA 4XHBA 2RMU1 1NY71 4N43C 2UU8A 5GLVA 4EN6B 1B09A 4BMEA 1HQWA 3U10A 3WV6A 4MGKE 3WUCA 2H0BA 5JPNB 4LBJA 4XFHA 3VDDB 2D6PA 4YVSC 2XUMA 2D3SA 5L7OA 5D8AB 4BA6A 1BBT3 3CEWA 1W6OB 1RUE2 4TWTA 1HQNA 1H0BA 4Z92B 2RJLA 1UU4A 3ZYGA 1QY4A 4M0NA 2YGLA 2ZJCA 4AVVA 4KGQA 3R0RA 1M06G 3I59A 3B02A 2NQYA 4XHXA 4QM9A 1AHSA 3OGJA 1VBA1 3AMMA 3TRSB 4YSFA 4KBBA 1KS5A 3ES4A 3SCHA 4CDQB 5BNQA 5C8CA 5FLHA 5I0RA 3ZSKA 4LE3A 1AZDA 1GNHA 3V56A 3N7LA 1VJ2A 3KD4A 5FAXA 2NZ9A 1SBDA 2DCKA 1EV11 2A6VA 3VZNA 3LOIA 1GKBA 4I01A 4YZ2A 4AGGA 2R042 1WGPA 2W0XA 4QGMA 2RM23 4XIKA 5K8SA 1PO12 5SV5A 4HT1T 1KQRA 5SV8A 3R4SA 4HPKA 2D3PA 1YO8A 4BYYA 2ZZQA 4Y1YA 2Q4SA 4HVOA 1DF0A 1ZYBA 4JDOA 3DL3A 1ULDA 4N43B 3ZFGA 2D6LX 1MQTB 3PMSA 1CAWA 4ZXKA 1NA1A 1DDLA 4W6XA 4IV1A 4F8AA 1PO13 1Q8QA 4AFCA 4XXPA 5JOYA 1Q43A 2OZJA 5IK8A 1POV0 1XE8A 1AL23 1H8VA 3B7MA 1FPN1 3TN91 2TBVA 4YRDA 3ZPYA 4AXOA 1DG6A 5A3MA 1R083 1UN1A 4L99A 1IHMA 2AUYA 3AYCA 5EFUA 3SLIA 5JR7B 5JVVA 4AK3A 3WDTA 5CADA 1LU1A 1UPSA 4OHXA 1AX2A 1U5YA 2DCYA 4ONUA 4XBLA 4E27A 5BYNA 4R9DA 3VBHA 5JZGB 1YFXA 2ZBJA 5E1RA 4IEPA 1TNFA 3AMNA 3M3CA 3RMXA 1QJX2 2MPFA 1LESA 3E6BA 3AJYA 3GBGA 4XF4A 1GR3A 1CIWA 1UD1A 1BMV2 1EAH3 1W6PB 2ZS6B 4NO4A 5A32B 2WNVB 2ENRA 3VZOA 5CFDA 3R4UA 1C3HA 3DF0A 4QPIA 1QH7A 4QPGC 2VVDA 2G4IA 4H7LA 3RPQA 2BVBA 3AXDA 1K5MA 1WCSA 1PO21 1FOD3 3HD8B 3T1LA 2HWB2 1PK6A 2VVFA 1O4YA 2OVUA 2UWCA 5C9AB 1CJDA 4IESA 1TE1B 2P2KA 1AR71 1S0CA 4YVWA 1A78A 4P9LA 2WFF2 1ZBE2 3MPPG 1A8DA 4FTBA 2WQ4A 2PHLA 2E6VA 4UW5A 1VBA3 4K7JA 2CGOA 3H1YA 1DGWX 5KXBA 5ABJA 5T3NA 3AMQA 1G9FA 2ZGNA 4ES9A 1VBC3 3GBWA 3ZIWA 4O9EA 2DVFA 1XNBA 5GZDA 4AI3A 2ZGPA 4YGBA 3WP3A 2ARXA 5J48A 2YDEA 5JCTA 3LWCA 5AC92 1UX6A 4TYSA 4CDWB 4S2GA 1FT9A 4CEWB 2NMOA 1XRUA 1BK1A 2GNDA 1PIV3 4NVPA 4YLZA 5CFCA 3E5UA 4GWNA 2Y38A 1GANA 2VW0A 4AFBA 2P3IA 1CAVA 5ACA1 1DZQA 4OHVA 4GB31 5AC93 2UYAA 1FX5A 2R32A 3V0BA 3ZX7A 3A4UA 1Z7S1 3LA2A 1ULEA 1R093 1Z0HA 3W9AA 1CAXB 4DB5A 1OKQA 3ES1A 4XF3A 2XL9A 3TWIA 2EAAA 3ME2A 1FYUA 2CV6A 1RITA 2XWBB 4P9GA 1W6QB 4KQ7A 3L2YA 1MS8A 1Q8PA 3WQ1A 3ZFFB 1JUIA 2RJKA 3LOBA 4XF1A 4CDXA 3IPVB 5HCBA 2WSUA 4U2AA 1BYHA 1OQEA 1RVF2 4F3JA 4AQ2A 4YNIA 5C6CA 2WSVA 2JG9C 1JOJA 3AMPA 4F83A 2P17A 2MHFA 1FMD3 3UL2A 4LHKA 2DYCA 2HEVF 4Q26A 2G9FA 1DQ6A 2JG8B 3FZ3A 4KWJA 1Y3TA 5GZEA 3MLJA 4YVSA 2HWD1 2VXRA 1AL0G 5DDJ3 4YVWB 1EPWA 3SHRA 3U07A 4FQZA 2WT2A 2EF6A 4HZFA 4ORFA 4LNVA 1OI6A 4IERA 4RQPA 2BWAA 2IC1A 4FXGB 5F6LB 4FT8A 3C2UA 1K5MB 4RSUA 3FC0A 2B39A 4L8QA 2FZ2A 2GMEA 3VKNA 4LBQA 4Z82A 4BQ1A 2WFPA 4GQ7A 5EYXA 4A7ZA 3OD0A 3WDYA 1H8TA 1O3SA 1QDCA 1G7YA 1ZBE3 1F2NA 1YFWA 2K0GA 5EJ3A 4AVBA 3ZSJA 1MACA 4FCAA 2ET1A 2O0OA 1S0IA 1ZBA3 1H2NA 4EV0A 5C4WB 3KS7A 3WCRA 3POWA 4LO6B 2AGSA 2WQZC 3JD71 4XYXA 1EP0A 1BMV1 1OMIA 4JGZC 1RMU2 2HEWF 2Q0AA 4HKLA 2X5IB 3PJQA 5A33A 1RUH1 1H2LA 5JIAA 4S2HA 4C0BA 1RMU1 3IM0A 1MS4A 1ZZCA 2ES3A 3RQ0A 4D69A 1HDKA 3KM5A