1AYM3

Human rhinovirus 16 coat protein at high resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
238
structure length
238
Chain Sequence
GLPVYVTPGSGQFMTTDDMQSPCALPWYHPTKEIFIPGEVKNLIEMCQVDTLIPINSTQSNIGNVSMYTVTLSPQTKLAEEIFAIKVDIASHPLATTLIGEIASYFTHWTGSLRFSFMFCGTANTTLKVLLAYTPPGIGKPRSRKEAMLGTHVVWDVGLQSTVSLVVPWISASQYRFTTPDTYSSAGYITCWYQTNFVVPPNTPNTAEMLCFVSGCKDFCLRMARDTDLHKQTGPITQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 16 COAT PROTEIN
publication title The refined structure of human rhinovirus 16 at 2.15 A resolution: implications for the viral life cycle.
pubmed doi rcsb
source organism Human rhinovirus sp.
molecule tags Virus
total genus 40
structure length 238
sequence length 238
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1aym300
1QQP2 1VBA1 5ACA3 1ZBE2 5FOJB 4N53B 4GMP1 4FSJA 1AYN1 1OPOA 1C8NA 5A33A 2ZTNA 1NY72 1VB4A 4CEYA 2R043 2RM21 4CDXC 1ND2B 1RUH1 1BMV2 2PLV3 1RUD3 1QQP3 3S6PA 5C4WB 2BFUS 5A32B 1HRV2 3ZFGB 3CJIB 5C8CB 2HWD2 2RS52 1RMU3 1PO12 4Q4Y2 4FTSA 2MEV3 1FPN1 1H8TA 2DF7A 1F8VA 1FMD2 2BPA2 1AL0G 5BNNC 1QJU2 1Z7S1 1RVF2 2HWF2 1AR71 2R072 5BNPA 1HXS1 1PVC2 1FOD2 2RS31 2XBO1 2RS53 1D4M2 4Q4Y3 4RHV1 1NOVA 1H8TC 3VBRC 4CDXB 1VAKA 3JB8A 4PDWB 1FMD3 1BBT2 1QJU3 1RVF3 2R073 5BNPC 1NA1C 1RUI2 2BBVA 2WZR2 2HWC2 2HWB1 1EV13 1VRH2 1D4M3 4IV1C 1VBD2 1RUC2 1RUF3 1BBT3 2RMU2 1ASJ2 4QPGA 5BNNB 1EAH1 4FTEA 2ZZQA 1QJX2 4AEDA 1PIV2 1R081 2WZR3 4WM7C 5L7OC 4Q4V1 1PGL2 1MEC1 1RUC3 4Y5Z0 1H8TB 3VBRB 1AR81 4Y4YA 2RMU3 1ZBE1 1RUE1 4JGZC 1VBC2 4QPIA 1VBB2 2X5IA 2WS91 5BNPB 4AEDC 4CDWC 2QQPA 2XPJA 1NA1B 1V9U1 2RS13 1PIV3 2RR12 1C8M2 1ND3A 1BMV1 1SMVA 1IHMA 1NCQC 5FMOL 1COV2 4IV1B 1HRV1 5D8AA 5BNOC 1ZBA1 1MQTA 5AC92 2HWD1 1AYM2 1VB2A 2X5IC 1POV0 2R063 1PO11 2FZ2A 2FZ1A 2RR13 4YVWA 1C8M3 1ND3C 4CDUA 3DPRA 4CDQC 1FMD1 4WM7B 1RVF1 2HWF1 5L7OB 1COV3 4RS5A 3VBHA 1PVC1 1BEV2 3HAGA 1FOD1 1RMU2 5AC93 1AYM3 4JGZB 1K5MA 2MEV2 1R093 1B35A 3JD71 1CJDA 3ZFEC 1AR63 4AEDB 1TME3 4CDWB 1AL21 2WWSA 3VBFA 4CDUC 1AUYA 4YVSA 1BBT1 5DDJ2 4SBVA 5C9AA 1NCQB 1POV3 1BEV3 1HRI3 1RUI1 1RUG2 2WZR1 2HWC1 3NAPA 4CEYC 1K5MC 5ABJA 5BNOB 5FMOS 2X5IB 4Q4X1 3VBOA 1VRH1 1VBD1 4RQPA 4EJRA 1ND3B 4YVSC 1RHI2 4NWVA 1ASJ1 1OOPA 5DDJ3 4CDQB 2GH8A 1QJX1 4BCUA 1AR91 4GMP0 1EV12 5K0UA 1RUG3 3ZFFA 3J8F1 1OHFA 1PO22 1RUF2 1PGL1 4RQPC 3ZFEB 1VBE1 4WM8A 4CDUB 1RHI3 3JBG3 1VBC1 2HWE3 4CEWA 1VBB1 2RM22 2WFF3 1C8M1 3M8LA 3ZFFC 5A33B 5ACA1 1PO23 3TN93 3VBSA 4CEYB 1K5MB 1COV1 1RB8G 5JZGA 1PGW2 2BUKA 4GMP3 4YVSB 4CEWC 2RS12 1AYN3 2R041 4Q4W2 2RM23 2PLV1 1RUD1 1RUH3 5CFDA 1QQP1 4N53A 1Z7S2 1A6CA 4QPGC 5JZGC 4N43A 4FTBA 4RQPB 1BEV1 1ND2A 2RS32 1RMU1 2R062 1NY71 2MEV1 4Q4W3 5C4WA 1FPN3 5CFDC 3ZFGA 4RR3A 3CJIA 3ZFFB 1Z7S3 1AR73 3VDDA 4QPIC 4N43C 3VBUA 1R092 2RS33 2RS51 2VQ0A 1RUG1 4Q4Y1 2IZWA 1AR62 1TME2 2HWB2 4CEWB 1R1A2 3FBMA 4RR3C 3CJIC 1QJU1 3JB4C 2R071 4GH4A 5D8AC 5CFCA 3VDDC 1MQTC 1HRI2 1CD3G 5J98B 1RUJ2 3VBUC 4QPGB 5JZGB 5LK7B 1X36A 1EV11 1D4M1 4YVWC 4PDWA 2HWB3 1DDLA 1R1A3 1MEC2 4JGYA 1RUF1 3DPRC 5J96B 4GH4C 5CFDB 1AR82 5CFCC 4RS5C 1RUE2 3VBHC 1EAH3 2WS92 4LLFA 1RUJ3 1V9U2 4QPIB 1B35C 1R083 4N43B 2Y26A 4PDWC 1RUC1 3VBFC 4Q4V3 4JGYC 5BNNA 1MEC3 4Z92B 3LOBA 3ZXAC 2RMU1 1QJY2 1W39A 3JBG2 2HWE2 1AR83 4RR3B 5C9AC 1ZBE3 1RUE3 1ZBA2 1PGW1 1TMF2 4GB32 5D8AB 2GSYA 2RS11 2WFF2 2WS93 1PIV1 3IDEA 3NAPC 3VDDB 4Q4W1 5ABJC 1MQTB 4IV3A 1V9U3 3TN92 3VBOC 3VBUB 1VBA2 3VBRA 1HQNA 1QJZA 4YVWB 1X33A 1HRV3 1QJY3 3DPRB 1OOPC 1NA1A 5GKAC 1AYN2 1ZBA3 1TMF3 4GB33 2HWD3 4GH4B 5CFCB 2R061 4RS5B 3VBHB 1M06G 5K0UC 2RR11 1RUH2 3JD72 1PO13 4IV3C 1F2NA 4IV1A 1NCRA 4RFT0 1AL22 1VBA3 1HX6A 1B35B 2HWF3 4WM8C 3VBFB 4JGYB 1GFF2 1PVC3 5AC91 2ZAHA 2TBVA 1AYM1 1FOD3 1R091 5C9AB 1FPN2 1AR61 4WM7A 1TME1 3JD73 4Q4X2 3VBSC 5L7OA 3NAPB 1R1A1 1NCRC 5ABJB 1AL23 1AR72 3VBOB 4NWWA 1HXS2 4JGZA 1POV1 1HRI1 2XBO2 4CDWA 1RUJ1 1OOPB 1AR92 1RUI3 2HWC3 4RHV2 3J8F2 5A32A 4Q4X3 1VRH3 5K0UB 5C8CA 1VBD3 4IV3B 4N53C 1NCQA 1HXS3 1VBE2 5DDJ1 5BNOA 1ASJ3 1ND2C 2BFUL 4WM8B 1QJX3 2XBO3 1AR93 5C4WC 1NG0A 3TN91 4RHV3 3J8F3 5ACA2 3ZFGC 2WLPA 5C8CC 4CDQA 3VBSB 1WCDJ 1RHI1 1NCRB 1QJY1 3JBG1 1EAH2 1VBE3 2HWE1 1TMF1 4GB31 1VBC3 1VBB3 1R082 2R042 2WFF1 4CDXA 2PLV2 1PO21 1RUD2 3ZFEA 1E57A 4Q4V2
chains in the Genus database with same CATH superfamily
1QQP2 3ABZA 4KWLA 4H7LA 4QQPA 4F3JA 3WHUA 1QWRA 4GWJA 4IE6A 4HANA 1JHNA 2VMIA 1IS3A 2W1WA 5DUXA 3ASIA 4XQDA 4N53B 4GMP1 2B9VA 4UW3A 4YM3A 4M01A 4FSJA 2J42A 2R32A 2XG3A 4ZZ8A 1NY72 5F37A 5FY5A 4OYUA 2WAOA 2RM21 4P08A 2Z79A 4Q0VA 5FP3A 1W6QA 3MHZA 3BI3A 3LE0A 2ES3A 1MS5A 1QQP3 2AACA 1O5LA 2VH9A 2TNFA 4FXKB 4Y22B 4HZFA 3V0BB 4NIIA 5GLWA 4YZ2A 3BB6A 3BOPA 5T3NA 2ADEA 3CJIB 1OH4A 2HEYF 1I5PA 1SLLA 2UWBA 4HKOA 4MGTA 1SHWB 4Y20A 2RS52 3ROUA 1KFUL 1UYPA 2ZGKA 5CVRA 4Q4Y2 4UWDA 4LBMA 5IT6A 2CAVA 1FPN1 3VKOA 3ZMNA 2OUHA 3NV4A 1H8TA 1LKNA 4IEZA 1W90A 4PT6A 5LY1A 1S0CA 3PVBB 2B46X 2GNDA 2CHHA 1T6BX 2F6BA 3MIEA 1AL0G 1AX2A 1QJU2 1DYOA 2HWF2 5HCFA 2JDYA 2QQVA 1AR71 4M0HA 4QM9A 5FY1A 5BNPA 5L36A 5A7NA 1CESA 2XJPA 2Z42A 1AX0A 3I2GA 2Y6JA 4XF1A 3USUA 1FOD2 2A6VA 3OYWA 4FCAA 4HSJA 4XJZA 1U5IA 3KMHA 5DG1A 3WNLA 1YQCA 2RS53 3SH5A 3M1HA 1Q3EA 1VLNA 2RE9A 2ZGMA 4Q4Y3 4PCRA 3T4HB 3DEMA 1BVP1 4UOJA 5LBBA 1BBT2 1QJU3 2C9AA 2PHDA 4QB2A 4BYYA 2RJLA 1GOGA 3WQ7A 4QHBA 3WW2A 2CV6A 3B02A 4FPKA 2BBVA 5FRAA 4K1YA 2WZR2 4P9YA 5LA2A 4D8MA 4DO0A 3HJRA 1W9YA 4D7YA 3A7QA 5FZ7A 5FWJA 3OD0A 1MS0A 1UX7A 1VBD2 3D5OA 4XUQA 3VZNA 1RUC2 3WP6A 4CCMA 3B7MA 3O5SA 4HFSA 2VBDA 5T52A 3KHCA 2VZTA 3OD4A 1TZOA 2DVBA 1Q8OA 1C5IA 2YBPA 1BBT3 4IEYA 4AW7A 4YG3A 2VUAA 4QPGA 2OX0A 5KHHA 3ALQA 5A70A 4LT5A 3OF1A 1QJX2 1GP5A 1Y3TA 3KQRA 2QQIA 3FUOA 2WNUA 1CAXB 3ZOIA 1GP6A 1PIV2 4BQ4A 1R081 2D6OX 2WZR3 1X8MA 2JDZA 3KF5A 3H8XA 2F4LA 2FQPA 3H9AA 4IESA 2YY1A 5C70A 5GZDA 2ZCWA 5FV3A 1WWYA 1RUC3 3ACLA 3KSCA 4PLMA 1LU1A 2IFWA 5AVAA 4QD2A 1YI7A 4NVPA 3VKNA 3PNAA 4LTAA 1GU3A 5JUVA 1AR81 4Y4YA 5FPXA 1IQAA 3WT3A 4QGMA 3POIA 1PVXA 2UU8A 5FYBA 4AEDC 4HKWA 4URAA 1PIV3 1AJOA 4J1XA 2WBKA 3PUAA 1OFNA 5LATA 3VKMA 4A7KA 4CSWA 2A71A 2WNVB 5H9QA 2VULA 4NPMA 5LZ6A 4P9JA 3ETQA 2C5DA 2XQRA 5FMOL 3SH4A 1G9BA 4WBBA 4YW1A 2V4VA 5JXHA 2EXIA 2VZRA 3WG2A 3DN7A 1YO8A 4QB6A 1O7FA 5AC92 2C4XA 2X5IC 1W28A 4AWDA 1GKBA 1GQHA 2QZ3A 4JCKA 2FZ2A 3BTAA 4GWIA 1F4AA 3WF2A 2FZ1A 1AVBA 1C1FA 2R0FA 3MYXA 5FWEA 3THCA 4A44A 5KBFA 2FCTA 3DGTA 3E5UA 4LK7A 2D93A 3P3PA 1SACA 4BXFA 2K2SA 2YBKA 1GZWA 3GDBA 2XLGA 4S2DA 2HWF1 5L7OB 1SBEA 4XFAA 5FZKA 2C26A 5FLIA 1YFUA 3VBHA 2ZABA 2ZA9A 1RXGA 1FV2A 2PQQA 4FT8A 4JKMA 4RL7A 4ZU5A 1DU3D 1CN1A 4BXSV 1FOD1 5JXIA 5AC93 4Z07A 2O8OA 4AZZA 5F3CA 4JGZB 4HL0A 2MEV2 1DHKB 1SDWA 4I3PA 3H50A 5T5LA 4Z8BA 3IIIA 4FFHA 1N1VA 2ARXA 4FQZA 4HBNA 3M2MA 5FZLA 1JOJA 3UJQA 4DFSA 1QEXA 2CGOA 2I2SA 1U5ZA 1AL21 1BHGA 1HKDA 1S55A 1SFPA 2DU0A 2VNGA 3I3EA 4JQRA 4A3ZA 4CDUC 4CCEA 4DOUA 3O1RA 1NE6A 3JQWA 1BBT1 1DFQA 4CCKA 4SBVA 1PZ8A 1SEFA 3WV6A 1UPIA 5FQ0A 5FBJA 2QBXA 2XLAA 4OI1A 3RZKA 3WG3A 3B94A 1LRHA 1UY4A 1V6MA 5T54A 5BNOB 2WZR1 4CEYC 4BQ2A 1K5MC 1XXNA 3GYDA 2P6CA 2YZ4A 3MIFA 3NWKA 4JDNA 3J7HA 4KU8A 3RSJA 4BQXA 5A6XA 2BVVA 4UW6A 2QVSB 1VBD1 1UKRA 4FOQA 4ASLA 4H2AA 5LBFA 3WNPA 1QXPA 2VNRA 2ZACA 3GHMA 1ND3B 3NNMA 4YVSC 3UYJA 3ZKYA 2BOIA 4A3XA 2EAAA 1CZVA 4NWVA 2HKXA 5K4LA 1H9WA 3W21A 4XURA 3USSA 5GZCA 1QJX1 4CP9B 1D2SA 5IVVA 4XABA 2BGPA 4LBJA 5GM0A 2A6WA 1OHFA 4AVCA 1PZ7A 1JYNA 1RUF2 2VMDA 4I30A 5JDBA 1V0AA 4NUBA 1IG0A 4NHKA 5CU1A 4RQPC 3ZFEB 2D43A 2XHNA 2LROA 1SQ4A 2R0HA 5A3NA 2O1QA 2O14A 1OBNA 4CE8A 3MLKA 5DAQA 4MHUA 3SCHA 1APNA 2VBPA 2VBBA 1HJGA 4BWOA 2AH2A 3AMQA 4HK9A 3HN1A 1E5HA 1XSQA 2VMCA 1S0JA 2QQKA 1WBFA 3M8LA 5FZBA 2GALA 4DXTA 1PX4A 3DXUA 4AF9A 1F5JA 1EPWA 3NV1A 1WW6A 4E8CA 3NV3A 4RYDA 1W6QB 1OI6A 2ZS6B 3FBYA 2IXHA 1CAVB 1SFNA 1J3PA 2VZVA 4CEWC 5L19A 4Q2FA 5T55A 1QIQA 4HG6B 4XFCA 3GF6A 2WL1A 3T2TA 1DIWA 1GBGA 3ILNA 4LKFA 5L73A 1RUH3 4Y20B 2YXSA 3WF0A 1TNRA 1WZXA 2VOKA 4LBNA 4HETA 4YARA 2HYKA 4V1PA 1SG3A 3LEKA 1DZRA 4YG0A 2WLQA 2XLFA 3I4IA 3C8XA 4JRAA 4UFHA 2P3KA 2VTXA 1LESA 3J26N 3APBA 2HEWF 1KDKA 4P00B 4QX2A 4RD7A 1G9CA 3ZR5A 1ND2A 1S2EA 4KQ7A 4Q8LA 3WDUA 2VNOA 1V00A 4LQRA 5FPZA 4EN6B 5I0RA 2MEV1 3HBKA 3OYWB 2RJ2A 4NPLA 4LHKA 1H9PA 1GYKA 1V6JA 3I59B 5FXWA 4ARYA 4DUVA 5CFDC 4NR1A 3ZFGA 3K4ZA 1NT0A 4IE0A 3UESA 1W6NA 5D21A 1X8EA 2FDFA 4EN7B 3ZFFB 3MV11 3OG2A 1XOYA 2A5ZA 2AREA 4QHOA 4UI9L 1UYXA 3BYWA 5KC5A 2A6YA 3ZXJA 3SC7X 3RPQA 2P1BA 3BOWA 3LZZA 3D4KA 1ZA7A 5ANQA 1QJFA 4XC9A 4BU2A 4Z2AA 1R092 4FPYA 2I07B 1NUKA 4KU7A 1DYPA 1TME2 4HK8A 5LASA 3J9SA 1JOPA 3AL6A 2EIGA 4RR3C 1QJEA 2D6PA 2HH9A 3IMMA 4XZPA 3S57A 1IOAA 4XVHA 1H6YA 3UK9A 4Y24A 3E5QA 4NHXA 1D2QA 1HN1A 3ZXFA 1F4HA 5J98B 3UETA 4QPGB 1JYXA 1Q8SA 1XSRA 3VHPA 2DUPA 3MI8A 3FE5A 4FPLA 5I0DA 4PDWA 1CX4A 1S0GA 4EZHA 3OOXA 3ZSLA 3K3NA 4X6QB 5L9BA 3M3OA 4PF5A 1RUF1 1BK0A 2PYTA 5FY0A 5FKBA 1HB1A 2VZPA 1OF3A 4LO4B 4RS5C 3IAQA 1UIJA 2ZGSA 1CR7A 5J7MA 1UL9A 2VNVA 2YC4A 3NW4A 4JHZA 2WIIB 4U2AA 2FDGA 1WA4A 2VR4A 1EYBA 2JXAA 5FFOC 4XW3A 4AHZA 1B35C 1UU4A 4N43B 3UGFA 2Y26A 3K75B 1UQXA 2B45X 3CNAA 3W9AA 1H1MA 4L97A 4AAPA 3R4DB 3KT4A 2A6XA 1U12A 2LRPA 5FZ3A 3S7IA 5FMDA 1QJY2 2AR6A 1ZBA2 3AZVA 4XF3A 1TMF2 4GB32 4M3CA 5J09A 5FZ0A 4PHZA 4YZ5A 3IDEA 2G19A 2VM9A 5FTTC 5BXXA 3VDDB 4IERA 2BWAA 4TXWA 5FYUA 5I0SA 2FDIA 2W46A 5T50A 4YZ3A 4I0BA 4HXCA 5FZCA 2XVKA 1X33A 2FHRA 3HD8B 3RMYA 1YCIA 2J1AA 1QJY3 3RZHA 4Y33A 3KD4A 2XVLA 1GZWB 4FVVA 4NRPA 1ZBA3 3B69A 3ZYGA 1TMF3 2LW8A 2HWD3 4GB33 4GH4B 4G3YC 2WC2A 3VBHB 5K0UC 1Q43A 2P6HA 1K3IA 4JRLA 3ETPA 1DQ0A 1OC1A 1PO13 1UOBA 2OW4A 1YYNA 1LENA 2Y38A 3EQEA 3M3IA 3N35A 2WWUA 2QFEA 3V56A 2VTXJ 5F7UA 2XL7A 1HX6A 2RVAA 2WKKA 3CBNA 3WSOA 2VQTA 5LEJA 3O1PA 4K8RB 1CIWA 1GNZA 3OBTA 4I02A 1ENSA 5AVPA 1TNFA 3T0DA 4M00A 2VY0A 1JYIA 1N3QA 3H0OA 1HQWA 1UCXA 1F15A 4FFFA 1XNTA 3WF3A 4AGGA 1R091 1S0BA 2JECA 4Y1ZA 2D97A 4E2SA 5FQ0B 2YYOA 3LA3A 4BH9A 3P3NA 1YIFA 1TME1 3JD73 1QKQA 4ATFA 1F5FA 4C1XA 1NCRC 1JXNA 2ID4A 4E2QA 3RZGA 4PLNA 2ETEA 4IE7A 3CLPA 4NWWA 2ZMLA 1JUHA 1S4CA 1H2KA 2ZBJA 1U0AA 3T0BA 1HLCA 4C0BA 2QJVA 2JB4A 3KB5A 4YW7A 4XFBA 3KVAA 2BEOA 4XUTA 5FDBA 3ZR6A 1AR92 3U37A 1LR5A 4Y22A 4DMIA 1NQDA 3V0BA 4LO7A 3KHBA 1CQ9A 4LLOA 2ORXA 4ZS2A 3C7EA 5FYHA 5J1XA 3DYOA 4K6BA 4AQ2A 3MFAA 4AI8A 1IG3A 1W2AX 3MGUA 3EHKA 3T2OA 1XNCA 3HQUA 1VBE2 5FYIA 5DDJ1 3BODA 1GQGA 4B7KA 1SLBA 2RDRA 3NKGA 5DAWA 4CCDA 4R9DA 5HCAA 1OQEA 1F31A 4XILA 3WQ0A 4FPHA 4B1LA 2V72A 4LO6B 4NJ4A 4WZFA 1AR93 4IEVA 5C4WC 3B9IA 1FAYA 2E26A 2W94A 4GIQA 3Q8CA 1Y9MA 4KH9A 4WZCA 4UFIA 3ZYBA 1SLTA 1X50A 2AC1A 3HNYM 5HV4A 5F39A 2Y64A 3PMSA 1JHJA 5FPAA 1QJY1 3V64A 1EAH2 1VBE3 1IS4A 2LS6A 2Q8OA 3UL2A 4P5YA 3TBDA 3WEZA 5JSRA 5FZGA 3H8UA 2XJUA 1TMF1 3CZJA 1VBC3 4GB31 5F5IA 3U4SA 1VBB3 2K0GA 4DB5A 1L7QA 2Q1ZB 5EIYB 4EN9B 2P17A 4DIQA 1GLHA 3T2QA 1W6MA 2JG9B 4H7MA 2R1BA 4AQTA 3RJRA 5CKMA 4CP1A 1PO21 1RUD2 3MUY1 4WVMA 3GCXA 2PHFA 3O0XA 2A70A 4CCOA 3HQXA 4IEPA 1WLCA 3NMBA 2VOVA 1AJKA 4FFIA 1J1LA 4MXWA 2OXBA 3VD7A 3RG0A 1DGWX 1UKGA 4COVA 3NJZA 4Y5TA 4LOTA 2ZHNA 4QGNA 4S2FA 4GKXA 3O1SA 1LCLA 1VB4A 2WT1A 4CEYA 5F9TA 1EUTA 3U07A 4LMFA 2JG8B 4ZXKA 4MOAA 1ND2B 3BTZA 1SCRA 2X8KA 1Q56A 1RUD3 2PHTA 2QE3A 3TAYA 4B4PA 4V2VA 4C8DA 4PI2A 4AE2A 3FHQA 5CKNA 3WW3A 2EIEA 5A32B 1LULA 2C0ZA 4OZOA 1CAXA 3ZFGB 1BXHA 2W0XA 1W6NB 4JTNA 4ASMB 4S2HA 2XUEA 3ZYFA 3W59A 1UY0A 3NQHA 1DGWA 1DQ6A 3PU3A 1VALA 1RMU3 3H7JA 3OGVA 4X8NA 1URXA 5LY2A 1FI2A 2WUHA 1IKQA 4CU7A 2E7TA 3LA7A 2GMMA 4ET7A 4IETA 2D5HA 5C3PA 1UZ0A 2DF7A 4QWNA 1WUVA 3EBRA 2BPA2 4P9GA 1A34A 1Z7S1 4XOGA 2R072 3LPGA 1Y9GA 4EQVA 4AFBA 1PVC2 5BY5A 5FXVA 1UXZA 2QQOA 4FOVA 4XJ8A 5FP8A 4BOWA 2YV8A 5IK8A 5KHJA 4QGLA 2EICA 5ANNA 4HN0A 3THDA 2WZEA 4TYSA 4XAEA 4JVAA 4DPNA 4Q0UA 4EN8B 5B4NA 4B29A 1NLSA 1FNYA 3K46A 4JTOA 3VBRC 2BERA 4A42A 2YPDA 3ELNA 1VAKA 4MZUA 4WVWA 3RI8A 4PDWB 1S2KA 3O0VA 1ZZ9A 3AJYA 4B3NA 4IGPA 1JW6A 3H8OA 1DZTA 4L8QA 2R073 5FMBA 5BPXA 3G6JB 2G9GA 3POFA 5I8SA 4CCNA 5A1LA 4HONA 1V6IA 3DUIA 3ON7A 4FPFA 1RUI2 3R4UA 4XMIA 1JZ6A 1WCKA 5FYCA 2XXZA 3JUUA 4INDA 2HWB1 1O4ZA 3MIBA 3AZXA 1EV13 2WT0A 3WW1A 3V65A 1PNGA 1PZ9A 3K4AA 2ZEWA 1VIWB 2FMYA 2QUOA 5FP4A 1W04A 3HR9A 3L2YA 5LBEA 1JZ7A 2RMU2 3PIGA 4LKEA 1H2MA 2DUOA 4HN1A 5IW0A 3OPZA 1EAH1 3Q8BA 1W8NA 3B01A 1OLMA 5G05L 1SCSA 1W8FA 2AGSA 1W6PA 3PIJA 3VHRA 3AB0A 4S2GA 2VMGA 3M7AA 4M3CB 4P9LA 3WNXA 4WM7C 5JXGA 1XNBA 2DDUA 3FUQA 3CL1A 4A41A 1MEC1 2DVGA 1UYYA 1SZBA 2BW8A 4OHVA 1CWPA 1H4GA 1NLRA 3ZPYA 5LB6A 2RMU3 1RUE1 3TEYA 1LNSA 1GZ9A 1SLAA 2PAEA 1YQ2A 1GUIA 1I9RA 1O8SA 3SXWA 2V09A 3N4MA 2WJSA 5FZ6A 4CDWC 2XPJA 3GCWA 5F6KA 1S0EA 2RR12 1C8M2 5D1IA 4BA6A 1ND3A 1JU4A 1W3XA 1BZWA 1SMVA 4XF0A 4IEQA 1IHMA 3KGLA 4K20A 3AP7A 2UYBA 2P5BA 2E7QA 4OUSA 1COV2 1S0IA 2V5DA 4CP9A 2VG9A 3JQXA 4MV2A 1L3JA 3LIHA 2C1FA 4LHLA 2PQSA 4QDSA 4RN5A 2CAUA 2JDMA 1AZDA 1VB2A 4AEKA 2Y6HA 2CWMA 4J1WA 5C3QA 1BYHA 4YM0A 2R063 4LA3A 2CGNA 2GN7A 5FKCA 2UWCA 2RR13 3AZYA 1C8M3 2UY8A 1XBFA 2ZX3A 2ZGQA 3ORJA 2QQMA 5FPUA 3NNLA 1ULEA 3KVBA 2G1MA 1YJLA 2OUJA 1GV9A 1COV3 3KT7A 4RS5A 1JYWA 2D6MA 1PVC1 3M4FA 2BTVC 2YROA 1BEV2 1OPMA 4SLIA 1JZ4A 3UKTA 4F7ZA 1WMEA 4KGQA 4PLOA 4YW5A 1A3KA 2MPFA 1PNFA 2ZEZA 5F5QA 2ZHMA 1B35A 5FY4A 2PHWA 3OGSA 2E53A 1CJDA 4QT6A 3WINE 1AR63 1FATA 1BCXA 3AVRA 3K3OA 4AEDB 3BCWA 1CAVA 1HB2A 1VE0A 1FX5A 1LGNA 1QU0A 2I45A 4CPBA 4DRRA 5IYYA 2WA3A 3D82A 4Y1VA 5A3MA 1WBLA 1MACA 1DZQA 2Q1MA 4JDMA 1UO9A 1BEV3 4AI2A 3VB9A 3O1MA 2DCKA 4LUKA 1HRI3 1RUI1 5FO9B 2V4AA 1RUG2 1GP4A 2YMZA 1JU3A 2X5IB 4IQPA 2BQPA 4BIFA 2P2KA 3B9CA 1IGOA 3RRDA 2VMHA 5BNQA 2ERFA 2V5YA 4QX7A 4EJRA 3WCSA 1MVQA 1JI6A 4XQWA 2HEVF 2VUDA 1DQ4A 3HEIA 4YGEA 1M4WA 2G9FA 2ET1A 2ZJCA 1LOAA 3LSEA 4J6GA 5DZFA 1JZ2A 2VOWA 3WXPA 3OPWA 3I59A 1IKPA 2JJ6A 3C7FA 4URTA 4I01A 5K0UA 1RUG3 1R64A 4UAPA 2TUNA 3RDIA 5C71A 2ZGTA 2H0VA 3I7DA 3J8F1 3ZFFA 4RGKA 5C3RA 5JI9A 5KHIA 2X29A 1NZIA 1UZZA 2Z5WA 2VW0A 3I2KA 4MYEA 1W6MB 3ZSEA 2DU1A 1XNAA 4WVMB 3TRSB 4N90A 4AHXA 4CDUB 4LBKA 3PMEA 2VUJA 3IT8A 1GSLA 2HWE3 2ZGUA 4AXOA 4ONUA 2VZUA 4M4PA 1MR5A 3K77A 4MXWB 3O1UA 3HT2A 2PFWA 1V6LA 3QACA 4Q0QA 2J1SA 4A6OA 1GICA 1C8M1 2WQ4A 3IM0A 4P5HA 4RSUA 2Q8DA 3VN4A 5A6YA 3TN93 4JC1A 4CEYB 2PXJA 1K5MB 4QHZA 3TEWA 2ADDA 2QQWA 2VCMA 2GNBA 4XHXA 1GWLA 1OXCA 1COV1 1QDOA 3AYAA 2Q1FA 3K4DA 4PI0A 1RB8G 5A6ZA 1S1AA 2PN5A 1VRBA 1AX1A 1GWMA 1PGW2 1UPSA 2BOJA 2EXJA 2QNKA 3OUJA 3AFKA 4Q0SA 4YVSB 4CU6A 3BIWE 1AYN3 3ZYPA 3FHIB 4Q4W2 2ZMKA 1A8DA 5APAA 3LGRA 3POYA 4LKSA 1NXMA 4ZONA 2D5FA 3AJZA 1QQP1 1ENQA 3FFQA 5JMOA 2WABA 4XF4A 4QX0A 2VQUA 1LEMA 4CP2A 2XONA 4YGCA 3BUCA 3OEBA 3LD8A 2DURA 2JDKA 4AI0A 4N43A 1W8WA 5JZGC 2VVFA 4RQPB 2HBUA 2ZX0A 1BEV1 4AR2A 2RS32 5FZ9A 4XUOA 4BK4A 1ZNPA 5C6CA 1NY71 1OT5A 5D2AA 2D3PA 4QX3A 5F2SA 1OMIA 3JD72 4Q4W3 3SQOA 5JOWA 4AOCA 2IXLA 5C4WA 4PIYA 1TG7A 2XVGA 5EJZB 1W8TA 5IFPA 1N1YA 1QHDA 1JMUB 3I97A 4YWAA 4BQ1A 1I6XA 3D3AA 4UW5A 2Y33A 2P34A 3CMGA 3ZO0B 3ES1A 4EV0A 3HIFA 4YPJA 4YW6A 2YFZA 4AVVA 2ZMNA 3I8TA 1H1AA 2GH2A 3VDDA 2XUMA 2W39A 4XFIA 3H1YA 1G9AA 4QPIC 2GP3A 3SITA 3RVHA 2RS33 1LOFA 3NNFA 2GC0A 4LBLA 2JDUA 2B7YA 2EALA 2RS51 4MHRA 3ZXEA 1RUG1 2GP5A 5HV0A 1A78A 4Q4Y1 4A2UA 2R30A 4KWJA 4CEWB 1X9PA 2D3SA 4Z82A 3MBWA 1OKOA 4XBNA 4M3CF 3Q8EA 5KC6A 3ACHA 3GM8A 4QXCA 3CJIC 4FO9A 1QJU1 4LBOA 1DLCA 3AK0A 1J3RA 5I91A 4GH4A 3SKJE 4BQ3A 2KA3A 3KF3A 1KS5A 1MQTC 1UAIA 3ES4A 5I8TA 4OUEA 5E8AA 3HT1A 4GD4A 1RUJ2 4R52A 3VBUC 4KMQA 4AVTA 4I3GA 3KCXA 1PM7A 3FZ3A 5CYYA 1GZTA 4YVWC 4CCCA 5KHKA 1W6PB 2E31A 4LR4A 4CXXA 3S5QA 1YJKA 2FD8A 2UY9A 1XNDA 1Y43B 2VU9A 4R4ZA 2VOTA 3WR0A 2HLEA 5CFDB 2YU1A 5C5TA 5CFCC 4KI5M 3ENRA 1JN2P 4FAHA 2W68A 4UFJA 5A3TA 1ALYA 5A7SA 2JKXA 1W99A 3H3ZA 2QDRA 2WS92 4W4ZA 1DF0A 3BKZA 1D0HA 1RUJ3 5DUVA 3UKNA 1V9U2 2IC1A 4A6SA 2AUYA 3WNKA 2J1VA 3WP4A 4BIOA 2R6QA 4BQ5A 4GZ9A 3POGA 1RUC1 1XYOA 1G7YA 4Q4V3 1BK1A 5C7GA 4JGYC 2Y6KA 3LFIA 2FCUA 2WQZC 4LBQA 3MF6A 2P4EA 1W39A 4XUPA 2HYXA 4D7TA 2EAKA 2BJSA 3AZZA 4RR3B 1ZBE3 1PGW1 1XRUA 3GALA 1XPWA 2GSYA 4MGZE 5E89A 1DGRN 2CYFA 3AKQA 2WS93 1PIV1 1ZZ8A 3T08A 4GWMA 4Z1VA 4Q4W1 5ABJC 1KXGA 5L9VA 1V9U3 5GLTA 3BPZA 4A45A 1JH5A 3NO8A 2GZWA 3VBRA 4AHWA 5F8PA 1QJZA 1NE4A 4XXAA 3TEXA 3WG1A 4ZZ5A 3VKLA 1PM4A 3FLTA 3ZVXA 2DFCA 1HRV3 5KXBA 1RJ8A 1WMXA 4Y3OA 5GKAC 2NZ9A 4HT1T 1FV3A 4PIZA 3RYPA 4AFMA 5LBCA 1HQLA 4RS5B 3VZJA 2XL9A 1RUH2 1BLZA 3WF4A 4IV3C 4MO3M 3KQ4B 3AMMA 4N8MA 4DEQA 5FPVA 3GJAA 3P5BA 4AG4A 5DZEA 1X9TA 3WDYA 4E4DX 5B2GB 3MFCA 4RFT0 3MLLA 1A8MA 4YZ4A 3WG4A 3HNBM 4LNVA 1B35B 4LE4A 3GGLA 3IZOA 1YEWA 3ECQA 5IVEA 2JG9A 4QPYA 5FZMA 5AC91 3QH6A 3L2HA 2D6KA 4CPBD 5IK4A 1QXRA 2E9QA 1TVGA 2LM3A 1ENXA 3POBA 2R7EB 4WM7A 4Q4X2 3VBSC 2PHXA 3C3VA 3WX5A 4QXKA 1VR3A 5CFCA 5JOXA 3I2FA 4OHXA 1HXS2 3D0SA 5FK7A 2CSGA 1GOFA 3MW2A 3OTFA 4OZXA 5HI0A 3NL1A 4FAGA 3OGGA 2KM2A 2JG8A 4RFRB 3GHNA 4O9GA 2R49A 3J7LA 2O0OA 1CPNA 4FBFA 4CDWA 1RUJ1 3LCPA 1ZRFA 4B1MA 2ZOEB 3KV6A 4HPKB 2HWC3 3CKHA 1YFXA 4RHV2 5A32A 1EP0A 2IUWA 4CVUA 3I2HA 1XNKA 2EIBA 4UW4A 2W1SA 4Q4X3 4YLZA 1VRH3 5K0UB 4LUMA 1UWWA 5FUNA 1PK6C 2CY6A 3E5XA 2DFBA 4N9HA 3RWNA 5HBAA 1HXS3 4J25A 2RV9A 3NNJA 1HJFA 2VCAA 1ASJ3 3NNGA 3UKVA 4XDOA 3ACIA 4N7UA 3UGHA 3PHMA 1VAVA 3MF9A 4KG8A 2A3XA 2PA7A 2Y6GA 1RJ7A 4LITA 1YHFA 1L7LA 4RHV3 2OIIA 4XJUA 5ACA2 2W3JA 1ZYBA 3AM2A 2WLPA 5FPLA 4OVEA 4K21A 4D6RA 1CZTA 5C8CC 3BIEA 3WW4A 2OQ6A 1D4VB 5DXDA 5BUVA 5J37A 1WCDJ 2IXCA 1OUXA 3AKTA 1NCRB 2ZAAA 4HVQA 3QLQA 3ZX7A 4DY3A 4NHLA 1ST8A 3PVOA 1J84A 1E5RA 2R042 3GBWA 3AP6A 1IPJA 4LJHA 4LEJA 5ISLA 3BTYA 2PLV2 4ZU4A 1E57A 5FZEA 3WP5A 2IVJA 4XE9A 5I0TA 2X09A 2YFUA 1QY4A 5ACA3 2CDOA 2EXHA 2FDHA 1O5UA 2NP0A 3WY6A 5EJ3A 2IXJA 2VE1A 2DV9A 4OFGA 2ZPXA 2J1UA 3ACFA 4KWKA 3MIDA 5FOJB 3LB9A 4MGIE 4NROA 4AGRA 3WHTA 5A33A 1C8NA 1LGBA 4DUWA 5SV8A 2R043 3V0AB 3RZLA 4CDXC 1J1TA 1RUH1 1WW7A 2VVDA 2A3YA 2ZGPA 2PLV3 1D0GA 3B5LB 5T5PA 3S6PA 4ARXA 4Q29A 5C4WB 2WYSA 4IEXA 3GZUC 4CU8A 3GBFA 3E6BA 4IDZA 3MICA 1WMFA 2HWD2 1RIRA 4GALA 4NN0A 4CUCA 1JYTA 4Q0PA 1G9FA 1QOOA 2VW2A 3J4UH 2CDPA 1NYWA 1PO12 2QCSB 1CONA 4YYOA 3POEA 4IGQA 4B4QA 1DCSA 2W91A 1ULFA 4FTSA 5FLJA 3ZN4A 3MIHA 5JI7A 5C33A 2VECA 1F8VA 5JR2A 4HVOA 5BNNC 4OQ9A 2ATFA 4NAMA 3VLBB 1UMZA 4K7JA 1KITA 1MS9A 1HXS1 1K5JA 4E4SA 4LK6A 3ZDSA 1GNHA 3PUSA 3AP5A 4YW3A 1GR3A 5A1AA 1UF2C 2NQYA 2LTNA 4OCTA 4L9BA 3IAPA 2A73B 1OH3A 1W9FA 3I2IA 4ZS3A 1ULOA 2VUCA 1W0NA 2K46A 2W87A 5A7QA 5FO7B 1E5SA 1D4M2 1Y4WA 4RHV1 2AYHA 1YFWA 3B00A 4E4ZA 1H8TC 2ORZA 3KLSA 2OQ7A 1O8PA 5GLVA 3LSDA 1ULPA 3FWEA 3ATGA 5EPAA 3SH3A 5E6HA 2XJRA 4NOTA 4UYBA 3RJ2X 1XQNA 1MZEA 4DRVA 2ZX1A 3JXSA 5BNPC 1NA1C 1CIYA 4XTMA 3FFZA 1OD5A 3KCCA 2WINB 4NIHA 3KV9A 5FO8B 4FI9A 4OI4A 1RXFA 1Z0HA 1YXWA 3QOPA 1WA6X 5J48A 3BALA 4MG2A 2Y6LA 1D4M3 1LHWA 4IV1C 5FYVA 3ZIXA 3TWIA 3VGIA 2JIJA 2LALA 4A7ZA 3CEWA 1WKYA 1BQPA 2ZGOA 1D7PM 2JB8A 5F2WA 5DAPA 5LW9A 1QDCA 3VZLA 3R05A 4QAWA 5FMCA 3ZYRA 3I2DA 4QPWA 2ZZQA 4FTEA 1CGPA 4LBQB 1QH7A 5IK7A 5A7WB 3M3QA 4AEDA 4CZSA 3ZSKA 1WMDA 4LBQD 1WD3A 1X7NA 5HXMA 3SEEA 2ZEYA 2I74A 3O14A 3OUIA 1CJPA 5FPBA 3ZN6A 4QX8A 1UY2A 1MS4A 3PJYA 4DS0A 1QOSA 3ZDVA 3VBRB 2W5FA 1HW5A 4META 1LGCA 1OF4A 1G86A 1BJQA 1VBC2 4QPIA 1VBB2 3M70A 2X5IA 5KR7A 3AYCA 5FZHA 3C7GA 3LPFA 1ONAA 4M4RA 2QQPA 2WNUC 4OLLA 2RS13 3WZ1A 2BNMA 3OBAA 1LHUA 4NPRA 1MVEA 4AHYA 3LKJA 1GNYA 3IPVB 4OHWA 2UURA 3PTRB 3H7YA 4D6SA 1NCQC 4NIAA 3U11A 4QXBA 2E51A 1RGSA 3EMRA 4MX3A 4YGDA 2XDVA 1CX1A 3BN6A 3H1MA 2XHKA 1ZBA1 1MQTA 4PBOA 4NIGA 1LU2A 2HWD1 5FYYA 2VTFA 1AYM2 3GZEA 2DYCA 3EO6A 3TNQA 1POV0 1PO11 2BGOA 2FMDA 2QQUA 1E5IA 1YWKA 2P3YA 2SBAA 1IS6A 3LFMA 3P6BA 4YVWA 3RNSA 4PIXA 2EXKA 3KCYA 3RQ0A 1RYYA 3KGZA 4CDUA 4L92A 2P37A 5LK5A 4CDQC 3AX4A 3LAGA 4WM7B 2UWAA 2YGMA 2NM1A 4R4XA 2XJTA 4E9KA 2DCZA 4MGSA 3KZ4C 2ZGLA 1RMU2 1WW5A 3O0WA 1AYM3 4Q1PA 2RDSA 1K5MA 2CL2A 3U14A 3JD71 5AFEA 2E32A 3BPSA 4IXLA 3FHAA 1H30A 5H9PA 3TYJA 4C1WA 4CDWB 4NRMA 1UIKA 4ZPIA 1AXYA 3ZM8A 2WWSA 5EQUA 5FZ4A 1AUYA 1HV0A 2IVIB 1JS9A 3MEPA 3QH7A 4R9AA 4XUNA 4YVSA 2VL4A 5DUUA 3QD6A 3NV2A 5DPNA 5JAXA 1POV3 4Y26A 5F3GA 3IIAA 1STMA 5ABJA 4H3WA 5FZAA 4Q1RA 3AZWA 3AYDA 5GLUA 5K9YA 2BGCA 5FLHA 2E33A 3O7OA 1WCSA 5KXDA 3GNEA 3I54A 1JYCA 4RQPA 3VDCA 3S0MA 1W6OA 4XF9A 5A80A 2XGXA 4LPLA 1OVPA 1RHI2 4YRDA 3VKFC 1C57A 3N36A 2XJQA 1SDDB 4LO8A 3A0KA 2GH8A 3GZTB 2NMNA 1K42A 3JCIA 4IE4A 5FAXA 5FK8A 1S0FA 1AR91 4GMP0 1EV12 4N7IA 4XBQA 5F32A 5LCWL 2DBNA 4K40A 3VL8A 5JIUA 2ET7A 5DN2A 4LA2A 5F5CA 5GZFA 4PQQA 2X53S 1OLQA 1ENRA 4PF1A 4XFFA 1MZ5A 3S5AA 2VVEA 1VBE1 4XQ4A 3UNPA 3UJOA 1RHI3 1UZVA 3JBG3 2OPKA 4IL7A 2C9KA 1O4TA 1VBC1 4CEWA 1VBB1 4FPOB 5A7PA 1U5YA 2Q8CA 2KR2A 3N9LA 5GZEA 4PJYA 2RM22 1AHSA 2WFF3 1HN0A 4UXAA 5A33B 2HBTA 1NX9A 2JWPA 3U4XA 3VBSA 4AI9A 4OHZA 4CUAA 4DUXA 1YQ5A 3PUIA 4MH0E 5FUIA 4CRQA 1V6NA 2VZSA 4RA0A 1ZX5A 4XMAA 3IN9A 3OUHA 4EE2A 4H14A 1O3RA 4YM1A 5CA6A 1J58A 5JWPA 1Y9QA 4GMP3 3WNOA 2OT7A 3OBZA 3PUHA 4NE9A 4JKLA 2WSVA 5FZDA 2RM23 4LULA 1RUD1 3THPA 4JQTA 5CFDA 4QU2A 4DXZA 1T2XA 1K12A 4P02B 2ZKNA 2DCJA 2DTYA 2GMEA 5FYZA 1C5HA 1PMIA 1ZM1A 2BZDA 1A6CA 1YQ8A 2Y60A 3HWJA 4B8EA 5CEHA 2FCVA 4FTBA 3SMHA 2Q0AA 1NAEA 4BE3A 2VJXA 5GALA 1EY2A 1RMU1 2R062 5JIAA 1VJ2A 3IB3A 4V2WA 5TSWA 4A7YA 1TQ5A 2YG0A 4XJWA 1JBCA 1FPN3 1YQ6A 3I3DA 2WDBA 3VD3A 3Q8AA 1QMJA 4RR3A 1WD4A 3T30A 4WVZA 1HIXA 5EWSA 3INAA 3ZXGA 4OULA 2JE8A 4UFMA 1AR73 2QDNA 3BGAA 4HOOA 4R9BA 1UZWA 2VW1A 2R16A 4OI2A 3WDXA 4D7SA 3AKRA 2JEMA 4BDVB 1AR62 5I8YA 2Y34A 1UD1A 3GJBA 4L0PA 5I0UA 4CUBA 5FZOA 5JCTA 4E8DA 1R1A2 3FBMA 3VZMA 4GXLA 1R1ZA 2BRTA 4M3CE 2Y0IA 2R071 4QKBA 5D8AC 4YGBA 3GZAA 1UN1A 3I3QA 3K51A 1V6OA 1RUOA 4UF0A 2NYYA 4W6WA 2J22A 1HRI2 3WNNA 3N3HA 4X6RB 3H3LA 5GZGA 4MADA 1RC6A 4QKDA 5JZGB 3F2ZA 5LWBA 3SCFA 1VAMA 5LK7B 1X36A 1EV11 1OLRA 2VXJA 3S7EA 1N1SA 4BLJA 4BM8A 1O3TA 5FUPA 3U78A 2H0BA 4NAOA 4EYUA 5EJ1B 1R1A3 4EWDA 5IFTA 3DPRC 2VCBA 2WO3A 3VUOA 4EWEA 1LOBA 5J96B 4XZUG 3ZN6B 3KV4A 2YU2A 4QX5A 2ZKLA 1AR82 4JX0A 3PU8A 5CKQA 2XH6A 3AKPA 4MXVA 1ZRDA 2JIGA 4HKLA 3RYKA 2VZQA 1LOGA 1UU6A 2YB7A 4XHBA 4LLFA 1W2OA 4QPIB 3SHRA 1R083 4OMDA 4DXRA 3DYPA 4PDWC 1YUDA 2Q5TA 2P3JA 1KGYA 4XBLA 1C28A 3VBFC 2OZJA 5BNNA 3LOBA 1UW8A 3O1VA 2WO2A 3LDKA 5FZ8A 2RMU1 1ZZ6A 3ZXAC 5FYSA 5FJKA 4ZU7A 2BNOA 2HWE2 2VD7A 1AR83 1GOHA 3I3BA 4HPKA 2R1DA 4TN7A 4D3WA 4YZ1A 5A3PA 5C9AC 2VGDA 3PVEA 5I93A 3NAPC 5JVVA 4R9CA 5GJ6A 4EZ4A 5JPNB 4E27A 1MQTB 2WZ8A 1ZREA 1OVSA 3TN92 2CGPA 1WLTA 4CCLA 3VBOC 3VBUB 1VBA2 2JDNA 4MSVA 2JX9A 2B4KA 1LB2A 2D6NA 2HJIA 3AC0A 2W9XA 4YVWB 2PTMA 2UYAA 1DLLA 1UZYA 4P9WA 2EIDA 3MUZ1 1J59A 3I2JA 4AI1A 1FYUA 1OOPC 1NA1A 5FY7A 3F95A 2CWSA 1AYN2 5FJHA 4ISRA 3G7DA 1VMHA 4AQ6A 2WO1A 3HBZA 5CFCB 2R061 5FXXA 4Z2WA 1M06G 2GU9A 3T4VA 2RR11 4AGVA 1ZRIA 1OA4A 3R4SA 3ZN5A 5A3OA 4KG0A 4IV1A 2DCYA 5DAXA 1UXXX 3E97A 5LA0A 1NCRA 1AL22 1REEA 1VBA3 3QCWA 2JENA 4FOWA 4QQ2A 5E1RA 4KWUA 1LEDA 2W08A 3KM5A 1CAUB 1AXKA 2ZZJA 3VL9A 2CTVA 2HWF3 4WM8C 4I0AA 3T0AA 4JGYB 1US3A 1OD3A 1GFF2 1EPZA 1XU2A 4K8FA 2D7FA 3K48A 4OQ8A 2LUWA 3IWZA 4AQSA 1FOD3 4AL9A 4DNYA 1MS3A 3X29B 2VAUA 2EVXA 5CZKA 1I5ZA 2DVFA 1AR61 3URFA 5CG8A 2ZGNA 4AEJA 4COUA 4Q26A 1LHNA 1R1A1 3LQCA 5F5AA 5ABJB 4AFDA 1AL23 1LAJA 1W2TA 4QKFA 2OKXA 5F3EA 2EA7A 3W20A 2MNGA 1ZVFA 3B93A 2YUEA 3LWCA 4Y1YA 1VP6A 3WOGA 4AVSA 1JOBA 4BMEA 5IATA 2D3RA 3V0AA 1UX6A 4AFCA 4YG6A 2AEZA 1W6OB 2D44A 1HRI1 2OYZA 2XBO2 3L9JT 2DUQA 4XDQA 1SPPA 4P14A 1POQA 1JZ8A 4L11A 1H0BA 4IGOA 3ZYIB 3C7HA 4FFGA 1LOCA 3IDCB 3N9OA 3OEAA 1JZ5A 1N3PA 1REFA 3VD5A 3WDTA 2VCCA 1ZA4A 3BU0A 2A1XA 2WFPA 1VBD3 4G4FA 4IV3B 4N53C 1NCQA 3OJBA 1ZRCA 5CISA 2OVUA 2WT2A 2WSUA 2ZHLA 3O12A 5DUWA 3PL0A 4OUMA 4A4AA 3ZSJA 1ULGA 2QKDA 1QJX3 2XBO3 1DGLA 1NG0A 3UGGA 2RG4A 3WDWA 1H2LA 2NLRA 4QDRA 3VHNA 3IDAA 1H8VA 4CDQA 2FBEA 3AL5A 4ORFA 2QTWB 1Z78A 4MVTA 5DABA 3VBSB 5FZIA 3ILRA 1ODMA 1SFYA 1ZZBA 2HWE1 2W52A 3AFGA 1W8UA 1W2NA 3ZSMA 3CIHA 2IWGB 2IXIA 1ZZ7A 4K3UA 3N9NA 4CYDA 1GANA 3LA2A 1XB9A 5FYMA 3TN91 3ZXKA 1SBDA 4Q4V2 3N9QA 4FXGB 3AMNA 2X05A 1VBA1 4UBHA 5A3UA 1XU1A 1I3HA 2ILMA 1AXZA 5IVYA 5ERLA 2VZ1A 2XJSA 4AVAA 1FNZA 1ZZCA 2Q4SA 1ZBE2 1W8ZA 1GWKA 1PK6B 1J3QA 4P9IA 3RZJA 1AYN1 1OPOA 1WLWA 4G9SB 1KD7A 2ZTNA 4ITCA 2BDRA 1GMMA 2JDHA 4KNCA 1W0PA 3S30A 2PAMA 3AVSA 4QQLA 2Q8EA 3VDAA 4CXYA 1BMV2 3T09A 1CAWA 3BVCA 4NIDA 4QQOA 4D6QA 1T6GC 4HSLA 5FZFA 2GC1A 5CNAA 2BFUS 1HRV2 5A7WA 2RHPA 1DP0A 1YIPA 3FX3A 4GA9A 5C8CB 2GDFA 3RZMA 3CDZB 5HCBA 4I09A 2A3WA 2JE9A 3WDVA 5IAVA 5IVJA 1F35A 2QZ2A 2Q30A 3HQRA 4FOYA 1H2NA 4PQ9A 4ZY9A 2MEV3 1X82A 1QNYA 3A4UA 3SCGA 4QMAA 1ZRRA 4K1ZA 4QU1A 3TOJA 2OZ6A 2C24A 1FMD2 1KDMA 1OLME 1RVF2 5DZGA 4LHSA 5E88A 5FZOB 4YSFA 4JAAA 1PGSA 3DECA 1OFSA 4D94A 2E7AA 3J7NA 4LXLA 2WA4A 4XIKA 1G6NA 2RS31 5FXZA 5HCHA 3N7JA 3IPVA 2XBO1 3T1MA 2DCTA 3AXDA 3E1F1 3SKVA 4UF0B 1JZ3A 1S0DA 3LDBA 3CO2A 4AAXA 5IAXA 4P9XA 3W58A 1NOVA 5LRRA 5C5UA 1VPHA 3ZXLA 5HPOA 4YW4A 3D0JA 3JB8A 4CDXB 5BV6A 1LODA 1FMD3 3LF7A 3BTXA 4O61A 1RVF3 1Q8PA 1QXJA 5EV7A 3POJA 1HDKA 3O1TA 5IWFA 2W95A 4BK5A 4HMZA 1GQPA 1G9DA 3DKWA 2HWC2 4Q5OA 4W6YA 4GAZA 2WNVC 1ULCA 1UOJA 3CU7A 4AFAA 2NMOA 5FP9A 4DINB 1VRH2 2XWJB 1MZ6A 1W2UA 1LECA 2XMLA 4F8AA 4FPJA 1RL3A 4KL1A 1RUF3 3VD9A 2XJVA 2B9UA 2W92A 2PAKA 3HN3A 3KT1A 4MGYE 4Y1XA 3THTA 1JODA 3CF6E 1ASJ2 5FZ1A 5JR7B 1YNAA 5BNNB 5LRSA 4L2NA 1C4RA 4K9SA 1FXZA 1YI9A 4RGGA 2EF6A 4M0NA 3RZZA 3ZKUA 3ZLIA 3OGJA 4BJ0A 3U0ZA 1P8JA 3A21A 1QOTA 3WLUA 3MIGA 4QQHA 3LEMA 3OPTA 5F6LB 5L7OC 4Q4V1 4XPVA 1PGL2 3U10A 4Y5Z0 2WN2A 3AP4A 3J7MA 1C3HA 3I2OA 1H8TB 2VPVA 4KGGA 4BQYA 4O65A 1ZBE1 4JGZC 1YC61 4D0QA 3WUCA 2PMWB 2QQNA 4CU9A 3ZXDA 2PHLA 2WS91 4AYUA 5BNPB 1NA1B 1C1LA 1V9U1 1N3OA 2BU9A 3NKTA 3USUB 3B3QE 4YW2A 4KBZA 1ULDA 4XCBA 1BMV1 5CB7A 1OKQA 4U36A 2TEPA 5JOYA 4OI0A 5F3IA 2AENA 4IV1B 4JKKA 1HRV1 5D8AA 3VZKA 2J1TA 1FT9A 4XYXA 2XKOA 4COYA 2PELA 5BNOC 3WVJA 4OMCA 4XAAA 2ZGRA 4DEVA 5IVFA 5JSOA 3FL7A 4DXSA 3D6EA 2AEYA 3AYEA 3POSA 1W3VA 3PTYA 1OUSA 2ZHKA 4GKYA 5JOZA 1NQJA 2ZX4A 1UOGA 4JV4A 1ND3C 1H6XA 1UOFA 3KWVA 1O91A 3DPRA 4ZHNA 1Q8QA 2GC3A 1FMD1 3N7KA 2N7GA 1RVF1 4BLIA 1LOEA 1UYZA 4H55A 1UNBA 3RFRA 3PURA 3Q9OA 4FPGA 3HAGA 5IK5A 5CG9A 4LIVA 2W1QA 1YFYA 5FIXA 1DG6A 1R093 1S2BA 2KXLA 3MPPG 5LEKA 4Y5SA 5FP7A 4TLFA 2K9ZA 3ST7A 5JLVA 3ZFEC 1TME3 1SPPB 2WNUB 4DZGA 3VBFA 4QX1A 4BB3A 3MPBA 3EJKA 1AF9A 1G8WA 3MV01 5FBZA 2WRAA 1RTVA 2Y8KA 4AEMA 5DDJ2 5DAVA 2JE7A 4C90A 5C9AA 1NCQB 2WZPP 4YFZA 1IZ3A 3N9MA 2VQAA 3GXUA 4F83A 3NAPA 1BVVA 2HWC1 3EYPA 4N9IA 2MHFA 2OS2A 2BYVE 4JHTA 4LOSA 5FMOS 4Y1UA 2J1EA 2WR9A 3ILFA 4Q4X1 2GNTA 4ZXEA 1VRH1 5SV5A 3VBOA 2BWCA 2B39A 2WQ8A 5FREA 2BP6A 1XE8A 4HLTA 3IKWA 5IHRA 1OA2A 2PHUA 3AKSA 1O4YA 3AMHA 2ZXQA 1ASJ1 1U5XA 1OOPA 5DDJ3 4CDQB 1I1EA 3DL3A 5DMYA 5KXEA 1HB4A 1W9TA 4BCUA 1NXD1 2H6CA 3MO4A 3N7MA 2FDJA 4L99A 5C3OA 4GJZA 3OY8A 3PDQA 1PO22 3QBQA 4IEWA 4ISQA 4Q8KA 2ARCA 2JD9A 2NN8A 2Z69A 4RGAA 5IVBA 1PGL1 3NJVA 3WUDA 4X8PA 4W6XA 4ES8A 4NHYA 4WM8A 1JYVA 1WCQA 2F4PA 2DWRA 3LIGA 1W8HA 2G4IA 4NHMA 2ZX2A 3WNMA 3VD4A 2W1UA 5L9RA 2NPIA 1K45A 2CU5A 3BU7A 2XOMA 2B8MA 3N7LA 1DBNA 2Z2SB 4XTPA 1SBFA 3ZFFC 5LA1A 2DVDA 2WNEA 1PHMA 1PO23 5ACA1 1EUUA 1XC6A 2D98A 4IEUA 5JXJA 3WCRA 1CPMA 3VHOA 4R8HA 4IE5A 1Y7BA 1CAWB 2VMFA 3LOIA 2ARBA 2G9ZA 1US2A 5FCCA 3CHXA 4XXPA 1VMFA 4XJAA 4B7EA 3DV8A 3NVCA 4IW3A 5JZGA 2BBAA 4CTEA 2BUKA 2QQLA 5EZWA 4EWAA 1WLDA 1XJAA 2GN3A 2RS12 5DG2A 3OGRA 4MUVA 4TTGA 2R041 1DYKA 3HNMA 5FY9A 1O59A 3W5NA 3HMYA 2PLV1 2JDAA 1KEXA 3SEPA 5M0TA 4LKDA 3R0RA 5A7OA 3H8RA 3ZYJB 1W9SA 4N53A 4DY5A 1Z7S2 4ES9A 3R6SA 5J36A 4YM2A 5EHDA 3MZHA 3HOBA 3CJXA 3CQOA 3EB7A 4QPGC 2KD7A 3ITQA 1MS8A 2RDQA 3DXTA 3MW3A 4LO5B 4BMBA 1YRZA 1WGPA 2VOXA 4LORA 2GMPA 1DQ2A 1PMHX 1PX3A 4MLOA 1NZCA 5JPMB 2C6SA 2RJKA 1KJLA 3CJIA 2X10A 1ODNA 1SLCA 1Z7S3 1QF3A 2OPWA 1H4HA 2GAUA 3N9PA 3WF1A 4NO4A 3TB0A 4BHPA 1W06A 1Q5OA 3ACGA 4N43C 1O3QA 4XFGA 3U1XA 4GJYA 3VBUA 4KBBA 4NMIA 1MZFA 3MDPA 1O3SA 2VQ0A 5E16A 3WP3A 3TEZA 2IZWA 3K2OA 2HWB2 1RITA 5IUQA 3VZOA 3WQBA 3HVDA 5CBLA 1KRIA 4EN0A 1WCUA 1OQDA 3RYRA 3AP9A 1UY1A 2W47A 3RMXA 5JSPA 3JB4C 1V6KA 2YDEA 5IVCA 3D8CA 2WYFA 2IFRA 3EXUA 2QQJA 2WAAA 3JU9A 1OQ1A 1DQ5A 2WWJA 3DF0A 1B09A 3NJXA 2BVBA 1TEIA 3U75A 3VDDC 5CAZA 5CIRA 1CD3G 5A3WA 4PBPA 4CXWA 4C0HA 4TLGA 1LOFC 2Y6FA 1LHVA 4XEZA 1RINA 2A75A 4XIOA 2JDPA 2JKBA 1Q8VA 1SLIA 1MPXA 2P3IA 1CAUA 1D4M1 2E63A 2O8QA 2RDNA 2HWB3 3FMGA 4HVRA 4E2GA 2A7AA 4QKNA 1DDLA 2WNOA 3PVNA 1XE0A 3I49A 5A1FA 1MEC2 4JGYA 4I2OA 3SNMA 3T2PA 1OURA 4WVVA 2XB6C 4IEOA 1DQ1A 1QGLA 2JD4A 2XQXA 2ZEXA 5LA9A 4GH4C 3T3YA 3LEGA 2XKPA 3T1LA 4AI3A 1RUE2 4FP2A 3VBHC 4YNIA 2VZ3A 3IDBB 1UMIA 4W65A 1EAH3 1OSGA 3H42B 4E4HA 3ZIWA 4LIUA 5GLZA 4BQWA 4CP0A 3DYMA 5K7PA 3H1WA 1VMJA 2OA2A 4ASKA 4WV8A 4I0WB 3WQ1A 2YHJA 3IBMA 1W0OA 5F1RA 5KXCA 4LE3A 1KFXL 1XE7A 2B5HA 1HB3A 3RS6A 4JZRA 4GULA 4CUGA 3O1OA 1MEC3 5C8WA 3OB8A 4Z92B 2CNAA 4UBGA 5BYNA 3KV5A 3JBG2 3M3CA 3PLQA 4GQ7A 4XFHA 5FR3A 4UFLA 3ZYHA 1RUE3 4FPEA 4BPZA 4XJ9A 5D8AB 1YLLA 3OSDA 2YC2A 2RS11 2WFF2 1W05A 4XDPA 4TZDA 2DTWA 3A0NA 4IV3A 1RUNA 2DBIA 4QXHA 1KS4A 1HQNA 2ENRA 5A3LA 3SISA 1REDA 3RGBA 3RWKX 3E6CC 3DCQA 1UMHA 3KS7A 2VXRA 3ME2A 3HPNA 2DVAA 4Q27A 3DPRB 5HXVA 4AVBA 1TE1B 5EYXA 1PMJX 3LEIA 1N47A 4DQAA 5J3UA 4UFKA 4W8JA 3FN9A 2AZ5A 4CCJA 2PHRA 2WNVA 4QB1A 4FP3A 3E6DA 3SLIA 3FC0A 2A6ZA 2YBSA 3AMPA 3NRUA 5CADA 5H9SA 1F2NA 1NKGA 1JTZX 2IXKA 5DQ0A 4OHYA 4XCAA 4TSVA 1MS1A 3ZMOA 3A22A 2XR4A 1GZCA 1ACCA 1W9WA 4COZA 2JICA 5JMCA 3VBFB 1W8OA 4XACA 1XYNA 1BKZA 2Y0OA 3W5MA 1PVC3 4FQ4A 2ZAHA 2TBVA 3NJYA 1AYM1 1IS5A 4XETA 5FOBB 5C9AB 4LHNA 3VDBA 4O9EA 5AFBA 3LDRA 1FPN2 3MW4A 5IJRA 3PUQA 3UV9A 1XYPA 4O7XA 3IMNA 5L7OA 3NAPB 5KHGA 1PK6A 3PJQA 1IQDC 5A6QA 2D6LX 1IPKA 2ARAA 1AR72 4W50A 3P1IA 3VBOB 4MGQA 4BISA 1O6UA 2YGLA 5T5OA 4JGZA 2FDKA 3FLPA 1POV1 3ZPOA 2J7MA 2GNMA 2JG9C 2VZOA 3H3UA 4B4RA 5C3SA 4BZ4A 2V73A 4QDQA 1OOPB 1RUI3 1H1IA 3J8F2 1UU5A 3GBGA 4ATEA 3DKQA 1NLQA 5T5JA 3FJSA 3Q8FA 2VMEA 5C8CA 2XWBB 3OY8B 1DGRA 1QNWA 2BNNA 2YPJA 3A23A 4EROA 4D69A 2L9LA 2W2IA 4GWNA 3POWA 5G04L 2Z4FA 3FLRA 3OCPA 4CA9A 3C2UA 3NSTA 3JZVA 5BNOA 4AK3A 1WW4A 2JG8C 4TWTA 1ND2C 2BFUL 1JUIA 2H6BA 4WM8B 5H9RA 1V70A 5K8SA 2BV4A 1LHOA 3M3EA 1KQRA 1OA3A 2F17A 1W03A 2J1RA 4JDOA 3J8F3 5EFUA 1KJRA 3TNPB 2WO7A 3VV1A 2B42B 2GC2A 3CZUA 3ZFGC 2D40A 3RI9A 4ZKTB 2E6VA 4Y4RA 5EYYA 5FYTA 4QM8A 5B4XA 1CZSA 1F9KA 3OBRA 1CVNA 1LTEA 5EXOA 1RHI1 1L7RA 2YC0A 3AXEA 3C7OA 3JBG1 4NRQA 1UY3A 1QH6A 4UT5A 3WD5A 1LJ7A 4C91A 4FPCA 1J83A 5KWRA 2WN3A 2VO5A 1N1TA 3MLJA 5FY8A 4COWA 4YFWA 1IPSA 1R082 4MGKE 4IUGA 2WFF1 4CDXA 1HV1A 2SLIA 2VC9A 3UT0A 3I3MA 3ZFEA 5EP9A
chains in the Genus database with same CATH topology
1QQP2 4KWLA 4H7LA 4QQPA 4F3JA 3WHUA 1QWRA 4HANA 1JHNA 2VMIA 1IS3A 5DUXA 3ASIA 4XQDA 4N53B 4GMP1 4UW3A 4YM3A 4M01A 4FSJA 2R32A 2XG3A 1NY72 2RM21 2Z79A 4Q0VA 1W6QA 2ES3A 1MS5A 1QQP3 4FXKB 1O5LA 2VH9A 2TNFA 4Y22B 3V0BB 4HZFA 5GLWA 4YZ2A 3BB6A 3BOPA 5T3NA 3CJIB 2HEYF 1SLLA 2UWBA 4HKOA 4Y20A 2RS52 3ROUA 1KFUL 2ZGKA 5CVRA 4Q4Y2 5IT6A 4LBMA 2CAVA 1FPN1 3VKOA 3ZMNA 2OUHA 3NV4A 1H8TA 1LKNA 4IEZA 1S0CA 3PVBB 2B46X 2GNDA 2F6BA 3MIEA 1AL0G 1AX2A 1QJU2 2HWF2 5HCFA 1AR71 4M0HA 4QM9A 5BNPA 5L36A 1CESA 2XJPA 2Z42A 1AX0A 4XF1A 3USUA 1FOD2 2A6VA 3OYWA 4FCAA 4HSJA 4XJZA 1U5IA 3KMHA 5DG1A 2RS53 3SH5A 3M1HA 1Q3EA 1VLNA 2RE9A 2ZGMA 4Q4Y3 4PCRA 1BVP1 1BBT2 1QJU3 2C9AA 2PHDA 4BYYA 2RJLA 3WQ7A 4QHBA 3WW2A 2CV6A 3B02A 4FPKA 2BBVA 5FRAA 4K1YA 2WZR2 4P9YA 4D7YA 3OD0A 1MS0A 1VBD2 3D5OA 3VZNA 3WP6A 1RUC2 3B7MA 3O5SA 4HFSA 5T52A 3OD4A 2DVBA 1Q8OA 1C5IA 4IEYA 1BBT3 4AW7A 4YG3A 2VUAA 4QPGA 5KHHA 3ALQA 3OF1A 1QJX2 1Y3TA 3KQRA 3FUOA 2WNUA 1CAXB 1PIV2 1R081 2D6OX 2WZR3 1X8MA 2JDZA 2FQPA 3H9AA 4IESA 2YY1A 5GZDA 2ZCWA 5AVAA 1RUC3 3ACLA 3KSCA 4PLMA 1LU1A 2IFWA 4QD2A 1YI7A 4NVPA 3VKNA 3PNAA 4LTAA 1AR81 4Y4YA 5FPXA 1IQAA 3WT3A 1PVXA 2UU8A 4AEDC 4HKWA 1PIV3 1AJOA 4J1XA 1OFNA 3VKMA 4A7KA 2A71A 2WNVB 5H9QA 2VULA 4P9JA 3ETQA 2C5DA 3SH4A 5FMOL 1G9BA 4WBBA 4YW1A 2EXIA 3WG2A 3DN7A 1YO8A 1O7FA 5AC92 2X5IC 4AWDA 1GKBA 1GQHA 2QZ3A 4JCKA 2FZ2A 3BTAA 2FZ1A 1AVBA 1C1FA 2R0FA 3MYXA 5KBFA 3DGTA 3E5UA 2D93A 3P3PA 1SACA 2K2SA 1GZWA 4S2DA 2XLGA 2HWF1 5L7OB 1SBEA 4XFAA 5FLIA 1YFUA 3VBHA 2ZABA 2ZA9A 4FT8A 1FV2A 2PQQA 4RL7A 4ZU5A 5IK7A 4LT5A 1DU3D 1CN1A 1FOD1 5AC93 4Z07A 2O8OA 4JGZB 4HL0A 2MEV2 1DHKB 1SDWA 4I3PA 3H50A 5T5LA 4Z8BA 1N1VA 2ARXA 4FQZA 4HBNA 3M2MA 3UJQA 1JOJA 4DFSA 2CGOA 2I2SA 1U5ZA 1AL21 2DU0A 1HKDA 1S55A 2VNGA 4JQRA 4CDUC 4DOUA 1NE6A 3JQWA 1BBT1 1DFQA 4SBVA 1PZ8A 1SEFA 3WV6A 1UPIA 5FQ0A 2XLAA 4OI1A 3WG3A 3B94A 1LRHA 1V6MA 5T54A 5BNOB 2WZR1 4CEYC 1K5MC 1XXNA 3GYDA 2YZ4A 3MIFA 3NWKA 4JDNA 4KU8A 3RSJA 2BVVA 4UW6A 2QVSB 1VBD1 1UKRA 4FOQA 4ASLA 1QXPA 2VNRA 2ZACA 3GHMA 1ND3B 4YVSC 4A3XA 2EAAA 4NWVA 2HKXA 1H9WA 5GZCA 3USSA 1QJX1 1D2SA 4LBJA 5GM0A 2A6WA 1OHFA 4AVCA 1PZ7A 1RUF2 4I30A 5JDBA 4NHKA 5CU1A 4RQPC 3ZFEB 2D43A 1SQ4A 2R0HA 2O1QA 3MLKA 3SCHA 1APNA 4BWOA 2AH2A 3AMQA 4HK9A 3HN1A 1S0JA 1WBFA 3M8LA 2GALA 4AF9A 1F5JA 1EPWA 3NV1A 1WW6A 3NV3A 1W6QB 1OI6A 2ZS6B 3FBYA 2IXHA 1CAVB 1SFNA 1J3PA 4CEWC 5L19A 4Q2FA 5T55A 4XFCA 3GF6A 2WL1A 3T2TA 1DIWA 1GBGA 3ILNA 5L73A 1RUH3 4Y20B 2YXSA 1TNRA 2VOKA 4LBNA 4HETA 4YARA 2HYKA 4V1PA 1DZRA 4YG0A 2WLQA 2XLFA 3I4IA 4JRAA 2P3KA 1LESA 3J26N 3APBA 2HEWF 1KDKA 4RD7A 1G9CA 1ND2A 4KQ7A 4Q8LA 3WDUA 2VNOA 1V00A 5FPZA 4EN6B 5I0RA 2MEV1 3OYWB 4LHKA 1H9PA 1GYKA 1V6JA 3I59B 5CFDC 4NR1A 3ZFGA 1W6NA 1X8EA 4EN7B 3ZFFB 2A5ZA 2AREA 5KC5A 2A6YA 3ZXJA 3RPQA 3BOWA 3LZZA 3D4KA 1R092 4FPYA 2I07B 4KU7A 1DYPA 1TME2 4HK8A 3J9SA 2EIGA 4RR3C 2D6PA 4XZPA 1IOAA 3UK9A 4Y24A 3E5QA 1D2QA 3ZXFA 5J98B 4QPGB 1Q8SA 3VHPA 2DUPA 3MI8A 3FE5A 4FPLA 4PDWA 1CX4A 1S0GA 3ZSLA 4X6QB 3M3OA 4PF5A 1RUF1 2PYTA 4LO4B 4RS5C 1UIJA 2ZGSA 1CR7A 5J7MA 1UL9A 3NW4A 4U2AA 2WIIB 1WA4A 1EYBA 2JXAA 5FFOC 4XW3A 4AHZA 1B35C 1UU4A 4N43B 2Y26A 2B45X 3CNAA 3W9AA 1H1MA 4L97A 3R4DB 3KT4A 2A6XA 1U12A 3S7IA 1QJY2 2AR6A 1ZBA2 3AZVA 4XF3A 1TMF2 4GB32 4M3CA 5J09A 4YZ5A 3IDEA 5FTTC 3VDDB 5BXXA 4IERA 2BWAA 5I0SA 5T50A 4YZ3A 4I0BA 2XVKA 1X33A 2FHRA 3HD8B 3RMYA 1YCIA 1QJY3 3KD4A 2XVLA 1GZWB 4FVVA 1ZBA3 3B69A 3ZYGA 1TMF3 4GB33 2HWD3 4GH4B 4G3YC 2WC2A 3VBHB 5K0UC 1Q43A 4JRLA 3JD72 1DQ0A 1PO13 2OW4A 3EQEA 2Y38A 1YYNA 1LENA 3M3IA 3N35A 2QFEA 3V56A 2XL7A 1HX6A 2WKKA 5LEJA 1CIWA 1GNZA 3OBTA 4I02A 1ENSA 5AVPA 1TNFA 4M00A 2VY0A 1JYIA 1N3QA 3H0OA 1HQWA 1UCXA 4AGGA 1R091 1S0BA 2JECA 4Y1ZA 2D97A 4E2SA 5FQ0B 2YYOA 3LA3A 4BH9A 3P3NA 1YIFA 1TME1 3JD73 1QKQA 4ATFA 1F5FA 4C1XA 1NCRC 1JXNA 4E2QA 4PLNA 2ETEA 4NWWA 3CLPA 2ZMLA 1JUHA 1H2KA 2ZBJA 1U0AA 1HLCA 4C0BA 2QJVA 3KB5A 4XFBA 2BEOA 5FDBA 1AR92 1LR5A 4Y22A 4DMIA 1NQDA 3V0BA 4LO7A 1CQ9A 4LLOA 4K6BA 4AQ2A 3MFAA 4AI8A 3MGUA 3EHKA 1XNCA 1VBE2 5DDJ1 3BODA 1GQGA 4B7KA 1SLBA 3NKGA 4R9DA 5HCAA 1OQEA 1F31A 4XILA 3WQ0A 4FPHA 4LO6B 4WZFA 1AR93 4IEVA 5C4WC 3B9IA 1FAYA 4GIQA 4KH9A 4WZCA 1SLTA 1X50A 3PMSA 1QJY1 3V64A 1EAH2 1VBE3 1IS4A 2Q8OA 3UL2A 5JSRA 3TBDA 3H8UA 2XJUA 1TMF1 4GB31 1VBC3 4DB5A 1VBB3 2K0GA 2Q1ZB 4EN9B 2P17A 1GLHA 1W6MA 2JG9B 4H7MA 2R1BA 4AQTA 3RJRA 4CP1A 5KHGA 1PO21 1RUD2 4WVMA 2PHFA 3O0XA 2A70A 3HQXA 4IEPA 1WLCA 2VOVA 1AJKA 1J1LA 4MXWA 3RG0A 1DGWX 1UKGA 4COVA 3NJZA 2ZHNA 4QGNA 4S2FA 4GKXA 1LCLA 1VB4A 2WT1A 4CEYA 5F9TA 3U07A 4ZXKA 2JG8B 1ND2B 1SCRA 2X8KA 1Q56A 1RUD3 2PHTA 2QE3A 3TAYA 4B4PA 4AE2A 3WW3A 5A32B 1LULA 2C0ZA 1CAXA 3ZFGB 1BXHA 2W0XA 1W6NB 4JTNA 4ASMB 4S2HA 3W59A 1DGWA 1DQ6A 1VALA 1RMU3 3H7JA 4X8NA 1URXA 1FI2A 1IKQA 2E7TA 3LA7A 2GMMA 4IETA 2D5HA 2DF7A 1WUVA 3EBRA 2BPA2 4P9GA 1Z7S1 4XOGA 2R072 4AFBA 1PVC2 5BY5A 4XJ8A 4FOVA 4BOWA 2YV8A 5IK8A 5KHJA 4QGLA 4HN0A 4TYSA 4JVAA 4DPNA 4Q0UA 4EN8B 4B29A 1NLSA 1FNYA 4JTOA 3VBRC 3ELNA 1VAKA 4MZUA 4WVWA 3RI8A 4PDWB 1S2KA 3O0VA 1ZZ9A 3AJYA 4B3NA 1JW6A 1DZTA 4L8QA 2R073 5BPXA 3G6JB 2G9GA 5I8SA 1V6IA 3DUIA 4FPFA 1RUI2 3R4UA 4XMIA 1WCKA 3JUUA 4INDA 2HWB1 1O4ZA 3MIBA 3AZXA 1EV13 2WT0A 3WW1A 3V65A 1PNGA 1PZ9A 1VIWB 2FMYA 2QUOA 3HR9A 3L2YA 2RMU2 1H2MA 2DUOA 4HN1A 3OPZA 1EAH1 3B01A 1SCSA 2AGSA 1W6PA 3VHRA 3AB0A 4S2GA 2VMGA 3M7AA 4M3CB 4P9LA 3WNXA 4WM7C 1XNBA 3FUQA 3CL1A 1MEC1 2DVGA 2BW8A 4OHVA 1H4GA 1NLRA 3ZPYA 2RMU3 1RUE1 1SLAA 1GZ9A 2PAEA 1I9RA 3SXWA 2V09A 3N4MA 2WJSA 4CDWC 2XPJA 5F6KA 1S0EA 2RR12 1C8M2 5D1IA 4BA6A 1ND3A 1BZWA 1SMVA 4XF0A 4IEQA 1IHMA 3KGLA 4K20A 3AP7A 2UYBA 2E7QA 4OUSA 1COV2 1S0IA 2VG9A 3JQXA 4MV2A 1L3JA 2C1FA 4LHLA 2CAUA 1AZDA 1VB2A 4AEKA 2CWMA 4J1WA 1BYHA 4YM0A 2R063 4LA3A 2CGNA 2GN7A 2UWCA 2RR13 3AZYA 1C8M3 2UY8A 2ZX3A 2ZGQA 1ULEA 2OUJA 1YJLA 1GV9A 1COV3 3KT7A 4RS5A 2D6MA 1PVC1 3M4FA 2BTVC 2YROA 1BEV2 1OPMA 4SLIA 3UKTA 4F7ZA 1WMEA 4KGQA 4PLOA 4YW5A 1A3KA 2MPFA 1PNFA 5F5QA 2ZHMA 1B35A 2PHWA 3WINE 2E53A 1CJDA 4QT6A 1AR63 1FATA 1BCXA 4AEDB 3BCWA 1CAVA 1FX5A 1LGNA 1QU0A 2I45A 4DRRA 2WA3A 3D82A 4Y1VA 5A3MA 1WBLA 1MACA 1DZQA 2Q1MA 4JDMA 4AI2A 1BEV3 2DCKA 4LUKA 1HRI3 1RUI1 5FO9B 1RUG2 2YMZA 4IQPA 2X5IB 2BQPA 4BIFA 2P2KA 3B9CA 1IGOA 3RRDA 2VMHA 5BNQA 2ERFA 2V5YA 4EJRA 3WCSA 1MVQA 4XQWA 2HEVF 1DQ4A 4YGEA 1M4WA 2G9FA 2ET1A 2ZJCA 1LOAA 3LSEA 4J6GA 5DZFA 2VOWA 3WXPA 3I59A 1IKPA 2JJ6A 4URTA 4I01A 5K0UA 1RUG3 3RDIA 2TUNA 2ZGTA 2H0VA 3I7DA 3J8F1 3ZFFA 5KHIA 5JI9A 2X29A 1UZZA 2Z5WA 2VW0A 4MYEA 1W6MB 3ZSEA 2DU1A 4WVMB 3TRSB 4N90A 4AHXA 4CDUB 4LBKA 3PMEA 2VUJA 3IT8A 1GSLA 2HWE3 2ZGUA 4AXOA 4ONUA 4MXWB 1MR5A 3HT2A 2PFWA 1V6LA 3QACA 4Q0QA 1GICA 1C8M1 2WQ4A 3IM0A 4P5HA 4RSUA 3VN4A 3TN93 4JC1A 4CEYB 1K5MB 2GNBA 4XHXA 1COV1 1QDOA 3AYAA 1RB8G 1S1AA 2PN5A 1AX1A 1PGW2 1UPSA 2EXJA 2QNKA 4Q0SA 3AFKA 4YVSB 3BIWE 1AYN3 3ZYPA 3FHIB 4Q4W2 2ZMKA 1A8DA 3LGRA 3POYA 1NXMA 2D5FA 3AJZA 1QQP1 1ENQA 3FFQA 4XF4A 1LEMA 4CP2A 4YGCA 5JZGC 2DURA 4AI0A 4N43A 2VVFA 4RQPB 2ZX0A 1BEV1 2RS32 1ZNPA 5C6CA 1NY71 2D3PA 1OMIA 4Q4W3 5JOWA 2IXLA 5C4WA 4PIYA 2XVGA 1N1YA 1QHDA 4BQ1A 1I6XA 4UW5A 2P34A 3ZO0B 3ES1A 4EV0A 3HIFA 4AVVA 2ZMNA 3I8TA 1H1AA 2GH2A 3VDDA 2XUMA 2W39A 4XFIA 3H1YA 1G9AA 4QPIC 3SITA 2RS33 1LOFA 4LBLA 2GC0A 2RS51 2B7YA 2EALA 3ZXEA 1RUG1 1A78A 4Q4Y1 2R30A 4KWJA 4CEWB 2D3SA 4Z82A 4XBNA 4M3CF 5KC6A 3CJIC 4FO9A 1QJU1 4LBOA 3AK0A 1J3RA 5I91A 4GH4A 2KA3A 1KS5A 1MQTC 1UAIA 3ES4A 5I8TA 5E8AA 3HT1A 1RUJ2 4R52A 3VBUC 4AVTA 4I3GA 3KCXA 1PM7A 3FZ3A 4YVWC 5KHKA 1W6PB 4LR4A 1YJKA 2UY9A 1XNDA 1Y43B 2VU9A 4R4ZA 3WR0A 5CFDB 5CFCC 3ENRA 1JN2P 4FAHA 2W68A 1ALYA 3H3ZA 2QDRA 2WS92 1DF0A 1D0HA 1RUJ3 5DUVA 3UKNA 1V9U2 2IC1A 2AUYA 4BIOA 3WP4A 2R6QA 1RUC1 1XYOA 1G7YA 4Q4V3 1BK1A 4JGYC 2WQZC 4LBQA 3MF6A 1W39A 4D7TA 2EAKA 3AZZA 4RR3B 1ZBE3 1PGW1 1XRUA 3GALA 2GSYA 5E89A 4MGZE 1DGRN 2CYFA 3AKQA 2WS93 1PIV1 1ZZ8A 4Z1VA 4GWMA 4Q4W1 5ABJC 1KXGA 1V9U3 5GLTA 3BPZA 1JH5A 3NO8A 2GZWA 3VBRA 4AHWA 1QJZA 1NE4A 4XXAA 3WG1A 3VKLA 3ZVXA 3FLTA 2DFCA 1HRV3 5KXBA 1RJ8A 5GKAC 2NZ9A 4HT1T 1FV3A 4PIZA 3RYPA 4AFMA 1HQLA 4RS5B 3VZJA 2XL9A 1RUH2 4IV3C 3AMMA 4AG4A 4E4DX 5DZEA 3WDYA 5B2GB 3MFCA 4RFT0 3MLLA 1A8MA 4YZ4A 3WG4A 4LNVA 1B35B 4LE4A 3ECQA 2JG9A 4QPYA 5AC91 3QH6A 3L2HA 2D6KA 5IK4A 1QXRA 2E9QA 2LM3A 1ENXA 4WM7A 4Q4X2 3VBSC 2PHXA 3C3VA 3WX5A 4QXKA 1VR3A 5JOXA 4OHXA 1HXS2 3D0SA 3MW2A 3OTFA 4OZXA 5HI0A 3NL1A 4FAGA 3OGGA 2KM2A 2JG8A 3GHNA 4O9GA 2R49A 2O0OA 1CPNA 4FBFA 4CDWA 1RUJ1 3LCPA 1ZRFA 2ZOEB 4HPKB 2HWC3 1YFXA 4RHV2 5A32A 1EP0A 1XNKA 4UW4A 4Q4X3 4YLZA 1VRH3 5K0UB 4LUMA 1PK6C 2CY6A 3E5XA 2DFBA 4N9HA 3RWNA 5HBAA 1HXS3 1ASJ3 3UKVA 4N7UA 3PHMA 1VAVA 3MF9A 4KG8A 2A3XA 2PA7A 1RJ7A 1YHFA 4RHV3 2OIIA 4XJUA 5ACA2 1ZYBA 3AM2A 2WLPA 4OVEA 4K21A 5C8CC 3WW4A 5J37A 1D4VB 5DXDA 5BUVA 1WCDJ 2IXCA 3AKTA 1NCRB 2ZAAA 4HVQA 3QLQA 3ZX7A 4DY3A 4NHLA 3PVOA 3GBWA 2R042 3AP6A 1IPJA 4LEJA 2PLV2 4ZU4A 1E57A 3WP5A 4XE9A 5I0TA 1QY4A 5ACA3 2EXHA 1O5UA 2NP0A 3WY6A 5EJ3A 2IXJA 2DV9A 4OFGA 2ZPXA 4KWKA 3MIDA 5FOJB 3LB9A 4MGIE 4AGRA 3WHTA 5A33A 1C8NA 1LGBA 5SV8A 2R043 3V0AB 4CDXC 1J1TA 1RUH1 1WW7A 2VVDA 2A3YA 2ZGPA 2PLV3 1D0GA 3B5LB 5T5PA 3S6PA 4Q29A 5C4WB 4IEXA 3GZUC 3GBFA 3E6BA 3MICA 1WMFA 2HWD2 1RIRA 4GALA 4NN0A 4Q0PA 1G9FA 1QOOA 2VW2A 3J4UH 1NYWA 1PO12 2QCSB 1CONA 4YYOA 4B4QA 4FTSA 1ULFA 5FLJA 3ZN4A 3MIHA 5JI7A 5C33A 2VECA 1F8VA 4HVOA 5BNNC 2ATFA 3VLBB 1UMZA 4K7JA 1KITA 1MS9A 1HXS1 4E4SA 3ZDSA 1GNHA 3AP5A 4YW3A 1GR3A 1UF2C 2NQYA 2LTNA 4L9BA 2A73B 5FO7B 1D4M2 4RHV1 2AYHA 1YFWA 3B00A 4E4ZA 1H8TC 3KLSA 5GLVA 3LSDA 3SH3A 3FWEA 3ATGA 2XJRA 4NOTA 3RJ2X 1XQNA 1MZEA 4DRVA 2ZX1A 5BNPC 1NA1C 4XTMA 3FFZA 1OD5A 3KCCA 2WINB 5FO8B 4OI4A 1Z0HA 1YXWA 3QOPA 5J48A 3BALA 3ZIXA 1D4M3 1LHWA 4IV1C 3TWIA 3VGIA 2LALA 4A7ZA 3CEWA 2ZGOA 1BQPA 1QDCA 3VZLA 3R05A 3ZYRA 3I2DA 4FTEA 2ZZQA 1CGPA 4LBQB 1QH7A 3M3QA 4AEDA 4CZSA 3ZSKA 1WMDA 4LBQD 1WD3A 1X7NA 2I74A 3O14A 1CJPA 3ZN6A 1MS4A 3PJYA 4DS0A 1QOSA 3VBRB 1HW5A 4META 1LGCA 1G86A 1BJQA 1VBC2 4QPIA 1VBB2 3M70A 2X5IA 3AYCA 1ONAA 2QQPA 2WNUC 4OLLA 2RS13 3WZ1A 2BNMA 1LHUA 4NPRA 1MVEA 4AHYA 3LKJA 4OHWA 3IPVB 2UURA 3H7YA 1NCQC 3U11A 2E51A 1RGSA 4MX3A 4YGDA 3H1MA 2XHKA 1ZBA1 1MQTA 4PBOA 1LU2A 2HWD1 1AYM2 2DYCA 3EO6A 3TNQA 1POV0 1PO11 2FMDA 2SBAA 1YWKA 3RNSA 1IS6A 4YVWA 4PIXA 2EXKA 3KCYA 3RQ0A 3KGZA 4CDUA 4L92A 2P37A 5LK5A 4CDQC 3AX4A 3LAGA 4WM7B 2UWAA 2YGMA 2NM1A