1AYM3

Human rhinovirus 16 coat protein at high resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
238
structure length
238
Chain Sequence
GLPVYVTPGSGQFMTTDDMQSPCALPWYHPTKEIFIPGEVKNLIEMCQVDTLIPINSTQSNIGNVSMYTVTLSPQTKLAEEIFAIKVDIASHPLATTLIGEIASYFTHWTGSLRFSFMFCGTANTTLKVLLAYTPPGIGKPRSRKEAMLGTHVVWDVGLQSTVSLVVPWISASQYRFTTPDTYSSAGYITCWYQTNFVVPPNTPNTAEMLCFVSGCKDFCLRMARDTDLHKQTGPITQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 16 COAT PROTEIN
publication title The refined structure of human rhinovirus 16 at 2.15 A resolution: implications for the viral life cycle.
pubmed doi rcsb
source organism Human rhinovirus sp.
molecule tags Virus
total genus 40
structure length 238
sequence length 238
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1aym300
4NWVA 2WFF2 5C4WC 2HWB1 1D4M2 1PVC3 1R082 3ZFGA 1ZBA3 1TME2 2HWE3 1QJY3 1AR61 2R042 1MEC2 4WM7B 4WM7C 2HWB2 3VBUB 4GMP0 3VBUC 1BBT1 5JZGA 1WCDJ 1RB8G 1AR62 1X36A 1C8M2 1Z7S3 3JD73 5A33A 1PVC2 1RUG1 3JB8A 3VBOB 4CEYB 1FPN1 3VBOC 1EV11 2DF7A 4CEYC 1VBA1 3JBG1 2RR11 2TBVA 5ACA3 2RS31 3VBHC 4RQPB 1COV3 4CDUA 1VBB3 2BFUL 4RQPC 1ASJ1 1EV12 1RHI1 1ND3B 5C4WA 1RVF2 1ND3C 1NA1B 4BCUA 1A6CA 2RS32 1NA1C 1PIV3 1RUH1 3JD72 1RMU1 5D8AB 3ZFEC 5D8AC 1F2NA 2BPA2 4WM7A 4Y5Z0 3VBUA 1RUH2 4RS5B 3JB4C 4GMP3 1ZBE3 1QJU3 1R093 4RS5C 5ACA2 1COV2 5AC93 1VBB2 1RUD1 1VRH3 4Q4X3 4YVWB 1HXS1 2X5IB 4YVWC 1E57A 2X5IC 1PIV2 3VBOA 1AL23 4CEYA 1PGL2 3VBHA 1VBE1 5K0UB 2ZZQA 3NAPB 4RQPA 5K0UC 3NAPC 1RUF1 1QJX3 1ZBE2 4JGZB 1QJU2 4JGYA 1ND3A 4JGZC 5AC92 1BEV3 1NA1A 4RR3B 4CDWC 4RR3C 1VRH2 1PO23 4Q4V3 1AYM3 1RUF2 2PLV3 3ZFEA 1EAH1 5D8AA 3S6PA 2WZR3 1AL22 1FMD1 1AR93 5CFDB 2HWF1 2HWD3 5CFDC 4RS5A 1R1A1 1AR81 1R083 4Q4Y1 2FZ1A 2RS51 1FMD2 1IHMA 1QJX2 1AYN1 2XPJA 1NY71 2HWB3 4YVWA 2X5IA 4Q4Y2 3J8F1 1PO22 2WLPA 1AR63 1AYN2 1ND2C 2IZWA 1NY72 5DDJ1 2BFUS 1AR92 5K0UA 3J8F2 3NAPA 1BBT3 1RUJ1 2HWD2 4WM8B 4EJRA 4JGZA 1FOD1 4WM8C 2RM21 4CDWA 4RR3A 5DDJ2 1OHFA 1B35C 1BMV1 5BNPB 4Y4YA 5BNPC 1RUG3 1NOVA 4IV3B 2RM22 1FPN3 1EV13 4IV3C 1VBA3 3JBG3 5CFDA 2RR13 1RVF3 5BNOB 2RS33 5BNOC 4GB31 1BBT2 1ASJ3 1HRI1 1RHI3 2HWC1 4CDQB 4CDQC 2Y26A 2ZTNA 1QQP1 1VBC1 1RUH3 2QQPA 4GB32 3VBHB 1RMU3 1HRI2 1ND2A 1RUC1 1RUG2 1QJZA 1FPN2 2FZ2A 1RUE1 4JGYB 1VBA2 1QQP2 1HX6A 1ZBA1 3JBG2 2HWE1 2RR12 4JGYC 1VBD1 5J98B 5J96B 5GKAC 1V9U1 4QPGB 4WM8A 4QPGC 1RUD3 3VBFC 3ZFEB 1ASJ2 1B35A 1RUE2 1RHI2 1HXS3 5BNPA 4LLFA 1AR71 4IV3A 1RMU2 5A32A 1MQTA 1VBE3 5BNOA 1OPOA 4YVSB 1POV1 4RHV1 1AR72 1RUF3 4YVSC 1TMF1 4CDQA 5FOJB 3ZXAC 1RUD2 2WS91 1PO11 2GSYA 3VBRB 1EAH3 2MEV1 1HXS2 2R061 3VBRC 1HRV1 4PDWB 1FMD3 3IDEA 2HWF3 5C8CB 4PDWC 1NCQB 4CDXB 5C8CC 4CDWB 1NCQC 4CDXC 1R1A3 1VBE2 4Q4Y3 4QPGA 1HRV2 3VBFA 2RS53 1AYN3 3TN91 4Q4W1 3J8F3 1SMVA 2RMU1 2BBVA 1EAH2 1M06G 3M8LA 5DDJ3 2HWF2 1RUJ3 2XBO1 4YVSA 5ABJB 1NG0A 2RMU2 1VB2A 5ABJC 1R1A2 1AR82 3CJIB 1FOD3 2RM23 3CJIC 4N53B 2RS52 1ND2B 4N53C 4FSJA 4NWWA 5FMOL 3VBRA 1RUI1 4QPIB 2RS11 4QPIC 4IV1B 4PDWA 1AYM1 1OOPB 4IV1C 1NCQA 4CDXA 5C8CA 3DPRC 4FTSA 1OOPC 1B35B 1POV0 1RUI2 4GB33 2RS12 1RUJ2 1NCRB 1HRI3 2HWC3 1NCRC 2WFF1 5LK7B 1FOD2 1D4M1 5A32B 1QQP3 4Z92B 1TME1 1VBC3 2R041 4GH4C 1BMV2 1MQTB 1MEC1 1MQTC 4FTBA 1RUC3 3VBSB 4N43B 2BUKA 3VBSC 1W39A 4N43C 1RUE3 1VBD3 1GFF2 1V9U3 2R071 5ABJA 1C8M1 3CJIA 5C9AB 4SBVA 4N53A 5C9AC 2HWC2 2R072 1PVC1 3VDDA 1AR73 1CJDA 1VBC2 4QPIA 1QJY1 1H8TB 4IV1A 3DPRA 1H8TC 3VBFB 1OOPA 1RUC2 3HAGA 1K5MB 1HQNA 1K5MC 1POV3 4RHV3 1ZBA2 2HWE2 1VBD2 1QJY2 1NCRA 5BNNB 1V9U2 1RVF1 1TMF3 1DDLA 5BNNC 1Z7S1 2WS93 1PO13 3JD71 4GH4A 2MEV3 4AEDB 2R063 1VAKA 4AEDC 1HRV3 1Z7S2 3VBSA 4N43A 1AUYA 2WWSA 4CEWB 5ACA1 1F8VA 1COV1 4CEWC 1VBB1 2VQ0A 4RHV2 5C9AA 1TMF2 2ZAHA 5FMOS 3TN93 4Q4W3 1AL0G 1X33A 2WS92 1PIV1 1PO12 3LOBA 2RMU3 4RFT0 1PGL1 1AR83 2MEV2 2R062 1H8TA 5CFCB 1PGW1 5CFCC 1K5MA 2XBO3 4GMP1 5L7OB 1ZBE1 1QJU1 1R091 3FBMA 5L7OC 5BNNA 5AC91 1VB4A 1PGW2 3ZFFB 1VRH1 4Q4X1 3ZFFC 1R092 3TN92 3ZFGB 4Q4W2 1RUI3 4AEDA 3ZFGC 2RS13 1AL21 1CD3G 4Q4X2 4CEWA 5JZGB 5JZGC 2XBO2 1QJX1 2WFF3 3VDDB 1BEV1 3VDDC 1D4M3 4FTEA 4Q4V1 1PO21 1TME3 3DPRB 5A33B 2PLV1 1C8NA 2R043 1MEC3 2WZR1 1BEV2 5CFCA 1AR91 2HWD1 4Q4V2 1AYM2 2PLV2 2R073 4CDUB 5L7OA 1C8M3 1R081 4CDUC 2WZR2 4GH4B 2GH8A 5C4WB 3ZFFA
chains in the Genus database with same CATH superfamily
4LO6B 5JSOA 3VLBB 2LRPA 3UGFA 2KXLA 2DVBA 3T08A 2WO2A 4CRQA 3WNLA 2VZRA 1PVC3 5G04L 3DCQA 4DXZA 3O0WA 1QXRA 1AR61 2WWJA 2J1AA 1TEIA 2V5YA 5IVVA 1MEC2 4WM7B 3EBRA 3E5UA 4FVVA 2OIIA 3RS6A 1AVBA 1JYIA 4HETA 1EPWA 2O1QA 1VALA 1VE0A 1AR62 1LOEA 1XBFA 3VHRA 2GAUA 2E31A 3HQUA 4BZ4A 2KR2A 2RHPA 3DYPA 5F3GA 4MXVA 1K12A 5JIUA 4L2NA 3F2ZA 1LHWA 2IXLA 2PAKA 4CCDA 4CCJA 1HJGA 3JB8A 4HFSA 2OUHA 4CEYB 5FMCA 3RJ2X 4XCBA 2BDRA 2W95A 3ZXKA 3JBG1 2IFWA 3SKVA 2GC1A 1COV3 3AZWA 4IERA 4IL7A 3AMMA 2E33A 1LEDA 5FY9A 1PK6C 2VUCA 4BE3A 1W8NA 3AZVA 4M3CB 3RMYA 1RHI1 2VOTA 1ND3B 2QNKA 3H7JA 1DQ5A 1OLMA 2IXJA 1RVF2 3K4ZA 4IEPA 5FZLA 3RJRA 1A6CA 3LEKA 5LY2A 3WX5A 4B1MA 2JIGA 3DXTA 5FK7A 4AHXA 3PNAA 2G1MA 3OEBA 1WCQA 1OQDA 2WWUA 3OPWA 1G8WA 4NRMA 5LWBA 4COWA 2BNOA 3I2DA 3J26N 5F6LB 4EQVA 1GOFA 3EJKA 5E8AA 1VMHA 4JV4A 2HH9A 4AI0A 4AR2A 1SG3A 1FNZA 5IAXA 1H1AA 3V56A 5ACA2 3VZJA 4A45A 1JZ4A 2ZMLA 1B09A 4AFDA 4UW6A 3B69A 1N3OA 3HIFA 4HK9A 3LQCA 2BYVE 4WZCA 4YG0A 1YO8A 4OZXA 4Q4X3 4CPBD 3KQRA 4QM8A 5HCHA 5JR2A 4YVWB 4XF0A 1HXS1 4ZS3A 2P3YA 1IG0A 4DS0A 1E57A 1JHNA 2X5IC 1PIV2 2P17A 4CTEA 1AL23 2UY8A 4MSVA 2CSGA 4CCKA 2X8KA 3ZYHA 3KLSA 1PGL2 4AEKA 3CDZB 4KG8A 3LIGA 3LEMA 3FE5A 4FCAA 1PK6A 4DB5A 4ATEA 5K0UC 1HQLA 4QAWA 4QXBA 4XHBA 5DABA 4NMIA 3A4UA 4UFJA 2VMHA 1E5RA 4LHSA 3T0DA 4JGZC 2YMZA 4LBLA 2OQ6A 5AC92 4R9BA 2WUHA 4RR3B 1UNBA 1ODNA 3MUZ1 3POIA 1OD5A 4Q8KA 2V72A 2Q0AA 3KCCA 1VRH2 5FYYA 2Q5TA 3BB6A 4UT5A 5FXWA 2EICA 1EAH1 3J7LA 3S6PA 4RSUA 1KS5A 1GNHA 1BYHA 3LFMA 5F3EA 3UJQA 5CKQA 5FPXA 5GZGA 5TSWA 5FAXA 2Y60A 2TUNA 5FOJB 3NL1A 4P08A 2ET7A 4PHZA 1LOFC 1V6OA 1H8VA 2J42A 5FO9B 1LKNA 1RYYA 1UO9A 3N7KA 1R1A1 4GD4A 4DZGA 5FWEA 1GP6A 4Q2FA 4XVHA 3E6CC 2G9GA 2A73B 5EXOA 4R8HA 4PBOA 2RS51 2J1EA 4R4ZA 1QJX2 1MS3A 3NNMA 4UAPA 4GZ9A 4XF3A 2OW4A 3OYWB 5FZOA 2Q8EA 3I2GA 4BMEA 1YQ6A 1BK1A 2A6ZA 2XJPA 2NP0A 4YFZA 4EE2A 2X5IA 3J8F1 5HCFA 1OD3A 5IATA 1PO22 1ULDA 2WLPA 2Z42A 1NLRA 2JDYA 4D0QA 5JSPA 2VOXA 1H30A 1LHNA 1W8WA 2OPWA 1ND2C 3MUY1 4LO5B 2I07B 4M4PA 4AHWA 1ENQA 1O4TA 1OA2A 1UZVA 3POBA 2IVJA 5DDJ1 2CNAA 4DEQA 1I1EA 4F83A 1CIWA 2IFRA 5K0UA 3J8F2 2MNGA 1BBT3 2HWD2 3LPGA 1EPZA 3UYJA 4WM8B 2ORXA 2YY1A 3N7MA 4EJRA 4AVCA 2CL2A 4JGZA 4MGSA 5FRAA 2NMOA 3RPQA 1G6NA 3AP6A 5DDJ2 3KB5A 4LNVA 3WLUA 1CPMA 4QDQA 4AG4A 1GZ9A 3PL0A 2E51A 4Y4YA 3KVAA 4HSLA 2BV4A 3ZR6A 5EWSA 1KEXA 1Y9MA 2RV9A 4LKFA 1UX7A 2JG8C 2RR13 3WR0A 1LOFA 4BQ1A 4ARXA 5BNOC 4OI0A 2WNOA 4GB31 1O4ZA 1E5HA 4QKFA 3B00A 4PBPA 2DWRA 4ET7A 3BU0A 1V70A 1XB9A 2K2SA 4CP9B 2W39A 2JWPA 2ZTNA 3Q8BA 1Q8PA 1VBC1 4OULA 1O5UA 4GB32 1REFA 4KQ7A 4F7ZA 2VZ1A 2XGXA 4FPCA 1ND2A 4QHZA 1FNYA 1RUC1 5D2AA 1UD1A 1QU0A 4BM8A 3WF3A 1S0CA 1FPN2 5L9VA 2FZ2A 4ISQA 3WDWA 3K77A 3K3OA 2HWE1 3APBA 5FYTA 5J96B 1O3QA 1V9U1 4UW3A 4XJZA 1YI9A 2ES3A 5JWPA 3W20A 3VBFC 1UIJA 1WLCA 2ZMKA 3ZXEA 1ASJ2 4YZ1A 1D2QA 4EWDA 4AQ2A 5CA6A 3OCPA 4HXCA 3TYJA 1TE1B 4JQTA 1W6OA 2QE3A 2VMDA 3GF6A 1ZRRA 2XWJB 3ITQA 4HG6B 4XF1A 3USUA 2PAEA 3HMYA 2Y38A 1Q3EA 2ORZA 4EWAA 4DPNA 1LAJA 3FLTA 3OGJA 2UU8A 3MIDA 5T55A 3AVRA 1W3XA 2P6CA 1DQ0A 1CESA 4NN0A 1QF3A 4KNCA 3SITA 3UT0A 5BNOA 4AK3A 5F5IA 3SCHA 2NLRA 4YVSB 4BB3A 4RHV1 1JXNA 1RUF3 1WUVA 5FREA 3RI8A 4QX2A 4XW3A 1O59A 2YGLA 2P37A 5GLWA 3I49A 2BZDA 5I8TA 3A0KA 3KGLA 4V2WA 1W90A 3LE0A 4XURA 5FYVA 3ZXAC 1RUD2 3H0OA 1Q43A 3D3AA 5F5QA 4NIGA 2FDHA 2D3SA 4V2VA 3N9PA 4NPMA 5KHGA 3VBRB 4BMBA 2YDEA 2MEV1 2FHRA 3NV3A 1QDCA 3BCWA 3HT2A 1OSGA 1FMD3 5CG9A 2NMNA 3AL6A 1IKPA 1LOGA 1ONAA 1Q56A 2VZQA 1OBNA 1UU4A 1DU3D 3ZO0B 5C8CC 3AM2A 3BGAA 3BYWA 4HSJA 4Q4Y3 5IJRA 3NWKA 1UY3A 1UY1A 2W1SA 1J84A 1I9RA 2QZ2A 3HWJA 3VBFA 2O0OA 3I3QA 4QB6A 4TTGA 2FQPA 4GWNA 2QBXA 1J3QA 5IYYA 3CBNA 2AC1A 4YZ5A 3WDVA 4BA6A 1W28A 5A3UA 1NYWA 4Q4W1 5EJ3A 4YW3A 1YEWA 5FP9A 4R4XA 2RMU1 2VMCA 4KMQA 4JHTA 3V0BB 1W6NB 2D3RA 1OC1A 2Q4SA 2WAOA 2ZBJA 1UOFA 5FLHA 5F37A 4XIOA 3DYMA 2WQ8A 3ES4A 5HCAA 1KFUL 3KMHA 4XEZA 4CUGA 3F95A 4K8FA 4N7UA 2CV6A 2HWF2 3AB0A 4YGEA 5FXVA 4B4RA 2ZS6B 2RMU2 1NUKA 1AR82 3TOJA 3CJIB 2L9LA 2FDKA 1Q8SA 1U5YA 2F4LA 1AXZA 4Q0QA 3H8RA 3ZKUA 3GJAA 3O5SA 4LE4A 1ND2B 5A6ZA 3NV2A 4QQ2A 3CHXA 2RE9A 4AI2A 4P9JA 1UXXX 2Q30A 3W59A 3HN3A 4BQXA 4CA9A 1ZRIA 5IK4A 1OA3A 2VNOA 5ANNA 2GMMA 1I3HA 4ZPIA 3SXWA 3U10A 3WXPA 4Y4RA 2XHKA 4YARA 5C8CA 4FTSA 4OYUA 1UW8A 3ACIA 1POV0 2XL7A 4JAAA 5A3LA 3MGUA 4HPKA 3C7EA 3UGHA 1RUJ2 1DF0A 1W6MA 2VE1A 3CKHA 1HRI3 2HWC3 5E16A 3R0RA 3T1LA 4XFIA 4A41A 4R52A 2BEOA 5LK7B 1IZ3A 2RDQA 3USSA 5F5AA 1QQP3 4Z92B 1K42A 2VVDA 1M4WA 2D7FA 1S1AA 2R041 3MV11 5GLUA 1U12A 3VBSB 1JH5A 2FDJA 2GN7A 1CX4A 4Q29A 2KM2A 2BNNA 1YCIA 1SLTA 1Y4WA 4QU1A 5L19A 1RUE3 1YQ5A 2EIGA 1X9TA 2W94A 4LXLA 4ZXKA 5BXXA 1S0EA 4S2DA 1GZWB 3INAA 1R64A 2QJVA 2R071 1MZEA 4AE2A 1C8M1 2YGMA 4HONA 4RL7A 2YBPA 3O14A 4H7LA 1H0BA 1G86A 1YFWA 4DOUA 3WCSA 1QNWA 2Z79A 3QH6A 5BUVA 2R072 1PVC1 2CHHA 4KL1A 1XNCA 1QXPA 1WBFA 2IWGB 3MPPG 4H7MA 4K7JA 3RQ0A 5C3PA 1UWWA 1H8TB 1BCXA 1UKGA 1WW7A 2H0BA 2G9FA 3VBFB 4LMFA 2OT7A 3JQXA 5T50A 2EIEA 3M1HA 3B9CA 1UZZA 1Y7BA 1HN0A 5FZMA 1K5MC 4X6RB 4U36A 3HQXA 1VBD2 3NW4A 2TEPA 2DUOA 5FUPA 2GN3A 1DDLA 3T09A 3PVNA 5FYIA 4AYUA 1DGLA 2J7MA 4N7IA 1J59A 5LRSA 3FHQA 1TZOA 3N9QA 1JODA 3S7EA 2VZSA 3KT7A 3H1YA 3PU3A 5FP4A 2LUWA 1HRV3 4D6SA 2XKOA 2VU9A 1PVXA 5HV0A 2EVXA 5A6YA 1MS4A 4LORA 1DIWA 4O9EA 4QQHA 4LKEA 1U0AA 4CEWB 4AGRA 3NRUA 1COV1 1Q5OA 2PFWA 2VQ0A 4QKBA 3MBWA 5DAVA 1DG6A 3ZPYA 2QQNA 1W3VA 4XQWA 3TN93 1O7FA 1W0OA 4LK6A 2Z4FA 1AL0G 2X53S 2YPJA 3DKQA 2IUWA 2DURA 2ZGLA 1YYNA 4LKDA 3AFKA 5SV8A 3VZLA 3GBFA 1DLLA 2J1TA 3AYCA 2ZEZA 1QMJA 3WHTA 2R062 4NIIA 1DGWA 2D5HA 5CFCB 3GHNA 5LY1A 1BLZA 1W6MB 1HW5A 2VBBA 5FZ0A 3QD6A 1UOGA 4I0WB 1K5MA 3MLJA 2XBO3 3ETQA 1STMA 4L11A 5FR3A 5KC6A 5A3TA 4LO4B 1W8FA 4YRDA 1HLCA 4BWOA 5L7OC 4LA3A 1MS1A 4X8NA 3ZFFB 2XJUA 4NHKA 4Q4X1 1X8EA 3ZYGA 5A7OA 2ZHKA 4WZFA 1ZZBA 1RUI3 3ZXFA 3G7DA 3ZFGC 3D5OA 1AL21 5DAWA 4A42A 4JRAA 1LECA 1CD3G 1KJLA 5FP3A 2DV9A 4IGOA 4Q4X2 4FPYA 4UBGA 4NUBA 4RGKA 3B93A 3LSDA 1BKZA 5EHDA 3UV9A 5LATA 1XNKA 3CF6E 4TZDA 2WN2A 1UZYA 4W50A 1ODMA 5JZGC 3TBDA 4MXWA 1P8JA 5DZFA 4HANA 2OXBA 2PHXA 2WNEA 2VNGA 3CEWA 3KT4A 3VDDC 4CCNA 1J1TA 1D4M3 3S0MA 2D6KA 1GSLA 3B94A 2VOWA 3L2HA 2NN8A 5FOBB 4LK7A 1FAYA 4XJAA 2YC2A 1ZZ8A 4JQRA 4XE9A 4HVQA 3ZLIA 3CQOA 3H9AA 1D2SA 2VD7A 2B46X 3A21A 3KWVA 3KS7A 3KCXA 4L97A 5FZ3A 4NIAA 5JMOA 4ES8A 4CXWA 4UYBA 1DQ1A 5L7OA 3I2JA 4UBHA 1SZBA 2JDNA 4LEJA 4CDUC 5CISA 4NO4A 3WQBA 4XMIA 2YU1A 2A71A 4B3NA 4GWIA 5J09A 3IAQA 5F3IA 2FMYA 4NWVA 3R05A 2WFF2 1TVGA 2R1BA 5CKNA 4BIFA 1O8SA 4FFGA 2Q1MA 5SV5A 2DYCA 3ZFGA 4MX3A 3A0NA 4JCKA 3ZM8A 1TME2 5A3PA 2HWE3 5E89A 1QJY3 4EN0A 3N35A 4YM1A 1O91A 2NYYA 3PVEA 2W52A 4IE0A 4Q1RA 4XTPA 4LR4A 4OCTA 4WM7C 5APAA 1N3PA 1V6MA 1H9WA 4Y22A 4CUCA 1BBT1 2BOJA 3AXDA 4P02B 1T6BX 5JZGA 3PHMA 1RB8G 5JCTA 4QXCA 3CLPA 1O5LA 1QHDA 3ETPA 3KHCA 1I6XA 2IXIA 1FXZA 1Z7S3 2UURA 3HVDA 2VCCA 3WQ1A 4PLNA 1BZWA 3RZGA 3JD73 5A33A 1PZ9A 3MLKA 3ROUA 3WEZA 1W2OA 5JXIA 2ARXA 4QQLA 1SDDB 3EYPA 3OGVA 3ZSLA 1O8PA 3OSDA 5JVVA 2ATFA 1WLWA 4IESA 4BQ4A 2DF7A 3UKTA 4CEYC 5KBFA 5KXCA 2EXIA 2RR11 2VCBA 1AZDA 2QQMA 4NPRA 5IHRA 3NNGA 4ZKTB 4CDUA 2ZABA 4D7YA 1VBB3 2LROA 5BNQA 2VO5A 3C3VA 4RGAA 2J1VA 1K5JA 5FQ0A 1T2XA 3RWKX 3WW4A 1KRIA 1ND3C 3IDCB 3H50A 5IFTA 1DGWX 4IEYA 4WVZA 3QACA 3O1UA 2BVVA 1XQNA 3WZ1A 3TEYA 3U78A 5GZDA 1WWYA 1F2NA 4IQPA 4WM7A 2WSVA 1NLSA 4BU2A 2FDIA 4V1PA 3OUHA 1QH7A 3I7DA 3WNMA 3IIIA 1ZBE3 4P9WA 3RWNA 1QJU3 1NXD1 1U5IA 1YFXA 1QH6A 1HB1A 1JYVA 3AP7A 3AX4A 1LNSA 2PA7A 3WQ7A 5KC5A 4FPKA 4XJ8A 1LRHA 2LW8A 5CBLA 3ME2A 4MGQA 3CO2A 5JPMB 2D6NA 2AENA 3WF4A 2NPIA 3ACLA 4YVWC 2VXRA 1O3SA 3OGSA 1NX9A 2RDNA 1JUHA 1AX2A 2PELA 2XQXA 4CEYA 1GZCA 3BTXA 3WDXA 4P00B 3L2YA 4IEUA 3UL2A 1UQXA 3UKVA 3AL5A 3NAPB 3FZ3A 5LEJA 3NJZA 4ZZ8A 4QX8A 4QB2A 4RYDA 1RUF1 4PLOA 4XABA 4M3CA 1S0GA 3KQ4B 1ND3A 4GKYA 2XR4A 1GKBA 5GJ6A 4Z2WA 2D97A 3K3NA 3ACFA 3P3NA 3ZIXA 4YM2A 4OQ8A 2WT1A 4RR3C 4Q4V3 1MZ6A 3DYOA 2OZ6A 1G9FA 5JAXA 1RUF2 2PLV3 1O3TA 2E6VA 4KH9A 5CVRA 3POFA 4Q0VA 2CAVA 5FJHA 4AFBA 1Y43B 4YG6A 5K7PA 1JYTA 4Z1VA 5FUIA 4AVTA 1ULEA 5LBBA 3R6SA 1FMD1 1AR93 5CFDB 3K4AA 3CIHA 1UYYA 4G3YC 3A23A 5JOWA 1UU5A 1XE0A 1W05A 1ZZ7A 2ZEXA 4PIXA 2PN5A 3NMBA 4Q4Y1 4EZ4A 4KBBA 3T3YA 3POWA 2XVLA 4Q0UA 2CYFA 1FMD2 1IHMA 1JUIA 3THTA 3BU7A 4QDRA 4UOJA 3WY6A 2VH9A 2HWB3 2BQPA 2JDAA 4PF5A 4QXHA 4YVWA 4HVRA 4XXPA 4KI5M 1S4CA 4Q4Y2 5FYSA 4I3GA 4W4ZA 2C6SA 4NRQA 2VAUA 4XDPA 5FZ8A 3GALA 4P14A 5A3WA 1XXNA 1W2NA 5BY5A 3KV6A 5F5CA 3GXUA 4QX0A 1RJ7A 3ST7A 3OGGA 2WT0A 5FLJA 5C6CA 3RZJA 4GWJA 4HBNA 3MW2A 1HV0A 2CAUA 2ETEA 1NZIA 2B9VA 5A70A 2JIJA 4Z8BA 4WM8C 4MUVA 4CCLA 4CPBA 5JMCA 4N9IA 4I09A 4LBQD 1EYBA 4RR3A 1OHFA 1W9SA 2P2KA 3UETA 1DZRA 2JKBA 1BMV1 2RJ2A 3MW3A 2VW1A 5BNPB 5LW9A 1SLCA 2V5DA 1XC6A 3BN6A 4XFBA 4D6QA 1RUG3 1NOVA 5KHHA 3VB9A 4UFHA 4C0BA 2VG9A 3ZYFA 5JLVA 3AKQA 3OJBA 1JW6A 1JS9A 1N1YA 1VBA3 4E4SA 2B8MA 2ZGNA 1GZTA 2YB7A 1T6GC 2OX0A 4G9SB 3VZMA 5FFOC 1CAUB 2OPKA 4BH9A 1RL3A 3IZOA 3BKZA 2W87A 4FOWA 4KG0A 4LBQB 1CWPA 3RZKA 1AXYA 1HRI1 1JOBA 1NQDA 2HWC1 3K51A 4S2HA 4CDQB 4XBQA 4FP2A 1E5IA 3WQ0A 3OYWA 1GOGA 1S0BA 4KWLA 2W47A 4O65A 1GYKA 2VQAA 1O6UA 1QQP1 4KBZA 3VKMA 1RUH3 3L9JT 2ET1A 1RMU3 2ARCA 1HRI2 1GQHA 1DBNA 1X9PA 2VL4A 5FZHA 2P4EA 1KXGA 2ZAAA 1QJZA 5JXHA 1W8OA 2JB8A 3AP9A 1LB2A 1RUE1 2HBTA 4LIVA 1DGRA 4XETA 1QQP2 1ZBA1 3JBG2 5J98B 3ABZA 1SCSA 1JI6A 5F39A 5IAVA 4HL0A 1LULA 4WM8A 1WKYA 4BQ3A 5IK5A 3H1WA 2E32A 2UWAA 4QPWA 2D43A 3E1F1 5LBFA 1RUE2 1RHI2 4J25A 3ACGA 2AACA 3NQHA 3D4KA 5HV4A 4E2GA 2Y0OA 1D4VB 4JDMA 2ID4A 1EUUA 5CKMA 4LLFA 4J1XA 4UW5A 1N1VA 2PMWB 5LRRA 3VZKA 1W9WA 1XSQA 3NSTA 1PHMA 2DU0A 3WHUA 1MQTA 1VBE3 2BTVC 2WO7A 4YW4A 4JTOA 2VCAA 1OPOA 4J1WA 1REEA 2JDKA 5F2SA 4OFGA 3CZUA 5FZDA 4YVSC 1CZTA 1LGNA 3FFZA 5FZ7A 3AKRA 2JE8A 4FBFA 3NNFA 3MIBA 4CP9A 1YQCA 4QGNA 2JD9A 3GJBA 5CIRA 4UF0B 2GSYA 5FIXA 4JKMA 5I0DA 3PTRB 1HXS2 3VBRC 2YROA 3WP3A 1JOPA 2W3JA 1HRV1 5HBAA 3C2UA 5GZEA 4PDWB 1W06A 2HLEA 2ZGPA 4DXRA 2GC2A 1DFQA 4CDXB 4Y1ZA 3VKNA 1UU6A 1G9AA 3ORJA 4BJ0A 3M7AA 2YHJA 3M3OA 5EP9A 2GNDA 3T1MA 1V6LA 4E8DA 2J22A 5FPUA 3MIHA 1HRV2 5K9YA 1QGLA 5FZCA 2Y8KA 4AAPA 1QXJA 1NXMA 2O14A 2VC9A 2PTMA 3E97A 4XFGA 1L7RA 3TN91 4HOOA 2VCMA 3WP5A 4XFHA 3WD5A 3POJA 2Q8DA 2E9QA 1SMVA 1LHOA 3C7GA 3JCIA 1CN1A 2OA2A 2PXJA 5IVBA 1S2BA 1EAH2 1W9FA 5CZKA 1JHJA 3RDIA 1M06G 3IWZA 3PJQA 1MS5A 3OF1A 2A3YA 2VMGA 1QKQA 2Q1FA 2ZJCA 1H2KA 5FZGA 5CEHA 2QQUA 3A7QA 1QDOA 1WMFA 2XBO1 4O9GA 3P1IA 4W65A 3H42B 4UFMA 4YVSA 5ABJB 5C33A 5C7GA 5DAXA 5JOYA 1R1A2 2DDUA 1FOD3 1CAVA 3W5MA 1PZ7A 1Y9QA 3NVCA 2RM23 3CJIC 3ZSJA 2GNMA 1YRZA 2RS52 4FXGB 1HIXA 3H8OA 2N7GA 1LTEA 3LDRA 3SMHA 4JHZA 3AFGA 4NWWA 5H9PA 3VBRA 1BVVA 3WG2A 3LA2A 4QU2A 1RUI1 4AVVA 4QT6A 5A7WA 1WMEA 5BYNA 1O3RA 5AFBA 4XJ9A 3W9AA 4OUSA 1OOPB 1DZTA 4AI1A 3MDPA 1CAWB 1PX3A 2AEZA 1PX4A 3MIFA 1RUI2 2VXJA 3P3PA 1NCRB 2QDRA 3POGA 5HXVA 1GQGA 3H7YA 4AVBA 3ECQA 3CMGA 1D4M1 1QWRA 4FI9A 2A1XA 4OHVA 2PHDA 3WF2A 5FZFA 3T0BA 2FCUA 4W6XA 1MQTB 2ZEYA 4RGGA 3RZMA 2WRAA 3LPFA 1PM4A 2NQYA 1W6NA 3V0BA 4INDA 1W04A 4E4ZA 4M0NA 1ZZ6A 3THDA 1H2LA 2BUKA 3VBSC 2W2IA 1W39A 1WCKA 2MHFA 3U14A 4QKDA 4AAXA 1JU4A 1WW4A 2P3KA 3NKTA 5C71A 2P3IA 1ZNPA 4XFAA 2W68A 2YU2A 3MHZA 1SBDA 2QTWB 2YC4A 3CJIA 5FP7A 5C9AB 1MPXA 5DXDA 1YWKA 4SBVA 4XJWA 1W2UA 5IVFA 5L9BA 1G9DA 1SLLA 4ORFA 3AC0A 5FO8B 1CQ9A 3U4XA 1SFPA 2RDRA 3M3EA 1AR73 1VBC2 2PHUA 1QJY1 2UWCA 3HN1A 5CAZA 4A3ZA 1H8TC 4NOTA 5JOXA 1RUC2 5FKCA 3O1RA 3H8XA 5A6XA 4LE3A 1H9PA 1POV3 1GP5A 3J7NA 2HWE2 1QJY2 2E53A 4FFFA 1V9U2 4A7KA 1SLAA 1TMF3 4CVUA 3MI8A 1YUDA 3GZAA 5FK8A 1Z7S1 2ZGTA 2Y6KA 5FY8A 2J1RA 1PO13 2WS93 3ATGA 5HPOA 1GLHA 2RDSA 3JD71 1GANA 3J7MA 1WLDA 4B7EA 1SACA 1OKQA 4FPGA 4AEDB 5I0RA 3ZN4A 3B7MA 3S30A 1Z7S2 1GQPA 3OBTA 2RVAA 4MH0E 3VBSA 4B4PA 1F35A 4XACA 1RC6A 5HI0A 1CAVB 3I2IA 4QMAA 4BISA 4FT8A 5KXEA 1ZZCA 2VPVA 1GZWA 3WG1A 4AFCA 2A6VA 4CEWC 4X6QB 1VBB1 1W2AX 1YFUA 4YZ2A 1DP0A 5JI9A 1K3IA 2ZGSA 5JUVA 3P5BA 4RHV2 2QQKA 1O4YA 2H6CA 2ZXQA 3TEWA 1XU1A 2ZAHA 4IEWA 3OY8A 5A7WB 1GNZA 2DVGA 1EY2A 4Y26A 5KXBA 1TQ5A 5FV3A 3M3CA 4QPYA 4OUEA 4IEXA 1GWMA 1W8UA 3I97A 3OPTA 2BW8A 2EXJA 3CL1A 2W1QA 4JC1A 3PUQA 2MEV2 4A2UA 3MFCA 1H8TA 4LBJA 3LA3A 4CU8A 5A7SA 3H8UA 1LGCA 5CFCC 4DINB 2F6BA 3KV4A 1YI7A 1ZBE1 4Y33A 1AXKA 1W9TA 1QJU1 3FBMA 3WW1A 4FOVA 3SCFA 4Y1XA 1XNDA 2J1UA 2UYAA 5FCCA 1XRUA 2WA4A 2WO3A 2QZ3A 4O7XA 3ZFFC 1QEXA 4FAGA 1ULOA 3MV01 4QXKA 3DF0A 3BIEA 1SBFA 4Q4W2 4WV8A 4Y1UA 4TN7A 4C8DA 3N7JA 2RS13 4AVAA 1I5PA 2XMLA 4M0HA 4HZFA 3U1XA 4AEJA 4KWJA 2ZGOA 3WCRA 5C3OA 1ULPA 2JICA 5LB6A 2DU1A 2V73A 5GLTA 4CEWA 2QKDA 3KF5A 3AYEA 4S2GA 3WF0A 3QBQA 4Z2AA 3OBZA 1IQDC 1XOYA 3FJSA 4FTEA 3RZZA 1UOBA 4AI9A 2BERA 2WQZC 2Q1ZB 4Q4V1 5J37A 1JU3A 4PIZA 3O7OA 2BGOA 4K9SA 2PLV1 3AJYA 3ZN5A 1RINA 4L99A 3WNPA 2B7YA 1MEC3 2PAMA 2R7EB 3LFIA 5FY5A 5C3RA 5CFCA 4HT1T 1ZA4A 1AR91 2W1WA 1VIWB 4XBLA 3V0AB 4Q4V2 5FY7A 2PLV2 3C8XA 4IW3A 5LA1A 2EXKA 1ULCA 2C26A 3RFRA 2LM3A 3PIGA 4HLTA 3WDTA 2BWAA 2GH8A 4H14A 4EN7B 4PLMA 4LUMA 5C4WB 3ZFFA 1UKRA 5I0UA 3ZIWA 4IUGA 3ZN6A 4XFCA 1S2EA 2GC3A 2HWB1 1W0PA 2PQSA 4D94A 5E1RA 2P3JA 4PI0A 5I91A 1ZBA3 5B2GB 2DFCA 2R042 2R16A 2JJ6A 4M00A 5IW0A 3VHOA 3ZX7A 4EN6B 2V09A 3HQRA 1JZ7A 1AHSA 4MGZE 2JG9B 2HWB2 2XH6A 3VBUB 5IVEA 4GMP0 3UNPA 1NE6A 3OUJA 5FZEA 5J48A 3GYDA 5FPZA 3OY8B 2BNMA 2DFBA 3K75B 4Q26A 4XBNA 5FY0A 1X36A 3JU9A 2O8QA 1C8M2 3PURA 5IK8A 2JXAA 3Q8FA 4W6WA 1XSRA 2A6WA 2D40A 3PMEA 1JYCA 1VPHA 4EROA 3OBAA 4CU6A 1PVC2 1RUG1 4YW1A 3VBOB 1QOOA 3A22A 3J9SA 1PMJX 1H4HA 1CX1A 4ONUA 1OPMA 3ILRA 1VBA1 3O0XA 3OOXA 4LTAA 2Z69A 5G05L 1OUXA 5ACA3 1PMHX 1DQ2A 4RQPB 5T5PA 1LHVA 2D6LX 2VUAA 2CGOA 1XNTA 3N36A 2LTNA 2WO1A 2X10A 1HN1A 3DN7A 3E6DA 5C3SA 1RTVA 1NA1B 5K4LA 4P9YA 3U4SA 4YWAA 2AEYA 1PIV3 4URAA 1C3HA 1RUH1 2ZHMA 4Q0PA 2BGPA 3ZYPA 1GMMA 1RMU1 1LEMA 3B02A 4YW5A 5D8AB 3VHPA 3WNXA 1CJPA 2YYOA 3MEPA 3RYPA 1SPPB 2JDHA 2VULA 4Y5Z0 5GZFA 1N47A 4Q27A 3U11A 5A80A 3WNNA 2XVGA 3N9NA 4RA0A 1JZ6A 1RUH2 4RS5B 3JB4C 5EJZB 3KF3A 2JECA 5FZBA 1IGOA 1COV2 1QJFA 4XC9A 5AC93 3NV4A 3VV1A 2WINB 1SLIA 5A6QA 3ZXDA 5C8WA 3NO8A 5DMYA 3VD9A 1VRH3 5DZEA 5C70A 4NE9A 4UXAA 3W5NA 3TAYA 4AQSA 1LJ7A 1C1FA 5KR7A 4LIUA 4BOWA 2VUDA 4BPZA 2BOIA 2ERFA 2XLAA 4QDSA 4C90A 2BWCA 3MICA 4XMAA 1VBE1 2VY0A 3E5QA 1YNAA 2C1FA 2ZZQA 3PIJA 1LHUA 3MZHA 4A44A 3NAPC 4LPLA 3ZN6B 3RYRA 1QJX3 1AJKA 4LLOA 3BODA 4JGYA 2HJIA 2HEYF 1W8TA 5GALA 5T5JA 3SH5A 2Y64A 4AGGA 4CDWC 2D6OX 3MFAA 4CU9A 4CXXA 3NKGA 4RFRB 1PO23 3GNEA 4H55A 4CP0A 1SEFA 3EHKA 1ZYBA 3N9LA 4ARYA 1GBGA 3LZZA 1UX6A 4HMZA 2I74A 2WZR3 1J83A 4TSVA 2KA3A 4BYYA 3FLRA 1AL22 3GZTB 1KQRA 1LR5A 2HWD3 3E6BA 5FPLA 2V4VA 3BVCA 4ASLA 5CNAA 5CFDC 4C0HA 5A7PA 3U07A 1R083 4I02A 4CUAA 5J3UA 4FQZA 4XUOA 1BQPA 2BU9A 5KHIA 2FZ1A 4FPHA 4XFFA 5H9SA 2WJSA 1W03A 2HEWF 1KJRA 5EPAA 3EXUA 3LEGA 5JR7B 4BQ5A 3S5AA 1NY71 4COUA 3IN9A 1WCSA 5IVCA 2C5DA 2JE9A 5T5OA 3VZNA 2ZPXA 3VL9A 2EAAA 4DEVA 4PQ9A 2PHLA 4FP3A 4ZZ5A 3QCWA 4Q0SA 3TNQA 2VZOA 3RGBA 4E2SA 2IZWA 1NY72 1YJKA 3JUUA 2BFUS 1L7QA 3WDYA 4FFIA 3I3EA 2VMIA 3NAPA 2XJRA 3ZMNA 3ZYIB 1S0IA 3RI9A 3ILFA 5EYYA 3BIWE 5FWJA 4JVAA 5ISLA 1FOD1 2WAAA 1MVEA 3DKWA 4OI1A 2I45A 5FYMA 2RM21 3I59A 4XUTA 1W8HA 5AVPA 4AQ6A 4CDWA 1G9BA 1BVP1 3PUIA 1MS0A 2UY9A 3LEIA 4K6BA 3AMHA 1DCSA 4QHOA 3UGGA 3BOPA 2FCTA 4G4FA 5BNPC 1WZXA 4IV3B 4LUKA 1UXZA 1FPN3 2RM22 1C28A 1EV13 1GWKA 3I2HA 4K21A 4I3PA 1LENA 5CFDA 4QX5A 4COZA 3UJOA 1CONA 1SBEA 2ZMNA 2RS33 2ZA9A 1BJQA 4AOCA 5B4NA 2XJSA 4QKNA 2JB4A 1BBT2 2B4KA 4ASMB 1ASJ3 4LJHA 4B29A 2A75A 3OGRA 3OTFA 4CDQC 3ZXJA 1OF3A 4XJUA 1MZFA 2PHRA 1IOAA 2XJQA 4UW4A 3RZLA 1A8DA 2A3WA 1OURA 2QQPA 3H3LA 2Q8OA 1WW5A 2WIIB 1UZ0A 4HK8A 5DUWA 3POSA 4GAZA 1YHFA 2WBKA 1QNYA 2PHTA 4NR1A 2FCVA 2WNVB 2XUEA 4JGYB 1ZX5A 4XPVA 3IPVA 2RR12 3K4DA 5FKBA 1KD7A 5GKAC 5A7QA 1V00A 1ULFA 4QPGB 4YZ4A 5DUXA 1WGPA 4PIYA 3FBYA 1GV9A 2DBNA 5A3OA 4JKKA 5LA2A 1RUD3 2D3PA 1V6KA 2CY6A 1NQJA 5GZCA 1X82A 4BIOA 3LKJA 4QHBA 3HJRA 3TWIA 5BNPA 2RJLA 2D6PA 2G4IA 3FC0A 3KCYA 4ZS2A 1OLME 5F7UA 1AR71 2CDOA 1CIYA 4K20A 3KZ4C 2KD7A 4L8QA 4UFKA 5CU1A 1AF9A 4ZXEA 4X8PA 3AP4A 3FUOA 2R30A 5JI7A 4BXSV 3HR9A 3N3HA 1CAUA 1POV1 1AR72 1GWLA 2AH2A 3NJVA 1LESA 4LBQA 4WVWA 1DQ4A 1TMF1 4CDQA 4ATFA 2WC2A 2WS91 1PO11 1U5XA 1WCUA 2XKPA 4ES9A 1MACA 1OT5A 4HVOA 1Q8VA 5FBZA 3OPZA 3D8CA 4F3JA 3O1PA 1OXCA 2RJKA 5AVAA 1H1MA 1S0JA 3GZEA 3T2TA 3MF9A 3S57A 3VGIA 2HWF3 4IXLA 2HEVF 4GJZA 1NCQB 4PDWC 1TG7A 4CP1A 3I59B 1OUSA 4MZUA 4CDWB 2W92A 4CDXC 2QUOA 1SLBA 2BP6A 4YW7A 5ERLA 3N7LA 4GKXA 2K0GA 2YG0A 2XVKA 2Q8CA 5KHKA 4YFWA 5FYCA 5JDBA 3NV1A 4MGTA 1AYN3 1UPIA 4Y24A 2DTWA 1FT9A 2ILMA 2ZGKA 2QDNA 2DBIA 3LD8A 3LDBA 4Y20B 3IDAA 5T54A 4KGQA 3AKPA 5A1LA 5L73A 3HBZA 1UY4A 4WBBA 3MF6A 4XUNA 2ZHLA 2ZGRA 3RG0A 4CE8A 2BBVA 2Y33A 2YBSA 1UL9A 3MLLA 2DCKA 4A6OA 4PCRA 3AKTA 1I5ZA 5FDBA 1RUJ3 4EZHA 1F9KA 1SCRA 1H2NA 1NG0A 2QQIA 2VZ3A 3LSEA 1VB2A 1VJ2A 3B3QE 1ZVFA 4DMIA 5ABJC 1UN1A 5HXMA 1V6IA 2GALA 4IEVA 4XAEA 5LCWL 1OLQA 4N53B 4WVMB 3WG4A 2QFEA 3I3BA 4D8MA 4FSJA 4UFIA 4UF0A 3O1SA 1KS4A 5FUNA 4LA2A 2DVAA 1NE4A 4IEZA 1XYPA 3IPVB 3IMMA 3Q8EA 2HKXA 4QPIB 1VMJA 2RS11 2WFPA 1JZ8A 3BTYA 4IV1B 4PDWA 1AYM1 4IEOA 4URTA 3THPA 5HCBA 4CDXA 3PUAA 1ULGA 1K45A 1OOPC 3TNPB 3D82A 1W6PB 2XPJA 4YNIA 5I8SA 2RS12 2Z2SB 5IFPA 4P9IA 5E6HA 4AI8A 1NCRC 4HKOA 2EALA 4CP2A 3WP6A 3EB7A 4LITA 3ZDSA 1ZM1A 2GP3A 4ISRA 5LBCA 3FL7A 5LASA 4OLLA 4GH4C 1BMV2 1F5FA 1HDKA 2B42B 1MEC1 4U2AA 1MQTC 4FPJA 4BQYA 4FTBA 3KSCA 4XXAA 4N43B 4UFLA 5EZWA 2VW0A 4YZ3A 4BK5A 1F15A 3AMPA 3KGZA 3OB8A 1VBD3 3FWEA 4FO9A 1GFF2 2YZ4A 5ABJA 2GNBA 4OHXA 1PNFA 3LB9A 3NNJA 1QY4A 4MGYE 1XYNA 4AFMA 4EN8B 3O12A 4AXOA 5DAQA 5C9AC 2HWC2 5DG2A 1JBCA 3W58A 3GZUC 4FOQA 4FPFA 3CU7A 3ZDVA 3I2FA 2ZCWA 5IVYA 3SEEA 4AFAA 2P6HA 3RRDA 2GNTA 1MS9A 4LBMA 1CJDA 4FQ4A 3SH3A 3C7FA 4LQRA 4SLIA 1F4HA 1OQ1A 1US3A 3LA7A 4A7ZA 3N4MA 2W9XA 5M0TA 3JQWA 1OOPA 1LU2A 4CUBA 1V6NA 4HN0A 2XG3A 1CAWA 2WDBA 4YW2A 5GLVA 4ZY9A 4E2QA 1HQNA 1SHWB 4Y5TA 1ZBA2 2YBKA 1C4RA 3ZSMA 5BNNB 1NCRA 2A70A 4MOAA 1RVF1 3LWCA 1UPSA 4IE5A 1IKQA 2D44A 2QCSB 2ENRA 5A3NA 1SQ4A 3LIHA 5LBEA 1A34A 4XCAA 4GH4A 3PUSA 1ENRA 3X29B 3ZR5A 1IS5A 2XOMA 1DQ6A 3LDKA 1X7NA 1F4AA 2R063 2VR4A 3PLQA 1VAKA 3CNAA 1MR5A 3WG3A 4ITCA 4QX3A 3OEAA 4AEDC 4YM0A 3WW2A 4LBOA 3M4FA 4XDQA 2DUQA 1MVQA 2WWSA 5ACA1 4OI4A 4BLIA 3OD4A 1ZRCA 3WP4A 3ZSEA 4F8AA 1G7YA 4IGPA 1XE8A 3ZOIA 3I4IA 3RVHA 2WNUB 2AR6A 2JEMA 2VMEA 1NLQA 3VHNA 1REDA 4MGKE 5C9AA 1HB3A 4QQOA 1D7PM 3BOWA 3TB0A 2FDFA 5FMOS 3O1OA 2NZ9A 1LOAA 4XQDA 3AYAA 2YFUA 1X33A 1IPKA 1PIV1 5T3NA 5LK5A 1YLLA 2G19A 3J4UH 4IETA 1W6QB 1UY2A 4YGBA 4RFT0 5FYUA 2RG4A 4N8MA 2Y6HA 4W6YA 2Y6GA 4M3CF 5DUVA 4CCEA 1PGL1 2ARAA 2ZGUA 4AZZA 4XZPA 4FFHA 4OUMA 2H0VA 3FX3A 4B8EA 2O8OA 3TEZA 1IPSA 4YPJA 4UI9L 4H2AA 5AC91 1OQEA 2EIDA 4M01A 2JX9A 4MVTA 1CAXA 1VRH1 4R9AA 3S5QA 4CXYA 4YG3A 3IIAA 3FN9A 3D0SA 3IKWA 4PT6A 3TN92 1UMHA 3NJYA 4AEDA 2BGCA 2F4PA 3SHRA 4E8CA 3NJXA 2GDFA 4C1WA 2XHNA 2XLFA 5F1RA 4NHXA 4YYOA 4DXSA 2XJTA 5IK7A 1UIKA 3ZKYA 3FHIB 4QM9A 1SFNA 4ZU5A 3EMRA 1LU1A 1LGBA 1XPWA 2VBDA 3GCXA 3M3QA 5CB7A 1ZRFA 2OQ7A 1H1IA 2XBO2 2XXZA 1QJX1 3BPZA 4YGCA 2WFF3 2R0HA 4ZU7A 5LA0A 3I3MA 3VZOA 3O1MA 2ADDA 4I01A 3KV5A 1PO21 1TME3 3HOBA 1UYXA 2D93A 2BVBA 4PJYA 4YLZA 4XF4A 4A7YA 4E4HA 3AMNA 2WZR1 3VD4A 4C91A 4E9KA 2VMFA 2ZGMA 5JPNB 4XF9A 2OS2A 4OHYA 2WZEA 3AZZA 2HWD1 2K46A 3T0AA 3ENRA 1R081 1VAVA 2PYTA 1F31A 4XQ4A 1C5HA 2VM9A 1UZWA 2WZR2 4EN9B 2FD8A 5I0TA 4GH4B 2W46A 2IVIB 3FHAA 4GIQA 3BUCA 4CCMA 1LOCA 1GP4A 4L9BA 4NHLA 3P6BA 3MO4A 4J6GA 5C4WC 4I2OA 1D4M2 5CG8A 1R082 3UESA 1JN2P 1OH3A 5EYXA 2E7QA 3URFA 4OVEA 4DO0A 2WT2A 4D69A 2QQJA 4B1LA 2IXCA 2P34A 3T4HB 2Y0IA 2A7AA 1RIRA 2PHWA 5FTTC 1APNA 1FI2A 1X8MA 2JG9C 2X29A 3VBUC 2VJXA 4XTMA 3J7HA 1WCDJ 2E26A 5GLZA 3VKLA 4D7SA 2A5ZA 3RNSA 1JYNA 4LT5A 4GA9A 5H9RA 4I30A 2AZ5A 1Y9GA 1CVNA 4QX7A 3I2OA 3FLPA 4XZUG 3GDBA 3WVJA 3PVOA 1NZCA 3W21A 2VTFA 4BDVB 3VUOA 3K2OA 5FZKA 2GP5A 1NT0A 1XNAA 3N9OA 3RMXA 1YJLA 3ACHA 4RN5A 5IWFA 1FPN1 3VBOC 1EV11 2GH2A 4Q8LA 4MO3M 5DG1A 1L3JA 4YGDA 3THCA 2TBVA 4TLGA 3V0AA 4ZHNA 2OVUA 4E4DX 1A78A 2RS31 1BXHA 2WQ4A 1CAXB 1PK6B 2XUMA 4IDZA 4JRLA 5DZGA 3VBHC 4D6RA 2BFUL 2XJVA 3LAGA 4RQPC 2XL9A 1AJOA 2A6YA 1ASJ1 1DHKB 1EV12 3ZYJB 4MADA 4OHWA 2C9AA 1C5IA 2C24A 5B4XA 5C4WA 4BCUA 2RS32 4DFSA 1NA1C 5IUQA 3ZYRA 4K40A 4AVSA 1EP0A 1UOJA 2W91A 2Y6LA 3JD72 2PQQA 3HEIA 3ZFEC 1GUIA 5D8AC 1WA4A 2BPA2 1DYOA 3SC7X 3K48A 4DY3A 2JG9A 5JIAA 3VBUA 1X50A 1J1LA 5FZ1A 2CTVA 2P1BA 2ZKLA 3WINE 4A4AA 1ENSA 4GMP3 3O1TA 2JG8A 1J3RA 3QLQA 4GALA 1R093 4RS5C 4MV2A 5GM0A 1VBB2 1RUD1 2JKXA 2CGPA 2ZX2A 5FZOB 3T2PA 1IS4A 4JTNA 3Q9OA 2X5IB 1NAEA 2EA7A 4IGQA 2W5FA 5FMDA 3VBOA 1PNGA 3MW4A 1IQAA 4NRPA 5FXZA 1XNBA 1DYKA 3VBHA 4KWKA 5K0UB 1V6JA 4RQPA 1Z78A 4KU8A 4NAMA 2JDZA 5KWRA 2BJSA 2YPDA 1ZBE2 3VDAA 4JGZB 1XE7A 1QJU2 3ZVXA 4EWEA 1G9CA 1ZREA 2QQWA 4M4RA 4QGLA 2E7AA 4GWMA 1ST8A 1BEV3 2ZEWA 1NA1A 5FY4A 4XDOA 4B7KA 1QOSA 4IEQA 4JDNA 4NJ4A 5FY1A 4DIQA 5JXJA 5LZ6A 1AYM3 3PU8A 2D6MA 2C4XA 4BQ2A 1ZZ9A 3ZFEA 3E5XA 4DRRA 5D8AA 4HN1A 3GCWA 1CZVA 1SPPA 1CZSA 2MPFA 3HD8B 1VMFA 3KT1A 4TYSA 3N9MA 2HWF1 5KXDA 5LEKA 2Y34A 5J1XA 4NIHA 2P5BA 2FDGA 4RS5A 3R4SA 1VR3A 4OZOA 2JD4A 1AR81 4LULA 4TWTA 4AI3A 4N9HA 4O61A 3U0ZA 3RYKA 1OA4A 1AYN1 3BTAA 3QH7A 3DL3A 1DYPA 3OUIA 2DCZA 2Y6JA 3HPNA 1PGSA 3TRSB 5F8PA 5KHJA 5DPNA 2HYXA 4AHZA 1W99A 1AR63 3M2MA 4DUVA 3PJYA 5FJKA 1AYN2 2VGDA 4JZRA 3PUHA 3LOIA 4Y1VA 3ON7A 3Q8CA 4E27A 2XB6C 4KWUA 2E63A 4S2FA 1AR92 1RUJ1 4D3WA 4YW6A 1JYWA 3VDCA 5CYYA 3IB3A 3AZYA 2VQTA 4MHUA 4DNYA 3B5LB 5C3QA 1RGSA 1S0DA 2GC0A 5F3CA 2ZGQA 2WLQA 1SFYA 3DUIA 4FAHA 1B35C 1WLTA 3FFQA 4AHYA 1WW6A 1H2MA 3MYXA 1W6OB 4R9DA 5FPAA 3AK0A 1H4GA 2R49A 3USUB 1UYPA 1KDKA 1S0FA 3OD0A 4IE4A 5FZ9A 3VL8A 4GQ7A 5D21A 1WD3A 2JG8B 3V64A 4LO7A 4IV3C 5FXXA 5LA9A 3JBG3 3VKFC 2XQRA 2CU5A 1RVF3 3AJZA 1VP6A 2W1UA 5BNOB 2I2SA 1KFXL 3POYA 4XILA 2ZOEB 4NHMA 2C0ZA 5IVJA 4A6SA 4MHRA 1RHI3 5DN2A 1JYXA 4MG2A 2CWMA 4R9CA 2AUYA 1WMXA 1YQ2A 3IT8A 3GHMA 3KHBA 2Y26A 1W8ZA 2B9UA 3BPSA 3LCPA 1UYZA 4KU7A 5D1IA 5FO7B 3WSOA 5A1FA 3VBHB 1JOJA 3ZSKA 3T30A 2GZWA 1RITA 1RUG2 4P9XA 4XIKA 2QVSB 4K8RB 4COYA 4FPOB 2WNVC 1VBA2 1HX6A 4JGYC 1VBD1 4W8JA 4Z07A 1YXWA 1WD4A 4P9LA 2CWSA 1E5SA 4QPGC 3WUDA 2DTYA 3HT1A 3ZFEB 1B35A 1GICA 1VLNA 3R4DB 3UK9A 4AWDA 1HB2A 1TNFA 1HXS3 1ZA7A 4BK4A 1F5JA 3RSJA 2PHFA 1WMDA 2Y6FA 4IV3A 1RMU2 4DY5A 2K9ZA 2ZZJA 3WDUA 5A32A 2VUJA 4COVA 3D6EA 2G9ZA 3U75A 4Y1YA 4L0PA 1HV1A 5F32A 2JE7A 2VNRA 4QX1A 2OKXA 1PZ8A 3HBKA 3T4VA 2BBAA 1HKDA 2VECA 2W08A 3AXEA 2E7TA 5L36A 1GR3A 5FLIA 1GU3A 4LHNA 3WUCA 1OI6A 2WR9A 1IPJA 2WSUA 1ACCA 1IG3A 1N1SA 2B45X 2VTXJ 5FMBA 3I8TA 1JZ2A 3PVBB 3H3UA 4ASKA 4BQWA 4OI2A 3ILNA 1IS6A 3WNKA 1EAH3 1W0NA 2R061 4OMCA 3T2OA 4LO8A 4I0BA 3AMQA 2WZ8A 3U37A 4K1YA 2ADEA 2JDMA 3IDEA 2WA3A 2WNVA 3IBMA 1Q8OA 5C8CB 5JXGA 3ASIA 2DVDA 1NCQC 4NHYA 2DUPA 3VDBA 1R1A3 2ZX3A 1VBE2 4XYXA 4QPGA 4HPKB 4FPEA 2SLIA 3SH4A 3I3DA 1DLCA 4XAAA 4FOYA 2RS53 1BHGA 4QGMA 1V0AA 4JKLA 4Q5OA 4DRVA 3RZHA 1YQ8A 4JDOA 5FYBA 2XWBB 1KITA 1AX0A 3MIEA 5EV7A 4IE7A 3WF1A 4CZSA 2IC1A 1HQWA 3IMNA 4M3CE 2VQUA 3J8F3 2ZX0A 2X09A 1XJAA 1FX5A 4XUQA 4LHKA 2TNFA 1OFSA 1POQA 3MPBA 1UF2C 4DQAA 4C1XA 2VZTA 1UAIA 2VZVA 4LHLA 2EF6A 1UMZA 3WT3A 4EYUA 2OUJA 3ZYBA 3UKNA 1PMIA 3M8LA 5DDJ3 4CSWA 4TXWA 2UWBA 4MYEA 5FPVA 1LODA 4CCOA 1C1LA 3DEMA 1LOBA 1XU2A 1J58A 2DCTA 3C7HA 4LKSA 4EV0A 4HKLA 2DVFA 3ELNA 2VW2A 3H1MA 1N1TA 3H3ZA 5FBJA 3SISA 1FV2A 2HYKA 4N53C 3ZXLA 4NROA 3SKJE 2EAKA 5FMOL 3IM0A 4BXFA 4NVPA 4DUWA 2J1SA 4DXTA 2IXHA 5CADA 2ARBA 4QPIC 2IXKA 1RXGA 2WN3A 3BTZA 2AGSA 4IV1C 1NCQA 2LS6A 3DPRC 1OF4A 5JSRA 2ZX1A 1B35B 4NIDA 2Z5WA 2H6BA 4GB33 2D98A 4D7TA 3QOPA 5T52A 2VVEA 1ZRDA 4LOSA 4N90A 2WFF1 1J3PA 4XOGA 1FYUA 3AYDA 1FOD2 2VOVA 3V65A 5ANQA 1S55A 5J7MA 2CDPA 4Y20A 2VOKA 5FYHA 5A32B 1TME1 1VBC3 4LBNA 3GM8A 5K8SA 1OLRA 4OHZA 1FV3A 2GU9A 3VKOA 5AFEA 1RUC3 5I93A 2VVFA 2EXHA 4NPLA 4PQQA 1W2TA 4N43C 3ZPOA 2XDVA 1WA6X 2GMEA 4AL9A 1V9U3 2WYSA 2B5HA 2ZX4A 3OBRA 2VZPA 1OVSA 5DUUA 3PDQA 1CGPA 1QOTA 2CGNA 4N53A 4WVMA 3WNOA 4YSFA 1H6YA 4GXLA 4A3XA 2W0XA 3R4UA 5A1AA 3M3IA 1AX1A 2QQVA 2V4AA 3VDDA 1JZ3A 1URXA 4NAOA 1DZQA 3HNBM 3FMGA 4QPIA 1US2A 2JDPA 4IV1A 5EIYB 3DPRA 4BLJA 4YM3A 1KGYA 3KVBA 1QIQA 1W9YA 2QQLA 2R6QA 2VNVA 3B9IA 3EO6A 3HAGA 1K5MB 1VAMA 4K1ZA 4TLFA 2YUEA 4L92A 5T5LA 3O1VA 1W6PA 3EQEA 3JZVA 1CR7A 4RHV3 2WABA 1JZ5A 3GGLA 3IDBB 4QD2A 1KDMA 3AP5A 2A6XA 5BNNC 3SCGA 1ALYA 5C5UA 1RXFA 3M70A 1R1ZA 3G6JB 4QWNA 4FXKB 4Q1PA 1MZ5A 3AVSA 5I8YA 3FUQA 5DQ0A 4AQTA 4CU7A 5FYZA 3ES1A 2NM1A 2MEV3 3AZXA 3K46A 5EJ1B 3PTYA 3WV6A 3CJXA 2FBEA 1OFNA 1UY0A 4HKWA 4OMDA 5FZ4A 3NNLA 4N43A 5E88A 1XYOA 1AUYA 2F17A 4Y5SA 3B01A 2ZACA 4IE6A 5A7NA 4AEMA 5A3MA 1F8VA 1JTZX 4Z82A 3SNMA 2OZJA 1YC61 2GMPA 3C7OA 3MIGA 4MXWB 5L9RA 3SLIA 2WZPP 2VBPA 1Y3TA 1BK0A 4P9GA 4AW7A 4KGGA 1MS8A 2AREA 2WNUC 3PMSA 1TMF2 3D0JA 2R1DA 3GBGA 1H6XA 3SEPA 1L7LA 2FMDA 3KM5A 4Q4W3 3VD7A 2WS92 1PO12 1FATA 1YIFA 4GJYA 5EFUA 3LOBA 2UYBA 1OKOA 2RMU3 2ZHNA 5BV6A 1OVPA 2SBAA 1AR83 3DGTA 5FZIA 4AGVA 3BI3A 4PI2A 2EIBA 2X05A 1PGW1 5I0SA 3KD4A 1YIPA 4QQPA 5FZAA 1VRBA 2ZKNA 3AKSA 4GMP1 4CYDA 1QJEA 5L7OB 5EQUA 1GNYA 1R091 3GBWA 5H9QA 2B39A 5C5TA 4DUXA 4P5HA 5BNNA 1D0GA 2BRTA 5J36A 1RUNA 1VB4A 1DGRN 3KV9A 4QB1A 1RUOA 2OYZA 3TEXA 3IAPA 3HNMA 5IT6A 1PGW2 1RJ8A 4MGIE 3DV8A 5FPBA 3OG2A 4UWDA 3WOGA 2D5FA 3I2KA 5F2WA 3VD3A 3ZXGA 1R092 1UMIA 2AYHA 3ALQA 4LBKA 4LOTA 4RD7A 2DCYA 2XONA 3JXSA 4FPLA 5F6KA 3ZFGB 4META 5JOZA 1TNRA 1ENXA 1EUTA 3DXUA 3BALA 2JENA 2R32A 2YC0A 3LGRA 4MLOA 4PF1A 4AF9A 1IS3A 4Y22B 3SQOA 2YXSA 5JZGB 3WW3A 2DCJA 2VTXA 3I54A 5BPXA 2JDUA 2WL1A 1HJFA 2YV8A 3HNYM 3O0VA 4H3WA 3VD5A 4OQ9A 1JMUB 4BHPA 2WNUA 3LF7A 1A3KA 2HBUA 2VZUA 3VDDB 1N3QA 1BEV1 1OH4A 1S2KA 2R0FA 4JX0A 3VN4A 4P5YA 1D0HA 3CZJA 1A8MA 1WBLA 3Q8AA 4XHXA 4GULA 5FZ6A 3DPRB 3DECA 5A33B 1C8NA 2R043 1Z0HA 3POEA 4K3UA 1W6QA 1CPNA 2WYFA 4I0AA 2YFZA 4CCCA 5FP8A 1SDWA 1LCLA 2XLGA 1BEV2 1YFYA 4XUPA 3T2QA 4B4QA 4ZONA 1GOHA 1OMIA 1HB4A 2WKKA 1AYM2 1PM7A 4WVVA 3ZMOA 5DAPA 2A3XA 2R073 4CDUB 1C8M3 4ZU4A 3S7IA 2QQOA 2LALA 5F9TA 1Q8QA 1UCXA 5FQ0B 2C9KA 4Y3OA 1U5ZA 1NKGA 1C57A
chains in the Genus database with same CATH topology
4LO6B 5JSOA 3VLBB 2KXLA 2DVBA 4CRQA 1PVC3 4DXZA 3O0WA 1QXRA 1AR61 1TEIA 2V5YA 1MEC2 4WM7B 3EBRA 3E5UA 4FVVA 2OIIA 3RS6A 1AVBA 1JYIA 4HETA 1EPWA 2O1QA 1VALA 1AR62 1LOEA 3VHRA 2GAUA 4BZ4A 2RHPA 4MXVA 5JIUA 4L2NA 1LHWA 2IXLA 2PAKA 3JB8A 4HFSA 2OUHA 4CEYB 3RJ2X 3ZXKA 3JBG1 2IFWA 2GC1A 1COV3 3AZWA 4IERA 4IL7A 3AMMA 4BE3A 1LEDA 1PK6C 3AZVA 4M3CB 3RMYA 1RHI1 3H7JA 1ND3B 2QNKA 1DQ5A 2IXJA 4IEPA 1RVF2 3RJRA 1A6CA 3WX5A 4AHXA 3PNAA 1OQDA 1G8WA 4COWA 2BNOA 3I2DA 3J26N 5F6LB 3EJKA 5E8AA 4JV4A 4AI0A 1FNZA 1H1AA 3V56A 5ACA2 3VZJA 2ZMLA 1B09A 4AFDA 4UW6A 3B69A 1N3OA 3HIFA 4HK9A 4WZCA 2BYVE 4YG0A 1YO8A 4OZXA 4Q4X3 3KQRA 4QM8A 4YVWB 4XF0A 1HXS1 4DS0A 1E57A 1JHNA 2X5IC 1PIV2 2P17A 4CTEA 1AL23 2UY8A 4MSVA 2X8KA 3KLSA 1PGL2 4AEKA 4KG8A 3FE5A 4FCAA 1PK6A 4DB5A 4ATEA 5K0UC 1HQLA 4XHBA 3A4UA 2VMHA 4JGZC 2YMZA 4LBLA 5AC92 4R9BA 4RR3B 4Q8KA 1OD5A 2Q0AA 3KCCA 1VRH2 2Q5TA 3BB6A 1EAH1 3S6PA 4RSUA 1KS5A 1GNHA 1BYHA 3UJQA 5FPXA 5GZGA 5TSWA 5FAXA 2TUNA 3NL1A 2ET7A 1LOFC 1V6OA 1H8VA 5FO9B 1LKNA 3N7KA 4DZGA 1R1A1 3E6CC 4Q2FA 2G9GA 2A73B 5EXOA 4R8HA 4PBOA 2RS51 4R4ZA 1QJX2 1MS3A 4XF3A 2XPJA 2OW4A 3OYWB 4BMEA 1BK1A 2A6ZA 2XJPA 2NP0A 4YFZA 2X5IA 3J8F1 5HCFA 1PO22 1ULDA 2WLPA 2Z42A 1NLRA 5JSPA 2VOXA 1H30A 1LHNA 4LO5B 1ND2C 4AHWA 2I07B 1ENQA 1O4TA 1OA2A 5DDJ1 2CNAA 1I1EA 4F83A 1CIWA 2IFRA 5K0UA 3J8F2 2MNGA 1BBT3 2HWD2 1EPZA 4WM8B 2YY1A 3N7MA 4EJRA 4AVCA 2CL2A 4JGZA 5FRAA 2NMOA 3RPQA 1G6NA 3AP6A 5DDJ2 3KB5A 4LNVA 3WLUA 1CPMA 4AG4A 1GZ9A 2E51A 4Y4YA 4HSLA 5EWSA 2JG8C 2RR13 3WR0A 1LOFA 4BQ1A 5BNOC 4OI0A 4GB31 1O4ZA 3B00A 4PBPA 2DWRA 1V70A 2K2SA 2W39A 2ZTNA 1Q8PA 1VBC1 4OULA 1O5UA 4GB32 1REFA 4KQ7A 4F7ZA 2XGXA 4FPCA 1ND2A 1FNYA 1RUC1 1UD1A 1QU0A 4BM8A 1S0CA 1FPN2 2FZ2A 4ISQA 3WDWA 2HWE1 3APBA 5J96B 1O3QA 1V9U1 4UW3A 4XJZA 1YI9A 2ES3A 5JWPA 3VBFC 1UIJA 1WLCA 2ZMKA 3ZXEA 1ASJ2 4YZ1A 1D2QA 4EWDA 4AQ2A 5CA6A 3OCPA 3TYJA 1TE1B 1W6OA 2QE3A 3GF6A 1ZRRA 2XWJB 3USUA 4B4PA 4XF1A 2PAEA 3HMYA 2Y38A 1Q3EA 4EWAA 4DPNA 3FLTA 3OGJA 2UU8A 3MIDA 5T55A 1DQ0A 1CESA 4NN0A 1QF3A 4KNCA 3SITA 5BNOA 4AK3A 3SCHA 2NLRA 4YVSB 4RHV1 1JXNA 1RUF3 1WUVA 5FREA 3RI8A 4XW3A 2YGLA 2P37A 5GLWA 5I8TA 3A0KA 3KGLA 5FOJB 3ZXAC 1RUD2 3H0OA 1Q43A 5F5QA 2D3SA 5KHGA 3VBRB 4BMBA 2YDEA 2MEV1 2FHRA 3NV3A 1QDCA 3BCWA 3HT2A 1OSGA 1FMD3 5CG9A 2NMNA 1IKPA 1LOGA 1ONAA 1Q56A 5C8CC 1UU4A 1DU3D 3ZO0B 3AM2A 4HSJA 4Q4Y3 3NWKA 1I9RA 3HWJA 2QZ2A 3VBFA 2O0OA 2FQPA 4GWNA 1J3QA 4YZ5A 3WDVA 4BA6A 1NYWA 4Q4W1 5EJ3A 4YW3A 4R4XA 2RMU1 3V0BB 1W6NB 2D3RA 2Q4SA 2ZBJA 5FLHA 4XIOA 3ES4A 5HCAA 1KFUL 3KMHA 4XEZA 4K8FA 4B4RA 4N7UA 2CV6A 2HWF2 3AB0A 4YGEA 2ZS6B 2RMU2 1AR82 3TOJA 3CJIB 1Q8SA 1U5YA 1AXZA 4Q0QA 3O5SA 4LE4A 1ND2B 3NV2A 4QQ2A 2RE9A 4AI2A 4P9JA 2Q30A 3W59A 5IK4A 1OA3A 2VNOA 2GMMA 1I3HA 3U10A 3SXWA 3WXPA 4YARA 5C8CA 2XHKA 4FTSA 1UW8A 1POV0 2XL7A 4JAAA 5A3LA 3MGUA 4HPKA 1RUJ2 1DF0A 1W6MA 3T1LA 5E16A 1HRI3 2HWC3 3R0RA 4XFIA 4R52A 2BEOA 5LK7B 1IZ3A 3USSA 1QQP3 4Z92B 2VVDA 1M4WA 2D7FA 1S1AA 2R041 5GLUA 1U12A 3VBSB 1JH5A 2GN7A 1CX4A 4Q29A 2KM2A 2BNNA 1YCIA 1SLTA 5L19A 1RUE3 2EIGA 4ZXKA 5BXXA 1S0EA 4S2DA 1GZWB 3INAA 2QJVA 2R071 1MZEA 4AE2A 1C8M1 2YGMA 4RL7A 3O14A 4H7LA 1H0BA 1G86A 1YFWA 4DOUA 3WCSA 1QNWA 2Z79A 3QH6A 5BUVA 2R072 1PVC1 4KL1A 1XNCA 1QXPA 1WBFA 2IWGB 3MPPG 4H7MA 4K7JA 3RQ0A 1H8TB 1BCXA 1UKGA 1WW7A 2H0BA 2G9FA 3VBFB 3JQXA 5T50A 3M1HA 3B9CA 1UZZA 1Y7BA 1K5MC 4X6RB 4U36A 3HQXA 1VBD2 3NW4A 2TEPA 2DUOA 2GN3A 1DDLA 3PVNA 4AYUA 1DGLA 4N7IA 1J59A 5LRSA 3S7EA 3KT7A 3H1YA 2LUWA 1HRV3 2XKOA 2VU9A 1PVXA 2EVXA 1MS4A 4O9EA 1DIWA 4QQHA 1U0AA 4CEWB 4AGRA 1COV1 1Q5OA 2PFWA 2VQ0A 1DG6A 3ZPYA 4XQWA 3TN93 1O7FA 1W0OA 1AL0G 2X53S 2YPJA 3ZXLA 2DURA 2ZGLA 1YYNA 3AFKA 5SV8A 3VZLA 3GBFA 1DLLA 3AYCA 1QMJA 3WHTA 2R062 1DGWA 2D5HA 5CFCB 3GHNA 1W6MB 1HW5A 3QD6A 4I0WB 1K5MA 3MLJA 2XBO3 3ETQA 4L11A 5KC6A 4LO4B 4YRDA 5L7OC 1HLCA 4BWOA 4LA3A 1MS1A 4X8NA 3ZFFB 2XJUA 4NHKA 4Q4X1 1X8EA 3ZYGA 2ZHKA 4WZFA 1ZZBA 1RUI3 3ZXFA 3G7DA 3ZFGC 3D5OA 1AL21 4JRAA 1LECA 1CD3G 1KJLA 2DV9A 4Q4X2 4FPYA 4UBGA 3B93A 3LSDA 1BKZA 3UV9A 1XNKA 3CF6E 4TZDA 1UZYA 5JZGC 3TBDA 4MXWA 5DZFA 4HANA 2PHXA 2WNEA 2VNGA 3CEWA 3KT4A 3VDDC 1J1TA 1D4M3 3S0MA 2D6KA 1GSLA 3B94A 2VOWA 3L2HA 2NN8A 5FOBB 1FAYA 4XJAA 4HVQA 1ZZ8A 4JQRA 4XE9A 3H9AA 1D2SA 2B46X 3KS7A 3KCXA 4L97A 4ES8A 5L7OA 1DQ1A 4UBHA 4LEJA 4CDUC 4NO4A 4XMIA 4B3NA 2A71A 5J09A 2FMYA 4NWVA 3R05A 2WFF2 2R1BA 4BIFA 2Q1MA 5SV5A 2DYCA 3ZFGA 4MX3A 3A0NA 4JCKA 1TME2 2HWE3 5E89A 1QJY3 4EN0A 3N35A 4YM1A 1O91A 2NYYA 3PVEA 2W52A 4Q1RA 4XTPA 4LR4A 4WM7C 1N3PA 1V6MA 1H9WA 4Y22A 1BBT1 3AXDA 5JZGA 3PHMA 1RB8G 5JCTA 3CLPA 1O5LA 1QHDA 1I6XA 2IXIA 1FXZA 1Z7S3 2UURA 3WQ1A 4PLNA 1BZWA 3JD73 5A33A 1PZ9A 3MLKA 3ROUA 2ARXA 4QQLA 3ZSLA 5JVVA 2ATFA 1WLWA 4IESA 2DF7A 3UKTA 4CEYC 5KBFA 5KXCA 2EXIA 2RR11 1AZDA 4NPRA 4ZKTB 4CDUA 2ZABA 4D7YA 1VBB3 5BNQA 3C3VA 4RGAA 5FQ0A 3WW4A 1KRIA 1ND3C 3IDCB 3H50A 1DGWX 4IEYA 4WVZA 3QACA 2BVVA 1XQNA 3WZ1A 5GZDA 1F2NA 4IQPA 4WM7A 2WSVA 1NLSA 4V1PA 1QH7A 3I7DA 1ZBE3 4P9WA 3RWNA 1QJU3 1NXD1 1U5IA 1YFXA 1QH6A 3AP7A 3AX4A 2PA7A 3WQ7A 5KC5A 4FPKA 4XJ8A 1LRHA 5CBLA 3ME2A 3CO2A 5JPMB 2D6NA 2AENA 2NPIA 3ACLA 4YVWC 2VXRA 1O3SA 1JUHA 1AX2A 2PELA 4CEYA 1GZCA 3WDXA 3L2YA 4IEUA 3UL2A 3UKVA 3NAPB 3FZ3A 5LEJA 3NJZA 1RUF1 4PLOA 4M3CA 1S0GA 1ND3A 4GKYA 4Z2WA 1GKBA 5GJ6A 2D97A 3P3NA 3ZIXA 4YM2A 2WT1A 4RR3C 4Q4V3 1MZ6A 2OZ6A 1G9FA 5JAXA 1RUF2 2PLV3 1O3TA 2E6VA 4KH9A 5CVRA 4Q0VA 2CAVA 4AFBA 5K7PA 1Y43B 4YG6A 4Z1VA 4AVTA 1ULEA 3R6SA 1FMD1 1AR93 5CFDB 4G3YC 5JOWA 1UU5A 1ZZ7A 4PIXA 2PN5A 4Q4Y1 4KBBA 3POWA 2XVLA 4Q0UA 2CYFA 1FMD2 1IHMA 1JUIA 3THTA 3BU7A 3WY6A 2VH9A 2HWB3 2BQPA 4PF5A 4YVWA 4HVRA 4XXPA 4Q4Y2 4I3GA 3GALA 4P14A 1XXNA 5BY5A 3ST7A 1RJ7A 3OGGA 2WT0A 5FLJA 5C6CA 4HBNA 3MW2A 1HV0A 2CAUA 2ETEA 4Z8BA 4WM8C 4MUVA 5JMCA 4N9IA 4I09A 4LBQD 1EYBA 4RR3A 1OHFA 2P2KA 1DZRA 2JKBA 1BMV1 3MW3A 2VW1A 5BNPB 1SLCA 4XFBA 1RUG3 1NOVA 5KHHA 4C0BA 2VG9A 5JLVA 3AKQA 3OJBA 1JW6A 1N1YA 1VBA3 4E4SA 2B8MA 2ZGNA 1T6GC 4G9SB 3VZMA 5FFOC 1CAUB 2OPKA 1RL3A 4FOWA 4KG0A 4LBQB 1AXYA 1HRI1 1NQDA 2HWC1 4S2HA 3K51A 4CDQB 4XBQA 4FP2A 3WQ0A 3OYWA 1S0BA 4KWLA 1GYKA 2VQAA 1QQP1 3VKMA 1RUH3 3L9JT 2ET1A 1RMU3 1HRI2 1GQHA 1DBNA 1KXGA 2ZAAA 1QJZA 1LB2A 3AP9A 1RUE1 4XETA 1DGRA 1QQP2 1ZBA1 3JBG2 5J98B 1SCSA 4HL0A 1LULA 4WM8A 5IK5A 3H1WA 2UWAA 2D43A 1RUE2 1RHI2 3D4KA 4E2GA 2Y0OA 1D4VB 4JDMA 4LLFA 4J1XA 4UW5A 1N1VA 5LRRA 3VZKA 3NSTA 1PHMA 2DU0A 3WHUA 1MQTA 1VBE3 2BTVC 4YW4A 4JTOA 1OPOA 4J1WA 1REEA 4OFGA 4YVSC 1LGNA 3FFZA 3AKRA 4FBFA 3MIBA 4QGNA 5CIRA 2GSYA 1HXS2 3VBRC 2YROA 3WP3A 5HBAA 1HRV1 3C2UA 5GZEA 4PDWB 2ZGPA 2GC2A 1DFQA 4CDXB 4Y1ZA 3VKNA 1UU6A 1G9AA 3M7AA 2YHJA 3M3OA 2GNDA 3T1MA 1V6LA 3MIHA 1HRV2 5K9YA 1QGLA 1QXJA 1NXMA 2PTMA 3E97A 4XFGA 3TN91 3WP5A 4XFHA 3WD5A 2E9QA 1SMVA 1LHOA 3JCIA 1CN1A 2OA2A 1S2BA 1EAH2 3RDIA 1M06G 3IWZA 3PJQA 1MS5A 3OF1A 2A3YA 2VMGA 1QKQA 2ZJCA 1H2KA 4O9GA 1QDOA 1WMFA 2XBO1 4W65A 4YVSA 5ABJB 5C33A 5JOYA 1R1A2 1FOD3 1CAVA 1PZ7A 1Y9QA 3NVCA 2RM23 3CJIC 3ZSJA 2GNMA 1YRZA 2RS52 4FXGB 1HIXA 2N7GA 1LTEA 3SMHA 3AFGA 4NWWA 5H9PA 3VBRA 1BVVA 3WG2A 3LA2A 4QU2A 1RUI1 4AVVA 4QT6A 1WMEA 5BYNA 1O3RA 5AFBA 4XJ9A 3W9AA 4OUSA 1OOPB 1DZTA 4AI1A 3MDPA 1CAWB 3MIFA 1RUI2 3P3PA 5HXVA 1NCRB 2QDRA 1GQGA 3H7YA 4AVBA 3ECQA 1D4M1 1QWRA 4OHVA 2PHDA 4W6XA 1MQTB 4RGGA 2NQYA 1W6NA 3V0BA 4INDA 4E4ZA 4M0NA 1ZZ6A 1H2LA 2BUKA 3VBSC 1W39A 1WCKA 2MHFA 1WW4A 2P3KA 3NKTA 2P3IA 1ZNPA 4XFAA 2W68A 1SBDA 3CJIA 5C9AB 5DXDA 1YWKA 4SBVA 4XJWA 1W2UA 1G9DA 1SLLA 4ORFA 5FO8B 1CQ9A 3U4XA 3M3EA 1AR73 1VBC2 2PHUA 1QJY1 2UWCA 3HN1A 5CAZA 5JOXA 1H8TC 4NOTA 1RUC2 4LE3A 1H9PA 1POV3 2HWE2 1QJY2 2E53A 4A7KA 1V9U2 1SLAA 1TMF3 3MI8A 1YUDA 3GZAA 1Z7S1 2ZGTA 2WS93 1PO13 3ATGA 1GLHA 3JD71 1GANA 1WLDA 4B7EA 1SACA 1OKQA 4FPGA 4AEDB 5I0RA 3ZN4A 3B7MA 3S30A 1Z7S2 3OBTA 4MH0E 3VBSA 5HI0A 1RC6A 1CAVB 4QMAA 4FT8A 5KXEA 1ZZCA 2VPVA 1GZWA 3WG1A 4AFCA 2A6VA 4CEWC 4X6QB 1VBB1 1YFUA 4YZ2A 5JI9A 2ZGSA 4RHV2 1O4YA 2H6CA 1XU1A 2ZAHA 4IEWA 3OY8A 1GNZA 2DVGA 1EY2A 4Y26A 5KXBA 1TQ5A 3M3CA 4QPYA 4IEXA 2BW8A 2EXJA 3CL1A 4JC1A 4A2UA 2MEV2 3MFCA 1H8TA 4LBJA 3LA3A 3H8UA 1LGCA 5CFCC 4DINB 2F6BA 1YI7A 1ZBE1 1AXKA 1QJU1 3FBMA 3WW1A 4FOVA 3SCFA 4Y1XA 1XNDA 2UYAA 5FCCA 1XRUA 2WA4A 2QZ3A 3ZFFC 4FAGA 4QXKA 3DF0A 1SBFA 4Q4W2 4WV8A 4Y1UA 3N7JA 2RS13 4AVAA 4M0HA 4HZFA 4AEJA 4KWJA 2ZGOA 3WCRA 2JICA 4CEWA 2DU1A 2V73A 5GLTA 2QKDA 3AYEA 4S2GA 3QBQA 3FJSA 4FTEA 3RZZA 2WQZC 5J37A 2Q1ZB 4Q4V1 4PIZA 3O7OA 4K9SA 2PLV1 3AJYA 3ZN5A 1RINA 4L99A 2B7YA 1MEC3 2PAMA 5CFCA 4HT1T 1ZA4A 1AR91 4XBLA 1VIWB 3V0AB 4Q4V2 2PLV2 2EXKA 1ULCA 2LM3A 4HLTA 3WDTA 2BWAA 2GH8A 4H14A 4EN7B 4PLMA 4LUMA 5C4WB 3ZFFA 1UKRA 5I0UA 3ZIWA 3ZN6A 4XFCA 2GC3A 2HWB1 1W0PA 4D94A 5E1RA 2P3JA 5I91A 1ZBA3 5B2GB 2DFCA 2R042 2R16A 2JJ6A 4M00A 3VHOA 3ZX7A 4EN6B 2V09A 1AHSA 4MGZE 2JG9B 2HWB2 2XH6A 3VBUB 4GMP0 1NE6A 5J48A 3GYDA 5FPZA 3OY8B 2BNMA 2DFBA 4Q26A 4XBNA 1X36A 3JU9A 2O8QA 1C8M2 5IK8A 2JXAA 4W6WA 2A6WA 2D40A 3PMEA 1JYCA 4EROA 1PVC2 1RUG1 4YW1A 3VBOB 1QOOA 3J9SA 1H4HA 4ONUA 1OPMA 3ILRA 1VBA1 3O0XA 4LTAA 2Z69A 5ACA3 1DQ2A 4RQPB 5T5PA 1LHVA 2D6LX 2VUAA 2CGOA 3N36A 2LTNA 3DN7A 3E6DA 1RTVA 1NA1B 4P9YA 1PIV3 1C3HA 1RUH1 2ZHMA 4Q0PA 3ZYPA 1RMU1 1LEMA 3B02A 4YW5A 5D8AB 3VHPA 3WNXA 1CJPA 2YYOA 3MEPA 3RYPA 2VULA 4Y5Z0 5GZFA 1N47A 4Q27A 3U11A 2XVGA 4RA0A 1RUH2 4RS5B 3JB4C 2JECA 1IGOA 1COV2 5AC93 3NV4A 3VV1A 2WINB 1SLIA 5C8WA 3ZXDA 3NO8A 1VRH3 5DZEA 4UXAA 3TAYA 4AQSA 1LJ7A 1C1FA 4BOWA 4BPZA 2ERFA 2XLAA 2BWCA 3MICA 4XMAA 1VBE1 2VY0A 3E5QA 1YNAA 2C1FA 2ZZQA 1LHUA 3MZHA 3NAPC 3ZN6B 3RYRA 1QJX3 1AJKA 4LLOA 3BODA 4JGYA 2HJIA 2HEYF 3SH5A 5GALA 5T5JA 4AGGA 4CDWC 2D6OX 3MFAA 3NKGA 1PO23 3GNEA 4H55A 4CP0A 1SEFA 3EHKA 1ZYBA 1GBGA 3LZZA 1UX6A 4HMZA 2I74A 2WZR3 4TSVA 2KA3A 4BYYA 3FLRA 1AL22 3GZTB 1KQRA 1LR5A 2HWD3 3E6BA 4ASLA 5CFDC 5CNAA 4C0HA 3U07A 1R083 4I02A 5J3UA 4FQZA 1BQPA 5KHIA 2FZ1A 4FPHA 4XFFA 5H9SA 2WJSA 2HEWF 1KJRA 3EXUA 5JR7B 1NY71 4COUA 3IN9A 1WCSA 2C5DA 2JE9A 5T5OA 3VZNA 2ZPXA 3VL9A 2EAAA 4PQ9A 2PHLA 4FP3A 3QCWA 4Q0SA 3TNQA 4E2SA 2IZWA 1NY72 1YJKA 3JUUA 2BFUS 3WDYA 2VMIA 3NAPA 2XJRA 3ZMNA 3ZYIB 1S0IA 3RI9A 3ILFA 5EYYA 3BIWE 4JVAA 1FOD1 3DKWA 1MVEA 4OI1A 2I45A 2RM21 3I59A 5AVPA 4AQ6A 4CDWA 1G9BA 1BVP1 1MS0A 2UY9A 4K6BA 3AMHA 3BOPA 4G4FA 5BNPC 4LUKA 4IV3B 2RM22 1FPN3 1C28A 1EV13 4K21A 4I3PA 1LENA 5CFDA 4QX5A 4COZA 3UJOA 1CONA 1SBEA 2ZMNA 2RS33 2ZA9A