1AYM3

Human rhinovirus 16 coat protein at high resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
238
structure length
238
Chain Sequence
GLPVYVTPGSGQFMTTDDMQSPCALPWYHPTKEIFIPGEVKNLIEMCQVDTLIPINSTQSNIGNVSMYTVTLSPQTKLAEEIFAIKVDIASHPLATTLIGEIASYFTHWTGSLRFSFMFCGTANTTLKVLLAYTPPGIGKPRSRKEAMLGTHVVWDVGLQSTVSLVVPWISASQYRFTTPDTYSSAGYITCWYQTNFVVPPNTPNTAEMLCFVSGCKDFCLRMARDTDLHKQTGPITQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 16 COAT PROTEIN
publication title The refined structure of human rhinovirus 16 at 2.15 A resolution: implications for the viral life cycle.
pubmed doi rcsb
source organism Human rhinovirus sp.
total genus 40
structure length 238
sequence length 238
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1aym300
1VBB1 1TMF1 1POV3 1VBA1 5C8CC 2HWF3 1NCRC 1ZBA2 1ND3C 2MEV1 2WFF1 4JGYB 4PDWA 1X36A 1M06G 1QQP3 2R063 1RUD3 1RUG2 1AR71 4JGZC 5DDJ3 2HWD3 3VBHC 4AEDC 2BUKA 2RS51 4Q4Y3 4WM8B 3JD72 1FOD3 1AYM2 1RUE1 1GFF2 3JBG3 1PVC1 5L7OB 1DDLA 2HWC2 4CDUC 1AR91 1V9U2 4IV1A 2X5IB 1FPN1 1VRH1 1B35A 1EV12 3ZXAC 5BNOC 1X33A 1ASJ2 1NY72 4WM8A 1RUJ1 4Q4V1 5J96B 4N53B 3TN92 4GMP1 3NAPC 1PGL2 1PO13 1VAKA 4CDQC 1AR62 1Z7S1 4N43B 5AC93 2RR13 1K5MC 2FZ1A 1RMU1 1RUF3 4RS5C 5BNPC 5K0UA 2TBVA 3ZFEC 1HRV3 2IZWA 2Y26A 1BEV3 1ZBE1 1BBT2 5BNNC 5C4WC 1QJY3 1BMV2 5LK7B 2HWE1 3ZFFB 4N43A 1QJX2 2WZR1 4Q4W2 2R073 1VBD3 4RQPB 3CJIA 1AR81 1ND2A 4Q4X1 3VBSA 2XBO3 2HWB3 1D4M1 2RS12 1PGW2 3ZFFA 1A6CA 4QPIC 3TN93 1AL22 5C9AB 1RUH1 4PDWC 5CFCC 3ZFGA 5ABJA 5FMOL 3FBMA 2HWF2 5CFDB 1EAH1 1ZBA1 2ZTNA 4GH4C 3VBFB 4Y4YA 3VBRC 1QQP2 1VBC2 1VBA3 4YVSB 1OOPA 2R062 1RUD2 1VBE3 5DDJ2 1NA1A 4IV1C 4CEWB 2HWD2 1B35C 5GKAC 5CFDA 4Q4Y2 1R093 3JD71 1FOD2 2GH8A 1HRI3 1QJU1 3VBFA 1AYM1 3JBG2 4FSJA 3J8F3 1RHI3 2HWC1 5C4WB 1V9U1 4YVSA 1CD3G 1AL0G 1HXS1 4YVWA 5JZGB 1NCQB 4CEYA 1PO23 1PVC3 5K0UC 4RFT0 4CDXC 1PGL1 1SMVA 1PO12 1AR61 5AC92 2RR12 3VDDB 1RUF2 5JZGA 1RVF3 1VBC3 1MEC3 3VBOB 1F2NA 2R041 1MQTB 1HRV2 1TME3 1BEV2 3CJIC 1ND2C 3VBSC 1R083 1QJY2 1RB8G 4QPGB 3DPRB 2WS93 4JGYA 1QJX1 3VDDA 4Q4W1 2R072 3VBOA 1VBD2 2XBO2 4WM7B 2DF7A 5ABJC 4GB33 2HWB2 4Z92B 3DPRA 2RS11 1PGW1 3VBUB 1RUC3 4Q4X3 5L7OA 1AL21 4IV3C 1OHFA 2ZZQA 1RUI3 1POV1 2X5IA 4FTEA 5D8AC 1AYN2 1FMD3 1H8TB 1OOPC 1NA1C 1CJDA 2HWF1 4CDWC 2RS33 1RUH3 5A32B 4N53A 4RHV3 5C8CB 2RMU3 4CDXB 1VBA2 1QQP1 1VB2A 1NCRB 1ND3B 1NOVA 2R061 1VBE2 1RUD1 2VQ0A 5DDJ1 1EAH3 1H8TA 2HWD1 4RR3C 4YVWC 1PIV3 2PLV3 2RM23 1R092 4JGZB 1FOD1 1HRI2 4CEYC 5A32A 3J8F2 3JBG1 1RHI2 1HX6A 3VBHB 5C8CA 4AEDB 1NCRA 1COV3 1R1A3 4BCUA 4Y5Z0 5ACA3 4CDUB 1QJU3 4RQPA 1PO22 1PVC2 1AYN3 1HXS3 5BNOB 4AEDA 1C8M3 1PO11 2BBVA 1VBB3 1TMF3 2RR11 1RUF1 5C9AA 1RVF2 1RUJ2 1MEC2 4JGYC 4Q4V2 4IV3B 3NAPB 1TME2 1RUG1 4CDQB 1BEV1 5D8AB 2MEV3 1K5MB 2WFF3 4RS5B 1R082 5BNPB 5BNOA 1RMU2 2WS92 3ZFEB 2R043 4WM8C 5BNNB 4NWWA 1AR73 2R071 1VBD1 2WLPA 5L7OC 2QQPA 2XBO1 2BFUS 2RS53 1EV11 2X5IC 4CEWA 1K5MA 4RR3B 4GB32 1ASJ1 1RUE3 1NY71 1AR93 1IHMA 1RUC2 1FPN3 4Q4X2 3TN91 5BNNA 1VRH3 5C4WA 4N53C 1RUI2 1FMD2 2WWSA 1C8NA 1RUJ3 1QJZA 4N43C 4Q4V3 4QPIB 4PDWB 5CFCB 1NCQA 2RS32 4GMP3 1OPOA 1VB4A 1RUH2 1BBT1 4RHV2 2RMU2 1AUYA 1Z7S3 4SBVA 1BMV1 5J98B 1RMU3 1VBE1 1EAH2 4GH4B 3ZFFC 4QPIA 3VBRB 1PIV2 1ZBE3 2PLV2 1MQTA 2RM22 5CFCA 1R091 3ZFGC 4RQPC 4IV1B 1HRI1 2HWE3 3J8F1 1RHI1 2BPA2 1B35B 2WZR3 4QPGA 1COV2 1R1A2 4GH4A 1AR83 5ACA2 3VBRA 1QJU2 5C9AC 1PO21 4GMP0 4WM7A 1POV0 1D4M3 1HXS2 3JB8A 1C8M2 1HQNA 5CFDC 3VBUA 1VBB2 5K0UB 1TMF2 3VBFC 1RVF1 1VBC1 1MEC1 1TME1 4YVSC 1ZBA3 2MEV2 2WFF2 1R081 4CEWC 4Q4Y1 2WS91 2R042 3CJIB 1ND2B 3VBSB 1AR72 1RUG3 4CDXA 4EJRA 1ND3A 2RS52 3JD73 4GB31 1AYM3 1RUE2 5JZGC 2HWC3 1AR92 4JGZA 1RUC1 1V9U3 3ZFGB 1NCQC 1FPN2 5ABJB 5A33B 1F8VA 3VBHA 1VRH2 5FOJB 1EV13 1RUI1 5FMOS 1FMD1 5AC91 1ASJ3 3JB4C 3VDDC 4CDUA 2XPJA 1HRV1 3VBOC 2RS31 1MQTC 1W39A 1OOPB 4RHV1 4NWVA 5A33A 1NA1B 2RMU1 1AR63 1QJY1 1Z7S2 4FTBA 4CDWB 1NG0A 2GSYA 3IDEA 4QPGC 3DPRC 4IV3A 1PIV1 1ZBE2 3NAPA 1BBT3 2PLV1 2RM21 4CDQA 5D8AA 2HWE2 4WM7C 4RS5A 4YVWB 2FZ2A 3M8LA 5BNPA 1QJX3 2WZR2 2HWB1 4Q4W3 2ZAHA 1COV1 1R1A1 4CDWA 3ZFEA 4FTSA 4CEYB 1AR82 1WCDJ 3VBUC 5ACA1 3LOBA 4LLFA 2BFUL 1AYN1 1D4M2 2RS13 3HAGA 4RR3A 1H8TC 1C8M1 1E57A 3S6PA 1AL23
chains in the Genus database with same CATH superfamily
4JKKA 4PIZA 5HBAA 3IPVA 1POV3 5JPNB 1D2QA 1YC61 4LULA 3IN9A 2QBXA 2X10A 1UNBA 3D3AA 1LHVA 3P5BA 5CAZA 1GMMA 2V4VA 4CCCA 3EHKA 3IDAA 3NVCA 1XXNA 1I6XA 4GZ9A 3MW3A 1LEMA 2HWF3 1RTVA 2DWRA 3HQRA 3N3HA 1LB2A 1ZBA2 2J1UA 4QX8A 4ZU7A 2XQRA 3NWKA 1W6MB 4NO4A 4ORFA 5I0UA 4X8NA 3DGTA 1I5PA 2JENA 1TVGA 3V0BA 1IS5A 3WDVA 5KC5A 1W0NA 2XJUA 4LE4A 3T30A 2VMCA 2WYFA 3ITQA 5CISA 5HV0A 2FDGA 5FZ8A 2WO3A 1V6JA 3POBA 5JOWA 5A7OA 4JQTA 3CLPA 1QH7A 3JBG3 4F7ZA 3WG4A 4DIQA 3A4UA 3ZMOA 1NX9A 1FXZA 4LA2A 4IUGA 1FPN1 3NL1A 3LPGA 1G9BA 2Q8CA 5FTTC 4CXYA 1B35A 2HH9A 3AXEA 1MVQA 3DYPA 4RSUA 2VVDA 2CAVA 4WZFA 3ZXAC 1JZ2A 3PU3A 4LBMA 3WNPA 1X33A 3K48A 4KWUA 1PNGA 4MVTA 1YFXA 1XU1A 3M2MA 5FZ9A 3JU9A 2Q4SA 4M01A 4N53B 4AR2A 3AXDA 2VECA 4ARYA 3NAPC 4XBNA 3VKNA 1PO13 1NE6A 2VPVA 3QACA 4CDQC 1WD4A 3AKRA 2RJLA 1AR62 1Z7S1 4MGKE 3JUUA 1K5MC 2FZ1A 1RUF3 4LO6B 4A42A 1IQDC 1X7NA 4IGOA 5K0UA 1AX2A 1N3QA 3GZTB 2ARAA 2Z69A 3ZFEC 1HRV3 2VMEA 2Y26A 1H9WA 1WGPA 3OPTA 4QD2A 5EP9A 4QQPA 3ME2A 2G19A 1GLHA 1NQJA 2ZCWA 1W8TA 4QHOA 4Y22A 5C4WC 1OUSA 2L9LA 2HWE1 1HB1A 1QIQA 2A75A 4FCAA 2EAKA 5GJ6A 5FP7A 2X8KA 3ZR5A 5M0TA 1NAEA 3MYXA 2PHRA 5A7WB 1DP0A 4XQDA 1A8DA 2BP6A 3U4XA 3VBSA 2Q1ZB 2F17A 5FPLA 4D6SA 4NAOA 3GHMA 3AZYA 1F4AA 2B7YA 4OVEA 4XFBA 4D7SA 4MG2A 3KCYA 3FFZA 1JBCA 4QAWA 2YC4A 1W06A 2B4KA 2W08A 2RS12 1PGW2 3E6CC 1Q8PA 3QH7A 1DYKA 1FAYA 4BMBA 3TN93 3EMRA 5C9AB 5FYZA 2B5HA 4PDWC 3ZFGA 3CZUA 1GOFA 1O8SA 4K21A 3ZSLA 2JIJA 3ZXFA 4I0WB 2YYOA 5F1RA 5GZGA 2JE7A 3DXTA 2H0VA 2PELA 3E6DA 1H2LA 4MOAA 4B1MA 2ZX1A 1A78A 4CRQA 3QOPA 1DQ2A 2W39A 3AL6A 4HZFA 4FAGA 3IBMA 4Y4YA 3UKTA 1HLCA 3JXSA 4D69A 4UFKA 3C2UA 2FCTA 2A3WA 3VBRC 4CTEA 1VBC2 1VBA3 3H50A 4YVSB 3NQHA 2R062 4L9BA 3SEEA 3EO6A 2Q8OA 1NA1A 3IT8A 4YSFA 2D5FA 4CEWB 4D7YA 1CGPA 4MH0E 4I3PA 3ZXGA 1FATA 3ZYRA 4OI2A 2WQ4A 1QF3A 2A6ZA 4Y20A 5GKAC 4Q4Y2 4S2GA 3RYPA 1YQ5A 2D3RA 3H1YA 4IEQA 1ULEA 3AYEA 3JD71 1FOD2 1N1TA 4UF0A 2DV9A 1W9SA 3O14A 3ZIWA 4BIOA 1AYM1 2W91A 2BGOA 1YI9A 1CPMA 4TSVA 5JVVA 3VHRA 4FSJA 2HWC1 4UW6A 1TEIA 4CCDA 1HXS1 4AQTA 1VIWB 2OIIA 2Y6KA 3WF1A 1C5IA 5FZ3A 1VP6A 3KMHA 3DCQA 1AXKA 1GANA 4CEYA 1LHOA 1PO23 1PVC3 2D43A 5BXXA 1LESA 3KF5A 4C0BA 5F32A 4B1LA 2AR6A 4WV8A 4BK5A 1BKZA 3I8TA 1QDCA 1UZZA 4FOVA 5CYYA 5FV3A 4CDXC 1JHJA 2P5BA 5F2WA 3CJXA 2E9QA 1DZQA 3I2FA 3E6BA 3T09A 1XNBA 2H0BA 3UETA 1ULCA 2B9UA 2JDYA 3VDDB 2VY0A 4XW3A 1G8WA 3KLSA 4QX1A 5FZ4A 1MEC3 2F4PA 3VBOB 3POWA 1CIYA 4LIUA 3SH4A 5LCWL 1LAJA 3CJIC 2C0ZA 4MLOA 3SITA 1WMDA 1RB8G 4IXLA 4QPGB 4XIKA 3MDPA 4E2GA 2C1FA 2CGNA 2JDHA 4OHYA 2YG0A 4HXCA 1T6GC 2JG8C 4LR4A 3WDWA 4BQ4A 3CU7A 2WAAA 2IVJA 4XDPA 4MV2A 1OKQA 5FY7A 5L9VA 2R072 2ZHLA 2HYXA 4XJUA 1VBD2 2PHFA 3ZXKA 4BMEA 3V65A 3PMEA 3OF1A 4EN0A 4YGEA 2I74A 4XDQA 1GZCA 1QXRA 4YNIA 5FZ1A 4GB33 4OMCA 1KD7A 5C33A 4RGAA 3DPRA 5FBZA 1SDDB 2RDSA 5IATA 3BGAA 4BQ1A 3I3MA 1RJ8A 4YM3A 3AP6A 1LJ7A 1W3XA 1WCQA 4Q4X3 3FWEA 1AL21 3NV1A 4A45A 4C1WA 3N4MA 2G9ZA 5E1RA 2RG4A 4TYSA 2VW1A 1G9AA 1J84A 5D8AC 1AYN2 1OOPC 3PJYA 5FP3A 3GJBA 3RI8A 5F37A 4S2DA 5JSPA 1F35A 2DDUA 1DF0A 1S0FA 5KR7A 3QBQA 3NJYA 2E31A 2GC2A 4RHV3 5C8CB 4XXAA 1F4HA 2JG9C 5H9SA 3NNGA 1VB2A 2W92A 5GZEA 4HSJA 2OXBA 1ND3B 1UL9A 1RUD1 4FFIA 4LHLA 1EAH3 2VUCA 2HWD1 4XOGA 1UU6A 2Q1MA 2OUHA 2C24A 3LEKA 3DUIA 1GWKA 3MIEA 4I3GA 2VNVA 4JGZB 1W04A 1HRI2 2NPIA 5AVAA 2E51A 4J1XA 3T0AA 1S0DA 1OLME 3ZN4A 3VBHB 4TTGA 2OKXA 1GP5A 1SPPA 2QQIA 3CQOA 2QZ2A 1WMEA 4AEDB 5B4NA 1GZ9A 4GWJA 3Q8BA 2WNVA 3FL7A 4XYXA 1W9YA 4DXTA 4ZS3A 4Y5Z0 4XF9A 2OQ7A 4DFSA 4EZ4A 2Q0AA 4BJ0A 2WLQA 2YU1A 1U5IA 2BTVC 1HB2A 4OI4A 4QDSA 4BZ4A 1YJLA 5C5UA 2XJTA 3J26N 2PXJA 3RRDA 3U37A 3AJYA 3VZOA 3EBRA 2EXKA 5DQ0A 1QHDA 1SG3A 1H9PA 1GSLA 1TMF3 2RR11 1JODA 2A70A 1ZA7A 1FT9A 1ULFA 2YROA 3POEA 2OA2A 2XWJB 4XJWA 1UF2C 4QGLA 3SCFA 5K8SA 1POQA 1RUG1 4LEJA 3C7FA 3ST7A 1GNHA 5BYNA 5C3QA 1BEV1 4K7JA 2R30A 2WFF3 3F2ZA 4RS5B 1FV3A 2DUPA 5FMDA 1Q8SA 1UY4A 2ZGSA 4JV4A 4RL7A 3VDAA 3RZJA 4YGDA 2IXJA 5FKCA 1CONA 1XNCA 1C8M1 1H2KA 1MS9A 3HEIA 3K4ZA 4CCNA 4NWWA 4YW5A 4BQ3A 1AR73 3EB7A 5BNNB 4N90A 4XC9A 2OVUA 2XLAA 5L7OC 3BKZA 5I8YA 1CR7A 4LHKA 2KA3A 2XBO1 3ATGA 2RS53 2X5IC 3O0WA 1K5MA 4RR3B 1SCRA 2XDVA 3IMNA 3D4KA 2CU5A 3MF6A 1ASJ1 3OGJA 1OA3A 2YU2A 3WG2A 1HV0A 1NY71 2DVAA 1RUC2 1QKQA 4JAAA 2J1VA 5HCBA 2AEZA 5KXBA 2O14A 1W9WA 3GDBA 4P02B 3C7OA 3HQXA 5C4WA 1OA4A 3JZVA 4ZZ5A 1RUI2 4DUVA 1UZVA 3P3NA 1KFUL 5L9RA 3S30A 3SMHA 3VGIA 2J1RA 3TWIA 1C8NA 1XQNA 5IK4A 4Q4V3 4N43C 4S2FA 1PK6C 2BDRA 2LUWA 2V73A 1HJGA 1GZWA 2XR4A 2YDEA 3AM2A 2P3KA 1NCQA 3OSDA 3QD6A 4LUMA 1LTEA 2YBSA 2RS32 2PYTA 5DZFA 4AVTA 4INDA 2DCKA 4KGGA 3V0BB 3KV4A 1AUYA 1JH5A 1UMZA 2ZJCA 3U10A 2HEWF 4MXVA 1LHNA 3T2TA 1VBE1 4QX3A 4EWEA 3ACGA 2RV9A 1IG0A 2V5DA 4XF4A 3HN1A 4LK7A 3ZN6A 1SQ4A 5CG8A 2RM22 4A2UA 1R091 1C3HA 2WN3A 5FYUA 4HVOA 4RQPC 2Y6GA 5FPZA 3UV9A 5F39A 4F8AA 3U78A 1B35B 2BJSA 4OZOA 3THPA 5KHKA 2ZA9A 4IDZA 1CZTA 5KBFA 1WKYA 2A6VA 1AR83 2B45X 2PA7A 3APBA 3POIA 5F5QA 1RIRA 3VZNA 1G6NA 4XABA 4DY3A 5ACA2 3VBRA 1IZ3A 1W0PA 1V6NA 4U2AA 1UKRA 1HXS2 4P5HA 3ETQA 3RWKX 5E8AA 5ANQA 5B4XA 1HQNA 4HN0A 3P3PA 4NVPA 4PF5A 3VBUA 3ZXJA 1OQ1A 1VBB2 5CFDC 5K0UB 4QT6A 1LECA 3W5MA 2ZGTA 3VBFC 3I2GA 4IE6A 3WDXA 2FD8A 4NPLA 3URFA 2WT1A 2D40A 4Y22B 1GP4A 2K0GA 5D21A 4GALA 1ZM1A 2Q5TA 1ZBA3 4K8FA 1C5HA 2MEV2 3D5OA 1R081 4PI0A 2AH2A 2ZGLA 1DU3D 5LBFA 3E5XA 3H3UA 2WS91 3AL5A 2GC3A 3CIHA 2CGOA 2RDQA 5A3MA 5GLTA 1V0AA 4K3UA 3UK9A 3VBSB 4CDXA 4JQRA 3VL9A 4Q0PA 2WWUA 2XOMA 4EJRA 1Y43B 2D6LX 1XOYA 1ULPA 3NW4A 2C4XA 3U07A 1A3KA 4BOWA 2JXAA 5FXZA 3W21A 4XFAA 2DVBA 2ZGUA 2D3PA 5C71A 4IEWA 2BNOA 3C3VA 5A7SA 1AR92 3WW3A 3ZFGB 2Z2SB 1BK0A 3POYA 4DINB 4E2QA 1F8VA 2EALA 4MADA 5CKQA 3RZGA 4YM2A 1S55A 3ZIXA 4I2OA 4FO9A 2LRPA 4ZKTB 1FMD1 1LOAA 2WDBA 1H1MA 4FP2A 4FFGA 1YQ8A 4CDUA 1SFYA 2R0HA 2W9XA 3TNPB 3UGGA 2XPJA 1DYOA 1W8HA 4NHYA 2DBIA 4HVQA 1YQ6A 3R4SA 4NWVA 1NA1B 5A33A 1AJKA 1AR63 1QJY1 2J1AA 3GZAA 4FTBA 1J3PA 4LE3A 4EE2A 3MLLA 4QQ2A 4AHXA 1NG0A 2QVSB 4MZUA 4CDWB 1J83A 1LRHA 2PHUA 4Y20B 3S7EA 1PX3A 2ZEWA 3DKQA 5CADA 4M3CA 5SV5A 4AFDA 4QDRA 4MHUA 3ZXDA 3ZDVA 5KHGA 3AVRA 4NIIA 3LE0A 2P3YA 5A80A 5H9QA 5A7NA 5D8AA 1YFUA 3B94A 2XJVA 2N7GA 1WW6A 5BNPA 1OD5A 2WZR2 1RXFA 1U5YA 2ZAHA 1COV1 1R1A1 3B93A 4XACA 3VD4A 2A5ZA 2KD7A 5FYIA 3MV01 2P3JA 4HK8A 3FMGA 4CEYB 1CIWA 4KI5M 1WCDJ 3H3LA 1UOJA 2JG9A 1NZIA 5GZDA 2QCSB 4UFLA 4E4SA 2WSVA 3LSDA 5T5LA 1BHGA 1ZRCA 4JZRA 4FPFA 4MGSA 2RS13 1E57A 2CHHA 1H8TC 3MHZA 1W3VA 5FZGA 4Q0QA 3KM5A 3OG2A 1U5XA 2IC1A 5LA2A 3H7YA 2VO5A 2J1TA 1S0IA 2P37A 5FZ6A 4R9AA 2UYAA 4SLIA 4LA3A 5T52A 4L99A 3AZXA 1NCRC 2R0FA 2GMPA 4JTOA 1CAWA 5T3NA 3M3EA 1CAUA 1H2NA 3FLPA 2V4AA 5T5PA 4NRMA 5ERLA 4XF1A 1MR5A 4XFFA 1SFNA 3BPZA 3N9QA 4AVVA 5FQ0A 1M06G 2W3JA 1FNZA 2UY9A 5FZFA 2GZWA 2R063 3KGLA 4XMAA 4AQ6A 2F6BA 1RUG2 3AP4A 3K77A 3SISA 5HCAA 2PN5A 1QMJA 1ZZCA 1SHWB 2JDKA 1UXXX 3ZX7A 4BK4A 4HOOA 4LKDA 3LA2A 5E16A 2HBTA 4N9IA 4Q4Y3 4WM8B 2DFBA 3D0JA 4XUQA 4ZONA 4XXPA 5FIXA 1FOD3 5JDBA 3SC7X 2FQPA 1RUE1 4ET7A 5A6YA 1ZVFA 3PMSA 1W03A 4IV1A 2PAEA 2WC2A 4P14A 5EFUA 5JXGA 4ZHNA 1Q8VA 1VRH1 4QKFA 2X29A 1VLNA 1JYVA 4KWKA 4LBLA 5JCTA 1ZRFA 4FPLA 3MIBA 4YG3A 3DEMA 1LOFA 1NUKA 1ASJ2 5FO8B 2P34A 4IE7A 1NY72 4I0AA 3KZ4C 4YWAA 1DDLA 5J96B 3RWNA 3IM0A 4RGKA 1SLIA 4QB1A 4AQ2A 1O3SA 3T2OA 4GWMA 1XNAA 1FYUA 1ZZ8A 4XQWA 1VAKA 3FE5A 3J4UH 4IESA 4E4ZA 5FO9B 2JDMA 2ZPXA 2G9GA 3ZXLA 3T1LA 5AFEA 5FJHA 3N9NA 5IAXA 4HMZA 3O1VA 5F5AA 3DV8A 4LQRA 3I2IA 2XWBB 5FZCA 4WVMA 1CAXA 1ZBE1 1SPPB 1UU4A 5LK7B 1ENSA 1MS0A 4Q1RA 4W8JA 4KQ7A 2WNVB 3ZFFB 2XMLA 4N43A 5I0SA 4Y1XA 1PK6A 4MSVA 1IGOA 1OFSA 5FZHA 3GZEA 4IGQA 4A3ZA 4NIAA 4BB3A 4XUOA 4EN6B 2R073 2VG9A 4LKEA 1VBD3 3R4UA 4ISRA 2GU9A 4JKMA 1ND2A 3HIFA 2QNKA 5EJ3A 3ASIA 3WG1A 1W6NA 3FC0A 1YXWA 3KSCA 3ACIA 2JJ6A 4E4HA 3J7MA 1D4M1 4JC1A 4B3NA 4RN5A 2OQ6A 3W58A 1T2XA 3B02A 2VBPA 1S2EA 4K1YA 4QPIC 5EPAA 3T2QA 4IE5A 1RUH1 1YRZA 2EIDA 2PQSA 2VQTA 5GLZA 5JOZA 1ULDA 1JTZX 2WQ8A 1W8ZA 3VZKA 4FQ4A 4MXWA 5ABJA 2PHLA 3HPNA 1W6PA 1LHUA 4AWDA 3WDTA 4XVHA 3PURA 2GNTA 3UJQA 1K5JA 5FXVA 3MZHA 5A70A 5LASA 2B42B 4LUKA 4QX7A 4XTMA 4GH4C 3U75A 3WLUA 3WHTA 1ULGA 3HT2A 2DBNA 2W46A 1QQP2 4QKDA 3FX3A 2VNGA 2ZMLA 4KBZA 5DDJ2 2VC9A 4FPGA 1VAMA 1L7LA 2XVGA 2ID4A 4WZCA 3HR9A 5CFDA 1GNZA 2GDFA 4BQ2A 1NT0A 1ZRDA 4K40A 3VDBA 2LW8A 2OX0A 1H8VA 1UOFA 1HRI3 4LO7A 3VBFA 4OCTA 5HCFA 2BNNA 2YB7A 3HNMA 3NNLA 2XXZA 5BY5A 3TRSB 5C4WB 5IVFA 1V9U1 2TUNA 2BNMA 3RI9A 1AL0G 4YVWA 4C8DA 1UKGA 2D6PA 2W2IA 4GWNA 5JZGB 3H7JA 4YGBA 4QXBA 5FZMA 2RHPA 1JYWA 1GZWB 1NCQB 3I54A 1XJAA 3WF3A 4AW7A 1QOOA 1QOTA 2ORZA 4QM9A 1OC1A 4RFT0 2KR2A 3RMYA 2ZEZA 1WCSA 3W20A 5C6CA 5JPMB 3U11A 4W50A 4MX3A 5F3GA 1TE1B 4W65A 4AHWA 2AC1A 5C3RA 3UNPA 3TAYA 1PGL1 1OF4A 2EXIA 1L7QA 4QPWA 1LOCA 1PM7A 2VCCA 2FBEA 4JDNA 2BVBA 1JZ8A 4WVVA 5IUQA 1ZZ6A 1JUHA 3HT1A 1A34A 2DCJA 4LBJA 4YW2A 5LB6A 2Y6HA 1KDMA 1U5ZA 4YARA 3RNSA 4QU2A 3GBGA 5LK5A 5FK7A 5J36A 1I1EA 3DKWA 1QJY2 2BQPA 2I07B 3UGHA 1G9DA 2OS2A 1W2OA 3N35A 2DUQA 1IG3A 3I2HA 4JGYA 3WF0A 1QJX1 2NP0A 3OD0A 1FV2A 4Q4W1 1TZOA 3T4VA 4G9SB 1HB4A 3NNMA 4UW3A 3N9PA 4I0BA 1AX1A 4UFHA 2YGMA 3LIGA 2WRAA 3VHOA 4PBPA 1KJLA 3D82A 4DMIA 2FMDA 3Q8EA 1MZEA 2JWPA 1JW6A 4AXOA 4A7KA 3H0OA 4IEZA 4XFCA 1HQWA 1RUC3 2NQYA 3KCCA 3VBUB 1Y3TA 1UYXA 4IV3C 5KXDA 1XNKA 4B4PA 4ZXEA 1RUI3 1POV1 1WLDA 4CSWA 3R0RA 5IVYA 3WG3A 5EYXA 5FK8A 2OW4A 4DXRA 4AVCA 4Z82A 4NE9A 5HXVA 4QXHA 4AYUA 1LOBA 2HWF1 4BM8A 1O3QA 2PHXA 3MLKA 2RS33 1X50A 4CP9A 5FYYA 5A32B 3LA3A 4QDQA 5JI9A 4AGVA 4CDXB 4H55A 3OBAA 1N3PA 1NOVA 2JDPA 5C8WA 1SDWA 1S4CA 1O4TA 1H8TA 2W1WA 4HANA 2ZMNA 4CA9A 4COWA 1E5IA 1XYNA 2P2KA 4XUNA 1SLCA 3HQUA 4XJZA 1F31A 1KEXA 1YYNA 1TNRA 1WBFA 2IWGB 2RM23 3H9AA 4DS0A 2CWMA 4IEOA 4W6XA 4XCBA 3VZLA 1ENRA 5TSWA 1HB3A 2WR9A 3EQEA 1LGBA 3I3DA 1VALA 4X8PA 2VGDA 3J8F2 3JBG1 1RHI2 1W6OA 4BLIA 5A6ZA 1UXZA 2PQQA 3ZYIB 1LOEA 2VXRA 2VTXJ 1NCRA 3HBZA 3WNOA 5JOYA 2VMIA 3U1XA 3K3OA 4HLTA 4KWJA 4XUPA 5H9PA 1W8WA 2XB6C 4C90A 5ACA3 1W28A 5DUWA 3V0AB 3P6BA 4CDUB 2JDAA 2LROA 1NLQA 4D3WA 4ATEA 3MBWA 4OFGA 2BEOA 5I0TA 1R64A 5DZEA 4YFWA 4PI2A 1HXS3 4OHWA 3PLQA 2W47A 5K4LA 5BNOB 2TNFA 1W9FA 4Q0UA 5JMCA 2DU1A 1MVEA 4YGCA 1PO11 3O1SA 4MGYE 2BBAA 2JDZA 2GNBA 4FT8A 1VBB3 3LSEA 1JZ5A 2W1UA 1WBLA 1RUF1 1RVF2 5I0DA 1DGWX 1F9KA 2VZPA 2W1SA 5LA1A 1AXYA 2RE9A 4UYBA 3SH3A 1MS5A 1TME2 3AZWA 3IDCB 3QH6A 2WO7A 3VHNA 3WINE 2G1MA 1VJ2A 2ENRA 5D8AB 5FZKA 3AYDA 4GKXA 2MEV3 3AP9A 2JE8A 2GN7A 4N7UA 3DN7A 2ZMKA 1EPZA 2HKXA 4UOJA 5BNPB 2UYBA 3AMNA 1O5UA 5F6LB 3VKLA 1C28A 3DL3A 3EXUA 2A1XA 3VDCA 1WZXA 2QQJA 1V70A 2YGLA 4PLOA 1WA6X 4JDOA 4LPLA 3RFRA 1WCKA 5CA6A 2WLPA 2AREA 2QQPA 4XMIA 1PZ8A 2E33A 5BPXA 1EV11 4AI2A 5FP9A 2ZGKA 4BXFA 4AFAA 1UOBA 4EROA 4JHZA 1AR93 4B4RA 4DY5A 2VOXA 4URTA 5FLIA 4I09A 5FBJA 3TN91 3W59A 3LQCA 4N53C 1DCSA 2WNUA 5C70A 1J1LA 2HJIA 2UWAA 3WP3A 5A7QA 5C3PA 3KT1A 2RDRA 2VZUA 5LY1A 4BISA 5DMYA 1CAWB 1CAUB 1RUJ3 4LO4B 4Z2WA 1QY4A 5FUPA 2YFUA 4LBOA 5CFCB 2YMZA 3WVJA 4GMP3 1OPOA 1CWPA 1RUH2 1C57A 3VUOA 1URXA 2IXIA 4Q0VA 5E89A 1S0EA 1ZREA 2RMU2 4YYOA 4L8QA 5FDBA 2JB4A 3POGA 1RMU3 1SBEA 2ZHKA 3T2PA 4HL0A 1YFWA 3B7MA 5IVCA 5J1XA 4PQ9A 3RYRA 3RVHA 1BQPA 1RGSA 4QPIA 1LKNA 3HOBA 4IEXA 1PIV2 4P5YA 1V6IA 2PLV2 3D0SA 4XEZA 3TYJA 1H1IA 1MQTA 4YZ2A 4IV1B 2VMFA 5JI7A 1W2AX 5EQUA 3LFMA 3USUB 1ZX5A 2WZR3 1MZ6A 4UFMA 2DCYA 1QEXA 1QDOA 1N3OA 3BCWA 3OUJA 5IVBA 5FYTA 4GH4A 4CUAA 2VCMA 2GNMA 1UIKA 4UW4A 1W2NA 4AAPA 2ARBA 1QNWA 5FMBA 3MIHA 3ZYBA 2WFPA 3VD9A 5C9AC 4BQXA 2PMWB 1PO21 1UD1A 1YIPA 4WM7A 5CKNA 1OH4A 3RGBA 1SBFA 3JB8A 4FVVA 1C8M2 5IW0A 3I2DA 1ENXA 4ARXA 3UYJA 1QNYA 3KV6A 3ZYJB 4NUBA 1MEC1 4WVMB 1CAXB 3NJVA 4AVBA 4BIFA 2ADDA 4OYUA 1N1SA 5D2AA 2NLRA 1ST8A 4YVSC 3ETPA 3GZUC 2VZSA 3N7KA 1J3RA 1N1VA 4DRRA 4CEWC 1HN1A 1PK6B 2YUEA 4M00A 1UO9A 1AX0A 2ZXQA 4MGZE 1OT5A 3T1MA 1OURA 1X8MA 3RZZA 1ND2B 1MPXA 1RUG3 2FCVA 3K3NA 3NV4A 4TXWA 3WZ1A 1DZTA 1VMFA 1W6NB 1XBFA 2DTWA 3MIFA 4FP3A 4B7KA 3KHCA 1IPKA 1UZ0A 4YM1A 1NXD1 2Z4FA 1UPIA 3PVNA 4P00B 4QQLA 2LS6A 4LOSA 5FPBA 4YFZA 4TLFA 4GB31 3KWVA 5FPAA 2LTNA 4HK9A 1JYXA 1UYPA 3ZYHA 3TEWA 2X53S 2ZACA 2ZX4A 1ZA4A 2PHTA 1DZRA 3ZSMA 4CCMA 1FPN2 5ABJB 4YW6A 4MXWB 5JWPA 3O1MA 1NZCA 4JVAA 5FMOS 3LEGA 5JUVA 1NQDA 2VW0A 5AC91 1ASJ3 2XH6A 5IK5A 1AHSA 2QKDA 3VDDC 4XURA 1E5HA 1K42A 1G7YA 5IJRA 2P17A 3E97A 3VBOC 5APAA 4IL7A 2UU8A 3L2YA 3MFCA 1W39A 1CVNA 3OUIA 4FFFA 4LMFA 4RHV1 3A22A 1Z7S2 5I93A 2ZAAA 3WNKA 3ZPYA 3I59B 2DVFA 2I45A 3OGVA 1ACCA 2OUJA 1G9CA 3A7QA 4QPGC 3KD4A 5DZGA 5A3PA 2D6MA 2XKPA 5H9RA 2HEVF 2BZDA 1JOBA 3WW2A 4IV3A 2JIGA 3NAPA 5FYHA 1UAIA 1XE8A 5FWJA 4Q8LA 4DNYA 2IVIB 4QQOA 4CDQA 3O1RA 3UT0A 5DUXA 3SKJE 5FKBA 1PGSA 2HWE2 3OGGA 3PUSA 1O5LA 3WDUA 1LEDA 4YVWB 2FCUA 3IIAA 4XCAA 5F5CA 1UX6A 2FZ2A 4XBLA 4Y5SA 2HWB1 4C1XA 3ZKYA 3ZFEA 4FTSA 4HKLA 3BI3A 3N36A 5EXOA 3IPVB 2GALA 2XJPA 4Z07A 3FHIB 5JXJA 4HT1T 4QU1A 2Y6JA 4PT6A 5G05L 3WW1A 3BB6A 4AI0A 1SLTA 1W6QA 5A1LA 2H6CA 5I0RA 2ETEA 3CMGA 4NAMA 3KCXA 4AAXA 1H6YA 2ZBJA 5LZ6A 5DAVA 3S6PA 2YPJA 4D6QA 5FLJA 1TMF1 1OI6A 2ARCA 2Y33A 1LGNA 4JDMA 4L97A 4NRPA 4PIXA 5DAXA 1UY0A 3LD8A 2C5DA 1UPSA 3H8UA 5C8CC 3MUY1 4WVZA 5LATA 4COVA 3CDZB 3VZJA 3BTAA 4HBNA 5DUUA 1ND3C 2GN3A 3POFA 4IE0A 2WFF1 4P9WA 1OLQA 1SCSA 4JGYB 4PDWA 4V2VA 3LF7A 2D6OX 3CL1A 3N9OA 1CZSA 1QQP3 1RINA 4D94A 3POJA 2DUOA 5FUIA 2Q8EA 4JGZC 1AR71 1YWKA 3K46A 1CQ9A 1EY2A 5DDJ3 4K9SA 4GAZA 2QQNA 3GF6A 4ZS2A 3VBHC 5F5IA 4AEDC 3BODA 4CXWA 2A71A 3O1PA 2RS51 1BJQA 1QU0A 2XL9A 3JD72 5FY0A 1W6MA 5GZFA 4Y1ZA 1XC6A 1AYM2 1N1YA 2VZRA 4GA9A 1GFF2 2HWC2 4CE8A 2QQLA 3BOPA 4QMAA 1QXPA 2J42A 5A1FA 1MZFA 3S7IA 3CZJA 3C7GA 5GLUA 1EV12 3RPQA 4CP2A 2WN2A 4XE9A 1JUIA 5EZWA 1GUIA 1IQAA 2WT0A 4FPJA 2VMGA 1J3QA 4Q4V1 3LAGA 4BQYA 1BK1A 4CP9B 3AKSA 2VZVA 1W9TA 1UYZA 5J09A 4HFSA 1Q3EA 5EHDA 3N7LA 3TN92 4A7YA 5B2GB 5CVRA 5LBBA 4TN7A 1OLRA 5DN2A 4W6WA 1IS6A 1REEA 2D6NA 3AYAA 4CVUA 4X6RB 5JIUA 4RS5C 1S0BA 4XZUG 4EWDA 1PX4A 1UX7A 3WHUA 4AQSA 1KITA 1Q43A 1DQ0A 2TBVA 1XB9A 1IKPA 4EQVA 1VRBA 2XQXA 3OJBA 4QX5A 4R9BA 5KXEA 1RJ7A 2CYFA 5E88A 5BNNC 2VU9A 2E26A 3IIIA 1W6OB 1H30A 4KU8A 4E8DA 1QJY3 3O1TA 3NV3A 3AB0A 3INAA 1YO8A 1ZRIA 4V1PA 3GBWA 2EAAA 4FFHA 3WR0A 3AYCA 3PUIA 5CG9A 1WW7A 2OZJA 3ZXEA 3CJIA 5FFOC 1E5RA 1AR81 2WZ8A 3FBYA 3L2HA 3LGRA 2JD4A 4TZDA 2ZX3A 4MGIE 1TQ5A 2VZ1A 4LBQD 4NJ4A 4Y4RA 5GZCA 3DYMA 1V00A 3MF9A 2JG8A 1ZZ7A 2R32A 2VUDA 4CCKA 2ZGNA 3SHRA 4GJYA 1W05A 1A8MA 2FDJA 2YHJA 3LOIA 1AL22 3ORJA 4LNVA 3OEBA 5A3LA 4LTAA 3M1HA 1XU2A 2QQMA 5A7WA 2J7MA 2QE3A 5FMOL 1GP6A 1V6MA 2J1EA 2P1BA 2Z42A 1O4ZA 3WXPA 2IXHA 3AX4A 3FBMA 4E8CA 1RUNA 4YW4A 4CPBD 4EWAA 1ZBA1 4XJAA 1Q8OA 2VOWA 4UF0B 4LO8A 1SACA 1S0CA 2HEYF 3AMQA 3IAPA 1B09A 3THTA 5FPUA 2XGXA 1OOPA 1XYPA 2BVVA 1RUD2 2ZX2A 4M4RA 4Y1VA 4CYDA 2RDNA 3WV6A 2HWD2 4ZU5A 1DLCA 1HDKA 3S0MA 1B35C 2XLGA 3H1WA 3HNYM 1QJU1 1RYYA 2Y60A 3OB8A 3J8F3 1OBNA 1RHI3 2DCZA 4AFCA 1S2BA 4H3WA 1FNYA 2WNUB 4QXCA 1D2SA 3GJAA 4YVSA 5FOBB 3OD4A 5LEJA 1FX5A 1KDKA 2WA3A 3E5UA 4DZGA 1UZWA 4D8MA 2GP3A 2VVFA 2CDPA 2JEMA 2AEYA 4UXAA 5DAQA 4BA6A 1MS8A 3I3EA 4M3CE 3KS7A 3LZZA 5K0UC 5FZIA 4AEMA 3O7OA 3OGSA 5FYSA 3OOXA 4MUVA 1SMVA 5GLWA 3AVSA 1CN1A 5GALA 4PLNA 3OCPA 1AR61 5AC92 2RR12 4GD4A 3L9JT 2VR4A 5ANNA 1RVF3 1VBC3 4NOTA 4EN8B 4A41A 1F2NA 2EXJA 2R041 3GGLA 3NMBA 1MQTB 1VAVA 2E63A 5T55A 1TME3 4QWNA 1BEV2 5A3UA 1CESA 2EA7A 3BTXA 3PJQA 3VBSC 1GWMA 1LNSA 4Q26A 1F5JA 2KM2A 3ZM8A 4BQWA 4A4AA 3VHPA 5LBEA 1BVP1 2J22A 3DPRB 4NPMA 1BXHA 5C5TA 4L0PA 4LBQA 4KNCA 3VDDA 1MS4A 2RJKA 5EWSA 3A0KA 3DYOA 4ZXKA 1WD3A 4OI1A 2EVXA 3VBOA 2XVLA 2ZKLA 4Q1PA 3CBNA 3CHXA 3HVDA 4LITA 2XBO2 4WM7B 2P6HA 4IEVA 4R9CA 4PJYA 3R6SA 3ILRA 3KT4A 1IPJA 3KF3A 4PIYA 4CP0A 1CX4A 4KU7A 2HWB2 2WA4A 4Z92B 1GKBA 3JQWA 2RS11 1PGW1 3ZLIA 3FUQA 2WNOA 2VMDA 2JICA 4QX2A 4CPBA 5L7OA 4M4PA 5J37A 2A3YA 1OHFA 3OPZA 4NHKA 1KS5A 2ZZQA 2X5IA 4FPCA 2ATFA 5HCHA 4EYUA 5DABA 1ZYBA 3BVCA 3KV9A 1NA1C 4LKSA 4I02A 4UAPA 1QH6A 4CDWC 4EN9B 2IFWA 5EV7A 5FZ0A 2BGPA 2WT2A 2EF6A 4JRAA 4KWLA 2UURA 4MGTA 1OXCA 1Y9QA 1RUH3 4C0HA 5JSRA 1P8JA 2ZGPA 1BCXA 2RMU3 4AI8A 3I49A 3C8XA 1RXGA 1T6BX 3AP7A 3GCXA 2VQ0A 2R061 1ZZ9A 1VBE2 2PAMA 5FAXA 3FLRA 2YPDA 3WUDA 1YHFA 2ET7A 2Y38A 4A44A 4E4DX 5IYYA 3PL0A 1PIV3 3OBZA 2PLV3 1TG7A 2PTMA 3AKPA 3OBRA 1R092 4IE4A 4R4ZA 3ZN5A 2FMYA 3GNEA 1FOD1 1GV9A 4NHLA 4CEYC 4Z8BA 4QKBA 1CPNA 1APNA 1HX6A 2BU9A 4JRLA 5C8CA 1Z0HA 1CAVA 4COZA 2ZOEB 3RS6A 1DGLA 3SXWA 2RJ2A 1MS1A 4Q0SA 4YLZA 3B69A 2XUEA 3SCHA 3BU0A 3MGUA 4RQPA 2Q8DA 3X29B 4YZ3A 1WW4A 3ILFA 3K4DA 1DHKB 3UGFA 4DPNA 1AYN3 1V6OA 2WL1A 1XNTA 4AI1A 1E5SA 2V72A 4AEDA 1N47A 4AZZA 1C8M3 1WUVA 1V6LA 4EV0A 2BBVA 3UESA 2VNRA 4AVSA 1XYOA 3PU8A 4HSLA 4H7MA 1C1LA 4IETA 4OMDA 4Q4V2 3ZYGA 4IV3B 1Q5OA 4JTNA 1MACA 3NAPB 4XTPA 3SLIA 3ZYFA 3VKMA 4ES9A 3H1MA 4CDQB 3B9IA 4M0NA 2XUMA 5T5JA 1Y7BA 4FPOB 1V6KA 2P4EA 4LXLA 1K5MB 5FUNA 1R082 1YQCA 3VD3A 1XSRA 4AEKA 5I91A 1US3A 1WA4A 3GBFA 2WS92 3C7EA 3ZFEB 4CCJA 5A1AA 3CF6E 4XHBA 1SBDA 5IWFA 3AMMA 4WM8C 2F4LA 5F7UA 1MZ5A 2ZGOA 3LIHA 1K12A 3SH5A 4A6SA 4FBFA 3U0ZA 5I8TA 2R071 3TEYA 3GXUA 1VBD1 1X82A 4ZZ8A 3AFKA 2W87A 1EYBA 4YZ5A 5A6XA 2XLFA 4AOCA 1HJFA 1ULOA 4NRQA 2AZ5A 4UWDA 5EYYA 1D7PM 1YI7A 2QQVA 3KQ4B 4HG6B 3B00A 1UOGA 2WNEA 3BTZA 5EJZB 2EXHA 5IAVA 3I3BA 3WOGA 4BQ5A 3LKJA 2QQKA 4OHXA 1QGLA 4OUMA 4OULA 2KXLA 4N8MA 1FPN3 4XF3A 5A3WA 3ZO0B 5BNNA 1O3RA 1DGRA 2JKBA 2VCBA 1HKDA 2A7AA 2E7TA 1G9FA 2W52A 3ELNA 4P9LA 1GQGA 2HLEA 2ZEXA 5FY8A 3UKVA 4ASMB 5JAXA 1BLZA 3LWCA 1FMD2 2Y34A 2WWSA 5F3CA 1LENA 2AUYA 4CZSA 3ZN6B 4K6BA 2B8MA 2QQWA 4PDWB 2WKKA 4ZU4A 4O65A 3RJRA 3UKNA 1D0GA 3RQ0A 4H14A 1K3IA 4YM0A 1HW5A 1BBT1 4MO3M 4Y5TA 1AF9A 2C9AA 1KRIA 3WP5A 1O4YA 1Z7S3 3MV11 2Y8KA 4AF9A 1BMV1 5J98B 2ZGQA 2GMEA 3MUZ1 1GICA 2ZZJA 2D6KA 1ODNA 2A6YA 3C7HA 3MICA 2WNVC 1W2UA 2R7EB 2YXSA 3PTYA 3ZFFC 3VBRB 2WSUA 2DU0A 4YG6A 5DG2A 4MHRA 2NMNA 1AZDA 4UFIA 1SLLA 2NZ9A 3IMMA 1HRI1 3MW4A 2IXKA 4GJZA 1DQ6A 2GC0A 2HWE3 1NYWA 2D5HA 4QGNA 1D4VB 1HN0A 2PHWA 2OYZA 4DB5A 1COV2 1R1A2 2VOTA 5FY5A 3WNMA 2W0XA 3K4AA 5EIYB 3I7DA 3A0NA 2WABA 1LHWA 1QJU2 4RGGA 2PHDA 4GMP0 3MIDA 4IGPA 4QHZA 3DXUA 1UW8A 1PNFA 2PFWA 1UN1A 3F95A 4I30A 4FI9A 2ERFA 2EIBA 4OQ8A 4QHBA 3GM8A 1LR5A 1IS4A 4IEYA 5FYCA 2DCTA 1F15A 4JKLA 2IXCA 3AKQA 3WQ1A 2E7QA 5FO7B 1H4GA 2R16A 4QGMA 2OPKA 4HPKA 3U14A 1LGCA 3ACLA 4BHPA 4GQ7A 3UJOA 3D6EA 5CKMA 4HKWA 3OYWA 2BERA 2W5FA 2OZ6A 4BXSV 5EJ1B 2BWAA 3OPWA 1HQLA 3MI8A 3WEZA 4XAAA 2R042 1X9TA 1YEWA 2DFCA 3CJIB 4P9IA 4W6YA 4AI3A 4AE2A 2WBKA 4UBGA 1RC6A 1OH3A 3LCPA 1JXNA 2VTFA 3MIGA 1NLRA 4LBNA 2VZOA 3ILNA 4DUWA 3BUCA 3WP4A 1DFQA 1Q8QA 2VULA 3G7DA 2JG8B 4XDOA 1S1AA 2VXJA 5F3IA 3JD73 4XFGA 5FYMA 1GYKA 3CO2A 3OY8A 1AYM3 1RUE2 1XE0A 4J1WA 4U36A 4F3JA 2Z79A 5JZGC 2HWC3 4Q2FA 2VOVA 4P9XA 3SCGA 1RUC1 1H1AA 2W68A 1NCQC 2YC0A 3HD8B 4OI0A 5A33B 2I2SA 1VRH2 3WCSA 1GNYA 3K2OA 5FOJB 1EV13 3AP5A 4AHZA 1RUI1 5A3NA 4HONA 1JYCA 1WLCA 4BWOA 4M3CB 3VB9A 2FDKA 3Q8FA 5SV8A 3WCRA 3A23A 1WCUA 2J1SA 4YPJA 3BYWA 3PTRB 1XNDA 1HRV1 2RS31 2DTYA 3I3QA 1KGYA 4XIOA 4BYYA 1OOPB 2VUJA 2OT7A 4G4FA 4QKNA 3H8OA 2D93A 2QDNA 4F83A 1HIXA 2YFZA 4MYEA 5KWRA 4O9GA 1GBGA 2R6QA 2Q1FA 4A7ZA 1AXZA 4LT5A 4LLOA 2VNOA 4M3CF 3IDEA 2XJSA 4KMQA 5E6HA 4FXGB 4J6GA 1PMJX 3M3QA 2JG9B 4ITCA 1ZBE2 5FZBA 2A3XA 3LFIA 2RM21 3LPFA 2JDUA 1GR3A 3ON7A 2JE9A 1EUTA 4LK6A 1DQ5A 3S5QA 1DQ4A 3M8LA 4Y1UA 3TEXA 5AFBA 1UY2A 1JU4A 4V2WA 2WJSA 4CXXA 4CDWA 3WF2A 3W9AA 4QM8A 2CDOA 5DPNA 4X6QB 3NJXA 3VLBB 3WX5A 2VW2A 1WW5A 3LA7A 3VBUC 3MPBA 3THDA 5ACA1 2ZHMA 2VUAA 5C3SA 1NXMA 3WQ7A 5DUVA 3LOBA 1O7FA 3IB3A 4LLFA 4Y26A 1IKQA 2ZABA 4UBHA 5FXXA 4DUXA 3FHQA 4LJHA 5L73A 3NNFA 4Y24A 2O8OA 3EJKA 1D4M2 3IDBB 3VV1A 2DURA 5L7OB 1TNFA 3FZ3A 2QFEA 5J3UA 4O9EA 5CZKA 3ZR6A 4Y3OA 3J7HA 5FQ0B 2VBBA 1AL23 1LU2A 1JHNA 4KG0A 1VBB1 3UL2A 5I8SA 3ZDSA 2DYCA 1VBA1 3RSJA 3LDBA 5L36A 3K75B 5JOXA 1LODA 2FHRA 2VZQA 4R4XA 5T5OA 4CCLA 2MNGA 1ZRRA 2MEV1 2QQOA 2YZ4A 4PCRA 4AFMA 2V5YA 3WD5A 3O5SA 3BN6A 4LBQB 2Y6LA 5A3TA 1PMHX 4L2NA 1X36A 4YW3A 2CTVA 3JQXA 1SFPA 4CU7A 4CUCA 1FI2A 1W0OA 4FAHA 3O0VA 5F3EA 1RUD3 4IQPA 3RZKA 1ZZBA 2HWD3 2CGPA 1BZWA 1YFYA 1UIJA 1UCXA 3G6JB 3WNNA 3Q9OA 2BUKA 4CU9A 5C3OA 5LEKA 3I2OA 5D1IA 3BIEA 1DLLA 2UY8A 4DXZA 1JU3A 4K8RB 2VE1A 3O1OA 3HNBM 5CEHA 4AI9A 3B01A 4PBOA 1LCLA 1PVC1 1BYHA 4TWTA 3WP6A 4AGGA 5FMCA 3ES1A 4CDUC 1AR91 1V9U2 4QB2A 1WWYA 5FLHA 2X5IB 4FOQA 1UY1A 3NNJA 3BALA 3OGRA 4LHSA 3J7NA 3KVBA 1ONAA 5LWBA 5BNOC 4COUA 2GH2A 2QJVA 3RDIA 1VMJA 5CU1A 2IUWA 4WM8A 1RUJ1 2D97A 3PVEA 4GULA 1OLMA 4NN0A 4XHXA 5JMOA 3OTFA 4FPHA 5C7GA 4KGQA 2BOIA 4GMP1 5FZOA 1PGL2 2X05A 1UMHA 4TLGA 4XBQA 4N43B 5AC93 2EIGA 1STMA 2RR13 1SZBA 5CBLA 2AENA 1RMU1 3NKGA 1WLTA 3QCWA 5FPVA 5BNPC 4NIDA 1I3HA 2V09A 4AVAA 3VZMA 2VTXA 3N9LA 3RZHA 2IZWA 1EP0A 2D98A 1BEV3 3H8XA 3CNAA 1BBT2 4XILA 1US2A 4RD7A 2P6CA 3DF0A 1W8UA 3PUHA 2VQAA 1CAVB 2VZTA 2SBAA 4GWIA 1Y9GA 4BU2A 4B7EA 5KXCA 1REDA 1BMV2 4NR1A 1YIFA 2K2SA 1ENQA 1NLSA 4XFHA 1KXGA 2XJRA 4Z2AA 1QJX2 1AJOA 2WZR1 1UMIA 3B5LB 4Q4W2 3KHBA 3GCWA 1DQ1A 2SLIA 4R52A 4RQPB 3P1IA 4DRVA 1JYIA 5DAPA 4Q4X1 5JR2A 2CWSA 2XBO3 1W6PB 2D44A 3PNAA 4B8EA 4CCOA 3RJ2X 1RITA 5J7MA 5KHJA 4AFBA 2XONA 3BPSA 4Y33A 2HWB3 1DIWA 2O0OA 4QX0A 1OQEA 3ZFFA 1H6XA 2HBUA 2QQUA 1WMXA 3DECA 1VR3A 1XRUA 2W94A 4N7IA 1A6CA 4O61A 4RA0A 2WINB 4J25A 3VN4A 4ZPIA 4AHYA 1OPMA 3E1F1 5CFCC 3MW2A 3WQBA 1REFA 3HBKA 2FDIA 5K7PA 1W8FA 2GMMA 2ES3A 2CNAA 4G3YC 2HWF2 3M3IA 1EAH1 4HN1A 4QQHA 5CFDB 4AEJA 2ZTNA 5G04L 5A6QA 2IXLA 1DYPA 1O8PA 3VBFB 4XETA 2ZGRA 1QOSA 2D3SA 5FZLA 1CJPA 1VMHA 2JX9A 3R05A 1C4RA 4H7LA 4XFIA 2E53A 2VH9A 1VBE3 4S2HA 2EICA 4IV1C 4NIGA 2BV4A 3NJZA 3B3QE 5LRRA 4OHVA 4QPYA 2YBPA 1KJRA 2R1BA 2RVAA 1R093 1LOFC 1PZ9A 5DG1A 1PMIA 2LM3A 3FLTA 4O7XA 2GH8A 2UWBA 3J7LA 5GM0A 2BYVE 2XHKA 3JBG2 1H0BA 1U12A 4WBBA 5ISLA 3ZOIA 4IEPA 1CD3G 2H6BA 1RL3A 2C26A 4K20A 4IERA 5BNQA 2VQUA 3NRUA 1AVBA 4B4QA 4ONUA 2Y0OA 2EIEA 3IKWA 4PQQA 2YBKA 1PVXA 1UWWA 4YRDA 4K1ZA 4FOYA 5FZAA 5L19A 2Z5WA 2B46X 4FPYA 4PF1A 5IFTA 3BOWA 2ILMA 5JIAA 3O12A 2QDRA 2BWCA 1PO12 5FRAA 2A6XA 1LULA 1W8OA 5F6KA 1JOPA 3AMHA 2CAUA 4DEQA 2Q30A 4AG4A 1RUF2 4PHZA 5JZGA 5IVJA 1YQ2A 1IPSA 5JR7B 1JZ4A 4L92A 5BUVA 4LO5B 1S0JA 1OUXA 3MFAA 1HRV2 1JS9A 1OVPA 5FY1A 4EZHA 2WO1A 2VM9A 3POSA 1ND2C 2AGSA 5IK7A 5T54A 1R083 2E6VA 3MLJA 3LDKA 4HETA 5HPOA 1JN2P 1QJEA 3WNLA 5F8PA 5LA9A 2WS93 4XZPA 1F5FA 1ZNPA 2W95A 4E27A 4P9YA 1HV1A 4NROA 5LW9A 1Y4WA 4FQZA 4NMIA 1BVVA 2R49A 4YZ4A 1YLLA 3VD7A 5LA0A 4YW1A 3ZKUA 4XPVA 3KB5A 4FPEA 2DF7A 5ABJC 2G4IA 4JX0A 4YG0A 2CL2A 1J58A 5CIRA 1NKGA 4CP1A 4H2AA 2QUOA 3VKOA 2G9FA 3CKHA 5BV6A 4HPKB 4AL9A 2ARXA 3WSOA 2ZHNA 2FDHA 4RFRB 4UW5A 3TOJA 4FTEA 2JD9A 1U0AA 3WW4A 2ZX0A 1YUDA 2XHNA 1CZVA 4DQAA 1FMD3 1UQXA 1GQHA 1H8TB 3HMYA 4HVRA 3NKTA 3OYWB 3S5AA 1PM4A 4XAEA 3HJRA 1CJDA 5FP4A 3PHMA 3A21A 5IK8A 2FDFA 1I5ZA 4D0QA 3W5NA 3ACHA 4N53A 5HXMA 3MEPA 4DXSA 1QWRA 1QQP1 1VBA2 4FOWA 2E32A 3M70A 1NCRB 1PHMA 1L3JA 4OUEA 4Y1YA 3T0BA 4C91A 1Z78A 2GNDA 3TB0A 5A7PA 5DDJ1 4B29A 3R4DB 3OEAA 3AZVA 4JCKA 3EYPA 3BU7A 3H3ZA 4LHNA 4RR3C 2DVDA 3SEPA 4YVWC 1QJFA 1IS3A 3OY8B 4BH9A 4AK3A 1IOAA 5JXHA 4OQ9A 1W90A 4XUTA 5A32A 5IFPA 1UYYA 5FREA 3ABZA 4MGQA 3NO8A 5DXDA 3N9MA 2IFRA 3TEZA 3GYDA 2WIIB 1COV3 1R1A3 4E2SA 1GU3A 3E5QA 2A6WA 5FWEA 4CUGA 1GQPA 1OQDA 3PUQA 3VD5A 2HYKA 4BCUA 4D7TA 4URAA 5KC6A 2NN8A 1GZTA 2JKXA 3M4FA 1JMUB 3ES4A 4QXKA 3KT7A 1QJU3 3AC0A 3K51A 3M3OA 2WAOA 3SKVA 1PO22 1PVC2 1GOHA 5JSOA 4DOUA 1JZ7A 4UI9L 3T08A 2ET1A 4PLMA 3KQRA 3IAQA 1QXJA 1X9PA 5FY9A 2VCAA 3B9CA 4JHTA 1G86A 3THCA 4XQ4A 2ZGMA 1X8EA 2BRTA 2NM1A 2VMHA 2WUHA 3D8CA 5FCCA 5C9AA 2WQZC 1RUJ2 1MEC2 1OKOA 4JGYC 3V0AA 5FZEA 1D0HA 3WY6A 1SLBA 4N9HA 1YNAA 5HI0A 2QZ3A 3O1UA 3LEMA 1ODMA 2C9KA 2P3IA 4ES8A 3FHAA 4IW3A 4LORA 1JZ3A 5BNOA 2DVGA 4Z1VA 1JI6A 1RMU2 3H42B 3LDRA 4BPZA 3MPPG 2R043 1SEFA 1O91A 3WT3A 4A3XA 4RYDA 1DG6A 5F9TA 1CX1A 1JYTA 2BGCA 1GOGA 4AGRA 3I2KA 3M7AA 4EN7B 2BFUS 4CEWA 3M3CA 2AYHA 5FR3A 2VL4A 4GB32 2C6SA 4UT5A 3J9SA 1RUE3 5FY4A 4LOTA 1IHMA 4CCEA 2VBDA 3AK0A 3RZMA 4W4ZA 4Q4X2 3I97A 1VRH3 1WLWA 4I01A 2PAKA 4NHXA 2WYSA 4GKYA 1OSGA 5FZDA 4UFJA 3RMXA 3WQ0A 2XVKA 4OUSA 1YCIA 1MS3A 4FPKA 1OF3A 1GWLA 1QJZA 4QPIB 1DBNA 4BLJA 2JDNA 5IVVA 4OLLA 1UU5A 3TNQA 4Q29A 3RZLA 1OVSA 4NHMA 2CSGA 3U4SA 1VB4A 4RHV2 4FXKB 5FXWA 2MHFA 4SBVA 3AJZA 1JZ6A 1M4WA 1EAH2 4GH4B 3AFGA 3SQOA 1VE0A 2XKOA 3KVAA 2B9VA 1ZBE3 3ROUA 3GALA 3IWZA 2BOJA 3Q8CA 2ZKNA 5CFCA 4R9DA 4R8HA 4XJ8A 3ZFGC 1J1TA 4COYA 2YC2A 1KFXL 3J8F1 1RHI1 4KBBA 5JLVA 2BPA2 4P9GA 1EPWA 4P08A 3N7MA 4QPGA 3ZSKA 4XF0A 1H4HA 4IEUA 1R1ZA 3SNMA 3BIWE 4CU6A 1O3TA 3ALQA 2VD7A 5GLVA 5T50A 3FFQA 1OA2A 2NMOA 5LBCA 3FN9A 2O8QA 2VVEA 4ATFA 4NPRA 2A73B 2WZPP 5CB7A 3ACFA 2LALA 1XPWA 1DGWA 2JECA 3LB9A 4HKOA 5FZOB 4META 2ZS6B 1KQRA 1D4M3 1POV0 4BE3A 2WWJA 2GAUA 2CY6A 3I2JA 5FPXA 1RUOA 4E9KA 1Q56A 3USUA 3LEIA 1NE4A 3PVOA 1TMF2 1VPHA 1S0GA 2AACA 2XG3A 3RG0A 1J59A 3PIJA 4XJ9A 3TBDA 1RVF1 1VBC1 2ADEA 5FYVA 1DGRN 5HV4A 1TME1 4CU8A 2YV8A 3OBTA 4LIVA 3O0XA 2WFF2 2O1QA 3ZPOA 2WO2A 4Q8KA 5FP8A 5K9YA 1W2TA 3IZOA 3PIGA 4YZ1A 4WVWA 4Q4Y1 3ZYPA 3V56A 2OPWA 5KHHA 4BDVB 2ORXA 3BTYA 3AMPA 2GC1A 1Y9MA 1WMFA 4L11A 1AR72 5L9BA 1EUUA 3VL8A 3PDQA 2VZ3A 1W8NA 4P9JA 1ND3A 3H8RA 2VOKA 3NSTA 1OFNA 2WNUC 5LY2A 2RS52 5DAWA 2K9ZA 4ASLA 1JYNA 3OUHA 4NIHA 3KGZA 2YY1A 4M0HA 2W1QA 3T4HB 2NYYA 1UZYA 4JGZA 1V9U3 2QTWB 3VBHA 3WDYA 3RYKA 3NV2A 3WUCA 4LBKA 2Y6FA 4KL1A 1L7RA 2E7AA 4GIQA 1KS4A 1I9RA 1H2MA 1UY3A 3JB4C 5J48A 2B39A 4OZXA 3WNXA 3WF4A 3Q8AA 1K45A 3T3YA 1ALYA 1O6UA 3ZSEA 4Q5OA 3USSA 5FJKA 2WZEA 1MQTC 3JCIA 4YW7A 4A6OA 3N7JA 2RMU1 1XE7A 2ZEYA 4OHZA 1SLAA 4KH9A 1OMIA 4CUBA 2GSYA 3HWJA 3CEWA 4D6RA 2XL7A 3DPRC 5CNAA 5IHRA 4ISQA 3S57A 3AKTA 4GXLA 2CV6A 5IT6A 2JB8A 5JXIA 5IVEA 3FUOA 5FYBA 1PIV1 1BBT3 2PLV1 3ZSJA 5KHIA 4DO0A 3PUAA 3KV5A 3MO4A 2VJXA 1W6QB 4ASKA 2BW8A 2XJQA 4WM7C 5AVPA 4RS5A 1LOGA 1OD3A 1QJX3 2D7FA 4LKFA 3QLQA 5A3OA 1XSQA 4QB6A 3VKFC 3I59A 3AZZA 3ECQA 4Q4W3 4ZY9A 3ZVXA 2Y0IA 3I4IA 4DEVA 2VAUA 3T0DA 4KG8A 2K46A 1AR82 3FJSA 4Q27A 2UWCA 3HN3A 1W99A 5F2SA 2Y64A 3GHNA 2BFUL 2GP5A 1AYN1 1PZ7A 2TEPA 3ENRA 1JOJA 3V64A 2MPFA 3ZMNA 5LRSA 2X09A 1LU1A 5FZ7A 3HAGA 4RR3A 1S2KA 2R1DA 1O59A 1C1FA 1YJKA 3PVBB
chains in the Genus database with same CATH topology
4PIZA 5HBAA 3IPVA 1POV3 5JPNB 1D2QA 4LULA 3IN9A 5CAZA 1LHVA 3EHKA 3NVCA 1XXNA 1I6XA 3MW3A 1LEMA 2HWF3 1RTVA 2DWRA 3N3HA 1LB2A 1ZBA2 4ZU7A 3NWKA 1W6MB 4NO4A 4ORFA 5I0UA 4X8NA 3DGTA 2JENA 3V0BA 1IS5A 3WDVA 5KC5A 4LE4A 2XJUA 1V6JA 5JOWA 3CLPA 1QH7A 3JBG3 4F7ZA 3WG4A 3A4UA 3ZMOA 1FXZA 4LA2A 1FPN1 3NL1A 1G9BA 5FTTC 1B35A 3AXEA 1MVQA 4RSUA 3ZXAC 2VVDA 2CAVA 4WZFA 4LBMA 1X33A 3K48A 1PNGA 4MVTA 1YFXA 1XU1A 3M2MA 3JU9A 2Q4SA 4M01A 4N53B 3AXDA 2VECA 3NAPC 4XBNA 3VKNA 1PO13 1NE6A 2VPVA 3QACA 4CDQC 1WD4A 3AKRA 2RJLA 1AR62 1Z7S1 4MGKE 3JUUA 1K5MC 2FZ1A 1RUF3 4LO6B 1X7NA 5K0UA 1AX2A 1N3QA 3GZTB 2Z69A 3ZFEC 1HRV3 2Y26A 1H9WA 1WGPA 4QD2A 4QQPA 3ME2A 1GLHA 1NQJA 2ZCWA 4Y22A 5C4WC 2HWE1 2A75A 4FCAA 2EAKA 5GJ6A 2X8KA 3MYXA 2PHRA 4XQDA 1A8DA 3U4XA 3VBSA 2Q1ZB 4D7SA 3GHMA 3AZYA 2B7YA 4OVEA 4XFBA 3KCYA 3FFZA 1JBCA 2W08A 3E6CC 2RS12 1PGW2 1Q8PA 3QH7A 1DYKA 1FAYA 4BMBA 3TN93 5C9AB 2B5HA 4PDWC 3ZFGA 3ZXFA 3ZSLA 4K21A 4I0WB 2YYOA 5F1RA 5GZGA 2JE7A 2H0VA 2PELA 3E6DA 1H2LA 2ZX1A 1A78A 4CRQA 3QOPA 1DQ2A 2W39A 4HZFA 4FAGA 3IBMA 4Y4YA 3UKTA 1HLCA 4D69A 3C2UA 2A3WA 3VBRC 4CTEA 1VBC2 1VBA3 3H50A 4YVSB 2R062 3EO6A 2Q8OA 1NA1A 3IT8A 4YSFA 2D5FA 4CEWB 4D7YA 1CGPA 4MH0E 4I3PA 3ZXGA 1FATA 3ZYRA 4OI2A 2WQ4A 1QF3A 2A6ZA 4Y20A 5GKAC 4Q4Y2 4S2GA 3RYPA 2D3RA 3H1YA 4IEQA 1ULEA 3AYEA 3JD71 1FOD2 1N1TA 2DV9A 3ZIWA 3O14A 4BIOA 1AYM1 4FSJA 1YI9A 1CPMA 4TSVA 5JVVA 3VHRA 2HWC1 4UW6A 1TEIA 1HXS1 4AQTA 1VIWB 2OIIA 1C5IA 1VP6A 3KMHA 1AXKA 1GANA 4CEYA 1LHOA 1PO23 1PVC3 2D43A 5BXXA 1LESA 4C0BA 2AR6A 4WV8A 1BKZA 3I8TA 1QDCA 1UZZA 4FOVA 4CDXC 3CJXA 2E9QA 1DZQA 3E6BA 1XNBA 2H0BA 1ULCA 2B9UA 3VDDB 2VY0A 4XW3A 1G8WA 3KLSA 1MEC3 2F4PA 3VBOB 3POWA 3SH4A 3CJIC 2C0ZA 4MLOA 3SITA 1WMDA 1RB8G 4IXLA 4QPGB 4XIKA 3MDPA 4E2GA 2C1FA 2CGNA 4OHYA 1T6GC 2JG8C 4LR4A 3WDWA 3CU7A 4MV2A 1OKQA 2R072 2ZHLA 4XJUA 3ZXKA 1VBD2 2PHFA 4BMEA 3V65A 3PMEA 3OF1A 4EN0A 4YGEA 2I74A 4XDQA 1GZCA 1QXRA 4YNIA 5C33A 4GB33 1KD7A 4RGAA 3DPRA 5FBZA 4BQ1A 1RJ8A 4YM3A 3AP6A 1LJ7A 4Q4X3 3FWEA 1AL21 3NV1A 4C1WA 3N4MA 5E1RA 4TYSA 2VW1A 1G9AA 5D8AC 1AYN2 1OOPC 3PJYA 3RI8A 4S2DA 5JSPA 1DF0A 1S0FA 3QBQA 2GC2A 4RHV3 5C8CB 4XXAA 2JG9C 5H9SA 1VB2A 5GZEA 4HSJA 1ND3B 1UL9A 1RUD1 4LHLA 1EAH3 2HWD1 4XOGA 1UU6A 2Q1MA 2OUHA 3DUIA 3MIEA 4I3GA 4JGZB 2NPIA 1HRI2 5AVAA 2E51A 4J1XA 1S0DA 3ZN4A 3VBHB 4AEDB 2QZ2A 1WMEA 1GZ9A 2WNVA 4XYXA 4Y5Z0 4XF9A 4DFSA 2Q0AA 2WLQA 1U5IA 2BTVC 4OI4A 4BZ4A 1YJLA 2XJTA 3J26N 3RRDA 3AJYA 3VZOA 3EBRA 2EXKA 1QHDA 1H9PA 1GSLA 1TMF3 2RR11 2A70A 1FT9A 1ULFA 2YROA 2XWJB 2OA2A 4XJWA 1UF2C 4QGLA 3SCFA 5K8SA 4LEJA 1RUG1 3ST7A 1GNHA 5BYNA 1BEV1 4K7JA 2R30A 2WFF3 4RS5B 1FV3A 2DUPA 1Q8SA 4JV4A 2ZGSA 4RL7A 4YGDA 2IXJA 1CONA 1XNCA 1H2KA 1MS9A 5BNNB 4NWWA 4YW5A 1AR73 4N90A 2OVUA 2XLAA 5L7OC 5I8YA 1CR7A 4LHKA 2KA3A 2XBO1 3ATGA 2RS53 2X5IC 3O0WA 1K5MA 4RR3B 1SCRA 3IMNA 3D4KA 3MF6A 3OGJA 1ASJ1 3WG2A 1OA3A 1HV0A 1NY71 2DVAA 1RUC2 1QKQA 4JAAA 5HCBA 5KXBA 3HQXA 5C4WA 1OA4A 3JZVA 1RUI2 3P3NA 1KFUL 3S30A 3SMHA 3VGIA 3TWIA 1C8NA 1XQNA 5IK4A 4Q4V3 4N43C 4S2FA 1PK6C 2LUWA 2V73A 2YDEA 1GZWA 3AM2A 4LUMA 2P3KA 1NCQA 3QD6A 1LTEA 2RS32 2PYTA 5DZFA 4AVTA 4INDA 2DCKA 4KGGA 3V0BB 1AUYA 1JH5A 1UMZA 2ZJCA 3U10A 2HEWF 4MXVA 1LHNA 3T2TA 1VBE1 4EWEA 4XF4A 3HN1A 3ZN6A 1SQ4A 5CG8A 2RM22 4A2UA 1R091 1C3HA 4HVOA 4RQPC 5FPZA 3UV9A 4F8AA 1B35B 3THPA 5KHKA 2ZA9A 5KBFA 2A6VA 2B45X 1AR83 2PA7A 3APBA 5F5QA 3VZNA 4DY3A 1RIRA 5ACA2 1G6NA 3VBRA 1IZ3A 1W0PA 1V6NA 4U2AA 1UKRA 1HXS2 4P5HA 3ETQA 5E8AA 3ZXJA 1HQNA 4HN0A 3P3PA 4NVPA 4PF5A 3VBUA 5CFDC 1OQ1A 1VBB2 5K0UB 4QT6A 1LECA 2ZGTA 3VBFC 3WDXA 3URFA 2WT1A 2D40A 4Y22B 2K0GA 4GALA 1ZM1A 2Q5TA 1ZBA3 4K8FA 1C5HA 2MEV2 3D5OA 1R081 2AH2A 2ZGLA 1DU3D 3E5XA 3H3UA 2WS91 2GC3A 2CGOA 5A3MA 5GLTA 4K3UA 3VBSB 3UK9A 4CDXA 4JQRA 3VL9A 4Q0PA 4EJRA 1Y43B 2D6LX 3NW4A 3U07A 1A3KA 4BOWA 2JXAA 4XFAA 2DVBA 2ZGUA 2D3PA 4IEWA 2BNOA 3C3VA 1AR92 3WW3A 3ZFGB 2Z2SB 4E2QA 3POYA 4DINB 1F8VA 2EALA 4YM2A 1S55A 3ZIXA 4I2OA 4FO9A 4ZKTB 1FMD1 1LOAA 1H1MA 4FP2A 4CDUA 1SFYA 2R0HA 3TNPB 2XPJA 4HVQA 4NWVA 3R4SA 5A33A 1NA1B 1AJKA 1AR63 1QJY1 3GZAA 4FTBA 1J3PA 4LE3A 3MLLA 4QQ2A 4AHXA 1NG0A 2QVSB 4MZUA 4CDWB 1LRHA 2PHUA 4Y20B 3S7EA 5CADA 4M3CA 5SV5A 4AFDA 3ZXDA 5KHGA 5H9QA 5D8AA 1YFUA 3B94A 2XJVA 2N7GA 1WW6A 5BNPA 1OD5A 2WZR2 1U5YA 2ZAHA 1COV1 1R1A1 3B93A 2A5ZA 4HK8A 2P3JA 3FMGA 4CEYB 1CIWA 1WCDJ 2JG9A 5GZDA 2QCSB 4E4SA 2WSVA 3LSDA 5T5LA 1ZRCA 4FPFA 2RS13 1E57A 1H8TC 4Q0QA 3KM5A 1U5XA 2IC1A 3H7YA 1S0IA 2P37A 4R9AA 2UYAA 4SLIA 4LA3A 5T52A 4L99A 3AZXA 1NCRC 2R0FA 2GMPA 4JTOA 1CAWA 5T3NA 3M3EA 1CAUA 1H2NA 3FLPA 5T5PA 4XF1A 1MR5A 4XFFA 1SFNA 3BPZA 4AVVA 5FQ0A 1M06G 1FNZA 2UY9A 2GZWA 2R063 3KGLA 4XMAA 4AQ6A 2F6BA 1RUG2 3AP4A 3SISA 5HCAA 2PN5A 1QMJA 1ZZCA 3ZX7A 3LA2A 5E16A 4N9IA 4Q4Y3 4WM8B 2DFBA 3D0JA 4XXPA 1FOD3 5JDBA 2FQPA 1RUE1 1ZVFA 3PMSA 4IV1A 2PAEA 2WC2A 4P14A 5EFUA 1Q8VA 1VRH1 2X29A 1VLNA 4KWKA 4LBLA 5JCTA 1ZRFA 4FPLA 3MIBA 4YG3A 1LOFA 1ASJ2 5FO8B 2P34A 1NY72 4I0AA 3KZ4C 1DDLA 5J96B 3RWNA 3IM0A 1SLIA 4AQ2A 1O3SA 4GWMA 1FYUA 1ZZ8A 4XQWA 1VAKA 3FE5A 3J4UH 4IESA 4E4ZA 5FO9B 2ZPXA 2G9GA 3ZXLA 3T1LA 5AFEA 4HMZA 3DV8A 2XWBB 4WVMA 1CAXA 1ZBE1 1UU4A 5LK7B 1ENSA 1MS0A 4Q1RA 4KQ7A 2WNVB 3ZFFB 4N43A 5I0SA 4Y1XA 1PK6A 4MSVA 1IGOA 1OFSA 4EN6B 2R073 2VG9A 1VBD3 3R4UA 4ISRA 2GU9A 1ND2A 3HIFA 2QNKA 5EJ3A 3ASIA 3WG1A 1W6NA 3FC0A 1YXWA 3KSCA 2JJ6A 1D4M1 4JC1A 4B3NA 3W58A 3B02A 4K1YA 4QPIC 1RUH1 1YRZA 5GLZA 5JOZA 1ULDA 1JTZX 3VZKA 5ABJA 4FQ4A 4MXWA 2PHLA 1W6PA 1LHUA 4AWDA 3WDTA 2GNTA 3UJQA 3MZHA 2B42B 4LUKA 4XTMA 4GH4C 3WLUA 3WHTA 1ULGA 3HT2A 1QQP2 3FX3A 2VNGA 2ZMLA 5DDJ2 4FPGA 1VAMA 2XVGA 4WZCA 3HR9A 5CFDA 1GNZA 2GDFA 1ZRDA 4K40A 1H8VA 3VBFA 1HRI3 4LO7A 5HCFA 2BNNA 5BY5A 3TRSB 5C4WB 1V9U1 2TUNA 2BNMA 3RI9A 1AL0G 4YVWA 1UKGA 2D6PA 4GWNA 5JZGB 3H7JA 4YGBA 2RHPA 1GZWB 1NCQB 3I54A 4AW7A 1QOOA 1QOTA 4QM9A 4RFT0 3RMYA 1WCSA 5C6CA 5JPMB 3U11A 4MX3A 1TE1B 4W65A 4AHWA 1PGL1 3TAYA 2EXIA 1LOCA 1PM7A 2FBEA 4JDNA 2BVBA 4WVVA 5IUQA 1ZZ6A 1JUHA 3HT1A 2DCJA 4LBJA 4YW2A 1KDMA 1U5ZA 4YARA 3RNSA 4QU2A 3GBGA 5LK5A 5J36A 1I1EA 3DKWA 1QJY2 2BQPA 2I07B 1G9DA 3N35A 2DUQA 2NP0A 4JGYA 1QJX1 3OD0A 1FV2A 4Q4W1 4G9SB 4UW3A 4I0BA 1AX1A 2YGMA 3VHOA 4PBPA 1KJLA 3D82A 4DMIA 2FMDA 1MZEA 4AXOA 1JW6A 4A7KA 3H0OA 4IEZA 4XFCA 1HQWA 1RUC3 2NQYA 3KCCA 3VBUB 1Y3TA 4IV3C 5KXDA 1XNKA 4B4PA 1RUI3 1POV1 1WLDA 3R0RA 3WG3A 5EYXA 2OW4A 4AVCA 4Z82A 5HXVA 4AYUA 1LOBA 2HWF1 4BM8A 1O3QA 2PHXA 3MLKA 2RS33 1X50A 5A32B 3LA3A 5JI9A 4AGVA 4CDXB 4H55A 1N3PA 1NOVA 5C8WA 1SDWA 1O4TA 1H8TA 4HANA 2ZMNA 4COWA 2P2KA 1XYNA 1SLCA 4XJZA 1F31A 1YYNA 3H9AA 1TNRA 1WBFA 2IWGB 2RM23 4DS0A 2CWMA 4IEOA 4W6XA 3VZLA 1ENRA 5TSWA 3EQEA 1LGBA 1VALA 4X8PA 2VGDA 3J8F2 3JBG1 1RHI2 1W6OA 4BLIA 2PQQA 3ZYIB 1LOEA 2VXRA 1NCRA 3HBZA 5JOYA 2VMIA 4HLTA 4KWJA 5H9PA 2XB6C 4C90A 5ACA3 5DUWA 3V0AB 4CDUB 4D3WA 4ATEA 4OFGA 2BEOA 5I0TA 5DZEA 4YFWA 1HXS3 4OHWA 3PLQA 5BNOB 2TNFA 4Q0UA 5JMCA 2DU1A 1MVEA 4YGCA 1PO11 4MGYE 2JDZA 2GNBA 4FT8A 1VBB3 3LSEA 1WBLA 1RUF1 1RVF2 1DGWX 1F9KA 1AXYA 2RE9A 3SH3A 1MS5A 1TME2 3AZWA 3IDCB 3QH6A 3VHNA 3WINE 1VJ2A 2ENRA 5D8AB 3AYDA 4GKXA 2MEV3 3AP9A 4N7UA 2GN7A 3DN7A 2ZMKA 1EPZA 2HKXA 5BNPB 2UYBA 3AMNA 1O5UA 5F6LB 3VKLA 1C28A 3DL3A 3EXUA 2YGLA 1V70A 4PLOA 4JDOA 1WCKA 5CA6A 2WLPA 2AREA 2QQPA 4XMIA 1PZ8A 5BPXA 1EV11 4AI2A 2ZGKA 4AFAA 4EROA 1AR93 4B4RA 4DY5A 2VOXA 4URTA 5FLIA 4I09A 3W59A 3TN91 4N53C 2WNUA 1J1LA 2HJIA 2UWAA 3WP3A 3KT1A 1CAWB 1CAUB 1RUJ3 4LO4B 4Z2WA 1QY4A 4LBOA 5CFCB 2YMZA 3WVJA 4GMP3 1OPOA 1RUH2 1C57A 3VUOA 1URXA 2IXIA 4Q0VA 5E89A 1S0EA 1ZREA 2RMU2 4YYOA 4L8QA 5FDBA 1RMU3 1SBEA 2ZHKA 4HL0A 1YFWA 3B7MA 4PQ9A 3RYRA 1BQPA 1RGSA 4QPIA 1LKNA 4IEXA 1PIV2 4XEZA 1V6IA 2PLV2 3D0SA 3TYJA 1H1IA 1MQTA 4YZ2A 4IV1B 5JI7A 3USUB 1ZX5A 2WZR3 1MZ6A 2DCYA 1QDOA 1N3OA 3BCWA 4GH4A 4UW4A 2GNMA 1UIKA 2ARBA 1QNWA 3MIHA 2WFPA 5C9AC 1PO21 1UD1A 1YIPA 4WM7A 1SBFA 3JB8A 4FVVA 1C8M2 3I2DA 1ENXA 1QNYA 3ZYJB 1MEC1 4WVMB 1CAXB 4AVBA 4BIFA 1N1SA 2NLRA 4YVSC 3GZUC 3N7KA 1J3RA 1N1VA 4DRRA 4CEWC 2YUEA 1PK6B 4M00A 1AX0A 4MGZE 3T1MA 1X8MA 3RZZA 1ND2B 1RUG3 3NV4A 3WZ1A 1DZTA 1W6NB 2DTWA 3MIFA 4FP3A 4B7KA 1IPKA 4YM1A 1NXD1 1UPIA 3PVNA 4QQLA 4YFZA 4TLFA 4GB31 2LTNA 4HK9A 2X53S 2ZACA 2ZX4A 1ZA4A 2PHTA 1DZRA 3ZSMA 1FPN2 5ABJB 5JWPA 4MXWB 1NZCA 4JVAA 5FMOS 1NQDA 2VW0A 5AC91 1ASJ3 2XH6A 5IK5A 1AHSA 2QKDA 3VDDC 1G7YA 2P17A 3E97A 3VBOC 4IL7A 2UU8A 3L2YA 3MFCA 1W39A 1CVNA 4RHV1 1Z7S2 5I93A 2ZAAA 3ZPYA 3I59B 2DVFA 2I45A 1G9CA 2OUJA 4QPGC 3KD4A 5DZGA 2D6MA 2XKPA 5H9RA 2HEVF 3WW2A 4IV3A 3NAPA 1UAIA 1XE8A 4Q8LA 4DNYA 4CDQA 4QQOA 5DUXA 1PGSA 2HWE2 3OGGA 3WDUA 1O5LA 1LEDA 4YVWB 3IIAA 2FZ2A 1UX6A 4XBLA 2HWB1 4C1XA 3ZFEA 4FTSA 4HKLA 3N36A 5EXOA 3IPVB 2GALA 2XJPA 4Z07A 3FHIB 4HT1T 3WW1A 3BB6A 4AI0A 1SLTA 1W6QA 2H6CA 5I0RA 2ETEA 3KCXA 2ZBJA 3S6PA 2YPJA 5FLJA 1TMF1 1OI6A 4JDMA 4L97A 1LGNA 4PIXA 2C5DA 1UPSA 3H8UA 5C8CC 4WVZA 4COVA 3VZJA 3BTAA 4HBNA 5DUUA 1ND3C 2GN3A 2WFF1 4P9WA 1OLQA 1SCSA 4JGYB 4PDWA 2D6OX 3CL1A 1QQP3 1RINA 4D94A 2DUOA 4JGZC 1AR71 1YWKA 5DDJ3 1CQ9A 1EY2A 4K9SA 3GF6A 3VBHC 4AEDC 3BODA 2A71A 2RS51 1BJQA 1QU0A 2XL9A 3JD72 1W6MA 5GZFA 4Y1ZA 1AYM2 1N1YA 4GA9A 1GFF2 2HWC2 3BOPA 4QMAA 1QXPA 1MZFA 3S7IA 5GLUA 1EV12 3RPQA 4CP2A 4XE9A 1JUIA 5EZWA 4FPJA 1IQAA 2WT0A 2VMGA 1J3QA 4Q4V1 3LAGA 1BK1A 3AKSA 4HFSA 1Q3EA 3TN92 3N7LA 4A7YA 5B2GB 5CVRA 1OLRA 5JIUA 4W6WA 1IS6A 1REEA 2D6NA 3AYAA 4X6RB 4RS5C 1S0BA 4EWDA 3WHUA 4AQSA 1KITA 1Q43A 1DQ0A 2TBVA 1IKPA 3OJBA 4QX5A 4R9BA 5KXEA 1RJ7A 2CYFA 5E88A 5BNNC 2VU9A 1W6OB 1H30A 4KU8A 1QJY3 3NV3A 3AB0A 3INAA 1YO8A 4V1PA 3GBWA 2EAAA 3WR0A 5CG9A 3AYCA 1WW7A 2OZJA 3ZXEA 3CJIA 5FFOC 1AR81 3L2HA 3FBYA 3LGRA 2JD4A 4TZDA 2ZX3A 4MGIE 1TQ5A 4LBQD 5GZCA 1V00A 3MF9A 2JG8A 1ZZ7A 2R32A 2ZGNA 3SHRA 1A8MA 2YHJA 3LOIA 1AL22 4LNVA 5A3LA 4LTAA 3M1HA 1XU2A 2QE3A 5FMOL 1V6MA 2Z42A 1O4ZA 3WXPA 2IXHA 3AX4A 3FBMA 1RUNA 4YW4A 4EWAA 1ZBA1 4XJAA 1Q8OA 2VOWA 4LO8A 1SACA 1S0CA 2HEYF 3AMQA 1B09A 3THTA 2XGXA 1OOPA 1XYPA 2BVVA 1RUD2 2ZX2A 4Y1VA 4CYDA 3WV6A 2HWD2 4ZU5A 1HDKA 3S0MA 1B35C 2XLGA 3H1WA 1QJU1 3J8F3 1RHI3 2DCZA 4AFCA 1S2BA 4H3WA 1FNYA 2WNUB 5FOBB 1D2SA 4YVSA 5LEJA 3OD4A 1FX5A 1KDKA 2WA3A 3E5UA 4DZGA 2VVFA 2JEMA 4UXAA 4BA6A 1MS8A 4M3CE 3KS7A 3LZZA 5K0UC 4AEMA 3O7OA 4MUVA 1SMVA 5GLWA 1CN1A 5GALA 4PLNA 3OCPA 1AR61 5AC92 2RR12 3L9JT 1RVF3 1VBC3 4NOTA 4EN8B 1F2NA 2EXJA 2R041 5T55A 1MQTB 1VAVA 2E63A 1TME3