1AYM3

Human rhinovirus 16 coat protein at high resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
238
structure length
238
Chain Sequence
GLPVYVTPGSGQFMTTDDMQSPCALPWYHPTKEIFIPGEVKNLIEMCQVDTLIPINSTQSNIGNVSMYTVTLSPQTKLAEEIFAIKVDIASHPLATTLIGEIASYFTHWTGSLRFSFMFCGTANTTLKVLLAYTPPGIGKPRSRKEAMLGTHVVWDVGLQSTVSLVVPWISASQYRFTTPDTYSSAGYITCWYQTNFVVPPNTPNTAEMLCFVSGCKDFCLRMARDTDLHKQTGPITQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The refined structure of human rhinovirus 16 at 2.15 A resolution: implications for the viral life cycle.
pubmed doi rcsb
source organism Human rhinovirus sp.
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 16 COAT PROTEIN
total genus 40
structure length 238
sequence length 238
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1aym300
1PO13 2BFUS 4N43A 4CDQB 1W39A 1RUH2 2WZR2 1VBE1 1RUI1 5FMOS 2PLV2 4WM8A 3CJIB 1ND3A 1FOD1 2XBO1 4RHV3 1AL22 4RQPA 1AR73 1PO11 1RVF1 1V9U1 1C8NA 2BPA2 5D8AC 1NCRB 1R093 4QPGA 1QJX1 4RS5A 3VBSB 1RMU2 3JD72 4CDWA 3VBHC 3JD73 2RR12 1ASJ1 1C8M2 1K5MB 5ACA3 1RUD3 1QJY2 1RUG2 1VAKA 2RMU3 1D4M3 4QPGB 4WM7C 4WM8B 2WFF1 1R082 1ZBE2 3VBRB 5L7OB 2HWB2 2RMU1 4FTEA 2R072 4IV3C 1FPN1 1VBD2 4Q4X2 4CEWC 5C9AB 4Q4W3 2RS12 4GB33 4RHV2 5K0UB 3JBG2 1NCQA 1AR71 4Q4W2 4IV1A 1AR91 1QJX3 1TME1 5ABJA 1AL0G 1TMF1 2Y26A 4Q4V1 3ZFFA 5ABJC 1AR93 5DDJ1 5ACA1 1MQTC 1CJDA 1EAH2 3HAGA 1ASJ3 1RUH3 4GH4C 1X33A 5CFCA 4N43B 3ZFEC 5CFCC 3J8F1 4RS5B 4N53C 5ABJB 2FZ1A 1OOPB 1VBA3 1FPN3 3DPRA 1E57A 1NG0A 4RQPB 2RR13 5AC91 1NCRC 3CJIC 2WZR3 3NAPC 1RUE2 2IZWA 1OOPA 1VRH2 1PVC1 2RS51 5A33B 1PGL1 1RUF3 1VBB3 1Z7S2 3IDEA 1BEV1 1HQNA 1RUJ2 4CDQA 1RHI2 1ND2A 1RUF2 1VBB2 3VBSA 1R1A2 1R1A3 4CEWB 3VBFA 2BUKA 3VBFC 1VBE2 5DDJ3 1ZBE3 1AYN1 2WS93 2R061 3TN93 4WM7A 4BCUA 1NY71 1RUC1 1COV2 1COV3 4PDWA 1R091 5A33A 2RS32 1EV11 1AR62 3VBHA 2VQ0A 1QJX2 4GH4B 4JGZC 5BNOC 1HRI2 3JD71 5K0UC 5C8CC 1QQP2 1R083 5BNOA 3VBSC 3S6PA 1PIV2 2RR11 3LOBA 5BNNB 4RS5C 4Q4Y1 2HWE2 1MQTA 4RFT0 1RVF3 1V9U3 1VBC2 4RR3C 1BMV1 4WM7B 2RS13 4GB32 1PO21 1FMD1 2HWB1 1GFF2 2MEV1 5CFDB 1TME3 5JZGA 3JB4C 1FPN2 1VBD1 3ZFEA 1AYM2 2RS11 2TBVA 4JGZA 4QPGC 1H8TC 5D8AB 1RUE3 3VBUB 1ND3B 1QJU2 1H8TA 1RMU3 1B35B 2RS33 1RUG3 1RUD2 2HWD2 5J98B 1HXS2 1D4M2 3VBOB 4Q4V2 5A32B 4CEYA 1RUH1 4CDUA 5JZGB 3ZFFC 1PGW1 2R042 4CDUC 2WS92 2PLV1 4CEYC 4YVWB 2GH8A 2RM21 4Z92B 1AR81 2XBO2 3VDDC 3NAPB 2R043 1ND3C 1AL21 1HRV1 1MEC1 4JGZB 1BBT1 3ZFGA 4Q4X3 1SMVA 2GSYA 5CFDA 4IV3A 1TMF3 5BNPA 4GMP0 2RS53 1RVF2 1V9U2 1FOD3 2ZZQA 4YVSA 2WZR1 1POV1 1RUI3 5BNPC 1PO23 4JGYB 1ZBA2 2HWC2 2RM23 1AR83 5JZGC 1BEV3 4GMP1 4YVWC 1RUE1 1PVC3 1PO12 1PVC2 2WWSA 3NAPA 4IV1B 1ASJ2 3VBHB 1RB8G 1B35A 3TN91 3VBOA 1RUG1 5C8CB 2R073 1AYN3 1VBA1 1NA1C 4YVSB 1CD3G 1RMU1 5BNPB 4GMP3 5C8CA 4NWWA 3JBG3 5C4WA 4Q4V3 3VBUC 4AEDA 2R062 2WLPA 1C8M1 4FTBA 1QJY1 4QPIC 2R071 3VBRC 1COV1 5L7OC 2WFF3 4Q4X1 2HWF3 1HRI3 3ZFGC 5BNNC 4CDWB 1HRV3 1MEC3 1QQP3 2WFF2 1R081 3JBG1 1VRH3 4Q4W1 1AR92 1EAH3 1NCRA 1NCQC 4RR3B 2RMU2 1VBC3 5C4WB 1QQP1 1DDLA 1POV3 2BFUL 4SBVA 4EJRA 4RHV1 1ND2C 1NOVA 4Y5Z0 1HXS3 1VBE3 5DDJ2 4FSJA 1RUC3 4Q4Y2 1EAH1 4CDWC 2HWF2 1AYM3 1K5MC 2HWE1 1OHFA 1VBC1 4CDQC 3VDDA 1RUJ3 1IHMA 4CDUB 4CEYB 4RR3A 1FMD2 1VB2A 1WCDJ 5GKAC 3J8F2 1Z7S3 1ZBA3 2HWC3 3J8F3 4WM8C 4CDXA 1RUI2 1FOD2 2R063 1POV0 4N43C 4N53A 2FZ2A 1NA1B 3VBRA 5L7OA 1OPOA 5FMOL 4FTSA 1VRH1 5C9AC 2ZTNA 1RUD1 4CDXB 5K0UA 1VBD3 1RUF1 1VBB1 2XBO3 2MEV3 5LK7B 1VB4A 2DF7A 4AEDB 1AL23 4JGYC 1NA1A 5AC93 3VBOC 5AC92 1PGW2 2X5IC 2R041 1PGL2 3ZFFB 2RM22 3DPRB 1BEV2 1QJZA 1RUJ1 1PIV3 1NY72 1RUC2 1MQTB 1RHI1 4Q4Y3 1F8VA 1R1A1 3VDDB 4QPIA 5A32A 3VBFB 4CDXC 2RS31 5BNNA 1ZBE1 3ZFEB 1AR61 1AYN2 2PLV3 2BBVA 1ZBA1 2HWC1 2HWD3 1RHI3 1A6CA 1M06G 5BNOB 5D8AA 1R092 1B35C 1EV12 4RQPC 3TN92 1AR72 1VBA2 1QJU3 1TME2 1HRI1 1ND2B 5FOJB 2XPJA 1HX6A 1TMF2 2X5IA 4PDWB 5CFCB 4GB31 1QJY3 1PO22 1PIV1 1C8M3 3FBMA 5J96B 4N53B 3VBUA 4GH4A 5C4WC 5ACA2 1FMD3 5CFDC 4QPIB 4YVSC 3ZXAC 4AEDC 5C9AA 4IV3B 2HWB3 1BMV2 4Y4YA 1H8TB 2QQPA 1OOPC 2MEV2 4PDWC 2HWE3 3DPRC 1AUYA 4YVWA 2HWD1 1AYM1 1HXS1 4NWVA 1AR63 3CJIA 4LLFA 3ZFGB 3JB8A 4IV1C 4CEWA 1X36A 1QJU1 2RS52 3M8LA 2WS91 4JGYA 2HWF1 1Z7S1 1F2NA 1AR82 1K5MA 1EV13 1NCQB 2ZAHA 1HRV2 1MEC2 1BBT2 1BBT3 2X5IB 1D4M1
chains in the Genus database with same CATH superfamily
1PO13 2WNVA 5CB7A 4OUEA 4CDQB 3NNJA 3ZKUA 1T6GC 3SEEA 4OQ8A 1RUH2 3NNLA 5GLZA 4R9AA 2UY9A 4QQPA 5FQ0B 2WZR2 1VBE1 1XOYA 4YNIA 1A3KA 2D6MA 2PLV2 5FMOS 5FY7A 5FFOC 1FOD1 3FUOA 2RJ2A 2W46A 4XF4A 5EYYA 1ONAA 3O1SA 2E53A 1UMHA 1OLQA 1YFWA 4D94A 2WNUA 3NJYA 3NSTA 5C71A 5JDBA 1OA2A 3KD4A 1NZCA 3HIFA 4RGAA 4RQPA 1AR73 3I2OA 3ACIA 2OS2A 2XQRA 1HQWA 2RJLA 1RVF1 1V9U1 3M3EA 4IEPA 5T52A 3M1HA 1C8NA 2IVJA 4LPLA 2VMGA 4FPYA 1PK6B 5KXCA 5FP8A 3T3YA 5CIRA 3MIEA 4IE4A 4Y1ZA 2AEZA 4QXBA 1W9SA 1GNHA 1GQPA 1PM7A 3U0ZA 3WLUA 3WW1A 4XZPA 2FDHA 2J7MA 4Y3OA 1HV0A 1LAJA 1CN1A 4CDWA 2WN2A 3WNMA 5FXZA 4LA3A 4ZPIA 5CADA 2FD8A 1QOOA 3IMMA 4LULA 4BXFA 2ADDA 1J1TA 2D3SA 2RR12 4BQYA 2DCZA 3H42B 3NJVA 4YG6A 1L3JA 2OPWA 1VAKA 2WNUB 1JN2P 3CHXA 4XF0A 4XMIA 1IQDC 4LO6B 1RTVA 2RMU3 4KWLA 4NPMA 4XBNA 5F37A 4QPGB 5EJZB 2E26A 3JQWA 4YW4A 3BI3A 2WFF1 1WD4A 1R082 1DF0A 5CG9A 4MGKE 4IE6A 1UKGA 3VBRB 2DFBA 1O5LA 2PQSA 1CPMA 1O3QA 4XEZA 3NRUA 2CV6A 4FTEA 1UYYA 3EJKA 2XLAA 4PIZA 2PHUA 4LJHA 4UOJA 4GB33 3ZVXA 4AK3A 1EUUA 4XYXA 1J84A 4UBGA 3JBG2 1Q8OA 2J1RA 4DOUA 5HI0A 1AR71 5KHHA 5A1LA 1AR91 4MHRA 1WLDA 1O91A 1UX6A 1RXGA 1QJX3 2FMDA 3C7EA 5FTTC 3ZXLA 4DY5A 5FPAA 1WCSA 1SCSA 5JIAA 4R9CA 5J1XA 1DGWA 3I2GA 3KCXA 1YFUA 2LM3A 4BISA 5ABJC 3J7HA 2JWPA 3A23A 2WNOA 4DPNA 3ZN5A 5GZGA 3JZVA 3SNMA 2PAEA 2X05A 4AW7A 3SCHA 5ACA1 2NM1A 2VVFA 1UZ0A 1VLNA 2XKPA 3E5QA 5TSWA 4C0HA 1RUH3 1W8NA 1OF3A 3ME2A 4GH4C 5D1IA 5ANNA 3U11A 4JKKA 3OYWB 5FZEA 1X33A 2LUWA 2QQUA 1BZWA 1WMEA 4N43B 2JG8B 2ZA9A 5DAQA 5FZCA 1ULPA 4DUVA 4PHZA 3ZFEC 1GZWA 4H14A 2XUEA 4COVA 5HV4A 1G9AA 3J8F1 4UF0B 4XXAA 2AACA 3HD8B 1DQ6A 3ZYHA 2QTWB 4EV0A 2B9VA 2XUMA 3ZYIB 2HKXA 2FZ1A 4TXWA 2NYYA 5ABJB 5J37A 1W06A 3FE5A 1VBA3 1KGYA 3CZUA 3BCWA 5FBJA 2Z69A 2V4VA 2VTFA 2XG3A 1AXYA 2ZGPA 4KI5M 2ET1A 3RPQA 2EIDA 2G9ZA 2RR13 1NCRC 1RUE2 1XNAA 1OOPA 3DYPA 3WQ0A 2RS51 1S0FA 3N9NA 4UI9L 1RUF3 5FY4A 5GALA 1W2TA 1X82A 1SBDA 3C2UA 3FLRA 3LIGA 1MVQA 1OQ1A 1RITA 1RUJ2 1XJAA 2VVEA 4XURA 3WZ1A 3K2OA 1RHI2 3K3NA 3ZXGA 4H7MA 3VBSA 3VHPA 3MW3A 3ZYPA 3GCXA 1C1FA 4BZ4A 5FYCA 5F6LB 5FAXA 4CEWB 1H8VA 3AC0A 3JQXA 1BLZA 2QQKA 1WMFA 3RGBA 1HB1A 4OUMA 3I3DA 4NROA 3AFGA 4HFSA 1VBE2 3VBFC 3CZJA 2AUYA 2BNNA 4FPFA 1JW6A 3EQEA 5KC6A 1GQHA 2GNMA 3OEAA 4X8PA 5FP7A 2CWMA 3TN93 2QQWA 4XACA 1HJFA 3WP3A 2D97A 4YZ2A 5JVVA 4NRPA 1R091 2PTMA 5A33A 3HJRA 4IEUA 4ITCA 4XJAA 5FZ4A 2BYVE 2VH9A 1W6PA 1UN1A 3LA2A 4PQ9A 1AR62 1YC61 1V00A 3M70A 2SLIA 2JECA 3ZO0B 1LOAA 2J1VA 1QEXA 2Z4FA 4FPKA 4NAOA 2WWJA 1N3PA 5K0UC 3ZMNA 5LATA 3U37A 5BNOA 4XQDA 2VW2A 3TEYA 4QWNA 3WD5A 4B29A 2RR11 5C8WA 1G9BA 4URAA 4Q0VA 1BJQA 4DEVA 1LHNA 4A3ZA 1PK6C 3MEPA 4Q4Y1 3W5MA 2Y6FA 3VL8A 1AJOA 4M0NA 5JI7A 4G4FA 5FZ1A 1S0BA 1LU2A 3O1MA 1RVF3 1V9U3 3R4DB 3I49A 2JD9A 2BDRA 5FLHA 2D43A 4EQVA 4LOSA 3D4KA 1GYKA 4IEQA 5FK7A 4UFMA 4XXPA 1ZM1A 3J7MA 5EWSA 5J48A 1C4RA 2JE8A 1OLME 1WMXA 4HKWA 5FJHA 5A7SA 3WCSA 3RDIA 1GFF2 3KMHA 4Q27A 2A7AA 5T5JA 4XE9A 4EE2A 2XWBB 3UKVA 4UBHA 1KEXA 5FV3A 4BIFA 4WZFA 4BMEA 2W92A 4ZHNA 1W90A 1LOGA 3DKQA 1JZ7A 4BOWA 1G9CA 3THTA 3LDBA 5D8AB 2JKBA 2QNKA 4LORA 1D0GA 1H8TA 2XJPA 4COWA 1CX1A 1RMU3 2FCVA 1I1EA 2BGPA 1RJ8A 5T5LA 3ZXKA 3O1RA 4OULA 4OZOA 2RS33 2WO1A 5DXDA 3EYPA 4Y22B 1SBFA 2UURA 4MZUA 2WRAA 2BNMA 5J3UA 4A42A 1XNBA 2JDMA 1CVNA 3I3BA 4S2FA 4D3WA 2OZJA 4QX1A 5LW9A 1I5PA 3M2MA 3NKTA 1Y9GA 5IFPA 2RVAA 5IK8A 5FP3A 1PGW1 1EY2A 2VC9A 4KBBA 3B3QE 4GZ9A 5FYHA 3W20A 4XDQA 2VUDA 4TTGA 2GH8A 2RM21 4Q0SA 2CL2A 4Y4RA 1Q8SA 4AFDA 4Q5OA 2Q8CA 3WNXA 3ZDSA 2WABA 1AL21 3KSCA 3ZFGA 1EUTA 4Q4X3 4B3NA 4LEJA 4UXAA 5CFDA 3S30A 2PN5A 3L9JT 5BNPA 4FOWA 2JG8C 2RS53 1J3PA 1V0AA 1W2NA 2Y0IA 4TYSA 3RZZA 3ZN6A 5A6QA 4AAXA 1RUI3 5A7WA 4BK4A 4EZHA 3ZMOA 4NIIA 1I9RA 3UGHA 2E51A 4LO4B 1OQEA 3KS7A 3MLKA 1NLQA 4XQ4A 1BEV3 1GWKA 3S57A 4GMP1 5F9TA 5DZGA 3ZYJB 3GZEA 1RUE1 2D5HA 2D40A 1CAVB 2VMDA 1PVC3 4EWDA 2GNBA 3OD0A 4J1WA 2IXKA 3NW4A 4K8RB 1RB8G 1ASJ2 3VBHB 4XUTA 3TN91 2CTVA 2EAKA 1MACA 5IWFA 4AFBA 2FDKA 5E6HA 5I0TA 1JMUB 1NA1C 2W1UA 4C90A 3VDAA 1CD3G 1Y3TA 1JYXA 2AGSA 2BGCA 5FY8A 1MS4A 3HPNA 3JBG3 3I59B 2GMEA 3GHMA 4JQRA 5F2WA 4MLOA 1DP0A 1SCRA 5C4WA 3VBUC 1JUIA 5C5TA 4CU7A 5JXHA 2WLPA 1C8M1 4TSVA 5EYXA 2X53S 3AKTA 3I3QA 4OHWA 2O8OA 1QJY1 5E89A 2NMNA 2YBPA 1BVVA 4HONA 4HANA 4LBMA 5L7OC 1K42A 4LLOA 2YBKA 4N7UA 2GNTA 4PBPA 5CYYA 3UYJA 4M3CB 3MIBA 4EN9B 1HRI3 2ZS6B 3ZFGC 3KQRA 2R7EB 4E4ZA 4YW5A 3DKWA 3O1VA 2H0BA 3WW2A 2YV8A 1TZOA 1SQ4A 3WUCA 2YZ4A 1DU3D 4FP3A 4XBLA 2RMU2 2VZSA 3AMPA 4LOTA 4ES9A 4G9SB 3SISA 3Q8AA 1GZWB 3AL6A 1UQXA 1FNZA 1POV3 4HVRA 3POWA 4AL9A 4BK5A 3ZXJA 1LOFC 2Y8KA 2EIGA 3PUAA 5GZDA 4RHV1 1OF4A 4P9LA 1OLRA 5KHJA 5DDJ2 2OUHA 2E7AA 4Q4Y2 3N9QA 1GWLA 1KJLA 1AYM3 1JUHA 2YU2A 1TE1B 1F31A 4FAHA 3IPVA 1K5MC 3AYDA 1OHFA 1I6XA 1OC1A 1AZDA 1UZZA 1BQPA 4CDQC 1O4ZA 1XYOA 3SMHA 1ODNA 3EO6A 3AP7A 2A70A 3FLPA 3OSDA 5FZDA 3HNBM 2BZDA 5T5PA 5HXMA 5GKAC 1YIFA 4YPJA 3O1TA 4K3UA 1OKOA 4AGGA 1STMA 1QIQA 1CIWA 3KQ4B 1S0JA 3LB9A 4AI9A 2PMWB 4EZ4A 1CAUA 2FHRA 3ACLA 1POV0 2P34A 5E1RA 5FCCA 5JMOA 4FPJA 4DINB 5L7OA 4MSVA 4ZU4A 1F4HA 2VOVA 3N35A 4E2GA 4QXCA 5GZCA 5JPMB 5LBBA 4QKBA 1CZVA 4PIXA 5FMDA 4YYOA 1LTEA 1GNYA 4FTSA 1O8SA 2ZHKA 2C0ZA 2FBEA 5J36A 5A6YA 2J42A 2AREA 2W9XA 2ZTNA 2B7YA 2AR6A 3KV5A 4CDXB 2Y6LA 3OOXA 1QXRA 4QHZA 2VCMA 1VBD3 1RUF1 4YZ4A 3AFKA 1LKNA 4YSFA 1W6QB 2SBAA 3SKJE 4AHYA 2VZQA 1REEA 1NA1A 5AC92 1LOFA 4B1MA 1PGW2 2A6VA 4FBFA 5DUWA 3OGVA 4LMFA 3PHMA 4QHOA 3K4DA 2ADEA 1FI2A 2RM22 3ZFFB 4YM1A 2EIBA 2E63A 3DPRB 3VB9A 1QJZA 1PIV3 4JC1A 4RN5A 4YW3A 2Y0OA 5HCFA 4CDQA 3CJXA 3ASIA 1MVEA 5A6XA 1S2KA 3VD9A 5J09A 1R1A1 3LA3A 5K9YA 3PUHA 3AVSA 3IAPA 2PELA 3PTRB 4QGLA 4CDXC 4CSWA 2RS31 4HKLA 4XFHA 3Q8CA 1ZBE1 3M7AA 1Y4WA 1VJ2A 1VMFA 4NN0A 4IE5A 5DAVA 3ZFEB 1LR5A 2PLV3 5F1RA 2HWD3 1RHI3 2FCUA 3N9MA 2BV4A 5FYIA 1A6CA 3DXTA 5M0TA 3V0AA 4D8MA 1WGPA 2ORZA 2TEPA 3JUUA 4H2AA 3NNGA 3BPSA 1QOSA 2IVIB 2KXLA 4EWEA 5BNOB 5JUVA 4I30A 3W21A 4ZONA 4I2OA 2TNFA 1VRBA 1B35C 1W6PB 3H1WA 4LE3A 4LK7A 4QX2A 1W6QA 5F6KA 3TN92 1FATA 4QU1A 1GOHA 2VULA 4INDA 5IATA 2QQNA 4XDOA 1XC6A 4OHXA 5F3CA 2BNOA 3RRDA 1TME2 5K8SA 5FZKA 1HRI1 3VD7A 4RSUA 1AVBA 5FBZA 2VPVA 2Z42A 2C5DA 2ET7A 4FPCA 4XDPA 3CO2A 2P4EA 4UW3A 2GN7A 4AI1A 4E8CA 3FWEA 5JI9A 1W04A 1LGNA 3POJA 4L8QA 5FPXA 2ZGSA 5A7PA 3WSOA 4MGZE 1UOFA 4FPEA 4KGGA 4XTPA 3RMXA 1SHWB 3WR0A 1QKQA 2XJUA 4QPIB 1F9KA 3ZYBA 3W59A 1JZ2A 4BE3A 3LKJA 2WO7A 5DPNA 1DG6A 4IV3B 1H2NA 3T0DA 3URFA 4MX3A 5H9RA 4XBQA 1H8TB 3WOGA 2Y64A 2C9AA 2Q8OA 2VOWA 4NHKA 3VLBB 5FIXA 2JG9A 1LJ7A 1YO8A 3PUQA 1L7LA 2B46X 2HWD1 2ZX0A 4CU8A 2VZUA 4XVHA 4IEOA 4AI0A 2VZ3A 3MO4A 3MUY1 3CJIA 3MUZ1 3LQCA 3O14A 4HXCA 2P2KA 4LUKA 4I0WB 4QX8A 3ZR5A 2JICA 4NE9A 3ZX7A 3H8OA 2WQ4A 4IW3A 3DXUA 5CVRA 2Z5WA 3GNEA 1Y9QA 1W3XA 2WS91 4MXWA 4PCRA 5KWRA 1N3QA 4XMAA 1LGCA 1G9DA 1DYKA 1NCQB 1WW4A 2A75A 1MEC2 1BBT2 2YFZA 4FT8A 2Y33A 1U5IA 3E6DA 2JIGA 2C1FA 2BFUS 3S7IA 3JCIA 4N43A 2XLGA 4YM0A 1W39A 3HWJA 4URTA 1I5ZA 1O4YA 3WG2A 5GLTA 1U0AA 2O1QA 1UU6A 4P9JA 5FPZA 3OD4A 3WCRA 4GWNA 3CJIB 4QQHA 3BIEA 5F8PA 2Y38A 3SITA 4AFCA 4QMAA 1AF9A 2IC1A 3QACA 3MV11 4RHV3 3MIDA 4XIOA 3VV1A 4Z07A 4GULA 4LIVA 2PFWA 3TYJA 3VDBA 3SH4A 1KS4A 1H9WA 1UY1A 1OI6A 1W6NB 2AH2A 2DCKA 3LFIA 1YJLA 3OGGA 3T2QA 3GALA 3HNMA 2BPA2 3WQ1A 3K75B 1WLTA 4AVCA 2ZGOA 5FYUA 4AR2A 2W47A 4BPZA 4RS5A 1XRUA 2VZPA 3RZMA 1PVXA 3VBSB 5FUNA 2BERA 3USUB 1UY3A 4IGQA 4M3CE 4M3CA 4CU9A 1CAVA 2VTXJ 1YI7A 4LKDA 1KXGA 5BNQA 3JD73 2L9LA 2XXZA 4LNVA 1LHWA 1NT0A 1IZ3A 2VY0A 1RUG2 3OY8A 1KD7A 3WG3A 4FOQA 1R64A 2Q5TA 1FV3A 4N90A 5DAWA 2ZX3A 2Q1ZB 3PMEA 1D4M3 2WWUA 1OLMA 2XJQA 2PXJA 4N9IA 2G9GA 3KVAA 4LA2A 1G8WA 3RSJA 2B9UA 1PK6A 3BTAA 1ZBE2 2IXCA 3K4AA 2V5DA 3MBWA 5GLVA 5JLVA 1JTZX 1WA4A 2P17A 4YGBA 2FQPA 3P6BA 5BPXA 1RGSA 3M3IA 3BUCA 2HBTA 2KM2A 4OLLA 4UW4A 5ANQA 1W8UA 2R072 4IV3C 1ZZ8A 1FPN1 2D3PA 3BU7A 2G9FA 2C24A 3C7FA 4Z82A 1ZZ7A 3HEIA 4Q4W3 1NX9A 5A70A 2YMZA 3LGRA 3VL9A 1AXZA 1OSGA 1W8ZA 1ZVFA 4BQ1A 2VW0A 2BOJA 1DZTA 4PIYA 2P6CA 1HDKA 2X09A 3SQOA 2XL7A 4JZRA 1TNFA 4PLOA 1TME1 3AZVA 3OBZA 4QU2A 5DZFA 1AL0G 1SACA 5F5QA 4YZ5A 2XVLA 1Q56A 1DQ2A 4FFIA 1QHDA 2Y26A 4KGQA 3ZIWA 4Q4V1 3E6BA 3OBRA 2XB6C 4V2VA 4HOOA 3PTYA 1DIWA 2LW8A 1YXWA 3ROUA 2YY1A 5FYSA 1OUSA 1MQTC 5T5OA 4AFAA 1EAH2 2WAAA 3HAGA 1CAXB 1F4AA 1W0OA 1PHMA 2D44A 1SLBA 1GZTA 5A3PA 2JEMA 1UX7A 5CFCA 2GALA 4XC9A 5EFUA 4YM3A 4Z2AA 2GDFA 5IW0A 3CLPA 4UFIA 2QQOA 1GKBA 2D3RA 3QCWA 4FI9A 1YYNA 2HLEA 4M01A 4N53C 3H8UA 3WXPA 1UCXA 4TWTA 3WDWA 4E4HA 3LDRA 1H2MA 3SEPA 4NOTA 3IDCB 3MV01 2WL1A 4XF1A 3HR9A 4WZCA 1NG0A 1QH7A 1HN1A 4O7XA 2IXJA 4IERA 2BVVA 1V6MA 2IZWA 3G6JB 1UMZA 1VRH2 4XW3A 5FPBA 4XJ8A 2UWCA 1VBB3 1X9TA 2DU1A 4Q29A 1BEV1 2A6YA 1RC6A 1O3RA 3WDXA 1N3OA 2JDYA 2PAMA 3NNFA 1OXCA 4P02B 1PM4A 1JYVA 1RUOA 4HN0A 3POGA 2JE7A 4DFSA 3PDQA 4Q8KA 4JHZA 2O8QA 4OHVA 3ITQA 1H0BA 1S0DA 1NXD1 4NHYA 3DCQA 4WM7A 3U4XA 1UPIA 1H9PA 1GU3A 1GICA 2P1BA 4AHWA 1DFQA 2PHFA 2V72A 4PDWA 4XFAA 3CBNA 4GWJA 2OYZA 3BIWE 1FXZA 1H6XA 1V6OA 3ETQA 5A3UA 5FYYA 1BYHA 5DG1A 3FFQA 3VZLA 5CBLA 3P3PA 1ULEA 3LZZA 2QE3A 2VNRA 2A3WA 2RG4A 5JR2A 5I8YA 4JGZC 1N1VA 3VN4A 4FO9A 1UMIA 4S2GA 5C8CC 4M4PA 1QQP2 4Y5SA 3VBSC 2DURA 5FMCA 3S6PA 4CCOA 4BJ0A 1PIV2 4Y1XA 2BJSA 5C3RA 2YBSA 5BNNB 3PU8A 3WNNA 4QM9A 1XSRA 5FWJA 1W8HA 3B94A 4PLMA 4QGNA 4NR1A 2UU8A 4MV2A 5GLWA 3TWIA 4AZZA 2HWE2 1MQTA 2VXRA 3H7JA 3KVBA 4QDQA 1JZ4A 1VBC2 1XQNA 4J1XA 1UO9A 1UXXX 1UL9A 1BMV1 4WM7B 3POYA 4GB32 1PO21 5LRSA 5HCAA 2YC2A 3GBGA 2CGNA 4QKNA 4XTMA 2MEV1 2UY8A 3AMHA 1TME3 4Q1RA 4AXOA 4D6SA 4ZU7A 4WVVA 3MFCA 1FPN2 4P9XA 4XOGA 2GAUA 3IDBB 1QY4A 3N9LA 4NIGA 3H7YA 2JX9A 2JB4A 2WZEA 4QPGC 5A3LA 1ALYA 1ZZ9A 2ZCWA 5LBFA 2F6BA 2W94A 1YFYA 2RV9A 3KT7A 2GZWA 1ZRFA 1B35B 2KD7A 2ZKLA 3DV8A 3RS6A 1W6MB 2DVDA 2CHHA 3T2PA 5J98B 3MF9A 2QDRA 4H7LA 4Q4V2 2D6PA 2WBKA 1JYWA 4C0BA 1QH6A 3ZLIA 2DCJA 3ZFFC 3NNMA 3V65A 5T55A 2R042 3Q8FA 5FY0A 4CDUC 4CEYC 1AR81 1YQ2A 2XBO2 3NAPB 1AX1A 1SLCA 3FZ3A 3M3OA 2PHDA 3VKFC 3N7MA 1J58A 1SMVA 1OA4A 2Q30A 2XVGA 3SC7X 3D5OA 1W8OA 5B4NA 4BMBA 4YVSA 4MUVA 3NV1A 4KWUA 2WZR1 1GANA 1POV1 1PO23 1JOPA 3AL5A 4BQ4A 3U07A 5DZEA 4XETA 1ZBA2 5F5CA 5FPLA 5CU1A 5T3NA 4YZ1A 4Q26A 5IK5A 2V4AA 4GAZA 4Y1UA 3EHKA 1U5YA 3I2FA 5ISLA 2W52A 2LROA 2R16A 1XE8A 4V1PA 3ZYFA 3RZHA 3NAPA 3LIHA 2J1EA 1B35A 2JDKA 3R4SA 3RQ0A 2HEWF 3OUHA 2ZGTA 4COYA 5C8CB 1CESA 2R073 4MGTA 1AYN3 3A4UA 1U5XA 2DFCA 4MGYE 4BWOA 1I3HA 3O5SA 1RL3A 5F3IA 3FC0A 3WP5A 5EJ3A 4E2SA 5F7UA 1XB9A 1S1AA 2C9KA 4OI2A 4YM2A 1SFNA 2BTVC 1UYZA 5BNPB 1GQGA 4LT5A 2XJSA 3LSDA 1TVGA 4NWWA 4QQ2A 5E16A 1ENSA 2QDNA 2XWJB 4QDRA 5DAPA 1UU4A 2ZGNA 4FP2A 5AVPA 5FZFA 3ZPOA 4AEDA 4ES8A 4CXXA 1WLCA 3PJYA 1H4HA 2VG9A 4HPKB 1IKPA 4QPIC 1LHUA 4ASLA 2K46A 3ZN6B 3U1XA 2IUWA 4Q4X1 4P14A 4YFWA 3ST7A 3PVNA 4P5HA 4D7YA 4HK8A 3NMBA 4GQ7A 4HVOA 4CDWB 4AVBA 2GC2A 2JDHA 4CE8A 5DMYA 2WFF2 1B09A 3KV6A 4A45A 3W5NA 1R081 3LDKA 4KNCA 1IS3A 4Q4W1 1EAH3 4AHZA 4MG2A 1OVPA 2VMHA 3J7NA 4RR3B 1PNFA 3RI8A 2EXKA 2DWRA 1MZEA 2YYOA 1GBGA 3KB5A 5C4WB 1QQP1 2BFUL 2WO3A 1XNCA 3IT8A 2GP3A 2GP5A 3LEIA 1ND2C 2R1DA 3IIIA 2HJIA 1V6NA 1VBE3 4QKFA 2FMYA 5CKMA 4BB3A 4AI2A 4CDWC 4D0QA 1A34A 2WDBA 4CXWA 1LRHA 2VQTA 4L92A 2HWE1 3MIFA 3CIHA 4B4RA 4UAPA 1VBC1 5LA9A 4META 4EYUA 4K21A 1S4CA 1NAEA 1OMIA 1O6UA 1YIPA 2A3YA 3DYOA 3IZOA 4I3GA 4ZS3A 1IHMA 1ULDA 5G04L 4RR3A 3WQ7A 1GUIA 4CDUB 4CEYB 4EROA 3R6SA 4O61A 1WCDJ 3FMGA 3UK9A 1ZBA3 3Q8BA 1XE7A 2N7GA 3J8F3 4W50A 2JENA 3D0SA 1RUI2 3TEWA 1HKDA 1PX3A 3EMRA 3RWKX 2P3JA 3LE0A 5FK8A 4BQWA 5FDBA 2R063 4QPYA 5JPNB 4OZXA 2QQVA 4N43C 4N53A 5IVCA 5LCWL 2JG9C 4CPBD 4ZZ8A 4RD7A 2WT0A 3O7OA 5FMOL 3SHRA 1XXNA 3WVJA 2K9ZA 2BRTA 3A7QA 4HLTA 1MS5A 1YWKA 2VJXA 1IG0A 1JHNA 1NKGA 1F5FA 1LOBA 1UZVA 2JB8A 5K0UA 5H9PA 3W9AA 5FRAA 1VBB1 4AQSA 5LK7B 4AQTA 1FNYA 1UXZA 5HCHA 3ORJA 4HK9A 1ACCA 2ZJCA 4KWKA 2D7FA 4BYYA 3P1IA 4JGYC 2EF6A 5AC93 3VBOC 1LU1A 3WP4A 4C8DA 2X5IC 2R041 2XVKA 3ELNA 3GYDA 5L36A 4JTOA 3N9PA 4JRAA 1RUJ1 2ZHNA 3ACGA 4J6GA 2ZGLA 1NY72 5KHGA 1HB4A 1MQTB 1RHI1 1RUC2 3ACFA 5HBAA 2AYHA 4A44A 3VZKA 2YPJA 4QPIA 4D69A 5A32A 3VBFB 3MIHA 5L9RA 2F4PA 1C1LA 1GOFA 4BH9A 1REDA 4K6BA 1W9FA 4A7KA 2K0GA 3WDYA 1XNKA 3CEWA 4LHNA 2ZACA 4O65A 1ZBA1 2H6BA 1TG7A 3ZIXA 1E5HA 2EXJA 4IL7A 5GZFA 3PURA 5C5UA 1YI9A 3C7HA 2G4IA 3ILFA 3ZXDA 2VMIA 4ISRA 5D8AA 1R092 4MGQA 1W2OA 4ZU5A 2R30A 1H1IA 5FO7B 2VQUA 1JBCA 1US3A 2Z2SB 3GM8A 2Q8EA 3LPGA 1WMDA 3WV6A 2WA4A 2I74A 2W95A 4NPRA 2Q1MA 5FYBA 2W0XA 2OQ7A 5LASA 1S55A 1QXPA 1QJU3 1ND2B 1QDOA 5B4XA 5LY2A 1TMF2 3ZSJA 5A6ZA 4LITA 3OGSA 5IT6A 5LA0A 1SFYA 5IUQA 1D7PM 1CR7A 5FKCA 3EB7A 1MS9A 1C8M3 1HQLA 3UGGA 5IVJA 4CU6A 4GH4A 2FDJA 2KA3A 1PNGA 2ZEXA 4IEZA 3HVDA 4ARYA 2ZEWA 1GR3A 5CFDC 5DG2A 2VZVA 3J7LA 3I3MA 2VMCA 1W6MA 1VMJA 3IKWA 4QAWA 2W3JA 1JYNA 1LOEA 2HWB3 4SLIA 4CUGA 3IWZA 4BHPA 1UYPA 3RZKA 4DZGA 4NHLA 3LD8A 2WYSA 4XFGA 4YG3A 5FQ0A 3OCPA 1ZZ6A 4FXGB 2HWE3 4YWAA 1ZRRA 5FUPA 3BOPA 4EN7B 5LA1A 4A7ZA 1HXS1 2VOKA 2E9QA 1AR63 1IPKA 3POEA 4NIAA 4LLFA 4XUQA 2VAUA 3UESA 3ZFGB 3AMNA 1IKQA 4HSLA 4CEWA 1UKRA 3GZTB 5GZEA 3UETA 1JOJA 1X36A 4JGYA 4MOAA 1ZYBA 3KV9A 5FYMA 5EPAA 1ZRDA 1Z7S1 5CNAA 2ZAAA 3A21A 3DYMA 3AZYA 1EV13 1CAXA 1OD5A 4BA6A 2ZAHA 2ZEYA 4NHXA 4B7KA 5C70A 2YXSA 1HRV2 2A6ZA 3FN9A 1ZZCA 4RFRB 1Y43B 2X5IB 3K3OA 2I2SA 5FY1A 3VKMA 2D5FA 1GWMA 3OG2A 2JDAA 1WBLA 4PQQA 1UOBA 4FFGA 1KITA 2C26A 2RE9A 3AXDA 4GJYA 5DABA 3RVHA 3K51A 4DXTA 4QT6A 4FOVA 5C6CA 2VU9A 1RUI1 2QJVA 3RZJA 3T2TA 1PZ7A 4WM8A 1QNWA 2Y60A 2E33A 3CNAA 4YARA 3GCWA 1AL22 2WQ8A 2XHKA 4RL7A 3WW4A 2VCAA 4DMIA 1PO11 2XGXA 4LBQD 1SDWA 1W03A 3POSA 1WZXA 1NLSA 2YDEA 5D8AC 2OKXA 5G05L 1R093 3AP9A 4K9SA 4MHUA 2W2IA 4H55A 2BVBA 3KHCA 4LBQA 3WG1A 4LTAA 5E88A 1CIYA 3FHQA 1RMU2 1HW5A 2Y6GA 4OUSA 4M3CF 4MXWB 1LESA 1TQ5A 2VNVA 3I2HA 2WNEA 2EVXA 5FP9A 1ODMA 1J83A 1W3VA 1ASJ1 3CKHA 3DECA 4AEKA 1S0GA 2VBDA 5JSPA 1H6YA 2VW1A 4CXYA 1RUD3 2UYAA 2ZBJA 4QD2A 2A6WA 4FPGA 5FO9B 3BYWA 3BU0A 5LEKA 2IFWA 5A1AA 4N7IA 4H3WA 1YQ6A 3FFZA 4WM7C 5FJKA 3HQUA 1YHFA 4WM8B 3OY8B 1S2BA 1DGRA 3IB3A 3B7MA 4I01A 2VUJA 5C33A 2HH9A 5JXGA 2ZEZA 4MGSA 5L7OB 1LULA 2ZXQA 1OVSA 2HWB2 1CAUB 2WSUA 3I2DA 1VBD2 4IQPA 4QQOA 4CEWC 5C9AB 2DVBA 5FKBA 2RS12 3RYRA 4D6QA 2BGOA 3NWKA 1W99A 2DBNA 5CAZA 1NE6A 1LODA 2TUNA 2JDNA 5SV5A 1D2QA 1YCIA 4F8AA 1G6NA 3NVCA 1XSQA 1R1ZA 2E6VA 4MXVA 5ABJA 3O0VA 1TMF1 1V6IA 3U10A 1ZZBA 2Q0AA 3RG0A 1KRIA 1SG3A 5EZWA 3H3UA 1HB3A 4UF0A 4XUPA 5LZ6A 5JCTA 3OB8A 5BXXA 1W2UA 3GJBA 4B4QA 1P8JA 5DDJ1 3BODA 3BPZA 4E4SA 2GH2A 1CJDA 4NAMA 1ASJ3 3KV4A 5KBFA 1SEFA 3IAQA 5LB6A 3DGTA 4Q0QA 3H3ZA 5KXEA 5FUIA 3LWCA 5JMCA 2X29A 2JIJA 4R9BA 4R9DA 3B02A 1BK1A 2XDVA 2QQJA 4P5YA 5C3PA 4L2NA 4KBZA 2WC2A 5CKQA 5BUVA 1FPN3 1LEMA 4HN1A 3DPRA 1E57A 1ZNPA 2RDSA 2WZ8A 4I09A 4KU7A 4XJZA 3D6EA 3I2IA 3FJSA 3OYWA 4RQPB 2WZR3 1HIXA 4A3XA 2WLQA 3AKQA 5A33B 1PGL1 4GWIA 1Z7S2 3J26N 4HKOA 5FWEA 1MZFA 2Y6KA 3MHZA 3AP6A 2D6LX 1IS4A 1HQNA 3I7DA 4LK6A 4ZXKA 3MW4A 3OGJA 1RUF2 1EP0A 2QQMA 2ERFA 3A22A 5EP9A 1OFSA 3B00A 1R1A3 1SFPA 3LF7A 1J3QA 3VBFA 1GP4A 2BUKA 4OI4A 4XUNA 3U75A 1XNDA 1AX2A 4ET7A 3HBKA 4YGDA 5CKNA 4EN8B 1JH5A 1ZBE3 1AYN1 1KQRA 4HL0A 2VOXA 2VE1A 3AK0A 1BK0A 4LO8A 1O8PA 4HMZA 1URXA 2G19A 4I0BA 4OMCA 1COV3 3HN3A 1K12A 3AKRA 2ARBA 2NQYA 4FAGA 3C8XA 2XHNA 3KHBA 2RS32 1EV11 4HG6B 4QPWA 3ZYGA 5I8SA 3TNPB 3VBHA 2XKOA 2VQ0A 3HMYA 1O5UA 2GC1A 4GH4B 1O7FA 4AWDA 3CF6E 2ZHLA 5BNOC 4Q1PA 1APNA 3TEZA 3DF0A 2RJKA 1ST8A 1R083 3GXUA 1YJKA 2DUQA 3L2HA 3G7DA 5LK5A 4AEMA 3WF1A 4YW1A 3LA7A 1DZRA 3S5QA 2ARXA 3QBQA 4RS5C 4XPVA 1GZ9A 5J7MA 3BTZA 2FDGA 4JVAA 3VD3A 2BW8A 1CAWB 3KM5A 1POQA 2DBIA 2VZOA 4I3PA 1HJGA 2XLFA 4KL1A 4QX0A 3ZDVA 3WT3A 1BVP1 2ZKNA 3ZOIA 3WP6A 1OFNA 2Q4SA 2HWB1 5JAXA 3VGIA 3U78A 1C3HA 4LBNA 2MHFA 1VBD1 3KZ4C 1AYM2 3VZNA 1UNBA 2VCCA 1DYPA 4I0AA 3GZAA 1QOTA 2RS11 2TBVA 5GLUA 1YQ5A 4JGZA 1H8TC 5T50A 4ZKTB 1IPSA 1SBEA 1PZ9A 1K3IA 4CA9A 1JZ5A 2QQLA 1GLHA 1LHOA 1S0IA 3J9SA 3OBTA 4JTNA 1QJU2 3VBUB 4CVUA 1ULGA 5I0SA 3T4VA 4OHYA 4V2WA 2ZGRA 4PF5A 4CP1A 3DUIA 2PYTA 2P3KA 4JV4A 1D4VB 1RUG3 1W9TA 2O14A 2VMFA 3I3EA 1EPZA 1UF2C 1X8MA 4MO3M 2HWD2 2UWAA 2ZMNA 4FXKB 4COZA 3E1F1 1D4M2 4LE4A 3VBOB 3MLLA 3P5BA 4LHLA 4AFMA 3ZM8A 3WDVA 1X50A 3AMQA 5FZIA 4LUMA 2R1BA 1RUH1 2BQPA 1W9WA 2XH6A 5A32B 3NKGA 4M4RA 5FZGA 2RDQA 1OA3A 2WS92 2PLV1 4YVWB 4KG0A 1E5SA 5L73A 1NLRA 4Z92B 4KG8A 3OUIA 4F7ZA 2ZGKA 3VDDC 3E6CC 4OQ9A 1MEC1 1OBNA 1AJKA 1BBT1 3NV4A 4NIDA 5DUXA 5A7WB 2GSYA 2VUAA 1LNSA 3AB0A 5I93A 3GZUC 4GMP0 4WVMA 4YW2A 1RVF2 1V9U2 1FYUA 2ZZQA 5CG8A 2IXHA 4BM8A 2NLRA 3CQOA 5BNPC 1U12A 2WR9A 2HWC2 2RM23 2Y6HA 5FZHA 3SCFA 3BTXA 4CP0A 4DXSA 1GV9A 3UNPA 4LKEA 2CGOA 4AYUA 2DVGA 5LBCA 4CP2A 5LY1A 4A7YA 4YVWC 2IWGB 4XAAA 2Y34A 3TAYA 1AX0A 1KDMA 4XHXA 5FZ9A 5IHRA 3OPZA 4BDVB 3OTFA 2J1SA 5F3GA 3RYPA 4CUAA 2C4XA 3D82A 3VBOA 1LCLA 5FZ7A 1QF3A 3I54A 4GKXA 1VBA1 3USSA 2YG0A 3Q9OA 4YVSB 2W87A 4UFHA 4EWAA 4AHXA 4GMP3 5FZ6A 2W91A 4W6WA 1MPXA 2AZ5A 1DQ5A 3K77A 3HT1A 1Z78A 3NL1A 5FZBA 4ONUA 4G3YC 1DZQA 4B8EA 1G7YA 2WNVB 4LBKA 5H9QA 5JXIA 2PHLA 4ISQA 2W08A 1W05A 3IN9A 2VR4A 4QX7A 3T08A 3VBRC 2VD7A 3RNSA 4IEYA 3ZSLA 2RDRA 4AEJA 1IGOA 3L2YA 5A3TA 1SZBA 1YNAA 1MEC3 1KFUL 4OYUA 1QQP3 4YZ3A 2HYXA 1W0NA 3ILRA 3JBG1 4AGRA 2YFUA 3RWNA 1VRH3 2WO2A 1AR92 3WG4A 4XJ9A 1QXJA 3DL3A 3KT1A 1NCRA 3OF1A 2D93A 4KU8A 4PT6A 3W58A 4IE0A 2DUOA 2LRPA 2VQAA 1REFA 4N9HA 4IXLA 4UW6A 4BQXA 2BEOA 3ZKYA 4O9GA 4XFCA 3OGRA 4R4ZA 4A6SA 2VOTA 2B42B 3GHNA 4EJRA 2EXIA 1BHGA 2CYFA 1W8WA 2QZ2A 3PVEA 4GWMA 4Y5Z0 5H9SA 5HXVA 4FSJA 1Q43A 3KF3A 1UIJA 2GNDA 1W0PA 4FVVA 3AZZA 1O59A 2BWAA 2B39A 5FREA 4C1XA 2JD4A 2JXAA 1VIWB 3VDDA 4DRRA 1DLLA 2WT1A 3T0AA 2JDUA 3D8CA 2F4LA 1KFXL 3FBYA 3K48A 1VE0A 2ZMKA 4TLFA 3WNPA 1ULCA 1Y7BA 4YFZA 3J8F2 1Z7S3 2HWC3 5IFTA 3E97A 3O12A 3DEMA 4IGPA 1SLAA 2VGDA 4IUGA 2YUEA 1AHSA 1MS1A 2PHTA 1NA1B 2FZ2A 5IYYA 3VBRA 2D98A 4Q2FA 3SLIA 2OZ6A 4Y5TA 1OPOA 5D21A 5DAXA 1YLLA 4CTEA 1BKZA 5EIYB 1GZCA 1A8DA 4I02A 5C9AC 1HV1A 4JHTA 5JXJA 1TEIA 4GXLA 3VKNA 1C57A 2A73B 1YRZA 4ZXEA 1CZTA 1UPSA 2Y6JA 2XBO3 4KH9A 2MEV3 1JYIA 4CZSA 2DF7A 3MDPA 1LOCA 3RMYA 2V09A 1CQ9A 2E32A 2YC0A 3R05A 3C3VA 2J1TA 2ENRA 2W68A 3OEBA 5IK7A 3WW3A 1OUXA 3ZPYA 3IM0A 1OPMA 3ES4A 5HV0A 4AI3A 5JSRA 4P08A 2Q8DA 1BEV2 3MPPG 5DUVA 2NN8A 4Q4Y3 2P3IA 1X7NA 2V73A 2I45A 4L9BA 3H1YA 4JQTA 3VDDB 1VP6A 2P37A 1OH3A 3ES1A 4A2UA 1CGPA 3B9IA 5FY5A 1QNYA 4CCJA 4TN7A 3E5XA 4CCLA 3KGLA 3LSEA 2JG8A 3R4UA 1AR61 1WCQA 2MPFA 3FLTA 1V6LA 3MLJA 1VAMA 4P00B 4C91A 2HWC1 2OVUA 5I8TA 2DUPA 4K40A 4UW5A 2R0HA 5FZAA 3AJYA 1G86A 4PF1A 1DGRN 3FHAA 3ATGA 1YFXA 4P9GA 2IFRA 1V70A 1F15A 3POFA 4XILA 2XOMA 5D2AA 2AENA 3TEXA 4FCAA 2ES3A 1H2KA 4NUBA 4UT5A 2VO5A 3AM2A 1Q8VA 4OMDA 1UOJA 1VR3A 3AKPA 4OVEA 4WV8A 2VECA 4CPBA 3PIGA 5K7PA 5AFEA 2D6KA 2HEVF 2P5BA 1VBA2 1IQAA 3PL0A 1JS9A 1NZIA 1UIKA 2V5YA 4HT1T 1EPWA 1QMJA 2PAKA 2R6QA 4XCAA 3UGFA 4AVSA 1JU4A 1HX6A 2C6SA 1CX4A 4YRDA 2VTXA 2X5IA 1X9PA 3AVRA 3PJQA 2QUOA 4GKYA 1IPJA 1QJY3 4YGEA 5CFCB 2AC1A 3FL7A 4QHBA 1PIV1 2JJ6A 4QQLA 1WW7A 5J96B 2DDUA 3S0MA 3GBFA 3VBUA 5C4WC 1DYOA 3V64A 4E27A 1M4WA 3PVBB 4MYEA 4Y22A 1A78A 2CSGA 3BVCA 3B69A 3UKTA 5AFBA 2MNGA 2VZRA 2DTWA 4QKDA 4LKFA 2DYCA 4PBOA 4LBLA 4YVSC 3B9CA 3V56A 2WUHA 3PNAA 2J1UA 3GJAA 5A3WA 4AEDC 5C9AA 2BP6A 4CYDA 4E2QA 5LEJA 2WKKA 3WDTA 1BMV2 1H1MA 2F17A 2X10A 4QXKA 3NQHA 4BQ3A 4HZFA 2AEYA 3I8TA 2PHXA 4PJYA 4RYDA 3WHUA 1OOPC 2MEV2 2R49A 2WT2A 3KCCA 3LFMA 2H6CA 3UKNA 4PDWC 3WEZA 2WINB 1DGLA 1JI6A 3PU3A 1FX5A 5KR7A 3LEGA 4IE7A 4NWVA 2WIIB 1WUVA 5F32A 2ILMA 3KF5A 3F2ZA 5A7OA 3JB8A 4IV1C 2WN3A 1JHJA 3UJOA 3ENRA 3NV3A 3WF2A 4QB1A 4FPOB 2XL9A 2UYBA 2VBBA 3AMMA 3ECQA 4QDSA 3AX4A 3RFRA 3NJXA 3TNQA 1OURA 1DHKB 2JE9A 2ZGUA 4JDMA 2CGPA 3SKVA 3B01A 4R52A 4RA0A 4UYBA 1O3TA 2VCBA 1O3SA 4AGVA 3PLQA 3QD6A 4XIKA 2QKDA 4IDZA 2D6OX 3AKSA 3KT4A 2HEYF 3AYEA 2WYFA 3PMSA 1NUKA 1ND3A 2EAAA 5FP4A 3ZSMA 3WF3A 2XBO1 5CA6A 5IVBA 1J3RA 2XQXA 4U2AA 3T0BA 2B4KA 4D7SA 3O1OA 4NMIA 5DQ0A 3UJQA 1VMHA 1UZWA 3CU7A 3I59A 2ORXA 4EN0A 4XZUG 1W9YA 2A5ZA 2X8KA 3A0NA 4UFKA 1FAYA 4AQ6A 3Q8EA 5JIUA 1NCRB 4PLNA 2HBUA 1ZREA 1AXKA 3CDZB 4S2DA 1OH4A 4XQWA 4QPGA 5FYTA 4L11A 1QJX1 2EIEA 1JYCA 3ALQA 3JD72 3OJBA 4Y24A 3VBHC 3AJZA 3THPA 3U14A 1UYXA 1UOGA 2WFPA 4Z8BA 3RJRA 4LBOA 1GMMA 3R0RA 2YC4A 1C8M2 2OXBA 1K5MB 1UY2A 3MF6A 3USUA 5ACA3 3APBA 1QJY2 3WNOA 4RGGA 4XCBA 1D2SA 2QZ3A 1CWPA 3MYXA 3O0WA 4Y1YA 5KC5A 1QGLA 1X8EA 4OHZA 4BXSV 5A80A 1D0HA 4AF9A 5FYZA 1YQCA 2VL4A 4ATEA 1XU2A 3VZJA 3JU9A 1RINA 5GM0A 4QX3A 2UWBA 1GP6A 3M3CA 2PHWA 2RHPA 4ZY9A 2RMU1 5SV8A 5EJ1B 2VUCA 3OBAA 4Q4X2 2WJSA 3VZMA 2G1MA 2B8MA 1ULFA 4MVTA 1YQ8A 4W8JA 4ZZ5A 2JDZA 1NQJA 3LOIA 4OI1A 1Z0HA 2W1QA 2E31A 1WWYA 2VNGA 4N8MA 4RHV2 1V6JA 3J4UH 1W2AX 3PIJA 5CZKA 3AYAA 1MZ5A 1NCQA 3THCA 4DQAA 5K0UB 4FFFA 2XR4A 4Q0UA 4IV1A 4Q4W2 5FO8B 1OKQA 2O0OA 1PX4A 4W4ZA 2EICA 1J59A 2CAVA 3N36A 4ORFA 2IXIA 4CP9B 5JOXA 2A6XA 4IEWA 2CDPA 4RGKA 1XYPA 1WLWA 3T1LA 4NHMA 1RJ7A 3LEMA 1E5RA 2OX0A 2ZGQA 1GNZA 4FQZA 2R32A 5E8AA 3ZFFA 3NJZA 1RYYA 1AR93 2A1XA 2WSVA 4AOCA 3KWVA 3N4MA 2P3YA 3N3HA 4K20A 3ZXFA 4JX0A 3INAA 1XYNA 3BGAA 5FZMA 1RXFA 3M4FA 4NRMA 4QGMA 2WNVC 3UL2A 2DTYA 1UAIA 2GN3A 2W5FA 4OI0A 1YUDA 4C1WA 5CISA 1XPWA 1E5IA 1DQ4A 3IMNA 4XUOA 1NYWA 2QQIA 2YGLA 4FOYA 3ZSKA 5IVEA 4GIQA 5CFCC 1N47A 3GF6A 3H8RA 4RS5B 4YW7A 2BOIA 4K7JA 2WNUC 4NPLA 4JKMA 1LEDA 2OW4A 1OOPB 1OT5A 1KDKA 2ID4A 2ZX2A 3WX5A 3ILNA 2ZOEB 3IPVB 5F3EA 5FZ0A 5FOBB 5AC91 1F5JA 3CJIC 2YU1A 1QJEA 3NAPC 3T09A 1WA6X 3VUOA 1PVC1 1IS6A 5FMBA 2DCTA 3IDEA 4QB6A 4XJWA 3KGZA 2VM9A 1G9FA 1S2EA 5ERLA 2LTNA 2ZZJA 1ND2A 2ETEA 1NQDA 1VBB2 3CMGA 1R1A2 4IESA 5FY9A 4HSJA 4AAPA 1JU3A 4BU2A 1CAWA 1ZRCA 3K46A 2PA7A 5DUUA 4PI0A 5DDJ3 5FXVA 5IVFA 2WS93 1T2XA 3N9OA 1DBNA 2R061 2GU9A 1NXMA 3MW2A 4FPHA 5IJRA 4BCUA 1F35A 1NY71 3AZWA 5A3NA 1RUC1 3I2KA 1COV2 2ZMLA 1EYBA 5EHDA 2GMMA 3KLSA 4UWDA 5FZ8A 2WZPP 4DY3A 1GP5A 4IETA 1QWRA 1YEWA 5JOWA 4YW6A 5F5IA 3H1MA 3M3QA 3AZXA 4Q0PA 1UY4A 3X29B 2JG9B 5HCBA 2FDIA 2ARCA 4Y20B 4DUXA 1W8FA 2FDFA 1MZ6A 2EALA 4NRQA 2XJRA 4M00A 4BQ5A 4GD4A 1QJX2 4AVTA 4Z1VA 5FR3A 2EA7A 1HLCA 1HRI2 4WBBA 3JD71 1UY0A 2ZX1A 4DRVA 4IEVA 2NMOA 3V0BB 1DQ0A 2VMEA 4E8DA 1N1YA 4YGCA 3LPFA 3GBWA 3LOBA 1MR5A 4XFFA 5K4LA 3AYCA 3N7JA 4HVQA 5L19A 2BWCA 4CCMA 1Y9MA 4LHSA 1JODA 3B5LB 1XU1A 4ATFA 4XAEA 3E5UA 4U36A 3ETPA 5FZOB 5KXDA 4RFT0 4B1LA 2FCTA 5KHIA 4RR3C 2XMLA 4AI8A 2OQ6A 1TNRA 2QCSB 2RS13 3DN7A 2XONA 4R8HA 3SH3A 1CONA 3RZGA 1FMD1 4HETA 3AXEA 4JAAA 4WVMB 1S0EA 3SH5A 4OCTA 5BY5A 5KHKA 1JOBA 1IS5A 5CFDB 3N7LA 3IIAA 1JZ6A 5JZGA 2Q1FA 3JB4C 5F5AA 4LO7A 4A6OA 3ZFEA 4DIQA 1LECA 2A3XA 3GDBA 3SXWA 2ARAA 1SPPA 2DVFA 2I07B 4B7EA 3V0AB 2DV9A 4XFBA 1SLLA 1RUE3 1KJRA 3PVOA 4Y33A 5JSOA 5IK4A 1ND3B 3BN6A 5FLIA 4JDNA 1LB2A 1QJFA 1PZ8A 5B2GB 4TZDA 3U4SA 4IEXA 1RUD2 4LO5B 4UFLA 1UU5A 1JZ3A 3VZOA 1LENA 1HXS2 1Q5OA 1PGSA 4W65A 4DXRA 3A0KA 4CEYA 4CDUA 1IOAA 3WF4A 3HN1A 5JZGB 2NP0A 2ZX4A 3WDUA 4COUA 3LAGA 3AP5A 2H0VA 2RDNA 2QFEA 1Q8PA 2WAOA 3FUQA 2R043 1ND3C 1HRV1 4JGZB 1QU0A 4QM8A 4E4DX 4XJUA 3FX3A 2HYKA 3KCYA 2GC3A 5FLJA 1OD3A 1OQDA 5KXBA 4IV3A 4GALA 1HN0A 1TMF3 4FPLA 4DO0A 2OA2A 1FOD3 1H1AA 5BYNA 4KWJA 1MS0A 3VKLA 4JGYB 1ZRIA 2VVDA 3NV2A 2A71A 3VHRA 5A7NA 1AR83 3P3NA 3UT0A 5JZGC 1CJPA 3H50A 3D0JA 1W6OA 5LBEA 1UWWA 5A3MA 3POIA 1DQ1A 2B45X 4W6YA 3I2JA 1MS3A 2BBAA 1BXHA 3I4IA 5F39A 1PO12 1PVC2 1T6BX 2GC0A 2WWSA 4IV1B 2CY6A 3OPWA 4F3JA 2CNAA 1VAVA 5IVVA 1RUG1 2CDOA 1FT9A 1ZA7A 3QH7A 3RI9A 4CUBA 5FPUA 5A1FA 1O4TA 3BALA 5AVAA 3VHOA 3WQBA 5LWBA 4AQ2A 1H2LA 1WD3A 5FZLA 3T30A 3ZXEA 1RMU1 3OPTA 3EXUA 4HPKA 3PUIA 5C8CA 4XF9A 2JDPA 3MGUA 3TB0A 2W1WA 4JKLA 1C5IA 4Q4V3 1C5HA 5APAA 4DB5A 4JCKA 2R062 5HPOA 4L97A 2LALA 3MI8A 3WHTA 1WW6A 2OIIA 4FTBA 1FV2A 4QXHA 2QVSB 5IVYA 2R071 2YROA 4K8FA 1COV1 5FYVA 2WFF3 4Z2WA 3VD5A 2HWF3 2B5HA 4LIUA 5LRRA 3O1UA 3N7KA 5BNNC 2CAUA 3F95A 1HRV3 5DN2A 3WF0A 3S7EA 3VKOA 4LKSA 3MPBA 4Q8LA 5F2SA 3T1MA 1W6OB 3OUJA 4MADA 4CUCA 1NCQC 2ZABA 4BIOA 4L0PA 3WUDA 2ZHMA 4CCKA 3BOWA 5JOZA 1VBC3 1CPNA 4WVWA 5EQUA 3C7OA 2NZ9A 1DDLA 1CZSA 5I0DA 1GOGA 4X6RB 4SBVA 4F83A 1K45A 1UW8A 1NOVA 1HB2A 3VD4A 1HXS3 4P9IA 1IG3A 5JWPA 1XNTA 5CEHA 1RUC3 4NVPA 4P9YA 1EAH1 2HWF2 3HOBA 3WNKA 1H4GA 3CL1A 1Q8QA 4TLGA 4FFHA 3ABZA 4BQ2A 5I0UA 2CWSA 5EXOA 4ASMB 5I91A 1J1LA 3H0OA 2DU0A 4GA9A 4A4AA 2YB7A 4S2HA 1RUJ3 1N1TA 4NIHA 3H9AA 3PUSA 1FMD2 3H3LA 1VB2A 1VPHA 1ENXA 1PMHX 1UZYA 4JRLA 4O9EA 4WM8C 5L9BA 4CDXA 2E7TA 4CCCA 5IAXA 1A8MA 4M0HA 4QX5A 3WY6A 3QOPA 3IBMA 1SPPB 1K5JA 1FOD2 4W6XA 4JDOA 1US2A 5C3SA 5LA2A 5T54A 4LBJA 1DLCA 3ACHA 1Q3EA 4EN6B 1L7QA 4LHKA 3S5AA 1VRH1 4DUWA 2PQQA 2EXHA 2NPIA 3GGLA 3K4ZA 1L7RA 3QH6A 5A3OA 1RUD1 2KR2A 5FPVA 1JYTA 1XE0A 3HQXA 1H30A 4MH0E 4B4PA 1C28A 1NE4A 3ZR6A 1XBFA 3HT2A 1VB4A 3I97A 5EV7A 4BLIA 4AEDB 1AL23 4Y26A 3O0XA 2Z79A 5FXXA 3T2OA 1UD1A 2GMPA 3POBA 5I0RA 4A41A 4QB2A 5JOYA 4X8NA 2J1AA 1PGL2 2XJTA 3NO8A 4AVAA 4AVVA 3RZLA 2DVAA 1LHVA 4D6RA 2R0FA 3RYKA 1ENRA 2BU9A 2OUJA 5GJ6A 3VDCA 2J22A 4LQRA 5FZOA 3H8XA 1F8VA 2WA3A 1ENQA 5C7GA 4R4XA 1WKYA 3D3AA 4CCDA 2ATFA 2YHJA 1SLTA 4DNYA 1BCXA 1WCUA 3V0BA 1WW5A 5BNNA 3EBRA 1LGBA 2VXJA 2YPDA 4ARXA 1KS5A 2WQZC 1AYN2 2YGMA 1N1SA 3BB6A 4NJ4A 3IDAA 2BBVA 4XFIA 1ZA4A 5A7QA 4KQ7A 2ZGMA 3TRSB 4CCNA 3JXSA 4YLZA 3ZYRA 4IGOA 4CP9A 2IXLA 5C3QA 1M06G 4WVZA 2VZTA 4LXLA 3BKZA 3FHIB 2VBPA 3WINE 5BV6A 2K2SA 1PMIA 1S0CA 1EV12 2CU5A 4J25A 4RQPC 4Y20A 3UV9A 3BTYA 1AR72 2ZPXA 4AG4A 4P9WA 2JKXA 5IAVA 4LR4A 4BLJA 4DEQA 5FOJB 4X6QB 2XPJA 5FZ3A 5FXWA 1RUNA 4PDWB 4LBQB 3TBDA 4GB31 1PO22 1DGWX 2VNOA 2W39A 3FBMA 1SDDB 1ULOA 4K1YA 4ZS2A 4N53B 2PHRA 1U5ZA 3C7GA 4FQ4A 4GJZA 5ACA2 3HNYM 1FMD3 5L9VA 4CCEA 3LEKA 4CRQA 4MGIE 2QBXA 4Y1VA 3ZXAC 4K1ZA 3QLQA 4OFGA 4KMQA 1PMJX 4L99A 1JXNA 4Y4YA 3WNLA 1W28A 4AE2A 1RIRA 3HBZA 2P6HA 1GSLA 2QQPA 3MZHA 1W8TA 2XJVA 3MFAA 3MICA 2E7QA 3DPRC 1AUYA 4XHBA 3HQRA 4YVWA 3ON7A 3ZN4A 4PI2A 3O1PA 1AYM1 1ZX5A 2OT7A 3TOJA 2OPKA 1JZ8A 3LCPA 3ZSEA 1QDCA 4HBNA 5C3OA 2VZ1A 3T4HB 1DCSA 4YG0A 4DS0A 4E9KA 3MIGA 4XF3A 2DCYA 3RJ2X 3AP4A 4DXZA 1QJU1 2D6NA 4NO4A 1WCKA 2RS52 1VALA 3M8LA 5JR7B 3THDA 2HWF1 4ASKA 1F2NA 1AR82 1K5MA 3B93A 4D7TA 1V6KA 2LS6A 1WBFA 2W1SA 4XABA 1W6NA 1MS8A 1SLIA 4UFJA 3VHNA 3SCGA 1BBT3 1D4M1
chains in the Genus database with same CATH topology
1PO13 2WNVA 5CB7A 4CDQB 1T6GC 1RUH2 5GLZA 4R9AA 2UY9A 4QQPA 5FQ0B 2WZR2 1VBE1 4YNIA 1A3KA 2D6MA 2PLV2 5FMOS 5FFOC 1FOD1 3FUOA 4XF4A 5EYYA 1ONAA 2E53A 1OLQA 1YFWA 4D94A 2WNUA 3NSTA 5JDBA 1OA2A 3KD4A 1NZCA 3HIFA 4RGAA 4RQPA 1AR73 4LT5A 3M3EA 1HQWA 2RJLA 1RVF1 1V9U1 4IEPA 5T52A 3M1HA 1C8NA 2VMGA 4FPYA 1PK6B 5KXCA 5CIRA 3MIEA 4Y1ZA 1GNHA 1PM7A 3U0ZA 3WLUA 3WW1A 4XZPA 1HV0A 1CN1A 4CDWA 4LA3A 5CADA 1QOOA 4LULA 1J1TA 2D3SA 2RR12 2DCZA 4YG6A 1L3JA 1VAKA 2WNUB 1JN2P 4XF0A 4XMIA 4LO6B 1RTVA 2RMU3 4KWLA 4XBNA 4QPGB 3JQWA 4YW4A 2WFF1 1WD4A 1R082 1DF0A 5CG9A 4MGKE 1UKGA 3VBRB 2DFBA 1O5LA 1CPMA 1O3QA 4XEZA 2CV6A 4FTEA 3EJKA 2XLAA 4PIZA 2PHUA 4GB33 3ZVXA 4AK3A 4XYXA 4UBGA 3JBG2 1Q8OA 4DOUA 5HI0A 1AR71 5KHHA 1AR91 1WLDA 1O91A 1UX6A 1QJX3 2FMDA 5FTTC 3ZXLA 4DY5A 1WCSA 1SCSA 5JIAA 4R9CA 1DGWA 3KCXA 1YFUA 2LM3A 5ABJC 4DPNA 3ZN5A 5GZGA 3JZVA 3SNMA 2PAEA 4AW7A 3SCHA 5ACA1 2NM1A 2VVFA 1VLNA 2XKPA 3E5QA 5TSWA 4C0HA 1RUH3 4GH4C 3ME2A 3U11A 5D1IA 3OYWB 1X33A 2LUWA 1BZWA 1WMEA 4N43B 2JG8B 2ZA9A 3ZFEC 1GZWA 4H14A 4COVA 1G9AA 3J8F1 4XXAA 3HD8B 1DQ6A 4EV0A 2XUMA 3ZYIB 2HKXA 2FZ1A 5ABJB 2NYYA 5J37A 3FE5A 1VBA3 3BCWA 2Z69A 2XG3A 2ZGPA 1AXYA 2ET1A 3RPQA 2RR13 1NCRC 1RUE2 1OOPA 3WQ0A 2RS51 1S0FA 1RUF3 5GALA 1X82A 1SBDA 3C2UA 3FLRA 1MVQA 1OQ1A 1RITA 1RUJ2 3ZXGA 2VVEA 4CDQA 3WZ1A 1RHI2 4H7MA 3VBSA 3VHPA 3MW3A 3ZYPA 1C1FA 4BZ4A 4CEWB 5F6LB 5FAXA 1H8VA 3JQXA 1WMFA 4OUMA 3AFGA 4HFSA 1VBE2 3VBFC 2AUYA 2BNNA 4FPFA 1JW6A 3EQEA 5KC6A 1GQHA 2GNMA 4X8PA 3TN93 2CWMA 3WP3A 2D97A 5JVVA 1R091 2PTMA 5A33A 4IEUA 4ITCA 4XJAA 2BYVE 2VH9A 1W6PA 1UN1A 3LA2A 4PQ9A 1AR62 1V00A 3M70A 2SLIA 2JECA 3ZO0B 1LOAA 4FPKA 1N3PA 5K0UC 3ZMNA 5BNOA 4XQDA 2VW2A 3WD5A 4B29A 2RR11 5C8WA 1G9BA 4Q0VA 1BJQA 1LHNA 1PK6C 3MEPA 4Q4Y1 3VL8A 1AJOA 4M0NA 5JI7A 4G4FA 1S0BA 1LU2A 1RVF3 1V9U3 3R4DB 5FLHA 2D43A 3D4KA 1GYKA 4IEQA 4XXPA 1ZM1A 5EWSA 5J48A 1C4RA 4HKWA 3WCSA 3RDIA 1GFF2 3KMHA 4Q27A 2A7AA 5T5JA 4XE9A 2XWBB 3UKVA 4UBHA 4BMEA 4BIFA 4WZFA 1LOGA 4BOWA 1G9CA 3THTA 5D8AB 2JKBA 2QNKA 1D0GA 1H8TA 2XJPA 4COWA 1RMU3 1I1EA 1RJ8A 5T5LA 3ZXKA 4OULA 2RS33 5DXDA 4Y22B 1SBFA 2UURA 4MZUA 2BNMA 5J3UA 1XNBA 1CVNA 4S2FA 4D3WA 2OZJA 3M2MA 3NKTA 5IK8A 1PGW1 1EY2A 4KBBA 3B3QE 4XDQA 2GH8A 2RM21 4Q0SA 2CL2A 4AFDA 1Q8SA 3WNXA 3ZDSA 1AL21 3KSCA 3ZFGA 4Q4X3 4B3NA 4LEJA 4UXAA 5CFDA 3S30A 2PN5A 3L9JT 5BNPA 4FOWA 2JG8C 2RS53 1J3PA 3RZZA 2Y0IA 3ZN6A 4TYSA 1RUI3 3ZMOA 1I9RA 2E51A 4LO4B 1OQEA 3KS7A 3MLKA 4XQ4A 1BEV3 4GMP1 5F9TA 5DZGA 3ZYJB 1RUE1 2D5HA 1CAVB 2D40A 4EWDA 1PVC3 2GNBA 3OD0A 4J1WA 2IXKA 3NW4A 1RB8G 1ASJ2 3VBHB 3TN91 2CTVA 2EAKA 1MACA 4AFBA 5I0TA 1NA1C 4C90A 1CD3G 1Y3TA 2AGSA 2BGCA 1MS4A 3JBG3 3I59B 2GMEA 3GHMA 4JQRA 4MLOA 1SCRA 5C4WA 3VBUC 1JUIA 2WLPA 1C8M1 4TSVA 5EYXA 2X53S 3AKTA 4OHWA 2O8OA 1QJY1 5E89A 2NMNA 1BVVA 4HANA 4LBMA 5L7OC 4LLOA 4N7UA 4PBPA 2GNTA 4EN9B 4M3CB 3MIBA 1HRI3 2ZS6B 3ZFGC 3KQRA 4E4ZA 4YW5A 3DKWA 2H0BA 3WW2A 2YV8A 1SQ4A 3WUCA 2YZ4A 1DU3D 4FP3A 4XBLA 2RMU2 3AMPA 4ES9A 4G9SB 3SISA 1GZWB 1FNZA 1POV3 4HVRA 3POWA 3ZXJA 1LOFC 2EIGA 5GZDA 4RHV1 4P9LA 1OLRA 5KHJA 5DDJ2 2OUHA 2E7AA 4Q4Y2 1KJLA 1AYM3 1JUHA 4FAHA 1TE1B 1F31A 3IPVA 1K5MC 3AYDA 1OHFA 1I6XA 1AZDA 1UZZA 1BQPA 4CDQC 1O4ZA 1XYOA 3SMHA 3EO6A 3AP7A 2A70A 3FLPA 5T5PA 5GKAC 1YIFA 4K3UA 4AGGA 1CIWA 1S0JA 3LB9A 1CAUA 2FHRA 3ACLA 1POV0 2P34A 5E1RA 5FCCA 4FPJA 4DINB 5L7OA 4MSVA 4ZU4A 2VOVA 3N35A 4E2GA 5GZCA 5JPMB 4PIXA 4YYOA 1LTEA 4FTSA 2ZHKA 2C0ZA 2FBEA 5J36A 2AREA 2ZTNA 2B7YA 2AR6A 4CDXB 1QXRA 4YZ4A 1VBD3 1RUF1 3AFKA 1LKNA 4YSFA 1W6QB 2SBAA 4AHYA 1REEA 1NA1A 5AC92 1LOFA 1PGW2 2A6VA 4FBFA 5DUWA 3PHMA 1FI2A 2RM22 3ZFFB 4YM1A 2E63A 3DPRB 1QJZA 1PIV3 4JC1A 5HCFA 4YW3A 2Y0OA 3CJXA 3ASIA 1MVEA 1S2KA 5J09A 1R1A1 3LA3A 5K9YA 2PELA 4QGLA 4CDXC 2RS31 4HKLA 4XFHA 1ZBE1 3M7AA 1VJ2A 4NN0A 3ZFEB 1LR5A 2PLV3 5F1RA 2HWD3 1RHI3 1A6CA 3V0AA 1WGPA 2TEPA 3JUUA 1QOSA 2KXLA 4EWEA 5BNOB 4I30A 4I2OA 2TNFA 4LE3A 1B35C 1W6PB 3H1WA 1W6QA 5F6KA 3TN92 1FATA 2VULA 4INDA 4OHXA 2BNOA 3RRDA 1TME2 5K8SA 1HRI1 4RSUA 1AVBA 5FBZA 2VPVA 2Z42A 2C5DA 2ET7A 4FPCA 3CO2A 4UW3A 2GN7A 4AI1A 3FWEA 5JI9A 1LGNA 4L8QA 5FPXA 2ZGSA 4MGZE 4XTPA 4FPEA 4KGGA 3RMXA 3WR0A 1QKQA 2XJUA 4QPIB 1F9KA 3W59A 4BE3A 3LKJA 1DG6A 4IV3B 1H2NA 3URFA 4MX3A 5H9RA 4XBQA 1H8TB 3WOGA 2C9AA 2Q8OA 2VOWA 4NHKA 3VLBB 2JG9A 1LJ7A 1YO8A 2B46X 2HWD1 2ZX0A 4AI0A 4IEOA 4LUKA 3CJIA 3O14A 2P2KA 4I0WB 2JICA 3ZX7A 2WQ4A 5CVRA 2Z5WA 3GNEA 1Y9QA 2WS91 4MXWA 4PCRA 5KWRA 1N3QA 4XMAA 1LGCA 1G9DA 1DYKA 1NCQB 1WW4A 2A75A 1MEC2 1BBT2 4FT8A 1U5IA 3E6DA 2C1FA 2BFUS 3S7IA 3JCIA 4N43A 2XLGA 4YM0A 1W39A 3HWJA 4URTA 1I5ZA 1O4YA 3WG2A 5GLTA 1U0AA 2O1QA 1UU6A 4P9JA 5FPZA 3OD4A 3WCRA 4GWNA 3CJIB 4QQHA 2Y38A 3SITA 4AFCA 4QMAA 1AF9A 2IC1A 3QACA 4RHV3 3MIDA 4XIOA 3VV1A 4Z07A 4GULA 3TYJA 2PFWA 3SH4A 1KS4A 1H9WA 1OI6A 1W6NB 2AH2A 2DCKA 3OGGA 1YJLA 2BPA2 3GALA 3WQ1A 1WLTA 4AVCA 2ZGOA 4BPZA 4RS5A 1XRUA 1PVXA 3VBSB 3USUB 4M3CE 4M3CA 1CAVA 1YI7A 1KXGA 5BNQA 3JD73 4LNVA 1LHWA 1IZ3A 2VY0A 1RUG2 3OY8A 1KD7A 3WG3A 4FOQA 2Q5TA 1FV3A 4N90A 2ZX3A 2Q1ZB 3PMEA 1D4M3 2XJQA 4N9IA 2G9GA 4LA2A 1G8WA 3RSJA 2B9UA 1PK6A 3BTAA 1ZBE2 2IXCA 5GLVA 5JLVA 1JTZX 1WA4A 2P17A 4YGBA 2FQPA 5BPXA 1RGSA 3M3IA 2KM2A 4OLLA 4UW4A 2R072 4IV3C 1ZZ8A 1FPN1 2D3PA 3BU7A 2G9FA 4Z82A 1ZZ7A 4Q4W3 2YMZA 3LGRA 3VL9A 1AXZA 1OSGA 1ZVFA 4BQ1A 2VW0A 1DZTA 4PIYA 1HDKA 2XL7A 1TNFA 4PLOA 1TME1 3AZVA 4QU2A 5DZFA 1AL0G 1SACA 5F5QA 4YZ5A 2XVLA 1Q56A 1DQ2A 1QHDA 2Y26A 4KGQA 3ZIWA 4Q4V1 3E6BA 3OBRA 2XB6C 3PTYA 1DIWA 3ROUA 1YXWA 2YY1A 1MQTC 5T5OA 4AFAA 1EAH2 3HAGA 1CAXB 1W0OA 1PHMA 2D44A 1SLBA 2JEMA 5CFCA 2GALA 5EFUA 4YM3A 2GDFA 3CLPA 1GKBA 2D3RA 3QCWA 1YYNA 4M01A 4N53C 3H8UA 3WXPA 1UCXA 4TWTA 3WDWA 1H2MA 4NOTA 3IDCB 2WL1A 4XF1A 3HR9A 4WZCA 1NG0A 1QH7A 2IXJA 4IERA 2BVVA 1V6MA 2IZWA 3G6JB 1UMZA 1VRH2 4XW3A 4XJ8A 2UWCA 1VBB3 2DU1A 4Q29A 1BEV1 2A6YA 1RC6A 1O3RA 3WDXA 1N3OA 2PAMA 1RUOA 4HN0A 2JE7A 4DFSA 4Q8KA 2O8QA 4OHVA 1H0BA 1S0DA 1NXD1 4WM7A 3U4XA 1UPIA 1H9PA 1GICA 4AHWA 1DFQA 2PHFA 4PDWA 4XFAA 2OYZA 3BIWE 1FXZA 1V6OA 3ETQA 1BYHA 5DG1A 3FFQA 3VZLA 5CBLA 3P3PA 1ULEA 3LZZA 2QE3A 2VNRA 2A3WA 5I8YA 4JGZC 1N1VA 3VN4A 4FO9A 4S2GA 5C8CC 1QQP2 3VBSC 2DURA 3S6PA 1PIV2 4Y1XA 5BNNB 4QM9A 3B94A 4PLMA 4QGNA 4NR1A 2UU8A 4MV2A 5GLWA 3TWIA 2HWE2 1MQTA 2VXRA 3H7JA 1VBC2 1XQNA 4J1XA 1UL9A 1BMV1 4WM7B 3POYA 4GB32 1PO21 5LRSA 5HCAA 3GBGA 2CGNA 4XTMA 2MEV1 2UY8A 3AMHA 1TME3 4Q1RA 4AXOA 4ZU7A 4WVVA 3MFCA 1FPN2 4P9XA 4XOGA 2GAUA 3IDBB 1QY4A 3H7YA 2JX9A 5A3LA 4QPGC 1ALYA 1ZZ9A 2ZCWA 2F6BA 1YFYA 3KT7A 2GZWA 1ZRFA 1B35B 2ZKLA 3DV8A 3RS6A 1W6MB 2DVDA 5J98B 3MF9A 2QDRA 4H7LA 4Q4V2 2D6PA 4C0BA 1QH6A 2DCJA 3ZFFC 3V65A 5T55A 2R042 4CDUC 4CEYC 1AR81 2XBO2 3NAPB 1AX1A 1SLCA 3FZ3A 3M3OA 2PHDA 3VKFC 3N7MA 1J58A 1SMVA 1OA4A 2Q30A 2XVGA 3D5OA 4BMBA 4YVSA 4MUVA 3NV1A 2WZR1 1GANA 1POV1 1PO23 3U07A 5DZEA 4XETA 1ZBA2 5CU1A 5T3NA 4YZ1A 4Q26A 5IK5A 4Y1UA 3EHKA 1U5YA 2W52A 2R16A 1XE8A 4V1PA 3NAPA 1B35A 3R4SA 3RQ0A 4COYA 2HEWF 2ZGTA 5C8CB 1CESA 2R073 1AYN3 3A4UA 1U5XA 2DFCA 4MGYE 4BWOA 1I3HA 3O5SA 1RL3A 4E2SA 3FC0A 3WP5A 5EJ3A 1S1AA 4YM2A 4OI2A 5BNPB 1SFNA 2BTVC 1GQGA 2XJSA 3LSDA 4NWWA 4QQ2A 5E16A 1ENSA 2QDNA 2XWJB 5AVPA 1UU4A 2ZGNA 4FP2A 4AEDA 4ES8A 1WLCA 3PJYA 1H4HA 2VG9A 4HPKB 1IKPA 4QPIC 1LHUA 4ASLA 3ZN6B 4YFWA 4Q4X1 4P14A 3ST7A 4D7YA 3PVNA 4P5HA 4HK8A 4GQ7A 4HVOA 4CDWB 4AVBA 2GC2A 2WFF2 1B09A 1R081 4KNCA 1IS3A 4Q4W1 1EAH3 4AHZA 2VMHA 4RR3B 1PNFA 3RI8A 2EXKA 2DWRA 1MZEA 2YYOA 1GBGA 3KB5A 5C4WB 1QQP1 2BFUL 1XNCA 3IT8A 1ND2C 2R1DA 2HJIA 1V6NA 1VBE3 2FMYA 4AI2A 4CDWC 1LRHA 4L92A 2HWE1 3MIFA 4B4RA 1VBC1 4META 4K21A 1OMIA 1YIPA 2A3YA 4I3GA 3WQ7A 4YZ2A 4CDUB 1IHMA 1ULDA 4CEYB 4RR3A 4EROA 3R6SA 1WCDJ 3FMGA 3UK9A 1ZBA3 1XE7A 2N7GA 3J8F3 2JENA 3D0SA 1RUI2 1HKDA 2P3JA 5FDBA 2R063 4QPYA 5JPNB 4OZXA 4N43C 4N53A 2JG9C 4RD7A 2WT0A 3O7OA 5FMOL 3SHRA 1XXNA 3WVJA 2K9ZA 4HLTA 1MS5A 1YWKA 1JHNA 1F5FA 1LOBA 5K0UA 5H9PA 3W9AA 5FRAA 1VBB1 4AQSA 5LK7B 4AQTA 1FNYA 4HK9A 2ZJCA 4KWKA 2D7FA 4BYYA 4JGYC 2EF6A 5AC93 3VBOC 1LU1A 3WP4A 2X5IC 2R041 2XVKA 3ELNA 3GYDA 5L36A 4JTOA 4JRAA 1RUJ1 2ZHNA 4J6GA 5KHGA 2ZGLA 1NY72 1RUC2 1MQTB 1RHI1 5HBAA 2AYHA 3VZKA 2YPJA 4QPIA 4D69A 5A32A 3VBFB 3MIHA 2F4PA 1C1LA 4BH9A 1REDA 4K6BA 4A7KA 2K0GA 3WDYA 1XNKA 3CEWA 4LHNA 2ZACA 1ZBA1 2H6BA 3ZIXA 2EXJA 4IL7A 5GZFA 1YI9A 2G4IA 3ILFA 3ZXDA 2VMIA 4ISRA 5D8AA 1R092 4ZU5A 2R30A 1H1IA 5FO7B 1JBCA 2Z2SB 1WMDA 3WV6A 2WA4A 2I74A 4NPRA 2Q1MA 2W0XA 1S55A 1QXPA 1QJU3 1ND2B 1QDOA 1TMF2 3ZSJA 5IT6A 1SFYA 5IUQA 1CR7A 1MS9A 1C8M3 1HQLA 4GH4A 2KA3A 1PNGA 4IEZA 1GR3A 5CFDC 5DG2A 1W6MA 3IKWA 1LOEA 2HWB3 4SLIA 3IWZA 4BHPA 4DZGA 4NHLA 4XFGA 4YG3A 5FQ0A 3OCPA 1ZZ6A 4FXGB 2HWE3 1ZRRA 3BOPA 4EN7B 4A7ZA 1HXS1 2VOKA 2E9QA 1AR63 1IPKA 4LLFA 3ZFGB 3AMNA 1IKQA 4HSLA 4CEWA 1UKRA 3GZTB 5GZEA 1JOJA 1X36A 4JGYA 1ZYBA 1ZRDA 1Z7S1 5CNAA 2ZAAA 1EV13 1CAXA 1OD5A 4BA6A 2ZAHA 4B7KA 2YXSA 1HRV2 2A6ZA 1ZZCA 1Y43B 2X5IB 2I2SA 3VKMA 2D5FA 1WBLA 1KITA 2RE9A 3AXDA 3K51A 4QT6A 4FOVA 5C6CA 2VU9A 1RUI1 2QJVA 3T2TA 1PZ7A 4WM8A 1QNWA 3CNAA 4YARA 1AL22 4RL7A 2XHKA 3WW4A 4DMIA 1PO11 2XGXA 4LBQD 1SDWA 3POSA 1NLSA 2YDEA 5D8AC 1R093 3AP9A 4K9SA 4H55A 2BVBA 4LBQA 3WG1A 4LTAA 5E88A 1RMU2 1HW5A 4OUSA 4M3CF 4MXWB 1LESA 1TQ5A 2WNEA 2EVXA 1ASJ1 4AEKA 1S0GA 5JSPA 2VW1A 1RUD3 2UYAA 2ZBJA 4QD2A 2A6WA 4FPGA 5FO9B 5LEKA 2IFWA 4N7IA 4H3WA 3FFZA 4WM7C 1YHFA 4WM8B 3OY8B 1S2BA 1DGRA 3B7MA 4I01A 2VUJA 5C33A 5L7OB 1LULA 2HWB2 1CAUB 2WSUA 3I2DA 1VBD2 4IQPA 4QQOA 4CEWC 5C9AB 2DVBA 2RS12 3RYRA 3NWKA 5CAZA 1NE6A 1LODA 2TUNA 5SV5A 1D2QA 1YCIA 4F8AA 1G6NA 3NVCA 1R1ZA 2E6VA 4MXVA 5ABJA 3O0VA 1TMF1 1V6IA 3U10A 1ZZBA 2Q0AA 3RG0A 1KRIA 5EZWA 3H3UA 5JCTA 5BXXA 1W2UA 4B4QA 5DDJ1 3BODA 3BPZA 4E4SA 2GH2A 1CJDA 1ASJ3 5KBFA 1SEFA 3DGTA 4Q0QA 3H3ZA 5KXEA 3LWCA 5JMCA 2X29A 4R9BA 4R9DA 3B02A 1BK1A 4L2NA 2WC2A 5BUVA 1FPN3 1LEMA 4HN1A 3DPRA 1E57A 1ZNPA 4I09A 4KU7A 4XJZA 3D6EA 4RQPB 3FJSA 3OYWA 2WZR3 1HIXA 4A3XA 2WLQA 3AKQA 5A33B 1PGL1 1Z7S2 3J26N 4HKOA 1MZFA 3AP6A 2D6LX 1IS4A 1HQNA 3I7DA 4ZXKA 3MW4A 3OGJA 1RUF2 1EP0A 2ERFA 1OFSA 3B00A 1R1A3 1J3QA 3VBFA 2BUKA 4OI4A 1XNDA 1AX2A 4YGDA 4EN8B 1JH5A 1ZBE3 1AYN1 1KQRA 4HL0A 2VOXA 3AK0A 4LO8A 4HMZA 1URXA 4I0BA 1COV3 3AKRA 2ARBA 2NQYA 4FAGA 2RS32 1EV11 3ZYGA 5I8SA 3TNPB 3VBHA 2XKOA 2VQ0A 3HMYA 1O5UA 2GC1A 4GH4B 1O7FA 4AWDA 3CF6E 2ZHLA 5BNOC 4Q1PA 1APNA 3DF0A 2RJKA 1R083 1YJKA 2DUQA 3L2HA 3G7DA