3WCRA

Crystal structure of plant lectin (ligand-free form)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
235
structure length
229
Chain Sequence
ASQTSFSFQRFNETNLILQRDATVSSKGQLRLTNVNDNGEPTLSSLGRAFYSAPIQIWDNTTGAVASFATSFTFNIDVPNNSGPADGLAFVLLPVGSQPKDKGGLLGLFNNYKYDSNAHTVAVEFDTLYKPRHIGIDVNSIKSIKTTTWDFVKGENAEVLITYDSSTKLLVASLVYPSLKTSFIVSDTVDLKSVLPEWVIVGFTATTGITKGNVETNDILSWSFASKLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Phytohemagglutinin from Phaseolus vulgaris (PHA-E) displays a novel glycan recognition mode using a common legume lectin fold
pubmed doi rcsb
molecule tags Sugar binding protein
molecule keywords Erythroagglutinin
total genus 56
structure length 229
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wcrA00
1YRZA 2E51A 1LOFA 3ZXLA 4FVVA 1IS5A 1KDMA 3RSJA 4XHBA 3WG4A 1LEMA 4XJZA 1DBNA 1BKZA 1DQ1A 3GNEA 1GKBA 4FPFA 2ZGOA 5LK5A 1A78A 3ILRA 3AYDA 2CL2A 4LBNA 1LHOA 5JOZA 4TZDA 1CVNA 2VH9A 4GA9A 1RINA 1V6KA 2OW4A 3NV1A 2YV8A 4PQ9A 4AWDA 2ZACA 1JOJA 3USUB 1JHNA 1Q8VA 1N1YA 3SH4A 5EYXA 3WUCA 4YZ3A 4L8QA 5CAZA 1KRIA 1D0HA 1YIFA 1PZ9A 2UURA 3APBA 5DZGA 1QNWA 1AXYA 3R4SA 1R1ZA 2CY6A 3AYEA 5GZCA 1V6MA 3T1MA 5E89A 1N3OA 3VKOA 2YROA 4Q8KA 4HL0A 4YGBA 1GNZA 3O0XA 3D6EA 2A75A 3B69A 1VLNA 3SNMA 5IUQA 3NV4A 2ARXA 4NOTA 4YG0A 1FV2A 2WNEA 4KBBA 1WLWA 1LOGA 4K1ZA 4XMIA 2PHXA 5H9RA 1CN1A 1GYKA 1F31A 3WDWA 2CWMA 4Y1YA 2A3XA 1BJQA 2A7AA 2AGSA 2E7TA 1G7YA 1W6PB 3POYA 1UKGA 5EWSA 4DRRA 2JE9A 1HQLA 3SH3A 3IPVA 4LBKA 2ZBJA 4FPLA 4XTMA 1LOBA 2OUJA 2DYCA 2UU8A 1G86A 1DQ2A 4YZ5A 3POWA 5DUXA 3M3OA 3ZXFA 1MS4A 4FPHA 4ISQA 3IM0A 1LEDA 2XB6C 2R1BA 5GJ6A 4K1YA 1SFYA 2TEPA 3OY8B 1Q8PA 3WG3A 1ZM1A 1BXHA 3POSA 3C2UA 3N7MA 2NZ9A 4W65A 4MYEA 3N7JA 3SH5A 3WV6A 4BOWA 4XJUA 3OBRA 1S0FA 2DVDA 1DGLA 1WW7A 1FYUA 4YW3A 1N47A 3ZXJA 4ZKTB 1I1EA 3B3QE 2VW1A 5KXCA 4BM8A 2ZGQA 1EPWA 3FUOA 3VKFC 3PVEA 1V6JA 3RMXA 2UWAA 3PJQA 2A6VA 2H0BA 1C57A 4GWMA 4Y22B 2D6PA 1AJKA 2ZMNA 3HN1A 1GSLA 1F5FA 1LECA 4YZ4A 2VY0A 1SCSA 4FPEA 2Z42A 2NP0A 5H9SA 1JW6A 3Q9OA 2NMNA 3OPZA 3WDVA 2ZGKA 2ERFA 1SBFA 1WLCA 3AYAA 1JBCA 2PHUA 4AVSA 2PELA 3V0AA 2D44A 2GNDA 4XILA 4XBQA 3WUDA 2DU0A 5IK5A 1WD4A 4GWNA 3WHTA 3BTAA 2LALA 2A71A 4I30A 4P14A 1G9CA 4UW5A 1ONAA 2PHWA 4FOWA 1D2SA 1SLCA 2DVBA 3VKMA 1Z78A 3ZSMA 4DPNA 1QU0A 3BODA 1V6LA 1SLBA 5DUUA 5DZFA 1SACA 4GALA 1CESA 2AYHA 3ZPYA 3I8TA 1X50A 4XYXA 5JVVA 1LCLA 2OUHA 2AUYA 2DU1A 4YFWA 3ZYRA 2Q5TA 2R49A 5IT6A 1UN1A 4GXLA 2XG3A 1JN2P 4WZFA 4DS0A 1OKQA 2EIGA 1AJOA 3O0VA 3AP5A 3AP7A 2EXJA 1IOAA 1MS8A 1W6OA 3ASIA 1LULA 1S0DA 4LBJA 2I2SA 2JDZA 1WW5A 5DG1A 4XMAA 3OJBA 3FLTA 4LBMA 1LENA 2ZHNA 1FAYA 3ATGA 1ENSA 2AENA 2E53A 3AXEA 4FPYA 4Y20A 4FPCA 5CB7A 1BQPA 1LHWA 4FPOB 1G8WA 4JC1A 3TAYA 2GMPA 2LTNA 3B00A 5HCBA 5IK8A 2WLQA 4AGGA 4FOVA 3B01A 3M1HA 1W6MB 1QOTA 2R1DA 3BIWE 5GM0A 1S0EA 1QGLA 1UMZA 1LHNA 2DWRA 4YLZA 2SBAA 2PHFA 2A3WA 2VUAA 3UK9A 1LGBA 5FRAA 1QF3A 3V65A 3V0AB 1ULCA 4FOQA 2AREA 1ZA4A 3DGTA 4P9WA 1ULDA 4XE9A 5IK7A 1VIWB 1LGNA 4U36A 3WDXA 5E88A 1N1SA 3NWKA 1I3HA 2DVFA 2EALA 2WJSA 3ZSLA 1APNA 2ZGMA 3AZWA 4CZSA 3W58A 1UZZA 1Y7BA 4UW6A 2ZGNA 1Q8OA 1S0CA 3WHUA 1G9DA 2R0HA 2EAKA 2A6WA 1FNZA 1LODA 1N3PA 1V6OA 1SLAA 2ZGSA 3OGGA 4Q8LA 4Y26A 5BYNA 4P9XA 3RMYA 4H55A 2G4IA 4PBOA 2WQZC 5T52A 1QDOA 1SLLA 2JJ6A 1RITA 3DUIA 2D3SA 2AH2A 1VAVA 2HYKA 3N7LA 1GICA 5JOXA 2ARBA 5FREA 4PCRA 2CYFA 5CA6A 4P9YA 3WCSA 4XJAA 1FV3A 4R9CA 3RS6A 2EF6A 2GNMA 3AFKA 4JRAA 4FPJA 4BLJA 2YZ4A 4Y1ZA 2OVUA 1NXD1 1H9PA 1SCRA 2GALA 4RA0A 4AGVA 1LHUA 4YM1A 3CNAA 4CTEA 1UAIA 1S0JA 3VKLA 1QNYA 4YZ1A 5KXEA 5SV8A 1A8DA 1ULEA 2PHTA 1IS6A 2ZGRA 5T5OA 4DQAA 3IN9A 3MPPG 4XBNA 1W6NB 3PVOA 2ZAAA 3N7KA 2CTVA 4WVWA 2EXKA 2YY1A 4FQ4A 2WT2A 3AZYA 3WLUA 1AXKA 1OFSA 1CJPA 2GN7A 2YXSA 2BQPA 4M00A 3WG2A 4K20A 1FATA 3AXDA 1HKDA 1QMJA 3N36A 3IKWA 1W0OA 1G9AA 3ZXEA 4YG6A 3WZ1A 1QOSA 3FLRA 2KM2A 1GV9A 5H9QA 4FPGA 3WNXA 2W08A 1GLHA 3SITA 2DUQA 4LBOA 1Z0HA 4XIKA 1AX1A 3A4UA 1IS3A 2ZMKA 3USUA 3O12A 3ZVXA 5HCFA 3ENRA 5JMCA 1WCSA 2JECA 3AZVA 4YZ2A 4FP2A 2UWBA 2DUPA 2VXRA 1ENQA 4LBLA 2GNTA 1CR7A 4YM0A 3H0OA 2ZHKA 2ZGUA 1Q8SA 1V6NA 3W59A 1N1TA 1GZWA 2D6KA 5GZEA 1BYHA 2GMEA 3AZXA 4YGCA 4YGDA 5GZDA 2WT0A 1FNYA 3L2YA 4XIOA 4BLIA 2C5DA 3NV2A 1GZCA 1S0BA 1YYNA 5T54A 5DZEA 3FUQA 1RIRA 4GKXA 2DTYA 2YMZA 3BOPA 1A3KA 3INAA 1IKPA 2AR6A 5EXOA 3V0BB 3WG1A 1S1AA 2ZZJA 2A6YA 3ZXKA 1W6PA 1YI7A 2C9AA 2DVAA 1O4ZA 1PZ7A 1SBDA 4PBPA 3B9CA 5DUWA 4AVVA 4OZXA 3V0BA 4ISRA 2ZGPA 4Y1UA 1GBGA 5E8AA 1GZ9A 1QDCA 1DQ5A 3M3EA 1MACA 1WW4A 2DVGA 5L73A 5DUVA 5GZFA 3M2MA 4C1XA 1Q8QA 4Q26A 2ZKNA 3WDYA 1WD3A 4XXAA 1HDKA 3MEPA 5GLWA 1DQ0A 3IPVB 2GN3A 4TYSA 4ATEA 2GMMA 1DLLA 2ZMLA 3N3HA 3JU9A 1VALA 2SLIA 1KQRA 3VV1A 1ULFA 2ZGTA 1W0PA 3ZYPA 4Z8BA 4Q1RA 5HCAA 2D6MA 4XJ9A 1W6OB 1MR5A 2ZABA 4FPKA 2NM1A 4LBQA 3JUUA 5KXDA 1LHVA 1MVEA 1UL9A 2NYYA 4YFZA 1F9KA 1H30A 1KJLA 4LBQB 3R4UA 4Y20B 5JLVA 1KJRA 2JE7A 1UZYA 4XJWA 1C1FA 1DYPA 3A0KA 5F9TA 3OBTA 1SLIA 1UPSA 2D6NA 3WCRA 1IKQA 1AF9A 2VW2A 3QCWA 3M3CA 4Y1VA 2ZA9A 1GZWB 2D6LX 3FFZA 2D7FA 1LU2A 1SLTA 2GNBA 4ZXKA 5JOWA 4JCKA 4YW2A 3AX4A 3UL2A 1B09A 1C1LA 4Y22A 2A5ZA 1URXA 2E7QA 5GLVA 1LGCA 3TB0A 3VKNA 4XDQA 1GANA 4CRQA 4F83A 4BPZA 1WUVA 2D43A 1BZWA 3R05A 3AK0A 4BQ1A 1MS5A 1JYIA 1C4RA 4D69A 2D3RA 2ES3A 3HMYA 3PMEA 1H9WA 5GLUA 3RQ0A 3MW3A 3ZSKA 3WDTA 2WKKA 2RHPA 2VU9A 1S0IA 1CPMA 1U0AA 1LOFC 4PF5A 1TEIA 3AZZA 4R9BA 3D4KA 3LSDA 4C1WA 2VW0A 2D3PA 4YG3A 4XZPA 2W39A 1VAMA 3QLQA 4XOGA 1HQWA 1S0GA 1DHKB 2P3JA 4DRVA 1UX6A 2P37A 4IQPA 5GALA 5T5PA 3PVNA 1CQ9A 2V73A 1J1TA 3IMNA 1LESA 1JYCA 3OYWB 4M3CF 4R9DA 3AYCA 2A3YA 3GALA 3ILNA 3LSEA 4LBQD 5CNAA 2NMOA 2WSVA 3MW4A 2WSUA 3OYWA 1PZ8A 1LOAA 2NN8A 4FP3A 3T2TA 1CONA 1WW6A 4BMBA 1MS9A 1OQ1A 2JD4A 3LCPA 1WBLA 3O5SA 4YW4A 5KXBA 2ENRA 1AX2A 5EYYA 3UJOA 3RG0A 1IS4A 4WV8A 1LJ7A 2P2KA 2A6XA 2W68A 1LU1A 1O4YA 3VUOA 2PHRA 1W6MA 1LOEA 4M3CB 3O0WA 1G9FA 1ULGA 2ZHLA 3U4XA 5T5JA 1DZQA 1QKQA 1DQ6A 3WVJA 3AP6A 4M3CA 1YO8A 3AP4A 4XTPA 2FMDA 3SLIA 1CIWA 4YW1A 5GLZA 3ILFA 4GKYA 4YW5A 4AVTA 5GZGA 1MZ5A 1FX5A 1MS1A 4YGEA 4YM3A 1N1VA 1CPNA 1DFQA 1MVQA 3I4IA 2FHRA 1V6IA 1AX0A 1SBEA 2WT1A 2JKBA 2DTWA 1LTEA 2R16A 4R9AA 3V64A 5CBLA 1KDKA 4Q2FA 4K21A 3AJZA 3SISA 1MS3A 3ZSJA 4YM2A 2P3KA 3AP9A 5T5LA 1N3QA 1G9BA 4Y24A 4ATFA 2CWSA 3AJYA 4XHXA 2ZGLA 2UWCA 4XJ8A 4Q27A 4UW3A 3M3QA 4DFSA 1DIWA 4FOYA 2GDFA 1DQ4A 3KM5A 2DURA 1V00A 1QOOA 3HR9A 1ENRA 3MW2A 4RL7A 4NO4A 5T55A 4AGRA 1NLSA 4U2AA 2A6ZA 1AZDA 1AVBA 2A70A 1WLDA 4ASMB 4ITCA 2W52A 2E6VA 4XBLA 5DXDA 3T1LA 5H9PA 1HLCA 5GLTA 3KQRA 1XQNA 5JOYA 2ZHMA 1GNHA 2V5YA 1W6NA 5DG2A 1Q56A 3FBYA 3N35A 4BMEA 5IK4A 5JDBA 4Y1XA 4Q1PA 1JXNA 2D6OX 3NV3A 5AVAA 2P34A 3FLPA 4M01A 3D5OA 3WDUA 4UW4A 1LOCA 3A0NA 2DV9A 2R0FA 1DYKA 2DUOA 1JUIA 5T50A 2EXIA 2EXHA 3UJQA 4FQZA 4HANA 1KITA 1WBFA 2CNAA 1W6QA 4WVVA 1AXZA 4M3CE 5F5QA 1MZ6A 2P3IA 4XXPA 3RRDA 4AYUA 2B7YA 1YXWA 3WOGA 3OY8A 4SLIA 1MS0A 1W6QB
chains in the Genus database with same CATH superfamily
1YRZA 4EN6B 2E51A 3MYXA 5LRRA 1ZZCA 1VBB3 1VB4A 1GQHA 2R073 1IS5A 3FHIB 3I2KA 4QHBA 5JIAA 5C8CA 3VBUA 3WG4A 4XJZA 1BKZA 1DQ1A 3GNEA 4FPFA 3U14A 2ZGOA 3WQ1A 4AHZA 3AYDA 1CAWA 1EV11 2CL2A 4DINB 3WF3A 4LLFA 3ZKUA 1UOBA 4UBGA 2YV8A 3FX3A 1CAWB 4Y5SA 4PIXA 5J7MA 1JOJA 1F35A 4HT1T 2V72A 3K51A 3O1TA 1ULOA 3MLKA 2Y6JA 1D0HA 5BPXA 3ZXDA 2UURA 1Q43A 3J8F1 5FJKA 5FZKA 3J8F2 3K4ZA 1R1ZA 2J42A 3AYEA 3NW4A 2O1QA 3CQOA 3VKOA 3HN3A 2YROA 2RJLA 4IE0A 4Q8KA 3L2HA 4Q4Y1 4YYOA 1GNZA 4HVRA 5C3QA 1VLNA 1RUG1 2GH2A 1R083 2JG9C 1PVC2 2YDEA 4NOTA 1FV2A 2GC2A 5J37A 4NIDA 4KBBA 4QQOA 1WLWA 1XNDA 3NAPA 3WNMA 5F6LB 4LKDA 2PHXA 2VNRA 1GYKA 1R081 1F31A 3WDWA 2VOKA 4IEYA 2BZDA 2A3XA 1HB2A 2Q30A 4Y1YA 4DXZA 4DIQA 4GULA 1W6PB 4A2UA 3T2PA 1WMDA 1ZRCA 4DRRA 1STMA 1HQLA 5DPNA 5FYMA 1L7QA 4L92A 3VHOA 2QKDA 5HV4A 4OZOA 4CUCA 3E6BA 1REDA 2CHHA 1DQ2A 4AFDA 2RS31 2R043 2B46X 2PLV3 4AAXA 4FPHA 4ISQA 5CFDA 3E5QA 2O8QA 5C5UA 5KC6A 5I0DA 1TZOA 4KI5M 4K1YA 3TOJA 2TEPA 4NAOA 4CDXA 5F3GA 3WG3A 1ZM1A 4QKBA 4YVSC 2YC2A 1CAXA 4W65A 4MYEA 1KFUL 3N7JA 4FFGA 3GBWA 3SH5A 4PDWB 1PX3A 2E63A 5FZOB 4BOWA 1XC6A 3EYPA 4CEWC 3WP6A 1ZBE2 1I1EA 4DXSA 1FYUA 1N47A 4M0NA 3AVRA 1GNYA 4L99A 4BYYA 3K4DA 4CCJA 2VW1A 2QTWB 4BM8A 5BNPB 4FAHA 2VPVA 1AHSA 3FUOA 3L9JT 5L36A 1JYTA 2Y33A 1V6JA 3TYJA 4D6SA 2VQAA 4HOOA 3ZDSA 4GB33 5LEKA 4CCMA 2H0BA 2RS32 4LE4A 1OD3A 4GWMA 2DCTA 4NROA 4LORA 3O14A 1RB8G 4CU9A 2W3JA 4FPEA 2ZXQA 2AZ5A 2HWF3 1I9RA 4CXXA 2VULA 4LK6A 5EJ3A 3ROUA 2UYAA 2XVKA 1QHDA 1OLRA 1A8MA 2ZGKA 1L7RA 2ERFA 1F5JA 3AYAA 4XFFA 4OHWA 4E4HA 4AVSA 3V0AA 4JGZC 3VBSA 4P08A 5DDJ2 1VBA2 2TUNA 3HQXA 3WUDA 1RUF3 4ZZ8A 3WHTA 4CSWA 2YPJA 2RS53 2A71A 4P14A 3RZGA 5A7WB 3GYDA 1B35A 2HWD2 4UW5A 1VBB1 2PHWA 3H9AA 4FOWA 5F39A 1NZIA 2XGXA 1D2SA 3FJSA 3HJRA 4YVWB 3J7MA 4AQSA 1K5JA 3BODA 5DZFA 1B35B 2AYHA 2HWB2 5FPVA 1W2TA 5JXGA 5FZCA 1ZRIA 3HQRA 5D8AC 1H4HA 3ACLA 4JQTA 4CDWC 3AMNA 2GAUA 1OOPA 1EY2A 4IE4A 5FQ0B 4GXLA 4WZFA 3EBRA 3HNBM 1PMHX 3NNFA 3O0VA 4W6XA 1US3A 3NMBA 3T09A 4C91A 2VQTA 3WP4A 5LRSA 5JI7A 4HSLA 2QBXA 2UY9A 4MH0E 4FTEA 4LBJA 1HW5A 3PUIA 4E2SA 2E32A 5DAXA 1D0GA 2ZX1A 1UY4A 4KQ7A 1UZ0A 2WIIB 2HWC2 2VVEA 3OGSA 4LBMA 3KV6A 3AXEA 4Y20A 1RGSA 1ASJ2 2Y6FA 1LHWA 3AKPA 4FPOB 3T2QA 1G8WA 4HN0A 5LCWL 3TAYA 3RJ2X 4NAMA 4CEYA 5FZGA 5A3LA 2WLQA 4NUBA 5FWJA 1NXMA 4L0PA 5BNNC 4DUXA 3VBFC 3BIWE 5FLJA 1UMZA 1LHNA 5FY1A 4DEVA 3JBG3 2SBAA 2XBO2 5A3PA 4FXKB 2BTVC 2JWPA 3V65A 5JR7B 2MNGA 2CSGA 4FOQA 4P9WA 3JD73 4XE9A 1ULDA 5FZ9A 5FYBA 3HNMA 3RGBA 4U36A 3VBUB 4AFCA 4PT6A 3SXWA 3WDXA 4JGZB 1BHGA 5E88A 5A7NA 3T4HB 1ASJ1 1APNA 2E26A 4A6SA 5AC91 1Y7BA 3Q8AA 1FMD3 3LEKA 5IVCA 3S57A 4FSJA 3KT4A 4B1LA 1E5SA 4I09A 1LR5A 1DZRA 4CDUC 4Y26A 1SLAA 5BYNA 1H8TA 1RUH3 2YC4A 4UF0A 2KD7A 2D5FA 2W1SA 3BCWA 3POJA 4V2WA 4EWAA 3ZSEA 4PBOA 5DABA 2BFUS 1RITA 3FE5A 4GB31 3VBHA 4EN7B 3HD8B 1FOD3 2J1RA 1PK6B 1HRV2 4Q4X1 5ACA1 1LB2A 1JYNA 3S7EA 3JQXA 2BP6A 2WYSA 1FPN1 4P9YA 1FV3A 2EF6A 4QGLA 5IFTA 2FDIA 5JPMB 3BIEA 2PXJA 2BWCA 4IEXA 1F8VA 3TEWA 1RUE3 2YZ4A 3NAPB 4DUVA 1JMUB 1SCRA 4YWAA 3SHRA 2OQ6A 4Q4V2 1HN1A 3D3AA 2VMIA 2BJSA 4YM1A 5C70A 2WN3A 1UAIA 4QM9A 2ID4A 2W91A 5SV8A 2VQ0A 1ULEA 3BVCA 1IS6A 5T5OA 1QQP2 4DQAA 4QM8A 4AVVA 3PVOA 3R4DB 3I97A 1OUXA 3WINE 2EXKA 3GGLA 2WT2A 4N8MA 1OFSA 4H3WA 4OCTA 2YXSA 1AL22 3CDZB 5LBFA 4PJYA 4HKOA 4LKEA 4BB3A 3MZHA 2VVFA 2RS52 5HPOA 4RD7A 3UGFA 1X8EA 1R1A3 2V09A 2KM2A 1C5IA 3SITA 4TSVA 4EE2A 1KS5A 1OT5A 2ET1A 4XIKA 4AHYA 3USUA 4CCCA 1IS3A 3THPA 5EJZB 3BU0A 1GR3A 5JMCA 2R32A 3H3ZA 5BNPA 1R082 3AZVA 4KNCA 4YSFA 3NO8A 1UXXX 2UWBA 1R091 2WAAA 4FP2A 2DUPA 1IGOA 2WS93 4QPIC 4EWDA 5ANNA 2WO2A 4ZU4A 4AVBA 2D93A 3OGJA 1POV3 4NPRA 4CDUB 4M0HA 4INDA 2WS91 3F95A 1BYHA 2EA7A 4YGDA 4YGCA 3SCHA 4QU2A 1H2KA 2Q0AA 2WT0A 3L2YA 4XIOA 3NV2A 5EZWA 4NPMA 4MZUA 2GH8A 2JDUA 4QPGA 1SMVA 3KGZA 5FMOL 4QPWA 1EV13 3AM2A 1LAJA 2XJVA 3WNLA 2WFF3 5FK8A 4CPBD 4FT8A 3VBSB 1PVC3 4HK8A 4WVMA 1YI7A 1ND2A 2BV4A 2C9AA 1PZ7A 3GBGA 1H2LA 3LGRA 4LLOA 4PBPA 3HT1A 4XQDA 5FY4A 5FWEA 4Q0VA 2ZGPA 2FCUA 2FD8A 1DQ5A 1MACA 4OI2A 5FZMA 4RS5C 1RMU2 1J84A 2WWSA 4UT5A 1Q8QA 2W94A 2ZKNA 4RHV3 1WD3A 5IWFA 5C4WC 1JZ3A 1HN0A 4DY3A 2GN3A 5FAXA 4FO9A 4IV3C 4ATEA 2GMMA 3VLBB 1OPMA 2QVSB 3GM8A 3N3HA 1RUNA 1WCQA 3VV1A 3ZYPA 1Y4WA 1ULFA 3BKZA 5CISA 4BIOA 3WF2A 1GFF2 5K0UC 1OQDA 2LM3A 3A21A 4MGYE 1W6OB 1MQTA 1ACCA 2WFF2 2HWF2 2WNUB 4CUAA 2VCAA 2NM1A 2WFF1 5A1FA 4PF1A 1NCRA 2BU9A 1FPN3 3JUUA 2Y0OA 1CD3G 1BEV3 5KXDA 4UAPA 1W28A 1UL9A 4CP1A 2XWJB 1H30A 4IGPA 4LBQB 4NRPA 4O65A 4Y20B 3H8RA 4H7LA 2JE7A 4ZPIA 3MV01 4XJWA 2YB7A 5FKCA 2RG4A 3A0KA 5DAPA 2MHFA 5D2AA 1ALYA 5G04L 3U11A 1YNAA 2A73B 4AOCA 2VW2A 1YQ2A 3M3CA 3OGRA 1LU2A 1SLTA 2FDJA 4LR4A 3SC7X 3CJXA 4JCKA 3B94A 4QQHA 4QX2A 4YW2A 1B09A 2RMU1 1J1LA 2EIDA 3IDAA 1URXA 4META 2O0OA 2WNVB 2PAEA 4COUA 3WNNA 4COZA 2ZPXA 1OA3A 1NQDA 2Y60A 3VBOC 4D7SA 3NJXA 3HOBA 4BA6A 2ES3A 3ZSKA 2DFCA 3ZPOA 2RHPA 2JIGA 2XDVA 3H3UA 4JGZA 5FV3A 1BVVA 3VZJA 1BCXA 3MO4A 3DPRB 1AR71 4J1WA 4EZHA 3WD5A 1RUC1 1K5MC 3D4KA 4LIUA 3PUAA 3RVHA 1XPWA 5L7OA 1W2NA 4YG3A 4MUVA 2EICA 4FFIA 4TWTA 2P3JA 5L7OB 2P37A 5T5PA 4CCLA 4M3CF 3R6SA 3C7OA 2A3YA 3GALA 4LBQD 5DAQA 3ZYFA 4IDZA 4IV3B 1VMHA 2Y64A 1RUG3 2Y6GA 5I0RA 2WN2A 2NN8A 2P6HA 3LZZA 4FP3A 4IV1A 5EPAA 3T2TA 1WW6A 2J1AA 1HRI2 1PGW1 2HWD1 1UCXA 2WUHA 1NCRB 5AVPA 4PI2A 4UFMA 5F3IA 5F37A 5BNNB 2F4LA 1GOFA 1Q3EA 1IS4A 4OI4A 2E9QA 4EJRA 1FOD2 3ZYIB 5KHKA 3D82A 1LU1A 3PLQA 3O0WA 1PO13 2RMU2 1SZBA 1QKQA 1DQ6A 1O6UA 2VCMA 1YO8A 2DBIA 3AP4A 2FMDA 1NZCA 2ATFA 4YW1A 3I59A 4YW5A 5EQUA 1OMIA 1NT0A 3ZFEA 4XEZA 2MEV2 3VHNA 2VZSA 3NQHA 4A45A 4YM3A 1BK0A 1CPNA 1EAH1 1UY0A 5FY9A 1QJU3 5J98B 3I2IA 4ES9A 2CDOA 4QGNA 5A7WA 4UXAA 1KDKA 4MGKE 3E97A 1MS3A 1TMF3 1XXNA 3MUY1 2IZWA 3OD4A 1H8TB 4QD2A 3AP9A 4XF3A 1N3QA 5T5LA 2ZX0A 5JAXA 5FO9B 2CWSA 4XHXA 1EV12 4DB5A 1KD7A 4J6GA 5HXVA 4XJ8A 2TNFA 1NAEA 1W06A 2RDRA 5JUVA 3WQ7A 1W2UA 1QXRA 4CDUA 3LPFA 1V00A 1BBT2 3MW2A 4RL7A 4D8MA 1F2NA 4NO4A 2D98A 3GXUA 3OPTA 4Q29A 4QB2A 5LA9A 5A6ZA 5BNPC 1AZDA 2R071 2VUDA 4IV1B 2Y38A 1ND3B 4BDVB 1AL23 4B29A 3LE0A 2RR11 1QJX2 4PLOA 3ME2A 2W2IA 1HLCA 5FZEA 5H9PA 3KQRA 3KV9A 1VBE2 1XQNA 3O1OA 4AZZA 2W95A 1UPIA 2V5YA 2CAVA 1Q56A 3N35A 3DV8A 4Q1PA 2D6OX 5AVAA 1SDWA 1YUDA 3FLPA 4CEYB 3A0NA 4QAWA 4P9LA 2R0FA 2WFPA 4NVPA 4AEMA 1DYKA 2WABA 2JIJA 1W9TA 4K9SA 4FQZA 5FXXA 2XBO1 1KITA 1AYM2 4HN1A 1JS9A 1WBFA 2GZWA 2R7EB 4I3PA 2XQRA 4WVVA 3I2JA 4E4SA 4XXPA 4BIFA 3ACFA 4I3GA 3WOGA 3P5BA 3H7JA 4NRMA 2GP3A 1MS0A 2W9XA 4ORFA 3ZXLA 1PMJX 4ZS2A 1U5ZA 4AI9A 1LEMA 3TWIA 1J59A 1GKBA 4KH9A 2VNGA 5LK5A 4D3WA 3T0DA 1LHOA 1MZEA 1E5HA 2WAOA 3VZKA 2VH9A 4GA9A 4XDOA 1XYNA 4AI8A 3NV1A 4GIQA 4PQ9A 2PAKA 4A3ZA 4AWDA 1TME2 1OOPC 2RM23 2VZ1A 3C3VA 1N1YA 2J1VA 3SH4A 3VDDA 5CAZA 4YZ3A 1OKOA 2JDHA 1JZ2A 2W87A 4GMP1 1KRIA 1YIFA 1PZ9A 3APBA 3OF1A 1AR73 5SV5A 3MGUA 2GC0A 2VZOA 2VGDA 3J7NA 3R4SA 3SEPA 1V6MA 2VO5A 2BUKA 1K3IA 1N3OA 4GMP3 3DL3A 5E89A 4FAGA 3AMMA 1BMV1 5F5IA 5C5TA 3G6JB 4QPIB 3NNJA 3IB3A 4AR2A 4QGMA 1RUI3 4CDQA 2ETEA 2YPDA 1REEA 3ZXAC 2H6BA 3SNMA 3NV4A 1W8NA 2ARXA 5B2GB 1WMFA 1D4M2 1WWYA 2VMCA 4UFJA 4XMIA 2BPA2 3NSTA 3CJIC 5H9RA 4A42A 5A3WA 1ZBE1 4ET7A 1BJQA 1ENXA 4ZS3A 1WKYA 4CYDA 2PLV2 1C28A 2I07B 3JXSA 4NMIA 1OBNA 2JE9A 3BU7A 3SH3A 2ZBJA 1UU5A 1CZTA 1NA1B 1UMIA 2R062 1RUD1 4FCAA 4KGGA 4LO6B 4G9SB 3J7LA 1OH4A 3POWA 3M3OA 5DUXA 5EIYB 3UNPA 2YU2A 2K2SA 2PHLA 3IM0A 2RDNA 2WZEA 5GJ6A 5FIXA 5EJ1B 4QT6A 1W3XA 5FZFA 5HBAA 1Q8PA 1ZRRA 4NRQA 4B1MA 1BXHA 3AL5A 3ZX7A 3VBRB 4RYDA 4XACA 2DDUA 2ORZA 1CAUA 4Y4YA 4K6BA 3WV6A 4NIHA 4R8HA 1O3QA 4XJUA 1QJY1 5C7GA 1WW7A 4ZKTB 2AEZA 4MGZE 3B3QE 4H7MA 5F7UA 5C71A 5KXCA 1EPWA 1SFNA 1D2QA 4IGOA 3VBHC 4AVCA 3S5AA 1AL0G 1YEWA 3VDDB 2A6VA 4N90A 2JG9A 1C57A 5A1LA 1YLLA 3ES4A 4HLTA 3S7IA 3VD7A 2ZMNA 3HN1A 4Y33A 4Q4V1 2VY0A 3WEZA 2XLAA 4DXTA 2XMLA 3D8CA 5H9SA 3TN92 2DFBA 3KHBA 2NMNA 1W8HA 1UYXA 2FMYA 4QWNA 3BI3A 1WZXA 4L97A 3RFRA 1SBFA 1WLCA 2YBSA 3AB0A 4CP9A 1JBCA 2HWE3 3O1RA 2PELA 2CGNA 2D44A 1QXPA 4HPKB 4XBQA 2DU0A 3OUIA 1RUC3 4OYUA 3DYMA 2QFEA 2W47A 2OYZA 1YQ8A 3TEZA 5F5CA 2WYFA 1OVSA 4HKLA 2IUWA 4Y5TA 1JOBA 2Z79A 3ZKYA 1RYYA 2D5HA 2JG8A 1V6LA 1SLBA 5DUUA 3WQ0A 4N7UA 3ZFGA 1W2OA 1SACA 2GC1A 3MPBA 4XCAA 1XNAA 5FLIA 1CESA 3JB4C 1VBD3 1ZZ6A 5FYIA 1GP5A 1COV2 3I8TA 4LTAA 2JG8B 4XYXA 5JVVA 4ZXEA 5LB6A 2B8MA 3FN9A 3ZYRA 3TN91 1UN1A 4X6QB 1PGL2 1TMF2 3RZKA 3TNPB 3UETA 3ASIA 5F3EA 4XAAA 1S0DA 2KXLA 1MEC1 1T6BX 2JDZA 4QXBA 5APAA 4XMAA 5A32A 3M7AA 5FY0A 3FLTA 5LZ6A 1RTVA 3KT1A 4LITA 4JKMA 3ZR5A 1FAYA 3EB7A 1UY3A 2E53A 4FPYA 4OUMA 4FPCA 4OHZA 2ZEXA 4MXVA 5HV0A 2GMPA 3RWKX 2JG9B 3UGGA 1AR92 1V9U3 1Y9QA 2XVLA 4AGGA 3VD4A 4JV4A 5FZ8A 2G9GA 1QOTA 5GM0A 2WA3A 3H8OA 1S0EA 1F15A 2YG0A 1PO11 1O91A 1H1IA 2AC1A 4HFSA 3H1MA 2WINB 5DDJ1 2PHFA 1WMEA 5LA2A 2A3WA 1ZBA3 1LGBA 4RS5B 4JGYB 1VBB2 5IK7A 1OUSA 1VIWB 4K8RB 5FUIA 2XJRA 3E6DA 2ARAA 2VZ3A 1N1SA 3NWKA 2EALA 2QUOA 1UQXA 2BNNA 5CG8A 4CZSA 3W58A 3GF6A 1UZWA 1Q8OA 1G9DA 1QH7A 2R0HA 4JKKA 1N3PA 1I5PA 3MHZA 3OGGA 2R6QA 4FXGB 5LBEA 3RMYA 5L19A 2WO3A 2WQZC 2DCKA 5J96B 1QDOA 4X8PA 4HBNA 4ZU5A 4JHZA 2D3SA 5LY1A 1OLMA 2HYKA 1K12A 3N7LA 3NKGA 2IXLA 3ZN4A 3ES1A 5EHDA 5CFCC 1ZREA 1RUD2 3HEIA 5FO8B 2RS12 4CCEA 3CU7A 1JYXA 4QDQA 1RXGA 1HB4A 1HXS2 3EJKA 4BQ5A 1KFXL 2OX0A 4QDSA 1O4TA 4NHLA 1NXD1 1W05A 3VZOA 4WVMB 1MPXA 2WRAA 4RA0A 5FZ1A 4P5HA 3CNAA 4YZ1A 1S0JA 2XJUA 1QNYA 3VKLA 4CU7A 5KXEA 1A8DA 1K45A 4CPBA 1QJY3 2ZGRA 3OUJA 3IN9A 3MPPG 1W6NB 4DOUA 3UT0A 2YY1A 4EN9B 1G6NA 4MADA 4C0BA 1AXKA 4QKFA 2XONA 3WG2A 1MQTC 1FATA 5FZ7A 4NR1A 2RR13 1C5HA 1HKDA 3IKWA 2CDPA 1BEV2 2PMWB 3UKTA 1G9AA 1QJU2 3WZ1A 1QOSA 5CKMA 3FLRA 5A3UA 2C0ZA 5FP3A 1CAUB 1ZZ8A 4W8JA 4LA2A 4E8DA 1Z0HA 3KV5A 3AKQA 3I7DA 2OPKA 3DKQA 3O12A 2HWE1 3FFQA 1I6XA 2HEWF 3AKRA 4NHKA 3H1WA 1UXZA 4PDWC 4QX7A 2WWUA 5HI0A 4HZFA 3T0AA 4HMZA 1ENQA 1WA6X 1YFWA 2GNTA 3CBNA 3H7YA 4GD4A 3ON7A 2IFWA 4L9BA 4YM0A 2ZHKA 2ZGUA 5CKNA 1Z7S2 1WCKA 4GWIA 2C4XA 2LW8A 2R072 2HEVF 1RUD3 2GMEA 3AZXA 5GZDA 4BHPA 3CJIB 1BVP1 1EUUA 2C5DA 3DCQA 2PQSA 1W8UA 4XFHA 5I8YA 5T54A 3FUQA 2YMZA 3BOPA 4IW3A 5IJRA 4AK3A 3RNSA 3I2GA 5LY2A 3BPSA 2ZZJA 1E57A 1VBC2 2RV9A 2QQVA 2A6YA 5DDJ3 4COYA 1S55A 3UKVA 2HWF1 2X05A 5DUWA 3GZUC 3RYKA 5A33A 3V0BA 3B9CA 2ZOEB 4OZXA 3O1UA 1AYN2 1GBGA 1QJY2 1RL3A 2HEYF 3LFIA 5E8AA 3OEBA 1WW4A 4JTNA 1ND2B 4D94A 2VOTA 1V0AA 3HVDA 4Q26A 2IVJA 1W03A 3VBRC 3FMGA 2LROA 1M4WA 1NKGA 1UYYA 3IPVB 3H50A 4LPLA 1LKNA 2Q1FA 3IZOA 3VD9A 1DLLA 1PNFA 2TBVA 2SLIA 2BEOA 5FYSA 2C1FA 4AHWA 4E2QA 2BWAA 2JG8C 1RUJ2 3EQEA 2B39A 3PU3A 1VBD1 2DF7A 4RGKA 1O3SA 2WQ4A 2QQLA 1ZBE3 1MR5A 2VM9A 2XL9A 2P6CA 5TSWA 4FPKA 3WW4A 4LBQA 4ASKA 2VQUA 3FC0A 3K3NA 1LHVA 3W21A 1JU3A 4YFZA 2NYYA 4IL7A 1GQGA 1KJLA 1R1A2 4AI2A 5LW9A 3R4UA 5C8CC 1EAH2 1KJRA 3B5LB 3LA2A 2PTMA 1W9YA 1DYPA 2H0VA 5L9VA 2QQUA 3OBTA 3KSCA 2G19A 4OULA 4Z07A 4Z82A 1IKQA 2WLPA 3BTYA 4Y1VA 3RZMA 1VRBA 2D7FA 3WW2A 5JOWA 4Y4RA 3N4MA 3GZEA 1C1LA 2RJ2A 3MUZ1 4CCOA 5GLVA 3WF0A 1RJ7A 5I0UA 3ZR6A 5F2WA 3E1F1 4BPZA 1U5XA 1HV1A 2Y8KA 4EROA 4D6QA 1BZWA 1JH5A 3AK0A 3I54A 5GKAC 2BYVE 1GOHA 1YJLA 5I0SA 2B42B 1UX7A 3PMEA 4XUNA 3WDTA 5K4LA 4D6RA 1GWKA 5EFUA 3NRUA 1CPMA 1QH6A 4BE3A 2HBTA 4N9HA 5FZHA 3D0SA 3KF3A 3MLLA 4E9KA 2VUCA 1E5IA 2W39A 4KGQA 4E4DX 3FHAA 4XOGA 5ERLA 1HQWA 3V56A 1DHKB 3POEA 4O9GA 4OUSA 4NE9A 1QQP3 4S2DA 1T6GC 4DRVA 5C3SA 1VBD2 5GALA 3PVNA 2V73A 1J1TA 3OYWB 5LA1A 1FI2A 3KCXA 4UFIA 4AI0A 3WNOA 5IFPA 5CIRA 4CEWB 2WSVA 4FFFA 2CAUA 4P00B 3OYWA 2BVBA 3IBMA 1XNBA 3CZUA 4OQ9A 2X10A 5JSPA 4M4PA 1OD5A 2JD4A 2PQQA 3T08A 5FBZA 2VG9A 3VDDC 5KXBA 5KBFA 4A41A 3IMMA 5EYYA 2Q8EA 4LUKA 5FTTC 4LUMA 1ZBA2 1LJ7A 3HQUA 4WV8A 2BRTA 1W3VA 2RR12 2BOJA 1RUH2 2PHRA 4KBZA 1UU4A 2YU1A 3T30A 2VTXA 1G9FA 4CP2A 1XBFA 2ZEZA 3U4XA 4CUGA 5ABJA 3VGIA 5C9AC 4AFBA 1RUI1 2DCYA 3J4UH 1AR93 1V9U2 4AHXA 5KR7A 3I3DA 5FXVA 3SLIA 4AG4A 4G4FA 5FYTA 2ILMA 4Y3OA 3KV4A 4GKYA 1ULPA 5FP4A 4AVTA 2ADDA 5GZGA 4MXWA 1MZ5A 4JRLA 4OLLA 1XB9A 4C0HA 5A6YA 3JD72 5JI9A 3FHQA 3ZYBA 3O1VA 3ABZA 2DTWA 5AFEA 1LTEA 4V1PA 3WX5A 5K7PA 4R9AA 3VDBA 2XJTA 1VBE1 1UIJA 2BNMA 1OFNA 3PL0A 3SISA 2LS6A 3TNQA 3LKJA 3ZSJA 4QMAA 2YUEA 4CCDA 4QU1A 1COV1 4PLNA 3J9SA 1PVC1 4BK5A 3U07A 4ZONA 2ZGLA 4XDPA 1RUI2 1K5MB 1COV3 3VHRA 4DFSA 1DIWA 2GDFA 3I2OA 2XR4A 2DURA 2PN5A 3K77A 5EP9A 1QOOA 3HR9A 5FYZA 1NX9A 4JQRA 4Q0PA 3U10A 2A6ZA 1UW8A 2JE8A 2A70A 2OS2A 4WZCA 1WLDA 2HYXA 1POV1 4ITCA 4CDWA 1TVGA 5CYYA 1HB3A 1QJX1 4K3UA 3SCGA 1RUF1 4XBLA 1XJAA 4TLFA 4WBBA 4XFIA 3T1LA 2HJIA 3VD3A 5A3NA 3FWEA 5FDBA 4JDOA 5GLTA 1VPHA 2VOVA 5JOYA 2JDPA 2ZHMA 1GZTA 1GNHA 3B7MA 5G05L 1XYOA 1W6NA 5DG2A 4BMEA 2BERA 3NNGA 4Y1XA 3RWNA 3NV3A 3WDUA 3D5OA 2IXKA 1LOCA 3VBSC 5IVBA 1JUIA 5JWPA 3H8XA 2MEV1 4B7EA 4HANA 1VE0A 2QCSB 3EHKA 5JSOA 4QQPA 2C26A 1PGSA 2X5IA 4M3CE 4FTSA 1EPZA 1YQ6A 3RI9A 3ZYJB 3K46A 4AYUA 4EWEA 3OY8A 4BXFA 1SQ4A 4H2AA 1EAH3 1W6QB 2W52A 3T2OA 4JTOA 1LOFA 1C8NA 1OI6A 3MICA 5I8SA 1KDMA 2WA4A 4XUTA 3RSJA 4ARYA 5L7OC 3N9NA 1DBNA 1PO23 2RVAA 3M70A 1PNGA 1XRUA 5A7QA 5JOZA 1CVNA 1ZRFA 2D40A 1V6KA 2RE9A 1SG3A 2BDRA 4LXLA 2Q8DA 3PVBB 3PJYA 4Z92B 2WNUC 3HT2A 1JHNA 4XZUG 2VZQA 4QX1A 2Z2SB 3DECA 3WUCA 3WNPA 3B02A 4KWUA 4MSVA 4QHOA 5DAVA 1ASJ3 1AXYA 2PHDA 3F2ZA 3K2OA 3SKVA 3JBG1 5C3RA 5GZCA 3ETPA 4GH4B 3CL1A 1L3JA 3MBWA 4YGBA 2XHNA 3O0XA 2LRPA 1M06G 1VAKA 2JENA 2A75A 2XUEA 3WXPA 4BQ4A 5J1XA 3IDBB 4WM7C 3CF6E 3GBFA 4K1ZA 4F8AA 3N9MA 2XPJA 3AFGA 2QQPA 1GP4A 1CN1A 1PO22 1OPOA 2F17A 2EAAA 4JAAA 2CWMA 4OMCA 2A7AA 3K3OA 2E7TA 1G7YA 5EWSA 5CEHA 2J1UA 3HWJA 4AEDA 3IPVA 4FPLA 3OOXA 1LOBA 3IDCB 1JZ6A 1IQAA 2DYCA 2OUJA 1JU4A 1G86A 1WCUA 1IPJA 2J1EA 4HVOA 1XNCA 1RUE2 3ZXFA 4ES8A 1MS4A 4RFRB 4CDXC 3GCXA 5BV6A 2D97A 4AI3A 4DZGA 2ET7A 2R1BA 3VBRA 1W8OA 2W0XA 2XQXA 1RHI2 4IEOA 4Q4W3 3POFA 1RUG2 2V4AA 5FYUA 1AR91 3POSA 1KS4A 3C2UA 4XF0A 3N7MA 2ZEYA 2NZ9A 5A3TA 4HK9A 4P9JA 2VZTA 4LO4B 1SPPB 4RQPA 1DP0A 1S0FA 2DVDA 3ZXJA 4BZ4A 3EMRA 1OLQA 1NCQC 1QJX3 3SQOA 3H1YA 2FDHA 1XE0A 1KGYA 1MEC2 2JDMA 3DXUA 3GHNA 2NQYA 4LO7A 3VKFC 2UWAA 1AYN3 3THTA 2PAMA 2WNVC 1RXFA 5BXXA 2D6PA 4CXYA 1RUH1 5ABJB 1YHFA 4AXOA 1F5FA 2VMGA 4XUOA 5AC92 1YFXA 4KG8A 5F1RA 3W5MA 2Z42A 4CP9B 1DU3D 4QPIA 4CDQB 1JW6A 4MXWB 2ZS6B 3WDVA 1IHMA 4QPYA 4LOSA 3OPWA 2VMDA 4JGYA 3A22A 4KWJA 4LHLA 1VRH1 2GNDA 4XILA 3JD71 5IK5A 2VBDA 4LK7A 1WD4A 1Y3TA 4GWNA 4PIZA 4S2HA 4A4AA 2LALA 1G9CA 5FYHA 1TNRA 1ONAA 3LA7A 2PA7A 1RC6A 2DVBA 1SLCA 1R093 1CZVA 4MOAA 4D7YA 4MHRA 3KGLA 4W50A 4N43B 5F6KA 5FK7A 4RFT0 3O1PA 3O1SA 4GMP0 3ZPYA 4E2GA 1CZSA 2XJPA 3BUCA 5I0TA 1ODNA 4TXWA 4QX0A 3RYRA 4NIAA 1PK6C 4UOJA 4KL1A 4YFWA 4EN8B 5J3UA 1REFA 2Q5TA 3AMHA 5F2SA 1WMXA 5FZ4A 2WZR3 4XPVA 5IT6A 1JN2P 4DS0A 2EIGA 1AJOA 1UOJA 3AP5A 5E16A 1GUIA 4LQRA 1IOAA 1OF4A 3QH6A 3LDBA 2I2SA 1QJEA 5DG1A 5JMOA 4AF9A 4TTGA 3OJBA 1RUE1 3OCPA 2XKOA 5FP7A 5K0UA 4O9EA 4X8NA 4FFHA 1O3RA 4BU2A 5K9YA 4NJ4A 1H4GA 4RHV1 4RN5A 3ACIA 3B00A 1X9TA 5BNNA 2NLRA 3ZFFB 3GZAA 3AMPA 4E8CA 1D7PM 4AQ2A 1JZ4A 1W9WA 3M1HA 5AFBA 1UIKA 1GQPA 1BLZA 5CKQA 2ZEWA 3TEYA 4AI1A 4COVA 1RHI3 4RS5A 4DMIA 2JDKA 3I2HA 4V2VA 4YLZA 3VBFA 4BCUA 3ST7A 1IG3A 1HRI1 2VUAA 4F3JA 2BFUL 5FRAA 2WDBA 3GJBA 1ULCA 1VBE3 2AREA 1X33A 1ZA4A 1LGNA 4QB1A 1PVXA 2WO7A 3KCCA 4KU7A 1VJ2A 4UWDA 2DVFA 4Z1VA 1ST8A 4QKDA 4R4XA 3WR0A 5CFDC 1UZVA 2IXHA 1GWLA 1YJKA 3ORJA 4UW6A 5A3OA 3WHUA 1IQDC 2EAKA 4N9IA 4AW7A 3LAGA 3BTXA 3UKNA 1LODA 4P5YA 1V6OA 2ZGSA 1UNBA 2ZAHA 2ZX2A 1SEFA 1LNSA 1ZX5A 2G4IA 1NYWA 4DXRA 2GSYA 2JJ6A 1SLLA 3N9QA 1AYN1 1SFPA 1OOPB 1H8TC 5T52A 3C7HA 2E33A 5FQ0A 1RVF1 4XW3A 1VAVA 3CLPA 1DYOA 4CEWA 4EV0A 1HXS3 5JOXA 2ARBA 3FBMA 1W0NA 2VR4A 3BPZA 4PCRA 2CYFA 4UYBA 5JPNB 3UESA 4IE7A 3WCSA 1XSQA 4MO3M 4QPGB 4XJAA 2V5DA 5FPUA 4R9CA 4FTBA 1JZ8A 3RS6A 3AL6A 1NLQA 5JXHA 2WBKA 2R042 2XWBB 2YHJA 3HBKA 4UFHA 4AGVA 5F32A 4CTEA 2CV6A 2MEV3 4IEUA 1RUJ1 1RJ8A 1DGRA 2JICA 1V9U1 1J3PA 4IEWA 4MGTA 3N7KA 2CTVA 4YNIA 4AQTA 1I5ZA 3VHPA 1RUJ3 1ZNPA 1EUTA 4FQ4A 3AZYA 4XUPA 3WLUA 2IVIB 4A7ZA 2GN7A 2GP5A 2Z5WA 1X82A 4AEJA 2WR9A 1ZZBA 2Y34A 2Q1ZB 3AXDA 5A7PA 3OBAA 1EP0A 3ZYGA 1W0OA 2IXCA 3THDA 3ZXEA 3LWCA 3MIGA 4YG6A 1NOVA 1UYZA 3J8F3 2XH6A 1S4CA 1GV9A 1DF0A 1QJZA 1X9PA 2GC3A 2QQMA 1GLHA 2Y6HA 3CKHA 2DUQA 5H9QA 3VD5A 1PM4A 4RQPB 4NHMA 2GU9A 4F7ZA 2X8KA 1AX1A 3A4UA 2F4PA 2ZMKA 5AC93 5C8CB 3KB5A 3ZVXA 3ENRA 1PGL1 4GH4C 1U5IA 1WCSA 2JECA 2OZJA 1H2NA 2OXBA 2OZ6A 4UF0B 1RMU1 1CR7A 3C7FA 4I0BA 3H0OA 4ZZ5A 2JX9A 5LWBA 1Q8SA 1VBA3 2K9ZA 3H8UA 1TE1B 3HBZA 1N1TA 2IC1A 1GZWA 2D6KA 3MF6A 3VBHB 4BLIA 3LIGA 4XAEA 1S0BA 4BQ2A 2EVXA 5DZEA 2JB4A 1H6XA 2KR2A 4IGQA 5EV7A 3IIAA 1JZ7A 3V0BB 2XXZA 4HVQA 3OG2A 2WZR1 4P02B 2FDKA 2XKPA 4KWLA 1W6PA 2WZ8A 1QWRA 5ANQA 1SBDA 1FXZA 4Q4W2 1O5UA 2WL1A 4LHSA 4Y1UA 1GZ9A 1DGRN 4BXSV 5C4WA 3ZYHA 2FZ2A 4Q4Y3 5DUVA 5GZFA 4WM7B 3KLSA 3WDYA 5FMOS 1YIPA 4XXAA 2ZX3A 2G9ZA 4B4RA 1GU3A 5GLWA 1DQ0A 2HLEA 1BMV2 4OVEA 1S2EA 3IDEA 1FOD1 4ARXA 5I8TA 5JCTA 5FYCA 3U75A 1C8M3 2OA2A 3Q8FA 3WNXA 1XE7A 1KQRA 2YGMA 5FZAA 2ZGTA 1MQTB 1W0PA 2RM22 4Z8BA 4IV3A 5I91A 5HCAA 2D6MA 1NCRC 1VR3A 2DBNA 2JDAA 4XJ9A 2YBKA 1J3RA 1PO21 2ZABA 3LIHA 4XCBA 2HWB3 3J7HA 4HKWA 3T0BA 5I93A 2XJQA 1DZTA 3QD6A 1CAXB 1H8VA 1OVPA 2BNOA 2J7MA 2O14A 2PLV1 5FYVA 4TN7A 5ABJC 3ZO0B 4RQPC 4I01A 3GDBA 4OMDA 1PGW2 4Q4X2 5ACA2 3I49A 4XFCA 3NKTA 2P5BA 1K42A 1F4AA 1MEC3 3VL8A 1RUF2 3U0ZA 1SLIA 2D6NA 2VUJA 2OIIA 1AF9A 4XFAA 4JHTA 3DEMA 1GZWB 4Q5OA 2QQWA 2WNVA 4R52A 2VTFA 5HCHA 3AX4A 3UL2A 4Y22A 4DO0A 1DCSA 3TB0A 3QOPA 3WF4A 1VRH3 4CRQA 4I02A 1GANA 1HB1A 5F3CA 4OI1A 1IZ3A 2V4VA 1PM7A 2IWGB 1NE6A 2ZX4A 3LB9A 5FUPA 4FBFA 1C4RA 3OTFA 1Y9GA 4XFGA 4YVWA 5GLUA 1H9WA 3MF9A 2ARCA 5F8PA 2VU9A 3I3BA 5B4XA 4A6OA 1S0IA 1T2XA 2ZTNA 1U0AA 4C90A 1HRV3 1TEIA 1Y43B 2W1WA 3AZZA 1UMHA 1UOFA 5ISLA 1GWMA 3LSDA 4Q4X3 5ACA3 4J25A 1NQJA 3RI8A 1UO9A 4AVAA 4I2OA 2HWC3 3MIDA 4XZPA 3QLQA 1K5MA 4IEPA 4Z2WA 4YVSB 3PUHA 1UX6A 1VBC1 3ZXGA 1POV0 3IMNA 2PYTA 3GHMA 1LESA 1JYCA 5BY5A 5M0TA 4B4QA 3JB8A 4IV1C 4LOTA 3ILNA 4QB6A 5CNAA 3ZDVA 3ZIXA 1W04A 1YQ5A 5IW0A 3MW4A 4XVHA 1S2KA 2WSUA 1FMD2 3GCWA 5A32B 1LOAA 3RZZA 1JYWA 4BMBA 2WNUA 2P3YA 3LA3A 4IEQA 4KMQA 5K0UB 1OQ1A 1W39A 3K4AA 1HV0A 4YW4A 2ENRA 3UJOA 3RG0A 2P2KA 1DGWX 1ZBA1 2A6XA 1NLRA 2R041 2VD7A 1JI6A 2W68A 4NHXA 3VUOA 1D4VB 3QBQA 1TME3 1ULGA 2XLGA 5CVRA 1RHI1 2QQNA 3VZNA 4S2FA 5T5JA 4YARA 5LBBA 3WVJA 5FR3A 3ETQA 2B4KA 4M3CA 4XTPA 5FKBA 3G7DA 3O1MA 1CIWA 2VZRA 1IG0A 4BK4A 4LNVA 3TBDA 2W1UA 1ND2C 4EYUA 1NE4A 4I0AA 1FX5A 3DXTA 1MS1A 2EIEA 2VOXA 1YCIA 4YGEA 3I59B 1N1VA 4JDMA 1DFQA 4X6RB 1MVQA 1UY1A 2J1TA 3I4IA 2FHRA 5DAWA 1V6IA 1JUHA 4UBHA 4RR3A 1SBEA 1GOGA 1UYPA 4IUGA 4Q0QA 2JKBA 4DEQA 2YGLA 4QXKA 2DCZA 1JYVA 3USSA 5CBLA 4OHYA 4Q2FA 4ASLA 3AJZA 1HJGA 4RR3B 2I74A 5CU1A 4YM2A 2P3KA 4OHVA 4HG6B 4BJ0A 1G9BA 3E6CC 2XL7A 4MV2A 2HWE2 4PHZA 1EYBA 4B3NA 3OBZA 3E5XA 2QE3A 2VMHA 4GQ7A 4QQ2A 3WF1A 1MZFA 1QQP1 3VL9A 2VL4A 5J09A 3I2DA 3MLJA 4Q4V3 5B4NA 3LFMA 1DQ4A 3AVSA 3KM5A 5BNOA 5JZGA 3B9IA 4QX5A 4AFAA 3WQBA 1ENRA 5FY5A 4DUWA 3AKTA 4AGRA 1ODMA 2VCCA 1OURA 2UY8A 4URAA 4P9GA 4DNYA 2C6SA 4XQ4A 5FMBA 3KHCA 2HWD3 4UI9L 2E6VA 1AUYA 1J58A 4LO8A 2A1XA 2QQOA 1U5YA 1XU1A 2QQJA 4JVAA 1CX1A 3WNKA 5FMCA 1YWKA 5JDBA 1UY2A 5FY8A 5L9RA 3W5NA 4FI9A 2P34A 1E5RA 1CWPA 3SCFA 2JD9A 2VZUA 4MGIE 2EXIA 3UJQA 3NJYA 1JTZX 4L11A 4JGYC 3RZJA 2CNAA 1W6QA 4A44A 5D21A 1AXZA 5F5QA 4I0WB 2KA3A 3RRDA 2R061 2YFZA 3NNLA 1R64A 2B7YA 1YXWA 4SLIA 3OUHA 4AAPA 2ZJCA 4UW4A 2Z69A 3ECQA 1QY4A 3NVCA 3A7QA 4FVVA 2VCBA 5IHRA 4XHBA 1O8SA 5LEJA 2G9FA 1A78A 3ILRA 4LBNA 4TZDA 2W1QA 1W8TA 4LT5A 1RINA 5FYYA 2OW4A 3PIGA 3WT3A 4A3XA 1C8M2 1PO12 2ZACA 3USUB 2JDYA 2RDSA 1Q8VA 3UYJA 2X09A 2XJSA 5EYXA 4L8QA 1R1A1 4GH4A 1X8MA 5DZGA 1HRV1 5IVJA 1QNWA 4W6WA 1HJFA 3O7OA 4CDQC 2CY6A 3PUQA 3W9AA 2B9VA 3M3IA 3T1MA 5KHHA 4HL0A 4MLOA 2BGCA 3D6EA 2O8OA 3B69A 5IUQA 3LEIA 4YG0A 4IEVA 4XURA 2P4EA 2WNEA 3CIHA 3U4SA 3BOWA 4Q0SA 4OFGA 1KXGA 1LOGA 5DMYA 1W9FA 2RMU3 3S0MA 3H42B 1PX4A 1TMF1 1NA1A 2AGSA 4N43C 4LEJA 3P1IA 3POYA 1UKGA 1PIV3 1VRH2 2RS13 4JKLA 4LBKA 4PI0A 4XTMA 5D8AB 3OGVA 1FT9A 3CO2A 4BQ3A 1YFYA 5IATA 2UU8A 2VE1A 4YZ5A 4D7TA 5FP8A 2AACA 3N9PA 1BEV1 1LEDA 2X5IB 2FDGA 3BGAA 4N53C 2XB6C 1SFYA 2ZCWA 3T4VA 3OY8B 4ZU7A 3C8XA 2HWB1 4ZHNA 4QQLA 1P8JA 1W8FA 5FZ0A 4CU6A 2E31A 3A23A 3HNYM 3LEMA 2VTXJ 4EZ4A 4WM8C 2PFWA 5LA0A 2K0GA 3QH7A 4YPJA 5A70A 1FMD1 3OBRA 3OD0A 2R30A 2B9UA 1DGLA 4YW3A 3NJZA 3CEWA 5FO7B 1BBT1 2ZGQA 4M4RA 4CE8A 5A7OA 1J83A 3PVEA 3VZMA 3RMXA 2XUMA 1XE8A 3JBG2 3PJQA 3MIFA 2WS92 2Y6LA 3PNAA 1HXS1 3FL7A 4Y22B 1AJKA 2IFRA 1A6CA 1QJU1 3OB8A 2I45A 2YFUA 2BVVA 5CADA 1GSLA 1LECA 4YZ4A 2BGPA 1CGPA 1SCSA 5F5AA 3SMHA 1Y9MA 2XOMA 2NP0A 3H3LA 3Q9OA 1W99A 4QX3A 5A6QA 3ZLIA 3OPZA 5JXJA 4CXWA 4AEDC 4GJZA 3RDIA 3ACGA 4UFKA 5C3PA 2PHUA 4OHXA 3KZ4C 1R092 4XQWA 1H1AA 2B45X 2BOIA 1JOPA 3Q8BA 3BTAA 2BGOA 4I30A 2QDRA 3J26N 3VKMA 3ZSMA 4L2NA 1Z78A 2J22A 1QU0A 5LATA 2N7GA 1RMU3 3BN6A 1YQCA 4GALA 1ZZ9A 1CAVB 3C7GA 2XVGA 3POGA 2L9LA 4RHV2 1AR63 3R0RA 4URTA 4BH9A 1OC1A 1X50A 4BQYA 1XSRA 4RR3C 2QZ2A 1LCLA 2ADEA 2OUHA 2AUYA 2DU1A 3IAPA 3OEAA 5CFCB 2QDNA 5BNOB 5JZGB 3GJAA 4CDXB 2R49A 5C3OA 2VBBA 2W92A 2XG3A 4JDNA 1OKQA 1TG7A 3AP7A 1OXCA 4LULA 2EXJA 3X29B 1MS8A 1W6OA 3PMSA 1LULA 4MG2A 3ZIWA 5FZOA 1SPPA 1WW5A 5IVYA 4BISA 1JHJA 3B93A 1JODA 5FXWA 3DN7A 4CCKA 1SHWB 5C9AB 1FPN2 1LENA 1KEXA 1X36A 2ZHNA 1ENSA 2AENA 3ATGA 3SEEA 1PIV2 3ZFFA 2RS51 3DYPA 3PURA 1PMIA 2YC0A 5CB7A 1BQPA 2XLFA 3JCIA 4JC1A 2VZPA 1NCQB 1UKRA 2LTNA 5HCBA 5IK8A 3S30A 4LA3A 1UOGA 4C8DA 4CCNA 1TQ5A 4FOVA 4IE6A 3B01A 4PQQA 1W6MB 2R1DA 3N9LA 4R4ZA 3ZN5A 5JR2A 4S2GA 3WW3A 5BUVA 3P6BA 1QGLA 4O7XA 1ZRDA 1TME1 5A80A 4QKNA 4CA9A 3BTZA 2DWRA 4GB32 1AR83 2DCJA 1HX6A 3HPNA 3KMHA 1SDDB 5J48A 3UK9A 1A34A 2VBPA 2W5FA 4AE2A 1QF3A 3V0AB 2UYBA 1UF2C 3DPRC 1WLTA 4DY5A 3DGTA 5T3NA 1JZ5A 5FBJA 4QXCA 3MIHA 2VMFA 4J1XA 2RDQA 3BYWA 4N53B 5FPZA 1VP6A 3ZSLA 1I3HA 2WJSA 4LE3A 5FZLA 2ZGMA 3AZWA 1UZZA 1CJDA 1S0CA 2Y0IA 2ZGNA 4XETA 5FJHA 3URFA 5FP9A 2BBVA 2A6WA 1FNZA 3VN4A 2HKXA 1CAVA 4GJYA 2IXIA 4CU8A 1UD1A 4Q8LA 3AMQA 2YYOA 3I3EA 1D4M3 2FZ1A 4P9XA 1ND3C 1O8PA 1B35C 1W2AX 3LOIA 5CZKA 1CX4A 3PU8A 4H55A 5CFCA 1OSGA 3M8LA 2AEYA 5JSRA 3DUIA 4K8FA 4OUEA 1DGWA 2FCVA 2AH2A 3WP3A 5IVVA 2G1MA 2HH9A 2J1SA 4B7KA 1GICA 5FREA 3EO6A 3CJIA 2JXAA 3LDRA 3KS7A 4QDRA 5BNOC 5JZGC 4IESA 1AR82 4BWOA 5CA6A 4AQ6A 1AR81 4JZRA 3K48A 2VNVA 2GNMA 3AFKA 4JRAA 4NPLA 4O61A 4FPJA 2E7AA 3UV9A 4XFBA 4BLJA 4Y1ZA 1W90A 5DN2A 2OVUA 1NY71 3U78A 1O3TA 1H9PA 3IWZA 2GALA 2C24A 1LHUA 1NG0A 3I3QA 4E4ZA 1POQA 4A7KA 3POBA 4HETA 1BK1A 3RYPA 2PHTA 3NL1A 2OQ7A 5C4WB 1DDLA 3NJVA 4XBNA 1Q5OA 3WW1A 2ZAAA 4WVWA 4LHKA 5JIUA 2EIBA 5E6HA 3VBOB 2YBPA 3ZN6B 1CJPA 4NIIA 2BQPA 4M00A 1Z7S1 4K20A 3GZTB 4GAZA 4YVWC 5FMDA 1NA1C 1XOYA 1XU2A 2RS11 4CEYC 2QZ3A 1QMJA 3N36A 3D0JA 3Q8EA 5IAVA 3FZ3A 1DG6A 3PIJA 4QHZA 4K7JA 3M4FA 2ZZQA 4JX0A 4ZY9A 1IPKA 2BW8A 3ZFGC 4FPGA 2W08A 2VXJA 3LQCA 5FOJB 2FQPA 4LBOA 4LKFA 4COWA 4LKSA 4CVUA 4XUQA 4IEZA 2CU5A 1RUOA 5HCFA 2RJKA 4NWWA 2OKXA 4AL9A 3OSDA 4YZ2A 4HSJA 3U1XA 3ZOIA 2VXRA 3N9OA 4LBLA 2MPFA 2P1BA 4YRDA 5FCCA 1AL21 5C8WA 3KT7A 4IXLA 1V6NA 3W59A 3MI8A 5GZEA 1AR72 4CP0A 3IIIA 1FNYA 2WZPP 3E5UA 1PIV1 1GZCA 3RJRA 1YYNA 4GKXA 1RIRA 5A7SA 5C33A 2DTYA 2VC9A 3INAA 1A3KA 4MHUA 5FUNA 1YFUA 1IKPA 2WQ8A 2VJXA 3KVAA 1OA2A 2AR6A 4MVTA 5EXOA 1S1AA 3WG1A 5A33B 4Q0UA 3ZXKA 5FPAA 2IXJA 2DVAA 1VMFA 4IERA 1O4ZA 4K40A 4D0QA 3K75B 3PHMA 4ISRA 4Q4W1 1QDCA 3M3EA 5L73A 2DVGA 3VDAA 5KWRA 4BQWA 4B4PA 1W9SA 3M2MA 4C1XA 2CGOA 4N43A 1BBT3 5LASA 4RGGA 3VBOA 1HDKA 3VBUC 4MX3A 2JKXA 3MEPA 1X7NA 1ZA7A 4TYSA 4Q4Y2 4WM8B 1RUC2 3KWVA 1NY72 4Y5Z0 2ZMLA 2WC2A 5E1RA 3JU9A 1VALA 3RPQA 2QQKA 1ZVFA 3ACHA 4Q1RA 2H6CA 5FFOC 3MDPA 1AR61 3PTYA 3ZM8A 4BQXA 5LK7B 1WGPA 5FZ6A 4NN0A 3KVBA 3NNMA 2LUWA 1OF3A 3JQWA 3P3NA 3HAGA 3TN93 5A1AA 4RSUA 4KWKA 1MVEA 3S5QA 3MIBA 4LHNA 1F9KA 3VB9A 5JLVA 2RS33 4PIYA 2FBEA 4HXCA 4WVZA 1HIXA 1UZYA 2HWC1 1XYPA 3CZJA 1C1FA 1S2BA 2B5HA 2NPIA 3AKSA 3EXUA 5F9TA 4QX8A 2CGPA 2Q4SA 1UPSA 4SBVA 3WCRA 3NAPC 5FPXA 2VOWA 3QCWA 1XNTA 2ZA9A 2D6LX 1LRHA 1OQEA 2GNBA 3FFZA 4QXHA 4ZXKA 1GMMA 3WY6A 4NHYA 3ZFFC 3MIEA 3WP5A 2A5ZA 2E7QA 3POIA 4KG0A 1LGCA 5FZIA 3VKNA 4XDQA 4CUBA 4F83A 5FXZA 1WUVA 2D43A 3R05A 4BQ1A 1OLME 3CMGA 3DKWA 3KF5A 1MS5A 2VMEA 1JYIA 1RVF2 4D69A 2D3RA 1V70A 3HMYA 3RQ0A 3KQ4B 3MW3A 1ZYBA 3LEGA 4P9IA 2WKKA 5CG9A 1IPSA 1NUKA 3MV11 4HPKA 3UGHA 3ZFEC 1LOFC 4PF5A 2ORXA 4R9BA 2Q8CA 3ZMNA 2X53S 4G3YC 4WM7A 1W8ZA 4MGSA 1AYM3 5D8AA 4YVSA 2OT7A 3KD4A 1YC61 5FZBA 4C1WA 2VW0A 2R063 4Z2AA 3U37A 2D3PA 2QNKA 3DPRA 2Q8OA 1GP6A 1VAMA 4LO5B 5IAXA 4XF4A 5DQ0A 4UFLA 5CFDB 1S0GA 2FCTA 2XBO3 4IQPA 1AR62 3W20A 4OI0A 1CQ9A 3SKJE 5A3MA 2FDFA 4R9DA 3AYCA 1W8WA 4W4ZA 4XABA 3LSEA 3S6PA 4DPNA 2NMOA 5FOBB 2JDNA 1OHFA 1DLCA 3AC0A 1VMJA 2F6BA 1O7FA 1PZ8A 5IVEA 4AFMA 3T3YA 4ONUA 4KU8A 1CONA 4PDWA 4CDWB 1MS9A 4RGAA 1UU6A 3LCPA 1HQNA 1WBLA 1TNFA 3O5SA 2VNOA 3PDQA 1RVF3 4XC9A 2X29A 5HXMA 5K8SA 1AX2A 5KHJA 5KHGA 4QPGC 3ELNA 5A6XA 1HRI3 5KHIA 1O4YA 2JB8A 1H2MA 1W6MA 5C9AA 5IYYA 4W6YA 1LOEA 2RM21 4M3CB 2ZHLA 3VZLA 3PUSA 4LIVA 2QJVA 3LDKA 1DZQA 4XF9A 1J3QA 3TEXA 1H1MA 1NCQA 3AP6A 1O59A 4GZ9A 1QXJA 5FZDA 5L9BA 4LMFA 5GLZA 3JZVA 1C8M1 4IETA 3ILFA 2K46A 4GWJA 5FPBA 1US2A 2HBUA 2Q1MA 2QQIA 2WWJA 2XHKA 3THCA 3CHXA 4XF1A 1VBA1 5JXIA 2C9KA 4TLGA 4EN0A 3PTRB 1WCDJ 3LPGA 2VZVA 3P3PA 3VBFB 5D1IA 3Q8CA 3MFAA 5FPLA 1ZZ7A 4B8EA 5IVFA 1AX0A 5C6CA 2WT1A 5J36A 1YI9A 1Z7S3 3DYOA 5BNQA 4OQ8A 2R16A 3V64A 1CIYA 4K21A 4YW7A 3C7EA 4IE5A 5FY7A 4N53A 2BBAA 3ZFGB 5KC5A 3HIFA 4Y24A 2VAUA 4ATFA 3AJYA 1WA4A 1OH3A 2WNOA 2VVDA 2UWCA 1QJFA 3LF7A 5FLHA 1L7LA 2W46A 1OA4A 4Q27A 4UW3A 2Y6KA 3M3QA 4FOYA 3BALA 2ZKLA 2Z4FA 4NIGA 1ND3A 4H14A 3LD8A 3DF0A 5T55A 4AEKA 1NLSA 4U2AA 1XNKA 1AVBA 3ALQA 4PLMA 4ASMB 3IT8A 3LOBA 1PK6A 1C3HA 3I3MA 5DXDA 3I2FA 1QIQA 4NWVA 4E27A 3RZLA 1U12A 3BB6A 2VECA 3TRSB 1VB2A 4YW6A 2Y26A 2WZR2 3FBYA 4N7IA 3RZHA 4EQVA 1D4M1 3QACA 5IK4A 1JXNA 5LBCA 3ITQA 4M01A 1UWWA 2P17A 2WO1A 2DV9A 4AEDB 5FZ3A 2DUOA 3IAQA 2X5IC 5T50A 2EXHA 4LJHA 1O5LA 1VBC3 2OPWA 4HONA 3ZMOA 1AYM1 1F4HA 4A7YA 4WM8A 1PHMA 1MZ6A 2P3IA 3MFCA 3WSOA 3ZFEB 3VDCA 1H0BA 2JEMA 4MGQA 3ZN6A 3KCYA 1QEXA 1H6YA
chains in the Genus database with same CATH topology
1YRZA 4EN6B 2E51A 3MYXA 5LRRA 1ZZCA 1VBB3 1VB4A 1GQHA 2R073 1IS5A 3FHIB 4QHBA 5JIAA 5C8CA 3VBUA 3WG4A 4XJZA 1BKZA 1DQ1A 3GNEA 4FPFA 3WQ1A 2ZGOA 4AHZA 3AYDA 1CAWA 1EV11 2CL2A 4DINB 4LLFA 4UBGA 2YV8A 3FX3A 1CAWB 4PIXA 5J7MA 1JOJA 4HT1T 3K51A 3MLKA 5BPXA 1D0HA 3ZXDA 2UURA 1Q43A 3J8F1 3J8F2 1R1ZA 3NW4A 3AYEA 2O1QA 3VKOA 2YROA 2RJLA 4Q8KA 3L2HA 4Q4Y1 4YYOA 1GNZA 4HVRA 1VLNA 1RUG1 2GH2A 1R083 2JG9C 1PVC2 2YDEA 4NOTA 1FV2A 2GC2A 5J37A 4KBBA 4QQOA 1WLWA 1XNDA 3NAPA 5F6LB 2PHXA 2VNRA 1GYKA 1R081 1F31A 3WDWA 2VOKA 4IEYA 2Q30A 2A3XA 4Y1YA 4DXZA 4GULA 1W6PB 4A2UA 1WMDA 1ZRCA 4DRRA 1HQLA 4L92A 3VHOA 2QKDA 3E6BA 1REDA 1DQ2A 4AFDA 2RS31 2R043 2B46X 2PLV3 4FPHA 4ISQA 5CFDA 3E5QA 2O8QA 5KC6A 4K1YA 3TOJA 2TEPA 4CDXA 3WG3A 1ZM1A 4YVSC 1CAXA 4W65A 4MYEA 1KFUL 3N7JA 3GBWA 3SH5A 4PDWB 2E63A 4BOWA 4CEWC 3WP6A 1ZBE2 1I1EA 1FYUA 1N47A 4M0NA 4L99A 4BYYA 2VW1A 4BM8A 5BNPB 4FAHA 2VPVA 1AHSA 3FUOA 3L9JT 5L36A 3TYJA 1V6JA 2VQAA 3ZDSA 5LEKA 4GB33 2H0BA 2RS32 4LE4A 4GWMA 2DCTA 3O14A 1RB8G 4FPEA 2AZ5A 2HWF3 1I9RA 2VULA 5EJ3A 3ROUA 2UYAA 2XVKA 1QHDA 1OLRA 1A8MA 2ZGKA 2ERFA 1F5JA 3AYAA 4XFFA 4OHWA 4AVSA 3V0AA 4JGZC 3VBSA 5DDJ2 1VBA2 2TUNA 3HQXA 3WUDA 1RUF3 3WHTA 2YPJA 2RS53 2A71A 4P14A 3GYDA 1B35A 2HWD2 4UW5A 1VBB1 2PHWA 3H9AA 4FOWA 2XGXA 3FJSA 1D2SA 4YVWB 4AQSA 3BODA 5DZFA 1B35B 2AYHA 2HWB2 5D8AC 1H4HA 3ACLA 4CDWC 3AMNA 2GAUA 1OOPA 1EY2A 5FQ0B 4GXLA 4WZFA 3EBRA 4W6XA 3O0VA 5LRSA 4C91A 3WP4A 5JI7A 4HSLA 4MH0E 2UY9A 4FTEA 4LBJA 1HW5A 4E2SA 1D0GA 2ZX1A 4KQ7A 2WIIB 2HWC2 2VVEA 4LBMA 3AXEA 4Y20A 1RGSA 1ASJ2 1LHWA 3AKPA 4FPOB 1G8WA 4HN0A 3TAYA 3RJ2X 4CEYA 5A3LA 2WLQA 1NXMA 5BNNC 3VBFC 3BIWE 1UMZA 1LHNA 3JBG3 2SBAA 2XBO2 4FXKB 2BTVC 3V65A 5JR7B 2MNGA 4FOQA 4P9WA 4XE9A 3JD73 1ULDA 3VBUB 4U36A 4AFCA 3SXWA 3WDXA 4JGZB 5E88A 1ASJ1 1APNA 5AC91 1Y7BA 1FMD3 4FSJA 3KT4A 4I09A 1LR5A 1DZRA 4CDUC 4Y26A 1SLAA 5BYNA 1H8TA 1RUH3 2D5FA 3BCWA 4EWAA 3ZSEA 4PBOA 2BFUS 1RITA 3FE5A 4GB31 3VBHA 4EN7B 3HD8B 1FOD3 1PK6B 1HRV2 4Q4X1 5ACA1 3S7EA 3JQXA 4P9YA 1FPN1 1FV3A 2EF6A 4QGLA 5JPMB 2BWCA 4IEXA 1F8VA 1RUE3 2YZ4A 3NAPB 1SCRA 3SHRA 4Q4V2 2VMIA 4YM1A 1UAIA 4QM9A 5SV8A 2VQ0A 1ULEA 1IS6A 5T5OA 1QQP2 4DQAA 4QM8A 4AVVA 3PVOA 3R4DB 3WINE 2EXKA 2WT2A 1OFSA 4H3WA 2YXSA 1AL22 4PJYA 4HKOA 3MZHA 2VVFA 2RS52 4RD7A 1X8EA 1R1A3 2V09A 2KM2A 1C5IA 3SITA 4TSVA 1KS5A 2ET1A 4XIKA 4AHYA 3USUA 1IS3A 3THPA 1GR3A 5JMCA 2R32A 3H3ZA 5BNPA 1R082 3AZVA 4KNCA 4YSFA 3NO8A 4FP2A 2UWBA 1R091 2DUPA 1IGOA 2WS93 4QPIC 4EWDA 4ZU4A 4AVBA 2D93A 3OGJA 1POV3 4NPRA 4CDUB 4M0HA 4INDA 2WS91 1BYHA 2EA7A 4YGDA 4YGCA 3SCHA 4QU2A 1H2KA 2Q0AA 2WT0A 3L2YA 4XIOA 3NV2A 5EZWA 4MZUA 2GH8A 4QPGA 5FMOL 1SMVA 3KGZA 1EV13 3AM2A 2XJVA 2WFF3 4FT8A 3VBSB 1PVC3 4HK8A 4WVMA 1YI7A 1ND2A 2C9AA 3LGRA 1PZ7A 3GBGA 1H2LA 4PBPA 4LLOA 5FLJA 3HT1A 4XQDA 4Q0VA 2ZGPA 1DQ5A 1MACA 4OI2A 4RS5C 1RMU2 2WWSA 1Q8QA 2ZKNA 4RHV3 1WD3A 5C4WC 4DY3A 2GN3A 5FAXA 4FO9A 4IV3C 4ATEA 2GMMA 3VLBB 1OPMA 2QVSB 1RUNA 3N3HA 3VV1A 3ZYPA 1ULFA 4BIOA 1GFF2 5K0UC 1OQDA 2LM3A 4MGYE 1W6OB 1MQTA 2WFF2 2HWF2 2WNUB 2NM1A 2WFF1 1NCRA 1FPN3 3JUUA 2Y0OA 1CD3G 1BEV3 5KXDA 1UL9A 4CP1A 2XWJB 1H30A 4LBQB 4Y20B 4H7LA 2JE7A 4XJWA 3A0KA 2MHFA 1ALYA 3U11A 1YNAA 2A73B 2VW2A 3M3CA 4LR4A 1LU2A 1SLTA 3CJXA 4JCKA 3B94A 4QQHA 4YW2A 1B09A 2RMU1 1J1LA 1URXA 4META 2O0OA 2WNVB 2PAEA 4COUA 4COZA 2ZPXA 1OA3A 1NQDA 4D7SA 3VBOC 4BA6A 2ES3A 3ZSKA 2DFCA 2RHPA 3VZJA 3H3UA 4JGZA 1BVVA 1BCXA 3DPRB 1AR71 4J1WA 3WD5A 1RUC1 1K5MC 3D4KA 4YG3A 4MUVA 4TWTA 2P3JA 5L7OB 2P37A 5T5PA 4M3CF 3R6SA 4LBQD 2A3YA 3GALA 4IV3B 1RUG3 5I0RA 2NN8A 3LZZA 4FP3A 4IV1A 3T2TA 1WW6A 1HRI2 1PGW1 2HWD1 1UCXA 1NCRB 5AVPA 5BNNB 1Q3EA 1IS4A 4OI4A 2E9QA 4EJRA 1FOD2 3ZYIB 5KHKA 3D82A 1LU1A 3PLQA 3O0WA 1PO13 2RMU2 1QKQA 1DQ6A 1YO8A 3AP4A 2FMDA 1NZCA 2ATFA 4YW1A 3I59A 4YW5A 1OMIA 3ZFEA 4XEZA 2MEV2 3VHNA 4YM3A 1CPNA 1EAH1 1QJU3 5J98B 4ES9A 4QGNA 4UXAA 1KDKA 4MGKE 3E97A 1MS3A 1TMF3 1XXNA 3OD4A 2IZWA 4QD2A 1H8TB 4XF3A 3AP9A 5T5LA 1N3QA 2ZX0A 5JAXA 5FO9B 2CWSA 4XHXA 1EV12 4DB5A 1KD7A 4J6GA 5HXVA 4XJ8A 2TNFA 3WQ7A 1W2UA 1QXRA 4CDUA 1V00A 1BBT2 3MW2A 4RL7A 1F2NA 4NO4A 2D98A 4Q29A 5BNPC 1AZDA 2R071 4IV1B 2Y38A 1ND3B 1AL23 4B29A 2RR11 1QJX2 4PLOA 3ME2A 5H9PA 1HLCA 3KQRA 1VBE2 1XQNA 1UPIA 2V5YA 2CAVA 1Q56A 3N35A 3DV8A 4Q1PA 2D6OX 5AVAA 1SDWA 1YUDA 3FLPA 4CEYB 3A0NA 4P9LA 2R0FA 2WFPA 4NVPA 4AEMA 1DYKA 4K9SA 4FQZA 2XBO1 1KITA 1AYM2 4HN1A 2GZWA 1WBFA 4I3PA 4WVVA 4E4SA 4XXPA 4BIFA 4I3GA 3WOGA 3H7JA 1MS0A 4ORFA 3ZXLA 1U5ZA 1LEMA 3TWIA 1J59A 1GKBA 4KH9A 2VNGA 5LK5A 4D3WA 1LHOA 1MZEA 3VZKA 2VH9A 4GA9A 1XYNA 4AI8A 3NV1A 4GIQA 4PQ9A 2PAKA 4AWDA 1TME2 1OOPC 2RM23 3C3VA 1N1YA 3SH4A 3VDDA 5CAZA 4YZ3A 1KRIA 4GMP1 1YIFA 1PZ9A 3APBA 3OF1A 1AR73 5SV5A 3MGUA 2GC0A 2VGDA 3R4SA 1V6MA 2BUKA 4GMP3 1N3OA 5E89A 3DL3A 4FAGA 3AMMA 1BMV1 3G6JB 4QPIB 4CDQA 4QGMA 1RUI3 2ETEA 1REEA 3ZXAC 2H6BA 3SNMA 3NV4A 2ARXA 5B2GB 1WMFA 1D4M2 4XMIA 2BPA2 3NSTA 3CJIC 5H9RA 1ZBE1 1BJQA 1ENXA 4CYDA 2PLV2 1C28A 2I07B 2JE9A 3BU7A 3SH3A 2ZBJA 1UU5A 1NA1B 2R062 4FCAA 1RUD1 4LO6B 4KGGA 4G9SB 3POWA 5DUXA 3M3OA 2K2SA 2PHLA 3IM0A 5GJ6A 4QT6A 5HBAA 1Q8PA 1ZRRA 1BXHA 3ZX7A 3VBRB 1CAUA 4Y4YA 4K6BA 3WV6A 4R8HA 1O3QA 4XJUA 1QJY1 1WW7A 4ZKTB 4MGZE 3B3QE 4H7MA 5KXCA 1EPWA 1SFNA 1D2QA 3VBHC 4AVCA 1AL0G 3VDDB 2A6VA 4N90A 2JG9A 1C57A 1YLLA 3ES4A 4HLTA 3S7IA 2ZMNA 3HN1A 4Q4V1 2VY0A 2XLAA 3D8CA 5H9SA 3TN92 2DFBA 2NMNA 2FMYA 4L97A 1SBFA 1WLCA 3AB0A 1JBCA 2HWE3 2PELA 2CGNA 2D44A 1QXPA 4HPKB 4XBQA 2DU0A 1RUC3 2QFEA 2OYZA 4HKLA 2Z79A 2D5HA 2JG8A 1V6LA 1SLBA 5DUUA 3WQ0A 4N7UA 3ZFGA 2GC1A 1SACA 3MPBA 5FLIA 1CESA 3JB4C 1VBD3 1ZZ6A 1COV2 3I8TA 4LTAA 2JG8B 4XYXA 5JVVA 2B8MA 3ZYRA 3TN91 1UN1A 4X6QB 1PGL2 1TMF2 3TNPB 3ASIA 1S0DA 2KXLA 1MEC1 2JDZA 4XMAA 5A32A 3M7AA 3FLTA 1RTVA 3KT1A 1FAYA 4FPYA 2E53A 4OUMA 4FPCA 4OHZA 4MXVA 2GMPA 2JG9B 1AR92 1V9U3 1Y9QA 2XVLA 4AGGA 4JV4A 2G9GA 1QOTA 5GM0A 2WA3A 1S0EA 1PO11 1O91A 1H1IA 4HFSA 3H1MA 2WINB 5DDJ1 2PHFA 1WMEA 2A3WA 1ZBA3 1LGBA 4RS5B 4JGYB 1VBB2 5IK7A 1VIWB 2XJRA 3E6DA 1N1SA 3NWKA 2EALA 2QUOA 2BNNA 5CG8A 4CZSA 3W58A 3GF6A 1Q8OA 1G9DA 1QH7A 2R0HA 1N3PA 3OGGA 2R6QA 4FXGB 3RMYA 5L19A 2WQZC 2DCKA 5J96B 1QDOA 4X8PA 4HBNA 4ZU5A 2D3SA 2HYKA 3ZN4A 3N7LA 3NKGA 2IXLA 3ES1A 1ZREA 5CFCC 1RUD2 5FO8B 2RS12 3CU7A 1HXS2 3EJKA 1KFXL 1O4TA 4NHLA 1NXD1 3VZOA 4WVMB 4RA0A 4P5HA 3CNAA 4YZ1A 1S0JA 2XJUA 1QNYA 3VKLA 5KXEA 1A8DA 1QJY3 2ZGRA 3IN9A 3MPPG 1W6NB 4DOUA 2YY1A 4EN9B 1G6NA 4C0BA 1AXKA 3WG2A 1MQTC 1FATA 4NR1A 2RR13 1C5HA 1HKDA 3IKWA 1BEV2 3UKTA 1G9AA 1QJU2 3WZ1A 1QOSA 3FLRA 2C0ZA 1CAUB 1ZZ8A 4LA2A 1Z0HA 3AKQA 3I7DA 2OPKA 3O12A 2HWE1 3FFQA 1I6XA 2HEWF 3AKRA 4NHKA 3H1WA 4PDWC 5HI0A 4HZFA 4HMZA 1ENQA 1YFWA 2GNTA 3H7YA 4L9BA 2IFWA 4YM0A 2ZHKA 2ZGUA 1Z7S2 1WCKA 2R072 2HEVF 1RUD3 2GMEA 3AZXA 5GZDA 4BHPA 3CJIB 1BVP1 2C5DA 5I8YA 4XFHA 5T54A 3FUQA 2YMZA 3BOPA 4AK3A 3RNSA 2ZZJA 1E57A 1VBC2 2A6YA 5DDJ3 4COYA 1S55A 3UKVA 2HWF1 3RYKA 5DUWA 3GZUC 5A33A 3V0BA 3B9CA 2ZOEB 4OZXA 1AYN2 1GBGA 1QJY2 1RL3A 2HEYF 5E8AA 1WW4A 4JTNA 1ND2B 4D94A 4Q26A 3VBRC 3FMGA 1M4WA 3IPVB 3H50A 1LKNA 1DLLA 1PNFA 2TBVA 2SLIA 2BEOA 2C1FA 4AHWA 4E2QA 2BWAA 2JG8C 1RUJ2 3EQEA 2B39A 1VBD1 2DF7A 1O3SA 2WQ4A 1ZBE3 1MR5A 2XL9A 5TSWA 4FPKA 3WW4A 4LBQA 3FC0A 1LHVA 4YFZA 2NYYA 4IL7A 1GQGA 1KJLA 1R1A2 4AI2A 3R4UA 5C8CC 1EAH2 1KJRA 3B5LB 3LA2A 2PTMA 1DYPA 2H0VA 3OBTA 3KSCA 4OULA 4Z07A 4Z82A 1IKQA 2WLPA 4Y1VA 3WW2A 2D7FA 5JOWA 3N4MA 1C1LA 5GLVA 1RJ7A 5I0UA 4BPZA 1U5XA 1HV1A 4EROA 1BZWA 1JH5A 3AK0A 3I54A 5GKAC 2BYVE 1YJLA 5I0SA 2B42B 3PMEA 3WDTA 5EFUA 1CPMA 1QH6A 4BE3A 4N9HA 3D0SA 3MLLA 4E9KA 2W39A 4KGQA 4E4DX 4XOGA 1HQWA 3V56A 1DHKB 4DRVA 4O9GA 4OUSA 1QQP3 4S2DA 1T6GC 1VBD2 5GALA 3PVNA 2V73A 1J1TA 3OYWB 1FI2A 3KCXA 4AI0A