3WCRA

Crystal structure of plant lectin (ligand-free form)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
235
structure length
229
Chain Sequence
ASQTSFSFQRFNETNLILQRDATVSSKGQLRLTNVNDNGEPTLSSLGRAFYSAPIQIWDNTTGAVASFATSFTFNIDVPNNSGPADGLAFVLLPVGSQPKDKGGLLGLFNNYKYDSNAHTVAVEFDTLYKPRHIGIDVNSIKSIKTTTWDFVKGENAEVLITYDSSTKLLVASLVYPSLKTSFIVSDTVDLKSVLPEWVIVGFTATTGITKGNVETNDILSWSFASKLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Erythroagglutinin
publication title Phytohemagglutinin from Phaseolus vulgaris (PHA-E) displays a novel glycan recognition mode using a common legume lectin fold
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 56
structure length 229
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wcrA00
2YROA 1FNZA 1UX6A 2B7YA 1CIWA 2GDFA 1F31A 1AZDA 2GNTA 3WZ1A 1CR7A 3WG4A 3MW3A 1OFSA 1GYKA 1QOOA 1SBDA 3AJYA 4Y22A 5H9RA 1H9WA 5GZGA 1WD4A 4M3CF 2A71A 3AYAA 2ZABA 3RS6A 4XMIA 4XHXA 2GNBA 4FPFA 3WDWA 1W6QA 1S0DA 4TYSA 1CONA 3IKWA 2DV9A 3BODA 4P9WA 1KQRA 4WVWA 1W6NB 1UN1A 1ULEA 1IKQA 4M3CA 1Z78A 1NXD1 4FOYA 4YW2A 1W0OA 5JOYA 3FBYA 2ES3A 4FOQA 3WUDA 1GSLA 2PHXA 1Q8VA 2OW4A 3N36A 1ENRA 1Y7BA 2R1DA 4XXPA 4AWDA 2ZGKA 4LBQA 5IT6A 5T5OA 1UPSA 3N3HA 2JE7A 4RL7A 4DRRA 4XTMA 3DGTA 1C1FA 1AXZA 4W65A 2YY1A 2YZ4A 3C2UA 4P9YA 3VKMA 4CZSA 5IK7A 2WLQA 2DVGA 3B69A 1RINA 4UW4A 2YXSA 3FLRA 3OYWA 1IS5A 3RMXA 3W59A 4Y20B 5JMCA 5GALA 1Q56A 1JOJA 2ENRA 4FOWA 2JDZA 1AX1A 3IPVB 2EXIA 2YMZA 2ZZJA 1SLTA 1MS4A 3N7MA 4XIKA 3IMNA 3O0XA 4XOGA 2GALA 2DVAA 1GANA 4XIOA 2CYFA 1GKBA 1JYCA 2R0FA 3B9CA 4RA0A 1V6KA 3JU9A 5SV8A 1LOFA 1N3OA 1LCLA 3AXEA 3ZSJA 4AGVA 3V0AA 1YIFA 4Y20A 1WCSA 5FREA 3OBRA 3WVJA 1N1SA 3IM0A 3RQ0A 3POSA 3ILFA 1W6OB 2A7AA 3FUOA 2AGSA 1G7YA 1MS5A 2PHFA 1MACA 2WJSA 3LCPA 4XXAA 3WNXA 4HANA 1ULCA 3IN9A 4D69A 3WDVA 1JYIA 1G9FA 1WBLA 2WKKA 3WCSA 2A6XA 4BQ1A 1S0FA 2EAKA 1N1YA 2DYCA 4DS0A 2WT1A 2NM1A 5IK8A 4MYEA 5E88A 3NV2A 5HCAA 1LOGA 4NOTA 5AVAA 2P3KA 1G9DA 4KBBA 2GMMA 2EXJA 1KJRA 3ENRA 1SFYA 3PVOA 3NV1A 2D6MA 2JD4A 4YZ4A 4I30A 4XTPA 3SITA 4FPCA 3RMYA 1AX0A 1JUIA 2R16A 2RHPA 2R0HA 1MS1A 2A6VA 4NO4A 1G9AA 3FLPA 3OY8A 2CL2A 3QLQA 3WOGA 3AXDA 1WW4A 3N35A 2AH2A 3M1HA 4ISQA 4YLZA 3INAA 3V0BA 4BLJA 1FAYA 2NMNA 4GKYA 2ZHLA 3WG3A 1VAVA 3VKFC 2A3XA 4CTEA 5JOXA 1WLDA 5KXDA 1S0EA 1SACA 1LEDA 3R4UA 2W08A 5GLUA 3B3QE 1LHUA 5GLVA 1CPNA 3VUOA 1HDKA 2XG3A 2LALA 3GALA 1WLWA 2NP0A 1SLIA 2ZGRA 1N47A 5CB7A 2DTYA 2ZGSA 2GMPA 3ILNA 5L73A 2I2SA 4DFSA 1QNWA 2HYKA 4P14A 3PVNA 4Y1VA 1LTEA 3U4XA 3A0NA 1LOEA 2D44A 1H9PA 2ZBJA 3O12A 1V6OA 2LTNA 4FPEA 3ZSKA 2OUJA 1XQNA 1QDOA 2VY0A 2W39A 2W52A 1LULA 4U36A 2E51A 1DLLA 2DURA 1LHOA 1A8DA 1UZZA 4L8QA 2BQPA 2ARBA 1MZ5A 4ITCA 4XJAA 5CAZA 4BMBA 2EIGA 4TZDA 4UW3A 1LHWA 2A5ZA 2PHUA 3LSDA 3M2MA 4XJ9A 5DZFA 1JHNA 4GKXA 1DYKA 2EXHA 2DVDA 2ZGNA 1WUVA 3ILRA 4YW5A 3ZXKA 1S0BA 3N7KA 3TB0A 3USUB 3ZXJA 4DQAA 3VKLA 1LESA 1LOCA 5E8AA 4LBMA 1C57A 1ULDA 1YO8A 5HCBA 3WDTA 1SBEA 4FPYA 1WW6A 4K1YA 3R4SA 4XBLA 4R9BA 2WT0A 1LOFC 4Q27A 3HR9A 3AFKA 2FMDA 1R1ZA 1W6MB 3DUIA 3AP5A 3O0WA 4YGEA 3M3CA 1V6IA 4LBNA 3AYEA 2AENA 2ARXA 1MS8A 2CNAA 1MR5A 1VAMA 1LU1A 3AX4A 5GLZA 4FQZA 1GLHA 4PBOA 3SH5A 4ATFA 2WSUA 2ZA9A 1ENSA 1QKQA 1LENA 1DQ4A 1HQWA 1DQ5A 1FV2A 1V6NA 2DU1A 3WDYA 4DRVA 3L2YA 1LEMA 1W6NA 2A3YA 2DU0A 2VW2A 2P2KA 4Q2FA 2KM2A 5KXEA 5CA6A 1MZ6A 2UWAA 5H9QA 5FRAA 3SH4A 1LECA 1YRZA 1A3KA 1DFQA 1V6MA 1GV9A 4XE9A 4XMAA 5JVVA 3LSEA 1SLAA 1D2SA 1VALA 1UMZA 1KJLA 3BIWE 4R9CA 4WVVA 3ZVXA 2VW1A 3WG2A 1GZWB 4Y24A 2PHTA 1AF9A 3AZZA 1URXA 2DVBA 2ZGTA 3WCRA 1OQ1A 3H0OA 2AYHA 3AJZA 1DQ6A 1IS6A 3WV6A 4K21A 2DVFA 4FOVA 1C1LA 1JN2P 1LOBA 2UU8A 3AP9A 4LBLA 1FX5A 5EWSA 1LOAA 5T5JA 3AZVA 1S1AA 1D0HA 3NV3A 1JXNA 4YZ3A 4UW6A 5JOWA 2E7QA 3IPVA 3SISA 1AJKA 3OPZA 1AVBA 1IOAA 1UL9A 4FPLA 1ENQA 2V73A 4YGBA 4OZXA 2D7FA 1RIRA 1SCSA 3T1MA 5IK4A 5JDBA 5DUVA 4M00A 4LBOA 1CQ9A 1BQPA 1SLBA 3UK9A 1PZ7A 1CN1A 1CPMA 2P34A 2D43A 1PZ9A 3MW2A 1W6OA 2GNMA 2AUYA 3ATGA 3O0VA 4ATEA 4FQ4A 1MS3A 5T52A 1BKZA 4R9AA 1UKGA 1NLSA 2GN7A 2SBAA 4YW4A 4YZ2A 2E7TA 4ZXKA 4YG0A 3AYDA 2ERFA 5DUUA 1FATA 2ZHKA 4YM1A 4LBQD 1Q8SA 5T5LA 5GLTA 1F9KA 4YFZA 4FP2A 4Y1XA 1OKQA 1LGCA 2Q5TA 4Q8LA 1G9BA 4SLIA 4Y1ZA 3FFZA 4LBJA 1QGLA 2NZ9A 1SLLA 4XHBA 3WLUA 1WBFA 4FPJA 2C9AA 1LGNA 5DZEA 3D4KA 2NMOA 2CY6A 2JE9A 2VW0A 4AYUA 1GICA 3HN1A 1DQ2A 3OGGA 1WLCA 1FYUA 2JKBA 2A3WA 3M3OA 1B09A 3APBA 5GLWA 4AGRA 1GBGA 4YM3A 4YZ1A 1W6PB 2PHRA 2UWCA 5GZEA 1BYHA 1SLCA 3MPPG 5GZFA 5DG2A 3HMYA 1S0JA 2ZAAA 3MW4A 4FPHA 3AP7A 4BM8A 5KXBA 2PHWA 1DGLA 3M3QA 5H9PA 1I3HA 2D3SA 2ZKNA 1YI7A 4Q8KA 1ZA4A 2GMEA 2A75A 4Q26A 4YGCA 2GNDA 4U2AA 4F83A 5DG1A 1PZ8A 2AREA 3N7JA 4CRQA 1C4RA 1X50A 3KM5A 3SH3A 4YW1A 2EXKA 2A70A 4YG3A 5GZCA 2DUPA 2ZMKA 2ZGPA 1KDMA 4JCKA 1WW7A 5DZGA 5CBLA 3ZXFA 5E89A 4LBKA 4XILA 3GNEA 2D6OX 1KDKA 4ZKTB 4JRAA 1LODA 3VKOA 1AXYA 4FPKA 3NWKA 5EYXA 1Z0HA 2JJ6A 3QCWA 2H0BA 2DUOA 1BXHA 4HL0A 1UZYA 2ZGMA 4Q1RA 4Y22B 5DUWA 3ZXLA 3PVEA 2P37A 3UJQA 1GZCA 3CNAA 1EPWA 1DQ0A 1CVNA 2R1BA 2V5YA 1N1TA 3O5SA 3ZPYA 2ZMLA 3ZYPA 3Q9OA 2G4IA 2ZHNA 5EXOA 3WHTA 1U0AA 4FPOB 1FNYA 3USUA 3TAYA 1VIWB 4YZ5A 2NN8A 4BPZA 1QF3A 3AZXA 3WUCA 2VXRA 4M3CB 1S0CA 2CWSA 4YGDA 1VLNA 4AVSA 1UAIA 2TEPA 5HCFA 1QU0A 1G9CA 3WHUA 1AXKA 2ZACA 4Z8BA 3V64A 2VU9A 3RSJA 1I1EA 1QOTA 1S0IA 1DQ1A 4DPNA 1W6MA 4LBQB 1S0GA 3AP4A 3AYCA 3V65A 3A0KA 3A4UA 2DUQA 1MS9A 4BMEA 3POWA 5T5PA 3PMEA 1MS0A 3R05A 3ZYRA 1G8WA 3OYWB 1LHNA 1TEIA 1O4ZA 4AVVA 4XYXA 2WT2A 5F9TA 1LU2A 2E6VA 2OVUA 5JOZA 4WV8A 1ULGA 3ASIA 3KQRA 4GXLA 1AJOA 4GA9A 2A6YA 1N3PA 1QOSA 3POYA 2VUAA 3PJQA 4BOWA 3FLTA 2E53A 1GZWA 1YXWA 4XZPA 3V0AB 1A78A 1ULFA 2P3JA 2EF6A 1AX2A 4AGGA 2W68A 5GZDA 4R9DA 2Z42A 5KXCA 1DBNA 3B01A 1DIWA 4XJZA 3RRDA 4P9XA 1N1VA 2SLIA 2ZGOA 2EALA 4M01A 3T1LA 2ZGUA 3I4IA 1MVEA 2C5DA 1Q8PA 1APNA 3WDXA 1LGBA 4K1ZA 2DTWA 4Y1YA 3ZSLA 4PQ9A 2D3PA 4FVVA 2A6WA 1FV3A 2WQZC 4YFWA 3AP6A 1CJPA 2D6KA 1YYNA 3D5OA 4PF5A 2AR6A 4XDQA 4JC1A 4Y26A 5GM0A 1SBFA 1W0PA 5CNAA 1GZ9A 1GNZA 4WZFA 5DUXA 4XBNA 4FPGA 4YM0A 3OBTA 1HKDA 3OY8B 4C1XA 3RG0A 5IUQA 4C1WA 3BTAA 3AZYA 4Q1PA 3ZXEA 3V0BB 1GNHA 4M3CE 2R49A 1IS3A 2WSVA 5IK5A 2FHRA 3M3EA 2WNEA 2GN3A 1DYPA 3AZWA 3N7LA 2DWRA 2ZMNA 1DZQA 2NYYA 1LHVA 3UJOA 3B00A 3ZSMA 2JECA 2ZHMA 4AVTA 2VH9A 1DHKB 3W58A 5EYYA 2CTVA 2PELA 4XJUA 3SLIA 5BYNA 2UWBA 1O4YA 4PCRA 1HQLA 1IKPA 5H9SA 1ONAA 2UURA 3WDUA 5LK5A 1QDCA 1ZM1A 1LJ7A 3UL2A 3SNMA 1W6PA 4XBQA 1G86A 1N3QA 2ZGQA 1IS4A 1F5FA 1V6LA 2D6NA 1WW5A 1BJQA 3D6EA 4Y1UA 1Q8QA 4FP3A 1V6JA 1QNYA 4YW3A 3JUUA 4IQPA 4GWMA 4H55A 3WG1A 1KITA 3VKNA 1KRIA 4UW5A 1H30A 4XJWA 3FUQA 4ASMB 1J1TA 4K20A 3NV4A 5T54A 4GWNA 2OUHA 4XJ8A 3T2TA 2CWMA 2P3IA 1SCRA 2D6PA 4ISRA 1Q8OA 2XB6C 5JLVA 2YV8A 3MEPA 2D3RA 1RITA 1MVQA 1WD3A 5T50A 1QMJA 5DXDA 4PBPA 5T55A 1CESA 2ZGLA 2D6LX 4GALA 1BZWA 2A6ZA 1JW6A 3BOPA 3I8TA 4YG6A 1V00A 5F5QA 3AK0A 4YM2A 5GJ6A 3VV1A 1JBCA 1W6QB 1HLCA 3OJBA 4BLIA
chains in the Genus database with same CATH superfamily
1X33A 1FNZA 2GNTA 1CIWA 1O8PA 1F31A 2Z79A 3TEXA 3AMNA 3EB7A 4IEVA 3BVCA 1RMU1 4KGQA 1DCSA 1D2QA 3HBKA 5A3MA 5H9RA 1VBD1 3K3OA 5L7OC 1WD4A 2BWCA 1ND3C 2QE3A 2QFEA 4HN0A 4Y4RA 2GNBA 2CSGA 3IKWA 1W6NB 1W8OA 1NG0A 1IKQA 1AYN2 4ZU5A 1BHGA 4BQXA 1Z78A 3H8UA 5FZBA 1ZRFA 4YW2A 4QX0A 1W0OA 3UT0A 3FBYA 2ES3A 2HWB2 3CZUA 2XH6A 4FOQA 3WUDA 1GSLA 2R7EB 2VE1A 1GP6A 4L9BA 4F3JA 3ZDSA 5LBCA 1Y7BA 2R1DA 3OGSA 1GOGA 4HKWA 5JSOA 4UFIA 4QQPA 1AYM2 1JU3A 4OFGA 2JDHA 5T5OA 1FOD3 4UFHA 2WAOA 1U12A 3VHPA 2BDRA 2JICA 2FBEA 2YY1A 5C8CA 3C2UA 4AI8A 5IK7A 2WLQA 3EJKA 4RGGA 3M7AA 2JDKA 1XJAA 2DVGA 4XCBA 1RINA 1VJ2A 2YPDA 1IS5A 5GALA 2Q8CA 1JOJA 4I2OA 2ENRA 2HWF2 4XIKA 3IPVB 1IQAA 2EXIA 2YMZA 1SLTA 1MS4A 4E2GA 4E8CA 3IMNA 1E5SA 1ZZBA 3I97A 4XFAA 5CG8A 1JYCA 2R0FA 4UT5A 5L9VA 1UQXA 4RA0A 1V6KA 1S2KA 4BXFA 4FTBA 2JENA 2X8KA 5HXVA 4CVUA 1N3OA 3VB9A 2JB8A 5J48A 3ZFFB 3V0AA 4YVSC 1YIFA 4Y20A 3ZYJB 3GXUA 4Q0UA 3IM0A 1ST8A 3KVBA 3MIBA 2Y6HA 1GP5A 2P17A 2RJKA 1W6OB 3S0MA 5FYVA 2AGSA 1ZZ7A 5A3UA 1TQ5A 2PHFA 4W4ZA 1GQHA 1R1A3 1MACA 2B9UA 2JG8A 3LCPA 4LQRA 2MPFA 3HT1A 2BGPA 4HANA 4E4DX 1G9FA 4GZ9A 3HQXA 1NY71 5FMCA 3JD73 3WCSA 5LK7B 3K75B 4RQPA 2ZZQA 1KFXL 3T2OA 4D6QA 2DYCA 1COV1 2C0ZA 5FZ1A 2J7MA 1XNBA 5IK8A 2JE8A 2YUEA 3NV2A 5E88A 4QHOA 2HBUA 2ZX0A 4NOTA 3OEBA 1PGW1 2P3KA 1JUHA 3R4DB 1H6XA 5BNNB 4KBBA 5F37A 1PMHX 1JS9A 4XVHA 3THPA 1KJRA 1SFYA 5BV6A 4OMCA 2YBSA 4I30A 3LA3A 2IFRA 3TN92 4COVA 1OI6A 2RJ2A 2R16A 2RHPA 3CIHA 5CU1A 4DXSA 2A6VA 1GNYA 1X7NA 4NO4A 4KWUA 4DOUA 5A3NA 2B4KA 3OY8A 5BPXA 4QX2A 3AXDA 4NHMA 4NRQA 5A32B 3V0BA 2ZEXA 3GF6A 2PTMA 4JX0A 1CAWA 3O1OA 4RS5A 3DL3A 2EVXA 1PO22 5FYUA 3RDIA 3VKFC 1HN1A 4OZOA 5IW0A 2WO7A 4AL9A 4FFGA 1S0EA 2GZWA 3VGIA 1LEDA 3B3QE 4MXWA 5GLVA 3THCA 5ABJA 4C91A 3B7MA 1HDKA 2F4LA 3NNFA 4GB33 3CO2A 2LUWA 4HKLA 4IGOA 2ZGRA 3JBG2 1RUD3 5CB7A 4ZXEA 3ILNA 2GMPA 2YFUA 3I59A 4QXKA 1VBB2 2FMYA 5L73A 2Q8OA 3VBHB 4JGYB 1W2UA 4KU8A 4DXTA 5FLIA 3MF6A 3OSDA 4Y33A 3U4XA 2RM21 5LASA 4V1PA 3A0NA 1POV1 1PVC2 3TOJA 4ASLA 2D44A 2ZBJA 1W8TA 4MGQA 2YFZA 3CZJA 3VD3A 1E5IA 2ARAA 5FTTC 1GQGA 1FPN1 4BB3A 3PIJA 4CCKA 1M06G 1QDOA 3VN4A 3MBWA 4O7XA 2E51A 4U36A 5FP7A 5AC93 2DURA 2VZ3A 3G6JB 2RMU1 2EA7A 1UZZA 2C6SA 2BQPA 2ARBA 5C8CC 1UMHA 5CAZA 3SKJE 4TZDA 4FI9A 4NN0A 2A5ZA 4RD7A 5F5IA 3U37A 2HWC2 2WO1A 2VD7A 4XJ9A 2EXHA 3ILRA 2DVDA 3DYOA 2VM9A 4AFMA 5IVBA 5KHKA 1K12A 2F17A 4Q4X2 2TBVA 3KV4A 2ZOEB 4LBMA 1C57A 1ZBE1 1ZNPA 4LORA 5HCBA 5LA0A 4MVTA 1VBA2 4N43A 1TME1 3JQXA 1UZVA 4XBLA 4H14A 3F95A 5DAVA 4CE8A 4NIDA 5DDJ2 5FMOL 3AFKA 4B4QA 3DUIA 1A6CA 1CZSA 3I2DA 3P1IA 3M3CA 4UBHA 5FZHA 3FL7A 4LBNA 4Q4Y3 1PIV1 3NJVA 2ARXA 1MS8A 1F5JA 3MIDA 5FAXA 3VBRB 2FCTA 2JG8C 3IT8A 4QU2A 1XB9A 2WSUA 1RHI2 2W95A 4XETA 3KCYA 2WINB 2FDGA 3EYPA 1RUNA 4NPMA 3T09A 4GJYA 1W6NA 4QWNA 1QXJA 4L2NA 4Q2FA 5FJKA 3X29B 1X9PA 4IGPA 2JB4A 1O7FA 2FZ1A 2W1QA 2BVVA 3SH4A 3RJRA 1LECA 1YRZA 3DCQA 3I2IA 3OTFA 4IE6A 2JIJA 4EWEA 4XMAA 1VAKA 1WZXA 1SLAA 1ZZ9A 3LSEA 1UMZA 4DY5A 3GGLA 5EJ3A 2J1VA 1CAXB 3KGLA 4JKKA 4Y24A 5KR7A 4N8MA 1OPMA 4QU1A 1MZEA 1SG3A 1IS6A 1C1LA 1LOBA 3AP9A 2UU8A 3POJA 2WLPA 4LBLA 5F39A 1LOAA 4DB5A 1BCXA 5KWRA 1D0HA 1KXGA 3RZZA 2DDUA 1RUOA 4AF9A 4HONA 1TVGA 4LIVA 4AAXA 2W87A 3LIGA 3IPVA 4RS5C 3OPZA 3R0RA 4HVRA 1UL9A 2VOVA 4QB2A 5F3EA 3WINE 3WW1A 5I8TA 5FMBA 4BJ0A 3CEWA 1ASJ1 1H1MA 2D7FA 2FQPA 2RJLA 1SFPA 2EIEA 1PO23 3OGRA 1EAH2 4Q4W3 5FZ7A 5ABJC 3K3NA 3TEWA 4QX3A 5C70A 3S30A 4AI1A 2P34A 1W2TA 2HH9A 2W5FA 1W6OA 5J3UA 3M4FA 1YJLA 3JBG3 5FXWA 1W8ZA 1ZRDA 3KV6A 3LKJA 5T52A 4N7UA 1BKZA 1YQ2A 3NAPB 1NLSA 4RGKA 3WW4A 2SBAA 5JMOA 1ZBA2 1NQDA 3AYDA 2JDNA 2QQLA 2BFUL 1Q8SA 5T5LA 1EV12 4CP9B 4Y1XA 2RS12 2Q5TA 3GZEA 1FOD1 3EQEA 3NMBA 4CDXB 1G9BA 2GH2A 3ETPA 4D94A 5BNNA 3CHXA 1OPOA 3PTYA 3W5NA 2J1SA 1QXRA 2WN2A 4FPJA 5DZEA 1NCQB 2ZEWA 3D4KA 1QEXA 2CY6A 2JE9A 3OCPA 1GICA 1OA3A 1Z7S2 2HWC3 1WLCA 2JKBA 2A3WA 4INDA 4Q4V2 5I91A 5FY7A 1ZRIA 1GBGA 4Q4X3 4N43C 2PHRA 1UZ0A 2RDQA 5BY5A 5DG2A 3WF1A 3WR0A 5EHDA 5A32A 1FMD2 2V09A 5JPMB 3T3YA 4CDUC 1E5RA 1DGLA 2HWE3 5H9PA 2GMEA 4Q26A 4MX3A 1O91A 1DDLA 1SHWB 3RI8A 3RWNA 3B5LB 5FPAA 1PGSA 3UESA 1R1A1 5ACA1 2JDAA 4TTGA 2A1XA 2B46X 1MPXA 3WF3A 4DMIA 2A70A 3KLSA 1L7LA 4LULA 4W6WA 3H1YA 3VBHA 2DUPA 4ORFA 1JZ8A 3JD71 4JGYA 1TMF3 1UKRA 2BW8A 4JCKA 4R52A 5DZGA 1NQJA 3IDEA 2RV9A 3KSCA 5FUPA 2QKDA 4XILA 1KDKA 2BZDA 4ZKTB 3ZDVA 4J1XA 4JRAA 1L3JA 1VBD2 5FY4A 1U5ZA 1BBT3 1AXYA 3ZXAC 2JJ6A 1XOYA 4BZ4A 2H0BA 3K2OA 5C7GA 5LA9A 4D0QA 5BUVA 4Q1RA 2J1AA 3CKHA 4XFBA 4A7YA 3CNAA 1BVVA 4CPBD 4ZZ5A 2R1BA 1B35B 1N1TA 3O5SA 4UAPA 5FMOS 5F32A 5F5AA 4CDQB 1W8WA 3WHTA 4YZ5A 2ZCWA 3FBMA 3RZKA 4M3CB 1S0CA 1VBE3 3FHQA 3MUZ1 4HVOA 4N9HA 5FMDA 1UAIA 4JDMA 2X05A 4AVSA 4XFGA 4Y5SA 1RXFA 4PLMA 4S2DA 5FBJA 1QU0A 4KWKA 1I5PA 5M0TA 5B4NA 1RTVA 3VZJA 4QHZA 1UD1A 4RN5A 5FPBA 1GQPA 2DCTA 4GB31 4L97A 1S0GA 3AP4A 4LKSA 4K8FA 4QX1A 3MZHA 2XJVA 4Q0SA 5LBEA 4Z92B 2ZKLA 2Y60A 4BMEA 5FZ3A 2FDKA 3K51A 3VD5A 4E9KA 3OUHA 3VBSB 3ZYRA 2G9ZA 2OIIA 3OYWB 1ZBA3 1LHNA 2CAVA 4R8HA 5I0TA 5F9TA 1LU2A 1RL3A 2BV4A 2E6VA 1BK1A 1SDDB 4H7MA 3I2FA 1NLQA 4YW6A 3WSOA 5JOZA 1REDA 5L19A 2VZRA 3ASIA 4XUPA 3ROUA 5AC91 2R32A 2BWAA 5BNNC 4QT6A 4LKEA 5A7WA 3NNJA 1N3PA 5EQUA 4OHZA 4BOWA 2E53A 5FP9A 2GP5A 4LPLA 1ULFA 2B39A 1NZIA 3VDAA 1RJ7A 1NY72 1SQ4A 5FYBA 4HZFA 2QQJA 5GZDA 2CGOA 5FLJA 1DIWA 3MIFA 3RRDA 1COV2 3VD7A 1HQNA 1N1VA 5E1RA 1F4HA 5I0SA 4QDRA 4OVEA 2QDNA 4L99A 3E6CC 1PGW2 3I4IA 3MV01 2VCMA 1RUF2 1POV0 4GIQA 5F6KA 4BQ4A 1APNA 1J83A 4PT6A 4WVZA 2DTWA 3JB4C 2C1FA 2O0OA 1IQDC 1W9YA 1VRH1 5FZAA 1OLQA 4FBFA 4Q4Y1 3OGVA 4ASKA 3J8F3 4HETA 5FYMA 4IEZA 3MV11 4EZHA 4AVCA 4NROA 4P9GA 5FDBA 2BFUS 5F6LB 2J1UA 2ZJCA 3MO4A 4DY3A 5CNAA 3VBHC 2VQTA 1GNZA 3KB5A 4LOSA 4JGYC 4ET7A 5FCCA 4NRMA 4AEKA 4XBNA 1UCXA 4E4HA 3NAPA 3OBTA 3ES1A 4NVPA 4C1XA 1RMU3 2BERA 4YVSB 3AZYA 5FXZA 3WF0A 4CP9A 5FZIA 1AR61 2WNEA 3LB9A 4K9SA 4OI4A 2E33A 1AL23 2WRAA 4CDXA 1YQ8A 4KGGA 2NYYA 2BEOA 3UJOA 3B00A 3ZSMA 1WKYA 2VH9A 1DHKB 2RM22 1NCQA 2WR9A 3OPTA 5EYYA 5FK8A 3W58A 4XJUA 4ZU4A 3ZXGA 1AR81 4HG6B 2UYAA 3A23A 4MGTA 1XE7A 5LK5A 1K5JA 1FPN2 3JZVA 2NQYA 3P5BA 2YU1A 1MZFA 4CU7A 1OKOA 1G86A 2ZGQA 1NT0A 1F15A 1V6LA 5JIUA 2RMU2 4LOTA 1WW5A 1BJQA 4Y1UA 1HRV3 1W3XA 4BCUA 1V6JA 4Q4W1 1BMV1 2Y6JA 4BQ3A 4YNIA 2VAUA 3OG2A 4QQHA 4AOCA 1KITA 5JZGB 4PI2A 1W2OA 1VRBA 3SHRA 4K20A 4D6RA 5A7PA 4HVQA 1R091 4GWNA 4DZGA 1ZBE2 5FUNA 3LFIA 2CWMA 1TME2 2D6PA 2XB6C 3VL8A 4B1MA 4ZU7A 1US3A 4META 3AKPA 2R061 4IEWA 4P9IA 3P3NA 1WD3A 3B94A 5DN2A 2VNRA 4PBPA 5DXDA 2VTXJ 3KS7A 3ABZA 1F8VA 1CAVB 2KR2A 2Y38A 1NLRA 1PIV2 4D3WA 5CFCC 1JBCA 3PJYA 4AI2A 1HLCA 4CUBA 4N90A 2ZAHA 2YROA 4I0AA 5FP4A 4AQ6A 5A3LA 5CADA 3AC0A 3DKQA 4CCJA 2F4PA 3N9PA 4GWJA 1OFSA 1QJU3 1QOOA 1SBDA 2XMLA 2WNOA 5I0RA 4P02B 1H9WA 5F1RA 2XJTA 4R4ZA 2ILMA 1WMDA 2A71A 5CIRA 4XMIA 4CDQA 4TLGA 4XHXA 2VGDA 1S0DA 5A70A 4YSFA 2DV9A 4P9WA 5CZKA 1KQRA 4WVWA 1OBNA 1UN1A 3AMPA 4M3CA 3CDZB 2HWE1 1NXD1 4CDWB 3GZTB 5J98B 2FCUA 4PLOA 2QDRA 4OHWA 3U10A 3POGA 4AW7A 3BB6A 3EBRA 5FJHA 4EN8B 2ZGKA 3VBUA 1HJFA 1UU6A 2ZTNA 1STMA 4DXRA 1OF4A 3N3HA 2JE7A 4DRRA 3NKTA 5IVEA 1RUC3 1T6GC 2PHLA 3AMQA 4P9YA 1TMF1 4LUMA 3IB3A 1ASJ2 3VBSA 2YXSA 3FLRA 2QNKA 3OYWA 3RMXA 4Y20B 5F2WA 1Q56A 1BBT1 4JDNA 2YG0A 1IPSA 5J1XA 4CUGA 1AX1A 2VCBA 2ZZJA 1PM7A 4CDXC 1UU4A 2GALA 3ON7A 3BUCA 3KD4A 5HCHA 1GANA 2CYFA 2VMDA 4XABA 5CFDB 1ZA7A 1NUKA 1XYPA 3JU9A 5SV8A 2WZR3 2PLV1 1LOFA 3AXEA 4YWAA 4AGVA 4P08A 2HKXA 1UYPA 3WVJA 1YFYA 4E4SA 5AFBA 4ZHNA 4XAEA 4MO3M 1U5XA 3POSA 2A7AA 3FUOA 4CU8A 1VBE1 2BGCA 5F3GA 1FPN3 4KH9A 3E6DA 1FOD2 3DF0A 5FZ6A 4QQLA 1H8TB 1UXXX 4D69A 4RHV1 4LO8A 4ZS2A 3PNAA 3WDVA 4F7ZA 1JYIA 3SXWA 3WF4A 4BK4A 3QOPA 2A6XA 3WNPA 4B7EA 4BQ1A 1TG7A 4DS0A 4Z2AA 2P3YA 4MYEA 2G19A 2RDRA 2VBPA 2W2IA 4WM8A 3HQUA 3J26N 3LDKA 1WLTA 4W6XA 3E5UA 1DYOA 5A7NA 3I2GA 3PVOA 3IDAA 1CAUB 2GSYA 4IDZA 4XTPA 3RYKA 3U14A 1TME3 3RMYA 3U75A 1AX0A 2AC1A 3UGGA 1MS1A 3PDQA 1OMIA 4IEPA 3C7HA 1G9AA 3H1MA 5A7SA 1OT5A 2CL2A 1AR71 1GOFA 4CPBA 1JOBA 4ISQA 4YLZA 5C3PA 5FZGA 4A7ZA 4HN1A 3GBGA 4J6GA 4YVSA 4MOAA 4AR2A 1R1A2 2B42B 2NMNA 2Q1ZB 2QCSB 5ACA2 2ZHLA 1VAVA 1A8MA 5IVVA 4CTEA 2XDVA 1GU3A 1WLDA 4HT1T 4ZY9A 3AMMA 1CX1A 5C3QA 3JD72 3OB8A 5C33A 1D4VB 1D0GA 4BWOA 3GBFA 2IXKA 3ZM8A 4CDQC 1CPNA 3UNPA 1W04A 4JKLA 4UYBA 3VZKA 3VUOA 1BEV3 4QXBA 1WLWA 1SLIA 1VPHA 1N47A 3J9SA 3MUY1 2WA3A 5A1LA 2I2SA 2BGOA 2TUNA 3K48A 1QNWA 5HBAA 2WC2A 5FZ0A 2P1BA 3PVNA 4XUNA 3O12A 2OX0A 1V6OA 3KMHA 3J8F1 1QQP1 5A6ZA 4MGSA 3VBUC 4LK7A 2XXZA 4K8RB 5FFOC 2I74A 1XQNA 5JZGA 3Q8FA 4K3UA 3ZFEA 3SQOA 1F4AA 4XUTA 2DCKA 2E26A 4KBZA 1MZ5A 5IAXA 3AL6A 1KGYA 4A6OA 1JOPA 4BMBA 1SEFA 3ZKYA 2XJQA 3VBSC 2W92A 1YQCA 4CDUB 3M2MA 2CAUA 3C7FA 1DYKA 1D7PM 4JAAA 3ZXKA 4CEWB 5JSPA 1ASJ3 3N7KA 3J7MA 1VR3A 4HPKB 5JSRA 3VKLA 1LOCA 5E8AA 1V9U3 4BH9A 4A42A 4GB32 1CAVA 1ULDA 1YO8A 5FPVA 3VZMA 2X09A 3WDTA 1AL21 1RUD2 4H7LA 3R4SA 3H42B 2VQAA 2FZ2A 1LOFC 1YHFA 2IC1A 2FMDA 1UOJA 1W8HA 1W6MB 1PMIA 3WNNA 3AP5A 4YGEA 5EZWA 5LRSA 3RYRA 2AENA 3ITQA 4MGKE 3AX4A 5GLZA 3E1F1 2WNVB 3KV5A 1H2LA 4FAGA 3O1RA 4AQTA 5AC92 3A22A 5C4WB 1QKQA 3L2YA 3ZIXA 1LEMA 1HRV1 2A3YA 2VW2A 4LT5A 5JPNB 2PAKA 4CDWA 3H3UA 3EO6A 2R073 3WP3A 3HPNA 4WM8C 5AVPA 4QPIB 5H9QA 5J09A 4PHZA 3AM2A 3LWCA 1UOBA 3S57A 3WQBA 5JOXA 2FDIA 4LKFA 4R9CA 3BIWE 4WVVA 1YWKA 3DXTA 3MYXA 3WG2A 1UIJA 2OPKA 1OHFA 1AF9A 3AZZA 1YI9A 1URXA 2Y8KA 5IFTA 1OURA 2VOXA 2LRPA 3ZKUA 4FOVA 3KWVA 1SPPB 1JN2P 1VRH2 1FX5A 2K0GA 5EWSA 1WCQA 5T5JA 4IV3B 4Q4Y2 2RS53 1O6UA 4NMIA 2QZ3A 4ONUA 2E7QA 3VLBB 4MGYE 5FOBB 1LB2A 3SISA 2MEV1 1KS4A 2IXLA 5LA2A 5ACA3 1ENQA 1O4TA 1GR3A 4YGBA 1QJU1 1OVSA 1RIRA 4NHXA 2XQXA 5LBFA 2ET7A 4MGZE 5CFDA 4C8DA 5IK4A 1HX6A 2JIGA 5DUVA 1JZ4A 1CQ9A 1BQPA 2PQQA 2Q1MA 4NR1A 3DYMA 4HK9A 3UK9A 4FFFA 1CPMA 2D43A 2RG4A 3E6BA 1PZ9A 3MW2A 4COWA 4ATEA 5LY1A 2AUYA 3O0VA 1CWPA 2VZQA 1OSGA 1REEA 3DECA 5C5UA 5A6QA 4R9AA 3H7JA 1AR62 5CEHA 2GN7A 5IVYA 4ZXKA 1H8TA 4CXYA 5J7MA 2ERFA 5DUUA 1FATA 2ZHKA 4LBQD 1OF3A 4QX8A 4CSWA 5GLTA 4YFZA 5I8YA 4L11A 4CXXA 5JZGC 1RUH1 3RNSA 1UU5A 1LGCA 2J1EA 1AR82 2TNFA 3ZFEC 5K7PA 4LTAA 2RR11 3FFZA 1RUC1 1W9TA 4CCEA 1QGLA 2XWBB 4N9IA 5LW9A 5A1AA 1GWLA 2H6BA 2BUKA 1KEXA 3FX3A 5A6XA 1CAUA 2VW0A 3OF1A 4P9LA 4AYUA 1HB3A 3HN1A 1H1AA 4Q4W2 4XZUG 4UFLA 3T4HB 2MHFA 3NNLA 4YM3A 5GLWA 4AGRA 1W6PB 4RSUA 1SLCA 1NCRB 3MPPG 5FUIA 4COZA 1ODNA 3ETQA 1S0JA 1R092 4I02A 2V5DA 5KXBA 3I49A 2WZR1 2PHWA 3Q8CA 2W1UA 3U07A 1I3HA 3RFRA 1EUTA 4AHYA 4Q8KA 1ZA4A 1L7RA 4YGCA 5LB6A 5J96B 3AKSA 2BVBA 3ZSEA 2R062 2BNOA 2IXHA 4XDOA 3LAGA 4EN6B 2WFPA 5FYYA 3D8CA 1X50A 5FPZA 1WA6X 3NJXA 4YW1A 1EUUA 2EXKA 4QDSA 3NL1A 4QDQA 3ZN5A 1QXPA 1NA1B 3PU8A 2ZMKA 4CDWC 5C8WA 3S5AA 2ZGPA 4AHXA 5CKMA 2WYFA 2WL1A 3I3BA 3E5XA 3ZXFA 5FY1A 4XDPA 5E89A 2D93A 4G3YC 4IXLA 5HV4A 2D6OX 4DXZA 2VOWA 3PLQA 1VBC1 2BBAA 4LR4A 4I01A 5FYCA 3VZNA 1M4WA 3GJBA 4EQVA 3KHCA 5FYTA 4BYYA 1Z0HA 3I2JA 2ORZA 3VBFC 5CG9A 4KMQA 4HL0A 3LPGA 5DUWA 4Y22B 1ULOA 5FLHA 3VZOA 1K42A 3PVEA 3UJQA 2JDMA 1GZCA 4NIIA 1I5ZA 1EPWA 2HWE2 1DQ0A 1T6BX 3PU3A 4HK8A 2GC0A 4NPRA 4Z82A 2CGNA 4AE2A 4FSJA 5GKAC 4CDUA 3ZYPA 2G4IA 2ZHNA 5EXOA 4CEWA 1J3QA 3RZJA 1VRH3 2W46A 4FPOB 1FNYA 1VIWB 4LO6B 3JXSA 4HPKA 2CU5A 4NAMA 3RVHA 1QF3A 3AZXA 1ENXA 3WUCA 4YGDA 3FC0A 3URFA 3CJXA 2R30A 1AXKA 5CFDC 3O14A 4Z8BA 3QH7A 1ULPA 3T0BA 2VU9A 4IEQA 4A3ZA 4AG4A 1OUXA 1TMF2 4LHSA 2YPJA 1JYXA 2AZ5A 1W6MA 4QKBA 4LBQB 1BEV1 4A4AA 1PVXA 3AYCA 4N53B 1BBT2 4IERA 3A0KA 4KWJA 1W90A 2DUQA 2XGXA 2WNVA 5A7WB 5CFCB 3POWA 1J58A 5T5PA 2HWD3 2Y6KA 5IYYA 1H8TC 1RXGA 3HIFA 1AR63 2YBKA 4IL7A 5JIAA 1MQTB 1ZX5A 2YC4A 3CF6E 1H8VA 5EJ1B 3WD5A 5FZFA 4LMFA 2PLV2 2OVUA 2X53S 3KGZA 4WV8A 2IVIB 1ULGA 2GH8A 4QPIA 5F3IA 4GXLA 1AR83 1AJOA 4CA9A 4GA9A 3HQRA 1VBE2 3POYA 5CISA 3DKWA 3PJQA 5LBBA 3ZN6B 1C8M3 3D3AA 1QJZA 1YXWA 2H6CA 4WVMA 5FYIA 3LPFA 4XZPA 4RHV2 1A78A 4BQWA 1AX2A 1ND2B 1XU1A 3T4VA 1HV1A 2C24A 1NE6A 2Z42A 4R9DA 3ZYGA 1SPPA 1V9U1 4XJZA 4XC9A 2UYBA 2XQRA 3WEZA 4QPYA 1GWMA 4IV3A 3UKVA 1JTZX 4M01A 2JD9A 4B4PA 5FO7B 1HJGA 1MVEA 2C5DA 2XVLA 1OD5A 1OC1A 1Q8PA 2PMWB 2OYZA 4GD4A 1LGBA 1R093 4PQ9A 3AB0A 2XHKA 2OQ6A 1O3TA 2DCJA 4OUEA 2YB7A 4A3XA 1H2NA 1YYNA 3BU7A 4AEMA 2R063 3D5OA 4XF1A 5DAPA 3I3EA 1AR72 1PK6C 2AR6A 4JC1A 3IAPA 2WWSA 2ZX4A 4LO7A 4WZFA 4XF3A 2WYSA 2VMEA 3Q8BA 4QGNA 1WWYA 3HBZA 4YM0A 2R071 3BKZA 1L7QA 3U1XA 3UGHA 1ZZ6A 3TNQA 4OUSA 5AFEA 4QM9A 3BTAA 5LEJA 4JTNA 4Q1PA 4E2QA 3POEA 1Y4WA 1GNHA 2R49A 2WSVA 4QXHA 2OKXA 2C26A 3N7LA 4LNVA 2DWRA 1HRI1 3O1VA 5FOJB 3FWEA 3PMSA 1PO11 5E16A 2ZHMA 3ZN4A 4CEWC 2CTVA 5EPAA 5BYNA 4PCRA 1O4YA 5H9SA 2B9VA 1ONAA 1QQP2 2RS51 3J8F2 1JZ7A 1MEC1 2UURA 3JCIA 4QMAA 4KL1A 3WDUA 1QDCA 3J7LA 1ZM1A 1LJ7A 1YLLA 3LDBA 4CP2A 1F2NA 1W6PA 2V4VA 2AEYA 1N3QA 1NCRA 1F5FA 3GDBA 3PUAA 2PYTA 2OT7A 1IZ3A 4NRPA 1XE8A 2VG9A 4LLOA 1OLRA 3SC7X 5LATA 3JUUA 1W3VA 2CDOA 4GWMA 4H55A 2QQOA 3IIIA 1RMU2 1KRIA 4UW5A 3PIGA 1T2XA 4XJWA 3FUQA 2WNVC 2G9GA 2VZ1A 3NV4A 4AVBA 2Y0OA 3P3PA 4HKOA 3T2TA 5JR2A 2IUWA 1AL22 2UY8A 4OHVA 4IE4A 5JLVA 3MEPA 1AL0G 4UFKA 1NA1A 2QTWB 3HVDA 4B1LA 5C6CA 5DMYA 1RITA 3UETA 2CDPA 3WP4A 1H1IA 1CZVA 5T55A 1RUE1 3WNKA 2D6LX 2PLV3 4GALA 4QPIC 1JW6A 3BOPA 4PIYA 5F5QA 4JHTA 4PI0A 4RYDA 2D40A 4QX5A 3VV1A 3DV8A 1TE1B 2IVJA 4BK5A 3R6SA 5F2SA 2GDFA 2B7YA 2O8QA 5KC5A 1SFNA 3WZ1A 1CR7A 3H8XA 3SCHA 4Y22A 5A3OA 3AJYA 1HRV2 4AVAA 1V0AA 3NJZA 1H2MA 4JRLA 4I3PA 2YC2A 4RHV3 3FZ3A 3ZMNA 1RB8G 4UOJA 4M3CF 3AYAA 3WF2A 4IV3C 3BU0A 3VBUB 3WDWA 1W6QA 4ZPIA 4FT8A 4X8NA 1YFUA 3SCGA 4GH4B 5BXXA 2B8MA 1ULEA 4QGLA 4B7KA 1OH4A 2Q8EA 5KHHA 3OEAA 4FOYA 3RZHA 3MF9A 1EP0A 1AR93 2VVDA 3C8XA 2PHXA 1S4CA 3S5QA 4J1WA 2WNUB 2Z2SB 4AWDA 3ZR6A 1RUJ3 1UY1A 3GCXA 4LBQA 5C4WA 4DNYA 2JG9B 2K2SA 1AR73 4N53A 1H4GA 3DGTA 5CKNA 3KHBA 2VZVA 4W65A 5D2AA 3C3VA 5CFCA 2BYVE 2YZ4A 3RZLA 2LM3A 2WO3A 2QJVA 3VDDB 4CZSA 5C3OA 5JXJA 1W28A 1Q5OA 4D7SA 3B69A 1QJU2 1W2NA 2RE9A 2XL9A 4UW4A 1MQTA 1TNFA 4FXKB 4XF9A 1O3QA 5F5CA 3LDRA 2BTVC 4LXLA 3N7MA 4XAAA 4XOGA 3W9AA 2VULA 3VHOA 3H3LA 5D8AA 2ADEA 2V4AA 3HT2A 1O59A 3ZN6A 3U0ZA 1LCLA 2D5HA 5I93A 1XYNA 2ZX3A 1WCSA 2VMIA 2BBVA 1N1SA 1ND2A 3RQ0A 1LKNA 4OI1A 4WM8B 1QQP3 1OLMA 1W9FA 2QQUA 5IVJA 1MS5A 1RUH2 3EXUA 4CCNA 4BQ5A 1NCRC 2C4XA 3WNXA 1LAJA 2RR12 3O1SA 3IN9A 3ALQA 3AVRA 3F2ZA 1RUC2 4AZZA 2VBDA 2RS33 3CLPA 3I2KA 4Z1VA 1S0FA 2EAKA 1N1YA 1X36A 1UX7A 4O65A 2PAMA 2NM1A 2WT1A 3WNMA 3GBWA 3VD9A 3O1PA 2R043 3JB8A 3WP5A 4NHKA 3BOWA 4FFHA 5HCAA 1LOGA 5AVAA 2FCVA 4BIOA 1G9DA 2ET1A 2GMMA 3ZYHA 1W03A 2HWD1 3FJSA 3ENRA 3ME2A 5JXGA 5JUVA 2PN5A 3NV1A 2D6MA 2JD4A 4YZ4A 1NA1C 3SITA 4LA2A 1WMXA 1JUIA 5FY8A 1QJX3 4AFDA 2WZR2 2JXAA 2WN3A 3GJAA 3J7NA 2ZEYA 3KCXA 3MPBA 2NPIA 4TN7A 1WW4A 3N35A 4ATFA 2VL4A 2XBO1 1K45A 1ZZ8A 1CD3G 3M1HA 3TEZA 4TLFA 5LEKA 4XFCA 4IEXA 4OQ8A 4BLJA 3EHKA 2WIIB 1FXZA 1FAYA 2GC2A 2Z4FA 3FMGA 1C8M1 1US2A 4NAOA 3WG3A 5JCTA 4S2FA 3VZLA 2A3XA 5KXDA 3ACHA 2VTFA 5FO9B 1JYNA 4IEUA 2JEMA 4LHNA 3W5MA 1SACA 3R4UA 5DAWA 4LE4A 1IG3A 2P6CA 4XFIA 5KHIA 2XG3A 1ODMA 2LALA 2ZXQA 3GALA 1VBC2 2ZGSA 4LUKA 3ST7A 3ZFEB 1JHJA 4DFSA 3M8LA 2WQ8A 4XF4A 5EJZB 3BIEA 5A3PA 1UNBA 1NYWA 4P14A 4RFT0 5BNOB 3E97A 2WABA 4MXVA 1LOEA 1H9PA 2VCCA 3KV9A 4O9EA 5J37A 2LTNA 5L9RA 4F8AA 3VDCA 4PDWB 5C4WC 2A73B 2OUJA 3NJYA 2CHHA 1LULA 4N53C 2VC9A 4NIHA 4AHZA 4QB1A 1A8DA 3UYJA 3GZAA 2W0XA 4L8QA 2KXLA 1J3RA 4XJAA 4P5YA 5FZOB 4YYOA 1YUDA 2MEV3 1MQTC 2OA2A 4GKXA 2ZGNA 3ZXJA 3GYDA 5SV5A 3USUB 4JGZB 2WWJA 2ZX2A 4OQ9A 4PF1A 3RJ2X 2XHNA 1ZZCA 4ZONA 1PHMA 1BEV2 3T30A 1CZTA 2R6QA 4M0HA 1QJY1 4FPYA 4K1YA 5D8AC 1Q3EA 5IJRA 2VUDA 4IUGA 5F7UA 5FP8A 4Q27A 2Z69A 5FKCA 4BA6A 1R1ZA 4UXAA 5F8PA 1UWWA 3O0WA 3AKRA 2BPA2 2IXIA 1ND2C 4PIXA 2XJPA 4NIGA 1V6IA 1DG6A 3AYEA 5FZLA 1PNFA 3D82A 1MR5A 1VAMA 5E6HA 3HD8B 4S2GA 1PGL1 1HIXA 2ZPXA 4PBOA 3ECQA 3SH5A 3WW2A 1GZTA 2ZA9A 4QKFA 2VNOA 2Q0AA 1RUH3 2HEWF 1IHMA 4DRVA 1HQWA 1FV2A 4OYUA 3WDYA 4GH4A 2RR13 3VBFB 4AXOA 4DEVA 2KM2A 2RDSA 2DCYA 5KC6A 1GP4A 1MZ6A 4OMDA 2VMCA 4JKMA 5CA6A 4K6BA 2UWAA 1PX3A 2HEYF 2XONA 2VZOA 4TXWA 3HNMA 5FRAA 4I3GA 4X6QB 2WNUA 4M4RA 1A3KA 5JVVA 1V6MA 2BOIA 1V9U2 4X6RB 4XW3A 1O3RA 5FK7A 3CU7A 5FR3A 1VMFA 2JG9A 3ZXDA 1NOVA 3O1MA 3CBNA 2ZGTA 3WCRA 3H0OA 2AYHA 3AJZA 1DQ6A 1JMUB 1CIYA 3VDDA 1YQ5A 4K21A 5EP9A 1VB2A 4WM7B 3VDBA 4ARXA 1R081 2L9LA 4JDOA 3AZVA 3D0JA 4XQWA 3NV3A 1D4M3 5A3TA 1DGRA 2K9ZA 3VL9A 2GP3A 4UW6A 4YZ3A 5IVCA 1AJKA 4FPLA 1AVBA 4FAHA 2V73A 5JR7B 4OZXA 1SCSA 3T1MA 3H7YA 5DAQA 2Y33A 2VMHA 3N9NA 5JDBA 1PM4A 2R072 4M00A 3S7IA 2WS93 3MHZA 4FTEA 1PZ7A 3WX5A 3MIEA 2YDEA 3QACA 5TSWA 3QH6A 1GMMA 5B2GB 4FQ4A 1VBC3 4ZZ8A 1MS3A 2OXBA 3KVAA 1AR91 4YZ2A 2E7TA 1HRI2 2W91A 2W94A 1YIPA 2GC3A 1PO12 3T2QA 1F9KA 1KS5A 1O8SA 1BLZA 3NRUA 4BE3A 5JXHA 1RUJ1 1OKQA 5A7QA 5EV7A 3GZUC 2RS52 4KG8A 4LBJA 3C7GA 2NZ9A 1SLLA 4XHBA 3IMMA 4JQRA 3WLUA 1WBFA 2VZSA 3MICA 2C9AA 5BNPB 3O1UA 1SDWA 1W9SA 2NMOA 5D21A 3KT4A 4QGMA 1DQ2A 1Y9GA 1FYUA 3BYWA 4UFMA 1GUIA 3DPRB 2XKPA 3K77A 1IG0A 3O7OA 3WXPA 4A45A 4P9JA 2UWCA 5GZEA 1BYHA 4C0HA 5GZFA 3I3QA 3HMYA 1PK6B 1HXS3 1EV11 3MW4A 3DN7A 3M3QA 1XNTA 1BK0A 2D3SA 1ALYA 2QQNA 2ZKNA 4OI2A 2A75A 1OVPA 2GNDA 1YEWA 1WMEA 4F83A 5FY9A 1RUE2 2AREA 2JX9A 4XFHA 1XC6A 3N7JA 3WQ7A 1C4RA 4E2SA 1Z7S1 4GH4C 5K4LA 4PQQA 3MIGA 3B93A 3SH3A 1XXNA 1YC61 3B9IA 4YG3A 3UKNA 4E4ZA 5GZCA 3IIAA 1RUI3 2RS31 5FBZA 4CEYB 3ZX7A 1KDMA 3ZFGB 5BNOA 4OHXA 3M3IA 4LHLA 1IPKA 1K5MB 4LBKA 3H3ZA 2R041 2WNUC 1JI6A 4HFSA 1CJDA 3SEEA 1LODA 3VKOA 2HJIA 2PA7A 1QH6A 1RVF3 2J1TA 4CCCA 5JI7A 4CU6A 4LEJA 4BQ2A 1W8UA 2JDYA 4PDWA 3NWKA 4Q0QA 3UV9A 3QCWA 2JG9C 3WP6A 2DUOA 1BXHA 2ZGMA 3HWJA 3ZXLA 2P37A 3PTRB 4LK6A 3SKVA 3VDDC 1QJX1 3MLJA 5FZOA 2BOJA 4QKDA 3TWIA 1CVNA 1AHSA 2ZMLA 3LFMA 3Q9OA 4J25A 2WZ8A 1U0AA 5DABA 2Y6FA 4CU9A 4E8DA 3USUA 2NN8A 4JGZA 5JWPA 2QQPA 4AFCA 2VXRA 2TEPA 1OA4A 2KA3A 1ZREA 5FZKA 1XNDA 2NLRA 2VQ0A 2ZACA 3ELNA 1I9RA 1PNGA 3V64A 3RSJA 4EV0A 3NW4A 1I1EA 1S0IA 3ZYFA 5LWBA 3BI3A 4FTSA 4QKNA 2OQ7A 1R64A 3S6PA 2WBKA 4CUCA 2W3JA 5CYYA 2X10A 1XRUA 3I3DA 2X5IB 4MH0E 3V65A 4NUBA 5FPUA 2ID4A 2J1RA 1WGPA 1MS9A 1C5IA 1RUG3 2YGLA 2CGPA 2IFWA 5FZDA 3R05A 2O1QA 4WVMB 1G8WA 5FZCA 3O1TA 3GCWA 1HRI3 3VBFA 4G9SB 3AKQA 3BPZA 4EROA 1WCUA 2D97A 5ISLA 4AVVA 4XYXA 2WT2A 1PO13 1REFA 2XPJA 3POIA 2QUOA 4Q5OA 1WMFA 1J3PA 5JAXA 3WQ0A 3KQRA 1BVP1 1X9TA 4LLFA 5FZ9A 1LRHA 1QOSA 1MEC3 2XOMA 3RGBA 2VUAA 3FLTA 5LRRA 2VBBA 2OPWA 2G9FA 4YW7A 4CUAA 3HOBA 5C3SA 2QQWA 1H4HA 3BCWA 2EF6A 2ETEA 2XLAA 4AGGA 2Y0IA 2W68A 2J22A 1DBNA 2PXJA 1RC6A 2OS2A 4WM7A 4AI0A 2SLIA 2ZGOA 3PHMA 4IEYA 2EALA 2ZGUA 1OQDA 2DF7A 2FDHA 1SZBA 3K46A 2K46A 4G4FA 2HWD2 3WDXA 5A33B 4K1ZA 1O3SA 4CP0A 2D3PA 4FVVA 2A6WA 5DPNA 4PLNA 1FV3A 2JKXA 2WQZC 4YFWA 4AQSA 4QPGA 3N4MA 1CJPA 2D6KA 3HJRA 3RZGA 4CCMA 4KQ7A 1OOPA 1IPJA 4XDQA 1RUE3 1SBFA 1TNRA 1W0PA 2XBO2 2ZX1A 1OFNA 1UMIA 2DFBA 5DQ0A 4AEDB 4AFBA 5BNOC 2HBTA 1C8M2 4TWTA 5CKQA 1XSQA 2W47A 3CJIB 2WZPP 5L36A 1H0BA 2PAEA 3RG0A 4BISA 4C1WA 1JODA 2P4EA 1RUF1 4PDWC 4A7KA 3ZXEA 1BMV2 4HMZA 1UOFA 4M3CE 3H1WA 1IS3A 4D6SA 5IK5A 2FHRA 3M3EA 4ES9A 1DYPA 4IV1B 1HB1A 2O14A 2LS6A 2ZMNA 1DZQA 1YFWA 4URAA 2JECA 4JQTA 2VZTA 4LKDA 5BNPA 5G05L 4YARA 2EAAA 2VZPA 5HXMA 2WAAA 3SLIA 4GJZA 1HQLA 1IKPA 4JGZC 2WFF3 4DINB 3KCCA 1D4M1 3DPRA 3TBDA 1YFXA 3HEIA 1S2BA 3UL2A 1JZ2A 1S2EA 3MLLA 3SMHA 2I07B 1IS4A 3TEYA 3W20A 1X82A 4LJHA 3WT3A 1PK6A 4LO4B 3MFAA 1HB2A 1Q8QA 4FP3A 3AL5A 1QNYA 4KNCA 5FZEA 4D7YA 3THDA 4IQPA 2WS91 5JXIA 1W8NA 4Z07A 1UPIA 4OI0A 2XWJB 4GAZA 4ASMB 3BALA 1J1TA 2YU2A 5ERLA 1AYN3 4NPLA 2OUHA 4XJ8A 5K0UB 4FCAA 2P3IA 2D98A 1J84A 1QJY2 1SCRA 1Q8OA 2HWB3 2RDNA 3WY6A 2YV8A 2QQMA 1S55A 3OOXA 4PJYA 1EPZA 4CEYA 2IWGB 3ZFGA 1MVQA 1F35A 1QMJA 1J1LA 1CESA 2ZGLA 1DP0A 1K5MA 3W21A 3I8TA 4YG6A 1AYM3 1JH5A 1V00A 3AK0A 3LZZA 4YM2A 1QJFA 1W6QB 3TNPB 3CL1A 3OJBA 2B5HA 3HNYM 2XKOA 4BLIA 5FQ0B 1CGPA 1PGL2 1UX6A 4PIZA 5K8SA 1AZDA 5FYZA 4GMP3 2QQVA 3WG4A 3MW3A 1GYKA 2WZEA 5GZGA 3H8OA 2EIBA 4WM7C 3LEIA 3MLKA 4CP1A 2ZABA 1DZRA 3RS6A 2HWF3 3N9LA 5D1IA 1YQ6A 3A7QA 4FPFA 4JTOA 4YVWB 1QJEA 1CONA 1O5UA 3KF5A 4IE5A 3BODA 4TYSA 2BP6A 1HXS1 3BGAA 5C9AB 4NHYA 2VNGA 3T0DA 4OLLA 4RFRB 2B45X 4A6SA 5JOYA 1C5HA 1HB4A 4UBGA 3I54A 4EN0A 4QPGC 1Q8VA 4V2WA 5HV0A 3L2HA 2OW4A 3GHNA 4MHRA 3N36A 1ENRA 3AVSA 4RGAA 4XXPA 3VHRA 1OOPC 1ZRRA 3S7EA 1X8EA 2W1SA 3ZVXA 3L9JT 4GQ7A 1R082 5IT6A 3BTYA 5IAVA 1UPSA 2X5IA 4EJRA 1H2KA 4RL7A 2ADDA 4RQPC 2LW8A 4XTMA 3GHMA 4ZS3A 1C1FA 2XBO3 2I45A 1XBFA 1AXZA 1RUI1 1OUSA 5FYSA 4QAWA 5D8AB 3VKMA 4IW3A 1LR5A 2E31A 3T2PA 3VBOB 3POBA 5JMCA 3W59A 1RVF1 4OULA 3KF3A 2EIDA 4FOWA 2JDZA 3ZMOA 2H0VA 5LCWL 3O0XA 3SCFA 4K7JA 2DVAA 4XIOA 5FY5A 1GKBA 1EYBA 2BNNA 3B9CA 4GWIA 1UIKA 1NZCA 2RVAA 4FO9A 4XFFA 3TN93 1JYTA 4IGQA 5BNPC 5EFUA 2AEZA 4EZ4A 1AR92 3ZYBA 3ORJA 3ZSJA 4EN9B 4V2VA 1DGWA 4NIAA 5FREA 3OBRA 3DPRC 3NQHA 3MGUA 4HOOA 5FY0A 3ILFA 2EICA 4MV2A 1RUJ2 2IXCA 1G7YA 2WJSA 4H2AA 4XXAA 1W06A 1ULCA 4COYA 4OHYA 2WKKA 1WBLA 2WQ4A 1ZRCA 5KHGA 5A33A 5C3RA 2XLFA 3ZFFA 1VMHA 1PX4A 3OBAA 4I0WB 1WA4A 3NKGA 1UW8A 1OXCA 2ZS6B 1W8FA 3P6BA 3LIHA 2Z5WA 1VBB3 1V70A 4NJ4A 1RUG1 5A6YA 5BNQA 1JU4A 1DZTA 2EXJA 2AACA 1G6NA 3FHIB 1XU2A 1PVC3 2QZ2A 3UKTA 1QJY3 4CEYC 2VUCA 4FPCA 4EWAA 3ZFGC 4AEDA 2R0HA 1UY0A 4Q0VA 1XNCA 1K5MC 4AK3A 3FLPA 3CJIA 1O5LA 3QLQA 3WOGA 2AH2A 4JHZA 3INAA 1UYYA 3U4SA 4KI5M 5FXVA 1KFUL 4XACA 4B4RA 4DUVA 4GKYA 3ACIA 3DEMA 1UYZA 4IV1A 3N9QA 3NNGA 4HXCA 3WQ1A 2HLEA 2RS32 4Y5Z0 3QBQA 2XJUA 5FZ4A 2W08A 5GLUA 2XUEA 1LHUA 3MI8A 4WBBA 1HV0A 2LROA 5ANNA 2R042 5B4XA 2NP0A 3C7OA 1VBA3 2DTYA 3KT1A 3OGJA 3BTXA 5DDJ3 1DGRN 3N9OA 2HYKA 2VVFA 5JI9A 3KQ4B 4Y1VA 1PMJX 1LTEA 3CQOA 1NE4A 4MUVA 1UF2C 2JWPA 2MNGA 1QJX2 5FXXA 3ZOIA 4FPEA 1VE0A 5CVRA 4L0PA 4EN7B 1J59A 2BRTA 3ZSKA 2Y6LA 3FN9A 2VY0A 2W39A 1RHI3 2E32A 2W52A 2X5IC 3CMGA 3TYJA 3BPSA 1DLLA 1R083 1LHOA 3V56A 3FFQA 5C5TA 3IDCB 4ITCA 1VMJA 5IVFA 2EIGA 3I3MA 5K0UA 4UW3A 4TSVA 1LHWA 2PHUA 4BHPA 4O61A 2VVEA 3LSDA 5A7OA 5DZFA 1JHNA 2PHDA 1WUVA 4YW5A 3ZPOA 1S0BA 2E63A 1OQEA 3TB0A 4DQAA 2WUHA 4DIQA 1LESA 3THTA 2OZ6A 3IWZA 3NVCA 2V72A 4RR3B 1UYXA 1JZ5A 3RZMA 2VXJA 4W8JA 1SBEA 3LOIA 5FKBA 1WW6A 4MHUA 4R9BA 3ZR5A 4UF0B 2WT0A 5FQ0A 2E7AA 3HR9A 4CXWA 2P6HA 4W50A 2WFF1 3IBMA 3NO8A 4XEZA 1NXMA 1W2AX 2X29A 2CNAA 1LU1A 4Y5TA 5I0UA 3IAQA 4FQZA 1GLHA 3LF7A 4YVWA 1ENSA 4MGIE 1V6NA 1LENA 1DQ4A 1X8MA 1DQ5A 2DU1A 4QHBA 3AFGA 5C9AA 2JDPA 2DU0A 2VUJA 2P2KA 2QQKA 4UWDA 1Y3TA 5FWEA 3ZFFC 1EAH3 3PUIA 4COUA 5KXEA 1DU3D 2MEV2 4A2UA 1E5HA 1RUD1 1Y9MA 2QVSB 2YYOA 3VBRA 2G1MA 3T08A 2DFCA 1DFQA 2Y34A 1GV9A 4XE9A 1AYN1 1D2SA 1VALA 1KJLA 1W39A 3ES4A 3HAGA 1HW5A 4JV4A 4MSVA 2VW1A 1GZWB 3ACGA 2HWB1 2PHTA 3NNMA 4AEDC 2DVBA 3OD4A 1C3HA 2Y64A 3Q8AA 1OQ1A 4XCAA 3U11A 3WV6A 2VZUA 1EV13 2DVFA 3CJIC 3I2HA 4B29A 5L7OB 4LA3A 3BTZA 4B8EA 5IFPA 4JVAA 3VBOA 1ND3B 4C90A 1JZ3A 1AYM1 1S1AA 2RS13 4ES8A 4SBVA 1QY4A 4IE0A 1JXNA 5JOWA 3ZIWA 5LY2A 1CAXA 4IV1C 1IOAA 4GMP1 3MIHA 1QH7A 4E27A 3ZLIA 4CYDA 1Z7S3 4DUWA 5KBFA 4Q4V3 2VO5A 1SLBA 2Q4SA 4LBOA 2HWF1 2VOKA 3H9AA 4Y3OA 1CN1A 2DBNA 4N7IA 1UY3A 4O9GA 3K4AA 4XF0A 5FIXA 1UXZA 2GNMA 3ATGA 1FMD3 1AUYA 3RI9A 1RGSA 3LQCA 1YCIA 4OUMA 1UKGA 3G7DA 1XYOA 4YW4A 3DXUA 4YG0A 1XNKA 1VP6A 2VMFA 1UY2A 3MDPA 4MLOA 4YM1A 2IZWA 5LZ6A 3J7HA 3RPQA 1EY2A 4R4XA 4FP2A 5ANQA 4GULA 4A41A 4Q8LA 1D4M2 3FE5A 4QQ2A 4SLIA 4Y1ZA 2FDFA 4IE7A 3IDBB 5K9YA 5K0UC 1GFF2 5FO8B 4NWVA 1LGNA 4URTA 4BU2A 1WCKA 1FI2A 1H6YA 3OGGA 4EE2A 4JZRA 1VBD3 1NAEA 3M3OA 1GWKA 2W9XA 2IXJA 2WS92 1B09A 3APBA 2HEVF 3PURA 1RYYA 2O8OA 4YZ1A 2QQIA 1VB4A 3T0AA 2C9KA 2XLGA 3TN91 2VOTA 3PVBB 3H8RA 2ZAAA 4FPHA 5T3NA 4BM8A 2ORXA 3AP7A 5IHRA 1OH3A 2J42A 2VTXA 3OBZA 4HBNA 1YI7A 4DO0A 3WNLA 4U2AA 2Q8DA 3RWKX 1XE0A 3U78A 1XNAA 5DG1A 4YVWC 3NSTA 1PZ8A 4Z2WA 1GOHA 4HSJA 1UY4A 1LNSA 1W99A 4IESA 4CRQA 3VHNA 4LHKA 3KM5A 5C9AC 1PO21 1W9WA 4A44A 2PFWA 1NKGA 3ACLA 3OUJA 3K4DA 1HN0A 4QB6A 4AI9A 4D7TA 1WW7A 4XQ4A 2XJSA 5CBLA 3LEMA 3KT7A 1SMVA 3VBRC 4EWDA 3GNEA 5A3WA 1JYVA 4KG0A 4HLTA 4YPJA 1YNAA 3JBG1 2Y26A 1U5IA 2XR4A 4KWLA 3LEGA 1VBB1 2VR4A 3H50A 4FFIA 4FPKA 4QX7A 4LIUA 4EYUA 5LA1A 5EYXA 2VJXA 3HN3A 3LA2A 3C7EA 4XPVA 1PVC1 1UZYA 1HXS2 3EMRA 3PUSA 4AHWA 5L9BA 4H3WA 1W05A 2DBIA 3OD0A 4LO5B 3VBOC 2V5YA 1WCDJ 3ZPYA 1A34A 2ZEZA 4UFJA 4MG2A 4AQ2A 3TAYA 1DGWX 1Y43B 3I7DA 4BPZA 3USSA 2YC0A 4Y4YA 2CWSA 3LGRA 5IWFA 1VLNA 4P5HA 1DF0A 4RR3A 4BQYA 5FV3A 4BXSV 5HCFA 1G9CA 2HWC1 3ACFA 3WHUA 3N9MA 1RUI2 1XSRA 4UF0A 1QOTA 3HNBM 4DPNA 1DQ1A 1B35A 1U5YA 1UOGA 4FXGB 3OPWA 4Q4X1 5FPXA 2VCAA 4YRDA 3RYPA 1COV3 5FP3A 2W1WA 2XVGA 3LA7A 1VBA1 1I6XA 1RVF2 4IETA 4L92A 1QIQA 3A4UA 3KZ4C 5DDJ1 1RUF3 3AKTA 4CCDA 4W6YA 4DEQA 5C8CB 4NWWA 3JQWA 2JDUA 1NX9A 3PMEA 2VMGA 1MS0A 1ZYBA 1UO9A 4B3NA 2WA4A 1TEIA 5I8SA 1O4ZA 1C8NA 3D0SA 1P8JA 2WO2A 2BU9A 4KU7A 3VD4A 2XVKA 2ATFA 4XQDA 4AAPA 1RHI1 1OD3A 3M70A 3K4ZA 4QQOA 2P5BA 2A6YA 3NAPC 5FYHA 5J36A 4MZUA 1GZWA 3TRSB 1C28A 1TZOA 4OCTA 3V0AB 4QXCA 1DLCA 5HI0A 2P3JA 4P00B 2BJSA 3AMHA 4QPGB 3FHAA 5APAA 1JZ6A 2VNVA 5KXCA 1POQA 3B01A 5L7OA 2YGMA 1Y9QA 4P9XA 4AEJA 1RJ8A 1W0NA 1ND3A 2JG8B 2Q30A 2F6BA 1OOPB 4CCOA 1UZWA 5A1FA 3LE0A 3B02A 4LE3A 2UY9A 4NHLA 3T1LA 5G04L 2E9QA 4XUOA 3WW3A 1NCQC 1RUG2 5DAXA 5FWJA 1OA2A 4RQPB 4Y1YA 3ZSLA 5IATA 4IEOA 2N7GA 2RM23 4MADA 1POV3 1QHDA 2GAUA 3QD6A 4M4PA 3AP6A 4XURA 3SEPA 4BDVB 3PUQA 4AFAA 4ARYA 4PF5A 4Y26A 2YHJA 4I0BA 5GM0A 1JYWA 2VQUA 5FPLA 1GZ9A 2FD8A 5C71A 4UI9L 3WNOA 5DUXA 2RMU3 1MEC2 2KD7A 3MFCA 1EAH1 2WDBA 2XUMA 4FPGA 3A21A 3BN6A 1HKDA 3OY8B 5F3CA 2FDJA 2D5FA 4BIFA 2XJRA 5IUQA 3PL0A 2CV6A 4S2HA 1QWRA 4QPWA 3J4UH 3V0BB 3POFA 1CAWB 1ZBE3 1XPWA 2GN3A 3AZWA 4RS5B 2Y6GA 3Q8EA 1K3IA 1ZBA1 3I2OA 2Q1FA 3ZO0B 3GM8A 4I09A 1LHVA 4K40A 1Q43A 1ZVFA 2OZJA 2GC1A 4AVTA 4D8MA 4LITA 1YJKA 4MXWB 5ABJB 2YBPA 2PELA 2UWBA 1IGOA 2PQSA 2RS11 3LD8A 2BNMA 3OUIA 1FT9A 1PIV3 3I59B 5FZMA 5FZ8A 4RR3C 3E5QA 2XL7A 3SNMA 5A80A 4XBQA 4Q29A 4QD2A 5KHJA 2D6NA 2GU9A 3PUHA 3D6EA 1B35C 4YW3A 2ARCA 4M0NA 4Q4V1 4X8PA 2WWUA 1E57A 3LOBA 2HYXA 4WZCA 3ZYIB 1ACCA 5HPOA 3WG1A 3VKNA 1H30A 1FMD1 5T54A 2VECA 2VPVA 4NE9A 4QM8A 4ISRA 1KD7A 4CCLA 2D3RA 5EIYB 3LEKA 5T50A 1OLME 3UGFA 4Q0PA 2DCZA 4AI3A 1BZWA 2A6ZA 2WFF2 3IZOA 4N43B 2QBXA 3DYPA 4HSLA 5GJ6A 4DUXA 1CX4A 5I0DA 4GMP0 4XUQA 4C0BA
chains in the Genus database with same CATH topology
1X33A 1FNZA 2GNTA 1CIWA 2Z79A 1F31A 3AMNA 4IEVA 1RMU1 4KGQA 1D2QA 5A3MA 5H9RA 1VBD1 5L7OC 1WD4A 2BWCA 1ND3C 2QE3A 2QFEA 4HN0A 2GNBA 3IKWA 1W6NB 1NG0A 1IKQA 1AYN2 4ZU5A 1ZRFA 1Z78A 3H8UA 4YW2A 1W0OA 3FBYA 2ES3A 2HWB2 4FOQA 2XH6A 3WUDA 4F3JA 1GSLA 4L9BA 3ZDSA 1Y7BA 2R1DA 4HKWA 5JSOA 4QQPA 1AYM2 4OFGA 5T5OA 1FOD3 1U12A 3VHPA 2JICA 2FBEA 2YY1A 5C8CA 3C2UA 4AI8A 5IK7A 2WLQA 3EJKA 4RGGA 3M7AA 2DVGA 1RINA 1VJ2A 1IS5A 5GALA 1JOJA 4I2OA 2ENRA 2HWF2 4XIKA 3IPVB 1IQAA 2EXIA 2YMZA 1SLTA 1MS4A 4E2GA 3IMNA 1ZZBA 4XFAA 5CG8A 1JYCA 2R0FA 4RA0A 1V6KA 1S2KA 4FTBA 2JENA 2X8KA 5HXVA 1N3OA 5J48A 3ZFFB 3V0AA 4YVSC 1YIFA 4Y20A 3ZYJB 4Q0UA 3IM0A 3MIBA 2P17A 2RJKA 1W6OB 3S0MA 1ZZ7A 2AGSA 1TQ5A 2PHFA 1GQHA 1R1A3 1MACA 2B9UA 2JG8A 3LCPA 2MPFA 3HT1A 4HANA 4E4DX 1G9FA 3WCSA 3HQXA 1NY71 5LK7B 3JD73 4RQPA 2ZZQA 1KFXL 2DYCA 1COV1 2C0ZA 1XNBA 5IK8A 2YUEA 5E88A 3NV2A 2ZX0A 4NOTA 1PGW1 2P3KA 1JUHA 3R4DB 5BNNB 4KBBA 3THPA 1KJRA 1SFYA 5BV6A 4I30A 3LA3A 2IFRA 3TN92 4COVA 1OI6A 2R16A 2RHPA 5CU1A 2A6VA 4NO4A 1X7NA 4DOUA 3OY8A 5BPXA 3AXDA 4NHMA 5A32B 3V0BA 3GF6A 2PTMA 1CAWA 4RS5A 3DL3A 2EVXA 1PO22 3RDIA 3VKFC 1S0EA 2GZWA 3VGIA 1LEDA 3B3QE 4MXWA 5GLVA 5ABJA 4C91A 3B7MA 1HDKA 4GB33 3CO2A 2LUWA 4HKLA 2ZGRA 3JBG2 1RUD3 5CB7A 3ILNA 2GMPA 3I59A 4QXKA 5L73A 1VBB2 2FMYA 3VBHB 2Q8OA 4JGYB 1W2UA 4KU8A 5FLIA 3MF6A 3U4XA 2RM21 3TOJA 4V1PA 3A0NA 1POV1 1PVC2 4ASLA 2D44A 2ZBJA 5FTTC 1GQGA 1FPN1 1M06G 1QDOA 3VN4A 4U36A 2E51A 5AC93 2DURA 3G6JB 2RMU1 2EA7A 1UZZA 5C8CC 2BQPA 2ARBA 5CAZA 4TZDA 4NN0A 2A5ZA 4RD7A 2HWC2 4XJ9A 2EXHA 3ILRA 2DVDA 4AFMA 5KHKA 4Q4X2 2TBVA 2ZOEB 4LBMA 1C57A 1ZBE1 1ZNPA 5HCBA 4MVTA 1VBA2 4N43A 1TME1 3JQXA 4XBLA 4H14A 5DDJ2 5FMOL 3AFKA 4B4QA 3DUIA 1A6CA 3I2DA 3M3CA 4UBHA 4LBNA 4Q4Y3 1PIV1 5FAXA 2ARXA 1MS8A 1F5JA 3MIDA 3VBRB 2JG8C 3IT8A 4QU2A 2WSUA 1RHI2 4XETA 3KCYA 2WINB 1RUNA 1W6NA 1QXJA 4L2NA 4Q2FA 3X29B 1O7FA 2FZ1A 2BVVA 3SH4A 3RJRA 1LECA 1YRZA 4EWEA 3OTFA 4XMAA 1VAKA 3LSEA 1SLAA 1ZZ9A 1UMZA 4DY5A 5EJ3A 1CAXB 3KGLA 4Y24A 1OPMA 1MZEA 1IS6A 1C1LA 1LOBA 3AP9A 2UU8A 4LBLA 2WLPA 5KWRA 4DB5A 1LOAA 1BCXA 1D0HA 1KXGA 3RZZA 1RUOA 4AF9A 3IPVA 4RS5C 3OPZA 3R0RA 4HVRA 1UL9A 2VOVA 3WINE 3WW1A 5I8TA 3CEWA 1ASJ1 1H1MA 2D7FA 2FQPA 2RJLA 1PO23 1EAH2 4Q4W3 5ABJC 3S30A 4AI1A 2P34A 1W6OA 5J3UA 3M4FA 1YJLA 3JBG3 1ZRDA 3LKJA 5T52A 4N7UA 1BKZA 3NAPB 3WW4A 1NLSA 2SBAA 1ZBA2 1NQDA 3AYDA 2BFUL 1Q8SA 5T5LA 1EV12 4Y1XA 2RS12 2Q5TA 1FOD1 3EQEA 4CDXB 1G9BA 2GH2A 4D94A 5BNNA 1OPOA 3PTYA 4FPJA 1QXRA 5DZEA 1NCQB 3D4KA 2CY6A 2JE9A 3OCPA 1GICA 1OA3A 1Z7S2 2HWC3 1WLCA 2JKBA 2A3WA 4INDA 4Q4V2 5I91A 1GBGA 4Q4X3 4N43C 2PHRA 5BY5A 5DG2A 3WR0A 5A32A 1FMD2 2V09A 5JPMB 4CDUC 1DGLA 2HWE3 5H9PA 2GMEA 4Q26A 4MX3A 1O91A 1DDLA 3RI8A 3RWNA 3B5LB 1PGSA 1R1A1 5ACA1 2B46X 4DMIA 2A70A 3KLSA 4LULA 3VBHA 4W6WA 3H1YA 2DUPA 4ORFA 3JD71 4JGYA 1TMF3 1UKRA 2BW8A 4JCKA 4R52A 5DZGA 1NQJA 3IDEA 3KSCA 2QKDA 4XILA 1KDKA 4ZKTB 4J1XA 4JRAA 1L3JA 1VBD2 1U5ZA 1BBT3 1AXYA 3ZXAC 2JJ6A 4BZ4A 2H0BA 5BUVA 4Q1RA 4XFBA 4A7YA 3CNAA 1BVVA 2R1BA 1B35B 1N1TA 3O5SA 5FMOS 4CDQB 3WHTA 4YZ5A 2ZCWA 3FBMA 4M3CB 1S0CA 1VBE3 4HVOA 4N9HA 4AVSA 1UAIA 4JDMA 4XFGA 4PLMA 4S2DA 1QU0A 4KWKA 1RTVA 3VZJA 1UD1A 2DCTA 4GB31 4L97A 1S0GA 3AP4A 4K8FA 3MZHA 2XJVA 4Q0SA 4Z92B 2ZKLA 4BMEA 3K51A 4E9KA 3VBSB 3ZYRA 2OIIA 3OYWB 1ZBA3 1LHNA 2CAVA 4R8HA 5I0TA 5F9TA 1LU2A 1RL3A 2E6VA 4H7MA 1BK1A 5JOZA 5L19A 1REDA 3ROUA 3ASIA 5AC91 2R32A 2BWAA 5BNNC 4QT6A 1N3PA 4OHZA 4BOWA 2E53A 1ULFA 2B39A 1RJ7A 1NY72 1SQ4A 4HZFA 5GZDA 2CGOA 5FLJA 1DIWA 3MIFA 3RRDA 1COV2 1HQNA 1N1VA 5E1RA 5I0SA 4OVEA 2QDNA 4L99A 3E6CC 1PGW2 3I4IA 1RUF2 1POV0 4GIQA 5F6KA 1APNA 4WVZA 2DTWA 3JB4C 2C1FA 2O0OA 1VRH1 1OLQA 4FBFA 4Q4Y1 3J8F3 4HETA 4IEZA 4AVCA 4P9GA 5FDBA 2BFUS 5F6LB 2ZJCA 4DY3A 5CNAA 3VBHC 1GNZA 3KB5A 4JGYC 5FCCA 4AEKA 4XBNA 1UCXA 3NAPA 3OBTA 3ES1A 4NVPA 4C1XA 1RMU3 4YVSB 3AZYA 1AR61 2WNEA 3LB9A 4K9SA 4OI4A 1AL23 4CDXA 4KGGA 2NYYA 2BEOA 3UJOA 3B00A 3ZSMA 2VH9A 1DHKB 2RM22 1NCQA 3W58A 5EYYA 3ZXGA 4XJUA 4ZU4A 1AR81 2UYAA 1XE7A 5LK5A 3JZVA 1FPN2 2NQYA 1MZFA 1G86A 2ZGQA 1V6LA 5JIUA 2RMU2 1WW5A 1BJQA 4Y1UA 1HRV3 4BCUA 1V6JA 4Q4W1 1BMV1 4YNIA 4QQHA 5JZGB 1KITA 3SHRA 4K20A 4HVQA 1R091 4GWNA 4DZGA 1ZBE2 2CWMA 1TME2 2D6PA 2XB6C 3VL8A 4ZU7A 4META 3AKPA 2R061 4IEWA 4P9IA 3P3NA 1WD3A 3B94A 5DXDA 2VNRA 4PBPA 3KS7A 1F8VA 1CAVB 2Y38A 1NLRA 1PIV2 4D3WA 5CFCC 1JBCA 3PJYA 4AI2A 1HLCA 4N90A 2ZAHA 2YROA 4I0AA 4AQ6A 5A3LA 5CADA 2F4PA 1OFSA 1QJU3 1QOOA 1SBDA 5I0RA 1H9WA 5F1RA 2XJTA 4R4ZA 2ILMA 1WMDA 2A71A 5CIRA 4XMIA 4CDQA 4XHXA 2VGDA 1S0DA 4YSFA 2DV9A 4P9WA 1KQRA 4WVWA 1UN1A 3AMPA 4M3CA 2HWE1 1NXD1 4CDWB 3GZTB 5J98B 4PLOA 2QDRA 4OHWA 3U10A 4AW7A 3BB6A 3EBRA 4EN8B 2ZGKA 3VBUA 1UU6A 2ZTNA 3N3HA 2JE7A 4DRRA 3NKTA 1RUC3 1T6GC 2PHLA 3AMQA 4P9YA 1TMF1 4LUMA 1ASJ2 3VBSA 2YXSA 3FLRA 2QNKA 3OYWA 3RMXA 4Y20B 1Q56A 1BBT1 4JDNA 1AX1A 2ZZJA 1PM7A 4CDXC 1UU4A 2GALA 3KD4A 1GANA 2CYFA 5CFDB 1XYPA 3JU9A 5SV8A 2WZR3 2PLV1 1LOFA 3AXEA 4AGVA 2HKXA 3WVJA 5AFBA 1YFYA 4E4SA 1U5XA 3POSA 2A7AA 3FUOA 1VBE1 2BGCA 1FPN3 4KH9A 3E6DA 1FOD2 3DF0A 4QQLA 1H8TB 4D69A 4RHV1 4LO8A 3WDVA 3PNAA 4F7ZA 1JYIA 3SXWA 3QOPA 2A6XA 4B7EA 4BQ1A 4DS0A 4MYEA 4WM8A 3J26N 1WLTA 4W6XA 3E5UA 3PVOA 1CAUB 2GSYA 4XTPA 3RYKA 1TME3 3RMYA 1AX0A 1MS1A 1OMIA 4IEPA 1G9AA 3H1MA 2CL2A 1AR71 4ISQA 4YLZA 4A7ZA 4HN1A 3GBGA 4J6GA 4YVSA 1R1A2 2B42B 2NMNA 2Q1ZB 2QCSB 5ACA2 2ZHLA 1VAVA 1A8MA 4CTEA 1WLDA 4HT1T 3AMMA 3JD72 5C33A 1D4VB 1D0GA 4BWOA 3GBFA 2IXKA 4CDQC 1CPNA 3VZKA 3VUOA 1BEV3 1WLWA 1SLIA 1N47A 3J9SA 2WA3A 2I2SA 2TUNA 3K48A 1QNWA 5HBAA 2WC2A 3PVNA 3O12A 1V6OA 3KMHA 3J8F1 1QQP1 3VBUC 5FFOC 2I74A 1XQNA 5JZGA 4K3UA 3ZFEA 2DCKA 1MZ5A 4BMBA 1SEFA 2XJQA 3VBSC 4CDUB 3M2MA 2CAUA 4CEWB 1DYKA 4JAAA 3ZXKA 5JSPA 1ASJ3 3N7KA 1VR3A 4HPKB 5JSRA 3VKLA 1LOCA 5E8AA 1V9U3 4BH9A 4GB32 1CAVA 1ULDA 1YO8A 3VZMA 3WDTA 1AL21 1RUD2 4H7LA 3R4SA 2VQAA 2FZ2A 1LOFC 1YHFA 2IC1A 2FMDA 1W6MB 1PMIA 3AP5A 4YGEA 5EZWA 5LRSA 3RYRA 2AENA 4MGKE 3AX4A 5GLZA 2WNVB 1H2LA 4FAGA 4AQTA 5AC92 1QKQA 3L2YA 3ZIXA 1LEMA 1HRV1 2A3YA 2VW2A 4LT5A 5JPNB 2PAKA 4CDWA 3H3UA 3EO6A 2R073 3WP3A 4WM8C 5AVPA 4QPIB 5H9QA 5J09A 3AM2A 3LWCA 5JOXA 4R9CA 3BIWE 4WVVA 1YWKA 3MYXA 3WG2A 1UIJA 2OPKA 1OHFA 1AF9A 3AZZA 1YI9A 1URXA 2VOXA 4FOVA 1JN2P 1VRH2 1FX5A 2K0GA 5EWSA 5T5JA 4IV3B 4Q4Y2 2RS53 2QZ3A 4ONUA 2E7QA 3VLBB 4MGYE 5FOBB 1LB2A 3SISA 2MEV1 1KS4A 2IXLA 5ACA3 1ENQA 1O4TA 1GR3A 4YGBA 1QJU1 1RIRA 5CFDA 2ET7A 4MGZE 5IK4A 1HX6A 5DUVA 1CQ9A 1BQPA 2PQQA 2Q1MA 4NR1A 4HK9A 3UK9A 1CPMA 2D43A 3E6BA 1PZ9A 3MW2A 4COWA 4ATEA 2AUYA 3O0VA 1OSGA 1REEA 4R9AA 3H7JA 1AR62 2GN7A 4ZXKA 1H8TA 5J7MA 2ERFA 5DUUA 1FATA 2ZHKA 4LBQD 4YFZA 5GLTA 5I8YA 4L11A 5JZGC 1RUH1 3RNSA 1UU5A 1LGCA 3ZFEC 1AR82 2TNFA 5K7PA 4LTAA 2RR11 3FFZA 1RUC1 1QGLA 2XWBB 4N9IA 2H6BA 2BUKA 3FX3A 1CAUA 2VW0A 3OF1A 4P9LA 4AYUA 3HN1A 1H1AA 4Q4W2 2MHFA 4YM3A 5GLWA 4AGRA 1W6PB 4RSUA 1SLCA 1NCRB 3MPPG 4COZA 3ETQA 1S0JA 1R092 4I02A 5KXBA 2WZR1 2PHWA 3U07A 1I3HA 4AHYA 4Q8KA 1ZA4A 4YGCA 3AKSA 2BVBA 3ZSEA 2R062 2BNOA 2IXHA 3LAGA 4EN6B 2WFPA 3D8CA 1X50A 5FPZA 4YW1A 2EXKA 3ZN5A 3NL1A 1QXPA 1NA1B 2ZMKA 4CDWC 5C8WA 2ZGPA 4AHXA 2WL1A 3E5XA 3ZXFA 5E89A 2D93A 4G3YC 4IXLA 2D6OX 4DXZA 2VOWA 3PLQA 1VBC1 4LR4A 4I01A 3VZNA 1M4WA 4BYYA 1Z0HA 3VBFC 5CG9A 4HL0A 5FLHA 5DUWA 4Y22B 3VZOA 3PVEA 3UJQA 1GZCA 1I5ZA 1EPWA 2HWE2 1DQ0A 4HK8A 4NPRA 2GC0A 4Z82A 2CGNA 4AE2A 4FSJA 5GKAC 4CDUA 3ZYPA 2G4IA 2ZHNA 5EXOA 4CEWA 1J3QA 1VRH3 4FPOB 1FNYA 1VIWB 4LO6B 4HPKA 1QF3A 3AZXA 1ENXA 3WUCA 4YGDA 3FC0A 3URFA 3CJXA 2R30A 1AXKA 5CFDC 3O14A 4Z8BA 3QH7A 2VU9A 4IEQA 4AG4A 1TMF2 2YPJA 2AZ5A 1W6MA 4LBQB 1BEV1 1PVXA 3AYCA 4N53B 1BBT2 4IERA 3A0KA 4KWJA 2DUQA 2XGXA 2WNVA 5CFCB 3POWA 1J58A 5T5PA <