3WCRA

Crystal structure of plant lectin (ligand-free form)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
235
structure length
229
Chain Sequence
ASQTSFSFQRFNETNLILQRDATVSSKGQLRLTNVNDNGEPTLSSLGRAFYSAPIQIWDNTTGAVASFATSFTFNIDVPNNSGPADGLAFVLLPVGSQPKDKGGLLGLFNNYKYDSNAHTVAVEFDTLYKPRHIGIDVNSIKSIKTTTWDFVKGENAEVLITYDSSTKLLVASLVYPSLKTSFIVSDTVDLKSVLPEWVIVGFTATTGITKGNVETNDILSWSFASKLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Erythroagglutinin
publication title Phytohemagglutinin from Phaseolus vulgaris (PHA-E) displays a novel glycan recognition mode using a common legume lectin fold
pubmed doi rcsb
total genus 56
structure length 229
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wcrA00
1LTEA 1LECA 1SLCA 4XTPA 3ZVXA 1ULCA 3A4UA 2JJ6A 3B9CA 4FQZA 1H9WA 4FOWA 1H30A 3M3EA 3UL2A 1SBFA 2VXRA 2DU0A 1QMJA 2ERFA 2EALA 3AZZA 5DUUA 5T5LA 1A8DA 3R05A 1LODA 2ZGRA 4Q1RA 2NYYA 2AH2A 1BZWA 1ZA4A 4NOTA 3Q9OA 1GKBA 2W39A 2P37A 1FNZA 3PVOA 4PBPA 4Y1ZA 3LCPA 4YGEA 1LHOA 2NZ9A 5SV8A 3WDYA 3VKMA 4XE9A 1CESA 5H9QA 4YLZA 1LHNA 3AZVA 3ZXKA 1KJLA 3AFKA 1ULEA 3D6EA 3MPPG 4Q26A 1ULFA 3WOGA 1AXKA 2E7TA 1ENSA 4ITCA 5GLWA 5DZFA 4R9CA 1WW7A 1V6IA 1DQ0A 1SLTA 4YG6A 3SH4A 1PZ8A 4GA9A 2FHRA 4FPGA 4M00A 5CB7A 1QDCA 1DGLA 1Z78A 4DQAA 2R0HA 2ZABA 3PVNA 1UL9A 4W65A 2ES3A 3O0XA 1WBFA 3NV1A 3JU9A 5IUQA 3RG0A 1RIRA 3AXDA 5JDBA 3SH3A 1F9KA 2GNBA 3O12A 1LHVA 1J1TA 3CNAA 3APBA 1N1SA 4TYSA 5DG2A 1YI7A 3WVJA 1C4RA 1FV2A 3BOPA 3IKWA 3USUB 4HANA 4YZ3A 3AK0A 2E6VA 5JVVA 2D3SA 1WLWA 2R1BA 1SCRA 4XHXA 4Q2FA 1O4ZA 2WSUA 2PHTA 4K21A 1F31A 3WCRA 3PVEA 1DQ5A 5E8AA 2EAKA 3AXEA 5T50A 3WDVA 5JOWA 1ENQA 2W68A 3ATGA 2DWRA 1HKDA 2ZHLA 3ZXJA 4BLJA 2A75A 1AXZA 4CZSA 4R9BA 2H0BA 4YW4A 3RQ0A 5JMCA 3VV1A 1HLCA 1S1AA 1MS4A 2DUPA 4U36A 2D6NA 5T52A 1MZ5A 2EXHA 2C5DA 2AR6A 5EXOA 5CBLA 5FREA 2VW1A 4FPJA 2XG3A 1QKQA 1O4YA 2ZHNA 2JECA 1KJRA 4AWDA 5IK7A 2JE7A 3OPZA 2DVDA 1W6NA 3VUOA 2CWMA 3BIWE 1FX5A 2W08A 3D5OA 5HCAA 3AP4A 1W6PA 2P3KA 5JOZA 5LK5A 2GDFA 5H9PA 3VKFC 1LGNA 1MR5A 1ONAA 2WKKA 1GZWB 1NXD1 2GMPA 5GLTA 1QU0A 3N7KA 2GN3A 1U0AA 3C2UA 4YFZA 4Q1PA 1CIWA 1WLDA 2OVUA 3WHTA 1BKZA 5BYNA 2P3JA 3N7LA 3B01A 1YRZA 1G7YA 4FOYA 1DQ6A 1W6QA 3AJYA 3NV4A 1IS5A 1GYKA 3ILFA 1MVQA 3A0KA 1LJ7A 1NLSA 3I4IA 4FOVA 4WV8A 3AZYA 3AYDA 2DVBA 5F5QA 2A3YA 3AJZA 3AYEA 1HQLA 1QOSA 3POSA 5GLZA 2PHWA 1Q8QA 3O0VA 5CA6A 2E53A 2R0FA 2B7YA 1GBGA 1S0JA 1MS9A 3PJQA 2ZGMA 4GKYA 2VW2A 3LSEA 4KBBA 5DUWA 3POWA 5GZFA 3SH5A 1W0OA 1JHNA 4YM1A 5KXEA 5DZGA 4I30A 1LEDA 4ISRA 2NM1A 2DVAA 3OBRA 1W6MB 2GNDA 4XBQA 1N1VA 1QOTA 1GZCA 2Z42A 1LGCA 5GLUA 3IPVB 3N7MA 4LBQB 1S0DA 1G9FA 4AVVA 4XXPA 1Z0HA 2P3IA 1CVNA 1BXHA 3FLRA 1W6OB 4M3CA 2A6YA 2UU8A 3MEPA 3WDTA 3AP9A 1ENRA 5T5OA 4FVVA 4AVTA 3WG3A 2NMOA 3AP5A 2WT0A 3DGTA 5EYYA 2DTYA 4FPCA 2R16A 1KDKA 1S0GA 2AENA 2D6KA 2ZMKA 2GMMA 4JCKA 3UJOA 2A5ZA 4ZXKA 1JW6A 1V6OA 1VAVA 4FOQA 2A71A 4CTEA 1FAYA 2ZA9A 1G9AA 3ZYPA 2DVGA 1VAMA 2VH9A 4K20A 1MS1A 4XBNA 5H9RA 2P34A 1N3PA 2TEPA 1LHWA 2DYCA 4FPEA 4FPFA 1UZYA 5H9SA 4DS0A 1MS8A 2A6VA 3WG4A 1S0FA 2D3PA 5GALA 1I3HA 3AZWA 4XZPA 5KXBA 2VY0A 3ILNA 1S0CA 3M3QA 1MVEA 2D6LX 1GNZA 3ASIA 1V00A 1Y7BA 3V0AA 3O0WA 4XTMA 4Y24A 4Q27A 2SLIA 2YXSA 4FPKA 1AZDA 4SLIA 1S0BA 1Q8OA 3M3CA 1G9DA 4XYXA 5E88A 1LOFC 3NV2A 4GXLA 1DHKB 1DZQA 2D3RA 4YM2A 2DV9A 1H9PA 2A6ZA 2OUJA 5EWSA 5AVAA 4GWNA 4UW6A 3W58A 3OGGA 1D0HA 1QNWA 4U2AA 2WNEA 1CPMA 5JLVA 4LBKA 1LOGA 2VU9A 4ASMB 1MS5A 2WT2A 4AGRA 4XJ9A 2DVFA 4DRVA 4YW5A 3ZYRA 1JYIA 1DQ4A 1IOAA 2AUYA 4XOGA 5T5JA 3SLIA 1UZZA 2LTNA 1YIFA 4ZKTB 3IN9A 1JYCA 3ZXLA 1UAIA 2ZMLA 4WVWA 3BTAA 5IK8A 3SITA 4YGCA 1EPWA 1SACA 5L73A 1X50A 4JRAA 3RRDA 2DU1A 2UURA 5T55A 2ZGPA 2JKBA 3V0BA 1C57A 1YO8A 4L8QA 5HCFA 4K1YA 4XJZA 4FPLA 5IT6A 1V6MA 1ULGA 4LBJA 1ZM1A 3SISA 2GNMA 5GM0A 3POYA 5DXDA 2C9AA 1WW6A 2PHXA 2D7FA 1B09A 4GALA 4PCRA 2D6OX 4WZFA 3ZXFA 3WCSA 2ZHMA 5EYXA 4Y22A 4R9DA 2ZGKA 2YZ4A 1SLBA 1W6NB 4PQ9A 2WQZC 1PZ9A 4FQ4A 4RA0A 4YG3A 5T5PA 4YW3A 4Y22B 1S0IA 5E89A 1V6KA 1W6PB 3AYAA 2A6WA 3T2TA 1A3KA 1N1TA 5KXDA 2YY1A 4BMBA 3WUDA 3ENRA 1PZ7A 2GNTA 2WJSA 4R9AA 1OFSA 2DUOA 3W59A 3GNEA 3MW2A 1GSLA 1KQRA 4HL0A 2R49A 4AGVA 2P2KA 4WVVA 3FLPA 4NO4A 2CY6A 3OYWA 1FNYA 1S0EA 1W6QB 2ZGSA 1MACA 1C1FA 3A0NA 2KM2A 5GJ6A 3QCWA 1GLHA 3OYWB 3ZPYA 1N3QA 1LENA 1WW5A 1N1YA 2OUHA 1UMZA 1OKQA 4AYUA 4M3CF 1VIWB 3WG2A 4BMEA 2ZGTA 4P9XA 4XIOA 3FFZA 1IKQA 3WDXA 1DFQA 2NN8A 3UJQA 4GWMA 3OY8A 1LU1A 2ARBA 3RMYA 1APNA 2WLQA 2D6PA 4PBOA 1G9CA 3WLUA 3GALA 4YZ1A 2D44A 1IS6A 4H55A 5IK5A 3VKLA 4ISQA 4YZ4A 3AX4A 5DUVA 1C1LA 4ATEA 2DUQA 4FP2A 3FUQA 1SLIA 2BQPA 4F83A 2CYFA 4YZ5A 5CAZA 2RHPA 3B00A 2XB6C 4BQ1A 2R1DA 3ZSLA 3AP7A 4YW2A 4DPNA 1DBNA 3HR9A 4BM8A 1QNYA 3R4UA 4YM0A 4M3CB 4YGDA 1AVBA 4BOWA 3L2YA 3N3HA 2PELA 4YG0A 5KXCA 1WUVA 2E51A 4IQPA 2ZGNA 4LBMA 1GV9A 1RITA 1UX6A 2WSVA 4FPYA 1F5FA 3OBTA 2JDZA 4XBLA 4D69A 1VALA 1GANA 2AREA 2PHRA 3KM5A 4YZ2A 1LGBA 1CN1A 4Y1YA 1WLCA 2DURA 2G4IA 4XJWA 2WT1A 5GLVA 3FBYA 5IK4A 1LOCA 1SLAA 2CNAA 1BJQA 2PHFA 1VLNA 2D6MA 2A7AA 1RINA 4FP3A 4FPOB 1CPNA 1SCSA 4Q8LA 5GZGA 2EF6A 4DRRA 4Z8BA 2CWSA 1DYPA 3VKNA 2SBAA 2ZZJA 3RMXA 2EXIA 3T1LA 1MS0A 4K1ZA 1LHUA 3RS6A 1Q8PA 5HCBA 4OZXA 4GKXA 1QF3A 3V0AB 3WZ1A 2UWAA 2A3WA 4M01A 4YGBA 1YXWA 3MW3A 4BLIA 4YM3A 1ULDA 3B3QE 2V5YA 1LOFA 1WD4A 3IM0A 1R1ZA 1QGLA 1TEIA 1WBLA 1UKGA 1LCLA 3D4KA 1GNHA 5GZEA 4TZDA 4Y26A 3WUCA 1JBCA 3BODA 2YROA 4LBOA 3ZSJA 1XQNA 2AYHA 1DQ1A 3DUIA 1UPSA 3H0OA 2PHUA 2VW0A 1SBEA 4XJ8A 2E7QA 3O5SA 5DUXA 1N3OA 4DFSA 3M3OA 1DIWA 1FV3A 2CTVA 4LBLA 4C1WA 1UN1A 1W0PA 1LESA 2FMDA 1KDMA 3USUA 3ILRA 3NWKA 4UW4A 2GN7A 1WCSA 3AYCA 3UK9A 1MZ6A 4XDQA 2OW4A 1WD3A 1IS4A 1G86A 1WW4A 4LBNA 4AVSA 2A6XA 1CQ9A 4BPZA 3M1HA 5GZCA 1FYUA 4YW1A 1JOJA 1N47A 2UWCA 3LSDA 3OJBA 4RL7A 5JOXA 2A3XA 3V0BB 3TB0A 2GMEA 1GZ9A 2Q5TA 2UWBA 3HMYA 3NV3A 3RSJA 2EXKA 4C1XA 3B69A 2VUAA 1AX2A 4Y20A 2HYKA 2I2SA 2ZGLA 1DLLA 3INAA 1BYHA 3WDWA 2EXJA 4PF5A 1I1EA 2ZGUA 1AF9A 1AXYA 3AP6A 4XJUA 2A70A 4Y20B 1FATA 1Q8SA 2AGSA 2W52A 3FUOA 2ZACA 4XMIA 3AZXA 3U4XA 4P9WA 4UW5A 5T54A 1CONA 3MW4A 1CR7A 4XJAA 2DTWA 2D43A 1JUIA 1CJPA 3FLTA 3PMEA 4UW3A 2YV8A 4ATFA 3WG1A 4XIKA 3IMNA 1V6LA 2ZHKA 1GZWA 3WNXA 1LOBA 1KITA 3T1MA 1IKPA 4XHBA 5DG1A 3SNMA 2LALA 2ZMNA 1DYKA 1OQ1A 1AJKA 2V73A 2ARXA 2NMNA 1AX0A 4AGGA 1D2SA 3N36A 4M3CE 1URXA 3KQRA 1SBDA 3JUUA 1G9BA 1HQWA 5DZEA 4P14A 5GZDA 3WHUA 1BQPA 1JN2P 1GICA 1LEMA 3ZSMA 1G8WA 2ZAAA 4Y1VA 1LOEA 4XMAA 1YYNA 2CL2A 3ZXEA 4CRQA 1JXNA 3OY8B 3M2MA 2ZGQA 3V64A 4XILA 5JOYA 1QOOA 4FPHA 2JE9A 3HN1A 1LOAA 4P9YA 3N7JA 1KRIA 3QLQA 1V6NA 1V6JA 3VKOA 3N35A 3I8TA 3V65A 1LU2A 1QDOA 2EIGA 2ZGOA 4Q8KA 1A78A 4XXAA 2YMZA 1AX1A 1MS3A 2GALA 4Y1XA 3WV6A 5CNAA 2ZBJA 1W6MA 2ZKNA 4YFWA 1LULA 3R4SA 2JD4A 1IS3A 3IPVA 2ENRA 4LBQA 4Y1UA 5FRAA 1SFYA 1Q8VA 1DQ2A 3WDUA 1SLLA 2NP0A 1Q56A 3TAYA 1HDKA 4MYEA 1AJOA 1W6OA 4JC1A 4LBQD 3ZSKA 5F9TA
chains in the Genus database with same CATH superfamily
2Y6LA 4WVMB 1VBC3 3ZVXA 1JI6A 5LEJA 1QEXA 1H30A 1QXJA 3O1PA 3RI9A 2G9GA 2VXRA 1GWKA 5HCHA 2DU0A 1TME1 3AZZA 5C8WA 3NO8A 5CKMA 2PAKA 2C4XA 2NYYA 2X5IC 4HZFA 4IEVA 1BZWA 1ZZ8A 1ZA4A 2BJSA 2XJTA 4NAMA 2W39A 4LO6B 1HRV2 4Y1ZA 2PLV1 5FXVA 4IV3B 4YGEA 3MGUA 5D21A 2VE1A 1IQAA 2RMU3 2ZXQA 1H6XA 4XE9A 3FFQA 5H9QA 1LHNA 5LATA 3ST7A 3WF4A 1AR81 4IETA 4MG2A 1ULEA 3MPPG 3I3MA 3D8CA 3VDBA 4E4HA 5C8CC 1WLTA 3DL3A 4XFCA 5J09A 5IVCA 4R9CA 5JIUA 2AEYA 2V5DA 4QMAA 3CJIC 1YQCA 1VMHA 5CEHA 4Z92B 1RHI2 4LXLA 1EUTA 3WEZA 3WY6A 2W94A 4JGYA 2R0HA 4ES9A 1SDWA 4KWJA 2EICA 1HJGA 4MXWB 4YNIA 3NNJA 3ZOIA 2HKXA 4DMIA 4AVBA 1RUNA 3I2FA 4OLLA 1VBB3 2P6HA 3VGIA 1X36A 1F9KA 1DDLA 2QTWB 4BHPA 4QM9A 2JKXA 4JDNA 1BMV1 1UU6A 5FZEA 2B45X 1OLMA 3I97A 3PUSA 2CV6A 4CDUC 4HANA 4HKLA 2WUHA 2R1BA 1SCRA 2Q1ZB 4NRMA 3H8UA 3IIIA 5FZLA 4QPIA 4I0WB 2WSUA 2PHTA 4HFSA 1RUE3 3PMSA 2RS33 3PVEA 4Y33A 5FP8A 3ROUA 3WCRA 1ENQA 2W68A 5E16A 3ATGA 2DWRA 2ZHLA 5JSOA 2A75A 4IV1B 3S6PA 2VO5A 5LK7B 3I54A 1RMU3 3QH7A 5JMCA 3VV1A 2DUPA 3J8F1 2LRPA 1DGWA 2EXHA 5EXOA 1UD1A 1OPMA 1BCXA 1AR91 2VMCA 5FZDA 2RE9A 3ZKUA 3AMNA 2ZHNA 3LZZA 5ISLA 4FFHA 3R6SA 4C8DA 5E6HA 3OSDA 1GP6A 4AWDA 4RD7A 5CFCC 4CA9A 5L36A 5KWRA 3AVSA 4D7SA 3CDZB 2BERA 2WNVB 3NAPB 4N90A 5FWJA 4XUQA 2W08A 4QPYA 5HCAA 1QJX1 4JTOA 5JOZA 5LW9A 1W9WA 5F5AA 2JDAA 2VVEA 5JUVA 3MF9A 1A34A 4CXWA 3SMHA 1W99A 2R071 1GU3A 2VCCA 4BIFA 5CVRA 2E7AA 3TNQA 4FOYA 3AJYA 2R6QA 1JYTA 1R1A1 2R063 4HVOA 2Y6GA 1BEV1 1AR92 1GYKA 1HW5A 1MVQA 2RR11 2V72A 3A0KA 3E5QA 3WD5A 4AI3A 4Z2WA 3E6BA 2VZTA 3AZYA 5FY1A 1OHFA 4AZZA 5B2GB 1HQLA 4NN0A 1AYN1 1QOSA 3CKHA 3BYWA 2WL1A 4IEOA 3LDRA 5GLZA 3O1RA 4ZZ8A 5FZOA 3JQXA 3RZJA 2BVBA 3RJRA 4B4RA 4XFFA 3I3DA 5IAVA 5I8YA 1QJX2 4GKYA 2VW2A 3LSEA 5A33A 5KXEA 3SH5A 3UGFA 1W8TA 3S30A 2JG8A 1RUF1 1Y4WA 4AEDB 4SBVA 3WNLA 1HB1A 1W6MB 2GNDA 3K4AA 2W91A 5F37A 4NUBA 3IPVB 1G9FA 4GIQA 2R072 4QQLA 2JENA 3IDEA 4E4ZA 5CFDC 2A6YA 3RYPA 2UU8A 3VDDB 3LEKA 1BEV2 1ENRA 1CD3G 4E2SA 4XAEA 4YVWC 2IXCA 2Q1MA 3WG3A 4GB31 5HXMA 3ORJA 3WP4A 1ND2A 2E9QA 3OGVA 1Z7S2 2DTYA 3HEIA 1H4HA 2AENA 3PU3A 1W2TA 4JCKA 4CEYA 2XVGA 3UJOA 1OMIA 4E9KA 4F3JA 1ZBE2 2JD9A 2X5IB 1PMHX 1C5IA 2ZA9A 1ACCA 3WW4A 2W1QA 5FZFA 2XKOA 3OGSA 4K20A 2JG9A 4UXAA 5FXZA 1RUF2 3KQ4B 3UKNA 1JYWA 1X33A 1LHWA 1W04A 1OLRA 1UZYA 2A6VA 1UIKA 4QQPA 3WG4A 1NY71 2XLFA 3AZWA 4XZPA 4DEVA 5C8CB 1MVEA 2D6LX 4G9SB 5LA9A 3ASIA 2VBPA 4YWAA 5I93A 4URAA 1Y43B 4KBZA 3CJIB 2SLIA 3E1F1 5IVJA 1DZRA 1AZDA 2CHHA 5A6ZA 2FBEA 1PIV1 5JMOA 1EYBA 3HD8B 4UFJA 3GDBA 3RVHA 3K3OA 1YLLA 2D3RA 2ADEA 3BPZA 2OUJA 2PXJA 4W6YA 5EWSA 4RGGA 5AVAA 3OUIA 4ORFA 1QNWA 4U2AA 1CPMA 1PHMA 4OZOA 3ZFGC 3GHMA 1LOGA 5FLJA 2VU9A 4ASMB 1MS5A 2WT2A 4XUPA 4DRVA 3OBZA 4LO4B 5D2AA 1JYIA 1RUG1 1IOAA 1L7LA 2QE3A 2WZ8A 4KH9A 1Q43A 2NLRA 3SHRA 3SLIA 1PM4A 3IN9A 3UESA 4AW7A 4BA6A 4LNVA 5LBFA 2ZMLA 4QKBA 4Y3OA 4CEWC 3BTAA 2VCMA 5IK8A 2ZOEB 4R52A 1UNBA 3KCYA 4CSWA 4OVEA 5HBAA 2UURA 1OOPB 1W8NA 2ZGPA 3QD6A 4DXZA 1PIV2 5HCFA 5JXGA 5F2SA 4ZU7A 5C5UA 5BNOA 3DECA 2VZUA 1PK6B 4QPWA 2GNMA 5EP9A 3POYA 2IUWA 4COUA 2YUEA 5DXDA 2C9AA 5BY5A 1WW6A 2PHLA 4PCRA 4RFT0 4H14A 5JIAA 4IL7A 3VZKA 3WCSA 4FFGA 4I0BA 4Y22A 5EYXA 5BNNA 4FTEA 5CFCB 2RV9A 4KWUA 2BOJA 1QQP1 4I3GA 5CG9A 1M06G 1ASJ1 4YG3A 4YW3A 3QBQA 4NR1A 4BYYA 5BNPC 4DEQA 1W6PB 1X82A 2FCVA 3AYAA 1COV3 1CAVA 5KHIA 5KXDA 5A3UA 1GQGA 1EAH3 1DP0A 1PO11 1PZ7A 2PMWB 1OXCA 3ENRA 1RB8G 4QX0A 3LOBA 1RUJ2 2QJVA 2AACA 2XH6A 2RS12 3I2JA 3W59A 5L9RA 4CDXA 3MW2A 1GSLA 4DNYA 5C9AC 1VBE3 4HL0A 2QQLA 4WVVA 3OUJA 1HB2A 2J7MA 1C3HA 1VRH2 4JKMA 4PJYA 2GAUA 2BFUS 4LHLA 4A3ZA 3KF3A 5HI0A 4QXCA 1H2KA 1W9YA 1WMDA 4UOJA 3IDBB 4RR3A 1BBT2 3EJKA 1R093 1XRUA 1WW5A 4CDQC 2OUHA 4MGTA 4M3CF 1F2NA 3WG2A 3NVCA 3I2DA 4LE4A 3WDXA 1DFQA 3UJQA 4GWMA 1D4M3 3X29B 1LU1A 3H8OA 4LLOA 4PBOA 5C5TA 5F2WA 1OURA 4YZ1A 1AR72 1C8M3 3VKLA 3AX4A 5DUVA 4HLTA 2K46A 2BQPA 2RG4A 2CYFA 1HXS3 1OUSA 3OCPA 3ZSLA 5A1LA 3AP7A 4X8PA 4DPNA 1QJU1 4BM8A 1QNYA 4YM0A 4YGDA 5A32B 5FYCA 4A45A 4BOWA 3L2YA 4YG0A 4LK7A 3IDAA 5C3RA 1WUVA 5IATA 2JE8A 1C5HA 1CAWA 3Q8EA 5LBEA 3D3AA 2W47A 4YVWB 2OA2A 3OBTA 4D69A 5IFTA 3K3NA 3WNKA 2NQYA 2PHRA 4LO8A 5KC5A 1MPXA 1W03A 4IEPA 2ARCA 2VGDA 3GZUC 4YZ2A 1PVC1 5IVYA 2JICA 2VOKA 2QQVA 2RDNA 4XJWA 3FBYA 1R083 1LOCA 5FZ9A 1BJQA 1RINA 1OKOA 1GFF2 2XHKA 1GUIA 2YYOA 2OX0A 4MZUA 4JGZA 2H6BA 2CWSA 3POIA 5F6KA 1DYPA 1PNFA 5J36A 2ZZJA 2EXIA 2FQPA 3CEWA 3MO4A 1ST8A 4MO3M 1MS0A 3VZMA 3RYKA 5A3PA 3FWEA 1HB3A 5HCBA 2NPIA 4OZXA 3MUY1 3DEMA 3TEXA 4CPBA 2A3WA 4YM3A 1YXWA 4NIGA 2R043 1J83A 3IM0A 3LEIA 4AAXA 1QGLA 3DF0A 1RUC3 2VAUA 4JKLA 1GNHA 2V4AA 4JGYC 1W9TA 1PVC2 1XNCA 5F3GA 1D0GA 4QXHA 5C3SA 5FYSA 3ZFGB 2OQ6A 1UPSA 3H0OA 2PHUA 2WFPA 1CJDA 3O5SA 3Q8CA 2HWC2 1FPN3 3KVAA 3M3OA 5FZIA 3DN7A 3ELNA 2WWUA 2Q8EA 1E5RA 3SCGA 2JDMA 2QNKA 2WA3A 4GJYA 3USUA 4C1WA 2XJSA 2RJ2A 1WCSA 2EIDA 3KT7A 1MZ6A 3NL1A 4MADA 4QGNA 4UYBA 5FPLA 5LB6A 4CCCA 1Y9QA 1JZ6A 1XE7A 4CEWB 3HNBM 5A3LA 1GR3A 4B1LA 2W0XA 5DDJ2 4BPZA 1W9FA 4YW1A 1JOJA 1IPKA 5FZ6A 2BFUL 1CAUB 1NZCA 2A3XA 3V0BB 2FZ1A 5ANQA 4BB3A 4AR2A 5D1IA 1GZ9A 4CCNA 5FQ0A 1OVSA 1TMF2 4FCAA 4LKEA 4MHUA 4XQDA 5KHHA 2XJPA 4C1XA 2VUAA 5A7PA 4RS5C 4MGSA 4N53A 5DAXA 4BCUA 2VNRA 2ZGLA 5A7NA 4CVUA 1OA3A 5FXXA 3WDWA 1ZA7A 4HBNA 2ZGUA 4PF5A 1AXYA 3H1YA 1I1EA 4Y20B 5EV7A 3RDIA 3WNNA 2O0OA 2BBVA 3N9MA 3AZXA 2VOWA 4AI8A 4IEZA 1Q3EA 5BNPB 3WXPA 4A41A 2XXZA 2DTWA 1VBA2 1FOD3 5A7WA 3S7IA 3ACHA 4IE5A 3ACIA 1ZBA2 4HN1A 4XUOA 3PMEA 2MPFA 4UW3A 3C7FA 4D7TA 4AFDA 4CP9B 5AFEA 4META 1LNSA 1O3TA 4IGOA 2ZX2A 3POJA 3H8RA 3WNXA 5FZ0A 1U12A 1ZZ7A 2YU1A 2J1RA 4XHBA 3SNMA 1SQ4A 2ZMNA 2UY9A 4XC9A 3UYJA 1SZBA 3E97A 5F3IA 5D8AA 2BWAA 4AGGA 3HT1A 5FYVA 1XE8A 2E63A 4LKSA 3ZFEA 1SBDA 4ZY9A 1DZTA 5L7OA 1BQPA 1WMFA 2X05A 4CDQB 2FCUA 4XMAA 2HWB1 1O3QA 5J7MA 1O8SA 3CO2A 5A80A 3IT8A 4PLMA 4HVRA 4XILA 5C6CA 2WO1A 4A4AA 1LOAA 4TTGA 4CCKA 1W8FA 3HBZA 3N35A 4QQ2A 3V65A 4WM7C 1GOHA 3W5NA 1A78A 3MV01 2YMZA 4HT1T 1JZ7A 1AX1A 1RUH3 2W1WA 2GALA 3NNMA 4AE2A 4HN0A 4HSLA 1OA4A 4Q0SA 2JG8C 4M0NA 1HV0A 4UT5A 4NPLA 2PHDA 4L92A 4XW3A 3RWNA 1LULA 5CZKA 2JD4A 5CADA 4UF0B 4LBQA 1NT0A 5FP3A 4FT8A 1DQ2A 3I3EA 3LA2A 4D8MA 1RUI3 4CUCA 2NP0A 1XJAA 4MYEA 5AC92 1DGRA 4QPGA 4E8CA 3HAGA 1W6OA 4JC1A 4LBQD 4JHTA 1V9U1 3R4DB 3ZSKA 5KBFA 2WFF1 3VL8A 1UQXA 3G6JB 5F3EA 2I45A 1TNRA 2JJ6A 2WS91 1O3SA 4OI0A 5I0SA 3UL2A 1SBFA 2A73B 2ORZA 3J7MA 1YQ5A 3TN91 2AZ5A 1AR63 2ERFA 1XSQA 5DUUA 1R64A 2KA3A 3GJAA 5FYYA 5FMCA 4CEYC 2J1VA 3S5AA 4B7EA 3AMQA 2P37A 2LM3A 4PBPA 5JSPA 3LCPA 4IUGA 1LHOA 4GZ9A 5LBBA 3CJXA 3VKMA 2XPJA 1JHJA 2HWF3 1QXRA 3AZVA 1OLQA 4QXKA 4W6XA 1W3XA 4Q0PA 3LQCA 3IDCB 3AKQA 1AXKA 4BQ2A 1ENSA 2OZ6A 1SFNA 5DZFA 4QQHA 4CP2A 4YG6A 4EROA 1SLTA 5BUVA 1CZSA 4WBBA 1T6GC 4FXGB 4M00A 5CB7A 3TWIA 1QDCA 2DCTA 1V9U2 2OPKA 2PAMA 4DQAA 2WFF2 5EJ1B 5FUIA 3GYDA 1PNGA 3U0ZA 2Y60A 3NV1A 2ZX4A 5IUQA 1RL3A 3RG0A 3KLSA 5SV5A 5B4XA 4TWTA 1NCQA 3HT2A 3CZUA 1EUUA 2YDEA 2X53S 3VHRA 2Y33A 1CX4A 2F4PA 2XL7A 2YPJA 1YI7A 2VM9A 3OEAA 4L99A 1FV2A 4OQ9A 1X9PA 2VQAA 1QJEA 1VRBA 3GZAA 4YZ3A 3TNPB 1YJKA 1QXPA 2GP3A 3MF6A 5FJKA 1WLWA 1VJ2A 3H7YA 4XHXA 3T0BA 3THTA 3WF2A 4K21A 1K5MC 3UGGA 3WDVA 3C7OA 2ET7A 1JZ3A 2VMGA 1HKDA 4XF9A 1YHFA 1UO9A 1AXZA 1HB4A 1JU4A 4R9BA 1PGW1 2H0BA 4XZUG 1HLCA 1S1AA 1MS4A 2Z79A 5T52A 1OPOA 2D6NA 4D0QA 1MZ5A 3DCQA 1XYNA 4JVAA 5LA1A 4RS5B 3JBG3 4MUVA 4EN6B 2OIIA 5FXWA 5CBLA 2B8MA 4FPJA 1S55A 1VR3A 3THCA 1QKQA 5BNOC 1O4YA 4XDPA 3ZR5A 4R4ZA 2PYTA 2P4EA 2WAOA 2HEWF 5IK7A 2EA7A 3OPZA 4XCAA 1NG0A 3ZKYA 4RFRB 1W6NA 2JDKA 3FX3A 5BNNC 1FX5A 3DKWA 1NAEA 5L9VA 2VUCA 3D5OA 1JU3A 3AP4A 2P6CA 1WCUA 2GP5A 5LK5A 2GDFA 3VKFC 1KS4A 2TBVA 3MIHA 1JYNA 2D5FA 2WDBA 2WKKA 2WIIB 4QB2A 4OUMA 1RJ7A 2GN3A 1U0AA 3C2UA 4Q4Y1 3VD5A 2B5HA 2YC4A 4G3YC 1REDA 1RUD1 2OVUA 2VUDA 1PGW2 4CDXC 3T3YA 2HWD3 4BU2A 1YRZA 1G7YA 1DQ6A 1W6QA 4KWLA 5LY1A 4FI9A 4DIQA 4FTSA 1IS5A 3POEA 4QB6A 5AVPA 2KXLA 2C24A 4ARYA 5JPNB 2ZX0A 3E5XA 3GF6A 1CZTA 2XHNA 3AYDA 2DVBA 3O14A 4HXCA 4RHV2 3USSA 4HSJA 3VBUA 3G7DA 3LEMA 5I8TA 5FMOS 1AL23 3PUAA 5CA6A 4Q0VA 1H8TA 2E53A 2ZEZA 1I5PA 2B7YA 2WZR1 4JRLA 4XF4A 4MGYE 4ZS2A 2X10A 2WNUB 1JHNA 1W8HA 1K45A 4I30A 4WM7B 5JZGA 1PO21 3ZO0B 1OFNA 3U37A 3O1VA 4ISRA 2DVAA 3OBRA 5C33A 3KGLA 4XBQA 1H1IA 2IVJA 1QOTA 1GZCA 2CAUA 3J9SA 1LGCA 1RUD2 3OGRA 2Y6JA 2YFZA 1S0DA 5FY5A 4ZXEA 1CVNA 1BXHA 3BGAA 2VULA 2TNFA 3RI8A 4MGZE 1EY2A 1RVF1 1ODNA 2CDPA 3AMMA 5K4LA 4AVTA 2NMOA 3PUQA 1BVP1 2JB8A 2VUJA 4UWDA 4FPCA 2R16A 2ZMKA 1S0GA 2C26A 1AYM1 2D6KA 2GMMA 2VJXA 3LDBA 2AEZA 1V6OA 3D0SA 1FAYA 3ZYPA 3K46A 1RYYA 2DVGA 2JWPA 2VH9A 2X29A 4XBNA 3UGHA 4XFGA 5A7OA 3VBRB 2P34A 1N3PA 2TEPA 3MBWA 4Y4YA 1LR5A 4FPFA 4Q4W3 1E57A 3C7GA 5H9SA 1STMA 2XBO1 4DS0A 2BGOA 3PJYA 1QJZA 2Z5WA 4JGZC 5GALA 4LTAA 1I3HA 2HJIA 1T2XA 1TG7A 3U11A 1XOYA 1NZIA 2OZJA 4A7KA 2RM22 4BK5A 4D6QA 1H1MA 3T08A 3V0AA 2CGOA 1FMD1 3O0WA 1OF4A 4Q27A 4FPKA 4RQPA 4AK3A 1OF3A 2G19A 4LK6A 5HXVA 4LOTA 1VP6A 3I2OA 1TME2 1S0BA 3ETQA 3NNLA 4GH4A 5HPOA 4XYXA 5FYBA 4XF1A 5JXHA 2FZ2A 2VD7A 5FYUA 1UYPA 4KGGA 1VBC1 1H6YA 1DHKB 1DZQA 2A6ZA 1GWLA 4H7LA 4HKWA 2PLV2 2VR4A 3PHMA 4PI0A 3FC0A 1AR93 1V70A 3TOJA 3I59A 3NNFA 2YGMA 1HX6A 1QH6A 4B4PA 2QQPA 4XJ9A 3RZKA 1AR82 3PNAA 1ZRRA 1H2LA 4FFFA 2VNGA 4XOGA 3AKSA 4GD4A 1YIFA 3ZXLA 1UAIA 4ET7A 4AI2A 5FYZA 5I0RA 1K5MB 4WM8C 2QZ2A 3GM8A 1EPWA 1SACA 1XU2A 2VQUA 3I2IA 5L73A 5FZGA 5FYHA 4G4FA 5A6YA 5JI9A 4QU2A 4QHZA 3ZN4A 1BK0A 1ZM1A 3WQ0A 1NLQA 3S7EA 3SISA 1ND3A 1VBC2 4WVZA 1BMV2 4D3WA 2ZJCA 1W3VA 5LRSA 2D7FA 5BNOB 5FMOL 2G1MA 4CYDA 5FY4A 1VBB1 4WZFA 3ZXFA 1SPPA 2ZHMA 3VBFC 4DXSA 4LO7A 4R9DA 2ZGKA 4URTA 2YZ4A 4EN9B 4BDVB 3FJSA 1XBFA 1PZ9A 3LPFA 3N4MA 1MQTA 4NRQA 2L9LA 2VECA 1BK1A 4QDSA 4Y22B 5IFPA 1UZ0A 1Z7S3 4LULA 2A6WA 1YFXA 3D82A 4PDWA 2PFWA 4IEQA 4Q29A 1ZBE3 3A21A 5FY7A 5K0UA 3WUDA 3ZXDA 4E2GA 4CP0A 5FZ7A 1SDDB 1CAVB 4R9AA 4CDWA 3BU0A 3J8F2 1OFSA 2DUOA 2D98A 4BZ4A 4QDRA 1RUE1 2QDNA 2RS31 4FXKB 1IG0A 5CYYA 2ARAA 4Q5OA 1HN0A 3MUZ1 2Q4SA 3U75A 1VBD3 1S0EA 1RMU1 3JD73 1DG6A 2KM2A 3K75B 5FZHA 5GJ6A 4AI1A 4TLFA 5I0TA 4WZCA 5D8AC 1N3QA 2HWE3 3I3QA 4EYUA 4YVSA 1UMZA 1OKQA 4AYUA 1VBB2 3ZFEC 5J98B 4O9EA 1D2QA 1CAXA 2ZGTA 5C4WB 2VOXA 1KEXA 1IKQA 1NCRC 1NQJA 2NN8A 4IESA 1HN1A 1U5YA 2QQNA 3A23A 4AG4A 5FPBA 4AOCA 2ARBA 2ETEA 2VQTA 4HK9A 3DXTA 1APNA 3ZYBA 1G9CA 4GMP3 2WZEA 1W2UA 3GALA 5C3OA 3VD4A 4D94A 2QQUA 5C3PA 5JPMB 5IK5A 1U5IA 2OS2A 3B5LB 4FP2A 3FUQA 5EZWA 4CUGA 4COYA 1R1A2 3B00A 2XB6C 2BBAA 3U07A 4GJZA 2Y6KA 5HV4A 2RR12 4XUTA 1W06A 1RMU2 1VB2A 1YUDA 4M3CB 4NHKA 2YHJA 3N3HA 4KL1A 2PELA 1KD7A 2XQRA 4CUBA 4QX5A 2CGNA 1AYN2 2E51A 2R061 2ZGNA 4LBMA 3BI3A 1UX6A 4S2DA 3A7QA 1F5FA 1EV13 5FYIA 2RS53 3VD9A 2YGLA 4PIXA 4QPGC 1DF0A 2QQIA 4EWEA 1CAWB 3K48A 4WVMA 4NJ4A 4N43A 1LGBA 1WLCA 2D93A 4NIHA 5GLVA 2GC3A 5FZ1A 1QJFA 1YC61 3K4ZA 1VLNA 2D6MA 4QB1A 5A7QA 1DLCA 3DPRC 1W2NA 4Q8LA 2BNMA 2JXAA 2DFCA 4NHYA 3URFA 4Z8BA 4IV3A 4K3UA 3VKNA 4QGMA 3U78A 1QJY3 1POV3 3ZR6A 3T1LA 5IHRA 1HRI3 4K1ZA 1WMXA 1FXZA 1JUHA 2GZWA 4C0BA 5KHJA 1XNKA 1W8WA 2RDQA 4GKXA 3MFCA 1IG3A 2UWAA 4M01A 4GB32 3MW3A 3LIHA 2HBTA 3LWCA 3B3QE 1RUJ3 1ZRFA 3O7OA 1WD4A 2RS13 1R1ZA 1TEIA 4IE7A 3OF1A 1ULPA 5BPXA 1F15A 4MV2A 3KV6A 1LCLA 3ZM8A 3PIGA 4N9IA 2YFUA 3H3UA 4CU6A 4ES8A 4C91A 2H6CA 4MXWA 4QWNA 4W6WA 3T30A 1VRH3 1Y9MA 4ZHNA 2YROA 5LA2A 4CE8A 1NA1A 1XQNA 2VMDA 4W4ZA 3VZOA 4CDUB 4CP1A 2AYHA 1BBT3 2XKPA 4XJ8A 3Q8BA 1N3OA 1K5JA 1NCQC 4XAAA 1NY72 2H0VA 4CCOA 4K7JA 3KMHA 4IEYA 3S57A 3ILRA 3NWKA 2GN7A 3AYCA 2BDRA 3WQBA 2VTXA 3OOXA 2VMEA 2JDPA 4HKOA 3E6CC 2A6XA 4WM8B 3O1UA 1HJFA 1AR73 3LA3A 1PX4A 2J1UA 3FZ3A 3SKJE 4AI0A 1D7PM 4V1PA 3HOBA 2GMEA 3UETA 2RDRA 4IV1A 4Y4RA 2Q5TA 2ZEWA 2EXKA 2GH2A 3HQUA 2VC9A 3LKJA 1UW8A 4K8FA 4N9HA 4IE4A 4LQRA 2XQXA 3U4SA 5LZ6A 2HYKA 2BNOA 2I2SA 5EFUA 4LUKA 4JAAA 4COZA 4XJUA 3VHNA 3VBFB 1RUG2 2A70A 1FATA 3IWZA 1JOBA 4AHXA 2JEMA 2XDVA 2ZACA 3FE5A 3BALA 1XE0A 4XMIA 5FY9A 3U4XA 2UYBA 5CIRA 3QH6A 4EZHA 4XJAA 1US3A 1OVPA 4PF1A 4BJ0A 3WF3A 3NAPA 2KR2A 1CJPA 3FLTA 1NE6A 4PLOA 1UOGA 3WG1A 4PHZA 2VZSA 5A7WB 3IMNA 1OQEA 2B9UA 3ALQA 5FKCA 1DGRN 3DYMA 3AC0A 5FMDA 2LALA 4QAWA 2WO7A 5EHDA 1OQDA 2WO3A 4BQWA 1VB4A 1H2NA 5C3QA 1QY4A 1AX0A 1D2SA 1VMJA 1URXA 3KQRA 4AEKA 2GC1A 3JUUA 5FV3A 1KXGA 4P14A 4BXFA 1QQP2 1JN2P 4NIDA 1B35A 1ASJ2 3RJ2X 1YJLA 4LHNA 1LKNA 2ZAAA 4LHSA 3GBGA 4GMP0 2LUWA 4Y1VA 1LOEA 1XC6A 3GBWA 5CKNA 5JSRA 3EMRA 5LEKA 2WZPP 2CL2A 3ZXEA 2BGCA 2E26A 3OY8B 1NCRB 1O7FA 2FMYA 1PO12 2DF7A 1QOOA 3W9AA 1F35A 2JE9A 2QFEA 3E5UA 3WT3A 3MZHA 3N7JA 5KC6A 1KRIA 3QLQA 4UFIA 4QX3A 1V6JA 2D97A 1COV1 5IVBA 1H8TC 2W95A 3I2HA 3SCFA 4Q8KA 1CIYA 4MLOA 4XXAA 1EAH1 4YRDA 4LE3A 4AEDA 2HWC3 5FIXA 4AAPA 4HPKB 3KCCA 2WNOA 4XFAA 3GCWA 2A1XA 1VBE1 1W6MA 1GP4A 3L2HA 2Q8DA 2K2SA 2TUNA 3R4SA 3UT0A 1MZFA 3IPVA 1Q8VA 3MIBA 1SLLA 3VZLA 1ENXA 1HDKA 5ACA3 1SHWB 5DDJ3 2B42B 4D6RA 4LJHA 3EO6A 3VBSA 3VDDA 3UKVA 3T0DA 5F9TA 4A6SA 4IEUA 1SLCA 1R091 4HOOA 3I2KA 3WF0A 3SKVA 3LD8A 3A4UA 3B9CA 1H9WA 4Y5Z0 4JTNA 3M3EA 1JZ8A 1TMF3 3ACFA 4QKFA 2WRAA 1UOJA 1QMJA 3IBMA 3WQ7A 1J58A 2J22A 1JYXA 5T5LA 3R05A 4Q1RA 2ZGRA 4N8MA 3H3ZA 5M0TA 1D4M1 3RFRA 2X5IA 4X6QB 4NOTA 1GKBA 3DPRB 1EAH2 1QJU2 1C8M1 2PQSA 2YBKA 1YWKA 3LB9A 4QX7A 2B4KA 3ZDVA 2LS6A 3AKRA 5KR7A 4Y5SA 3ZXKA 2W1SA 3LFIA 3KD4A 1VBE2 3D6EA 4UAPA 3ETPA 1VBA3 1HXS1 4EN8B 5GLWA 1ZBA3 3DV8A 4INDA 3TBDA 1V6IA 4GA9A 5FZ8A 4NROA 4FPGA 3LDKA 4P08A 4O61A 3CJIA 3PVBB 5FZMA 1Z78A 5IYYA 3PVNA 1UL9A 2I07B 4RQPC 4OYUA 2DCZA 3POBA 2Z2SB 4W65A 3O0XA 5FZ4A 3CU7A 3IAPA 1W8UA 2ATFA 4GH4C 3JCIA 2ZPXA 4ZPIA 4PQQA 3MIDA 4PI2A 3UKTA 1J1TA 2EAAA 4P00B 4D6SA 3CNAA 1D4M2 4DY3A 3VD7A 3APBA 1N1SA 3AMHA 4TYSA 1UY1A 5DG2A 3ZXGA 1R081 3VZJA 4E27A 3RPQA 4OQ8A 3WVJA 1JMUB 3IKWA 2IXHA 3BOPA 4IDZA 1TVGA 1YNAA 5EQUA 2HYXA 3TRSB 2IFWA 3LEGA 1CWPA 4BQXA 3MPBA 5JVVA 4OUSA 2BVVA 5FWEA 4A7ZA 4QPIC 1UCXA 1UKRA 2OQ7A 4Q2FA 3UNPA 4FAHA 5A3OA 3ZFFA 5FLIA 5T50A 5E8AA 2OPWA 3AMPA 4CU9A 5JOWA 5LASA 2BYVE 4BLJA 1MZEA 2MEV3 2R041 4ZU5A 2IXLA 3KT1A 4FAGA 3RQ0A 1OOPA 2X8KA 1YI9A 4K6BA 5K8SA 2C5DA 4A3XA 4EQVA 1RUC1 4E4SA 2LW8A 1YEWA 3CBNA 4YSFA 5FREA 2VW1A 1PK6A 5FK8A 4CCDA 2O8OA 3BUCA 4L97A 2BNNA 3SXWA 5AC93 2JECA 2YPDA 5F1RA 5JWPA 1ND3C 3ZYJB 4ONUA 2E32A 2JE7A 1MEC3 3BPSA 3CF6E 5CFCA 2DVDA 2UYAA 2JDUA 2CWMA 3I3BA 1YFWA 1GWMA 1HIXA 3BIWE 1LRHA 1FPN1 1QHDA 3MV11 3BVCA 1W6PA 1MQTC 2IZWA 2WN2A 4A7YA 5C9AB 2WO2A 2WR9A 2W46A 1WMEA 2ZAHA 5APAA 1LGNA 1MR5A 1ONAA 1GZWB 1NXD1 4PDWC 1JZ5A 5GLTA 1QU0A 1I9RA 1EP0A 3N7KA 4YFZA 3ON7A 3PDQA 4IW3A 4DUWA 1CIWA 2R042 1WLDA 1RTVA 1WZXA 3KV4A 3WW1A 1BKZA 3TYJA 4QQOA 5BYNA 1EPZA 4Q4X3 3N7LA 2YBPA 3B01A 1GZTA 1WCQA 3KSCA 4AL9A 1RUC2 5JXJA 3IB3A 4XFIA 3ILFA 1LJ7A 5IJRA 3I4IA 4FOVA 2VCAA 5FZAA 1Q5OA 4P5YA 3ZN6B 3H8XA 3AYEA 4YVSC 2XVLA 1A6CA 3POSA 2BGPA 2PHWA 3O0VA 1FPN2 3NW4A 1S0JA 3HQRA 1MS9A 5F3CA 3PJQA 4KBBA 4YW7A 5DUWA 5FPZA 5J1XA 3POWA 1IQDC 1FOD1 3GCXA 4YM1A 5DZGA 5EIYB 3VZNA 2VTFA 5FTTC 4UFKA 4FSJA 2J1TA 3HBKA 4CCMA 5DAWA 5GLUA 3RNSA 5FCCA 3N7MA 4AVVA 4XXPA 2XOMA 4W8JA 2P3IA 5GKAC 3WSOA 5FY0A 4ZS3A 4M4RA 2HWB2 5A32A 5FUNA 3WDTA 3OPWA 3BTYA 4XUNA 3T0AA 3U10A 1NXMA 1ND2C 4YVWA 2OXBA 2DDUA 2WT0A 3DGTA 3PURA 4NIIA 4NVPA 3S5QA 4L2NA 2A5ZA 4MGIE 4ZXKA 1NX9A 1JW6A 1X8MA 2RJLA 4FOQA 3BKZA 4L0PA 4N43C 2JG9C 4EWDA 2CAVA 1VAMA 2GH8A 4EN7B 1MS1A 3SQOA 2G9FA 4GWJA 4NWVA 4NPRA 1W05A 1XSRA 2DYCA 4FPEA 1TZOA 2YC2A 4ZONA 5FZBA 3TEZA 4LO5B 2RJKA 1RUH1 4BQ5A 1S0FA 3H3LA 4IV3C 1PVXA 5KXBA 3ILNA 2VG9A 2XGXA 1GNZA 4QGLA 1T6BX 1V00A 3BOWA 1Y7BA 3HPNA 4EN0A 4Y24A 2WS92 2QBXA 2YXSA 1RUI1 4J6GA 4JGYB 4MVTA 1S4CA 3TN92 1XU1A 4RYDA 1YQ6A 1ZRCA 5E88A 3VHOA 1FT9A 3BB6A 1O5UA 3NV2A 4KQ7A 4GXLA 5J37A 2P5BA 4OHZA 4Y5TA 2DV9A 1H9PA 4GH4B 4E2QA 1DYOA 2CGPA 1D0HA 5JLVA 3HJRA 1AR61 2WNEA 2O14A 3AL5A 4LBKA 2ID4A 4N7IA 3ZFGA 5BV6A 4DUXA 3FHAA 1NA1C 2VMHA 2ILMA 4RHV3 2DVFA 1X7NA 1DU3D 3P3NA 1O5LA 5T5JA 1UZVA 4NMIA 1UZZA 2LTNA 3M7AA 4RGKA 2JB4A 2RDSA 2HWF1 2XL9A 4QPIB 5L19A 3FBMA 4WVWA 2PAEA 4Q0QA 5EJ3A 3SITA 3OB8A 4YGCA 1YIPA 2Y26A 1W0NA 4XETA 2DU1A 1S2KA 3N9PA 1A8MA 1O6UA 3V0BA 3GJBA 1YO8A 4L8QA 4UBHA 2W92A 4K1YA 5IT6A 2VCBA 1V6MA 1ULGA 4LBJA 4IV1C 4Q4V1 2VMIA 4B29A 2PHXA 1B09A 1NYWA 2C1FA 3NJYA 3H1MA 2VXJA 3OD4A 4V2VA 1ULOA 1SLBA 4QHBA 1WCDJ 2WQZC 3S0MA 4H2AA 1CZVA 4JDOA 4FQ4A 2PTMA 4RA0A 5T5PA 4JQRA 1UIJA 4QXBA 5E89A 1YFUA 1QH7A 3H42B 1A3KA 2IFRA 1HRV3 2YY1A 4A42A 4BMBA 5FOBB 2FD8A 4KG0A 4E8DA 2HWF2 2PN5A 3WNMA 4JDMA 2GNTA 1DCSA 1O8PA 2WJSA 4PDWB 5LCWL 1JTZX 2WAAA 3GNEA 3OD0A 1XYPA 4OFGA 4XPVA 4AGVA 2P2KA 3FLPA 2R32A 4NO4A 2CY6A 3OYWA 4COWA 1FNYA 2J1SA 2ZGSA 3A0NA 3BU7A 3QCWA 3WW2A 1RHI3 4RR3C 4Q4V2 5F7UA 3JBG1 4OCTA 2RM23 1M4WA 4GQ7A 5F6LB 1LENA 5FP9A 1N1YA 1PMJX 3NJZA 4P9LA 3LF7A 1QIQA 3PIJA 4BMEA 2VTXJ 2Q8CA 1B35C 3ITQA 4XIOA 1TME3 4YVSB 3FFZA 3M4FA 5FZOB 3WX5A 3K77A 1CAXB 2AC1A 5A33B 3RMYA 4NHLA 2XUEA 2WLQA 2D6PA 2PLV3 4IE6A 4Q4Y2 2JG8B 3JQWA 1YFYA 1UOFA 2D44A 1IS6A 3HIFA 4H55A 5FKBA 4ISQA 4DOUA 4XFHA 4DY5A 1C1LA 4ATEA 3B02A 5ABJA 1AR83 1ZX5A 4UBGA 5FYTA 4F83A 4YZ5A 5CAZA 3FL7A 4BQ1A 4B8EA 3GZTB 1UU4A 1YQ2A 4LOSA 4YW2A 4AEDC 3HR9A 3R4UA 2VBBA 1O4TA 4KMQA 4UF0A 4A6OA 5KXCA 2HWD1 2ZS6B 2P3YA 4XURA 3JBG2 4IQPA 2ZX1A 1GV9A 2WSVA 2JDZA 4XBLA 4XABA 1ND2B 5F8PA 3FN9A 3VBHA 1KGYA 1O3RA 1UX7A 2WZR2 4AHZA 3VBSC 2AREA 3VDDC 4ZU4A 4CEYB 2G9ZA 3KM5A 4I3PA 3THDA 4I2OA 4OHYA 1NE4A 2B39A 4BK4A 4L11A 4Y1YA 1AL21 1PO22 2DURA 2G4IA 5F5IA 2WT1A 5IVVA 2O1QA 2CNAA 4N43B 2JG9B 2PHFA 5F5CA 4AVSA 4XCBA 1CPNA 3NRUA 3OUHA 2EF6A 1PGSA 4EJRA 3A22A 3ZSEA 2SBAA 3GBFA 4JZRA 4M4PA 3CQOA 2C6SA 4RN5A 1KFUL 5FPUA 4YW6A 2X09A 1H0BA 2GC0A 1U5ZA 1RVF2 1QF3A 3LE0A 2Y0OA 4YGBA 2JX9A 2QVSB 2HWD2 1F5JA 1VPHA 4B7KA 1LOFA 3J8F3 3L9JT 5DN2A 1AYM2 5FP7A 1UKGA 2GSYA 4CXYA 1OC1A 1H8VA 3D4KA 2XJRA 4S2FA 1IZ3A 4L9BA 4W50A 2QDRA 3VD3A 3RZHA 2HLEA 4NHXA 4TZDA 4Y26A 1P8JA 3WUCA 4DB5A 4C90A 3BODA 3HVDA 3JB4C 4LBOA 3ZSJA 1UY0A 5FMBA 3C3VA 3C7EA 1HV1A 1AL22 1PMIA 1DQ1A 2UY8A 4NPMA 4QX8A 3KVBA 4XACA 2FDIA 2E7QA 2Y0IA 2RMU1 2XBO2 5DUXA 1NA1B 3MYXA 5FR3A 3VBOA 2IXJA 3ES4A 1FV3A 5EJZB 4LBLA 3NJXA 1QJX3 1W0PA 1LESA 5K9YA 1REEA 2PQQA 3UK9A 2ORXA 2DFBA 1VAKA 1FMD2 3GGLA 4Q4W1 1WD3A 1WW4A 4LBNA 3ZN5A 4XQWA 2VZOA 3M1HA 3OPTA 5JXIA 3WINE 2GU9A 1N47A 2UWCA 3FHQA 3WP5A 3MI8A 4BQYA 4RL7A 3Q8AA 4B4QA 3WNPA 2WQ4A 3ZFFC 3TB0A 2R073 3P1IA 1OSGA 3NV3A 2UWBA 3HMYA 4JX0A 3RSJA 4MGQA 4I0AA 1R1A3 4N53C 3B69A 2HEYF 1JS9A 1ZZCA 1PGL1 1BEV3 3EXUA 1W8OA 1OOPC 2VZPA 2RR13 2XJUA 4RS5A 3RZZA 3LAGA 3CL1A 5G04L 3INAA 1DLLA 1WKYA 1BYHA 3WP6A 4OUEA 5BNNB 4BQ4A 5AFBA 1PK6C 1AYN3 4JQTA 1JZ4A 1Q8SA 2AGSA 3RGBA 4DUVA 3QOPA 1NOVA 2VOVA 2RMU2 3EYPA 5A6XA 2FDKA 4IE0A 1K3IA 4UW5A 5T54A 1CONA 3AB0A 3MW4A 3ZX7A 1CR7A 3ZXAC 3TEYA 4LMFA 3EBRA 2ADDA 2XR4A 1JUIA 5FBZA 2WWSA 4TN7A 1RUF3 2YV8A 4Q4W2 4ATFA 1GMMA 1UF2C 1UYYA 4CDXB 5LRRA 3C7HA 3O1TA 1J1LA 4IEXA 3T1MA 1IKPA 4O9GA 3GHNA 5DG1A 1RJ8A 4IEWA 4A44A 4BH9A 1OQ1A 2EIEA 3LPGA 1AUYA 4LEJA 3RWKX 2MHFA 1UMHA 3BTXA 1PGL2 1E5SA 1JOPA 1OA2A 4J1WA 4M3CE 4RR3B 5E1RA 5L7OC 1C28A 5GZDA 2BOIA 4GB33 2LROA 3W20A 4J1XA 2Y38A 4A2UA 1YYNA 5T3NA 4CRQA 1B35B 2C0ZA 4CUAA 1U5XA 4LKFA 1JXNA 1ZYBA 1W2AX 2ZGQA 3HNYM 3HWJA 1UYZA 2XMLA 4OHWA 4FBFA 5IAXA 3GXUA 4LR4A 4FPHA 4P9YA 3HN1A 5JOYA 3VHPA 4PIYA 1Z7S1 5ERLA 5A1AA 1RUE2 2RS32 3VKOA 4DXTA 2WNUA 4QX1A 2D40A 3PTYA 1ZBE1 5K7PA 1ZVFA 4EV0A 4WM7A 4N7UA 4OHXA 3AL6A 2BW8A 1MS3A 1UYXA 4Y1XA 5CFDA 3ZLIA 2FDHA 1F8VA 2VL4A 3WV6A 3BN6A 1OI6A 2OKXA 4BQ3A 2ZKNA 2ZX3A 2C9KA 1UXZA 3WP3A 1OH3A 2HEVF 2BUKA 1I6XA 2ENRA 1SFPA 1V0AA 4KI5M 2DBNA 1VBD1 4GAZA 2VOTA 5B4NA 1Q56A 3JD71 1ODMA 1PIV3 3OGJA 3T4VA 2XONA 4C0HA 2WA4A 2QQKA 1UWWA 1LTEA 1LECA 2F17A 2HWE1 2O8QA 3I7DA 4XTPA 5FLHA 1ULCA 4FQZA 4FOWA 3VBSB 5A3TA 2Y6HA 1LAJA 1UY2A 3E6DA 3PL0A 4BXSV 5C70A 2EALA 1A8DA 1L7QA 1LODA 2E33A 1XXNA 2AH2A 2JDYA 2WQ8A 2DBIA 2WABA 2N7GA 3Q9OA 3EB7A 1FNZA 3PVOA 4GMP1 1RUG3 4JGZB 4P02B 2JIGA 2QQMA 2NZ9A 1G6NA 5SV8A 3WDYA 3VBRA 1K12A 3ZSMA 3KB5A 1CESA 3OEBA 3FMGA 4YLZA 2XWJB 1OT5A 3DKQA 1KJLA 3AFKA 3JB8A 4QKDA 4Q26A 3WOGA 2VMFA 1ULFA 2R062 1X9TA 2E7TA 2W9XA 1PX3A 4ITCA 5A70A 1W28A 3H9AA 1KFXL 1RXGA 2VZVA 1WW7A 4BISA 1DQ0A 1VBD2 2VZ3A 4OULA 3SH4A 1PZ8A 3JD72 2FHRA 4ASLA 3AVRA 4E4DX 2JDNA 3K51A 4NHMA 1DGLA 3T2PA 2ZKLA 2ZABA 3QACA 5IWFA 2HWE2 3VDCA 3U1XA 4Q0UA 1EV11 1ZRDA 2RS51 2Y8KA 4CCLA 2ES3A 5CKQA 1X8EA 3OG2A 1WBFA 5A3WA 1GP5A 4QX2A 3JU9A 1RIRA 3AXDA 5JDBA 3SH3A 3H7JA 2GNBA 3O12A 1LHVA 2W1UA 1BLZA 3ZMNA 5A3NA 3P6BA 2BV4A 1QQP3 2FDJA 1ASJ3 3JZVA 5FZKA 1C4RA 4HONA 3USUB 4B1MA 5A1FA 2FDFA 2QUOA 4XF0A 3NQHA 3B94A 4K40A 3AK0A 2E6VA 3OBAA 2D3SA 1PO13 4Z82A 1QJY1 1POV1 3IAQA 1XB9A 4EZ4A 1O4ZA 3WNOA 1HRI1 2J1EA 1F31A 4F7ZA 1GQHA 1DQ5A 4MH0E 2EAKA 2VVDA 1XNBA 3AXEA 1K5MA 4DO0A 2F6BA 3ZXJA 2XWBB 2WINB 5FQ0B 3ZFFB 4CZSA 4YW4A 1RUJ1 5LBCA 4U36A 2RS11 4S2GA 4N53B 4DXRA 2W5FA 4B3NA 2P1BA 1EV12 5FFOC 2RS52 2AR6A 3LGRA 2XG3A 4LHKA 1Y3TA 3AKPA 3LFMA 4Z1VA 1VRH1 1KJRA 5I8SA 1IGOA 3WR0A 5FPAA 4GULA 2XVKA 2WNVA 4IERA 1NKGA 4TSVA 1BBT1 1CGPA 3VUOA 1SG3A 2VNVA 1D4VB 1O91A 4CU7A 1CX1A 3ACLA 2WYSA 3J7HA 4I09A 2P3KA 1QJY2 2IWGB 5H9PA 1S2BA 1HRI2 2GMPA 5KHGA 1WGPA 2W2IA 1REFA 1XNTA 3POFA 4K8RB 4KWKA 2P17A 1AR71 4Q1PA 2BRTA 1QJU3 3RYRA 3WHTA 3B7MA 5IVEA 5D8AB 1RXFA 2P3JA 2BWCA 4FO9A 4H3WA 3ZYHA 3ZFEB 1SMVA 1TQ5A 5DAPA 3NV4A 5L7OB 3PTRB 2Z4FA 4OI4A 3HN3A 4HG6B 3NMBA 3Q8FA 3N9QA 1NLSA 4LPLA 3IZOA 4TXWA 5FY8A 1ZZ6A 3HNMA 4WV8A 1JH5A 1UXXX 4I01A 5F5QA 3VBUC 4AQSA 2A3YA 3AJZA 4NAOA 1PVC3 1VMFA 3KZ4C 4NE9A 2JIJA 2Q30A 3SEPA 2FDGA 1POQA 2CDOA 5C4WA 1IHMA 1Q8QA 3R0RA 5I91A 1JZ2A 2R0FA 1GBGA 4XF3A 2MNGA 4O65A 2QZ3A 4TLGA 2ZGMA 2EVXA 2QCSB 5GZFA 4AXOA 1W0OA 2CSGA 3K4DA 2HBUA 5JZGC 4Z07A 2FCTA 2VZ1A 3P3PA 1DGWX 1GOGA 4NRPA 1LEDA 1GOFA 1OBNA 4X8NA 4XDOA 2NM1A 3N9NA 4P5HA 1N1VA 1VE0A 2Z42A 3J7NA 3ZYGA 2ZEYA 3MIGA 4LBQB 5ABJC 4YARA 4BIOA 4PIZA 1UU5A 1Z0HA 3KCXA 3NJVA 4QPGB 5F39A 3M3IA 4M3CA 3FLRA 1W6OB 3ZPOA 5FDBA 2BPA2 1OD3A 3MEPA 3AP9A 5T5OA 2ZEXA 4BWOA 3RZGA 4FVVA 1POV0 2V09A 3AP5A 2WN3A 5ANNA 3NKTA 3J7LA 4KU8A 2JDHA 4LIVA 2XJVA 5EYYA 3VDAA 3KHCA 1KDKA 1COV2 5A6QA 4YYOA 3VBHC 4ASKA 3JXSA 1IPJA 1VAVA 2WLPA 2A71A 3NNGA 4CTEA 5I0DA 1G9AA 4LA2A 1J84A 5LWBA 4I02A 4AQTA 5H9RA 3RZLA 2E31A 4IGQA 1AHSA 4IGPA 4AFAA 1PM7A 4MHRA 5FPXA 5L9BA 5C8CA 4QT6A 1MS8A 2HWC1 2Y64A 4OHVA 2D3PA 4IXLA 2VY0A 1S0CA 3M3QA 3DYOA 2BZDA 4J25A 2VVFA 2WBKA 3LA7A 1R092 4XTMA 1KS5A 3EQEA 3ZYFA 4LUMA 3ZIXA 4SLIA 5ACA1 3MIEA 5DDJ1 4NWWA 4OI1A 1ZRIA 1J3RA 1Q8OA 2BTVC 3CIHA 3M3CA 1G9DA 1LOFC 3I2GA 4F8AA 4CPBD 4O7XA 4YM2A 3CMGA 3AM2A 1TMF1 1NCQB 2QKDA 4GWNA 4UW6A 3VL9A 3OGGA 3W58A 5FOJB 1H2MA 4CDUA 1C8M2 4KG8A 3O1OA 4V2WA 3PUIA 4AGRA 2YG0A 2YC0A 3MLJA 3I49A 4YW5A 3ZYRA 5IVFA 1HXS2 1NLRA 3NKGA 1DQ4A 2AUYA 5DAQA 2GC2A 4ZKTB 1BHGA 2ZTNA 3VBOC 1JYCA 2F4LA 4EWAA 1TNFA 4CU8A 2Y6FA 1GNYA 4AHYA 2YU2A 1GQPA 1ZZ9A 1VBA1 3PU8A 1X50A 4K9SA 3VN4A 1ZBA1 2D5HA 4FFIA 4JRAA 1F4AA 4WM8A 4X6RB 3RRDA 5BNQA 1ZNPA 2ET1A 5T55A 1ZREA 2JKBA 3PLQA 5ACA2 1C57A 2B46X 1OUXA 4XJZA 4FPLA 3SC7X 3O1SA 2Q0AA 5A3MA 4OMDA 3KV9A 5GM0A 5I0UA 1RGSA 2OYZA 3T4HB 1F4HA 1UPIA 2XLGA 5J3UA 2XLAA 1R082 4GALA 4XFBA 2D6OX 2HWB3 2Q1FA 2BP6A 4LKDA 2R30A 5DMYA 4PQ9A 1W6NB 3VBFA 2J1AA 5JR2A 1NQDA 4R8HA 1S0IA 3N9OA 1V6KA 3T2TA 3KT4A 1C8NA 1N1TA 5K0UC 1US2A 2IVIB 3HQXA 2VZQA 2WYFA 3ABZA 1J3PA 3J26N 5FZ3A 5BXXA 5A7SA 4AI9A 4CDWC 1ALYA 4MOAA 5FJHA 5FO9B 4P9GA 2YB7A 4QKNA 4HK8A 1KQRA 2R49A 3F2ZA 5FO8B 3ZDSA 3LOIA 2MEV1 4XQ4A 1J59A 1W6QB 1MACA 4M0HA 1C1FA 5J48A 3W5MA 4Z2AA 5FYMA 1GLHA 1XYOA 1V9U3 3OYWB 3ZPYA 4MXVA 2WFF3 2R7EB 1S2EA 2WS93 4AFMA 1VIWB 3KGZA 5DABA 1BVVA 3VBUB 4EE2A 3TN93 5AC91 2QQJA 4R4XA 3K2OA 2Q8OA 4P9XA 3SEEA 3MICA 1MEC1 1H8TB 3OY8A 1NCRA 4BE3A 3VB9A 2OT7A 3B9IA 3MDPA 4KGQA 3W21A 1XPWA 2B9VA 4MSVA 1L3JA 1LB2A 5FUPA 3WLUA 5JZGB 2VZRA 3T2OA 1OH4A 4YZ4A 4JV4A 2ZZQA 2DUQA 3ZMOA 3ECQA 1WA4A 2WNUC 3V56A 1SLIA 3M8LA 4CXXA 2RHPA 4HPKA 1W39A 2R1DA 2W3JA 1NUKA 2J42A 4UFHA 2MEV2 1DBNA 1UZWA 3EHKA 2XJQA 3ES1A 5ABJB 4UI9L 4QHOA 4CCJA 1AVBA 4Q4X1 5FBJA 1XNDA 3IIAA 2Z69A 2VNOA 3T2QA 1H1AA 1RITA 3KHBA 4QD2A 4FPYA 3CZJA 4LT5A 1VALA 3CHXA 1GANA 2RVAA 1XNAA 5FK7A 4ZZ5A 2I74A 1FOD2 1MEC2 1RUOA 5FO7B 3VBHB 3BCWA 1CN1A 2W87A 4S2HA 3H50A 4AF9A 5IK4A 3AFGA 1SLAA 3J4UH 4FP3A 4FPOB 2A7AA 2VPVA 4AFBA 3FHIB 3UV9A 3BTZA 1SCSA 1OLME 4LLFA 4RGAA 3U14A 1H4GA 3DPRA 5GZGA 2HH9A 4DRRA 3N9LA 3RMXA 4LIUA 2WC2A 3MFAA 5DPNA 4QM8A 1LHUA 3RS6A 3VBRC 1Q8PA 5FZCA 3SCHA 3V0AB 3WZ1A 1W90A 4AHWA 2IXKA 3T09A 4BLIA 4Q4X2 4RQPB 1ULDA 3O1MA 2EIBA 3C8XA 1W2OA 2V5YA 5CU1A 3OTFA 5C7GA 2V4VA 3BIEA 1WBLA 1IPSA 4AEMA 5C71A 4AVCA 2DCYA 4PLNA 3AKTA 3M70A 2QQWA 5GZEA 1J3QA 4MGKE 2QQOA 1O59A 3MHZA 1JBCA 4UFMA 4P9IA 1AL0G 4KU7A 4Q4V3 2Y34A 3DUIA 3I59B 1JODA 5JI7A 4RSUA 2VW0A 1SBEA 5EPAA 4HVQA 1RUH2 3P5BA 4DFSA 1DIWA 2CTVA 4LORA 3ZYIB 1UN1A 3H1WA 4CEWA 2FMDA 4AEJA 1KDMA 3KWVA 4UW4A 3VBOB 4KNCA 4D7YA 1HQNA 4XDQA 1SEFA 2OW4A 1RUI2 1CAUA 1IS4A 1G86A 3THPA 5GZCA 1CQ9A 4P9JA 1FYUA 2DCKA 4Q4Y3 5CG8A 3LSDA 3OJBA 2ZCWA 4JKKA 1RUD3 5JOXA 1E5IA 1QWRA 2PA7A 3POGA 5KHKA 1AX2A 1ND3B 1RC6A 1AR62 4LA3A 4Y20A 5JCTA 4JHZA 4GWIA 1SPPB 1Y9GA 2EXJA 1YQ8A 5DAVA 1AF9A 3AP6A 4QDQA 4AQ2A 3ZIWA 2W52A 3FUOA 5BNPA 4LITA 1MQTB 1FI2A 2VQ0A 1ZZBA 4P9WA 5F32A 5CISA 2WZR3 4OI2A 1L7RA 4CP9A 2WNVC 3NAPC 4RHV1 1YCIA 2D43A 1WA6X 5K0UB 3D0JA 5FP4A 1UMIA 4HMZA 1PO23 5C9AA 1K42A 4CDWB 4XIKA 5LY2A 3VLBB 1V6LA 2ZHKA 3MLLA 1GZWA 4HETA 4YPJA 3RZMA 1LOBA 1KITA 3DXUA 1DYKA 3MIFA 1AJKA 2V73A 3B93A 2ARXA 3WF1A 3KS7A 4FTBA 2NMNA 4CDQA 3N36A 1W9SA 4MX3A 1RVF3 5FAXA 5TSWA 1G9BA 3KV5A 1HQWA 5DZEA 1I5ZA 3WHUA 3LIGA 4AFCA 3MLKA 1GICA 2IC1A 4XVHA 2BEOA 1LEMA 1G8WA 2IXIA 3TEWA 3GZEA 1UY4A 3DYPA 4H7MA 2YBSA 1AYM3 3KF5A 3ZN6A 3V64A 3M2MA 2K0GA 1WWYA 1OD5A 5JAXA 2CU5A 2DCJA 4DINB 4XEZA 1V6NA 2K9ZA 5C4WC 4AVAA 1UY3A 3I8TA 4ARXA 1HRV1 1LU2A 1QDOA 2EIGA 2ZGOA 2VBDA 2BU9A 5HV0A 1WCKA 5DQ0A 3IMMA 4QU1A 2XBO3 5JR7B 4UFLA 4CCEA 2KD7A 4OMCA 4AQ6A 5CNAA 2ZBJA 4PT6A 5IW0A 3WQ1A 5J96B 1TE1B 3NSTA 3PUHA 4YFWA 5G05L 4NIAA 5CFDB 1E5HA 1UOBA 3CLPA 5LA0A 1IS3A 2WWJA 1FMD3 4Y1UA 2XUMA 1SFYA 5FRAA 3ACGA 3WDUA 5FPVA 4COVA 3TAYA 4DZGA 1AJOA 1JYVA 1RHI1 3ME2A 3F95A 3WW3A 1W8ZA 2RM21
chains in the Genus database with same CATH topology
4WVMB 1VBC3 3ZVXA 5LEJA 1H30A 1QXJA 3RI9A 2G9GA 2VXRA 2DU0A 1TME1 3AZZA 5C8WA 3NO8A 2PAKA 2NYYA 2X5IC 4HZFA 4IEVA 1BZWA 1ZZ8A 1ZA4A 2XJTA 2W39A 4LO6B 1HRV2 4Y1ZA 2PLV1 4IV3B 4YGEA 3MGUA 1IQAA 2RMU3 4XE9A 3FFQA 5H9QA 1LHNA 3ST7A 1AR81 4IETA 1ULEA 3MPPG 3D8CA 5C8CC 1WLTA 3DL3A 4XFCA 5J09A 4R9CA 5JIUA 4QMAA 3CJIC 4Z92B 1RHI2 3WY6A 4JGYA 2R0HA 4ES9A 1SDWA 4KWJA 4MXWB 4YNIA 2HKXA 4DMIA 4AVBA 1RUNA 4OLLA 1VBB3 3VGIA 1X36A 1F9KA 1DDLA 4BHPA 4QM9A 4JDNA 1BMV1 1UU6A 2B45X 4CDUC 2CV6A 4HANA 4HKLA 2R1BA 1SCRA 2Q1ZB 3H8UA 4QPIA 4I0WB 2WSUA 2PHTA 4HFSA 1RUE3 3PMSA 2RS33 3PVEA 3ROUA 3WCRA 3WINE 1ENQA 2W68A 5E16A 3ATGA 2DWRA 2ZHLA 5JSOA 2A75A 4IV1B 3S6PA 5LK7B 3I54A 1RMU3 3QH7A 5JMCA 3VV1A 2DUPA 3J8F1 1DGWA 2EXHA 5EXOA 1UD1A 1OPMA 1BCXA 1AR91 2RE9A 3AMNA 2ZHNA 3LZZA 3R6SA 4AWDA 4RD7A 5CFCC 5L36A 5KWRA 4D7SA 2WNVB 3NAPB 4N90A 2W08A 4QPYA 5HCAA 1QJX1 4JTOA 5JOZA 2VVEA 3MF9A 3SMHA 2R071 4BIFA 5CVRA 2E7AA 3TNQA 4FOYA 3AJYA 2R6QA 1R1A1 2R063 4HVOA 1HW5A 1BEV1 1AR92 1GYKA 1MVQA 2RR11 3A0KA 3E5QA 3WD5A 4AI3A 4Z2WA 3E6BA 3AZYA 1OHFA 5B2GB 1HQLA 4NN0A 1AYN1 1QOSA 2WL1A 4IEOA 5GLZA 3JQXA 2BVBA 3RJRA 4B4RA 4XFFA 5I8YA 1QJX2 4GKYA 2VW2A 3LSEA 5A33A 5KXEA 3SH5A 3S30A 2JG8A 1RUF1 4AEDB 4SBVA 1W6MB 2GNDA 3IPVB 1G9FA 4GIQA 2R072 4QQLA 2JENA 3IDEA 4E4ZA 2A6YA 3RYPA 2UU8A 3VDDB 1BEV2 1ENRA 1CD3G 4E2SA 4YVWC 2IXCA 2Q1MA 3WG3A 4GB31 3WP4A 1ND2A 2E9QA 1Z7S2 2DTYA 1H4HA 2AENA 4CEYA 4JCKA 2XVGA 3UJOA 1OMIA 4E9KA 4F3JA 1ZBE2 2X5IB 1C5IA 2ZA9A 3WW4A 2XKOA 4K20A 2JG9A 4UXAA 1RUF2 3UKNA 1X33A 1LHWA 1OLRA 1UZYA 2A6VA 1UIKA 4QQPA 3WG4A 1NY71 2XLFA 3AZWA 4XZPA 5C8CB 1MVEA 2D6LX 4G9SB 3ASIA 5I93A 1Y43B 3CJIB 2SLIA 1DZRA 1AZDA 2FBEA 1PIV1 1EYBA 3HD8B 1YLLA 2D3RA 3BPZA 4W6YA 2OUJA 5EWSA 5AVAA 4RGGA 4ORFA 1QNWA 4U2AA 1CPMA 1PHMA 3ZFGC 3GHMA 1LOGA 5FLJA 2VU9A 4ASMB 1MS5A 2WT2A 4DRVA 4LO4B 1JYIA 1RUG1 1IOAA 2QE3A 3SLIA 4KH9A 1Q43A 2NLRA 3SHRA 4BA6A 4EN6B 3IN9A 4AW7A 4LNVA 2ZMLA 4CEWC 3BTAA 5IK8A 2ZOEB 4R52A 3KCYA 5HBAA 4OVEA 2UURA 1OOPB 2ZGPA 3QD6A 4DXZA 1PIV2 5HCFA 4ZU7A 5BNOA 1PK6B 2GNMA 3POYA 4COUA 2YUEA 5DXDA 2C9AA 5BY5A 1WW6A 2PHLA 4PCRA 4RFT0 4H14A 5JIAA 4IL7A 3VZKA 3WCSA 4I0BA 4Y22A 5EYXA 5BNNA 4FTEA 5CFCB 5CG9A 1QQP1 4I3GA 1M06G 1ASJ1 4YG3A 4YW3A 3QBQA 4NR1A 4BYYA 5BNPC 1W6PB 1X82A 3AYAA 1COV3 1CAVA 5KHIA 5KXDA 1GQGA 1EAH3 1PO11 1PZ7A 3ENRA 1RB8G 3LOBA 1RUJ2 2QJVA 2XH6A 2RS12 3W59A 4CDXA 3MW2A 1GSLA 4DNYA 5C9AC 1VBE3 4HL0A 4WVVA 1C3HA 1VRH2 4PJYA 2GAUA 2BFUS 4LHLA 5HI0A 1H2KA 1WMDA 3IDBB 4RR3A 1BBT2 3EJKA 1R093 1XRUA 1WW5A 4CDQC 2OUHA 4M3CF 1F2NA 3WG2A 3NVCA 3I2DA 4LE4A 3WDXA 1DFQA 3UJQA 4GWMA 1D4M3 3X29B 1LU1A 4LLOA 4PBOA 4YZ1A 1AR72 1C8M3 3VKLA 3AX4A 5DUVA 4HLTA 2BQPA 2CYFA 1HXS3 3OCPA 3ZSLA 3AP7A 4X8PA 4DPNA 1QJU1 4BM8A 1QNYA 4YM0A 4YGDA 5A32B 4BOWA 3L2YA 4YG0A 1WUVA 1C5HA 1CAWA 4YVWB 2OA2A 3OBTA 4D69A 5KC5A 2NQYA 2PHRA 4LO8A 4IEPA 3GZUC 2VGDA 4YZ2A 1PVC1 2JICA 2VOKA 4XJWA 3FBYA 1R083 1LOCA 1BJQA 1RINA 1GFF2 2XHKA 2YYOA 4MZUA 4JGZA 2H6BA 2CWSA 5F6KA 5J36A 1DYPA 1PNFA 2ZZJA 2EXIA 2FQPA 3CEWA 1MS0A 3VZMA 3RYKA 3FWEA 5HCBA 2NPIA 4OZXA 2A3WA 4YM3A 1YXWA 2R043 3IM0A 1QGLA 3DF0A 1RUC3 1GNHA 4JGYC 1PVC2 1XNCA 1D0GA 3ZFGB 1UPSA 3H0OA 2PHUA 2WFPA 1CJDA 3O5SA 2HWC2 1FPN3 3M3OA 3DN7A 3ELNA 4C1WA 3SCGA 2QNKA 2WA3A 3USUA 2XJSA 3NL1A 1WCSA 3KT7A 4QGNA 1MZ6A 1Y9QA 1XE7A 4CEWB 5A3LA 1GR3A 2W0XA 5DDJ2 4BPZA 4YW1A 1JOJA 1IPKA 2BFUL 1CAUB 1NZCA 2A3XA 3V0BB 2FZ1A 5D1IA 1GZ9A 5FQ0A 1TMF2 4FCAA 4XQDA 5KHHA 2XJPA 4C1XA 2VUAA 4RS5C 4N53A 4BCUA 2VNRA 2ZGLA 1OA3A 3WDWA 4HBNA 4PF5A 2ZGUA 1I1EA 1AXYA 3H1YA 4Y20B 5EV7A 3RDIA 2O0OA 2BBVA 3AZXA 2VOWA 4AI8A 4IEZA 1Q3EA 5BNPB 3WXPA 2DTWA 1VBA2 1FOD3 3S7IA 1ZBA2 4HN1A 5AFEA 3PMEA 2MPFA 4UW3A 4D7TA 4AFDA 4META 1O3TA 2ZX2A 3WNXA 1U12A 1ZZ7A 4XHBA 3SNMA 1SQ4A 2ZMNA 2UY9A 3E97A 5D8AA 2BWAA 4AGGA 3HT1A 1XE8A 2E63A 3ZFEA 1SBDA 1DZTA 5L7OA 1BQPA 1WMFA 4CDQB 4XMAA 2HWB1 1O3QA 5J7MA 3CO2A 3IT8A 4PLMA 4HVRA 4XILA 5C6CA 1LOAA 3HBZA 3N35A 4QQ2A 3V65A 4WM7C 1A78A 2YMZA 4HT1T 1AX1A 1RUH3 2GALA 4AE2A 4HN0A 4HSLA 1OA4A 4Q0SA 2JG8C 4M0NA 1HV0A 4XW3A 3RWNA 2PHDA 4L92A 1LULA 2JD4A 5CADA 4LBQA 4FT8A 1DQ2A 3LA2A 2NP0A 1RUI3 4MYEA 5AC92 1DGRA 4QPGA 3HAGA 1W6OA 4JC1A 4LBQD 1V9U1 3R4DB 3ZSKA 5KBFA 2WFF1 3VL8A 3G6JB 1O3SA 2I45A 1TNRA 2JJ6A 2WS91 4OI0A 5I0SA 3UL2A 1SBFA 2A73B 3TN91 2AZ5A 1AR63 2ERFA 5DUUA 2KA3A 4CEYC 4B7EA 3AMQA 2P37A 2LM3A 4PBPA 5JSPA 3LCPA 1LHOA 3CJXA 3VKMA 2XPJA 2HWF3 1QXRA 3AZVA 1OLQA 4QXKA 4W6XA 4Q0PA 3IDCB 3AKQA 1AXKA 1ENSA 2OZ6A 1SFNA 5DZFA 4QQHA 4CP2A 4YG6A 4EROA 1SLTA 5BUVA 4WBBA 1T6GC 4FXGB 4M00A 5CB7A 3TWIA 1QDCA 2DCTA 1V9U2 2OPKA 2PAMA 4DQAA 2WFF2 3GYDA 1PNGA 3U0ZA 3NV1A 2ZX4A 5IUQA 1RL3A 3RG0A 3KLSA 5SV5A 4TWTA 1NCQA 3HT2A 2YDEA 2X53S 3VHRA 1CX4A 2F4PA 2XL7A 2YPJA 1YI7A 4L99A 1FV2A 2VQAA 4YZ3A 3GZAA 3TNPB 1YJKA 1QXPA 3MF6A 1WLWA 1VJ2A 3H7YA 4XHXA 3THTA 4K21A 1K5MC 3WDVA 2ET7A 2VMGA 1HKDA 4XF9A 1YHFA 1AXZA 4R9BA 1PGW1 2H0BA 1HLCA 1S1AA 1MS4A 2Z79A 5T52A 1OPOA 2D6NA 1MZ5A 1XYNA 4JVAA 4RS5B 3JBG3 4MUVA 2OIIA 5CBLA 2B8MA 4FPJA 1S55A 1VR3A 1QKQA 5BNOC 1O4YA 4R4ZA 2PYTA 2HEWF 5IK7A 2EA7A 3OPZA 1NG0A 1W6NA 3FX3A 5BNNC 1FX5A 3DKWA 3D5OA 3AP4A 5LK5A 2GDFA 3VKFC 1KS4A 2TBVA 3MIHA 2D5FA 2WKKA 2WIIB 4OUMA 1RJ7A 2GN3A 1U0AA 3C2UA 4Q4Y1 2B5HA 4G3YC 1REDA 1RUD1 2OVUA 1PGW2 4CDXC 2HWD3 1YRZA 1G7YA 1DQ6A 1W6QA 4KWLA 4FTSA 1IS5A 5AVPA 2KXLA 5JPNB 2ZX0A 3E5XA 3GF6A 3AYDA 3O14A 2DVBA 4RHV2 3USSA 4HSJA 3VBUA 3G7DA 5I8TA 5FMOS 1AL23 5CA6A 4Q0VA 1H8TA 2E53A 4XF4A 2B7YA 2WZR1 4JRLA 4MGYE 2WNUB 1JHNA 4I30A 4WM7B 5JZGA 1PO21 3ZO0B 1OFNA 4ISRA 2DVAA 3OBRA 5C33A 3KGLA 4XBQA 1H1IA 1QOTA 1GZCA 2CAUA 3J9SA 1LGCA 1RUD2 1S0DA 1CVNA 1BXHA 2VULA 2TNFA 3RI8A 4MGZE 1EY2A 1RVF1 3AMMA 4AVTA 2NMOA 1BVP1 2VUJA 4FPCA 2R16A 2ZMKA 1S0GA 1AYM1 2D6KA 2GMMA 1V6OA 3D0SA 1FAYA 3ZYPA 2X29A 2DVGA 2VH9A 4XBNA 4XFGA 3VBRB 2P34A 1N3PA 2TEPA 4Y4YA 1LR5A 4FPFA 4Q4W3 1E57A 5H9SA 2XBO1 4DS0A 3PJYA 1QJZA 2Z5WA 4JGZC 5GALA 4LTAA 1I3HA 2HJIA 3U11A 2OZJA 4A7KA 2RM22 1H1MA 3V0AA 2CGOA 1FMD1 3O0WA 4Q27A 4FPKA 4RQPA 4AK3A 5HXVA 1VP6A 1TME2 1S0BA 3ETQA 4GH4A 2FZ2A 4XYXA 4XF1A 4KGGA 1VBC1 1DHKB 1DZQA 2A6ZA 4H7LA 4HKWA 2PLV2 3PHMA 3FC0A 1AR93 1V70A 3TOJA 3I59A 2YGMA 1HX6A 1QH6A 4B4PA 2QQPA 4XJ9A 1AR82 3PNAA 1ZRRA 1H2LA 2VNGA 4XOGA 3AKSA 1YIFA 3ZXLA 1UAIA 4AI2A 5I0RA 1K5MB 4WM8C 2QZ2A 1EPWA 1SACA 1XU2A 5L73A 4G4FA 5JI9A 4QU2A 3ZN4A 1ZM1A 3WQ0A 3S7EA 3SISA 1ND3A 1VBC2 4WVZA 1BMV2 4D3WA 2ZJCA 5LRSA 2D7FA 5BNOB 5FMOL 4CYDA 1VBB1 4WZFA 3ZXFA 2ZHMA 3VBFC 4LO7A 4R9DA 2ZGKA 4URTA 2YZ4A 4EN9B 3FJSA 1PZ9A 3N4MA 1MQTA 2VECA 1BK1A 4Y22B 1Z7S3 4LULA 2A6WA 1YFXA 3D82A 4PDWA 2PFWA 4IEQA 4Q29A 1ZBE3 5K0UA 3WUDA 3ZXDA 4E2GA 4CP0A 1CAVB 4R9AA 4CDWA 3J8F2 1OFSA 2DUOA 2D98A 4BZ4A 1RUE1 2QDNA 2RS31 4FXKB 2Q4SA 1VBD3 1S0EA 1RMU1 3JD73 1DG6A 2KM2A 5GJ6A 4AI1A 4TLFA 5I0TA 4WZCA 5D8AC 1N3QA 2HWE3 4YVSA 1UMZA 1OKQA 4AYUA 1VBB2 3ZFEC 5J98B 4O9EA 1D2QA 1CAXA 2ZGTA 5C4WB 2VOXA 1IKQA 1NCRC 1NQJA 2NN8A 4IESA 4AG4A 1U5YA 2ARBA 2ETEA 4HK9A 1APNA 1G9CA 4GMP3 1W2UA 3GALA 4D94A 5JPMB 5IK5A 1U5IA 3B5LB 4FP2A 3FUQA 5EZWA 4COYA 1R1A2 3B00A 2XB6C 3U07A 2RR12 1RMU2 1VB2A 1YUDA 4M3CB 4NHKA 2YHJA 3N3HA 4KL1A 2PELA 1KD7A 4QX5A 2CGNA 1AYN2 2E51A 2R061 2ZGNA 4LBMA 1UX6A 4S2DA 1F5FA 1EV13 2RS53 2YGLA 4PIXA 4QPGC 1DF0A 4EWEA 1CAWB 3K48A 4WVMA 4N43A 1LGBA 1WLCA 2D93A 5GLVA 2GC3A 1VLNA 2D6MA 3DPRC 4Q8LA 2BNMA 2JXAA 2DFCA 3URFA 4Z8BA 4IV3A 4K3UA 3VKNA 4QGMA 1QJY3 1POV3 3T1LA 1HRI3 4K1ZA 4C0BA 1FXZA 1JUHA 2GZWA 5KHJA 1XNKA 4GKXA 3MFCA 2UWAA 4M01A 4GB32 3MW3A 3LWCA 3B3QE 1RUJ3 1ZRFA 3O7OA 1WD4A 2RS13 1R1ZA 1TEIA 5BPXA 3OF1A 4MV2A 1LCLA 4N9IA 3H3UA 4ES8A 4C91A 2H6CA 4MXWA 4W6WA 1VRH3 2YROA 1NA1A 1XQNA 3VZOA 4CDUB