3WCRA

Crystal structure of plant lectin (ligand-free form)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
235
structure length
229
Chain Sequence
b'ASQTSFSFQRFNETNLILQRDATVSSKGQLRLTNVNDNGEPTLSSLGRAFYSAPIQIWDNTTGAVASFATSFTFNIDVPNNSGPADGLAFVLLPVGSQPKDKGGLLGLFNNYKYDSNAHTVAVEFDTLYKPRHIGIDVNSIKSIKTTTWDFVKGENAEVLITYDSSTKLLVASLVYPSLKTSFIVSDTVDLKSVLPEWVIVGFTATTGITKGNVETNDILSWSFASKLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Erythroagglutinin
publication title Phytohemagglutinin from Phaseolus vulgaris (PHA-E) displays a novel glycan recognition mode using a common legume lectin fold
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 56
structure length 229
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wcrA00
3LSDA 1WUVA 1AF9A 1FYUA 1WBLA 4XYXA 1AX2A 1LOCA 1SLTA 2DVFA 4P9WA 1KDMA 3O0XA 4WVWA 1V00A 2A6VA 1GZWA 3POWA 1SBFA 1R1ZA 5IK4A 3FFZA 1WBFA 1I3HA 4FPLA 2WLQA 2D44A 1UMZA 1DIWA 5JOXA 2A3WA 3RRDA 4FP2A 1GZWB 1DQ6A 3GNEA 3WDYA 3V0BA 4YG0A 1JW6A 1HQWA 3W58A 3A0KA 2D6LX 3V0BB 1V6IA 5GZGA 2SLIA 4I30A 4BLJA 2ZGLA 1IS5A 2AGSA 1FNYA 4HANA 2XB6C 4BOWA 2R0FA 3R05A 2R0HA 1S0BA 2VUAA 2NMNA 3WOGA 1S0IA 2A5ZA 1DQ5A 2WT0A 5E89A 1SLLA 2GMPA 5LK5A 4XIKA 1S0JA 1ULCA 2H0BA 4IQPA 2EXIA 2JDZA 2EXKA 4AVTA 1G9CA 1GLHA 2ZGUA 4K1YA 3B9CA 2NN8A 2BQPA 3NV4A 1LGBA 3V0AA 2ZGNA 5L73A 2V73A 1Q8OA 3WHUA 2SBAA 2JJ6A 4XILA 3SH3A 2FMDA 2KM2A 2D6OX 5HCBA 3V0AB 5KXDA 4P14A 3ZXFA 1W0PA 2PHRA 3MW2A 1HQLA 1QNWA 3A0NA 1S0CA 3VKMA 4R9BA 1Q8PA 3ILRA 4RA0A 1AX1A 1QNYA 2VW2A 1FX5A 1MR5A 2CYFA 2OVUA 4U2AA 4WZFA 1DHKB 3USUB 4Y1ZA 5CB7A 1LODA 2A7AA 4YW3A 1LEDA 2D6PA 3RSJA 2ARBA 1DYPA 3ENRA 1YIFA 5JLVA 5FRAA 1BJQA 1S0FA 1O4ZA 1FV2A 1GANA 1W6QA 2EXHA 5GLUA 3CNAA 5JOZA 3VUOA 2A71A 2A3YA 1UAIA 1BXHA 1VIWB 4AYUA 1LOGA 4C1XA 4XMAA 1WD4A 4Y26A 3M2MA 2D6NA 1UX6A 3BTAA 1ULDA 2I2SA 1RITA 3M3QA 5GLVA 2C9AA 3MW4A 4YW2A 4LBOA 1IS6A 4WVVA 2PHWA 1UL9A 1D2SA 3ASIA 2JD4A 1DQ1A 4P9YA 1IS3A 1LGNA 1LULA 1N47A 3PJQA 4Q1PA 1N3OA 3ZSKA 1Q8SA 1A3KA 1G9BA 1HDKA 4FVVA 2WSVA 2P37A 5H9RA 3BIWE 4GWNA 4PBOA 2GNTA 4GWMA 5CAZA 3HN1A 4M01A 5IK8A 2D3RA 1MS9A 4XJAA 2YROA 1NLSA 2EIGA 3N36A 2ARXA 3B01A 5GLTA 3WG4A 2AUYA 5T54A 2ZBJA 3RQ0A 3ZXEA 4P9XA 5DUVA 2A6XA 3KM5A 4XDQA 1UKGA 5T50A 3O0WA 1RIRA 2ZHKA 3N7MA 5GALA 1GZCA 1AVBA 1W6NA 2DVAA 2YZ4A 3T1LA 3ZSMA 1JUIA 2DTWA 4GA9A 4AVVA 3O0VA 3IKWA 1PZ7A 2ZHNA 4YM1A 1W6NB 3NV3A 4FQZA 1W6OB 2WT2A 3A4UA 5DXDA 2A3XA 3WLUA 1AX0A 4FPHA 2D7FA 1LHOA 3I4IA 1S0DA 2W39A 3BOPA 3D4KA 1CPMA 3INAA 2P2KA 4BM8A 3OY8A 3UJOA 2DUOA 1YYNA 1N1VA 2DVGA 2ZMLA 4YW1A 2W52A 4DQAA 4K1ZA 3OY8B 5GLZA 4YZ4A 2V5YA 4SLIA 3B3QE 2D6MA 3AZYA 3AP4A 2VH9A 4U36A 1CQ9A 1JHNA 2P3JA 4DFSA 4FPGA 1UZZA 4FP3A 5EWSA 3ZSJA 2JE9A 5IT6A 3T1MA 5GZCA 1PZ9A 1G7YA 1QDOA 1SLAA 3AXEA 3V64A 1LHNA 2JE7A 3POYA 3SNMA 4LBLA 4AGVA 1SACA 2CY6A 2ZGPA 3L2YA 5T52A 4LBMA 4YFZA 1APNA 2DWRA 3AP6A 2ZA9A 1CIWA 2ZMKA 3PVNA 5T5PA 1QMJA 3ZYPA 3VV1A 1B09A 1ZA4A 2Z42A 2ES3A 4FPEA 5T55A 4YZ3A 5DG2A 3AZZA 3SH4A 5CBLA 4XJUA 4XXPA 2A6ZA 1GZ9A 4FOWA 2P3IA 1KRIA 1MACA 2B7YA 3WCSA 1WW5A 3C2UA 1CN1A 4YGBA 3FLRA 3Q9OA 2W68A 1G86A 1LHWA 3ILNA 4CRQA 1Y7BA 3OGGA 1SLCA 2RHPA 4XBNA 4PBPA 4DRVA 5HCAA 2WNEA 2LALA 1SFYA 1QU0A 5DG1A 3ATGA 2ZAAA 3MPPG 3MEPA 2AYHA 4NOTA 4YZ1A 2CTVA 3WCRA 1SBEA 4Q8KA 5H9QA 2D3PA 5JVVA 1GBGA 3AZWA 4Q1RA 2PHUA 3V65A 1G8WA 1V6LA 4YM2A 1AXYA 1D0HA 1YI7A 1DQ2A 1V6JA 1UZYA 5F9TA 1WCSA 2A70A 4Y1YA 4YW4A 3IN9A 2R49A 2NYYA 5EYYA 5IK5A 1SCSA 2YV8A 2VXRA 3FUQA 3H0OA 5AVAA 2YMZA 1GSLA 1ENQA 1KJRA 1QOSA 2ZGMA 4HL0A 4YM0A 4XHBA 4FPOB 3AYAA 2R1DA 3WG3A 3WDVA 1W6QB 3B69A 1ENSA 2ZHMA 5GJ6A 2W08A 3VKOA 1CR7A 1UN1A 5GZDA 2DVBA 5T5LA 3PVEA 4CZSA 2VW0A 1URXA 5CA6A 3AYEA 2AENA 1GKBA 3WNXA 3AJYA 2LTNA 2DURA 4XJWA 1Q56A 3VKNA 2A6YA 1QKQA 4YM3A 2GNMA 2DUQA 4JC1A 3ZXKA 4DRRA 1OFSA 2GNDA 2UWBA 1GICA 1N3PA 1LOBA 1BYHA 1LU2A 1MS8A 2NZ9A 4GKYA 3UJQA 4C1WA 3ILFA 1WW4A 4YFWA 1FNZA 2ZGRA 3DUIA 3NV2A 4XZPA 5KXBA 4M00A 3WG1A 1SCRA 2EALA 1W6MA 2NM1A 1AJOA 1SBDA 3TAYA 2DU0A 2VY0A 3IMNA 3M3OA 2CL2A 2E7QA 4UW6A 4LBQA 4ATFA 2TEPA 1W6MB 3OPZA 2OUHA 5DUXA 4TYSA 1BZWA 4M3CF 2D6KA 2A75A 3WUCA 3AXDA 1V6NA 2R1BA 4JCKA 2ZGOA 1QOTA 1Q8VA 1C1FA 1ONAA 4XXAA 3FBYA 5JMCA 4ITCA 1JXNA 1UPSA 1LOAA 1VAVA 3AZXA 2PHXA 2ZACA 5BYNA 3PVOA 2C5DA 1LGCA 3LCPA 1C57A 1CVNA 1WLDA 3OYWA 5E8AA 1J1TA 4LBKA 4R9CA 2EXJA 4K20A 4BMBA 3N3HA 5DZEA 3B00A 1MS3A 4LBNA 4BLIA 5H9PA 1MS4A 2DVDA 4Y20A 3N7JA 4NO4A 1LCLA 3AP5A 1AXZA 3LSEA 4PCRA 1ULFA 4W65A 5T5JA 5KXCA 3U4XA 1MZ6A 4XTPA 2PELA 1WLCA 2ZGSA 4XBQA 4Y20B 1ENRA 4YLZA 2UU8A 2ZGKA 1O4YA 3JU9A 4GKXA 4Y22A 2AH2A 2OW4A 2GMMA 5JDBA 2ERFA 2GNBA 2WQZC 4YZ5A 1H9PA 1LESA 1N1TA 1S0GA 2DYCA 3AFKA 1DZQA 4F83A 1LOFC 2E53A 1PZ8A 1C1LA 4YZ2A 4KBBA 3ZVXA 1JN2P 3AK0A 2ZHLA 2UWAA 2UURA 4H55A 4ZXKA 3ZYRA 3WUDA 5IK7A 1IS4A 1LECA 1OKQA 1V6OA 1A8DA 4Q26A 1GV9A 1TEIA 1W0OA 4FPKA 3N35A 1ULEA 1GNZA 3BODA 1KJLA 3RS6A 2DV9A 4XHXA 3SLIA 4Q8LA 3FLPA 1BKZA 4AGGA 2E51A 1LEMA 5KXEA 2ZABA 4YGCA 1LENA 3N7LA 3QCWA 4XJZA 3AX4A 2VW1A 4Y1VA 4UW5A 2XG3A 1AJKA 4Y1UA 1DFQA 1S1AA 5H9SA 5GLWA 1CESA 1DYKA 2Q5TA 3NV1A 4JRAA 2GDFA 1DLLA 3GALA 3R4UA 2G4IA 4FOYA 4ISQA 5E88A 4ATEA 2NP0A 3FUOA 3MW3A 1VALA 3AP9A 4D69A 2ENRA 2NMOA 4XOGA 3DGTA 2YY1A 3OBTA 1QGLA 1S0EA 1MS0A 1CONA 4AWDA 2PHFA 1JYIA 2ZGQA 2DTYA 3SITA 4R9AA 2ZGTA 4UW4A 1RINA 4YG3A 2EF6A 5GZEA 3OBRA 1KQRA 4FOVA 2DU1A 4FQ4A 1FV3A 3M3EA 1GNHA 1A78A 1WW7A 3RMXA 4BMEA 1G9AA 1N3QA 1NXD1 2UWCA 5DUUA 1QOOA 3WDTA 1W6PA 3FLTA 3ZXLA 4ZKTB 1V6KA 4MYEA 4RL7A 2CNAA 4M3CA 5CNAA 3USUA 3AJZA 3HR9A 1G9DA 1F31A 4WV8A 2P3KA 1W6PB 1JOJA 2ZMNA 3RG0A 2CWSA 4M3CB 2ZZJA 1AXKA 4FPJA 4L8QA 1YXWA 5IUQA 1BQPA 1C4RA 3AYCA 1LOEA 3O12A 3O5SA 3VKFC 3TB0A 2R16A 3T2TA 3ZPYA 2JECA 3POSA 1FAYA 2CWMA 1LHUA 2VU9A 3AYDA 2P34A 5GM0A 3IPVA 1MVQA 3JUUA 3QLQA 4YG6A 4FPYA 4ISRA 1CPNA 1FATA 1YRZA 3RMYA 2D43A 1GYKA 2WJSA 1IKPA 3IPVB 2FHRA 4XMIA 2E6VA 4Q27A 4Y24A 1QF3A 3VKLA 4UW3A 4XIOA 3D6EA 5F5QA 1DQ4A 1WW6A 4PF5A 1OQ1A 4R9DA 4FPCA 4LBQD 3N7KA 2AREA 5EYXA 4XTMA 4XJ8A 5T5OA 2JKBA 3WDXA 3AZVA 3WDUA 5JOYA 1I1EA 4ASMB 1IKQA 5FREA 1Z78A 1ULGA 1MZ5A 1U0AA 4YGDA 3WV6A 4OZXA 3WDWA 1N1SA 1LJ7A 1F9KA 1MS5A 2AR6A 1MVEA 1H9WA 1EPWA 1LOFA 4LBQB 4M3CE 4DS0A 1QDCA 4BPZA 1HKDA 3UL2A 3SH5A 2PHTA 4CTEA 1JYCA 5HCFA 5EXOA 1JBCA 3R4SA 4K21A 3NWKA 1G9FA 4DPNA 1LHVA 1DBNA 2WSUA 1YO8A 2D3SA 3OJBA 4Z8BA 1DQ0A 1N1YA 1Q8QA 1WD3A 2DUPA 1VAMA 1KDKA 2OUJA 1ZM1A 3D5OA 4Y1XA 4XJ9A 3HMYA 3OYWB 1AZDA 5SV8A 4PQ9A 2GALA 3WVJA 3KQRA 4YGEA 1H30A 1LU1A 4XBLA 2EAKA 1W6OA 4GALA 2GN3A 1CJPA 1MS1A 3M3CA 1V6MA 3I8TA 3PMEA 3APBA 3M1HA 4XE9A 5DZGA 5DZFA 4Q2FA 1HLCA 1Z0HA 3WHTA 4AVSA 2GMEA 1DGLA 2A6WA 3WG2A 4FPFA 2WT1A 4GXLA 1VLNA 5GZFA 3UK9A 3IM0A 1KITA 3ZSLA 4LBJA 3WZ1A 4AGRA 3AP7A 1IOAA 2WKKA 4Y22B 2YXSA 3SISA 5JOWA 1SLBA 2E7TA 4FOQA 1X50A 2GN7A 5DUWA 2HYKA 3W59A 1F5FA 1XQNA 1LTEA 3ZXJA 2ZKNA 4BQ1A 4TZDA 4YW5A 1SLIA 1WLWA
chains in the Genus database with same CATH superfamily
1I6XA 1WBLA 2JENA 1JZ8A 1AX2A 3O0XA 1TZOA 2A6VA 1GZWA 1KFUL 4KH9A 4MV2A 5IK4A 5FLIA 3VD9A 3FFZA 2XJSA 2WZEA 4IEWA 4MO3M 2D44A 1K45A 1DIWA 1VPHA 2HBTA 2A3WA 3LKJA 5DQ0A 3RRDA 2FDIA 4I09A 3HQXA 2WIIB 5FY1A 3HEIA 2I07B 1PVXA 1GOFA 3IB3A 4YG0A 3ACGA 1I5PA 5D8AA 1AR72 1T2XA 2JKXA 4I30A 4CDWA 2J1UA 5A1FA 3SCFA 2JIGA 4LQRA 1PGL2 4H7LA 4GH4B 4YVSA 2XLGA 2ZX3A 3CQOA 1HB2A 2J1TA 3QACA 2R0FA 3R05A 5E6HA 3VBFB 3X29B 3DEMA 1RXFA 5FQ0A 2A5ZA 1Z7S3 1K12A 2Q1ZB 5CFDB 1VRH1 2RVAA 1PHMA 4IQPA 2EXIA 4XABA 2YPJA 2ZGUA 5J7MA 3GZTB 4L2NA 4RD7A 3HIFA 3NV4A 4OUSA 5FBZA 2WZR3 1C8M2 2ZS6B 3V0AA 1BBT2 1TME3 2AEYA 1Q8OA 2V73A 3I2GA 2FMDA 4G3YC 3KLSA 4V2VA 3O1SA 4Q0VA 1EUTA 1ZRIA 2A73B 1F2NA 3AFGA 5FCCA 2C24A 3NNFA 3THDA 1GQHA 2HWC3 3OCPA 1OA3A 5DDJ3 3WNNA 5FYUA 1QNYA 3BPZA 2OVUA 2CYFA 4U2AA 1XE8A 5C3RA 3NAPB 4Y1ZA 5CB7A 1Y4WA 4LHKA 4O9EA 3CDZB 1LEDA 3RSJA 1Y9GA 4TWTA 4CPBA 2XUMA 5FV3A 3ZFFC 5FRAA 5JLVA 5JUVA 1JOBA 1RUH1 4NHYA 5IVCA 1OMIA 1FV2A 3VUOA 3PNAA 1GU3A 1UF2C 4MVTA 3BTZA 1AL0G 1HRV3 1V9U2 4EYUA 3H50A 3NO8A 1HB3A 4C1XA 3N9MA 1WD4A 3GZAA 1XU2A 2X5IC 3PTRB 4Y26A 4J6GA 2ETEA 1BEV1 2P6HA 5GLVA 5EIYB 3EMRA 2RMU1 4Z82A 4Y4RA 2MNGA 3G6JB 4YW2A 3RWKX 4LBOA 1ASJ2 2PHWA 2W94A 2P6CA 2VMHA 5FP9A 1S2BA 1WMXA 2JD4A 4CDQC 4DUXA 3T0DA 1IS3A 1LGNA 1N47A 1RJ7A 4NIGA 4Z07A 1NCRC 1D4M1 1Q8SA 4AHWA 2FCVA 1U5XA 5DABA 2RS13 2ZX4A 1HN1A 2E7AA 2J1SA 1KEXA 4SBVA 5F5IA 4AI9A 5AFBA 1JHJA 5FPVA 3S5QA 4AFAA 2VTFA 1ND3A 1RUI2 2QUOA 4OHZA 3T2PA 4AFMA 3K4AA 1X9TA 2YROA 1NLSA 2EIGA 3N36A 2ARXA 1BMV2 4QHBA 3WG4A 5M0TA 1PM4A 2XJUA 5LBBA 1CAXB 3WQ1A 3KM5A 4XDOA 4L99A 4XDQA 2TNFA 5FP4A 3PHMA 1UU5A 4CP0A 1WMDA 2YU1A 5AC92 4K40A 3J9SA 2PLV3 2ZHKA 3N7MA 3EJKA 1EV11 3NKTA 3NJXA 1AVBA 1SDWA 4XFAA 3T1LA 4BIFA 2JD9A 3ZSMA 4PF1A 2WWSA 4BQYA 1QJFA 1IPSA 3CEWA 3T4HB 4P9IA 3O0VA 4UFMA 4R8HA 2J1AA 3PIGA 1D7PM 4FQZA 4WM7B 1TNRA 3OGRA 2UY8A 2A3XA 4AQ2A 4TTGA 1VBA1 1AYM3 3WW4A 1OPMA 2WZPP 3BOPA 3JXSA 3AVRA 1CAUA 4CCKA 3I2HA 4E27A 1AR73 3OY8A 3UJOA 3VBSA 5ERLA 3O1PA 1YYNA 4XUOA 2DVGA 2ZMLA 4DQAA 4GD4A 5FK7A 2Q8EA 2VZUA 2ILMA 5I91A 4YZ4A 2BJSA 4CU9A 1CGPA 1R64A 4DEVA 2WNVB 1UPIA 4PIXA 4CCCA 4XEZA 2VH9A 4RR3A 3C3VA 5IVYA 4D94A 1REDA 5C8CA 3LA2A 4RQPA 2P3JA 4OMCA 4DFSA 5EWSA 3T1MA 4EWDA 4MGZE 3WNOA 1VRH2 4CXWA 1BBT3 1W99A 3CBNA 3POYA 4ONUA 5FWEA 5J48A 2VQAA 4NROA 4YARA 1YQ2A 4E4ZA 2ZTNA 4LBMA 4Q0QA 3BPSA 1APNA 2P3YA 1MZFA 3RNSA 2ZMKA 1AR61 5SV5A 2JIJA 5ANNA 3ZYPA 2ID4A 1US2A 5FPUA 1IQDC 2JWPA 3WW2A 1H1IA 3J7NA 2XJRA 3D0JA 5CBLA 3AZZA 4XXPA 3OUIA 3O1TA 2A6ZA 2XR4A 4Z2AA 4DEQA 1KRIA 1MACA 1MEC1 4WVMA 1ZZBA 1WWYA 2B7YA 2X53S 2QCSB 4YGBA 3WCSA 1CN1A 4CRQA 1NG0A 4XCAA 3ZN6A 3H3UA 4BCUA 2WRAA 1FOD1 1ZVFA 4ORFA 1V9U3 1RUH2 4KWUA 2P5BA 1C3HA 4CEWB 5CKQA 3BYWA 4N7UA 2ORZA 1QU0A 4D6QA 2ZAAA 2W2IA 3ZYBA 4BK4A 5FPAA 3NNGA 4QPYA 3ZFGA 2D3PA 4QX5A 4CDQB 4OCTA 2YHJA 2PHUA 1BEV2 1ASJ3 2VMIA 1G8WA 4AQ6A 1AXYA 1NCRB 2RMU2 1JZ7A 4KGQA 1L7RA 2OQ7A 4Y1YA 1JU4A 5JZGA 2R49A 4N53C 4BA6A 1O4TA 5C4WB 5IK5A 2YMZA 4E4DX 1GSLA 4UFHA 3ZKYA 1QOSA 1X8EA 2ZGMA 4AK3A 5DAWA 4XHBA 1RUI3 1D4M2 3W5NA 4FPOB 2XBO3 4FTEA 2R1DA 5A6YA 2WYSA 3B69A 4UBHA 4META 3VBOB 3MIFA 4Z2WA 2KA3A 2ZHMA 5FAXA 3DYOA 1M4WA 2R071 2UY9A 4JGZB 2W08A 3RI8A 3VKOA 1UOJA 2DVBA 2RR11 4QB6A 4QPIC 2WNUC 2ZX0A 3I3DA 3AYEA 4MXWB 4YVWA 3WNPA 5FOBB 5AC93 1WA6X 3PU8A 3WNXA 1ZREA 3AJYA 1QH7A 2QQIA 4XJWA 4BQ3A 5C70A 4CE8A 1VE0A 3KCXA 4K8RB 4W50A 1ENXA 2A6YA 1JZ6A 2CSGA 3UNPA 1EV12 3S30A 1UOGA 4YW7A 2GNDA 2UWBA 3I3BA 3SQOA 5I93A 1GICA 1N3PA 1LU2A 1BYHA 1F4HA 3OOXA 4O61A 4HBNA 4L9BA 3J7HA 2BVBA 1NLQA 2VAUA 1OUXA 4GIQA 2XVLA 5IAVA 3NV2A 1SFNA 4XZPA 4D7TA 1XNKA 1EAH3 4M00A 5KXBA 1SCRA 3BKZA 1VBA2 2LROA 1O8PA 1W06A 4AL9A 1AJOA 1RGSA 2WA4A 5LEKA 4E2SA 2DU0A 4BJ0A 2CL2A 4CUBA 4UW6A 4ATFA 3ZKUA 1AYN1 4LOSA 4D7SA 2VO5A 3MDPA 1ZX5A 3PLQA 1FI2A 1Q8VA 4WVZA 5FZCA 1QY4A 5JMCA 1UPSA 1VAVA 3MIGA 2ZACA 3ALQA 4CP1A 2VJXA 1XNCA 1B35B 1HXS1 1WLDA 2ET7A 3OYWA 3RZGA 1J1TA 3MHZA 3LEGA 4LBKA 3M7AA 4YRDA 3OUJA 1REEA 2C1FA 1MQTC 1RC6A 1ZRRA 3N9QA 3AVSA 3A21A 4D6RA 3CF6E 4QX3A 3B00A 4NE9A 1OHFA 4CCJA 1MS3A 4BLIA 1XYPA 3D82A 1K5MB 1MS4A 3GDBA 3N7JA 3ZFEA 1LCLA 3AP5A 1AXZA 4PCRA 1YIPA 5LBCA 2VTXJ 5JXGA 4I0WB 3WT3A 3T09A 4AR2A 1AR62 3DCQA 1ENRA 3W5MA 2UU8A 3K3NA 4MADA 5A1AA 2DFCA 2ZKLA 3WR0A 1W8TA 2K46A 2OW4A 2E31A 2GNBA 3BU7A 2WQZC 3AM2A 2HWB1 1LESA 2RM21 4YZ5A 2DYCA 5BNPA 4XC9A 5FPXA 1LOFC 2K2SA 1W03A 1RUH3 2EIEA 4KBBA 4IV3B 3ZVXA 4W4ZA 1FOD2 2FZ1A 3BOWA 4ZPIA 4PLMA 1RUJ3 4NAMA 3ZFFA 2W1WA 2IC1A 4LOTA 5F3EA 1RMU1 3BODA 5CYYA 2VULA 2VZOA 2E51A 1LEMA 4LEJA 4HN1A 4S2DA 2J7MA 4J1XA 5F7UA 4Y1VA 2W92A 4A3XA 4TSVA 2X5IA 2XG3A 1DFQA 3GCXA 1NZCA 3NKGA 2WNOA 5H9SA 1CESA 4JRAA 3J8F2 3J7LA 5FTTC 3GALA 1DLLA 1R1A1 4CDXC 2G4IA 1D4M3 1OLQA 3E5UA 2GH2A 1O59A 4D69A 5JIUA 2Z79A 4A7ZA 4CEYC 1C5HA 1VMFA 4W6YA 2YG0A 4NJ4A 1CONA 1QXJA 4C8DA 1JODA 5BPXA 4JRLA 4AWDA 2QQKA 3HBZA 3MO4A 2ZGQA 5FBJA 3UGHA 2R072 4LPLA 2ZGTA 2VZ1A 2Q8DA 4P5HA 1O5LA 1SDDB 2YBPA 2RR12 1J59A 2FQPA 3ETPA 1RYYA 1W2NA 4XETA 3VDDB 1FV3A 3WF3A 1WW7A 1A78A 5KHGA 5L36A 4L92A 3O1VA 2Y8KA 5JXHA 1NXD1 3E5QA 3WDTA 4A2UA 2NPIA 3ZX7A 5A3TA 2YU2A 4OQ9A 2ADEA 3RZLA 2IXKA 2R32A 5JCTA 3HR9A 2WO1A 3ON7A 4WV8A 1G9DA 2PQQA 1W6PB 1ZRFA 3LEMA 4RGGA 2ZMNA 3K77A 3ACHA 2VNOA 4R52A 2ZZJA 4L8QA 4Q4W1 5A7WB 5F3CA 3NW4A 4Y4YA 1A6CA 1BQPA 1SPPB 3AYCA 5F2WA 5FMBA 3VKFC 2PYTA 5IW0A 3ZPYA 4C0BA 1FAYA 2R063 1LHUA 1DYOA 3S6PA 4A41A 4GAZA 1EUUA 3JUUA 1RUD3 2BBAA 4R4ZA 3QLQA 5FYHA 4DNYA 4FPYA 4BZ4A 3BB6A 4IEQA 2EICA 5B2GB 3IPVB 2C9KA 2WJSA 4ZU5A 3VB9A 2WR9A 1Z7S1 2BERA 5CKMA 3VKLA 4C91A 5F5QA 1WW6A 1C8NA 2QQOA 1YQ8A 1OQ1A 2D93A 4FPCA 1HXS2 3N7KA 4LK6A 4R9DA 5ANQA 4XJ8A 5EYXA 3WDXA 3WDUA 2WZR1 1UOBA 1TME1 4ASMB 1IKQA 1CAVB 1X8MA 4CYDA 2B42B 4AFDA 2VXJA 3THTA 4IE6A 3TNPB 3PIJA 2AR6A 2W91A 3I2KA 1NQJA 4EJRA 2BWCA 4LBQB 1EPWA 2R7EB 4EN8B 2HWC1 5DDJ1 4CTEA 5BNOA 5C33A 1QJU1 1K5JA 1YUDA 3R4SA 1H2MA 1LRHA 5DN2A 5EXOA 5HCFA 1ZZCA 2UYBA 4K21A 1O3QA 2W3JA 5FO7B 3M4FA 5CVRA 2V09A 3OJBA 4Z8BA 5CFCA 5ABJC 1WD3A 5JR7B 2RM22 2OUJA 4Y1XA 3VD7A 4IETA 3H7JA 3CJIB 4BQWA 4XBLA 2WS91 1W6OA 2QKDA 4GALA 1NCQB 2GN3A 5JPMB 4ZY9A 3I8TA 1LB2A 4PDWA 3M1HA 2XMLA 5DZGA 3TN93 3PUAA 4HVQA 1IQAA 1OLME 1RMU2 2JDAA 1W8UA 1AR93 3QH6A 3JBG3 4BDVB 3VHPA 4CCOA 3IM0A 1KITA 4MGSA 3QOPA 3GCWA 1CJDA 4Y3OA 1ND3C 3J8F3 4FOQA 5FY0A 5LA2A 2B4KA 4BISA 1X50A 2GN7A 2HYKA 4YNIA 4B3NA 1VBE3 3K4DA 3U1XA 3MI8A 4DXSA 2ZKNA 4BQ1A 4TZDA 1R1A2 2RS11 2H0VA 1SLIA 5A32A 1WLWA 3LSDA 3WSOA 1FYUA 3KV4A 4BQXA 4P9WA 1SLTA 5EHDA 4N53A 2YYOA 3GHMA 1SBFA 2WLQA 3MLKA 1H0BA 5JOXA 1VBB1 5EZWA 1HW5A 1XSRA 2Z2SB 3WP3A 4RGAA 1GZWB 2W5FA 2XOMA 2AZ5A 4OVEA 4P00B 1OI6A 2PLV1 3B9IA 1JW6A 3A0KA 2Y38A 4G4FA 1V6IA 5AFEA 4NRMA 5A3UA 3P5BA 3GJAA 5KBFA 2AGSA 3T3YA 5FYZA 1AUYA 1FNYA 3H7YA 5D8AB 4TLFA 2WABA 4AVSA 4B8EA 1JU3A 4RFRB 2R0HA 4CDWB 2Z5WA 1J3PA 1D4VB 1QWRA 2VUAA 4QPGB 4Y5SA 1S0IA 1DQ5A 2ZEZA 4YVSB 1SLLA 5LK5A 2OQ6A 1AYM1 1QJX2 2H0BA 4IEXA 2JDZA 4XQDA 4OLLA 4AVTA 1GLHA 3L9JT 1G9CA 3B9CA 2NN8A 2V4VA 4AEDB 3NNMA 4Q4W2 4JHTA 5L73A 4IESA 2SBAA 4IGOA 5FOJB 1JYXA 5C8CC 4BB3A 4CCEA 3K2OA 4MG2A 2QVSB 5HCBA 3V0AB 3KGZA 2W9XA 1UIKA 2CGOA 2VZTA 3LEKA 5D1IA 1E5RA 1KS4A 4IGPA 4AHYA 3VKMA 3VBUA 4R9BA 1Q8PA 1HRI2 5DAVA 4AAPA 1AX1A 3JB4C 4WZFA 1MR5A 2OIIA 1ULPA 1EYBA 3FHQA 1Z7S2 3LE0A 4IE4A 2WLPA 3USUB 3UV9A 1T6BX 3ES1A 3JB8A 2D6PA 3GXUA 3LWCA 4QX2A 3PJYA 2ARBA 1BBT1 1DYPA 3ENRA 4NIDA 4QKNA 4QB1A 4C90A 5JOZA 2Q30A 4XF4A 5G04L 2A3YA 1TME2 2VQ0A 1OBNA 1VIWB 4A3ZA 4NHXA 1ODNA 2GC3A 2PAEA 4QXHA 5F5AA 5F2SA 3LZZA 4DOUA 2GSYA 4BQ4A 5K9YA 1UY1A 4ARXA 3QBQA 3RZMA 1PVC3 3M3QA 2HWC2 1QJU2 4XFHA 4NWVA 2RM23 3CMGA 2F4PA 1GUIA 2W46A 4WVVA 3Q8FA 3EO6A 4XUTA 1RUOA 1XYNA 2RDNA 2XWJB 3ASIA 4UFKA 4EV0A 4QKFA 1DQ1A 3PL0A 2DCKA 4QHZA 1JUHA 1N3OA 3PURA 3ZFGC 4PLNA 1G9BA 2P37A 2YC4A 1HB1A 5FUIA 3BIWE 2WN3A 3ZLIA 2WS92 4JDMA 4PBOA 2GNTA 4XUPA 1TE1B 3ZIWA 4M01A 3I2FA 5IK8A 1H8TC 1IG0A 1UY4A 4YPJA 3BTXA 1J3QA 3KCCA 3RQ0A 4NHMA 4P9XA 1Y9QA 2A6XA 3VZJA 4LA3A 3D0SA 1UKGA 3OF1A 5DPNA 5KHJA 5LCWL 3PTYA 1GQPA 2OA2A 5GALA 3U75A 1NY72 2JDUA 2DVAA 1R1A3 2QDNA 3DPRB 2W1SA 2HWD3 2ZAHA 2FDJA 3IBMA 3WD5A 4AHXA 5FYIA 2QTWB 3GHNA 1DP0A 4QMAA 3A7QA 2XBO1 4COWA 3IKWA 1PZ7A 2ZHNA 2BOIA 2VE1A 3NV3A 5F5CA 2RS12 3CIHA 1VB4A 2BV4A 1GNYA 2HLEA 2WT2A 3A4UA 4RFT0 4NPRA 4CDUC 4DZGA 3WLUA 2DBNA 2Y6HA 1AX0A 2JDMA 4B1MA 2J1EA 1VBB2 2W39A 5AC91 1OFNA 3D4KA 4UT5A 3PUHA 4E2GA 3HWJA 1DG6A 5LASA 4K6BA 4UYBA 3OB8A 1W2TA 1PMJX 2XXZA 3BGAA 2PLV2 4YW1A 3AMNA 4XUQA 3FL7A 3JZVA 4K1ZA 3OY8B 4JV4A 3VBSB 1UYYA 4QX8A 2BZDA 4SLIA 2ADDA 4QDQA 4RYDA 3Q8AA 3S57A 3HD8B 4NUBA 4AVBA 5LEJA 1QJX3 1H8VA 4NIHA 4KG8A 1WMFA 5A33A 2XONA 5FZ9A 4FP3A 4CCMA 4FTSA 1EAH1 1U5ZA 2RDQA 5GZCA 4Q4W3 2VNRA 2XLFA 1AYM2 1G7YA 1QDOA 1SLAA 4RR3B 1GP5A 1LHNA 4RQPB 4LBLA 1SACA 2CY6A 2ZGPA 2QZ2A 3L2YA 3I3QA 5IAXA 1IGOA 3KVBA 2Q4SA 3OGJA 5FZ8A 2G1MA 3P3NA 3ZN5A 2DWRA 2ZA9A 2R043 1WCKA 3ELNA 1CIWA 2RG4A 4LE4A 4WM8A 4YWAA 4AFBA 1VBD1 4AG4A 2RS53 3DXTA 1HRI3 2QJVA 4Q0UA 1B09A 1ZA4A 5A7NA 2Z42A 3OSDA 2JDYA 1OPOA 3B5LB 5FZBA 2TUNA 5A3OA 3ZYHA 4HFSA 2BNNA 1YJLA 3LEIA 3ZFEC 1XE0A 3CL1A 2H6CA 3CLPA 1WW5A 3Q9OA 3I3MA 1UYZA 1VMJA 4UWDA 1Y7BA 3OGGA 4IXLA 1SLCA 1OD3A 4WVMB 3RVHA 4NRQA 3DKWA 5JI9A 2VGDA 4OHXA 1NA1A 4DRVA 3ZN6B 1WA4A 5BNPC 5A3PA 2E33A 3ACLA 2AACA 4J1WA 2ZOEB 3OEAA 5DG1A 3ATGA 3MEPA 5JSOA 2MPFA 2CTVA 1QJU3 4Q8KA 2Y33A 2W0XA 4LTAA 4ZONA 2YPDA 4XFCA 5LBEA 1D0HA 1YI7A 1W9FA 5FKBA 3VHOA 4NHKA 5F9TA 1WCSA 1U12A 3Q8CA 3IN9A 5J3UA 5JIAA 4UXAA 4CCDA 3H0OA 3FUQA 5AVAA 1KS5A 2DCZA 1R081 5JZGB 1KJRA 2WS93 4HL0A 1I9RA 1H6YA 1RUJ1 4HPKB 5A1LA 1WGPA 3AYAA 3WINE 5ABJA 1W6QB 3NNJA 5FZ3A 2F6BA 1CR7A 3E6BA 1UN1A 1H4GA 1WKYA 5CA6A 1NYWA 1URXA 2FBEA 1AL23 1XOYA 3K3OA 4B29A 5JWPA 1OXCA 2DURA 3PU3A 2PN5A 3WF1A 2HEYF 4MHUA 3AKPA 4YVWB 1QKQA 4LKEA 4YM3A 2GNMA 2DUQA 2WAOA 4HETA 2RV9A 1KFXL 5K4LA 4A44A 1W04A 5FZLA 4IEOA 1LOBA 2XBO2 5FYCA 2IFWA 1UZWA 1WW4A 4IV1B 2VZRA 1FNZA 2YUEA 1VBB3 3ABZA 4CDXA 3HN3A 4OHVA 5LBFA 3HNBM 3WX5A 1GQGA 2EALA 2NM1A 5C3PA 5JSRA 3KT1A 4CU7A 3B94A 2VECA 3OGSA 3UT0A 4QXCA 3A22A 2TEPA 2OUHA 4TYSA 1BZWA 5D21A 4JGYA 3WUCA 3AXDA 3MIDA 3IDBB 1GMMA 3IAQA 4CCNA 3U37A 2ZGOA 2QE3A 5JR2A 2XKPA 3SCGA 1ONAA 1GR3A 1WLTA 4ITCA 1JXNA 3I97A 1LOAA 3KV5A 3LAGA 3N4MA 4QQLA 1NLRA 3LCPA 1C57A 3J26N 4S2HA 5CEHA 4GWIA 4DO0A 1EAH2 1BHGA 4K20A 3UYJA 2VCAA 5DZEA 2DCJA 3W9AA 2FDKA 2R061 4LBNA 2DVDA 4Y20A 3VBRC 2XJTA 1RUD1 1ND2A 3LB9A 2VC9A 2ZEWA 4IEVA 1MPXA 1ULFA 1W28A 4MGKE 4H14A 2PELA 2J22A 4KU7A 1VBD2 1WZXA 1YQCA 3AMMA 4XBQA 4YLZA 3SCHA 2ZGKA 3T2OA 2RS32 1FT9A 2O14A 3PMSA 2WYFA 4Y22A 5BNNA 1DLCA 1PX3A 2GMMA 1TG7A 2ERFA 2HWF3 3HQRA 3ZYFA 4N43C 4LIVA 2JG8C 4CP9A 1DZQA 4NN0A 2VZSA 4UF0A 3FC0A 1PZ8A 1C1LA 3POFA 4XF9A 3USSA 5BNOC 5C9AC 3H8OA 4ZXKA 3ZYRA 3MFCA 5IK7A 1JZ2A 1OT5A 1S2EA 3CU7A 3KSCA 5CFCC 1UY3A 1VP6A 1GV9A 5J37A 4NPLA 5KC6A 3N35A 4MOAA 4MGYE 1KJLA 2F4LA 2BNMA 4QXBA 4OI1A 3ZFFB 5HBAA 1SHWB 4OMDA 4YGCA 3OTFA 1LENA 1DZTA 3N7LA 1US3A 4XJZA 5FP3A 2VW1A 2VNVA 4BK5A 2IVJA 2BRTA 4Y1UA 2YFUA 4PDWC 1S1AA 1HX6A 2GDFA 4GH4A 5E88A 1UY0A 1XRUA 4ATEA 5IVVA 2X5IB 3FUOA 3MW3A 3VBFA 3AP9A 2NP0A 2ENRA 2YY1A 1R082 5F3GA 2Q0AA 1S0EA 1EP0A 3GM8A 1LKNA 1RUJ2 5CFDA 3EB7A 3TN91 2PHFA 2XH6A 3VBHC 1JYIA 3HNMA 2Y6KA 5F6LB 3OBAA 1KD7A 5FKCA 3SITA 1RUC1 3KS7A 1AR91 3U4SA 5ACA2 3I2JA 2GZWA 3JBG1 2EF6A 4YG3A 2O8QA 3BIEA 2QNKA 2QDRA 5JAXA 5L7OA 2XWBB 3J8F1 3J7MA 5KHKA 1H8TA 3SEPA 5EPAA 1YFYA 1W9WA 4FQ4A 5KHIA 1XSQA 2FCTA 4HXCA 1VBE1 4LO4B 3RMXA 5HCHA 5K7PA 4MGIE 4D8MA 3E1F1 2OX0A 2OZ6A 3VN4A 3WW3A 1VMHA 1V6KA 5FP7A 4RL7A 4QGNA 2EIDA 4M3CA 5CNAA 3NAPA 3VD3A 4AEKA 4E8CA 4I01A 5EJ1B 2VG9A 1RUG2 3SXWA 2CWSA 1DDLA 2HEVF 5J96B 3DECA 4FSJA 1YXWA 2BGPA 4PJYA 5I0UA 1HV1A 2Q1MA 3MLLA 2VL4A 1XE7A 3TB0A 5LK7B 3TNQA 4CDUA 5IFTA 3VHNA 3N9LA 4KNCA 3U07A 2Q1FA 5FMCA 5GM0A 5T3NA 3NSTA 2XQRA 4ISRA 3S5AA 1CPNA 3JQWA 4XDPA 5C5TA 1GYKA 5K8SA 2E6VA 3MIHA 4Y24A 3FX3A 1QF3A 4UW3A 3D6EA 2WBKA 4H7MA 3VDCA 1UO9A 1QJZA 2PA7A 3M70A 2K0GA 2FCUA 4LBQD 2QZ3A 4XTMA 2RDSA 3VBUC 1Z78A 4NR1A 1PX4A 3E5XA 4NHLA 1F9KA 2R062 4CVUA 4C0HA 1WCDJ 2ZPXA 2X29A 3MV01 1VBD3 3ITQA 4N9IA 5AVPA 3UKNA 5A6QA 1E5HA 1RUD2 4KWJA 2RS33 3ZMOA 1CAXA 5JI7A 5LATA 3SH5A 4QQOA 3UL2A 1GZTA 4N7IA 1JBCA 4XQWA 2XQXA 4ET7A 2BPA2 4IGQA 2JXAA 5IVBA 5FUNA 4DUWA 5FZGA 4FAGA 2VBDA 1YO8A 1W9TA 2DUPA 1ZBA3 4Y5Z0 1UIJA 3NL1A 1VAMA 1KDKA 1ZM1A 3D5OA 3VHRA 2Y64A 4KQ7A 3KF3A 5CISA 5CFCB 3WVJA 4AVCA 5JXJA 3KQRA 1UU6A 5FZHA 1H30A 1LU1A 4AFCA 1KXGA 2Z4FA 4WM7A 2O1QA 5JSPA 3U78A 1CJPA 2Y0OA 2VQUA 3KMHA 3LDKA 1V0AA 3APBA 4GB32 3LFMA 3FFQA 1UYPA 4XE9A 2JDKA 3KCYA 5DZFA 3T08A 1HLCA 1KGYA 5IVFA 1PVC1 3TWIA 5J1XA 3OPTA 3NJYA 2CGNA 4LMFA 4MX3A 2FDHA 4RN5A 4GXLA 2DF7A 1UKRA 1VLNA 5FYSA 4MXVA 1AHSA 4NIAA 3ZSLA 4AGRA 3WZ1A 5F37A 3LDBA 3SISA 5A7PA 1X9PA 3MFAA 1SLBA 4RHV3 2QQNA 5F3IA 5FJKA 3TEYA 5LRRA 2FD8A 4EZHA 2PHLA 3R6SA 1AR82 4K9SA 3S7IA 1F5FA 1YHFA 1SEFA 4LHSA 4LJHA 1H1MA 1E5IA 1CX4A 1R083 4UI9L 3ZXJA 4CA9A 2JDHA 4M0NA 5FYBA 5SV8A 1WUVA 1JTZX 2P17A 2B8MA 1R093 4RS5C 4WVWA 4CCLA 1KDMA 1JS9A 4E8DA 4GULA 3POWA 1R1ZA 5A32B 4UFJA 5ACA3 3N9PA 4FPLA 3TN92 1VB2A 1UMZA 1DGRN 1OOPC 5EQUA 4N53B 4KWLA 1PM7A 4XVHA 1PK6C 1RUC2 5A3NA 3WDYA 1AR92 3MUY1 5FZEA 3JBG2 3V0BA 4JQRA 3VZOA 2ZEXA 3LIGA 1DU3D 2XVGA 2RJLA 1HQWA 3SEEA 2JICA 2XL9A 4CXXA 2D6LX 5GZGA 2HWD1 2LM3A 2SLIA 5FO9B 3UGFA 4BLJA 2ZGLA 1VBE2 1IS5A 4DY5A 3QH7A 2ZXQA 3EHKA 5JMOA 4QPIB 2VVDA 4BOWA 2WNUB 3GF6A 4ZXEA 1RUG3 1S0BA 1ZNPA 4JKLA 3BN6A 1WCQA 2NMNA 3WOGA 2Q8OA 2WT0A 4UFIA 5E89A 4XIKA 1S0JA 3C7HA 3MZHA 1Y3TA 4A4AA 4QD2A 2LW8A 1UYXA 5A80A 4CEWA 4W6WA 3E97A 2ZGNA 3WHUA 1ZA7A 2JJ6A 2VOKA 4TLGA 4XFIA 2CV6A 3SH3A 4JTNA 4LO6B 4N90A 4AAXA 2XDVA 4JHZA 1PMHX 4XCBA 4P14A 1W8OA 3UKVA 3H1YA 1W0PA 4I02A 4K3UA 2PHRA 4QAWA 1S2KA 3A0NA 1S0CA 2ATFA 4DIQA 1QJX1 4RA0A 2Y60A 2VUJA 2VW2A 1DHKB 2A7AA 4XF0A 4YW3A 4WM8C 3C7GA 5FK8A 3K75B 2R6QA 4K8FA 2YGMA 3KVAA 2OKXA 5L9VA 1YIFA 1TMF2 3ZDVA 1O4ZA 2EXHA 4BYYA 5A3LA 5GLUA 3CNAA 2WO3A 3IIAA 5GKAC 2R041 3RZHA 1O8SA 1BXHA 4YYOA 3C7EA 4JX0A 5JPNB 3VD4A 5DMYA 4LNVA 2RS51 3I54A 1LOGA 4D6SA 4XMAA 2FDGA 1HRI1 2D6NA 1IG3A 4MXWA 1VBC3 3URFA 4CSWA 4LHLA 3AL6A 3B7MA 4LE3A 1L3JA 1MQTB 4H2AA 1NA1C 4QDSA 3VBRA 4IERA 2C9AA 4B4QA 4BE3A 1IS6A 1JI6A 1E57A 1YCIA 3NNLA 5FZOA 4P9YA 3PJQA 2G9FA 2OYZA 5CG9A 3ZSKA 1L7QA 1HDKA 4LO8A 4R4XA 3POIA 2CDPA 1ODMA 3ACIA 4N43A 2JG8A 4LLFA 3BTYA 4GWNA 4INDA 1H2KA 4GB33 4I0AA 3HN1A 3H42B 4BHPA 1MS9A 4XJAA 5FXWA 2OS2A 4QB2A 3T30A 5C9AA 2KD7A 1IZ3A 3WP5A 1NOVA 5T54A 2ZBJA 3ZXEA 1PVC2 5DUVA 3U14A 5K0UC 3HPNA 2EA7A 4F7ZA 1OKOA 3P3PA 5T50A 3MV11 1AR83 5CKNA 3HAGA 4UFLA 5LA0A 2YGLA 1GWKA 1W6NA 2BVVA 5DAPA 3WQ0A 2BEOA 5FZDA 5BUVA 3AKRA 4AVVA 2LUWA 2Y6GA 4HZFA 4BQ2A 1WCUA 2BDRA 2VUDA 1OVPA 1B35A 4HN0A 5IYYA 4WBBA 5DXDA 3VZLA 2VVEA 3MLJA 1SMVA 1RUC3 3ORJA 4FXGB 1YQ6A 3MPBA 4FPHA 2K9ZA 3BU0A 4O9GA 1AL21 1LHOA 1S0DA 3I4IA 4CDXB 4ZZ8A 1CPMA 4YW6A 3LQCA 2P2KA 2VCBA 1XU1A 3KWVA 1NY71 5I0SA 4KU8A 1RB8G 3VBHA 2BNOA 5ISLA 4CEYB 4K7JA 2DUOA 3MF9A 4NMIA 5IFPA 1N1VA 3IMMA 4HSLA 2HWD2 3SMHA 2WDBA 5FZ4A 5C3SA 3KZ4C 2BU9A 2ZJCA 3QD6A 3DV8A 2VOXA 3B3QE 2D98A 2GC2A 2D6MA 3AZYA 3RJRA 4HKLA 4U36A 1CQ9A 4HK8A 4HLTA 4HVOA 1W8FA 1W8NA 4BXSV 3NRUA 4JGYC 3AXEA 3V64A 3T2QA 3WQBA 1JZ4A 3E6CC 1M06G 4AW7A 2F17A 2RDRA 2WAAA 1JOPA 4B4RA 4GJYA 2X05A 4EE2A 1IHMA 2VCCA 1HB4A 1GP4A 1UMIA 5T5PA 1QMJA 1XNBA 3MBWA 5FYTA 3RYPA 2CDOA 3GBFA 4WM8B 5FLHA 5T55A 4YZ3A 2I74A 2JDPA 1D0GA 3MGUA 3ZPOA 1ZZ7A 1PNFA 5FR3A 5HPOA 5L9BA 1O3SA 5FPZA 1ND2C 2PFWA 1TMF3 3RGBA 5FQ0B 3C2UA 3FLRA 2IUWA 4QQ2A 1G86A 1LHWA 2HYXA 2OXBA 1CZSA 2YFZA 3ILNA 4ARYA 2XJQA 2RHPA 2XHKA 4MGQA 4EWAA 4XBNA 5BNNC 5L9RA 4KL1A 1QJY3 4LULA 1BK1A 2R042 1UZVA 2JB8A 2IXIA 3POBA 4YZ1A 4HT1T 2AYHA 4L11A 3WP4A 2RS52 2ZCWA 3GGLA 2YDEA 4BIOA 1JYVA 5CG8A 3DYMA 4IL7A 4DXZA 2BTVC 2HWF1 2O8OA 1V6LA 4YM2A 1OUSA 1V6JA 1UZYA 2UYAA 2DCTA 2KR2A 3WF0A 5EYYA 1IPJA 2YV8A 2EAAA 1ENQA 1UQXA 1X7NA 4YM0A 4OULA 3WW1A 3WG3A 4OFGA 4DY3A 1XNAA 2B46X 2ORXA 2ARAA 5GJ6A 1W3VA 3RI9A 5A7WA 1RJ8A 4GZ9A 5ABJB 4GH4C 4OYUA 1NX9A 3PVEA 1T6GC 4OUMA 5E1RA 1SQ4A 3VBFC 4CZSA 5C8WA 4XFFA 5EJZB 1UD1A 1F15A 5CFDC 2QQVA 1QJEA 2VZQA 2WA3A 4A7KA 1Q56A 1YEWA 1QXPA 2YBSA 4JDOA 4DRRA 3ZXKA 5J36A 4FFHA 3DF0A 3WXPA 2WZ8A 1MS8A 2NZ9A 2VMEA 5L7OC 4QX0A 4GKYA 3UJQA 4C1WA 3ILFA 2P4EA 4GWJA 5IHRA 4I3GA 5DAXA 2WC2A 1L7LA 2ZGRA 2WO7A 1LNSA 2WFF2 1ND3B 1VJ2A 1OLMA 2V4AA 3JD73 4CP2A 1BCXA 4IUGA 1CAVA 5LY1A 2BGOA 1W6MA 4Q4Y1 4RS5A 1SBDA 3HOBA 3TAYA 1AL22 5HI0A 3M3OA 4QDRA 3NAPC 4AI2A 3U0ZA 1H1AA 4LBQA 2W95A 4IEYA 5DUXA 3OPZA 3WF4A 3UKTA 1PO11 1OOPA 2D6KA 2VR4A 3I3EA 1POV3 2A75A 1PK6A 2PTMA 5LRSA 2GP5A 2VNGA 5F8PA 1OH4A 2B39A 4EN0A 1UNBA 4XXAA 3FBYA 2X09A 3NVCA 1U5YA 1WMEA 1O3TA 2QQLA 5A3MA 2PHXA 1UZ0A 1W2AX 2C5DA 1LGCA 5KC5A 1YFWA 1CVNA 1FXZA 2VOWA 5E8AA 2EXJA 3LIHA 4TXWA 3U11A 4V1PA 1CX1A 5FY8A 2DDUA 3I59A 4BMBA 3L2HA 1NCQA 3N3HA 4XUNA 1Y9MA 2W47A 2JX9A 3ME2A 3IDCB 4X6QB 4FXKB 4XQ4A 1CAUB 4N9HA 3FHIB 4OI4A 4CU8A 4F3JA 5KXCA 4Q5OA 4Z1VA 5T5JA 4BWOA 1NAEA 4F8AA 2Q8CA 2ZGSA 2BW8A 4Y20B 1SG3A 3MIBA 1O4YA 4XFBA 1X33A 2DBIA 3JU9A 4GKXA 2VZPA 4HSJA 5D2AA 2AH2A 5F39A 4HKWA 4KG0A 5JDBA 4FO9A 5FZKA 1S0GA 1QQP2 2WWUA 5C8CB 4XF1A 1RUNA 3ZXGA 3GZEA 3DYPA 4GJZA 4YZ2A 4S2GA 2QQJA 4E4HA 2ZHLA 2UWAA 2UURA 4GMP3 4H55A 5LB6A 4B4PA 4AEJA 4KGGA 1IS4A 4G9SB 5C4WC 1ALYA 2XL7A 1OKQA 3KV6A 3LA7A 4PI2A 2IWGB 4Q26A 3ECQA 3NJVA 2ARCA 2RS31 5A70A 1YLLA 1MZEA 2B45X 1ULEA 2MEV2 4FPKA 2JE8A 3RS6A 2H6BA 3B93A 1H2NA 4XHXA 5FZMA 3FLPA 5FZAA 1BKZA 3G7DA 1DGWX 5KXEA 2ZABA 4WM7C 3AX4A 1ZBA1 2HWF2 1UOFA 4M4PA 3WQ7A 4UW5A 5KHHA 5E16A 5CIRA 3ZXDA 1QIQA 1DYKA 1RUF3 2Q5TA 1X82A 2VQTA 3NV1A 3R4UA 4FOYA 4ISQA 4YW4A 5C6CA 1CWPA 1VALA 1V70A 4OI2A 3DGTA 4QPGA 3TRSB 1H2LA 3PUIA 4LORA 1C5IA 1XC6A 1CIYA 1F4AA 1XB9A 2PQSA 2DTYA 4LKDA 2ZZQA 4XW3A 4QM8A 4AEDA 4R9AA 3TEXA 1QXRA 4B7EA 2WNVC 1RINA 2ZEYA 3LGRA 5G05L 1OLRA 3WEZA 1CZVA 2WINB 3AMHA 2WL1A 3ZFGB 1OQDA 3K51A 3FBMA 4QGLA 3OBRA 3KF5A 1KQRA 2WQ8A 4FOVA 4P5YA 4RHV1 2DU1A 3FHAA 4XURA 1PMIA 1YQ5A 5EV7A 3IDAA 1A34A 3JCIA 1GNHA 1FMD1 3MUZ1 5L7OB 2J1RA 4BMEA 2TBVA 4QQHA 1H8TB 5F1RA 5K0UA 3ZXAC 1QOOA 3FLTA 3ZXLA 5FZ7A 1R091 3P6BA 2CNAA 3HBKA 3USUA 2BYVE 3DXUA 3KD4A 2WFF3 2YC2A 2C4XA 2P3KA 4X8NA 5ACA1 3RZKA 4HG6B 2W87A 3B02A 3RG0A 4I2OA 2JDNA 4IE7A 4M3CB 1AXKA 4FPJA 3H8XA 2JEMA 4UOJA 2WFPA 2VCMA 2G9GA 2CGPA 4AI1A 3O12A 1C4RA 3RWNA 4BU2A 1EY2A 3H3LA 2R16A 3R4DB 4Q4Y2 1RHI3 3T0BA 1FPN3 2JECA 1ZRCA 4P9JA 2CWMA 2VU9A 3AYDA 2P34A 1DZRA 4AE2A 1MVQA 2WO2A 1F8VA 2YBKA 3POJA 5FPBA 1PO12 4X6RB 1O6UA 5FZ1A 3VZKA 4CDUB 1FATA 4CEWC 4P9GA 1RUG1 2Y34A 3LA3A 1OSGA 2FHRA 4Q27A 4AXOA 3BALA 3H9AA 3D3AA 1XBFA 1DQ4A 4E2QA 4ZU4A 4D0QA 4W6XA 3H1MA 2PMWB 2I45A 3O1RA 3AMQA 2AREA 2LS6A 4LK7A 3VZMA 5T5OA 2JKBA 3AZVA 4D3WA 4CU6A 5JOYA 1ULGA 1U0AA 1Q3EA 4OZXA 3WDWA 5FWJA 1N1SA 1LJ7A 5BV6A 1MS5A 3W20A 5FUPA 1MVEA 1H9WA 4M3CE 4MHRA 4NAOA 4NRPA 5FMOL 4DS0A 1QDCA 1STMA 1PO23 1HKDA 4PIZA 1CAWA 1JYCA 4JVAA 4A6SA 3WF2A 4URAA 2Y6FA 4E9KA 3K48A 4IE0A 3AMPA 1J1LA 3NWKA 4HONA 1QQP3 4QU2A 3VBOC 1LHVA 1COV2 2WSUA 4JGZC 4QKBA 1DQ0A 4EQVA 1N1YA 1Q8QA 3DPRA 4KMQA 4Q4X2 1UMHA 2V72A 3WNLA 4Q4V2 1TNFA 1TQ5A 1XYOA 1W05A 3KT4A 3OYWB 4ES8A 3JQXA 1PGW2 2JG9A 5FY7A 4YGEA 5EJ3A 1GWLA 2D5FA 3J4UH 4AEMA 2EAKA 3GBGA 3GZUC 4L0PA 2Y26A 2VMDA 4OUEA 3AKTA 2XKOA 4O65A 4QU1A 2MEV3 3IAPA 1RVF1 2XHNA 3M3CA 4QT6A 4A45A 3ZFEB 1VBC1 2E32A 3LF7A 3ZDSA 4MGTA 3WHTA 4AI3A 1DGLA 2A6WA 4LUMA 4GQ7A 4FPFA 1LAJA 4FT8A 3VZNA 3AP7A 1IOAA 2WKKA 3D8CA 4FFGA 5APAA 5BNPB 1ZBA2 4LXLA 1RUE1 1OC1A 3W59A 4UAPA 1XQNA 1LTEA 3DL3A 2X10A 1JYTA 2GP3A 3LPGA 4YW5A 2HKXA 1OF4A 4FFFA 3WG2A 2HH9A 1AF9A 1OF3A 4GB31 3BVCA 2DVFA 1LOCA 4XYXA 4EN9B 3PUSA 3VGIA 1PGSA 1V00A 3RZZA 1PIV1 3VDBA 1WBFA 1I3HA 3HVDA 2PAMA 3N9NA 3ZR6A 3HQUA 4FP2A 1YJKA 1DQ6A 3GNEA 1NXMA 1C8M3 2B5HA 3KHCA 1AR81 2RJ2A 2HBUA 1B35C 5F32A 3W58A 4RHV2 4NWWA 2QQUA 3V0BB 4COUA 1UX7A 1FMD2 2IXJA 4IE5A 4LUKA 5KR7A 2BOJA 4QWNA 4HANA 2XB6C 4DXTA 1K5MC 1R092 2LRPA 3DKQA 2BBVA 4AF9A 2GMPA 1ULCA 3O1UA 5C3QA 3IT8A 2EXKA 5LW9A 3ETQA 2KXLA 4K1YA 4W8JA 2EVXA 2BQPA 4Q4Y3 2VBPA 3RJ2X 5C71A 5CU1A 1LGBA 5A7QA 5B4XA 2C0ZA 1GP6A 2GH8A 4WZCA 4XILA 1PO13 4MUVA 5FXVA 2KM2A 2D6OX 2NLRA 2OPKA 1DGWA 4IV3C 5KXDA 2CU5A 1YFUA 3ZXFA 4COYA 2OZJA 4Z92B 1F5JA 4MZUA 3SC7X 3MW2A 1G6NA 1HQLA 1QNWA 4ASLA 3PDQA 3VL9A 4BXFA 3ILRA 3ZYJB 3EXUA 1E5SA 1J83A 2AC1A 3GBWA 3O14A 1FX5A 3M3IA 4EROA 3UGGA 4P02B 2VMCA 1LODA 3IZOA 4B1LA 4EWEA 5B4NA 3I49A 2WWJA 1BJQA 3NQHA 4PLOA 4AOCA 4HPKA 1S0FA 1VAKA 3OD4A 1GANA 1W6QA 2J42A 2A71A 3AKQA 1UAIA 5IJRA 1F35A 4AYUA 4LITA 5TSWA 2JB4A 3M2MA 1J84A 1UX6A 3BTAA 1ULDA 2I2SA 1RITA 4I3PA 5FZFA 1COV3 2GC1A 3I7DA 5I0DA 3VLBB 3OPWA 3MW4A 4Q4X3 3AL5A 1TMF1 4Q4V3 1UL9A 1D2SA 3VBRB 1LULA 2Y0IA 4Q1PA 5FY4A 2CAUA 3ST7A 3T0AA 3SKJE 4XZUG 1A3KA 2IZWA 4FVVA 5FZOB 3VDDC 2MHFA 2WSVA 4XACA 5H9RA 1QJY1 4IV1A 4PI0A 4DMIA 3THPA 4V2WA 4GWMA 5CAZA 2D3RA 1D2QA 4M4RA 1BVP1 4N43B 3WP6A 1RVF2 2JG8B 5CADA 3B01A 5GLTA 2AUYA 1VBC2 5FZIA 1CD3G 4FTBA 5BNOB 3BCWA 5C9AB 4PHZA 2CAVA 1GOHA 3O0WA 1RIRA 4YSFA 5A7OA 4HK9A 1GZCA 3F2ZA 2YZ4A 3C8XA 1OA4A 1RUE2 4JTOA 4A6OA 1JUIA 2DTWA 3CJXA 4GA9A 4Q0PA 5FZ0A 2VVFA 4JAAA 5FXXA 4YM1A 5A3WA 1W6NB 2XGXA 4NPMA 1H4HA 2DFBA 5IWFA 1X36A 2P1BA 3UETA 2IFRA 1W6OB 4E4SA 4OQ8A 2VUCA 1HN0A 1YWKA 2XJPA 1PIV2 1VRH3 4PDWB 4QGMA 1J58A 2D7FA 2W1QA 3INAA 3P1IA 1VRBA 1IPKA 2PAKA 4AQTA 3WNMA 5HXVA 4BM8A 4CUAA 3E6DA 4MSVA 4XAEA 1OH3A 4H3WA 3IWZA 1FMD3 4XPVA 3HT1A 2GU9A 2WNVA 4L97A 2W52A 4BQ5A 1UWWA 4HMZA 3VBHB 5GLZA 2V5YA 2IVIB 4QPWA 1W8HA 3ACFA 3AP4A 4HVRA 2B9UA 5LWBA 3O1OA 1JHNA 1ZYBA 1JZ5A 1OURA 3JD71 4FPGA 1UZZA 3ZSJA 2RJKA 4CUCA 2HWE1 2JE9A 5IT6A 1JZ3A 4EN7B 5HXMA 1JYNA 5IATA 1PZ9A 5I0TA 4ZZ5A 3FN9A 5I8YA 2JE7A 3SNMA 1MEC2 2PHDA 4AGVA 5IVJA 3TBDA 2QQPA 3ZO0B 1W90A 3MICA 5T52A 4YFZA 5FMOS 3EQEA 3AP6A 3RFRA 4JZRA 5LZ6A 1POV1 2E63A 3PVNA 5BY5A 3CJIC 1K42A 1GFF2 1JYWA 3VV1A 1I5ZA 1TVGA 1U5IA 2ES3A 2VMFA 1NCQC 4FPEA 1BEV3 5DG2A 3SH4A 5F6KA 4IW3A 4XJUA 1JMUB 4AVAA 2RMU3 5FDBA 1GZ9A 4FOWA 1UY2A 2P3IA 3ZOIA 1NUKA 2ZX2A 4CXYA 4QHOA 3WNKA 2HJIA 5A7SA 1ZBE1 3H3ZA 2W68A 4DXRA 2BFUL 5KWRA 2QFEA 1W2UA 4PBPA 4CUGA 2FMYA 5HCAA 2VZVA 2WNEA 5LY2A 2LALA 1SFYA 4LHNA 5BXXA 3FZ3A 4LKFA 3MPPG 4CDQA 2ZX1A 3POGA 4NOTA 5FZ6A 3WCRA 1SBEA 1UCXA 3NJZA 1NCRA 5H9QA 5JVVA 4CPBD 1GBGA 2OPWA 3AZWA 5EP9A 4Q1RA 3V65A 2W1UA 4JKKA 3ZYIB 5C4WA 1DGRA 3VBUB 4AI8A 1DQ2A 1XJAA 5IVEA 2OT7A 2A70A 3ZM8A 2NYYA 3H8RA 1EV13 3IDEA 1OQEA 1SCSA 3PVBB 2VXRA 3A23A 4GMP1 3VBOA 3S0MA 1UW8A 3BI3A 3MYXA 5FPLA 2C6SA 4JGZA 1DCSA 4LR4A 4PIYA 3WDVA 4B7KA 1POV0 1QJY2 1ENSA 1HJGA 1Q43A 1RVF3 3M8LA 4XFGA 4IEZA 3KGLA 5GZDA 1W8WA 5D8AC 5T5LA 1VBA3 3ZYGA 4CDWC 2VW0A 4ES9A 1GKBA 2AENA 4QPGC 1XPWA 3V56A 2RE9A 3CZUA 2LTNA 2VOVA 4YVSC 5C5UA 3EBRA 1W9SA 2WN2A 3K46A 2EIBA 5FYVA 1RUF1 3VKNA 1RUE3 1OD5A 2VTXA 3ZIXA 5J09A 4AEDC 4JC1A 3S7EA 3OBZA 1OFSA 1AYN2 3LOBA 4UBGA 3ES4A 1O3RA 2WQ4A 3LDRA 1O7FA 3AB0A 3PUQA 5FMDA 1PIV3 5C3OA 4YFWA 4ZHNA 2IXLA 5HV0A 3DUIA 3FJSA 2VBBA 5FFOC 3TYJA 4AZZA 4JQTA 3WG1A 3RYKA 2R30A 2VY0A 5I8TA 3IMNA 2E7QA 2VMGA 4O7XA 1NE6A 2XPJA 4RS5B 1W6MB 4KI5M 4M3CF 2BUKA 3WY6A 1Q5OA 4LIUA 5CZKA 1V6NA 4GMP0 1AR63 4RSUA 4COZA 3F95A 2R1BA 1NKGA 4JCKA 1QOTA 1C1FA 1OOPB 3OGVA 1ZZ8A 1XNDA 2WFF1 1PK6B 4AQSA 3AZXA 5FO8B 3BUCA 5BYNA 2FZ2A 3ZR5A 4QX7A 3PVOA 2X8KA 3AKSA 1MEC3 2IXHA 1DF0A 3JD72 4R9CA 2HWE2 2HWB2 2VPVA 1K5MA 2DCYA 2D97A 4LO5B 4EZ4A 4OHWA 3CZJA 1FOD3 1RHI1 1FPN1 1JH5A 2J1VA 5I8SA 1HRV1 5H9PA 4Q29A 2C26A 1PNGA 2N7GA 4NO4A 3I59B 4QXKA 1HIXA 3LSEA 4W65A 2ET1A 3U4XA 1W9YA 1MZ6A 4XTPA 3TEZA 3VDAA 1WLCA 3LPFA 2GAUA 2HEWF 3TOJA 1GWMA 1J3RA 2QQMA 4HKOA 1ULOA 4I0BA 5FY9A 4XAAA 4MH0E 1H9PA 3OUHA 1N1TA 4IV3A 3AFKA 4JDNA 4F83A 3I2OA 3CKHA 2E53A 5A33B 1GOGA 4QX1A 1ACCA 5JXIA 1ZBE2 4D7YA 1JN2P 1S55A 3AK0A 3WUDA 2E9QA 2O0OA 4FI9A 1Y43B 1BLZA 1LECA 4XF3A 5FYYA 4P08A 5FP8A 1V6OA 4DB5A 1A8DA 1ZRDA 3DPRC 3N9OA 4LLOA 5BNQA 1PO21 1TEIA 1W0OA 3KB5A 4ZU7A 1CZTA 2R073 1GNZA 1XNTA 3AC0A 5FLJA 2DV9A 3ZSEA 3SLIA 3GYDA 1REFA 4Q8LA 2JG9C 2RR13 3ZMNA 1H6XA 1QQP1 4AGGA 5C7GA 2QQWA 1HV0A 3QCWA 4QQPA 1QHDA 4RGKA 1AJKA 2Y6JA 2NQYA 4QM9A 4DINB 5FJHA 2G19A 3RPQA 2Z69A 5FXZA 5GLWA 1O91A 3H8UA 4QPIA 1NZIA 2WNUA 5A6XA 4LT5A 4OZOA 3SKVA 3LFIA 5HV4A 3EYPA 2NMOA 4XOGA 3OBTA 4LKSA 4ZS2A 2MEV1 1QGLA 4PT6A 1MS0A 4A7YA 4LA2A 1NA1B 1W2OA 2A1XA 5L19A 3VBSC 1OVSA 2BWAA 4UW4A 3VDDA 3OEBA 2D40A 4A42A 1YFXA 3HT2A 5J98B 4PQQA 4FFIA 1HQNA 1NE4A 5GZEA 1UU4A 1S4CA 3O7OA 3Q8BA 4NVPA 1QEXA 2YC0A 1AR71 3Q8EA 3M3EA 3O1MA 4RR3C 1AYN3 1VR3A 3SHRA 1RUF2 2Y6LA 4RQPC 4S2FA 1G9AA 1N3QA 1PGL1 3KV9A 1ZZ6A 4M0HA 2UWCA 5DUUA 4EN6B 1W8ZA 1W6PA 4IDZA 3UESA 4AI0A 2FDFA 4ZKTB 1W3XA 3THCA 4MYEA 4OHYA 3AJZA 3KT7A 5K0UB 1F31A 3K4ZA 4KWKA 3LD8A 1JOJA 2GC0A 1SPPA 1RXGA 5I0RA 1BK0A 4BH9A 2XVKA 2IXCA 3FMGA 1HXS3 3KHBA 4P9LA 4QKDA 1C8M1 4JKMA 5IUQA 3O5SA 3C7OA 1LOEA 4Y33A 3W21A 3MF6A 3T2TA 4FCAA 3POSA 2WZR2 1BVVA 5EFUA 3TEWA 3OG2A 1RL3A 3IPVA 3CO2A 4YG6A 3POEA 3T4VA 2E26A 1MQTA 1UXZA 1YRZA 3RMYA 2D43A 4DUVA 5DAQA 1IKPA 4XMIA 4LO7A 5LA9A 1NT0A 1W0NA 4Q0SA 5DDJ2 4XIOA 3R0RA 5A6ZA 2BFUS 2HWE3 2HWB3 5FYMA 1K3IA 5LA1A 4PF5A 3VD5A 3HJRA 3U10A 1QH6A 3RZJA 3MIEA 5FREA 4YGDA 3LOIA 1MZ5A 3WV6A 1V9U1 4FBFA 1RHI2 3CHXA 1FPN2 3RYRA 4N8MA 3IIIA 1HRV2 1YNAA 2XLAA 2VOTA 1LOFA 2VD7A 4COVA 1SZBA 4BPZA 3FWEA 5JZGC 1SFPA 2V5DA 1W39A 1RMU3 2PHTA 3I2IA 4JGYB 3ROUA 4AHZA 3H1WA 2G9ZA 1G9FA 1P8JA 1ASJ1 1POQA 1DBNA 2XJVA 3C7FA 4DPNA 3VL8A 1CAWB 2D3SA 3CJIA 1LR5A 1XXNA 3NMBA 1ZBE3 1RTVA 4XJ9A 3HMYA 1AZDA 4PQ9A 2GALA 2VZ3A 1UXXX 2L9LA 2D5HA 3DN7A 2B9VA 1RUI1 4OI0A 4KBZA 4YVWC 2BP6A 2JG9B 4MLOA 1MS1A 3PMEA 1HJFA 1V6MA 1BMV1 3KQ4B 2AEZA 3HNYM 1YC61 4Y5TA 1C28A 1ND2B 2CHHA 4TN7A 4Q2FA 1Z0HA 1PO22 2YB7A 2PXJA 1COV1 2BGCA 2XUEA 1ST8A 4HOOA 2GMEA 4NIIA 3FE5A 4IEUA 4ASKA 2WUHA 2WT1A 4Q4X1 3ZN4A 5GZFA 1EPZA 3I2DA 4IV1C 3UK9A 4CEYA 4LBJA 5FY5A 4Q4V1 1I1EA 4Y22B 4ZS3A 2YXSA 1OA2A 5BNNB 1A8MA 2E7TA 1NQDA 1PGW1 3GJBA 4FAHA 5JOWA 1O5UA 1ZZ9A 5DUWA 4J25A 4IEPA 5FIXA 3RDIA 4CP9B 3OD0A 4URTA 4UF0B 4X8PA 1YI9A 2QBXA 2VM9A
chains in the Genus database with same CATH topology
1I6XA 1WBLA 2JENA 1AX2A 3O0XA 2A6VA 1GZWA 1KFUL 4KH9A 4MV2A 5IK4A 5FLIA 3FFZA 2XJSA 4IEWA 2D44A 1DIWA 2A3WA 3LKJA 3RRDA 4I09A 3HQXA 2WIIB 2I07B 1PVXA 4YG0A 5D8AA 1AR72 4I30A 4CDWA 3SCFA 1PGL2 4H7LA 4GH4B 4YVSA 2XLGA 2ZX3A 3X29B 3QACA 2R0FA 3R05A 3VBFB 5FQ0A 2A5ZA 1Z7S3 5CFDB 2Q1ZB 1VRH1 1PHMA 4IQPA 2EXIA 2YPJA 2ZGUA 5J7MA 3GZTB 4L2NA 4RD7A 3HIFA 3NV4A 4OUSA 5FBZA 2WZR3 1C8M2 2ZS6B 3V0AA 1BBT2 1TME3 2V73A 1Q8OA 2FMDA 4G3YC 3KLSA 4Q0VA 2A73B 1F2NA 3AFGA 5FCCA 1GQHA 2HWC3 3OCPA 1OA3A 5DDJ3 1QNYA 3BPZA 2OVUA 2CYFA 4U2AA 1XE8A 3NAPB 4Y1ZA 5CB7A 4LHKA 4O9EA 1LEDA 3RSJA 4TWTA 2XUMA 3ZFFC 5FRAA 5JLVA 1RUH1 1OMIA 1FV2A 3VUOA 3PNAA 4MVTA 1UF2C 1AL0G 1HRV3 1V9U2 3H50A 3NO8A 4C1XA 1WD4A 3GZAA 1XU2A 2X5IC 4Y26A 4J6GA 2ETEA 1BEV1 5GLVA 2RMU1 4Z82A 2MNGA 3G6JB 4YW2A 4LBOA 1ASJ2 2PHWA 2VMHA 4CDQC 1S2BA 2JD4A 1IS3A 1LGNA 1N47A 1RJ7A 4Z07A 1NCRC 1D4M1 1Q8SA 4AHWA 1U5XA 2RS13 2ZX4A 4SBVA 2E7AA 5AFBA 5C4WC 4AFAA 1ND3A 1RUI2 2QUOA 4OHZA 4AFMA 2YROA 1NLSA 2EIGA 3N36A 2ARXA 1BMV2 4QHBA 3WG4A 2XJUA 1CAXB 3WQ1A 3KM5A 4L99A 4XDQA 2TNFA 3PHMA 1UU5A 4CP0A 1WMDA 5AC92 4K40A 3J9SA 2PLV3 2ZHKA 3N7MA 3EJKA 1EV11 3NKTA 1AVBA 1SDWA 4XFAA 3T1LA 4BIFA 3ZSMA 2WWSA 3CEWA 4P9IA 3O0VA 4R8HA 4FQZA 4WM7B 1TNRA 2UY8A 2A3XA 4AQ2A 1VBA1 1AYM3 3WW4A 1OPMA 2WZPP 3BOPA 1CAUA 4E27A 1AR73 3OY8A 3UJOA 3VBSA 1YYNA 4DQAA 2DVGA 2ZMLA 2ILMA 5I91A 4YZ4A 1CGPA 2WNVB 1UPIA 4PIXA 4XEZA 2VH9A 4RR3A 3C3VA 4D94A 1REDA 5C8CA 3LA2A 4RQPA 2P3JA 4DFSA 5EWSA 3T1MA 4EWDA 4MGZE 1VRH2 1BBT3 3POYA 4ONUA 5J48A 2VQAA 4YARA 4E4ZA 2ZTNA 4LBMA 4Q0QA 1APNA 3RNSA 1MZFA 2ZMKA 1AR61 5SV5A 3ZYPA 3WW2A 1H1IA 2XJRA 3D0JA 5CBLA 3AZZA 4XXPA 2A6ZA 1KRIA 1MACA 1MEC1 4WVMA 1ZZBA 2B7YA 2X53S 2QCSB 4YGBA 3WCSA 1CN1A 4CRQA 1NG0A 3ZN6A 3H3UA 4BCUA 1FOD1 1ZVFA 4ORFA 1V9U3 1RUH2 1C3HA 4CEWB 4N7UA 1QU0A 2ZAAA 4QPYA 3ZFGA 2D3PA 4QX5A 4CDQB 2YHJA 2PHUA 1BEV2 1ASJ3 2VMIA 1G8WA 4AQ6A 1AXYA 1NCRB 2RMU2 4KGQA 5JZGA 4Y1YA 2R49A 4N53C 4BA6A 1O4TA 5C4WB 5IK5A 2YMZA 4E4DX 1GSLA 4AK3A 1QOSA 1X8EA 2ZGMA 4FTEA 4XHBA 1RUI3 1D4M2 4FPOB 2XBO3 2R1DA 3B69A 4UBHA 4META 3VBOB 3MIFA 4Z2WA 2KA3A 2ZHMA 5FAXA 1M4WA 2R071 2UY9A 4JGZB 2W08A 3RI8A 3VKOA 2DVBA 2RR11 4QPIC 2WNUC 2ZX0A 3AYEA 4MXWB 4YVWA 5FOBB 5AC93 1ZREA 3WNXA 3AJYA 1QH7A 4XJWA 3KCXA 1ENXA 2A6YA 1EV12 3S30A 2GNDA 2UWBA 1GICA 1N3PA 1LU2A 1BYHA 4HBNA 4L9BA 2BVBA 4GIQA 2XVLA 3NV2A 1SFNA 4XZPA 4D7TA 1XNKA 1EAH3 4M00A 5KXBA 1SCRA 1VBA2 1AJOA 1RGSA 2WA4A 5LEKA 4E2SA 2DU0A 2CL2A 4UW6A 4ATFA 1AYN1 4D7SA 3MDPA 1ZX5A 3PLQA 1FI2A 1Q8VA 4WVZA 1QY4A 5JMCA 1UPSA 1VAVA 3MIGA 2ZACA 3ALQA 4CP1A 1XNCA 1B35B 1HXS1 1WLDA 2ET7A 3OYWA 1J1TA 4LBKA 4YRDA 3M7AA 1REEA 2C1FA 1MQTC 1RC6A 1ZRRA 3CF6E 3B00A 1OHFA 1MS3A 4BLIA 1XYPA 3D82A 1K5MB 1MS4A 3ZFEA 3N7JA 1LCLA 3AP5A 1AXZA 4PCRA 1YIPA 4I0WB 3WT3A 1AR62 1ENRA 2UU8A 2DFCA 2ZKLA 3WR0A 2OW4A 2GNBA 3BU7A 2WQZC 3AM2A 2HWB1 1LESA 2RM21 4YZ5A 2DYCA 5BNPA 5FPXA 1LOFC 2K2SA 1RUH3 4KBBA 4IV3B 3ZVXA 1FOD2 2FZ1A 3BOWA 4PLMA 1RUJ3 3ZFFA 2IC1A 1RMU1 3BODA 2VULA 2E51A 1LEMA 4LEJA 4HN1A 4S2DA 4J1XA 4Y1VA 4A3XA 4TSVA 2X5IA 2XG3A 1DFQA 3NKGA 1NZCA 5H9SA 1CESA 4JRAA 3J8F2 5FTTC 4CDXC 3GALA 1DLLA 1R1A1 2G4IA 1D4M3 1OLQA 3E5UA 2GH2A 4D69A 5JIUA 2Z79A 4A7ZA 4CEYC 1C5HA 4W6YA 1CONA 1QXJA 5BPXA 4JRLA 4AWDA 3HBZA 2ZGQA 2R072 2ZGTA 4P5HA 1O5LA 2RR12 1J59A 2FQPA 4XETA 3VDDB 1FV3A 1WW7A 1A78A 5KHGA 5L36A 4L92A 1NXD1 3E5QA 3WDTA 4A2UA 2NPIA 3ZX7A 2IXKA 2R32A 5JCTA 3HR9A 1G9DA 4WV8A 1ZRFA 2PQQA 1W6PB 4RGGA 2ZMNA 2VNOA 4R52A 2ZZJA 4L8QA 4Q4W1 3NW4A 4Y4YA 1A6CA 1BQPA 3AYCA 3VKFC 2PYTA 3ZPYA 4C0BA 1FAYA 2R063 1LHUA 3S6PA 3JUUA 1RUD3 4R4ZA 3QLQA 4DNYA 4FPYA 4BZ4A 3BB6A 4IEQA 5B2GB 3IPVB 2WJSA 4ZU5A 1Z7S1 3VKLA 4C91A 5F5QA 1WW6A 1C8NA 1OQ1A 2D93A 4FPCA 1HXS2 3N7KA 4R9DA 5EYXA 3WDXA 4XJ8A 3WDUA 4DRRA 2WZR1 1TME1 4ASMB 1IKQA 1CAVB 1X8MA 4CYDA 2B42B 4AFDA 3THTA 3TNPB 2AR6A 4EJRA 1NQJA 2BWCA 4LBQB 1EPWA 4EN8B 2HWC1 5DDJ1 4CTEA 5BNOA 5C33A 1QJU1 5EXOA 1YUDA 3R4SA 1H2MA 1LRHA 5HCFA 1ZZCA 2UYBA 4K21A 1O3QA 5FO7B 3M4FA 5CVRA 2V09A 3OJBA 4Z8BA 5CFCA 5ABJC 1WD3A 5JR7B 2RM22 2OUJA 4Y1XA 4IETA 3H7JA 3CJIB 4XBLA 2WS91 1W6OA 2QKDA 4GALA 1NCQB 2GN3A 5JPMB 3I8TA 1LB2A 4PDWA 3M1HA 3TN93 5DZGA 4HVQA 1IQAA 1RMU2 1AR93 3QH6A 3JBG3 3VHPA 3IM0A 1KITA 3QOPA 1CJDA 1ND3C 3J8F3 4FOQA 1X50A 2GN7A 2HYKA 4YNIA 4B3NA 1VBE3 3MI8A 2ZKNA 4BQ1A 4TZDA 1R1A2 2RS11 2H0VA 1SLIA 5A32A 1WLWA 3LSDA 1FYUA 4P9WA 1SLTA 4N53A 2YYOA 3GHMA 1SBFA 2WLQA 3MLKA 1H0BA 5JOXA 1VBB1 5EZWA 1HW5A 2Z2SB 3WP3A 4RGAA 1GZWB 2AZ5A 4OVEA 1OI6A 2PLV1 3B9IA 1JW6A 3A0KA 2Y38A 4G4FA 1V6IA 5AFEA 5KBFA 2AGSA 1AUYA 1FNYA 3H7YA 5D8AB 4TLFA 4B8EA 4CDWB 2R0HA 2Z5WA 1J3PA 1D4VB 1QWRA 2VUAA 4QPGB 1S0IA 1DQ5A 4YVSB 1SLLA 5LK5A 4IEXA 1AYM1 1QJX2 2H0BA 2JDZA 4XQDA 4OLLA 4AVTA 1GLHA 3L9JT 1G9CA 3B9CA 2NN8A 4AEDB 4Q4W2 5L73A 4IESA 2SBAA 5FOJB 5C8CC 2QVSB 5HCBA 3V0AB 3KGZA 1UIKA 2CGOA 5D1IA 1KS4A 4AHYA 3VKMA 3VBUA 4R9BA 1Q8PA 1HRI2 1AX1A 3JB4C 4WZFA 1MR5A 2OIIA 3UV9A 1EYBA 3USUB 1Z7S2 2WLPA 3ES1A 3JB8A 2D6PA 3LWCA 3PJYA 2ARBA 1BBT1 1DYPA 3ENRA 4C90A 5JOZA 2Q30A 4XF4A 2A3YA 1TME2 2VQ0A 1VIWB 2GC3A 2PAEA 3LZZA 4DOUA 2GSYA 5K9YA 3QBQA 1PVC3 3M3QA 2HWC2 1QJU2 4XFHA 4NWVA 2RM23 2F4PA 1RUOA 4WVVA 3EO6A 1XYNA 2XWJB 3ASIA 4EV0A 1DQ1A 2DCKA 1JUHA 1N3OA 3ZFGC 4PLNA 1G9BA 2P37A 3BIWE 2WS92 4JDMA 4PBOA 2GNTA 1TE1B 3ZIWA 4M01A 5IK8A 1H8TC 1J3QA 3KCCA 3RQ0A 4NHMA 4P9XA 1Y9QA 2A6XA 3VZJA 4LA3A 3D0SA 1UKGA 3OF1A 5KHJA 3PTYA 5GALA 2OA2A 1NY72 2DVAA 1R1A3 2QDNA 3DPRB 3IBMA 2HWD3 2ZAHA 3WD5A 4AHXA 3GHNA 4QMAA 4COWA 2XBO1 3IKWA 1PZ7A 2ZHNA 3NV3A 2RS12 1VB4A 3A4UA 2WT2A 4RFT0 4NPRA 4CDUC 4DZGA 3WLUA 1AX0A 1VBB2 2W39A 5AC91 1OFNA 3D4KA 4E2GA 3HWJA 1DG6A 4K6BA 2PLV2 4YW1A 3AMNA 3JZVA 4K1ZA 3OY8B 4JV4A 3VBSB 4SLIA 3HD8B 4AVBA 5LEJA 1QJX3 1H8VA 4KG8A 1WMFA 5A33A 4FP3A 4FTSA 1EAH1 1U5ZA 5GZCA 4Q4W3 2VNRA 2XLFA 1AYM2 1G7YA 1QDOA 1SLAA 4RR3B 1LHNA 4RQPB 4LBLA 1SACA 2CY6A 2ZGPA 2QZ2A 3L2YA 1IGOA 2Q4SA 3OGJA 3P3NA 3ZN5A 2DWRA 2ZA9A 2R043 1WCKA 3ELNA 1CIWA 4LE4A 4WM8A 4AFBA 1VBD1 4AG4A 2RS53 1HRI3 2QJVA 4Q0UA 1B09A 1ZA4A 2Z42A 1OPOA 3B5LB 2TUNA 4HFSA 2BNNA 1YJLA 3ZFEC 3CL1A 2H6CA 3CLPA 1WW5A 3Q9OA 1Y7BA 3OGGA 4IXLA 1SLCA 4WVMB 3DKWA 5JI9A 2VGDA 4OHXA 1NA1A 4DRVA 3ZN6B 1WA4A 5BNPC 3ACLA 4J1WA 2ZOEB 5DG1A 3ATGA 3MEPA 5JSOA 2MPFA 2CTVA 1QJU3 4Q8KA 2W0XA 4LTAA 4XFCA 1D0HA 1YI7A 3VHOA 4NHKA 5F9TA 1WCSA 1U12A 3IN9A 5J3UA 5JIAA 4UXAA 3H0OA 3FUQA 5AVAA 1KS5A 2DCZA 1R081 5JZGB 1KJRA 2WS93 4HL0A 1I9RA 1RUJ1 4HPKB 1WGPA 3AYAA 3WINE 5ABJA 1W6QB 2F6BA 1CR7A 3E6BA 1UN1A 1H4GA 5CA6A 1NYWA 1URXA 2FBEA 1AL23 5JWPA 4B29A 2DURA 2PN5A 2HEYF 3AKPA 4YVWB 1QKQA 4YM3A 2GNMA 2DUQA 4HETA 1KFXL 4IEOA 1LOBA 2XBO2 2IFWA 1WW4A 4IV1B 1FNZA 2YUEA 1VBB3 4OHVA 3WX5A 1GQGA 2EALA 2NM1A 5JSRA 3KT1A 3B94A 2VECA 2TEPA 2OUHA 4TYSA 1BZWA 4JGYA 3WUCA 3AXDA 3MIDA 3IDBB 2ZGOA 2QE3A 2XKPA 3SCGA 1ONAA 1GR3A 1WLTA 4ITCA 1JXNA 1LOAA 3LAGA 3N4MA 4QQLA 1NLRA 3LCPA 1C57A 3J26N 4S2HA 1EAH2 4K20A 5DZEA 2DCJA 3W9AA 2R061 4LBNA 2DVDA 4Y20A 3VBRC 2XJTA 1RUD1 1ND2A 3LB9A 4IEVA 1ULFA 4MGKE 4H14A 2PELA 4KU7A 4XBQA 1VBD2 3AMMA 3SCHA 4YLZA 2ZGKA 2RS32 1FT9A 3PMSA 4Y22A 5BNNA 2GMMA 2ERFA 2HWF3 4N43C 2JG8C 1DZQA 4NN0A 3FC0A 1PZ8A 1C1LA 4XF9A 3USSA 5BNOC 5C9AC 4ZXKA 3ZYRA 3MFCA 5IK7A 3CU7A 3KSCA 5CFCC 1VP6A 1GV9A 5J37A 5KC6A 3N35A 4MGYE 1KJLA 2BNMA 4OI1A 3ZFFB 5HBAA 4YGCA 3OTFA 1LENA 1DZTA 3N7LA 4XJZA 2VW1A 4Y1UA 4PDWC 1S1AA 1HX6A 2GDFA 4GH4A 5E88A 1XRUA 4ATEA 2NP0A 2X5IB 3FUOA 3MW3A 3VBFA 3AP9A 2ENRA 2YY1A 1R082 2Q0AA 1EP0A 1S0EA 5CFDA 1LKNA 1RUJ2 3TN91 2PHFA 2XH6A 3VBHC 1JYIA 5F6LB 3SITA 1KD7A 1RUC1 3KS7A 1AR91 5ACA2 3JBG1 2GZWA 4YG3A 2EF6A 2O8QA 2QNKA 2QDRA 5JAXA 5L7OA 2XWBB 3J8F1 5KHKA 1H8TA 1YFYA 4FQ4A 5KHIA