1IS6A

Mes-liganded congerin ii
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
134
structure length
134
Chain Sequence
DRAEVRNIPFKLGMYLTVGGVVNSNATRFSINVGESTDSIAMHMDHRFSYGADQNVLVLNSLVHNVGWQQEERSKKFPFTKGDHFQTTITFDTHTFYIQLSNGETVEFPNRNKDAAFNLIYLAGDARLTFVRLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Congerin II
publication title Crystal structure of a conger eel galectin (congerin II) at 1.45 A resolution: Implication for the accelerated evolution of a new ligand-binding site following gene duplication
pubmed doi rcsb
source organism Conger myriaster
total genus 28
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2001-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1is6A00
1UKGA 3AZXA 1U0AA 4R9BA 3WG3A 4FOVA 1X50A 3QCWA 3WOGA 5EWSA 4FPCA 5H9RA 3AP6A 3OYWA 1UZYA 3AZZA 2JDZA 3N36A 3ZXKA 4BLIA 3CNAA 2GMPA 3WUDA 3T1LA 1FX5A 4AYUA 2VY0A 1GZWA 2V73A 2E53A 1AXKA 1S1AA 1CPMA 1A3KA 1VLNA 4CRQA 5DG1A 4FPFA 4P9YA 1SLBA 3LSEA 3WDUA 3BIWE 3OY8B 3ENRA 4F83A 2R1BA 2ZGMA 4Y26A 5E88A 3RG0A 4YM0A 1PZ8A 2C9AA 1CVNA 2ZGPA 5IK8A 2OUHA 1IKQA 5AVAA 2EF6A 1N3PA 1Q56A 2DV9A 2JJ6A 3HMYA 2GMMA 4FVVA 5GLTA 5JOXA 4TZDA 3SLIA 1FNZA 3MEPA 2NP0A 1LENA 4YG3A 3DGTA 2PHXA 1A8DA 5DUXA 4BPZA 1AXYA 2PHTA 5H9PA 4Z8BA 1JUIA 4LBNA 2UWAA 4SLIA 1FNYA 3AJYA 4XHXA 2DTWA 4I30A 4XJAA 2ENRA 3SITA 2ARXA 2UU8A 4YGCA 2LTNA 4YGEA 2CWMA 2DURA 1QOTA 1G86A 1JXNA 4H55A 2ZHLA 5JDBA 2DYCA 4BLJA 4LBOA 4YGDA 3V0AB 1W6NB 3ZPYA 3GNEA 1UMZA 3PVOA 2JE9A 1XQNA 4XDQA 2VXRA 3WUCA 3FBYA 4M3CB 4NOTA 2ZBJA 1G9CA 2NMNA 2VW0A 4FPGA 3UL2A 4PF5A 4XJ9A 2ZGSA 3WVJA 1IS5A 1LOBA 2Q5TA 2EAKA 1SLCA 2A75A 2EXKA 4YW4A 3OJBA 2A71A 4PQ9A 4CTEA 1KJLA 4ATFA 4XIOA 1H30A 5DZGA 4Q8KA 2E7QA 2EXIA 1LU1A 4LBMA 4DFSA 3W59A 2V5YA 2YXSA 2RHPA 5IK7A 4PBPA 3WCRA 3M3QA 2CWSA 3FUQA 1UPSA 3ZXEA 3R4SA 2D6MA 1I3HA 4Y1VA 4BMBA 3U4XA 4R9CA 4YM1A 5E8AA 3N3HA 5E89A 1LULA 1GNZA 1LODA 1W6QA 1LOCA 1G9AA 2P3IA 1SFYA 1QKQA 2PHRA 4YLZA 5GZDA 4YFZA 3FLTA 2YZ4A 1Y7BA 3KQRA 1DFQA 1HDKA 2JD4A 2KM2A 4YW5A 1UAIA 3VKOA 1N1TA 3SH5A 2DTYA 1N1SA 4FPLA 4YW3A 4BM8A 1GKBA 4C1XA 4XTMA 1RIRA 3A4UA 4GXLA 4XJWA 4GKYA 5SV8A 2WT0A 3WNXA 4PBOA 1LHUA 1V00A 2EALA 1LHVA 1AX0A 1UZZA 3AP5A 3M1HA 4XOGA 3WG4A 2R16A 1JYCA 2ZGKA 2R0HA 3B01A 3VKMA 4XIKA 3GALA 4XBLA 4Q2FA 4TYSA 5JOZA 2FHRA 3N7KA 4YZ2A 4GWNA 1DQ0A 5HCBA 1CQ9A 2R0FA 3IMNA 3ZXLA 1PZ7A 2A6ZA 4XJZA 1CJPA 2CNAA 4YG6A 1UX6A 3ZVXA 2WSUA 3I8TA 4Y1UA 1LHOA 3N7JA 4Y1YA 1F9KA 2ZZJA 3C2UA 1Z78A 3ZXFA 2GN7A 4XTPA 3ILFA 4Y22B 1QU0A 3D6EA 3FFZA 1MR5A 2GNDA 5GJ6A 4FOYA 2ZGRA 2DUQA 1HKDA 2CL2A 1QOSA 1GSLA 1MS4A 4DRVA 4HL0A 1ULEA 2DVGA 2NZ9A 1C1LA 3D4KA 4XJ8A 2NYYA 1JW6A 1FATA 1QGLA 4WVWA 4AVTA 4C1WA 1KDMA 2TEPA 1KQRA 1AXZA 1LGNA 1S0BA 2D44A 2ZGNA 2W68A 3M3OA 3AXDA 1W6PB 4XBNA 1LOFA 3BODA 1BQPA 4KBBA 2ZGUA 4LBQD 1QOOA 1LOFC 1YRZA 4P9WA 5T50A 1W6OB 4M00A 1ULDA 5LK5A 1S0GA 4L8QA 4K1YA 4LBLA 2VU9A 3OBRA 1FYUA 4CZSA 3B00A 4Y20B 1S0DA 4M01A 1UL9A 2W08A 4GA9A 1N3OA 3ILNA 4UW6A 4DRRA 1S0EA 3AX4A 2DVDA 2W52A 1V6MA 4AWDA 3OPZA 5GLZA 1V6LA 1MZ5A 1CONA 1SCRA 2A6XA 3KM5A 5DUUA 2XG3A 3NV3A 2DVAA 4Y24A 1RINA 1DLLA 1LECA 3MW3A 3UJQA 1GZCA 2C5DA 5HCFA 2Z42A 4R9DA 1SACA 5IUQA 5T5OA 4D69A 1LHNA 3AK0A 2PHWA 1W6MB 2AH2A 1IS6A 3HR9A 4YZ5A 4WV8A 1AJKA 3WDYA 2SLIA 2GMEA 1VALA 1Q8SA 4Y1ZA 2B7YA 5DZEA 1MS5A 1JBCA 1QDCA 1V6NA 4XXAA 3VUOA 1QNYA 3OGGA 1GNHA 5GLWA 5FRAA 3OYWB 4AVSA 1MS0A 1BJQA 1WUVA 4GWMA 1RITA 1DIWA 3JUUA 3AZWA 2ZMLA 2HYKA 1BYHA 2WSVA 1SLIA 3SH3A 1GZWB 5T5JA 4XILA 1LESA 1DQ2A 2WNEA 1GYKA 1A78A 3RMXA 2WQZC 1AVBA 4WZFA 1Q8QA 1ENRA 2D6KA 1UN1A 4YFWA 1FV3A 2PELA 1WLCA 2JECA 3ASIA 3PVEA 5CAZA 2ZHKA 4UW5A 4XBQA 4XMIA 2JE7A 2YROA 1O4ZA 1QMJA 1W0PA 1WD4A 4OZXA 4XMAA 2AUYA 4FQ4A 1JOJA 4FPHA 2ZKNA 3NV2A 1ULCA 4Q26A 1G9DA 1WBFA 2ZHMA 1HQWA 2A3XA 1V6KA 1W0OA 2VW2A 1D0HA 2DU1A 1KJRA 5T5PA 3VKNA 1DQ6A 1AX1A 3AYEA 2NN8A 4FPEA 1ONAA 1WD3A 5DXDA 3INAA 3R4UA 2NM1A 4BMEA 4ATEA 4JRAA 3RMYA 1JHNA 2P37A 4M3CF 1C4RA 1N1VA 3POYA 1IOAA 2A6VA 3NWKA 1LHWA 2W39A 2JKBA 1QF3A 4LBQB 1N47A 3WCSA 2H0BA 4UW3A 5GLVA 2DVBA 2GNMA 3D5OA 4XHBA 4AGGA 4YM3A 2ZA9A 4XYXA 4HANA 2A7AA 1ULGA 3N35A 3PJQA 2CY6A 1F31A 2DUOA 5EYXA 1N1YA 3DUIA 3SH4A 3AP4A 1W6PA 3B9CA 3M3CA 4GKXA 4Y1XA 1YIFA 4FOWA 3V65A 4YW1A 1MS8A 2PHUA 3WDVA 1V6JA 3IN9A 3WZ1A 2WKKA 3AZVA 4DPNA 1BZWA 5EYYA 1CR7A 1S0JA 3OY8A 1S0CA 2P3JA 5GZGA 1W6OA 1LU2A 1LOEA 3IPVB 4Q1PA 1DBNA 3LCPA 4FQZA 3JU9A 3FLRA 1ULFA 4Y20A 4XJUA 3ATGA 2EIGA 3WDWA 2AENA 3I4IA 2GNTA 1O4YA 3POSA 1ENQA 1HLCA 4FPYA 3W58A 3M3EA 3WHUA 4YZ4A 5F5QA 3VKFC 1GZ9A 2D6NA 2VUAA 2E6VA 2A5ZA 1AJOA 1CPNA 2ZABA 4RL7A 2VH9A 2G4IA 4FOQA 4YM2A 5IT6A 2ERFA 4XXPA 4BOWA 5CBLA 1F5FA 3V0BB 3AP9A 3UJOA 4XE9A 4P9XA 1H9WA 4GALA 4MYEA 5GALA 1FAYA 4K1ZA 1SLTA 3T2TA 2ZACA 3A0KA 3B69A 1D2SA 2GNBA 3Q9OA 4IQPA 2D3RA 4JCKA 1N3QA 1W6MA 2I2SA 1LGCA 1VAMA 1SBFA 3TB0A 3V0AA 1BKZA 1W6NA 3ZSJA 2ZGQA 3O0XA 3VKLA 1WBLA 3BOPA 5H9SA 2E7TA 3QLQA 1SCSA 3A0NA 4M3CA 4R9AA 1JN2P 1H9PA 3B3QE 2DVFA 2ZAAA 3IM0A 3RQ0A 2ZGOA 1OKQA 1C1FA 5DUWA 2AR6A 4W65A 2D6LX 3UK9A 2P2KA 5JLVA 1GBGA 3USUB 1QNWA 2WT2A 2D6OX 3HN1A 3V64A 2P34A 5H9QA 2EXJA 3O5SA 2WLQA 1LTEA 1YO8A 3AZYA 2YMZA 4LBJA 5T5LA 2A70A 1DHKB 1MACA 2SBAA 3AJZA 3AYDA 5CNAA 2R49A 5L73A 2DUPA 4YGBA 3WHTA 3AXEA 4XZPA 1DQ5A 2CTVA 1LOAA 4FPKA 4AGVA 1C57A 1IS4A 3MW2A 1DQ4A 3WDXA 3PMEA 4K20A 2D3PA 5CB7A 1G9BA 3RS6A 3POWA 1LGBA 1TEIA 1G9FA 4NO4A 5T52A 5GZFA 5BYNA 1ZA4A 5F9TA 1DYPA 1YYNA 4ISRA 3BTAA 3WDTA 2NMOA 5KXBA 2DU0A 4U36A 2LALA 4LBQA 1J1TA 4Q1RA 5JMCA 1PZ9A 3ZYPA 1ENSA 4YZ1A 4DS0A 1EPWA 2OVUA 5JOWA 1QDOA 2E51A 4FP3A 3AYAA 2AYHA 3ZSLA 4YW2A 4U2AA 2UURA 2WT1A 3RRDA 1FV2A 3LSDA 5DZFA 3NV4A 2GALA 2OW4A 5GZCA 2BQPA 5IK4A 1Z0HA 2EXHA 2D3SA 3M2MA 5KXDA 1BXHA 1DZQA 4K21A 4RA0A 5T55A 1WW5A 1OFSA 2CYFA 3O0VA 4Q8LA 1AX2A 3T1MA 3IPVA 1URXA 3SNMA 3VV1A 3WG2A 2D43A 3AP7A 3MPPG 4ISQA 1KRIA 2A6WA 2VW1A 1GLHA 1OQ1A 3SISA 2D7FA 1CIWA 4Y22A 2FMDA 1S0IA 3N7LA 4YG0A 1DYKA 1LEDA 3AYCA 4FPJA 2AREA 3WG1A 3R05A 5GLUA 4ITCA 3RSJA 4FP2A 1MS3A 1AZDA 1KDKA 2ZMKA 3APBA 1I1EA 2OUJA 1MS9A 1YXWA 3L2YA 5JOYA 1CESA 2R1DA 1WLDA 1KITA 1GICA 3O12A 4ZXKA 2YV8A 3V0BA 1MVQA 4UW4A 1S0FA 1G7YA 2PHFA 2UWBA 2WJSA 4DQAA 3ZSKA 3IKWA 1R1ZA 2ZGLA 5CA6A 3ILRA 1MS1A 1ZM1A 5FREA 3AFKA 3FUOA 1SLLA 1LEMA 1JYIA 5EXOA 1Q8VA 2GN3A 1V6IA 3MW4A 4AGRA 1WW6A 3ZSMA 4PCRA 5DG2A 1WW4A 1YI7A 4AVVA 1CN1A 1HQLA 4M3CE 2A3WA 1GANA 2YY1A 3ZXJA 1APNA 3ZYRA 1SBDA 3H0OA 4P14A 1B09A 2D6PA 1LCLA 2AGSA 2DWRA 3WLUA 5GM0A 3O0WA 2UWCA 3NV1A 2ARBA 4Q27A 1MVEA 1LOGA 3FLPA 4YZ3A 1WW7A 4ASMB 4ZKTB 5KXEA 5GZEA 3PVNA 1GV9A 1W6QB 1NLSA 1LJ7A 2P3KA 5JVVA 4LBKA 1IS3A 1WLWA 3OBTA 5DUVA 1IKPA 3USUA 1V6OA 4FPOB 5T54A 1DGLA 2ZMNA 4BQ1A 3TAYA 2ES3A 5KXCA 5IK5A 4WVVA 1NXD1 1VIWB 1MZ6A 3N7MA 2XB6C 1AF9A 1G8WA 1Q8PA 2ZHNA 2A3YA 1DQ1A 2ZGTA 4JC1A 1WCSA 5HCAA 2A6YA 2GDFA 3WV6A 1VAVA 1SBEA 1Q8OA 1SLAA
chains in the Genus database with same CATH superfamily
4QKNA 2BWAA 2QQIA 1U0AA 4GH4B 4EN7B 1R1A2 1WMXA 4GULA 3OYWA 3AZZA 2YU1A 3JCIA 2JDZA 4KU8A 1RUH3 5L9BA 3IWZA 3T1LA 1FX5A 5BV6A 4I2OA 5E1RA 1AXKA 3RVHA 2C0ZA 3I2JA 1H8TA 1OF4A 5DG1A 1TMF1 2RJLA 3PMSA 3LSEA 5F2SA 3WDUA 3HEIA 1RMU2 4KG0A 2JD9A 2R32A 3OY8B 1QXRA 2R1BA 2ZGMA 3I59B 3LIGA 3RG0A 5LEKA 3BI3A 2VPVA 3VZOA 2XKPA 4RQPA 2XJQA 3MV11 2G9ZA 5DABA 2JG8C 4FFHA 2DFBA 1NXMA 2GMMA 5LB6A 5FYUA 4AK3A 3SLIA 1FNZA 3MEPA 5JOXA 1O6UA 1LENA 4HBNA 4YG3A 2NP0A 4TLFA 1DDLA 4XFIA 2PHXA 1E5RA 1VBA2 2PHTA 5H9PA 4PDWA 4P9IA 4D6RA 4XHXA 3ZIXA 4I30A 5HXVA 2ZX1A 3ES4A 1SMVA 1D2QA 4NHYA 4XJAA 3SC7X 4DB5A 2Q0AA 3VDCA 1OT5A 1AYN3 3CL1A 2CWMA 4YGEA 1F4HA 4HT1T 4XURA 3MUZ1 5FO8B 3VL8A 4GIQA 1TG7A 3MF6A 1L7LA 4GAZA 1JZ7A 5ABJC 4A41A 1YHFA 1UMZA 3K51A 3PVOA 5JXHA 1ND2B 1XQNA 2WNVC 3WF1A 3WUCA 3BTYA 2X5IB 1GOGA 4LXLA 4M3CB 2WN2A 2VMCA 2HKXA 4Y33A 5IYYA 3KCXA 3WF2A 5JIUA 1S55A 1TVGA 2EIDA 3NAPB 4Q0PA 1W8UA 3Q8BA 1RUNA 3EHKA 2HWE3 4PF5A 1CGPA 5K8SA 1IS5A 1NG0A 1J84A 1LOBA 4PT6A 2EXKA 4LHKA 1NT0A 4L99A 4PQ9A 1Z7S3 4ATFA 1J3RA 4CTEA 5HI0A 4LE3A 3R6SA 2E7QA 1FPN3 4A7ZA 1ZBA1 3E97A 2QKDA 2W0XA 3WCRA 4IGPA 5FY9A 1ZRRA 2D5FA 3Q8FA 5LY1A 4MGIE 2ZTNA 1COV3 4L92A 2JEMA 2WINB 4QX5A 4BMBA 5LA0A 3VD9A 1SEFA 5E89A 1GNZA 1HRI1 4QPGB 5G04L 3ZFGB 3NNMA 3C7HA 2YZ4A 1Y7BA 4JKMA 1GOHA 3ALQA 5FZEA 3SH5A 4FPLA 1RUI1 2QQVA 1GKBA 2D97A 5APAA 3A4UA 3ES1A 4MXWA 3ZXAC 4GKYA 1UOFA 2WT0A 1ZBE3 1BK0A 3NJYA 1AR93 4V2VA 5SV8A 3WNXA 5KWRA 2ZAHA 4CP9B 3ZYBA 2QVSB 4HVQA 1XE7A 2RM21 1RUJ3 2VQTA 3D8CA 4IV3B 1NE6A 3M1HA 3RZZA 3OCPA 4CEYB 1OOPB 4C8DA 4CDQB 5F32A 3ZMNA 1JZ2A 2R0HA 1OPOA 1RJ7A 2BW8A 3HN3A 4DEVA 1U5ZA 2Q1MA 4XIKA 4OULA 3DEMA 1UU6A 4YZ2A 4FFIA 5HCBA 2JB4A 3HIFA 4NIIA 3H42B 2QZ2A 4ES8A 2VZ3A 4YG6A 1OFNA 1UX6A 3H1WA 1YQ5A 4MGTA 2BNOA 2D93A 3TBDA 5FMOS 2FDIA 4DMIA 3C2UA 4QB1A 3CZJA 3S57A 2ID4A 3QOPA 1PGW2 3FFZA 3BGAA 3WW2A 3TEZA 3SCHA 2JDUA 3W5NA 4IEOA 1HV0A 2CL2A 1GQGA 1U5IA 3OOXA 1AHSA 1CZTA 3G7DA 4OYUA 3V56A 4AI8A 3KVBA 4DRVA 4V1PA 3LB9A 4QPYA 4XJ8A 2JX9A 5DN2A 1R082 3H3LA 4H7MA 3T2QA 2Z2SB 2A73B 4WVWA 4NIAA 2WRAA 1KDMA 4RGGA 1POV0 1AXZA 2ZGNA 3H1MA 2W68A 4LOTA 1NCQA 3AC0A 4BQ2A 1O8PA 1OLME 4B7EA 3T2OA 4XDOA 2PQQA 4DXZA 1NCQC 1W2OA 5IATA 1OA2A 2PLV1 2RS11 1S4CA 4A42A 2J1AA 2MNGA 2UY8A 2VGDA 5T50A 1CAUA 4HKWA 2Y60A 4IEQA 5LBCA 3P1IA 1WZXA 3JQXA 2VU9A 4LO7A 3N9OA 4CZSA 5JPMB 3PUSA 4Y20B 3GJAA 1UL9A 2EICA 4GB31 4OUSA 2RS52 3VBHA 4NROA 4LORA 2DBIA 3ILNA 2VOXA 4DRRA 3AX4A 3POGA 2DVDA 3JD72 4IE4A 5FPVA 3VBHC 4AWDA 3OPZA 1MZ5A 1V9U1 5CFCC 2VZVA 1B35B 3KM5A 2MEV3 1BLZA 2V4AA 1ASJ3 2DVAA 1FMD2 1RINA 1VBD3 1LECA 4K7JA 4ZY9A 3HQRA 4OHZA 3UJQA 1QJY3 3EYPA 1GQHA 2Z42A 4JGZB 5HCFA 2WNUA 3CJIB 4H7LA 5A32B 3S0MA 4RFT0 2X10A 4D69A 5T5OA 1CAWA 5FP3A 2HWD3 1VBE1 4AI9A 5L7OC 4JV4A 1CX1A 1SFNA 5ANQA 1PHMA 3QH7A 1XNCA 2RR13 2SLIA 4RSUA 2GMEA 5BNPA 2E32A 4LT5A 3MV01 4B1LA 5LEJA 3JBG3 1Y9GA 1EAH1 1JBCA 1V6NA 3OBZA 4L0PA 5DMYA 4CP0A 4KNCA 1BK1A 5GLWA 5FRAA 5K0UB 4PF1A 2XKOA 3AKQA 1AR81 1W9FA 1DIWA 3JUUA 1E57A 3GJBA 5JXJA 3S5QA 2CAVA 2ZMLA 1XYOA 2BOJA 2WSVA 1RVF3 1GZWB 3GZUC 1LESA 4XILA 1KD7A 2XJVA 1AVBA 5FJHA 3RMXA 3SKVA 3ZXDA 2NLRA 2D6KA 1VJ2A 1UN1A 3F95A 4DINB 4XFGA 2XGXA 3ST7A 5CAZA 3LAGA 3E6CC 4QWNA 2XWBB 2ZHKA 2HEWF 2JE7A 5FPUA 4NE9A 1QMJA 3VD4A 4OZXA 2AUYA 3VDDA 2JICA 5EHDA 3UKVA 2JDHA 3NV2A 4Q26A 1NA1B 2E26A 1WBFA 4ZZ5A 1YWKA 2ZHMA 4K40A 3VDDC 1HB4A 2Y6LA 3DYOA 2VOVA 4IE7A 1MEC3 3JXSA 1UOGA 4FO9A 4X6QB 2IFRA 3AYEA 3WR0A 3TN91 2HWC1 1W06A 4FPEA 4LIVA 4A4AA 2QE3A 3ITQA 2R063 4XCBA 3M4FA 1FI2A 1XRUA 2R072 1NLQA 4M4RA 2E31A 1N1VA 5JCTA 1K42A 2BVVA 2PAEA 1AR73 1GR3A 2W39A 1QF3A 4COVA 1RB8G 3KZ4C 1OF3A 3U4SA 5FZ1A 2H0BA 3QH6A 2DVBA 2RDNA 5EJ3A 3WNNA 5FY0A 4AGGA 4DNYA 4Z82A 2XLGA 1BEV1 4Z92B 2GZWA 3WINE 2G19A 3N35A 1GZTA 3PJQA 1PVC2 1K5MC 2DUOA 3ZFFC 4CDWC 4GJZA 5EYXA 1N1YA 2WWSA 3B9CA 1YFUA 1YIFA 1MS8A 3WDVA 1V6JA 3IN9A 4TN7A 2WKKA 3AZVA 1BVP1 1BMV2 3UYJA 4DPNA 3VBFA 2WFF2 5C8CC 1US3A 1ZRDA 1PGL1 1H6XA 1S0CA 2BOIA 2P3JA 3LDRA 3OY8A 4LE4A 1LU2A 1LOEA 2JDKA 3CF6E 4QX7A 1QH7A 5ERLA 5F5AA 5JI9A 3JU9A 4RS5A 4BH9A 3LGRA 5LBBA 4BIFA 2EIGA 5FZFA 2G1MA 3I4IA 4RS5C 2GNTA 4DXRA 5CFDA 1TNRA 3MFCA 4CU8A 1HLCA 3W58A 3M3EA 4NRMA 3WHUA 3N9NA 2D6NA 2A5ZA 2GAUA 1AJOA 4YM2A 2VH9A 2G4IA 4JTOA 5FZ9A 4XXPA 2A1XA 3D0JA 4QHOA 2VQAA 3UKNA 3AP9A 4I3GA 4D3WA 4GALA 5ISLA 1NQDA 1WA4A 2QQJA 3O14A 5GALA 4QPIA 2ZACA 3KMHA 2GNBA 3AMHA 3OUHA 4IQPA 4JCKA 1N3QA 5C71A 4QPIC 2B5HA 4HPKB 1H1MA 4M4PA 4P5YA 2O1QA 2ZGQA 3O0XA 1RUD3 3FN9A 1PO11 1PX3A 3WP5A 2X5IA 2VZRA 2E7TA 3MI8A 2BERA 4GWJA 4RFRB 4M3CA 3T2PA 4BQ3A 2TBVA 1ZZ9A 4OUMA 1NCRB 2VMEA 2Y6KA 4YW7A 5LW9A 3BIEA 4LTAA 1PO23 2H6CA 3NAPA 2Y6HA 5FYYA 5FZDA 3RQ0A 2VO5A 1H4HA 1TE1B 1UY4A 1OKQA 5DUWA 3GBWA 1SZBA 3MUY1 2AZ5A 4INDA 1J3QA 5FYHA 3VBRB 4AFMA 3DV8A 4GMP1 5A7WB 2Y0OA 2D6LX 3J8F1 4F8AA 3LE0A 2P2KA 2LUWA 3Q8CA 2R7EB 4X8PA 3NNLA 2VOKA 3K77A 3M70A 5G05L 3W20A 2BJSA 1O3QA 1JUHA 3H8OA 1AYN2 1NZCA 2WLQA 4LBJA 1YO8A 1T2XA 2V4VA 4IETA 4RHV1 3AJZA 4Q4V1 2HH9A 2DUPA 5L9RA 2FCVA 4N9HA 4FTSA 1ZVFA 4QPGA 2QBXA 1AYM2 3ZFGA 4ZS2A 2QJVA 1C57A 4NHMA 3LPGA 4PI2A 4G4FA 4TTGA 1YFXA 1XXNA 3WDXA 2IXJA 5A3OA 4KWUA 1BEV2 1I5PA 3POWA 3RS6A 1TEIA 1G9FA 1F8VA 3OB8A 5AC91 2HWE2 5J7MA 4SBVA 3N4MA 1OA4A 2XOMA 5LA9A 2WA3A 1OLMA 5FP8A 4CP9A 5FKCA 3WNOA 4BK5A 3VDAA 4CDQA 1ENSA 5JMCA 1H8TB 1KS4A 1YC61 1Z7S2 2GP3A 1EPWA 4Q4X1 4UAPA 2OVUA 4BXSV 3CZUA 1DGWA 1H2NA 1J83A 1QDOA 4WVMA 5JOWA 3AYAA 2AYHA 2XWJB 4NUBA 1RYYA 1NY72 3RRDA 4RQPB 1YJLA 1COV2 2GALA 3O1RA 1Z0HA 1E5SA 2D3SA 2EXHA 5D8AC 3M2MA 2VNGA 3DPRA 3G6JB 4XAAA 5DAQA 3RWNA 5KXDA 3I3EA 2RVAA 4ZONA 1A34A 3ELNA 5F3IA 5T55A 1JZ6A 1OFSA 1NLRA 2L9LA 3S5AA 2PQSA 2YB7A 1XNKA 3IPVA 4PDWB 4P9JA 4ISQA 2A6WA 5CIRA 5C33A 1OQ1A 3VZKA 5FYVA 3SISA 5J48A 4EN6B 2ADEA 4IE6A 1ZBE2 4YG0A 5JR7B 4CXYA 1E5IA 2J1RA 2WS92 3AYCA 5DAPA 1JZ4A 2JKXA 2VR4A 1Y4WA 1HXS1 1GNYA 4LO4B 1AZDA 1KDKA 4BWOA 2HWF1 2WNVB 5DDJ3 5JOYA 3B5LB 1WLDA 4XQ4A 2GC2A 3J7LA 4ZXKA 5B4XA 2B8MA 1HRV2 1PO12 4PLMA 1CZSA 1JODA 1RC6A 4LITA 5FWEA 3ZSKA 4ASLA 5CA6A 4OI0A 4ZXEA 2DFCA 4E8CA 4QKDA 5FREA 3AFKA 4AFAA 2Q30A 4Z2WA 2VCCA 4MG2A 3FUOA 1SLLA 3U78A 4QMAA 3KSCA 1ZNPA 2VQ0A 3ZSMA 1KXGA 5AFBA 4PCRA 3BYWA 3E5XA 5I0UA 1F35A 1UW8A 4AVVA 5A6XA 2WZR1 5BNOC 2A3WA 4F7ZA 5A3LA 4CXWA 2VAUA 5C3PA 3K3NA 1BBT3 3ZYRA 1QJFA 1D4M2 1B09A 2VZTA 3VBOC 2GU9A 5FOBB 3WLUA 4HETA 1I6XA 2IXKA 5FBZA 2C9KA 2Y34A 3NV1A 4Q27A 1LOGA 4ZKTB 1WW7A 5FIXA 4Q0SA 1ZZ7A 4EN8B 2P3KA 1UZVA 1WLWA 2JDMA 3GHNA 1W2TA 1W2NA 5A7SA 3ZYGA 1YFYA 4W6YA 3TNPB 1DGLA 4JGZA 1O7FA 3THCA 1PMJX 1NXD1 5EZWA 2RMU3 3JB8A 4LNVA 1DQ1A 1UY3A 2GP5A 4BB3A 4HMZA 3UKTA 2GDFA 1SBEA 2FQPA 1SLAA 2W94A 4HN0A 5A3TA 4O65A 5DQ0A 5E16A 4D94A 4FOVA 1C8M1 2IZWA 3IDBB 3WOGA 1DZTA 4FPCA 1UZYA 2VNVA 1KFUL 2XR4A 4O9GA 5BNNA 5HCHA 1UY2A 3N36A 1YQ2A 1X33A 2GMPA 4N7UA 5LA1A 4QU1A 1JYXA 1GZWA 2MEV2 5IVBA 1ASJ2 1VLNA 1S1AA 1CPMA 1WGPA 1O4TA 2E53A 4FPFA 5FMDA 4ZPIA 1DGRA 1VP6A 4AEMA 1QJY2 4QQ2A 1A8MA 4E2SA 3O1TA 1VBC1 4Y26A 2EIBA 5E88A 4AQ6A 2C9AA 1UIKA 1CVNA 4D7YA 2AEYA 2OUHA 4AI3A 3CBNA 4UI9L 2HWD2 2VG9A 3S6PA 1Q56A 2NPIA 3HMYA 3LD8A 4FVVA 4QQHA 5FAXA 1XYPA 2ARAA 3VHRA 2RR12 4QM8A 3DGTA 2W9XA 3JBG2 3WQ0A 3IDCB 4BPZA 1Y9MA 2RS31 4B7KA 1JUIA 4FAGA 4BQWA 3NNGA 2RG4A 4QXBA 4W6XA 5FLIA 5FP9A 1UQXA 2XONA 2XBO1 1W3XA 2UY9A 1KFXL 2ARXA 1NCQB 1I5ZA 3OGSA 4YGCA 3UESA 3H8RA 3PU8A 1RVF2 5FZCA 5LRRA 1KS5A 2DURA 2VZ1A 2PXJA 2CGPA 2QQKA 3KV5A 4H55A 5EFUA 4UFMA 1RUG3 2ZHLA 5JDBA 4BLJA 1R1A1 3V0AB 1ZBA3 4EROA 3ZFEA 1W6NB 4ZU5A 2N7GA 5DPNA 4LKDA 4XDQA 1D4VB 2OT7A 3KHBA 1UOBA 4ASKA 4H3WA 4CVUA 5CEHA 3ZFEC 3K3OA 2ET7A 3HNMA 2OPWA 1HRI3 1XYNA 3VBHB 3POJA 2QQPA 2DCZA 5CFCB 2VW0A 3N9PA 3OG2A 3MLJA 1MEC2 1RMU1 4QB6A 3C3VA 4XF3A 4CP1A 2ZGSA 2RV9A 3BTXA 4CCLA 4PIYA 1JYTA 2OX0A 3PIGA 2A75A 1PNGA 2QNKA 3AVRA 3OJBA 1RUI3 2ZX3A 3PL0A 4QGNA 4YW4A 1AR63 3C7OA 2Q8DA 5DZGA 1H30A 5K4LA 1AR72 1WMFA 1YCIA 1AL0G 1JZ8A 2YDEA 4Q5OA 1GP6A 1ENXA 5A7NA 5CZKA 1NYWA 2XXZA 4TXWA 4CPBD 1YNAA 2CWSA 3FUQA 5D2AA 3R4SA 1I3HA 1VBA1 4WM8C 1HV1A 4YM1A 5E8AA 3T08A 4CE8A 1SHWB 3RI8A 4E4DX 2BEOA 1LULA 1LODA 3KT4A 3MICA 4PJYA 1G9AA 3SCGA 2C26A 5BNPB 2WWUA 4RGAA 4NPLA 1EUUA 1UY1A 3IIIA 5FJKA 1PMHX 5CKNA 4TSVA 1EP0A 2C1FA 1HDKA 1UAIA 2YGMA 1N1SA 4BM8A 1W90A 4XTMA 4XJWA 3NMBA 4GXLA 3ACHA 4LULA 3VZJA 4XQDA 1UYYA 4KGGA 1LHUA 1V00A 1PX4A 2RDSA 1AX0A 1UZZA 1L7RA 3WG4A 2FDFA 4DUWA 5LASA 2O14A 3MGUA 4Q4Y1 5F5IA 5JSRA 5I8SA 5FY4A 3DCQA 3VKMA 1US2A 4KI5M 2G9FA 4XBLA 2I74A 2WABA 3VDDB 3BB6A 1DQ0A 2CDOA 2R0FA 1PZ7A 3E6BA 1W2AX 3MIFA 2A6ZA 4ET7A 4XJZA 4EV0A 1CJPA 1QIQA 5FMBA 5JZGA 3ZVXA 2JDNA 2PYTA 1REEA 3GXUA 2RS32 3DXUA 3N7JA 4DXTA 2ZZJA 4P00B 5JZGC 1PGSA 1PK6C 2LM3A 3ZXFA 2GN7A 2PLV3 4Y22B 3D6EA 3HBKA 4IXLA 1FOD2 4FOYA 2KD7A 2WO3A 1GQPA 3H50A 5IFTA 1MS4A 3JB4C 3TYJA 1VBB3 4BYYA 4N53C 2NYYA 1K5MB 4CDWB 5LK7B 1PO22 5A6YA 4QAWA 1LGNA 4K8FA 3BUCA 4AHZA 2B9VA 4XBNA 3I2OA 1LOFA 5C8CB 1VRH3 4DO0A 4UFHA 2LS6A 3Q8AA 4HN1A 2ZGUA 4LBQD 4V2WA 1AL23 1LOFC 1X9PA 2WFPA 2XDVA 2YBKA 3VBFB 4A7KA 1J3PA 1HIXA 4NHXA 4M00A 2JG8A 3TWIA 5FK8A 1S0GA 4RS5B 2ZX4A 1OI6A 3B00A 3MLKA 1S0DA 4M01A 3RZJA 2W08A 1IG3A 2HJIA 4YWAA 5BXXA 3KGZA 5FLJA 4MGSA 1N3OA 3B93A 2EIEA 5CFDB 2OS2A 2ATFA 1POV1 1S0EA 2IXLA 2W52A 3T0DA 2Q4SA 2Q8CA 1R64A 1EAH3 2E33A 4LO6B 5GLZA 4N9IA 4FT8A 1JYNA 4QX1A 1SCRA 3S7EA 2IFWA 2FDJA 3I2HA 5FZKA 5ACA3 4B4QA 4Y24A 1DLLA 3ZKUA 1AR83 3P3NA 1PGW1 2C5DA 2LW8A 2PTMA 3CQOA 1JI6A 4R9DA 4QPIB 1SACA 5IUQA 4UFLA 1SPPB 2WDBA 3KVAA 3AMPA 3M8LA 5ABJA 5FZHA 3T0AA 3RZKA 3AK0A 1R081 2WNVA 2AH2A 3K4DA 1IS6A 4G9SB 1GFF2 1Q8SA 1RXGA 4Y1ZA 4IDZA 4LR4A 4WBBA 5DZEA 1FXZA 3ORJA 1W9TA 1QNYA 5FZ4A 4Q4Y2 1W04A 1MS0A 5E6HA 1WUVA 2CU5A 3E6DA 2E9QA 4GWMA 2V09A 5F37A 1TZOA 4P9GA 3AZWA 3GCXA 3TN93 2HWC3 4EQVA 1W8WA 3SH3A 5I0DA 5T5JA 2WNEA 4Y5SA 4QB2A 2WQZC 1O3TA 3NRUA 3TEWA 2IWGB 3PUHA 2RS51 4YFWA 5JPNB 2PELA 3IMMA 3ASIA 1OQDA 5HBAA 2WWJA 4UW5A 1XNAA 4I09A 2YROA 3JD71 5GKAC 1W0PA 2ZEWA 5FPZA 4E4SA 3K48A 4Q0VA 5I8YA 4FQ4A 2VMFA 5FPXA 1IGOA 1G9DA 3HPNA 3NVCA 4JRLA 3WT3A 4A7YA 1FMD1 1HQWA 1V6KA 1W0OA 3WD5A 2VW2A 5T5PA 4QQPA 1W8TA 4WZCA 2YHJA 4URAA 3RDIA 4CCOA 2XUEA 4ATEA 2JDPA 4JRAA 1UU5A 2P37A 4M3CF 3POYA 2A6VA 3PURA 3O1MA 2JKBA 1N47A 5LCWL 5FKBA 3WCSA 4UW3A 2VD7A 1QJX1 4D7SA 3FMGA 4YM3A 3OUJA 2WAOA 2RJKA 4WVMB 1BBT2 2OQ6A 1ULGA 4FCAA 4J6GA 3ZX7A 5D8AB 2CY6A 3VZNA 4XC9A 3DUIA 4BCUA 2WC2A 3K4ZA 3T3YA 4O7XA 3O1SA 1W6PA 1H6YA 3NW4A 1UZWA 3DPRB 2X05A 3WZ1A 2BPA2 2XHNA 5A7PA 5IW0A 5C9AC 4BDVB 5IVYA 3WP6A 1X7NA 3T30A 5KC5A 3ECQA 4CCKA 3ACLA 1S0JA 1W6OA 5F3EA 3IPVB 5FZ7A 4Q1PA 4XUPA 2RMU2 2W2IA 4D8MA 2YYOA 4CPBA 3ATGA 1UCXA 1QQP2 2P6CA 3KT7A 2XJRA 1O4YA 3POSA 3VKFC 5I8TA 4AEKA 4NWVA 2JIJA 2ZABA 4RL7A 1CD3G 3OTFA 4FOQA 2ERFA 2R071 5IVVA 3KV9A 3RZHA 3MHZA 4XE9A 4XZUG 5BUVA 5F8PA 1SLTA 2C24A 3T2TA 3VD5A 3J8F3 1SQ4A 3Q9OA 4Q4W2 1XE0A 2D3RA 3CLPA 1GP5A 4YVWC 2I2SA 1LGCA 5BNOB 1IPJA 4IEYA 1Y3TA 2Q8EA 3V0AA 1BKZA 1W6NA 2DCTA 3HAGA 3VKLA 1PVC1 1LRHA 4RHV3 1QJEA 5H9SA 1QJU3 4Q4V3 3UGHA 2R30A 3QLQA 1SCSA 3ZLIA 3VBOB 3BU0A 4N43C 1JN2P 2DCKA 2DVFA 4TWTA 4JDMA 1Q3EA 1VAKA 5FYTA 4COYA 1BMV1 2WNOA 3MBWA 5CFCA 4DY5A 2WFF1 3WNPA 3BALA 4NJ4A 5FPLA 4GWIA 4UOJA 3WSOA 3AMQA 2HBUA 3LDKA 4IV1A 3H9AA 2OZ6A 3U37A 5FR3A 3O1PA 3UK9A 2VBPA 1TNFA 2FBEA 3WNLA 5JLVA 4IV1C 1I9RA 1Q5OA 1TME3 1HB2A 1OLRA 2ARCA 2WT2A 4QX2A 5FXWA 3WW4A 3PVBB 2W1SA 2H0VA 5C4WC 5L7OA 2YMZA 3SEPA 2A70A 1DHKB 1W8NA 5CNAA 3AYDA 3WEZA 4HSLA 4Q4X3 5JMOA 4YGBA 4XZPA 3OF1A 1HB3A 1D7PM 2UYAA 4FPKA 4B1MA 3PTRB 4QM9A 3OGJA 1QJX2 2QQNA 3PMEA 4K20A 2D3PA 4HONA 5CB7A 4GQ7A 4HVRA 4Q0QA 4OCTA 5BYNA 5F9TA 4A3ZA 4ISRA 2DCYA 5BNNB 4HK8A 3BTAA 1W8ZA 3LA3A 3MIGA 4U36A 1O91A 3OPWA 1CAVA 4LBQA 1J1TA 3VBUC 5F3CA 4JVAA 5EV7A 4MX3A 4Q1RA 4FSJA 3ZYPA 1C8NA 3KWVA 4YZ1A 1AR62 1OURA 3LF7A 4FP3A 1RUF3 4YW2A 5K7PA 1PM7A 4XW3A 4URTA 3I3DA 2BRTA 3RZGA 2EVXA 4KMQA 3VHPA 1HXS3 3I7DA 3MO4A 2Y26A 4XQWA 2X8KA 3IAQA 3MIDA 1RHI3 2X09A 3A23A 5FZ0A 2D40A 1UU4A 1DZQA 2XVLA 1HB1A 3EXUA 2CHHA 4CUGA 2J7MA 2CYFA 3W5MA 4LHSA 4UWDA 1AYN1 2HWB3 2HEYF 4OHWA 3O1UA 3D82A 2VTFA 2VW1A 4EE2A 1GLHA 5IAXA 1H4GA 1CIWA 4Y22A 5JSOA 1QXJA 4EWDA 1NAEA 4HG6B 1DYKA 1AYM1 4FPJA 5FP7A 4OI1A 2AREA 4AVAA 3U0ZA 1SFPA 4QDQA 1S2BA 2AC1A 1OC1A 2WZR3 4ITCA 1XNTA 5FPAA 5GLUA 3RSJA 5A6ZA 4FP2A 2ZMKA 4A3XA 1K5MA 4CDWA 3ZFFA 4A2UA 3DYMA 2DF7A 1QY4A 1CESA 2R1DA 1KITA 1GICA 2VMDA 3PDQA 3PIJA 4MO3M 4QKBA 3UGGA 5J37A 3IZOA 1S0FA 1XOYA 2PHFA 2HWE1 1DYOA 2UWBA 2JDYA 3O7OA 3CJXA 4DXSA 4P5HA 2ZGLA 2FDGA 5FUPA 2BGOA 5C8CA 4NAMA 2IXHA 1SG3A 2O0OA 5J09A 1Z7S1 2JG9C 1LEMA 2VZSA 1O59A 3HJRA 3E1F1 1GU3A 4LKEA 5DG2A 3EJKA 1NY71 1YI7A 1HQLA 1YLLA 1MQTA 1COV1 1W03A 5AVPA 1FT9A 1PIV3 3CKHA 5IAVA 1MQTC 4AVBA 3WX5A 1SBDA 4WM8B 4Z1VA 2D6PA 4ZS3A 1LCLA 3OUIA 3WP3A 3B9IA 2UWCA 4O61A 3FC0A 5FY7A 5KXEA 5L36A 1JOBA 2JDAA 5GZEA 3PVNA 5FFOC 5IVJA 1NLSA 1LJ7A 1W9WA 2QDRA 4O9EA 5JVVA 3WY6A 5DUVA 4KBZA 2YU2A 2Z69A 2Y64A 1EV13 3KF3A 4FPOB 1ZBE1 4J25A 5T54A 3HWJA 2WS91 4AHYA 4BQ1A 1RUH2 2ES3A 5IK5A 4WVVA 4QU2A 2VVDA 1VRH2 5FQ0B 4AF9A 1MZ6A 1PNFA 1SPPA 1W8FA 2P6HA 3N7MA 2XB6C 3POBA 5C7GA 5CG9A 4AFCA 2WL1A 1AL22 1DG6A 5CVRA 5L9VA 1OBNA 2WO2A 4K9SA 4YPJA 1WCSA 1VBC3 4LHLA 2A6YA 4OFGA 2FDKA 3GDBA 4LUKA 5JWPA 1HRV1 5JI7A 3AZXA 4IE5A 5L19A 5EIYB 5JUVA 3I2FA 2J42A 3QCWA 4HVOA 2HLEA 5EWSA 4Y3OA 5H9RA 5FZLA 3SCFA 2JIGA 5FO9B 1UXXX 3LWCA 1VPHA 3VHOA 4DEQA 5FZMA 3CNAA 3THPA 1U12A 4C0HA 3MYXA 4AYUA 3B02A 4HK9A 5ACA2 1OKOA 2ZPXA 4DUXA 1OUXA 4LOSA 1A3KA 2V72A 1SLBA 5JZGB 3BIWE 4QD2A 2VECA 2XBO3 3FE5A 3ENRA 4F83A 3ACFA 4I0WB 1F2NA 1D4M1 5C5UA 4JQRA 4EJRA 3E5UA 2XJSA 2ZGPA 1CX4A 1S2KA 1RUC3 4I0BA 1IKQA 5AVAA 5CKQA 1N3PA 2ZEYA 1Y43B 4BA6A 4NHKA 1JMUB 2IC1A 4TZDA 2WZ8A 4HLTA 4CEWC 2X53S 3I2GA 3ZR6A 3RZLA 1K12A 1UO9A 1A8DA 5DUXA 4AI1A 1AXYA 4OHYA 5FK7A 3RNSA 2JB8A 4Z8BA 1X82A 1VE0A 2R043 4LBNA 1FNYA 2XPJA 3QBQA 5M0TA 4JX0A 2ENRA 5FY1A 2BYVE 1A6CA 2WN3A 5FY8A 5CG8A 2LTNA 3B7MA 4BQXA 1QOTA 2X29A 3LA2A 1G86A 3LDBA 1FPN2 2ZCWA 2DYCA 4I3PA 3PLQA 2VCBA 3ZPYA 3GNEA 2JG8B 5D8AA 3FBYA 5FYMA 4RD7A 4H2AA 1PVXA 4ZU7A 1OH4A 2ET1A 2OKXA 2MEV1 1ASJ1 2ZBJA 4XAEA 4XPVA 3POIA 4NN0A 3H8XA 5C3RA 3KF5A 4B3NA 5J3UA 1ODNA 1QJY1 3WVJA 3OEBA 1DP0A 2Y6JA 3K46A 2FD8A 1YQ6A 2EAKA 1R093 2A71A 1RUE3 2HWD1 4W6WA 1KJLA 4COWA 4XIOA 2XLAA 4GJYA 2EXIA 1LU1A 3AKTA 4IL7A 4LBMA 3X29B 1AR92 3I97A 2V5YA 4OHVA 2YXSA 3W59A 2RR11 4PBPA 3M3QA 3ZKYA 1RUJ2 1UPSA 1W3VA 2IVJA 3OBAA 4Y1VA 3JBG1 4AQ2A 3J9SA 4R9CA 5ABJB 3U4XA 4YNIA 2BFUL 4CA9A 1HQNA 5A6QA 4XABA 4DUVA 1VR3A 1W6QA 2F17A 3WW3A 4IE0A 4MZUA 1VB4A 2VC9A 4YFZA 1QKQA 2VMHA 5GZDA 3WXPA 4CDUC 1EUTA 5F7UA 4IEUA 3KQRA 5FZ8A 2QQWA 1JH5A 2KM2A 2JD4A 4PQQA 1RTVA 1RVF1 1N1TA 2DCJA 2WR9A 2J1TA 4L2NA 4E2GA 3KD4A 1RIRA 4IEVA 4D6QA 3ME2A 4LUMA 1OQEA 3MIHA 3AB0A 3I2DA 5BNOA 3VLBB 2EALA 3AP5A 1YI9A 3JQWA 1JYCA 2PHLA 3VBOA 4AR2A 3U11A 5BNQA 2Y8KA 5LBEA 3LEGA 2XMLA 3B01A 4CCDA 4ARXA 1YIPA 4Q2FA 2IUWA 4D7TA 1MEC1 1RJ8A 4RN5A 5JOZA 1WCUA 4LO5B 4LO8A 4JKKA 3ZDSA 4DOUA 1CWPA 5A70A 3GCWA 1WLTA 2YC4A 5I91A 1K3IA 3ZXLA 3ETQA 1JZ5A 3ROUA 4BISA 2CNAA 4Y5TA 1AR71 3POEA 1O5LA 2WSUA 4Y1UA 5FYIA 5FZAA 3W21A 1NKGA 1LHOA 4Y1YA 1F9KA 1VB2A 3AKSA 4KWKA 3LPFA 3CMGA 1X8EA 3C7FA 4XUNA 1TMF3 4XTPA 5J1XA 3WNMA 1QU0A 5BY5A 2BTVC 1XPWA 5KC6A 2GNDA 5GJ6A 3CHXA 4E8DA 4NWWA 4E27A 2WAAA 1QJU2 2K0GA 4BU2A 4HL0A 1ULEA 2DVGA 2I45A 1C1LA 2NZ9A 3D4KA 3FHQA 3VN4A 2VZOA 1FATA 1QGLA 3GM8A 3KCCA 5KHKA 4AZZA 4C1WA 3EMRA 2TEPA 1XB9A 1S0BA 3M3OA 3BTZA 2P4EA 4ARYA 5C9AB 3AXDA 1W6PB 4IEZA 4NAOA 5FZBA 1BQPA 1VBD2 1QOOA 4OI2A 1YRZA 1TME2 4CUCA 1L7QA 3I2IA 5JXGA 1W6OB 5LK5A 1ULDA 3FX3A 3ZMOA 3DF0A 4E4HA 4L8QA 4MVTA 4K1YA 4QGMA 2B46X 3OBRA 1FYUA 3OD4A 1JZ3A 1UMHA 5A1LA 3VGIA 4GA9A 4NPMA 5C8WA 4UW6A 5KHHA 2XHKA 3BOWA 1V6MA 4OQ9A 4B4PA 1V6LA 3NNFA 3SHRA 2VCMA 4E9KA 1QH6A 2CDPA 4UFIA 4C90A 2XG3A 3LFIA 3BVCA 3NV3A 1ZRIA 3VHNA 2JENA 3H7JA 3JZVA 1XE8A 1FOD1 2XVKA 3OPTA 1PMIA 5F39A 4K8RB 1XC6A 1ZZ8A 1RUD1 2ZEZA 4OUEA 4YVWB 4JAAA 1LHNA 5FTTC 5IHRA 3MDPA 3ZYFA 2VM9A 3DXTA 2RS53 3KT1A 3N9LA 1RUF2 4YZ5A 2HEVF 1PO21 1CIYA 2OPKA 2B7YA 5ANNA 4CUAA 1QDCA 4XXAA 1RHI2 1QXPA 1WKYA 4XFHA 4KU7A 3OGGA 3WF0A 1GNHA 2K46A 1FMD3 4OMDA 1ND3C 1BJQA 4QHZA 2VZUA 2VBBA 1UIJA 2Y6FA 2AEZA 4FTBA 2HYKA 2H6BA 1S2EA 3NQHA 5IFPA 1SLIA 1EY2A 2HWB2 4IV1B 4MUVA 2WZPP 4AI2A 2R062 1A78A 4WZFA 1Q8QA 3S7IA 2BUKA 5FDBA 4WM8A 1HJFA 4XMIA 5L7OB 2RM23 1O4ZA 1WD4A 2ZJCA 5F3GA 2GSYA 4QX0A 3I49A 1XBFA 1JOJA 2XH6A 1O3RA 4WM7A 1ULCA 2KXLA 2A3XA 3OGVA 1D0HA 3VBSA 4WM7C 1KJRA 3AVSA 4C91A 4YARA 1WD3A 5FQ0A 3INAA 3R4UA 5F5CA 2NM1A 3VBSC 4BMEA 3VBUB 1YEWA 4QQLA 1C4RA 3RJRA 4D0QA 1IOAA 2OZJA 2P3YA 3KQ4B 3NWKA 2VXJA 3GYDA 3UETA 1CAVB 1UYZA 1UYXA 4L11A 4LBQB 4LA3A 4AEDA 5J36A 3KV6A 2WQ8A 3C7EA 2TUNA 2GNMA 4LK7A 3D5OA 4AEDC 5LWBA 2ZA9A 2QFEA 1PIV2 2VZQA 2A7AA 5A3PA 1H1AA 4W4ZA 4CU7A 4PLNA 2WYSA 3SH4A 5A1FA 1GUIA 3AP4A 3L9JT 4Y1XA 4IEPA 1DCSA 4HSJA 4YW1A 3A21A 2ILMA 2UYBA 4BK4A 1EV12 1LB2A 2XLFA 1AUYA 1PK6A 5GZGA 3A7QA 2OQ7A 3GBGA 1ULPA 3M7AA 1DBNA 3LCPA 3DKWA 3FLRA 2YPDA 3U10A 4XJUA 2YC0A 2RS13 4EN0A 2AENA 3RYPA 2LROA 3RWKX 4CCJA 1M4WA 4FXKB 3PTYA 4HOOA 4N53A 4FPYA 1RUD2 1NCRC 3ON7A 3P5BA 4QXCA 4F3JA 4P08A 1GZ9A 2VUAA 4GB33 2E6VA 4DZGA 1CPNA 4IGOA 3ZFFB 5FYSA 1IG0A 2P1BA 4A6SA 1F4AA 1F5FA 1GMMA 2GC1A 3LOIA 3VBRC 2B39A 3PUIA 1V9U3 2JG9B 1FAYA 4QDSA 2W1QA 3E5QA 4QDRA 1D2SA 1OXCA 1KGYA 2YPJA 3RI9A 1W6MA 5HXMA 1BBT1 4PIXA 1VAMA 1SBFA 2ZEXA 4LIUA 3LZZA 3T0BA 4KWJA 3TRSB 4UFJA 1RUC2 2BVBA 1MQTB 3CEWA 4OI4A 2OYZA 1VBE3 3A0NA 1QEXA 3O1VA 3BN6A 2WA4A 1H9PA 4S2HA 3AFGA 4HKLA 4KQ7A 2ZKLA 3IM0A 1IZ3A 1DF0A 2ZGOA 1VRBA 3OD0A 4PLOA 5C6CA 1SDDB 1C1FA 4S2FA 1BHGA 4MSVA 4W65A 2R042 1ZRCA 2RMU1 2W95A 1W8OA 4BQYA 4YW6A 2B4KA 1QQP1 4KG8A 5D21A 1H8TC 3HN1A 1DZRA 1LTEA 3HNYM 4YVSA 5F1RA 4S2GA 1WWYA 5FP4A 2SBAA 5T5LA 5L73A 1XSQA 1DLCA 1G6NA 2R49A 5KBFA 4YVSC 4RQPC 2ZZQA 2W1UA 3UV9A 2BNMA 5C3SA 1LOAA 3WF3A 1JOPA 4AGVA 4AAPA 1LAJA 1OHFA 1DQ4A 3MW2A 4MH0E 3SKJE 4AW7A 1G9BA 1IQDC 2E63A 4QT6A 1YUDA 3ZIWA 5T52A 4NO4A 2BBVA 3HBZA 5GZFA 5HV0A 4Q4W1 1ODMA 1YYNA 2FCTA 3T4VA 4NMIA 3ZDVA 1H1IA 2WQ4A 3HQUA 4PDWC 5KXBA 2NMOA 2VMGA 1UPIA 2J1VA 3SXWA 2WO1A 3FHIB 4KL1A 1R092 1RUE2 2FZ2A 2DBNA 3FFQA 4QX3A 5FO7B 1AYM3 5EJZB 3ZSLA 5B2GB 2UURA 2WT1A 3LQCA 3AL6A 3NSTA 1ZREA 2YFZA 5DZFA 3NV4A 2OW4A 2XJPA 4CEWB 5GZCA 2BZDA 2XL9A 3SEEA 1W2UA 3GF6A 1JYVA 1BEV3 5DDJ2 3GHMA 1POQA 4YRDA 3C7GA 1BXHA 3U14A 4EYUA 4HXCA 4MV2A 2QQOA 1WW5A 4XACA 3O0VA 5FXVA 1AX2A 2CV6A 2Z4FA 4LKFA 3VV1A 3WG2A 2YC2A 2D43A 3MPPG 1KRIA 4OZOA 1GOFA 2BP6A 2D7FA 2Y38A 1W9YA 2FMDA 1RUG1 1WMEA 5FYZA 1XJAA 3WG1A 2QZ3A 3ZOIA 4CU6A 5LZ6A 3NJZA 4Y5Z0 2C4XA 3IAPA 2W91A 3KLSA 3LIHA 1MS3A 3APBA 1ACCA 2OUJA 3VZMA 3ZR5A 3I3BA 2ADDA 4YYOA 2VBDA 2YV8A 5IVCA 1NE4A 4MADA 3T09A 4CUBA 3V0BA 4DQAA 2RDQA 5C9AA 1R1ZA 2PMWB 5A1AA 3ILRA 4AAXA 1MS1A 1O5UA 5KR7A 4MOAA 1AR61 5EXOA 1UYPA 2PFWA 2VNOA 1V6IA 1QWRA 2WS93 3MW4A 4S2DA 3T4HB 4AGRA 4UBHA 1WW4A 5EJ1B 3O1OA 1CN1A 5FZGA 4CSWA 4M3CE 5FY5A 3IIAA 2YY1A 1BCXA 1TMF2 2BGCA 3ZXJA 1APNA 1L3JA 2ZX2A 4X8NA 3LKJA 5KHJA 4P14A 4NRQA 2EAAA 1HRV3 2AGSA 1PO13 4NIHA 1MVEA 1YJKA 4AEJA 4YZ3A 3ZN6B 4LK6A 2VULA 4CDUB 1UX7A 1GV9A 1W6QB 4CXXA 4HFSA 4LBKA 1GP4A 3OBTA 5A80A 1IKPA 3USUA 1V6OA 2ZMNA 1HJGA 2BBAA 4CCCA 5FXXA 5FMOL 1VIWB 4GMP3 4YVWA 1O3SA 5A3WA 1QJZA 2ZHNA 3R4DB 4PHZA 3ZPOA 1D4M3 2FCUA 4I01A 4SLIA 4MGYE 4N43A 1MPXA 1UKGA 4EN9B 2GH2A 4R9BA 5JSPA 2B42B 3WG3A 5FYBA 2HYXA 1X50A 4C0BA 3AP6A 1H8VA 4QHBA 4EZ4A 4AQSA 4HKOA 4XETA 2EA7A 3ZXKA 5HV4A 2BWCA 1H0BA 4BLIA 4N8MA 3WUDA 4B8EA 2CSGA 5JR2A 2VY0A 2V73A 4AG4A 4CRQA 3UNPA 2JE8A 4P9YA 2YG0A 5C4WA 4P02B 2PHDA 1H2LA 2GC0A 4NPRA 1PZ8A 2F6BA 2QTWB 4Y4RA 3KB5A 4YM0A 5BPXA 5B4NA 1JYWA 5IK8A 1VBB1 1YQCA 4JGYA 5FLHA 5J98B 4AHWA 4FXGB 2EF6A 2DV9A 2JJ6A 5GLTA 1RUG2 4XUOA 4ZU4A 1ALYA 2GC3A 1ZBA2 4JGYC 2B9UA 3NJXA 2VVFA 2Q1ZB 4RR3A 2MPFA 1RUH1 4XDPA 1QHDA 2VUJA 1HRI2 1VRH1 4LA2A 2UWAA 5IVFA 4RR3C 3AJYA 3VBUA 2DTWA 2DDUA 4KH9A 4NIGA 3IB3A 2IVIB 1AL21 3AL5A 2BGPA 3SITA 2ZOEB 5J96B 4DY3A 2UU8A 1W0NA 1D0GA 3I3QA 1W28A 3MLLA 1RUI2 2ZXQA 1UXZA 5FZOA 4E2QA 5I93A 2WNUC 3N9MA 1JXNA 4TLGA 3ACIA 3VD3A 1GWLA 1JTZX 4LBOA 4YGDA 1IHMA 2JE9A 3BPSA 3NJVA 2RM22 4IUGA 2VXRA 3P6BA 4ONUA 3VDBA 5BNPC 4NOTA 3RYRA 2V5DA 2HWF3 3LEMA 3MPBA 3WQ1A 5ACA1 4R52A 2FZ1A 1G9CA 3J7HA 1CAXB 2NMNA 3AMNA 2W1WA 4FPGA 4XFCA 2YFUA 3UL2A 4OQ8A 2VUCA 4XJ9A 3KGLA 4QKFA 2Q5TA 1VMFA 4D6SA 1SLCA 4NR1A 2OIIA 1OSGA 1X8MA 3WW1A 1EYBA 1MZFA 4Q8KA 5A3MA 3SMHA 4DFSA 2FMYA 2RHPA 5IK7A 3GZAA 4JQTA 4M0HA 3ZN5A 1CJDA 3MIEA 3ZXEA 1W05A 2D6MA 5A3NA 2RE9A 1SDWA 3N3HA 1LOCA 2P3IA 1SFYA 2PHRA 4LQRA 4YLZA 3MZHA 4N90A 2J1EA 2VMIA 3FLTA 3U1XA 3ZM8A 4BIOA 5LA2A 1J1LA 3FZ3A 1ND3B 1OH3A 4XFAA 1DFQA 4YW5A 2JG9A 3S30A 3VKOA 4BHPA 4CDXA 4CCNA 2DTYA 4YW3A 1WCDJ 5LY2A 3WQBA 4C1XA 3I2KA 2PA7A 4CDXC 1FPN1 4LEJA 3URFA 4PBOA 4UFKA 1W8HA 3H7YA 2P5BA 4AHXA 1LHVA 2XJUA 4XOGA 4GH4A 1LNSA 2R16A 2PLV2 2RS12 5C3QA 4L97A 2QCSB 2ZGKA 4OMCA 2CGOA 3BU7A 4GH4C 4RGKA 4XUTA 2B45X 1NQJA 3GALA 4UF0B 4JZRA 2PAKA 4TYSA 2TNFA 1VBB2 2FHRA 2VCAA 3IDAA 3LEKA 3N7KA 4G3YC 4QQOA 4GB32 5EP9A 2LRPA 1C8M3 4GWNA 2ORZA 4WM7B 1CQ9A 3IMNA 2VUDA 4JKLA 4QXHA 2Q8OA 5DAVA 3PUQA 4MGKE 4M0NA 4QXKA 3IBMA 3VBSB 4COZA 1J59A 1AR91 3I59A 1V9U2 3I8TA 4BXFA 4R4ZA 4DIQA 3VBFC 5CISA 4I0AA 1STMA 1Z78A 3UGFA 1RUJ1 4N7IA 3WP4A 5CKMA 5LRSA 4NHLA 3ILFA 1UD1A 2PAMA 1ULOA 4LPLA 3B94A 1MR5A 4LLFA 4FFFA 4CP2A 1U5YA 2ZGRA 4XF4A 4AEDB 2DUQA 1HKDA 1QOSA 1GSLA 2Y0IA 3HT2A 3NL1A 3NKTA 3AKRA 1VBE2 5CFDC 4XF0A 4P9LA 3ZYIB 3DN7A 1JW6A 4XUQA 5A7QA 1V0AA 3I3MA 1XNDA 3PJYA 4J1WA 2CAUA 3IDEA 5FXZA 3NNJA 4AVTA 2JXAA 2WUHA 1KQRA 2WLPA 2D44A 2WYFA 3LA7A 1EAH2 3P3PA 2J1UA 3NKGA 2RS33 1X9TA 3CIHA 1WCKA 1XU1A 1IPKA 3BODA 3CDZB 3ZO0B 4A6OA 1ZZBA 1IPSA 1K45A 4KBBA 3AMMA 1AR82 4UT5A 4P9WA 1FOD3 2VQUA 1OA3A 1PK6B 2ZX0A 4AOCA 1ND2A 2VJXA 4FI9A 3R0RA 4LBLA 4CEWA 1UKRA 1UWWA 2WO7A 2XQXA 5A33B 4META 1ND2C 4J1XA 2X5IC 1R1A3 1ZZCA 2J1SA 4Q29A 3WF4A 1OPMA 4N53B 1H2KA 2W87A 1OUSA 2P17A 3HT1A 3TEXA 3ZN4A 3GZTB 1CONA 3NAPC 3PHMA 2D98A 4RYDA 2A6XA 3M3IA 1YFWA 4L9BA 5DUUA 4MHRA 1HW5A 2OXBA 2J22A 3MW3A 3C8XA 5JIAA 1UF2C 1GZCA 3HD8B 1RMU3 5FV3A 1C28A 3TN92 2HWC2 4QGLA 1C5HA 5C70A 3I54A 5T3NA 1QJU1 2PHWA 5LBFA 1W6MB 1X36A 3J4UH 3HR9A 2C6SA 2VOWA 1W9SA 3OGRA 1AJKA 4WV8A 3WDYA 1V70A 1VALA 4QPGC 1OLQA 2WBKA 1DGWX 4AFBA 4ES9A 4FBFA 3EBRA 1MS5A 1VBA3 3ZFGC 4CCMA 3VUOA 2HBTA 5EPAA 3LOBA 3OYWB 1PM4A 1Y9QA 3TNQA 4AVSA 3GZEA 4EWAA 1VBD1 1RITA 4LHNA 1TME1 5DAXA 1XNBA 3UT0A 3VB9A 1BYHA 3OEAA 1ZRFA 4IV3A 1DQ2A 4QX8A 1GYKA 4CEYA 1M06G 4IESA 5CU1A 1OOPA 2VNRA 3DYPA 1ENRA 2K9ZA 4WVZA 1PGL2 1FV3A 4IV3C 4CDQC 1WLCA 2JECA 4CEYC 3PVEA 1WCQA 1OOPC 4GZ9A 4X6RB 4XBQA 2YUEA 5SV5A 5KHIA 3FWEA 4YVSB 5FZ3A 2KA3A 3L2HA 4XMAA 3CU7A 2BFUS 4JHZA 3HNBM 3ZN6A 4FPHA 4Q4Y3 1J58A 2ZKNA 3RGBA 4CDUA 5IVEA 1BVVA 2ETEA 1W39A 3VL9A 2BDRA 2DU1A 3DPRC 3IT8A 3MF9A 3VKNA 1DQ6A 1AX1A 2XQRA 2NN8A 4MGZE 1ONAA 4H14A 5DXDA 3THTA 4QPWA 4OVEA 2VVEA 2VZPA 3RMYA 3RPQA 1JHNA 4BQ4A 5F2WA 1U5XA 4IEXA 5A7OA 1LHWA 4LJHA 1RUF1 5FMCA 3QD6A 1OD3A 4BQ5A 3N9QA 3MFAA 5GLVA 4ORFA 3NO8A 1UOJA 2Y33A 4UYBA 1T6BX 1NUKA 1RHI1 1RXFA 1TQ5A 2F4LA 3LFMA 4GD4A 4PIZA 4XHBA 4XYXA 4COUA 4HANA 3U07A 5FOJB 4Y4YA 1H2MA 1HN1A 4XF1A 3RYKA 1F31A 5FZIA 1GWMA 2OA2A 1RL3A 3KV4A 5A3UA 3M3CA 3AM2A 2HWB1 4GKXA 4FOWA 2VTXJ 3V65A 1IQAA 2PHUA 2R061 2VOTA 5CADA 3PUAA 4JDOA 4JHTA 4LMFA 2BU9A 1BZWA 5EYYA 1OVPA 1CR7A 2K2SA 1OMIA 2R6QA 2Z79A 1F15A 1ZX5A 4FQZA 3THDA 3J8F2 2RDRA 1ULFA 4Y20A 5JXIA 1UZ0A 3BKZA 5FBJA 4UBGA 3WDWA 3F2ZA 4MGQA 3D3AA 3PU3A 1ENQA 2G9GA 4YZ4A 4RHV2 4JDNA 5F5QA 5IJRA 1WMDA 4Q4V2 5DAWA 2FDHA 4BJ0A 1EPZA 4IERA 2QDNA 1B35A 4EWEA 3H8UA 4FAHA 5IT6A 3LEIA 1O8SA 3EB7A 4AI0A 4BOWA 5CBLA 4XFBA 1POV3 3V0BB 1B35C 3UJOA 4P9XA 1H9WA 2MHFA 5A32A 3CJIA 4MYEA 3KCYA 5KHGA 3RZMA 4K1ZA 3CO2A 5AFEA 4GMP0 4JGZC 3U75A 3A0KA 3B69A 3H3UA 3HQXA 1VMJA 3CJIC 3KS7A 2W47A 4MXWB 1QQP3 4UXAA 4A44A 5AC92 1PIV1 1UMIA 5K9YA 3TB0A 3ZSJA 4AE2A 3BPZA 1F5JA 1WBLA 5D1IA 3BOPA 4B29A 3AKPA 2Z5WA 4Q4X2 1R083 5FYCA 1LR5A 4R9AA 5K0UA 1P8JA 3B3QE 2Q1FA 2IXCA 5CYYA 4AQTA 1CAXA 2ZAAA 1EV11 4LKSA 5K0UC 5I0SA 2AR6A 2YBSA 3W9AA 5BNNC 5F6LB 4AXOA 3K75B 2RJ2A 4XVHA 3MIBA 4Q4W3 3GBFA 1ZA7A 2W3JA 2BV4A 1GBGA 3FBMA 3USUB 1QNWA 3ZYJB 1C3HA 3HOBA 2D6OX 3ZFEB 3V64A 2P34A 4IGQA 1JU4A 5H9QA 4NIDA 2EXJA 1RGSA 3O5SA 3AZYA 4FTEA 3DKQA 1MACA 4EZHA 2AACA 3WHTA 3K2OA 3AXEA 4OHXA 1NA1A 1DQ5A 2CTVA 1VMHA 3ZXGA 1HX6A 1YQ8A 5EQUA 3PNAA 1IS4A 4LLOA 4AFDA 4N43B 3JD73 4ZZ8A 2YGLA 1NA1C 1HXS2 1ND3A 4BZ4A 1KEXA 1NZIA 2HWF2 4NVPA 2XL7A 1LGBA 4XF9A 2Y6GA 4FFGA 3TEYA 4ZHNA 1REFA 1ZA4A 3EQEA 1DYPA 3POFA 3EO6A 3WQ7A 2E7AA 2VTXA 3WDTA 2DU0A 1W99A 2LALA 3H1YA 4R8HA 4XCAA 5IWFA 3RFRA 1LKNA 1PZ9A 1RUC1 1E5HA 4DS0A 3DL3A 5C4WB 4XEZA 2XVGA 3TOJA 3ACGA 5I0RA 2E51A 1CAUB 4W8JA 4Z07A 4CCEA 4U2AA 4MXVA 3KHCA 1FV2A 4MHUA 4UF0A 3LSDA 2WZR2 1QJX3 4JGYB 4K3UA 5AC93 2BQPA 4BE3A 5IK4A 1XU2A 2O8OA 2R041 4OLLA 2VE1A 1T6GC 4K21A 5C3OA 4RA0A 4AL9A 5I0TA 4B4RA 4HZFA 4RR3B 1JS9A 3ZSEA 4Q8LA 3RJ2X 2D5HA 3FHAA 3T1MA 1URXA 4JTNA 3SNMA 1REDA 2ZS6B 3AP7A 5F6KA 4KGQA 2W5FA 1NOVA 5LATA 4AVCA 2F4PA 2XUMA 1S0IA 3N7LA 4IEWA 1LEDA 4CYDA 2WNUB 1OVSA 3A22A 3R05A 3SQOA 1DU3D 5FUNA 1XSRA 1CAWB 3J26N 5FZOB 2I07B 2ORXA 3QACA 1I1EA 1DGRN 1MS9A 1YXWA 2IXIA 3L2YA 4IW3A 1HN0A 3O12A 2BNNA 2CGNA 2GH8A 1ZZ6A 1MVQA 4UW4A 4Z2AA 5HPOA 1G7YA 1JU3A 2WJSA 3IKWA 1ZYBA 1C8M2 4KWLA 1R091 1ZM1A 4PI0A 1RUE1 5FZ6A 1K5JA 1ST8A 2R073 4NRPA 3BCWA 1JYIA 4I02A 1Q8VA 2GN3A 3FJSA 1WW6A 2W46A 3J7NA 4HPKA 5FCCA 4E4ZA 3HVDA 3FL7A 5FUIA 2W92A 4YSFA 2VL4A 2YBPA 5FPBA 5FWJA 1C5IA 1GANA 5A33A 4CU9A 1OD5A 5DDJ1 2JWPA 1NCRA 1VBC2 1UNBA 3ABZA 5TSWA 2NQYA 3H0OA 1NX9A 4Q0UA 2DWRA 1PVC3 1RUOA 5GM0A 3VZLA 3O0WA 4W50A 2WZEA 2ARBA 4A45A 1UY0A 3FLPA 4ASMB 3VBRA 3D0SA 3H3ZA 2KR2A 5A7WA 3Q8EA 2WIIB 2O8QA 2PN5A 2QQLA 1IS3A 1MZEA 4XFFA 5C5TA 2WFF3 5KXCA 4K6BA 3TAYA 4MLOA 3DECA 4CDXB 3USSA 3ZYHA 2QQMA 1GWKA 3J7MA 1AF9A 1G8WA 1Q8PA 2A3YA 2ZGTA 1CZVA 2QUOA 3ETPA 3GGLA 4JC1A 2XBO2 3K4AA 3OSDA 4R4XA 3WNKA 1JHJA 5HCAA 3WV6A 3VD7A 1VAVA 1WA6X 5JAXA 1Q43A 1Q8OA 2QQUA 2XJTA
chains in the Genus database with same CATH topology
2BWAA 1U0AA 4GH4B 4EN7B 1R1A2 4GULA 3OYWA 3AZZA 3JCIA 2JDZA 4KU8A 1RUH3 3IWZA 3T1LA 1FX5A 5BV6A 4I2OA 5E1RA 1AXKA 2C0ZA 1H8TA 5DG1A 1TMF1 2RJLA 3PMSA 3LSEA 3WDUA 1RMU2 4KG0A 2R32A 3OY8B 1QXRA 2R1BA 2ZGMA 3I59B 3RG0A 5LEKA 2VPVA 3VZOA 2XKPA 4RQPA 2XJQA 2JG8C 2DFBA 1NXMA 2GMMA 4AK3A 5JOXA 3SLIA 1FNZA 3MEPA 2NP0A 1LENA 4HBNA 4YG3A 4TLFA 1DDLA 4XFIA 2PHXA 1VBA2 2PHTA 5H9PA 4PDWA 4P9IA 4XHXA 3ZIXA 4I30A 5HXVA 2ZX1A 3ES4A 1SMVA 1D2QA 4XJAA 4DB5A 2Q0AA 1AYN3 3CL1A 2CWMA 4YGEA 4HT1T 5FO8B 3VL8A 4GIQA 3MF6A 5ABJC 1YHFA 1UMZA 3K51A 3PVOA 1ND2B 1XQNA 2WNVC 3WUCA 2X5IB 4M3CB 2HKXA 3KCXA 5JIUA 1S55A 3NAPB 4Q0PA 1RUNA 3EHKA 2HWE3 4PF5A 1CGPA 5K8SA 1IS5A 1NG0A 1LOBA 2EXKA 4LHKA 4L99A 4PQ9A 1Z7S3 4ATFA 1J3RA 4CTEA 5HI0A 4LE3A 3R6SA 2E7QA 1FPN3 4A7ZA 1ZBA1 3E97A 2QKDA 2W0XA 3WCRA 1ZRRA 2D5FA 4MGIE 2ZTNA 1COV3 4L92A 2JEMA 2WINB 4QX5A 4BMBA 1SEFA 5E89A 1GNZA 1HRI1 4QPGB 3ZFGB 2YZ4A 1Y7BA 3SH5A 3ALQA 4FPLA 1RUI1 1GKBA 2D97A 3A4UA 3ES1A 4MXWA 3ZXAC 4GKYA 5SV8A 2WT0A 1ZBE3 3WNXA 1AR93 5KWRA 2ZAHA 4HVQA 2QVSB 1XE7A 2RM21 1RUJ3 3D8CA 4IV3B 4CDQB 1NE6A 3M1HA 3RZZA 3OCPA 4CEYB 1OOPB 3ZMNA 2R0HA 1OPOA 1RJ7A 2BW8A 1U5ZA 2Q1MA 4XIKA 4OULA 1UU6A 4YZ2A 5HCBA 3HIFA 2QZ2A 4ES8A 4YG6A 1OFNA 1UX6A 3H1WA 2BNOA 2D93A 3TBDA 5FMOS 4DMIA 3C2UA 3QOPA 1PGW2 3FFZA 3WW2A 3SCHA 4IEOA 1HV0A 2CL2A 1GQGA 1U5IA 1AHSA 3G7DA 3V56A 4DRVA 4AI8A 4V1PA 3LB9A 4QPYA 4XJ8A 2JX9A 1R082 4H7MA 2Z2SB 2A73B 4WVWA 1KDMA 4RGGA 1POV0 1AXZA 2ZGNA 3H1MA 2W68A 1NCQA 4B7EA 2PQQA 4DXZA 1NCQC 1OA2A 2PLV1 2RS11 2MNGA 2UY8A 2VGDA 5T50A 1CAUA 4HKWA 4IEQA 3JQXA 2VU9A 4LO7A 4CZSA 5JPMB 4Y20B 4GB31 1UL9A 4OUSA 2RS52 3VBHA 3ILNA 2VOXA 4DRRA 3AX4A 2DVDA 3JD72 3VBHC 4AWDA 3OPZA 1MZ5A 1V9U1 5CFCC 1B35B 3KM5A 2MEV3 1ASJ3 2DVAA 1FMD2 1RINA 1VBD3 1LECA 4K7JA 4OHZA 3UJQA 1QJY3 4JGZB 1GQHA 2Z42A 5HCFA 2WNUA 3CJIB 4H7LA 5A32B 3S0MA 4RFT0 4D69A 5T5OA 1CAWA 2HWD3 1VBE1 5L7OC 4JV4A 1SFNA 1PHMA 3QH7A 1XNCA 2RR13 2SLIA 4RSUA 2GMEA 5BNPA 4LT5A 5LEJA 3JBG3 1EAH1 1JBCA 1V6NA 4CP0A 4KNCA 1BK1A 5GLWA 5FRAA 5K0UB 2XKOA 3AKQA 1AR81 1DIWA 3JUUA 1E57A 2CAVA 2ZMLA 1XYOA 2WSVA 1RVF3 1GZWB 3GZUC 1LESA 4XILA 1KD7A 2XJVA 1AVBA 3RMXA 3ZXDA 2NLRA 2D6KA 1VJ2A 1UN1A 4DINB 4XFGA 2XGXA 3ST7A 5CAZA 3LAGA 3E6CC 2XWBB 2ZHKA 2HEWF 2JE7A 1QMJA 4OZXA 2AUYA 3VDDA 2JICA 3UKVA 3NV2A 4Q26A 1NA1B 1WBFA 1YWKA 2ZHMA 4K40A 3VDDC 2VOVA 1MEC3 4FO9A 4X6QB 2IFRA 3AYEA 3WR0A 3TN91 2HWC1 4FPEA 2QE3A 2R063 3M4FA 1FI2A 1XRUA 2R072 1N1VA 5JCTA 2BVVA 2PAEA 1AR73 1GR3A 2W39A 1QF3A 4COVA 1RB8G 3KZ4C 2H0BA 3QH6A 2DVBA 5EJ3A 4DNYA 4AGGA 4Z82A 2XLGA 1BEV1 4Z92B 2GZWA 3WINE 3N35A 3PJQA 1PVC2 1K5MC 2DUOA 3ZFFC 4CDWC 5EYXA 1N1YA 2WWSA 3B9CA 1YFUA 1YIFA 1MS8A 3WDVA 1V6JA 3IN9A 2WKKA 3AZVA 1BVP1 1BMV2 4DPNA 3VBFA 2WFF2 5C8CC 1ZRDA 1PGL1 3OY8A 1S0CA 2P3JA 4LE4A 1LU2A 1LOEA 3CF6E 5JI9A 1QH7A 3JU9A 4RS5A 4BH9A 3LGRA 4BIFA 2EIGA 3I4IA 4RS5C 2GNTA 5CFDA 1TNRA 3MFCA 1HLCA 3W58A 3M3EA 3WHUA 2D6NA 2A5ZA 2GAUA 1AJOA 4YM2A 2VH9A 2G4IA 4JTOA 4XXPA 3D0JA 2VQAA 3UKNA 3AP9A 4I3GA 4D3WA 4GALA 1NQDA 1WA4A 5GALA 3O14A 4QPIA 2ZACA 3KMHA 2GNBA 3AMHA 4IQPA 4JCKA 1N3QA 4QPIC 2B5HA 4HPKB 1H1MA 2O1QA 2ZGQA 3O0XA 1RUD3 1PO11 3WP5A 2X5IA 2E7TA 3MI8A 4M3CA 2TBVA 1ZZ9A 4OUMA 1NCRB 4LTAA 1PO23 2H6CA 3NAPA 3RQ0A 1H4HA 1TE1B 1OKQA 5DUWA 3GBWA 2AZ5A 4INDA 1J3QA 3VBRB 4AFMA 3DV8A 4GMP1 2Y0OA 2D6LX 3J8F1 4F8AA 2P2KA 2LUWA 4X8PA 2VOKA 3M70A 1O3QA 1JUHA 1AYN2 1NZCA 2WLQA 4LBJA 1YO8A 4IETA 4RHV1 3AJZA 4Q4V1 2DUPA 4N9HA 4FTSA 1ZVFA 4QPGA 1AYM2 3ZFGA 2QJVA 1C57A 4NHMA 4G4FA 1YFXA 1XXNA 3WDXA 2IXJA 1BEV2 3RS6A 3POWA 1TEIA 1G9FA 1F8VA 5AC91 2HWE2 5J7MA 4SBVA 3N4MA 1OA4A 2WA3A 5JMCA 4CDQA 1ENSA 1H8TB 1KS4A 1Z7S2 1EPWA 4Q4X1 2OVUA 1DGWA 1H2NA 4WVMA 1QDOA 5JOWA 3AYAA 2AYHA 2XWJB 3RRDA 1NY72 4RQPB 1YJLA 1COV2 2GALA 1Z0HA 2EXHA 2D3SA 5D8AC 3M2MA 2VNGA 3DPRA 3G6JB 5KXDA 3RWNA 3ELNA 5T55A 1OFSA 1NLRA 3IPVA 1XNKA 4PDWB 4P9JA 4ISQA 2A6WA 5CIRA 5C33A 1OQ1A 3VZKA 5J48A 3SISA 4EN6B 1ZBE2 4YG0A 5JR7B 2WS92 3AYCA 1HXS1 4LO4B 1AZDA 1KDKA 4BWOA 2HWF1 2WNVB 5DDJ3 5JOYA 3B5LB 1WLDA 4XQ4A 2GC2A 4ZXKA 2B8MA 1HRV2 1PO12 4PLMA 3ZSKA 1RC6A 4ASLA 5CA6A 4OI0A 2DFCA 5FREA 4AFAA 3AFKA 4Z2WA 2Q30A 3FUOA 1SLLA 4QMAA 3KSCA 1ZNPA 2VQ0A 3ZSMA 1KXGA 5AFBA 4PCRA 3E5XA 5I0UA 1UW8A 4AVVA 2WZR1 5BNOC 2A3WA 4F7ZA 5A3LA 1BBT3 3ZYRA 1D4M2 1B09A 3VBOC 2GU9A 5FOBB 3WLUA 4HETA 1I6XA 2IXKA 5FBZA 3NV1A 4Q27A 1LOGA 4ZKTB 1WW7A 4Q0SA 1ZZ7A 4EN8B 2P3KA 1WLWA 3GHNA 3ZYGA 1YFYA 4W6YA 3TNPB 1DGLA 4JGZA 1O7FA 1NXD1 5EZWA 2RMU3 3JB8A 4LNVA 1DQ1A 4HMZA 3UKTA 2GDFA 1SBEA 2FQPA 1SLAA 4HN0A 4D94A 5E16A 4FOVA 1C8M1 2IZWA 3IDBB 3WOGA 1DZTA 4FPCA 1UZYA 1KFUL 5BNNA 4O9GA 3N36A 1X33A 2GMPA 4N7UA 1GZWA 2MEV2 1ASJ2 1VLNA 1S1AA 1CPMA 1WGPA 1O4TA 2E53A 4FPFA 1DGRA 1VP6A 4AEMA 1QJY2 4QQ2A 1A8MA 4E2SA 1VBC1 4Y26A 5E88A 4AQ6A 2C9AA 1UIKA 1CVNA 4D7YA 2OUHA 4AI3A 2HWD2 2VG9A 3S6PA 1Q56A 2NPIA 3HMYA 4FVVA 4QQHA 5FAXA 1XYPA 3VHRA 2RR12 4QM8A 3DGTA 3JBG2 3WQ0A 4BPZA 3IDCB 2RS31 4B7KA 1JUIA 4FAGA 4W6XA 5FLIA 2XBO1 2UY9A 1KFXL 2ARXA 1NCQB 1I5ZA 4YGCA 5LRRA 1RVF2 1KS5A 2DURA 2CGPA 4H55A 5EFUA 1RUG3 2ZHLA 5JDBA 4BLJA 1R1A1 3V0AB 1ZBA3 4EROA 3ZFEA 1W6NB 4ZU5A 2N7GA 4XDQA 1D4VB 4H3WA 3ZFEC 2ET7A 1HRI3 1XYNA 3VBHB 2QQPA 2DCZA 5CFCB 2VW0A 3MLJA 1MEC2 1RMU1 4CP1A 3C3VA 4XF3A 2ZGSA 4PIYA 2A75A 1PNGA 2QNKA 3OJBA 4YW4A 1RUI3 2ZX3A 4QGNA 1AR63 5DZGA 1H30A 1AR72 1WMFA 1YCIA 1AL0G 2YDEA 1ENXA 1NYWA 1YNAA 2CWSA 3FUQA 3R4SA 1I3HA 1VBA1 4WM8C 1HV1A 4YM1A 5E8AA 4E4DX 3RI8A 2BEOA 1LULA 1LODA 3KT4A 3MICA 4PJYA 1G9AA 3SCGA 5BNPB 4RGAA 4TSVA 1EP0A 2C1FA 1HDKA 1UAIA 2YGMA 1N1SA 4BM8A 4XTMA 4XJWA 4GXLA 4LULA 3VZJA 4XQDA 4KGGA 1LHUA 1V00A 1AX0A 1UZZA 3WG4A 3MGUA 4Q4Y1 5JSRA 5I8SA 3VKMA 2G9FA 4XBLA 2I74A 3VDDB 3BB6A 1DQ0A 2R0FA 1PZ7A 3E6BA 3MIFA 2A6ZA 4XJZA 4EV0A 1CJPA 5JZGA 3ZVXA 2PYTA 1REEA 2RS32 3N7JA 2ZZJA 5JZGC 1PGSA 1PK6C 2LM3A 3ZXFA 2GN7A 2PLV3 4Y22B 3D6EA 4IXLA 1FOD2 4FOYA 3H50A 1MS4A 3JB4C 3TYJA 1VBB3 4BYYA 4N53C 2NYYA 1K5MB 4CDWB 5LK7B 1PO22 1LGNA 4K8FA 4AHZA 4XBNA 1LOFA 5C8CB 1VRH3 4HN1A 2ZGUA 4LBQD 1AL23 1LOFC 2WFPA 3VBFB 4A7KA 1J3PA 1HIXA 4M00A 2JG8A 3TWIA 1S0GA 4RS5B 2ZX4A 1OI6A 3B00A 3MLKA 1S0DA 4M01A 2W08A 2HJIA 5BXXA 3KGZA 5FLJA 1N3OA 3B93A 5CFDB 2ATFA 1POV1 1S0EA 2IXLA 2W52A 2Q4SA 1EAH3 5GLZA 4LO6B 4N9IA 4FT8A 1SCRA 3S7EA 2IFWA 5ACA3 4B4QA 4Y24A 1DLLA 1AR83 3P3NA 1PGW1 2C5DA 2PTMA 4R9DA 4QPIB 1SACA 5IUQA 3AMPA 3M8LA 5ABJA 3AK0A 1R081 2WNVA 2AH2A 1IS6A 4G9SB 1GFF2 1Q8SA 4Y1ZA 4LR4A 4WBBA 5DZEA 1FXZA 1QNYA 4Q4Y2 1MS0A 1WUVA 3E6DA 2E9QA 4GWMA 2V09A 4P9GA 3AZWA 3TN93 2HWC3 3SH3A 5T5JA 2WNEA 2WQZC 1O3TA 2IWGB 4YFWA 2RS51 5JPNB 2PELA 3ASIA 1OQDA 5HBAA 4UW5A 4I09A 2YROA 3JD71 5GKAC 1W0PA 5FPZA 4E4SA 5I8YA 3K48A 4Q0VA 4FQ4A 5FPXA 1IGOA 1G9DA 3NVCA 4JRLA 3WT3A 4A7YA 1FMD1 1HQWA 1V6KA 1W0OA 3WD5A 2VW2A 5T5PA 4QQPA 4WZCA 2YHJA 3RDIA 4ATEA 4JRAA 1UU5A 2P37A 4M3CF 3POYA 2A6VA 2JKBA 1N47A 3WCSA 4UW3A 1QJX1 4D7SA 3FMGA 4YM3A 2RJKA 4WVMB 1BBT2 1ULGA 4FCAA 4J6GA 3ZX7A 5D8AB 2CY6A 3VZNA 4BCUA 3DUIA 2WC2A 1W6PA 3NW4A 3DPRB 3WZ1A 2BPA2 5C9AC 3WP6A 1X7NA 5KC5A 3ECQA 3ACLA 1S0JA 1W6OA 3IPVB 4Q1PA 2RMU2 2YYOA 3ATGA 1UCXA 1QQP2 3KT7A 2XJRA 1O4YA 3POSA 3VKFC 5I8TA 4AEKA 4NWVA 2ZABA 4RL7A 1CD3G 3OTFA 4FOQA 2ERFA 2R071 4XE9A 5BUVA 1SLTA 3T2TA 3J8F3 1SQ4A 3Q9OA 4Q4W2 2D3RA 3CLPA 4YVWC 2I2SA 1LGCA 5BNOB 1IPJA 4IEYA 1Y3TA 3V0AA 1BKZA 1W6NA 2DCTA 3HAGA 3VKLA 1PVC1 1LRHA 4RHV3 5H9SA 1QJU3 4Q4V3 2R30A 3QLQA 1SCSA 3VBOB 4N43C 1JN2P 2DCKA 2DVFA 4TWTA 4JDMA 1Q3EA 1VAKA 4COYA 1BMV1 5CFCA 4DY5A 2WFF1 3BALA 3AMQA 4IV1A 3H9AA 2OZ6A 3UK9A 1TNFA 2FBEA 5JLVA 4IV1C 1I9RA 1Q5OA 1TME3 1OLRA 2WT2A 3WW4A 5AC93 3PVBB 2H0VA 5C4WC 5L7OA 2YMZA 2A70A 1DHKB 5CNAA 3AYDA 4HSLA 4Q4X3 4YGBA 4XZPA 3OF1A