1EYBA

Crystal structure of apo human homogentisate dioxygenase
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
439
structure length
419
Chain Sequence
AELKYISGFGNECSSEDPRCPGSLPEGQNNPQVCPYNLYAEQLSGSAFTCPRSTNKRSWLYRILPSVSHKPFESIDEGHVTHNWDEVDPDPNQLRWKPFEIPKASQKKVDFVSGLHTLCGAGDIKSNNGLAIHIFLCNTSMENRCFYNSDGDFLIVPQKGNLLIYTEFGKMLVQPNEICVIQRGMRFSIDVFEETRGYILEVYGVHFELPDLGPIGANGLANPRDFLIPIAWYEDRQVPGGYTVINKYQGKLFAAKQDVSPFNVVAWHGNYTPYKYNLKNFMVINSVAFDHADPSIFTVLTAKSVRPGVAIADFVIFPPRWGVADKTFRPPYYHRNCMSEFMGLIRGFLPGGGSLHSTMTPHGPDADCFEKASKVKLAPERIADGTMAFMFESSLSLAVTKWGLKASRLKSHFTPNSRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords HOMOGENTISATE 1,2-DIOXYGENASE
publication title Crystal structure of human homogentisate dioxygenase.
pubmed doi rcsb
source organism Homo sapiens
total genus 94
structure length 419
sequence length 439
ec nomenclature ec 1.13.11.5: Homogentisate 1,2-dioxygenase.
pdb deposition date 2000-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04209 HgmA homogentisate 1,2-dioxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1eybA02
5JSOA 5EZWA 3I7DA 4XF0A 3ES1A 4HLTA 3S0MA 3OD0A 3RYPA 3NKTA 3NL1A 5C8WA 4IEZA 3GYDA 2VPVA 4D7SA 4HVQA 2H0VA 4XF4A 1DZTA 4WBBA 1NE6A 4HVOA 1JUHA 3O14A 4Q29A 3LAGA 4JV4A 4IEYA 2FQPA 3NVCA 1FT9A 2Q0AA 3FHIB 3H3ZA 4FAGA 5LEJA 1NXMA 4IEQA 3EQEA 2EA7A 1QXRA 4IEXA 4YARA 1XRUA 4IETA 1RTVA 4E2GA 1EP0A 3EJKA 3DV8A 3BPZA 4XETA 3FX3A 4MGIE 5LEKA 2GC0A 3EHKA 1CAUB 3DN7A 3RYRA 4Q0QA 3B02A 1OMIA 4FAHA 4P9GA 5BXXA 3R6SA 4IEVA 4WZCA 3HT1A 1CAUA 2QJVA 1LB2A 2EVXA 2HJIA 3U0ZA 1RUOA 4XFHA 5FCCA 1NYWA 1FXZA 1OD5A 1GQHA 4QXKA 5JAXA 1WGPA 1YHFA 1U12A 4JVAA 3BU7A 3CEWA 2ET7A 3NJZA 1J1LA 2QNKA 3QACA 1ZZ7A 4MX3A 2B5HA 3CF6E 1FI2A 3LA2A 1RL3A 4LUMA 2GC2A 2XLFA 3E5UA 4UBGA 1EY2A 1NZCA 2KXLA 3UKVA 2Q4SA 5FPXA 3BB6A 4QMAA 2UY9A 4AQ6A 3VHRA 3I59B 4GULA 5FLJA 1O3QA 1O3SA 3MDPA 3M70A 5I0RA 5E16A 2UYAA 5J48A 1ZRFA 3I59A 1Q43A 1LKNA 2OYZA 1J58A 1YUDA 4ORFA 2VECA 4AXOA 1Y9QA 1PMIA 4QM9A 4IESA 2WC2A 5BUVA 5FPZA 3H1WA 3OGJA 4MH0E 2ET1A 4IEOA 2O1QA 4XFCA 4ZU4A 5J3UA 4XF9A 3DL3A 5I8TA 2PQQA 5BY5A 1IPJA 2MNGA 4I01A 3I54A 2CGPA 2PFWA 2D93A 2MHFA 1WA4A 1ZZ6A 2ETEA 4XFFA 3JZVA 1TQ5A 1UW8A 4RD7A 1VR3A 4R52A 1CAVB 4CYDA 1UD1A 3H50A 1PM7A 2H6BA 4XF1A 2N7GA 3GBFA 4EV0A 1CAVA 4L2NA 4XFAA 1H1IA 4Z07A 5I91A 3E6BA 2QDRA 3RYKA 3SXWA 2O8QA 4KU7A 1QWRA 4META 3DKWA 3U11A 3CO2A 2BYVE 3KMHA 4J1WA 3H9AA 4HMZA 2ZKLA 1LR5A 2PHDA 3TNPB 4ZU5A 2IXJA 1DZRA 3IWZA 3OTFA 3MPBA 3LOIA 2XKOA 5CADA 4EWAA 2ZCWA 3H3UA 1YFUA 4MUVA 3FFQA 4DINB 4J1XA 1ZZ8A 4HN0A 4YSFA 4F7ZA 2EAAA 3KCCA 4AVCA 4KL1A 3EBRA 5KHKA 4B29A 1QXJA 2Q30A 2VQAA 2D40A 2GC3A 3IDBB 1VJ2A 1ZZCA 5JSPA 3ELNA 3ACLA 4AVBA 4PIYA 3FE5A 1O5UA 1DGRA 2PA7A 4PIXA 3UKTA 3S7IA 3CLPA 1UIKA 4IEWA 4QX5A 2Z69A 4QGMA 3MYXA 1X8MA 2H6CA 1UIJA 1O3TA 3ZDSA 1V70A 5E1RA 4YNIA 5JR7B 2PTMA 3IDCB 1YLLA 5FLHA 3E97A 1I5ZA 3HT2A 4KU8A 2D5FA 4I0AA 4I09A 3PNAA 2Y0OA 5EFUA 3N4MA 4O9GA 4N9HA 3KSCA 2C0ZA 4AQ2A 4HBNA 4BHPA 4KWJA 3BALA 3RZZA 1OI6A 3HQXA 1CAXB 1ZRDA 4HZFA 2IXHA 2E9QA 4WVZA 5JCTA 3QOPA 5I8SA 4I3PA 4Q0UA 2XKPA 3ROUA 1HW5A 4A2UA 2CAVA 4LTAA 5F1RA 2XHKA 1CAXA 3U10A 2V09A 3CL1A 3ES4A 3ETQA 1YFYA 4UXAA 2IXCA 3FZ3A 4X6RB 5BV6A 3USSA 3KGLA 1YWKA 4I2OA 4L11A 3OF1A 1Q3EA 4OFGA 3TNQA 1Y3TA 2D5HA 3M3IA 3WW2A 3LZZA 1X8EA 4JTNA 5LRSA 1J3RA 4XEZA 4D7TA 4IERA 4IEPA 2GH2A 2IXLA 1UCXA 1EYBA 1OFNA 2HKXA 1ZNPA 3E6CC 4HVRA 4MGKE 4YRDA 1UPIA 3WW4A 1O4TA 1J59A 4BYYA 3LA7A 4NVPA 2Q1ZB 2PHLA 5CU1A 1L3JA 4MV2A 3E5QA 3D0JA 3IBMA 2DCTA 4Q0SA 5HI0A 4JTOA 3RPQA 1CGPA 2BEOA 2IXIA 2PAKA 2IC1A 5FDBA 1G6NA 2GC1A 5AVPA 2IXKA 3LA3A 4LLOA 1ZZ9A 1DGWA 1ZRRA 3SCFA 1WLTA 1CX4A 3ST7A 4BH9A 4KWKA 1XE8A 1RUNA 2GAUA 4TLFA 1Q5OA 3E6DA 1O3RA 2MPFA 2P17A 1I6XA 4UBHA 4LA3A 1J3PA 4E2SA 2OZJA 4PIZA 2GU9A 4QGLA 1O5LA 4E2QA 4Q0PA 5LRRA 3E5XA 4X6QB 5JSRA 2GZWA 5K8SA 4EWEA 5D1IA 2UYBA 4Z82A 4LA2A 3SMHA 4KWLA 3RDIA 1RC6A 5I0TA 3NW4A 4Q0VA 1ZX5A 4HN1A 2PAEA 4XFIA 3SHRA 1GQGA 4OLLA 3KGZA 1ZRCA 2PAMA 2B9UA 2QCSB 1X82A 4H7LA 1YFWA 3EO6A 4EWDA 1SQ4A 3MZHA 2BNMA 2K9ZA 3SCHA 1O7FA 1XE7A 3RNSA 1ZVFA 1ZZBA 4MGYE 2F4PA 4ZU7A 3D0SA 3H8UA 4AVAA 3G7DA 3OCPA 5I0SA 3SCGA 3CJXA 4PJYA 2XL9A 3L2HA 1EPZA 2CAUA 3H1YA 3WW3A 1NE4A 3H1MA 3LWCA 5J7MA 2I45A 4N9IA 5KHGA 4R8HA 5KHJA 2OA2A 3FWEA 4O9EA 1X7NA 4I0BA 5I8YA 4HSJA 2Z2SB 5CVRA 2WFPA 1SEFA 2OZ6A 4LULA 2BNNA 5I93A 3S7EA 2UY8A 3NSTA 4XFBA 3PLQA 4YYOA 4K8FA 2PYTA 4LEJA 4BIFA 1CAWB 2XLGA 2OPKA 4IEUA 4FT8A 2XLAA 1J3QA 3WW1A 1LRHA 4FBFA 5T3NA 3UKNA 1IPKA 1CAWA 5FQ0B 1VP6A 5BPXA 5FLIA 3FJSA 4I02A 4QM8A 2FMYA 3C3VA 2BNOA 4F8AA 2ATFA 1RGSA 2B8MA 2QVSB 5FQ0A 4MZUA 4XF3A 3H7YA 1H1MA 4LUKA 2XGXA 3H7JA 4QGNA 1YFXA 5I0UA 3HIFA 1SFNA 2K0GA 1QY4A 3BCWA 4EROA 2BGCA 4HSLA 5KHHA 3PVBB 4XFGA 5C6CA 2CV6A 2XL7A 3D82A 4ONUA 3IIAA 5KHIA 5KBFA 4MGZE 1ZREA
chains in the Genus database with same CATH superfamily
1AR61 5IYYA 5EZWA 3M8LA 2I07B 2WFF1 5IUQA 2K2SA 1S0JA 4HLTA 5J37A 5KR7A 1W6MA 5F5AA 3RWNA 2JEMA 4PQ9A 5FP8A 4XILA 5FFOC 1VBC2 4NHMA 4AQSA 3PU3A 4P08A 3WG3A 1W6QB 4XF4A 1ALYA 1ASJ1 1AR71 4BXSV 2FHRA 1IZ3A 1VMJA 4HVOA 4PCRA 3BU0A 4BIOA 1QJX3 4Y3OA 4YZ3A 1JHJA 4JV4A 5FRAA 1IKQA 3KVAA 5C8CA 4JCKA 2YROA 4CCKA 2WAOA 1U5YA 4M3CA 2BP6A 4LO7A 1KS4A 2RS32 3EQEA 4CP2A 5JMCA 1EV13 4CEWB 3VKMA 4DRRA 1JZ8A 4YARA 1XRUA 3C2UA 3K75B 4IETA 1V6OA 1RTVA 3JCIA 4GZ9A 4RQPA 1EP0A 1MQTC 3B5LB 3VBRB 4E2GA 5F32A 2ZHKA 1QJY2 2HH9A 2C9KA 3EJKA 4JGYC 4W65A 3BPZA 4XETA 4E8DA 1HRI2 2HWC2 1N47A 1RHI2 4IGQA 1S2KA 2HWB2 4MHUA 3P6BA 1RUG3 4FTBA 3LDBA 2J1EA 3AZXA 4P9IA 4C0HA 1GBGA 2XJUA 3URFA 5EJZB 1RUH1 2MEV1 3POEA 5GALA 4YG3A 3T0DA 3R4SA 3WUDA 4BQ1A 3ZFEB 4BB3A 3UK9A 5L9RA 2X8KA 4P9GA 1JYWA 2DYCA 5BXXA 2HYKA 2WS93 4IEVA 4WZCA 1CAUA 4ITCA 1R083 1GP6A 5HCFA 4CCJA 2QQVA 3A4UA 3WNXA 2VZVA 2DVDA 4JDOA 4O61A 5FCCA 4BU2A 1OD5A 5APAA 4R9CA 1FOD1 3NV4A 1POQA 1TMF2 2XHNA 3MIHA 4QU2A 3N9QA 4RS5B 1ZRIA 1QH7A 3G6JB 4LBQA 4LHLA 1OPOA 3VBFA 2RM22 5C3SA 4YZ4A 1UMZA 4IV1B 1H4HA 1OOPB 4N53A 4B4RA 1W2OA 3NJZA 5GZCA 5IFPA 1MS3A 3V0AA 2QNKA 3RWKX 3I4IA 1K42A 3QACA 1VLNA 1ZZ7A 3IAPA 2PLV1 2UURA 2C26A 2B5HA 4XCBA 3LA2A 1MS4A 4CPBA 1Y43B 3HN1A 1RL3A 2B39A 4LUMA 5FUNA 5BNPB 2XLFA 4DY3A 2VW0A 1CJDA 3E5UA 2PHTA 1OVPA 2ZBJA 1EY2A 2X29A 5A6QA 1GYKA 3UKVA 4AHXA 1K5MC 1POV3 3CIHA 1FMD2 2HWD2 2UY9A 4AYUA 2W1SA 4QDQA 1O3SA 1PIV3 1O3QA 4JC1A 4RHV2 1CR7A 1NA1B 3MDPA 4XHBA 1WBFA 1N1VA 3M70A 5I0RA 4QQOA 3PVNA 3POWA 2AREA 2ES3A 2NMOA 3OYWB 4FP3A 3UETA 5J48A 1OUXA 1LENA 3D4KA 4XJ8A 4DEQA 1W99A 3OPTA 1O4ZA 3ZR6A 5JDBA 2AZ5A 1H6XA 1URXA 1YUDA 4N7IA 4BPZA 3JUUA 1MACA 1STMA 3ACHA 3BPSA 1Y9QA 4AGGA 5FZ0A 1W2NA 4LBLA 5DDJ3 4ISRA 4D8MA 1CPNA 1ZBE1 4K1ZA 1AHSA 2YPDA 3ZXGA 2W9XA 2RMU2 2ZX1A 4NIGA 5FPZA 4MGQA 4Q8LA 2J1AA 5F6KA 2WZPP 3AP5A 2O1QA 2UU8A 2QQOA 3WUCA 2VXRA 3WXPA 1M06G 1S0FA 1GQPA 5J36A 5LWBA 2PELA 5CFDA 5I8TA 4EZHA 5K0UA 2BU9A 3FFZA 4XABA 4BQ5A 2RG4A 4K21A 2MNGA 2PMWB 1YC61 3AP4A 3JQXA 4IW3A 4EN7B 1GNYA 3I54A 3MV11 4LMFA 2R061 4XFFA 1AYN2 3OBRA 1D0HA 4EN8B 2TEPA 2WAAA 4XIKA 3CJIA 1ZBA2 2X5IB 2Y8KA 5FBZA 2VZSA 1W9TA 4XACA 5D2AA 3H42B 3LIHA 4B8EA 5F5CA 4B3NA 1PVC3 4ES8A 5IVBA 1XSQA 4QX1A 4YM1A 5F5QA 3ZYBA 1PM7A 4XF1A 2GN7A 4ZZ8A 5BNNA 4CEYB 4UW3A 5HXVA 3JB4C 4YM0A 4I0WB 1NZIA 5FBJA 1AR83 5FYVA 3T3YA 2DCKA 2WBKA 4OULA 3NNMA 1H1IA 4Z07A 4JGZB 2ZJCA 4FPCA 2QDRA 3AB0A 2TNFA 4URTA 4A7ZA 2O8QA 2W46A 2WNVB 2JG8C 3LD8A 3U11A 1SFYA 1QOSA 4C90A 2XOMA 1WW5A 5JZGA 5EYYA 5CG9A 1W39A 5A6XA 4AFCA 5BNQA 1LR5A 1MVEA 3M3EA 4GWMA 4S2HA 5GJ6A 3K48A 2JDMA 3KHBA 5ABJB 5CADA 2XKOA 4WVMA 1MS5A 3RMYA 3WY6A 5C9AA 3ZDVA 3T0AA 1UAIA 5CYYA 1BXHA 1YFUA 2EIBA 4OI1A 2ZEYA 2J1RA 5B2GB 5L19A 4TZDA 4CVUA 1Z7S2 4J1XA 3GJAA 3VBRA 1D4M1 1ONAA 1UX7A 3KCCA 3AM2A 2D6MA 1MZFA 1NY71 3A7QA 2BWAA 4RSUA 1VAMA 3CU7A 4Y33A 3WG4A 4JKLA 2XVGA 3K77A 4CRQA 3FBYA 2XBO3 4XJAA 3RRDA 1K5JA 3TN92 3C7OA 2R49A 1PGL1 1S1AA 1RVF3 2GMEA 4BOWA 1RIRA 3CKHA 1WD3A 4QKDA 3FE5A 3ZVXA 4QB1A 5A32A 1T6GC 1UY0A 2RS11 3GDBA 1WBLA 1GOFA 4UAPA 3MIFA 5FKBA 2JKXA 1HRV1 2JECA 3NAPB 2OPWA 3C7EA 2X09A 1YIPA 3ZSMA 1NXD1 4KBBA 1QJU1 2A6ZA 4KGGA 5DG1A 4YW4A 4DS0A 3FUOA 2EXKA 2H6CA 2VR4A 4S2FA 3LSDA 3B7MA 1V70A 4RS5A 4TLGA 1DCSA 5E1RA 4EJRA 1QXPA 4IV3B 5CFCC 2PTMA 4M4PA 5EXOA 1BK0A 2VZ1A 1I5ZA 3NJVA 1YRZA 4IV1A 1OOPA 2AENA 2Y6HA 3HT2A 3KF3A 3S5QA 3M3QA 1VRH3 4I0AA 4A41A 2B4KA 3O0VA 3WCSA 3O1VA 5F7UA 2VCMA 4NIAA 4GB32 1YIFA 5D8AB 1F5JA 4YVWB 2CYFA 4BHPA 1LESA 2JD4A 1QIQA 4KWJA 3ZLIA 3MF6A 1ZA7A 3BALA 1OI6A 1VRBA 1XXNA 3VBUA 5F3CA 3SH3A 1SFPA 3O7OA 4XUNA 1DGRN 1NA1A 5DAPA 3W9AA 4UFHA 4HZFA 1W6PB 4E4HA 4WVZA 3MW2A 3QOPA 2R1BA 5L36A 4Z8BA 4OUMA 1PMJX 2A73B 4HG6B 5FP3A 4R4ZA 1H8VA 1F4AA 3KQ4B 2VMHA 4UF0B 4XPVA 3ZSEA 5GLTA 1C8M3 1GMMA 1EAH2 3VDCA 2V5YA 1YFYA 3SC7X 2YDEA 4Q4X3 3ZFGC 5FUPA 1X33A 1CWPA 2ZGKA 3JD73 3MIGA 5BV6A 5BYNA 3HBKA 1Y4WA 3K3OA 3EB7A 4KG8A 4PDWB 4XE9A 3USSA 3KGLA 4OMCA 3VKOA 4TXWA 4CU6A 3K4DA 4H55A 4L11A 1UU5A 1HXS2 2RS53 1W04A 3ETPA 4AFAA 5FY4A 3JBG3 3I3EA 4GMP1 2ZGRA 1PHMA 3SQOA 4JTNA 5LRSA 4XEZA 1VPHA 3ALQA 3GXUA 4ZZ5A 5KXDA 1UCXA 3PL0A 4UFJA 3I2IA 1ZNPA 3IPVB 5GZFA 1UPIA 5FMDA 4PF1A 1D0GA 4DXZA 3WSOA 3GZUC 1UN1A 4NVPA 4MVTA 2PHLA 3PUHA 5CU1A 2XQXA 1CZTA 2NLRA 1L3JA 4CDQC 3CMGA 3VN4A 3N3HA 1V9U2 2DCTA 4LJHA 2VAUA 3HWJA 4NRQA 3MV01 2I2SA 2WO3A 4ATEA 4XC9A 5EWSA 4ZKTB 1HV1A 2DVBA 4BM8A 1QOTA 1AX1A 1CGPA 2BPA2 3FLPA 3UJOA 1SACA 3MHZA 2BOIA 5FY8A 2IXIA 5FP4A 1IS3A 3HVDA 4GIQA 4P14A 4RFT0 3RG0A 1KITA 4ASLA 2XJPA 3AMNA 1JYTA 1R1A3 5AVPA 2D6KA 5L7OC 3LA3A 1CONA 4LLOA 2SLIA 5FPAA 5FV3A 2JB8A 5C7GA 5F6LB 3T4VA 1VAKA 2ZGMA 1AXZA 2EICA 2JE7A 1NLQA 4JX0A 4FPHA 1XE8A 2DCZA 2WNVA 1RUNA 3E6DA 4MSVA 3UESA 1AR62 1MEC3 3HAGA 1H9PA 3K3NA 1I6XA 1WLCA 2O14A 2XDVA 4LA3A 3AK0A 1YJKA 4FVVA 4LQRA 4UBHA 1FPN1 4BWOA 3BTZA 1LEMA 1XNTA 2WWJA 2W52A 1YNAA 4QGLA 1H0BA 2JG9C 1ASJ2 1AR72 1C5IA 5C3PA 3ZSLA 5DPNA 1O8PA 5JSRA 5IHRA 2XONA 3MI8A 1PVXA 1LULA 4BK5A 2OX0A 3IB3A 4B7EA 4CE8A 4Z82A 3VGIA 4LA2A 3SMHA 1ND2B 5FZOB 3V0BB 4HXCA 4A6OA 1RMU1 2A6VA 3WP6A 2C9AA 5HCHA 4Y26A 4DXRA 4NAMA 3HJRA 3SHRA 4FQZA 4GH4C 1QU0A 3KGZA 4M01A 3WQBA 1LHVA 3O12A 5E88A 2AC1A 4RGGA 4XURA 3P1IA 1R1ZA 1X82A 2H0BA 4CDWC 3VBHC 3EO6A 5CBLA 2AH2A 2IZWA 1BVP1 1JN2P 3TEZA 2WKKA 4Z1VA 1BJQA 1OQDA 1O7FA 3ZO0B 1Q8OA 4LNVA 1RUH2 2I74A 2MEV2 3AXEA 1ZZBA 3I2KA 4AE2A 2F4PA 2XMLA 4GALA 4A3XA 4E4DX 2D6OX 3VBOB 1PO12 3HD8B 3AYEA 4IV3A 4SBVA 3G7DA 3SCGA 5IVVA 4PJYA 4EE2A 2VZ3A 1KQRA 2XL9A 4OI0A 1EPZA 3N7JA 2CAUA 3WW3A 1SPPB 3GCWA 4BQXA 3H1MA 3LWCA 2YGLA 2QQMA 2CTVA 1FOD2 5IVYA 4NMIA 2I45A 5D8AA 1W8ZA 2JG8A 3HNYM 3NMBA 2VBPA 5KHGA 5ANQA 5DN2A 2JDUA 4K8RB 4XDQA 4YVWA 1C57A 2RDQA 3GZEA 3IMNA 1W8OA 3OBAA 1MPXA 5IK8A 1AYM3 3RZMA 4O9EA 1WWYA 1X7NA 1QNYA 1PK6B 5F2WA 1PNFA 1HQNA 2FCUA 2PLV2 3AZWA 1OQEA 5T5JA 3ZSJA 1G8WA 1NLRA 1OT5A 2LS6A 2BNNA 4FOQA 4PBPA 2W0XA 4YW7A 4AFDA 5I93A 5JOYA 1ND3C 4CUGA 2OVUA 1JZ5A 2D6NA 2A6YA 2FD8A 4QPIC 4M0HA 4AL9A 4XFBA 1A78A 3NV1A 4Q4Y1 5FYZA 3PLQA 3OD4A 4Y24A 2ZX0A 5FYBA 4LEJA 1BEV2 2P34A 4LLFA 1CAWB 1MR5A 1W8HA 2OPKA 3MEPA 2CU5A 2VUJA 3H0OA 3TBDA 1J3QA 1HIXA 3I2FA 1UY1A 1OLMA 3DPRC 3M1HA 4PDWA 3WW1A 3EXUA 3TEXA 1IPKA 4COYA 2WL1A 1VP6A 4DO0A 1BK1A 2GNTA 4I02A 4BMEA 1F4HA 2YC4A 2G9GA 3NRUA 3VHOA 4LBOA 2BNOA 4BXFA 3NV3A 5GLZA 1H8TC 1YI9A 1AVBA 5A3MA 1X9TA 4XMIA 3AX4A 2XVKA 4CDUC 1VBC3 1YQ6A 3ZYIB 1H1MA 1ZBE2 4KQ7A 1TNFA 2QUOA 2VMFA 5DUXA 2XGXA 3IT8A 4MGSA 1A34A 4GWJA 4YZ1A 4A7KA 4DUWA 1YFXA 3A23A 1DLLA 4Q4V1 4CZSA 1SFNA 5HCAA 2BGCA 3GBWA 4FPGA 4HSLA 5KHHA 3OEBA 2BDRA 2CV6A 4OHVA 1SZBA 4IUGA 3O5SA 3KV6A 3FLTA 2QQLA 2RS33 5JSOA 3NNFA 4CCEA 3GGLA 3I7DA 3OPZA 2NYYA 5I0DA 4YVSB 1ULGA 3ZYJB 3D8CA 3O1OA 3AZZA 2R062 3OD0A 2KD7A 1QJY3 4XJUA 3NL1A 3RYPA 4E4SA 4L0PA 1HRI3 2HWC3 1RHI3 5C8WA 5F3EA 2HWB3 4IEZA 3CBNA 2VJXA 2H0VA 4Y4YA 4DPNA 1N1TA 1OVSA 2LALA 5CB7A 3HR9A 3WF1A 2ARCA 1FNYA 3TN91 4YLZA 3LAGA 3WOGA 2Q0AA 2IFWA 4RQPB 3FHIB 4ZONA 5GLUA 4OUEA 2OUHA 2R041 4SLIA 4XAAA 4QQPA 3VDDC 1UU4A 1XQNA 3WQ7A 5F37A 1XBFA 4Y22B 4IEXA 3T0BA 1G9AA 5LBEA 1I9RA 4IXLA 3QH7A 2YG0A 1JXNA 1TMF3 2QQPA 2D3PA 3DV8A 3ILFA 4QU1A 3CQOA 4JKMA 5LBCA 2XVLA 2RM23 3ACFA 1S0GA 5C5UA 4KBZA 3AP9A 4LK6A 5FZOA 1CAUB 3POIA 3PUIA 4COVA 3O0WA 1OMIA 4C1XA 3WDTA 3U75A 2C1FA 1JI6A 1ENQA 4WM7C 5CIRA 4FAHA 5C70A 3RZJA 5J98B 4K3UA 5FZ9A 3R6SA 4D6QA 1HLCA 1D4M2 3HT1A 1LB2A 2QJVA 4Q1PA 5JOXA 3B9IA 4FXKB 4OCTA 2HJIA 3NNGA 4LBQB 3SEEA 3VBFB 1NY72 3NO8A 4YW6A 5JIAA 1RUOA 1NYWA 4CDXB 2RJLA 1W6NA 1FMD3 2HWD3 2ORZA 3MPPG 4N53B 2WSVA 4NOTA 3QD6A 4TSVA 3RVHA 4RHV3 1DYKA 2C6SA 3KV9A 1YHFA 1MZ6A 5FYMA 5HXMA 4QPGC 1ULCA 2EXIA 2OS2A 3WNPA 1PGL2 2RR11 1QNWA 4PBOA 4DRVA 1XYNA 4UWDA 1LJ7A 2RDNA 2ET7A 2WA3A 3VBOA 2XG3A 3P3NA 3WF0A 2CDPA 4FOWA 4P00B 4UOJA 1Y9MA 5GKAC 3U4SA 3ZPYA 4BDVB 4LR4A 1HRV2 2ILMA 2KM2A 3I2OA 4CU7A 1SPPA 1QJU2 1I5PA 1QQP3 2HLEA 3ZXAC 3ZN5A 3VDBA 4GWIA 4UBGA 2XWBB 2WR9A 4YW1A 1NZCA 1HX6A 3WHUA 1SMVA 1W9YA 1CZSA 4NPRA 2ADDA 3BB6A 5FPUA 2RMU3 5DZEA 3VHRA 3DKQA 5FLJA 2ZOEB 1XYPA 1KDMA 1N1YA 1PK6A 1NLSA 1UF2C 4LO6B 2BOJA 5EP9A 1CIYA 4BLIA 3VUOA 1WKYA 1RINA 5C4WC 1K45A 3FHAA 3ZIXA 2YU2A 3VKNA 4RR3C 2CWSA 3U1XA 5A1AA 3HOBA 2WO2A 5KC6A 1J58A 4QQLA 2C5DA 2Y34A 4N90A 3SITA 1B35C 1LU1A 2VECA 4K20A 4AXOA 1AYN3 4L92A 3ZN6A 1VBB1 1ZBA3 5FWJA 2VZUA 1LOFA 1WMFA 4LIUA 5CKQA 4JHTA 5BUVA 2QDNA 5K0UB 1YQCA 3OGJA 4Z92B 1RUF1 3ZX7A 3LPGA 1S0EA 1IGOA 1ULDA 2BV4A 4XFCA 4D69A 5J3UA 5HV4A 5L73A 4GA9A 4JKKA 4N43B 4WM8C 5BY5A 2Y38A 1UO9A 4CEWC 3CJIB 4N8MA 3ZYPA 4K9SA 4NRPA 2OUJA 4I01A 1PZ8A 4LBNA 3ZYHA 1QHDA 2W94A 4AQTA 1PZ7A 3J26N 3ORJA 2ETEA 2ZGLA 1NOVA 3IAQA 5LA9A 1SCSA 2NP0A 4YGBA 1OH4A 2WT1A 5JOWA 5J1XA 1UW8A 2DWRA 3BTAA 3POSA 1VR3A 3IM0A 4IE6A 4R52A 1S0IA 2HWE2 3KS7A 4OZXA 3ZM8A 5BNNB 4HK8A 5M0TA 2Q8DA 4NPMA 4QHOA 5L9BA 2VY0A 4Q4W1 2IVJA 4XBQA 2H6BA 1AL22 3MFCA 3O1SA 3SISA 2R0HA 4YVSA 3GBFA 1Z7S3 1GOGA 1RXGA 1JYNA 2HEWF 1RUE1 4HKWA 1FV3A 2GMPA 2WT2A 5JZGB 1GOHA 2VOVA 3CNAA 5JOZA 1KFUL 1QGLA 1QWRA 2Y0IA 3F2ZA 3N9MA 4KU7A 3CO2A 4WVMB 5A3PA 1JOPA 4MADA 4DOUA 5G05L 3TN93 1MVQA 4J1WA 5C9AB 4QPIA 5HV0A 2P3KA 1BBT1 3ZYRA 2VC9A 3H9AA 4XQWA 3Q9OA 5JI7A 4AFMA 4CCCA 3TNPB 2R32A 5FOBB 1C3HA 1RUJ1 3KLSA 1GV9A 4XBLA 2LRPA 4EWAA 1V6JA 2NPIA 5FK7A 5K7PA 1J83A 2G1MA 2A5ZA 4U2AA 4Y22A 3MW3A 5C33A 2WN3A 4HKLA 3WHTA 5BNPC 1NCRB 2WYSA 5A7WA 2WZR2 4HN0A 4F7ZA 3THDA 3J8F1 1AR91 2J7MA 1N1SA 1MZ5A 5FMCA 3LFIA 4CPBD 3O1UA 1MS9A 1OHFA 1R093 1ULEA 1FPN2 4YFWA 2VQAA 4EN0A 1PO11 5A32B 3AFKA 1GNZA 4ZY9A 4NPLA 4HK9A 4DXSA 1F15A 2GC3A 3K51A 3PVEA 5LB6A 2VW2A 3IDBB 2OT7A 3VLBB 1OA3A 3Q8AA 1F31A 5JSPA 4GB33 4C91A 1RYYA 1H9WA 1DGRA 4FPEA 1SHWB 5IAXA 4E8CA 3S7IA 1REFA 2ZX2A 2AR6A 2Z42A 3LF7A 3WG1A 4LO4B 4COZA 4QX5A 4CDXA 1DQ0A 1KEXA 2VUDA 4QAWA 5ACA1 2UWCA 5FJKA 2WNUA 1RMU2 1UIJA 3ZDSA 3MFAA 5E89A 2BVVA 2VOXA 1S4CA 5FY0A 3E97A 1DQ5A 4FCAA 3FBMA 4G4FA 1DGWX 1PZ9A 4KU8A 4NO4A 5FOJB 4WZFA 2D5FA 3ZKYA 1EAH3 1REDA 3PNAA 1OKQA 2Y0OA 5IFTA 3VZLA 4CCLA 3IMMA 4N9HA 3QLQA 4V2VA 5A80A 1BEV1 1WMEA 2QZ3A 3WP5A 3VBUB 4HBNA 4ARXA 3JQWA 3CZUA 4NR1A 1ENRA 4RL7A 3RZZA 3WG2A 4U36A 5IW0A 3BGAA 4W50A 1G9DA 1MQTB 1HXS3 2X5IC 1O8SA 3W5MA 4OMDA 3T1LA 1K3IA 5T52A 1UZ0A 2IXHA 1RUC3 5G04L 1WCUA 5I8SA 3BUCA 4I3PA 2ERFA 1KGYA 4FOVA 3VHPA 2D6PA 2G4IA 4AHYA 1HW5A 2R072 4LTAA 4IE7A 4N7UA 4I3GA 2LW8A 1WLWA 2Q8CA 1CAXA 4CEYC 5IK7A 5A7OA 4FO9A 2WA4A 2R0FA 2QE3A 4QXHA 1XNKA 2QKDA 3KT7A 4UXAA 4X6RB 4NUBA 5T5PA 5IK4A 3ZFFC 2V4AA 1V9U3 2XJVA 4XTMA 4AI2A 5FO8B 2Y6GA 3MUZ1 1Q3EA 4H7MA 4XZUG 3M3IA 1DFQA 3TNQA 1A8DA 3RZLA 1AL0G 4CCMA 4Q4Y2 5B4XA 1W3VA 4CA9A 4PF5A 4ZHNA 1NUKA 1AXYA 2Y64A 4QWNA 4DUVA 2QQNA 1JOBA 2FDIA 2HKXA 3L9JT 4N43A 1UXXX 3E6CC 3BTXA 3N35A 4FI9A 1HB2A 1J59A 2WINB 3LA7A 3TAYA 2JDZA 2Q1ZB 2A70A 2VULA 3DYOA 4GMP3 2AACA 5JI9A 1AR63 5F3GA 2R7EB 1BMV1 1LEDA 4MV2A 4AAPA 4PHZA 3WLUA 2WFF3 4COWA 1XB9A 3D0JA 3IBMA 1K5MB 1WCSA 4Q0SA 5FR3A 2Z5WA 5AFEA 3OEAA 1LOAA 4CUBA 2DURA 2ARBA 1ODNA 2WQ4A 1AR73 1ASJ3 2VE1A 3C8XA 1G6NA 2GN3A 4Q4V2 4DMIA 3V64A 1WLDA 1JZ6A 3NAPC 1DP0A 1EPWA 3SCFA 5FMOL 1WLTA 2R6QA 3DF0A 3OSDA 4M3CE 4CP1A 4BH9A 1YQ8A 2XH6A 4KWKA 5C4WA 4Y20A 5GZEA 2P3IA 4TLFA 1Q5OA 2XWJB 4RA0A 5K4LA 1RUD1 1L7QA 2W91A 5FZCA 3SKJE 3BOWA 5DXDA 5FAXA 5H9PA 4AK3A 1W8NA 2OZJA 1B35A 2ZZQA 1OBNA 3WF3A 3FUQA 5A3OA 1DHKB 3T4HB 1Q8SA 2BQPA 3POGA 2E51A 3PUSA 1UOFA 5FZAA 4X6QB 3H8XA 2B45X 4B4QA 1NCRA 1RUH3 2MEV3 2VW1A 3WDVA 2WJSA 2LROA 1XSRA 4EWEA 1X50A 2HWF1 1PO13 3TOJA 4OQ8A 1RC6A 4BE3A 2P3JA 3J7LA 1IS4A 2R042 4Q0VA 5JXJA 5FTTC 1ZX5A 2VMDA 2GP5A 2G9FA 2VD7A 2YC0A 2W1WA 3WDUA 3ASIA 3POFA 2XR4A 3LFMA 4XCAA 4OLLA 1C28A 1W6OB 4NIHA 2VNVA 1FOD3 2RDSA 2WIIB 4NN0A 2BFUS 1UOGA 1V6LA 1L7RA 1N3PA 4PLNA 4WVWA 1HB4A 2B9UA 1GNHA 2DF7A 2QCSB 2YFZA 5BNOC 2P3YA 4KGQA 3ECQA 1YFWA 1OH3A 3ABZA 3KQRA 4EWDA 1S2BA 1SQ4A 4QHBA 5SV5A 3VZNA 3W5NA 3MZHA 2JIGA 3UT0A 5C3RA 2ZS6B 2PLV3 3WF2A 1LNSA 3O1MA 2VU9A 4XVHA 3PHMA 3H8UA 3I2DA 3ME2A 2JG8B 5KXCA 3OCPA 5CZKA 4AG4A 1PM4A 3LQCA 1Q56A 1DQ2A 3L2HA 1BCXA 2BWCA 1QF3A 3CDZB 1WMXA 1RXFA 4OQ9A 1SLAA 4BISA 4JAAA 4NIDA 5J7MA 1XE0A 4UFKA 1GUIA 3DYPA 5JLVA 4R8HA 5KHJA 2SBAA 2ZHNA 4CCDA 2KA3A 4RFRB 2OA2A 3PJYA 2D6LX 4NHLA 2RR12 4P5YA 5A7QA 4XDOA 2W95A 1JYVA 1ENXA 4DNYA 2WS92 1BVVA 1R082 2ZMLA 4XIOA 1HQLA 1MQTA 2ARAA 2Z2SB 5CVRA 1H2MA 4JGYA 4L97A 3D5OA 3ACGA 2XJQA 3THPA 4LK7A 4UW5A 4ZXKA 2VQTA 1EUTA 4JRAA 3VBSC 1HB3A 3S7EA 5EJ1B 4BQ2A 2UY8A 5KXEA 4H2AA 3GHNA 5JXGA 1ZBE3 3PUAA 5FYCA 1Z0HA 3E1F1 3B94A 4BIFA 5FO9B 1E5HA 3VB9A 4XYXA 1LTEA 1JYXA 1ODMA 3MIEA 2OKXA 3TYJA 2VOTA 3VD5A 3WF4A 2O0OA 3J7HA 3VZJA 2XLAA 1VBA1 4FBFA 3U4XA 2HWE1 1CZVA 2DFBA 1SLLA 2ZGSA 4AF9A 4GD4A 3UKNA 3ILNA 5BPXA 1V6KA 1LGNA 5FLIA 3FJSA 2QQJA 1H30A 4CP9A 1AL21 3HPNA 5DZGA 4CXYA 2B7YA 4A42A 5CFCB 1A6CA 4LT5A 4F8AA 1COV1 3AZVA 4AEJA 2R063 4MZUA 2QQUA 4Y1UA 1W2UA 1PGSA 5AC91 1UMIA 1VBB2 2VGDA 5JPMB 1TVGA 4LUKA 2W3JA 1U0AA 2RJKA 3K4ZA 3Q8EA 4A6SA 4ES9A 1CESA 5A70A 5DUWA 1S0CA 2HEVF 4OVEA 2ZGUA 4DY5A 2WYFA 1RUF2 2K0GA 1QY4A 3AZYA 4K7JA 1Q8QA 3AKRA 4EROA 4XFGA 1DQ6A 2J1UA 1XPWA 1XC6A 2W08A 2XL7A 3RZHA 3KHCA 4ONUA 3IIAA 1HDKA 4YWAA 3PTRB 2E6VA 1F8VA 1K5MA 2VOKA 4L9BA 4MGZE 3UGHA 1ZREA 2VMIA 2F17A 2ZA9A 2LUWA 2W2IA 3CHXA 3ITQA 3R4DB 5EPAA 5EV7A 1NCQC 4A4AA 1QH6A 4IE4A 4W8JA 4CXWA 3NKTA 4BK4A 1JS9A 2WZR1 5CAZA 4QT6A 2ZAAA 2AGSA 5FXXA 4NROA 3GYDA 1O59A 1YXWA 1VBE1 3VHNA 2JJ6A 2WO7A 2XUEA 3MUY1 1UNBA 5JUVA 1DZTA 3AP7A 2VM9A 3A21A 4Q4W2 3ZFGB 1JUHA 5CEHA 2Y60A 1TME1 3HNBM 2E7QA 2O8OA 2FQPA 4IEYA 5T5OA 1FT9A 5FPLA 4UW6A 4QQ2A 2GSYA 1D4M3 1GWKA 1NXMA 2WWSA 4IEQA 1RUE2 4QX0A 1TE1B 4R9DA 2EA7A 1BKZA 1QXRA 1TEIA 4FPFA 1LOEA 5DAVA 4QPWA 2WUHA 3ZFFA 3WDWA 3AVRA 1VBD1 4NHKA 1U5IA 5EIYB 1W8UA 4G9SB 2VCCA 1TZOA 3FX3A 3N9NA 1QKQA 2NM1A 4MGIE 1W28A 4INDA 1BBT2 5F2SA 4AVTA 3NKGA 5LEKA 2GC0A 4LHNA 1AR82 2BUKA 4W4ZA 1RUI1 3BVCA 2FDJA 2J42A 1W2TA 1D2QA 1RUJ2 2RS13 4MXWA 1WW4A 3B02A 4Q0QA 3TWIA 4CDQB 1HRV3 4AEDC 5GLVA 2ZX3A 4R9BA 1W6NB 2Y6JA 1VALA 1QJU3 2ZHLA 3LKJA 2VOWA 3AKTA 1W6OA 2V73A 2D98A 3J8F2 3VD7A 1AR92 1X9PA 2E53A 3LEMA 4NE9A 4PI0A 4AGRA 1FXZA 2A3XA 1FNZA 1UZWA 3WDYA 5FYHA 4FSJA 4QXKA 4OHXA 2A7AA 4JRLA 1GZCA 3KB5A 1WGPA 4ASMB 5L7OB 4FPYA 4EN6B 4Z2AA 1EUUA 2XUMA 5GM0A 3BU7A 2W5FA 1HN0A 4PLOA 5T50A 2VVDA 1IS6A 3CEWA 4AEKA 4JQRA 3FLRA 3ZN4A 1DIWA 2B42B 2R071 2CHHA 4MX3A 1IPSA 2J1VA 3CF6E 3N36A 1FI2A 5DAXA 3UYJA 1KDKA 4GXLA 1W9SA 2DBIA 2Y6KA 4LOTA 4Q27A 5ACA2 1KRIA 2GC2A 1US3A 1UMHA 2WQZC 3GJBA 2WN2A 1E5IA 2Q1MA 2KXLA 1Z78A 3JU9A 2JG9B 3LEKA 5FPXA 2JDHA 4DUXA 1DDLA 1A3KA 1WA6X 2G9ZA 2Y6LA 4QMAA 3T2OA 4QX3A 4AQ6A 2VTFA 5FO7B 2BW8A 5H9RA 4AVVA 4D6RA 1MS1A 4WVVA 5FZLA 4JHZA 3OPWA 3AMMA 3USUA 3AJZA 3ILRA 4BA6A 2VCBA 3I3QA 2UYAA 3WNNA 2F6BA 2J1SA 4QX2A 3ZN6B 3I59A 3I49A 2YB7A 2DBNA 4P9LA 1Q43A 3OGGA 1W3XA 1W05A 2CDOA 4A45A 3WD5A 3MF9A 5J09A 4DXTA 4ORFA 4Q8KA 2EIEA 4LBMA 4OHWA 5J96B 1J84A 1BYHA 1WCKA 4LIVA 5GLWA 4LHSA 1UYXA 2EIDA 5HBAA 1SLCA 1PMIA 2VNGA 5C8CC 3WP4A 4CDWB 4W6YA 3VBHB 2AUYA 4IESA 1MS0A 2WC2A 5IVFA 4MH0E 1S0DA 3C7GA 3SH5A 1U5XA 3U78A 1JYCA 4ZU4A 2GP3A 1CN1A 4ASKA 3B3QE 5BNOA 4G3YC 2VTXJ 4HONA 1UQXA 1LAJA 4XF9A 3DL3A 5CFCA 1MZEA 4UW4A 2YHJA 4E4ZA 1JBCA 4S2GA 5EJ3A 3LDRA 2V5DA 2MHFA 4LKSA 3O0XA 1PO21 5A7NA 5F9TA 3JZVA 3KVBA 4FPLA 3AFGA 4COUA 5A1FA 1KFXL 1LODA 3LB9A 2VVEA 2BBVA 4CYDA 1SCRA 4O7XA 2YYOA 4IGPA 4KWUA 5KXBA 3AKPA 3FMGA 3HQUA 4P9XA 5A7PA 2N7GA 3PUQA 3U37A 4EV0A 1C1FA 1CAVA 4JZRA 4LITA 4YM3A 4XFAA 3VBFC 2VO5A 1ND3B 1L7LA 4QPIB 3MBWA 1BMV2 1KD7A 4N53C 2ZACA 2FDFA 1Y7BA 1LOBA 1AF9A 1FPN3 1W0NA 3ENRA 1C1LA 3RYKA 3SXWA 4Q26A 5FYTA 3UV9A 4META 1GFF2 1VB2A 2KR2A 4MLOA 3VBSA 4CCNA 2XB6C 2Z79A 3KMHA 3ZFGA 4J25A 1HJFA 1OXCA 2BFUL 3SEPA 4NIIA 3ZYFA 4HMZA 2ZKLA 4ZU5A 2IXJA 3LSEA 3IWZA 3OTFA 5A7WB 3MW4A 3LOIA 4AVSA 5A1LA 3O1TA 4LE4A 4YG0A 1OKOA 2ZCWA 2R30A 2Y26A 1QJX1 4W6XA 2ORXA 3GM8A 4XQDA 4XXAA 5A3LA 2E63A 3C7FA 1XJAA 4MUVA 2W1QA 2YXSA 2QBXA 5E8AA 4DINB 1ZZ8A 4XOGA 4P9JA 4HFSA 1RMU3 5FMOS 1RB8G 1RUD2 4CDUB 1EV11 4XTPA 3EBRA 2HBTA 3I2JA 5KHKA 4V2WA 4A3ZA 1I1EA 2YZ4A 3WEZA 1W2AX 4XMAA 2E32A 4R9AA 1KXGA 3TRSB 2QZ2A 1RUG1 1ZZCA 1R64A 4QX8A 4CDQA 2VTXA 1C4RA 1WD4A 3ELNA 2A6WA 4D94A 4PIYA 3KV5A 4B1MA 1O5UA 3H8OA 2D3SA 1GR3A 2WNUB 3POJA 3T09A 2PA7A 1JTZX 3KM5A 1CX1A 3OJBA 2HWF2 1AJKA 5JXHA 4IEWA 5TSWA 2WS91 3DEMA 2Z69A 3ZKUA 5DMYA 4FTEA 1R081 3MGUA 1DU3D 1US2A 1O3TA 4YNIA 5L7OA 1REEA 5CFDC 1OFSA 5K0UC 1YLLA 5FLHA 2PHFA 4AHZA 4KMQA 5JVVA 5JR2A 1O91A 2WZ8A 1LHNA 1UZYA 2CGNA 5FZ7A 4MHRA 5IJRA 3RI9A 4I09A 3SKVA 5F5IA 5LATA 2ZAHA 3NJYA 5EFUA 4EQVA 1GZ9A 4O9GA 1DYPA 2CWMA 3K2OA 3IN9A 4NWWA 3AMHA 2C0ZA 3CJIC 4Y5Z0 5H9SA 3ZXFA 4AQ2A 3OGRA 4J6GA 4LKDA 3M2MA 2JDNA 2XJTA 4XUPA 3DECA 3VD4A 2JG9A 4D6SA 2RDRA 4DQAA 5JPNB 4FFGA 5FKCA 1ULPA 1CAXB 2EXJA 4Q4Y3 4IE0A 1ZRDA 1YYNA 1POV1 3AMPA 2PHRA 2XKPA 3H3LA 4I30A 4A2UA 1PIV1 3K4AA 4D0QA 3MO4A 3OUIA 2XHKA 4QDSA 1OLME 2ZTNA 2V09A 1SLTA 3CL1A 3U10A 3T08A 4GJZA 4WM7B 3OY8A 1IQAA 1JZ3A 5FMBA 1JZ2A 5JZGC 2VZPA 1POV0 4GH4A 1DGLA 2IXCA 1GANA 2WNOA 4LBJA 5FXVA 2PXJA 3NNJA 4AEDA 4CDWA 1YWKA 4URAA 3VBHA 5JWPA 1SBEA 2OW4A 4OFGA 1ULOA 1Y3TA 3I3BA 4OI4A 1UPSA 5DDJ1 5IK5A 3ZPOA 1LGBA 4QPGB 3LZZA 1E57A 1I3HA 1J3RA 2J1TA 3VBRC 1XNDA 3INAA 4IERA 5FZGA 3V65A 4NRMA 5LA1A 3NJXA 2ZZJA 4Q4V3 2IXLA 4ZPIA 1TNRA 5LCWL 5C71A 1ZA4A 5FZ6A 5A3UA 2YBSA 4HVRA 4MGKE 4QKBA 4Y1YA 2YGMA 4YRDA 4AEMA 2WQ8A 1H6YA 1O4TA 3GBGA 1VBA2 3WW4A 3R0RA 2DUQA 3B9CA 2HBUA 4YW3A 1NKGA 1FV2A 1OPMA 1UYYA 2JDPA 2W47A 3AYDA 3FN9A 3ZOIA 5IVEA 2Y33A 1H2KA 2A75A 4BQWA 3PIJA 3ZFEC 1JODA 1OLRA 5FZFA 1COV2 5HI0A 4JTOA 3U14A 3W21A 5AC92 2ZMNA 3EYPA 4Y1VA 2BEOA 3H8RA 1W03A 2HYXA 1APNA 1LGCA 2IC1A 1JU4A 2JD9A 2LTNA 3BYWA 3MIDA 5FZEA 5FDBA 1A8MA 1PVC1 4YFZA 3AMQA 4Y20B 5C4WB 2FMDA 2GC1A 4RS5C 2IXKA 1JU3A 1WZXA 1ZZ9A 1DGWA 5FPBA 1ND3A 2EXHA 5FYSA 1ZRRA 4RR3B 4CU8A 1UKRA 3LGRA 2JDKA 4GAZA 1W8TA 4D7YA 3ST7A 4IV1C 1OOPC 4YG6A 2PQSA 1O6UA 1AR81 1B35B 2R043 2DCJA 3MLKA 1OC1A 5A3NA 3OG2A 4GMP0 3WQ0A 4R4XA 4FTSA 4LBQD 1SG3A 2MPFA 2P17A 3BODA 5KC5A 2ZHMA 4E2SA 2YC2A 3KV4A 4EZ4A 3OBTA 3QCWA 3V56A 3DPRA 4JDMA 2ENRA 3I97A 4ARYA 3ATGA 2R16A 5CKMA 2GU9A 4B4PA 2A3YA 2ZGNA 4NWVA 5FXWA 5DUVA 3MLJA 1VBE2 4TYSA 4E2QA 3VBUC 5LASA 1JH5A 1Q8PA 1NA1C 4WM8B 1H8TA 1G86A 2GZWA 2VZOA 1SLBA 1TME2 2UYBA 3T1MA 3WQ1A 3S5AA 4AZZA 4CDUA 1SLIA 1V6MA 1CJPA 3KT4A 3VD9A 2ZABA 4XDPA 1GU3A 2B46X 3WNLA 3W58A 1TG7A 4HN1A 4LORA 2VH9A 4LOSA 1JHNA 5JIUA 4LHKA 4XXPA 1GQGA 1DG6A 1VBD2 3Q8BA 3F95A 3MLLA 1ST8A 3LEGA 2XBO1 5F39A 4YZ2A 5C5TA 1DZQA 3HQRA 1GZWA 4H7LA 4UYBA 4XUTA 2RR13 1NQJA 1RVF1 3KWVA 4TN7A 4DEVA 2K9ZA 1RUI2 3NNLA 1QJFA 1VIWB 1W9WA 1XE7A 2C24A 1ZVFA 1AUYA 3N7MA 4MGYE 5K9YA 1AJOA 1HQWA 1NT0A 4BLJA 3THTA 2V72A 3D0SA 4AVAA 3S6PA 1ACCA 3AYCA 2GNBA 4RGKA 4XQ4A 3AC0A 1KJRA 5DAQA 1NE4A 2P6CA 3O1PA 3KF5A 5FP7A 5FXZA 3B69A 4H14A 3A0NA 5JMOA 3VDDA 3N9OA 4JGYB 1WMDA 1VRH1 3ON7A 3PMSA 2BGOA 1J1TA 1D4VB 3T2QA 3FWEA 2XJRA 1YQ2A 3PTYA 4HANA 4HPKB 4B7KA 3VL9A 5HPOA 5DAWA 1N3OA 4HSJA 1OLQA 3FC0A 2QQWA 1DF0A 4CTEA 1G9BA 1CD3G 1UL9A 3KCYA 5FYIA 1OF4A 2OZ6A 2VNRA 1HB1A 2OXBA 5A33B 1W0OA 3N7KA 3AL5A 4JGZC 1VBB3 2VMGA 2JKBA 1YQ5A 4YGCA 4IGOA 4YYOA 4Q2FA 3IDAA 4TTGA 2WNVC 4PQQA 1WCQA 4WM7A 1IKPA 2QQIA 2BTVC 2XLGA 3J7MA 2GALA 1RUF3 3PDQA 1SBFA 5LY1A 5A7SA 3KT1A 3ZXKA 4IEUA 1C8M1 4CP9B 3UL2A 5SV8A 2R1DA 2DVFA 5LZ6A 4CCOA 1QQP2 1XNAA 3KCXA 5LK5A 5ABJC 4Q4X1 2NMNA 3P5BA 1UU6A 3JD71 3LDKA 2W92A 3VV1A 2FMYA 4GWNA 5FUIA 3C3VA 4FFHA 1S2EA 3POBA 4QPGA 1JOJA 1QJZA 5LW9A 3DYMA 4YM2A 2YBKA 1SDWA 1F9KA 1RGSA 2B8MA 2QVSB 3MIBA 2RS51 2VUCA 1XOYA 3H7YA 4XF3A 4BZ4A 5FQ0A 3GHMA 1E5RA 1O4YA 3JBG1 5AVAA 3B93A 4QPYA 2V4VA 3H7JA 4QGNA 1NX9A 4UI9L 5I0UA 3HIFA 4Q4W3 1DYOA 3BCWA 2ZGQA 3WDXA 1SBDA 2W68A 1K12A 1C8NA 1PX4A 5F8PA 2XXZA 3D82A 4CXXA 1W0PA 2ID4A 3DXUA 2Q8EA 1RUE3 4BQYA 4XHXA 4XF0A 4F83A 5DUUA 3ES1A 4Y1XA 5FY7A 1PO22 3POYA 3S0MA 2D44A 2W1UA 3AKSA 5FZDA 4H3WA 3ZR5A 5FK8A 3PVOA 4IV3C 1BBT3 1Y9GA 2VPVA 2VXJA 3VD3A 3K46A 3VZOA 4RR3A 3HNMA 4AFBA 4D7SA 4HVQA 5EYXA 4IDZA 1RUJ3 4O65A 4WBBA 1GP4A 1NE6A 1R1A1 1RJ8A 2DU0A 3O14A 4OHZA 4Q29A 1D2SA 3QH6A 3A22A 4K6BA 4UT5A 1W8FA 3ZFFB 1W6QA 3NVCA 5D8AC 1LU2A 1PGW1 5H9QA 2BBAA 3H3ZA 4FAGA 4MG2A 5LEJA 4YVWC 4GJYA 1AXKA 2DUPA 3J8F3 1AR93 3OB8A 1LHOA 1MEC1 1CVNA 2WZEA 3ACIA 5FZIA 4XUQA 1KJLA 2IUWA 4YGEA 4MXWB 2VG9A 4Y5SA 4NHYA 1KS5A 1GSLA 3BIWE 4WM8A 2GDFA 2B9VA 2X05A 1JUIA 4CEWA 5A3TA 3I2HA 3ZMNA 3GNEA 2VBDA 3EHKA 3DN7A 5FY5A 1FX5A 3RYRA 4CSWA 1V6NA 2BRTA 5L9VA 1G9CA 4EYUA 3TEYA 4E9KA 1QJX2 4KG0A 1H2LA 1LHUA 2FBEA 4FPJA 5ACA3 1LCLA 2PN5A 1VMHA 3HEIA 5FZBA 2AEYA 2EVXA 1PNGA 1YI7A 5LA0A 4PDWC 4XFHA 4AI0A 1EV12 4BMBA 2A71A 1GQHA 2FCVA 3ZFEA 3OOXA 4RGAA 5JAXA 3AKQA 4C8DA 1U12A 1QJEA 4X8PA 4FPKA 4JVAA 2CSGA 1RUG2 2DUOA 1OQ1A 3OUHA 1DQ1A 5DABA 1BEV3 4AOCA 1J1LA 5FWEA 3J4UH 3VZKA 3OUJA 2Q8OA 2DVGA 4NJ4A 2DFCA 1R092 1OUSA 3TEWA 2FZ2A 2X10A 4A44A 2YFUA 2W87A 4XJZA 4XAEA 2Q4SA 4XJ9A 3USUB 2P2KA 3WZ1A 1BZWA 2TUNA 3I59B 3JXSA 1UZZA 4GULA 4HPKA 3ZSKA 5BNPA 3HBZA 2WWUA 4C0BA 1B09A 3S57A 1WCDJ 1F35A 3KZ4C 1AX0A 1AYM1 5E16A 1ZRFA 5A33A 2VQUA 1LKNA 5D21A 5ISLA 2K46A 1UKGA 2DVAA 2JB4A 2OYZA 1FAYA 2EALA 5A6ZA 4MO3M 5FY1A 3THCA 3OYWA 1HKDA 4LO5B 4XW3A 1CIWA 5BNOB 5CKNA 2UWBA 4QM9A 4FFFA 2JWPA 5FYUA 4S2DA 3H1WA 3I2GA 4IQPA 1PIV2 2ET1A 1OURA 2A6XA 2GNMA 5CA6A 1MS8A 5FZ4A 4IEOA 4E27A 3PURA 3RS6A 3RI8A 2JE8A 3GCXA 4AI1A 5IATA 5IVCA 5E6HA 5FZKA 2AEZA 2PQQA 3PMEA 3U0ZA 1D7PM 2JICA 2VL4A 1IPJA 5FYYA 1XNBA 3BOPA 2OIIA 1RUC2 3T2PA 2CGPA 4P9YA 1ND2C 2PFWA 2D93A 4LPLA 4V1PA 1WA4A 3RJ2X 2ADEA 1ZZ6A 2A1XA 4KH9A 2P37A 5A3WA 1TQ5A 3D6EA 5DDJ2 5T5LA 1VBC1 4RD7A 5IAVA 2VZTA 1HJGA 3TB0A 1CAVB 3HMYA 1DLCA 2YBPA 1UD1A 4PT6A 4Q5OA 1VAVA 4CUAA 2WT0A 3H50A 1UY3A 1VB4A 3SH4A 1QDCA 2X5IA 2PHWA 1UOBA 1IG3A 3WVJA 1W06A 2WABA 4L2NA 1HV0A 1RITA 5GZGA 3VBSB 4LE3A 3ZIWA 3LOBA 1JZ4A 2RS31 3ZXLA 1RUD3 5CNAA 5I91A 3E6BA 3VBOC 5DG2A 4CEYA 3M7AA 4BQ4A 4FP2A 3ZYGA 5FZ3A 3DKWA 1QJY1 1GZTA 1H4GA 4Q1RA 3PJQA 2BYVE 2RV9A 4JGZA 1HRI1 2HWC1 1RHI1 1OA2A 5FJHA 1UYPA 2HWB1 2JDYA 2IWGB 4QKFA 4NHXA 5JXIA 2DV9A 2PHDA 4YGDA 1PMHX 1DZRA 1PVC2 5ANNA 3MPBA 1BLZA 4DIQA 3UGFA 3UJQA 2FDHA 4JDNA 5FP9A 2XPJA 1H1AA 2WFF2 3EMRA 3H3UA 4AGVA 2E7TA 4FPOB 4BQ3A 4Z2WA 2HWF3 2CGOA 3AP6A 4OUSA 5ERLA 3FFQA 1RJ7A 2A3WA 5ABJA 3DGTA 1PK6C 4YSFA 2EAAA 2FDKA 3R4UA 2VUAA 4AVCA 4KL1A 2Y6FA 1QEXA 4B29A 1QXJA 2Q30A 3I8TA 2D40A 3RFRA 3ZXEA 5B4NA 1TMF1 2J22A 2JENA 2IVIB 3L2YA 3GZTB 1DBNA 4OZOA 3RMXA 2GMMA 3W59A 2RM21 1T2XA 1VJ2A 4XUOA 1F5FA 1YEWA 3ACLA 4AVBA 3BI3A 2Q1FA 2ZGOA 4AHWA 2DDUA 2P5BA 3DCQA 1LOFC 4PIXA 3UKTA 1GWLA 3HN3A 3CLPA 4M3CF 1UIKA 3DXTA 3SNMA 3MICA 1IHMA 1JMUB 1NCQB 1UY2A 2FDGA 2YMZA 1LOGA 3GALA 4QGMA 3MYXA 1X8MA 4BCUA 2EAKA 1DQ4A 1WW7A 3NAPA 5JR7B 3WR0A 3IDCB 1FMD1 2HWD1 3B01A 2NZ9A 4LXLA 2C4XA 2XBO2 4RHV1 2L9LA 5T54A 4AI8A 2HEYF 1BQPA 3APBA 1RVF2 4ZS2A 3SLIA 3B00A 3N4MA 3IDEA 3KSCA 3W20A 1G9FA 4IE5A 5LBFA 2JX9A 2BERA 4QXBA 4OYUA 3N9LA 2DTWA 1JYIA 4M4RA 1GICA 3WNKA 1OSGA 5FY9A 1QQP1 3LIGA 4DFSA 3IIIA 1AX2A 1LOCA 3HQXA 4YVSC 3WV6A 2E9QA 5JCTA 5F3IA 3OY8B 4Q0UA 1GLHA 2EIGA 2RJ2A 2E26A 1IQDC 2PHUA 2RMU1 2ZXQA 3KD4A 4GH4B 1WW6A 3ROUA 4CUCA 2CAVA 4AW7A 1GWMA 1OD3A 1UWWA 5F1RA 5FREA 3VKLA 2ZMKA 1VRH2 2OQ7A 3ES4A 3ZXJA 5LBBA 1W6PA 1VBA3 1GKBA 4UFLA 2HWE3 3ETQA 4AEDB 4QKNA 2CNAA 3OBZA 1YO8A 5C3QA 3FZ3A 2CY6A 4LKFA 4UF0A 3O1RA 1AL23 1UOJA 1V0AA 4FFIA 4LO8A 4RQPC 4I2OA 3J9SA 1COV3 4L99A 5C3OA 3OF1A 1AYN1 2D5HA 3WW2A 4EN9B 2RVAA 5AC93 2TBVA 4ISQA 1ZBA1 2ZGPA 1NG0A 3D3AA 4RYDA 3ZMOA 1X8EA 3LE0A 4D7TA 4AR2A 4IEPA 2GH2A 2JIJA 4AAXA 1VE0A 1EYBA 4M0NA 1OFNA 3BN6A 2ZEWA 2VMCA 2ZEXA 1C8M2 2Z4FA 2RE9A 4QD2A 2QQKA 1T6BX 4BYYA 4FQ4A 2VZQA 4Q4X2 5LK7B 4KNCA 5FZHA 3JD72 4YZ5A 1BHGA 3IPVA 3I3DA 4HOOA 4TWTA 1LECA 4ET7A 4D3WA 4OHYA 4AWDA 4ZXEA 3E5QA 3VDAA 1WUVA 1IS5A 4P02B 3WINE 2RS52 4ZS3A 2WZR3 3RPQA 3CZJA 3JBG2 1GP5A 1ZM1A 1S0BA 2BGPA 4W6WA 4QB2A 1W9FA 4YW5A 2ARXA 1XNCA 2PAKA 2XJSA 3UGGA 1VBE3 4CDXC 5DZFA 1W6MB 3RZKA 2WNUC 4OI2A 3RSJA 3GF6A 1F2NA 4AI3A 2OQ6A 1TME3 2F4LA 2YV8A 1CPMA 3LEIA 3WT3A 4K1YA 1CX4A 4PI2A 3VKFC 1Z7S1 3DPRB 1U5ZA 2WSUA 2GAUA 4HT1T 2Q5TA 4X8NA 1YJLA 3GZAA 3P3PA 4HETA 4BJ0A 1UXZA 1S55A 2VZRA 5C8CB 1O3RA 2YU1A 4CP0A 2DTYA 2RHPA 1J3PA 1VBD3 1OA4A 1NQDA 2WNEA 4M3CB 4QB6A 4A7YA 4GQ7A 1XU1A 1E5SA 1H8TB 2D97A 3I3MA 4PIZA 4M00A 2DU1A 3IKWA 3PU8A 3U07A 1SDDB 4B1LA 1O5LA 2NN8A 1JZ7A 3BIEA 1RUI3 4Q0PA 5LRRA 2LM3A 4CU9A 3E5XA 3WNOA 2GNDA 5CG8A 1R1A2 4K40A 2NQYA 2P6HA 2ZX4A 2JXAA 5K8SA 2D7FA 2ZKNA 4QDRA 5D1IA 5T55A 2DCYA 1IG0A 3DUIA 4KWLA 1PGW2 2JDAA 4QX7A 3R05A 4UFIA 4WV8A 5I0TA 3RDIA 3NW4A 3WX5A 5AFBA 3X29B 1W90A 2E7AA 5FZ1A 3NV2A 2BJSA 1GZWB 1MEC2 1Q8VA 2PAEA 4P9WA 3M3OA 4XFIA 1ENSA 1VMFA 1R091 4QQHA 1ND2A 3OGSA 3V0BA 1ZRCA 2PAMA 4NAOA 5FZ8A 1P8JA 1PX3A 2XQRA 3Q8CA 3RJRA 4MGTA 1XU2A 4HL0A 4YW2A 4GB31 3N9PA 2BNMA 3A0KA 3Q8FA 3SCHA 3BKZA 5LA2A 4FOYA 1HN1A 1NCQA 3C7HA 2R073 3RNSA 3IZOA 3M3CA 5LY2A 2WLQA 2WRAA 4ZU7A 1C5HA 2G19A 3V0AB 4Y1ZA 4N43C 4L8QA 3M4FA 2D3RA 4XBNA 5I0SA 3T2TA 3VDDB 3CJXA 1QOOA 2VMEA 2VNOA 3RZGA 1V00A 4XJWA 2QFEA 3H1YA 5EQUA 1IOAA 4PLMA 3RGBA 5KWRA 2YY1A 2BZDA 2E31A 2RS12 4Y5TA 3LPFA 1NAEA 4N9IA 3AXDA 4MXVA 4KI5M 3AJYA 1QMJA 3WNMA 5BNNC 1EAH1 2D43A 1W8WA 1X36A 3VL8A 4IL7A 4Y4RA 5FZMA 2ZPXA 5FIXA 3T30A 4DB5A 1CQ9A 1M4WA 3UNPA 2EF6A 3OGVA 4I0BA 4XZPA 3N7LA 1ZYBA 5I8YA 2PHXA 2W39A 5IWFA 4YPJA 1XYOA 4C1WA 2WFPA 5FPVA 3FHQA 2QTWB 1H2NA 2YUEA 4LBKA 1SEFA 1G7YA 4LULA 3BTYA 3AVSA 4ATFA 2GH8A 1N3QA 4GKYA 1HXS1 4UFMA 5HCBA 3WCRA 4MOAA 2FZ1A 3NSTA 3AL6A 3NQHA 3PIGA 2JE9A 5GZDA 3NWKA 1RUC1 4K8FA 1ULFA 2BVBA 1QDOA 2PYTA 3JB8A 1V6IA 3QBQA 4P5HA 5C9AC 2X53S 3WP3A 1FATA 4RN5A 1UY4A 4MYEA 4FT8A 2FCTA 1UX6A 1LRHA 3ZXDA 5T3NA 4LKEA 1AYM2 2WDBA 2WO1A 1CAWA 5FQ0B 2WLPA 4QM8A 3RQ0A 2P1BA 3S30A 2UWAA 2VBBA 4HKOA 5EHDA 5CFDB 1V9U1 1NCRC 1PO23 2CL2A 2IFRA 4DZGA 2ATFA 4AI9A 2E33A 2AYHA 3J7NA 5CISA 1UZVA 4JQTA 4QHZA 1YCIA 3VZMA 1OF3A 3AYAA 5A6YA 2YPJA 3FL7A 2P4EA 3PVBB 4GKXA 2VCAA 1UYZA 5C6CA 5DQ0A 4F3JA 4FXGB 3LCPA 5IVJA 5KHIA 5IT6A 1FYUA 1JW6A 1LHWA 4QXCA 5KBFA 2ZEZA 1AZDA 2VVFA 2ZGTA 2VQ0A
chains in the Genus database with same CATH topology
1AR61 5EZWA 3M8LA 2I07B 2WFF1 5IUQA 2K2SA 1S0JA 4HLTA 5J37A 1W6MA 3RWNA 2JEMA 4PQ9A 4XILA 5FFOC 1VBC2 4NHMA 4AQSA 3WG3A 1W6QB 4XF4A 1ALYA 1ASJ1 1AR71 2FHRA 1IZ3A 4HVOA 4PCRA 4BIOA 1QJX3 4YZ3A 4JV4A 5FRAA 1IKQA 5C8CA 4JCKA 2YROA 1U5YA 4M3CA 4LO7A 4CP2A 1KS4A 2RS32 3EQEA 5JMCA 1EV13 4CEWB 3VKMA 4DRRA 4YARA 1XRUA 3C2UA 4IETA 1V6OA 1RTVA 3JCIA 3VBRB 4RQPA 1EP0A 1MQTC 3B5LB 4E2GA 2ZHKA 1QJY2 3EJKA 4JGYC 4W65A 3BPZA 4XETA 1HRI2 2HWC2 1N47A 1RHI2 1S2KA 2HWB2 4FTBA 1RUG3 4P9IA 3AZXA 4C0HA 1GBGA 2XJUA 3URFA 1RUH1 2MEV1 5GALA 4YG3A 3R4SA 3WUDA 4BQ1A 3ZFEB 3UK9A 2X8KA 4P9GA 2DYCA 5BXXA 2HYKA 2WS93 4IEVA 4WZCA 1CAUA 4ITCA 1R083 5HCFA 3WNXA 3A4UA 2DVDA 4JDOA 5FCCA 1OD5A 4R9CA 1FOD1 3NV4A 1TMF2 3MIHA 4QU2A 4RS5B 1QH7A 3G6JB 4LBQA 4LHLA 1OPOA 3VBFA 2RM22 4YZ4A 1UMZA 4IV1B 1H4HA 1OOPB 4N53A 4B4RA 5GZCA 3NJZA 3V0AA 1MS3A 2QNKA 3I4IA 3QACA 1VLNA 1ZZ7A 2PLV1 2UURA 2B5HA 3LA2A 1MS4A 1Y43B 3HN1A 1RL3A 2B39A 4LUMA 5BNPB 2XLFA 4DY3A 2VW0A 1CJDA 3E5UA 2PHTA 2ZBJA 1EY2A 2X29A 1GYKA 3UKVA 4AHXA 1K5MC 1POV3 1FMD2 2HWD2 2UY9A 4AYUA 1O3SA 1PIV3 1O3QA 4JC1A 4RHV2 1CR7A 1NA1B 3MDPA 4XHBA 1WBFA 1N1VA 3M70A 5I0RA 4QQOA 3PVNA 3POWA 2AREA 2ES3A 2NMOA 3OYWB 4FP3A 5J48A 1LENA 3D4KA 4XJ8A 1O4ZA 5JDBA 2AZ5A 1URXA 1YUDA 4N7IA 4BPZA 3JUUA 1MACA 1Y9QA 4AGGA 4LBLA 5DDJ3 4ISRA 1CPNA 1ZBE1 4K1ZA 1AHSA 3ZXGA 2RMU2 2ZX1A 5FPZA 4Q8LA 5F6KA 2WZPP 3AP5A 2O1QA 2UU8A 3WUCA 2VXRA 3WXPA 1M06G 1S0FA 5J36A 2PELA 5CFDA 5I8TA 5K0UA 3FFZA 4K21A 2MNGA 3AP4A 3JQXA 4EN7B 3I54A 2R061 4XFFA 1AYN2 3OBRA 1D0HA 4EN8B 2TEPA 4XIKA 3CJIA 1ZBA2 2X5IB 5FBZA 4B8EA 4B3NA 1PVC3 4ES8A 4YM1A 5F5QA 1PM7A 4XF1A 2GN7A 5BNNA 4CEYB 4UW3A 5HXVA 3JB4C 4YM0A 4I0WB 1AR83 2DCKA 4OULA 1H1IA 4Z07A 4JGZB 2ZJCA 4FPCA 2QDRA 3AB0A 2TNFA 4URTA 4A7ZA 2O8QA 2WNVB 2JG8C 3U11A 1SFYA 1QOSA 4C90A 1WW5A 5JZGA 5EYYA 5CG9A 1W39A 5BNQA 4AFCA 1LR5A 1MVEA 3M3EA 4GWMA 4S2HA 5GJ6A 3K48A 5ABJB 5CADA 2XKOA 4WVMA 1MS5A 3RMYA 3WY6A 5C9AA 1UAIA 4OI1A 1BXHA 1YFUA 5B2GB 5L19A 4TZDA 1Z7S2 4J1XA 3VBRA 1D4M1 1ONAA 3KCCA 3AM2A 2D6MA 1MZFA 1NY71 2BWAA 4RSUA 1VAMA 3CU7A 3WG4A 2XVGA 4CRQA 3FBYA 2XBO3 4XJAA 3RRDA 3TN92 2R49A 1PGL1 1S1AA 1RVF3 2GMEA 4BOWA 1RIRA 1WD3A 3FE5A 3ZVXA 5A32A 1T6GC 2RS11 1WBLA 3MIFA 1HRV1 2JECA 3NAPB 1YIPA 3ZSMA 1NXD1 4KBBA 1QJU1 2A6ZA 4KGGA 5DG1A 4YW4A 4DS0A 3FUOA 2EXKA 2H6CA 4S2FA 3LSDA 3B7MA 1V70A 4RS5A 5E1RA 4EJRA 5CFCC 1QXPA 4IV3B 2PTMA 5EXOA 1I5ZA 1YRZA 4IV1A 1OOPA 2AENA 3HT2A 3M3QA 1VRH3 4I0AA 3WCSA 3O0VA 4GB32 1YIFA 5D8AB 1F5JA 4YVWB 2CYFA 4BHPA 1LESA 2JD4A 4KWJA 3MF6A 3BALA 1OI6A 1XXNA 3VBUA 3SH3A 3O7OA 1DGRN 1NA1A 3W9AA 4HZFA 1W6PB 4WVZA 3MW2A 3QOPA 2R1BA 5L36A 4Z8BA 4OUMA 2A73B 4R4ZA 1H8VA 2VMHA 4XPVA 3ZSEA 5GLTA 1C8M3 1EAH2 2V5YA 1YFYA 2YDEA 4Q4X3 3ZFGC 1X33A 2ZGKA 3JD73 3MIGA 5BV6A 5BYNA 4PDWB 4KG8A 4XE9A 3USSA 3VKOA 3KGLA 4H55A 4L11A 1UU5A 1HXS2 2RS53 4AFAA 3JBG3 4GMP1 2ZGRA 1PHMA 4JTNA 5LRSA 4XEZA 3ALQA 5KXDA 1UCXA 1ZNPA 3IPVB 5GZFA 1UPIA 1D0GA 4DXZA 3GZUC 1UN1A 4NVPA 4MVTA 2PHLA 5CU1A 2NLRA 4CDQC 1L3JA 3VN4A 3N3HA 1V9U2 2DCTA 3HWJA 2I2SA 4ATEA 5EWSA 4ZKTB 1HV1A 2DVBA 4BM8A 1QOTA 1AX1A 1CGPA 2BPA2 3FLPA 3UJOA 1SACA 2IXIA 1IS3A 4P14A 4GIQA 4RFT0 3RG0A 1KITA 4ASLA 2XJPA 3AMNA 1R1A3 5AVPA 2D6KA 5L7OC 3LA3A 1CONA 4LLOA 2SLIA 5F6LB 1VAKA 2ZGMA 1AXZA 2JE7A 4FPHA 1XE8A 2DCZA 2WNVA 1RUNA 3E6DA 4MSVA 1AR62 1MEC3 3HAGA 1H9PA 1I6XA 1WLCA 4LA3A 4UBHA 3AK0A 1YJKA 4FVVA 4BWOA 1FPN1 1LEMA 2W52A 1YNAA 4QGLA 1H0BA 2JG9C 1ASJ2 1AR72 1C5IA 3ZSLA 5JSRA 3MI8A 1PVXA 1LULA 4B7EA 4Z82A 3VGIA 4LA2A 3SMHA 1ND2B 3V0BB 1RMU1 2A6VA 3WP6A 2C9AA 4Y26A 3SHRA 4FQZA 4GH4C 1QU0A 3KGZA 4M01A 1LHVA 3O12A 5E88A 4RGGA 1R1ZA 1X82A 2H0BA 4CDWC 3VBHC 3EO6A 5CBLA 2AH2A 2IZWA 1BVP1 1JN2P 2WKKA 4Z1VA 1BJQA 1OQDA 1O7FA 3ZO0B 1Q8OA 4LNVA 1RUH2 2I74A 2MEV2 3AXEA 1ZZBA 4AE2A 2F4PA 4GALA 4A3XA 4E4DX 2D6OX 3VBOB 1PO12 3HD8B 3AYEA 4IV3A 4SBVA 3G7DA 3SCGA 4PJYA 2XL9A 1KQRA 4OI0A 1EPZA 3N7JA 2CAUA 3WW3A 3H1MA 3LWCA 2YGLA 3TOJA 2CTVA 1FOD2 3SH5A 3WP5A 2I45A 5D8AA 2JG8A 5KHGA 4XDQA 4YVWA 1C57A 3IMNA 5IK8A 1AYM3 4O9EA 1X7NA 1QNYA 1PK6B 1PNFA 1HQNA 2PLV2 3AZWA 1OQEA 5T5JA 3ZSJA 1G8WA 1NLRA 2BNNA 4FOQA 4PBPA 2W0XA 5JOYA 4AFDA 5I93A 1ND3C 2OVUA 2D6NA 2A6YA 4QPIC 4M0HA 4XFBA 1A78A 3NV1A 4Q4Y1 3PLQA 3OD4A 4Y24A 2ZX0A 4LEJA 1BEV2 2P34A 4LLFA 1CAWB 1MR5A 2OPKA 3MEPA 2VUJA 3H0OA 3TBDA 1J3QA 1HIXA 3M1HA 3WW1A 3DPRC 4PDWA 3EXUA 1IPKA 4COYA 2WL1A 1VP6A 1BK1A 2GNTA 4I02A 4BMEA 2G9GA 3VHOA 4LBOA 2BNOA 3NV3A 5GLZA 1H8TC 1YI9A 1AVBA 5A3MA 4XMIA 3AX4A 2XVKA 4CDUC 1VBC3 3ZYIB 1H1MA 1ZBE2 4KQ7A 1TNFA 2QUOA 5DUXA 2XGXA 3IT8A 4YZ1A 4A7KA 1YFXA 1DLLA 4Q4V1 4CZSA 1SFNA 5HCAA 2BGCA 3GBWA 4FPGA 4HSLA 5KHHA 2CV6A 4OHVA 3O5SA 3FLTA 2RS33 5JSOA 3I7DA 3OPZA 2NYYA 4YVSB 1ULGA 3ZYJB 3D8CA 3AZZA 2R062 3OD0A 4XJUA 1QJY3 3RYPA 3NL1A 4E4SA 5C8WA 1HRI3 2HWC3 1RHI3 2HWB3 4IEZA 2H0VA 4Y4YA 4DPNA 1N1TA 2LALA 5CB7A 3HR9A 1FNYA 3TN91 4YLZA 3LAGA 3WOGA 2Q0AA 2IFWA 4RQPB 3FHIB 5GLUA 4SLIA 2OUHA 2R041 3VDDC 4QQPA 1UU4A 1XQNA 3WQ7A 4Y22B 4IEXA 1G9AA 1I9RA 4IXLA 3QH7A 1JXNA 1TMF3 2QQPA 2D3PA 3DV8A 3ILFA 2XVLA 2RM23 1S0GA 3AP9A 1CAUB 4COVA 3O0WA 1OMIA 4C1XA 3WDTA 2C1FA 4WM7C 1ENQA 5CIRA 4FAHA 5J98B 4K3UA 3R6SA 1HLCA 1D4M2 3HT1A 1LB2A 2QJVA 4Q1PA 5JOXA 3B9IA 4FXKB 3U0ZA 2HJIA 4LBQB 1RUOA 3VBFB 1NY72 3NO8A 5JIAA 1NYWA 4CDXB 2RJLA 1W6NA 1FMD3 2HWD3 3MPPG 4N53B 2WSVA 4NOTA 3QD6A 4TSVA 4RHV3 1DYKA 1YHFA 1MZ6A 4QPGC 1ULCA 2EXIA 1PGL2 2RR11 1QNWA 4PBOA 4DRVA 1XYNA 1LJ7A 2WA3A 2ET7A 3VBOA 2XG3A 3P3NA 4FOWA 5GKAC 3ZPYA 4LR4A 1HRV2 2ILMA 2KM2A 3ZXAC 1QJU2 1QQP3 3ZN5A 4UBGA 2XWBB 4YW1A 1NZCA 1HX6A 3WHUA 1SMVA 4NPRA 3BB6A 2RMU3 5DZEA 3VHRA 5FLJA 2ZOEB 1XYPA 1KDMA 1N1YA 1PK6A 1NLSA 1UF2C 4LO6B 4BLIA 3VUOA 1RINA 5C4WC 3ZIXA 3VKNA 4RR3C 2CWSA 5KC6A 1J58A 4QQLA 2C5DA 4N90A 3SITA 1B35C 1LU1A 2VECA 4K20A 4AXOA 1AYN3 4L92A 3ZN6A 1VBB1 1ZBA3 1LOFA 1WMFA 5BUVA 5K0UB 2QDNA 4Z92B 3OGJA 1RUF1 3ZX7A 1S0EA 1IGOA 1ULDA 4XFCA 4D69A 5J3UA 5L73A 4GA9A 4N43B 4WM8C 5BY5A 2Y38A 4CEWC 3CJIB 4K9SA 2OUJA 4I01A 1PZ8A 4LBNA 1QHDA 4AQTA 1PZ7A 3J26N 2ETEA 2ZGLA 1NOVA 1SCSA 2NP0A 4YGBA 5JOWA 2WT1A 1UW8A 2DWRA 3BTAA 3POSA 1VR3A 3IM0A 4R52A 1S0IA 2HWE2 3KS7A 4OZXA 5BNNB 4HK8A 2VY0A 4Q4W1 4XBQA 2H6BA 1AL22 3MFCA 3SISA 2R0HA 4YVSA 3GBFA 1Z7S3 2HEWF 1RUE1 4HKWA 1FV3A 2GMPA 2WT2A 5JZGB 2VOVA 3CNAA 5JOZA 1KFUL 1QGLA 1QWRA 2Y0IA 4KU7A 4WVMB 3CO2A 4DOUA 3TN93 5C9AB 1MVQA 4J1WA 4QPIA 2P3KA 1BBT1 3ZYRA 3H9AA 4XQWA 3Q9OA 5JI7A 4AFMA 3TNPB 2R32A 5FOBB 1C3HA 1RUJ1 3KLSA 1GV9A 4XBLA 4EWAA 1V6JA 2NPIA 5K7PA 2A5ZA 4U2AA 4Y22A 3MW3A 5C33A 4HKLA 3WHTA 5BNPC 1NCRB 2WZR2 4HN0A 4F7ZA 3J8F1 1AR91 1N1SA 1MZ5A 1MS9A 1OHFA 1R093 1ULEA 1FPN2 4YFWA 2VQAA 4EN0A 1PO11 5A32B 3AFKA 1GNZA 4HK9A 2GC3A 3PVEA 3K51A 4A7YA 2VW2A 3IDBB 3VLBB 1OA3A 1F31A 5JSPA 4GB33 4C91A 1H9WA 1DGRA 4FPEA 3S7IA 1REFA 2ZX2A 2AR6A 2Z42A 3WG1A 4COZA 4LO4B 4QX5A 4CDXA 1DQ0A 5ACA1 2UWCA 2WNUA 1RMU2 1UIJA 3ZDSA 3MFAA 5E89A 2BVVA 2VOXA 3E97A 1DQ5A 4FCAA 3FBMA 4G4FA 1DGWX 1PZ9A 4KU8A 4NO4A 5FOJB 4WZFA 2D5FA 1EAH3 1REDA 3PNAA 1OKQA 2Y0OA 3VZLA 4N9HA 3QLQA 1BEV1 1WMEA 2QZ3A 3VBUB 4HBNA 3JQWA 4NR1A 1ENRA 4RL7A 3RZZA 3WG2A 4U36A 1G9DA 1MQTB 1HXS3 2X5IC 3T1LA 5T52A 2IXHA 1RUC3 5I8SA 4I3PA 2ERFA 4FOVA 3VHPA 2D6PA 2G4IA 4AHYA 1HW5A 2R072 4LTAA 4N7UA 4I3GA 4CEYC 1WLWA 5IK7A 1CAXA 4FO9A 2WA4A 2R0FA 2QE3A 1XNKA 2QKDA 3KT7A 4UXAA 4X6RB 5T5PA 5IK4A 3ZFFC 1V9U3 2XJVA 4XTMA 4AI2A 5FO8B 4H7MA 1Q3EA 3TNQA 3M3IA 1DFQA 1A8DA 1AL0G 4Q4Y2 4PF5A 1AXYA 2HKXA 3L9JT 4N43A 3E6CC 3N35A 1J59A 2WINB 3LA7A 3TAYA 2JDZA 2Q1ZB 2A70A 2VULA 4GMP3 5JI9A 1AR63 1BMV1 1LEDA 4MV2A 3WLUA 2WFF3 4COWA 3D0JA 3IBMA 1K5MB 1WCSA 4Q0SA 2Z5WA 5AFEA 1LOAA 2DURA 2ARBA 2WQ4A 1AR73 1ASJ3 1G6NA 2GN3A 4Q4V2 4DMIA 3V64A 1WLDA 3NAPC 1EPWA 3SCFA 5FMOL 1WLTA 2R6QA 3DF0A 4M3CE 4CP1A 4BH9A 2XH6A 4KWKA 5C4WA 4Y20A 5GZEA 2P3IA 4TLFA 1Q5OA 2XWJB 4RA0A 1RUD1 3BOWA 5DXDA 5FAXA 5H9PA 4AK3A 2OZJA 1B35A 2ZZQA 3FUQA 1DHKB 1Q8SA 2BQPA 2E51A 4X6QB 2B45X 4B4QA 1NCRA 2VW1A 1RUH3 2MEV3 3WDVA 2WJSA 4EWEA 1X50A 2HWF1 1PO13 1RC6A 4BE3A 2P3JA 1IS4A 2R042 4Q0VA 5FTTC 1ZX5A 3WDUA 2YC0A 2G9FA 3ASIA 4OLLA 1C28A 1W6OB 1FOD3 2WIIB 4NN0A 2BFUS 1V6LA 1N3PA 4PLNA 4WVWA 2B9UA 2QCSB 1GNHA 2DF7A 5BNOC 4KGQA 3ECQA 1YFWA 3KQRA 4EWDA 1S2BA 1SQ4A 4QHBA 5SV5A 3VZNA 3MZHA 2ZS6B 2PLV3 2VU9A 3PHMA 3H8UA 3I2DA 3ME2A 2JG8B 5KXCA 3OCPA 4AG4A 1Q56A 1DQ2A 3L2HA 1BCXA 2BWCA 1QF3A 1SLAA 4JAAA 5J7MA 5JLVA 4R8HA 5KHJA 2SBAA 2ZHNA 2KA3A 2OA2A 3PJYA 2D6LX 4NHLA 2RR12 1ENXA 4DNYA 2WS92 1BVVA 1R082 2ZMLA 4XIOA 1HQLA 1MQTA 2Z2SB 5CVRA 1H2MA 4JGYA 4L97A 3D5OA 2XJQA 3THPA 4UW5A 4ZXKA 4JRAA 3VBSC 3S7EA 2UY8A 5KXEA 3GHNA 1ZBE3 1Z0HA 3B94A 4BIFA 5FO9B 4XYXA 1LTEA 3MIEA 3TYJA 2O0OA 3VZJA 2XLAA 1VBA1 4FBFA 3U4XA 2HWE1 2DFBA 2ZGSA 1SLLA 4AF9A 3UKNA 3ILNA 5BPXA 1V6KA 1LGNA 5FLIA 3FJSA 1H30A 1AL21 5DZGA 4LT5A 2B7YA 5CFCB 1A6CA 4F8AA 1COV1 3AZVA 4AEJA 2R063 4MZUA 4Y1UA 1W2UA 1PGSA 5AC91 1VBB2 2VGDA 5JPMB 4LUKA 1U0AA 2RJKA 4ES9A 1CESA 5DUWA 1S0CA 2HEVF 4OVEA 2ZGUA 4DY5A 1RUF2 2K0GA 1QY4A 3AZYA 4K7JA 1Q8QA 3AKRA 4EROA 4XFGA 1DQ6A 2W08A 2XL7A 4ONUA 3IIAA 1HDKA 1F8VA 2E6VA 1K5MA 2VOKA 4L9BA 4MGZE 1ZREA 2VMIA 2ZA9A 2LUWA 3R4DB 5EV7A 1NCQC 1QH6A 3NKTA 2WZR1 5CAZA 4QT6A 2ZAAA 2AGSA 3GYDA 1YXWA 1VBE1 3VHNA 2JJ6A 1DZTA 3AP7A 4Q4W2 3ZFGB 1JUHA 1TME1 2E7QA 2O8OA 2FQPA 4IEYA 5T5OA 1FT9A 4UW6A 4QQ2A 2GSYA 1D4M3 2WWSA 1NXMA 4IEQA 1RUE2 1TE1B 4R9DA 2EA7A 1BKZA 1QXRA 1TEIA 4FPFA 1LOEA 3ZFFA 3WDWA 1VBD1 4NHKA 1U5IA 4G9SB 3FX3A 1QKQA 2NM1A 4MGIE 4INDA 1BBT2 4AVTA 5LEKA 3NKGA 2GC0A 4LHNA 1AR82 2BUKA 1RUI1 1D2QA 1RUJ2 2RS13 4MXWA 1WW4A 3B02A 4Q0QA 3TWIA 4CDQB 1HRV3 4AEDC 5GLVA 2ZX3A 4R9BA 1W6NB 1VALA 1QJU3 2ZHLA 3LKJA 2VOWA 3AKTA 1W6OA 2V73A 2D98A 3J8F2 1AR92 2E53A 4AGRA 1FXZA 2A3XA 1FNZA 3WDYA 4FSJA 4QXKA 4OHXA 2A7AA 4JRLA 1GZCA 3KB5A 1WGPA 4ASMB 5L7OB 4FPYA 4EN6B 5GM0A 2XUMA 3BU7A 4PLOA 5T50A 2VVDA 1IS6A 3CEWA 4AEKA 4JQRA 3FLRA 3ZN4A 1DIWA 2B42B 2R071 4MX3A 3CF6E 3N36A 1FI2A 1KDKA 4GXLA 4Q27A 5ACA2 1KRIA 2GC2A 2WQZC 2Q1MA 2KXLA 1Z78A 3JU9A 2JG9B 5FPXA 1DDLA 1A3KA 4QMAA 4AQ6A 5FO7B 2BW8A 5H9RA 4AVVA 1MS1A 4WVVA 3AMMA 3USUA