1EYBA

Crystal structure of apo human homogentisate dioxygenase
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
439
structure length
419
Chain Sequence
AELKYISGFGNECSSEDPRCPGSLPEGQNNPQVCPYNLYAEQLSGSAFTCPRSTNKRSWLYRILPSVSHKPFESIDEGHVTHNWDEVDPDPNQLRWKPFEIPKASQKKVDFVSGLHTLCGAGDIKSNNGLAIHIFLCNTSMENRCFYNSDGDFLIVPQKGNLLIYTEFGKMLVQPNEICVIQRGMRFSIDVFEETRGYILEVYGVHFELPDLGPIGANGLANPRDFLIPIAWYEDRQVPGGYTVINKYQGKLFAAKQDVSPFNVVAWHGNYTPYKYNLKNFMVINSVAFDHADPSIFTVLTAKSVRPGVAIADFVIFPPRWGVADKTFRPPYYHRNCMSEFMGLIRGFLPGGGSLHSTMTPHGPDADCFEKASKVKLAPERIADGTMAFMFESSLSLAVTKWGLKASRLKSHFTPNSRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HOMOGENTISATE 1,2-DIOXYGENASE
publication title Crystal structure of human homogentisate dioxygenase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 94
structure length 419
sequence length 439
ec nomenclature ec 1.13.11.5: Homogentisate 1,2-dioxygenase.
pdb deposition date 2000-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04209 HgmA homogentisate 1,2-dioxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1eybA02
2VECA 3HT2A 5JSPA 2EA7A 5I0RA 4QGMA 5E1RA 4HLTA 3OTFA 3NJZA 4MGYE 4LTAA 3D0JA 5I8TA 4I09A 3FJSA 2C0ZA 4H7LA 2XGXA 2MPFA 4IESA 5FCCA 4IEPA 5FLHA 1ZRRA 3O14A 4MV2A 2ATFA 3IDBB 3U11A 3RYPA 5JCTA 4ZU4A 4BHPA 4I3PA 4OFGA 2B8MA 1NXMA 4F7ZA 2N7GA 4X6QB 2QCSB 3C3VA 1ZZ7A 2XL7A 2Q0AA 1EYBA 1UIJA 2Q30A 3JZVA 3IBMA 4BIFA 4BH9A 1J3RA 2XKOA 1J3PA 3WW1A 2IXHA 1O5LA 1DZTA 1Q43A 4PJYA 4PIYA 3D82A 3H7YA 4IEXA 1PM7A 5FQ0B 4GULA 4XFAA 1GQHA 4X6RB 2H6CA 3SCFA 3BCWA 4D7SA 1YUDA 2WC2A 4P9GA 4ORFA 2BNMA 1RGSA 5CVRA 5I93A 2GU9A 1YLLA 4WBBA 5BUVA 3FWEA 4HSJA 4HMZA 3FHIB 2OA2A 4Z07A 2B5HA 3LAGA 3E5QA 3ROUA 3IIAA 5JSOA 3H1WA 4JTOA 1ZZBA 1HW5A 2QJVA 2PYTA 3RYKA 2BGCA 1QWRA 4XF0A 4LLOA 4Q0VA 3RPQA 3BU7A 3FZ3A 4JTNA 1UIKA 4EROA 3NKTA 1EP0A 3MPBA 4Q0QA 5I0UA 3BPZA 3SXWA 1QY4A 5AVPA 3WW3A 2F4PA 4AXOA 3CJXA 3FFQA 2ETEA 2CGPA 4XEZA 2ET7A 3CEWA 2CAVA 2Y0OA 1WA4A 1RTVA 1V70A 1XE8A 3BALA 4Q0PA 2GZWA 2Q4SA 4HN0A 3I54A 2CAUA 3KMHA 1YFWA 4MH0E 1CAXA 5EZWA 1VP6A 3E97A 2D5HA 1GQGA 4AVCA 1I6XA 3RYRA 4HZFA 2GC3A 2VQAA 1X7NA 3OD0A 3H9AA 4E2GA 1IPJA 2K9ZA 1Q5OA 4HVRA 5LRRA 3H1YA 4LEJA 3OGJA 1OMIA 2D5FA 1CAVA 4AVAA 4DINB 3EJKA 2Q1ZB 4XFCA 1NYWA 3GBFA 3RZZA 1UD1A 4RD7A 1UCXA 1Y3TA 4MUVA 1ZVFA 2K0GA 2XKPA 1SEFA 2B9UA 2CV6A 5I8YA 5KHGA 3ACLA 4LUKA 2WFPA 1ZRDA 3ST7A 1CAXB 3LOIA 4XFFA 2I45A 3HIFA 4XF1A 4MZUA 4JVAA 2XLGA 4IEYA 2H0VA 1LB2A 1G6NA 5I0TA 1CAUB 4QM8A 2E9QA 5FQ0A 3MZHA 5LRSA 1ZREA 1RL3A 5KHHA 3EO6A 4KWLA 1X82A 1CAVB 3H8UA 4A2UA 2IXCA 1CGPA 1L3JA 2H6BA 4KU8A 3UKTA 5BXXA 4KWKA 4EWEA 2GC0A 5EFUA 4XFGA 4R8HA 2FQPA 3ES1A 5BV6A 1WLTA 1J59A 3FE5A 3E6CC 3WW4A 4I0AA 4QGNA 2XHKA 1J3QA 2PFWA 1NE4A 4BYYA 4QX5A 5J3UA 2PAEA 4WVZA 1LRHA 4FAHA 4MGIE 1H1MA 3QOPA 2UY9A 3I7DA 3M3IA 4YRDA 4FT8A 2O1QA 2BYVE 3TNQA 4XF4A 3E6DA 2MNGA 3U10A 4I01A 5E16A 3EHKA 3H50A 1VR3A 2EVXA 3U0ZA 4AVBA 1ZX5A 4IEVA 4IEQA 2IXIA 3ZDSA 4PIXA 5KHJA 2HKXA 1O3TA 1RC6A 4WZCA 4UBHA 2OZ6A 1J1LA 2GH2A 4Q0UA 1SQ4A 5KBFA 4O9EA 3E5UA 4O9GA 4IEOA 1ZRFA 4HVOA 4QM9A 1DZRA 4K8FA 1O7FA 3GYDA 4FBFA 3DL3A 3HT1A 3S7IA 4MX3A 4I0BA 3L2HA 3E6BA 4HSLA 5KHIA 5C8WA 2QNKA 3LWCA 5FPZA 5JAXA 5I91A 4HBNA 4XETA 1JUHA 3OF1A 4IEUA 2BNNA 4IEWA 1X8MA 2IXKA 4XF3A 2PQQA 5LEJA 1ZRCA 2ET1A 4IERA 2IXLA 4MGKE 4QMAA 2BNOA 1U12A 1O3QA 1ZZ6A 2OZJA 2ZCWA 4ONUA 3RDIA 3KSCA 2P17A 1YHFA 1CAUA 3MDPA 1ZZCA 4JV4A 1O3RA 1OD5A 2OPKA 5F1RA 4CYDA 2QDRA 2D40A 2PTMA 3S7EA 5LEKA 4AQ2A 2UYBA 2UYAA 2UY8A 1OFNA 2IC1A 4AQ6A 5FLIA 4E2SA 2DCTA 3NL1A 4XFHA 3VHRA 1YFYA 4L11A 3NVCA 1LR5A 4EWAA 1SFNA 1PMIA 3DN7A 4YARA 2PHDA 4META 4ZU5A 3DKWA 3H3ZA 4TLFA 3HQXA 3I59A 3KCCA 3OCPA 3LA7A 2PHLA 5I8SA 2PAKA 1UPIA 4Z82A 4IETA 2XLAA 3FX3A 1VJ2A 5CU1A 1O4TA 4ZU7A 3EBRA 2EAAA 2GC2A 5JSRA 1Y9QA 2HJIA 4XFBA 5FPXA 1J58A 1IPKA 3H7JA 1RUOA 4KL1A 4NVPA 4EWDA 1X8EA 2Z2SB 1XE7A 4LUMA 4B29A 4R52A 1XRUA 3DV8A 5D1IA 2MHFA 3PLQA 4LULA 1RUNA 2XLFA 1NZCA 1O5UA 3I59B 1DGWA 4XF9A 2IXJA 4KWJA 4UXAA 4YSFA 5JR7B 1H1IA 3E5XA 3WW2A 3S0MA 5BY5A 5BPXA 3CL1A 1CX4A 4HVQA 4LA3A 1Q3EA 3ES4A 3SCHA 1LKNA 4EV0A 3LZZA 5J48A 4N9HA 2O8QA 2FMYA 3LA3A 4Q0SA 2BEOA 4HN1A 5FLJA 2ZKLA 3H3UA 2XL9A 4Q29A 4F8AA 5J7MA 3MYXA 4UBGA 3LA2A 4D7TA 3BB6A 3UKNA 4LA2A 3TNPB 5K8SA 3CLPA 2D93A 1YFUA 2KXLA 2QVSB 1OI6A 2V09A 2PAMA 3ETQA 4FAGA 1DGRA 1ZZ8A 1FXZA 1EY2A 1ZZ9A 1CAWA 1QXJA 4OLLA 3SHRA 3USSA 3G7DA 3H1MA 3PVBB 1O3SA 3NW4A 1ZNPA 1EPZA 4XFIA 3IWZA 3IDCB 4L2NA 4YNIA 3N4MA 4PIZA 3RNSA 4MGZE 1TQ5A 5HI0A 3ELNA 4IEZA 3PNAA 5FDBA 1YFXA 1WGPA 3CO2A 4I02A 3SCGA 3EQEA 1FT9A 4QXKA 5C6CA 3SMHA 3D0SA 1YWKA 1FI2A 3M70A 5KHKA 4YYOA 1QXRA 4QGLA 3CF6E 3QACA 2VPVA 3UKVA 1NE6A 2PA7A 2OYZA 3R6SA 1CAWB 1I5ZA 3B02A 4J1WA 4E2QA 4J1XA 1UW8A 5I0SA 2Z69A 4KU7A 3KGZA 3NSTA 2GAUA 2GC1A 5T3NA 3KGLA 5CADA 4I2OA 4N9IA
chains in the Genus database with same CATH superfamily
3AKQA 4UWDA 3T2TA 3U75A 4YG0A 3HT2A 3GJBA 3DXTA 5I0RA 1SDDB 4HL0A 2RM22 4K1ZA 2R1BA 4QGMA 1V6NA 5A7OA 3VUOA 2WFF3 2JX9A 2QBXA 3V56A 3MLLA 4NOTA 5I8TA 5FXWA 2YC2A 1FPN2 1NLQA 4IV1C 2X29A 3T09A 4CCDA 5KC5A 5K0UA 2LRPA 1UZ0A 2R042 2RVAA 1H4GA 3GHNA 4IGQA 3ZYHA 2HYKA 1R1A3 1ASJ2 4H7LA 2XGXA 4M3CA 2MPFA 3BUCA 2A6ZA 4FFGA 2QQVA 5F5QA 4AI8A 2HEYF 3ZPYA 1ZRRA 3O14A 4Y4RA 5IVEA 1AR93 3DPRC 1OOPC 2VXJA 3VHNA 2D6NA 2QDNA 2VOWA 1PVC1 3HN1A 3RYPA 2L9LA 1PGSA 1MZEA 4N8MA 3OEAA 4Y5Z0 3GM8A 1FNZA 4UFMA 5I0DA 2ZMKA 3O0WA 4CEYC 3KS7A 3S30A 4X6QB 4CCNA 3HD8B 1NCQA 1NT0A 3AYEA 2K2SA 2Q0AA 3PURA 5FPBA 3AFGA 1UIJA 5JIAA 3ATGA 5DMYA 4N53C 1L7RA 4N90A 4BIFA 1ZM1A 1T6BX 2J22A 4C1XA 2A6WA 4Y5SA 4OVEA 1LGNA 3M3CA 3INAA 3ZXJA 1H6YA 3N9NA 1LECA 3C7OA 1UYZA 2BOIA 2ZPXA 4IE5A 4PIYA 4PJYA 2DWRA 1W6PA 4S2GA 2BGOA 5BNOC 4GULA 1I9RA 1UYYA 4MXWB 4XYXA 4ZHNA 1GOHA 1C28A 5IVYA 2ZGUA 4DEVA 3OB8A 3KD4A 5AC93 2WC2A 1QJX2 2YV8A 3VD7A 2GP3A 4RHV3 4RSUA 5KWRA 1XE0A 4ORFA 4LBJA 2RS11 5F6LB 3USUB 5A32B 4COYA 2QUOA 5HBAA 4H2AA 3KV6A 1ZBE3 4BK4A 3G6JB 3FWEA 1KGYA 2W68A 3WX5A 4CEYB 1HN1A 5IK8A 2OA2A 5C4WA 5IT6A 4AGRA 4S2DA 4FXKB 1C3HA 2DCKA 3LAGA 4CU9A 5F37A 1F35A 3EB7A 1TNRA 5T5OA 1AR82 2WAOA 2NN8A 4LO6B 5FZIA 2FDIA 2RS33 4LHSA 1EUUA 3Q8CA 4MADA 1HW5A 1SLLA 1D4M1 2LTNA 2QJVA 1ULEA 5FWJA 5ACA1 3ACHA 3ZYJB 4D0QA 1VALA 3GXUA 5EJ1B 1JOBA 3VBSC 5FZFA 3ZO0B 5I0UA 3BPZA 4YW5A 1COV2 3OJBA 5EQUA 3CJXA 2VMDA 1GNYA 2ETEA 3FFQA 4MGSA 2A6XA 5FJHA 1WD3A 2VUCA 4P9WA 3WXPA 2A3XA 2VOVA 4A7ZA 4LORA 4BWOA 3IT8A 4Q1RA 1ENSA 1DYKA 4WVMA 2Y0OA 4XTMA 1RTVA 1V70A 2WBKA 3M3OA 4Q0PA 4XCAA 4XBQA 2GZWA 3WG3A 4BQXA 5IVVA 1W06A 4FOYA 5IK4A 4GH4A 4LBNA 3BTZA 1ND2C 3N7MA 1ZYBA 5E8AA 1VRBA 2JIGA 4AFDA 3KVAA 5FUNA 4AVCA 1LOFC 2FCVA 1X7NA 2VQAA 1W6OB 1RUF1 3KT7A 3H9AA 4Y5TA 5F5IA 3GZEA 1IPJA 1DQ1A 2K9ZA 1Q5OA 1SPPB 1C5IA 4DY3A 1AX0A 4GMP0 2ORXA 3H1YA 1BEV3 4URAA 1OMIA 1EV12 1PZ9A 3M1HA 3QCWA 2C9AA 2D5FA 5FZOB 3T30A 3T08A 2WNEA 3WDUA 1VRH1 1NYWA 5C7GA 5T5JA 4ET7A 3WOGA 5GZFA 3ZYIB 3N7KA 3ACIA 2YHJA 4BCUA 1UCXA 1RUH2 4GB33 1BBT2 3FN9A 4Q4W3 1K5MC 4XUOA 1REDA 4AG4A 1SEFA 2CV6A 2ZACA 4FTSA 5DAPA 1FOD1 2NLRA 1PX4A 3BI3A 1LCLA 1VBA3 2RR13 1X50A 5E6HA 5JXGA 4QX1A 3ST7A 2HWB3 5B2GB 3QLQA 2J1AA 1ULPA 1PO21 5F3GA 4XF1A 4MZUA 1YXWA 2DU0A 4XURA 5FREA 3HEIA 1AX2A 1SACA 1H0BA 5F8PA 2GN7A 5T5LA 1HXS2 4WM8B 3VBRC 5I0TA 4IV1A 2B7YA 1QJEA 1XNCA 4QHBA 1E5HA 2E9QA 1VMJA 2VTXJ 2DVDA 2QQNA 4NR1A 4J6GA 1CZVA 2G4IA 1CGPA 1RJ7A 1JZ3A 3T2OA 2CY6A 4EWEA 3DPRA 1OOPA 2GC0A 2PLV1 1XNTA 3K3NA 3O1RA 3J9SA 5BV6A 4INDA 1WLTA 1NUKA 2WZPP 2O14A 4I0AA 1A3KA 3OUIA 2YC0A 5FZAA 2J1UA 4CEYA 1XJAA 4QX5A 4DUXA 2RDNA 1GWLA 3BODA 3GNEA 4WVZA 1IOAA 4XVHA 4DEQA 1LRHA 1H1MA 2YU1A 4QKNA 2XG3A 4PQ9A 3ZFGB 4OUSA 2YPDA 5C70A 1H6XA 2R49A 2QQLA 2W39A 4N53A 1YI7A 3MW4A 5SV5A 5HCHA 1C8M3 3POSA 1H4HA 1MEC2 4AVVA 4B8EA 1LESA 2BYVE 1KXGA 3WUCA 1QNWA 2D44A 3AM2A 3CQOA 4L92A 1WBFA 3E6DA 4MSVA 4P5YA 4TWTA 3ZXLA 5E16A 2CYFA 4RS5C 2XUMA 5LBEA 1PK6C 2ZGTA 4RL7A 1DQ5A 5FYCA 2EVXA 1W2NA 3TOJA 3VDCA 1G9DA 3PUIA 4XACA 5IATA 1RYYA 2A1XA 3B00A 2OIIA 2RE9A 3ZDSA 4PIXA 4AK3A 4QQ2A 3ZMNA 2F17A 3RWNA 3T0DA 2E6VA 5GALA 3R4UA 2I74A 3B94A 5IAVA 3TEXA 5FY9A 2VNVA 3JD71 4M01A 4RR3C 4F3JA 1RINA 2VY0A 1A78A 5KBFA 2DVGA 3E5UA 2RS13 4YGEA 3CIHA 4EYUA 1W05A 3F2ZA 5FBZA 2QQJA 3J8F1 3UNPA 4Y1ZA 5F5CA 2YC4A 4QXCA 5GZEA 3UGHA 2ZEWA 1IS5A 2YBPA 4JDOA 4AI3A 2YYOA 3S7IA 4BDVB 1G86A 3WNNA 3WQ0A 3L2HA 1MQTB 3E6BA 5A33A 4LHNA 4XW3A 4HETA 1GNHA 5C8WA 3KCXA 1LEMA 4Y20A 4CUCA 1VBC1 3A4UA 1RUE2 4OZXA 5JAXA 3VBSA 1B35C 4SBVA 3AVRA 2MEV2 3LFMA 1D4M3 5FYIA 1N3QA 2C26A 3E1F1 3EMRA 3LDKA 5ACA3 3ZSLA 2BNNA 4Q4Y2 4LHKA 1YQCA 1IS4A 2X53S 4XF3A 5LEJA 4KBBA 2IXLA 1KQRA 5FFOC 2BNOA 2RS51 1UOFA 5CNAA 3FLRA 3I3EA 1QKQA 4NIHA 4AI0A 4CP0A 1AYN1 3POYA 2RJ2A 4KNCA 5GLWA 3VN4A 1DBNA 4WM8A 1AR73 1KD7A 1O4ZA 1G8WA 2WFF2 4QX2A 2AGSA 5IAXA 3AL6A 1V6JA 3WP5A 2OPKA 1OA3A 4QDRA 4A6OA 2PTMA 3APBA 4LO7A 5FY8A 2Y6HA 1CR7A 4JX0A 4KGGA 1R1A2 4P08A 5LEKA 3MV11 4AF9A 2VQTA 3GHMA 1KFXL 3WG2A 5EJ3A 3VBUC 3MGUA 3S5QA 2DCTA 3NL1A 2YFZA 5DUUA 5H9RA 1HDKA 1K5MA 3LKJA 3MUY1 4BXFA 3OSDA 1VRH3 4Z2AA 2DF7A 3CMGA 3CZJA 4CCJA 5LBCA 2Y60A 4CXYA 2D7FA 3KCYA 1AXYA 3DN7A 5BNNC 2AYHA 3MHZA 4YM0A 1GUIA 5K9YA 4ASKA 1W9TA 1X9PA 4XMIA 4HT1T 1FOD3 2PHDA 4NWWA 2QQUA 3DKWA 1SBFA 2RDQA 3HQXA 3J7NA 3KCCA 3ORJA 4GWNA 2AC1A 2VVEA 4TLFA 5I8SA 1EUTA 4R9DA 4E8CA 5HPOA 1PO23 1SBDA 1W8WA 4W8JA 5G04L 1ZBA1 3RQ0A 5GLUA 4HXCA 2X10A 4DXRA 3RZJA 1JHNA 1A8MA 1W2OA 2HWE3 1NOVA 3MF6A 5A7NA 5JSRA 1QQP1 1YO8A 1W6QA 1XBFA 4JQRA 2Z42A 2A7AA 2OT7A 3LEMA 5A3OA 5K7PA 1J58A 3VD5A 1IPKA 3RZGA 4OMDA 4RGAA 1RUOA 1BHGA 4NIGA 4KL1A 4XC9A 5IJRA 4RHV2 5JMCA 2RHPA 4H7MA 2Z2SB 3WR0A 2WQZC 2CL2A 4OHWA 2JECA 2PLV3 4JGZB 1W90A 2E53A 5IUQA 3BKZA 2NM1A 1JZ4A 2VMEA 4JCKA 2VNGA 2PQSA 1YJLA 1X36A 4UI9L 4D8MA 3K4AA 2CGPA 1ACCA 1DGWA 1XOYA 4YVSC 4OHVA 3D5OA 1H2NA 2B46X 2XQRA 2B4KA 2J1SA 3N9OA 3UT0A 2RS32 3I3MA 1URXA 5FYHA 4FTEA 2RV9A 3D6EA 4QPWA 2IZWA 4YPJA 2BFUS 2QQIA 2WSVA 3BU0A 2HWF2 3CL1A 4M0HA 4QQOA 4CTEA 4WVWA 1Q3EA 4RS5A 1AHSA 1CPMA 1V0AA 1GOFA 2F6BA 5L9BA 3WDWA 3PVEA 1UY0A 4NO4A 4LBOA 2O8QA 3HBZA 1OPMA 3LEIA 1QNYA 1RUC1 2W08A 3NMBA 4E4HA 2VNRA 4JHZA 3KF5A 2WNUB 5FZ7A 1E57A 1Y4WA 2ZGLA 2XWBB 3B3QE 5CBLA 4RR3A 1GQPA 2BDRA 2WZEA 2AREA 2WNVB 1IG0A 2JDHA 2XL9A 3UETA 2JJ6A 2ZGQA 4Q29A 3W58A 4XE9A 3GZUC 5DG2A 2D6KA 1CIWA 4UBGA 3JD73 3BB6A 2K46A 4IL7A 1XU2A 1BKZA 1KDKA 2HWC2 5FZEA 2EICA 3A23A 1W2AX 1LHNA 1YFUA 4HKOA 3J8F3 2JD4A 2V09A 3ETQA 1BEV2 1JU3A 2ZBJA 4XILA 2DDUA 3IPVA 1DGRA 1RUD1 5LBFA 5A80A 1GP4A 1CAWA 4OLLA 3WF2A 3KHCA 5A7SA 4A41A 1S2EA 3SHRA 3H1MA 1UY4A 4FPCA 1VBB1 4Q4W2 1AXZA 1VBC3 1VPHA 1VBD2 3B93A 2WS92 3PVBB 3T3YA 4AHWA 5DN2A 2OX0A 5DAVA 5C3QA 1ZNPA 5FP3A 3IIIA 4G4FA 5A6ZA 3I3BA 5DUXA 4FTBA 3N4MA 1OLMA 2VMHA 3K2OA 1POQA 5K4LA 2ADEA 4ATFA 2VH9A 2HWB2 5AFEA 5HI0A 1UMZA 3Q8BA 2WO1A 3WSOA 2RS53 5FDBA 4MVTA 4KH9A 4HPKB 1YFXA 1UOGA 2DURA 3EQEA 3SCGA 2BTVC 1AYN3 1OUXA 4COUA 4JZRA 1AL0G 2QE3A 3AMNA 2VUJA 2FD8A 1MR5A 5KHKA 3M70A 4YYOA 3MV01 4PI2A 4AEMA 4QGLA 4KG8A 5JUVA 2VPVA 5DZFA 5BNQA 2P34A 3S6PA 3DGTA 3K51A 3K75B 4K20A 3VDAA 3WQBA 1NE6A 2OYZA 2DUOA 1UZVA 2FDHA 3VBUA 4UOJA 3J7LA 3V0BB 4E2QA 2WZR3 4GJYA 4J1XA 2R0FA 4MYEA 4LO4B 1G9CA 3SISA 3O7OA 2EALA 1AXKA 4FFHA 1JW6A 1XSRA 1POV1 5FP8A 1JU4A 5EJZB 1B09A 1W8OA 1HQWA 2GC1A 3KGZA 3NKGA 4GWMA 5BNNA 3KGLA 4BJ0A 4YW7A 4I2OA 2WYFA 4N9IA 3LF7A 1AYM3 1WW7A 3J7HA 2XVLA 4P02B 2Q8EA 5G05L 2X05A 1LTEA 3NAPC 3AKRA 3I49A 4FOVA 1PIV2 1QXPA 2WT1A 3WUDA 2EA7A 5BNPB 2J1EA 3M3EA 3ASIA 4K9SA 4P9JA 5FYZA 5FMOS 1C8M2 1UMIA 2ZABA 1GWKA 2ZX3A 4KGQA 3WP6A 3OTFA 3NJZA 2VE1A 2AENA 4W6WA 2XBO1 3BOWA 4QKFA 3TB0A 1YQ6A 3KB5A 3JUUA 2C9KA 3NQHA 4GA9A 5AVAA 1H8TB 4FPOB 4B4PA 4DRRA 4I09A 4DPNA 3FJSA 2FBEA 3T0BA 1REEA 2FCTA 4YW6A 5APAA 3RWKX 2R071 1ULCA 2FDFA 5FCCA 2H0BA 2P2KA 1H2KA 4MV2A 1QQP3 1RVF1 2ATFA 2WINB 1GICA 1D2QA 3ZSJA 4BZ4A 3KV9A 5FOBB 5JCTA 4ARYA 4BHPA 3K48A 1M4WA 2EXJA 3WF3A 2B8MA 3WVJA 2ZTNA 5EXOA 3C3VA 5CFCC 5TSWA 1UX7A 2GNDA 5GZGA 3O0XA 5FZ4A 3O0VA 2ZX2A 1EYBA 2ARBA 4P9XA 2ZXQA 4YVSA 2B45X 2BP6A 2R16A 3MFAA 1LOBA 5FZHA 2VW2A 4ZZ8A 2ZOEB 4L9BA 2E7AA 4Y33A 5A3LA 1CESA 2ZGSA 5K0UB 1W9SA 2VO5A 2JDNA 3PU8A 1OC1A 2VMCA 1UYXA 1QJZA 3H7YA 3O5SA 3IMNA 4M3CB 2ZHLA 1PM7A 3AZYA 3ZXAC 3C2UA 4CXXA 1WMEA 3SEPA 2IFWA 1BXHA 2B9VA 3LPGA 4X6RB 2LW8A 1EAH1 4CP1A 2VG9A 4UW3A 3SCFA 2QZ3A 3BCWA 3MIDA 3ZSMA 5IW0A 1CX1A 4P9GA 4Z2WA 1RUC3 2BNMA 1RGSA 4H3WA 4OI2A 4ASLA 2JG8C 4TYSA 2IFRA 3MFCA 4Q4V1 2VXRA 4BOWA 1OHFA 1ENRA 3ZYRA 2HEVF 5BUVA 5CISA 2VCAA 3Q8EA 1UX6A 2PHUA 3P3NA 4HSJA 1AR72 1N1SA 3VZNA 4Z07A 5DABA 1LJ7A 2CGOA 1MACA 1QOTA 2ZGRA 3OEBA 3ROUA 3WQ1A 4EE2A 1CN1A 3BIEA 1MPXA 1JYCA 4OHZA 5AFBA 3PTYA 5DDJ3 4QAWA 1W6MA 3RFRA 1NLRA 4EJRA 3X29B 4E4DX 4KWUA 2CWMA 4IE6A 3RPQA 5F39A 2CTVA 4JTNA 4ZS2A 1Q8VA 3TN91 3NKTA 2YBKA 4AZZA 4EROA 1EP0A 3MPBA 5DZEA 2Q8OA 4Q0QA 3O1MA 1F4AA 3SXWA 3B7MA 3GCWA 3HWJA 1RUD3 2F4PA 2ZEZA 4YZ2A 4XEZA 4XXAA 4BM8A 1WZXA 4GALA 1WCQA 3CEWA 5HCFA 1GZCA 1HKDA 2YU2A 2Q8DA 2OXBA 4AYUA 2PHWA 1VBB3 5FZ8A 1PMJX 1PNFA 1S0FA 2Q4SA 4MXVA 3KMHA 3B5LB 1FOD2 1XQNA 4XHXA 5IVCA 5C4WB 4MH0E 1CAXA 3I2FA 3ZX7A 1JI6A 3H0OA 4WVVA 3QH7A 3E97A 5EHDA 3SEEA 2EIDA 1PO22 3RYRA 3I2IA 1H8TA 1HB4A 2VNOA 2EAKA 1SLCA 3OD0A 3FUOA 3J26N 4CCKA 3AKPA 4BE3A 1Y9GA 2HWE2 3FUQA 5FZCA 3POJA 3MO4A 4AW7A 2R062 1BVVA 1FYUA 4PHZA 1JH5A 4LEJA 3OGJA 1A8DA 3MIHA 4IV3C 5L36A 2JB8A 1CAVA 3LDBA 5A1LA 4DINB 3EJKA 1CIYA 3C7HA 2JEMA 5FMBA 3RZZA 1BYHA 4ZZ5A 1UD1A 4QQLA 1DCSA 3OUJA 4RD7A 1Y3TA 1UWWA 2WL1A 5DZGA 5E89A 3ZR6A 4GXLA 4E9KA 1ZVFA 4IUGA 4XQ4A 2XKPA 1BMV2 1S2KA 2WA3A 1LHWA 2P4EA 2A73B 2WFPA 3NNJA 1POV3 2ZMLA 5LCWL 2ZKNA 5CKQA 1RHI1 3NAPA 4GH4B 1LOEA 2G1MA 3LOIA 4XFFA 3ZYBA 3HIFA 1YI9A 3WDXA 3AMMA 3ZDVA 5C71A 3TYJA 2BPA2 2WO3A 4IEYA 2H0VA 2DCZA 3AMQA 4XDOA 4YG6A 2HEWF 4LKDA 3UJOA 4EN9B 1VIWB 1CAUB 2OUJA 1BJQA 2VUAA 2WZ8A 4CDXC 3CU7A 3MZHA 1ZREA 1NX9A 1RL3A 3EO6A 3KHBA 5FP9A 3AXEA 3H8UA 4G9SB 2XBO3 3VKNA 1C1FA 1U5IA 1AR62 4XDPA 5FUPA 5EFUA 5JDBA 4XFGA 2V5YA 2R073 3W5MA 3FE5A 3VZLA 4M00A 3IM0A 3WDYA 3E6CC 5CYYA 3WW4A 4QGNA 1RVF3 2PXJA 2OPWA 3VZKA 2PFWA 3ZM8A 1NE4A 4BYYA 2DU1A 4XCBA 4NRMA 5CFCA 1ULGA 3U1XA 4LBLA 4MOAA 4QPIC 4XZUG 4MGIE 3C8XA 1GMMA 3ALQA 5FY4A 4IW3A 5EPAA 4AEDC 3HNMA 4DMIA 4K21A 4OI4A 2YG0A 3RI8A 4IV1B 3LDRA 2O1QA 2FDJA 1UPSA 1KS4A 4W50A 4YW4A 2JE7A 1TZOA 4XF4A 4Y1VA 2W52A 2WO2A 4LBMA 1KRIA 3EHKA 1VR3A 2WJSA 3OY8A 2RJKA 4K40A 1VBE1 2VQUA 3DPRB 1OOPB 1XNAA 3MI8A 1ZX5A 4IEVA 1VBC2 4IEQA 1OKOA 4FPFA 3EYPA 1O3SA 3JXSA 1DIWA 4XJAA 4ZONA 1AL22 1RUJ2 1U0AA 2HKXA 4RQPC 1ENQA 1EAH3 5LK5A 2JG8A 3P3PA 4I0WB 1LOAA 4WZCA 2VZRA 4W6XA 4ZPIA 5FXVA 1PMHX 1J1LA 3MIBA 4YGDA 5F3EA 2P3JA 1CVNA 2GH2A 2ZGOA 5FZ3A 2RS52 1JZ7A 1UXZA 3POFA 1HQNA 5JMOA 2ZZQA 4ZS3A 4IEOA 4N53B 4JRLA 4HVOA 4Q4V3 4QPIB 4XABA 2WWSA 4FBFA 1HIXA 2XJVA 2CDOA 2W47A 1UOJA 3PJQA 2JB4A 5BNOB 4W4ZA 4KI5M 2QQMA 4HKWA 5FO7B 1GLHA 1UKRA 3LEKA 1CD3G 3ZLIA 1I5PA 3I2OA 3FFZA 5A6QA 2ID4A 4CCOA 1OVSA 2E7TA 3KM5A 4XETA 2WZR2 3BVCA 3M7AA 3WCSA 4CCEA 1V9U1 1CQ9A 3AXDA 1IQDC 3OF1A 3WG1A 2DBIA 5C3PA 1GFF2 5A7QA 1X8MA 2J1VA 4ASMB 2DVAA 3TN93 2OQ7A 1RMU1 4A44A 4NAMA 1AF9A 1BVP1 1FV2A 3JB4C 4RQPB 2V4VA 1ZZ6A 1AYM2 2OZJA 4COVA 3I2HA 1RUG2 1Z7S1 4ONUA 5FY7A 1MZ6A 1WLWA 2O8OA 2P17A 2ZA9A 1NCRC 1YHFA 3O1UA 1CAUA 3C7EA 3MDPA 1ZZCA 4HFSA 4DQAA 4C90A 2EXHA 4JV4A 1SFPA 2V73A 5A33B 1QH6A 5A3UA 1K12A 3VD4A 2YY1A 3ACGA 4Y20B 1DQ4A 2DTWA 5H9SA 4U2AA 4IV3A 2UYAA 3PVNA 3VBSB 1W0NA 4E4ZA 2VU9A 1LOCA 1XSQA 1VAVA 2WABA 2WWUA 2OW4A 4Q5OA 1UNBA 5CG8A 2GNBA 1QHDA 1N3PA 4FPEA 4PLOA 4D6RA 2UU8A 4XFHA 1YFYA 1W2TA 4B1MA 1IQAA 2D6OX 3HBKA 3NVCA 1MZ5A 4AAXA 1TE1B 3NV4A 1SFNA 2LS6A 3MIEA 4NIIA 4EZ4A 1OH3A 3KF3A 4MG2A 1G7YA 4UAPA 4UW5A 4BIOA 1R082 2XB6C 4NHMA 3ZYFA 5KC6A 1ND2B 2W2IA 3QH6A 4Y22A 4UFIA 2YXSA 4ZU5A 4DXZA 4OMCA 3WDTA 3I59A 5JI7A 1RHI3 2PHLA 1NCRB 5FAXA 3JU9A 2Z79A 4CSWA 4IETA 2XLAA 4HONA 5T55A 4CDXA 1WCKA 1LHUA 5CU1A 4R9BA 2ZZJA 4AR2A 3EBRA 3CJIC 5J36A 3ACFA 4QQPA 2HJIA 1R64A 3B9CA 1OH4A 4C1WA 3RZLA 4MHRA 1OA4A 3POEA 5KR7A 2JDKA 2VZUA 2YBSA 1K5MB 4PDWC 1UKGA 1QJY1 1Q8PA 3N35A 3MF9A 4C0HA 1PGW1 2VOXA 3GGLA 4NVPA 1PVC3 5FYMA 1IKPA 4O61A 4JAAA 1X8EA 5F2SA 4A45A 1XE7A 4P9LA 1LHOA 4PLMA 4B29A 1I1EA 1OVPA 3ZXKA 4DUVA 4URTA 4CDWC 4LULA 2ZMNA 2XLFA 2ZGMA 4XUPA 4CDQC 1XPWA 4QPIA 3HJRA 1E5IA 5A1FA 4FPKA 4FI9A 4GD4A 4CUAA 2IXJA 5BNOA 2GN3A 4AEDA 3H8OA 2BGPA 2VZSA 4ES8A 3GBGA 2JDYA 2XJQA 3VBRB 1ZA7A 1LNSA 2OQ6A 1XNKA 3MICA 4RGGA 4YSFA 3W21A 5DDJ2 1OF4A 1OT5A 4X8PA 3E5XA 3VD3A 2A6VA 3OGRA 1FPN1 3SQOA 2VAUA 4HVQA 1W6QB 5FYVA 1NQDA 2EXIA 2G9FA 3RI9A 5JXHA 2R041 4Z92B 4OULA 1LKNA 1WW4A 4EV0A 1ASJ1 3Q9OA 5JZGC 3N7JA 2VUDA 4TTGA 5CKMA 4AEKA 4E8DA 1VMFA 2CHHA 4YW2A 1HQLA 1VBE3 1R091 2E33A 4RQPA 3LA3A 4OUEA 2X5IC 1TNFA 1VBB2 5ABJC 3OYWA 2CSGA 4HN1A 1F4HA 2DCYA 3D4KA 3WF1A 2ZKLA 1FATA 3PVOA 4FO9A 1OD3A 4K6BA 2I2SA 5LW9A 3N9LA 1FMD1 2DFCA 3AB0A 1VE0A 3WHUA 4CDWB 1CPNA 3BN6A 4QHOA 2BQPA 4WM7C 3LA2A 4D7TA 2VCMA 2XONA 2EIGA 3AKSA 5DG1A 3VLBB 2JIJA 4NJ4A 2A3WA 4ES9A 1W9WA 4QU1A 1SMVA 3D8CA 2DVFA 1HB2A 1DQ2A 4Y4YA 3WLUA 1AJOA 1PX3A 1O6UA 2A71A 2QVSB 3KWVA 3U14A 4CU8A 4RS5B 2PAMA 2R0HA 1S0BA 1PK6B 2F4LA 3ZPOA 3PL0A 2JDUA 2VMGA 1FXZA 1EY2A 1HX6A 1ZZ9A 2DVBA 4CP9A 2NMOA 5CEHA 2BBAA 1F5FA 1UU6A 5CIRA 1PO12 1KJLA 2ZEYA 5JZGB 2LUWA 5CB7A 1EPZA 2VW1A 1V9U3 4XFIA 3IWZA 4BQ1A 1MS9A 1ND2A 1Z78A 4RR3B 5ISLA 4L2NA 4CRQA 2WKKA 4MGZE 4AWDA 1TQ5A 1ODMA 3RZKA 3ZFEC 1RMU3 1LOFA 4XOGA 4HOOA 4IEZA 3PNAA 1NCRA 3CDZB 5A70A 1WMDA 4FFFA 1WUVA 2GH8A 4A42A 5FZGA 2A5ZA 3FHQA 1FT9A 3PUSA 1Z7S3 3GCXA 4WM7B 5C6CA 1IKQA 2JICA 1YWKA 1FI2A 1RUF3 2FDKA 2JKXA 2WT0A 2JG9C 3IPVB 1AR92 1EPWA 1D2SA 1B35B 4K1YA 1JZ8A 3TEZA 2XBO2 1CAWB 5T52A 3JQXA 3NWKA 2NP0A 3WD5A 3O1SA 1ZRIA 2VZ1A 1SBEA 4J1WA 4Y24A 5F7UA 1T2XA 2NQYA 2YROA 3LIGA 2VTXA 3SKJE 3ZKYA 5I0SA 3DYPA 4KG0A 5T50A 1V6MA 3IN9A 1RVF2 4KU7A 5JXIA 2CU5A 3NSTA 3IB3A 3VBHC 1TMF1 1W99A 3W59A 4EZHA 4PBPA 2DUPA 5LA2A 3S57A 2Y33A 3VBRA 2JD9A 3ZFEB 5JSPA 2C5DA 1JYVA 1MVEA 1S0IA 2Y6FA 4UF0A 5FYUA 2VBDA 1GWMA 5E1RA 1UY2A 5FZKA 5HV0A 1M06G 4IE0A 2FMDA 5JPNB 2P1BA 4MGYE 5DAWA 4YFWA 4AHZA 2JXAA 3CJIA 2W1QA 1WMXA 5AC92 3VBUB 2JG9B 3JBG1 3ZXFA 1SLBA 1EV11 3URFA 1E5SA 3AL5A 3POGA 4IEPA 4PDWA 4EN0A 5D8AC 5FLHA 3BTXA 2W5FA 3IDBB 1ZBE2 4Q8LA 1P8JA 3U11A 4NN0A 1HN0A 4DRVA 1EAH2 2R6QA 3FLTA 5EV7A 4I3PA 4ZU4A 5BNNB 2Q1MA 2BW8A 1QJY3 4CDWA 2D6MA 1H30A 1W3VA 2R7EB 1V00A 4PF1A 5FV3A 4CDQA 4F7ZA 2N7GA 2OS2A 1VB2A 3VBHB 3T1LA 3LSEA 3RZHA 3KQRA 4M3CF 1F15A 4Y1UA 1ZZ7A 2XQXA 2XL7A 4XIKA 2P37A 2VBPA 3FL7A 3WINE 1LGBA 3LB9A 1YQ8A 3GBWA 4AI9A 5FZ0A 4BH9A 1LAJA 3OPWA 1PK6A 1J3PA 3WW1A 1O5LA 1DZTA 4A7YA 4QWNA 3GJAA 2XJUA 1Q43A 1HXS1 2RJLA 4LO5B 4C0BA 3LGRA 1JOPA 2Y6KA 2HLEA 3DUIA 2VMIA 1LOGA 1W2UA 4PT6A 4XQDA 1XNDA 1LODA 5FXZA 2A3YA 1UOBA 3SKVA 2BFUL 5FQ0B 1DLCA 4BMEA 4XFAA 1GQHA 2X8KA 2QQWA 1QJU1 2NPIA 4AGGA 5JZGA 2Z4FA 3BIWE 5F6KA 5FPUA 2H6CA 1SLTA 2R043 2WN2A 3TN92 3SC7X 4N7IA 4NIDA 2X5IA 2AACA 5ABJA 3K3OA 1W8HA 5FPLA 1U5XA 4BQ4A 3LEGA 1C8NA 2GU9A 1T6GC 1YLLA 4WBBA 1R093 1QU0A 4NRPA 3I2JA 4WM7A 4YVSB 5FYYA 1JZ6A 1PGL2 1OSGA 2UWBA 1CZTA 1GYKA 5FYBA 1SLIA 1WMFA 4M3CE 4TZDA 1FMD3 2YMZA 3E5QA 5JOXA 3UJQA 3UL2A 1FV3A 3H1WA 1B35A 4JTOA 4S2HA 2E51A 4V2WA 1MZFA 1JZ2A 4YGBA 3A0NA 2PYTA 3M4FA 2BGCA 3RYKA 3AP6A 4XF0A 2VBBA 1ST8A 1W9FA 4GB32 4NPRA 3FBYA 3OGSA 3FZ3A 3HQUA 1UIKA 2BU9A 5T54A 4KQ7A 3WNXA 1VBA2 2RR12 1NZIA 2WIIB 1JODA 1NY72 5AVPA 3WW3A 4AXOA 4NPLA 2DYCA 2CAVA 2JWPA 2WDBA 1WA4A 3BALA 5FJKA 3ZFEA 3BPSA 4QKDA 3A0KA 4HN0A 1G9BA 5FZLA 1N1VA 5LASA 5A7WB 1WWYA 3RJRA 4LLFA 1XYPA 1UXXX 1WD4A 5EZWA 3HNBM 1JXNA 3LPFA 1PM4A 1VP6A 2HH9A 3OPZA 3NNGA 4XHBA 3SH3A 1ZA4A 3SITA 3WNOA 3V0AB 3M8LA 1I6XA 1CJPA 5J98B 2CDPA 2GC3A 1WW6A 4AVTA 1GZWB 1GZTA 2Y0IA 1W6MB 2A6YA 2NMNA 4LKEA 4NUBA 5A7PA 4DOUA 1GP5A 2JG9A 3VL9A 3L9JT 4NRQA 1HV1A 1STMA 2JKBA 2IVJA 4PF5A 4LJHA 4IGPA 5DQ0A 4BB3A 4XFCA 2Q1ZB 1XU1A 3HR9A 4BA6A 2P6CA 3GBFA 2MEV1 1QH7A 4O65A 4B1LA 5F9TA 1PVC2 2VZ3A 4AE2A 1KJRA 4Q4Y1 2GNTA 2K0GA 4Z1VA 2ZAAA 3VBHA 1W39A 2GALA 3PU3A 5KHGA 2XXZA 5SV8A 3ACLA 1US2A 4XUTA 2D98A 3DYMA 5KXDA 1OLRA 3WNLA 1Z0HA 3VZJA 2E31A 1U5ZA 1CAXB 1YNAA 1TMF3 2I45A 4Q4X1 1Q8QA 5FK7A 1QEXA 1LEDA 2WRAA 4P14A 2XLGA 2WFF1 4LQRA 4IQPA 1LB2A 1VLNA 4Y1YA 1ZBA3 5FMOL 5CKNA 4LK7A 3HN3A 3I97A 4QM8A 5B4XA 5FQ0A 3W9AA 3UYJA 1MS4A 2W92A 3F95A 3H3LA 4KWLA 5KHHA 1X82A 1CAVB 4XJ8A 4QX7A 2IXCA 3U37A 2G9GA 4QKBA 2W0XA 2W87A 4KU8A 1GNZA 3UKTA 1W8TA 5H9QA 5L7OC 5D8AA 5BXXA 3JBG3 1F31A 1L7QA 3ES1A 1EV13 1CJDA 2RS12 3KVBA 5IYYA 4L0PA 4XUNA 4CP2A 2XHKA 5J37A 3ZYPA 4UT5A 3RJ2X 1G9AA 3ZIWA 5C3SA 3T4VA 2IUWA 3LCPA 3VKOA 3NAPB 5J3UA 2EXKA 4RFRB 4TLGA 4XZPA 1S4CA 3VBFC 4K8RB 4A2UA 4JKKA 3QOPA 5FK8A 2QFEA 2YDEA 1Y43B 4XPVA 2Y6LA 3M3IA 2V4AA 3PMEA 5DAQA 3EXUA 4LKFA 4NHYA 5JI9A 4YRDA 2E26A 5DAXA 1V6LA 3VL8A 1ALYA 3ZKUA 1D4M2 1NQJA 2IVIB 5FPVA 2C1FA 2PHFA 3ZXEA 5ACA2 3KQ4B 2XJTA 4NHKA 4OQ8A 5JVVA 3AP4A 1SLAA 3H50A 4OHYA 1HJFA 1W8NA 1HXS3 2XJSA 5FY0A 3U0ZA 4UW4A 5FXXA 4COZA 2XHNA 3BTYA 1BZWA 1S0CA 2WA4A 3H42B 4NHLA 3VV1A 4AVBA 2IXIA 5LZ6A 3ZFFC 2RMU1 3K4ZA 4A4AA 5KHJA 5A3TA 4V2VA 1HV0A 1AZDA 2UWAA 4MO3M 1QJU3 1GKBA 1O3TA 2UURA 4RHV1 5GJ6A 5A7WA 5F2WA 3BTAA 4TSVA 4UBHA 5CFCB 2OZ6A 3IDEA 1J84A 4Q0UA 1GBGA 1SQ4A 1UU4A 1CONA 4M4PA 3AVSA 4O9EA 3K4DA 3V0AA 1AJKA 3AP5A 3M3QA 4O9GA 4PLNA 4UFKA 4B7EA 4LIUA 4XTPA 1GZWA 1Z7S2 1Q8OA 1S0DA 1H2MA 1MS5A 4K8FA 1O7FA 3GYDA 4LIVA 4QM9A 3WCRA 2VOTA 3HT1A 1RUF2 2VMFA 3AYDA 4NWVA 5GM0A 3WHTA 4MX3A 2GSYA 1W0PA 3AKTA 5LA1A 2RS31 1IS3A 1UZWA 4HSLA 3JCIA 2WYSA 1W28A 3OY8B 2HWF1 2VZPA 2WUHA 3LWCA 1ND3C 1VRH2 2E32A 3LQCA 3J7MA 1TG7A 4LBQD 5D2AA 2VZOA 3ETPA 4HBNA 5A3WA 1NA1C 2VULA 3AZZA 2PN5A 3VZMA 1K3IA 1BQPA 2AEZA 1W8ZA 2VZQA 5JWPA 1ENXA 2W1UA 4AHYA 1ZRCA 1YQ2A 5H9PA 3ZFFB 4IERA 4L8QA 4P00B 2JG8B 4FPHA 3N36A 4GMP1 4YVWC 1O3QA 4GIQA 1SFYA 2ZCWA 4CU6A 3DF0A 5EYXA 2XH6A 3FBMA 3RDIA 3ZN4A 4IE7A 2W3JA 4BLJA 2Y64A 1RB8G 1HB1A 3LIHA 1HJGA 4YZ3A 1UL9A 3OBZA 2ZX1A 2XJRA 2ZAHA 4JGYC 2AZ5A 5HXVA 1O3RA 1RXFA 2HWC1 1OD5A 4NHXA 5GLZA 5F1RA 5E88A 4CYDA 3H8XA 3ILFA 2FZ2A 4HANA 3B9IA 3PDQA 4QPYA 4CZSA 3OBTA 4QXBA 1O8SA 4AGVA 1UZYA 2VCBA 5JOWA 5C3OA 1PZ8A 2WNOA 3CZUA 3QD6A 2PLV2 3MLKA 4AQ6A 1QF3A 2J7MA 2XPJA 5EIYB 1HB3A 5L9RA 3VHRA 3MBWA 2VC9A 1VBD1 2WS91 1A6CA 4L11A 1QJY2 4AEJA 2MEV3 4KMQA 1PGW2 4SLIA 5FR3A 2HWD1 1PZ7A 2DCJA 3B69A 4Q4Y3 5GKAC 4YVWB 2HWB1 4GAZA 2VD7A 4ISQA 3AZXA 1XNBA 4META 4OI0A 2AEYA 4GZ9A 2ZHNA 3H3ZA 1DHKB 3P6BA 3VDBA 1GU3A 2VZVA 1POV0 3OD4A 1RIRA 4Q4X3 4WV8A 4Z82A 2EIEA 5GLTA 3FX3A 1VAMA 3JQWA 2WLPA 1JMUB 3N3HA 1VJ2A 4JGYB 1O4TA 4IV3B 1Y9QA 3WP3A 5C5TA 3W20A 1UZZA 3CKHA 3HOBA 5FZ1A 5L7OA 4O7XA 1ONAA 4UW6A 1OF3A 1VAKA 4UFHA 5M0TA 2GDFA 4L97A 2YUEA 5HV4A 1S0JA 4BMBA 4EWDA 4LBQA 1JHJA 4JQTA 4BQ3A 5LB6A 3JD72 3OGVA 4FP2A 1ULFA 4R52A 1XRUA 5D1IA 1R092 2BERA 2C6SA 2MHFA 3NNMA 4OUMA 1O91A 1S55A 1KITA 3VDDC 1HRI1 4H14A 3POWA 3VBFA 2OKXA 4Y22B 4JHTA 4A3ZA 3MLJA 5IWFA 2QQPA 1W3XA 3P5BA 1O5UA 2Y34A 3J8F2 4UYBA 3I59B 4XF9A 3RS6A 2EIBA 4CCLA 2WR9A 5F3CA 1FMD2 2BBVA 1PIV1 4KWJA 1O8PA 3J4UH 2JE8A 4UXAA 1C8M1 3VZOA 3SLIA 1MS3A 4CDXB 2Y6GA 2VVDA 3R4DB 2E7QA 2W91A 3WW2A 1BLZA 1O4YA 2VJXA 3KLSA 4RGKA 3V65A 3V64A 4D6QA 3ES4A 5FZ6A 1W9YA 4D69A 1TEIA 2FZ1A 3VD9A 1H9PA 4LMFA 2WQ4A 3WY6A 2WAAA 1WCDJ 3PUAA 1MS1A 4N9HA 3SNMA 3ZFFA 4OHXA 4CEWC 2ARXA 2RDSA 3NJYA 4M0NA 2Q1FA 2VTFA 2FMYA 4DFSA 4BU2A 1OQEA 3RRDA 2BUKA 2BEOA 2RMU3 4QDSA 2W46A 4MHUA 4Y3OA 4CCCA 1AYN2 2Y38A 5FLJA 3WV6A 5FMDA 4CA9A 1OXCA 2ZGNA 2ZS6B 3NO8A 4F8AA 4CPBD 3WZ1A 5J7MA 3U07A 4AEDB 2TUNA 3VDDB 1LGCA 4LA2A 2P3IA 1OURA 1N3OA 2ADDA 3L2YA 2VR4A 3WP4A 4NAOA 4OQ9A 4HG6B 1XXNA 5FZDA 1MVQA 1LHVA 1MS8A 2FCUA 2WO7A 4FAGA 1ND3A 1WBLA 4YG3A 4QPGC 1GOGA 4DNYA 1NA1A 3TRSB 2QQOA 4LITA 1LULA 4QX8A 5FKCA 4QX3A 2HWF3 3I8TA 1YRZA 1S0GA 1GANA 1QJFA 1NXD1 1QOSA 1V6OA 1W8FA 1YC61 4U36A 3THCA 4BQ2A 4EN6B 2D6PA 3ZIXA 3OYWB 4M4RA 4CEWB 1UQXA 4JDNA 2KM2A 3PUQA 4LKSA 4YVWA 4YNIA 5FY1A 2VL4A 5KXEA 3RMXA 4ISRA 1DQ6A 2JDPA 2YB7A 3ELNA 3M2MA 4N43C 3THDA 1JYNA 1TMF2 4JRAA 5B4NA 2TEPA 1TME1 5J96B 2W1SA 3O1PA 5CA6A 2WLQA 1WGPA 1FX5A 4GMP3 1MS0A 2P5BA 1AR71 1WA6X 2KR2A 2ZHMA 3A22A 4AFBA 4JGYA 5IVJA 2P3KA 5CAZA 3O1VA 1R1ZA 3D0SA 1ZBA2 1OLQA 2I07B 3AMHA 1QXRA 2CWSA 3LOBA 3QACA 2BVVA 4WM8C 4GQ7A 3UKVA 1QQP2 4XAEA 5ANNA 1GP6A 5GLVA 1AVBA 5LBBA 3R6SA 1WW5A 2HWC3 4CP9B 3R0RA 5C9AC 1UU5A 1WLDA 3PUHA 3B02A 4QPGB 2QTWB 3PMSA 1UW8A 2Q8CA 4QU2A 3JBG2 4AI1A 3S5AA 1X33A 1D7PM 2XJPA 2Z69A 1QDOA 1DF0A 3OBAA 2GAUA 1W8UA 3OGGA 4NE9A 3RG0A 4BQYA 3R05A 1NAEA 2NZ9A 5CADA 2XVGA 1VBD3 3TBDA 2WS93 3WF4A 5L19A 2P3YA 4N43B 2VECA 5CFDC 1J1TA 2YGLA 5A3MA 2HWD3 4QHZA 1K42A 5LY2A 5FP4A 3ZFGC 4HLTA 2ZHKA 4QDQA 4CPBA 3I4IA 5LA0A 4LTAA 3D0JA 3VKLA 4ZKTB 4XDQA 4FFIA 3ILNA 2HWE1 2ZX0A 2C0ZA 2R061 3I2DA 4COWA 2WWJA 2XOMA 1OLME 4KBZA 4C8DA 1C4RA 4IESA 1RUC2 4MXWA 2XMLA 3OUHA 3UGGA 5C9AB 1DYOA 3T1MA 4BLIA 1S0EA 1RUI1 1QJU2 3GF6A 1APNA 2CNAA 1CWPA 1HRV1 2BWCA 1YCIA 2GMEA 3GALA 4LK6A 4OFGA 1KEXA 1S1AA 4ZXKA 3TAYA 1NXMA 4AQSA 3SH4A 1BMV1 4BQWA 3USUA 4Q1PA 3VDDA 5A32A 3BOPA 2QCSB 2RM21 3PTRB 3MIGA 3LD8A 4QB6A 4UF0B 4IDZA 4B7KA 2VM9A 1HRI3 4B3NA 1DU3D 4YW3A 2Q30A 5CFDB 1XC6A 1IPSA 1BK0A 2ZGKA 3AP7A 3FC0A 3IBMA 1J3RA 1W04A 2XKOA 4B4RA 2IXHA 3IZOA 1OKQA 3CJIB 3OG2A 4A3XA 5IK7A 1PIV3 2NYYA 5DUVA 1RUD2 3D82A 5FO8B 1MQTC 2DBNA 4B4QA 2PHTA 4IEXA 2ENRA 5T5PA 4PDWB 2BWAA 4BK5A 3ME2A 2ARAA 4YW1A 2DV9A 1DGRN 2BJSA 1QIQA 3CNAA 4CEWA 5A3NA 5FMCA 3ILRA 1AR61 3MW2A 3AMPA 4QB1A 4CUBA 3O1OA 4JDMA 3GDBA 4GWIA 1YUDA 3LFIA 4Q27A 1GSLA 4XJUA 3VKMA 4D7SA 3THTA 3KT4A 4XXPA 4CDQB 2P6HA 1REFA 4P9IA 5CVRA 5I93A 2HYXA 3HNYM 4R4ZA 1PNGA 3I3QA 1KFUL 2QKDA 4HMZA 1JTZX 3FHIB 4BISA 4AHXA 3RSJA 4FP3A 3IAQA 2B5HA 5EWSA 1UYPA 2VOKA 1HLCA 2VQ0A 3IIAA 4FQ4A 5A1AA 2HBUA 5JSOA 5FOJB 3RZMA 5C8CC 2QZ2A 1ZZBA 3WDVA 1W6OA 2QQKA 3IAPA 3R4SA 1UY1A 1SPPA 2B39A 4EQVA 1QWRA 1YIPA 1IS6A 4LLOA 1J83A 4QPGA 4Q0VA 4P9YA 3BU7A 5FTTC 1W6NB 5EYYA 5FZOA 1DQ0A 1ODNA 3MUZ1 1QJX1 4PCRA 5FZMA 1QY4A 3N9QA 1NKGA 4DXTA 2X5IB 4HK9A 1S2BA 4GJZA 4XJ9A 5ABJB 2ET7A 5ANQA 5F32A 1AL21 1RUJ1 3CBNA 3MPPG 3ZXGA 3AK0A 2WT2A 4R9AA 5JLVA 4RYDA 4AQTA 1XE8A 3UESA 4N43A 3O1TA 3I54A 4YM1A 2CAUA 3KV4A 4G3YC 5F5AA 1YFWA 2XUEA 1AR81 1N1TA 1RXGA 2ZX4A 3OBRA 5GZDA 4ZXEA 2JDZA 3TEWA 2D5HA 4HK8A 3U78A 1GQGA 1TME3 4Q4X2 4HZFA 5KXCA 2A75A 4E2GA 1SZBA 2J1RA 4HVRA 5LRRA 2Y6JA 3K77A 5C8CB 2R072 5C9AA 3ABZA 3Q8FA 4DO0A 5IFTA 1COV1 4V1PA 2ZGPA 1YIFA 3ZVXA 4YM2A 4AVAA 4BQ5A 4H55A 4TXWA 4FPLA 2WZR1 1YYNA 2O0OA 4YZ5A 3DCQA 4MUVA 1WCSA 4OYUA 4EN7B 4YGCA 1DDLA 1NG0A 4XJZA 2B9UA 5I8YA 1LENA 3QBQA 4LUKA 1ZRDA 2WSUA 4MLOA 4R4XA 3ZYGA 1OQDA 1F9KA 5D21A 4JGZC 1AYM1 5CFDA 1C5HA 1RUG1 4JC1A 5FKBA 3ZN6B 4DXSA 5LA9A 4WZFA 3U4SA 3AZWA 1V6IA 4JKLA 3NV3A 3ZFGA 4CDUC 3AYCA 3CHXA 1NLSA 4JVAA 5C5UA 4XIOA 4OZOA 2ERFA 3ZSEA 3WEZA 1K5JA 1G6NA 3D3AA 4EN8B 3RGBA 4F83A 4Y1XA 5LK7B 2VZTA 1LU2A 3GZTB 2XDVA 3P1IA 5LRSA 3BGAA 4Z8BA 4IGOA 4D7YA 2YGMA 3AYAA 1XYNA 3N9MA 1L3JA 2H6BA 3FLPA 2G9ZA 1RUH1 4DS0A 1BBT1 3HPNA 4D94A 2D3PA 4KWKA 1O59A 1AX1A 3TWIA 4P5HA 3GZAA 2R063 4R8HA 4S2FA 3FMGA 4W6YA 2FQPA 4XBLA 4Q26A 1J59A 1WCUA 2RMU2 1ULOA 2LALA 2RDRA 1L7LA 2WNUC 5HCBA 3ITQA 3WG4A 4Q4V2 1J3QA 1RUI3 4FXGB 1JZ5A 2X09A 3AC0A 3PHMA 4AL9A 4NPMA 2PAEA 1HRV3 3DKQA 4W65A 4DIQA 4CE8A 4FAHA 1R081 3AX4A 2WNVC 3A7QA 2ZJCA 4LE4A 4QT6A 4YZ4A 2JE9A 2UY9A 3I7DA 4Y26A 1OUSA 2RM23 3LE0A 3NV2A 4FT8A 1DLLA 4OCTA 4J25A 4AFCA 4CDUB 4NROA 3TNQA 1BCXA 4FPJA 1DFQA 2AUYA 2YPJA 5JPMB 3MIFA 2RG4A 1DGWX 1FPN3 4LT5A 1W6NA 1MQTA 2MNGA 3U10A 5DPNA 3NRUA 5FO9B 4I01A 4LNVA 3BYWA 1JN2P 1N47A 5D8AB 1ASJ3 3C7FA 1JYIA 3IDAA 2SLIA 4YWAA 3I3DA 1XYOA 1PHMA 1FAYA 5FYSA 5J1XA 4YFZA 3U4XA 5LY1A 2BVBA 2D97A 5DXDA 1RC6A 1GV9A 3H8RA 1SDWA 1AR63 1W03A 2LROA 3RVHA 4PBOA 2PHRA 2C4XA 3MW3A 3T4HB 4A6SA 3SH5A 1IHMA 3AFKA 3NJVA 2A70A 2AH2A 4JKMA 4MGQA 5A6YA 5JR2A 3AJYA 1ZRFA 4XQWA 4ZY9A 4YZ1A 1MEC1 2W1WA 1E5RA 5JIUA 4QD2A 3MEPA 1DZRA 2VGDA 3FHAA 3ECQA 3DL3A 5C8CA 4FPGA 4GKYA 4IXLA 5FIXA 4I0BA 4PI0A 5DDJ1 3AP9A 5KHIA 2YZ4A 4FCAA 4LOSA 5LATA 3WF0A 4CCMA 2QNKA 3WNKA 5IFPA 1KDMA 3KZ4C 5FPZA 2KD7A 2PELA 5I91A 4DUWA 3HMYA 4CU7A 4FSJA 4XJWA 1JUHA 3I2GA 3PIGA 4IEUA 5JOZA 4E27A 2WN3A 3T0AA 4IEWA 5CZKA 3WNMA 2IXKA 5KXBA 2JENA 1H1AA 3DECA 4QQHA 2PQQA 4AVSA 1YJKA 1D4VB 1UY3A 2ET1A 1QJX3 1UN1A 4MGKE 2BOJA 4FVVA 1UF2C 4QMAA 4UFJA 1U12A 2TNFA 4BPZA 3ZN6A 5GZCA 1RHI2 1JBCA 2D3RA 1AL23 1RUJ3 2HBTA 3KSCA 2HWD2 1SCSA 3JZVA 3VBOC 3VGIA 5BNPC 2BZDA 5FBJA 2Y8KA 3VB9A 3N9PA 3POBA 3Q8AA 1AR83 1US3A 4AFAA 1F5JA 1OQ1A 1RUE1 2QDRA 1D0GA 1H2LA 1SCRA 2D40A 4K3UA 3S7EA 4AQ2A 2PHXA 1GR3A 2UYBA 3ZOIA 2J42A 2UY8A 1H8TC 3TEYA 5A6XA 1OFNA 2IC1A 1DGLA 2V5DA 5FLIA 4E2SA 2W95A 5J09A 2R32A 4QXHA 2ZEXA 1DP0A 2VW0A 2B42B 2G19A 5FY5A 4UFLA 5EP9A 1COV3 1PO11 4LO8A 1IGOA 1W0OA 1H9WA 2E63A 1A34A 1LR5A 3A21A 3VHPA 4EWAA 1WKYA 3T2PA 1PMIA 1TVGA 1U5YA 3DYOA 1AUYA 5DUWA 5HCAA 4JGZA 4DB5A 5C3RA 2TBVA 5C33A 1SG3A 4YARA 1D0HA 1GZ9A 1SHWB 4FOWA 5FZ9A 1YEWA 4AAPA 3DXUA 2R30A 4CXWA 1N1YA 1HRI2 4CDUA 3N7LA 1OBNA 3I2KA 3OCPA 3LA7A 2SBAA 3THPA 1Q8SA 3VBOB 1RUG3 4MGTA 3C7GA 4PQQA 2PAKA 4HKLA 1UPIA 4NMIA 5A3PA 1R1A1 3ZSKA 1JYWA 2YFUA 5L73A 2ARCA 3WNPA 2UWCA 4X8NA 3ZR5A 4ZU7A 2EAAA 2GC2A 4R9CA 5K0UC 1AR91 1VBE2 3PJYA 2DFBA 2R1DA 2V72A 1IG3A 3UK9A 3IKWA 4XFBA 5FPXA 1V6KA 3RMYA 1G9FA 1UMHA 3AZVA 3B01A 3H7JA 4Q8KA 1ULDA 4QX0A 1OA2A 1RUH3 1BBT3 2WNUA 3NNFA 4LUMA 1Y9MA 2D6LX 4QB2A 4YLZA 3NNLA 3ZMOA 1RUNA 3DV8A 1C1LA 3PLQA 4I3GA 4I30A 1NZCA 2WNVA 2Z5WA 1NCQC 1DZQA 1WLCA 3KV5A 3IMMA 5L9VA 1X9TA 2FDGA 1OFSA 5CG9A 5IK5A 1JS9A 1JUIA 2Y26A 1R083 4LBKA 2D43A 5JR7B 1I3HA 1H1IA 3WT3A 3S0MA 3ON7A 4RN5A 4XBNA 5BY5A 2XR4A 5BPXA 1CX4A 4LA3A 1CZSA 1LU1A 3SCHA 2GNMA 4DZGA 4BXSV 5L7OB 2C24A 4FOQA 4D6SA 2BRTA 2JDAA 1V9U2 2BV4A 2PMWB 5AC91 3OPTA 1KS5A 2OUHA 3LZZA 5J48A 4C91A 4GKXA 4N7UA 1IZ3A 4L99A 3HVDA 4ARXA 4FQZA 4LBQB 1RMU2 1QDCA 5IVFA 1ZBE1 2Q5TA 4Q0SA 3HAGA 5IHRA 1C57A 5ERLA 5HXMA 1Q56A 4CVUA 3OOXA 4LXLA 2GMMA 3VKFC 2DUQA 2AR6A 3H3UA 3VBFB 3HQRA 5JXJA 3K46A 1DG6A 3MYXA 1QGLA 3UKNA 4HPKA 1NCQB 5FYTA 1TME2 4AOCA 2VCCA 1FNYA 4LHLA 3TNPB 5C4WC 5K8SA 2XVKA 4K7JA 3CLPA 2D93A 1MEC3 1OPOA 1VB4A 1QOOA 2ORZA 2KXLA 1RITA 1OI6A 3JB8A 4E4SA 2OVUA 3KT1A 1ZZ8A 2EF6A 3UGFA 1YQ5A 2W94A 1QXJA 1W6PB 4GWJA 3USSA 1Y7BA 3G7DA 1K45A 4TN7A 5IVBA 3V0BA 1VMHA 4AFMA 4CUGA 3NW4A 3UV9A 3NJXA 4OI1A 2DTYA 4LPLA 3IDCB 2W9XA 4PIZA 5FRAA 3RNSA 4DY5A 1F8VA 2JDMA 3VHOA 5LWBA 2KA3A 1JOJA 4RFT0 5FZBA 5BYNA 2ILMA 4IE4A 4ITCA 2VVFA 3ZN5A 3VBOA 4GH4C 4ATEA 1JYXA 3CO2A 4I02A 4YM3A 1PGL1 5BNPA 4XMAA 4LE3A 4QXKA 2ES3A 1H8VA 4RA0A 5FWEA 2GMPA 4AI2A 2FHRA 3SMHA 1JYTA 3ENRA 1BEV1 1XB9A 4D3WA 1PVXA 3NV1A 2CGNA 3CF6E 1F2NA 2XWJB 4XUQA 5JOYA 4XAAA 1ND3B 3POIA 2PA7A 1NA1B 1DYPA 2D3SA 1I5ZA 4GB31 2GP5A 4Q4W1 1RUE3 2IWGB 5FUIA 2J1TA 1BK1A 1QMJA 3LSDA 4LR4A 3O12A 3ZXDA 3WQ7A 1VBA1 2RR11 4NIAA 3T2QA 1NY71 4LOTA 5FPAA 3DEMA 1UAIA 1RUI2 2LM3A 5FP7A 1UO9A 5T3NA 4Q2FA 3PIJA 3W5NA 1HRV2 3AJZA 4FPYA 1PO13 2WQ8A 5F3IA 4A7KA 4WVMB 1RJ8A
chains in the Genus database with same CATH topology
3AKQA 3T2TA 4YG0A 3HT2A 5I0RA 4K1ZA 4HL0A 2RM22 2R1BA 4QGMA 1V6NA 3VUOA 2WFF3 2JX9A 3V56A 3MLLA 4NOTA 5I8TA 1FPN2 4IV1C 5KC5A 2X29A 5K0UA 2R042 3GHNA 1H4GA 2HYKA 1R1A3 1ASJ2 4H7LA 2XGXA 4M3CA 2MPFA 2A6ZA 5F5QA 4AI8A 2HEYF 3ZPYA 1ZRRA 3O14A 1AR93 3DPRC 1OOPC 3VHNA 2D6NA 2QDNA 2VOWA 1PVC1 3HN1A 3RYPA 1PGSA 1MZEA 4Y5Z0 1FNZA 2ZMKA 3O0WA 4CEYC 3KS7A 3S30A 4X6QB 3HD8B 1NCQA 3AYEA 2K2SA 2Q0AA 3AFGA 1UIJA 5JIAA 3ATGA 4N53C 4N90A 4BIFA 1ZM1A 4C1XA 2A6WA 4OVEA 1LGNA 3M3CA 3INAA 3ZXJA 1LECA 4PIYA 2ZPXA 4PJYA 5BNOC 4S2GA 2DWRA 1W6PA 4GULA 1I9RA 4MXWB 4XYXA 1C28A 2ZGUA 3KD4A 5AC93 2WC2A 1QJX2 2YV8A 4RHV3 4RSUA 5KWRA 4ORFA 5HBAA 4LBJA 2RS11 5F6LB 3USUB 5A32B 4COYA 2QUOA 1ZBE3 3G6JB 3FWEA 2W68A 3WX5A 4CEYB 5IK8A 2OA2A 5C4WA 5IT6A 4AGRA 4S2DA 4FXKB 1C3HA 2DCKA 3LAGA 1TNRA 5T5OA 1AR82 2NN8A 4LO6B 2RS33 1HW5A 1SLLA 1D4M1 2LTNA 2QJVA 1ULEA 5ACA1 3ZYJB 1VALA 3VBSC 3ZO0B 5I0UA 3BPZA 4YW5A 1COV2 3OJBA 3CJXA 3FFQA 2ETEA 2CGPA 2A6XA 4A7ZA 1WD3A 4P9WA 3WXPA 2A3XA 2VOVA 4BWOA 3IT8A 4Q1RA 1ENSA 1DYKA 4WVMA 2Y0OA 4XTMA 1RTVA 1V70A 3M3OA 4Q0PA 4XBQA 2GZWA 3WG3A 4FOYA 5IK4A 4GH4A 4LBNA 1ND2C 3N7MA 1ZYBA 5E8AA 4AFDA 4AVCA 1LOFC 2VQAA 1X7NA 1W6OB 1RUF1 3KT7A 3H9AA 4DY3A 1IPJA 1DQ1A 2K9ZA 1Q5OA 1C5IA 1AX0A 4GMP0 3H1YA 1BEV3 1OMIA 1EV12 1PZ9A 3M1HA 3QCWA 2C9AA 2D5FA 2WNEA 3WDUA 1VRH1 1NYWA 5T5JA 3WOGA 5GZFA 3ZYIB 3N7KA 2YHJA 4BCUA 1UCXA 1RUH2 4GB33 1BBT2 4Q4W3 4BOWA 1K5MC 1REDA 4AG4A 1SEFA 2CV6A 2ZACA 4FTSA 1FOD1 2NLRA 1LCLA 1VBA3 2RR13 1X50A 3ST7A 2HWB3 5B2GB 3QLQA 1PO21 4XF1A 4MZUA 1YXWA 2DU0A 5FREA 1AX2A 1SACA 1H0BA 2GN7A 5T5LA 1HXS2 4WM8B 3VBRC 5I0TA 4IV1A 2B7YA 1XNCA 4QHBA 2E9QA 2DVDA 4NR1A 4J6GA 2G4IA 1CGPA 1RJ7A 2CY6A 4EWEA 3DPRA 1OOPA 2GC0A 2PLV1 3J9SA 5BV6A 4INDA 1WLTA 2WZPP 4I0AA 1A3KA 2YC0A 4CEYA 4QX5A 3BODA 3GNEA 4WVZA 1IOAA 1LRHA 1H1MA 2XG3A 4PQ9A 3ZFGB 4OUSA 2R49A 2W39A 4N53A 5SV5A 1YI7A 3MW4A 1C8M3 3POSA 1H4HA 1MEC2 4AVVA 4B8EA 1LESA 2BYVE 1KXGA 3WUCA 1QNWA 2D44A 3AM2A 4L92A 1WBFA 3E6DA 4MSVA 4TWTA 3ZXLA 5E16A 2CYFA 4RS5C 2XUMA 1PK6C 2ZGTA 4RL7A 1DQ5A 3TOJA 2EVXA 1G9DA 3B00A 2OIIA 2RE9A 3ZDSA 4PIXA 4AK3A 4QQ2A 3ZMNA 3RWNA 2E6VA 5GALA 3R4UA 2I74A 3B94A 3JD71 4M01A 4RR3C 4F3JA 1RINA 2VY0A 1A78A 5KBFA 2DVGA 3E5UA 2RS13 4YGEA 5FBZA 3J8F1 4Y1ZA 5GZEA 1IS5A 4JDOA 4AI3A 2YYOA 3S7IA 1G86A 3WQ0A 3L2HA 1MQTB 3E6BA 5A33A 4LHNA 4XW3A 4HETA 1GNHA 5C8WA 3KCXA 1LEMA 4Y20A 1VBC1 3A4UA 1RUE2 4OZXA 5JAXA 3VBSA 1B35C 4SBVA 2MEV2 1D4M3 1N3QA 5ACA3 3ZSLA 2BNNA 4Q4Y2 4LHKA 4XF3A 1IS4A 2X53S 5LEJA 4KBBA 2IXLA 1KQRA 5FFOC 2BNOA 2RS51 5CNAA 3FLRA 1QKQA 4AI0A 4CP0A 1AYN1 3POYA 4KNCA 5GLWA 3VN4A 1DBNA 4WM8A 1AR73 1KD7A 1O4ZA 1G8WA 2WFF2 2AGSA 1V6JA 3WP5A 2OPKA 1OA3A 2PTMA 3APBA 4LO7A 5LEKA 1CR7A 4KGGA 1R1A2 4AF9A 3GHMA 1KFXL 3WG2A 5EJ3A 3VBUC 3MGUA 2DCTA 3NL1A 5DUUA 5H9RA 1HDKA 1K5MA 3LKJA 1VRH3 2DF7A 2D7FA 3KCYA 1AXYA 3DN7A 5BNNC 2AYHA 4YM0A 5K9YA 4XMIA 4HT1T 1FOD3 2PHDA 4NWWA 3DKWA 1SBFA 4TLFA 3HQXA 3KCCA 4GWNA 2VVEA 5I8SA 4R9DA 1PO23 1SBDA 3RQ0A 1ZBA1 5GLUA 1JHNA 1A8MA 2HWE3 1NOVA 3MF6A 5JSRA 1QQP1 1YO8A 1W6QA 4JQRA 2Z42A 2A7AA 5K7PA 1J58A 1IPKA 4RGAA 1RUOA 4KL1A 5JMCA 4RHV2 2RHPA 4H7MA 2Z2SB 3WR0A 2WQZC 2CL2A 4OHWA 2JECA 2PLV3 4JGZB 2E53A 5IUQA 2NM1A 4JCKA 2VNGA 1YJLA 1X36A 1DGWA 4YVSC 4OHVA 3D5OA 1H2NA 2B46X 2RS32 1URXA 4FTEA 3D6EA 2IZWA 2BFUS 2WSVA 2HWF2 3CL1A 4M0HA 4QQOA 4CTEA 4WVWA 1Q3EA 4RS5A 1AHSA 1CPMA 3WDWA 2F6BA 3PVEA 4NO4A 4LBOA 2O8QA 3HBZA 1OPMA 1QNYA 1RUC1 2W08A 2VNRA 2WNUB 1E57A 2ZGLA 2XWBB 3B3QE 5CBLA 4RR3A 2AREA 2WNVB 2XL9A 2JJ6A 2ZGQA 4Q29A 3W58A 4XE9A 3GZUC 5DG2A 2D6KA 1CIWA 4UBGA 3JD73 3BB6A 4IL7A 1XU2A 1BKZA 1KDKA 2HWC2 1LHNA 1YFUA 4HKOA 3J8F3 2JD4A 2V09A 3ETQA 1BEV2 2ZBJA 4XILA 3IPVA 1DGRA 1RUD1 1CAWA 4OLLA 3SHRA 3H1MA 4FPCA 1VBB1 4Q4W2 1AXZA 1VBC3 3B93A 1VBD2 3PVBB 2WS92 4AHWA 1O3SA 1ZNPA 4G4FA 5DUXA 4FTBA 3N4MA 2VMHA 5HI0A 4ATFA 2VH9A 2HWB2 5AFEA 1UMZA 2RS53 5FDBA 4MVTA 4KH9A 4HPKB 1YFXA 2DURA 3EQEA 3SCGA 2BTVC 1AYN3 4COUA 1AL0G 2QE3A 3AMNA 2VUJA 1MR5A 5KHKA 3M70A 4YYOA 4AEMA 4QGLA 4KG8A 2VPVA 5DZFA 5BNQA 2P34A 3S6PA 3DGTA 3K51A 4K20A 1NE6A 2OYZA 2DUOA 3VBUA 3V0BB 4E2QA 2WZR3 4J1XA 2R0FA 4MYEA 4LO4B 1G9CA 3SISA 3O7OA 2EALA 1AXKA 1JW6A 1POV1 1B09A 3KGZA 1HQWA 2GC1A 3NKGA 4GWMA 5BNNA 3KGLA 4I2OA 4N9IA 1AYM3 1WW7A 2XVLA 1LTEA 3NAPC 3AKRA 4FOVA 1PIV2 1QXPA 2WT1A 3WUDA 2EA7A 5BNPB 3M3EA 3ASIA 4K9SA 4P9JA 5FMOS 1C8M2 2ZABA 2ZX3A 4KGQA 3WP6A 3OTFA 3NJZA 2AENA 4W6WA 2XBO1 3BOWA 3TB0A 3KB5A 3JUUA 5AVAA 4GA9A 4DRRA 4DPNA 1H8TB 4FPOB 4B4PA 4I09A 3FJSA 2FBEA 1REEA 2R071 1ULCA 5FCCA 2H0BA 2P2KA 1H2KA 4MV2A 1QQP3 1RVF1 2ATFA 2WINB 1GICA 1D2QA 3ZSJA 4BZ4A 5FOBB 5JCTA 4BHPA 3K48A 1M4WA 2EXJA 2B8MA 3WVJA 2ZTNA 5EXOA 3C3VA 5CFCC 5TSWA 2GNDA 5GZGA 3O0XA 3O0VA 2ZX2A 1EYBA 2ARBA 4P9XA 4YVSA 2B45X 2R16A 3MFAA 1LOBA 2VW2A 2ZOEB 4L9BA 2E7AA 5A3LA 1CESA 2ZGSA 5K0UB 3O5SA 1QJZA 3H7YA 3IMNA 4M3CB 2ZHLA 1PM7A 3AZYA 3ZXAC 3C2UA 1WMEA 2IFWA 1BXHA 4X6RB 4CP1A 1EAH1 2VG9A 4UW3A 3SCFA 2QZ3A 3BCWA 3MIDA 3ZSMA 4P9GA 4Z2WA 1RUC3 2BNMA 1RGSA 4H3WA 4OI2A 4ASLA 2JG8C 4TYSA 2IFRA 3MFCA 4Q4V1 2VXRA 1OHFA 1ENRA 3ZYRA 2HEVF 5BUVA 1UX6A 2PHUA 3P3NA 4HSJA 1AR72 1N1SA 3VZNA 4Z07A 1LJ7A 2CGOA 1MACA 1QOTA 2ZGRA 3ROUA 3WQ1A 1CN1A 1JYCA 4OHZA 5AFBA 3PTYA 5DDJ3 1W6MA 1NLRA 4EJRA 3X29B 4E4DX 2CWMA 3RPQA 2CTVA 4JTNA 1Q8VA 3TN91 3NKTA 4EROA 1EP0A 3MPBA 5DZEA 2Q8OA 4Q0QA 3SXWA 3B7MA 3HWJA 1RUD3 2F4PA 4YZ2A 4XEZA 4XXAA 4BM8A 4GALA 3CEWA 5HCFA 1GZCA 1HKDA 4AYUA 2PHWA 1VBB3 1PNFA 1S0FA 2Q4SA 4MXVA 3KMHA 3B5LB 1FOD2 1XQNA 4XHXA 5C4WB 4MH0E 1CAXA 3ZX7A 3H0OA 4WVVA 3QH7A 3E97A 1PO22 3RYRA 1H8TA 2VNOA 2EAKA 1SLCA 3OD0A 3FUOA 3J26N 3AKPA 4BE3A 2HWE2 3FUQA 4AW7A 2R062 1BVVA 1FYUA 1JH5A 4LEJA 3OGJA 1A8DA 3MIHA 4IV3C 5L36A 1CAVA 4DINB 3EJKA 2JEMA 3RZZA 1BYHA 1UD1A 4QQLA 4RD7A 5DZGA 4DRVA 1Y3TA 4E9KA 2WL1A 5E89A 4GXLA 1ZVFA 4XQ4A 2XKPA 1BMV2 1S2KA 2WA3A 1LHWA 2WFPA 2A73B 1POV3 2ZMLA 2ZKNA 1RHI1 3NAPA 4GH4B 1LOEA 3LOIA 4XFFA 3HIFA 1YI9A 3WDXA 3AMMA 3TYJA 2BPA2 4IEYA 2H0VA 2DCZA 3AMQA 4YG6A 2HEWF 3UJOA 4EN9B 1VIWB 1CAUB 2OUJA 1BJQA 2VUAA 4CDXC 3CU7A 3MZHA 1ZREA 1RL3A 3EO6A 3AXEA 3H8UA 4G9SB 2XBO3 3VKNA 1C1FA 1U5IA 1AR62 5EFUA 5JDBA 4XFGA 2V5YA 2R073 3FE5A 3VZLA 4M00A 3IM0A 3WDYA 3E6CC 3WW4A 4QGNA 1RVF3 3VZKA 2PFWA 4BYYA 1NE4A 2DU1A 5CFCA 1ULGA 4LBLA 4QPIC 4MGIE 3ALQA 4AEDC 4DMIA 4K21A 4OI4A 3RI8A 4IV1B 2O1QA 1UPSA 1KS4A 4YW4A 2JE7A 4XF4A 4Y1VA 2W52A 4LBMA 1KRIA 3EHKA 1VR3A 2WJSA 3OY8A 2RJKA 4K40A 1VBE1 3DPRB 1OOPB 3MI8A 1ZX5A 4IEVA 1VBC2 4IEQA 4FPFA 1DIWA 4XJAA 1AL22 1RUJ2 1U0AA 2HKXA 4RQPC 1ENQA 1EAH3 5LK5A 2JG8A 3P3PA 4I0WB 1LOAA 4WZCA 4W6XA 3MIBA 1J1LA 4YGDA 2P3JA 1CVNA 2GH2A 2ZGOA 2RS52 1HQNA 2ZZQA 4IEOA 4N53B 4JRLA 4HVOA 4Q4V3 4QPIB 2WWSA 4FBFA 1HIXA 2XJVA 3PJQA 5BNOB 4HKWA 5FO7B 1GLHA 1UKRA 1CD3G 3FFZA 2E7TA 3KM5A 4XETA 2WZR2 3M7AA 3WCSA 1V9U1 1CQ9A 3AXDA 3OF1A 3WG1A 1GFF2 1X8MA 4ASMB 2DVAA 3TN93 1RMU1 1AF9A 1BVP1 1FV2A 3JB4C 4RQPB 4COVA 1ZZ6A 1AYM2 2OZJA 1RUG2 1Z7S1 4ONUA 1MZ6A 1WLWA 2O8OA 2P17A 2ZA9A 1NCRC 1YHFA 1CAUA 4HFSA 3MDPA 1ZZCA 4DQAA 4C90A 2EXHA 4JV4A 2V73A 5A33B 1QH6A 2YY1A 4Y20B 1DQ4A 2DTWA 5H9SA 4U2AA 4IV3A 2UYAA 3PVNA 3VBSB 4E4ZA 2VU9A 1LOCA 1VAVA 2OW4A 5CG8A 2GNBA 1QHDA 1N3PA 4FPEA 4PLOA 2UU8A 4XFHA 1YFYA 1IQAA 2D6OX 3NVCA 1MZ5A 1TE1B 3NV4A 1SFNA 3MIEA 1G7YA 4UW5A 4BIOA 1R082 2XB6C 4NHMA 5KC6A 1ND2B 3QH6A 4Y22A 2YXSA 4ZU5A 4DXZA 3WDTA 3I59A 5JI7A 1RHI3 2PHLA 1NCRB 5FAXA 3JU9A 2Z79A 4IETA 2XLAA 5T55A 4CDXA 1WCKA 1LHUA 5CU1A 4R9BA 2ZZJA 3EBRA 3CJIC 5J36A 4QQPA 2HJIA 3B9CA 4C1WA 1OA4A 1K5MB 4PDWC 1UKGA 1QJY1 1Q8PA 3N35A 3MF9A 4C0HA 1PGW1 2VOXA 4NVPA 1PVC3 1IKPA 4JAAA 1X8EA 1XE7A 4P9LA 1LHOA 4PLMA 4B29A 1I1EA 3ZXKA 4URTA 4CDWC 4LULA 2ZMNA 2XLFA 2ZGMA 4CDQC 4QPIA 4FPKA 2IXJA 5BNOA 2GN3A 4AEDA 4ES8A 3GBGA 2XJQA 3VBRB 3MICA 1XNKA 4YSFA 4RGGA 5DDJ2 4X8PA 3E5XA 2A6VA 1FPN1 4HVQA 1W6QB 1NQDA 2EXIA 2G9FA 3RI9A 2R041 4Z92B 4OULA 1LKNA 1WW4A 4EV0A 1ASJ1 3Q9OA 5JZGC 3N7JA 4AEKA 4YW2A 1HQLA 1VBE3 1R091 4RQPA 3LA3A 2X5IC 1TNFA 1VBB2 5ABJC 3OYWA 4HN1A 2DCYA 3D4KA 2ZKLA 1FATA 3PVOA 4FO9A 4K6BA 2I2SA 1FMD1 2DFCA 3AB0A 3WHUA 4CDWB 1CPNA 2BQPA 4WM7C 3LA2A 4D7TA 2EIGA 3AKSA 5DG1A 3VLBB 2A3WA 4ES9A 1SMVA 3D8CA 2DVFA 1DQ2A 4Y4YA 3WLUA 1AJOA 2A71A 2QVSB 4RS5B 2PAMA 2R0HA 1S0BA 1PK6B 2VMGA 1FXZA 1EY2A 1HX6A 1ZZ9A 2DVBA 2NMOA 1F5FA 1UU6A 5CIRA 1PO12 1KJLA 5JZGB 2LUWA 5CB7A 1EPZA 2VW1A 1V9U3 4XFIA 3IWZA 4BQ1A 1MS9A 1ND2A 1Z78A 4RR3B 4L2NA 4CRQA 2WKKA 4MGZE 4AWDA 1TQ5A 3ZFEC 1RMU3 1LOFA 4XOGA 4IEZA 3PNAA 1NCRA 1WMDA 1WUVA 2GH8A 2A5ZA 1FT9A 1Z7S3 5C6CA 4WM7B 1IKQA 2JICA 1YWKA 1FI2A 1RUF3 2WT0A 2JG9C 3IPVB 1AR92 1EPWA 1D2SA 1B35B 4K1YA 2XBO2 1CAWB 5T52A 3JQXA 3NWKA 2NP0A 3WD5A 1SBEA 4J1WA 4Y24A 2NQYA 2YROA 5I0SA 4KG0A 5T50A 1V6MA 3IN9A 1RVF2 4KU7A 3NSTA 3VBHC 1TMF1 3W59A 4PBPA 2DUPA 3VBRA 3ZFEB 5JSPA 2C5DA 1MVEA 1S0IA 5E1RA 1M06G 2FMDA 4MGYE 4YFWA 4AHZA 2JXAA 3CJIA 5AC92 3VBUB 2JG9B 3JBG1 3ZXFA 1SLBA 1EV11 3URFA 4PDWA 4IEPA 4EN0A 5D8AC 5FLHA 3IDBB 1ZBE2 4Q8LA 3U11A 4NN0A 1EAH2 2R6QA 3FLTA 5EV7A 4I3PA 4ZU4A 5BNNB 2Q1MA 2BW8A 1QJY3 4CDWA 2D6MA 1H30A 4CDQA 1V00A 4F7ZA 2N7GA 1VB2A 3VBHB 3T1LA 3LSEA 3KQRA 4M3CF 4Y1UA 1ZZ7A 2XL7A 4XIKA 2P37A 3WINE 1LGBA 3LB9A 3GBWA 4BH9A 1PK6A 1J3PA 3WW1A 1O5LA 1DZTA 4A7YA 2XJUA 1Q43A 1HXS1 2RJLA 4LO5B 4C0BA 3LGRA 3DUIA 2VMIA 1LOGA 1W2UA 4XQDA 1XNDA 1LODA 2A3YA 4BMEA 2BFUL 5FQ0B 4XFAA 1GQHA 2X8KA 4AGGA 1QJU1 2NPIA 5JZGA 3BIWE 5F6KA 2H6CA 1SLTA 2R043 3TN92 4N7IA 2X5IA 5ABJA 1U5XA 1C8NA 2GU9A 1T6GC 1YLLA 4WBBA 1R093 1QU0A 4WM7A 4YVSB 1PGL2 1OSGA 2UWBA 1GYKA 1SLIA 1WMFA 4M3CE 4TZDA 1FMD3 2YMZA 3E5QA 5JOXA 3UJQA 3UL2A 1FV3A 3H1WA 1B35A 4JTOA 4S2HA 2E51A 1MZFA 4YGBA 3A0NA 2PYTA 3M4FA 2BGCA 3RYKA 3AP6A 4XF0A 4GB32 4NPRA 3FBYA 3FZ3A 1UIKA 5T54A 4KQ7A 3WNXA 1VBA2 2RR12 2WIIB 5AVPA 1NY72 3WW3A 4AXOA 2DYCA 2CAVA 1WA4A 3BALA 3ZFEA 3A0KA 4HN0A 1G9BA 3RJRA 1N1VA 4LLFA 1XYPA 1WD4A 5EZWA 1JXNA 4XHBA 1VP6A 3SITA 3OPZA 3SH3A 3V0AB 1ZA4A 3M8LA 1I6XA 1CJPA 5J98B 2GC3A 1WW6A 4AVTA 1GZWB 2Y0IA 1W6MB 2A6YA 2NMNA 4DOUA 2JG9A 3VL9A 3L9JT 1HV1A 2JKBA 4PF5A 4XFCA 2Q1ZB 1XU1A 3HR9A 4BA6A 3GBFA