5F32A

Crystal structure of human kdm4a in complex with compound 40
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
344
structure length
342
Chain Sequence
SARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysine-specific demethylase 4A
publication title 8-Substituted Pyrido[3,4-d]pyrimidin-4(3H)-one Derivatives As Potent, Cell Permeable, KDM4 (JMJD2) and KDM5 (JARID1) Histone Lysine Demethylase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 105
structure length 342
sequence length 344
chains with identical sequence B, C, D
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5f32A01
2YPDA 4CCMA 5LWBA 5A7WA 5A7SA 3PU8A 5ISLA 4LXLA 5FY9A 5FY4A 4EYUA 3ZPOA 5FYHA 5FXVA 1VRBA 5FYVA 5FZCA 4D6SA 5FYZA 3AVSA 5FP4A 3N9NA 4BU2A 5IVEA 4UF0A 5LW9A 4D6QA 2GP5A 5FPLA 5A1LA 2YBSA 3NJYA 4IGQA 4QX7A 5FY7A 5IVVA 5A7OA 5FP3A 5FXXA 5A7NA 4XDOA 3U4SA 5E6HA 4BISA 4IGOA 5FPBA 4QXCA 4Y4RA 5FY0A 5FUNA 5A3TA 4BXFA 4CCJA 4QXHA 5FJHA 5FZFA 3KVBA 5A7QA 5FP9A 5FZHA 3AL6A 4ASKA 2WWJA 5FZLA 5FYCA 2YBKA 5LY2A 4AAPA 5A80A 5FZ0A 4DO0A 4V2WA 5FYUA 2OS2A 5F3EA 5FZOB 3PUAA 4HONA 4DIQA 5IVFA 3DXUA 3OPTA 2P5BA 5FZBA 5LY1A 3N9OA 5FZEA 2OX0A 3N9PA 2YBPA 4URAA 5A3PA 2PXJA 2XDVA 4Y33A 5F2WA 4GJZA 5FZMA 4V2VA 3AVRA 5F3GA 2XUEA 4CSWA 5IVYA 3LDBA 5FZ7A 5FXWA 3RVHA 2Q8CA 4CCKA 5IVBA 5FZOA 4IGPA 5FWJA 4EZ4A 3N9MA 4LITA 4XDPA 3KVAA 5IW0A 5FZ6A 2XXZA 3K3NA 5A3WA 5FZKA 5IWFA 5FZ1A 5ANQA 3U78A 5KR7A 3DXTA 4Y3OA 5FBJA 4GD4A 5FY1A 5F5AA 5F5IA 5FP8A 3KV9A 4HOOA 3PUQA 5FZIA 5FYIA 3ZLIA 4CCNA 4UF0B 5A3NA 5FZAA 3KV4A 3UYJA 5FXZA 4CCOA 5F2SA 5FPUA 3KV6A 5FYSA 2OQ6A 5FPAA 3K3OA 5FYYA 2WWUA 2YU1A 5FZDA 5FZ4A 5K4LA 4CUGA 4QX8A 5FZGA 2VD7A 2GP3A 5FJKA 5FP7A 5FUPA 2Q8DA 5IVCA 3N9LA 2OQ7A 4QU1A 5F32A 3N9QA 5IVJA 5FZ8A 4GJYA 5A7PA 5F37A 4TN7A 5F3IA 5F3CA 4C8DA 3PU3A 2OT7A 5FWEA 5FYMA 5A7WB 4CCLA 4EZHA 5CEHA 5F5CA 2W2IA 5FY5A 3K2OA 3PUSA 2YU2A 4LIVA 5F39A 4QWNA 5FV3A 3AL5A 3PTRB 3KV5A 3PURA 5FPVA 5FYBA 4AI9A 4D6RA 4LIUA 3PDQA 2Q8EA 5FYTA 2XMLA 4NUBA 4QXBA 5FZ3A 5A1FA 3LD8A 5FY8A 4E4HA 3OPWA 4GAZA 5FZ9A
chains in the Genus database with same CATH superfamily
1FX5A 3LPFA 3EB7A 1YIFA 4CCMA 4DQAA 4QT6A 2GALA 4BQWA 2RJ2A 2JG8A 2ZEYA 4LO4B 2ZS6B 5FYHA 4QM8A 3ILNA 1C4RA 2WO3A 4XACA 2VNVA 2P3JA 5A33B 5C8CA 2IC1A 2VCBA 4Q5OA 5JR2A 1AUYA 2HWE2 2EICA 3S5QA 2Y6KA 4FFIA 4ZS3A 4ISQA 4XFBA 1NA1B 1X50A 1N3QA 3TN91 4YW7A 1W0NA 3U37A 1UNBA 1W6OB 1NE6A 1BBT3 2DCTA 5LK5A 4AVTA 3V0AA 1MQTC 3QLQA 4QXHA 5KBFA 2WFF1 5JOXA 3WNKA 2BW8A 3NW4A 1ULCA 2LRPA 5LY2A 3SMHA 3ZSLA 1UZZA 1TMF1 4KBZA 5FYUA 5F3EA 4NVPA 1D0HA 2PQQA 3ES1A 4HONA 5JXIA 1PO23 2IXLA 1DP0A 1W6NA 2W1SA 3DXUA 4XFIA 1UMZA 1A3KA 2IVIB 3RPQA 4FQ4A 3ZXDA 2ZKLA 4WM8C 2E53A 3UESA 1DGWA 4MADA 2JB8A 2HEWF 2YBPA 5EYXA 1WW6A 2F4LA 5GJ6A 1RJ7A 4P00B 1H1IA 1V9U3 2WN2A 3BYWA 1YLLA 1RUF3 4L2NA 4UBGA 2YZ4A 1ND2C 3I2KA 4D0QA 2QCSB 2F6BA 4CCKA 1ZRIA 4KWJA 3IZOA 4XJAA 3AC0A 4FSJA 4CDUB 1EV13 5KXCA 3B9CA 4XDPA 3T2TA 2JWPA 1ASJ2 3AZYA 3ITQA 3SITA 3ZKUA 3J7LA 1V6JA 2QZ3A 2A6VA 4LUKA 4XIKA 5FY1A 1GZWA 3RSJA 1QQP3 4MXVA 1CZTA 1RGSA 1OVSA 2AEYA 3OCPA 4AWDA 5B2GB 2DU1A 4IEVA 4AL9A 5CFCB 4W6XA 5FZIA 4XUQA 1BEV2 4LE3A 5FYIA 4ZZ5A 2LUWA 5A3NA 3KV4A 2FDFA 5F2SA 5JXGA 1X7NA 4IETA 1S2BA 2CDOA 3LWCA 3MV01 3ZFEB 2A3XA 5A32B 3WF0A 5K4LA 3AMNA 3ZSKA 1C8M2 3OGVA 4W8JA 1RUH2 4D94A 4CEYB 3V0BB 4S2GA 2QQLA 4TLFA 1UF2C 1X33A 2WSUA 5IVJA 5KXBA 1UQXA 1AYN3 1QJU1 2H6CA 2VW1A 3GCWA 2VW2A 4UI9L 4XZPA 1ZA4A 5T54A 4Q4Y2 1NT0A 1ND3C 1YI9A 3RNSA 4DPNA 3G7DA 4E4SA 1SBFA 1POV0 1SLAA 4IESA 3VBSA 1VBD2 3OBRA 4V1PA 5JXHA 3FWEA 2CTVA 4AEKA 3VBOC 1LKNA 5FZ3A 2PHLA 1PO12 3RI8A 4WV8A 3VDDA 4AI1A 4B4RA 3RZMA 4KGQA 1E5SA 4WVWA 4ZXKA 3BTYA 4Y22B 1MZEA 3ON7A 4N7IA 4AEJA 1JZ2A 1CAWA 4LXLA 5FY9A 5HV0A 2WZR2 5JI7A 3IKWA 4BQ1A 3ZIXA 1E5HA 4JV4A 5J7MA 3I49A 4MVTA 1F5FA 3I7DA 2JE7A 2EAAA 2VZVA 4NAMA 2KR2A 3V64A 4BZ4A 4SBVA 1JODA 5APAA 2DV9A 5A7NA 2QJVA 2E6VA 5A1AA 1UPSA 4QXCA 1XNBA 2ZX2A 5A3TA 3RDIA 4CCJA 4BWOA 1U5YA 2YYOA 4K8FA 3RYPA 3NV1A 1GFF2 4KWUA 3AP7A 1VMJA 2IXKA 1DYPA 3CJIC 2DBIA 4CPBD 5FZ0A 5LA1A 2ZHNA 2DCZA 4JRAA 4V2WA 1B35A 4A6OA 1ZBA3 3LEMA 3OD0A 3OYWB 4NE9A 3N7MA 3DV8A 3LE0A 2CY6A 1XE0A 4QU2A 2NM1A 4IV3A 1VBC1 3N35A 4YVSC 5I0UA 3T3YA 2B46X 1RUJ3 5CIRA 5FQ0A 3L2HA 2PHRA 4YM2A 4FPLA 5ABJB 5KHIA 2HH9A 3DPRA 3MLLA 4Q0PA 5C3OA 1DGRA 5D21A 1VP6A 1DU3D 2B39A 3NJVA 4FPYA 3KB5A 3VUOA 2KD7A 4R4XA 5IVBA 5ACA2 5J3UA 1JU3A 1W99A 2RDQA 4IEUA 4WZFA 2VCAA 5CG9A 4BYYA 3AKTA 3ZXLA 3BOWA 3TRSB 1NXMA 1UXXX 3MZHA 4FP3A 3Q8AA 4CU7A 1QU0A 1W0PA 1YIPA 4EE2A 3SH5A 5DDJ1 2ZTNA 1Y9MA 1QXJA 3PTYA 4R9CA 5F5IA 4OHYA 1ZX5A 2TEPA 4NRQA 1PZ8A 2YHJA 3WW4A 1RITA 3B5LB 5J96B 2YV8A 5IK7A 3J26N 2DVAA 2JE9A 4BDVB 2BFUL 3KF3A 4RFRB 3WP4A 1RMU3 5FPUA 1E5IA 5GZCA 1POV3 2Y6JA 1UZWA 4QD2A 3E5UA 1YJKA 5CA6A 2C6SA 3M3QA 4YLZA 5IJRA 5DZGA 4JCKA 3N7LA 2X5IC 3VDDB 3RYKA 5H9PA 3VBFA 2O8QA 3OBZA 4IXLA 1BVP1 1N1YA 4QGNA 4IV1A 1XOYA 1LULA 4P9YA 3VD9A 4LHSA 1OLME 4LIVA 4OUEA 1XC6A 3ZXKA 2JG9A 1A8DA 2VNGA 4HPKA 4YFZA 3MYXA 1LEDA 5FMOS 5FPVA 4AI9A 1GR3A 5JSRA 4OI4A 3T0BA 3NMBA 1X8MA 5EJ3A 4OHVA 1UOFA 1I5PA 3MBWA 5FZ9A 4CDQC 2XVGA 2JDHA 2QZ2A 2RS52 3MW3A 1WLWA 3OUHA 3BTAA 1O91A 2E7QA 4LBJA 5FKCA 1JHJA 1Y9GA 1O4TA 3I2IA 5FRAA 1OD3A 5CKQA 3TN93 3ZPOA 1VRBA 2VU9A 3IB3A 3KQ4B 4AI3A 2FQPA 1A6CA 5D1IA 1V00A 2AC1A 1C1LA 1W6MA 2YBSA 3NJYA 2XVKA 2ZCWA 5JIAA 2ZABA 5IVVA 3MEPA 2ZGSA 1MPXA 4YG0A 5IK4A 2A71A 5AC92 1HB1A 1QNWA 2WZPP 1EAH3 1OHFA 1TMF3 2BP6A 1GOHA 2VBDA 3CLPA 4IV3B 1GYKA 4Y4YA 5T5LA 5JAXA 4PLMA 1ZBE1 3KVBA 2E63A 3F2ZA 5A7QA 1DFQA 4AYUA 1GV9A 2NN8A 4YM3A 3DPRB 1HRV3 1AHSA 3RI9A 2HYKA 4AR2A 2D6OX 1F15A 4GWNA 1GZ9A 3AYCA 5J48A 4XDQA 4BB3A 3KT4A 5FDBA 5B4XA 5LEJA 2OYZA 2OPKA 1D4VB 2JDYA 2RDNA 1XYPA 3N3HA 3U07A 1JYNA 4KG8A 1NA1C 4E8DA 2RM21 3SLIA 3I59A 3U11A 5BNPB 1K5MA 4N90A 3GZUC 3WP3A 2SBAA 2EXIA 1DYKA 3D6EA 1YYNA 3LAGA 4WVMA 4FCAA 1Y3TA 1KQRA 1UMIA 5C6CA 1YJLA 5FZ7A 2V5DA 3GYDA 3MIBA 2YC4A 3THTA 4LO5B 3POBA 2BVBA 1QXPA 2WO7A 4PLOA 2YC0A 2GC1A 5T5OA 1W9FA 1C3HA 1JOJA 1F2NA 1QJY2 2WWSA 3EBRA 1H8VA 2R071 4LO7A 4W6YA 5GLTA 5A3WA 4RN5A 1JZ4A 2FDGA 3ZXAC 3TWIA 4R4ZA 1HKDA 1LODA 3O7OA 1FPN3 2MPFA 1OUXA 5J36A 3CDZB 2E7AA 1RUE1 1PGW2 5LBCA 2VUJA 1ACCA 4M3CA 5HI0A 1TNFA 3JQWA 1SZBA 4MH0E 1RUD2 1VBB2 2VVFA 1AX0A 2L9LA 3VBFB 2NP0A 2GNBA 3GNEA 4MSVA 4E8CA 4FBFA 5CKNA 2WS93 3DUIA 5F9TA 5HCBA 4LEJA 1COV1 4CDUC 1J3PA 2GZWA 1XE8A 2OQ6A 5C5UA 3K3OA 5EYYA 4RS5B 2XQRA 5C3PA 2R062 4JAAA 3SCGA 1HRI2 2JG9B 4F3JA 2Y0IA 2W9XA 2X29A 5FP7A 1OF3A 1FV3A 3BPZA 1DZRA 5FREA 2VR4A 3ZSJA 1YFWA 3TEWA 4IEWA 4AAXA 5I0DA 5GZEA 4ORFA 4DY3A 1W2UA 2RMU1 1C57A 2VMEA 2XLFA 4Z07A 3C7FA 3WUCA 4YARA 4LBQD 3D5OA 1ST8A 3ST7A 5IAVA 1KITA 1CR7A 3RMXA 3LB9A 1G9CA 5D2AA 3U14A 1I9RA 5A3UA 4EV0A 2W47A 3BU7A 4I09A 3VL9A 5FYBA 5GZFA 4DINB 3TOJA 4RHV1 2DVGA 2C4XA 2QUOA 1HX6A 3AZVA 4CEYC 4GAZA 1I1EA 1H1MA 2VNOA 3KZ4C 3L9JT 3ZMOA 5LZ6A 4CTEA 1CWPA 3USUA 3KT7A 5GALA 1LNSA 1MVQA 1S0EA 1QJX3 2D98A 1VPHA 2JG8C 5IUQA 3QBQA 1PHMA 3HOBA 5C4WA 3ZYHA 4D6QA 4C91A 5HPOA 3AMHA 3WDWA 5F8PA 1QMJA 3KWVA 3R4SA 1O7FA 2P1BA 4MGYE 3DYMA 2Y33A 4YZ4A 4YRDA 2I74A 2AACA 5IFTA 1T2XA 1ZNPA 4Z82A 4LJHA 4P08A 3M3IA 4QX2A 4CUAA 4TTGA 4LT5A 1UXZA 1IPSA 2QQNA 5FJHA 3IDAA 5FO8B 3RZJA 3I59B 3U4XA 1K5MB 4COYA 3NQHA 2EXJA 2KA3A 3P3PA 1VBC3 1WWYA 4ASKA 4OHWA 2OZ6A 3VKFC 4OULA 4QKNA 1LHWA 4DO0A 2Z42A 3ZMNA 1R64A 2JJ6A 3PUAA 5M0TA 4KH9A 5FZBA 4EN0A 2XG3A 4JKMA 3O1RA 3MF9A 3JCIA 4AFMA 4UFHA 5LRSA 4LKDA 4M00A 4DNYA 1JOPA 2QNKA 5JZGB 1ENSA 1TME3 2VY0A 3WF2A 5FZMA 1W0OA 4YM1A 1JUIA 3VHNA 5EWSA 2VMDA 1V6IA 4HVRA 3U1XA 5BY5A 3SISA 2YC2A 4LOSA 1YFYA 5FZOA 1NCQA 2FMYA 4KU8A 4RL7A 5IFPA 2R041 2JENA 2UURA 4JX0A 5DDJ3 4FFGA 4ARYA 1GQPA 5A3OA 2V5YA 3KVAA 1H9WA 3MICA 4H3WA 4I30A 3T2OA 4AVVA 5FFOC 2VE1A 4RQPA 4FTBA 5HXVA 1O5LA 4Q26A 2RV9A 3AP4A 2P3KA 1YFXA 4YVSA 1S4CA 1ZRDA 3IPVA 4FP2A 4AQTA 1DQ5A 2FZ1A 4EWEA 4HG6B 3K4AA 5ABJC 4ET7A 4QAWA 1WW4A 1YQ6A 4CP0A 2W1WA 2VMIA 3A21A 2UWBA 5DUXA 4LA2A 2HWB1 3ZLIA 4UF0B 2MHFA 2QQWA 3BGAA 2Z4FA 4HMZA 1D4M1 1RUNA 2PLV3 1PO21 2W95A 3CJXA 3T1LA 4GKXA 3VKMA 2KM2A 2ZAHA 1UWWA 1ENXA 5F7UA 4HXCA 4GH4B 4QX1A 4DUWA 4QX8A 4HSLA 1F9KA 2VMCA 3HT2A 3K51A 3I4IA 3PMEA 5C3QA 1LOGA 1JYIA 1RUF1 3A22A 5FZ8A 3C7GA 2WAOA 1SFPA 1Z7S3 2D3PA 5FMBA 3T30A 2XHKA 1LOCA 4BLIA 3PIGA 1VAVA 3RZGA 2XBO2 2CYFA 3WP5A 3BUCA 1EUUA 5C8WA 1EV11 1J1LA 4YW4A 3FL7A 2FD8A 5DUVA 3USUB 2FDJA 2JDNA 3BCWA 4IDZA 3KV5A 4LBLA 1W6PA 4UBHA 4B4PA 4MGKE 4DUVA 2XR4A 1OKOA 1QQP1 3AZZA 3C7HA 3VBSC 3BALA 5T5JA 3ACLA 2QQVA 3LSEA 5H9RA 3V56A 4QGMA 1WCQA 3VDDC 2MNGA 2R0HA 3T4VA 5C3RA 4E4DX 1JZ3A 2OW4A 3BN6A 2BFUS 2ZHKA 1BVVA 3GZTB 2XLAA 3FHQA 2PHXA 4XCBA 3AXEA 5AVAA 4Q1RA 1V6NA 2ES3A 4LA3A 3U0ZA 1HXS2 3H1YA 3FHAA 4LUMA 4XMIA 1LU1A 4BMEA 3U4SA 2VTXJ 4AEDB 3WDVA 2VCMA 1FOD2 1FYUA 3VD4A 4CDXB 3SNMA 2R7EB 1VJ2A 3T0DA 4XF1A 5D8AB 3ZXEA 4ASLA 2JDZA 4YW3A 3RWKX 1C5HA 3NV3A 3J7MA 2X10A 1DG6A 2WO1A 2J1EA 4UFIA 2O14A 2RM23 4XW3A 1FXZA 5IHRA 4PI2A 2W46A 5FZOB 1W9YA 2RE9A 1G6NA 3RYRA 2K0GA 3WNLA 1EP0A 5LY1A 2IXHA 1GQHA 5CG8A 4RQPB 1RUG2 2YMZA 3QOPA 4IV3C 1C8NA 4Y33A 1RVF3 2R073 2EIBA 3AVRA 1IPKA 1W8WA 2ARCA 4O9EA 3WQ0A 3DPRC 4RFT0 3ZN5A 2Q8CA 1MS9A 2VC9A 3MHZA 1BHGA 3AKQA 2TUNA 3WW1A 1DQ4A 5AFEA 3TEYA 4BE3A 3M8LA 5A33A 1GUIA 1K12A 1RUE3 4URTA 1NQDA 1X9TA 2XXZA 2QQPA 3RZKA 5FZKA 1YNAA 3AKSA 3KCCA 1DQ2A 3J4UH 4DS0A 2QQUA 4ES9A 4Q0UA 5KR7A 1NA1A 5HCFA 4NPLA 2VXJA 4GD4A 5BNOB 1AR62 2V09A 1GU3A 1R093 1VBA2 1F35A 1QEXA 4AI0A 1QDCA 1HN0A 3PUQA 5FMCA 4RSUA 3S5AA 2DTYA 1WA6X 3OD4A 2F17A 4CU9A 1ZM1A 1RHI3 4NOTA 3ZFFB 3H1WA 3HNYM 3IMMA 1U5ZA 4PIZA 4QKDA 2DUPA 4QM9A 4MHUA 3IIIA 1RUJ1 2AGSA 5ABJA 3AB0A 2IXJA 3P5BA 4AHYA 2GAUA 3DL3A 1G9BA 4ATFA 2ADDA 5FZGA 4UW4A 4L8QA 1AR82 5BXXA 4K40A 4QHOA 1LRHA 5TSWA 1H30A 1QXRA 4XILA 4KBBA 1CD3G 2ZGRA 1JBCA 4XQ4A 4PCRA 2QQIA 4RHV3 4NIIA 1H6YA 3SCFA 2XQXA 5BUVA 4COUA 2NPIA 1YC61 4HETA 2CWSA 2O0OA 3VBFC 1OLRA 2XJSA 1W3XA 5JIUA 3TEZA 3D4KA 2A3YA 3GJAA 1R1A1 1LOBA 4FQZA 3HNBM 4L97A 3VZJA 5A70A 2WZEA 1WUVA 1HB2A 4RS5C 1GICA 4TYSA 4YVWB 3GM8A 3B93A 3WLUA 3KSCA 2JG9C 3ZXGA 1CJDA 5L9BA 1IS6A 2TBVA 3LD8A 4FPHA 4OCTA 4PBPA 3RQ0A 4AE2A 3VV1A 3WY6A 1XSRA 3QACA 4A3ZA 1ZA7A 3O0VA 5A7WA 5A7SA 3PU8A 1AX1A 1VBE3 1H0BA 4CP9B 4NJ4A 1BZWA 1KEXA 1LOAA 1Q43A 4LKSA 4P9LA 2ZGPA 3VL8A 5CFCA 1FNZA 4NMIA 1RMU1 4K8RB 5FYVA 1PIV2 3WW2A 1F8VA 4ARXA 1S0GA 3M2MA 1F5JA 2GMEA 3WQ7A 4CEWB 4YSFA 4LLFA 3ZFEA 1O3QA 1UW8A 5E6HA 3RG0A 5A32A 2PAEA 1JZ8A 5E1RA 5CB7A 1SLTA 3OSDA 3P1IA 3AFGA 2FCUA 4GB31 4IGOA 4MOAA 2ENRA 3KHBA 2PAMA 3D3AA 5FY0A 2VZSA 3V0BA 4H2AA 1ONAA 2H6BA 2BBAA 1WW5A 1US3A 4W50A 5FP9A 5FZHA 1SEFA 2ZGMA 3JBG2 3LEKA 4KI5M 4E9KA 4AAPA 2JIJA 2CU5A 1KJLA 1VAMA 2JE8A 1R082 1XRUA 1H2NA 2VGDA 3O1OA 3T1MA 4BH9A 4QPGA 5K7PA 2VBPA 1REDA 2GMPA 5IVFA 2J1SA 1DGRN 3NVCA 4S2DA 4FFFA 4XUPA 1RXFA 4A41A 5BNQA 1K5JA 4K7JA 4NN0A 2R043 1SLCA 1XNKA 2DYCA 1AL22 3ZN4A 3MIFA 4Y22A 2RS31 4A7ZA 3LGRA 1K5MC 3MIDA 4M4RA 5DABA 2GDFA 1FT9A 1XQNA 1CZVA 2AEZA 2W0XA 1U5IA 4UFJA 2C24A 3VHRA 3WVJA 3ZOIA 4XBLA 3OY8B 4AFAA 4BIOA 4EZ4A 2QBXA 5LA2A 3V65A 5BNNB 1WMEA 2IFWA 2DFCA 5FZ6A 3TB0A 1ASJ3 1EAH1 3IDEA 3WG4A 4B1MA 3J8F1 2HWB3 5I8YA 2WLPA 1ULOA 1WZXA 1PX4A 5L7OB 1D4M3 4XQDA 1CONA 3HQRA 3OUIA 2WABA 1HRV1 5JZGC 3CL1A 3UKTA 5IYYA 2BJSA 1FMD2 4FPJA 3HJRA 1BEV3 2NMNA 1NKGA 4HN0A 4CCOA 4P9WA 2X05A 2ZHLA 3T0AA 4YZ2A 2ZACA 5GZGA 3OYWA 3H0OA 1REEA 4OUSA 5E8AA 3ZYJB 1GNHA 3IDCB 4NPRA 1UAIA 3OGSA 4DFSA 3KLSA 4NROA 4QU1A 5F32A 4XEZA 1I5ZA 3M1HA 2BGOA 4HVOA 3G6JB 3ACHA 4IL7A 4W6WA 3S7IA 3LKJA 4QPIB 1SLIA 2XUMA 3BODA 5JSOA 1VMFA 4CU8A 3EHKA 2R16A 2A70A 2ZGLA 3LSDA 2VQUA 2JXAA 3K77A 2Y6FA 5A7WB 2VMHA 2JIGA 5FAXA 4KWLA 3WHUA 3WG3A 4E2GA 1OI6A 1YFUA 5CNAA 1BBT2 1VBD3 1W8HA 2ZOEB 2MEV3 4B8EA 1FPN1 3PDQA 1OD5A 2XMLA 1AR92 4GH4C 2GNDA 2HEYF 3A0KA 3NKGA 2A7AA 4YG6A 5FK7A 3WQBA 2ZHMA 4XYXA 2J1VA 3K48A 1MR5A 2WZR3 4MUVA 3HN3A 3WDUA 3ZYPA 4AHWA 5C33A 2HWC1 1AYM2 2E31A 2WS91 4XJZA 4BU2A 3DYOA 3NV4A 1JYXA 1GP4A 3KF5A 1V6MA 1HQNA 4UFMA 4XOGA 5JSPA 1SMVA 5A1LA 1PK6B 2A75A 4NR1A 3ACIA 1Y7BA 3BIWE 1Y43B 4XETA 5C4WC 4ZKTB 1JZ5A 4Y26A 5JUVA 1NYWA 1V9U2 4XF4A 2W92A 2DTWA 4Y5Z0 4E27A 4QPGB 4XTMA 3H7JA 2WFPA 5FPBA 4LBMA 1UY1A 3UV9A 4PQQA 2W52A 3VBHA 2BVVA 2D43A 3MO4A 4B3NA 2Y0OA 1UPIA 3ZYBA 3WNOA 4H7LA 4ZS2A 1RYYA 3DECA 3RZHA 1LB2A 3PNAA 4FVVA 4AVAA 1GWLA 5LRRA 2VZUA 3NKTA 3RRDA 5A6YA 5LASA 4Q4V2 3B00A 4AEDC 3AKRA 4D7SA 2WYFA 1YO8A 4DRRA 5FZEA 1LEMA 4XHBA 4CDWA 5GZDA 4URAA 4CDXC 4D3WA 1N3PA 4MGZE 2FMDA 4I0WB 1ZZBA 4HVQA 1Q8VA 1UZYA 5D8AC 3MDPA 1QJX1 2BERA 4ES8A 1QJZA 1MS0A 3UGGA 3AK0A 5ACA3 2N7GA 4UFKA 5L19A 2HWD2 4MLOA 4S2HA 4H55A 1VRH2 5DAXA 4N8MA 1GZCA 1NCQC 3NJXA 1AYN2 1KS4A 3R0RA 4QX3A 4TWTA 2ZMKA 3POWA 5LB6A 3DXTA 2WNVB 3VZOA 2A3WA 3ABZA 1UL9A 4RQPC 3IM0A 4DMIA 4EN6B 1O5UA 3P3NA 4Q0SA 4HOOA 4YPJA 2PA7A 4Q4X1 4DZGA 3VLBB 1GNZA 4ISRA 3C7EA 4OYUA 4FOYA 1Q8SA 2ZXQA 3WX5A 3GHMA 1J3QA 1MEC2 3KM5A 5FZDA 2CGOA 1ZVFA 2DU0A 4K1ZA 2VBBA 4LK6A 1VAKA 2YDEA 2BNOA 2Q8DA 1TME1 5J37A 1S2KA 5BNPA 1PX3A 1UU5A 4ZU5A 1R1A3 3K46A 1W3VA 3UGHA 1UOBA 4EWAA 1I6XA 2XH6A 1QY4A 5GKAC 4C8DA 3POJA 1JN2P 2PMWB 5CEHA 1J1TA 3Q8EA 3GGLA 1UIJA 5F39A 2OXBA 1QH6A 3K4ZA 3WDYA 1PVC2 4RD7A 4AVSA 3WF3A 2D6PA 2BBVA 4QXBA 1UKRA 4S2FA 3ZSMA 1O59A 4CCNA 4AOCA 1G8WA 3CMGA 3DYPA 1PMIA 3VKLA 4MO3M 3MW2A 2VZRA 4XXAA 2PHTA 1UIKA 3PVOA 3ZIWA 1RUI1 3H1MA 1ZYBA 4EYUA 1ZBA2 5LCWL 2D7FA 3O1UA 2HKXA 3VB9A 2FCTA 2PLV1 4GB33 3VBHB 5I0SA 4AFBA 4HSJA 1OFNA 3LDRA 1RUJ2 5LA0A 5ANNA 1LOFC 3HT1A 2VJXA 2BWAA 4GALA 2ZPXA 1XYNA 4O65A 3OBTA 2EVXA 4WM7B 4XE9A 3LQCA 4RS5A 2ZJCA 3RMYA 5DZFA 1LTEA 3O14A 3PIJA 5AC93 1V0AA 1CIWA 1Z7S1 3ZXJA 4FXKB 4KNCA 4NAOA 4XAAA 3O1SA 2DUQA 1CN1A 4F7ZA 1AJKA 1ALYA 1ULEA 4MZUA 4CDWB 4YW1A 4Q4W1 1BMV2 1DBNA 2RG4A 1Q56A 4IQPA 5A80A 2VZ1A 3JB8A 2JB4A 3WZ1A 3FUOA 4BQ4A 4XJ9A 2ZGKA 3I3DA 4CEWC 1EPWA 1YQ5A 2RS33 5C71A 4DIQA 4Q8LA 4Q8KA 1PNGA 3PLQA 3E6CC 2HWF2 4HK9A 2GMMA 4HLTA 1G9FA 3GHNA 1U0AA 3ZVXA 3WP6A 1T6BX 2JDPA 3AP9A 4NRPA 3DEMA 1YEWA 3HNMA 1NXD1 1ZZ6A 2Q4SA 3CO2A 5FIXA 1GMMA 1RTVA 1FAYA 2YY1A 3E1F1 3J8F3 4OUMA 2LS6A 4QKBA 1W2OA 2XKOA 5FLJA 1HB3A 4DXTA 2DF7A 1OUSA 4W65A 4Z92B 1TE1B 5DUWA 3FLPA 2DCKA 4N7UA 1RUC1 2D97A 5C3SA 1QJY3 5KXEA 3NJZA 1NY71 1W8TA 5JCTA 1NZIA 1UY4A 4KG0A 4YWAA 1WD3A 4YGDA 1S0BA 1JYCA 4E2SA 5C5TA 1DQ1A 2VAUA 4I3GA 3THPA 5L36A 1LOEA 1ULPA 3ZXFA 4AGGA 4COWA 5HBAA 1DZTA 2AH2A 1UKGA 1CPNA 1SG3A 2C1FA 2XJRA 1HB4A 3AKPA 3KCXA 1QOSA 1VBB3 3NNMA 4XIOA 5E16A 2LALA 3JXSA 3ALQA 5FBZA 4AG4A 5FK8A 5HCAA 4WBBA 5GLUA 3EXUA 3O1VA 5BYNA 3AX4A 1PM7A 3POYA 2WWUA 2GC2A 2WSVA 1CJPA 1NAEA 5CBLA 4Q2FA 2R6QA 2Q1MA 2RR11 3ZFGB 1MS8A 2GP3A 3HBKA 2HBUA 5FR3A 2YPJA 5IVCA 2CGPA 1GKBA 3TN92 1QOTA 1RVF1 2X8KA 1PGL1 3N9QA 4N43B 4XJUA 1S0DA 3R4UA 1XNDA 1TZOA 4XPVA 5A7PA 5JZGA 5JOZA 4MGSA 3WEZA 3FUQA 2WFF2 3KT1A 2C9KA 2WR9A 4MXWA 1YI7A 4DY5A 3H9AA 1OOPA 1H8TB 2W3JA 5C9AB 2DVDA 1ENQA 2ERFA 3AXDA 4OI0A 3CBNA 3PTRB 1J84A 4P14A 1F31A 1EAH2 1TMF2 1W8NA 2P2KA 3MUZ1 3RZZA 4YM0A 1KRIA 5LEKA 4LBOA 2Q8EA 3ZKYA 2HWC3 2TNFA 1R091 1XE7A 4NUBA 4OI1A 4AFDA 1LJ7A 4E4HA 1XJAA 5A6XA 2EIDA 3TNQA 4FOVA 1VB2A 2LW8A 3ECQA 3O0XA 5LWBA 3C2UA 2CNAA 2Z69A 3GBFA 2VZPA 2PHWA 3M3EA 3OGRA 5EJ1B 4EJRA 1RHI1 5DG2A 5C7GA 2RDRA 1SFYA 3UJOA 3H8RA 2OVUA 4UF0A 1APNA 5HXMA 5IVEA 2AZ5A 2JEMA 2O8OA 3VDBA 3KGZA 1VE0A 1BQPA 4B29A 5CFCC 4IGQA 1W28A 1AR71 1BK1A 5A7OA 4COZA 5K8SA 5FXXA 4XDOA 4ZHNA 2XKPA 2Q1FA 2HEVF 3EO6A 3C7OA 4GH4A 5EXOA 5F5QA 4NIHA 4HBNA 3D8CA 3H3UA 3JD71 3ZFEC 5J09A 4XHXA 4CUBA 3FLRA 1MS4A 3ZX7A 3VBUA 3VZLA 3ZN6A 3U75A 1V6OA 2O1QA 3OF1A 3UNPA 1IG0A 2JD4A 3PVEA 4O7XA 3I54A 3RJRA 4DEQA 1SACA 3SH3A 2BV4A 1OF4A 4J1XA 1IKQA 2ILMA 5FUIA 2H0VA 5LA9A 3LOBA 1OKQA 2I2SA 3PUIA 1DQ0A 1OVPA 2F4PA 3R05A 4G4FA 1K45A 4QPGC 4ZXEA 4A7KA 4JTOA 1VBE1 4IEZA 1C28A 3OEBA 4C0BA 3HN1A 5CKMA 3KGLA 2WT0A 1WMDA 3HVDA 3LF7A 1W06A 3T08A 4ATEA 5FOBB 1BKZA 1QJU2 3LIHA 4I01A 1DYOA 4YW2A 1NUKA 4RR3A 4XXPA 2HWE1 3JB4C 1ULDA 1JI6A 3N9MA 3HPNA 2CDPA 3ZO0B 3GDBA 3WT3A 3ZYGA 4D69A 1Q8OA 2BEOA 3WOGA 3NWKA 5FPZA 1GWMA 3K3NA 1OA3A 1ODMA 4Q4X3 4AEDA 2R32A 1O3TA 5G05L 4JGZB 5T55A 4UAPA 2EXHA 2D6NA 1FI2A 2W91A 3TYJA 3LA2A 2WJSA 4CDXA 1W04A 4OMDA 1US2A 2QTWB 4PBOA 1UN1A 2A6WA 2ZKNA 4LQRA 2VG9A 1A78A 5FP8A 1YXWA 3JZVA 4Q29A 5D8AA 4BIFA 2RDSA 2A6ZA 4MGTA 3S30A 1SBDA 2W08A 2K46A 4O61A 3UYJA 5FXZA 3I8TA 3CNAA 1WD4A 2ARXA 3MI8A 2R30A 4MXWB 4MG2A 1OOPB 1ZRCA 2UY9A 4GWIA 4A6SA 1JU4A 1JYTA 5EP9A 2VULA 1GLHA 5JOYA 2QDNA 4MGQA 5CADA 2LM3A 1XU2A 4SLIA 4PF1A 1BLZA 4NHMA 3VHPA 2ZAAA 2ZMLA 4J25A 4N9IA 1RC6A 4XUOA 4OZXA 2YFUA 3WNMA 4CA9A 2PHUA 1IS3A 2UWCA 3EJKA 3PU3A 4CCLA 5FYMA 4M3CE 1NQJA 4QB1A 3UT0A 2W2IA 3EMRA 1IGOA 1PNFA 4L99A 3ZR5A 1ASJ1 2YU2A 5GLWA 4UW6A 5CAZA 4CUCA 1BK0A 4PF5A 3ZR6A 4NHLA 1RUI3 1YHFA 1OA4A 2WQ8A 5EQUA 4GULA 2RS13 4LHKA 2VZQA 4BCUA 1ND2B 4BLJA 3OPWA 3EQEA 3MPBA 1VBC2 1H2KA 2YPDA 5J98B 2NMOA 5BNOA 1IS5A 3TNPB 1BEV1 1HW5A 1NCRA 1Y4WA 2WNUA 3POSA 1G9AA 1UYZA 4K1YA 5FZCA 4FTEA 4QXKA 1LAJA 4A44A 2YGLA 2VUDA 3VBUB 2ZZQA 5LK7B 1SQ4A 2BNNA 2VVEA 3ZFFA 3ZN6B 2PFWA 1HXS3 1AZDA 2VECA 4EROA 3HWJA 1C8M1 4BQ5A 1RUH1 4XAEA 2R49A 1TME2 2VVDA 4Q4W3 1Q8PA 1HJGA 4XFGA 2ET1A 4K21A 1JXNA 4BJ0A 2BWCA 3NAPA 3POGA 1WLTA 4J6GA 4Y4RA 2ARAA 4Q4Y1 5FZFA 5DMYA 1KXGA 2ADEA 4ZY9A 4QQHA 2G4IA 3POEA 5DDJ2 3SH4A 4GQ7A 3ZYRA 1C5IA 1QNYA 2QDRA 3I97A 3B01A 5DAVA 1UYPA 4ZPIA 2FCVA 2P3IA 1VBD1 1UX7A 3CF6E 3VBHC 3SEPA 2MEV1 2B7YA 1MS1A 2XB6C 4RR3B 1LOFA 1DLCA 3CHXA 2E26A 1PO11 1G9DA 4WM7C 2J1RA 3FFZA 5DQ0A 3O5SA 4YFWA 4C90A 4YVWA 3WINE 1EPZA 4AHXA 1ND3B 3VHOA 1XYOA 5FLIA 5I93A 1NLQA 1RUG3 2WZR1 1FNYA 4QX5A 4WZCA 1RUC3 2XDVA 1Z0HA 3AJYA 1EUTA 1D7PM 1H2LA 3Q9OA 4A2UA 3AYAA 1DGWX 5CISA 4CDWC 4H14A 1TG7A 4CP9A 1AF9A 1YQCA 2RHPA 4HT1T 1C1FA 3SXWA 4GWMA 4FI9A 3VBOB 4QB6A 4IGPA 1YUDA 1VR3A 1UCXA 4B7EA 1CGPA 5IW0A 4JHTA 2D6MA 4CEWA 2CWMA 2AREA 3HR9A 2J22A 1X82A 3WG1A 1JYVA 5HCHA 1ZZCA 3PMSA 3HAGA 4EWDA 1DQ6A 2AUYA 3IIAA 5FBJA 1AR63 4E4ZA 1VBA3 4QPWA 5DAPA 2EIGA 5A3LA 2CSGA 1AXYA 1H9PA 4TZDA 4K20A 2OKXA 2D93A 2WO2A 4Y20A 4B4QA 1YRZA 2PTMA 2RR13 3U10A 5K0UA 4ITCA 3MIHA 5FO7B 3O12A 3NSTA 4KMQA 3KV6A 5FPAA 4DRVA 5G04L 1OXCA 1WCKA 3FC0A 1V6LA 3SCHA 1DHKB 4XVHA 1JHNA 2ZGTA 3M3CA 3HQUA 3FN9A 1OBNA 3I2DA 2NLRA 3IN9A 4YZ3A 3CJIB 1IQDC 1CVNA 5FMDA 2QE3A 3ROUA 2GU9A 4QQPA 3O1PA 2BPA2 2XVLA 1SCRA 1RIRA 2AR6A 4A3XA 2Y6GA 5ACA1 5BNPC 2CAUA 1ZBE2 4EZHA 3VGIA 2BGCA 1QGLA 1NCRB 3IWZA 3OY8A 3R4DB 4LKFA 2WNUB 1ZREA 5KXDA 3B7MA 5FV3A 3VKOA 3HIFA 4E2QA 5BNNA 2BTVC 1YQ8A 3WCSA 3OOXA 4PT6A 5FOJB 4NIDA 1GNYA 4P5YA 3NRUA 1IG3A 3TAYA 2E9QA 4CP1A 2A5ZA 5L7OA 2RM22 3UKNA 4ZZ8A 1UOJA 3NAPB 2BGPA 1AR73 3D0SA 3NL1A 5FY4A 5A3MA 2ORZA 5JR7B 2D40A 1I3HA 2VCCA 3WG2A 1N1VA 2R1DA 1WCDJ 1H8TC 1SLLA 1VMHA 1W2NA 2GP5A 2W5FA 2VOTA 3JD73 3PJYA 4OFGA 4XUTA 3B9IA 2QQKA 3DGTA 5FY7A 4Z1VA 2CGNA 1UZVA 4Z8BA 2VQ0A 3B69A 4Q1PA 2R072 2VUAA 2ZMNA 3KS7A 3PL0A 4BM8A 3WSOA 2JECA 4UW3A 2ET7A 4QPIA 4XURA 4Y1YA 1RUE2 2Y60A 3KMHA 3C3VA 3JBG3 1OH4A 2XOMA 4ZONA 4COVA 4INDA 1KFUL 4AEMA 1W6QA 4NWWA 4AI2A 1COV2 2X5IB 4I0BA 3DF0A 1HJFA 3BKZA 4IEOA 3OG2A 2HWE3 5L73A 3VBRA 1AX2A 1RINA 3LDKA 2PQSA 1WKYA 1MS3A 1F4AA 2JDAA 4B7KA 4R9BA 5A3PA 1OA2A 4L11A 1RHI2 1AL23 2B9UA 2C0ZA 3GZAA 1UU6A 4GZ9A 1ZZ7A 2VO5A 5F2WA 1H4HA 1GANA 3DCQA 3FBMA 4P9JA 4AGRA 4CSWA 1D2SA 5C70A 4CCEA 2IXCA 1ULGA 2RMU2 1LCLA 4Y20B 4AVBA 5BV6A 2ATFA 4IE4A 2ZEZA 3PUHA 2VH9A 3WUDA 5K0UB 5K9YA 3I2OA 1PK6A 4QQLA 4F83A 1JOBA 2CL2A 5AC91 4JRLA 3OGJA 3U78A 4NIAA 4G9SB 4LBQB 4GKYA 2J7MA 4RHV2 3JU9A 2ZA9A 4FPFA 4Z2WA 3I3MA 4IEXA 2G9ZA 3SEEA 2VOVA 2A1XA 2XWJB 3N7KA 2P3YA 1FMD3 2VOXA 4Q0VA 4X6RB 2Y6LA 5FZAA 3B02A 2C9AA 1UY2A 4AQ6A 4CZSA 4XCAA 4AK3A 3FJSA 2XGXA 4XFHA 2YU1A 4CUGA 2VZOA 3TBDA 3GALA 1VBE2 3F95A 3IAPA 2DVFA 5JMOA 4JGZC 1GOFA 1O4YA 1XBFA 1ZRRA 5GLZA 3SC7X 5DUUA 3J7NA 1X36A 2BYVE 1FV2A 5LATA 1XNAA 2R1BA 4QDRA 3QCWA 1JMUB 4CRQA 3HQXA 2HJIA 3UETA 2QFEA 1QJY1 1K3IA 1OQDA 3K2OA 5CU1A 3S57A 1IZ3A 3MLJA 1STMA 1OOPC 4UFLA 4XMAA 2B45X 4OQ8A 1REFA 5H9SA 1XU1A 1A34A 1AR93 1S55A 1QHDA 2OQ7A 1PGW1 3A0NA 2WNVA 3VKNA 2JDKA 4AVCA 3USSA 5HV4A 3P6BA 1QDOA 4YGEA 1RUD1 1VBB1 1C8M3 4LMFA 4P02B 1RUH3 4U2AA 1RB8G 3MIGA 3UJQA 2Q5TA 4XFFA 1AYM3 1S1AA 2W1UA 3W9AA 2YG0A 4J1WA 4XZUG 1NE4A 4LNVA 3AFKA 3LA3A 1VIWB 1IOAA 2DCYA 4XBQA 2R061 4Q4Y3 1HRI1 1AJOA 2R042 2C5DA 3VZMA 1UOGA 4PQ9A 3KQRA 1BCXA 4PDWB 2XJPA 1W6QB 2EXKA 1CIYA 3UKVA 2I45A 2ZEXA 4ASMB 3HD8B 4X6QB 3HBZA 4GMP3 4JDNA 3VBRB 2D3SA 1PO13 5EFUA 5GLVA 4YZ1A 3Q8CA 4HFSA 5FKBA 4A45A 5SV5A 4XJ8A 3GZEA 4UXAA 4UYBA 3BI3A 1HV1A 2YBKA 2Z2SB 1MS5A 3QH6A 4U36A 2BOJA 3VBUC 2GH8A 2IFRA 2HWB2 3AMQA 3WNPA 4L9BA 1KDMA 1D4M2 1WBLA 1Y9QA 1X9PA 4N53B 1PO22 4NWVA 4Q4V3 2WL1A 4Y24A 4LK7A 1KD7A 4CXYA 1WGPA 2XLGA 3I2FA 2Q30A 4AFCA 1QJEA 4RA0A 1NOVA 3QH7A 5E88A 4AI8A 5JXJA 2JDUA 2IZWA 1RUF2 4BHPA 5F3GA 4CCCA 3H3LA 3O1TA 4FO9A 3GCXA 3LDBA 2VXRA 4M01A 2V4VA 5DAQA 4FAGA 2ZX3A 2P6HA 3BPSA 1O3RA 1HV0A 2OA2A 1NG0A 2HWD3 3ETQA 4IW3A 5I0TA 1EV12 3THDA 3FLTA 5KWRA 1VRH3 4RR3C 3CZJA 3DKQA 4TLGA 3MGUA 5LBEA 4WM7A 3T4HB 4CE8A 2UU8A 4UWDA 4OHZA 1GBGA 1QQP2 4FPKA 1U12A 2JICA 2W39A 2FDIA 2GN7A 2JG8B 1NLRA 3W59A 4AW7A 4JKLA 3MV11 4IUGA 1LESA 4BQ3A 1N3OA 1OSGA 3AZWA 1OLMA 1VLNA 5C8CB 2MEV2 4Y5SA 1EY2A 1G7YA 4QX0A 4R9AA 5EZWA 3AMPA 4OVEA 5FYSA 2XWBB 2W87A 3LCPA 1MEC3 4QDQA 5FZ4A 2Y6HA 3INAA 4KQ7A 2VD7A 3OPZA 5IATA 2FDHA 2ARBA 3V0AB 4P9IA 4A42A 1TNRA 3L2YA 2DDUA 1J3RA 1LENA 2Z5WA 1DF0A 1GP5A 2BDRA 2WRAA 1DCSA 3H50A 2FBEA 3ZPYA 3JQXA 4TN7A 1M06G 2EF6A 4YYOA 4EQVA 2HYXA 1LR5A 3VD5A 4CYDA 4JVAA 1H2MA 5FY5A 4FAHA 4Y1VA 4K6BA 4M0HA 2J1UA 2WT2A 1PVC3 3GBGA 1GOGA 3AL5A 4QWNA 4BK4A 3ILFA 1S0CA 1W6NB 1LHOA 2YB7A 2P4EA 5I8SA 1WLCA 3LEIA 5KHKA 3K4DA 2EA7A 2JDMA 4DXSA 2WIIB 2AENA 5B4NA 3RJ2X 1N1SA 2CV6A 4NHYA 1ODNA 3IAQA 1Q5OA 3I2GA 3URFA 5BNOC 2G9GA 3AP5A 3OTFA 1SBEA 4XJWA 2FDKA 4BQ2A 4FTSA 1G86A 1NCRC 2WNUC 3LIGA 1SPPA 1W39A 1W8FA 4G3YC 5FCCA 3RGBA 3S7EA 4JHZA 5IK8A 4GA9A 2VUCA 2J1AA 1J83A 4QGLA 3ZFFC 1HQWA 1O6UA 1GZWB 4RGKA 3ZFGA 4K9SA 2WYSA 4N9HA 4QQ2A 2X53S 4BXFA 4YW5A 1NZCA 3E5XA 3FMGA 3PVBB 3H8OA 2XBO1 4N43A 2DURA 1LECA 3NAPC 4ZU7A 5JDBA 2YUEA 1W8ZA 3OBAA 2WAAA 4I3PA 2WBKA 2GC3A 5FZLA 5FYCA 3NO8A 4PHZA 3VZNA 4AF9A 2RS53 2NYYA 1CQ9A 4EN9B 5C9AA 1XNCA 2E32A 1H8TA 2I07B 4MYEA 4NO4A 1HLCA 2WNEA 2RS11 4Z2AA 3MFAA 5CFDA 4Y5TA 2VOWA 3ACFA 1LGNA 4QKFA 3A4UA 3OPTA 4LBKA 2HWF3 3S6PA 2KXLA 4OHXA 3K75B 1DDLA 5FPXA 3CIHA 4YNIA 1QIQA 2GSYA 1P8JA 3AMMA 3SQOA 4YVWC 3FZ3A 2GN3A 4IERA 1PMJX 5L9RA 1XB9A 2ID4A 5EIYB 1IKPA 4JQRA 4V2VA 2XUEA 3WDXA 4P9XA 4Y1XA 3W5MA 1J58A 1JUHA 1W03A 3RVHA 3CKHA 3T09A 3ME2A 3W58A 1HXS1 1KFXL 1LHVA 3J7HA 5E89A 2D44A 3VBSB 3BU0A 1YQ2A 4BXSV 4LORA 2VZTA 2XL7A 1UYYA 3ZSEA 2E33A 4JDMA 1KJRA 1R1A2 1FOD1 1B09A 1N1TA 1WW7A 2B8MA 2EALA 2WNOA 5EV7A 2HLEA 3H8XA 3PVNA 4TXWA 2G1MA 2WC2A 2Y34A 1M4WA 1CAWB 2BOIA 2D3RA 3ES4A 2FHRA 2V4AA 2IXIA 2QVSB 2RVAA 2W1QA 2WUHA 4I0AA 4LHLA 1QF3A 1UO9A 2BNMA 2VQTA 1GWKA 3LPGA 5DPNA 3H42B 3AYDA 3I2JA 4XF3A 1RMU2 1RL3A 1WMFA 1WBFA 3ZYIB 4HZFA 4BA6A 5K0UC 5F1RA 3AZXA 4IE5A 3MFCA 2ZX1A 1SFNA 1RUG1 5FJKA 1PM4A 5A6QA 2IWGB 2QKDA 4GB32 2PHDA 2V73A 4X8NA 2XPJA 3QD6A 2WKKA 1POQA 1UZ0A 2WFF3 2LROA 3KHCA 1MZ6A 3PUSA 4HKOA 1B35B 3ZYFA 1WCSA 4JGYA 4IEQA 4RYDA 5CZKA 1RUD3 4JDOA 3B3QE 1S2EA 1YCIA 1JYWA 2DBNA 1Z78A 5DG1A 4DB5A 1AR61 2DUOA 4QHZA 5FYTA 5FQ0B 1SPPB 1VBA1 3WNNA 3IBMA 4AZZA 5BNNC 1EYBA 1CESA 1JS9A 4JGZA 1IQAA 2R063 3VN4A 1HRI3 2Q8OA 1KDKA 1TQ5A 4KGGA 4JKKA 4H7MA 4LULA 4YG3A 4CVUA 1WLDA 5L7OC 2RS32 4ZU4A 5FYZA 3AVSA 5FP4A 4Q0QA 3OJBA 2ZGUA 4FPGA 2NZ9A 1OPOA 3LEGA 4QX7A 1O4ZA 3M4FA 2P17A 4BISA 1MACA 1MQTA 1AR81 1QWRA 3WDTA 2P37A 4META 1ZZ9A 5CFDB 3IT8A 1AXZA 1QJFA 4BQXA 3ENRA 2Y64A 3J8F2 1CAVA 2J1TA 1TVGA 5SV8A 4GIQA 1H4GA 1YWKA 1ZZ8A 3BTXA 2DFBA 2UYBA 4D7TA 1HRV2 4OQ9A 3WR0A 4BPZA 3OUJA 4NHKA 4KWKA 3MIEA 4IE6A 5IAXA 4QPIC 3WV6A 4M4PA 1FATA 2ZX0A 4WM8A 1OH3A 4LLOA 2ZEWA 1QH7A 3IDBB 4HKWA 4UOJA 3WF1A 2B5HA 2VW0A 2WN3A 4PDWC 3W20A 3N9OA 1ND2A 1PZ7A 4CPBA 2VOKA 3B94A 2Y26A 2UWAA 3GXUA 3N36A 2P34A 4KL1A 4PJYA 1UD1A 3I3QA 3VBRC 4XFAA 3GJBA 1PIV1 4HKLA 4IV1B 4JQTA 1QJU3 3MF6A 3WXPA 1CZSA 3X29B 1JH5A 3ATGA 2LTNA 1NLSA 4HANA 4HPKB 4LITA 4LKEA 3N7JA 4I02A 4YGCA 4DXZA 4EN7B 3IMNA 2BZDA 2VTFA 4IE0A 2EIEA 4QDSA 1ENRA 4N53C 3FE5A 4GXLA 4XUNA 1FPN2 4XQWA 1PK6C 3E5QA 4Y3OA 3WW3A 4DUXA 5JI9A 2DWRA 1MZ5A 4B1LA 3AM2A 2UYAA 3RWNA 4NIGA 4PIXA 3JBG1 3KV9A 2ETEA 1JTZX 1OURA 4F8AA 4Y1UA 1XSQA 4YW6A 5DAWA 5IK5A 1R081 2RJKA 2WDBA 1VALA 5I8TA 1PGSA 2XHNA 2HBTA 1NX9A 2HWC2 1W6MB 2WS92 3CEWA 1RJ8A 4LTAA 2DVBA 5CYYA 3WCRA 1GQGA 3ACGA 2VL4A 5KC6A 4JGYB 4W4ZA 1OMIA 2Y8KA 2ZX4A 1AL21 3N9LA 3PHMA 1ND3A 1CAUA 4IEYA 1HQLA 2VQAA 3FFQA 1PZ9A 3LA7A 1AL0G 3CZUA 3MUY1 5FWEA 3ASIA 4AQ2A 5JPNB 1J59A 5C8CC 1SHWB 3GF6A 2JKBA 2W68A 3VBOA 4CXWA 1CPMA 4L0PA 2G9FA 1F4HA 1UY3A 1W9TA 2W94A 1KGYA 5F6LB 1UX6A 2XJTA 4QQOA 1OQEA 3FBYA 2WLQA 3J9SA 3PURA 1S0FA 4D6RA 4P5HA 4RGAA 4I2OA 1HDKA 4K3UA 2DCJA 2D5FA 5T5PA 3RFRA 2BU9A 2WA4A 2VNRA 1MQTB 4FOWA 3WQ1A 1FMD1 4WVMB 4LPLA 5JPMB 3W21A 3I2HA 5ISLA 2WINB 3VDCA 2BRTA 2WNVC 1CAVB 3R6SA 1OLQA 4AQSA 4D6SA 3LZZA 3NV2A 1JW6A 1QJX2 2WA3A 1LGCA 3N9NA 4LBNA 4MX3A 4R8HA 3UL2A 4CU6A 1IPJA 5EPAA 5FPLA 1W9SA 2QQOA 2XBO3 2VMFA 3SKJE 1O8SA 1UU4A 3FX3A 2VMGA 4WM8B 4XTPA 3E97A 4MHRA 2PN5A 2JD9A 4OI2A 5FUNA 1O3SA 2YFZA 2FZ2A 3VDAA 1PMHX 2B4KA 4M3CB 3CJIA 5JMCA 4R52A 4XC9A 1OPMA 5FLHA 1LHNA 3E6DA 2GH2A 2WWJA 2XJQA 2YGMA 3I3BA 4JC1A 3THCA 2ZGOA 4KU7A 1BBT1 4Q4X2 2YROA 4XFCA 2GC0A 4HL0A 4FXGB 4DEVA 2GNMA 2XJVA 4QHBA 2OUJA 4FOQA 1GSLA 2OS2A 3LOIA 1AR91 2OIIA 1V70A 3O1MA 3E6BA 3BIEA 3HMYA 1WA4A 3ORJA 2VZ3A 2P5BA 4CXXA 1ZRFA 3VD7A 2OX0A 3N9PA 2IUWA 3H3ZA 3BOPA 1D0GA 2PXJA 1AYM1 4GJZA 3ZDVA 1W05A 1QKQA 2B9VA 2WZ8A 1FOD3 5FXWA 4BQYA 2ZGNA 1RXGA 2OUHA 1GZTA 1S0IA 3S0MA 3APBA 2VTXA 4X8PA 3N4MA 2ORXA 3BB6A 5JWPA 1V9U1 4D8MA 5IWFA 5JVVA 1U5XA 2A6XA 4CP2A 5J1XA 2G19A 3OB8A 4HN1A 5GM0A 4GMP1 2VM9A 4RGGA 3DKWA 3RS6A 1SDDB 4AGVA 5LBFA 1A8MA 3GBWA 3H7YA 3LFMA 1JZ6A 3D0JA 1D2QA 2CHHA 1UMHA 1CAXA 1H1AA 2SLIA 1LHUA 2JKXA 3NNLA 3O0WA 2C26A 4GWJA 4O9GA 2NQYA 4YZ5A 3M70A 1Q8QA 1CAUB 2E7TA 2K9ZA 3A7QA 5C4WB 4PLNA 1RUI2 1TEIA 2RS12 5ERLA 3UK9A 2PLV2 5KHHA 4Q4V1 5AFBA 5IT6A 5F6KA 1L7QA 2OZJA 5FYYA 3H8UA 3W5NA 4FPOB 2X5IA 4Q27A 5FUPA 4IE7A 4L92A 3UGFA 3C8XA 2A73B 2QQJA 2IVJA 1GP6A 4XABA 1T6GC 3EYPA 4GJYA 2PHFA 1Z7S2 4BOWA 3LFIA 4DXRA 3WNXA 4LO8A 5F3IA 1PVXA 1V6KA 4XF0A 3SKVA 4Y1ZA 4D7YA 1OC1A 2HWD1 1L7RA 1ZBE3 2OT7A 2XONA 4QPYA 5FO9B 1MZFA 4M0NA 5F5CA 1VRH1 2JX9A 4Q4W2 5T52A 1Q3EA 3HEIA 4PIYA 1AYN1 4MV2A 2PELA 3JUUA 1WCUA 1SLBA 4FT8A 4UW5A 4CDQA 2RJLA 4LIUA 1E5RA 4P9GA 3NNFA 1QOOA 2ZBJA 3M7AA 1SDWA 3ELNA 4LBQA 4R9DA 4XBNA 4WVZA 2P6CA 4JZRA 4FPEA 4OZOA 5CVRA 1DZQA 1IHMA 5LBBA 3VD3A 5KHJA 4YGBA 3BTZA 4CCDA 1AR83 5FXVA 1DGLA 1NCQB 2UY8A 3Q8FA 2WQ4A 3Q8BA 4AHZA 1OFSA 3MW4A 5LW9A 4LR4A 5EHDA 2WQZC 1WMXA 1B35C 5FTTC 1MEC1 1XXNA 4XF9A 4MGIE 2D6KA 4FPCA 5FP3A 1RUC2 4YVSB 1LGBA 1W9WA 2QQMA 3IPVB 4LHNA 4HK8A 3VZKA 1NY72 3WHTA 1W8OA 1S0JA 2R0FA 5A6ZA 3BVCA 5EJZB 3MLKA 1E57A 1K42A 1BYHA 5DN2A 4WVVA 5DZEA 2E51A 4LOTA 1UYXA 3TEXA 1H6XA 3ZFGC 1VB4A 2AYHA 2XL9A 1XPWA 3ILRA 3ZDSA 1BXHA 1RUOA 3AL6A 3ETPA 2EAKA 3POFA 1PVC1 4N43C 4PI0A 1W90A 4NHXA 3NNJA 5I0RA 2Z79A 1W6OA 2XJUA 4EN8B 3OEAA 2PYTA 5BPXA 1COV3 1PIV3 5C9AC 2ZGQA 4UT5A 2B42B 1ULFA 4OLLA 1W2TA 2VPVA 3T2PA 3WD5A 5CFDC 1IS4A 2RR12 2D5HA 3M3OA 2ZZJA 1ZBA1 1RVF2 1PGL2 1CX4A 1AVBA 2Q1ZB 3CU7A 5IVYA 1O8PA 2Y38A 1CAXB 4LE4A 2RMU3 4ONUA 5AVPA 5JOWA 5FWJA 1CX1A 1W8UA 3AJZA 1W6PB 2H0BA 1L3JA 3DN7A 2GNTA 3MPPG 3POIA 1N47A 1X8EA 1OT5A 3WF4A 5FZ1A 5ANQA 3AYEA 1XNTA 1R083 2WT1A 5DXDA 5FMOL 5H9QA 4IEPA 2A6YA 4LO6B 4PDWA 4C1XA 1SCSA 1R1ZA 1HIXA 1R092 2YXSA 3A23A 5F5AA 3T2QA 4M3CF 1BJQA 1DLLA 1JZ7A 1BMV1 3ZM8A 4FFHA 1URXA 2RS51 4CDUA 2V72A 4IV1C 5T3NA 4GMP0 1W2AX 3KCYA 3D82A 4JTNA 4OMCA 1MVEA 2CAVA 2J42A 1L7LA 3KD4A 1HN1A 4NPMA 2OPWA 2HWF1 3I3EA 5L9VA 4BMBA 3OGGA 2BUKA 4N53A 2X09A 3RZLA 1AR72 4AXOA 2PAKA 3PJQA 2Q0AA 4CDQB 5I91A 4NRMA 3FHIB 4QB2A 1POV1 1UY0A 5F37A 1AXKA 5KHGA 2D6LX 3JD72 4C0HA 5F3CA 4QMAA 3NNGA 5T50A 5JLVA 4C1WA 2BQPA 4BK5A 5KC5A 4TSVA 3AP6A 1LU2A 4CEYA 2K2SA 4A4AA 4DOUA 1KS5A 1OQ1A 4A7YA 4JGYC 3SHRA 5A1FA 1DIWA 3CQOA 5FY8A
chains in the Genus database with same CATH topology
2YPDA 4CCMA 5LWBA 5A7WA 5A7SA 3PU8A 5ISLA 4LXLA 5FY9A 5FY4A 4EYUA 3ZPOA 5FYHA 5FXVA 1VRBA 5FYVA 5FZCA 4D6SA 5FYZA 3AVSA 5FP4A 3N9NA 4BU2A 5IVEA 4UF0A 5LW9A 4D6QA 2GP5A 5FPLA 5A1LA 2YBSA 3NJYA 4IGQA 4QX7A 5FY7A 5IVVA 5A7OA 5FP3A 5FXXA 5A7NA 4XDOA 3U4SA 5E6HA 4BISA 4IGOA 5FPBA 4QXCA 4Y4RA 5FY0A 5FUNA 5A3TA 4BXFA 4CCJA 4QXHA 5FJHA 5FZFA 3KVBA 5A7QA 5FP9A 5FZHA 3AL6A 4ASKA 2WWJA 5FZLA 5FYCA 2YBKA 5LY2A 4AAPA 5A80A 5FZ0A 4DO0A 4V2WA 5FYUA 2OS2A 5F3EA 5FZOB 3PUAA 4HONA 4DIQA 5IVFA 3DXUA 3OPTA 2P5BA 5FZBA 5LY1A 3N9OA 5FZEA 2OX0A 3N9PA 2YBPA 4URAA 5A3PA 2PXJA 2XDVA 4Y33A 5F2WA 4GJZA 5FZMA 4V2VA 3AVRA 5F3GA 2XUEA 4CSWA 5IVYA 3LDBA 5FZ7A 5FXWA 3RVHA 2Q8CA 4CCKA 5IVBA 5FZOA 4IGPA 5FWJA 4EZ4A 3N9MA 4LITA 4XDPA 3KVAA 5IW0A 5FZ6A 2XXZA 3K3NA 5A3WA 5FZKA 5IWFA 5FZ1A 5ANQA 3U78A 5KR7A 3DXTA 4Y3OA 5FBJA 4GD4A 5FY1A 5F5AA 5F5IA 5FP8A 3KV9A 4HOOA 3PUQA 5FZIA 5FYIA 3ZLIA 4CCNA 4UF0B 5A3NA 5FZAA 3KV4A 3UYJA 5FXZA 4CCOA 5F2SA 5FPUA 3KV6A 5FYSA 2OQ6A 5FPAA 3K3OA 5FYYA 2WWUA 2YU1A 5FZDA 5FZ4A 5K4LA 4CUGA 4QX8A 5FZGA 2VD7A 2GP3A 5FJKA 5FP7A 5FUPA 2Q8DA 5IVCA 3N9LA 2OQ7A 4QU1A 5F32A 3N9QA 5IVJA 5FZ8A 4GJYA 5A7PA 5F37A 4TN7A 5F3IA 5F3CA 4C8DA 3PU3A 2OT7A 5FWEA 5FYMA 5A7WB 4CCLA 4EZHA 5CEHA 5F5CA 2W2IA 5FY5A 3K2OA 3PUSA 2YU2A 4LIVA 5F39A 4QWNA 5FV3A 3AL5A 3PTRB 3KV5A 3PURA 5FPVA 5FYBA 4AI9A 4D6RA 4LIUA 3PDQA 2Q8EA 5FYTA 2XMLA 4NUBA 4QXBA 5FZ3A 5A1FA 3LD8A 5FY8A 4E4HA 3OPWA 4GAZA 5FZ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YPD A;  4CCM A;  5LWB A;  5A7W A;  5A7S A;  3PU8 A;  5ISL A;  4LXL A;  5FY9 A;  5FY4 A;  4EYU A;  3ZPO A;  5FYH A;  5FXV A;  1VRB A;  5FYV A;  5FZC A;  4D6S A;  5FYZ A;  3AVS A;  5FP4 A;  3N9N A;  4BU2 A;  5IVE A;  4UF0 A;  5LW9 A;  4D6Q A;  2GP5 A;  5FPL A;  5A1L A;  2YBS A;  3NJY A;  4IGQ A;  4QX7 A;  5FY7 A;  5IVV A;  5A7O A;  5FP3 A;  5FXX A;  5A7N A;  4XDO A;  3U4S A;  5E6H A;  4BIS A;  4IGO A;  5FPB A;  4QXC A;  4Y4R A;  5FY0 A;  5FUN A;  5A3T A;  4BXF A;  4CCJ A;  4QXH A;  5FJH A;  5FZF A;  3KVB A;  5A7Q A;  5FP9 A;  5FZH A;  3AL6 A;  4ASK A;  2WWJ A;  5FZL A;  5FYC A;  2YBK A;  5LY2 A;  4AAP A;  5A80 A;  5FZ0 A;  4DO0 A;  4V2W A;  5FYU A;  2OS2 A;  5F3E A;  5FZO B;  3PUA A;  4HON A;  4DIQ A;  5IVF A;  3DXU A;  3OPT A;  2P5B A;  5FZB A;  5LY1 A;  3N9O A;  5FZE A;  2OX0 A;  3N9P A;  2YBP A;  4URA A;  5A3P A;  2PXJ A;  2XDV A;  4Y33 A;  5F2W A;  4GJZ A;  5FZM A;  4V2V A;  3AVR A;  5F3G A;  2XUE A;  4CSW A;  5IVY A;  3LDB A;  5FZ7 A;  5FXW A;  3RVH A;  2Q8C A;  4CCK A;  5IVB A;  5FZO A;  4IGP A;  5FWJ A;  4EZ4 A;  3N9M A;  4LIT A;  4XDP A;  3KVA A;  5IW0 A;  5FZ6 A;  2XXZ A;  3K3N A;  5A3W A;  5FZK A;  5IWF A;  5FZ1 A;  5ANQ A;  3U78 A;  5KR7 A;  3DXT A;  4Y3O A;  5FBJ A;  4GD4 A;  5FY1 A;  5F5A A;  5F5I A;  5FP8 A;  3KV9 A;  4HOO A;  3PUQ A;  5FZI A;  5FYI A;  3ZLI A;  4CCN A;  4UF0 B;  5A3N A;  5FZA A;  3KV4 A;  3UYJ A;  5FXZ A;  4CCO A;  5F2S A;  5FPU A;  3KV6 A;  5FYS A;  2OQ6 A;  5FPA A;  3K3O A;  5FYY A;  2WWU A;  2YU1 A;  5FZD A;  5FZ4 A;  5K4L A;  4CUG A;  4QX8 A;  5FZG A;  2VD7 A;  2GP3 A;  5FJK A;  5FP7 A;  5FUP A;  2Q8D A;  5IVC A;  3N9L A;  2OQ7 A;  4QU1 A;  5F32 A;  3N9Q A;  5IVJ A;  5FZ8 A;  4GJY A;  5A7P A;  5F37 A;  4TN7 A;  5F3I A;  5F3C A;  4C8D A;  3PU3 A;  2OT7 A;  5FWE A;  5FYM A;  5A7W B;  4CCL A;  4EZH A;  5CEH A;  5F5C A;  2W2I A;  5FY5 A;  3K2O A;  3PUS A;  2YU2 A;  4LIV A;  5F39 A;  4QWN A;  5FV3 A;  3AL5 A;  3PTR B;  3KV5 A;  3PUR A;  5FPV A;  5FYB A;  4AI9 A;  4D6R A;  4LIU A;  3PDQ A;  2Q8E A;  5FYT A;  2XML A;  4NUB A;  4QXB A;  5FZ3 A;  5A1F A;  3LD8 A;  5FY8 A;  4E4H A;  3OPW A;  4GAZ A;  5FZ9 A; 
#chains in the Genus database with same CATH topology
 1FX5 A;  3LPF A;  3EB7 A;  1YIF A;  4CCM A;  4DQA A;  4QT6 A;  2GAL A;  4BQW A;  2RJ2 A;  2JG8 A;  2ZEY A;  4LO4 B;  2ZS6 B;  5FYH A;  4QM8 A;  3ILN A;  1C4R A;  2WO3 A;  4XAC A;  2VNV A;  2P3J A;  5A33 B;  5C8C A;  2IC1 A;  2VCB A;  4Q5O A;  5JR2 A;  1AUY A;  2HWE 2;  2EIC A;  3S5Q A;  2Y6K A;  4FFI A;  4ZS3 A;  4ISQ A;  4XFB A;  1NA1 B;  1X50 A;  1N3Q A;  3TN9 1;  4YW7 A;  1W0N A;  3U37 A;  1UNB A;  1W6O B;  1NE6 A;  1BBT 3;  2DCT A;  5LK5 A;  4AVT A;  3V0A A;  1MQT C;  3QLQ A;  4QXH A;  5KBF A;  2WFF 1;  5JOX A;  3WNK A;  2BW8 A;  3NW4 A;  1ULC A;  2LRP A;  5LY2 A;  3SMH A;  3ZSL A;  1UZZ A;  1TMF 1;  4KBZ A;  5FYU A;  5F3E A;  4NVP A;  1D0H A;  2PQQ A;  3ES1 A;  4HON A;  5JXI A;  1PO2 3;  2IXL A;  1DP0 A;  1W6N A;  2W1S A;  3DXU A;  4XFI A;  1UMZ A;  1A3K A;  2IVI B;  3RPQ A;  4FQ4 A;  3ZXD A;  2ZKL A;  4WM8 C;  2E53 A;  3UES A;  1DGW A;  4MAD A;  2JB8 A;  2HEW F;  2YBP A;  5EYX A;  1WW6 A;  2F4L A;  5GJ6 A;  1RJ7 A;  4P00 B;  1H1I A;  1V9U 3;  2WN2 A;  3BYW A;  1YLL A;  1RUF 3;  4L2N A;  4UBG A;  2YZ4 A;  1ND2 C;  3I2K A;  4D0Q A;  2QCS B;  2F6B A;  4CCK A;  1ZRI A;  4KWJ A;  3IZO A;  4XJA A;  3AC0 A;  4FSJ A;  4CDU B;  1EV1 3;  5KXC A;  3B9C A;  4XDP A;  3T2T A;  2JWP A;  1ASJ 2;  3AZY A;  3ITQ A;  3SIT A;  3ZKU A;  3J7L A;  1V6J A;  2QZ3 A;  2A6V A;  4LUK A;  4XIK A;  5FY1 A;  1GZW A;  3RSJ A;  1QQP 3;  4MXV A;  1CZT A;  1RGS A;  1OVS A;  2AEY A;  3OCP A;  4AWD A;  5B2G B;  2DU1 A;  4IEV A;  4AL9 A;  5CFC B;  4W6X A;  5FZI A;  4XUQ A;  1BEV 2;  4LE3 A;  5FYI A;  4ZZ5 A;  2LUW A;  5A3N A;  3KV4 A;  2FDF A;  5F2S A;  5JXG A;  1X7N A;  4IET A;  1S2B A;  2CDO A;  3LWC A;  3MV0 1;  3ZFE B;  2A3X A;  5A32 B;  3WF0 A;  5K4L A;  3AMN A;  3ZSK A;  1C8M 2;  3OGV A;  4W8J A;  1RUH 2;  4D94 A;  4CEY B;  3V0B B;  4S2G A;  2QQL A;  4TLF A;  1UF2 C;  1X33 A;  2WSU A;  5IVJ A;  5KXB A;  1UQX A;  1AYN 3;  1QJU 1;  2H6C A;  2VW1 A;  3GCW A;  2VW2 A;  4UI9 L;  4XZP A;  1ZA4 A;  5T54 A;  4Q4Y 2;  1NT0 A;  1ND3 C;  1YI9 A;  3RNS A;  4DPN A;  3G7D A;  4E4S A;  1SBF A;  1POV 0;  1SLA A;  4IES A;  3VBS A;  1VBD 2;  3OBR A;  4V1P A;  5JXH A;  3FWE A;  2CTV A;  4AEK A;  3VBO C;  1LKN A;  5FZ3 A;  2PHL A;  1PO1 2;  3RI8 A;  4WV8 A;  3VDD A;  4AI1 A;  4B4R A;  3RZM A;  4KGQ A;  1E5S A;  4WVW A;  4ZXK A;  3BTY A;  4Y22 B;  1MZE A;  3ON7 A;  4N7I A;  4AEJ A;  1JZ2 A;  1CAW A;  4LXL A;  5FY9 A;  5HV0 A;  2WZR 2;  5JI7 A;  3IKW A;  4BQ1 A;  3ZIX A;  1E5H A;  4JV4 A;  5J7M A;  3I49 A;  4MVT A;  1F5F A;  3I7D A;  2JE7 A;  2EAA A;  2VZV A;  4NAM A;  2KR2 A;  3V64 A;  4BZ4 A;  4SBV A;  1JOD A;  5APA A;  2DV9 A;  5A7N A;  2QJV A;  2E6V A;  5A1A A;  1UPS A;  4QXC A;  1XNB A;  2ZX2 A;  5A3T A;  3RDI A;  4CCJ A;  4BWO A;  1U5Y A;  2YYO A;  4K8F A;  3RYP A;  3NV1 A;  1GFF 2;  4KWU A;  3AP7 A;  1VMJ A;  2IXK A;  1DYP A;  3CJI C;  2DBI A;  4CPB D;  5FZ0 A;  5LA1 A;  2ZHN A;  2DCZ A;  4JRA A;  4V2W A;  1B35 A;  4A6O A;  1ZBA 3;  3LEM A;  3OD0 A;  3OYW B;  4NE9 A;  3N7M A;  3DV8 A;  3LE0 A;  2CY6 A;  1XE0 A;  4QU2 A;  2NM1 A;  4IV3 A;  1VBC 1;  3N35 A;  4YVS C;  5I0U A;  3T3Y A;  2B46 X;  1RUJ 3;  5CIR A;  5FQ0 A;  3L2H A;  2PHR A;  4YM2 A;  4FPL A;  5ABJ B;  5KHI A;  2HH9 A;  3DPR A;  3MLL A;  4Q0P A;  5C3O A;  1DGR A;  5D21 A;  1VP6 A;  1DU3 D;  2B39 A;  3NJV A;  4FPY A;  3KB5 A;  3VUO A;  2KD7 A;  4R4X A;  5IVB A;  5ACA 2;  5J3U A;  1JU3 A;  1W99 A;  2RDQ A;  4IEU A;  4WZF A;  2VCA A;  5CG9 A;  4BYY A;  3AKT A;  3ZXL A;  3BOW A;  3TRS B;  1NXM A;  1UXX X;  3MZH A;  4FP3 A;  3Q8A A;  4CU7 A;  1QU0 A;  1W0P A;  1YIP A;  4EE2 A;  3SH5 A;  5DDJ 1;  2ZTN A;  1Y9M A;  1QXJ A;  3PTY A;  4R9C A;  5F5I A;  4OHY A;  1ZX5 A;  2TEP A;  4NRQ A;  1PZ8 A;  2YHJ A;  3WW4 A;  1RIT A;  3B5L B;  5J96 B;  2YV8 A;  5IK7 A;  3J26 N;  2DVA A;  2JE9 A;  4BDV B;  2BFU L;  3KF3 A;  4RFR B;  3WP4 A;  1RMU 3;  5FPU A;  1E5I A;  5GZC A;  1POV 3;  2Y6J A;  1UZW A;  4QD2 A;  3E5U A;  1YJK A;  5CA6 A;  2C6S A;  3M3Q A;  4YLZ A;  5IJR A;  5DZG A;  4JCK A;  3N7L A;  2X5I C;  3VDD B;  3RYK A;  5H9P A;  3VBF A;  2O8Q A;  3OBZ A;  4IXL A;  1BVP 1;  1N1Y A;  4QGN A;  4IV1 A;  1XOY A;  1LUL A;  4P9Y A;  3VD9 A;  4LHS A;  1OLM E;  4LIV A;  4OUE A;  1XC6 A;  3ZXK A;  2JG9 A;  1A8D A;  2VNG A;  4HPK A;  4YFZ A;  3MYX A;  1LED A;  5FMO S;  5FPV A;  4AI9 A;  1GR3 A;  5JSR A;  4OI4 A;  3T0B A;  3NMB A;  1X8M A;  5EJ3 A;  4OHV A;  1UOF A;  1I5P A;  3MBW A;  5FZ9 A;  4CDQ C;  2XVG A;  2JDH A;  2QZ2 A;  2RS5 2;  3MW3 A;  1WLW A;  3OUH A;  3BTA A;  1O91 A;  2E7Q A;  4LBJ A;  5FKC A;  1JHJ A;  1Y9G A;  1O4T A;  3I2I A;  5FRA A;  1OD3 A;  5CKQ A;  3TN9 3;  3ZPO A;  1VRB A;  2VU9 A;  3IB3 A;  3KQ4 B;  4AI3 A;  2FQP A;  1A6C A;  5D1I A;  1V00 A;  2AC1 A;  1C1L A;  1W6M A;  2YBS A;  3NJY A;  2XVK A;  2ZCW A;  5JIA A;  2ZAB A;  5IVV A;  3MEP A;  2ZGS A;  1MPX A;  4YG0 A;  5IK4 A;  2A71 A;  5AC9 2;  1HB1 A;  1QNW A;  2WZP P;  1EAH 3;  1OHF A;  1TMF 3;  2BP6 A;  1GOH A;  2VBD A;  3CLP A;  4IV3 B;  1GYK A;  4Y4Y A;  5T5L A;  5JAX A;  4PLM A;  1ZBE 1;  3KVB A;  2E63 A;  3F2Z A;  5A7Q A;  1DFQ A;  4AYU A;  1GV9 A;  2NN8 A;  4YM3 A;  3DPR B;  1HRV 3;  1AHS A;  3RI9 A;  2HYK A;  4AR2 A;  2D6O X;  1F15 A;  4GWN A;  1GZ9 A;  3AYC A;  5J48 A;  4XDQ A;  4BB3 A;  3KT4 A;  5FDB A;  5B4X A;  5LEJ A;  2OYZ A;  2OPK A;  1D4V B;  2JDY A;  2RDN A;  1XYP A;  3N3H A;  3U07 A;  1JYN A;  4KG8 A;  1NA1 C;  4E8D A;  2RM2 1;  3SLI A;  3I59 A;  3U11 A;  5BNP B;  1K5M A;  4N90 A;  3GZU C;  3WP3 A;  2SBA A;  2EXI A;  1DYK A;  3D6E A;  1YYN A;  3LAG A;  4WVM A;  4FCA A;  1Y3T A;  1KQR A;  1UMI A;  5C6C A;  1YJL A;  5FZ7 A;  2V5D A;  3GYD A;  3MIB A;  2YC4 A;  3THT A;  4LO5 B;  3POB A;  2BVB A;  1QXP A;  2WO7 A;  4PLO A;  2YC0 A;  2GC1 A;  5T5O A;  1W9F A;  1C3H A;  1JOJ A;  1F2N A;  1QJY 2;  2WWS A;  3EBR A;  1H8V A;  2R07 1;  4LO7 A;  4W6Y A;  5GLT A;  5A3W A;  4RN5 A;  1JZ4 A;  2FDG A;  3ZXA C;  3TWI A;  4R4Z A;  1HKD A;  1LOD A;  3O7O A;  1FPN 3;  2MPF A;  1OUX A;  5J36 A;  3CDZ B;  2E7A A;  1RUE 1;  1PGW 2;  5LBC A;  2VUJ A;  1ACC A;  4M3C A;  5HI0 A;  1TNF A;  3JQW A;  1SZB A;  4MH0 E;  1RUD 2;  1VBB 2;  2VVF A;  1AX0 A;  2L9L A;  3VBF B;  2NP0 A;  2GNB A;  3GNE A;  4MSV A;  4E8C A;  4FBF A;  5CKN A;  2WS9 3;  3DUI A;  5F9T A;  5HCB A;  4LEJ A;  1COV 1;  4CDU C;  1J3P A;  2GZW A;  1XE8 A;  2OQ6 A;  5C5U A;  3K3O A;  5EYY A;  4RS5 B;  2XQR A;  5C3P A;  2R06 2;  4JAA A;  3SCG A;  1HRI 2;  2JG9 B;  4F3J A;  2Y0I A;  2W9X A;  2X29 A;  5FP7 A;  1OF3 A;  1FV3 A;  3BPZ A;  1DZR A;  5FRE A;  2VR4 A;  3ZSJ A;  1YFW A;  3TEW A;  4IEW A;  4AAX A;  5I0D A;  5GZE A;  4ORF A;  4DY3 A;  1W2U A;  2RMU 1;  1C57 A;  2VME A;  2XLF A;  4Z07 A;  3C7F A;  3WUC A;  4YAR A;  4LBQ D;  3D5O A;  1ST8 A;  3ST7 A;  5IAV A;  1KIT A;  1CR7 A;  3RMX A;  3LB9 A;  1G9C A;  5D2A A;  3U14 A;  1I9R A;  5A3U A;  4EV0 A;  2W47 A;  3BU7 A;  4I09 A;  3VL9 A;  5FYB A;  5GZF A;  4DIN B;  3TOJ A;  4RHV 1;  2DVG A;  2C4X A;  2QUO A;  1HX6 A;  3AZV A;  4CEY C;  4GAZ A;  1I1E A;  1H1M A;  2VNO A;  3KZ4 C;  3L9J T;  3ZMO A;  5LZ6 A;  4CTE A;  1CWP A;  3USU A;  3KT7 A;  5GAL A;  1LNS A;  1MVQ A;  1S0E A;  1QJX 3;  2D98 A;  1VPH A;  2JG8 C;  5IUQ A;  3QBQ A;  1PHM A;  3HOB A;  5C4W A;  3ZYH A;  4D6Q A;  4C91 A;  5HPO A;  3AMH A;  3WDW A;  5F8P A;  1QMJ A;  3KWV A;  3R4S A;  1O7F A;  2P1B A;  4MGY E;  3DYM A;  2Y33 A;  4YZ4 A;  4YRD A;  2I74 A;  2AAC A;  5IFT A;  1T2X A;  1ZNP A;  4Z82 A;  4LJH A;  4P08 A;  3M3I A;  4QX2 A;  4CUA A;  4TTG A;  4LT5 A;  1UXZ A;  1IPS A;  2QQN A;  5FJH A;  3IDA A;  5FO8 B;  3RZJ A;  3I59 B;  3U4X A;  1K5M B;  4COY A;  3NQH A;  2EXJ A;  2KA3 A;  3P3P A;  1VBC 3;  1WWY A;  4ASK A;  4OHW A;  2OZ6 A;  3VKF C;  4OUL A;  4QKN A;  1LHW A;  4DO0 A;  2Z42 A;  3ZMN A;  1R64 A;  2JJ6 A;  3PUA A;  5M0T A;  4KH9 A;  5FZB A;  4EN0 A;  2XG3 A;  4JKM A;  3O1R A;  3MF9 A;  3JCI A;  4AFM A;  4UFH A;  5LRS A;  4LKD A;  4M00 A;  4DNY A;  1JOP A;  2QNK A;  5JZG B;  1ENS A;  1TME 3;  2VY0 A;  3WF2 A;  5FZM A;  1W0O A;  4YM1 A;  1JUI A;  3VHN A;  5EWS A;  2VMD A;  1V6I A;  4HVR A;  3U1X A;  5BY5 A;  3SIS A;  2YC2 A;  4LOS A;  1YFY A;  5FZO A;  1NCQ A;  2FMY A;  4KU8 A;  4RL7 A;  5IFP A;  2R04 1;  2JEN A;  2UUR A;  4JX0 A;  5DDJ 3;  4FFG A;  4ARY A;  1GQP A;  5A3O A;  2V5Y A;  3KVA A;  1H9W A;  3MIC A;  4H3W A;  4I30 A;  3T2O A;  4AVV A;  5FFO C;  2VE1 A;  4RQP A;  4FTB A;  5HXV A;  1O5L A;  4Q26 A;  2RV9 A;  3AP4 A;  2P3K A;  1YFX A;  4YVS A;  1S4C A;  1ZRD A;  3IPV A;  4FP2 A;  4AQT A;  1DQ5 A;  2FZ1 A;  4EWE A;  4HG6 B;  3K4A A;  5ABJ C;  4ET7 A;  4QAW A;  1WW4 A;  1YQ6 A;  4CP0 A;  2W1W A;  2VMI A;  3A21 A;  2UWB A;  5DUX A;  4LA2 A;  2HWB 1;  3ZLI A;  4UF0 B;  2MHF A;  2QQW A;  3BGA A;  2Z4F A;  4HMZ A;  1D4M 1;  1RUN A;  2PLV 3;  1PO2 1;  2W95 A;  3CJX A;  3T1L A;  4GKX A;  3VKM A;  2KM2 A;  2ZAH A;  1UWW A;  1ENX A;  5F7U A;  4HXC A;  4GH4 B;  4QX1 A;  4DUW A;  4QX8 A;  4HSL A;  1F9K A;  2VMC A;  3HT2 A;  3K51 A;  3I4I A;  3PME A;  5C3Q A;  1LOG A;  1JYI A;  1RUF 1;  3A22 A;  5FZ8 A;  3C7G A;  2WAO A;  1SFP A;  1Z7S 3;  2D3P A;  5FMB A;  3T30 A;  2XHK A;  1LOC A;  4BLI A;  3PIG A;  1VAV A;  3RZG A;  2XBO 2;  2CYF A;  3WP5 A;  3BUC A;  1EUU A;  5C8W A;  1EV1 1;  1J1L A;  4YW4 A;  3FL7 A;  2FD8 A;  5DUV A;  3USU B;  2FDJ A;  2JDN A;  3BCW A;  4IDZ A;  3KV5 A;  4LBL A;  1W6P A;  4UBH A;  4B4P A;  4MGK E;  4DUV A;  2XR4 A;  1OKO A;  1QQP 1;  3AZZ A;  3C7H A;  3VBS C;  3BAL A;  5T5J A;  3ACL A;  2QQV A;  3LSE A;  5H9R A;  3V56 A;  4QGM A;  1WCQ A;  3VDD C;  2MNG A;  2R0H A;  3T4V A;  5C3R A;  4E4D X;  1JZ3 A;  2OW4 A;  3BN6 A;  2BFU S;  2ZHK A;  1BVV A;  3GZT B;  2XLA A;  3FHQ A;  2PHX A;  4XCB A;  3AXE A;  5AVA A;  4Q1R A;  1V6N A;  2ES3 A;  4LA3 A;  3U0Z A;  1HXS 2;  3H1Y A;  3FHA A;  4LUM A;  4XMI A;  1LU1 A;  4BME A;  3U4S A;  2VTX J;  4AED B;  3WDV A;  2VCM A;  1FOD 2;  1FYU A;  3VD4 A;  4CDX B;  3SNM A;  2R7E B;  1VJ2 A;  3T0D A;  4XF1 A;  5D8A B;  3ZXE A;  4ASL A;  2JDZ A;  4YW3 A;  3RWK X;  1C5H A;  3NV3 A;  3J7M A;  2X10 A;  1DG6 A;  2WO1 A;  2J1E A;  4UFI A;  2O14 A;  2RM2 3;  4XW3 A;  1FXZ A;  5IHR A;  4PI2 A;  2W46 A;  5FZO B;  1W9Y A;  2RE9 A;  1G6N A;  3RYR A;  2K0G A;  3WNL A;  1EP0 A;  5LY1 A;  2IXH A;  1GQH A;  5CG8 A;  4RQP B;  1RUG 2;  2YMZ A;  3QOP A;  4IV3 C;  1C8N A;  4Y33 A;  1RVF 3;  2R07 3;  2EIB A;  3AVR A;  1IPK A;  1W8W A;  2ARC A;  4O9E A;  3WQ0 A;  3DPR C;  4RFT 0;  3ZN5 A;  2Q8C A;  1MS9 A;  2VC9 A;  3MHZ A;  1BHG A;  3AKQ A;  2TUN A;  3WW1 A;  1DQ4 A;  5AFE A;  3TEY A;  4BE3 A;  3M8L A;  5A33 A;  1GUI A;  1K12 A;  1RUE 3;  4URT A;  1NQD A;  1X9T A;  2XXZ A;  2QQP A;  3RZK A;  5FZK A;  1YNA A;  3AKS A;  3KCC A;  1DQ2 A;  3J4U H;  4DS0 A;  2QQU A;  4ES9 A;  4Q0U A;  5KR7 A;  1NA1 A;  5HCF A;  4NPL A;  2VXJ A;  4GD4 A;  5BNO B;  1AR6 2;  2V09 A;  1GU3 A;  1R09 3;  1VBA 2;  1F35 A;  1QEX A;  4AI0 A;  1QDC A;  1HN0 A;  3PUQ A;  5FMC A;  4RSU A;  3S5A A;  2DTY A;  1WA6 X;  3OD4 A;  2F17 A;  4CU9 A;  1ZM1 A;  1RHI 3;  4NOT A;  3ZFF B;  3H1W A;  3HNY M;  3IMM A;  1U5Z A;  4PIZ A;  4QKD A;  2DUP A;  4QM9 A;  4MHU A;  3III A;  1RUJ 1;  2AGS A;  5ABJ A;  3AB0 A;  2IXJ A;  3P5B A;  4AHY A;  2GAU A;  3DL3 A;  1G9B A;  4ATF A;  2ADD A;  5FZG A;  4UW4 A;  4L8Q A;  1AR8 2;  5BXX A;  4K40 A;  4QHO A;  1LRH A;  5TSW A;  1H30 A;  1QXR A;  4XIL A;  4KBB A;  1CD3 G;  2ZGR A;  1JBC A;  4XQ4 A;  4PCR A;  2QQI A;  4RHV 3;  4NII A;  1H6Y A;  3SCF A;  2XQX A;  5BUV A;  4COU A;  2NPI A;  1YC6 1;  4HET A;  2CWS A;  2O0O A;  3VBF C;  1OLR A;  2XJS A;  1W3X A;  5JIU A;  3TEZ A;  3D4K A;  2A3Y A;  3GJA A;  1R1A 1;  1LOB A;  4FQZ A;  3HNB M;  4L97 A;  3VZJ A;  5A70 A;  2WZE A;  1WUV A;  1HB2 A;  4RS5 C;  1GIC A;  4TYS A;  4YVW B;  3GM8 A;  3B93 A;  3WLU A;  3KSC A;  2JG9 C;  3ZXG A;  1CJD A;  5L9B A;  1IS6 A;  2TBV A;  3LD8 A;  4FPH A;  4OCT A;  4PBP A;  3RQ0 A;  4AE2 A;  3VV1 A;  3WY6 A;  1XSR A;  3QAC A;  4A3Z A;  1ZA7 A;  3O0V A;  5A7W A;  5A7S A;  3PU8 A;  1AX1 A;  1VBE 3;  1H0B A;  4CP9 B;  4NJ4 A;  1BZW A;  1KEX A;  1LOA A;  1Q43 A;  4LKS A;  4P9L A;  2ZGP A;  3VL8 A;  5CFC A;  1FNZ A;  4NMI A;  1RMU 1;  4K8R B;  5FYV A;  1PIV 2;  3WW2 A;  1F8V A;  4ARX A;  1S0G A;  3M2M A;  1F5J A;  2GME A;  3WQ7 A;  4CEW B;  4YSF A;  4LLF A;  3ZFE A;  1O3Q A;  1UW8 A;  5E6H A;  3RG0 A;  5A32 A;  2PAE A;  1JZ8 A;  5E1R A;  5CB7 A;  1SLT A;  3OSD A;  3P1I A;  3AFG A;  2FCU A;  4GB3 1;  4IGO A;  4MOA A;  2ENR A;  3KHB A;  2PAM A;  3D3A A;  5FY0 A;  2VZS A;  3V0B A;  4H2A A;  1ONA A;  2H6B A;  2BBA A;  1WW5 A;  1US3 A;  4W50 A;  5FP9 A;  5FZH A;  1SEF A;  2ZGM A;  3JBG 2;  3LEK A;  4KI5 M;  4E9K A;  4AAP A;  2JIJ A;  2CU5 A;  1KJL A;  1VAM A;  2JE8 A;  1R08 2;  1XRU A;  1H2N A;  2VGD A;  3O1O A;  3T1M A;  4BH9 A;  4QPG A;  5K7P A;  2VBP A;  1RED A;  2GMP A;  5IVF A;  2J1S A;  1DGR N;  3NVC A;  4S2D A;  4FFF A;  4XUP A;  1RXF A;  4A41 A;  5BNQ A;  1K5J A;  4K7J A;  4NN0 A;  2R04 3;  1SLC A;  1XNK A;  2DYC A;  1AL2 2;  3ZN4 A;  3MIF A;  4Y22 A;  2RS3 1;  4A7Z A;  3LGR A;  1K5M C;  3MID A;  4M4R A;  5DAB A;  2GDF A;  1FT9 A;  1XQN A;  1CZV A;  2AEZ A;  2W0X A;  1U5I A;  4UFJ A;  2C24 A;  3VHR A;  3WVJ A;  3ZOI A;  4XBL A;  3OY8 B;  4AFA A;  4BIO A;  4EZ4 A;  2QBX A;  5LA2 A;  3V65 A;  5BNN B;  1WME A;  2IFW A;  2DFC A;  5FZ6 A;  3TB0 A;  1ASJ 3;  1EAH 1;  3IDE A;  3WG4 A;  4B1M A;  3J8F 1;  2HWB 3;  5I8Y A;  2WLP A;  1ULO A;  1WZX A;  1PX4 A;  5L7O B;  1D4M 3;  4XQD A;  1CON A;  3HQR A;  3OUI A;  2WAB A;  1HRV 1;  5JZG C;  3CL1 A;  3UKT A;  5IYY A;  2BJS A;  1FMD 2;  4FPJ A;  3HJR A;  1BEV 3;  2NMN A;  1NKG A;  4HN0 A;  4CCO A;  4P9W A;  2X05 A;  2ZHL A;  3T0A A;  4YZ2 A;  2ZAC A;  5GZG A;  3OYW A;  3H0O A;  1REE A;  4OUS A;  5E8A A;  3ZYJ B;  1GNH A;  3IDC B;  4NPR A;  1UAI A;  3OGS A;  4DFS A;  3KLS A;  4NRO A;  4QU1 A;  5F32 A;  4XEZ A;  1I5Z A;  3M1H A;  2BGO A;  4HVO A;  3G6J B;  3ACH A;  4IL7 A;  4W6W A;  3S7I A;  3LKJ A;  4QPI B;  1SLI A;  2XUM A;  3BOD A;  5JSO A;  1VMF A;  4CU8 A;  3EHK A;  2R16 A;  2A70 A;  2ZGL A;  3LSD A;  2VQU A;  2JXA A;  3K77 A;  2Y6F A;  5A7W B;  2VMH A;  2JIG A;  5FAX A;  4KWL A;  3WHU A;  3WG3 A;  4E2G A;  1OI6 A;  1YFU A;  5CNA A;  1BBT 2;  1VBD 3;  1W8H A;  2ZOE B;  2MEV 3;  4B8E A;  1FPN 1;  3PDQ A;  1OD5 A;  2XML A;  1AR9 2;  4GH4 C;  2GND A;  2HEY F;  3A0K A;  3NKG A;  2A7A A;  4YG6 A;  5FK7 A;  3WQB A;  2ZHM A;  4XYX A;  2J1V A;  3K48 A;  1MR5 A;  2WZR 3;  4MUV A;  3HN3 A;  3WDU A;  3ZYP A;  4AHW A;  5C33 A;  2HWC 1;  1AYM 2;  2E31 A;  2WS9 1;  4XJZ A;  4BU2 A;  3DYO A;  3NV4 A;  1JYX A;  1GP4 A;  3KF5 A;  1V6M A;  1HQN A;  4UFM A;  4XOG A;  5JSP A;  1SMV A;  5A1L A;  1PK6 B;  2A75 A;  4NR1 A;  3ACI A;  1Y7B A;  3BIW E;  1Y43 B;  4XET A;  5C4W C;  4ZKT B;  1JZ5 A;  4Y26 A;  5JUV A;  1NYW A;  1V9U 2;  4XF4 A;  2W92 A;  2DTW A;  4Y5Z 0;  4E27 A;  4QPG B;  4XTM A;  3H7J A;  2WFP A;  5FPB A;  4LBM A;  1UY1 A;  3UV9 A;  4PQQ A;  2W52 A;  3VBH A;  2BVV A;  2D43 A;  3MO4 A;  4B3N A;  2Y0O A;  1UPI A;  3ZYB A;  3WNO A;  4H7L A;  4ZS2 A;  1RYY A;  3DEC A;  3RZH A;  1LB2 A;  3PNA A;  4FVV A;  4AVA A;  1GWL A;  5LRR A;  2VZU A;  3NKT A;  3RRD A;  5A6Y A;  5LAS A;  4Q4V 2;  3B00 A;  4AED C;  3AKR A;  4D7S A;  2WYF A;  1YO8 A;  4DRR A;  5FZE A;  1LEM A;  4XHB A;  4CDW A;  5GZD A;  4URA A;  4CDX C;  4D3W A;  1N3P A;  4MGZ E;  2FMD A;  4I0W B;  1ZZB A;  4HVQ A;  1Q8V A;  1UZY A;  5D8A C;  3MDP A;  1QJX 1;  2BER A;  4ES8 A;  1QJZ A;  1MS0 A;  3UGG A;  3AK0 A;  5ACA 3;  2N7G A;  4UFK A;  5L19 A;  2HWD 2;  4MLO A;  4S2H A;  4H55 A;  1VRH 2;  5DAX A;  4N8M A;  1GZC A;  1NCQ C;  3NJX A;  1AYN 2;  1KS4 A;  3R0R A;  4QX3 A;  4TWT A;  2ZMK A;  3POW A;  5LB6 A;  3DXT A;  2WNV B;  3VZO A;  2A3W A;  3ABZ A;  1UL9 A;  4RQP C;  3IM0 A;  4DMI A;  4EN6 B;  1O5U A;  3P3N A;  4Q0S A;  4HOO A;  4YPJ A;  2PA7 A;  4Q4X 1;  4DZG A;  3VLB B;  1GNZ A;  4ISR A;  3C7E A;  4OYU A;  4FOY A;  1Q8S A;  2ZXQ A;  3WX5 A;  3GHM A;  1J3Q A;  1MEC 2;  3KM5 A;  5FZD A;  2CGO A;  1ZVF A;  2DU0 A;  4K1Z A;  2VBB A;  4LK6 A;  1VAK A;  2YDE A;  2BNO A;  2Q8D A;  1TME 1;  5J37 A;  1S2K A;  5BNP A;  1PX3 A;  1UU5 A;  4ZU5 A;  1R1A 3;  3K46 A;  1W3V A;  3UGH A;  1UOB A;  4EWA A;  1I6X A;  2XH6 A;  1QY4 A;  5GKA C;  4C8D A;  3POJ A;  1JN2 P;  2PMW B;  5CEH A;  1J1T A;  3Q8E A;  3GGL A;  1UIJ A;  5F39 A;  2OXB A;  1QH6 A;  3K4Z A;  3WDY A;  1PVC 2;  4RD7 A;  4AVS A;  3WF3 A;  2D6P A;  2BBV A;  4QXB A;  1UKR A;  4S2F A;  3ZSM A;  1O59 A;  4CCN A;  4AOC A;  1G8W A;  3CMG A;  3DYP A;  1PMI A;  3VKL A;  4MO3 M;  3MW2 A;  2VZR A;  4XXA A;  2PHT A;  1UIK A;  3PVO A;  3ZIW A;  1RUI 1;  3H1M A;  1ZYB A;  4EYU A;  1ZBA 2;  5LCW L;  2D7F A;  3O1U A;  2HKX A;  3VB9 A;  2FCT A;  2PLV 1;  4GB3 3;  3VBH B;  5I0S A;  4AFB A;  4HSJ A;  1OFN A;  3LDR A;  1RUJ 2;  5LA0 A;  5ANN A;  1LOF C;  3HT1 A;  2VJX A;  2BWA A;  4GAL A;  2ZPX A;  1XYN A;  4O65 A;  3OBT A;  2EVX A;  4WM7 B;  4XE9 A;  3LQC A;  4RS5 A;  2ZJC A;  3RMY A;  5DZF A;  1LTE A;  3O14 A;  3PIJ A;  5AC9 3;  1V0A A;  1CIW A;  1Z7S 1;  3ZXJ A;  4FXK B;  4KNC A;  4NAO A;  4XAA A;  3O1S A;  2DUQ A;  1CN1 A;  4F7Z A;  1AJK A;  1ALY A;  1ULE A;  4MZU A;  4CDW B;  4YW1 A;  4Q4W 1;  1BMV 2;  1DBN A;  2RG4 A;  1Q56 A;  4IQP A;  5A80 A;  2VZ1 A;  3JB8 A;  2JB4 A;  3WZ1 A;  3FUO A;  4BQ4 A;  4XJ9 A;  2ZGK A;  3I3D A;  4CEW C;  1EPW A;  1YQ5 A;  2RS3 3;  5C71 A;  4DIQ A;  4Q8L A;  4Q8K A;  1PNG A;  3PLQ A;  3E6C C;  2HWF 2;  4HK9 A;  2GMM A;  4HLT A;  1G9F A;  3GHN A;  1U0A A;  3ZVX A;  3WP6 A;  1T6B X;  2JDP A;  3AP9 A;  4NRP A;  3DEM A;  1YEW A;  3HNM A;  1NXD 1;  1ZZ6 A;  2Q4S A;  3CO2 A;  5FIX A;  1GMM A;  1RTV A;  1FAY A;  2YY1 A;  3E1F 1;  3J8F 3;  4OUM A;  2LS6 A;  4QKB A;  1W2O A;  2XKO A;  5FLJ A;  1HB3 A;  4DXT A;  2DF7 A;  1OUS A;  4W65 A;  4Z92 B;  1TE1 B;  5DUW A;  3FLP A;  2DCK A;  4N7U A;  1RUC 1;  2D97 A;  5C3S A;  1QJY 3;  5KXE A;  3NJZ A;  1NY7 1;  1W8T A;  5JCT A;  1NZI A;  1UY4 A;  4KG0 A;  4YWA A;  1WD3 A;  4YGD A;  1S0B A;  1JYC A;  4E2S A;  5C5T A;  1DQ1 A;  2VAU A;  4I3G A;  3THP A;  5L36 A;  1LOE A;  1ULP A;  3ZXF A;  4AGG A;  4COW A;  5HBA A;  1DZT A;  2AH2 A;  1UKG A;  1CPN A;  1SG3 A;  2C1F A;  2XJR A;  1HB4 A;  3AKP A;  3KCX A;  1QOS A;  1VBB 3;  3NNM A;  4XIO A;  5E16 A;  2LAL A;  3JXS A;  3ALQ A;  5FBZ A;  4AG4 A;  5FK8 A;  5HCA A;  4WBB A;  5GLU A;  3EXU A;  3O1V A;  5BYN A;  3AX4 A;  1PM7 A;  3POY A;  2WWU A;  2GC2 A;  2WSV A;  1CJP A;  1NAE A;  5CBL A;  4Q2F A;  2R6Q A;  2Q1M A;  2RR1 1;  3ZFG B;  1MS8 A;  2GP3 A;  3HBK A;  2HBU A;  5FR3 A;  2YPJ A;  5IVC A;  2CGP A;  1GKB A;  3TN9 2;  1QOT A;  1RVF 1;  2X8K A;  1PGL 1;  3N9Q A;  4N43 B;  4XJU A;  1S0D A;  3R4U A;  1XND A;  1TZO A;  4XPV A;  5A7P A;  5JZG A;  5JOZ A;  4MGS A;  3WEZ A;  3FUQ A;  2WFF 2;  3KT1 A;  2C9K A;  2WR9 A;  4MXW A;  1YI7 A;  4DY5 A;  3H9A A;  1OOP A;  1H8T B;  2W3J A;  5C9A B;  2DVD A;  1ENQ A;  2ERF A;  3AXD A;  4OI0 A;  3CBN A;  3PTR B;  1J84 A;  4P14 A;  1F31 A;  1EAH 2;  1TMF 2;  1W8N A;  2P2K A;  3MUZ 1;  3RZZ A;  4YM0 A;  1KRI A;  5LEK A;  4LBO A;  2Q8E A;  3ZKY A;  2HWC 3;  2TNF A;  1R09 1;  1XE7 A;  4NUB A;  4OI1 A;  4AFD A;  1LJ7 A;  4E4H A;  1XJA A;  5A6X A;  2EID A;  3TNQ A;  4FOV A;  1VB2 A;  2LW8 A;  3ECQ A;  3O0X A;  5LWB A;  3C2U A;  2CNA A;  2Z69 A;  3GBF A;  2VZP A;  2PHW A;  3M3E A;  3OGR A;  5EJ1 B;  4EJR A;  1RHI 1;  5DG2 A;  5C7G A;  2RDR A;  1SFY A;  3UJO A;  3H8R A;  2OVU A;  4UF0 A;  1APN A;  5HXM A;  5IVE A;  2AZ5 A;  2JEM A;  2O8O A;  3VDB A;  3KGZ A;  1VE0 A;  1BQP A;  4B29 A;  5CFC C;  4IGQ A;  1W28 A;  1AR7 1;  1BK1 A;  5A7O A;  4COZ A;  5K8S A;  5FXX A;  4XDO A;  4ZHN A;  2XKP A;  2Q1F A;  2HEV F;  3EO6 A;  3C7O A;  4GH4 A;  5EXO A;  5F5Q A;  4NIH A;  4HBN A;  3D8C A;  3H3U A;  3JD7 1;  3ZFE C;  5J09 A;  4XHX A;  4CUB A;  3FLR A;  1MS4 A;  3ZX7 A;  3VBU A;  3VZL A;  3ZN6 A;  3U75 A;  1V6O A;  2O1Q A;  3OF1 A;  3UNP A;  1IG0 A;  2JD4 A;  3PVE A;  4O7X A;  3I54 A;  3RJR A;  4DEQ A;  1SAC A;  3SH3 A;  2BV4 A;  1OF4 A;  4J1X A;  1IKQ A;  2ILM A;  5FUI A;  2H0V A;  5LA9 A;  3LOB A;  1OKQ A;  2I2S A;  3PUI A;  1DQ0 A;  1OVP A;  2F4P A;  3R05 A;  4G4F A;  1K45 A;  4QPG C;  4ZXE A;  4A7K A;  4JTO A;  1VBE 1;  4IEZ A;  1C28 A;  3OEB A;  4C0B A;  3HN1 A;  5CKM A;  3KGL A;  2WT0 A;  1WMD A;  3HVD A;  3LF7 A;  1W06 A;  3T08 A;  4ATE A;  5FOB B;  1BKZ A;  1QJU 2;  3LIH A;  4I01 A;  1DYO A;  4YW2 A;  1NUK A;  4RR3 A;  4XXP A;  2HWE 1;  3JB4 C;  1ULD A;  1JI6 A;  3N9M A;  3HPN A;  2CDP A;  3ZO0 B;  3GDB A;  3WT3 A;  3ZYG A;  4D69 A;  1Q8O A;  2BEO A;  3WOG A;  3NWK A;  5FPZ A;  1GWM A;  3K3N A;  1OA3 A;  1ODM A;  4Q4X 3;  4AED A;  2R32 A;  1O3T A;  5G05 L;  4JGZ B;  5T55 A;  4UAP A;  2EXH A;  2D6N A;  1FI2 A;  2W91 A;  3TYJ A;  3LA2 A;  2WJS A;  4CDX A;  1W04 A;  4OMD A;  1US2 A;  2QTW B;  4PBO A;  1UN1 A;  2A6W A;  2ZKN A;  4LQR A;  2VG9 A;  1A78 A;  5FP8 A;  1YXW A;  3JZV A;  4Q29 A;  5D8A A;  4BIF A;  2RDS A;  2A6Z A;  4MGT A;  3S30 A;  1SBD A;  2W08 A;  2K46 A;  4O61 A;  3UYJ A;  5FXZ A;  3I8T A;  3CNA A;  1WD4 A;  2ARX A;  3MI8 A;  2R30 A;  4MXW B;  4MG2 A;  1OOP B;  1ZRC A;  2UY9 A;  4GWI A;  4A6S A;  1JU4 A;  1JYT A;  5EP9 A;  2VUL A;  1GLH A;  5JOY A;  2QDN A;  4MGQ A;  5CAD A;  2LM3 A;  1XU2 A;  4SLI A;  4PF1 A;  1BLZ A;  4NHM A;  3VHP A;  2ZAA A;  2ZML A;  4J25 A;  4N9I A;  1RC6 A;  4XUO A;  4OZX A;  2YFU A;  3WNM A;  4CA9 A;  2PHU A;  1IS3 A;  2UWC A;  3EJK A;  3PU3 A;  4CCL A;  5FYM A;  4M3C E;  1NQJ A;  4QB1 A;  3UT0 A;  2W2I A;  3EMR A;  1IGO A;  1PNF A;  4L99 A;  3ZR5 A;  1ASJ 1;  2YU2 A;  5GLW A;  4UW6 A;  5CAZ A;  4CUC A;  1BK0 A;  4PF5 A;  3ZR6 A;  4NHL A;  1RUI 3;  1YHF A;  1OA4 A;  2WQ8 A;  5EQU A;  4GUL A;  2RS1 3;  4LHK A;  2VZQ A;  4BCU A;  1ND2 B;  4BLJ A;  3OPW A;  3EQE A;  3MPB A;  1VBC 2;  1H2K A;  2YPD A;  5J98 B;  2NMO A;  5BNO A;  1IS5 A;  3TNP B;  1BEV 1;  1HW5 A;  1NCR A;  1Y4W A;  2WNU A;  3POS A;  1G9A A;  1UYZ A;  4K1Y A;  5FZC A;  4FTE A;  4QXK A;  1LAJ A;  4A44 A;  2YGL A;  2VUD A;  3VBU B;  2ZZQ A;  5LK7 B;  1SQ4 A;  2BNN A;  2VVE A;  3ZFF A;  3ZN6 B;  2PFW A;  1HXS 3;  1AZD A;  2VEC A;  4ERO A;  3HWJ A;  1C8M 1;  4BQ5 A;  1RUH 1;  4XAE A;  2R49 A;  1TME 2;  2VVD A;  4Q4W 3;  1Q8P A;  1HJG A;  4XFG A;  2ET1 A;  4K21 A;  1JXN A;  4BJ0 A;  2BWC A;  3NAP A;  3POG A;  1WLT A;  4J6G A;  4Y4R A;  2ARA A;  4Q4Y 1;  5FZF A;  5DMY A;  1KXG A;  2ADE A;  4ZY9 A;  4QQH A;  2G4I A;  3POE A;  5DDJ 2;  3SH4 A;  4GQ7 A;  3ZYR A;  1C5I A;  1QNY A;  2QDR A;  3I97 A;  3B01 A;  5DAV A;  1UYP A;  4ZPI A;  2FCV A;  2P3I A;  1VBD 1;  1UX7 A;  3CF6 E;  3VBH C;  3SEP A;  2MEV 1;  2B7Y A;  1MS1 A;  2XB6 C;  4RR3 B;  1LOF A;  1DLC A;  3CHX A;  2E26 A;  1PO1 1;  1G9D A;  4WM7 C;  2J1R A;  3FFZ A;  5DQ0 A;  3O5S A;  4YFW A;  4C90 A;  4YVW A;  3WIN E;  1EPZ A;  4AHX A;  1ND3 B;  3VHO A;  1XYO A;  5FLI A;  5I93 A;  1NLQ A;  1RUG 3;  2WZR 1;  1FNY A;  4QX5 A;  4WZC A;  1RUC 3;  2XDV A;  1Z0H A;  3AJY A;  1EUT A;  1D7P M;  1H2L A;  3Q9O A;  4A2U A;  3AYA A;  1DGW X;  5CIS A;  4CDW C;  4H14 A;  1TG7 A;  4CP9 A;  1AF9 A;  1YQC A;  2RHP A;  4HT1 T;  1C1F A;  3SXW A;  4GWM A;  4FI9 A;  3VBO B;  4QB6 A;  4IGP A;  1YUD A;  1VR3 A;  1UCX A;  4B7E A;  1CGP A;  5IW0 A;  4JHT A;  2D6M A;  4CEW A;  2CWM A;  2ARE A;  3HR9 A;  2J22 A;  1X82 A;  3WG1 A;  1JYV A;  5HCH A;  1ZZC A;  3PMS A;  3HAG A;  4EWD A;  1DQ6 A;  2AUY A;  3IIA A;  5FBJ A;  1AR6 3;  4E4Z A;  1VBA 3;  4QPW A;  5DAP A;  2EIG A;  5A3L A;  2CSG A;  1AXY A;  1H9P A;  4TZD A;  4K20 A;  2OKX A;  2D93 A;  2WO2 A;  4Y20 A;  4B4Q A;  1YRZ A;  2PTM A;  2RR1 3;  3U10 A;  5K0U A;  4ITC A;  3MIH A;  5FO7 B;  3O12 A;  3NST A;  4KMQ A;  3KV6 A;  5FPA A;  4DRV A;  5G04 L;  1OXC A;  1WCK A;  3FC0 A;  1V6L A;  3SCH A;  1DHK B;  4XVH A;  1JHN A;  2ZGT A;  3M3C A;  3HQU A;  3FN9 A;  1OBN A;  3I2D A;  2NLR A;  3IN9 A;  4YZ3 A;  3CJI B;  1IQD C;  1CVN A;  5FMD A;  2QE3 A;  3ROU A;  2GU9 A;  4QQP A;  3O1P A;  2BPA 2;  2XVL A;  1SCR A;  1RIR A;  2AR6 A;  4A3X A;  2Y6G A;  5ACA 1;  5BNP C;  2CAU A;  1ZBE 2;  4EZH A;  3VGI A;  2BGC A;  1QGL A;  1NCR B;  3IWZ A;  3OY8 A;  3R4D B;  4LKF A;  2WNU B;  1ZRE A;  5KXD A;  3B7M A;  5FV3 A;  3VKO A;  3HIF A;  4E2Q A;  5BNN A;  2BTV C;  1YQ8 A;  3WCS A;  3OOX A;  4PT6 A;  5FOJ B;  4NID A;  1GNY A;  4P5Y A;  3NRU A;  1IG3 A;  3TAY A;  2E9Q A;  4CP1 A;  2A5Z A;  5L7O A;  2RM2 2;  3UKN A;  4ZZ8 A;  1UOJ A;  3NAP B;  2BGP A;  1AR7 3;  3D0S A;  3NL1 A;  5FY4 A;  5A3M A;  2ORZ A;  5JR7 B;  2D40 A;  1I3H A;  2VCC A;  3WG2 A;  1N1V A;  2R1D A;  1WCD J;  1H8T C;  1SLL A;  1VMH A;  1W2N A;  2GP5 A;  2W5F A;  2VOT A;  3JD7 3;  3PJY A;  4OFG A;  4XUT A;  3B9I A;  2QQK A;  3DGT A;  5FY7 A;  4Z1V A;  2CGN A;  1UZV A;  4Z8B A;  2VQ0 A;  3B69 A;  4Q1P A;  2R07 2;  2VUA A;  2ZMN A;  3KS7 A;  3PL0 A;  4BM8 A;  3WSO A;  2JEC A;  4UW3 A;  2ET7 A;  4QPI A;  4XUR A;  4Y1Y A;  1RUE 2;  2Y60 A;  3KMH A;  3C3V A;  3JBG 3;  1OH4 A;  2XOM A;  4ZON A;  4COV A;  4IND A;  1KFU L;  4AEM A;  1W6Q A;  4NWW A;  4AI2 A;  1COV 2;  2X5I B;  4I0B A;  3DF0 A;  1HJF A;  3BKZ A;  4IEO A;  3OG2 A;  2HWE 3;  5L73 A;  3VBR A;  1AX2 A;  1RIN A;  3LDK A;  2PQS A;  1WKY A;  1MS3 A;  1F4A A;  2JDA A;  4B7K A;  4R9B A;  5A3P A;  1OA2 A;  4L11 A;  1RHI 2;  1AL2 3;  2B9U A;  2C0Z A;  3GZA A;  1UU6 A;  4GZ9 A;  1ZZ7 A;  2VO5 A;  5F2W A;  1H4H A;  1GAN A;  3DCQ A;  3FBM A;  4P9J A;  4AGR A;  4CSW A;  1D2S A;  5C70 A;  4CCE A;  2IXC A;  1ULG A;  2RMU 2;  1LCL A;  4Y20 B;  4AVB A;  5BV6 A;  2ATF A;  4IE4 A;  2ZEZ A;  3PUH A;  2VH9 A;  3WUD A;  5K0U B;  5K9Y A;  3I2O A;  1PK6 A;  4QQL A;  4F83 A;  1JOB A;  2CL2 A;  5AC9 1;  4JRL A;  3OGJ A;  3U78 A;  4NIA A;  4G9S B;  4LBQ B;  4GKY A;  2J7M A;  4RHV 2;  3JU9 A;  2ZA9 A;  4FPF A;  4Z2W A;  3I3M A;  4IEX A;  2G9Z A;  3SEE A;  2VOV A;  2A1X A;  2XWJ B;  3N7K A;  2P3Y A;  1FMD 3;  2VOX A;  4Q0V A;  4X6R B;  2Y6L A;  5FZA A;  3B02 A;  2C9A A;  1UY2 A;  4AQ6 A;  4CZS A;  4XCA A;  4AK3 A;  3FJS A;  2XGX A;  4XFH A;  2YU1 A;  4CUG A;  2VZO A;  3TBD A;  3GAL A;  1VBE 2;  3F95 A;  3IAP A;  2DVF A;  5JMO A;  4JGZ C;  1GOF A;  1O4Y A;  1XBF A;  1ZRR A;  5GLZ A;  3SC7 X;  5DUU A;  3J7N A;  1X36 A;  2BYV E;  1FV2 A;  5LAT A;  1XNA A;  2R1B A;  4QDR A;  3QCW A;  1JMU B;  4CRQ A;  3HQX A;  2HJI A;  3UET A;  2QFE A;  1QJY 1;  1K3I A;  1OQD A;  3K2O A;  5CU1 A;  3S57 A;  1IZ3 A;  3MLJ A;  1STM A;  1OOP C;  4UFL A;  4XMA A;  2B45 X;  4OQ8 A;  1REF A;  5H9S A;  1XU1 A;  1A34 A;  1AR9 3;  1S55 A;  1QHD A;  2OQ7 A;  1PGW 1;  3A0N A;  2WNV A;  3VKN A;  2JDK A;  4AVC A;  3USS A;  5HV4 A;  3P6B A;  1QDO A;  4YGE A;  1RUD 1;  1VBB 1;  1C8M 3;  4LMF A;  4P02 B;  1RUH 3;  4U2A A;  1RB8 G;  3MIG A;  3UJQ A;  2Q5T A;  4XFF A;  1AYM 3;  1S1A A;  2W1U A;  3W9A A;  2YG0 A;  4J1W A;  4XZU G;  1NE4 A;  4LNV A;  3AFK A;  3LA3 A;  1VIW B;  1IOA A;  2DCY A;  4XBQ A;  2R06 1;  4Q4Y 3;  1HRI 1;  1AJO A;  2R04 2;  2C5D A;  3VZM A;  1UOG A;  4PQ9 A;  3KQR A;  1BCX A;  4PDW B;  2XJP A;  1W6Q B;  2EXK A;  1CIY A;  3UKV A;  2I45 A;  2ZEX A;  4ASM B;  3HD8 B;  4X6Q B;  3HBZ A;  4GMP 3;  4JDN A;  3VBR B;  2D3S A;  1PO1 3;  5EFU A;  5GLV A;  4YZ1 A;  3Q8C A;  4HFS A;  5FKB A;  4A45 A;  5SV5 A;  4XJ8 A;  3GZE A;  4UXA A;  4UYB A;  3BI3 A;  1HV1 A;  2YBK A;  2Z2S B;  1MS5 A;  3QH6 A;  4U36 A;  2BOJ A;  3VBU C;  2GH8 A;  2IFR A;  2HWB 2;  3AMQ A;  3WNP A;  4L9B A;  1KDM A;  1D4M 2;  1WBL A;  1Y9Q A;  1X9P A;  4N53 B;  1PO2 2;  4NWV A;  4Q4V 3;  2WL1 A;  4Y24 A;  4LK7 A;  1KD7 A;  4CXY A;  1WGP A;  2XLG A;  3I2F A;  2Q30 A;  4AFC A;  1QJE A;  4RA0 A;  1NOV A;  3QH7 A;  5E88 A;  4AI8 A;  5JXJ A;  2JDU A;  2IZW A;  1RUF 2;  4BHP A;  5F3G A;  4CCC A;  3H3L A;  3O1T A;  4FO9 A;  3GCX A;  3LDB A;  2VXR A;  4M01 A;  2V4V A;  5DAQ A;  4FAG A;  2ZX3 A;  2P6H A;  3BPS A;  1O3R A;  1HV0 A;  2OA2 A;  1NG0 A;  2HWD 3;  3ETQ A;  4IW3 A;  5I0T A;  1EV1 2;  3THD A;  3FLT A;  5KWR A;  1VRH 3;  4RR3 C;  3CZJ A;  3DKQ A;  4TLG A;  3MGU A;  5LBE A;  4WM7 A;  3T4H B;  4CE8 A;  2UU8 A;  4UWD A;  4OHZ A;  1GBG A;  1QQP 2;  4FPK A;  1U12 A;  2JIC A;  2W39 A;  2FDI A;  2GN7 A;  2JG8 B;  1NLR A;  3W59 A;  4AW7 A;  4JKL A;  3MV1 1;  4IUG A;  1LES A;  4BQ3 A;  1N3O A;  1OSG A;  3AZW A;  1OLM A;  1VLN A;  5C8C B;  2MEV 2;  4Y5S A;  1EY2 A;  1G7Y A;  4QX0 A;  4R9A A;  5EZW A;  3AMP A;  4OVE A;  5FYS A;  2XWB B;  2W87 A;  3LCP A;  1MEC 3;  4QDQ A;  5FZ4 A;  2Y6H A;  3INA A;  4KQ7 A;  2VD7 A;  3OPZ A;  5IAT A;  2FDH A;  2ARB A;  3V0A B;  4P9I A;  4A42 A;  1TNR A;  3L2Y A;  2DDU A;  1J3R A;  1LEN A;  2Z5W A;  1DF0 A;  1GP5 A;  2BDR A;  2WRA A;  1DCS A;  3H50 A;  2FBE A;  3ZPY A;  3JQX A;  4TN7 A;  1M06 G;  2EF6 A;  4YYO A;  4EQV A;  2HYX A;  1LR5 A;  3VD5 A;  4CYD A;  4JVA A;  1H2M A;  5FY5 A;  4FAH A;  4Y1V A;  4K6B A;  4M0H A;  2J1U A;  2WT2 A;  1PVC 3;  3GBG A;  1GOG A;  3AL5 A;  4QWN A;  4BK4 A;  3ILF A;  1S0C A;  1W6N B;  1LHO A;  2YB7 A;  2P4E A;  5I8S A;  1WLC A;  3LEI A;  5KHK A;  3K4D A;  2EA7 A;  2JDM A;  4DXS A;  2WII B;  2AEN A;  5B4N A;  3RJ2 X;  1N1S A;  2CV6 A;  4NHY A;  1ODN A;  3IAQ A;  1Q5O A;  3I2G A;  3URF A;  5BNO C;  2G9G A;  3AP5 A;  3OTF A;  1SBE A;  4XJW A;  2FDK A;  4BQ2 A;  4FTS A;  1G86 A;  1NCR C;  2WNU C;  3LIG A;  1SPP A;  1W39 A;  1W8F A;  4G3Y C;  5FCC A;  3RGB A;  3S7E A;  4JHZ A;  5IK8 A;  4GA9 A;  2VUC A;  2J1A A;  1J83 A;  4QGL A;  3ZFF C;  1HQW A;  1O6U A;  1GZW B;  4RGK A;  3ZFG A;  4K9S A;  2WYS A;  4N9H A;  4QQ2 A;  2X53 S;  4BXF A;  4YW5 A;  1NZC A;  3E5X A;  3FMG A;  3PVB B;  3H8O A;  2XBO 1;  4N43 A;  2DUR A;  1LEC A;  3NAP C;  4ZU7 A;  5JDB A;  2YUE A;  1W8Z A;  3OBA A;  2WAA A;  4I3P A;  2WBK A;  2GC3 A;  5FZL A;  5FYC A;  3NO8 A;  4PHZ A;  3VZN A;  4AF9 A;  2RS5 3;  2NYY A;  1CQ9 A;  4EN9 B;  5C9A A;  1XNC A;  2E32 A;  1H8T A;  2I07 B;  4MYE A;  4NO4 A;  1HLC A;  2WNE A;  2RS1 1;  4Z2A A;  3MFA A;  5CFD A;  4Y5T A;  2VOW A;  3ACF A;  1LGN A;  4QKF A;  3A4U A;  3OPT A;  4LBK A;  2HWF 3;  3S6P A;  2KXL A;  4OHX A;  3K75 B;  1DDL A;  5FPX A;  3CIH A;  4YNI A;  1QIQ A;  2GSY A;  1P8J A;  3AMM A;  3SQO A;  4YVW C;  3FZ3 A;  2GN3 A;  4IER A;  1PMJ X;  5L9R A;  1XB9 A;  2ID4 A;  5EIY B;  1IKP A;  4JQR A;  4V2V A;  2XUE A;  3WDX A;  4P9X A;  4Y1X A;  3W5M A;  1J58 A;  1JUH A;  1W03 A;  3RVH A;  3CKH A;  3T09 A;  3ME2 A;  3W58 A;  1HXS 1;  1KFX L;  1LHV A;  3J7H A;  5E89 A;  2D44 A;  3VBS B;  3BU0 A;  1YQ2 A;  4BXS V;  4LOR A;  2VZT A;  2XL7 A;  1UYY A;  3ZSE A;  2E33 A;  4JDM A;  1KJR A;  1R1A 2;  1FOD 1;  1B09 A;  1N1T A;  1WW7 A;  2B8M A;  2EAL A;  2WNO A;  5EV7 A;  2HLE A;  3H8X A;  3PVN A;  4TXW A;  2G1M A;  2WC2 A;  2Y34 A;  1M4W A;  1CAW B;  2BOI A;  2D3R A;  3ES4 A;  2FHR A;  2V4A A;  2IXI A;  2QVS B;  2RVA A;  2W1Q A;  2WUH A;  4I0A A;  4LHL A;  1QF3 A;  1UO9 A;  2BNM A;  2VQT A;  1GWK A;  3LPG A;  5DPN A;  3H42 B;  3AYD A;  3I2J A;  4XF3 A;  1RMU 2;  1RL3 A;  1WMF A;  1WBF A;  3ZYI B;  4HZF A;  4BA6 A;  5K0U C;  5F1R A;  3AZX A;  4IE5 A;  3MFC A;  2ZX1 A;  1SFN A;  1RUG 1;  5FJK A;  1PM4 A;  5A6Q A;  2IWG B;  2QKD A;  4GB3 2;  2PHD A;  2V73 A;  4X8N A;  2XPJ A;  3QD6 A;  2WKK A;  1POQ A;  1UZ0 A;  2WFF 3;  2LRO A;  3KHC A;  1MZ6 A;  3PUS A;  4HKO A;  1B35 B;  3ZYF A;  1WCS A;  4JGY A;  4IEQ A;  4RYD A;  5CZK A;  1RUD 3;  4JDO A;  3B3Q E;  1S2E A;  1YCI A;  1JYW A;  2DBN A;  1Z78 A;  5DG1 A;  4DB5 A;  1AR6 1;  2DUO A;  4QHZ A;  5FYT A;  5FQ0 B;  1SPP B;  1VBA 1;  3WNN A;  3IBM A;  4AZZ A;  5BNN C;  1EYB A;  1CES A;  1JS9 A;  4JGZ A;  1IQA A;  2R06 3;  3VN4 A;  1HRI 3;  2Q8O A;  1KDK A;  1TQ5 A;  4KGG A;  4JKK A;  4H7M A;  4LUL A;  4YG3 A;  4CVU A;  1WLD A;  5L7O C;  2RS3 2;  4ZU4 A;  5FYZ A;  3AVS A;  5FP4 A;  4Q0Q A;  3OJB A;  2ZGU A;  4FPG A;  2NZ9 A;  1OPO A;  3LEG A;  4QX7 A;  1O4Z A;  3M4F A;  2P17 A;  4BIS A;  1MAC A;  1MQT A;  1AR8 1;  1QWR A;  3WDT A;  2P37 A;  4MET A;  1ZZ9 A;  5CFD B;  3IT8 A;  1AXZ A;  1QJF A;  4BQX A;  3ENR A;  2Y64 A;  3J8F 2;  1CAV A;  2J1T A;  1TVG A;  5SV8 A;  4GIQ A;  1H4G A;  1YWK A;  1ZZ8 A;  3BTX A;  2DFB A;  2UYB A;  4D7T A;  1HRV 2;  4OQ9 A;  3WR0 A;  4BPZ A;  3OUJ A;  4NHK A;  4KWK A;  3MIE A;  4IE6 A;  5IAX A;  4QPI C;  3WV6 A;  4M4P A;  1FAT A;  2ZX0 A;  4WM8 A;  1OH3 A;  4LLO A;  2ZEW A;  1QH7 A;  3IDB B;  4HKW A;  4UOJ A;  3WF1 A;  2B5H A;  2VW0 A;  2WN3 A;  4PDW C;  3W20 A;  3N9O A;  1ND2 A;  1PZ7 A;  4CPB A;  2VOK A;  3B94 A;  2Y26 A;  2UWA A;  3GXU A;  3N36 A;  2P34 A;  4KL1 A;  4PJY A;  1UD1 A;  3I3Q A;  3VBR C;  4XFA A;  3GJB A;  1PIV 1;  4HKL A;  4IV1 B;  4JQT A;  1QJU 3;  3MF6 A;  3WXP A;  1CZS A;  3X29 B;  1JH5 A;  3ATG A;  2LTN A;  1NLS A;  4HAN A;  4HPK B;  4LIT A;  4LKE A;  3N7J A;  4I02 A;  4YGC A;  4DXZ A;  4EN7 B;  3IMN A;  2BZD A;  2VTF A;  4IE0 A;  2EIE A;  4QDS A;  1ENR A;  4N53 C;  3FE5 A;  4GXL A;  4XUN A;  1FPN 2;  4XQW A;  1PK6 C;  3E5Q A;  4Y3O A;  3WW3 A;  4DUX A;  5JI9 A;  2DWR A;  1MZ5 A;  4B1L A;  3AM2 A;  2UYA A;  3RWN A;  4NIG A;  4PIX A;  3JBG 1;  3KV9 A;  2ETE A;  1JTZ X;  1OUR A;  4F8A A;  4Y1U A;  1XSQ A;  4YW6 A;  5DAW A;  5IK5 A;  1R08 1;  2RJK A;  2WDB A;  1VAL A;  5I8T A;  1PGS A;  2XHN A;  2HBT A;  1NX9 A;  2HWC 2;  1W6M B;  2WS9 2;  3CEW A;  1RJ8 A;  4LTA A;  2DVB A;  5CYY A;  3WCR A;  1GQG A;  3ACG A;  2VL4 A;  5KC6 A;  4JGY B;  4W4Z A;  1OMI A;  2Y8K A;  2ZX4 A;  1AL2 1;  3N9L A;  3PHM A;  1ND3 A;  1CAU A;  4IEY A;  1HQL A;  2VQA A;  3FFQ A;  1PZ9 A;  3LA7 A;  1AL0 G;  3CZU A;  3MUY 1;  5FWE A;  3ASI A;  4AQ2 A;  5JPN B;  1J59 A;  5C8C C;  1SHW B;  3GF6 A;  2JKB A;  2W68 A;  3VBO A;  4CXW A;  1CPM A;  4L0P A;  2G9F A;  1F4H A;  1UY3 A;  1W9T A;  2W94 A;  1KGY A;  5F6L B;  1UX6 A;  2XJT A;  4QQO A;  1OQE A;  3FBY A;  2WLQ A;  3J9S A;  3PUR A;  1S0F A;  4D6R A;  4P5H A;  4RGA A;  4I2O A;  1HDK A;  4K3U A;  2DCJ A;  2D5F A;  5T5P A;  3RFR A;  2BU9 A;  2WA4 A;  2VNR A;  1MQT B;  4FOW A;  3WQ1 A;  1FMD 1;  4WVM B;  4LPL A;  5JPM B;  3W21 A;  3I2H A;  5ISL A;  2WIN B;  3VDC A;  2BRT A;  2WNV C;  1CAV B;  3R6S A;  1OLQ A;  4AQS A;  4D6S A;  3LZZ A;  3NV2 A;  1JW6 A;  1QJX 2;  2WA3 A;  1LGC A;  3N9N A;  4LBN A;  4MX3 A;  4R8H A;  3UL2 A;  4CU6 A;  1IPJ A;  5EPA A;  5FPL A;  1W9S A;  2QQO A;  2XBO 3;  2VMF A;  3SKJ E;  1O8S A;  1UU4 A;  3FX3 A;  2VMG A;  4WM8 B;  4XTP A;  3E97 A;  4MHR A;  2PN5 A;  2JD9 A;  4OI2 A;  5FUN A;  1O3S A;  2YFZ A;  2FZ2 A;  3VDA A;  1PMH X;  2B4K A;  4M3C B;  3CJI A;  5JMC A;  4R52 A;  4XC9 A;  1OPM A;  5FLH A;  1LHN A;  3E6D A;  2GH2 A;  2WWJ A;  2XJQ A;  2YGM A;  3I3B A;  4JC1 A;  3THC A;  2ZGO A;  4KU7 A;  1BBT 1;  4Q4X 2;  2YRO A;  4XFC A;  2GC0 A;  4HL0 A;  4FXG B;  4DEV A;  2GNM A;  2XJV A;  4QHB A;  2OUJ A;  4FOQ A;  1GSL A;  2OS2 A;  3LOI A;  1AR9 1;  2OII A;  1V70 A;  3O1M A;  3E6B A;  3BIE A;  3HMY A;  1WA4 A;  3ORJ A;  2VZ3 A;  2P5B A;  4CXX A;  1ZRF A;  3VD7 A;  2OX0 A;  3N9P A;  2IUW A;  3H3Z A;  3BOP A;  1D0G A;  2PXJ A;  1AYM 1;  4GJZ A;  3ZDV A;  1W05 A;  1QKQ A;  2B9V A;  2WZ8 A;  1FOD 3;  5FXW A;  4BQY A;  2ZGN A;  1RXG A;  2OUH A;  1GZT A;  1S0I A;  3S0M A;  3APB A;  2VTX A;  4X8P A;  3N4M A;  2ORX A;  3BB6 A;  5JWP A;  1V9U 1;  4D8M A;  5IWF A;  5JVV A;  1U5X A;  2A6X A;  4CP2 A;  5J1X A;  2G19 A;  3OB8 A;  4HN1 A;  5GM0 A;  4GMP 1;  2VM9 A;  4RGG A;  3DKW A;  3RS6 A;  1SDD B;  4AGV A;  5LBF A;  1A8M A;  3GBW A;  3H7Y A;  3LFM A;  1JZ6 A;  3D0J A;  1D2Q A;  2CHH A;  1UMH A;  1CAX A;  1H1A A;  2SLI A;  1LHU A;  2JKX A;  3NNL A;  3O0W A;  2C26 A;  4GWJ A;  4O9G A;  2NQY A;  4YZ5 A;  3M70 A;  1Q8Q A;  1CAU B;  2E7T A;  2K9Z A;  3A7Q A;  5C4W B;  4PLN A;  1RUI 2;  1TEI A;  2RS1 2;  5ERL A;  3UK9 A;  2PLV 2;  5KHH A;  4Q4V 1;  5AFB A;  5IT6 A;  5F6K A;  1L7Q A;  2OZJ A;  5FYY A;  3H8U A;  3W5N A;  4FPO B;  2X5I A;  4Q27 A;  5FUP A;  4IE7 A;  4L92 A;  3UGF A;  3C8X A;  2A73 B;  2QQJ A;  2IVJ A;  1GP6 A;  4XAB A;  1T6G C;  3EYP A;  4GJY A;  2PHF A;  1Z7S 2;  4BOW A;  3LFI A;  4DXR A;  3WNX A;  4LO8 A;  5F3I A;  1PVX A;  1V6K A;  4XF0 A;  3SKV A;  4Y1Z A;  4D7Y A;  1OC1 A;  2HWD 1;  1L7R A;  1ZBE 3;  2OT7 A;  2XON A;  4QPY A;  5FO9 B;  1MZF A;  4M0N A;  5F5C A;  1VRH 1;  2JX9 A;  4Q4W 2;  5T52 A;  1Q3E A;  3HEI A;  4PIY A;  1AYN 1;  4MV2 A;  2PEL A;  3JUU A;  1WCU A;  1SLB A;  4FT8 A;  4UW5 A;  4CDQ A;  2RJL A;  4LIU A;  1E5R A;  4P9G A;  3NNF A;  1QOO A;  2ZBJ A;  3M7A A;  1SDW A;  3ELN A;  4LBQ A;  4R9D A;  4XBN A;  4WVZ A;  2P6C A;  4JZR A;  4FPE A;  4OZO A;  5CVR A;  1DZQ A;  1IHM A;  5LBB A;  3VD3 A;  5KHJ A;  4YGB A;  3BTZ A;  4CCD A;  1AR8 3;  5FXV A;  1DGL A;  1NCQ B;  2UY8 A;  3Q8F A;  2WQ4 A;  3Q8B A;  4AHZ A;  1OFS A;  3MW4 A;  5LW9 A;  4LR4 A;  5EHD A;  2WQZ C;  1WMX A;  1B35 C;  5FTT C;  1MEC 1;  1XXN A;  4XF9 A;  4MGI E;  2D6K A;  4FPC A;  5FP3 A;  1RUC 2;  4YVS B;  1LGB A;  1W9W A;  2QQM A;  3IPV B;  4LHN A;  4HK8 A;  3VZK A;  1NY7 2;  3WHT A;  1W8O A;  1S0J A;  2R0F A;  5A6Z A;  3BVC A;  5EJZ B;  3MLK A;  1E57 A;  1K42 A;  1BYH A;  5DN2 A;  4WVV A;  5DZE A;  2E51 A;  4LOT A;  1UYX A;  3TEX A;  1H6X A;  3ZFG C;  1VB4 A;  2AYH A;  2XL9 A;  1XPW A;  3ILR A;  3ZDS A;  1BXH A;  1RUO A;  3AL6 A;  3ETP A;  2EAK A;  3POF A;  1PVC 1;  4N43 C;  4PI0 A;  1W90 A;  4NHX A;  3NNJ A;  5I0R A;  2Z79 A;  1W6O A;  2XJU A;  4EN8 B;  3OEA A;  2PYT A;  5BPX A;  1COV 3;  1PIV 3;  5C9A C;  2ZGQ A;  4UT5 A;  2B42 B;  1ULF A;  4OLL A;  1W2T A;  2VPV A;  3T2P A;  3WD5 A;  5CFD C;  1IS4 A;  2RR1 2;  2D5H A;  3M3O A;  2ZZJ A;  1ZBA 1;  1RVF 2;  1PGL 2;  1CX4 A;  1AVB A;  2Q1Z B;  3CU7 A;  5IVY A;  1O8P A;  2Y38 A;  1CAX B;  4LE4 A;  2RMU 3;  4ONU A;  5AVP A;  5JOW A;  5FWJ A;  1CX1 A;  1W8U A;  3AJZ A;  1W6P B;  2H0B A;  1L3J A;  3DN7 A;  2GNT A;  3MPP G;  3POI A;  1N47 A;  1X8E A;  1OT5 A;  3WF4 A;  5FZ1 A;  5ANQ A;  3AYE A;  1XNT A;  1R08 3;  2WT1 A;  5DXD A;  5FMO L;  5H9Q A;  4IEP A;  2A6Y A;  4LO6 B;  4PDW A;  4C1X A;  1SCS A;  1R1Z A;  1HIX A;  1R09 2;  2YXS A;  3A23 A;  5F5A A;  3T2Q A;  4M3C F;  1BJQ A;  1DLL A;  1JZ7 A;  1BMV 1;  3ZM8 A;  4FFH A;  1URX A;  2RS5 1;  4CDU A;  2V72 A;  4IV1 C;  5T3N A;  4GMP 0;  1W2A X;  3KCY A;  3D82 A;  4JTN A;  4OMC A;  1MVE A;  2CAV A;  2J42 A;  1L7L A;  3KD4 A;  1HN1 A;  4NPM A;  2OPW A;  2HWF 1;  3I3E A;  5L9V A;  4BMB A;  3OGG A;  2BUK A;  4N53 A;  2X09 A;  3RZL A;  1AR7 2;  4AXO A;  2PAK A;  3PJQ A;  2Q0A A;  4CDQ B;  5I91 A;  4NRM A;  3FHI B;  4QB2 A;  1POV 1;  1UY0 A;  5F37 A;  1AXK A;  5KHG A;  2D6L X;  3JD7 2;  4C0H A;  5F3C A;  4QMA A;  3NNG A;  5T50 A;  5JLV A;  4C1W A;  2BQP A;  4BK5 A;  5KC5 A;  4TSV A;  3AP6 A;  1LU2 A;  4CEY A;  2K2S A;  4A4A A;  4DOU A;  1KS5 A;  1OQ1 A;  4A7Y A;  4JGY C;  3SHR A;  5A1F A;  1DIW A;  3CQO A;  5FY8 A; 
#chains in the Genus database with same CATH homology
 2YPD A;  4CCM A;  5LWB A;  5A7W A;  5A7S A;  3PU8 A;  5ISL A;  4LXL A;  5FY9 A;  5FY4 A;  4EYU A;  3ZPO A;  5FYH A;  5FXV A;  1VRB A;  5FYV A;  5FZC A;  4D6S A;  5FYZ A;  3AVS A;  5FP4 A;  3N9N A;  4BU2 A;  5IVE A;  4UF0 A;  5LW9 A;  4D6Q A;  2GP5 A;  5FPL A;  5A1L A;  2YBS A;  3NJY A;  4IGQ A;  4QX7 A;  5FY7 A;  5IVV A;  5A7O A;  5FP3 A;  5FXX A;  5A7N A;  4XDO A;  3U4S A;  5E6H A;  4BIS A;  4IGO A;  5FPB A;  4QXC A;  4Y4R A;  5FY0 A;  5FUN A;  5A3T A;  4BXF A;  4CCJ A;  4QXH A;  5FJH A;  5FZF A;  3KVB A;  5A7Q A;  5FP9 A;  5FZH A;  3AL6 A;  4ASK A;  2WWJ A;  5FZL A;  5FYC A;  2YBK A;  5LY2 A;  4AAP A;  5A80 A;  5FZ0 A;  4DO0 A;  4V2W A;  5FYU A;  2OS2 A;  5F3E A;  5FZO B;  3PUA A;  4HON A;  4DIQ A;  5IVF A;  3DXU A;  3OPT A;  2P5B A;  5FZB A;  5LY1 A;  3N9O A;  5FZE A;  2OX0 A;  3N9P A;  2YBP A;  4URA A;  5A3P A;  2PXJ A;  2XDV A;  4Y33 A;  5F2W A;  4GJZ A;  5FZM A;  4V2V A;  3AVR A;  5F3G A;  2XUE A;  4CSW A;  5IVY A;  3LDB A;  5FZ7 A;  5FXW A;  3RVH A;  2Q8C A;  4CCK A;  5IVB A;  5FZO A;  4IGP A;  5FWJ A;  4EZ4 A;  3N9M A;  4LIT A;  4XDP A;  3KVA A;  5IW0 A;  5FZ6 A;  2XXZ A;  3K3N A;  5A3W A;  5FZK A;  5IWF A;  5FZ1 A;  5ANQ A;  3U78 A;  5KR7 A;  3DXT A;  4Y3O A;  5FBJ A;  4GD4 A;  5FY1 A;  5F5A A;  5F5I A;  5FP8 A;  3KV9 A;  4HOO A;  3PUQ A;  5FZI A;  5FYI A;  3ZLI A;  4CCN A;  4UF0 B;  5A3N A;  5FZA A;  3KV4 A;  3UYJ A;  5FXZ A;  4CCO A;  5F2S A;  5FPU A;  3KV6 A;  5FYS A;  2OQ6 A;  5FPA A;  3K3O A;  5FYY A;  2WWU A;  2YU1 A;  5FZD A;  5FZ4 A;  5K4L A;  4CUG A;  4QX8 A;  5FZG A;  2VD7 A;  2GP3 A;  5FJK A;  5FP7 A;  5FUP A;  2Q8D A;  5IVC A;  3N9L A;  2OQ7 A;  4QU1 A;  5F32 A;  3N9Q A;  5IVJ A;  5FZ8 A;  4GJY A;  5A7P A;  5F37 A;  4TN7 A;  5F3I A;  5F3C A;  4C8D A;  3PU3 A;  2OT7 A;  5FWE A;  5FYM A;  5A7W B;  4CCL A;  4EZH A;  5CEH A;  5F5C A;  2W2I A;  5FY5 A;  3K2O A;  3PUS A;  2YU2 A;  4LIV A;  5F39 A;  4QWN A;  5FV3 A;  3AL5 A;  3PTR B;  3KV5 A;  3PUR A;  5FPV A;  5FYB A;  4AI9 A;  4D6R A;  4LIU A;  3PDQ A;  2Q8E A;  5FYT A;  2XML A;  4NUB A;  4QXB A;  5FZ3 A;  5A1F A;  3LD8 A;  5FY8 A;  4E4H A;  3OPW A;  4GAZ A;  5FZ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...