5F32A

Crystal structure of human kdm4a in complex with compound 40
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
344
structure length
342
Chain Sequence
SARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysine-specific demethylase 4A
publication title 8-Substituted Pyrido[3,4-d]pyrimidin-4(3H)-one Derivatives As Potent, Cell Permeable, KDM4 (JMJD2) and KDM5 (JARID1) Histone Lysine Demethylase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 105
structure length 342
sequence length 344
chains with identical sequence B, C, D
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5f32A01
3N9LA 5F32A 5ANQA 5FPLA 3UYJA 5A3TA 3K3NA 5FZOA 3N9QA 4QXBA 4D6QA 2VD7A 2Q8CA 5FPUA 5FZOB 5LW9A 5FWEA 5FYYA 4AAPA 2GP5A 5FYIA 5F37A 5FZ0A 5FXVA 4V2WA 3KVBA 5FP4A 5A3PA 5F3EA 5A7WB 4C8DA 5FYCA 5IVYA 3N9NA 2GP3A 5FPVA 5FY7A 3PUQA 2YPDA 4D6RA 4DO0A 4CCJA 3ZPOA 5FYVA 5FP8A 3OPWA 5FYBA 4BXFA 4CCOA 3KV4A 5FZ4A 4BISA 3PURA 4QX8A 2XUEA 5FYHA 4LIUA 2OS2A 5FZIA 4QXCA 3N9OA 5FYMA 5FYUA 4CCLA 5E6HA 2P5BA 5ISLA 5FZ7A 5FPBA 4QU1A 5FZFA 5F5CA 2Q8DA 2OQ6A 4ASKA 5IVFA 5IVEA 5FBJA 5FZKA 1VRBA 5A7WA 5A3WA 5FP3A 5FZ8A 5FP7A 3U4SA 5LWBA 5A80A 5FY4A 5FWJA 4GJZA 3AVRA 5FZCA 5FYZA 4GD4A 4UF0A 3KV5A 3RVHA 5F5IA 5FZGA 3PUAA 4UF0B 5F5AA 5FUNA 5A1FA 3AVSA 2OX0A 5A7OA 4LXLA 4URAA 3K2OA 5F3IA 4QX7A 5IVVA 4AI9A 3DXUA 4NUBA 5A3NA 2OQ7A 2Q8EA 4IGOA 5FY5A 4LITA 5FUPA 4BU2A 5FZBA 3N9PA 5A7NA 2XDVA 2YBPA 5FYTA 5FZDA 5F2SA 5IW0A 4LIVA 4HOOA 4XDOA 3N9MA 4QXHA 4HONA 3PDQA 3KVAA 3PUSA 5FPAA 5A7PA 4CSWA 2YU2A 4DIQA 5FJHA 3OPTA 5FZLA 4GJYA 3ZLIA 3AL6A 5FZEA 4V2VA 3DXTA 5LY2A 5KR7A 2W2IA 2YU1A 5FZ9A 2YBSA 5FZ1A 5A7SA 4IGQA 5A7QA 2XXZA 4D6SA 2WWUA 3KV9A 5FV3A 4CCMA 5FJKA 5FY1A 5FY0A 4EZ4A 5IVBA 5FYSA 5IVJA 4Y4RA 3PU3A 4QWNA 5FY9A 4IGPA 4CUGA 3PU8A 4Y3OA 5FXXA 5FXWA 5F3CA 5LY1A 3NJYA 4GAZA 2OT7A 5FP9A 4Y33A 5FZHA 2XMLA 3AL5A 5F39A 5A1LA 3KV6A 5FZ6A 2PXJA 5FZAA 3LDBA 4EYUA 5IVCA 4CCKA 2WWJA 3PTRB 5FY8A 4E4HA 2YBKA 4TN7A 5FZMA 5FXZA 3U78A 3K3OA 5F3GA 5F2WA 5FZ3A 5K4LA 5CEHA 5IWFA 4CCNA 4XDPA 4EZHA 3LD8A
chains in the Genus database with same CATH superfamily
2JG8C 4QX1A 4DRRA 5J1XA 1YQCA 4HSJA 3IWZA 4A6SA 5FZOA 1WZXA 4HMZA 2R16A 3HD8B 4LHLA 2WNUC 2VOKA 5C6CA 1QNYA 1FYUA 5FYYA 1XPWA 2HYXA 3LCPA 3S30A 3CL1A 4COUA 1W6MB 2EICA 2LALA 4JV4A 3DL3A 3UK9A 5JWPA 5FYCA 1RC6A 5ACA2 3ILFA 4N43A 3VD3A 1HRI2 4P5HA 4XETA 4Z82A 3GHMA 5FY7A 3PUQA 4NN0A 1Q8OA 4TXWA 5CISA 5KHGA 4WBBA 3O14A 1SLLA 1QDCA 4CCOA 2AZ5A 2HWF2 4XE9A 2XLFA 4R9BA 5DZEA 5JOXA 3GGLA 4FPKA 4BH9A 4LIUA 3MUY1 1GP4A 3S57A 3KWVA 1R081 1QQP3 3A0NA 2HLEA 4YW6A 1BMV1 1I9RA 2NPIA 3H1MA 4M4RA 5BV6A 5HXMA 4ASKA 3M3IA 4JKMA 4NPLA 3SKJE 3FLPA 1GQHA 1JYIA 1ZBA2 2J1SA 4BQWA 3WNLA 2Z2SB 1H1MA 4MH0E 1UMIA 4LBQD 4LLFA 5FP3A 4ZU4A 3U4SA 1UMHA 1ND2C 3NSTA 2EXHA 2VBBA 5FWJA 2I74A 2DF7A 5EFUA 4GWMA 2E31A 1L3JA 2QQKA 2XJQA 4AVAA 2VBPA 1H6XA 1HXS3 2R041 1GOGA 3KV5A 2YYOA 5F5AA 4AHZA 4YM2A 3VKNA 4PF5A 3H8XA 2CYFA 2RS11 1VBA3 4QXKA 5EJ1B 4IV3B 2P17A 5C33A 3I2JA 2D98A 3APBA 5FY5A 5FK7A 2FBEA 2FDFA 2ETEA 2JKBA 1S55A 2X5IB 2ZGSA 3PMSA 4XDOA 3VBRC 4BPZA 4QXHA 5C9AC 1AR91 3NWKA 3MLLA 1VBD1 2FMYA 2PTMA 4CEWB 3VHNA 5LK7B 1LB2A 3C3VA 5FMOL 1W8HA 1WBLA 3AYDA 5FJHA 4AHXA 3WHTA 5F6LB 2K46A 1LR5A 3B02A 1R1ZA 2I45A 2JB4A 2O1QA 3AMMA 4XUTA 2YU1A 4QMAA 5LY2A 1ODNA 5A6XA 3FMGA 2DVGA 2MEV1 2KXLA 2ZJCA 3WXPA 3VBOC 2XJUA 3WP3A 2VC9A 1UNBA 1COV3 3UGFA 3UGGA 1DFQA 4BE3A 4YM3A 1PX4A 3FC0A 4IGPA 1DIWA 3HBKA 2R073 3WY6A 5BPXA 3Q8EA 4OMDA 1ULCA 1O7FA 3I2OA 3C7OA 4AVBA 1AL22 1E5SA 4LK7A 3OCPA 1NA1C 1ULDA 3O1MA 1V6NA 3TAYA 2VZPA 4FPGA 3RNSA 4IEWA 1AR72 1OD5A 2C5DA 4IV1C 2BFUS 2HWD1 1CX4A 1QJU3 4I3PA 5DUVA 5EQUA 4DFSA 2ZKNA 3AKRA 3ZO0B 4HK8A 4B7EA 1QXPA 5IYYA 1OQ1A 3BYWA 5I0SA 1N3QA 3CJIB 5LZ6A 3VKOA 3AP9A 1Q8PA 2VZQA 4CDUA 1H9WA 3ZXKA 3RYKA 3LB9A 2GMMA 1UIKA 5BNNA 1MPXA 1LOGA 3GJAA 2Q8CA 4Q4V3 5JPMB 2CDOA 3MW2A 1XNAA 2D6OX 2RS31 1OUXA 2VCBA 1BBT3 4FAGA 3GZEA 3KT1A 1GYKA 3HOBA 1KQRA 3ZM8A 4LHNA 3GBFA 5EIYB 1OPOA 2CV6A 1EUUA 1OI6A 4TLGA 3ZN4A 1PO13 2WC2A 1I3HA 4Y1XA 5IVYA 5EJ3A 5HCFA 4LA2A 4DO0A 2IXKA 3DGTA 1YLLA 5T5JA 3J8F3 3POIA 1UWWA 5JSPA 2LS6A 3IBMA 4CU7A 4A44A 4M00A 3J4UH 1PZ9A 4Q4X2 3QOPA 5FZ4A 4BISA 5JXGA 4I30A 3ZFFA 4C1XA 1N1SA 2CAVA 1JHJA 2OS2A 1R1A1 3ABZA 3ME2A 2VUDA 1XB9A 2JENA 2D6LX 1BZWA 2F4PA 3LEMA 1QHDA 3N7LA 3PMEA 1DQ6A 4CCLA 4CDXB 5GLVA 3WQ1A 1PVXA 4XIOA 1CAWA 5IVFA 1PNFA 2QJVA 5L9VA 5IVEA 1S2KA 5FZKA 4NVPA 4QPIA 1QJFA 1PIV3 1VBC1 2JDYA 4PQQA 4CP9B 3DYOA 2VQ0A 5A3WA 4IEUA 5FMBA 1LKNA 1DF0A 1Z0HA 3Q8AA 5FZCA 5DG1A 1C1FA 4QX0A 4UYBA 5CIRA 4ZZ5A 2V4AA 3RVHA 1ZRIA 1XYNA 2EA7A 1DYKA 3MIHA 1OUSA 5BNOB 4AI0A 2ZGMA 2WNOA 1D4M3 1OQDA 2IC1A 4M3CA 3JD73 1SBEA 1ZA4A 1L7QA 1HV0A 3EYPA 4GB33 5DUUA 1O4ZA 1NCRA 1RUI1 2JDMA 2V73A 3JU9A 4EWEA 2AENA 2YBPA 2VMFA 1LOCA 5CZKA 4XMIA 5DDJ1 2SBAA 5LK5A 1FOD2 4AG4A 1WCKA 1AYN1 3I4IA 3JB4C 3MFAA 5K7PA 1TME1 4LT5A 2JDAA 3GNEA 1AJOA 5IAXA 2E53A 4CXWA 1CWPA 5LASA 1W6PB 2W2IA 3GCWA 1QJZA 4Q4W1 3L2HA 4K20A 4PIYA 2YBSA 2X53S 1UYYA 3HMYA 1K12A 1DGRA 3WV6A 2PFWA 5KHJA 2XLGA 4RL7A 1TE1B 1S0JA 2VXRA 4PLNA 2RMU1 4YVSA 2JJ6A 1IKQA 5GLTA 5C8WA 4UW6A 2DV9A 2PHDA 3WDVA 2D97A 4D94A 1JZ8A 2WINB 3CMGA 3OY8A 4AEDC 2RDSA 1DQ2A 3VZLA 3SC7X 1X9TA 2VOVA 3P6BA 1POV1 4HFSA 4JRLA 4YW5A 1ASJ1 3WQ0A 1W90A 4HL0A 4FPEA 4Z2WA 2AEZA 2DBNA 2PHWA 2J1UA 5LRRA 3ZIXA 1UX7A 3J7LA 5G05L 1BEV1 3VD7A 3WNOA 1SCRA 1LHVA 2ZGRA 3U07A 1Y9MA 3T0DA 4QDQA 2GH2A 3HT1A 1GZWB 1RYYA 3PVEA 4E4HA 1G9AA 2Q8OA 1LOFC 4QGNA 4CP1A 1W05A 2VJXA 1RUF2 5AFEA 4NPMA 3KF3A 1S4CA 4DMIA 3ZMOA 4EZHA 2F17A 2YC4A 4IEOA 1JZ2A 4QPGB 3D3AA 2W1SA 5J48A 4AQ2A 3MI8A 1JYTA 4MHUA 3I3BA 1GSLA 1H4GA 4INDA 1M4WA 2Q1ZB 3LKJA 5FZOB 3AKQA 4JX0A 3AP7A 2QQMA 1CAXA 3VZKA 1YJLA 5FKBA 3JBG3 1FNZA 3R0RA 4HLTA 5ACA1 1HRI1 1MVEA 4UW5A 4YW7A 2GAUA 5KXBA 2W91A 3K77A 4P9IA 1ULOA 1O4TA 4XMAA 4D6RA 3DPRC 2RJLA 4FPYA 2HWF1 4WM8A 4JGYB 1NQJA 2PLV3 1GZCA 5F7UA 1D0HA 2B45X 2WL1A 3IAPA 4QX8A 4CTEA 3IIIA 4MADA 4YSFA 3T09A 1STMA 4XF3A 5CU1A 3MYXA 1JN2P 1CPMA 1QQP2 2ZX3A 3VBUC 3OJBA 1LOBA 5E6HA 3WNKA 5FZ7A 4DQAA 1ZBA1 4AI8A 1CR7A 1F2NA 4FI9A 3MIDA 2DFBA 1ALYA 3SCFA 5I91A 4LLOA 1VRBA 1O8PA 4AL9A 1BCXA 3WZ1A 4DRVA 4WVZA 3VD9A 3M3QA 1WW5A 1BVP1 4F8AA 1RJ8A 3FUQA 3NV4A 2QQLA 4GD4A 1R64A 3S0MA 1AJKA 1HXS2 1V6JA 2RDRA 2XLAA 2GSYA 3KCCA 2VE1A 3H42B 4RR3B 4UI9L 2Q0AA 4HVRA 2VNGA 2WUHA 4XYXA 3VBHB 3VHRA 5KWRA 3ZYHA 2OPWA 2QDNA 1QDOA 4GWIA 5FO8B 1DLCA 2LROA 5ANNA 3MV01 5FZBA 4RGGA 2JDPA 3MF9A 1H2LA 4GKYA 5FAXA 3MIEA 4JDMA 2W3JA 3MLKA 4TWTA 3ENRA 1NLRA 1X33A 4QM9A 4CDQC 3VBSB 3EJKA 4G4FA 3TN93 5J3UA 4WVVA 5FPAA 2A6WA 5C8CB 3TNQA 4CSWA 1T6BX 2DBIA 1DLLA 1QF3A 2B7YA 2HJIA 1ZBE3 2V4VA 3M3CA 3R6SA 1SMVA 5CG8A 2WO7A 3J26N 4HN0A 4HXCA 1OKQA 3BTXA 1JOJA 3KQ4B 2ZX4A 2OVUA 3ZSJA 1PM4A 1SFNA 2RM21 3F95A 3SXWA 4AK3A 3R4DB 3KV9A 5D2AA 4AEKA 4IE5A 4XOGA 1GANA 1OSGA 2VXJA 5FY0A 5A3LA 1RUG2 5BNPA 4FP2A 1EP0A 1N3OA 5IVJA 1AR62 1EAH3 4N7UA 1OMIA 1W8TA 1ZVFA 2R072 4GXLA 3ZYIB 2BBVA 2B9VA 2HWB2 3VBFC 3W21A 2JD9A 1AL21 2FQPA 4CU8A 4NIGA 4E4ZA 4DUXA 4BMEA 4AFDA 1A78A 2W92A 4GWNA 4OYUA 4QM8A 4RYDA 3OGGA 4GQ7A 1AR71 3IDBB 2GNTA 2YZ4A 2P34A 1EY2A 1YYNA 2QQWA 5A6ZA 4A4AA 4C1WA 1YRZA 4L99A 3S5AA 2I07B 4XJZA 4XFCA 2AR6A 1Y3TA 4N9IA 3PJYA 2PHXA 5C71A 5GLUA 4A6OA 1SFPA 1LGCA 2DDUA 2D3RA 2DUQA 1SQ4A 2HYKA 3M7AA 1MS1A 2JD4A 1YJKA 1Z7S3 4G9SB 3OG2A 4K7JA 1J3PA 1T2XA 4M3CF 1KS5A 4QDSA 3C8XA 4W8JA 2TUNA 5IWFA 1O3QA 1LHOA 2XBO3 4ZONA 1PM7A 2TNFA 2ZAHA 2IFRA 3SH5A 1ZX5A 5C3RA 1H8TA 3T4VA 1GWKA 1PK6A 2R1DA 5BNNB 4LKDA 3ZR6A 1MACA 2R0FA 1MZ6A 4AF9A 2E51A 2BVBA 2ZGPA 5DUWA 5A33A 3AZVA 4TTGA 2ZGUA 4HPKB 1UPIA 1MEC3 5EHDA 1ZZBA 5ERLA 4NRPA 5A3OA 2D93A 2ET1A 3VZNA 3FL7A 3MF6A 3M2MA 1UCXA 5K0UC 4JHZA 4Q4X1 3IDAA 3J8F2 3GYDA 2P2KA 3OPWA 4XXPA 1IG3A 1VB2A 3TBDA 1ZRCA 3WOGA 4UOJA 1DG6A 2Q4SA 1OXCA 3LQCA 4HKWA 2CY6A 3C7FA 2ADEA 4F83A 2OA2A 5I0RA 2BPA2 5F5CA 1AYM3 1BK1A 2CHHA 3PTYA 4XF0A 3LSDA 5IT6A 5LA1A 1PGW1 1EPZA 4HBNA 1W6MA 1VBB3 2WLQA 1PIV2 4S2GA 2VTFA 3BI3A 1CAVB 4XFGA 3HEIA 5FQ0B 3JUUA 5FZ8A 1JZ5A 2ZZJA 4ZPIA 4ZZ8A 1PO23 5BUVA 1ND3C 4RQPA 1RJ7A 5FY4A 4ASLA 2D3PA 4QX2A 1YIPA 3POSA 3AYEA 1CN1A 1JW6A 4AHYA 3SHRA 1B35B 1OQEA 4UFKA 5CFCB 4NR1A 4NIHA 2ES3A 1VRH3 4YFZA 1FNYA 1D4M2 5EV7A 1KXGA 3T0BA 2C6SA 3JD72 2JIJA 3KMHA 3AZZA 3PVNA 1NT0A 4GB32 3N9PA 4JQRA 4TYSA 4FPLA 3UJQA 1FOD1 2JX9A 3ES4A 1BK0A 1WLDA 2GMPA 4KH9A 4B29A 4FFFA 4HONA 4EQVA 1V00A 5J96B 3GZUC 2JE7A 5FMOS 2QVSB 1IZ3A 5A3MA 4LOSA 3JQWA 4PDWB 3V64A 3WQ7A 1RUH2 5KHHA 4H55A 4JRAA 1HJGA 5T50A 4IEYA 4IUGA 4G3YC 2WA3A 5JSRA 4N7IA 2NMNA 1GICA 4XUPA 2X8KA 4YNIA 4IV3A 3B7MA 2LTNA 1Y9QA 4LUKA 4N43C 4QWNA 4WM7B 1O59A 4NJ4A 2RS12 4IL7A 4XHXA 1S2EA 2OT7A 3UT0A 2X5IA 4RA0A 5J09A 4A7YA 2RE9A 4CEWA 1XOYA 3T1LA 3DV8A 1UYXA 1AX2A 3PIGA 1WMEA 3RI8A 4J25A 4DNYA 3WDWA 3T2QA 1WD4A 3BPZA 1X8EA 5F3GA 3MW4A 1VAVA 4QQ2A 2YV8A 4KI5M 2MEV2 1YHFA 1K3IA 3CO2A 5JUVA 2FCTA 4HVOA 4IQPA 1OFSA 2ZX2A 2ZGNA 3RZHA 1EUTA 5FFOC 5LCWL 3LOBA 1CONA 2YPJA 2W1UA 3WF4A 4YARA 2XJTA 3IPVB 3SH4A 4E4DX 3IZOA 1KITA 4RN5A 1XNCA 2VVEA 3KSCA 4DXSA 1WGPA 2ZHNA 1CJPA 1CIWA 4X8PA 2OKXA 3CJIA 4FTEA 2Y6FA 4K40A 1QQP1 5FYHA 3EO6A 1GUIA 1NAEA 4MGYE 3ZYGA 3KHBA 5F8PA 4L92A 4XC9A 5KC6A 1DGRN 2QNKA 1A34A 5JAXA 2LUWA 2C1FA 4O61A 4FQ4A 3H3LA 1ENQA 2UY9A 5FK8A 3VDBA 4IERA 3S5QA 2WT0A 3MFCA 4NAOA 3DYPA 1HXS1 3KCYA 1RUD3 1NQDA 3AZYA 3ILNA 3NNMA 4LOTA 3IM0A 3MIBA 5FCCA 1Q3EA 4YZ3A 5E88A 1VBA1 3VBRB 2UWCA 4LKSA 1F31A 5FOJB 4MX3A 1C3HA 2YGLA 3WUDA 5GALA 5ABJA 3LOIA 3NAPC 4ZKTB 4ET7A 3ZXEA 4LITA 1PHMA 4CDXA 1C5HA 2QTWB 1CX1A 1QEXA 4QGMA 1QOOA 3E5XA 1W8FA 1L7LA 1EV13 2ZEWA 4PCRA 4XFAA 4Y1YA 1E5IA 4XABA 1S1AA 3AJYA 3MLJA 3PUSA 2XJSA 4LK6A 3TN92 4CP9A 3NO8A 1UOGA 5DUXA 2FHRA 3IN9A 5CB7A 4LBQB 1ZBE2 3O0VA 2IVJA 4DY5A 1OH3A 3OEAA 4MVTA 4PLOA 4COVA 5EZWA 1CQ9A 5FZ1A 1COV1 4META 2XONA 1RUG1 1AR61 2Z42A 3DKWA 1F8VA 4R52A 1N1TA 1AXKA 5BNOA 2R071 4PT6A 4QDRA 5AVAA 4BQXA 4URTA 1NA1B 2EIEA 1N47A 2HWB1 2Y64A 2NP0A 4QHZA 4IETA 1IG0A 5FXWA 4RFT0 4GAZA 4PBPA 1A8MA 5FZHA 5KHIA 1QY4A 4N53B 4KBBA 3LZZA 3ZSLA 1SLTA 4BJ0A 5DQ0A 4DEVA 1QJY3 5IFPA 3B9CA 1RUJ3 2CWMA 3KGZA 3GM8A 3OPZA 1W6PA 2H6CA 1OBNA 3GALA 1PX3A 2XJVA 2XHKA 1W8NA 2EALA 1DYOA 1UOJA 1YFUA 4Q0UA 1CAUB 5LB6A 3R05A 1DDLA 1J3QA 1Z7S2 2DVAA 3GBGA 4XILA 5CEHA 4XDPA 3ZSKA 1MR5A 3HR9A 1RUC3 2JE9A 2XBO2 5FPZA 5F32A 2E63A 3QCWA 2RMU2 5DAXA 1BBT1 1Y43B 3ACIA 1ENRA 1S0CA 1DCSA 2Q5TA 4QXBA 4R4XA 4V1PA 3BN6A 4OI4A 3J7HA 5FWEA 1D2QA 3FX3A 1ENXA 3QLQA 1US3A 4GA9A 5FYIA 1PO11 1AX0A 3RDIA 3AZWA 2H0BA 3LEIA 3OEBA 4UW4A 5B4NA 5FR3A 2CGOA 3H3UA 4P14A 2Y60A 3LIHA 2W1QA 4MUVA 4E2GA 4I02A 3J8F1 3POWA 3H1WA 5EWSA 4B4RA 3RMXA 5JOZA 4F3JA 3OBTA 4DOUA 1G7YA 1YI7A 5FP8A 1CZVA 3BVCA 1H8VA 1ZZ7A 4NHYA 2CGPA 4JDNA 1AXZA 4YZ1A 4QPGA 4XACA 2YC2A 3MO4A 2JDZA 2C24A 5HCHA 3IKWA 4NHKA 4QQHA 2HKXA 4RHV3 1UOFA 2A5ZA 4LO8A 1FATA 2P5BA 4P02B 1RUNA 1AX1A 1TEIA 1KJLA 1PIV1 1SLIA 2DVFA 3UNPA 4OI1A 1W9SA 5FBJA 1ZZ6A 1JZ3A 1VBB2 4QX5A 5I0DA 2R062 4J6GA 5BNQA 2LM3A 2VUAA 2E7AA 5JXJA 2D6NA 2PYTA 4GJZA 1RMU3 2ZXQA 4RQPB 3VDDB 4NMIA 1WA6X 5FYZA 2CSGA 3QH7A 4JGYA 1IHMA 2W5FA 3EMRA 1BQPA 5E16A 3UKTA 4GMP3 1D4M1 2J1RA 4ITCA 4U36A 4W6XA 2ZGQA 3KZ4C 3JD71 5FTTC 3WP6A 1VRH2 2OX0A 2YY1A 4MXVA 4GB31 1IPKA 2GC0A 5F3IA 5A7OA 2QDRA 5CFDC 4IE4A 4XUQA 1QJEA 2Q8EA 1O3TA 2VMGA 4O65A 5CKQA 3LE0A 4EN6B 2EIGA 4UWDA 2ORXA 3GJBA 3M3OA 1TZOA 4LULA 1UY3A 3NNLA 3IDCB 3V56A 2GNMA 3KVAA 2ZHMA 1RUH1 4NHLA 2UYBA 3ON7A 2YU2A 4BZ4A 2AYHA 2QQUA 2V09A 2WN3A 2GNDA 4V2VA 4QHOA 4AEDB 2VZVA 3FN9A 4H14A 2Y6LA 2BGPA 2BOJA 4LO4B 4EE2A 1GNYA 2DUPA 3POEA 3N7MA 1H1AA 4UBGA 2HWC3 4RR3A 5BXXA 1RITA 2QCSB 3VBHA 4Y20B 3LA3A 3ZVXA 3RPQA 2DTWA 1ULPA 2PAKA 3LFIA 4CUGA 3KF5A 2A6XA 3NJYA 4OLLA 1LHUA 4WM8C 2JG9B 3I2IA 1MS9A 4Y33A 3QBQA 5C4WC 3AKSA 3FJSA 4UFJA 2BERA 4AGGA 3VBSA 1HIXA 2IZWA 2WA4A 3ZFEB 2XPJA 3WD5A 2K2SA 5EXOA 2ZTNA 5C8CA 4MXWA 4XJUA 1OLRA 4FFHA 2UURA 4CVUA 5LBCA 1QXRA 1JZ7A 5FZAA 4AR2A 4LO7A 1MQTB 1HLCA 1UY4A 3CKHA 4L11A 4XJWA 3LDKA 2XGXA 3HQRA 2ORZA 3WW4A 4JTOA 1PVC2 3ZKUA 3ZPYA 3AXEA 4CYDA 1WLTA 1PMIA 4IXLA 1UYZA 2BQPA 1UL9A 2D6MA 4XFBA 2RM22 1WCQA 5FPLA 5A3TA 2LRPA 4BIFA 1RHI3 2XH6A 1QH7A 1UY1A 3GF6A 3JBG1 2PHTA 4YG3A 3WSOA 4A3ZA 1SHWB 4AQTA 3POBA 1ZZ9A 2ZEXA 2GP5A 1IS6A 4GH4B 1POV0 4AQSA 5DABA 5FDBA 4RFRB 3T3YA 1JI6A 2GC3A 1GWMA 4XQDA 4H3WA 4YPJA 4ZY9A 1HB3A 1UZ0A 5GZEA 3E97A 2R0HA 5L73A 4PIXA 1W8WA 4XQWA 4OHYA 1KD7A 1A8DA 2TEPA 1JYVA 3KB5A 3KCXA 2JICA 1XNDA 1GZ9A 1CZTA 1HN1A 5B4XA 2YB7A 1DZQA 1P8JA 5FYMA 2D7FA 3Q8CA 4WZCA 4QU1A 3ZXGA 1AF9A 1VB4A 1ULEA 2GALA 2VAUA 1RUE3 2VMIA 4LO5B 1V9U3 2WSUA 4Q1PA 3U1XA 1RIRA 1YQ2A 1W8UA 4HPKA 5SV5A 3ZYBA 2WNVC 1VJ2A 2XG3A 4LA3A 3WW1A 2QFEA 5JCTA 5LWBA 1KDKA 4BHPA 3KGLA 4LBJA 4AI3A 1S2BA 1RUD2 4JGZB 3DEMA 2AACA 2HH9A 3LFMA 1OPMA 1H30A 3I8TA 2E33A 4XZUG 3G6JB 1GLHA 4CDQB 3OGJA 2IFWA 1BHGA 2B9UA 2VW1A 1ZZCA 2WQ4A 2JIGA 3FWEA 3O7OA 1OOPB 4XJ8A 3UJOA 1YEWA 1XBFA 4M3CE 5A7NA 4K3UA 2D6PA 3TN91 1ZM1A 4PI0A 4W65A 1EV12 2XOMA 2JDNA 4D0QA 2W9XA 3SMHA 1HQLA 1ZBE1 1CAVA 5FQ0A 1JH5A 2WAOA 3GHNA 3IB3A 1UKRA 2A75A 2NN8A 3DYMA 4IE0A 4KG8A 4AEMA 1ZREA 3ACFA 1PGW2 5I8TA 4CPBA 1SLAA 3TB0A 2VNOA 2WKKA 2P4EA 4IGQA 1UN1A 2XHNA 2ZGTA 5A7QA 3WUCA 1B35A 3QD6A 1LOEA 4RS5B 4D6SA 5CFCA 4MGTA 4CDWB 4EZ4A 4BLIA 4SLIA 5GZFA 1RUOA 4Z07A 1FV2A 1XE8A 4FXGB 2XQRA 4P9YA 1LAJA 1GP6A 1I5PA 2A3YA 4JTNA 3BU7A 3WP5A 4ARXA 1VP6A 2DCZA 1Q8VA 1QJX3 1W9TA 5D8AC 2VG9A 3KV6A 4BLJA 4DZGA 3Q8FA 4AFBA 4DPNA 2RJ2A 2NQYA 4L8QA 1RVF3 3CEWA 3RGBA 2VO5A 5IK7A 1V70A 3BCWA 1HRV3 5CKNA 5FZ6A 1QJY2 1RUJ2 4PDWA 2WZR3 3NNGA 2LW8A 5JOWA 1IPSA 2EIDA 1N1YA 1Z7S1 3EQEA 4IESA 4LHSA 1J1LA 4TN7A 4AFAA 3RSJA 2XBO1 5DZFA 1SBFA 1FMD3 1RUC2 4WM7A 3SITA 1GWLA 4LBLA 4LBNA 3OGVA 4DB5A 2JKXA 4DXRA 5CBLA 5FPUA 1FAYA 4S2FA 2B39A 2EAKA 3KT7A 5FZ0A 4V2WA 5FP4A 5DAPA 1VPHA 4XUOA 5A32B 2JG8A 1QKQA 4NRQA 4XEZA 2MPFA 5LA2A 3AFKA 5GKAC 2QZ3A 4CCJA 1X9PA 4FO9A 2ERFA 2F6BA 2TBVA 1H2KA 3I3EA 4GZ9A 2J1TA 5APAA 5T3NA 3VV1A 1H0BA 1HV1A 4WZFA 2P37A 5GZCA 3URFA 1B09A 5AVPA 1UW8A 5E8AA 1BVVA 2B5HA 3ILRA 2R32A 4QXCA 3RZKA 1AYM1 3NJXA 1ND3B 4RHV2 2O8OA 3B94A 4AW7A 2WS93 4YVWC 2VPVA 3VUOA 1VBB1 1OURA 2R061 2Q8DA 1UQXA 3ZN6B 4XAAA 3IPVA 5LEJA 4FT8A 4AOCA 1PO21 2MHFA 2JWPA 1AR93 3LAGA 2WZPP 1IGOA 1DP0A 2XVKA 1OVPA 4PJYA 5A80A 3O1SA 5HV4A 1RMU2 2H0VA 4AVSA 2G4IA 2QQIA 1DGWX 1SZBA 1VRH1 3O0XA 3O5SA 3HT2A 4Z1VA 3T2PA 2BOIA 3I3QA 2XJPA 2PHFA 3GDBA 4KMQA 4E27A 1YFXA 3ZFGB 5EYXA 2OQ7A 1POQA 2XR4A 4QQOA 1ND2A 3OF1A 4XTPA 4IEQA 1GP5A 2VMHA 4QD2A 1W04A 4OHXA 2VZ1A 1LODA 3UESA 4UFLA 5A6YA 4Q0PA 2CNAA 1O6UA 4XJAA 1OLMA 4LEJA 3F2ZA 3RWKX 5F9TA 1NE6A 3HJRA 4CRQA 1REEA 1LGNA 1MZ5A 4BM8A 3ASIA 2HWD3 3VBRA 1X7NA 5GLZA 4CCMA 4KU8A 1C8M3 3RYRA 1FV3A 1VBA2 3AP5A 2E6VA 2W46A 4XBLA 5AC93 1J83A 1VBE3 2F4LA 1JYWA 4B1MA 5I93A 1U5XA 2FZ1A 5BY5A 2EVXA 1DQ0A 3VBOA 4AXOA 1KRIA 2ATFA 2WBKA 4W6WA 2VTXA 3AP6A 2DVDA 4K8RB 1NCQC 4LBQA 4FVVA 4MXWB 1HDKA 2B42B 1H9PA 3W5NA 1VMFA 2YFUA 1PVC1 2WWJA 4OVEA 3OUIA 4LHKA 5JXIA 1J58A 3SNMA 4KL1A 1A6CA 1YI9A 4CEYB 4O7XA 2OZJA 4BQ5A 2WO2A 1NA1A 1NUKA 2IXJA 1COV2 2VZRA 3LD8A 1CIYA 1J59A 2FMDA 1LJ7A 2NM1A 1LHWA 3K3NA 1AXYA 2VH9A 3GBWA 3QACA 3VZMA 2QQJA 3N9QA 1QNWA 1FPN3 1SACA 2IXLA 5FOBB 3RJRA 4N53A 5LW9A 1W2NA 3R4SA 3WDXA 1GU3A 2DYCA 1W0PA 3AMNA 2A3XA 4FPCA 2PAMA 1S0DA 3H3ZA 2A6YA 2X05A 2RDNA 4D7TA 3WF0A 5FXVA 2SLIA 2WNEA 5L36A 5ABJC 1QIQA 4NWVA 3E5UA 1YXWA 1OA2A 2VZOA 2Y26A 4CDXC 3OGRA 3RQ0A 2XKOA 2P3JA 3IT8A 1ENSA 1QJU2 1CAUA 2P1BA 1CGPA 4WVMB 1XE0A 4J1WA 3PNAA 4MGZE 3V65A 1XYOA 1W8OA 2FDHA 2BP6A 4YW4A 3WCRA 4AFMA 1LESA 4LBKA 4KWKA 4AGRA 3E6CC 4UFHA 5FZIA 1GNZA 1I5ZA 5JZGC 4BQ4A 3ZYPA 5F1RA 4Q4V2 5C5TA 2VZTA 1RUE2 3H8RA 2V5DA 1BBT2 2WQ8A 1V9U2 1BYHA 1JXNA 3ZIWA 2Y33A 1R093 1G9BA 1RUD1 1SLCA 1K5MB 1W0OA 4QKNA 5T5PA 3OSDA 3NAPB 1PO12 2BVVA 3IDEA 1DZRA 4Y4YA 5E89A 2VQAA 2JB8A 3DN7A 2FCVA 1GOFA 3NV3A 1SDDB 4PF1A 2WT1A 3T2TA 4P08A 3SLIA 2W95A 3WHUA 1APNA 1PGL2 2WO3A 1YIFA 3A7QA 1S0IA 4PQ9A 4B8EA 1IS3A 1F35A 1TNFA 1ZNPA 3WLUA 3WG3A 4BWOA 1W9WA 1JYNA 3AK0A 2DCJA 1EV11 2E9QA 3AP4A 1PGSA 4X8NA 1X82A 1ASJ3 1URXA 1S0GA 4K6BA 3VD4A 1XNBA 4C91A 1ZRFA 3CZJA 1SCSA 4L97A 2CU5A 2BFUL 2J1VA 2WYFA 2X09A 1UY0A 4XCAA 3VDDA 1FT9A 1LU2A 4X6RB 4XDQA 2WFF3 1LRHA 2WAAA 1GMMA 2AC1A 4MGIE 1QOTA 2QBXA 2BUKA 2PA7A 4AI1A 2O14A 4Q29A 4QPWA 3JCIA 3NVCA 1XQNA 4LE4A 3KHCA 2UYAA 1NYWA 1VR3A 3PU3A 5DXDA 3RG0A 5JI9A 3VGIA 1A3KA 2ZKLA 5CG9A 3AXDA 2Y34A 5I8YA 5A1LA 4Q5OA 5FO7B 1D0GA 1QJY1 1RUJ1 2UWAA 1RVF2 2JDKA 4QPGC 2K0GA 5HPOA 3I49A 1HRV2 2VQUA 4OUEA 4UFMA 1LENA 5ACA3 2ARCA 2WABA 3LSEA 2WZR2 3UV9A 4AEDA 4PHZA 5IAVA 4Q8KA 3ZKYA 2YDEA 5L7OB 1JOPA 1KJRA 4E8DA 3U11A 5FXZA 1UO9A 5H9SA 1KGYA 1C28A 1RUC1 3AB0A 4YYOA 5EJZB 3WG2A 5EPAA 4Y20A 4Y22B 2FDIA 3V0BB 2R49A 3LWCA 5GLWA 3WQBA 4E8CA 3THCA 4FOYA 2XVGA 3N9LA 5KC5A 1W6OB 2ZOEB 4R9DA 2Q30A 2DCYA 2GN3A 3O1UA 4JZRA 1RINA 2JG9A 4JGYC 1RL3A 3RJ2X 4XZPA 1H4HA 1F9KA 1NLQA 1LOFA 2AREA 4OZOA 4AAPA 2PQSA 4UT5A 3ZFEA 4BQ2A 3ECQA 2VCAA 2DVBA 4EV0A 1WD3A 2XWBB 4A45A 1MQTA 3HIFA 3H8OA 1MS0A 2JG8B 2IXHA 2G9ZA 4D7YA 2J1EA 4MOAA 3ZDSA 5DAVA 1E5RA 1PZ8A 3EB7A 5C3SA 5KHKA 1UKGA 1ZA7A 2WNUB 5FYVA 1XYPA 4JKLA 4NRMA 4LR4A 4TLFA 4Q8LA 3KV4A 2G9FA 2JDUA 5T52A 4RHV1 1H2MA 4BQYA 3AYAA 3ZDVA 5K8SA 5LRSA 1AL0G 4J1XA 1TQ5A 2WS92 2YFZA 1HQWA 3DPRA 2VOXA 4RR3C 1LECA 1W2OA 2OQ6A 3E6BA 4YM0A 4GH4A 3JBG2 4P00B 3EBRA 4RGKA 2ZX0A 3W5MA 3BU0A 4KNCA 1RMU1 5DAQA 2PELA 3BKZA 5CFDB 2VZ3A 5FUIA 4SBVA 2P6HA 2VQTA 4GMP1 3S7EA 3KT4A 3LF7A 3OOXA 3VBSC 2OUJA 5TSWA 1ZYBA 5C8CC 4OZXA 2K9ZA 3AVSA 1S0BA 2PLV2 3OTFA 3D0SA 4ISQA 4B4QA 4BDVB 3PLQA 5GZGA 3EHKA 2QE3A 1W28A 4OQ8A 5LBBA 1QMJA 1ND2B 3CU7A 4FPOB 4IE6A 4JVAA 2VULA 3N9MA 3TRSB 1WLCA 4H7MA 3MGUA 2WO1A 3OPTA 3MUZ1 3AL6A 1LCLA 4JGZA 4NROA 3WDUA 3D82A 4MGSA 4YGDA 4PIZA 4YLZA 3LEKA 5DZGA 5C4WB 3CIHA 4DY3A 1W3XA 1D2SA 3NMBA 4CDQA 5FIXA 1FI2A 5C9AB 4JDOA 1C8M2 2EAAA 3U37A 4KGGA 2BEOA 3WINE 4CUCA 5A70A 3PU8A 1OOPA 4ISRA 2EF6A 4YGEA 5AC92 2E26A 1GQGA 2L9LA 3TEWA 3CQOA 4I09A 3VDCA 1S0FA 1JZ6A 1SG3A 1XC6A 2YGMA 4NAMA 4BQ3A 3DF0A 3VBOB 2VCCA 3HNYM 2QZ2A 5FREA 4CDUC 1AUYA 3DECA 2A73B 1VMJA 2XL7A 4LO6B 3U14A 5IFTA 3MZHA 5BNNC 3KLSA 4HSLA 4XBNA 4A7KA 1UYPA 2G19A 2D5FA 4JHTA 4XFFA 4CCKA 3VKFC 3I59B 1DGWA 3BALA 3VBFA 4NO4A 2R7EB 3MIFA 4E9KA 2A6ZA 4IEPA 3PHMA 4RS5A 4CDWA 1LOAA 4DXZA 1RHI1 1OVSA 2A71A 4GULA 4HT1T 4AHWA 4P9GA 3NNFA 4LTAA 3SQOA 5ANQA 3BGAA 1EAH2 1K45A 4XBQA 3WNMA 1FPN2 3CBNA 5HCAA 4IV1B 5EYYA 3ZXDA 2Z79A 3ACHA 1RXFA 1WW7A 3D5OA 3POYA 4FFGA 2EIBA 4M01A 4H7LA 5JXHA 4A3XA 1JZ4A 2XWJB 3ZFFC 1RXGA 3THTA 4ES9A 3G7DA 4TSVA 3V0AB 1QJU1 1EYBA 1JUIA 1DYPA 3UKNA 1O5UA 3N9NA 1CPNA 2IWGB 1YQ5A 3UETA 1SPPB 1BJQA 1F15A 4HK9A 5FLJA 5JMCA 1G9CA 5C3QA 1MS3A 2Z69A 1FXZA 4QPIC 4Y5TA 4BXFA 4MYEA 3AZXA 3OGSA 3TEXA 4FPFA 1TMF3 3P5BA 1H1IA 4Q4V1 3VN4A 4QT6A 2I2SA 1RUE1 4BK4A 3RZJA 4FPJA 5ISLA 1V9U1 4BXSV 3B5LB 4NWWA 5FZFA 5K0UA 4CP0A 3N35A 2WRAA 3HNMA 2FD8A 3HAGA 4XF9A 4JAAA 3VHOA 4MG2A 3INAA 3RMYA 1R092 5A32A 1KFUL 4Y24A 2VW2A 1MEC2 2W1WA 1NZCA 4DS0A 1NCRC 5CKMA 3AX4A 3A21A 2C9KA 2ZABA 1PGL1 4DUWA 4MZUA 5JIAA 3FLRA 3SEPA 3N4MA 4ZXEA 2PHLA 4DUVA 4IW3A 4OHZA 2ZEYA 4LKEA 2ZS6B 4Y1ZA 4FSJA 2BYVE 1O4YA 4YW2A 3JB8A 4CA9A 4CXXA 2VUCA 1LU1A 1W2AX 3A22A 1ND3A 4BU2A 2GC2A 2PHRA 2VVFA 2XDVA 2VZUA 5FZDA 3OBRA 3SCGA 3WF1A 2UU8A 2G1MA 3OUHA 3ZN6A 1AYM2 4YVSC 1VIWB 1XSQA 4ARYA 5LATA 4OI2A 3BPSA 2BBAA 3VDAA 1WW6A 4AFCA 3TEYA 5FZLA 3NKGA 3ZLIA 5HI0A 5J36A 2CWSA 4FTBA 4L0PA 1PO22 4DXTA 3E1F1 2Y6JA 3CLPA 5A7SA 4Q4Y3 3R4UA 1RUF3 2ID4A 5D8AB 4XFIA 4KQ7A 4Q0SA 1YO8A 4FAHA 4BCUA 5FY1A 1C5IA 5I8SA 3ZFGA 1UIJA 2BZDA 4QB2A 4Y3OA 1QJX1 1PZ7A 3TWIA 5M0TA 2YROA 3X29B 1BXHA 2ARXA 3WCSA 3WDTA 1RVF1 4D69A 1G8WA 2MNGA 1I1EA 4NIDA 1HRV1 2C4XA 1E57A 1ULGA 2WZR1 2ZAAA 4W4ZA 2B8MA 2ZACA 4GIQA 1O8SA 2RS53 2P3KA 5JDBA 4GWJA 3E5QA 5KBFA 3IIAA 1US2A 3LDBA 2DU1A 4YM1A 1G6NA 1REDA 4YRDA 1GV9A 4QAWA 5JIUA 2Z5WA 3U78A 3DUIA 3VKMA 1FMD1 4Q1RA 5F2WA 5E1RA 5SV8A 5K4LA 4PLMA 3WNNA 1MS8A 3OD0A 4L2NA 1JS9A 4AGVA 2EXKA 2UWBA 1RGSA 3SCHA 2GU9A 3N7KA 5HBAA 3ROUA 5L9RA 4Q26A 5FPXA 4Y1UA 1LEDA 5A1AA 3WNXA 3T2OA 3U4XA 2D6KA 3BB6A 3KVBA 2ZGKA 2A1XA 1I6XA 4C8DA 2A70A 2BW8A 1NXMA 1OLQA 3N3HA 2Y0IA 4JCKA 2YPDA 3MPBA 2ZCWA 1C1LA 1Q43A 4YVWB 4CEYA 3M8LA 1VLNA 3GZAA 4B4PA 1Y4WA 4BOWA 3VZJA 1JYXA 1XJAA 5L9BA 1RB8G 3FLTA 2QUOA 3BIEA 3AKPA 2HBUA 2VR4A 4NHMA 4UW3A 1HB4A 1W3VA 2XL9A 3PURA 4OULA 4NIAA 1RTVA 2GNBA 2UY8A 1UZZA 2WS91 4YFWA 4QU2A 3USUA 4AAXA 1JODA 1UZVA 2JE8A 1SLBA 3KQRA 2C26A 3DPRB 3RZZA 1XXNA 4QX3A 1O91A 4DEQA 4ES8A 1V6OA 2N7GA 1CJDA 5H9RA 1Q56A 2WLPA 1UZYA 1ZRRA 4BB3A 1J3RA 5JSOA 4IE7A 3S6PA 2VMDA 3ZXJA 2DURA 3AVRA 3GZTB 2ZHLA 1PMJX 5DPNA 2ZMKA 3LA2A 4YWAA 3VBUB 4Q0VA 2CL2A 2PLV1 3L2YA 5F5IA 4WVMA 3U0ZA 1V6KA 2O8QA 1RUG3 2Y6KA 1WCSA 1AR63 2CGNA 1XU1A 4AZZA 1UAIA 5IHRA 4EWAA 3OBAA 1OF3A 3POJA 4OMCA 4QHBA 3WT3A 4FXKB 2HWB3 4YW1A 1YC61 2OW4A 2OZ6A 2RR13 4LIVA 4YGCA 3W20A 1W6NB 5BNPC 1J84A 1K5MA 2VOTA 3P3NA 3NAPA 2XB6C 1DHKB 5DG2A 1UD1A 4N53C 1JTZX 4ASMB 4COZA 5BYNA 3D0JA 1U5IA 1C8M1 1HB1A 4B1LA 2PAEA 3U75A 1PNGA 2VNRA 1AVBA 4TZDA 3MHZA 5AC91 4CCEA 3UKVA 1VBE1 1AR83 1XRUA 1NY72 1NCQB 3PUIA 4GALA 4LBMA 5LY1A 3IMNA 3B93A 3B3QE 3FHQA 2VM9A 3AL5A 5L19A 1XSRA 4MHRA 4M0HA 1ONAA 3WDYA 2RG4A 1V6MA 2PQQA 3P3PA 4DINB 2BNNA 4ATEA 3ZYRA 3CZUA 2W39A 4EJRA 1H2NA 4UXAA 1K5JA 4UAPA 1JHNA 4KWUA 4ZS3A 3BUCA 4CU9A 5CAZA 2E7QA 1H8TC 1UXZA 3P1IA 4OUSA 1PK6C 3NQHA 5K9YA 1LNSA 2KR2A 4P5YA 5FY8A 2W0XA 3MV11 4ONUA 5FMCA 3VBFB 5FZMA 1DBNA 2X29A 1EAH1 4ZXKA 4WV8A 1FPN1 4K21A 3T08A 1WA4A 1QU0A 3HBZA 2HWE3 3B9IA 2ZZQA 4MV2A 2RHPA 3ZXFA 4XW3A 3MDPA 3I2GA 3BIWE 4CE8A 3WEZA 1YUDA 4D3WA 4XAEA 2W87A 5A3PA 3B01A 4OHVA 5A7WB 2FCUA 5FLHA 1YFYA 3L9JT 2GP3A 5FPVA 3FE5A 3AJZA 3WF2A 5JZGB 5CYYA 2Q1FA 5L7OA 3ALQA 1N1VA 4COYA 1W9YA 4FBFA 4Q27A 3I3MA 4Y22A 2DCTA 3V0BA 3PIJA 4PI2A 2J42A 3ITQA 2NYYA 3ZSEA 1W6OA 1TMF2 2WDBA 1UZWA 3NKTA 2P6CA 1EPWA 4RQPC 3VDDC 3I3DA 3UL2A 4HKLA 2DWRA 3WVJA 2VVDA 3H0OA 4E2SA 1QH6A 1SEFA 4CUBA 1QOSA 5FPBA 4ZHNA 3I7DA 3ZXLA 1W6QA 4IDZA 1R083 1GBGA 3J7NA 3SKVA 1R091 5K0UB 3ZN5A 4Y5SA 1MEC1 3MW3A 4HKOA 3HN1A 2YHJA 3M4FA 3RI9A 3WNPA 2XJRA 4B3NA 3LDRA 5FP7A 3ATGA 1RUH3 2BTVC 3OB8A 4C90A 4LNVA 1DQ1A 4UF0A 2WNUA 1YCIA 3TYJA 5FZGA 4FOVA 1KS4A 3H1YA 2YUEA 3W9AA 2R043 1NKGA 3IAQA 3EXUA 3RWNA 3K4ZA 3C7GA 3UGHA 4I0AA 4IGOA 2RS13 4M0NA 5JOYA 3H7JA 5FYTA 5F2SA 4AQ6A 4HOOA 3PJQA 2FZ2A 1CZSA 2DUOA 2PHUA 4QB6A 1UY2A 3FBYA 4IV3C 3WW2A 1YQ6A 4LJHA 5KXDA 2HBTA 5CFDA 2WWSA 1VBD3 2WFF1 1C57A 1OLME 4I3GA 4NOTA 5FBZA 5FZEA 2JG9C 1QXJA 2FDGA 4CXYA 1Q8SA 2OXBA 2X5IC 4HZFA 4BYYA 1ULFA 4Q4Y2 2GH8A 2VCMA 4JKKA 5H9PA 1F4AA 3ZFEC 1AZDA 4K1ZA 2WWUA 2XVLA 4CEWC 1W9FA 2MEV3 2QKDA 3TNPB 1NG0A 1OD3A 2QQNA 1MQTC 1WMXA 4MGKE 1KDMA 3M1HA 3KM5A 3D4KA 4UFIA 5FY9A 4FTSA 1U0AA 4R4ZA 3VB9A 2WJSA 5F39A 4CUAA 2RDQA 1JYCA 4LUMA 2KD7A 2WFPA 3I2DA 4S2DA 1LHNA 2RS52 4ZU5A 1G9FA 4YG0A 4AEJA 5C3PA 4N43B 3HPNA 2OYZA 3A23A 4NE9A 4AI2A 3PTRB 4P9WA 5LEKA 2A3WA 4COWA 2HEYF 1LGBA 4WVWA 2ZPXA 1UU4A 2YBKA 3M3EA 1CD3G 4FOWA 4GH4C 1HX6A 4HG6B 3I2KA 1X36A 5FZ3A 5LA9A 5C4WA 4E2QA 2HWC2 3MPPG 4O9EA 4P9XA 4YGBA 4W6YA 1OFNA 5F6KA 3B00A 4CCNA 5C9AA 3ACLA 3VD5A 4IEVA 2JXAA 1MVQA 3UYJA 2A7AA 3D6EA 2IXIA 2VD7A 4XUNA 3HN3A 4CZSA 2D5HA 1NXD1 3CJIC 3SH3A 2YXSA 2FDKA 4QQPA 1HW5A 4XVHA 2RS33 2QQOA 3ETPA 1E5HA 4CP2A 4Y26A 1WCUA 3I59A 1IKPA 2Z4FA 2GZWA 4OI0A 2BNOA 1VE0A 3THDA 3OUJA 5FYBA 4RSUA 3WF3A 3JXSA 1CESA 3T0AA 2ZEZA 1C8NA 2W47A 1WBFA 2XUEA 3C7EA 4I0WB 4BIOA 2W68A 4JGZC 1DQ4A 4HVQA 2E32A 4XHBA 1RHI2 2B4KA 3FBMA 4N9HA 3Q9OA 1TVGA 4IV1A 3USUB 1R1A3 3RZLA 1W39A 4P9JA 3MIGA 4FP3A 1WKYA 1HJFA 2Q1MA 1CVNA 4YG6A 5T55A 4FOQA 4EWDA 3VHPA 3N7JA 1OOPC 4XQ4A 3V0AA 2BJSA 3I54A 4AE2A 1VBC3 5C70A 1OHFA 1VAMA 2ZGOA 4I01A 5GZDA 1SPPA 5A6QA 2WYSA 5AFBA 3BTZA 3O0WA 4ZU7A 1Y9GA 4AVCA 2H6BA 3WG1A 1LTEA 1GFF2 4UBHA 2WNVA 1JOBA 4Z8BA 5A3NA 1F5FA 1UX6A 4NUBA 5IVVA 1UF2C 5FRAA 4ORFA 5FO9B 2YC0A 1QWRA 2W94A 1KEXA 2VZSA 3CJXA 4LMFA 2RR12 4RS5C 5CA6A 1NX9A 4L9BA 4CDWC 1RUI3 1WW4A 5JVVA 4A41A 2OUHA 4LE3A 5BNOC 3A4UA 5CNAA 2VMCA 3AKTA 4EROA 2W08A 1F5JA 4LKFA 1WCDJ 3OYWA 5DDJ3 4DIQA 4EN8B 1Y7BA 2BWCA 4R9AA 1AYN3 1BKZA 2KM2A 1OT5A 5IATA 5IK4A 5FZ9A 1TME3 5H9QA 4LPLA 1OKOA 2EXJA 1U5YA 2IUWA 2XXZA 4Q4W3 2VECA 1NY71 4GMP0 5FJKA 4XCBA 4K1YA 1V6LA 1JUHA 4Y4RA 3VL8A 4H2AA 1AR82 2RMU3 3ZR5A 3J9SA 5FLIA 4CDUB 5F3CA 5FXXA 5IJRA 3LA7A 5CADA 2XUMA 1G86A 1HN0A 3GCXA 2BNMA 3LIGA 2CDPA 4XFHA 5GM0A 3O1VA 4LBOA 4XXAA 1GR3A 4B7KA 3O1PA 1POV3 3PVOA 3RYPA 5DN2A 4XTMA 1W2TA 2GC1A 2DU0A 5ABJB 2XKPA 2R30A 1IS5A 2AGSA 2ARBA 1BEV3 4Q2FA 2IXCA 4QKFA 1UU5A 2BGOA 5LBEA 2ADDA 5D8AA 3NV1A 3SEEA 1H6YA 3K3OA 1OA4A 1VAKA 1HQNA 4IEXA 3O1TA 2V72A 1W99A 1UOBA 3T1MA 1FX5A 1MZEA 4XF1A 2ZMNA 5JR7B 3ZFFB 1O3SA 3NV2A 5DAWA 2HWE2 1O3RA 3HQUA 4XIKA 4D6QA 1TNRA 3PUHA 1GQPA 1U5ZA 1WWYA 3AC0A 3CHXA 4AVVA 4CCDA 5HCBA 5IK5A 1QJX2 1CAWB 1YQ8A 2C0ZA 2OIIA 2AEYA 2R063 3VL9A 4HETA 4QPIB 1BLZA 3QH6A 2D43A 4A7ZA 3H50A 5EP9A 1HRI3 1NLSA 2VOWA 4HN1A 1V0AA 2BWAA 4MGQA 2WQZC 1ZRDA 3N36A 5T54A 2VY0A 4K9SA 4E4SA 5B2GB 1GKBA 2GMEA 3H9AA 3K4DA 4W50A 4YW3A 5HXVA 1TMF1 2AUYA 4F7ZA 3FUOA 3RZGA 2HWF3 3BOWA 3WR0A 2G9GA 4EN9B 1J1TA 1FMD2 4M3CB 4GKXA 1UMZA 1OH4A 1UU6A 5FKCA 5FYUA 1NCRB 4CCCA 2NMOA 3PL0A 4OUMA 1R082 1BMV2 1W6QB 2QQVA 1IQDC 3ZFGC 2ET7A 2YG0A 4AVTA 1ZBA3 4R8HA 4N8MA 3ZX7A 4XJ9A 2R1BA 2JEMA 3HQXA 1JMUB 1HKDA 3KD4A 4QKDA 3A0KA 2ZMLA 1NZIA 1DQ5A 1JBCA 2Y0OA 4YVWA 4ZS2A 4AWDA 1GOHA 1X8MA 4UF0B 5FUNA 1GZTA 3AFGA 1SBDA 4YVSB 1W2UA 2R042 5DMYA 2VGDA 2WT2A 3K2OA 3CF6E 3WW3A 5F5QA 1MZFA 1Z78A 2BGCA 3POFA 3O1RA 3OY8B 5FUPA 5HV0A 1F4HA 1V6IA 2GN7A 2BU9A 1PMHX 5IW0A 1GNHA 3FFQA 2KA3A 2WZEA 4FPHA 3ZXAC 1IPJA 1U12A 3HWJA 2A6VA 5C5UA 2J22A 3PDQA 3THPA 1T6GC 3GXUA 2IVIB 5J98B 3VBHC 2AH2A 4BK5A 5A7PA 4QB1A 4Q0QA 3WP4A 1AR92 3PVBB 4FQZA 3FHAA 1VBD2 1ST8A 3H8UA 4Q4Y1 2D3SA 2VU9A 3DXTA 4EN7B 1RUF1 5I0UA 3RS6A 2CTVA 1IS4A 1QGLA 2D44A 2RVAA 3KS7A 2VNVA 3VBUA 3RRDA 4D8MA 1PVC3 3VZOA 4O9GA 4D7SA 1VALA 2Y6GA 3ST7A 5GJ6A 3T30A 2RM23 3ELNA 3C7HA 5FYSA 4X6QB 2X10A 2ZA9A 4A2UA 3O1OA 3CDZB 3Q8BA 1LULA 3I2FA 3AYCA 3BOPA 4KWJA 3AMHA 2VW0A 5FP9A 4CEYC 3TEZA 1NOVA 2ILMA 4NHXA 1K42A 4QPYA 1UPSA 1W8ZA 1CAXB 2RS51 1XNTA 1X50A 3I97A 4KBZA 1AL23 1JU3A 1W6NA 4HANA 4K8FA 3RFRA 4OHWA 5KXEA 4MO3M 4PBOA 3C2UA 4Z2AA 4RGAA 2VBDA 3NJVA 3D8CA 2ZBJA 5IVCA 2O0OA 1AR73 1Q8QA 5J7MA 5JLVA 2ARAA 4I0BA 2BRTA 1OF4A 2HWC1 4WM8B 2HWD2 1AHSA 1LEMA 5I0TA 5D21A 5C7GA 1Q5OA 4YZ5A 1NCQA 3K4AA 3MEPA 1NE4A 2P3IA 3W58A 4S2HA 5T5LA 3SISA 3WX5A 5KXCA 2WR9A 1O5LA 4XURA 4Y5Z0 4YZ2A 1VBE2 4QQLA 2B46X 2NZ9A 3BODA 2ZGLA 3RZMA 3J7MA 5F37A 2ZHKA 3T4HB 3MBWA 2RS32 3O12A 2WZ8A 1VMHA 5F3EA 4XF4A 2P3YA 3ORJA 4LQRA 4CU6A 4NPRA 4BMBA 5JMOA 2DCKA 4KG0A 3K48A 4CPBD 1MS5A 4OCTA 5CVRA 2V5YA 4YZ4A 1IQAA 3ZYFA 3ZPOA 3IMMA 3MICA 2HEVF 1L7RA 2BV4A 2CAUA 1ACCA 2FDJA 2VL4A 2QQPA 3POGA 4U2AA 1K5MC 3NL1A 4Q4X3 5JPNB 4NIIA 4KWLA 3N9OA 4JC1A 4QKBA 3HNBM 2BDRA 1MS4A 3ACGA 3ZOIA 3M70A 1R1A2 3W59A 4I2OA 1WMFA 2OPKA 4BQ1A 3K51A 4P9LA 1G9DA 1JU4A 5A7WA 4C0HA 1OA3A 3S7IA 4M4PA 3NRUA 1YNAA 5T5OA 1VBC2 2C9AA 5G04L 2DFCA 2PN5A 3BTAA 5JZGA 1SDWA 5JR2A 2VUJA 4EN0A 2RJKA 2J7MA 3H7YA 3NW4A 4FCAA 4QGLA 4AYUA 3PUAA 1WMDA 5C3OA 1M06G 5IK8A 5A1FA 1ZZ8A 3LGRA 3VLBB 3OBZA 2Y38A 1DU3D 4LXLA 4URAA 3BTYA 4QX7A 5BNPB 4AI9A 3DXUA 2RR11 2WNVB 2PMWB 3DCQA 1W06A 1DGLA 2XQXA 2WSVA 3LPGA 4KGQA 3USSA 4ATFA 3U10A 4XPVA 2DTYA 2R6QA 2JECA 1B35C 1RUI2 3JQXA 5CFCC 1ODMA 3FFZA 3ETQA 1WLWA 1FOD3 3CNAA 3DKQA 4Z92B 5FMDA 2EXIA 5DDJ2 3NJZA 4KU7A 4GJYA 3OYWB 2GDFA 1AYN2 2D40A 5KR7A 3WG4A 1S0EA 3B69A 1TME2 2W52A 3K75B 3TOJA 1REFA 4OFGA 4A42A 3ES1A 2J1AA 2YMZA 3LPFA 4Q4W2 3AMQA 1AR81 3ZMNA 5LA0A 4IEZA 5FV3A 2NLRA 4MSVA 5IVBA 1XNKA 1OC1A 2HEWF 3NNJA 2Y6HA 3AMPA 3K46A 5IUQA 4PDWC 4Y1VA 2JDHA 3OD4A 5J37A 2RV9A 4LORA 1H8TB 5L7OC 1D7PM 1PK6B 3LEGA 3AM2A 3HVDA 2XMLA 2VTXJ 3FHIB 2E7TA 3FZ3A 3ZSMA 2VMEA 1C4RA 5A3UA 1DZTA 1ASJ2 1WUVA 5JI7A 1YWKA 1YFWA 3ZYJB 4JQTA 4R9CA 5A33B 1TG7A 1IOAA 1KFXL 4WM7C 1XU2A 1GZWA 2PXJA 2WN2A 1BEV2 4EYUA 2ZX1A 1D4VB 4RD7A 2ENRA 4MLOA 5D1IA 3JZVA 1UXXX 4FFIA 4BA6A 1N3PA 1SFYA 2WFF2 1W0NA 5LBFA 2WIIB 3VKLA 2Y8KA 1XE7A 1W03A 4N90A 3I2HA 3E6DA 4OQ9A 2HWE1 4C0BA 1HB2A
chains in the Genus database with same CATH topology
3N9LA 5F32A 5ANQA 5FPLA 3UYJA 5A3TA 3K3NA 5FZOA 3N9QA 4QXBA 4D6QA 2VD7A 2Q8CA 5FPUA 5FZOB 5LW9A 5FWEA 5FYYA 4AAPA 2GP5A 5FYIA 5F37A 5FZ0A 5FXVA 4V2WA 3KVBA 5FP4A 5A3PA 5F3EA 5A7WB 4C8DA 5FYCA 5IVYA 3N9NA 2GP3A 5FPVA 5FY7A 3PUQA 2YPDA 4D6RA 4DO0A 4CCJA 3ZPOA 5FYVA 5FP8A 3OPWA 5FYBA 4BXFA 4CCOA 3KV4A 5FZ4A 4BISA 3PURA 4QX8A 2XUEA 5FYHA 4LIUA 2OS2A 5FZIA 4QXCA 3N9OA 5FYMA 5FYUA 4CCLA 5E6HA 2P5BA 5ISLA 5FZ7A 5FPBA 4QU1A 5FZFA 5F5CA 2Q8DA 2OQ6A 4ASKA 5IVFA 5IVEA 5FBJA 5FZKA 1VRBA 5A7WA 5A3WA 5FP3A 5FZ8A 5FP7A 3U4SA 5LWBA 5A80A 5FY4A 5FWJA 4GJZA 3AVRA 5FZCA 5FYZA 4GD4A 4UF0A 3KV5A 3RVHA 5F5IA 5FZGA 3PUAA 4UF0B 5F5AA 5FUNA 5A1FA 3AVSA 2OX0A 5A7OA 4LXLA 4URAA 3K2OA 5F3IA 4QX7A 5IVVA 4AI9A 3DXUA 4NUBA 5A3NA 2OQ7A 2Q8EA 4IGOA 5FY5A 4LITA 5FUPA 4BU2A 5FZBA 3N9PA 5A7NA 2XDVA 2YBPA 5FYTA 5FZDA 5F2SA 5IW0A 4LIVA 4HOOA 4XDOA 3N9MA 4QXHA 4HONA 3PDQA 3KVAA 3PUSA 5FPAA 5A7PA 4CSWA 2YU2A 4DIQA 5FJHA 3OPTA 5FZLA 4GJYA 3ZLIA 3AL6A 5FZEA 4V2VA 3DXTA 5LY2A 5KR7A 2W2IA 2YU1A 5FZ9A 2YBSA 5FZ1A 5A7SA 4IGQA 5A7QA 2XXZA 4D6SA 2WWUA 3KV9A 5FV3A 4CCMA 5FJKA 5FY1A 5FY0A 4EZ4A 5IVBA 5FYSA 5IVJA 4Y4RA 3PU3A 4QWNA 5FY9A 4IGPA 4CUGA 3PU8A 4Y3OA 5FXXA 5FXWA 5F3CA 5LY1A 3NJYA 4GAZA 2OT7A 5FP9A 4Y33A 5FZHA 2XMLA 3AL5A 5F39A 5A1LA 3KV6A 5FZ6A 2PXJA 5FZAA 3LDBA 4EYUA 5IVCA 4CCKA 2WWJA 3PTRB 5FY8A 4E4HA 2YBKA 4TN7A 5FZMA 5FXZA 3U78A 3K3OA 5F3GA 5F2WA 5FZ3A 5K4LA 5CEHA 5IWFA 4CCNA 4XDPA 4EZHA 3LD8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N9L A;  5F32 A;  5ANQ A;  5FPL A;  3UYJ A;  5A3T A;  3K3N A;  5FZO A;  3N9Q A;  4QXB A;  4D6Q A;  2VD7 A;  2Q8C A;  5FPU A;  5FZO B;  5LW9 A;  5FWE A;  5FYY A;  4AAP A;  2GP5 A;  5FYI A;  5F37 A;  5FZ0 A;  5FXV A;  4V2W A;  3KVB A;  5FP4 A;  5A3P A;  5F3E A;  5A7W B;  4C8D A;  5FYC A;  5IVY A;  3N9N A;  2GP3 A;  5FPV A;  5FY7 A;  3PUQ A;  2YPD A;  4D6R A;  4DO0 A;  4CCJ A;  3ZPO A;  5FYV A;  5FP8 A;  3OPW A;  5FYB A;  4BXF A;  4CCO A;  3KV4 A;  5FZ4 A;  4BIS A;  3PUR A;  4QX8 A;  2XUE A;  5FYH A;  4LIU A;  2OS2 A;  5FZI A;  4QXC A;  3N9O A;  5FYM A;  5FYU A;  4CCL A;  5E6H A;  2P5B A;  5ISL A;  5FZ7 A;  5FPB A;  4QU1 A;  5FZF A;  5F5C A;  2Q8D A;  2OQ6 A;  4ASK A;  5IVF A;  5IVE A;  5FBJ A;  5FZK A;  1VRB A;  5A7W A;  5A3W A;  5FP3 A;  5FZ8 A;  5FP7 A;  3U4S A;  5LWB A;  5A80 A;  5FY4 A;  5FWJ A;  4GJZ A;  3AVR A;  5FZC A;  5FYZ A;  4GD4 A;  4UF0 A;  3KV5 A;  3RVH A;  5F5I A;  5FZG A;  3PUA A;  4UF0 B;  5F5A A;  5FUN A;  5A1F A;  3AVS A;  2OX0 A;  5A7O A;  4LXL A;  4URA A;  3K2O A;  5F3I A;  4QX7 A;  5IVV A;  4AI9 A;  3DXU A;  4NUB A;  5A3N A;  2OQ7 A;  2Q8E A;  4IGO A;  5FY5 A;  4LIT A;  5FUP A;  4BU2 A;  5FZB A;  3N9P A;  5A7N A;  2XDV A;  2YBP A;  5FYT A;  5FZD A;  5F2S A;  5IW0 A;  4LIV A;  4HOO A;  4XDO A;  3N9M A;  4QXH A;  4HON A;  3PDQ A;  3KVA A;  3PUS A;  5FPA A;  5A7P A;  4CSW A;  2YU2 A;  4DIQ A;  5FJH A;  3OPT A;  5FZL A;  4GJY A;  3ZLI A;  3AL6 A;  5FZE A;  4V2V A;  3DXT A;  5LY2 A;  5KR7 A;  2W2I A;  2YU1 A;  5FZ9 A;  2YBS A;  5FZ1 A;  5A7S A;  4IGQ A;  5A7Q A;  2XXZ A;  4D6S A;  2WWU A;  3KV9 A;  5FV3 A;  4CCM A;  5FJK A;  5FY1 A;  5FY0 A;  4EZ4 A;  5IVB A;  5FYS A;  5IVJ A;  4Y4R A;  3PU3 A;  4QWN A;  5FY9 A;  4IGP A;  4CUG A;  3PU8 A;  4Y3O A;  5FXX A;  5FXW A;  5F3C A;  5LY1 A;  3NJY A;  4GAZ A;  2OT7 A;  5FP9 A;  4Y33 A;  5FZH A;  2XML A;  3AL5 A;  5F39 A;  5A1L A;  3KV6 A;  5FZ6 A;  2PXJ A;  5FZA A;  3LDB A;  4EYU A;  5IVC A;  4CCK A;  2WWJ A;  3PTR B;  5FY8 A;  4E4H A;  2YBK A;  4TN7 A;  5FZM A;  5FXZ A;  3U78 A;  3K3O A;  5F3G A;  5F2W A;  5FZ3 A;  5K4L A;  5CEH A;  5IWF A;  4CCN A;  4XDP A;  4EZH A;  3LD8 A; 
#chains in the Genus database with same CATH topology
 2JG8 C;  4QX1 A;  4DRR A;  5J1X A;  1YQC A;  4HSJ A;  3IWZ A;  4A6S A;  5FZO A;  1WZX A;  4HMZ A;  2R16 A;  3HD8 B;  4LHL A;  2WNU C;  2VOK A;  5C6C A;  1QNY A;  1FYU A;  5FYY A;  1XPW A;  2HYX A;  3LCP A;  3S30 A;  3CL1 A;  4COU A;  1W6M B;  2EIC A;  2LAL A;  4JV4 A;  3DL3 A;  3UK9 A;  5JWP A;  5FYC A;  1RC6 A;  5ACA 2;  3ILF A;  4N43 A;  3VD3 A;  1HRI 2;  4P5H A;  4XET A;  4Z82 A;  3GHM A;  5FY7 A;  3PUQ A;  4NN0 A;  1Q8O A;  4TXW A;  5CIS A;  5KHG A;  4WBB A;  3O14 A;  1SLL A;  1QDC A;  4CCO A;  2AZ5 A;  2HWF 2;  4XE9 A;  2XLF A;  4R9B A;  5DZE A;  5JOX A;  3GGL A;  4FPK A;  4BH9 A;  4LIU A;  3MUY 1;  1GP4 A;  3S57 A;  3KWV A;  1R08 1;  1QQP 3;  3A0N A;  2HLE A;  4YW6 A;  1BMV 1;  1I9R A;  2NPI A;  3H1M A;  4M4R A;  5BV6 A;  5HXM A;  4ASK A;  3M3I A;  4JKM A;  4NPL A;  3SKJ E;  3FLP A;  1GQH A;  1JYI A;  1ZBA 2;  2J1S A;  4BQW A;  3WNL A;  2Z2S B;  1H1M A;  4MH0 E;  1UMI A;  4LBQ D;  4LLF A;  5FP3 A;  4ZU4 A;  3U4S A;  1UMH A;  1ND2 C;  3NST A;  2EXH A;  2VBB A;  5FWJ A;  2I74 A;  2DF7 A;  5EFU A;  4GWM A;  2E31 A;  1L3J A;  2QQK A;  2XJQ A;  4AVA A;  2VBP A;  1H6X A;  1HXS 3;  2R04 1;  1GOG A;  3KV5 A;  2YYO A;  5F5A A;  4AHZ A;  4YM2 A;  3VKN A;  4PF5 A;  3H8X A;  2CYF A;  2RS1 1;  1VBA 3;  4QXK A;  5EJ1 B;  4IV3 B;  2P17 A;  5C33 A;  3I2J A;  2D98 A;  3APB A;  5FY5 A;  5FK7 A;  2FBE A;  2FDF A;  2ETE A;  2JKB A;  1S55 A;  2X5I B;  2ZGS A;  3PMS A;  4XDO A;  3VBR C;  4BPZ A;  4QXH A;  5C9A C;  1AR9 1;  3NWK A;  3MLL A;  1VBD 1;  2FMY A;  2PTM A;  4CEW B;  3VHN A;  5LK7 B;  1LB2 A;  3C3V A;  5FMO L;  1W8H A;  1WBL A;  3AYD A;  5FJH A;  4AHX A;  3WHT A;  5F6L B;  2K46 A;  1LR5 A;  3B02 A;  1R1Z A;  2I45 A;  2JB4 A;  2O1Q A;  3AMM A;  4XUT A;  2YU1 A;  4QMA A;  5LY2 A;  1ODN A;  5A6X A;  3FMG A;  2DVG A;  2MEV 1;  2KXL A;  2ZJC A;  3WXP A;  3VBO C;  2XJU A;  3WP3 A;  2VC9 A;  1UNB A;  1COV 3;  3UGF A;  3UGG A;  1DFQ A;  4BE3 A;  4YM3 A;  1PX4 A;  3FC0 A;  4IGP A;  1DIW A;  3HBK A;  2R07 3;  3WY6 A;  5BPX A;  3Q8E A;  4OMD A;  1ULC A;  1O7F A;  3I2O A;  3C7O A;  4AVB A;  1AL2 2;  1E5S A;  4LK7 A;  3OCP A;  1NA1 C;  1ULD A;  3O1M A;  1V6N A;  3TAY A;  2VZP A;  4FPG A;  3RNS A;  4IEW A;  1AR7 2;  1OD5 A;  2C5D A;  4IV1 C;  2BFU S;  2HWD 1;  1CX4 A;  1QJU 3;  4I3P A;  5DUV A;  5EQU A;  4DFS A;  2ZKN A;  3AKR A;  3ZO0 B;  4HK8 A;  4B7E A;  1QXP A;  5IYY A;  1OQ1 A;  3BYW A;  5I0S A;  1N3Q A;  3CJI B;  5LZ6 A;  3VKO A;  3AP9 A;  1Q8P A;  2VZQ A;  4CDU A;  1H9W A;  3ZXK A;  3RYK A;  3LB9 A;  2GMM A;  1UIK A;  5BNN A;  1MPX A;  1LOG A;  3GJA A;  2Q8C A;  4Q4V 3;  5JPM B;  2CDO A;  3MW2 A;  1XNA A;  2D6O X;  2RS3 1;  1OUX A;  2VCB A;  1BBT 3;  4FAG A;  3GZE A;  3KT1 A;  1GYK A;  3HOB A;  1KQR A;  3ZM8 A;  4LHN A;  3GBF A;  5EIY B;  1OPO A;  2CV6 A;  1EUU A;  1OI6 A;  4TLG A;  3ZN4 A;  1PO1 3;  2WC2 A;  1I3H A;  4Y1X A;  5IVY A;  5EJ3 A;  5HCF A;  4LA2 A;  4DO0 A;  2IXK A;  3DGT A;  1YLL A;  5T5J A;  3J8F 3;  3POI A;  1UWW A;  5JSP A;  2LS6 A;  3IBM A;  4CU7 A;  4A44 A;  4M00 A;  3J4U H;  1PZ9 A;  4Q4X 2;  3QOP A;  5FZ4 A;  4BIS A;  5JXG A;  4I30 A;  3ZFF A;  4C1X A;  1N1S A;  2CAV A;  1JHJ A;  2OS2 A;  1R1A 1;  3ABZ A;  3ME2 A;  2VUD A;  1XB9 A;  2JEN A;  2D6L X;  1BZW A;  2F4P A;  3LEM A;  1QHD A;  3N7L A;  3PME A;  1DQ6 A;  4CCL A;  4CDX B;  5GLV A;  3WQ1 A;  1PVX A;  4XIO A;  1CAW A;  5IVF A;  1PNF A;  2QJV A;  5L9V A;  5IVE A;  1S2K A;  5FZK A;  4NVP A;  4QPI A;  1QJF A;  1PIV 3;  1VBC 1;  2JDY A;  4PQQ A;  4CP9 B;  3DYO A;  2VQ0 A;  5A3W A;  4IEU A;  5FMB A;  1LKN A;  1DF0 A;  1Z0H A;  3Q8A A;  5FZC A;  5DG1 A;  1C1F A;  4QX0 A;  4UYB A;  5CIR A;  4ZZ5 A;  2V4A A;  3RVH A;  1ZRI A;  1XYN A;  2EA7 A;  1DYK A;  3MIH A;  1OUS A;  5BNO B;  4AI0 A;  2ZGM A;  2WNO A;  1D4M 3;  1OQD A;  2IC1 A;  4M3C A;  3JD7 3;  1SBE A;  1ZA4 A;  1L7Q A;  1HV0 A;  3EYP A;  4GB3 3;  5DUU A;  1O4Z A;  1NCR A;  1RUI 1;  2JDM A;  2V73 A;  3JU9 A;  4EWE A;  2AEN A;  2YBP A;  2VMF A;  1LOC A;  5CZK A;  4XMI A;  5DDJ 1;  2SBA A;  5LK5 A;  1FOD 2;  4AG4 A;  1WCK A;  1AYN 1;  3I4I A;  3JB4 C;  3MFA A;  5K7P A;  1TME 1;  4LT5 A;  2JDA A;  3GNE A;  1AJO A;  5IAX A;  2E53 A;  4CXW A;  1CWP A;  5LAS A;  1W6P B;  2W2I A;  3GCW A;  1QJZ A;  4Q4W 1;  3L2H A;  4K20 A;  4PIY A;  2YBS A;  2X53 S;  1UYY A;  3HMY A;  1K12 A;  1DGR A;  3WV6 A;  2PFW A;  5KHJ A;  2XLG A;  4RL7 A;  1TE1 B;  1S0J A;  2VXR A;  4PLN A;  2RMU 1;  4YVS A;  2JJ6 A;  1IKQ A;  5GLT A;  5C8W A;  4UW6 A;  2DV9 A;  2PHD A;  3WDV A;  2D97 A;  4D94 A;  1JZ8 A;  2WIN B;  3CMG A;  3OY8 A;  4AED C;  2RDS A;  1DQ2 A;  3VZL A;  3SC7 X;  1X9T A;  2VOV A;  3P6B A;  1POV 1;  4HFS A;  4JRL A;  4YW5 A;  1ASJ 1;  3WQ0 A;  1W90 A;  4HL0 A;  4FPE A;  4Z2W A;  2AEZ A;  2DBN A;  2PHW A;  2J1U A;  5LRR A;  3ZIX A;  1UX7 A;  3J7L A;  5G05 L;  1BEV 1;  3VD7 A;  3WNO A;  1SCR A;  1LHV A;  2ZGR A;  3U07 A;  1Y9M A;  3T0D A;  4QDQ A;  2GH2 A;  3HT1 A;  1GZW B;  1RYY A;  3PVE A;  4E4H A;  1G9A A;  2Q8O A;  1LOF C;  4QGN A;  4CP1 A;  1W05 A;  2VJX A;  1RUF 2;  5AFE A;  4NPM A;  3KF3 A;  1S4C A;  4DMI A;  3ZMO A;  4EZH A;  2F17 A;  2YC4 A;  4IEO A;  1JZ2 A;  4QPG B;  3D3A A;  2W1S A;  5J48 A;  4AQ2 A;  3MI8 A;  1JYT A;  4MHU A;  3I3B A;  1GSL A;  1H4G A;  4IND A;  1M4W A;  2Q1Z B;  3LKJ A;  5FZO B;  3AKQ A;  4JX0 A;  3AP7 A;  2QQM A;  1CAX A;  3VZK A;  1YJL A;  5FKB A;  3JBG 3;  1FNZ A;  3R0R A;  4HLT A;  5ACA 1;  1HRI 1;  1MVE A;  4UW5 A;  4YW7 A;  2GAU A;  5KXB A;  2W91 A;  3K77 A;  4P9I A;  1ULO A;  1O4T A;  4XMA A;  4D6R A;  3DPR C;  2RJL A;  4FPY A;  2HWF 1;  4WM8 A;  4JGY B;  1NQJ A;  2PLV 3;  1GZC A;  5F7U A;  1D0H A;  2B45 X;  2WL1 A;  3IAP A;  4QX8 A;  4CTE A;  3III A;  4MAD A;  4YSF A;  3T09 A;  1STM A;  4XF3 A;  5CU1 A;  3MYX A;  1JN2 P;  1CPM A;  1QQP 2;  2ZX3 A;  3VBU C;  3OJB A;  1LOB A;  5E6H A;  3WNK A;  5FZ7 A;  4DQA A;  1ZBA 1;  4AI8 A;  1CR7 A;  1F2N A;  4FI9 A;  3MID A;  2DFB A;  1ALY A;  3SCF A;  5I91 A;  4LLO A;  1VRB A;  1O8P A;  4AL9 A;  1BCX A;  3WZ1 A;  4DRV A;  4WVZ A;  3VD9 A;  3M3Q A;  1WW5 A;  1BVP 1;  4F8A A;  1RJ8 A;  3FUQ A;  3NV4 A;  2QQL A;  4GD4 A;  1R64 A;  3S0M A;  1AJK A;  1HXS 2;  1V6J A;  2RDR A;  2XLA A;  2GSY A;  3KCC A;  2VE1 A;  3H42 B;  4RR3 B;  4UI9 L;  2Q0A A;  4HVR A;  2VNG A;  2WUH A;  4XYX A;  3VBH B;  3VHR A;  5KWR A;  3ZYH A;  2OPW A;  2QDN A;  1QDO A;  4GWI A;  5FO8 B;  1DLC A;  2LRO A;  5ANN A;  3MV0 1;  5FZB A;  4RGG A;  2JDP A;  3MF9 A;  1H2L A;  4GKY A;  5FAX A;  3MIE A;  4JDM A;  2W3J A;  3MLK A;  4TWT A;  3ENR A;  1NLR A;  1X33 A;  4QM9 A;  4CDQ C;  3VBS B;  3EJK A;  4G4F A;  3TN9 3;  5J3U A;  4WVV A;  5FPA A;  2A6W A;  5C8C B;  3TNQ A;  4CSW A;  1T6B X;  2DBI A;  1DLL A;  1QF3 A;  2B7Y A;  2HJI A;  1ZBE 3;  2V4V A;  3M3C A;  3R6S A;  1SMV A;  5CG8 A;  2WO7 A;  3J26 N;  4HN0 A;  4HXC A;  1OKQ A;  3BTX A;  1JOJ A;  3KQ4 B;  2ZX4 A;  2OVU A;  3ZSJ A;  1PM4 A;  1SFN A;  2RM2 1;  3F95 A;  3SXW A;  4AK3 A;  3R4D B;  3KV9 A;  5D2A A;  4AEK A;  4IE5 A;  4XOG A;  1GAN A;  1OSG A;  2VXJ A;  5FY0 A;  5A3L A;  1RUG 2;  5BNP A;  4FP2 A;  1EP0 A;  1N3O A;  5IVJ A;  1AR6 2;  1EAH 3;  4N7U A;  1OMI A;  1W8T A;  1ZVF A;  2R07 2;  4GXL A;  3ZYI B;  2BBV A;  2B9V A;  2HWB 2;  3VBF C;  3W21 A;  2JD9 A;  1AL2 1;  2FQP A;  4CU8 A;  4NIG A;  4E4Z A;  4DUX A;  4BME A;  4AFD A;  1A78 A;  2W92 A;  4GWN A;  4OYU A;  4QM8 A;  4RYD A;  3OGG A;  4GQ7 A;  1AR7 1;  3IDB B;  2GNT A;  2YZ4 A;  2P34 A;  1EY2 A;  1YYN A;  2QQW A;  5A6Z A;  4A4A A;  4C1W A;  1YRZ A;  4L99 A;  3S5A A;  2I07 B;  4XJZ A;  4XFC A;  2AR6 A;  1Y3T A;  4N9I A;  3PJY A;  2PHX A;  5C71 A;  5GLU A;  4A6O A;  1SFP A;  1LGC A;  2DDU A;  2D3R A;  2DUQ A;  1SQ4 A;  2HYK A;  3M7A A;  1MS1 A;  2JD4 A;  1YJK A;  1Z7S 3;  4G9S B;  3OG2 A;  4K7J A;  1J3P A;  1T2X A;  4M3C F;  1KS5 A;  4QDS A;  3C8X A;  4W8J A;  2TUN A;  5IWF A;  1O3Q A;  1LHO A;  2XBO 3;  4ZON A;  1PM7 A;  2TNF A;  2ZAH A;  2IFR A;  3SH5 A;  1ZX5 A;  5C3R A;  1H8T A;  3T4V A;  1GWK A;  1PK6 A;  2R1D A;  5BNN B;  4LKD A;  3ZR6 A;  1MAC A;  2R0F A;  1MZ6 A;  4AF9 A;  2E51 A;  2BVB A;  2ZGP A;  5DUW A;  5A33 A;  3AZV A;  4TTG A;  2ZGU A;  4HPK B;  1UPI A;  1MEC 3;  5EHD A;  1ZZB A;  5ERL A;  4NRP A;  5A3O A;  2D93 A;  2ET1 A;  3VZN A;  3FL7 A;  3MF6 A;  3M2M A;  1UCX A;  5K0U C;  4JHZ A;  4Q4X 1;  3IDA A;  3J8F 2;  3GYD A;  2P2K A;  3OPW A;  4XXP A;  1IG3 A;  1VB2 A;  3TBD A;  1ZRC A;  3WOG A;  4UOJ A;  1DG6 A;  2Q4S A;  1OXC A;  3LQC A;  4HKW A;  2CY6 A;  3C7F A;  2ADE A;  4F83 A;  2OA2 A;  5I0R A;  2BPA 2;  5F5C A;  1AYM 3;  1BK1 A;  2CHH A;  3PTY A;  4XF0 A;  3LSD A;  5IT6 A;  5LA1 A;  1PGW 1;  1EPZ A;  4HBN A;  1W6M A;  1VBB 3;  2WLQ A;  1PIV 2;  4S2G A;  2VTF A;  3BI3 A;  1CAV B;  4XFG A;  3HEI A;  5FQ0 B;  3JUU A;  5FZ8 A;  1JZ5 A;  2ZZJ A;  4ZPI A;  4ZZ8 A;  1PO2 3;  5BUV A;  1ND3 C;  4RQP A;  1RJ7 A;  5FY4 A;  4ASL A;  2D3P A;  4QX2 A;  1YIP A;  3POS A;  3AYE A;  1CN1 A;  1JW6 A;  4AHY A;  3SHR A;  1B35 B;  1OQE A;  4UFK A;  5CFC B;  4NR1 A;  4NIH A;  2ES3 A;  1VRH 3;  4YFZ A;  1FNY A;  1D4M 2;  5EV7 A;  1KXG A;  3T0B A;  2C6S A;  3JD7 2;  2JIJ A;  3KMH A;  3AZZ A;  3PVN A;  1NT0 A;  4GB3 2;  3N9P A;  4JQR A;  4TYS A;  4FPL A;  3UJQ A;  1FOD 1;  2JX9 A;  3ES4 A;  1BK0 A;  1WLD A;  2GMP A;  4KH9 A;  4B29 A;  4FFF A;  4HON A;  4EQV A;  1V00 A;  5J96 B;  3GZU C;  2JE7 A;  5FMO S;  2QVS B;  1IZ3 A;  5A3M A;  4LOS A;  3JQW A;  4PDW B;  3V64 A;  3WQ7 A;  1RUH 2;  5KHH A;  4H55 A;  4JRA A;  1HJG A;  5T50 A;  4IEY A;  4IUG A;  4G3Y C;  2WA3 A;  5JSR A;  4N7I A;  2NMN A;  1GIC A;  4XUP A;  2X8K A;  4YNI A;  4IV3 A;  3B7M A;  2LTN A;  1Y9Q A;  4LUK A;  4N43 C;  4QWN A;  4WM7 B;  1O59 A;  4NJ4 A;  2RS1 2;  4IL7 A;  4XHX A;  1S2E A;  2OT7 A;  3UT0 A;  2X5I A;  4RA0 A;  5J09 A;  4A7Y A;  2RE9 A;  4CEW A;  1XOY A;  3T1L A;  3DV8 A;  1UYX A;  1AX2 A;  3PIG A;  1WME A;  3RI8 A;  4J25 A;  4DNY A;  3WDW A;  3T2Q A;  1WD4 A;  3BPZ A;  1X8E A;  5F3G A;  3MW4 A;  1VAV A;  4QQ2 A;  2YV8 A;  4KI5 M;  2MEV 2;  1YHF A;  1K3I A;  3CO2 A;  5JUV A;  2FCT A;  4HVO A;  4IQP A;  1OFS A;  2ZX2 A;  2ZGN A;  3RZH A;  1EUT A;  5FFO C;  5LCW L;  3LOB A;  1CON A;  2YPJ A;  2W1U A;  3WF4 A;  4YAR A;  2XJT A;  3IPV B;  3SH4 A;  4E4D X;  3IZO A;  1KIT A;  4RN5 A;  1XNC A;  2VVE A;  3KSC A;  4DXS A;  1WGP A;  2ZHN A;  1CJP A;  1CIW A;  4X8P A;  2OKX A;  3CJI A;  4FTE A;  2Y6F A;  4K40 A;  1QQP 1;  5FYH A;  3EO6 A;  1GUI A;  1NAE A;  4MGY E;  3ZYG A;  3KHB A;  5F8P A;  4L92 A;  4XC9 A;  5KC6 A;  1DGR N;  2QNK A;  1A34 A;  5JAX A;  2LUW A;  2C1F A;  4O61 A;  4FQ4 A;  3H3L A;  1ENQ A;  2UY9 A;  5FK8 A;  3VDB A;  4IER A;  3S5Q A;  2WT0 A;  3MFC A;  4NAO A;  3DYP A;  1HXS 1;  3KCY A;  1RUD 3;  1NQD A;  3AZY A;  3ILN A;  3NNM A;  4LOT A;  3IM0 A;  3MIB A;  5FCC A;  1Q3E A;  4YZ3 A;  5E88 A;  1VBA 1;  3VBR B;  2UWC A;  4LKS A;  1F31 A;  5FOJ B;  4MX3 A;  1C3H A;  2YGL A;  3WUD A;  5GAL A;  5ABJ A;  3LOI A;  3NAP C;  4ZKT B;  4ET7 A;  3ZXE A;  4LIT A;  1PHM A;  4CDX A;  1C5H A;  2QTW B;  1CX1 A;  1QEX A;  4QGM A;  1QOO A;  3E5X A;  1W8F A;  1L7L A;  1EV1 3;  2ZEW A;  4PCR A;  4XFA A;  4Y1Y A;  1E5I A;  4XAB A;  1S1A A;  3AJY A;  3MLJ A;  3PUS A;  2XJS A;  4LK6 A;  3TN9 2;  4CP9 A;  3NO8 A;  1UOG A;  5DUX A;  2FHR A;  3IN9 A;  5CB7 A;  4LBQ B;  1ZBE 2;  3O0V A;  2IVJ A;  4DY5 A;  1OH3 A;  3OEA A;  4MVT A;  4PLO A;  4COV A;  5EZW A;  1CQ9 A;  5FZ1 A;  1COV 1;  4MET A;  2XON A;  1RUG 1;  1AR6 1;  2Z42 A;  3DKW A;  1F8V A;  4R52 A;  1N1T A;  1AXK A;  5BNO A;  2R07 1;  4PT6 A;  4QDR A;  5AVA A;  4BQX A;  4URT A;  1NA1 B;  2EIE A;  1N47 A;  2HWB 1;  2Y64 A;  2NP0 A;  4QHZ A;  4IET A;  1IG0 A;  5FXW A;  4RFT 0;  4GAZ A;  4PBP A;  1A8M A;  5FZH A;  5KHI A;  1QY4 A;  4N53 B;  4KBB A;  3LZZ A;  3ZSL A;  1SLT A;  4BJ0 A;  5DQ0 A;  4DEV A;  1QJY 3;  5IFP A;  3B9C A;  1RUJ 3;  2CWM A;  3KGZ A;  3GM8 A;  3OPZ A;  1W6P A;  2H6C A;  1OBN A;  3GAL A;  1PX3 A;  2XJV A;  2XHK A;  1W8N A;  2EAL A;  1DYO A;  1UOJ A;  1YFU A;  4Q0U A;  1CAU B;  5LB6 A;  3R05 A;  1DDL A;  1J3Q A;  1Z7S 2;  2DVA A;  3GBG A;  4XIL A;  5CEH A;  4XDP A;  3ZSK A;  1MR5 A;  3HR9 A;  1RUC 3;  2JE9 A;  2XBO 2;  5FPZ A;  5F32 A;  2E63 A;  3QCW A;  2RMU 2;  5DAX A;  1BBT 1;  1Y43 B;  3ACI A;  1ENR A;  1S0C A;  1DCS A;  2Q5T A;  4QXB A;  4R4X A;  4V1P A;  3BN6 A;  4OI4 A;  3J7H A;  5FWE A;  1D2Q A;  3FX3 A;  1ENX A;  3QLQ A;  1US3 A;  4GA9 A;  5FYI A;  1PO1 1;  1AX0 A;  3RDI A;  3AZW A;  2H0B A;  3LEI A;  3OEB A;  4UW4 A;  5B4N A;  5FR3 A;  2CGO A;  3H3U A;  4P14 A;  2Y60 A;  3LIH A;  2W1Q A;  4MUV A;  4E2G A;  4I02 A;  3J8F 1;  3POW A;  3H1W A;  5EWS A;  4B4R A;  3RMX A;  5JOZ A;  4F3J A;  3OBT A;  4DOU A;  1G7Y A;  1YI7 A;  5FP8 A;  1CZV A;  3BVC A;  1H8V A;  1ZZ7 A;  4NHY A;  2CGP A;  4JDN A;  1AXZ A;  4YZ1 A;  4QPG A;  4XAC A;  2YC2 A;  3MO4 A;  2JDZ A;  2C24 A;  5HCH A;  3IKW A;  4NHK A;  4QQH A;  2HKX A;  4RHV 3;  1UOF A;  2A5Z A;  4LO8 A;  1FAT A;  2P5B A;  4P02 B;  1RUN A;  1AX1 A;  1TEI A;  1KJL A;  1PIV 1;  1SLI A;  2DVF A;  3UNP A;  4OI1 A;  1W9S A;  5FBJ A;  1ZZ6 A;  1JZ3 A;  1VBB 2;  4QX5 A;  5I0D A;  2R06 2;  4J6G A;  5BNQ A;  2LM3 A;  2VUA A;  2E7A A;  5JXJ A;  2D6N A;  2PYT A;  4GJZ A;  1RMU 3;  2ZXQ A;  4RQP B;  3VDD B;  4NMI A;  1WA6 X;  5FYZ A;  2CSG A;  3QH7 A;  4JGY A;  1IHM A;  2W5F A;  3EMR A;  1BQP A;  5E16 A;  3UKT A;  4GMP 3;  1D4M 1;  2J1R A;  4ITC A;  4U36 A;  4W6X A;  2ZGQ A;  3KZ4 C;  3JD7 1;  5FTT C;  3WP6 A;  1VRH 2;  2OX0 A;  2YY1 A;  4MXV A;  4GB3 1;  1IPK A;  2GC0 A;  5F3I A;  5A7O A;  2QDR A;  5CFD C;  4IE4 A;  4XUQ A;  1QJE A;  2Q8E A;  1O3T A;  2VMG A;  4O65 A;  5CKQ A;  3LE0 A;  4EN6 B;  2EIG A;  4UWD A;  2ORX A;  3GJB A;  3M3O A;  1TZO A;  4LUL A;  1UY3 A;  3NNL A;  3IDC B;  3V56 A;  2GNM A;  3KVA A;  2ZHM A;  1RUH 1;  4NHL A;  2UYB A;  3ON7 A;  2YU2 A;  4BZ4 A;  2AYH A;  2QQU A;  2V09 A;  2WN3 A;  2GND A;  4V2V A;  4QHO A;  4AED B;  2VZV A;  3FN9 A;  4H14 A;  2Y6L A;  2BGP A;  2BOJ A;  4LO4 B;  4EE2 A;  1GNY A;  2DUP A;  3POE A;  3N7M A;  1H1A A;  4UBG A;  2HWC 3;  4RR3 A;  5BXX A;  1RIT A;  2QCS B;  3VBH A;  4Y20 B;  3LA3 A;  3ZVX A;  3RPQ A;  2DTW A;  1ULP A;  2PAK A;  3LFI A;  4CUG A;  3KF5 A;  2A6X A;  3NJY A;  4OLL A;  1LHU A;  4WM8 C;  2JG9 B;  3I2I A;  1MS9 A;  4Y33 A;  3QBQ A;  5C4W C;  3AKS A;  3FJS A;  4UFJ A;  2BER A;  4AGG A;  3VBS A;  1HIX A;  2IZW A;  2WA4 A;  3ZFE B;  2XPJ A;  3WD5 A;  2K2S A;  5EXO A;  2ZTN A;  5C8C A;  4MXW A;  4XJU A;  1OLR A;  4FFH A;  2UUR A;  4CVU A;  5LBC A;  1QXR A;  1JZ7 A;  5FZA A;  4AR2 A;  4LO7 A;  1MQT B;  1HLC A;  1UY4 A;  3CKH A;  4L11 A;  4XJW A;  3LDK A;  2XGX A;  3HQR A;  2ORZ A;  3WW4 A;  4JTO A;  1PVC 2;  3ZKU A;  3ZPY A;  3AXE A;  4CYD A;  1WLT A;  1PMI A;  4IXL A;  1UYZ A;  2BQP A;  1UL9 A;  2D6M A;  4XFB A;  2RM2 2;  1WCQ A;  5FPL A;  5A3T A;  2LRP A;  4BIF A;  1RHI 3;  2XH6 A;  1QH7 A;  1UY1 A;  3GF6 A;  3JBG 1;  2PHT A;  4YG3 A;  3WSO A;  4A3Z A;  1SHW B;  4AQT A;  3POB A;  1ZZ9 A;  2ZEX A;  2GP5 A;  1IS6 A;  4GH4 B;  1POV 0;  4AQS A;  5DAB A;  5FDB A;  4RFR B;  3T3Y A;  1JI6 A;  2GC3 A;  1GWM A;  4XQD A;  4H3W A;  4YPJ A;  4ZY9 A;  1HB3 A;  1UZ0 A;  5GZE A;  3E97 A;  2R0H A;  5L73 A;  4PIX A;  1W8W A;  4XQW A;  4OHY A;  1KD7 A;  1A8D A;  2TEP A;  1JYV A;  3KB5 A;  3KCX A;  2JIC A;  1XND A;  1GZ9 A;  1CZT A;  1HN1 A;  5B4X A;  2YB7 A;  1DZQ A;  1P8J A;  5FYM A;  2D7F A;  3Q8C A;  4WZC A;  4QU1 A;  3ZXG A;  1AF9 A;  1VB4 A;  1ULE A;  2GAL A;  2VAU A;  1RUE 3;  2VMI A;  4LO5 B;  1V9U 3;  2WSU A;  4Q1P A;  3U1X A;  1RIR A;  1YQ2 A;  1W8U A;  4HPK A;  5SV5 A;  3ZYB A;  2WNV C;  1VJ2 A;  2XG3 A;  4LA3 A;  3WW1 A;  2QFE A;  5JCT A;  5LWB A;  1KDK A;  4BHP A;  3KGL A;  4LBJ A;  4AI3 A;  1S2B A;  1RUD 2;  4JGZ B;  3DEM A;  2AAC A;  2HH9 A;  3LFM A;  1OPM A;  1H30 A;  3I8T A;  2E33 A;  4XZU G;  3G6J B;  1GLH A;  4CDQ B;  3OGJ A;  2IFW A;  1BHG A;  2B9U A;  2VW1 A;  1ZZC A;  2WQ4 A;  2JIG A;  3FWE A;  3O7O A;  1OOP B;  4XJ8 A;  3UJO A;  1YEW A;  1XBF A;  4M3C E;  5A7N A;  4K3U A;  2D6P A;  3TN9 1;  1ZM1 A;  4PI0 A;  4W65 A;  1EV1 2;  2XOM A;  2JDN A;  4D0Q A;  2W9X A;  3SMH A;  1HQL A;  1ZBE 1;  1CAV A;  5FQ0 A;  1JH5 A;  2WAO A;  3GHN A;  3IB3 A;  1UKR A;  2A75 A;  2NN8 A;  3DYM A;  4IE0 A;  4KG8 A;  4AEM A;  1ZRE A;  3ACF A;  1PGW 2;  5I8T A;  4CPB A;  1SLA A;  3TB0 A;  2VNO A;  2WKK A;  2P4E A;  4IGQ A;  1UN1 A;  2XHN A;  2ZGT A;  5A7Q A;  3WUC A;  1B35 A;  3QD6 A;  1LOE A;  4RS5 B;  4D6S A;  5CFC A;  4MGT A;  4CDW B;  4EZ4 A;  4BLI A;  4SLI A;  5GZF A;  1RUO A;  4Z07 A;  1FV2 A;  1XE8 A;  4FXG B;  2XQR A;  4P9Y A;  1LAJ A;  1GP6 A;  1I5P A;  2A3Y A;  4JTN A;  3BU7 A;  3WP5 A;  4ARX A;  1VP6 A;  2DCZ A;  1Q8V A;  1QJX 3;  1W9T A;  5D8A C;  2VG9 A;  3KV6 A;  4BLJ A;  4DZG A;  3Q8F A;  4AFB A;  4DPN A;  2RJ2 A;  2NQY A;  4L8Q A;  1RVF 3;  3CEW A;  3RGB A;  2VO5 A;  5IK7 A;  1V70 A;  3BCW A;  1HRV 3;  5CKN A;  5FZ6 A;  1QJY 2;  1RUJ 2;  4PDW A;  2WZR 3;  3NNG A;  2LW8 A;  5JOW A;  1IPS A;  2EID A;  1N1Y A;  1Z7S 1;  3EQE A;  4IES A;  4LHS A;  1J1L A;  4TN7 A;  4AFA A;  3RSJ A;  2XBO 1;  5DZF A;  1SBF A;  1FMD 3;  1RUC 2;  4WM7 A;  3SIT A;  1GWL A;  4LBL A;  4LBN A;  3OGV A;  4DB5 A;  2JKX A;  4DXR A;  5CBL A;  5FPU A;  1FAY A;  4S2F A;  2B39 A;  2EAK A;  3KT7 A;  5FZ0 A;  4V2W A;  5FP4 A;  5DAP A;  1VPH A;  4XUO A;  5A32 B;  2JG8 A;  1QKQ A;  4NRQ A;  4XEZ A;  2MPF A;  5LA2 A;  3AFK A;  5GKA C;  2QZ3 A;  4CCJ A;  1X9P A;  4FO9 A;  2ERF A;  2F6B A;  2TBV A;  1H2K A;  3I3E A;  4GZ9 A;  2J1T A;  5APA A;  5T3N A;  3VV1 A;  1H0B A;  1HV1 A;  4WZF A;  2P37 A;  5GZC A;  3URF A;  1B09 A;  5AVP A;  1UW8 A;  5E8A A;  1BVV A;  2B5H A;  3ILR A;  2R32 A;  4QXC A;  3RZK A;  1AYM 1;  3NJX A;  1ND3 B;  4RHV 2;  2O8O A;  3B94 A;  4AW7 A;  2WS9 3;  4YVW C;  2VPV A;  3VUO A;  1VBB 1;  1OUR A;  2R06 1;  2Q8D A;  1UQX A;  3ZN6 B;  4XAA A;  3IPV A;  5LEJ A;  4FT8 A;  4AOC A;  1PO2 1;  2MHF A;  2JWP A;  1AR9 3;  3LAG A;  2WZP P;  1IGO A;  1DP0 A;  2XVK A;  1OVP A;  4PJY A;  5A80 A;  3O1S A;  5HV4 A;  1RMU 2;  2H0V A;  4AVS A;  2G4I A;  2QQI A;  1DGW X;  1SZB A;  1VRH 1;  3O0X A;  3O5S A;  3HT2 A;  4Z1V A;  3T2P A;  2BOI A;  3I3Q A;  2XJP A;  2PHF A;  3GDB A;  4KMQ A;  4E27 A;  1YFX A;  3ZFG B;  5EYX A;  2OQ7 A;  1POQ A;  2XR4 A;  4QQO A;  1ND2 A;  3OF1 A;  4XTP A;  4IEQ A;  1GP5 A;  2VMH A;  4QD2 A;  1W04 A;  4OHX A;  2VZ1 A;  1LOD A;  3UES A;  4UFL A;  5A6Y A;  4Q0P A;  2CNA A;  1O6U A;  4XJA A;  1OLM A;  4LEJ A;  3F2Z A;  3RWK X;  5F9T A;  1NE6 A;  3HJR A;  4CRQ A;  1REE A;  1LGN A;  1MZ5 A;  4BM8 A;  3ASI A;  2HWD 3;  3VBR A;  1X7N A;  5GLZ A;  4CCM A;  4KU8 A;  1C8M 3;  3RYR A;  1FV3 A;  1VBA 2;  3AP5 A;  2E6V A;  2W46 A;  4XBL A;  5AC9 3;  1J83 A;  1VBE 3;  2F4L A;  1JYW A;  4B1M A;  5I93 A;  1U5X A;  2FZ1 A;  5BY5 A;  2EVX A;  1DQ0 A;  3VBO A;  4AXO A;  1KRI A;  2ATF A;  2WBK A;  4W6W A;  2VTX A;  3AP6 A;  2DVD A;  4K8R B;  1NCQ C;  4LBQ A;  4FVV A;  4MXW B;  1HDK A;  2B42 B;  1H9P A;  3W5N A;  1VMF A;  2YFU A;  1PVC 1;  2WWJ A;  4OVE A;  3OUI A;  4LHK A;  5JXI A;  1J58 A;  3SNM A;  4KL1 A;  1A6C A;  1YI9 A;  4CEY B;  4O7X A;  2OZJ A;  4BQ5 A;  2WO2 A;  1NA1 A;  1NUK A;  2IXJ A;  1COV 2;  2VZR A;  3LD8 A;  1CIY A;  1J59 A;  2FMD A;  1LJ7 A;  2NM1 A;  1LHW A;  3K3N A;  1AXY A;  2VH9 A;  3GBW A;  3QAC A;  3VZM A;  2QQJ A;  3N9Q A;  1QNW A;  1FPN 3;  1SAC A;  2IXL A;  5FOB B;  3RJR A;  4N53 A;  5LW9 A;  1W2N A;  3R4S A;  3WDX A;  1GU3 A;  2DYC A;  1W0P A;  3AMN A;  2A3X A;  4FPC A;  2PAM A;  1S0D A;  3H3Z A;  2A6Y A;  2X05 A;  2RDN A;  4D7T A;  3WF0 A;  5FXV A;  2SLI A;  2WNE A;  5L36 A;  5ABJ C;  1QIQ A;  4NWV A;  3E5U A;  1YXW A;  1OA2 A;  2VZO A;  2Y26 A;  4CDX C;  3OGR A;  3RQ0 A;  2XKO A;  2P3J A;  3IT8 A;  1ENS A;  1QJU 2;  1CAU A;  2P1B A;  1CGP A;  4WVM B;  1XE0 A;  4J1W A;  3PNA A;  4MGZ E;  3V65 A;  1XYO A;  1W8O A;  2FDH A;  2BP6 A;  4YW4 A;  3WCR A;  4AFM A;  1LES A;  4LBK A;  4KWK A;  4AGR A;  3E6C C;  4UFH A;  5FZI A;  1GNZ A;  1I5Z A;  5JZG C;  4BQ4 A;  3ZYP A;  5F1R A;  4Q4V 2;  5C5T A;  2VZT A;  1RUE 2;  3H8R A;  2V5D A;  1BBT 2;  2WQ8 A;  1V9U 2;  1BYH A;  1JXN A;  3ZIW A;  2Y33 A;  1R09 3;  1G9B A;  1RUD 1;  1SLC A;  1K5M B;  1W0O A;  4QKN A;  5T5P A;  3OSD A;  3NAP B;  1PO1 2;  2BVV A;  3IDE A;  1DZR A;  4Y4Y A;  5E89 A;  2VQA A;  2JB8 A;  3DN7 A;  2FCV A;  1GOF A;  3NV3 A;  1SDD B;  4PF1 A;  2WT1 A;  3T2T A;  4P08 A;  3SLI A;  2W95 A;  3WHU A;  1APN A;  1PGL 2;  2WO3 A;  1YIF A;  3A7Q A;  1S0I A;  4PQ9 A;  4B8E A;  1IS3 A;  1F35 A;  1TNF A;  1ZNP A;  3WLU A;  3WG3 A;  4BWO A;  1W9W A;  1JYN A;  3AK0 A;  2DCJ A;  1EV1 1;  2E9Q A;  3AP4 A;  1PGS A;  4X8N A;  1X82 A;  1ASJ 3;  1URX A;  1S0G A;  4K6B A;  3VD4 A;  1XNB A;  4C91 A;  1ZRF A;  3CZJ A;  1SCS A;  4L97 A;  2CU5 A;  2BFU L;  2J1V A;  2WYF A;  2X09 A;  1UY0 A;  4XCA A;  3VDD A;  1FT9 A;  1LU2 A;  4X6R B;  4XDQ A;  2WFF 3;  1LRH A;  2WAA A;  1GMM A;  2AC1 A;  4MGI E;  1QOT A;  2QBX A;  2BUK A;  2PA7 A;  4AI1 A;  2O14 A;  4Q29 A;  4QPW A;  3JCI A;  3NVC A;  1XQN A;  4LE4 A;  3KHC A;  2UYA A;  1NYW A;  1VR3 A;  3PU3 A;  5DXD A;  3RG0 A;  5JI9 A;  3VGI A;  1A3K A;  2ZKL A;  5CG9 A;  3AXD A;  2Y34 A;  5I8Y A;  5A1L A;  4Q5O A;  5FO7 B;  1D0G A;  1QJY 1;  1RUJ 1;  2UWA A;  1RVF 2;  2JDK A;  4QPG C;  2K0G A;  5HPO A;  3I49 A;  1HRV 2;  2VQU A;  4OUE A;  4UFM A;  1LEN A;  5ACA 3;  2ARC A;  2WAB A;  3LSE A;  2WZR 2;  3UV9 A;  4AED A;  4PHZ A;  5IAV A;  4Q8K A;  3ZKY A;  2YDE A;  5L7O B;  1JOP A;  1KJR A;  4E8D A;  3U11 A;  5FXZ A;  1UO9 A;  5H9S A;  1KGY A;  1C28 A;  1RUC 1;  3AB0 A;  4YYO A;  5EJZ B;  3WG2 A;  5EPA A;  4Y20 A;  4Y22 B;  2FDI A;  3V0B B;  2R49 A;  3LWC A;  5GLW A;  3WQB A;  4E8C A;  3THC A;  4FOY A;  2XVG A;  3N9L A;  5KC5 A;  1W6O B;  2ZOE B;  4R9D A;  2Q30 A;  2DCY A;  2GN3 A;  3O1U A;  4JZR A;  1RIN A;  2JG9 A;  4JGY C;  1RL3 A;  3RJ2 X;  4XZP A;  1H4H A;  1F9K A;  1NLQ A;  1LOF A;  2ARE A;  4OZO A;  4AAP A;  2PQS A;  4UT5 A;  3ZFE A;  4BQ2 A;  3ECQ A;  2VCA A;  2DVB A;  4EV0 A;  1WD3 A;  2XWB B;  4A45 A;  1MQT A;  3HIF A;  3H8O A;  1MS0 A;  2JG8 B;  2IXH A;  2G9Z A;  4D7Y A;  2J1E A;  4MOA A;  3ZDS A;  5DAV A;  1E5R A;  1PZ8 A;  3EB7 A;  5C3S A;  5KHK A;  1UKG A;  1ZA7 A;  2WNU B;  5FYV A;  1XYP A;  4JKL A;  4NRM A;  4LR4 A;  4TLF A;  4Q8L A;  3KV4 A;  2G9F A;  2JDU A;  5T52 A;  4RHV 1;  1H2M A;  4BQY A;  3AYA A;  3ZDV A;  5K8S A;  5LRS A;  1AL0 G;  4J1X A;  1TQ5 A;  2WS9 2;  2YFZ A;  1HQW A;  3DPR A;  2VOX A;  4RR3 C;  1LEC A;  1W2O A;  2OQ6 A;  3E6B A;  4YM0 A;  4GH4 A;  3JBG 2;  4P00 B;  3EBR A;  4RGK A;  2ZX0 A;  3W5M A;  3BU0 A;  4KNC A;  1RMU 1;  5DAQ A;  2PEL A;  3BKZ A;  5CFD B;  2VZ3 A;  5FUI A;  4SBV A;  2P6H A;  2VQT A;  4GMP 1;  3S7E A;  3KT4 A;  3LF7 A;  3OOX A;  3VBS C;  2OUJ A;  5TSW A;  1ZYB A;  5C8C C;  4OZX A;  2K9Z A;  3AVS A;  1S0B A;  2PLV 2;  3OTF A;  3D0S A;  4ISQ A;  4B4Q A;  4BDV B;  3PLQ A;  5GZG A;  3EHK A;  2QE3 A;  1W28 A;  4OQ8 A;  5LBB A;  1QMJ A;  1ND2 B;  3CU7 A;  4FPO B;  4IE6 A;  4JVA A;  2VUL A;  3N9M A;  3TRS B;  1WLC A;  4H7M A;  3MGU A;  2WO1 A;  3OPT A;  3MUZ 1;  3AL6 A;  1LCL A;  4JGZ A;  4NRO A;  3WDU A;  3D82 A;  4MGS A;  4YGD A;  4PIZ A;  4YLZ A;  3LEK A;  5DZG A;  5C4W B;  3CIH A;  4DY3 A;  1W3X A;  1D2S A;  3NMB A;  4CDQ A;  5FIX A;  1FI2 A;  5C9A B;  4JDO A;  1C8M 2;  2EAA A;  3U37 A;  4KGG A;  2BEO A;  3WIN E;  4CUC A;  5A70 A;  3PU8 A;  1OOP A;  4ISR A;  2EF6 A;  4YGE A;  5AC9 2;  2E26 A;  1GQG A;  2L9L A;  3TEW A;  3CQO A;  4I09 A;  3VDC A;  1S0F A;  1JZ6 A;  1SG3 A;  1XC6 A;  2YGM A;  4NAM A;  4BQ3 A;  3DF0 A;  3VBO B;  2VCC A;  3HNY M;  2QZ2 A;  5FRE A;  4CDU C;  1AUY A;  3DEC A;  2A73 B;  1VMJ A;  2XL7 A;  4LO6 B;  3U14 A;  5IFT A;  3MZH A;  5BNN C;  3KLS A;  4HSL A;  4XBN A;  4A7K A;  1UYP A;  2G19 A;  2D5F A;  4JHT A;  4XFF A;  4CCK A;  3VKF C;  3I59 B;  1DGW A;  3BAL A;  3VBF A;  4NO4 A;  2R7E B;  3MIF A;  4E9K A;  2A6Z A;  4IEP A;  3PHM A;  4RS5 A;  4CDW A;  1LOA A;  4DXZ A;  1RHI 1;  1OVS A;  2A71 A;  4GUL A;  4HT1 T;  4AHW A;  4P9G A;  3NNF A;  4LTA A;  3SQO A;  5ANQ A;  3BGA A;  1EAH 2;  1K45 A;  4XBQ A;  3WNM A;  1FPN 2;  3CBN A;  5HCA A;  4IV1 B;  5EYY A;  3ZXD A;  2Z79 A;  3ACH A;  1RXF A;  1WW7 A;  3D5O A;  3POY A;  4FFG A;  2EIB A;  4M01 A;  4H7L A;  5JXH A;  4A3X A;  1JZ4 A;  2XWJ B;  3ZFF C;  1RXG A;  3THT A;  4ES9 A;  3G7D A;  4TSV A;  3V0A B;  1QJU 1;  1EYB A;  1JUI A;  1DYP A;  3UKN A;  1O5U A;  3N9N A;  1CPN A;  2IWG B;  1YQ5 A;  3UET A;  1SPP B;  1BJQ A;  1F15 A;  4HK9 A;  5FLJ A;  5JMC A;  1G9C A;  5C3Q A;  1MS3 A;  2Z69 A;  1FXZ A;  4QPI C;  4Y5T A;  4BXF A;  4MYE A;  3AZX A;  3OGS A;  3TEX A;  4FPF A;  1TMF 3;  3P5B A;  1H1I A;  4Q4V 1;  3VN4 A;  4QT6 A;  2I2S A;  1RUE 1;  4BK4 A;  3RZJ A;  4FPJ A;  5ISL A;  1V9U 1;  4BXS V;  3B5L B;  4NWW A;  5FZF A;  5K0U A;  4CP0 A;  3N35 A;  2WRA A;  3HNM A;  2FD8 A;  3HAG A;  4XF9 A;  4JAA A;  3VHO A;  4MG2 A;  3INA A;  3RMY A;  1R09 2;  5A32 A;  1KFU L;  4Y24 A;  2VW2 A;  1MEC 2;  2W1W A;  1NZC A;  4DS0 A;  1NCR C;  5CKM A;  3AX4 A;  3A21 A;  2C9K A;  2ZAB A;  1PGL 1;  4DUW A;  4MZU A;  5JIA A;  3FLR A;  3SEP A;  3N4M A;  4ZXE A;  2PHL A;  4DUV A;  4IW3 A;  4OHZ A;  2ZEY A;  4LKE A;  2ZS6 B;  4Y1Z A;  4FSJ A;  2BYV E;  1O4Y A;  4YW2 A;  3JB8 A;  4CA9 A;  4CXX A;  2VUC A;  1LU1 A;  1W2A X;  3A22 A;  1ND3 A;  4BU2 A;  2GC2 A;  2PHR A;  2VVF A;  2XDV A;  2VZU A;  5FZD A;  3OBR A;  3SCG A;  3WF1 A;  2UU8 A;  2G1M A;  3OUH A;  3ZN6 A;  1AYM 2;  4YVS C;  1VIW B;  1XSQ A;  4ARY A;  5LAT A;  4OI2 A;  3BPS A;  2BBA A;  3VDA A;  1WW6 A;  4AFC A;  3TEY A;  5FZL A;  3NKG A;  3ZLI A;  5HI0 A;  5J36 A;  2CWS A;  4FTB A;  4L0P A;  1PO2 2;  4DXT A;  3E1F 1;  2Y6J A;  3CLP A;  5A7S A;  4Q4Y 3;  3R4U A;  1RUF 3;  2ID4 A;  5D8A B;  4XFI A;  4KQ7 A;  4Q0S A;  1YO8 A;  4FAH A;  4BCU A;  5FY1 A;  1C5I A;  5I8S A;  3ZFG A;  1UIJ A;  2BZD A;  4QB2 A;  4Y3O A;  1QJX 1;  1PZ7 A;  3TWI A;  5M0T A;  2YRO A;  3X29 B;  1BXH A;  2ARX A;  3WCS A;  3WDT A;  1RVF 1;  4D69 A;  1G8W A;  2MNG A;  1I1E A;  4NID A;  1HRV 1;  2C4X A;  1E57 A;  1ULG A;  2WZR 1;  2ZAA A;  4W4Z A;  2B8M A;  2ZAC A;  4GIQ A;  1O8S A;  2RS5 3;  2P3K A;  5JDB A;  4GWJ A;  3E5Q A;  5KBF A;  3IIA A;  1US2 A;  3LDB A;  2DU1 A;  4YM1 A;  1G6N A;  1RED A;  4YRD A;  1GV9 A;  4QAW A;  5JIU A;  2Z5W A;  3U78 A;  3DUI A;  3VKM A;  1FMD 1;  4Q1R A;  5F2W A;  5E1R A;  5SV8 A;  5K4L A;  4PLM A;  3WNN A;  1MS8 A;  3OD0 A;  4L2N A;  1JS9 A;  4AGV A;  2EXK A;  2UWB A;  1RGS A;  3SCH A;  2GU9 A;  3N7K A;  5HBA A;  3ROU A;  5L9R A;  4Q26 A;  5FPX A;  4Y1U A;  1LED A;  5A1A A;  3WNX A;  3T2O A;  3U4X A;  2D6K A;  3BB6 A;  3KVB A;  2ZGK A;  2A1X A;  1I6X A;  4C8D A;  2A70 A;  2BW8 A;  1NXM A;  1OLQ A;  3N3H A;  2Y0I A;  4JCK A;  2YPD A;  3MPB A;  2ZCW A;  1C1L A;  1Q43 A;  4YVW B;  4CEY A;  3M8L A;  1VLN A;  3GZA A;  4B4P A;  1Y4W A;  4BOW A;  3VZJ A;  1JYX A;  1XJA A;  5L9B A;  1RB8 G;  3FLT A;  2QUO A;  3BIE A;  3AKP A;  2HBU A;  2VR4 A;  4NHM A;  4UW3 A;  1HB4 A;  1W3V A;  2XL9 A;  3PUR A;  4OUL A;  4NIA A;  1RTV A;  2GNB A;  2UY8 A;  1UZZ A;  2WS9 1;  4YFW A;  4QU2 A;  3USU A;  4AAX A;  1JOD A;  1UZV A;  2JE8 A;  1SLB A;  3KQR A;  2C26 A;  3DPR B;  3RZZ A;  1XXN A;  4QX3 A;  1O91 A;  4DEQ A;  4ES8 A;  1V6O A;  2N7G A;  1CJD A;  5H9R A;  1Q56 A;  2WLP A;  1UZY A;  1ZRR A;  4BB3 A;  1J3R A;  5JSO A;  4IE7 A;  3S6P A;  2VMD A;  3ZXJ A;  2DUR A;  3AVR A;  3GZT B;  2ZHL A;  1PMJ X;  5DPN A;  2ZMK A;  3LA2 A;  4YWA A;  3VBU B;  4Q0V A;  2CL2 A;  2PLV 1;  3L2Y A;  5F5I A;  4WVM A;  3U0Z A;  1V6K A;  2O8Q A;  1RUG 3;  2Y6K A;  1WCS A;  1AR6 3;  2CGN A;  1XU1 A;  4AZZ A;  1UAI A;  5IHR A;  4EWA A;  3OBA A;  1OF3 A;  3POJ A;  4OMC A;  4QHB A;  3WT3 A;  4FXK B;  2HWB 3;  4YW1 A;  1YC6 1;  2OW4 A;  2OZ6 A;  2RR1 3;  4LIV A;  4YGC A;  3W20 A;  1W6N B;  5BNP C;  1J84 A;  1K5M A;  2VOT A;  3P3N A;  3NAP A;  2XB6 C;  1DHK B;  5DG2 A;  1UD1 A;  4N53 C;  1JTZ X;  4ASM B;  4COZ A;  5BYN A;  3D0J A;  1U5I A;  1C8M 1;  1HB1 A;  4B1L A;  2PAE A;  3U75 A;  1PNG A;  2VNR A;  1AVB A;  4TZD A;  3MHZ A;  5AC9 1;  4CCE A;  3UKV A;  1VBE 1;  1AR8 3;  1XRU A;  1NY7 2;  1NCQ B;  3PUI A;  4GAL A;  4LBM A;  5LY1 A;  3IMN A;  3B93 A;  3B3Q E;  3FHQ A;  2VM9 A;  3AL5 A;  5L19 A;  1XSR A;  4MHR A;  4M0H A;  1ONA A;  3WDY A;  2RG4 A;  1V6M A;  2PQQ A;  3P3P A;  4DIN B;  2BNN A;  4ATE A;  3ZYR A;  3CZU A;  2W39 A;  4EJR A;  1H2N A;  4UXA A;  1K5J A;  4UAP A;  1JHN A;  4KWU A;  4ZS3 A;  3BUC A;  4CU9 A;  5CAZ A;  2E7Q A;  1H8T C;  1UXZ A;  3P1I A;  4OUS A;  1PK6 C;  3NQH A;  5K9Y A;  1LNS A;  2KR2 A;  4P5Y A;  5FY8 A;  2W0X A;  3MV1 1;  4ONU A;  5FMC A;  3VBF B;  5FZM A;  1DBN A;  2X29 A;  1EAH 1;  4ZXK A;  4WV8 A;  1FPN 1;  4K21 A;  3T08 A;  1WA4 A;  1QU0 A;  3HBZ A;  2HWE 3;  3B9I A;  2ZZQ A;  4MV2 A;  2RHP A;  3ZXF A;  4XW3 A;  3MDP A;  3I2G A;  3BIW E;  4CE8 A;  3WEZ A;  1YUD A;  4D3W A;  4XAE A;  2W87 A;  5A3P A;  3B01 A;  4OHV A;  5A7W B;  2FCU A;  5FLH A;  1YFY A;  3L9J T;  2GP3 A;  5FPV A;  3FE5 A;  3AJZ A;  3WF2 A;  5JZG B;  5CYY A;  2Q1F A;  5L7O A;  3ALQ A;  1N1V A;  4COY A;  1W9Y A;  4FBF A;  4Q27 A;  3I3M A;  4Y22 A;  2DCT A;  3V0B A;  3PIJ A;  4PI2 A;  2J42 A;  3ITQ A;  2NYY A;  3ZSE A;  1W6O A;  1TMF 2;  2WDB A;  1UZW A;  3NKT A;  2P6C A;  1EPW A;  4RQP C;  3VDD C;  3I3D A;  3UL2 A;  4HKL A;  2DWR A;  3WVJ A;  2VVD A;  3H0O A;  4E2S A;  1QH6 A;  1SEF A;  4CUB A;  1QOS A;  5FPB A;  4ZHN A;  3I7D A;  3ZXL A;  1W6Q A;  4IDZ A;  1R08 3;  1GBG A;  3J7N A;  3SKV A;  1R09 1;  5K0U B;  3ZN5 A;  4Y5S A;  1MEC 1;  3MW3 A;  4HKO A;  3HN1 A;  2YHJ A;  3M4F A;  3RI9 A;  3WNP A;  2XJR A;  4B3N A;  3LDR A;  5FP7 A;  3ATG A;  1RUH 3;  2BTV C;  3OB8 A;  4C90 A;  4LNV A;  1DQ1 A;  4UF0 A;  2WNU A;  1YCI A;  3TYJ A;  5FZG A;  4FOV A;  1KS4 A;  3H1Y A;  2YUE A;  3W9A A;  2R04 3;  1NKG A;  3IAQ A;  3EXU A;  3RWN A;  3K4Z A;  3C7G A;  3UGH A;  4I0A A;  4IGO A;  2RS1 3;  4M0N A;  5JOY A;  3H7J A;  5FYT A;  5F2S A;  4AQ6 A;  4HOO A;  3PJQ A;  2FZ2 A;  1CZS A;  2DUO A;  2PHU A;  4QB6 A;  1UY2 A;  3FBY A;  4IV3 C;  3WW2 A;  1YQ6 A;  4LJH A;  5KXD A;  2HBT A;  5CFD A;  2WWS A;  1VBD 3;  2WFF 1;  1C57 A;  1OLM E;  4I3G A;  4NOT A;  5FBZ A;  5FZE A;  2JG9 C;  1QXJ A;  2FDG A;  4CXY A;  1Q8S A;  2OXB A;  2X5I C;  4HZF A;  4BYY A;  1ULF A;  4Q4Y 2;  2GH8 A;  2VCM A;  4JKK A;  5H9P A;  1F4A A;  3ZFE C;  1AZD A;  4K1Z A;  2WWU A;  2XVL A;  4CEW C;  1W9F A;  2MEV 3;  2QKD A;  3TNP B;  1NG0 A;  1OD3 A;  2QQN A;  1MQT C;  1WMX A;  4MGK E;  1KDM A;  3M1H A;  3KM5 A;  3D4K A;  4UFI A;  5FY9 A;  4FTS A;  1U0A A;  4R4Z A;  3VB9 A;  2WJS A;  5F39 A;  4CUA A;  2RDQ A;  1JYC A;  4LUM A;  2KD7 A;  2WFP A;  3I2D A;  4S2D A;  1LHN A;  2RS5 2;  4ZU5 A;  1G9F A;  4YG0 A;  4AEJ A;  5C3P A;  4N43 B;  3HPN A;  2OYZ A;  3A23 A;  4NE9 A;  4AI2 A;  3PTR B;  4P9W A;  5LEK A;  2A3W A;  4COW A;  2HEY F;  1LGB A;  4WVW A;  2ZPX A;  1UU4 A;  2YBK A;  3M3E A;  1CD3 G;  4FOW A;  4GH4 C;  1HX6 A;  4HG6 B;  3I2K A;  1X36 A;  5FZ3 A;  5LA9 A;  5C4W A;  4E2Q A;  2HWC 2;  3MPP G;  4O9E A;  4P9X A;  4YGB A;  4W6Y A;  1OFN A;  5F6K A;  3B00 A;  4CCN A;  5C9A A;  3ACL A;  3VD5 A;  4IEV A;  2JXA A;  1MVQ A;  3UYJ A;  2A7A A;  3D6E A;  2IXI A;  2VD7 A;  4XUN A;  3HN3 A;  4CZS A;  2D5H A;  1NXD 1;  3CJI C;  3SH3 A;  2YXS A;  2FDK A;  4QQP A;  1HW5 A;  4XVH A;  2RS3 3;  2QQO A;  3ETP A;  1E5H A;  4CP2 A;  4Y26 A;  1WCU A;  3I59 A;  1IKP A;  2Z4F A;  2GZW A;  4OI0 A;  2BNO A;  1VE0 A;  3THD A;  3OUJ A;  5FYB A;  4RSU A;  3WF3 A;  3JXS A;  1CES A;  3T0A A;  2ZEZ A;  1C8N A;  2W47 A;  1WBF A;  2XUE A;  3C7E A;  4I0W B;  4BIO A;  2W68 A;  4JGZ C;  1DQ4 A;  4HVQ A;  2E32 A;  4XHB A;  1RHI 2;  2B4K A;  3FBM A;  4N9H A;  3Q9O A;  1TVG A;  4IV1 A;  3USU B;  1R1A 3;  3RZL A;  1W39 A;  4P9J A;  3MIG A;  4FP3 A;  1WKY A;  1HJF A;  2Q1M A;  1CVN A;  4YG6 A;  5T55 A;  4FOQ A;  4EWD A;  3VHP A;  3N7J A;  1OOP C;  4XQ4 A;  3V0A A;  2BJS A;  3I54 A;  4AE2 A;  1VBC 3;  5C70 A;  1OHF A;  1VAM A;  2ZGO A;  4I01 A;  5GZD A;  1SPP A;  5A6Q A;  2WYS A;  5AFB A;  3BTZ A;  3O0W A;  4ZU7 A;  1Y9G A;  4AVC A;  2H6B A;  3WG1 A;  1LTE A;  1GFF 2;  4UBH A;  2WNV A;  1JOB A;  4Z8B A;  5A3N A;  1F5F A;  1UX6 A;  4NUB A;  5IVV A;  1UF2 C;  5FRA A;  4ORF A;  5FO9 B;  2YC0 A;  1QWR A;  2W94 A;  1KEX A;  2VZS A;  3CJX A;  4LMF A;  2RR1 2;  4RS5 C;  5CA6 A;  1NX9 A;  4L9B A;  4CDW C;  1RUI 3;  1WW4 A;  5JVV A;  4A41 A;  2OUH A;  4LE3 A;  5BNO C;  3A4U A;  5CNA A;  2VMC A;  3AKT A;  4ERO A;  2W08 A;  1F5J A;  4LKF A;  1WCD J;  3OYW A;  5DDJ 3;  4DIQ A;  4EN8 B;  1Y7B A;  2BWC A;  4R9A A;  1AYN 3;  1BKZ A;  2KM2 A;  1OT5 A;  5IAT A;  5IK4 A;  5FZ9 A;  1TME 3;  5H9Q A;  4LPL A;  1OKO A;  2EXJ A;  1U5Y A;  2IUW A;  2XXZ A;  4Q4W 3;  2VEC A;  1NY7 1;  4GMP 0;  5FJK A;  4XCB A;  4K1Y A;  1V6L A;  1JUH A;  4Y4R A;  3VL8 A;  4H2A A;  1AR8 2;  2RMU 3;  3ZR5 A;  3J9S A;  5FLI A;  4CDU B;  5F3C A;  5FXX A;  5IJR A;  3LA7 A;  5CAD A;  2XUM A;  1G86 A;  1HN0 A;  3GCX A;  2BNM A;  3LIG A;  2CDP A;  4XFH A;  5GM0 A;  3O1V A;  4LBO A;  4XXA A;  1GR3 A;  4B7K A;  3O1P A;  1POV 3;  3PVO A;  3RYP A;  5DN2 A;  4XTM A;  1W2T A;  2GC1 A;  2DU0 A;  5ABJ B;  2XKP A;  2R30 A;  1IS5 A;  2AGS A;  2ARB A;  1BEV 3;  4Q2F A;  2IXC A;  4QKF A;  1UU5 A;  2BGO A;  5LBE A;  2ADD A;  5D8A A;  3NV1 A;  3SEE A;  1H6Y A;  3K3O A;  1OA4 A;  1VAK A;  1HQN A;  4IEX A;  3O1T A;  2V72 A;  1W99 A;  1UOB A;  3T1M A;  1FX5 A;  1MZE A;  4XF1 A;  2ZMN A;  5JR7 B;  3ZFF B;  1O3S A;  3NV2 A;  5DAW A;  2HWE 2;  1O3R A;  3HQU A;  4XIK A;  4D6Q A;  1TNR A;  3PUH A;  1GQP A;  1U5Z A;  1WWY A;  3AC0 A;  3CHX A;  4AVV A;  4CCD A;  5HCB A;  5IK5 A;  1QJX 2;  1CAW B;  1YQ8 A;  2C0Z A;  2OII A;  2AEY A;  2R06 3;  3VL9 A;  4HET A;  4QPI B;  1BLZ A;  3QH6 A;  2D43 A;  4A7Z A;  3H50 A;  5EP9 A;  1HRI 3;  1NLS A;  2VOW A;  4HN1 A;  1V0A A;  2BWA A;  4MGQ A;  2WQZ C;  1ZRD A;  3N36 A;  5T54 A;  2VY0 A;  4K9S A;  4E4S A;  5B2G B;  1GKB A;  2GME A;  3H9A A;  3K4D A;  4W50 A;  4YW3 A;  5HXV A;  1TMF 1;  2AUY A;  4F7Z A;  3FUO A;  3RZG A;  2HWF 3;  3BOW A;  3WR0 A;  2G9G A;  4EN9 B;  1J1T A;  1FMD 2;  4M3C B;  4GKX A;  1UMZ A;  1OH4 A;  1UU6 A;  5FKC A;  5FYU A;  1NCR B;  4CCC A;  2NMO A;  3PL0 A;  4OUM A;  1R08 2;  1BMV 2;  1W6Q B;  2QQV A;  1IQD C;  3ZFG C;  2ET7 A;  2YG0 A;  4AVT A;  1ZBA 3;  4R8H A;  4N8M A;  3ZX7 A;  4XJ9 A;  2R1B A;  2JEM A;  3HQX A;  1JMU B;  1HKD A;  3KD4 A;  4QKD A;  3A0K A;  2ZML A;  1NZI A;  1DQ5 A;  1JBC A;  2Y0O A;  4YVW A;  4ZS2 A;  4AWD A;  1GOH A;  1X8M A;  4UF0 B;  5FUN A;  1GZT A;  3AFG A;  1SBD A;  4YVS B;  1W2U A;  2R04 2;  5DMY A;  2VGD A;  2WT2 A;  3K2O A;  3CF6 E;  3WW3 A;  5F5Q A;  1MZF A;  1Z78 A;  2BGC A;  3POF A;  3O1R A;  3OY8 B;  5FUP A;  5HV0 A;  1F4H A;  1V6I A;  2GN7 A;  2BU9 A;  1PMH X;  5IW0 A;  1GNH A;  3FFQ A;  2KA3 A;  2WZE A;  4FPH A;  3ZXA C;  1IPJ A;  1U12 A;  3HWJ A;  2A6V A;  5C5U A;  2J22 A;  3PDQ A;  3THP A;  1T6G C;  3GXU A;  2IVI B;  5J98 B;  3VBH C;  2AH2 A;  4BK5 A;  5A7P A;  4QB1 A;  4Q0Q A;  3WP4 A;  1AR9 2;  3PVB B;  4FQZ A;  3FHA A;  1VBD 2;  1ST8 A;  3H8U A;  4Q4Y 1;  2D3S A;  2VU9 A;  3DXT A;  4EN7 B;  1RUF 1;  5I0U A;  3RS6 A;  2CTV A;  1IS4 A;  1QGL A;  2D44 A;  2RVA A;  3KS7 A;  2VNV A;  3VBU A;  3RRD A;  4D8M A;  1PVC 3;  3VZO A;  4O9G A;  4D7S A;  1VAL A;  2Y6G A;  3ST7 A;  5GJ6 A;  3T30 A;  2RM2 3;  3ELN A;  3C7H A;  5FYS A;  4X6Q B;  2X10 A;  2ZA9 A;  4A2U A;  3O1O A;  3CDZ B;  3Q8B A;  1LUL A;  3I2F A;  3AYC A;  3BOP A;  4KWJ A;  3AMH A;  2VW0 A;  5FP9 A;  4CEY C;  3TEZ A;  1NOV A;  2ILM A;  4NHX A;  1K42 A;  4QPY A;  1UPS A;  1W8Z A;  1CAX B;  2RS5 1;  1XNT A;  1X50 A;  3I97 A;  4KBZ A;  1AL2 3;  1JU3 A;  1W6N A;  4HAN A;  4K8F A;  3RFR A;  4OHW A;  5KXE A;  4MO3 M;  4PBO A;  3C2U A;  4Z2A A;  4RGA A;  2VBD A;  3NJV A;  3D8C A;  2ZBJ A;  5IVC A;  2O0O A;  1AR7 3;  1Q8Q A;  5J7M A;  5JLV A;  2ARA A;  4I0B A;  2BRT A;  1OF4 A;  2HWC 1;  4WM8 B;  2HWD 2;  1AHS A;  1LEM A;  5I0T A;  5D21 A;  5C7G A;  1Q5O A;  4YZ5 A;  1NCQ A;  3K4A A;  3MEP A;  1NE4 A;  2P3I A;  3W58 A;  4S2H A;  5T5L A;  3SIS A;  3WX5 A;  5KXC A;  2WR9 A;  1O5L A;  4XUR A;  4Y5Z 0;  4YZ2 A;  1VBE 2;  4QQL A;  2B46 X;  2NZ9 A;  3BOD A;  2ZGL A;  3RZM A;  3J7M A;  5F37 A;  2ZHK A;  3T4H B;  3MBW A;  2RS3 2;  3O12 A;  2WZ8 A;  1VMH A;  5F3E A;  4XF4 A;  2P3Y A;  3ORJ A;  4LQR A;  4CU6 A;  4NPR A;  4BMB A;  5JMO A;  2DCK A;  4KG0 A;  3K48 A;  4CPB D;  1MS5 A;  4OCT A;  5CVR A;  2V5Y A;  4YZ4 A;  1IQA A;  3ZYF A;  3ZPO A;  3IMM A;  3MIC A;  2HEV F;  1L7R A;  2BV4 A;  2CAU A;  1ACC A;  2FDJ A;  2VL4 A;  2QQP A;  3POG A;  4U2A A;  1K5M C;  3NL1 A;  4Q4X 3;  5JPN B;  4NII A;  4KWL A;  3N9O A;  4JC1 A;  4QKB A;  3HNB M;  2BDR A;  1MS4 A;  3ACG A;  3ZOI A;  3M70 A;  1R1A 2;  3W59 A;  4I2O A;  1WMF A;  2OPK A;  4BQ1 A;  3K51 A;  4P9L A;  1G9D A;  1JU4 A;  5A7W A;  4C0H A;  1OA3 A;  3S7I A;  4M4P A;  3NRU A;  1YNA A;  5T5O A;  1VBC 2;  2C9A A;  5G04 L;  2DFC A;  2PN5 A;  3BTA A;  5JZG A;  1SDW A;  5JR2 A;  2VUJ A;  4EN0 A;  2RJK A;  2J7M A;  3H7Y A;  3NW4 A;  4FCA A;  4QGL A;  4AYU A;  3PUA A;  1WMD A;  5C3O A;  1M06 G;  5IK8 A;  5A1F A;  1ZZ8 A;  3LGR A;  3VLB B;  3OBZ A;  2Y38 A;  1DU3 D;  4LXL A;  4URA A;  3BTY A;  4QX7 A;  5BNP B;  4AI9 A;  3DXU A;  2RR1 1;  2WNV B;  2PMW B;  3DCQ A;  1W06 A;  1DGL A;  2XQX A;  2WSV A;  3LPG A;  4KGQ A;  3USS A;  4ATF A;  3U10 A;  4XPV A;  2DTY A;  2R6Q A;  2JEC A;  1B35 C;  1RUI 2;  3JQX A;  5CFC C;  1ODM A;  3FFZ A;  3ETQ A;  1WLW A;  1FOD 3;  3CNA A;  3DKQ A;  4Z92 B;  5FMD A;  2EXI A;  5DDJ 2;  3NJZ A;  4KU7 A;  4GJY A;  3OYW B;  2GDF A;  1AYN 2;  2D40 A;  5KR7 A;  3WG4 A;  1S0E A;  3B69 A;  1TME 2;  2W52 A;  3K75 B;  3TOJ A;  1REF A;  4OFG A;  4A42 A;  3ES1 A;  2J1A A;  2YMZ A;  3LPF A;  4Q4W 2;  3AMQ A;  1AR8 1;  3ZMN A;  5LA0 A;  4IEZ A;  5FV3 A;  2NLR A;  4MSV A;  5IVB A;  1XNK A;  1OC1 A;  2HEW F;  3NNJ A;  2Y6H A;  3AMP A;  3K46 A;  5IUQ A;  4PDW C;  4Y1V A;  2JDH A;  3OD4 A;  5J37 A;  2RV9 A;  4LOR A;  1H8T B;  5L7O C;  1D7P M;  1PK6 B;  3LEG A;  3AM2 A;  3HVD A;  2XML A;  2VTX J;  3FHI B;  2E7T A;  3FZ3 A;  3ZSM A;  2VME A;  1C4R A;  5A3U A;  1DZT A;  1ASJ 2;  1WUV A;  5JI7 A;  1YWK A;  1YFW A;  3ZYJ B;  4JQT A;  4R9C A;  5A33 B;  1TG7 A;  1IOA A;  1KFX L;  4WM7 C;  1XU2 A;  1GZW A;  2PXJ A;  2WN2 A;  1BEV 2;  4EYU A;  2ZX1 A;  1D4V B;  4RD7 A;  2ENR A;  4MLO A;  5D1I A;  3JZV A;  1UXX X;  4FFI A;  4BA6 A;  1N3P A;  1SFY A;  2WFF 2;  1W0N A;  5LBF A;  2WII B;  3VKL A;  2Y8K A;  1XE7 A;  1W03 A;  4N90 A;  3I2H A;  3E6D A;  4OQ9 A;  2HWE 1;  4C0B A;  1HB2 A; 
#chains in the Genus database with same CATH homology
 3N9L A;  5F32 A;  5ANQ A;  5FPL A;  3UYJ A;  5A3T A;  3K3N A;  5FZO A;  3N9Q A;  4QXB A;  4D6Q A;  2VD7 A;  2Q8C A;  5FPU A;  5FZO B;  5LW9 A;  5FWE A;  5FYY A;  4AAP A;  2GP5 A;  5FYI A;  5F37 A;  5FZ0 A;  5FXV A;  4V2W A;  3KVB A;  5FP4 A;  5A3P A;  5F3E A;  5A7W B;  4C8D A;  5FYC A;  5IVY A;  3N9N A;  2GP3 A;  5FPV A;  5FY7 A;  3PUQ A;  2YPD A;  4D6R A;  4DO0 A;  4CCJ A;  3ZPO A;  5FYV A;  5FP8 A;  3OPW A;  5FYB A;  4BXF A;  4CCO A;  3KV4 A;  5FZ4 A;  4BIS A;  3PUR A;  4QX8 A;  2XUE A;  5FYH A;  4LIU A;  2OS2 A;  5FZI A;  4QXC A;  3N9O A;  5FYM A;  5FYU A;  4CCL A;  5E6H A;  2P5B A;  5ISL A;  5FZ7 A;  5FPB A;  4QU1 A;  5FZF A;  5F5C A;  2Q8D A;  2OQ6 A;  4ASK A;  5IVF A;  5IVE A;  5FBJ A;  5FZK A;  1VRB A;  5A7W A;  5A3W A;  5FP3 A;  5FZ8 A;  5FP7 A;  3U4S A;  5LWB A;  5A80 A;  5FY4 A;  5FWJ A;  4GJZ A;  3AVR A;  5FZC A;  5FYZ A;  4GD4 A;  4UF0 A;  3KV5 A;  3RVH A;  5F5I A;  5FZG A;  3PUA A;  4UF0 B;  5F5A A;  5FUN A;  5A1F A;  3AVS A;  2OX0 A;  5A7O A;  4LXL A;  4URA A;  3K2O A;  5F3I A;  4QX7 A;  5IVV A;  4AI9 A;  3DXU A;  4NUB A;  5A3N A;  2OQ7 A;  2Q8E A;  4IGO A;  5FY5 A;  4LIT A;  5FUP A;  4BU2 A;  5FZB A;  3N9P A;  5A7N A;  2XDV A;  2YBP A;  5FYT A;  5FZD A;  5F2S A;  5IW0 A;  4LIV A;  4HOO A;  4XDO A;  3N9M A;  4QXH A;  4HON A;  3PDQ A;  3KVA A;  3PUS A;  5FPA A;  5A7P A;  4CSW A;  2YU2 A;  4DIQ A;  5FJH A;  3OPT A;  5FZL A;  4GJY A;  3ZLI A;  3AL6 A;  5FZE A;  4V2V A;  3DXT A;  5LY2 A;  5KR7 A;  2W2I A;  2YU1 A;  5FZ9 A;  2YBS A;  5FZ1 A;  5A7S A;  4IGQ A;  5A7Q A;  2XXZ A;  4D6S A;  2WWU A;  3KV9 A;  5FV3 A;  4CCM A;  5FJK A;  5FY1 A;  5FY0 A;  4EZ4 A;  5IVB A;  5FYS A;  5IVJ A;  4Y4R A;  3PU3 A;  4QWN A;  5FY9 A;  4IGP A;  4CUG A;  3PU8 A;  4Y3O A;  5FXX A;  5FXW A;  5F3C A;  5LY1 A;  3NJY A;  4GAZ A;  2OT7 A;  5FP9 A;  4Y33 A;  5FZH A;  2XML A;  3AL5 A;  5F39 A;  5A1L A;  3KV6 A;  5FZ6 A;  2PXJ A;  5FZA A;  3LDB A;  4EYU A;  5IVC A;  4CCK A;  2WWJ A;  3PTR B;  5FY8 A;  4E4H A;  2YBK A;  4TN7 A;  5FZM A;  5FXZ A;  3U78 A;  3K3O A;  5F3G A;  5F2W A;  5FZ3 A;  5K4L A;  5CEH A;  5IWF A;  4CCN A;  4XDP A;  4EZH A;  3LD8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...