5F32A

Crystal structure of human kdm4a in complex with compound 40
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
344
structure length
342
Chain Sequence
SARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Lysine-specific demethylase 4A
publication title 8-Substituted Pyrido[3,4-d]pyrimidin-4(3H)-one Derivatives As Potent, Cell Permeable, KDM4 (JMJD2) and KDM5 (JARID1) Histone Lysine Demethylase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 105
structure length 342
sequence length 344
chains with identical sequence B, C, D
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5f32A01
2YU2A 3N9LA 1VRBA 5IVBA 3PTRB 5FPUA 4BU2A 5F39A 5FYMA 4IGOA 5A3WA 5FP4A 4EYUA 5A1FA 5FP3A 5F3CA 4URAA 5F3GA 5A1LA 3DXTA 5FYIA 2W2IA 5IVCA 3K2OA 4GAZA 5FYVA 5F5CA 2Q8EA 5FY1A 4CCLA 4C8DA 5FBJA 5A7OA 5ISLA 5FZ1A 2XXZA 4Y3OA 5FYUA 5FYBA 5FXZA 5K4LA 4BISA 4QU1A 3ZPOA 5F5IA 5FZAA 4UF0A 2OT7A 5LY2A 3UYJA 4CCMA 4D6QA 2P5BA 3PUSA 5FPVA 5FZCA 5IW0A 5IVJA 5A7QA 3OPWA 3ZLIA 5IWFA 5FY5A 4D6SA 5F2SA 5FJKA 4XDPA 5FY8A 4QXCA 5FZOB 3LDBA 5FZFA 5FXXA 5IVYA 5F3IA 4AAPA 2WWUA 4CCJA 5FV3A 5FYCA 2YPDA 5FZBA 5FPAA 5A80A 2XDVA 2XMLA 3N9MA 2YBSA 4TN7A 5A7WA 3KV5A 5FUPA 5ANQA 4EZ4A 3U78A 4GD4A 4IGQA 5FPBA 5FZ3A 5FZ9A 5FZ6A 5A7NA 5LWBA 5FZMA 3KV6A 5FZ4A 4CCKA 2PXJA 5FXVA 5FP7A 5F5AA 3PURA 3DXUA 4GJYA 4HONA 3KVAA 4V2WA 5A3PA 5F37A 5FPLA 4DO0A 3PDQA 5FYYA 5F32A 5F2WA 5FZ7A 2VD7A 3N9NA 3PU8A 4LITA 2OQ7A 3PUQA 5A7PA 3N9PA 4UF0B 5FZHA 3OPTA 4QX7A 3U4SA 3AVSA 5FY4A 4BXFA 5FP9A 2OQ6A 4GJZA 4QXHA 5FZ8A 4E4HA 3LD8A 2WWJA 5FY7A 4Y33A 5A7SA 4CCOA 4QX8A 2OX0A 4D6RA 4NUBA 2Q8CA 2Q8DA 3KV9A 4Y4RA 4IGPA 3K3OA 5FYHA 5FY0A 5IVEA 5LW9A 3PUAA 4AI9A 5CEHA 5F3EA 2GP3A 5FWJA 3N9OA 5FZKA 5FUNA 5FWEA 5FZGA 3N9QA 4QXBA 4CCNA 3RVHA 2OS2A 3AL6A 2XUEA 3K3NA 4LIVA 4DIQA 4XDOA 2YU1A 5FY9A 4EZHA 3KV4A 5IVVA 5A3NA 5FYZA 2GP5A 4QWNA 5FXWA 3AVRA 3NJYA 4LXLA 5FJHA 5FZOA 3AL5A 2YBPA 4ASKA 5FZLA 2YBKA 3KVBA 5FP8A 4CUGA 5FZDA 5FYTA 5E6HA 5FZIA 4HOOA 4CSWA 4V2VA 5FZEA 5LY1A 4LIUA 5A3TA 3PU3A 5FZ0A 5KR7A 5A7WB 5FYSA 5IVFA
chains in the Genus database with same CATH superfamily
3MIDA 1O4ZA 2OUJA 4QHZA 3RMXA 1I1EA 2FCUA 1LOGA 1X9TA 1RINA 1RHI3 4RHV1 4R8HA 5J09A 3I2GA 4GKXA 3V0AA 3IZOA 3UJOA 5FCCA 3ZR6A 5H9SA 4MX3A 2E9QA 3CEWA 4XPVA 4YGEA 4HT1T 2W95A 1TME2 5CADA 5JXHA 5FMDA 1NLRA 3H7YA 5FOJB 3NSTA 5FYBA 5FXZA 1EUTA 4HBNA 5JIUA 2XVLA 3UYJA 4AI1A 1A34A 5T5LA 2WABA 1HRI2 2QTWB 1IKPA 2CDPA 4B1LA 5L7OA 2BBAA 3AC0A 4XJ8A 3VD7A 1OKQA 1UPSA 1O8SA 3LIGA 1EAH2 4MXWB 4YM3A 1T6GC 3ZN6A 5FZOB 3MLLA 5ANNA 1KD7A 1LULA 1L7QA 4HSJA 1HN0A 1KJLA 3AYCA 1FOD1 1AR72 3OBTA 1FMD2 2AGSA 3DYOA 2RJLA 4DXTA 4RS5A 4AVSA 1GLHA 4PHZA 2VUDA 1QQP3 1MS9A 3LPFA 4XJUA 1S0GA 1PZ7A 4F8AA 5H9PA 1W28A 3PVNA 2W94A 3NL1A 1QH7A 3DPRC 1ZM1A 1PZ9A 3OGSA 5A7NA 5C3QA 5T54A 2V72A 3WP3A 1ZRDA 3KCCA 3SEEA 5K8SA 4JRLA 2BNNA 5FXVA 1WMEA 4FPYA 2WN3A 4LOSA 4V2WA 2TEPA 3B01A 3POWA 3WW1A 4QKFA 4QQOA 1J3RA 1BHGA 2YB7A 3MUZ1 1HQNA 4WVMA 1C5IA 2DFCA 2XJRA 2I45A 5AC93 3WF0A 3AB0A 2OYZA 1US3A 2VMEA 3POJA 3BIWE 4XBQA 3NW4A 4ASMB 4RFT0 3CJIB 3DEMA 5C3RA 4BXFA 2VVDA 4RSUA 1UZWA 1UY1A 4GJZA 2Y0IA 4OHZA 4L11A 2CGOA 5DUVA 1BEV1 3VD4A 2XLAA 2ENRA 2Q8CA 3ILFA 1G9DA 1Z78A 2WJSA 2J1AA 1PIV2 1COV1 3RWNA 2WQ4A 3VDDB 4JX0A 4AI9A 3KGZA 5LBBA 1RUE1 2QQVA 3WG1A 2RG4A 1UPIA 3IAPA 3DKWA 3TN93 3OGGA 4FO9A 5FZGA 5FWEA 2RE9A 4CYDA 2HWB3 1BKZA 3J8F3 3OB8A 4CCNA 5GZEA 3TEWA 2Y6KA 2QJVA 5C8CC 3ZDVA 2YFZA 1WMDA 1Z0HA 5LK5A 1ULGA 4C90A 2ETEA 3KQ4B 5C8WA 2Y6LA 3AVRA 3CMGA 1BVVA 1K5MC 2MEV2 1UO9A 1PK6C 5CIRA 1HXS2 3QH7A 4HOOA 2WT2A 3WNXA 4CP1A 3SCHA 1F35A 2BWCA 2BRTA 2DVAA 3VB9A 4LTAA 3IWZA 1FX5A 3TOJA 2HYKA 3JQWA 2PAKA 2X8KA 2AH2A 2JE9A 1C57A 2Y6FA 4CEWC 2QKDA 5EYXA 1VRBA 2F17A 4GXLA 3MIGA 1ND3C 2XKOA 4AQ2A 5F3CA 3MYXA 1STMA 3WUCA 1VBC3 3WY6A 5FR3A 2BNOA 2CL2A 3K2OA 5FMBA 3MLJA 5FREA 2Q8EA 1AYM1 1XNKA 1XQNA 2H6BA 2IVJA 2V4VA 3GNEA 1GZWB 5T5OA 4HK8A 5A32B 5IUQA 3BCWA 2D93A 2K0GA 3E6DA 2RDQA 5LCWL 2VBDA 1VRH2 3O0WA 4LUMA 3HVDA 5FPVA 4L97A 2E26A 1T2XA 2DWRA 4LUKA 2BEOA 2Y64A 1RUJ1 4K1YA 1VBA2 1DGWA 2KR2A 3DGTA 5T55A 4D6SA 3WDYA 1ZBA3 4OVEA 1XYNA 3LDBA 4MO3M 5JR2A 3I54A 1Q8PA 4QPIA 2B46X 4A3XA 1AR61 1QEXA 4XQ4A 1C5HA 1YEWA 2IXCA 2DUQA 1U0AA 4ZY9A 4BPZA 2XMLA 4QPGC 3EYPA 5J7MA 3IKWA 3V64A 2HLEA 4HZFA 3D4KA 5I0DA 3LDRA 3ZFFC 1W8WA 3FMGA 2HEYF 1RVF3 2RM23 4IGQA 2FDKA 5A6XA 5K9YA 2VOTA 2WO7A 2ZTNA 3UGFA 1XPWA 1UY4A 1S0FA 2A70A 3BPZA 1W3VA 2QZ3A 3T1MA 3L2HA 3N9NA 5TSWA 1JYIA 2O14A 1OQEA 4OI0A 3ACFA 3M70A 2CYFA 1LEDA 3VHRA 2XUMA 4P14A 2GC1A 4RR3C 3WP6A 1H2KA 3QH6A 4GIQA 1WMXA 3IIAA 4EE2A 4LMFA 5CFCA 3O1MA 3DCQA 5ERLA 1KXGA 4LT5A 4BQXA 2ZAHA 5LEKA 2Q4SA 3M1HA 5FY7A 2KD7A 5KC6A 4DPNA 1AF9A 5JSOA 2IXLA 1CQ9A 4CDWC 3R0RA 1LGCA 1AXKA 2XJSA 3DECA 2UU8A 3K3OA 2HWC3 3UL2A 1QJY1 2GC3A 2QQKA 1SHWB 4QMAA 2FDFA 1OSGA 2OW4A 2O0OA 2BUKA 1QF3A 3AFGA 5DAPA 2VMDA 4Z8BA 4MUVA 1ONAA 2XB6C 4LE4A 5FUNA 2P4EA 1CJPA 4LBOA 2OS2A 3KHCA 2VCAA 3HAGA 1T6BX 4CU6A 1O3RA 5LZ6A 2ZEYA 4DIQA 4W8JA 3RZGA 2ZEWA 4GB32 3HNMA 4XUNA 5HCAA 1PO23 3N4MA 1O3QA 2WIIB 3I2DA 3O7OA 1BQPA 5GM0A 3ZYJB 4S2HA 2GP5A 3N3HA 4A7ZA 4BK4A 2E51A 2CY6A 2ZX2A 4NHKA 3UT0A 4AHXA 1AJOA 3VGIA 3ZPYA 1PNFA 2D44A 2J1VA 2RR13 1Q8QA 3EBRA 2WO2A 4CCEA 3VD9A 5FZEA 5A3LA 4WM8A 1H30A 1CAVA 5G05L 2J42A 1HQLA 1UKGA 5A33B 1ALYA 3WDUA 3ST7A 4BQ4A 1WW7A 3BYWA 1JZ2A 4MSVA 1YI9A 1N1TA 4JTOA 2UWBA 4GAZA 1LKNA 2RV9A 4XHXA 4XFFA 1PGW1 3AKPA 5C9AB 3HD8B 3P1IA 1QH6A 2LUWA 3M3CA 5GZGA 1R093 3ZSLA 1XJAA 2J22A 3A0KA 4G9SB 4Y1VA 1NG0A 1I5ZA 2Z2SB 1A8DA 2JE8A 5HPOA 2VW2A 5KWRA 1XYOA 1GMMA 1QJU2 3JBG3 4WM7A 4BE3A 5JZGC 1ZBE3 1N1VA 2VZTA 1CESA 1U12A 1LOBA 1UCXA 3FBMA 4P02B 4BQ2A 1XXNA 5FXXA 5IVYA 1NY71 3ES1A 1W6MA 2GMPA 3MIHA 1N3QA 4P9IA 4QM9A 3AM2A 1AR83 1MEC3 1BK1A 1RTVA 1OOPC 1RUD1 5LATA 1W04A 2R072 5CFDA 2NM1A 2ET1A 3HT1A 3WQBA 4QB2A 1IPKA 4B8EA 4DUXA 3NNGA 1SACA 5CYYA 4JGZC 4Q26A 1OD5A 2WBKA 3SNMA 1YO8A 2K9ZA 3V0AB 1QOSA 2VU9A 2YV8A 4JDNA 4YGCA 4MG2A 4GQ7A 2F4PA 2BJSA 2DCZA 4QU2A 1JI6A 1UX6A 2DU0A 4D8MA 2A73B 5A3PA 4IEWA 1JH5A 2Q1FA 4XIKA 4AXOA 5C3PA 3MPBA 1VBE3 5HCBA 1DFQA 4NRQA 1LTEA 4LITA 5FLIA 4YYOA 2YUEA 1RMU2 2XHNA 4W6YA 4DY3A 3ETPA 1F31A 4GWIA 4O9GA 1SCRA 1O91A 1FV2A 5FZHA 2R061 1NX9A 3QOPA 2XGXA 1DYPA 2QQMA 4LBQD 5L7OB 4OHYA 3E6BA 3GJBA 3Q9OA 3VBSA 4CTEA 5JLVA 2WFF2 3KLSA 3ZN6B 5EP9A 4RHV3 5FMOS 3OD4A 3ZXLA 3LA2A 4D7YA 2VCBA 4YVWA 2FDGA 2EAKA 3PVBB 5CKMA 2ZOEB 5JIAA 3W58A 4COVA 3H8OA 4IE0A 2JG8C 2LTNA 4Q8KA 4RS5B 4OUEA 1CX4A 4JGYC 5EXOA 3MW2A 2WR9A 4K9SA 3AXDA 5EJ1B 3WVJA 2WNUA 1YNAA 2E53A 4B7EA 3WDWA 4B3NA 2PTMA 3ZXFA 2RDNA 3I7DA 2UYBA 2KXLA 5JWPA 1JYNA 1V0AA 5KC5A 1MZEA 1YJKA 2VUAA 4K7JA 2ORZA 2WZR1 4UFHA 1F9KA 3AXEA 2JDKA 2MNGA 2ZABA 4XF3A 1WCQA 3LF7A 2VQTA 3NVCA 4ONUA 5K0UC 4XMAA 4WVMB 1OUSA 1TZOA 5BNPA 1W06A 4KNCA 5FP8A 1FOD3 2ARAA 5FYTA 3ZXAC 3SXWA 4N8MA 4D3WA 4E4ZA 3ZO0B 2Z5WA 3RZKA 5B4XA 3WP4A 1FPN1 2CU5A 2UURA 2D6PA 3FLTA 1UF2C 3PU3A 3CL1A 3THDA 1JODA 1G8WA 4J1WA 2VZRA 4I01A 4Q0PA 2ZHLA 2VTFA 3ABZA 4FPLA 2BOJA 2MPFA 3SITA 4CPBD 4D94A 4MGQA 3VBRA 2ZX1A 3OTFA 2WO3A 1IQDC 2BPA2 5FDBA 2D43A 3FWEA 1RUNA 1H2LA 1JU3A 4R4ZA 3JUUA 5DMYA 1PZ8A 5FZ1A 4XDQA 3WLUA 2LROA 3MBWA 4W6WA 2FDIA 2WZEA 3F95A 5GJ6A 2JIGA 3H3UA 1Y9QA 4AGGA 4XJWA 1W9YA 5LASA 1LENA 4M4RA 3OGRA 1AYM2 4AYUA 5L9VA 2WRAA 3JB4C 1NA1C 5E1RA 2D3PA 1BEV3 3A23A 3WQ7A 1QXJA 3O1SA 1F15A 2BFUL 1WBFA 4Q4X2 1LR5A 2P3IA 5DPNA 4OLLA 1AL21 1TME1 1COV3 3KHBA 1US2A 3GCXA 1N3OA 1SDDB 4CCJA 4LA3A 3AYEA 1RUE3 2C0ZA 1VBD2 2PQSA 1W8UA 4IV1C 3GZEA 1IPJA 2OZ6A 3IDBB 4H7LA 1VIWB 1VP6A 1GR3A 5DUWA 5E89A 5FIXA 3RMYA 4BYYA 5ANQA 2VNOA 3O1PA 1FNYA 3D0SA 1QDOA 2B39A 2DCKA 4GD4A 5LB6A 3UETA 1ZNPA 1H8TC 4LKSA 4IERA 4P9LA 5JXJA 2RDSA 4BK5A 2WUHA 3I4IA 1D2QA 1JS9A 2DU1A 3PURA 1K45A 1MVQA 3R4DB 1AR71 2AZ5A 3DPRA 2IVIB 4G4FA 5FPLA 1FMD1 2EXJA 3VL9A 4CE8A 3USSA 4QQPA 4OUSA 2WN2A 3UKTA 2ZKNA 3POIA 3FN9A 3GJAA 4YNIA 1JOPA 5HXVA 1W8NA 5EWSA 4K40A 1SG3A 1OI6A 1YQ6A 3I2KA 3V0BA 1CPMA 1VMFA 4FQZA 4AQ6A 4CUBA 1VBB2 5FZ8A 4QKDA 2VW0A 1W6OA 2A6WA 3POEA 3JCIA 4PF5A 4DS0A 3NQHA 4E8CA 5FQ0A 4QPIB 1XNDA 3PUHA 5HCHA 3NNMA 1RUOA 2OX0A 3ZYHA 1QJZA 5GZFA 4HG6B 4ES8A 1OH4A 1R1A2 2WS93 1V6NA 1KFUL 4GALA 2AC1A 4CEYC 3PUAA 2Q8OA 4P5YA 1UZYA 3KSCA 4KQ7A 4LR4A 4ZHNA 1AR92 4GH4C 1HN1A 1LOAA 2FCTA 3K4AA 4P9WA 2VZSA 5D2AA 4CXXA 3S0MA 1XU2A 1BBT3 1A3KA 1QJY2 5GLWA 4ATFA 4R9DA 1RUJ3 1WLWA 1BYHA 4HMZA 3MZHA 4LK6A 4N9IA 1XRUA 4L9BA 1OA4A 1S0JA 4JTNA 3K4DA 5I91A 2AUYA 4H14A 5A3NA 5FYZA 1PIV1 2VPVA 4LNVA 1DBNA 4JV4A 1AR63 4BOWA 4DINB 2YBPA 4HETA 2WT0A 3GF6A 4PF1A 3VV1A 5C8CA 3T0AA 1KJRA 1URXA 4Q5OA 1N47A 2ARCA 4XCAA 1BZWA 3AP9A 1K12A 2VL4A 4PBPA 4PIZA 4XFCA 5CFCB 1PK6A 1KITA 1O4YA 5CZKA 2G1MA 1PMJX 3GHMA 5JSPA 2XBO1 4QDRA 2D5FA 4ZKTB 3I8TA 4RQPC 2JKXA 2MEV1 3KCYA 2D6KA 1HXS1 4KMQA 4P9XA 4CEWA 2UY9A 2WKKA 5C3OA 3VKOA 1QDCA 5F5CA 1ND3A 1DQ1A 2Y34A 3I3MA 5CG9A 4Q4V2 2OPKA 2ADDA 1W2TA 3O14A 4DMIA 3WNPA 1LOFC 2FZ1A 1BLZA 4ISRA 1G9AA 4FSJA 3VN4A 3SCGA 4P9GA 1UN1A 4G3YC 1OFSA 4TZDA 3WX5A 1KRIA 1EPWA 3GALA 1WLCA 5A7QA 4BQ1A 1JOJA 5F2SA 4FAHA 2X5IC 3VHPA 3QLQA 2ZA9A 4P5HA 5L9BA 3VDAA 3ZN5A 4QXKA 4IEXA 3ETQA 4IDZA 5FV3A 5A3MA 3DV8A 4XYXA 1IPSA 3VKLA 4WM8B 1CAVB 5A80A 1VRH1 5F6LB 1OT5A 1DLCA 3RGBA 2DUPA 1AX1A 1GKBA 1UWWA 1WLDA 3I3QA 5CKQA 1VBA1 4A7KA 1Q43A 4YWAA 4QPGA 3J7HA 3OBRA 2ZX3A 4C1WA 4YZ2A 2C9KA 3LDKA 3HT2A 4KBZA 3ZFFA 5FP7A 5LBFA 3DXUA 4LHKA 3U75A 4OHVA 4UFLA 1PMIA 5F7UA 1UL9A 4XF4A 2X53S 4IQPA 1KQRA 5FZ7A 3H8XA 4JRAA 2R32A 5M0TA 3LGRA 1NT0A 4KWJA 2W46A 3O0XA 5A6ZA 4AHYA 3MV11 4LHLA 4LBLA 4WM7B 4XVHA 3I3DA 1XOYA 5EIYB 1C8NA 4BQYA 1HRV3 4RR3A 4FCAA 1W6MB 5IAVA 1K5JA 3KZ4C 4JKKA 3VBUC 4MYEA 1DCSA 5CFDB 4L8QA 1A8MA 5LK7B 1CIWA 3G6JB 3KMHA 2OXBA 3VBFB 4CDWA 4CXWA 2GP3A 2E7QA 3O12A 4XXPA 1YI7A 1KS4A 3K4ZA 5ACA2 3VHOA 3WCRA 3K46A 5DAVA 3UGHA 2XUEA 4A44A 3R4UA 4QKNA 4XDOA 2YU1A 1IS6A 3SEPA 2VTXA 1SLBA 2VOVA 2WWSA 4YG6A 5JOXA 2NMOA 2VNVA 1N1YA 3THPA 2ZGQA 1ENRA 1ULOA 2VVEA 1RIRA 3BGAA 4YZ3A 1RUG3 1XBFA 3CO2A 2VQAA 1BMV2 3S57A 1OLRA 1RUD3 1H9WA 5E6HA 1OLMA 5GALA 4JVAA 2QNKA 2W5FA 1E5HA 1PO13 4E4SA 2BP6A 2WQ8A 3VBSB 5FZ0A 5LRRA 1SMVA 3FE5A 1RUI2 3NV2A 5A1AA 2FD8A 3WUDA 2J7MA 4IEVA 1GSLA 2HH9A 1CVNA 1POQA 3O0VA 4H55A 4KI5M 4YVWB 3ELNA 3NMBA 2VUCA 3RWKX 3O1VA 1YLLA 2GNTA 1HLCA 2XONA 4AWDA 5GLTA 1D2SA 2W2IA 5IVCA 4FFIA 2WA3A 3HNYM 5FYVA 3APBA 4QT6A 4IESA 4AHWA 1S4CA 2VCCA 3AP7A 2E63A 1LECA 2OA2A 1MS4A 3BN6A 1OXCA 2RS31 3FHAA 2R063 4MV2A 2WNUB 3ZDSA 2P6HA 4ORFA 2ZX4A 3T1LA 2XQRA 4CCMA 1ULFA 3PUSA 4BIFA 1H1MA 2XJQA 4AFMA 3RSJA 1O3TA 2QBXA 4XW3A 1OUXA 2AEYA 5I8SA 5BNPB 1NLQA 3G7DA 3AYAA 4ZXKA 1JZ4A 2TNFA 5IFPA 3PTYA 1W2AX 1UIKA 5F9TA 1NUKA 4F3JA 5JCTA 5JZGA 2GALA 2Y26A 2YPDA 3MGUA 4K8RB 1AX2A 1SLTA 5CAZA 4QDQA 4UYBA 4OZXA 4ZZ5A 4TN7A 2ZGMA 3BPSA 4AL9A 2C5DA 3CJXA 1P8JA 1RUF3 1AL22 3K75B 1LGNA 4JDOA 4CRQA 1QJX2 1OOPA 1QJU1 2RMU2 5SV8A 2WZR3 1ENSA 1GP4A 3M4FA 5FZ3A 3VBRB 1G9BA 1GYKA 3KV6A 1UOFA 3SKJE 5FLJA 2AREA 1S0BA 4JGZA 3NJZA 3RZLA 5KHKA 4TWTA 4LULA 1ZA4A 3WP5A 2R071 2BV4A 1W6NA 4LHSA 2JEMA 3PU8A 2ID4A 2OQ7A 5JXGA 1FPN3 1UU6A 3VZJA 1JZ5A 4MGKE 3OPTA 3KM5A 1PVC1 1W2UA 2JB4A 4MGYE 1Y43B 2BNMA 2JG9C 4LBMA 2J1EA 3ZIWA 4AVTA 2V5YA 3H42B 4Z1VA 1QXRA 1S1AA 4GWNA 4R52A 5IK4A 2VO5A 2YXSA 3B94A 1VR3A 3HWJA 2VMGA 1ULDA 2HWF1 3LOIA 2H6CA 1A78A 1C8M2 3H1WA 4WVZA 3KV9A 3C7EA 2WT1A 4Q4W2 1RMU1 3M3OA 4NIHA 5FFOC 1GZTA 4IEZA 1XC6A 4NWVA 2ZGUA 2QDRA 4N53C 5KXDA 4R9CA 4NRPA 3CKHA 2JG8A 2C4XA 2WFF1 2Y8KA 1ZZ7A 2VQUA 3LKJA 4JGYA 4YM1A 4NAMA 2VC9A 4CU8A 3OSDA 1L3JA 5DZEA 3LQCA 1AYN2 4S2DA 1YFWA 3DPRB 4NPMA 1TME3 2W1WA 4Z92B 2D6MA 1MQTC 1TG7A 1TNRA 1HB3A 3WDTA 1HQWA 1WUVA 5BUVA 5K0UA 3POYA 3GXUA 5BXXA 1HRI3 5KXEA 5C5TA 2G19A 3WNMA 2ZGKA 3CU7A 4AFAA 1EAH3 1VB2A 2QUOA 2QQNA 3PUIA 4CDUC 1W6OB 1E5SA 4MVTA 1Q8SA 5FQ0B 2Y6JA 2D3RA 1WCSA 3JB8A 2W1SA 2J1TA 5DAWA 1Z7S2 1B09A 2B4KA 3U0ZA 1DGWX 1HB4A 2B8MA 1AR73 4NIAA 3WR0A 1FMD3 1H1IA 5EHDA 1POV1 4XXAA 4OQ8A 1LU2A 5BNNC 1G9CA 3HMYA 4JQTA 2PN5A 4YW6A 5FK8A 2ZBJA 3WNOA 4FQ4A 5IK8A 3QCWA 3MO4A 2XBO2 3C7GA 1RYYA 4Y3OA 2Z4FA 5FYUA 3RI8A 3RS6A 5DAQA 5CKNA 4FTSA 3S5QA 2G9FA 2JDZA 2XJVA 2XH6A 1PGSA 4UWDA 2OT7A 3OEBA 3N7MA 1QOTA 3S30A 5IW0A 3ZXEA 2EXHA 3H3ZA 5KHHA 2K46A 4FPKA 4Y20A 4CDXC 1CAXA 1GZCA 4H3WA 4N7UA 5FJKA 5FY5A 5IYYA 1RUH1 5C8CB 5IJRA 2V73A 3NWKA 5T5PA 1UXZA 5CNAA 4XZUG 4QGMA 2DV9A 3EJKA 3GM8A 1VMJA 5FZBA 3ZSEA 4AFDA 1PK6B 2YC4A 2YBSA 1UW8A 4W50A 2GNBA 4YW2A 3O1UA 4A6SA 3IAQA 3C3VA 3BTAA 3K48A 2WC2A 4IV1A 2JECA 2P34A 4L2NA 3T3YA 1CD3G 3KGLA 4Q4X1 3AMPA 1W6PA 3ZSKA 5C6CA 1Y3TA 1PIV3 1S0IA 3DYPA 5APAA 4CEWB 3N35A 1ND3B 2JIJA 1H8TA 3KVAA 4GJYA 4XC9A 1VBD1 5JR7B 5I0UA 3AZZA 4A6OA 5A6YA 1OA3A 5F32A 1H6XA 1JHJA 3EMRA 1BCXA 3UK9A 4ARXA 1GANA 2J1UA 4EV0A 4XOGA 4YGDA 4YW7A 1UAIA 2VG9A 5FY4A 4QD2A 2BVVA 1TNFA 5JMOA 4R9AA 3HBZA 5DUUA 4GULA 2YDEA 1GICA 2H0VA 1FI2A 2B9UA 1QXPA 2I07B 2MEV3 2UWCA 4N43C 2XPJA 2W52A 3I2HA 1HXS3 1H9PA 4WVVA 2Q8DA 4M4PA 1LCLA 1NCRB 4Y4RA 1RB8G 2YROA 1X50A 3D3AA 2P37A 2QQUA 1YFXA 2HBUA 1DGRN 5LW9A 2C6SA 5EYYA 1VAVA 4LBQA 5C4WC 2X09A 1N1SA 4Y1UA 1VLNA 3E5XA 4PIYA 2JD9A 1VBB1 3POSA 2WINB 3OF1A 4YG0A 4TSVA 5A3UA 4CEYA 4QPGB 2HJIA 3JXSA 4X6RB 2YMZA 4GMP1 4LO7A 2GNMA 3ILNA 2ILMA 4LIVA 1OMIA 4GH4A 3T2QA 4Q0VA 2FBEA 1H2MA 2VQ0A 4YVSC 1R1A1 3PMSA 3FUOA 4HKOA 3I3BA 1WCDJ 2P2KA 5FXWA 4LXLA 4W4ZA 1AR91 4Q0UA 2O1QA 2X10A 3WF4A 1RXFA 1REFA 4HSLA 1VRH3 1Y9GA 2VOWA 1DQ5A 3MF6A 4FFHA 4FAGA 2W1QA 1VBA3 2XJUA 3J7LA 5A7WB 3RG0A 3HEIA 5FYSA 5F1RA 2C26A 3PVEA 1ODMA 4FOQA 2R042 4M3CA 4RR3B 3ILRA 3WHTA 2OPWA 5A1FA 4BH9A 1LESA 2RVAA 1R082 4AF9A 4DEVA 1YHFA 2CAVA 2FMDA 3GZAA 4FPGA 1D4M2 4C8DA 3O5SA 4RQPA 1RGSA 4CDWB 1AVBA 5I93A 1ND2C 1ZZ8A 2VBPA 3M8LA 1SQ4A 4H2AA 5LEJA 3INAA 1K42A 4BISA 1DYOA 1QGLA 1CN1A 2PA7A 4QU1A 4CPBA 4HVOA 1FATA 1DHKB 5IK5A 3O1TA 1YXWA 3MV01 3H0OA 4OHXA 2Q1ZB 4KU7A 1LOFA 4DUWA 3LSEA 4OQ9A 2ZZQA 2RS32 1FYUA 3WZ1A 1FT9A 3A22A 3AMQA 5T3NA 3I2OA 2ES3A 3VBOC 2R16A 3GBGA 3BOPA 4JDMA 3MIFA 3NNFA 1OA2A 4Q4V1 4XHBA 5DABA 3CHXA 3KB5A 4EROA 1WLTA 3MPPG 2VAUA 1ACCA 3N9MA 3U14A 2GMEA 1GQHA 1WWYA 4DXSA 5FUPA 5I8TA 2B7YA 3ZFGC 2XJTA 4X8PA 4PQ9A 2WSUA 5I8YA 3U78A 3WG4A 4JZRA 1R64A 3AJZA 4ZONA 1O4TA 1UY2A 3C2UA 2ZGPA 1J84A 3LAGA 5FPBA 1QNWA 5FZ9A 2A1XA 5LWBA 4YW1A 4PBOA 3OCPA 4Q0SA 4OYUA 4Q4Y2 4XFAA 2WNVB 3SQOA 4CCKA 3SC7X 3MIEA 4E4DX 5JOZA 3B00A 1X36A 2DF7A 2VD7A 3B9IA 2VZ3A 2Q0AA 5BNQA 2HBTA 4LBKA 1WZXA 4BMBA 4FPOB 4GB33 5LA2A 1NKGA 4XAAA 4RFRB 4QX2A 2QQLA 4B1MA 4I30A 1PVC2 1VPHA 1UMIA 1VB4A 1VMHA 4IE4A 3L2YA 5E88A 4AVBA 5JZGB 2D97A 5DDJ2 3VBHC 1BVP1 4LEJA 5F3EA 2DUOA 4CDQC 1DLLA 4AEKA 2HWF2 3VBUA 2B9VA 4FPEA 1UYPA 4UFIA 5C7GA 1MS3A 4HFSA 2JXAA 2DCYA 1U5XA 1WKYA 3LSDA 3FLRA 4NVPA 1M06G 1W0PA 5H9RA 3T2OA 1FV3A 4JGZB 1DQ2A 5GLZA 1SLAA 2A71A 2G4IA 4RD7A 5F8PA 4AEDC 2ZEXA 4LKDA 4AEJA 4NIDA 3THCA 1CZTA 2P1BA 1W6NB 3ZYPA 3AL5A 2ADEA 4AQTA 4CUGA 4MOAA 1EYBA 5BNOC 4I3PA 1ASJ1 3KWVA 4XTMA 4PDWC 1H2NA 3D8CA 3RYRA 5ACA1 4I2OA 1PX4A 1XE7A 5H9QA 5I0TA 3B9CA 1ZREA 2HWE2 4EJRA 2FDHA 1QJU3 2W68A 5CU1A 3P3PA 4YPJA 1J83A 5CG8A 3ZFEA 1NZCA 4B4PA 4Y1ZA 1UZVA 4E9KA 2VZUA 1BMV1 3CDZB 4RYDA 5A3WA 1DQ4A 1OH3A 5FP4A 1WA4A 4URAA 1LU1A 2C24A 1NE4A 3I2FA 2EF6A 4CP9A 2R073 2RDRA 1YWKA 2XLFA 3N36A 2W47A 4RL7A 4CCLA 1NXMA 5IFTA 3W5NA 5FBJA 4HPKA 4XE9A 2JG8B 4O65A 1RUI1 4DY5A 4JGYB 4UF0A 2R7EB 1W6QA 3VL8A 2P5BA 2NMNA 1UZ0A 4R4XA 3A7QA 3MHZA 4QHBA 1YIFA 5AFEA 1S55A 4QXCA 2BWAA 3BODA 1E5RA 1H8VA 1UMZA 3URFA 2RHPA 4OULA 2ERFA 4D6RA 5HBAA 1CAWA 1RMU3 5K0UB 4IW3A 5LBCA 3WOGA 3H1YA 5BYNA 3KCXA 2W9XA 4BWOA 2DBNA 2WFF3 1RUH2 3AFKA 1XSRA 4JHZA 4EZ4A 4BIOA 3H8RA 3TEXA 4AEMA 5CA6A 4P00B 3BUCA 4I3GA 1DIWA 4IE7A 1AHSA 4XMIA 1ZRFA 2DVGA 2DCJA 2WYFA 5J36A 4HXCA 1IOAA 3LA7A 4UW4A 1SDWA 2ZGSA 4FPHA 3E5QA 4PQQA 3U07A 3WF2A 4E8DA 4QX0A 5F37A 4QGLA 1LAJA 2K2SA 5AFBA 3E97A 4IETA 1SBDA 3PHMA 5B2GB 2OVUA 2RS52 3PUQA 4XUOA 5DAXA 2ZGOA 3ZXKA 2RJKA 1QJX1 2RMU1 2GC0A 2CHHA 1OKOA 3ASIA 4Y20B 1C4RA 2OQ6A 3N7JA 1CAXB 4XIOA 5DZGA 4B4QA 5JDBA 3AZXA 2YC0A 5A7SA 1G6NA 2JG9A 1EV12 5FBZA 1POV3 3IMMA 2GN7A 4Z07A 4WZCA 5AC91 2A7AA 2W92A 3H7JA 4COZA 2Y33A 3PJQA 3VD3A 5CEHA 1EP0A 1POV0 1Q56A 1WA6X 2JE7A 4RA0A 2ZACA 1LHUA 5ABJC 1Q3EA 1PM7A 3OY8A 1LEMA 1WD3A 3WXPA 1RL3A 3ZKYA 1V6MA 5HV0A 4IV1B 3RVHA 3ACLA 2YFUA 1W6PB 4N53A 2IC1A 1S2KA 1WBLA 1C8M1 2ET7A 3JZVA 3MFAA 2EIEA 2VE1A 3QACA 1JZ3A 2P17A 5T50A 1UYXA 1H8TB 2WYSA 2Y0OA 2W08A 2Z42A 4NHLA 2DFBA 4Q4W1 4OUMA 4QWNA 4Y5Z0 3WF3A 3ZMNA 3H50A 4HVQA 2ATFA 1HJGA 4Q8LA 1SFYA 2QCSB 5FZDA 4XJZA 5L73A 1AZDA 5HCFA 2HWB1 3VLBB 3FX3A 1LRHA 1NCQC 4LLOA 1AYM3 1MQTA 1V9U2 1HJFA 1OLQA 5A3TA 1JZ7A 4YG3A 2HWD2 1AYN1 4FP3A 2SLIA 3J9SA 2G9GA 4Q4X3 5IATA 3PTRB 5F3GA 3DXTA 4QGNA 5FYIA 4CDUA 4YZ5A 1VBD3 4UW5A 4ZU5A 4Q27A 1OVPA 2FHRA 3HPNA 1RUC2 1U5YA 4LBQB 3S5AA 1ZRRA 4CA9A 1WGPA 1VAMA 3OUJA 2GC2A 4LO4B 3HQUA 1IKQA 3VZOA 4CEYB 2PLV2 3W59A 1JUHA 5BNNA 1KEXA 4CXYA 4GH4B 1Z7S1 2BBVA 3AKTA 3OOXA 4O9EA 5SV5A 1K5MA 3NRUA 3P6BA 4NPLA 3WNLA 2V4AA 4CP2A 4EWEA 2PHTA 3ZXDA 3U10A 5CFCC 5E8AA 3HNBM 1Q5OA 2NN8A 3DYMA 4IL7A 2WWUA 2BGOA 4CDXA 3JD72 5FYCA 1MZ5A 1V00A 1QJFA 2P6CA 3I2IA 4N7IA 4ET7A 3SLIA 3ZSJA 4E27A 1VBB3 4KG0A 4AFCA 4A7YA 2QVSB 2VECA 3VUOA 4GMP3 4I0BA 4UW3A 2GU9A 1ZBA1 4IXLA 4M3CB 1IS5A 2IXIA 2KA3A 3L9JT 3ON7A 4SBVA 3ALQA 4YW3A 4BZ4A 4DNYA 4DRRA 1B35C 1R1A3 1X9PA 3BVCA 1MR5A 1YQ2A 4GMP0 4ZU4A 4AGVA 2PXJA 2D98A 4Z2AA 3Q8FA 3RZZA 2VNRA 1UXXX 4J25A 4RQPB 2ZEZA 1AR93 2PAMA 4MGTA 2JDAA 2ARXA 4MGIE 2JJ6A 2UY8A 3AMNA 1W0NA 2F6BA 3N7LA 4QM8A 5A7PA 5EFUA 3AK0A 1QJY3 2A6YA 4V1PA 4A42A 5JI9A 3M3IA 1S0DA 1RVF1 3AYDA 5D8AC 4EWAA 2W87A 4YZ1A 5IHRA 3OUHA 3WQ0A 1UQXA 2CTVA 5FP9A 3T2TA 3GBFA 1BK0A 4IUGA 3W5MA 2Q30A 1PMHX 3HQRA 2WWJA 1ST8A 1EPZA 3HR9A 2IUWA 4NJ4A 5D21A 2V09A 3E1F1 1PVXA 4NUBA 4OHWA 4Y4YA 1D0HA 3SH3A 1I9RA 4N43A 5JVVA 4E2GA 1ZVFA 3NAPC 4XFBA 1JBCA 5EPAA 3KT7A 4OFGA 1ZYBA 3M2MA 2WDBA 5LA9A 1K3IA 2W1UA 1KDMA 1DP0A 1W05A 3KF5A 4ZZ8A 5FWJA 5IT6A 3I97A 4AI3A 1GBGA 1W0OA 2DURA 5FUIA 3AL6A 5C4WA 1XE0A 2OZJA 3K3NA 4LO6B 3CIHA 3HOBA 4UFKA 5A3OA 2QQPA 3KV4A 3CQOA 4K1ZA 4X8NA 4AI2A 3CNAA 4W6XA 1TMF2 3IMNA 1QWRA 1XNTA 4LHNA 3LEGA 4Q4V3 4AI0A 2JDHA 1CX1A 1GFF2 2ZGTA 5JPNB 1J1LA 2EIBA 2RS12 3CLPA 4QHOA 4YVSA 3ZYBA 1UIJA 4YM2A 1X82A 4MADA 3PLQA 2DVFA 2HEVF 4BHPA 2VZQA 3MICA 1YQ5A 1HX6A 1XB9A 2CGPA 1ODNA 5IVFA 4IV3C 2YU2A 3N9LA 4FXGB 4WVWA 1ASJ2 1GNHA 4Y1YA 3RZJA 2R0FA 3VBFC 4XFGA 2WO1A 5FYMA 4AAXA 4F7ZA 2DVDA 2VVFA 4XAEA 1YQ8A 4JCKA 4XBNA 3OYWA 1KS5A 1OHFA 3VDBA 1U5IA 2XLGA 3C8XA 4HKWA 3TWIA 2P3YA 4B4RA 4BLJA 5ISLA 3VBUB 2IXKA 5JSRA 4AVVA 1I3HA 1LOCA 1QY4A 3UESA 3ACHA 3B3QE 5FZAA 1J3QA 1UZZA 3FBYA 3LOBA 3V65A 5LY2A 2R041 3IBMA 4FI9A 1E5IA 1ND2A 2N7GA 2GZWA 2PYTA 4LQRA 2KM2A 1R081 2VH9A 1UY3A 3GCWA 5FY8A 3HJRA 1F5JA 1QNYA 3MFCA 4XJ9A 3HQXA 3FLPA 1D4M1 2QE3A 3OGVA 2BZDA 1C28A 4UXAA 1RHI2 1MS5A 1KGYA 4NOTA 2VJXA 3BTXA 3B5LB 3HN1A 1OPOA 1XSQA 1LOEA 3SHRA 4M0NA 5A33A 3VBOA 5L19A 2PHWA 2VGDA 2CWSA 3ZFEB 1J59A 5KHJA 2D6LX 5J96B 1MACA 2GAUA 1YYNA 2JDNA 3ZYIB 3ZFGA 3VKMA 4CU9A 4WBBA 3QBQA 4CP9B 3CF6E 3D82A 3W9AA 5I0SA 1DGRA 2BFUS 1QJEA 2R1DA 5EZWA 5FAXA 3NV3A 4E2SA 1LB2A 3I59A 4HPKB 1QU0A 1UYZA 1REDA 4NMIA 1JW6A 4B29A 5ACA3 4ZS3A 3KQRA 3KF3A 2L9LA 4UF0B 2CWMA 1D7PM 1W6QB 2A5ZA 5J48A 1IGOA 1HV1A 3ITQA 1C1FA 3AVSA 1CZVA 1HB2A 4FT8A 2WA4A 2VNGA 4ITCA 3W21A 4DB5A 4DFSA 2GMMA 4Q4Y1 3PL0A 4E4HA 1PHMA 1QQP2 2VMHA 1REEA 1W8HA 4ZXEA 2WSVA 3Q8AA 1DZQA 3RDIA 2XWJB 1GP6A 1XE8A 1CAWB 2VMFA 4CCOA 1GZ9A 1AXZA 2WL1A 2FCVA 4I0WB 2BVBA 1KDKA 1PM4A 1CAUA 2AYHA 1GOFA 5FY0A 4QQLA 4YFWA 4QPWA 3WT3A 4EWDA 4GZ9A 5G04L 2ZHMA 3WW4A 4FTEA 2A6ZA 4AVCA 1RUI3 2DCTA 3T0DA 2CV6A 2JDMA 4LLFA 1OQ1A 4B7KA 4EQVA 1ENXA 2EA7A 3S7IA 4YLZA 4L99A 4OMCA 5AVAA 3TNPB 3VBHA 2VMIA 1DU3D 1HW5A 5AC92 2QFEA 2XVKA 4O7XA 4CDQA 5C70A 4LO5B 1UNBA 5BY5A 1JZ6A 1X8MA 3IDCB 3WINE 2QZ2A 2AENA 3J26N 2WFPA 2XHKA 4UAPA 5DDJ1 3SH5A 3T4VA 1OLME 2JWPA 4ASKA 1DG6A 3FFQA 2YBKA 3WCSA 2JX9A 4EN8B 5FZIA 1L7LA 4AEDA 4LKEA 4XEZA 2GN3A 2I74A 2VUJA 5JOWA 5LBEA 4DXRA 4NHYA 1IG3A 5BNOA 5FPXA 2Y6HA 4JKMA 1J1TA 3ACGA 5KR7A 1NZIA 4PDWA 3WF1A 5FO8B 3TN92 2JG9B 1QHDA 2HWB2 3J8F2 3LA3A 1NAEA 2NZ9A 2WNEA 2Q5TA 4ZS2A 1YJLA 1UOBA 4XACA 3USUA 2IFRA 3KT4A 3I2JA 2WAOA 1CWPA 2HWE1 3OY8B 1AL23 1ZRCA 3CJIC 1QJX3 3ACIA 2RMU3 1SLIA 4EN7B 1C3HA 3ZPOA 3ATGA 2QDNA 5JAXA 1JUIA 2R1BA 2TUNA 3FHQA 4N53B 2EICA 4RGAA 5F5IA 4ARYA 3A0NA 3MF9A 3AMMA 3ZX7A 3ZVXA 5FOBB 3E5UA 3D0JA 4C0BA 3V0BB 3ZLIA 3J7MA 1O7FA 2E33A 4Q1RA 3OBZA 3VDDC 4TTGA 4M01A 3ZSMA 4BDVB 3ZYRA 3U37A 1LODA 1YCIA 3F2ZA 3PMEA 1V6JA 2EVXA 2UWAA 4WZFA 4AE2A 5C5UA 1VBC2 5K7PA 3H9AA 5JOYA 1GU3A 1QIQA 4K3UA 1MQTB 1XNCA 2QQOA 3BOWA 4FPCA 2VZPA 4LA2A 1UOJA 1C1LA 1UYYA 2XQXA 5EV7A 3ZXGA 1H6YA 1DQ6A 3LWCA 5FMOL 1C8M3 4ZU7A 4YW5A 2ORXA 3GZUC 4MLOA 2GNDA 4Q4W3 4CDUB 1TQ5A 1V6LA 4HONA 4M3CF 4JHTA 3MIBA 4XTPA 2ZKLA 3T08A 2WZPP 1ZBA2 2VCMA 4TLFA 2E7AA 5F2WA 4MHUA 4A3ZA 3RJ2X 1MVEA 5BNNB 3N9PA 1HDKA 4QX7A 1NA1A 2ZXQA 3AKQA 2XL9A 3SMHA 3RNSA 1AYN3 2SBAA 1NOVA 3ZYFA 1OPMA 1K5MB 3Q8BA 4LBJA 2QQJA 3LEKA 2ZS6B 4PLMA 2C1FA 3EQEA 2ZJCA 4PJYA 4U36A 3PJYA 2PHLA 2E31A 1ZZBA 3J7NA 4KBBA 1RVF2 2RM22 4TYSA 4YW4A 4C0HA 1SPPA 1V6KA 4PT6A 1W90A 1WMFA 2I2SA 4CDXB 3KS7A 4Q2FA 4NHMA 3RFRA 2RS51 1LJ7A 2BQPA 2R49A 3VKNA 1YQCA 4KGQA 2ZGRA 3SCFA 5C33A 4KWKA 2VXRA 2NP0A 4X6QB 4NAOA 2PAEA 4MGSA 1Z7S3 2BGPA 1L7RA 1ZZ9A 2NLRA 4W65A 5ABJA 4HL0A 4NPRA 5LA0A 2D40A 1EV11 2BDRA 2EXIA 4IEYA 5I0RA 4LJHA 4Q29A 2WS91 3DL3A 1JTZX 4J1XA 4LORA 4DQAA 1PX3A 2E7TA 2XBO3 3ECQA 1WW4A 4CVUA 3KVBA 1BXHA 2YPJA 4DEQA 1DZRA 4AG4A 1GQPA 1MZFA 1X33A 1UX7A 2HWC2 1BBT1 1TEIA 1ENQA 3BU0A 3CZUA 1FXZA 4XQWA 1NCRC 3M3QA 1JYXA 1H1AA 3S6PA 4XFIA 4F83A 5FO9B 3DUIA 3LB9A 1OVSA 3AKSA 1NCQA 4QB1A 3U4XA 3UKNA 5IVBA 4BU2A 3KT1A 4IGOA 4RGKA 3ZYGA 5A1LA 2VBBA 2ZZJA 1W2OA 4N43B 2IXJA 3MEPA 4GA9A 3ZFFB 2NPIA 3PIJA 1LNSA 1PO22 3E6CC 4K8FA 4NHXA 3IB3A 3VKFC 1V9U1 1BJQA 2XXZA 4CP0A 2E32A 4NRMA 2HWD1 3UV9A 3PIGA 5C4WB 3ZN4A 5IK7A 3LFMA 2RR12 4FOWA 1MPXA 4NR1A 3S7EA 1ZX5A 2B5HA 4WV8A 5IVJA 3MI8A 4I09A 4S2FA 4UFMA 2CNAA 1ZRIA 2CAUA 2Z69A 5J1XA 1RUC1 1UU4A 1GOHA 3AZWA 4CZSA 1W39A 1JYCA 3RRDA 1S0CA 1X8EA 4KG8A 2R30A 4PCRA 4YVSB 4HN1A 1S2EA 4XJAA 3POFA 3WSOA 4AAPA 1F4AA 2OIIA 4L0PA 2PLV1 5FLHA 3WDXA 2PHRA 3H8UA 1AL0G 3R6SA 4H7MA 4MGZE 3IPVA 1AUYA 1TE1B 1LGBA 4TLGA 3LZZA 3OG2A 2HKXA 3VZMA 2VZ1A 1UMHA 1R092 3LPGA 4DXZA 4K6BA 2VZVA 3NJXA 2ZMKA 2JDUA 1MS8A 3BIEA 1VJ2A 2JD4A 4GWJA 5FZMA 3OYWB 1Y4WA 4UOJA 5FZ4A 4BJ0A 4D7SA 4CCCA 3JD71 2A3WA 1F2NA 2BTVC 1SEFA 1RITA 4Z82A 3JBG2 5DXDA 3T30A 1ZBE2 1B35A 1OF4A 2YY1A 4EN6B 4IEPA 3RYPA 4CUCA 2NQYA 4Y22A 4JC1A 2Y38A 2W91A 2DYCA 3U4SA 5KHIA 1AR82 1MEC2 1ND2B 2JB8A 2CDOA 3WQ1A 4NIIA 5IAXA 2X5IA 5DG2A 1W8TA 4FVVA 2O8OA 4FOVA 1PGL2 4FBFA 1XNAA 2CGNA 5D8AA 4Y33A 1NE6A 4N90A 5C9AC 4PLOA 1ULEA 2WNOA 2D5HA 4IGPA 2WLQA 3THTA 4AHZA 4DUVA 4FOYA 3EB7A 4LBNA 3VBOB 1J58A 2ZHNA 3RPQA 1ULCA 1HIXA 2JENA 5KXBA 1GWLA 2WNVC 4BQ3A 3BTYA 2DTWA 3N9OA 1V6OA 1VBE2 2R043 4NWWA 3HBKA 5FK7A 3NAPA 2Y6GA 1O3SA 1W9FA 4DRVA 2VMCA 1HRV1 1R083 1JN2P 3JU9A 3ZFGB 1TVGA 3ZOIA 1ZZ6A 4BM8A 3TEZA 4INDA 3IDEA 1KFXL 4OZOA 5IVVA 1D4M3 4K20A 2J1RA 3HN3A 2D6NA 4RHV2 3MW3A 3I59B 4COWA 4IE6A 5KHGA 3NKGA 3R4SA 4HKLA 4AVAA 5FPZA 1I6XA 2P3JA 2GH2A 5FMCA 4V2VA 5FRAA 2DVBA 4O61A 1IS3A 3NV4A 4LIUA 4Y5SA 1D0GA 4M3CE 2ZCWA 4QPYA 4SLIA 2RS33 2JDPA 4XUPA 3ROUA 4IEOA 2YGLA 1TMF1 1SFPA 3GHNA 1OOPB 2EIDA 1I5PA 1RUG1 2YG0A 4Y5TA 2MHFA 2OUHA 4Q0QA 5FP3A 3T4HB 5D1IA 1CAUB 3AKRA 2RS11 4HK9A 1OQDA 4IV3A 1JYVA 4ES9A 3OJBA 4FFFA 4BB3A 1JHNA 1PO11 2VY0A 3VBFA 4PLNA 4XCBA 3X29B 3TRSB 5A7OA 3BALA 3IN9A 3OBAA 2EXKA 5L7OC 2LM3A 3VBHB 1FOD2 3WD5A 3R05A 4COUA 2UYAA 1DYKA 2V5DA 4CDQB 1W2NA 1LHOA 2HEWF 2VOKA 4Q4Y3 4FPJA 2JDYA 1HB1A 3FZ3A 5DUXA 2A3YA 4K21A 2W39A 5DQ0A 1UY0A 5EJZB 1F4HA 4XURA 3K51A 2PFWA 3O1RA 1Q8OA 2PHDA 1IHMA 1YIPA 2AEZA 4I02A 3O1OA 4GWMA 4RS5C 2P3KA 5F3IA 4BA6A 4AEDB 4Z2WA 2A75A 2LALA 2FMYA 3UJQA 3WNKA 1UD1A 5HI0A 1S2BA 2WZ8A 3TAYA 4PI0A 4HVRA 2BU9A 2BGCA 2VULA 1FNZA 5BNOB 5A70A 4PDWB 2FDJA 3EO6A 4A45A 3Q8CA 1QKQA 2C9AA 1GNYA 3NO8A 3PNAA 1PVC3 5FKBA 1H0BA 4P9YA 5EJ3A 5FZ6A 1UKRA 5JXIA 2G9ZA 2LRPA 3UKVA 5DDJ3 4LO8A 3DN7A 1RHI1 3FUQA 3USUB 4HN0A 5FTTC 3ZXJA 5JPMB 4NE9A 1BEV2 2HWF3 2VW1A 3SKVA 3VDCA 1RUF1 2HYXA 1COV2 4BXSV 3AJYA 3IT8A 2VXJA 2Y60A 3B93A 3C7FA 1VE0A 3TBDA 1W03A 1RUE2 5HV4A 4IEQA 4QKBA 2VTXJ 3U11A 1ZZCA 2PQQA 1YC61 1R1ZA 1JMUB 3LD8A 4UI9L 1V6IA 3VD5A 1X7NA 1W8ZA 3ME2A 1E57A 4HANA 3POGA 3T2PA 4M0HA 5A6QA 2X05A 3U1XA 3W20A 3NNJA 5J3UA 1SLLA 4NIGA 2HWE3 5IVEA 5C71A 4FP2A 2ZGLA 1GUIA 3B69A 4OI4A 2ARBA 3UGGA 5KXCA 1YFUA 1CPNA 2PHUA 2VR4A 3B02A 4P9JA 3BU7A 1QQP1 2XJPA 4A41A 3CBNA 1DZTA 2YYOA 3RZMA 4LK7A 1NQJA 5FY9A 4EZHA 1H4GA 5J37A 2WAAA 4MXWA 3EHKA 2WLPA 5FJHA 5FZOA 4PI2A 4JAAA 5FZLA 4BMEA 4JKLA 1O8PA 1SCSA 2VOXA 3ES4A 1IQAA 2AACA 4ASLA 3OD0A 3FFZA 1OURA 1LHNA 1NA1B 2ZPXA 2WS92 3WNNA 5BPXA 5CB7A 3NNLA 3ENRA 2R6QA 3RJRA 2EALA 3FL7A 4FTBA 3OPZA 1GOGA 5GKAC 5F39A 1OBNA 1SPPB 1BBT2 4CU7A 2Q1MA 1RUJ2 1DQ0A 2A6VA 1FAYA 4MZUA 2E6VA 1NYWA 4J6GA 1HRI1 4D7TA 5FY1A 1RUH3 2LS6A 4QX5A 1WW5A 3OUIA 3FJSA 1Q8VA 4META 3KD4A 1EAH1 1RJ8A 1AR62 3EXUA 4Y24A 2DTYA 3LCPA 4A2UA 5ABJB 3TN91 1XU1A 1QOOA 3DKQA 4D6QA 3P5BA 4QPIC 3J8F1 1SFNA 3CJIA 1UOGA 1SBFA 3OPWA 3VZNA 1SBEA 1CONA 1W8FA 3I3EA 2VZOA 4P08A 2H0BA 1NQDA 4RGGA 3AZVA 3ZIXA 1YRZA 2ZMNA 3AX4A 1OC1A 3C7HA 5FZFA 3BI3A 3RZHA 1W99A 1W8OA 2RS53 2IFWA 2X29A 1RJ7A 2W0XA 3FC0A 3T09A 4FFGA 4PIXA 3BTZA 5FKCA 3VDDA 5FPAA 3WG3A 4KL1A 1S0EA 4AQSA 2EIGA 4OI1A 2DDUA 1NCQB 1EV13 4XZPA 3AP5A 2R0HA 4C1XA 3A4UA 3ZMOA 1CIYA 1EY2A 1APNA 4DZGA 3M7AA 5JI7A 1IS4A 2W3JA 1QMJA 1WD4A 1YFYA 5F5AA 1VBC1 3NJVA 2FQPA 1MS0A 4DO0A 2ZAAA 3PDQA 5GLVA 5FYYA 3WW3A 4GKYA 3MLKA 1CR7A 4OCTA 1VAKA 4AK3A 3TEYA 1SZBA 1M4WA 5T5JA 1HKDA 2XL7A 4RN5A 3WDVA 4D0QA 3OEAA 4UW6A 4QXHA 4YSFA 1ULPA 1MS1A 3ORJA 4KU8A 1SLCA 1G9FA 2D6OX 3WEZA 3P3NA 2VM9A 4UBGA 5L36A 3MW4A 2PHXA 4YFZA 4QX8A 1UU5A 2D7FA 1H4HA 3IM0A 3J4UH 3NKTA 3POBA 2JKBA 4LKFA 4XUQA 5FYHA 1RC6A 3DF0A 2A6XA 4FPFA 1JZ8A 1V9U3 2NYYA 2ZX0A 4XILA 3VZLA 3IPVB 4XF9A 1D4VB 2YHJA 1G7YA 2HWD3 4QX1A 4BQWA 1GZWA 4QB6A 4UT5A 5A32A 3BKZA 3GZTB 5FZKA 4XBLA 4YARA 1JYTA 1OFNA 3N9QA 1HV0A 4QXBA 4LOTA 2B42B 4XABA 5LRSA 2D3SA 5B4NA 2RM21 5CBLA 1O5LA 1F8VA 2ZHKA 1W9SA 2YC2A 1RUC3 1VALA 3LEIA 1B35B 1GNZA 3NJYA 1O6UA 2RJ2A 3AP6A 4MXVA 4NROA 2B45X 4WM8C 4XF0A 1CZSA 3LFIA 4MH0E 1HRV2 4CCDA 2PLV3 2QQIA 4CUAA 4Y22B 3UNPA 1NXD1 3PVOA 3ZM8A 5C3SA 5KBFA 1PGW2 4I0AA 1GWKA 3IIIA 2GH8A 4AR2A 3QD6A 1CGPA 2X5IB 3C7OA 1DF0A 1LHWA 1WCKA 2IZWA 4UFJA 1JXNA 4M00A 5D8AB 4EN0A 3AMHA 4KWLA 5J98B 2GDFA 3JQXA 2ZMLA 4EN9B 5FPUA 1NCRA 3WW2A 1ZA7A 2OKXA 4EYUA 3LEMA 4S2GA 3JD73 4XFHA 4AFBA 3WV6A 3RI9A 3WHUA 1JU4A 2HWC1 2QQWA 2F4LA 4QQ2A 3A21A 1NY72 1N3PA 3LE0A 1RUG2 4QX3A 5K4LA 3NAPB 4ZPIA 1RUD2 3H1MA 4WM7C 5JMCA 5FO7B 2BW8A 2YZ4A 3LIHA 5JUVA 3CZJA 3I49A 3K77A 4IEUA 4YGBA 3Q8EA 4COYA 3SH4A 1PO12 4LE3A 5FZCA 1WW6A 5IWFA 5DZFA 4XDPA 1O59A 1XYPA 1WCUA 2PHFA 4KGGA 1PO21 3B7MA 2WQZC 5CFDC 1IZ3A 5HXMA 1AXYA 5LA1A 1PNGA 3N7KA 2AR6A 3NV1A 1IG0A 4R9BA 3M3EA 2XDVA 2RR11 2BERA 2BYVE 2XVGA 4IE5A 5A7WA 4BQ5A 3KV5A 2O8QA 1G86A 1W3XA 2JICA 4NO4A 4U2AA 3SISA 3HIFA 1NLSA 4L92A 4AW7A 2R062 3BB6A 3MDPA 4QAWA 4XETA 4YM0A 3TYJA 1W9WA 5F5QA 2XOMA 5CVRA 1GQGA 4IV3B 4QDSA 3D6EA 3H3LA 3TB0A 4HLTA 1JYWA 4LPLA 1OF3A 1J3PA 4JQRA 2XR4A 5GZCA 1GV9A 1XNBA 4URTA 1CJDA 5AVPA 5DN2A 2IWGB 3GBWA 3VZKA 1RXGA 2GSYA 3VBSC 2BOIA 1F5FA 1R091 4YVWC 4Y26A 1LHVA 3AP4A 1EUUA 5GZDA 4D69A 2CSGA 4C91A 1TMF3 2A3XA 1A6CA 2J1SA 4XQDA 2EAAA 1RUF2 2FZ2A 3GGLA 1MZ6A 5F6KA 4E2QA 4N9HA 4BLIA 2RS13 2ZGNA 3JBG1 4KH9A 2PMWB 1ZBE1 2WZR2 4YZ4A 4AI8A 1AJKA 4A4AA 1DGLA 3ZFEC 3TNQA 4AOCA 1V70A 4TXWA 4OMDA 3MUY1 2WNUC 2XG3A 4UBHA 4XUTA 2XWBB 3ZKUA 5E16A 1AX0A 4Q1PA 3ZR5A 1AR81 1MEC1 4GB31 1GWMA 5T52A 3WG2A 5C9AA 2DBIA 4MHRA 1O5UA 3T0BA 1ASJ3 4DOUA 1U5ZA 1OD3A 2YGMA 2LW8A 1PGL1 5BV6A 1FPN2 1W9TA 2IXHA 5GLUA 4FXKB 1JOBA 2TBVA 4ATEA 2WNVA 5BNPC 2Z79A 2XKPA 3VHNA 5CISA 4OI2A 1GP5A 3RQ0A 3V56A 5L9RA 3OGJA 5DG1A 4XF1A 4QQHA 3GDBA 2PELA 3GYDA 3FHIB 4ISQA 1Y9MA 1Y7BA 4NN0A 4CSWA 1VBE1 1YUDA 4YRDA 4BCUA 5LY1A 3D5OA 4AZZA 3RYKA 5EQUA 4KWUA 3VBRC 3AZYA 4AGRA 3IDAA 4Y1XA 1DDLA
chains in the Genus database with same CATH topology
2YU2A 3N9LA 1VRBA 5IVBA 3PTRB 5FPUA 4BU2A 5F39A 5FYMA 4IGOA 5A3WA 5FP4A 4EYUA 5A1FA 5FP3A 5F3CA 4URAA 5F3GA 5A1LA 3DXTA 5FYIA 2W2IA 5IVCA 3K2OA 4GAZA 5FYVA 5F5CA 2Q8EA 5FY1A 4CCLA 4C8DA 5FBJA 5A7OA 5ISLA 5FZ1A 2XXZA 4Y3OA 5FYUA 5FYBA 5FXZA 5K4LA 4BISA 4QU1A 3ZPOA 5F5IA 5FZAA 4UF0A 2OT7A 5LY2A 3UYJA 4CCMA 4D6QA 2P5BA 3PUSA 5FPVA 5FZCA 5IW0A 5IVJA 5A7QA 3OPWA 3ZLIA 5IWFA 5FY5A 4D6SA 5F2SA 5FJKA 4XDPA 5FY8A 4QXCA 5FZOB 3LDBA 5FZFA 5FXXA 5IVYA 5F3IA 4AAPA 2WWUA 4CCJA 5FV3A 5FYCA 2YPDA 5FZBA 5FPAA 5A80A 2XDVA 2XMLA 3N9MA 2YBSA 4TN7A 5A7WA 3KV5A 5FUPA 5ANQA 4EZ4A 3U78A 4GD4A 4IGQA 5FPBA 5FZ3A 5FZ9A 5FZ6A 5A7NA 5LWBA 5FZMA 3KV6A 5FZ4A 4CCKA 2PXJA 5FXVA 5FP7A 5F5AA 3PURA 3DXUA 4GJYA 4HONA 3KVAA 4V2WA 5A3PA 5F37A 5FPLA 4DO0A 3PDQA 5FYYA 5F32A 5F2WA 5FZ7A 2VD7A 3N9NA 3PU8A 4LITA 2OQ7A 3PUQA 5A7PA 3N9PA 4UF0B 5FZHA 3OPTA 4QX7A 3U4SA 3AVSA 5FY4A 4BXFA 5FP9A 2OQ6A 4GJZA 4QXHA 5FZ8A 4E4HA 3LD8A 2WWJA 5FY7A 4Y33A 5A7SA 4CCOA 4QX8A 2OX0A 4D6RA 4NUBA 2Q8CA 2Q8DA 3KV9A 4Y4RA 4IGPA 3K3OA 5FYHA 5FY0A 5IVEA 5LW9A 3PUAA 4AI9A 5CEHA 5F3EA 2GP3A 5FWJA 3N9OA 5FZKA 5FUNA 5FWEA 5FZGA 3N9QA 4QXBA 4CCNA 3RVHA 2OS2A 3AL6A 2XUEA 3K3NA 4LIVA 4DIQA 4XDOA 2YU1A 5FY9A 4EZHA 3KV4A 5IVVA 5A3NA 5FYZA 2GP5A 4QWNA 5FXWA 3AVRA 3NJYA 4LXLA 5FJHA 5FZOA 3AL5A 2YBPA 4ASKA 5FZLA 2YBKA 3KVBA 5FP8A 4CUGA 5FZDA 5FYTA 5E6HA 5FZIA 4HOOA 4CSWA 4V2VA 5FZEA 5LY1A 4LIUA 5A3TA 3PU3A 5FZ0A 5KR7A 5A7WB 5FYSA 5IVFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YU2 A;  3N9L A;  1VRB A;  5IVB A;  3PTR B;  5FPU A;  4BU2 A;  5F39 A;  5FYM A;  4IGO A;  5A3W A;  5FP4 A;  4EYU A;  5A1F A;  5FP3 A;  5F3C A;  4URA A;  5F3G A;  5A1L A;  3DXT A;  5FYI A;  2W2I A;  5IVC A;  3K2O A;  4GAZ A;  5FYV A;  5F5C A;  2Q8E A;  5FY1 A;  4CCL A;  4C8D A;  5FBJ A;  5A7O A;  5ISL A;  5FZ1 A;  2XXZ A;  4Y3O A;  5FYU A;  5FYB A;  5FXZ A;  5K4L A;  4BIS A;  4QU1 A;  3ZPO A;  5F5I A;  5FZA A;  4UF0 A;  2OT7 A;  5LY2 A;  3UYJ A;  4CCM A;  4D6Q A;  2P5B A;  3PUS A;  5FPV A;  5FZC A;  5IW0 A;  5IVJ A;  5A7Q A;  3OPW A;  3ZLI A;  5IWF A;  5FY5 A;  4D6S A;  5F2S A;  5FJK A;  4XDP A;  5FY8 A;  4QXC A;  5FZO B;  3LDB A;  5FZF A;  5FXX A;  5IVY A;  5F3I A;  4AAP A;  2WWU A;  4CCJ A;  5FV3 A;  5FYC A;  2YPD A;  5FZB A;  5FPA A;  5A80 A;  2XDV A;  2XML A;  3N9M A;  2YBS A;  4TN7 A;  5A7W A;  3KV5 A;  5FUP A;  5ANQ A;  4EZ4 A;  3U78 A;  4GD4 A;  4IGQ A;  5FPB A;  5FZ3 A;  5FZ9 A;  5FZ6 A;  5A7N A;  5LWB A;  5FZM A;  3KV6 A;  5FZ4 A;  4CCK A;  2PXJ A;  5FXV A;  5FP7 A;  5F5A A;  3PUR A;  3DXU A;  4GJY A;  4HON A;  3KVA A;  4V2W A;  5A3P A;  5F37 A;  5FPL A;  4DO0 A;  3PDQ A;  5FYY A;  5F32 A;  5F2W A;  5FZ7 A;  2VD7 A;  3N9N A;  3PU8 A;  4LIT A;  2OQ7 A;  3PUQ A;  5A7P A;  3N9P A;  4UF0 B;  5FZH A;  3OPT A;  4QX7 A;  3U4S A;  3AVS A;  5FY4 A;  4BXF A;  5FP9 A;  2OQ6 A;  4GJZ A;  4QXH A;  5FZ8 A;  4E4H A;  3LD8 A;  2WWJ A;  5FY7 A;  4Y33 A;  5A7S A;  4CCO A;  4QX8 A;  2OX0 A;  4D6R A;  4NUB A;  2Q8C A;  2Q8D A;  3KV9 A;  4Y4R A;  4IGP A;  3K3O A;  5FYH A;  5FY0 A;  5IVE A;  5LW9 A;  3PUA A;  4AI9 A;  5CEH A;  5F3E A;  2GP3 A;  5FWJ A;  3N9O A;  5FZK A;  5FUN A;  5FWE A;  5FZG A;  3N9Q A;  4QXB A;  4CCN A;  3RVH A;  2OS2 A;  3AL6 A;  2XUE A;  3K3N A;  4LIV A;  4DIQ A;  4XDO A;  2YU1 A;  5FY9 A;  4EZH A;  3KV4 A;  5IVV A;  5A3N A;  5FYZ A;  2GP5 A;  4QWN A;  5FXW A;  3AVR A;  3NJY A;  4LXL A;  5FJH A;  5FZO A;  3AL5 A;  2YBP A;  4ASK A;  5FZL A;  2YBK A;  3KVB A;  5FP8 A;  4CUG A;  5FZD A;  5FYT A;  5E6H A;  5FZI A;  4HOO A;  4CSW A;  4V2V A;  5FZE A;  5LY1 A;  4LIU A;  5A3T A;  3PU3 A;  5FZ0 A;  5KR7 A;  5A7W B;  5FYS A;  5IVF A; 
#chains in the Genus database with same CATH topology
 3MID A;  1O4Z A;  2OUJ A;  4QHZ A;  3RMX A;  1I1E A;  2FCU A;  1LOG A;  1X9T A;  1RIN A;  1RHI 3;  4RHV 1;  4R8H A;  5J09 A;  3I2G A;  4GKX A;  3V0A A;  3IZO A;  3UJO A;  5FCC A;  3ZR6 A;  5H9S A;  4MX3 A;  2E9Q A;  3CEW A;  4XPV A;  4YGE A;  4HT1 T;  2W95 A;  1TME 2;  5CAD A;  5JXH A;  5FMD A;  1NLR A;  3H7Y A;  5FOJ B;  3NST A;  5FYB A;  5FXZ A;  1EUT A;  4HBN A;  5JIU A;  2XVL A;  3UYJ A;  4AI1 A;  1A34 A;  5T5L A;  2WAB A;  1HRI 2;  2QTW B;  1IKP A;  2CDP A;  4B1L A;  5L7O A;  2BBA A;  3AC0 A;  4XJ8 A;  3VD7 A;  1OKQ A;  1UPS A;  1O8S A;  3LIG A;  1EAH 2;  4MXW B;  4YM3 A;  1T6G C;  3ZN6 A;  5FZO B;  3MLL A;  5ANN A;  1KD7 A;  1LUL A;  1L7Q A;  4HSJ A;  1HN0 A;  1KJL A;  3AYC A;  1FOD 1;  1AR7 2;  3OBT A;  1FMD 2;  2AGS A;  3DYO A;  2RJL A;  4DXT A;  4RS5 A;  4AVS A;  1GLH A;  4PHZ A;  2VUD A;  1QQP 3;  1MS9 A;  3LPF A;  4XJU A;  1S0G A;  1PZ7 A;  4F8A A;  5H9P A;  1W28 A;  3PVN A;  2W94 A;  3NL1 A;  1QH7 A;  3DPR C;  1ZM1 A;  1PZ9 A;  3OGS A;  5A7N A;  5C3Q A;  5T54 A;  2V72 A;  3WP3 A;  1ZRD A;  3KCC A;  3SEE A;  5K8S A;  4JRL A;  2BNN A;  5FXV A;  1WME A;  4FPY A;  2WN3 A;  4LOS A;  4V2W A;  2TEP A;  3B01 A;  3POW A;  3WW1 A;  4QKF A;  4QQO A;  1J3R A;  1BHG A;  2YB7 A;  3MUZ 1;  1HQN A;  4WVM A;  1C5I A;  2DFC A;  2XJR A;  2I45 A;  5AC9 3;  3WF0 A;  3AB0 A;  2OYZ A;  1US3 A;  2VME A;  3POJ A;  3BIW E;  4XBQ A;  3NW4 A;  4ASM B;  4RFT 0;  3CJI B;  3DEM A;  5C3R A;  4BXF A;  2VVD A;  4RSU A;  1UZW A;  1UY1 A;  4GJZ A;  2Y0I A;  4OHZ A;  4L11 A;  2CGO A;  5DUV A;  1BEV 1;  3VD4 A;  2XLA A;  2ENR A;  2Q8C A;  3ILF A;  1G9D A;  1Z78 A;  2WJS A;  2J1A A;  1PIV 2;  1COV 1;  3RWN A;  2WQ4 A;  3VDD B;  4JX0 A;  4AI9 A;  3KGZ A;  5LBB A;  1RUE 1;  2QQV A;  3WG1 A;  2RG4 A;  1UPI A;  3IAP A;  3DKW A;  3TN9 3;  3OGG A;  4FO9 A;  5FZG A;  5FWE A;  2RE9 A;  4CYD A;  2HWB 3;  1BKZ A;  3J8F 3;  3OB8 A;  4CCN A;  5GZE A;  3TEW A;  2Y6K A;  2QJV A;  5C8C C;  3ZDV A;  2YFZ A;  1WMD A;  1Z0H A;  5LK5 A;  1ULG A;  4C90 A;  2ETE A;  3KQ4 B;  5C8W A;  2Y6L A;  3AVR A;  3CMG A;  1BVV A;  1K5M C;  2MEV 2;  1UO9 A;  1PK6 C;  5CIR A;  1HXS 2;  3QH7 A;  4HOO A;  2WT2 A;  3WNX A;  4CP1 A;  3SCH A;  1F35 A;  2BWC A;  2BRT A;  2DVA A;  3VB9 A;  4LTA A;  3IWZ A;  1FX5 A;  3TOJ A;  2HYK A;  3JQW A;  2PAK A;  2X8K A;  2AH2 A;  2JE9 A;  1C57 A;  2Y6F A;  4CEW C;  2QKD A;  5EYX A;  1VRB A;  2F17 A;  4GXL A;  3MIG A;  1ND3 C;  2XKO A;  4AQ2 A;  5F3C A;  3MYX A;  1STM A;  3WUC A;  1VBC 3;  3WY6 A;  5FR3 A;  2BNO A;  2CL2 A;  3K2O A;  5FMB A;  3MLJ A;  5FRE A;  2Q8E A;  1AYM 1;  1XNK A;  1XQN A;  2H6B A;  2IVJ A;  2V4V A;  3GNE A;  1GZW B;  5T5O A;  4HK8 A;  5A32 B;  5IUQ A;  3BCW A;  2D93 A;  2K0G A;  3E6D A;  2RDQ A;  5LCW L;  2VBD A;  1VRH 2;  3O0W A;  4LUM A;  3HVD A;  5FPV A;  4L97 A;  2E26 A;  1T2X A;  2DWR A;  4LUK A;  2BEO A;  2Y64 A;  1RUJ 1;  4K1Y A;  1VBA 2;  1DGW A;  2KR2 A;  3DGT A;  5T55 A;  4D6S A;  3WDY A;  1ZBA 3;  4OVE A;  1XYN A;  3LDB A;  4MO3 M;  5JR2 A;  3I54 A;  1Q8P A;  4QPI A;  2B46 X;  4A3X A;  1AR6 1;  1QEX A;  4XQ4 A;  1C5H A;  1YEW A;  2IXC A;  2DUQ A;  1U0A A;  4ZY9 A;  4BPZ A;  2XML A;  4QPG C;  3EYP A;  5J7M A;  3IKW A;  3V64 A;  2HLE A;  4HZF A;  3D4K A;  5I0D A;  3LDR A;  3ZFF C;  1W8W A;  3FMG A;  2HEY F;  1RVF 3;  2RM2 3;  4IGQ A;  2FDK A;  5A6X A;  5K9Y A;  2VOT A;  2WO7 A;  2ZTN A;  3UGF A;  1XPW A;  1UY4 A;  1S0F A;  2A70 A;  3BPZ A;  1W3V A;  2QZ3 A;  3T1M A;  3L2H A;  3N9N A;  5TSW A;  1JYI A;  2O14 A;  1OQE A;  4OI0 A;  3ACF A;  3M70 A;  2CYF A;  1LED A;  3VHR A;  2XUM A;  4P14 A;  2GC1 A;  4RR3 C;  3WP6 A;  1H2K A;  3QH6 A;  4GIQ A;  1WMX A;  3IIA A;  4EE2 A;  4LMF A;  5CFC A;  3O1M A;  3DCQ A;  5ERL A;  1KXG A;  4LT5 A;  4BQX A;  2ZAH A;  5LEK A;  2Q4S A;  3M1H A;  5FY7 A;  2KD7 A;  5KC6 A;  4DPN A;  1AF9 A;  5JSO A;  2IXL A;  1CQ9 A;  4CDW C;  3R0R A;  1LGC A;  1AXK A;  2XJS A;  3DEC A;  2UU8 A;  3K3O A;  2HWC 3;  3UL2 A;  1QJY 1;  2GC3 A;  2QQK A;  1SHW B;  4QMA A;  2FDF A;  1OSG A;  2OW4 A;  2O0O A;  2BUK A;  1QF3 A;  3AFG A;  5DAP A;  2VMD A;  4Z8B A;  4MUV A;  1ONA A;  2XB6 C;  4LE4 A;  5FUN A;  2P4E A;  1CJP A;  4LBO A;  2OS2 A;  3KHC A;  2VCA A;  3HAG A;  1T6B X;  4CU6 A;  1O3R A;  5LZ6 A;  2ZEY A;  4DIQ A;  4W8J A;  3RZG A;  2ZEW A;  4GB3 2;  3HNM A;  4XUN A;  5HCA A;  1PO2 3;  3N4M A;  1O3Q A;  2WII B;  3I2D A;  3O7O A;  1BQP A;  5GM0 A;  3ZYJ B;  4S2H A;  2GP5 A;  3N3H A;  4A7Z A;  4BK4 A;  2E51 A;  2CY6 A;  2ZX2 A;  4NHK A;  3UT0 A;  4AHX A;  1AJO A;  3VGI A;  3ZPY A;  1PNF A;  2D44 A;  2J1V A;  2RR1 3;  1Q8Q A;  3EBR A;  2WO2 A;  4CCE A;  3VD9 A;  5FZE A;  5A3L A;  4WM8 A;  1H30 A;  1CAV A;  5G05 L;  2J42 A;  1HQL A;  1UKG A;  5A33 B;  1ALY A;  3WDU A;  3ST7 A;  4BQ4 A;  1WW7 A;  3BYW A;  1JZ2 A;  4MSV A;  1YI9 A;  1N1T A;  4JTO A;  2UWB A;  4GAZ A;  1LKN A;  2RV9 A;  4XHX A;  4XFF A;  1PGW 1;  3AKP A;  5C9A B;  3HD8 B;  3P1I A;  1QH6 A;  2LUW A;  3M3C A;  5GZG A;  1R09 3;  3ZSL A;  1XJA A;  2J22 A;  3A0K A;  4G9S B;  4Y1V A;  1NG0 A;  1I5Z A;  2Z2S B;  1A8D A;  2JE8 A;  5HPO A;  2VW2 A;  5KWR A;  1XYO A;  1GMM A;  1QJU 2;  3JBG 3;  4WM7 A;  4BE3 A;  5JZG C;  1ZBE 3;  1N1V A;  2VZT A;  1CES A;  1U12 A;  1LOB A;  1UCX A;  3FBM A;  4P02 B;  4BQ2 A;  1XXN A;  5FXX A;  5IVY A;  1NY7 1;  3ES1 A;  1W6M A;  2GMP A;  3MIH A;  1N3Q A;  4P9I A;  4QM9 A;  3AM2 A;  1AR8 3;  1MEC 3;  1BK1 A;  1RTV A;  1OOP C;  1RUD 1;  5LAT A;  1W04 A;  2R07 2;  5CFD A;  2NM1 A;  2ET1 A;  3HT1 A;  3WQB A;  4QB2 A;  1IPK A;  4B8E A;  4DUX A;  3NNG A;  1SAC A;  5CYY A;  4JGZ C;  4Q26 A;  1OD5 A;  2WBK A;  3SNM A;  1YO8 A;  2K9Z A;  3V0A B;  1QOS A;  2VU9 A;  2YV8 A;  4JDN A;  4YGC A;  4MG2 A;  4GQ7 A;  2F4P A;  2BJS A;  2DCZ A;  4QU2 A;  1JI6 A;  1UX6 A;  2DU0 A;  4D8M A;  2A73 B;  5A3P A;  4IEW A;  1JH5 A;  2Q1F A;  4XIK A;  4AXO A;  5C3P A;  3MPB A;  1VBE 3;  5HCB A;  1DFQ A;  4NRQ A;  1LTE A;  4LIT A;  5FLI A;  4YYO A;  2YUE A;  1RMU 2;  2XHN A;  4W6Y A;  4DY3 A;  3ETP A;  1F31 A;  4GWI A;  4O9G A;  1SCR A;  1O91 A;  1FV2 A;  5FZH A;  2R06 1;  1NX9 A;  3QOP A;  2XGX A;  1DYP A;  2QQM A;  4LBQ D;  5L7O B;  4OHY A;  3E6B A;  3GJB A;  3Q9O A;  3VBS A;  4CTE A;  5JLV A;  2WFF 2;  3KLS A;  3ZN6 B;  5EP9 A;  4RHV 3;  5FMO S;  3OD4 A;  3ZXL A;  3LA2 A;  4D7Y A;  2VCB A;  4YVW A;  2FDG A;  2EAK A;  3PVB B;  5CKM A;  2ZOE B;  5JIA A;  3W58 A;  4COV A;  3H8O A;  4IE0 A;  2JG8 C;  2LTN A;  4Q8K A;  4RS5 B;  4OUE A;  1CX4 A;  4JGY C;  5EXO A;  3MW2 A;  2WR9 A;  4K9S A;  3AXD A;  5EJ1 B;  3WVJ A;  2WNU A;  1YNA A;  2E53 A;  4B7E A;  3WDW A;  4B3N A;  2PTM A;  3ZXF A;  2RDN A;  3I7D A;  2UYB A;  2KXL A;  5JWP A;  1JYN A;  1V0A A;  5KC5 A;  1MZE A;  1YJK A;  2VUA A;  4K7J A;  2ORZ A;  2WZR 1;  4UFH A;  1F9K A;  3AXE A;  2JDK A;  2MNG A;  2ZAB A;  4XF3 A;  1WCQ A;  3LF7 A;  2VQT A;  3NVC A;  4ONU A;  5K0U C;  4XMA A;  4WVM B;  1OUS A;  1TZO A;  5BNP A;  1W06 A;  4KNC A;  5FP8 A;  1FOD 3;  2ARA A;  5FYT A;  3ZXA C;  3SXW A;  4N8M A;  4D3W A;  4E4Z A;  3ZO0 B;  2Z5W A;  3RZK A;  5B4X A;  3WP4 A;  1FPN 1;  2CU5 A;  2UUR A;  2D6P A;  3FLT A;  1UF2 C;  3PU3 A;  3CL1 A;  3THD A;  1JOD A;  1G8W A;  4J1W A;  2VZR A;  4I01 A;  4Q0P A;  2ZHL A;  2VTF A;  3ABZ A;  4FPL A;  2BOJ A;  2MPF A;  3SIT A;  4CPB D;  4D94 A;  4MGQ A;  3VBR A;  2ZX1 A;  3OTF A;  2WO3 A;  1IQD C;  2BPA 2;  5FDB A;  2D43 A;  3FWE A;  1RUN A;  1H2L A;  1JU3 A;  4R4Z A;  3JUU A;  5DMY A;  1PZ8 A;  5FZ1 A;  4XDQ A;  3WLU A;  2LRO A;  3MBW A;  4W6W A;  2FDI A;  2WZE A;  3F95 A;  5GJ6 A;  2JIG A;  3H3U A;  1Y9Q A;  4AGG A;  4XJW A;  1W9Y A;  5LAS A;  1LEN A;  4M4R A;  3OGR A;  1AYM 2;  4AYU A;  5L9V A;  2WRA A;  3JB4 C;  1NA1 C;  5E1R A;  2D3P A;  1BEV 3;  3A23 A;  3WQ7 A;  1QXJ A;  3O1S A;  1F15 A;  2BFU L;  1WBF A;  4Q4X 2;  1LR5 A;  2P3I A;  5DPN A;  4OLL A;  1AL2 1;  1TME 1;  1COV 3;  3KHB A;  1US2 A;  3GCX A;  1N3O A;  1SDD B;  4CCJ A;  4LA3 A;  3AYE A;  1RUE 3;  2C0Z A;  1VBD 2;  2PQS A;  1W8U A;  4IV1 C;  3GZE A;  1IPJ A;  2OZ6 A;  3IDB B;  4H7L A;  1VIW B;  1VP6 A;  1GR3 A;  5DUW A;  5E89 A;  5FIX A;  3RMY A;  4BYY A;  5ANQ A;  2VNO A;  3O1P A;  1FNY A;  3D0S A;  1QDO A;  2B39 A;  2DCK A;  4GD4 A;  5LB6 A;  3UET A;  1ZNP A;  1H8T C;  4LKS A;  4IER A;  4P9L A;  5JXJ A;  2RDS A;  4BK5 A;  2WUH A;  3I4I A;  1D2Q A;  1JS9 A;  2DU1 A;  3PUR A;  1K45 A;  1MVQ A;  3R4D B;  1AR7 1;  2AZ5 A;  3DPR A;  2IVI B;  4G4F A;  5FPL A;  1FMD 1;  2EXJ A;  3VL9 A;  4CE8 A;  3USS A;  4QQP A;  4OUS A;  2WN2 A;  3UKT A;  2ZKN A;  3POI A;  3FN9 A;  3GJA A;  4YNI A;  1JOP A;  5HXV A;  1W8N A;  5EWS A;  4K40 A;  1SG3 A;  1OI6 A;  1YQ6 A;  3I2K A;  3V0B A;  1CPM A;  1VMF A;  4FQZ A;  4AQ6 A;  4CUB A;  1VBB 2;  5FZ8 A;  4QKD A;  2VW0 A;  1W6O A;  2A6W A;  3POE A;  3JCI A;  4PF5 A;  4DS0 A;  3NQH A;  4E8C A;  5FQ0 A;  4QPI B;  1XND A;  3PUH A;  5HCH A;  3NNM A;  1RUO A;  2OX0 A;  3ZYH A;  1QJZ A;  5GZF A;  4HG6 B;  4ES8 A;  1OH4 A;  1R1A 2;  2WS9 3;  1V6N A;  1KFU L;  4GAL A;  2AC1 A;  4CEY C;  3PUA A;  2Q8O A;  4P5Y A;  1UZY A;  3KSC A;  4KQ7 A;  4LR4 A;  4ZHN A;  1AR9 2;  4GH4 C;  1HN1 A;  1LOA A;  2FCT A;  3K4A A;  4P9W A;  2VZS A;  5D2A A;  4CXX A;  3S0M A;  1XU2 A;  1BBT 3;  1A3K A;  1QJY 2;  5GLW A;  4ATF A;  4R9D A;  1RUJ 3;  1WLW A;  1BYH A;  4HMZ A;  3MZH A;  4LK6 A;  4N9I A;  1XRU A;  4L9B A;  1OA4 A;  1S0J A;  4JTN A;  3K4D A;  5I91 A;  2AUY A;  4H14 A;  5A3N A;  5FYZ A;  1PIV 1;  2VPV A;  4LNV A;  1DBN A;  4JV4 A;  1AR6 3;  4BOW A;  4DIN B;  2YBP A;  4HET A;  2WT0 A;  3GF6 A;  4PF1 A;  3VV1 A;  5C8C A;  3T0A A;  1KJR A;  1URX A;  4Q5O A;  1N47 A;  2ARC A;  4XCA A;  1BZW A;  3AP9 A;  1K12 A;  2VL4 A;  4PBP A;  4PIZ A;  4XFC A;  5CFC B;  1PK6 A;  1KIT A;  1O4Y A;  5CZK A;  2G1M A;  1PMJ X;  3GHM A;  5JSP A;  2XBO 1;  4QDR A;  2D5F A;  4ZKT B;  3I8T A;  4RQP C;  2JKX A;  2MEV 1;  3KCY A;  2D6K A;  1HXS 1;  4KMQ A;  4P9X A;  4CEW A;  2UY9 A;  2WKK A;  5C3O A;  3VKO A;  1QDC A;  5F5C A;  1ND3 A;  1DQ1 A;  2Y34 A;  3I3M A;  5CG9 A;  4Q4V 2;  2OPK A;  2ADD A;  1W2T A;  3O14 A;  4DMI A;  3WNP A;  1LOF C;  2FZ1 A;  1BLZ A;  4ISR A;  1G9A A;  4FSJ A;  3VN4 A;  3SCG A;  4P9G A;  1UN1 A;  4G3Y C;  1OFS A;  4TZD A;  3WX5 A;  1KRI A;  1EPW A;  3GAL A;  1WLC A;  5A7Q A;  4BQ1 A;  1JOJ A;  5F2S A;  4FAH A;  2X5I C;  3VHP A;  3QLQ A;  2ZA9 A;  4P5H A;  5L9B A;  3VDA A;  3ZN5 A;  4QXK A;  4IEX A;  3ETQ A;  4IDZ A;  5FV3 A;  5A3M A;  3DV8 A;  4XYX A;  1IPS A;  3VKL A;  4WM8 B;  1CAV B;  5A80 A;  1VRH 1;  5F6L B;  1OT5 A;  1DLC A;  3RGB A;  2DUP A;  1AX1 A;  1GKB A;  1UWW A;  1WLD A;  3I3Q A;  5CKQ A;  1VBA 1;  4A7K A;  1Q43 A;  4YWA A;  4QPG A;  3J7H A;  3OBR A;  2ZX3 A;  4C1W A;  4YZ2 A;  2C9K A;  3LDK A;  3HT2 A;  4KBZ A;  3ZFF A;  5FP7 A;  5LBF A;  3DXU A;  4LHK A;  3U75 A;  4OHV A;  4UFL A;  1PMI A;  5F7U A;  1UL9 A;  4XF4 A;  2X53 S;  4IQP A;  1KQR A;  5FZ7 A;  3H8X A;  4JRA A;  2R32 A;  5M0T A;  3LGR A;  1NT0 A;  4KWJ A;  2W46 A;  3O0X A;  5A6Z A;  4AHY A;  3MV1 1;  4LHL A;  4LBL A;  4WM7 B;  4XVH A;  3I3D A;  1XOY A;  5EIY B;  1C8N A;  4BQY A;  1HRV 3;  4RR3 A;  4FCA A;  1W6M B;  5IAV A;  1K5J A;  3KZ4 C;  4JKK A;  3VBU C;  4MYE A;  1DCS A;  5CFD B;  4L8Q A;  1A8M A;  5LK7 B;  1CIW A;  3G6J B;  3KMH A;  2OXB A;  3VBF B;  4CDW A;  4CXW A;  2GP3 A;  2E7Q A;  3O12 A;  4XXP A;  1YI7 A;  1KS4 A;  3K4Z A;  5ACA 2;  3VHO A;  3WCR A;  3K46 A;  5DAV A;  3UGH A;  2XUE A;  4A44 A;  3R4U A;  4QKN A;  4XDO A;  2YU1 A;  1IS6 A;  3SEP A;  2VTX A;  1SLB A;  2VOV A;  2WWS A;  4YG6 A;  5JOX A;  2NMO A;  2VNV A;  1N1Y A;  3THP A;  2ZGQ A;  1ENR A;  1ULO A;  2VVE A;  1RIR A;  3BGA A;  4YZ3 A;  1RUG 3;  1XBF A;  3CO2 A;  2VQA A;  1BMV 2;  3S57 A;  1OLR A;  1RUD 3;  1H9W A;  5E6H A;  1OLM A;  5GAL A;  4JVA A;  2QNK A;  2W5F A;  1E5H A;  1PO1 3;  4E4S A;  2BP6 A;  2WQ8 A;  3VBS B;  5FZ0 A;  5LRR A;  1SMV A;  3FE5 A;  1RUI 2;  3NV2 A;  5A1A A;  2FD8 A;  3WUD A;  2J7M A;  4IEV A;  1GSL A;  2HH9 A;  1CVN A;  1POQ A;  3O0V A;  4H55 A;  4KI5 M;  4YVW B;  3ELN A;  3NMB A;  2VUC A;  3RWK X;  3O1V A;  1YLL A;  2GNT A;  1HLC A;  2XON A;  4AWD A;  5GLT A;  1D2S A;  2W2I A;  5IVC A;  4FFI A;  2WA3 A;  3HNY M;  5FYV A;  3APB A;  4QT6 A;  4IES A;  4AHW A;  1S4C A;  2VCC A;  3AP7 A;  2E63 A;  1LEC A;  2OA2 A;  1MS4 A;  3BN6 A;  1OXC A;  2RS3 1;  3FHA A;  2R06 3;  4MV2 A;  2WNU B;  3ZDS A;  2P6H A;  4ORF A;  2ZX4 A;  3T1L A;  2XQR A;  4CCM A;  1ULF A;  3PUS A;  4BIF A;  1H1M A;  2XJQ A;  4AFM A;  3RSJ A;  1O3T A;  2QBX A;  4XW3 A;  1OUX A;  2AEY A;  5I8S A;  5BNP B;  1NLQ A;  3G7D A;  3AYA A;  4ZXK A;  1JZ4 A;  2TNF A;  5IFP A;  3PTY A;  1W2A X;  1UIK A;  5F9T A;  1NUK A;  4F3J A;  5JCT A;  5JZG A;  2GAL A;  2Y26 A;  2YPD A;  3MGU A;  4K8R B;  1AX2 A;  1SLT A;  5CAZ A;  4QDQ A;  4UYB A;  4OZX A;  4ZZ5 A;  4TN7 A;  2ZGM A;  3BPS A;  4AL9 A;  2C5D A;  3CJX A;  1P8J A;  1RUF 3;  1AL2 2;  3K75 B;  1LGN A;  4JDO A;  4CRQ A;  1QJX 2;  1OOP A;  1QJU 1;  2RMU 2;  5SV8 A;  2WZR 3;  1ENS A;  1GP4 A;  3M4F A;  5FZ3 A;  3VBR B;  1G9B A;  1GYK A;  3KV6 A;  1UOF A;  3SKJ E;  5FLJ A;  2ARE A;  1S0B A;  4JGZ A;  3NJZ A;  3RZL A;  5KHK A;  4TWT A;  4LUL A;  1ZA4 A;  3WP5 A;  2R07 1;  2BV4 A;  1W6N A;  4LHS A;  2JEM A;  3PU8 A;  2ID4 A;  2OQ7 A;  5JXG A;  1FPN 3;  1UU6 A;  3VZJ A;  1JZ5 A;  4MGK E;  3OPT A;  3KM5 A;  1PVC 1;  1W2U A;  2JB4 A;  4MGY E;  1Y43 B;  2BNM A;  2JG9 C;  4LBM A;  2J1E A;  3ZIW A;  4AVT A;  2V5Y A;  3H42 B;  4Z1V A;  1QXR A;  1S1A A;  4GWN A;  4R52 A;  5IK4 A;  2VO5 A;  2YXS A;  3B94 A;  1VR3 A;  3HWJ A;  2VMG A;  1ULD A;  2HWF 1;  3LOI A;  2H6C A;  1A78 A;  1C8M 2;  3H1W A;  4WVZ A;  3KV9 A;  3C7E A;  2WT1 A;  4Q4W 2;  1RMU 1;  3M3O A;  4NIH A;  5FFO C;  1GZT A;  4IEZ A;  1XC6 A;  4NWV A;  2ZGU A;  2QDR A;  4N53 C;  5KXD A;  4R9C A;  4NRP A;  3CKH A;  2JG8 A;  2C4X A;  2WFF 1;  2Y8K A;  1ZZ7 A;  2VQU A;  3LKJ A;  4JGY A;  4YM1 A;  4NAM A;  2VC9 A;  4CU8 A;  3OSD A;  1L3J A;  5DZE A;  3LQC A;  1AYN 2;  4S2D A;  1YFW A;  3DPR B;  4NPM A;  1TME 3;  2W1W A;  4Z92 B;  2D6M A;  1MQT C;  1TG7 A;  1TNR A;  1HB3 A;  3WDT A;  1HQW A;  1WUV A;  5BUV A;  5K0U A;  3POY A;  3GXU A;  5BXX A;  1HRI 3;  5KXE A;  5C5T A;  2G19 A;  3WNM A;  2ZGK A;  3CU7 A;  4AFA A;  1EAH 3;  1VB2 A;  2QUO A;  2QQN A;  3PUI A;  4CDU C;  1W6O B;  1E5S A;  4MVT A;  1Q8S A;  5FQ0 B;  2Y6J A;  2D3R A;  1WCS A;  3JB8 A;  2W1S A;  2J1T A;  5DAW A;  1Z7S 2;  1B09 A;  2B4K A;  3U0Z A;  1DGW X;  1HB4 A;  2B8M A;  1AR7 3;  4NIA A;  3WR0 A;  1FMD 3;  1H1I A;  5EHD A;  1POV 1;  4XXA A;  4OQ8 A;  1LU2 A;  5BNN C;  1G9C A;  3HMY A;  4JQT A;  2PN5 A;  4YW6 A;  5FK8 A;  2ZBJ A;  3WNO A;  4FQ4 A;  5IK8 A;  3QCW A;  3MO4 A;  2XBO 2;  3C7G A;  1RYY A;  4Y3O A;  2Z4F A;  5FYU A;  3RI8 A;  3RS6 A;  5DAQ A;  5CKN A;  4FTS A;  3S5Q A;  2G9F A;  2JDZ A;  2XJV A;  2XH6 A;  1PGS A;  4UWD A;  2OT7 A;  3OEB A;  3N7M A;  1QOT A;  3S30 A;  5IW0 A;  3ZXE A;  2EXH A;  3H3Z A;  5KHH A;  2K46 A;  4FPK A;  4Y20 A;  4CDX C;  1CAX A;  1GZC A;  4H3W A;  4N7U A;  5FJK A;  5FY5 A;  5IYY A;  1RUH 1;  5C8C B;  5IJR A;  2V73 A;  3NWK A;  5T5P A;  1UXZ A;  5CNA A;  4XZU G;  4QGM A;  2DV9 A;  3EJK A;  3GM8 A;  1VMJ A;  5FZB A;  3ZSE A;  4AFD A;  1PK6 B;  2YC4 A;  2YBS A;  1UW8 A;  4W50 A;  2GNB A;  4YW2 A;  3O1U A;  4A6S A;  3IAQ A;  3C3V A;  3BTA A;  3K48 A;  2WC2 A;  4IV1 A;  2JEC A;  2P34 A;  4L2N A;  3T3Y A;  1CD3 G;  3KGL A;  4Q4X 1;  3AMP A;  1W6P A;  3ZSK A;  5C6C A;  1Y3T A;  1PIV 3;  1S0I A;  3DYP A;  5APA A;  4CEW B;  3N35 A;  1ND3 B;  2JIJ A;  1H8T A;  3KVA A;  4GJY A;  4XC9 A;  1VBD 1;  5JR7 B;  5I0U A;  3AZZ A;  4A6O A;  5A6Y A;  1OA3 A;  5F32 A;  1H6X A;  1JHJ A;  3EMR A;  1BCX A;  3UK9 A;  4ARX A;  1GAN A;  2J1U A;  4EV0 A;  4XOG A;  4YGD A;  4YW7 A;  1UAI A;  2VG9 A;  5FY4 A;  4QD2 A;  2BVV A;  1TNF A;  5JMO A;  4R9A A;  3HBZ A;  5DUU A;  4GUL A;  2YDE A;  1GIC A;  2H0V A;  1FI2 A;  2B9U A;  1QXP A;  2I07 B;  2MEV 3;  2UWC A;  4N43 C;  2XPJ A;  2W52 A;  3I2H A;  1HXS 3;  1H9P A;  4WVV A;  2Q8D A;  4M4P A;  1LCL A;  1NCR B;  4Y4R A;  1RB8 G;  2YRO A;  1X50 A;  3D3A A;  2P37 A;  2QQU A;  1YFX A;  2HBU A;  1DGR N;  5LW9 A;  2C6S A;  5EYY A;  1VAV A;  4LBQ A;  5C4W C;  2X09 A;  1N1S A;  4Y1U A;  1VLN A;  3E5X A;  4PIY A;  2JD9 A;  1VBB 1;  3POS A;  2WIN B;  3OF1 A;  4YG0 A;  4TSV A;  5A3U A;  4CEY A;  4QPG B;  2HJI A;  3JXS A;  4X6R B;  2YMZ A;  4GMP 1;  4LO7 A;  2GNM A;  3ILN A;  2ILM A;  4LIV A;  1OMI A;  4GH4 A;  3T2Q A;  4Q0V A;  2FBE A;  1H2M A;  2VQ0 A;  4YVS C;  1R1A 1;  3PMS A;  3FUO A;  4HKO A;  3I3B A;  1WCD J;  2P2K A;  5FXW A;  4LXL A;  4W4Z A;  1AR9 1;  4Q0U A;  2O1Q A;  2X10 A;  3WF4 A;  1RXF A;  1REF A;  4HSL A;  1VRH 3;  1Y9G A;  2VOW A;  1DQ5 A;  3MF6 A;  4FFH A;  4FAG A;  2W1Q A;  1VBA 3;  2XJU A;  3J7L A;  5A7W B;  3RG0 A;  3HEI A;  5FYS A;  5F1R A;  2C26 A;  3PVE A;  1ODM A;  4FOQ A;  2R04 2;  4M3C A;  4RR3 B;  3ILR A;  3WHT A;  2OPW A;  5A1F A;  4BH9 A;  1LES A;  2RVA A;  1R08 2;  4AF9 A;  4DEV A;  1YHF A;  2CAV A;  2FMD A;  3GZA A;  4FPG A;  1D4M 2;  4C8D A;  3O5S A;  4RQP A;  1RGS A;  4CDW B;  1AVB A;  5I93 A;  1ND2 C;  1ZZ8 A;  2VBP A;  3M8L A;  1SQ4 A;  4H2A A;  5LEJ A;  3INA A;  1K42 A;  4BIS A;  1DYO A;  1QGL A;  1CN1 A;  2PA7 A;  4QU1 A;  4CPB A;  4HVO A;  1FAT A;  1DHK B;  5IK5 A;  3O1T A;  1YXW A;  3MV0 1;  3H0O A;  4OHX A;  2Q1Z B;  4KU7 A;  1LOF A;  4DUW A;  3LSE A;  4OQ9 A;  2ZZQ A;  2RS3 2;  1FYU A;  3WZ1 A;  1FT9 A;  3A22 A;  3AMQ A;  5T3N A;  3I2O A;  2ES3 A;  3VBO C;  2R16 A;  3GBG A;  3BOP A;  4JDM A;  3MIF A;  3NNF A;  1OA2 A;  4Q4V 1;  4XHB A;  5DAB A;  3CHX A;  3KB5 A;  4ERO A;  1WLT A;  3MPP G;  2VAU A;  1ACC A;  3N9M A;  3U14 A;  2GME A;  1GQH A;  1WWY A;  4DXS A;  5FUP A;  5I8T A;  2B7Y A;  3ZFG C;  2XJT A;  4X8P A;  4PQ9 A;  2WSU A;  5I8Y A;  3U78 A;  3WG4 A;  4JZR A;  1R64 A;  3AJZ A;  4ZON A;  1O4T A;  1UY2 A;  3C2U A;  2ZGP A;  1J84 A;  3LAG A;  5FPB A;  1QNW A;  5FZ9 A;  2A1X A;  5LWB A;  4YW1 A;  4PBO A;  3OCP A;  4Q0S A;  4OYU A;  4Q4Y 2;  4XFA A;  2WNV B;  3SQO A;  4CCK A;  3SC7 X;  3MIE A;  4E4D X;  5JOZ A;  3B00 A;  1X36 A;  2DF7 A;  2VD7 A;  3B9I A;  2VZ3 A;  2Q0A A;  5BNQ A;  2HBT A;  4LBK A;  1WZX A;  4BMB A;  4FPO B;  4GB3 3;  5LA2 A;  1NKG A;  4XAA A;  4RFR B;  4QX2 A;  2QQL A;  4B1M A;  4I30 A;  1PVC 2;  1VPH A;  1UMI A;  1VB4 A;  1VMH A;  4IE4 A;  3L2Y A;  5E88 A;  4AVB A;  5JZG B;  2D97 A;  5DDJ 2;  3VBH C;  1BVP 1;  4LEJ A;  5F3E A;  2DUO A;  4CDQ C;  1DLL A;  4AEK A;  2HWF 2;  3VBU A;  2B9V A;  4FPE A;  1UYP A;  4UFI A;  5C7G A;  1MS3 A;  4HFS A;  2JXA A;  2DCY A;  1U5X A;  1WKY A;  3LSD A;  3FLR A;  4NVP A;  1M06 G;  1W0P A;  5H9R A;  3T2O A;  1FV3 A;  4JGZ B;  1DQ2 A;  5GLZ A;  1SLA A;  2A71 A;  2G4I A;  4RD7 A;  5F8P A;  4AED C;  2ZEX A;  4LKD A;  4AEJ A;  4NID A;  3THC A;  1CZT A;  2P1B A;  1W6N B;  3ZYP A;  3AL5 A;  2ADE A;  4AQT A;  4CUG A;  4MOA A;  1EYB A;  5BNO C;  4I3P A;  1ASJ 1;  3KWV A;  4XTM A;  4PDW C;  1H2N A;  3D8C A;  3RYR A;  5ACA 1;  4I2O A;  1PX4 A;  1XE7 A;  5H9Q A;  5I0T A;  3B9C A;  1ZRE A;  2HWE 2;  4EJR A;  2FDH A;  1QJU 3;  2W68 A;  5CU1 A;  3P3P A;  4YPJ A;  1J83 A;  5CG8 A;  3ZFE A;  1NZC A;  4B4P A;  4Y1Z A;  1UZV A;  4E9K A;  2VZU A;  1BMV 1;  3CDZ B;  4RYD A;  5A3W A;  1DQ4 A;  1OH3 A;  5FP4 A;  1WA4 A;  4URA A;  1LU1 A;  2C24 A;  1NE4 A;  3I2F A;  2EF6 A;  4CP9 A;  2R07 3;  2RDR A;  1YWK A;  2XLF A;  3N36 A;  2W47 A;  4RL7 A;  4CCL A;  1NXM A;  5IFT A;  3W5N A;  5FBJ A;  4HPK A;  4XE9 A;  2JG8 B;  4O65 A;  1RUI 1;  4DY5 A;  4JGY B;  4UF0 A;  2R7E B;  1W6Q A;  3VL8 A;  2P5B A;  2NMN A;  1UZ0 A;  4R4X A;  3A7Q A;  3MHZ A;  4QHB A;  1YIF A;  5AFE A;  1S55 A;  4QXC A;  2BWA A;  3BOD A;  1E5R A;  1H8V A;  1UMZ A;  3URF A;  2RHP A;  4OUL A;  2ERF A;  4D6R A;  5HBA A;  1CAW A;  1RMU 3;  5K0U B;  4IW3 A;  5LBC A;  3WOG A;  3H1Y A;  5BYN A;  3KCX A;  2W9X A;  4BWO A;  2DBN A;  2WFF 3;  1RUH 2;  3AFK A;  1XSR A;  4JHZ A;  4EZ4 A;  4BIO A;  3H8R A;  3TEX A;  4AEM A;  5CA6 A;  4P00 B;  3BUC A;  4I3G A;  1DIW A;  4IE7 A;  1AHS A;  4XMI A;  1ZRF A;  2DVG A;  2DCJ A;  2WYF A;  5J36 A;  4HXC A;  1IOA A;  3LA7 A;  4UW4 A;  1SDW A;  2ZGS A;  4FPH A;  3E5Q A;  4PQQ A;  3U07 A;  3WF2 A;  4E8D A;  4QX0 A;  5F37 A;  4QGL A;  1LAJ A;  2K2S A;  5AFB A;  3E97 A;  4IET A;  1SBD A;  3PHM A;  5B2G B;  2OVU A;  2RS5 2;  3PUQ A;  4XUO A;  5DAX A;  2ZGO A;  3ZXK A;  2RJK A;  1QJX 1;  2RMU 1;  2GC0 A;  2CHH A;  1OKO A;  3ASI A;  4Y20 B;  1C4R A;  2OQ6 A;  3N7J A;  1CAX B;  4XIO A;  5DZG A;  4B4Q A;  5JDB A;  3AZX A;  2YC0 A;  5A7S A;  1G6N A;  2JG9 A;  1EV1 2;  5FBZ A;  1POV 3;  3IMM A;  2GN7 A;  4Z07 A;  4WZC A;  5AC9 1;  2A7A A;  2W92 A;  3H7J A;  4COZ A;  2Y33 A;  3PJQ A;  3VD3 A;  5CEH A;  1EP0 A;  1POV 0;  1Q56 A;  1WA6 X;  2JE7 A;  4RA0 A;  2ZAC A;  1LHU A;  5ABJ C;  1Q3E A;  1PM7 A;  3OY8 A;  1LEM A;  1WD3 A;  3WXP A;  1RL3 A;  3ZKY A;  1V6M A;  5HV0 A;  4IV1 B;  3RVH A;  3ACL A;  2YFU A;  1W6P B;  4N53 A;  2IC1 A;  1S2K A;  1WBL A;  1C8M 1;  2ET7 A;  3JZV A;  3MFA A;  2EIE A;  2VE1 A;  3QAC A;  1JZ3 A;  2P17 A;  5T50 A;  1UYX A;  1H8T B;  2WYS A;  2Y0O A;  2W08 A;  2Z42 A;  4NHL A;  2DFB A;  4Q4W 1;  4OUM A;  4QWN A;  4Y5Z 0;  3WF3 A;  3ZMN A;  3H50 A;  4HVQ A;  2ATF A;  1HJG A;  4Q8L A;  1SFY A;  2QCS B;  5FZD A;  4XJZ A;  5L73 A;  1AZD A;  5HCF A;  2HWB 1;  3VLB B;  3FX3 A;  1LRH A;  1NCQ C;  4LLO A;  1AYM 3;  1MQT A;  1V9U 2;  1HJF A;  1OLQ A;  5A3T A;  1JZ7 A;  4YG3 A;  2HWD 2;  1AYN 1;  4FP3 A;  2SLI A;  3J9S A;  2G9G A;  4Q4X 3;  5IAT A;  3PTR B;  5F3G A;  3DXT A;  4QGN A;  5FYI A;  4CDU A;  4YZ5 A;  1VBD 3;  4UW5 A;  4ZU5 A;  4Q27 A;  1OVP A;  2FHR A;  3HPN A;  1RUC 2;  1U5Y A;  4LBQ B;  3S5A A;  1ZRR A;  4CA9 A;  1WGP A;  1VAM A;  3OUJ A;  2GC2 A;  4LO4 B;  3HQU A;  1IKQ A;  3VZO A;  4CEY B;  2PLV 2;  3W59 A;  1JUH A;  5BNN A;  1KEX A;  4CXY A;  4GH4 B;  1Z7S 1;  2BBV A;  3AKT A;  3OOX A;  4O9E A;  5SV5 A;  1K5M A;  3NRU A;  3P6B A;  4NPL A;  3WNL A;  2V4A A;  4CP2 A;  4EWE A;  2PHT A;  3ZXD A;  3U10 A;  5CFC C;  5E8A A;  3HNB M;  1Q5O A;  2NN8 A;  3DYM A;  4IL7 A;  2WWU A;  2BGO A;  4CDX A;  3JD7 2;  5FYC A;  1MZ5 A;  1V00 A;  1QJF A;  2P6C A;  3I2I A;  4N7I A;  4ET7 A;  3SLI A;  3ZSJ A;  4E27 A;  1VBB 3;  4KG0 A;  4AFC A;  4A7Y A;  2QVS B;  2VEC A;  3VUO A;  4GMP 3;  4I0B A;  4UW3 A;  2GU9 A;  1ZBA 1;  4IXL A;  4M3C B;  1IS5 A;  2IXI A;  2KA3 A;  3L9J T;  3ON7 A;  4SBV A;  3ALQ A;  4YW3 A;  4BZ4 A;  4DNY A;  4DRR A;  1B35 C;  1R1A 3;  1X9P A;  3BVC A;  1MR5 A;  1YQ2 A;  4GMP 0;  4ZU4 A;  4AGV A;  2PXJ A;  2D98 A;  4Z2A A;  3Q8F A;  3RZZ A;  2VNR A;  1UXX X;  4J25 A;  4RQP B;  2ZEZ A;  1AR9 3;  2PAM A;  4MGT A;  2JDA A;  2ARX A;  4MGI E;  2JJ6 A;  2UY8 A;  3AMN A;  1W0N A;  2F6B A;  3N7L A;  4QM8 A;  5A7P A;  5EFU A;  3AK0 A;  1QJY 3;  2A6Y A;  4V1P A;  4A42 A;  5JI9 A;  3M3I A;  1S0D A;  1RVF 1;  3AYD A;  5D8A C;  4EWA A;  2W87 A;  4YZ1 A;  5IHR A;  3OUH A;  3WQ0 A;  1UQX A;  2CTV A;  5FP9 A;  3T2T A;  3GBF A;  1BK0 A;  4IUG A;  3W5M A;  2Q30 A;  1PMH X;  3HQR A;  2WWJ A;  1ST8 A;  1EPZ A;  3HR9 A;  2IUW A;  4NJ4 A;  5D21 A;  2V09 A;  3E1F 1;  1PVX A;  4NUB A;  4OHW A;  4Y4Y A;  1D0H A;  3SH3 A;  1I9R A;  4N43 A;  5JVV A;  4E2G A;  1ZVF A;  3NAP C;  4XFB A;  1JBC A;  5EPA A;  3KT7 A;  4OFG A;  1ZYB A;  3M2M A;  2WDB A;  5LA9 A;  1K3I A;  2W1U A;  1KDM A;  1DP0 A;  1W05 A;  3KF5 A;  4ZZ8 A;  5FWJ A;  5IT6 A;  3I97 A;  4AI3 A;  1GBG A;  1W0O A;  2DUR A;  5FUI A;  3AL6 A;  5C4W A;  1XE0 A;  2OZJ A;  3K3N A;  4LO6 B;  3CIH A;  3HOB A;  4UFK A;  5A3O A;  2QQP A;  3KV4 A;  3CQO A;  4K1Z A;  4X8N A;  4AI2 A;  3CNA A;  4W6X A;  1TMF 2;  3IMN A;  1QWR A;  1XNT A;  4LHN A;  3LEG A;  4Q4V 3;  4AI0 A;  2JDH A;  1CX1 A;  1GFF 2;  2ZGT A;  5JPN B;  1J1L A;  2EIB A;  2RS1 2;  3CLP A;  4QHO A;  4YVS A;  3ZYB A;  1UIJ A;  4YM2 A;  1X82 A;  4MAD A;  3PLQ A;  2DVF A;  2HEV F;  4BHP A;  2VZQ A;  3MIC A;  1YQ5 A;  1HX6 A;  1XB9 A;  2CGP A;  1ODN A;  5IVF A;  4IV3 C;  2YU2 A;  3N9L A;  4FXG B;  4WVW A;  1ASJ 2;  1GNH A;  4Y1Y A;  3RZJ A;  2R0F A;  3VBF C;  4XFG A;  2WO1 A;  5FYM A;  4AAX A;  4F7Z A;  2DVD A;  2VVF A;  4XAE A;  1YQ8 A;  4JCK A;  4XBN A;  3OYW A;  1KS5 A;  1OHF A;  3VDB A;  1U5I A;  2XLG A;  3C8X A;  4HKW A;  3TWI A;  2P3Y A;  4B4R A;  4BLJ A;  5ISL A;  3VBU B;  2IXK A;  5JSR A;  4AVV A;  1I3H A;  1LOC A;  1QY4 A;  3UES A;  3ACH A;  3B3Q E;  5FZA A;  1J3Q A;  1UZZ A;  3FBY A;  3LOB A;  3V65 A;  5LY2 A;  2R04 1;  3IBM A;  4FI9 A;  1E5I A;  1ND2 A;  2N7G A;  2GZW A;  2PYT A;  4LQR A;  2KM2 A;  1R08 1;  2VH9 A;  1UY3 A;  3GCW A;  5FY8 A;  3HJR A;  1F5J A;  1QNY A;  3MFC A;  4XJ9 A;  3HQX A;  3FLP A;  1D4M 1;  2QE3 A;  3OGV A;  2BZD A;  1C28 A;  4UXA A;  1RHI 2;  1MS5 A;  1KGY A;  4NOT A;  2VJX A;  3BTX A;  3B5L B;  3HN1 A;  1OPO A;  1XSQ A;  1LOE A;  3SHR A;  4M0N A;  5A33 A;  3VBO A;  5L19 A;  2PHW A;  2VGD A;  2CWS A;  3ZFE B;  1J59 A;  5KHJ A;  2D6L X;  5J96 B;  1MAC A;  2GAU A;  1YYN A;  2JDN A;  3ZYI B;  3ZFG A;  3VKM A;  4CU9 A;  4WBB A;  3QBQ A;  4CP9 B;  3CF6 E;  3D82 A;  3W9A A;  5I0S A;  1DGR A;  2BFU S;  1QJE A;  2R1D A;  5EZW A;  5FAX A;  3NV3 A;  4E2S A;  1LB2 A;  3I59 A;  4HPK B;  1QU0 A;  1UYZ A;  1RED A;  4NMI A;  1JW6 A;  4B29 A;  5ACA 3;  4ZS3 A;  3KQR A;  3KF3 A;  2L9L A;  4UF0 B;  2CWM A;  1D7P M;  1W6Q B;  2A5Z A;  5J48 A;  1IGO A;  1HV1 A;  3ITQ A;  1C1F A;  3AVS A;  1CZV A;  1HB2 A;  4FT8 A;  2WA4 A;  2VNG A;  4ITC A;  3W21 A;  4DB5 A;  4DFS A;  2GMM A;  4Q4Y 1;  3PL0 A;  4E4H A;  1PHM A;  1QQP 2;  2VMH A;  1REE A;  1W8H A;  4ZXE A;  2WSV A;  3Q8A A;  1DZQ A;  3RDI A;  2XWJ B;  1GP6 A;  1XE8 A;  1CAW B;  2VMF A;  4CCO A;  1GZ9 A;  1AXZ A;  2WL1 A;  2FCV A;  4I0W B;  2BVB A;  1KDK A;  1PM4 A;  1CAU A;  2AYH A;  1GOF A;  5FY0 A;  4QQL A;  4YFW A;  4QPW A;  3WT3 A;  4EWD A;  4GZ9 A;  5G04 L;  2ZHM A;  3WW4 A;  4FTE A;  2A6Z A;  4AVC A;  1RUI 3;  2DCT A;  3T0D A;  2CV6 A;  2JDM A;  4LLF A;  1OQ1 A;  4B7K A;  4EQV A;  1ENX A;  2EA7 A;  3S7I A;  4YLZ A;  4L99 A;  4OMC A;  5AVA A;  3TNP B;  3VBH A;  2VMI A;  1DU3 D;  1HW5 A;  5AC9 2;  2QFE A;  2XVK A;  4O7X A;  4CDQ A;  5C70 A;  4LO5 B;  1UNB A;  5BY5 A;  1JZ6 A;  1X8M A;  3IDC B;  3WIN E;  2QZ2 A;  2AEN A;  3J26 N;  2WFP A;  2XHK A;  4UAP A;  5DDJ 1;  3SH5 A;  3T4V A;  1OLM E;  2JWP A;  4ASK A;  1DG6 A;  3FFQ A;  2YBK A;  3WCS A;  2JX9 A;  4EN8 B;  5FZI A;  1L7L A;  4AED A;  4LKE A;  4XEZ A;  2GN3 A;  2I74 A;  2VUJ A;  5JOW A;  5LBE A;  4DXR A;  4NHY A;  1IG3 A;  5BNO A;  5FPX A;  2Y6H A;  4JKM A;  1J1T A;  3ACG A;  5KR7 A;  1NZI A;  4PDW A;  3WF1 A;  5FO8 B;  3TN9 2;  2JG9 B;  1QHD A;  2HWB 2;  3J8F 2;  3LA3 A;  1NAE A;  2NZ9 A;  2WNE A;  2Q5T A;  4ZS2 A;  1YJL A;  1UOB A;  4XAC A;  3USU A;  2IFR A;  3KT4 A;  3I2J A;  2WAO A;  1CWP A;  2HWE 1;  3OY8 B;  1AL2 3;  1ZRC A;  3CJI C;  1QJX 3;  3ACI A;  2RMU 3;  1SLI A;  4EN7 B;  1C3H A;  3ZPO A;  3ATG A;  2QDN A;  5JAX A;  1JUI A;  2R1B A;  2TUN A;  3FHQ A;  4N53 B;  2EIC A;  4RGA A;  5F5I A;  4ARY A;  3A0N A;  3MF9 A;  3AMM A;  3ZX7 A;  3ZVX A;  5FOB B;  3E5U A;  3D0J A;  4C0B A;  3V0B B;  3ZLI A;  3J7M A;  1O7F A;  2E33 A;  4Q1R A;  3OBZ A;  3VDD C;  4TTG A;  4M01 A;  3ZSM A;  4BDV B;  3ZYR A;  3U37 A;  1LOD A;  1YCI A;  3F2Z A;  3PME A;  1V6J A;  2EVX A;  2UWA A;  4WZF A;  4AE2 A;  5C5U A;  1VBC 2;  5K7P A;  3H9A A;  5JOY A;  1GU3 A;  1QIQ A;  4K3U A;  1MQT B;  1XNC A;  2QQO A;  3BOW A;  4FPC A;  2VZP A;  4LA2 A;  1UOJ A;  1C1L A;  1UYY A;  2XQX A;  5EV7 A;  3ZXG A;  1H6Y A;  1DQ6 A;  3LWC A;  5FMO L;  1C8M 3;  4ZU7 A;  4YW5 A;  2ORX A;  3GZU C;  4MLO A;  2GND A;  4Q4W 3;  4CDU B;  1TQ5 A;  1V6L A;  4HON A;  4M3C F;  4JHT A;  3MIB A;  4XTP A;  2ZKL A;  3T08 A;  2WZP P;  1ZBA 2;  2VCM A;  4TLF A;  2E7A A;  5F2W A;  4MHU A;  4A3Z A;  3RJ2 X;  1MVE A;  5BNN B;  3N9P A;  1HDK A;  4QX7 A;  1NA1 A;  2ZXQ A;  3AKQ A;  2XL9 A;  3SMH A;  3RNS A;  1AYN 3;  2SBA A;  1NOV A;  3ZYF A;  1OPM A;  1K5M B;  3Q8B A;  4LBJ A;  2QQJ A;  3LEK A;  2ZS6 B;  4PLM A;  2C1F A;  3EQE A;  2ZJC A;  4PJY A;  4U36 A;  3PJY A;  2PHL A;  2E31 A;  1ZZB A;  3J7N A;  4KBB A;  1RVF 2;  2RM2 2;  4TYS A;  4YW4 A;  4C0H A;  1SPP A;  1V6K A;  4PT6 A;  1W90 A;  1WMF A;  2I2S A;  4CDX B;  3KS7 A;  4Q2F A;  4NHM A;  3RFR A;  2RS5 1;  1LJ7 A;  2BQP A;  2R49 A;  3VKN A;  1YQC A;  4KGQ A;  2ZGR A;  3SCF A;  5C33 A;  4KWK A;  2VXR A;  2NP0 A;  4X6Q B;  4NAO A;  2PAE A;  4MGS A;  1Z7S 3;  2BGP A;  1L7R A;  1ZZ9 A;  2NLR A;  4W65 A;  5ABJ A;  4HL0 A;  4NPR A;  5LA0 A;  2D40 A;  1EV1 1;  2BDR A;  2EXI A;  4IEY A;  5I0R A;  4LJH A;  4Q29 A;  2WS9 1;  3DL3 A;  1JTZ X;  4J1X A;  4LOR A;  4DQA A;  1PX3 A;  2E7T A;  2XBO 3;  3ECQ A;  1WW4 A;  4CVU A;  3KVB A;  1BXH A;  2YPJ A;  4DEQ A;  1DZR A;  4AG4 A;  1GQP A;  1MZF A;  1X33 A;  1UX7 A;  2HWC 2;  1BBT 1;  1TEI A;  1ENQ A;  3BU0 A;  3CZU A;  1FXZ A;  4XQW A;  1NCR C;  3M3Q A;  1JYX A;  1H1A A;  3S6P A;  4XFI A;  4F83 A;  5FO9 B;  3DUI A;  3LB9 A;  1OVS A;  3AKS A;  1NCQ A;  4QB1 A;  3U4X A;  3UKN A;  5IVB A;  4BU2 A;  3KT1 A;  4IGO A;  4RGK A;  3ZYG A;  5A1L A;  2VBB A;  2ZZJ A;  1W2O A;  4N43 B;  2IXJ A;  3MEP A;  4GA9 A;  3ZFF B;  2NPI A;  3PIJ A;  1LNS A;  1PO2 2;  3E6C C;  4K8F A;  4NHX A;  3IB3 A;  3VKF C;  1V9U 1;  1BJQ A;  2XXZ A;  4CP0 A;  2E32 A;  4NRM A;  2HWD 1;  3UV9 A;  3PIG A;  5C4W B;  3ZN4 A;  5IK7 A;  3LFM A;  2RR1 2;  4FOW A;  1MPX A;  4NR1 A;  3S7E A;  1ZX5 A;  2B5H A;  4WV8 A;  5IVJ A;  3MI8 A;  4I09 A;  4S2F A;  4UFM A;  2CNA A;  1ZRI A;  2CAU A;  2Z69 A;  5J1X A;  1RUC 1;  1UU4 A;  1GOH A;  3AZW A;  4CZS A;  1W39 A;  1JYC A;  3RRD A;  1S0C A;  1X8E A;  4KG8 A;  2R30 A;  4PCR A;  4YVS B;  4HN1 A;  1S2E A;  4XJA A;  3POF A;  3WSO A;  4AAP A;  1F4A A;  2OII A;  4L0P A;  2PLV 1;  5FLH A;  3WDX A;  2PHR A;  3H8U A;  1AL0 G;  3R6S A;  4H7M A;  4MGZ E;  3IPV A;  1AUY A;  1TE1 B;  1LGB A;  4TLG A;  3LZZ A;  3OG2 A;  2HKX A;  3VZM A;  2VZ1 A;  1UMH A;  1R09 2;  3LPG A;  4DXZ A;  4K6B A;  2VZV A;  3NJX A;  2ZMK A;  2JDU A;  1MS8 A;  3BIE A;  1VJ2 A;  2JD4 A;  4GWJ A;  5FZM A;  3OYW B;  1Y4W A;  4UOJ A;  5FZ4 A;  4BJ0 A;  4D7S A;  4CCC A;  3JD7 1;  2A3W A;  1F2N A;  2BTV C;  1SEF A;  1RIT A;  4Z82 A;  3JBG 2;  5DXD A;  3T30 A;  1ZBE 2;  1B35 A;  1OF4 A;  2YY1 A;  4EN6 B;  4IEP A;  3RYP A;  4CUC A;  2NQY A;  4Y22 A;  4JC1 A;  2Y38 A;  2W91 A;  2DYC A;  3U4S A;  5KHI A;  1AR8 2;  1MEC 2;  1ND2 B;  2JB8 A;  2CDO A;  3WQ1 A;  4NII A;  5IAX A;  2X5I A;  5DG2 A;  1W8T A;  4FVV A;  2O8O A;  4FOV A;  1PGL 2;  4FBF A;  1XNA A;  2CGN A;  5D8A A;  4Y33 A;  1NE6 A;  4N90 A;  5C9A C;  4PLO A;  1ULE A;  2WNO A;  2D5H A;  4IGP A;  2WLQ A;  3THT A;  4AHZ A;  4DUV A;  4FOY A;  3EB7 A;  4LBN A;  3VBO B;  1J58 A;  2ZHN A;  3RPQ A;  1ULC A;  1HIX A;  2JEN A;  5KXB A;  1GWL A;  2WNV C;  4BQ3 A;  3BTY A;  2DTW A;  3N9O A;  1V6O A;  1VBE 2;  2R04 3;  4NWW A;  3HBK A;  5FK7 A;  3NAP A;  2Y6G A;  1O3S A;  1W9F A;  4DRV A;  2VMC A;  1HRV 1;  1R08 3;  1JN2 P;  3JU9 A;  3ZFG B;  1TVG A;  3ZOI A;  1ZZ6 A;  4BM8 A;  3TEZ A;  4IND A;  3IDE A;  1KFX L;  4OZO A;  5IVV A;  1D4M 3;  4K20 A;  2J1R A;  3HN3 A;  2D6N A;  4RHV 2;  3MW3 A;  3I59 B;  4COW A;  4IE6 A;  5KHG A;  3NKG A;  3R4S A;  4HKL A;  4AVA A;  5FPZ A;  1I6X A;  2P3J A;  2GH2 A;  5FMC A;  4V2V A;  5FRA A;  2DVB A;  4O61 A;  1IS3 A;  3NV4 A;  4LIU A;  4Y5S A;  1D0G A;  4M3C E;  2ZCW A;  4QPY A;  4SLI A;  2RS3 3;  2JDP A;  4XUP A;  3ROU A;  4IEO A;  2YGL A;  1TMF 1;  1SFP A;  3GHN A;  1OOP B;  2EID A;  1I5P A;  1RUG 1;  2YG0 A;  4Y5T A;  2MHF A;  2OUH A;  4Q0Q A;  5FP3 A;  3T4H B;  5D1I A;  1CAU B;  3AKR A;  2RS1 1;  4HK9 A;  1OQD A;  4IV3 A;  1JYV A;  4ES9 A;  3OJB A;  4FFF A;  4BB3 A;  1JHN A;  1PO1 1;  2VY0 A;  3VBF A;  4PLN A;  4XCB A;  3X29 B;  3TRS B;  5A7O A;  3BAL A;  3IN9 A;  3OBA A;  2EXK A;  5L7O C;  2LM3 A;  3VBH B;  1FOD 2;  3WD5 A;  3R05 A;  4COU A;  2UYA A;  1DYK A;  2V5D A;  4CDQ B;  1W2N A;  1LHO A;  2HEW F;  2VOK A;  4Q4Y 3;  4FPJ A;  2JDY A;  1HB1 A;  3FZ3 A;  5DUX A;  2A3Y A;  4K21 A;  2W39 A;  5DQ0 A;  1UY0 A;  5EJZ B;  1F4H A;  4XUR A;  3K51 A;  2PFW A;  3O1R A;  1Q8O A;  2PHD A;  1IHM A;  1YIP A;  2AEZ A;  4I02 A;  3O1O A;  4GWM A;  4RS5 C;  2P3K A;  5F3I A;  4BA6 A;  4AED B;  4Z2W A;  2A75 A;  2LAL A;  2FMY A;  3UJQ A;  3WNK A;  1UD1 A;  5HI0 A;  1S2B A;  2WZ8 A;  3TAY A;  4PI0 A;  4HVR A;  2BU9 A;  2BGC A;  2VUL A;  1FNZ A;  5BNO B;  5A70 A;  4PDW B;  2FDJ A;  3EO6 A;  4A45 A;  3Q8C A;  1QKQ A;  2C9A A;  1GNY A;  3NO8 A;  3PNA A;  1PVC 3;  5FKB A;  1H0B A;  4P9Y A;  5EJ3 A;  5FZ6 A;  1UKR A;  5JXI A;  2G9Z A;  2LRP A;  3UKV A;  5DDJ 3;  4LO8 A;  3DN7 A;  1RHI 1;  3FUQ A;  3USU B;  4HN0 A;  5FTT C;  3ZXJ A;  5JPM B;  4NE9 A;  1BEV 2;  2HWF 3;  2VW1 A;  3SKV A;  3VDC A;  1RUF 1;  2HYX A;  1COV 2;  4BXS V;  3AJY A;  3IT8 A;  2VXJ A;  2Y60 A;  3B93 A;  3C7F A;  1VE0 A;  3TBD A;  1W03 A;  1RUE 2;  5HV4 A;  4IEQ A;  4QKB A;  2VTX J;  3U11 A;  1ZZC A;  2PQQ A;  1YC6 1;  1R1Z A;  1JMU B;  3LD8 A;  4UI9 L;  1V6I A;  3VD5 A;  1X7N A;  1W8Z A;  3ME2 A;  1E57 A;  4HAN A;  3POG A;  3T2P A;  4M0H A;  5A6Q A;  2X05 A;  3U1X A;  3W20 A;  3NNJ A;  5J3U A;  1SLL A;  4NIG A;  2HWE 3;  5IVE A;  5C71 A;  4FP2 A;  2ZGL A;  1GUI A;  3B69 A;  4OI4 A;  2ARB A;  3UGG A;  5KXC A;  1YFU A;  1CPN A;  2PHU A;  2VR4 A;  3B02 A;  4P9J A;  3BU7 A;  1QQP 1;  2XJP A;  4A41 A;  3CBN A;  1DZT A;  2YYO A;  3RZM A;  4LK7 A;  1NQJ A;  5FY9 A;  4EZH A;  1H4G A;  5J37 A;  2WAA A;  4MXW A;  3EHK A;  2WLP A;  5FJH A;  5FZO A;  4PI2 A;  4JAA A;  5FZL A;  4BME A;  4JKL A;  1O8P A;  1SCS A;  2VOX A;  3ES4 A;  1IQA A;  2AAC A;  4ASL A;  3OD0 A;  3FFZ A;  1OUR A;  1LHN A;  1NA1 B;  2ZPX A;  2WS9 2;  3WNN A;  5BPX A;  5CB7 A;  3NNL A;  3ENR A;  2R6Q A;  3RJR A;  2EAL A;  3FL7 A;  4FTB A;  3OPZ A;  1GOG A;  5GKA C;  5F39 A;  1OBN A;  1SPP B;  1BBT 2;  4CU7 A;  2Q1M A;  1RUJ 2;  1DQ0 A;  2A6V A;  1FAY A;  4MZU A;  2E6V A;  1NYW A;  4J6G A;  1HRI 1;  4D7T A;  5FY1 A;  1RUH 3;  2LS6 A;  4QX5 A;  1WW5 A;  3OUI A;  3FJS A;  1Q8V A;  4MET A;  3KD4 A;  1EAH 1;  1RJ8 A;  1AR6 2;  3EXU A;  4Y24 A;  2DTY A;  3LCP A;  4A2U A;  5ABJ B;  3TN9 1;  1XU1 A;  1QOO A;  3DKQ A;  4D6Q A;  3P5B A;  4QPI C;  3J8F 1;  1SFN A;  3CJI A;  1UOG A;  1SBF A;  3OPW A;  3VZN A;  1SBE A;  1CON A;  1W8F A;  3I3E A;  2VZO A;  4P08 A;  2H0B A;  1NQD A;  4RGG A;  3AZV A;  3ZIX A;  1YRZ A;  2ZMN A;  3AX4 A;  1OC1 A;  3C7H A;  5FZF A;  3BI3 A;  3RZH A;  1W99 A;  1W8O A;  2RS5 3;  2IFW A;  2X29 A;  1RJ7 A;  2W0X A;  3FC0 A;  3T09 A;  4FFG A;  4PIX A;  3BTZ A;  5FKC A;  3VDD A;  5FPA A;  3WG3 A;  4KL1 A;  1S0E A;  4AQS A;  2EIG A;  4OI1 A;  2DDU A;  1NCQ B;  1EV1 3;  4XZP A;  3AP5 A;  2R0H A;  4C1X A;  3A4U A;  3ZMO A;  1CIY A;  1EY2 A;  1APN A;  4DZG A;  3M7A A;  5JI7 A;  1IS4 A;  2W3J A;  1QMJ A;  1WD4 A;  1YFY A;  5F5A A;  1VBC 1;  3NJV A;  2FQP A;  1MS0 A;  4DO0 A;  2ZAA A;  3PDQ A;  5GLV A;  5FYY A;  3WW3 A;  4GKY A;  3MLK A;  1CR7 A;  4OCT A;  1VAK A;  4AK3 A;  3TEY A;  1SZB A;  1M4W A;  5T5J A;  1HKD A;  2XL7 A;  4RN5 A;  3WDV A;  4D0Q A;  3OEA A;  4UW6 A;  4QXH A;  4YSF A;  1ULP A;  1MS1 A;  3ORJ A;  4KU8 A;  1SLC A;  1G9F A;  2D6O X;  3WEZ A;  3P3N A;  2VM9 A;  4UBG A;  5L36 A;  3MW4 A;  2PHX A;  4YFZ A;  4QX8 A;  1UU5 A;  2D7F A;  1H4H A;  3IM0 A;  3J4U H;  3NKT A;  3POB A;  2JKB A;  4LKF A;  4XUQ A;  5FYH A;  1RC6 A;  3DF0 A;  2A6X A;  4FPF A;  1JZ8 A;  1V9U 3;  2NYY A;  2ZX0 A;  4XIL A;  3VZL A;  3IPV B;  4XF9 A;  1D4V B;  2YHJ A;  1G7Y A;  2HWD 3;  4QX1 A;  4BQW A;  1GZW A;  4QB6 A;  4UT5 A;  5A32 A;  3BKZ A;  3GZT B;  5FZK A;  4XBL A;  4YAR A;  1JYT A;  1OFN A;  3N9Q A;  1HV0 A;  4QXB A;  4LOT A;  2B42 B;  4XAB A;  5LRS A;  2D3S A;  5B4N A;  2RM2 1;  5CBL A;  1O5L A;  1F8V A;  2ZHK A;  1W9S A;  2YC2 A;  1RUC 3;  1VAL A;  3LEI A;  1B35 B;  1GNZ A;  3NJY A;  1O6U A;  2RJ2 A;  3AP6 A;  4MXV A;  4NRO A;  2B45 X;  4WM8 C;  4XF0 A;  1CZS A;  3LFI A;  4MH0 E;  1HRV 2;  4CCD A;  2PLV 3;  2QQI A;  4CUA A;  4Y22 B;  3UNP A;  1NXD 1;  3PVO A;  3ZM8 A;  5C3S A;  5KBF A;  1PGW 2;  4I0A A;  1GWK A;  3III A;  2GH8 A;  4AR2 A;  3QD6 A;  1CGP A;  2X5I B;  3C7O A;  1DF0 A;  1LHW A;  1WCK A;  2IZW A;  4UFJ A;  1JXN A;  4M00 A;  5D8A B;  4EN0 A;  3AMH A;  4KWL A;  5J98 B;  2GDF A;  3JQX A;  2ZML A;  4EN9 B;  5FPU A;  1NCR A;  3WW2 A;  1ZA7 A;  2OKX A;  4EYU A;  3LEM A;  4S2G A;  3JD7 3;  4XFH A;  4AFB A;  3WV6 A;  3RI9 A;  3WHU A;  1JU4 A;  2HWC 1;  2QQW A;  2F4L A;  4QQ2 A;  3A21 A;  1NY7 2;  1N3P A;  3LE0 A;  1RUG 2;  4QX3 A;  5K4L A;  3NAP B;  4ZPI A;  1RUD 2;  3H1M A;  4WM7 C;  5JMC A;  5FO7 B;  2BW8 A;  2YZ4 A;  3LIH A;  5JUV A;  3CZJ A;  3I49 A;  3K77 A;  4IEU A;  4YGB A;  3Q8E A;  4COY A;  3SH4 A;  1PO1 2;  4LE3 A;  5FZC A;  1WW6 A;  5IWF A;  5DZF A;  4XDP A;  1O59 A;  1XYP A;  1WCU A;  2PHF A;  4KGG A;  1PO2 1;  3B7M A;  2WQZ C;  5CFD C;  1IZ3 A;  5HXM A;  1AXY A;  5LA1 A;  1PNG A;  3N7K A;  2AR6 A;  3NV1 A;  1IG0 A;  4R9B A;  3M3E A;  2XDV A;  2RR1 1;  2BER A;  2BYV E;  2XVG A;  4IE5 A;  5A7W A;  4BQ5 A;  3KV5 A;  2O8Q A;  1G86 A;  1W3X A;  2JIC A;  4NO4 A;  4U2A A;  3SIS A;  3HIF A;  1NLS A;  4L92 A;  4AW7 A;  2R06 2;  3BB6 A;  3MDP A;  4QAW A;  4XET A;  4YM0 A;  3TYJ A;  1W9W A;  5F5Q A;  2XOM A;  5CVR A;  1GQG A;  4IV3 B;  4QDS A;  3D6E A;  3H3L A;  3TB0 A;  4HLT A;  1JYW A;  4LPL A;  1OF3 A;  1J3P A;  4JQR A;  2XR4 A;  5GZC A;  1GV9 A;  1XNB A;  4URT A;  1CJD A;  5AVP A;  5DN2 A;  2IWG B;  3GBW A;  3VZK A;  1RXG A;  2GSY A;  3VBS C;  2BOI A;  1F5F A;  1R09 1;  4YVW C;  4Y26 A;  1LHV A;  3AP4 A;  1EUU A;  5GZD A;  4D69 A;  2CSG A;  4C91 A;  1TMF 3;  2A3X A;  1A6C A;  2J1S A;  4XQD A;  2EAA A;  1RUF 2;  2FZ2 A;  3GGL A;  1MZ6 A;  5F6K A;  4E2Q A;  4N9H A;  4BLI A;  2RS1 3;  2ZGN A;  3JBG 1;  4KH9 A;  2PMW B;  1ZBE 1;  2WZR 2;  4YZ4 A;  4AI8 A;  1AJK A;  4A4A A;  1DGL A;  3ZFE C;  3TNQ A;  4AOC A;  1V70 A;  4TXW A;  4OMD A;  3MUY 1;  2WNU C;  2XG3 A;  4UBH A;  4XUT A;  2XWB B;  3ZKU A;  5E16 A;  1AX0 A;  4Q1P A;  3ZR5 A;  1AR8 1;  1MEC 1;  4GB3 1;  1GWM A;  5T52 A;  3WG2 A;  5C9A A;  2DBI A;  4MHR A;  1O5U A;  3T0B A;  1ASJ 3;  4DOU A;  1U5Z A;  1OD3 A;  2YGM A;  2LW8 A;  1PGL 1;  5BV6 A;  1FPN 2;  1W9T A;  2IXH A;  5GLU A;  4FXK B;  1JOB A;  2TBV A;  4ATE A;  2WNV A;  5BNP C;  2Z79 A;  2XKP A;  3VHN A;  5CIS A;  4OI2 A;  1GP5 A;  3RQ0 A;  3V56 A;  5L9R A;  3OGJ A;  5DG1 A;  4XF1 A;  4QQH A;  3GDB A;  2PEL A;  3GYD A;  3FHI B;  4ISQ A;  1Y9M A;  1Y7B A;  4NN0 A;  4CSW A;  1VBE 1;  1YUD A;  4YRD A;  4BCU A;  5LY1 A;  3D5O A;  4AZZ A;  3RYK A;  5EQU A;  4KWU A;  3VBR C;  3AZY A;  4AGR A;  3IDA A;  4Y1X A;  1DDL A; 
#chains in the Genus database with same CATH homology
 2YU2 A;  3N9L A;  1VRB A;  5IVB A;  3PTR B;  5FPU A;  4BU2 A;  5F39 A;  5FYM A;  4IGO A;  5A3W A;  5FP4 A;  4EYU A;  5A1F A;  5FP3 A;  5F3C A;  4URA A;  5F3G A;  5A1L A;  3DXT A;  5FYI A;  2W2I A;  5IVC A;  3K2O A;  4GAZ A;  5FYV A;  5F5C A;  2Q8E A;  5FY1 A;  4CCL A;  4C8D A;  5FBJ A;  5A7O A;  5ISL A;  5FZ1 A;  2XXZ A;  4Y3O A;  5FYU A;  5FYB A;  5FXZ A;  5K4L A;  4BIS A;  4QU1 A;  3ZPO A;  5F5I A;  5FZA A;  4UF0 A;  2OT7 A;  5LY2 A;  3UYJ A;  4CCM A;  4D6Q A;  2P5B A;  3PUS A;  5FPV A;  5FZC A;  5IW0 A;  5IVJ A;  5A7Q A;  3OPW A;  3ZLI A;  5IWF A;  5FY5 A;  4D6S A;  5F2S A;  5FJK A;  4XDP A;  5FY8 A;  4QXC A;  5FZO B;  3LDB A;  5FZF A;  5FXX A;  5IVY A;  5F3I A;  4AAP A;  2WWU A;  4CCJ A;  5FV3 A;  5FYC A;  2YPD A;  5FZB A;  5FPA A;  5A80 A;  2XDV A;  2XML A;  3N9M A;  2YBS A;  4TN7 A;  5A7W A;  3KV5 A;  5FUP A;  5ANQ A;  4EZ4 A;  3U78 A;  4GD4 A;  4IGQ A;  5FPB A;  5FZ3 A;  5FZ9 A;  5FZ6 A;  5A7N A;  5LWB A;  5FZM A;  3KV6 A;  5FZ4 A;  4CCK A;  2PXJ A;  5FXV A;  5FP7 A;  5F5A A;  3PUR A;  3DXU A;  4GJY A;  4HON A;  3KVA A;  4V2W A;  5A3P A;  5F37 A;  5FPL A;  4DO0 A;  3PDQ A;  5FYY A;  5F32 A;  5F2W A;  5FZ7 A;  2VD7 A;  3N9N A;  3PU8 A;  4LIT A;  2OQ7 A;  3PUQ A;  5A7P A;  3N9P A;  4UF0 B;  5FZH A;  3OPT A;  4QX7 A;  3U4S A;  3AVS A;  5FY4 A;  4BXF A;  5FP9 A;  2OQ6 A;  4GJZ A;  4QXH A;  5FZ8 A;  4E4H A;  3LD8 A;  2WWJ A;  5FY7 A;  4Y33 A;  5A7S A;  4CCO A;  4QX8 A;  2OX0 A;  4D6R A;  4NUB A;  2Q8C A;  2Q8D A;  3KV9 A;  4Y4R A;  4IGP A;  3K3O A;  5FYH A;  5FY0 A;  5IVE A;  5LW9 A;  3PUA A;  4AI9 A;  5CEH A;  5F3E A;  2GP3 A;  5FWJ A;  3N9O A;  5FZK A;  5FUN A;  5FWE A;  5FZG A;  3N9Q A;  4QXB A;  4CCN A;  3RVH A;  2OS2 A;  3AL6 A;  2XUE A;  3K3N A;  4LIV A;  4DIQ A;  4XDO A;  2YU1 A;  5FY9 A;  4EZH A;  3KV4 A;  5IVV A;  5A3N A;  5FYZ A;  2GP5 A;  4QWN A;  5FXW A;  3AVR A;  3NJY A;  4LXL A;  5FJH A;  5FZO A;  3AL5 A;  2YBP A;  4ASK A;  5FZL A;  2YBK A;  3KVB A;  5FP8 A;  4CUG A;  5FZD A;  5FYT A;  5E6H A;  5FZI A;  4HOO A;  4CSW A;  4V2V A;  5FZE A;  5LY1 A;  4LIU A;  5A3T A;  3PU3 A;  5FZ0 A;  5KR7 A;  5A7W B;  5FYS A;  5IVF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...