4ZXKA

Carbohydrate binding domain from streptococcus pneumoniae nana sialidase
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
188
structure length
188
Chain Sequence
GAMVIEKEDVETNASNGQRVDLSSELDKLKKLENATVHMEFKPDAKAPAFYNLFSVSSATKKDEYFTMAVYNNTATLEGRGSDGKQFYNNYNDAPLKVKPGQWNSVTFTVEKPTAELPKGRVRLYVNGVLSRTSLRSGNFIKDMPDVTHVQIGATKRANNTVWGSNLQIRNLTVYNRALTPEEVQKRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Sialidase A
publication title Carbohydrate binding domain from Streptococcus pneumoniae NanA sialidase
rcsb
source organism Streptococcus pneumoniae
total genus 57
structure length 188
sequence length 188
chains with identical sequence B
ec nomenclature ec 3.2.1.18: Exo-alpha-sialidase.
pdb deposition date 2015-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4zxkA00
1GSLA 1C4RA 1QDOA 2AGSA 1LJ7A 1WD3A 1AX0A 2WSVA 2ZHNA 3LSEA 3M1HA 4FPCA 4LBNA 2ARBA 1SFYA 5GLWA 1HKDA 1QKQA 2V5YA 4LBQA 1DBNA 5CAZA 1SLCA 3AYAA 4M3CF 3T2TA 2JE7A 1KITA 1LU2A 2WSUA 1IKQA 4GA9A 2W39A 3ENRA 4Q1PA 4Y26A 3HMYA 4YW5A 3WG2A 2E51A 2D6KA 3OGGA 2PHWA 2AH2A 2OVUA 1N3PA 2AR6A 1CQ9A 4CTEA 5HCFA 3ZXLA 2DV9A 1G9BA 1GZCA 4Q8KA 2UURA 4XTPA 1PZ8A 3M3CA 3M3OA 4R9AA 1MS0A 1MZ6A 4WVVA 2D6PA 5IUQA 3DGTA 1SBFA 4XMIA 1MS3A 2VU9A 4YLZA 2VUAA 1R1ZA 4TYSA 2R49A 3OJBA 4ATFA 4YFWA 1JYCA 1DYKA 3ILFA 1LOBA 2UWCA 2KM2A 1KQRA 1SBEA 4W65A 1W6QB 4ATEA 1F31A 4Y24A 2C9AA 1G7YA 1N1YA 1QNYA 2YROA 3R05A 2SLIA 3N7LA 2ZGUA 1ULGA 3V65A 3A0KA 3WZ1A 2DUQA 1D2SA 5JMCA 1DQ1A 1Q8VA 1S0JA 1QF3A 4CRQA 3APBA 3RQ0A 4Y22B 2WT1A 3PVNA 5DUUA 2D3RA 1ULDA 5DG2A 2ZA9A 4Q27A 3W59A 2LTNA 4R9DA 4UW5A 3HR9A 3WUDA 1QOTA 2ENRA 1AXYA 3BODA 2P3KA 4D69A 2OW4A 1YI7A 2YY1A 2A5ZA 3PVEA 4FPJA 4JCKA 1CPNA 1URXA 5CNAA 4UW3A 2DVDA 5HCAA 2NZ9A 2WKKA 5EYXA 4GWMA 3VKOA 4M3CB 3BIWE 1V6JA 5DZEA 3V0BB 4FQZA 2AYHA 4AWDA 2ES3A 3AZZA 2OUJA 4JC1A 4DRRA 5DZFA 3D5OA 3JU9A 4XDQA 3V0AA 3D6EA 2R16A 2DTWA 3VKLA 5GZDA 1JXNA 3WCSA 4BLIA 3PMEA 3VKMA 3ZYPA 4K21A 3FUQA 1LGCA 4Q1RA 2EXIA 3POWA 3OY8B 3WG1A 1G9FA 1B09A 2D6LX 2EXJA 1DQ4A 5EXOA 3QLQA 1W0OA 1W6OB 3L2YA 4UW6A 1G86A 4DPNA 1F5FA 1A78A 2ERFA 4P14A 3WDTA 1CJPA 2ZHKA 2PHUA 2D6OX 3ZPYA 3A0NA 1V6MA 3FLPA 1LESA 3IMNA 5BYNA 4I30A 2P2KA 2JE9A 1S0BA 4NO4A 3WDXA 3O0WA 5JOYA 1NXD1 1W6PB 2PHTA 1GV9A 2GMPA 2A3YA 3ILRA 4HL0A 4XZPA 3VKNA 1FAYA 1MVQA 4AGVA 1FATA 5JOWA 4Y1ZA 1DQ6A 4XIKA 1LCLA 2ZGMA 1XQNA 2PHFA 4XHXA 2WLQA 1Q8PA 3ZYRA 3N7KA 1LECA 2P37A 2P34A 1JHNA 5T50A 1ZM1A 3UK9A 2PHRA 1Q56A 1V6IA 3MPPG 2CWSA 3ZVXA 3M3QA 4LBQB 1S0IA 5E88A 2TEPA 2A6VA 3AP9A 2GDFA 1N47A 1OQ1A 1Q8QA 3AFKA 1N1TA 3GNEA 3UL2A 1UAIA 5GLTA 1GNZA 1GZWA 1UMZA 1IKPA 3MEPA 1DQ2A 1BYHA 5IK5A 3TAYA 2EXKA 1N3QA 2EAKA 1VAMA 3AJYA 4FP3A 2I2SA 5L73A 3AP6A 3B3QE 1V00A 1IS3A 4XJ8A 3WDVA 4GXLA 2V73A 1MS8A 1RITA 2DURA 4M3CE 2W08A 3AYCA 3LSDA 2E7QA 3RRDA 1H9PA 3AP5A 3NV2A 4PBOA 5GJ6A 2C5DA 3ZXEA 1MACA 4YGCA 1IS4A 2ZBJA 3OYWB 1HQLA 3D4KA 3R4UA 2DVBA 3KQRA 3ZXKA 3USUA 4Y20B 2ZKNA 2UWBA 3FLRA 1W6NA 5H9QA 4YW4A 2DVGA 1SBDA 3IPVA 3DUIA 2D7FA 1Q8SA 2ZABA 3AYEA 4YW2A 3RMXA 3WDYA 3WOGA 4DFSA 3NV3A 1NLSA 1JYIA 1SLAA 4FPKA 4DS0A 1AF9A 2EALA 3T1MA 4ASMB 2JECA 1N3OA 1Y7BA 2ZMLA 1OKQA 4FPFA 2DTYA 4YM3A 2ZGPA 2W68A 3Q9OA 3AK0A 2ZMNA 3O0XA 1AZDA 2GNDA 3N7MA 4K1ZA 4FOVA 4XE9A 3SH4A 2NMNA 3MW4A 3R4SA 3M2MA 3OPZA 2CY6A 2YV8A 4GKXA 1AJKA 4OZXA 5IK8A 1CESA 1WLWA 1H9WA 3SLIA 5DG1A 1LHOA 4Y1VA 3B69A 4XIOA 1MS4A 4BMEA 2OUHA 3PVOA 1J1TA 3CNAA 4XYXA 4DQAA 5GZCA 1Q8OA 3IM0A 1ULCA 1LGBA 1WW6A 4AVSA 1ZA4A 4M00A 1MS5A 3ZSMA 1YXWA 3VV1A 5HCBA 2YMZA 1C57A 3WNXA 2D3PA 3N36A 4WVWA 4WV8A 3BTAA 1ULFA 2GN7A 1QNWA 1WW5A 5DUXA 3W58A 4C1XA 5IK7A 2RHPA 2NMOA 2VW0A 4LBLA 1WD4A 1DLLA 4LBOA 4ZKTB 2ZHLA 1S0FA 5DUVA 4BQ1A 4DRVA 1LOFA 4XJWA 4Y1UA 1W6MB 3AX4A 2VW2A 1BZWA 1D0HA 1JN2P 1RIRA 3SITA 3WHUA 2AENA 3N3HA 4U2AA 2ZGSA 3VKFC 5GZGA 1W6QA 3T1LA 1G9DA 5GM0A 1H30A 1QOOA 2WNEA 1O4ZA 1LOAA 3AXEA 1ENSA 4YGDA 1SACA 2VH9A 4BPZA 4ZXKA 1S0DA 1DHKB 1V6NA 1C1FA 2A6YA 2PHXA 3NWKA 4LBQD 1LHVA 1AVBA 1HLCA 2E7TA 4Y22A 1S0CA 2WQZC 1AX2A 1S1AA 2WT0A 1LHNA 4YZ2A 1CONA 3I4IA 1ULEA 4U36A 1X50A 3WDUA 4BMBA 1JBCA 2ZGLA 3VUOA 5H9RA 5GZEA 3JUUA 1CR7A 4SLIA 5GLZA 1MVEA 2NYYA 2A6XA 3FBYA 1PZ9A 5JOXA 1WLCA 1YIFA 2GNTA 1GYKA 4P9WA 4AVVA 3AYDA 1SLLA 2P3IA 3I8TA 4M3CA 2HYKA 5DUWA 1A8DA 1LEMA 3V0BA 1GNHA 3UJQA 1YYNA 2B7YA 2BQPA 1DIWA 2D43A 2ZGOA 4PQ9A 3WVJA 4P9XA 4AGRA 1BKZA 1UKGA 4Z8BA 3C2UA 1QOSA 2UWAA 3AXDA 2YXSA 2GNBA 1N1VA 3N7JA 4BLJA 3OY8A 1DFQA 3AP4A 1VAVA 3AP7A 4YGEA 3FFZA 4Q26A 4YZ3A 1KJRA 1W6OA 2GNMA 2VW1A 1N1SA 1GLHA 1YO8A 3N35A 3O5SA 5CB7A 4NOTA 5T54A 2ZGQA 1UPSA 1KJLA 1W6NB 3IN9A 4XJZA 2A3WA 5FREA 1LEDA 1UL9A 4UW4A 2D44A 4PF5A 2YZ4A 1FNZA 3UJOA 2AREA 1GICA 2VY0A 1CPMA 1GBGA 2JKBA 2R0FA 2A6ZA 1FX5A 1LOCA 4XBNA 2JDZA 4XJAA 3WHTA 1W6PA 1QGLA 2A70A 2R1DA 3RG0A 4FOQA 1I3HA 2Q5TA 5IK4A 3AZYA 4XJUA 4R9BA 3ZSKA 1ENQA 1HDKA 1SLTA 3ZXFA 5JOZA 1S0GA 3PJQA 2ZGKA 1LGNA 1VALA 2E53A 3AZVA 3RS6A 4XMAA 1VIWB 3V64A 1KDKA 4FPGA 5EYYA 1V6KA 4FVVA 4M01A 1U0AA 2E6VA 4P9YA 5GALA 1S0EA 5T55A 1CN1A 1MZ5A 3SNMA 2GMEA 3U4XA 5KXDA 2R0HA 1IOAA 1TEIA 3KM5A 1LTEA 1MR5A 3RSJA 5F9TA 1LULA 3AJZA 2DUPA 1WBLA 1SLIA 1UZYA 1WUVA 1CIWA 3WUCA 1FV2A 4ISRA 1GKBA 2D6MA 1G9CA 2R1BA 3POSA 1FV3A 1G8WA 2UU8A 3OBRA 1AXZA 3FLTA 4XJ9A 1C1LA 1BJQA 4JRAA 1JOJA 4PCRA 1JW6A 4LBJA 2H0BA 1IS5A 2LALA 2VXRA 4XHBA 3WCRA 1FNYA 3FUOA 3B00A 1WW4A 1LHWA 4FPLA 4Y1YA 5DZGA 1LU1A 3WLUA 3OYWA 3V0AB 3HN1A 5AVAA 1KRIA 4YZ1A 1WCSA 4Y20A 5T5LA 2A71A 5LK5A 2EF6A 4GALA 4HANA 1DZQA 1QU0A 1QDCA 5T5OA 5JDBA 5CBLA 1AJOA 1W0PA 2DU0A 3ILNA 4XOGA 4XXAA 2A3XA 4FPOB 4ITCA 1MS1A 1BXHA 2DUOA 4H55A 2GN3A 1KDMA 2ZACA 1Z78A 2NP0A 2ZGNA 4XTMA 3GALA 1IS6A 4YM0A 4YZ4A 2CYFA 4F83A 3WDWA 4YFZA 1SCRA 2DYCA 1UX6A 2EXHA 4MYEA 1PZ7A 1LODA 4XILA 4RL7A 1VLNA 3INAA 2A6WA 4GKYA 4TZDA 1AX1A 2JD4A 4Q2FA 1OFSA 4FPYA 3ZXJA 2CL2A 3M3EA 2A7AA 2CNAA 2ZZJA 3WG3A 1CVNA 4AVTA 4XXPA 3ATGA 4BOWA 4FPEA 2A75A 2CWMA 2NN8A 4RA0A 2FMDA 4YM1A 5FRAA 2G4IA 5H9SA 2D3SA 4Y1XA 2D6NA 3ASIA 3TB0A 3AZXA 1UN1A 1DQ5A 5E8AA 4FOWA 4BM8A 2GALA 2ZGRA 3NV1A 1UZZA 4GWNA 4PBPA 4XBQA 5GZFA 4WZFA 1A3KA 5T5JA 4K20A 1JUIA 3WV6A 1WBFA 4AGGA 5KXEA 4LBKA 1LHUA 1F9KA 1ENRA 2ZGTA 3SH5A 2NM1A 2ZHMA 2AUYA 4YG3A 3H0OA 3WG4A 2JJ6A 2ARXA 1GZWB 2P3JA 4CZSA 1LOGA 2DVAA 2FHRA 4Q8LA 3OBTA 4YG0A 4C1WA 1W6MA 2XB6C 4YW3A 1RINA 3AZWA 5F5QA 4YGBA 1GANA 5T5PA 2ZMKA 1QMJA 1SLBA 2Z42A 3RMYA 4AYUA 1MS9A 2WT2A 4YG6A 4YZ5A 4R9CA 5KXCA 1V6LA 2XG3A 5GLVA 3ZSLA 3O12A 1LOFC 2W52A 2DU1A 2ZAAA 3O0VA 4FP2A 4FPHA 5CA6A 3QCWA 1G9AA 2CTVA 5JVVA 3USUB 1HQWA 1BQPA 1ONAA 4K1YA 5SV8A 5KXBA 3SISA 4LBMA 1AXKA 3IPVB 3SH3A 3MW3A 3LCPA 1DQ0A 1Z0HA 5EWSA 4IQPA 1WW7A 1DGLA 1FYUA 2WJSA 3IKWA 1YRZA 3BOPA 2GMMA 3B9CA 5T52A 4ISQA 5E89A 3ZSJA 4KBBA 1GZ9A 1APNA 3MW2A 2PELA 1WLDA 5IT6A 1EPWA 5H9PA 1LOEA 1O4YA 5JLVA 2DVFA 4FQ4A 1V6OA 2DWRA 3A4UA 2SBAA 5GLUA 1I1EA 1LENA 3B01A 3POYA 4FOYA 4XBLA 1DYPA 4YM2A 4YW1A 3NV4A 1SCSA 2EIGA 4L8QA 5DXDA
chains in the Genus database with same CATH superfamily
1EV11 1C4RA 1PO11 1WD3A 3LSEA 2AACA 4C8DA 2W2IA 3CL1A 3RGBA 1OKOA 2PYTA 3B93A 1HKDA 1OC1A 4JKMA 3PMSA 1S2KA 1UYZA 2JG8C 4LBQA 1PMIA 3AYAA 1NA1C 1LU2A 3WW2A 4Q1PA 2TUNA 2UY9A 4YW5A 3WG2A 4LOTA 2E51A 4A41A 4E4SA 2AH2A 2OVUA 1OXCA 3ES4A 2VCBA 1C5IA 2AR6A 3LEGA 3PDQA 1CQ9A 3ZXLA 1GZCA 4MSVA 2UURA 3GDBA 2X53S 3M3CA 3M3OA 4R9AA 1KD7A 1MS0A 1MZ6A 1ULPA 2IFWA 4WVVA 5KHHA 5FWJA 5IUQA 4R52A 1SBFA 1BEV2 4JTOA 2WS93 4CEYC 4LT5A 2WN3A 1MS3A 2RS51 2VU9A 3H1YA 3ACGA 4MGYE 4TYSA 5LBBA 4D6RA 4ATFA 1XNKA 4N43A 4MVTA 4CDQC 1JOPA 5FYUA 4RSUA 3ZIWA 4KL1A 5JZGA 4L0PA 4ONUA 1LOBA 1CX1A 4BQ5A 2VAUA 5A32B 3ALQA 1SBEA 4W65A 4AEDB 5A3TA 4O7XA 2IXLA 1KGYA 4XFAA 4Y24A 1DDLA 2PLV3 3VBFB 1H2NA 4PI2A 2Y6GA 5FUPA 3V65A 3N7LA 5F2WA 3UGHA 1X36A 5FK7A 5IVEA 1Q8VA 4G3YC 1QF3A 3POBA 1OVSA 4FO9A 4HSJA 1AYN1 4KGQA 4MXWA 4CRQA 4HG6B 3W59A 1OT5A 4OUSA 3WUDA 1QOTA 4KI5M 5SV5A 1RUG2 4LA3A 1EUTA 2VL4A 1YUDA 1PMJX 3VKOA 4M3CB 1UY1A 1V6JA 1TG7A 2NQYA 5I0RA 4FQZA 4IV1B 3RI8A 2HWC3 3E5UA 4AWDA 4JC1A 4DRRA 2J1VA 3D5OA 3JU9A 3J7NA 1TMF3 2HWB3 3NQHA 3D6EA 1W99A 2W87A 4E2GA 1DGWA 5A3MA 5FZ8A 2BJSA 5HV4A 3VKLA 5B4XA 3MV11 3CU7A 1ZVFA 3KF5A 3PMEA 5FY4A 4BLIA 3GJAA 2ET7A 5JMCA 1LGCA 4XF0A 4DEVA 3POWA 4Y33A 3WG1A 1TZOA 1A34A 3ZOIA 1RHI3 1VBB1 2EXJA 3I59A 2FDHA 1AL23 3OUJA 3QLQA 3L2YA 1WCDJ 2X8KA 4NJ4A 3EHKA 1X7NA 4P14A 5FXZA 1OD5A 3WDTA 3BUCA 5BNPC 4QB6A 4WM8A 2O1QA 5E16A 5T3NA 3S30A 2PHUA 1NAEA 2D6OX 4CU8A 3ZPYA 1CD3G 2IZWA 3FLPA 3VD9A 5IYYA 5EIYB 5ABJB 1S0BA 2DCTA 4HK9A 5JOYA 3S5QA 4QQPA 2GMPA 1U5ZA 1NLQA 2A3YA 3GZUC 3ILRA 3MLLA 1KEXA 1MVQA 2CSGA 4LKDA 1J84A 3IT8A 4AGVA 3OTFA 1FATA 5IVBA 1HRI1 2JEMA 2PHFA 4XHXA 1Q8PA 4QB2A 3D3AA 1Y9MA 1RYYA 2E33A 1JHNA 5T50A 4CPBD 4AZZA 1HQNA 4NHKA 3TRSB 3ACFA 3H3ZA 4KMQA 2QQWA 3MPPG 1BEV3 4OUEA 3VB9A 3M3QA 1R092 3PU8A 1NG0A 3AMNA 3MF6A 4QX2A 1YFXA 3J8F2 3UL2A 4X6RB 5FTTC 1N47A 1Q8QA 2G9GA 4JV4A 5GLTA 4NRPA 1OQEA 1IG3A 2GU9A 3EJKA 2IXJA 1BVVA 4M4PA 4COVA 1XSRA 1VBD1 1NE6A 3AJYA 3PUAA 2B46X 2P6HA 4DUWA 2V4VA 2FCUA 5AVPA 3O1UA 4XJ8A 4RR3C 3KV6A 5CFCA 3GYDA 4GXLA 3LFMA 1MS8A 4K3UA 4CYDA 3TEYA 4M3CE 3O1TA 1FMD2 3AYCA 5EP9A 4A4AA 1H9PA 4GIQA 2DBIA 4PBOA 5EZWA 3TOJA 5BNOA 3NW4A 1Z7S1 1IS4A 3OYWB 1Q43A 3R4UA 4JDOA 3RZLA 1RUG3 2WZPP 3ZXKA 5IVJA 1VPHA 5FZHA 3NL1A 3E6CC 3NAPA 1ZZ8A 5FZ9A 2WFF2 4MUVA 1Q8SA 2ZABA 4YW2A 3CHXA 4I0WB 1NLSA 1JYIA 2WO1A 1ACCA 4FPKA 3MDPA 3H8XA 3T4VA 4OZOA 4ASMB 1EAH1 2JECA 2I45A 2I07B 3ZN5A 2JE8A 1OKQA 1P8JA 2Z69A 1PX4A 4OQ8A 2VOXA 3K3OA 3G7DA 3IAPA 1AZDA 4PQQA 4WM7C 1NCQA 2TNFA 3OSDA 4SBVA 5A7NA 4D3WA 4UOJA 3ZYIB 3DPRB 3OPZA 4XFFA 1QJU3 5FYVA 2CY6A 3C8XA 4Q4V3 1IQDC 5AC92 3B9IA 2VZ1A 3WY6A 1AJKA 1W39A 1ZZCA 2BFUS 4AK3A 1VBA3 1CAVA 3TEZA 5A7SA 4A42A 5C4WC 1M06G 5DDJ2 2Z4FA 5BNQA 4BMEA 3SQOA 4XYXA 4IV3B 4BK4A 5GZCA 2QTWB 3JQXA 2QQOA 1Q8OA 4G4FA 1ZNPA 4UF0A 5CEHA 1EYBA 1MS5A 5JXGA 1PNGA 2VTFA 4LMFA 5HCBA 1C57A 4F8AA 2D3PA 4WVWA 4RFT0 4FTSA 4WV8A 3BTAA 1ULFA 5A3OA 1BBT2 5CG8A 1RUI2 4DEQA 3LPGA 1F15A 1ZX5A 3ZKUA 5C7GA 2NMOA 4Q4Y2 1DLLA 1L7RA 3C3VA 1KS5A 3K51A 3OGSA 1BK0A 1H8TC 2J7MA 4OLLA 2W1SA 4BQ1A 4DZGA 3RZMA 4Q4X2 2VXJA 2JKXA 4QX5A 2VBPA 3HJRA 4D0QA 2H0VA 3DYMA 5EHDA 2LUWA 4B4RA 3I2FA 5FZDA 4Q5OA 1OA3A 2CGPA 3FHIB 2VVEA 1FOD3 3K46A 1W6QA 5IFPA 1LKNA 1G9DA 2MEV2 4CDXB 1K3IA 4XCAA 4XACA 1H30A 5FO9B 4LA2A 5FPAA 5IW0A 3OPWA 1O4ZA 2ZXQA 1LOAA 4QX1A 4TTGA 1ENSA 2QZ2A 1ZZ6A 3ELNA 2JG9B 3J4UH 4AOCA 4NHYA 4XAEA 5FQ0A 3H7YA 5D8AB 1VMFA 1ST8A 3T2QA 4YZ2A 4ZZ8A 3I4IA 1U5YA 5FJHA 5FY5A 3LKJA 4MXVA 5JAXA 3MGUA 5K0UC 5H9RA 5GZEA 2R062 4SLIA 1AYM3 4BWOA 1B35C 5ACA3 2YGMA 5E1RA 4AVVA 4PIXA 4IGOA 2RG4A 2JG8A 4I3PA 4O9EA 5L7OC 1NA1A 1NT0A 3LDBA 5FUNA 3BIEA 4Z82A 4LTAA 1DIWA 2ZS6B 5FIXA 4AGRA 1QJX2 1BKZA 4C90A 1UKGA 2JIJA 3SEPA 4Z8BA 4JDNA 2YDEA 1HB1A 4GMP1 3O1OA 2GNBA 1YLLA 4PT6A 2XJTA 1ND2B 2J1RA 5FP3A 1DFQA 3AP4A 5ANQA 3VD4A 2B45X 2VZSA 3NMBA 3N35A 3PTYA 3N9QA 1N1SA 3N9OA 4P9IA 2Q8EA 3O5SA 4MGIE 5FZFA 4A2UA 4CEYA 1UW8A 1H2MA 1W6NB 3FHQA 3VBOC 4UW4A 3I3EA 4CDQA 2YZ4A 3THCA 3UJOA 4IL7A 2VBBA 1DU3D 2A6ZA 1FX5A 4XUOA 3ZN6A 1JMUB 2YGLA 1TE1B 2V4AA 4BU2A 1W06A 4P5YA 2EVXA 3RG0A 1I3HA 4IEQA 2Q5TA 5J1XA 1R091 4OHWA 5IK4A 1R1A3 1YHFA 3AZYA 2QDRA 4HSLA 4ZU5A 4R9BA 3ZSEA 3J8F1 4CCMA 4BA6A 5JOZA 4Q4Y3 2ZGKA 2F17A 3CIHA 4DUXA 3E1F1 1VIWB 2XJPA 4XMAA 3HBZA 1ND3B 3BU7A 3CEWA 4OHXA 4ZXEA 2GC2A 4M01A 2HWF3 4IE5A 4AFCA 5GALA 3CMGA 1T6BX 2PAEA 1CN1A 3GJBA 2J42A 4Q4W3 1YFWA 4YVSB 5FZLA 3SNMA 3U4XA 4AXOA 4JDMA 4FTBA 2O8OA 3LEMA 4JRLA 4IE0A 3VDAA 1LTEA 1MR5A 1W2UA 5IAXA 3AJZA 2DUPA 1WBLA 1FMD1 4XFBA 4D7YA 3MLJA 3LWCA 1Y9QA 4QXHA 2RV9A 2JWPA 1NY72 2D6MA 3VL9A 4P9JA 2MEV3 2R1BA 3MV01 3POSA 3U0ZA 5FBZA 1WZXA 4C0HA 2G1MA 4IEUA 2FZ1A 5A7WB 4PF1A 4NHLA 2W5FA 2X5IB 4N7IA 4PCRA 2AZ5A 2WFF1 5LEJA 2VMHA 5F5CA 5FWEA 2ORZA 5APAA 3GZAA 3WCRA 3FUOA 2PQQA 2HWE1 4FPLA 1QXJA 4Q29A 4Y1YA 2HH9A 3HN1A 4QHZA 1ASJ2 1WCSA 2E32A 5JCTA 4IUGA 4QU1A 5CISA 2VGDA 3KQ4B 3CQOA 1QY4A 5BNPA 2XUEA 5JDBA 2BNOA 2YPDA 4XFHA 3FWEA 5A33A 4FPOB 3Q8AA 3OPTA 3S6PA 5AC91 2DUOA 1BXHA 2R072 3T2PA 4H55A 3VHOA 4Z07A 3Q8FA 3T2OA 2ZACA 3PIJA 3C7HA 2ZGNA 4FFFA 3GALA 4YZ4A 3AMHA 4ZONA 5DDJ1 3WT3A 1E57A 2CYFA 4JX0A 3WDWA 4LO7A 2DYCA 3C7FA 4A44A 2GC3A 2RS11 1RUF2 1RUH2 2A6WA 4QM8A 4TZDA 1OSGA 1OFSA 3K4ZA 2ZZJA 5FMOS 3GXUA 3WG3A 4I01A 2QQKA 1Y43B 4NHMA 3BKZA 2YB7A 3POFA 5FRAA 3U75A 1BBT1 2EIDA 4RHV3 1RUI1 2D6NA 3ASIA 3TB0A 4YSFA 2RJ2A 1OOPC 4GH4B 2WO2A 4OQ9A 3S0MA 4QM9A 1AUYA 4GQ7A 5GZFA 1YQCA 4WZFA 3NJZA 4H7LA 5T5JA 3WV6A 5C6CA 2VTXJ 2RVAA 4Q4X1 2VUCA 4LBKA 4HVRA 3JZVA 1ENRA 2ZGTA 1ODNA 2NM1A 5KHJA 5JXHA 1D2QA 3VBUB 1W9FA 3LOIA 3KV4A 1W8HA 4GZ9A 3WNLA 5K7PA 5KWRA 3EB7A 2Y6HA 5LRSA 1EP0A 2JDHA 2N7GA 4N8MA 2FHRA 2WNUB 3I2GA 4P9LA 4Q8LA 5LBCA 3SKVA 2J22A 3OBTA 2YC2A 2C1FA 1ZRFA 1W6MA 2XB6C 3RI9A 4ZU4A 4LEJA 2VUDA 5FP4A 1QMJA 1SLBA 4AG4A 5C9AB 3RMYA 4AYUA 5TSWA 1MS9A 3AMMA 2IXKA 4YZ5A 4R9CA 5KXCA 4BCUA 5GLVA 3WF2A 2YBSA 2VQUA 2WZEA 1HN1A 3O0VA 1POQA 2DU1A 2ZAAA 1SPPB 3LEKA 5BNNB 5CA6A 2R061 1MEC2 2E31A 2CTVA 3QCWA 3TWIA 2O8QA 4NIHA 4CP0A 3S7IA 3SISA 3CJIB 3RYKA 3I7DA 4LBMA 4WM7A 1AXKA 5FP8A 3SH3A 1CAUA 1TME2 1DQ0A 1YQ6A 4AEDC 3U14A 1DGLA 3IKWA 5FLHA 3AVSA 4GWJA 5C70A 3RNSA 2CDPA 3MW2A 2XBO2 1QJX1 4EN0A 5JLVA 5C4WA 4JZRA 3WINE 2DVFA 1S55A 4IXLA 4AI3A 5C33A 2ARAA 1V6OA 2QQNA 2RS31 3A4UA 3MO4A 4FI9A 1RB8G 5FZ6A 4GD4A 4D8MA 2EIGA 3U07A 4L8QA 1QDOA 4IEXA 1LJ7A 4FPCA 1AR92 4LIUA 1JODA 4M0NA 1UU5A 3M1HA 3ZO0B 4XDPA 4QGLA 1SFYA 2R043 4EN6B 5GLWA 2X09A 1UQXA 1Q5OA 3WW3A 3ZXGA 1WCUA 3IMMA 2V5YA 1SLCA 2DCYA 3KT4A 4I0BA 5LA9A 3T2TA 2JE7A 4IV1C 4CP9A 4E4DX 2WSUA 5FCCA 1IKQA 5EJ1B 5FZ0A 1NCRB 3H8OA 5FZMA 1H8TA 2P5BA 4S2DA 1N3PA 3P6BA 3VBSB 3T0AA 5LWBA 4KWKA 4G9SB 1KXGA 5HCFA 1W8NA 4CTEA 2P3YA 3ZYBA 4XTPA 1J3PA 2XQRA 1COV3 4LULA 3DGTA 2Q1MA 2QCSB 5I0SA 3I54A 2V5DA 4XMIA 1ZBE2 3KV9A 3ROUA 4UI9L 3J7MA 4QKBA 2W94A 2IC1A 3OJBA 1TNFA 2UYAA 1GUIA 4ZY9A 3NVCA 2VVDA 3EYPA 2ZJCA 3ILFA 4HFSA 4ES9A 1UY0A 4QXBA 5ABJC 2UWCA 2VMCA 1KQRA 2R30A 4CP1A 5JSOA 1R081 3A7QA 1F31A 1IPKA 3Q8CA 5K0UA 1SDWA 1G7YA 5I8SA 4UYBA 1NY71 1RMU3 3ACHA 2XL7A 3R05A 5A3PA 3WZ1A 4KNCA 3A0KA 5CBLA 1D2SA 2C6SA 1W03A 3ETQA 5A7PA 3NAPC 1ZYBA 4Y22B 4Q0PA 5L7OA 1WWYA 2D3RA 1ULDA 2WAOA 2ZA9A 4X6QB 4B3NA 3PIGA 3HR9A 5B2GB 5C8CB 2ENRA 2PQSA 2XJSA 4D69A 2C9KA 4DO0A 2R7EB 1ZZBA 4FPJA 4JCKA 5HCAA 4WVMA 1ASJ1 3FC0A 3MIGA 5I8TA 2WKKA 2FDFA 4D7TA 2OS2A 3BIWE 4CP2A 3A22A 1I6XA 2C26A 2VZOA 3DEMA 2BGPA 2ES3A 4L2NA 4FSJA 1TME3 4MGQA 2WS92 4XPVA 3TBDA 3POJA 4RS5B 4KG0A 3RDIA 4CU9A 5F37A 2WAAA 3LIHA 1JZ4A 2R071 3V0AA 4NWWA 3MZHA 1UYPA 2R16A 4KWLA 4NIIA 4I02A 2DTWA 3VBOA 1JYVA 4FCAA 4Z92B 2WA3A 1HW5A 3FUQA 3I3BA 4Q1RA 2LW8A 4K7JA 1AR63 1J3QA 3OY8B 2Y60A 5FMCA 1B09A 1RUH1 1RUF1 1UZVA 2BU9A 2XUMA 3K3NA 1DQ4A 4BQYA 2PLV2 2LM3A 4UW6A 1I5ZA 3DCQA 2ERFA 1XE0A 2BBAA 3BPZA 5FXXA 3I2DA 4L11A 1VJ2A 1C8NA 2OQ6A 2ZHKA 4NAOA 2QUOA 2BGCA 2BBVA 5F39A 2J1UA 4O61A 1LESA 2YBKA 3IMNA 2XMLA 3GHMA 3PUIA 4P02B 1HXS3 4AHYA 5BYNA 3FX3A 5C3SA 1WMDA 3Q8BA 3WDXA 1W6PB 5DAQA 1ZRRA 4FAGA 2EA7A 5F3GA 1FAYA 5A6QA 2VZVA 1PIV3 4HZFA 1UXXX 1CGPA 1DQ6A 1PK6B 3E5XA 4QQHA 4XIKA 2ZGMA 1NYWA 3DPRC 2WLQA 2WC2A 3N7KA 1E5SA 4HK8A 1A6CA 4B29A 2MHFA 4QPWA 1TMF2 2HWB2 5C3RA 5IWFA 4WVZA 3MLKA 3QACA 5CKMA 2QQVA 4HKOA 5FKCA 2CWSA 1CAWB 3IWZA 3N9MA 3VDDB 4LBQB 1K5MB 3ZVXA 3O1RA 2XJQA 4AHWA 5E88A 4CUBA 4IV3C 2TEPA 2G9FA 5F1RA 2A6VA 3AP9A 3VBRB 3WEZA 1N1TA 1JI6A 1RHI2 1UAIA 2FMYA 1AL22 5F5AA 1GZWA 1UKRA 2PAMA 3MEPA 4IDZA 2XWBB 4UBGA 4IEOA 3ES1A 1SMVA 1ENXA 1D4M3 3CKHA 2D98A 4GWIA 5FLJA 3WR0A 4OI0A 3AP6A 5LEKA 1MEC1 3CZUA 2WUHA 3WNMA 3WDVA 1NQJA 4XZUG 1AL0G 4H2AA 3ZFEA 3AKQA 3MI8A 4UFHA 3RZHA 4NR1A 4BIFA 2W08A 2DFCA 1OLME 5CU1A 3PL0A 3RRDA 3AP5A 5GJ6A 1GFF2 2CHHA 3LQCA 4N7UA 3M8LA 3QH6A 4QAWA 1PNFA 2DVBA 2XBO1 5JI7A 3USUA 1WA6X 3H1MA 4Y20B 3FLRA 1W8FA 5H9QA 3B02A 1OLRA 2DVGA 3OBAA 1BLZA 1V0AA 4Y4YA 1O3QA 3DUIA 3WP4A 2QBXA 3RMXA 3O1VA 2XXZA 3HNBM 2BYVE 5A3WA 3THTA 1XPWA 1RXFA 4UAPA 2G9ZA 1GWLA 4CDXC 2EALA 4HPKB 2DCKA 4DS0A 1YJKA 5J7MA 5A6YA 4PHZA 2ZMLA 1AR91 1WCQA 1ZREA 3KMHA 3BI3A 2ZGPA 2W68A 1UF2C 4K1ZA 3O0XA 3N7MA 2GNDA 2JG9C 2YU1A 4K8FA 1O5LA 2XWJB 4XE9A 4AI8A 2NMNA 1C28A 3MW4A 5D8AC 3ECQA 2OKXA 1OOPA 2ZEYA 2PAKA 4FTEA 2BGOA 2RMU3 4OI4A 3VLBB 2XKOA 3AMPA 4QT6A 4UFKA 3KV5A 2WR9A 3HQRA 3V56A 3U1XA 4Y1VA 5LA0A 2C4XA 2J1SA 2XJVA 4F3JA 2OUHA 3GM8A 4CDWB 1J1TA 3CNAA 3TN93 4DQAA 1CAXA 4N53B 4PDWB 3IM0A 4CPBA 1MQTB 4FBFA 3D8CA 2DCJA 3LB9A 3ZR5A 4YWAA 5C3OA 5ERLA 3N36A 3VHNA 5EJZB 1ZBE1 1QNWA 2ZKLA 4IEZA 5DUXA 5CZKA 3VZOA 1ND2C 2JDPA 4NVPA 1WD4A 3I59B 3DV8A 1JH5A 3D0SA 3FL7A 3KGZA 1GR3A 2FDJA 4XCBA 2B4KA 3VHPA 3VN4A 3NJYA 4Y1UA 4P08A 3LF7A 1JU4A 4TN7A 1YNAA 3AX4A 4AHXA 2VW2A 1HN0A 1QJEA 1D0HA 2D97A 3U10A 5JPNB 3VZNA 1QJU2 2AENA 2XDVA 3EMRA 4Q4V2 3DXTA 3LIGA 4MHRA 5A32A 5FXVA 4AEDA 1YQ8A 1VBA2 4BQ3A 1PO23 4AQ2A 2Y6FA 2WNEA 2W0XA 2OIIA 2W47A 3PVBB 3VBFA 2B42B 4N90A 1NX9A 2ZX0A 2VH9A 3TEXA 1NUKA 1W9YA 4BPZA 1TQ5A 2V09A 2OPWA 1C1FA 2A6YA 4LBQD 1F8VA 1PGW2 1O8SA 3LPFA 2WQZC 2OT7A 3M70A 5ANNA 3MIDA 4U36A 4BMBA 4NN0A 2ZGLA 1ND3C 2WS91 4MGZE 4CEWC 5FKBA 1QJY3 4YVSC 3AB0A 4XEZA 5JOXA 1YIFA 1GYKA 3THPA 4IE7A 4LE4A 4P9WA 1L7LA 1SLLA 2P3IA 2WZR3 3I8TA 4HVOA 4M3CA 3UV9A 2F4LA 4W8JA 1GQHA 2HWD3 4IV1A 5FP7A 3RZZA 1E5RA 5IAVA 1HIXA 1UD1A 2PA7A 3WVJA 2BDRA 5JR7B 3ZFFB 4QKNA 2PLV1 1BVP1 5FY0A 1RJ7A 3BTZA 1C8M3 1DCSA 1XU1A 3C2UA 1QOSA 1OFNA 1PX3A 2JD9A 2UWAA 5FZOB 2YXSA 1KS4A 4COZA 4EJRA 4FT8A 2BWAA 5J48A 5M0TA 2X5IC 2TBVA 1UY2A 4DXRA 1RUNA 1FOD2 1N1VA 2FCTA 1UIKA 4QPGB 1XB9A 3AP7A 4YGEA 4UFLA 3X29B 3DN7A 3FFZA 2VOWA 4Q26A 3ZDSA 2H6BA 5CFDB 4B8EA 5CB7A 4NOTA 2CGOA 4RFRB 5T54A 5J09A 2JDAA 1UPSA 3MPBA 3VZLA 2A3WA 1VRBA 4H7MA 3ZFGC 3ZPOA 5JR2A 1OPOA 4IERA 2AREA 2DBNA 5KR7A 1PGL1 1GICA 1CPMA 3CDZB 4JGZC 1XE8A 2HWC1 5ABJA 4XJAA 4XBNA 2JIGA 4P00B 5K9YA 1QGLA 4TWTA 1TMF1 2HWB1 1AYM2 2BPA2 2R1DA 5L36A 3BN6A 5K4LA 5ACA2 3HN3A 3BTYA 2QZ3A 1REFA 2VPVA 2JDMA 5FYSA 1DGRA 4DMIA 5A1LA 4AVBA 2F4PA 2CGNA 3DF0A 5IVFA 1HDKA 4JKLA 3ZXFA 2WNVB 1UO9A 1RHI1 3K75B 1S0GA 1AL21 5G05L 2E53A 3T4HB 1C3HA 1OURA 5A3UA 2QQUA 5EYYA 4IEYA 4XETA 4IE6A 2QQIA 4ASKA 5C5UA 1O3TA 1SZBA 4P5HA 2GMEA 1VB4A 1WCKA 4PI0A 5BNNA 4EN9B 4LXLA 2ZEZA 3MBWA 4GH4C 4XF4A 2XQXA 4XW3A 5FYMA 2XJUA 3RSJA 1NQDA 2PFWA 2IFRA 3ORJA 5F9TA 5C5TA 3VZJA 1W05A 4I2OA 2VNOA 3NKGA 1UZYA 3IDCB 3P3NA 1FV2A 1GKBA 3E5QA 2PXJA 3RYRA 1W9SA 3WF1A 5F7UA 3GBGA 1AXZA 3FLTA 3KVAA 1GNYA 1C1LA 1F4HA 5IVYA 3VBUC 2Q4SA 4MGSA 2H0BA 4D6QA 2VXRA 3JBG3 3IIAA 5EJ3A 4K8RB 1JZ7A 2WNUC 1H6XA 1UOBA 1WW4A 1LHWA 2A1XA 3DKQA 1LU1A 3BALA 5DZGA 3OYWA 4NPMA 2B5HA 4YZ1A 1BEV1 5LB6A 2A71A 4V2WA 5FYTA 1VMHA 4HANA 1R1A2 1W2OA 5C9AC 3CBNA 3RVHA 1CX4A 2IUWA 3T08A 4B4PA 2DU0A 3ON7A 3U4SA 1J58A 4TLFA 4ITCA 4LO8A 2GN3A 2HWF2 4QPIC 5BNNC 5KHIA 3LAGA 4JQRA 1KDMA 5L9VA 4Q4W2 2NP0A 1IS6A 1FI2A 2VTXA 4A7KA 3CJIC 4O9GA 4YFZA 4L9BA 3ACLA 3RZKA 4MYEA 1UX6A 2WDBA 3LA7A 3DPRA 3INAA 3MIHA 2RJKA 2VVFA 2Q1FA 5BV6A 2JD4A 2HLEA 3M3EA 3VD7A 2DCZA 3ATGA 4UBHA 5F6KA 4FPEA 1F2NA 1RUG1 1UU4A 2NN8A 5EPAA 3LE0A 4MV2A 4IV3A 1IPJA 2KR2A 3WF4A 4S2GA 3H8RA 1REEA 4FOWA 4QWNA 2ZGRA 1PVC3 1VRH3 1UZZA 4F7ZA 2LRPA 4HT1T 4OCTA 4QGNA 3VBHB 2PTMA 5CG9A 2B39A 2QQPA 2RM23 2FD8A 1WBFA 4AGGA 4YNIA 4XUPA 4AI1A 1F9KA 3I2HA 4Q0VA 3SH5A 4BJ0A 4DY5A 4RQPB 2WFPA 3H0OA 2JJ6A 4CDUB 3AFGA 1QJU1 1NCRC 2K0GA 2VD7A 4Q4V1 4E8DA 4CZSA 1LOGA 1RUJ3 2DVAA 3J7HA 5LY2A 2YC0A 1W9TA 2FCVA 2W1UA 1VBA1 2Y6JA 5CADA 3NJXA 1D4VB 1WLTA 3HNMA 3AZWA 4KG8A 4YGBA 5F5QA 3HQXA 1GANA 2Q8OA 2ZMKA 4A6OA 5FP9A 3ZIXA 4ZU7A 4BQ4A 4YG6A 2Q8CA 1PGW1 4CSWA 1DGRN 2WWSA 3TNPB 3BCWA 2JDKA 4CDXA 2I74A 2YU2A 4RGAA 1LOFC 1JZ6A 3C7EA 1POV0 4INDA 5EV7A 4I3GA 4XFGA 3CO2A 5JVVA 4D6SA 4D7SA 3R4DB 4RHV2 1V9U3 5A70A 2WQ4A 3S7EA 3SCHA 2JG9A 2Y34A 4Y5SA 3IPVB 3K4DA 5LRRA 1Z0HA 1QJFA 5D8AA 3PJYA 1WW7A 1OQDA 4NRQA 2BWCA 1RL3A 2ZX1A 4OFGA 5T52A 5E89A 3ZSJA 4XUNA 1G6NA 3TNQA 4YVWB 2VOVA 1BCXA 1CJDA 1EPWA 1OH3A 1T2XA 3UKTA 4FQ4A 1M4WA 4BH9A 4L92A 3WD5A 2J1TA 1UIJA 2SBAA 4FOYA 1FOD1 5C8CC 5IATA 1SCSA 3JD72 4FXKB 1DP0A 4URTA 3I3QA 2ETEA 4CUAA 2WSVA 3RJRA 1AX0A 2ZHNA 4O65A 5KC5A 3QD6A 4LBNA 4JGYC 2CAUA 1W8TA 1QKQA 3P1IA 4R4ZA 4UFIA 1FT9A 1DBNA 4BIOA 4M3CF 1ND2A 2WWJA 1JHJA 4A3XA 2VBDA 4GA9A 3T09A 1HB2A 3HMYA 3I2IA 4NROA 4QKDA 5FPLA 1AR83 1DZTA 5I0UA 2D6KA 2VJXA 2F6BA 3HPNA 2PHWA 3KT7A 1UXZA 3OGGA 4ARYA 1GU3A 2XGXA 1AYM1 1XYPA 5I8YA 2K9ZA 2IXIA 1OI6A 2YUEA 4J1WA 5ACA1 3AKRA 4MZUA 5LCWL 1PZ8A 3AVRA 3T3YA 3U78A 4Q0UA 4LHSA 5FZIA 2D6PA 4LKSA 2GAUA 2XH6A 3H3LA 1GQPA 2X10A 5F3CA 5JMOA 5LK7B 4YLZA 2VUAA 1R1ZA 1JYNA 4KWUA 1W0NA 1RUC3 3LDRA 4LO5B 3E6BA 4YFWA 1JYCA 4XC9A 1JZ5A 1JYTA 1WKYA 3MIEA 3O1SA 2BERA 3WSOA 4CXWA 3ZFEC 1NZIA 5CKNA 5DAPA 4I09A 4ATEA 4XDOA 4UXAA 3WXPA 1ND3A 2C9AA 2RR13 2B8MA 2ZCWA 2R042 4CEWA 4CUGA 2C0ZA 3L9JT 5JUVA 4YVSA 1QNYA 2YROA 1RVF3 1ULGA 4QX8A 1UY3A 1PK6C 2ATFA 4QX3A 1S0JA 5A7OA 4TXWA 1XJAA 3APBA 4CA9A 3A23A 3I2KA 2WBKA 4D94A 5DG2A 3DECA 4AFBA 1TVGA 4KU8A 4IEWA 4Q27A 4R9DA 3O14A 1ZBA2 2ADEA 4LIVA 2VCCA 2VNRA 3H1WA 2CAVA 2OW4A 1YI7A 2YY1A 2A5ZA 2LS6A 3VDDC 5FMDA 1K5MC 1URXA 3I2JA 2DVDA 4RR3B 3GCXA 3HD8B 3HT2A 2NZ9A 5EYXA 5A7WA 1COV2 3E6DA 2X5IA 4H3WA 3VBRC 1R1A1 4B4QA 5DZEA 3V0BB 2JXAA 3RPQA 1EPZA 4LLOA 3AZZA 2OUJA 4OUMA 1RJ8A 4Q4Y1 5DZFA 3ZXAC 3BGAA 1XYOA 1BHGA 1NE4A 3CLPA 2BVBA 2HWF1 3ZN4A 1JUHA 2JB4A 1OD3A 4Q4W1 1SFNA 1JXNA 3ZFGA 1JS9A 4E2QA 1XU2A 3VKMA 1QIQA 2WZ8A 4FFHA 3KHCA 3H50A 2EXIA 5DAVA 3RJ2X 4JGZA 4AAXA 3D82A 3OUHA 1YQ2A 4QB1A 5EXOA 1UNBA 2RDNA 1W0OA 1W6OB 1AR73 1OUXA 2VCMA 3JD73 4DPNA 1F5FA 1RMU2 1CWPA 2MEV1 4BXFA 4J1XA 1R64A 2OZJA 1K45A 4V1PA 4QDQA 4XURA 1RUE2 4I30A 2WWUA 4CU6A 2P2KA 3QBQA 1OUSA 1XYNA 5T5OA 3O0WA 4NIAA 3S5AA 5A1FA 4FXGB 4RN5A 4YRDA 1GV9A 3W5MA 3OCPA 5F3EA 4XZPA 5D2AA 1US2A 4AFDA 3HNYM 3O1MA 1POV3 5F8PA 5JOWA 4Y1ZA 1OPMA 1LCLA 1W2TA 2CU5A 4GH4A 1WMFA 2P1BA 2P37A 2P34A 1HB3A 4DY3A 1VBC3 5I91A 1LRHA 4LKFA 1ZM1A 3MIBA 3UK9A 2PHRA 4QKFA 1O3SA 1IGOA 3VBFC 1QWRA 4A7ZA 4Q0SA 2AEYA 4CDWC 1GOGA 4X8PA 4Y5TA 3U11A 3K2OA 3VBUA 1Y9GA 4N53C 1PO12 3AFKA 1XNCA 2Y33A 5IVVA 1AR62 5J37A 1MQTC 1GNZA 3E97A 4XQDA 1DGWX 1PHMA 1BYHA 5HCHA 5IK5A 2WNUA 3TAYA 1N3QA 2XJRA 2I2SA 5L73A 1DG6A 1S4CA 4JAAA 1V00A 3CF6E 1IS3A 2C24A 2K46A 5FY7A 1OF3A 4RHV1 2GSYA 5C9AA 3D0JA 2V73A 3WF3A 2EICA 5I0TA 5A6XA 1RITA 1HXS2 1K5JA 1JOBA 5F3IA 4L97A 4EROA 2B9UA 3B94A 5E6HA 2VOTA 4P9GA 3ZXEA 4BDVB 1MACA 3B7MA 1O8PA 1UMHA 4QPIA 1SPPA 1RUD3 1ZBA3 2ZBJA 1HQLA 3A21A 1PIV2 2Q1ZB 3K48A 3KQRA 2RDRA 3LZZA 3USSA 4XFIA 3WW4A 3UGGA 2A73B 3IIIA 4CXXA 2UY8A 1DYOA 1SBDA 3CJIA 5FPZA 1PM7A 2D7FA 4KBZA 4AEKA 3AYEA 1UYXA 2BEOA 3NV3A 5A1AA 1SLAA 4QDRA 3W9AA 3KCXA 5FDBA 1AF9A 3T1MA 2BVVA 1HV0A 2X29A 1W3VA 1PM4A 2W92A 1B35B 1ZA7A 2DTYA 4CU7A 4YM3A 4ZZ5A 2MNGA 1FPN3 2HEWF 3KHBA 2ZMNA 3PHMA 2OZ6A 2VZRA 3PTRB 1JTZX 4FOVA 3SH4A 1VBE3 3MUY1 3M2MA 3WQBA 3HT1A 3KVBA 1AHSA 4L99A 3IDEA 4AI9A 3NO8A 1BK1A 3THDA 5C3QA 1CESA 1D4M2 1RXGA 3LGRA 4EE2A 2ZEXA 4KWJA 4WVMB 5D1IA 3SLIA 4IE4A 1MS4A 4UWDA 2BFUL 3LD8A 2W91A 1W28A 4LQRA 3FE5A 1HRV3 1WW6A 1LGBA 4PLMA 3PUSA 4AVSA 1NCRA 1ZA4A 3HAGA 3MYXA 4K6BA 5DN2A 3VV1A 3WNXA 3PUHA 3ZFFC 1RUE3 3AKSA 3FJSA 2RDSA 2GN7A 3PU3A 1WW5A 3VZKA 5L19A 4QX0A 4N9HA 3RYPA 4QQ2A 2D40A 2QFEA 2RHPA 2VR4A 3W58A 4ASLA 4LBLA 2VW0A 3VZMA 4LBOA 4QPGC 4ZKTB 4E8CA 2FQPA 4RD7A 5CFDC 2G19A 2ZAHA 3VHRA 4CCKA 5FYYA 4GB33 4JHZA 4XVHA 5DUVA 4DRVA 1LOFA 5DMYA 2R041 5I93A 1O7FA 5FZCA 3GGLA 2Q30A 1JN2P 4CUCA 1MPXA 3WHUA 3NNLA 4QPYA 4UFMA 2RMU2 4YPJA 4QU2A 4U2AA 1QQP3 3T1LA 1EV13 1PO13 5GM0A 4HBNA 1QH7A 1F4AA 2IVJA 4XF9A 3ACIA 1U12A 4HVQA 4YGDA 3WP3A 1SACA 1U5IA 1S0DA 3BYWA 3TN92 2OXBA 2W3JA 1LR5A 3NWKA 4Y22A 1AVBA 1COV1 1HLCA 2E7TA 2WNVC 1S0CA 1AX2A 1S1AA 2WT0A 1LHNA 1CONA 4NHXA 3WDUA 1ULEA 4HKWA 1X50A 1O59A 2WINB 5AFEA 5C8CA 3VUOA 5FZKA 4QXCA 4CE8A 1MVEA 1JZ3A 2NYYA 2A6XA 3FBYA 1PZ9A 4JGYA 1HRI2 1WLCA 2GNTA 5JWPA 3IDBB 3PUQA 1OLMA 3IDAA 1YI9A 2OA2A 3BPSA 1A8DA 1LEMA 1XOYA 2JDNA 3FHAA 3AM2A 3UJQA 4CCOA 2VZ3A 3HVDA 1H1IA 2B7YA 1REDA 1F35A 2BQPA 3KZ4C 4PQ9A 4GJYA 4P9XA 2RS53 2QVSB 3ZYHA 5ISLA 1W2AX 1HB4A 5DQ0A 2VCAA 5FO8B 1RMU1 1WMEA 4DXTA 2W1WA 4BK5A 3NNFA 2ZX4A 3MICA 2WN2A 3P5BA 3OY8A 1VAVA 5JSRA 4Z2AA 2YC4A 1PO22 1WA4A 2GNMA 2VW1A 1YO8A 1GLHA 2YG0A 5FZ3A 2ZGQA 2VM9A 1KJLA 1X8MA 3IN9A 1O91A 5FREA 1LEDA 3BB6A 3RWKX 2D44A 3ZXDA 4S2FA 3OBZA 1FNZA 3PLQA 4EYUA 1AYN3 5IHRA 3G6JB 3Q8EA 2VY0A 1U5XA 5FPBA 5KBFA 5A3NA 1TME1 2JDZA 3WHTA 1W6PA 4WZCA 1QJY2 1SQ4A 3NNMA 3AL6A 2ZX2A 4FOQA 4PLNA 4H14A 2GZWA 2WZR2 4N43B 2XONA 2PHLA 1PK6A 4LITA 1ZRDA 3LEIA 2HWD2 4XJUA 3ZSKA 5JZGB 1AR61 1ENQA 3TEWA 1XNDA 3PURA 4K9SA 2FZ2A 4FFGA 3S57A 1VALA 5FK8A 3AZVA 3RS6A 1KDKA 1C8M2 1V6KA 5DAWA 5T55A 1LAJA 1JU3A 1CAWA 1MZ5A 4TLGA 1X33A 1K5MA 3PNAA 3VDDA 5KXDA 2R0HA 4LUKA 1IOAA 1CAXB 1TEIA 4AW7A 2R32A 3VBRA 2BP6A 3FZ3A 3HBKA 4MXWB 1PMHX 2ZZQA 1VBB3 1HXS1 3KB5A 1A8MA 3HWJA 4MOAA 5FZ4A 3VBHC 1WUVA 5EFUA 4ISRA 1O5UA 1X8EA 4LK7A 3K77A 2ILMA 2XL9A 3OBRA 1G8WA 2UU8A 4QX7A 3W21A 5HI0A 1PIV1 5FPVA 1GP5A 3F95A 1GP4A 4RQPC 4CDUC 3I2OA 1JW6A 1XE7A 2D5HA 1IS5A 2K2SA 3JXSA 3WNKA 4OHYA 5FZGA 2GH2A 3SMHA 5FPXA 4K40A 4BISA 1MZEA 1YQ5A 2GP5A 5AVAA 2PN5A 2W95A 2ZOEB 3C7GA 4COYA 4Y20A 1K42A 3MHZA 4GALA 1O3RA 1QDCA 2ET1A 1HRI3 2D5FA 1AJOA 2E7AA 1W0PA 4HLTA 4OULA 2E26A 3H7JA 3KD4A 3R6SA 5FOBB 4R8HA 3ZMOA 3N9LA 4BB3A 2Y6KA 4HPKA 4NIGA 1MS1A 2MPFA 3AC0A 5GKAC 2GH8A 3KCYA 3SXWA 4GMP0 1XC6A 1D4M1 4XTMA 2CDOA 2ZEWA 4ES8A 3WP6A 4WM8B 2EXHA 5CVRA 4XILA 3M3IA 3POGA 4RL7A 5FAXA 4LHNA 4Q2FA 1QEXA 4ZHNA 2CL2A 5HXMA 1IZ3A 4XXPA 4YVWC 1VBD3 2A75A 2RE9A 2CWMA 4EWAA 1SEFA 1OMIA 2LROA 5FMOL 5H9SA 2D3SA 4CDWA 1BMV2 1J3RA 4NMIA 4E4HA 2QE3A 2EIBA 3AZXA 4N53A 2OPKA 3JBG2 4PDWA 1PVXA 5CIRA 3SKJE 1MQTA 4A45A 1US3A 2Y6LA 3NV1A 4PBPA 4XBQA 1H6YA 4DXSA 1A3KA 3ZKYA 1Z7S3 5KXEA 3AMQA 2XR4A 1LHUA 3MUZ1 2B9VA 2CV6A 2OX0A 4NRMA 5A6ZA 4BYYA 2VMEA 2ZHMA 4BHPA 4B7KA 1NXMA 2ARXA 2XLGA 2RMU1 3CZJA 1ZRCA 1GP6A 2P3JA 2JDYA 4LORA 4NAMA 1EAH3 3ABZA 4QQOA 1XNBA 5J96B 4C1WA 3TYJA 3N9NA 2GP3A 4YW3A 4IEVA 5CFCB 2XHKA 3TN91 4HETA 4LR4A 1V6LA 4EWEA 2E9QA 4YYOA 4B1MA 3O12A 4MG2A 3VDCA 5BNOB 2VECA 2ZX3A 2D93A 4BQ2A 3NNGA 5HV0A 2RJLA 1BQPA 1ONAA 5KXBA 4YARA 3LDKA 3NAPB 5HXVA 3LCPA 5LZ6A 5EWSA 4IQPA 4MLOA 4AR2A 1PVC2 1VRH2 3AL5A 1FYUA 2WJSA 5DAXA 1E5HA 1YRZA 4OYUA 2GMMA 5FJKA 2RM22 4LLFA 4KBBA 1APNA 5BPXA 4M4RA 2BW8A 2PELA 5KHKA 4MO3M 4UT5A 2E63A 1J59A 5C3PA 3KS7A 3I97A 3EBRA 1NCQB 3GZEA 4AAPA 4EZHA 3O7OA 2IWGB 3OD4A 5A80A 3B01A 1QJZA 1RUJ2 1GSLA 2AGSA 2EAAA 3ZFFA 1PO21 1CAVB 4W6WA 1NZCA 1OHFA 2ARBA 1QXPA 1VMJA 5FZOA 1IPSA 1YCIA 3WX5A 5CAZA 4OMCA 4OI2A 2HEYF 2YPJA 2Y0OA 1KITA 1OA4A 4QPGA 4RGGA 3I49A 2DF7A 2W39A 3ENRA 4UF0B 1H2KA 1RC6A 4Y26A 5CFDA 2OQ7A 2P4EA 5FR3A 1ZZ9A 1QJY1 5LATA 2WYSA 4MGTA 1V9U2 2DV9A 3OEAA 1G9BA 4Q8KA 3WF0A 3IZOA 5FUIA 1GWKA 1H4HA 2WZR1 4CCLA 2HWE2 2HWD1 1LNSA 3P3PA 5FYCA 1HX6A 1VB2A 2P6CA 3KWVA 4DOUA 5FYBA 1JYWA 2HKXA 2VZPA 3KSCA 4QDSA 4Y3OA 5FY8A 1C8M1 2FBEA 2R49A 3DKWA 2VMDA 4XABA 1DYKA 4NUBA 1W90A 4URAA 4EZ4A 3DYOA 2Q0AA 4AF9A 4AVAA 2WNVA 2KM2A 1L3JA 5LA1A 1W6QB 3J26N 1D0GA 2Y38A 1JZ2A 4S2HA 4XUTA 2XVKA 4B7EA 1N1YA 3OG2A 3NSTA 5FYHA 3KLSA 3N9PA 3W20A 2SLIA 2RS12 2VMIA 2ZGUA 4GMP3 2VUJA 5DPNA 2DUQA 2Y0IA 2WABA 2VZTA 1DQ1A 3JCIA 5DXDA 3WNNA 3WNOA 3RFRA 1OA2A 3RQ0A 2WT1A 2VQTA 3PVNA 4LKEA 5DUUA 5FQ0B 3WQ1A 2VZUA 3UT0A 2LTNA 1AR82 1MZFA 1SFPA 4NPRA 4UW5A 5FPUA 1AXYA 3BODA 2P3KA 2JICA 2VMGA 1HJFA 5F32A 3PVEA 5CNAA 1CPNA 4UW3A 2VC9A 4GWMA 1UOGA 5K8SA 3OEBA 4V2VA 1W9WA 2JB8A 2JG8B 3DYPA 1NA1B 2AYHA 3BU0A 1GOHA 2Y64A 1CIYA 2DDUA 1DZRA 1W3XA 2KA3A 3M7AA 4XDQA 4XUQA 4IESA 1RUC2 3ZMNA 2FDKA 5GZDA 5FOJB 3WCSA 1RTVA 4AL9A 3VGIA 1R093 4B1LA 1I9RA 3ZYPA 4K21A 2WNOA 1V70A 4NWVA 4COUA 3J8F3 2ARCA 4W4ZA 1G9FA 2HBUA 2D6LX 4MADA 2VNVA 2RR12 3GBWA 2NLRA 3ETPA 4ZS3A 4OI1A 5I0DA 3ITQA 4CEYB 4PJYA 1G86A 1A78A 3ZYFA 4HMZA 1RVF2 3VBSC 4CCCA 5IVCA 4COWA 4BXSV 3OOXA 1CJPA 5IFTA 2R6QA 4CDQB 1S2EA 1GZTA 2ADDA 3HQUA 4BQWA 4EN8B 1BMV1 2HBTA 1ALYA 1V6MA 3A0NA 5JIAA 4DUVA 4LE3A 2BNMA 2UYBA 2JE9A 1FMD3 3JBG1 3POEA 4ET7A 4NO4A 1NOVA 3ZN6B 1XNTA 1NXD1 3I3DA 1OVPA 2PHTA 3HOBA 4QHBA 3SHRA 4HL0A 3VKNA 4KGGA 3ZYGA 1SG3A 2YFZA 1XQNA 4E27A 2WFF3 3U37A 5LASA 3ZYRA 1LECA 4UFJA 1W8ZA 1Y3TA 2HWE3 3VBHA 5A3LA 4DIQA 3BTXA 4LUMA 1YC61 3HEIA 5C8WA 1Q56A 1V6IA 4EWDA 4AVCA 5KHGA 2RS32 4QQLA 4BE3A 1S0IA 1EUUA 4AI0A 1YJLA 2WA4A 2GDFA 1OQ1A 4RQPA 3GNEA 4CDUA 1GQGA 4Y4RA 2ZPXA 4CCDA 2WIIB 1UMZA 1IKPA 1AR72 4J6GA 1DQ2A 5FO7B 5AC93 5FY1A 3URFA 4IEPA 4AE2A 2EXKA 1UWWA 1J1LA 2EAKA 5JIUA 1VAMA 4LO4B 4FP3A 5FMBA 2DFBA 3SC7X 1VAKA 3B3QE 5DDJ3 4META 3FMGA 2RS13 3FFQA 4NIDA 2DURA 1NKGA 3LSDA 2E7QA 3WW1A 3NV2A 1PVC1 1VRH1 2C5DA 3POIA 4RS5C 4YGCA 2PMWB 2RM21 2VQAA 3ZX7A 4YW7A 3D4KA 4AFMA 1UX7A 3EQEA 2VO5A 1IG0A 2UWBA 2ZKNA 1W6NA 1BBT3 2BOIA 4YW4A 1RUI3 5BNPB 3MFCA 5LW9A 3IPVA 3WDYA 1W8UA 2QNKA 3FBMA 3WOGA 4DFSA 1VBC2 1UYYA 4HN1A 4QMAA 5A33B 5EQUA 1RUJ1 4CEWB 3H42B 1E5IA 1N3OA 1Y7BA 5FFOC 4FPFA 4MX3A 4YVWA 4C91A 4Q4X3 5FBJA 3T30A 5HBAA 1CZTA 2KXLA 3Q9OA 1UPIA 3AK0A 1L7QA 4XQ4A 1R082 4W6YA 3ZDVA 3R4SA 2BOJA 4IGPA 5DABA 2FDIA 2YV8A 4GKXA 4AEJA 2WO3A 4OZXA 4YW6A 3UGFA 5IK8A 1WLWA 1H9WA 4HN0A 3UNPA 2VE1A 4AEMA 4IGQA 5DG1A 1LHOA 3B69A 1H1MA 3LFIA 4AQ6A 4XIOA 3QOPA 4CCNA 1RUOA 1V9U1 2VULA 1XBFA 4OHVA 3PVOA 4HONA 5F6LB 4LHLA 3IBMA 5FV3A 1Q3EA 1W8WA 1ULCA 2IVIB 4M00A 3ZSMA 1YXWA 3JB8A 4LPLA 1YIPA 2YMZA 1GWMA 1RUD2 3BVCA 1OLQA 4A3ZA 3VD3A 1RGSA 5F5IA 3WQ0A 2R063 3ZFGB 5LY1A 2L9LA 4C1XA 5IK7A 2YYOA 1QXRA 4JGZB 1YFUA 2ZHLA 4KQ7A 1S0FA 2QQMA 2X05A 4IW3A 5JSPA 4XF1A 3VD5A 4AFAA 3MFAA 4XJWA 1QJX3 1FPN2 1XNAA 3H3UA 4N9IA 4QD2A 2W9XA 3T0BA 4QXKA 1W6MB 5J36A 1TNRA 1NLRA 2Z79A 3J9SA 1BZWA 1VBE2 1RIRA 4NPLA 3SITA 2RS33 3W5NA 4DNYA 2FDGA 3N3HA 5FZBA 5FZEA 2YHJA 5BUVA 5GZGA 2ZGSA 3UESA 3VKFC 4AQSA 1JZ8A 3ZYJB 4LNVA 1AR81 1QOOA 4KU7A 1UU6A 3GCWA 3AXEA 4N43C 1H8VA 3AKTA 4MH0E 1S2BA 1DHKB 5FXWA 2VQ0A 1V6NA 2RDQA 4ZXKA 1J83A 4WM7B 4Q0QA 1HRV2 2PHXA 5JXJA 1CAUB 1LHVA 5JZGC 3RZJA 3AKPA 3F2ZA 4OHZA 3OGRA 3ZLIA 1ZZ7A 1JBCA 3NRUA 3OB8A 2QJVA 3GBFA 3UKNA 3JUUA 1CR7A 5GLZA 4A6SA 5LBEA 5D21A 3WP5A 1UOJA 1UZWA 5C4WB 3RZGA 4RR3A 1RUC1 1KFXL 3AYDA 2VOKA 4BQXA 1VP6A 1HJGA 2HYKA 2H6CA 2XLAA 2QQJA 2XKPA 5DUWA 3UKVA 3VDBA 1GNHA 1C5HA 3V0BA 1EY2A 4GB32 1YYNA 5FZAA 1STMA 2D43A 2ZGOA 4E2SA 4XAAA 2RR11 4AI2A 5BY5A 1X9PA 2QDNA 3AXDA 1RVF1 3N4MA 1UY4A 3IB3A 1VE0A 1ZRIA 2XVGA 4CP9B 3ZR6A 1QQP2 3N7JA 4BLJA 3UETA 5FLIA 1ULOA 1EV12 1YWKA 4PDWC 4FFIA 1R083 4YZ3A 2NPIA 1KJRA 1W6OA 4QPIB 1H8TB 3C7OA 1JYXA 1VR3A 1SHWB 1QHDA 4XJZA 5CKQA 1UL9A 5LA2A 2JENA 4TSVA 4PF5A 1W2NA 4Z2WA 2AC1A 4DINB 1GBGA 2BZDA 2JKBA 2R0FA 4MGKE 1LOCA 2J1AA 1WMXA 1OH4A 2A70A 2Z2SB 3OF1A 5JI9A 1X9TA 1QH6A 5L9BA 1ASJ3 2WQ8A 1F5JA 3R0RA 1DF0A 3DXUA 4WM8C 5IJRA 4LK6A 3OGJA 2W46A 3EO6A 3OD0A 4C0BA 1SLTA 2QQLA 4ZPIA 3PJQA 1LGNA 4Z1VA 2RS52 4XFCA 1AR71 2JX9A 2O14A 3V64A 3KF3A 2R073 3K4AA 4FPGA 5K0UB 3JD71 3NNJA 1PGSA 4FVVA 1U0AA 2E6VA 1O4TA 2YFUA 1S0EA 4P9YA 4GAZA 4GULA 4M0HA 2BV4A 2XVLA 2AEZA 3NJVA 2Q8DA 3KT1A 4HKLA 4LHKA 5LBFA 5FZ7A 1UMIA 3KM5A 3M4FA 2VZQA 5L7OB 3ST7A 1LULA 1RUF3 1RUH3 5JPMB 4X8NA 5JXIA 1SLIA 4W50A 2WO7A 1CIWA 4JHTA 3WUCA 3SEEA 2WRAA 1G9CA 3SCFA 1YFYA 1FV3A 3UYJA 4LOSA 1O6UA 2BNNA 4XJ9A 1POV1 2BRTA 1HV1A 4IETA 1AYN2 1BJQA 4ZS2A 4JRAA 1JOJA 1SDDB 3QH7A 5AFBA 4Y5Z0 3O1PA 4LBJA 1H4GA 2LALA 2GC0A 4XF3A 3GHNA 4XHBA 1FNYA 1VBC1 2WYFA 2ZTNA 3B00A 4NE9A 2O0OA 3L2HA 3WLUA 1T6GC 2JDUA 3V0AB 5F2SA 1KRIA 2PHDA 2IXHA 2P17A 2YBPA 3VBSA 5T5LA 3HIFA 3VBOB 3WQ7A 2Y26A 5LK5A 2EF6A 2Y8KA 5CFCC 3JB4C 1DZQA 1QU0A 3WNPA 4LO6B 3ILNA 2HEVF 4ORFA 4XOGA 4FAHA 1W8OA 3FN9A 4XXAA 2A3XA 1XSQA 1W04A 3DL3A 5BNOC 1CZVA 1IHMA 1GMMA 2HYXA 4R4XA 1B35A 4PIZA 1Z78A 2KD7A 1OBNA 4YM0A 3J7LA 3ZM8A 4JVAA 3IAQA 4F83A 3RWNA 1SCRA 1UOFA 4DB5A 1PZ7A 1LODA 2QKDA 4MHUA 1VLNA 3GZTB 1VBB2 4GKYA 3H8UA 4BZ4A 1AX1A 3ZXJA 2W1QA 4FPYA 4DXZA 2HJIA 2XLFA 2A7AA 2CNAA 1K12A 2WLPA 1CVNA 5FZ1A 3VL8A 4AVTA 5FYZA 4OMDA 3KCCA 3OUIA 4JGYB 1ZBA1 1RUD1 4BOWA 4RA0A 1X82A 2FMDA 1MEC3 1UCXA 2BTVC 2J1EA 3ME2A 1YEWA 1NCQC 2G4IA 4WBBA 4YM1A 5BXXA 4Y1XA 4EQVA 4QGMA 5A7QA 2XHNA 5C71A 4PIYA 4JTNA 1UN1A 1ODMA 1DQ5A 1UZ0A 3MIFA 4HOOA 1FXZA 5E8AA 2GALA 4GWNA 4I0AA 4QHOA 4AHZA 4BM8A 5KC6A 3LA2A 3T0DA 1XRUA 3JQWA 4K20A 1JUIA 4EV0A 2XBO3 5L9RA 1FPN1 4AQTA 4HXCA 1H2LA 1KFUL 4PLOA 1VBE1 2AUYA 1OF4A 2BUKA 2VMFA 4YG3A 5J98B 3WG4A 5J3UA 2IXCA 4CVUA 1GZWB 3I3MA 3CJXA 4XQWA 4CCEA 4E9KA 3LOBA 4RS5A 1AR93 4YG0A 1DLCA 2XOMA 3MF9A 4JQTA 1H0BA 1RINA 4GJZA 5T5PA 1H1AA 2Z42A 4CXYA 1I5PA 1LB2A 3OGVA 3ZFEB 2WT2A 3LA3A 1HRV1 1XXNA 4LJHA 4RYDA 1CZSA 2XG3A 4ARXA 2EIEA 3ZSLA 1VBD2 2ID4A 1RUE1 4JKKA 2W52A 1D7PM 4E4ZA 4FP2A 4FPHA 4KH9A 5FYIA 2GC1A 1G9AA 3GF6A 3USUB 4RGKA 1HQWA 1Y4WA 4K1YA 5SV8A 1PGL2 2HWC2 3B5LB 5CYYA 2V72A 1WGPA 3MW3A 5B4NA 4W6XA 4EN7B 2WL1A 5HPOA 1IQAA 2VG9A 3EXUA 3BOPA 3H9AA 4J25A 3B9CA 5G04L 5FY9A 2XPJA 4GB31 1Z7S2 4ISQA 1GZ9A 1ZBE3 3BOWA 4CCJA 1WLDA 5IT6A 2Z5WA 5H9PA 1LOEA 1O4YA 2OYZA 3SCGA 3KGLA 2ORXA 2DWRA 5GLUA 1I1EA 3NKTA 1LENA 1OOPB 3POYA 2VNGA 4XBLA 1DYPA 4YM2A 4YW1A 3NV4A 1QQP1 4A7YA 1GOFA 1EAH2 4OVEA
chains in the Genus database with same CATH topology
1EV11 1C4RA 1PO11 1WD3A 3LSEA 3CL1A 2PYTA 3B93A 1HKDA 3PMSA 1S2KA 2JG8C 4LBQA 1PMIA 3AYAA 1NA1C 1LU2A 3WW2A 4Q1PA 2TUNA 2UY9A 4YW5A 3WG2A 2E51A 4E4SA 2AH2A 2OVUA 3ES4A 1C5IA 2AR6A 1CQ9A 3ZXLA 1GZCA 4MSVA 2UURA 2X53S 3M3CA 3M3OA 4R9AA 1KD7A 1MS0A 1MZ6A 2IFWA 4WVVA 5KHHA 5IUQA 4R52A 1SBFA 1BEV2 4JTOA 2WS93 4CEYC 4LT5A 1MS3A 2RS51 2VU9A 3H1YA 4MGYE 4TYSA 4ATFA 1XNKA 4N43A 4MVTA 4CDQC 4RSUA 3ZIWA 4KL1A 5JZGA 4ONUA 1LOBA 5A32B 3ALQA 1SBEA 4W65A 4AEDB 2IXLA 4XFAA 4Y24A 1DDLA 2PLV3 3VBFB 1H2NA 3V65A 3N7LA 1X36A 1Q8VA 4G3YC 1QF3A 4HSJA 4FO9A 4KGQA 4CRQA 1AYN1 4MXWA 3W59A 4OUSA 3WUDA 1QOTA 5SV5A 1RUG2 4LA3A 1YUDA 3VKOA 4M3CB 1V6JA 2NQYA 5I0RA 4FQZA 4IV1B 3RI8A 2HWC3 3E5UA 4AWDA 4JC1A 4DRRA 3D5OA 3JU9A 1TMF3 2HWB3 3D6EA 5A3MA 4E2GA 1DGWA 3VKLA 3CU7A 1ZVFA 4BLIA 3PMEA 2ET7A 1LGCA 4XF0A 3POWA 3WG1A 1RHI3 1VBB1 2EXJA 3I59A 1AL23 3QLQA 3L2YA 1WCDJ 2X8KA 3EHKA 1X7NA 4P14A 1OD5A 3WDTA 5BNPC 4WM8A 2O1QA 5E16A 5T3NA 3S30A 2PHUA 2D6OX 3ZPYA 1CD3G 2IZWA 3FLPA 5ABJB 1S0BA 2DCTA 4HK9A 5JOYA 4QQPA 2GMPA 1U5ZA 2A3YA 3GZUC 3ILRA 3MLLA 1MVQA 3IT8A 4AGVA 3OTFA 1FATA 1HRI1 2JEMA 2PHFA 4XHXA 1Q8PA 1JHNA 5T50A 1HQNA 4NHKA 3TRSB 3H3ZA 3MPPG 1BEV3 3M3QA 1R092 1NG0A 3AMNA 3MF6A 1YFXA 3J8F2 3UL2A 4X6RB 5FTTC 1N47A 1Q8QA 2G9GA 4JV4A 5GLTA 1OQEA 2GU9A 3EJKA 2IXJA 1BVVA 4COVA 1VBD1 1NE6A 3AJYA 2B46X 5AVPA 4XJ8A 4RR3C 5CFCA 3GYDA 4GXLA 1MS8A 4K3UA 4CYDA 4M3CE 1FMD2 3AYCA 1H9PA 4GIQA 5EZWA 4PBOA 3TOJA 5BNOA 3NW4A 1Z7S1 1IS4A 3OYWB 1Q43A 3R4UA 4JDOA 1RUG3 2WZPP 3ZXKA 3NL1A 3E6CC 3NAPA 1ZZ8A 2WFF2 4MUVA 1Q8SA 2ZABA 4YW2A 4I0WB 1NLSA 1JYIA 4FPKA 3MDPA 4ASMB 1EAH1 2JECA 2I45A 2I07B 3ZN5A 1OKQA 2Z69A 2VOXA 3G7DA 1AZDA 4WM7C 1NCQA 2TNFA 4SBVA 4D3WA 3ZYIB 3DPRB 3OPZA 4XFFA 1QJU3 2CY6A 5AC92 4Q4V3 3B9IA 3WY6A 1AJKA 1W39A 1ZZCA 2BFUS 4AK3A 1VBA3 1CAVA 5C4WC 1M06G 5DDJ2 5BNQA 4BMEA 4XYXA 4IV3B 5GZCA 3JQXA 1Q8OA 4G4FA 1ZNPA 1EYBA 1MS5A 1PNGA 5HCBA 1C57A 4F8AA 2D3PA 4WVWA 4RFT0 4FTSA 4WV8A 3BTAA 1ULFA 1BBT2 5CG8A 1RUI2 1ZX5A 2NMOA 4Q4Y2 1DLLA 3C3VA 1KS5A 3K51A 4OLLA 1H8TC 4BQ1A 4DZGA 4Q4X2 4QX5A 2H0VA 2LUWA 4B4RA 1OA3A 2CGPA 3FHIB 2VVEA 1FOD3 1W6QA 1LKNA 1G9DA 2MEV2 4CDXB 1H30A 5FO9B 4LA2A 1O4ZA 1LOAA 1ENSA 2QZ2A 1ZZ6A 3ELNA 2JG9B 3J4UH 5FQ0A 3H7YA 5D8AB 4YZ2A 3I4IA 1U5YA 3LKJA 4MXVA 5JAXA 3MGUA 5K0UC 5H9RA 5GZEA 2R062 4SLIA 1AYM3 4BWOA 1B35C 5ACA3 2YGMA 5E1RA 4AVVA 4PIXA 2JG8A 4I3PA 4O9EA 5L7OC 1NA1A 4Z82A 4LTAA 1DIWA 2ZS6B 4AGRA 1QJX2 1BKZA 4C90A 1UKGA 4Z8BA 4JDNA 2YDEA 4GMP1 2GNBA 1YLLA 2XJTA 1ND2B 1DFQA 3AP4A 2B45X 3N35A 3PTYA 4P9IA 1N1SA 4A2UA 3O5SA 4MGIE 4CEYA 1UW8A 1H2MA 1W6NB 3VBOC 4UW4A 4CDQA 2YZ4A 3UJOA 4IL7A 1DU3D 2A6ZA 1FX5A 3ZN6A 2YGLA 1TE1B 2EVXA 3RG0A 1I3HA 4IEQA 2Q5TA 1R091 4OHWA 5IK4A 1R1A3 1YHFA 3AZYA 2QDRA 4HSLA 4ZU5A 4R9BA 3ZSEA 3J8F1 4BA6A 5JOZA 4Q4Y3 2ZGKA 4XMAA 1VIWB 2XJPA 3HBZA 1ND3B 3BU7A 3CEWA 4OHXA 2GC2A 4M01A 2HWF3 4AFCA 5GALA 2PAEA 1CN1A 4YVSB 4Q4W3 1YFWA 3SNMA 3U4XA 4AXOA 4JDMA 4FTBA 2O8OA 4JRLA 1LTEA 1MR5A 1W2UA 3AJZA 2DUPA 1WBLA 1FMD1 4XFBA 4D7YA 3MLJA 3LWCA 1Y9QA 1NY72 2D6MA 3VL9A 4P9JA 2MEV3 2R1BA 3POSA 3U0ZA 5FBZA 4C0HA 4IEUA 2FZ1A 4NHLA 2X5IB 4N7IA 4PCRA 2AZ5A 2WFF1 5LEJA 2VMHA 3WCRA 3GZAA 3FUOA 2PQQA 2HWE1 4FPLA 1QXJA 4Q29A 4Y1YA 3HN1A 1ASJ2 1WCSA 5JCTA 2VGDA 1QY4A 5BNPA 5JDBA 2BNOA 4XFHA 3FWEA 5A33A 4FPOB 3S6PA 5AC91 2DUOA 1BXHA 2R072 4H55A 3VHOA 4Z07A 2ZACA 2ZGNA 3GALA 4YZ4A 3AMHA 5DDJ1 3WT3A 1E57A 2CYFA 3WDWA 4LO7A 2DYCA 2GC3A 2RS11 1RUF2 1RUH2 2A6WA 4QM8A 4TZDA 1OSGA 1OFSA 2ZZJA 5FMOS 3WG3A 4I01A 1Y43B 4NHMA 5FRAA 1BBT1 4RHV3 1RUI1 2D6NA 3ASIA 3TB0A 4YSFA 1OOPC 4GH4B 3S0MA 4QM9A 1AUYA 4GQ7A 5GZFA 4WZFA 3NJZA 4H7LA 5T5JA 3WV6A 5C6CA 4Q4X1 4LBKA 4HVRA 3JZVA 1ENRA 2ZGTA 2NM1A 5KHJA 1D2QA 3VBUB 3LOIA 5KWRA 5K7PA 5LRSA 1EP0A 2N7GA 2FHRA 2WNUB 4P9LA 4Q8LA 3OBTA 2C1FA 1ZRFA 1W6MA 2XB6C 3RI9A 4ZU4A 4LEJA 4AG4A 1QMJA 1SLBA 5C9AB 3RMYA 4AYUA 5TSWA 1MS9A 3AMMA 2IXKA 4YZ5A 4R9CA 5KXCA 4BCUA 5GLVA 3O0VA 2DU1A 2ZAAA 5BNNB 5CA6A 2R061 1MEC2 3QCWA 2CTVA 3TWIA 2O8QA 4CP0A 3S7IA 3SISA 3CJIB 3RYKA 3I7DA 4LBMA 4WM7A 1AXKA 3SH3A 1CAUA 1TME2 1DQ0A 4AEDC 1DGLA 3IKWA 5FLHA 3RNSA 3MW2A 2XBO2 1QJX1 4EN0A 5JLVA 5C4WA 3WINE 2DVFA 1S55A 4IXLA 4AI3A 5C33A 1V6OA 2RS31 3A4UA 1RB8G 2EIGA 3U07A 4L8QA 1QDOA 4IEXA 1LJ7A 4FPCA 1AR92 4M0NA 1UU5A 3M1HA 3ZO0B 4QGLA 1SFYA 2R043 4EN6B 5GLWA 3WW3A 1Q5OA 3ZXGA 2V5YA 1SLCA 2DCYA 3KT4A 4I0BA 3T2TA 4E4DX 2JE7A 4IV1C 2WSUA 5FCCA 1IKQA 1NCRB 1H8TA 4S2DA 1N3PA 3VBSB 4KWKA 4G9SB 1KXGA 5HCFA 4CTEA 4XTPA 1J3PA 1COV3 4LULA 3DGTA 2Q1MA 2QCSB 5I0SA 3I54A 4XMIA 1ZBE2 3ROUA 2IC1A 3OJBA 1TNFA 2UYAA 3NVCA 2VVDA 4HFSA 2ZJCA 3ILFA 4ES9A 5ABJC 2UWCA 4CP1A 1KQRA 2R30A 5JSOA 1R081 1F31A 1IPKA 5K0UA 1SDWA 1G7YA 5I8SA 1NY71 1RMU3 2XL7A 3R05A 3WZ1A 4KNCA 3A0KA 1D2SA 3ETQA 3NAPC 1ZYBA 4Y22B 4Q0PA 5L7OA 2D3RA 1ULDA 2ZA9A 4X6QB 4B3NA 3HR9A 5B2GB 5C8CB 2ENRA 2XJSA 4D69A 1ZZBA 4FPJA 4JCKA 5HCAA 4WVMA 1ASJ1 3FC0A 3MIGA 5I8TA 2WKKA 4D7TA 3BIWE 4CP2A 1I6XA 4L2NA 2ES3A 4FSJA 1TME3 4XPVA 2WS92 3TBDA 4RS5B 4KG0A 3RDIA 2R071 3V0AA 4NWWA 3MZHA 2R16A 4KWLA 4I02A 2DTWA 3VBOA 4FCAA 4Z92B 2WA3A 1HW5A 3FUQA 4Q1RA 4K7JA 1AR63 1J3QA 3OY8B 4AVCA 1B09A 1RUH1 1RUF1 2XUMA 1DQ4A 2PLV2 2LM3A 4UW6A 1I5ZA 2ERFA 3BPZA 3I2DA 4L11A 1VJ2A 1C8NA 2ZHKA 2QUOA 2BGCA 2BBVA 1LESA 3IMNA 5BYNA 3GHMA 1HXS3 4AHYA 3FX3A 1WMDA 3WDXA 1W6PB 1ZRRA 4FAGA 2EA7A 1FAYA 1PIV3 4HZFA 1CGPA 1DQ6A 1PK6B 3E5XA 4QQHA 4XIKA 2ZGMA 1NYWA 3DPRC 2WLQA 2WC2A 3N7KA 4HK8A 1A6CA 4B29A 2MHFA 1TMF2 2HWB2 4WVZA 3MLKA 3QACA 4HKOA 2CWSA 1CAWB 3IWZA 3ZVXA 3VDDB 4LBQB 1K5MB 2XJQA 4AHWA 5E88A 4IV3C 2TEPA 2G9FA 5F1RA 2A6VA 3AP9A 3VBRB 1N1TA 1RHI2 1UAIA 2FMYA 1AL22 1GZWA 1UKRA 2PAMA 3MEPA 2XWBB 4UBGA 4IEOA 3ES1A 1SMVA 1ENXA 1D4M3 2D98A 5FLJA 3WR0A 4OI0A 3AP6A 5LEKA 1MEC1 3WDVA 1NQJA 1AL0G 3ZFEA 3AKQA 3MI8A 4NR1A 4BIFA 2W08A 2DFCA 5CU1A 3RRDA 3AP5A 5GJ6A 1GFF2 4N7UA 3M8LA 3QH6A 1PNFA 2DVBA 2XBO1 5JI7A 3USUA 4Y20B 3H1MA 5H9QA 3FLRA 3B02A 1OLRA 2DVGA 4Y4YA 1O3QA 3DUIA 3WP4A 3RMXA 3THTA 2BYVE 4CDXC 5J7MA 4DS0A 2EALA 4HPKB 2DCKA 1YJKA 2ZMLA 1AR91 1ZREA 3KMHA 2ZGPA 2W68A 1UF2C 4K1ZA 3O0XA 3N7MA 2GNDA 2JG9C 4K8FA 1O5LA 2XWJB 4XE9A 4AI8A 2NMNA 1C28A 3MW4A 5D8AC 3ECQA 1OOPA 2PAKA 4FTEA 2RMU3 4OI4A 3VLBB 2XKOA 3AMPA 4QT6A 3V56A 4Y1VA 2XJVA 4F3JA 2OUHA 4CDWB 1J1TA 3CNAA 3TN93 4DQAA 1CAXA 4N53B 4PDWB 3IM0A 1MQTB 4FBFA 3D8CA 2DCJA 3LB9A 3N36A 3VHNA 1ZBE1 1QNWA 2ZKLA 4IEZA 5DUXA 3VZOA 1ND2C 4NVPA 1WD4A 3I59B 3DV8A 1JH5A 3D0SA 3KGZA 1GR3A 3VHPA 3VN4A 4Y1UA 1YNAA 3AX4A 4AHXA 2VW2A 1D0HA 2D97A 3U10A 5JPNB 3VZNA 1QJU2 2AENA 4Q4V2 5A32A 4AEDA 1VBA2 1PO23 4AQ2A 2WNEA 2W0XA 2OIIA 3PVBB 3VBFA 2B42B 4N90A 2ZX0A 2VH9A 4BPZA 1TQ5A 2V09A 1C1FA 2A6YA 4LBQD 1F8VA 1PGW2 2WQZC 3M70A 3MIDA 4U36A 4BMBA 4NN0A 2ZGLA 1ND3C 2WS91 4MGZE 4CEWC 1QJY3 4YVSC 3AB0A 4XEZA 5JOXA 1YIFA 1GYKA 3THPA 4LE4A 4P9WA 1SLLA 2P3IA 2WZR3 3I8TA 4HVOA 4M3CA 3UV9A 1GQHA 2HWD3 4IV1A 3RZZA 1HIXA 1UD1A 2PA7A 3WVJA 5JR7B 3ZFFB 2PLV1 1BVP1 1RJ7A 1C8M3 1XU1A 3C2UA 1QOSA 1OFNA 4COZA 2UWAA 4EJRA 2YXSA 1KS4A 5J48A 4FT8A 2BWAA 2X5IC 2TBVA 1RUNA 1FOD2 1N1VA 1UIKA 4QPGB 3AP7A 3X29B 4YGEA 3ZDSA 5CFDB 3DN7A 3FFZA 2VOWA 4Q26A 2H6BA 4B8EA 5CB7A 4NOTA 2CGOA 5T54A 5J09A 1UPSA 3MPBA 3VZLA 2A3WA 4H7MA 3ZFGC 1OPOA 4IERA 2AREA 1PGL1 1GICA 1CPMA 4JGZC 1XE8A 2HWC1 5ABJA 4XJAA 4XBNA 5K9YA 1QGLA 4TWTA 1TMF1 2HWB1 1AYM2 2BPA2 2R1DA 5L36A 5ACA2 2QZ3A 1REFA 2VPVA 4DMIA 1DGRA 4AVBA 2F4PA 2CGNA 3DF0A 1HDKA 3ZXFA 2WNVB 1RHI1 1S0GA 1AL21 2E53A 1C3HA 5EYYA 4IEYA 4XETA 1O3TA 4P5HA 2GMEA 1VB4A 1WCKA 4EN9B 4GH4C 4XF4A 4XW3A 2XJUA 3RSJA 1NQDA 2PFWA 2IFRA 5F9TA 3VZJA 4I2OA 2VNOA 3NKGA 1UZYA 3IDCB 3P3NA 1FV2A 1GKBA 3E5QA 3RYRA 3GBGA 1AXZA 3FLTA 1C1LA 3VBUC 2Q4SA 2H0BA 2VXRA 3JBG3 3IIAA 5EJ3A 2WNUC