1UOFA

Deacetoxycephalosporin c synthase complexed with penicillin g
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
310
structure length
267
Chain Sequence
MDTTVPTFSLAELQQGLHQDEFRRCLRDKGLFYLTDCGLTDTELKSAKDLVIDFFEHGSEAEKRAVTSPVPTMRRGFTGLYSMCYSMGTADNLFPSGDFERIWTQYFDRQYTASRAVAREVLRATGTEPDGGVEAFLDCEPLLRFRYFRMAPHYDLSMVTLIQQTPFVSLQAEVGGAFTDLPYRPDAVLVFCGAIATLVTGGQVKAPRHHVAAPRTSSVFFLRPNADFTFSVPLARECGFDVSLDGETATFQDWIGGNYVNIRRTSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structural Basis of Cephalosporin Formation in a Mononuclear Ferrous Enzyme
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Oxidoreductase
molecule keywords DEACETOXYCEPHALOSPORIN C SYNTHETASE
total genus 79
structure length 267
sequence length 310
ec nomenclature ec 1.14.20.1: Deacetoxycephalosporin-C synthase.
pdb deposition date 2003-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
A PF14226 DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.330 Mainly Beta Sandwich Jelly Rolls B-lactam Antibiotic, Isopenicillin N Synthase; Chain 1uofA00
1DCSA 1RXFA 1W2AX 5C3OA 5C3SA 4XAEA 1ODNA 1W3XA 1W05A 1HJFA 1RXGA 1OC1A 1W2OA 4RGKA 1W28A 2WO7A 1IPSA 1ODMA 1BK0A 1HB1A 1E5HA 1OBNA 1QJEA 2VE1A 1E5IA 1BLZA 1UOGA 2BJSA 2VCMA 2VBPA 1UZWA 3ON7A 3OOXA 2JB4A 2Y60A 2DBNA 2IVIB 1W06A 3ZKUA 1E5RA 5C3PA 1UOFA 5APAA 3ZKYA 1E5SA 1W3VA 1WA6X 2VBDA 2BRTA 1W9YA 2BU9A 4BB3A 1HB3A 1UO9A 1QIQA 2Y6FA 3ZOIA 1HB2A 1GP6A 1QJFA 1W03A 1GP4A 1GP5A 1W2NA 2IVJA 2DBIA 2VBBA 5C3RA 1HB4A 1UNBA 1UOBA 1W04A 2JB8A 2CSGA 5C3QA 2VAUA 1HJGA
chains in the Genus database with same CATH superfamily
2W0XA 1UXZA 2VQTA 3WNOA 1C8NA 2BGCA 3IMMA 5FP7A 5ABJB 1W6QB 4JVAA 4B7KA 4IEPA 1T6GC 1AR61 4NN0A 1DHKB 1JYIA 4RS5C 3I2HA 2IXLA 4PF5A 5IAVA 1UPIA 4OMCA 2F4PA 4Q4X3 5FJKA 4B4PA 3I7DA 3J7LA 4AEKA 2ZZJA 3D4KA 4ET7A 2CGPA 3G6JB 2XUMA 1IS5A 3ROUA 1Q8QA 3NJXA 3NWKA 5H9RA 2XH6A 4E4DX 4WVWA 4P00B 4U36A 2JKBA 2YZ4A 3DYOA 1IQDC 5A7OA 3SITA 3ZSKA 1XXNA 1SCRA 1XQNA 2IVJA 3IZOA 1GP4A 4S2GA 1W0NA 4YWAA 3NV2A 3Q8AA 4E9KA 4FTEA 2Q1ZB 1EPZA 1SG3A 1HB4A 2WL1A 4FQ4A 4TYSA 1FPN3 3TB0A 5KBFA 2W08A 1CX1A 3M70A 4BE3A 3O1OA 1UMHA 3DF0A 1YIPA 3H0OA 3T08A 2VZ3A 3KD4A 2D5FA 1AYN2 4L11A 3SNMA 2OPWA 3IDAA 1QY4A 4AGGA 1DZRA 2VULA 4OI2A 2VMCA 3GJAA 4EJRA 1NQJA 4IL7A 2RE9A 1CGPA 5IVYA 4OI0A 5LRRA 5GZFA 3I59A 2IXKA 3TBDA 2VL4A 3RMXA 2WWJA 2YROA 3FMGA 1Z7S2 1EAH1 4Q4Y2 2IFWA 1ZM1A 1DCSA 1YQCA 4E27A 1SBEA 3MPBA 2PAKA 1LOCA 2JIGA 2IXJA 4N7IA 5CA6A 2XL9A 3TN91 1ZZCA 2UY8A 5J7MA 1O3QA 3PUSA 1RUF1 1EV11 2VCAA 4XC9A 1DQ4A 3LIGA 2ZHNA 3OOXA 1RB8G 1YFXA 1POV1 2WAOA 4W6XA 2KA3A 2OQ6A 2KXLA 2OPKA 1F9KA 5FZAA 1QGLA 2WYFA 5L36A 4MH0E 1AX1A 3KQ4B 1G9AA 3VD4A 5JZGB 4AHWA 2VVDA 2H0VA 3PUIA 1H0BA 4QPGB 1W6OA 4D6RA 3VUOA 4FOQA 4CXYA 1UXXX 1AR63 1RVF1 3HR9A 3OGSA 4LBQD 1AZDA 3R0RA 4TN7A 2ZEXA 5LBCA 1I3HA 1RUJ3 2XVLA 3KHBA 4YARA 3FFQA 4XQ4A 3ZXAC 1RUG3 3NKGA 3ZMNA 4BXFA 1QJY2 2D93A 2JDNA 1W6QA 3RFRA 2C4XA 3UJQA 4M0NA 1XU2A 4RQPB 3VD7A 1W6NB 3RQ0A 5LZ6A 4D8MA 5K9YA 3S5AA 1DQ5A 4WM7B 2WYSA 2VECA 1LGBA 5LEKA 3VKNA 4LBJA 3DXUA 3TNPB 1PK6B 4BQYA 5BUVA 2Y6FA 3AZWA 2PA7A 3GZEA 4YGBA 2R0FA 3ATGA 4I0WB 5CG8A 3WP3A 1C28A 5HV0A 4LBMA 3K77A 1KQRA 4JHZA 4UF0A 2YMZA 3ZN6A 4AAPA 4DINB 2Q4SA 4CDWB 1CAUB 4FP3A 4L99A 3E1F1 1MS0A 2F17A 2OUJA 4YM0A 2EAAA 1GQPA 4XETA 5DUWA 1FMD1 2R042 5DDJ2 2KR2A 4Y20A 4YZ3A 1UX7A 2E26A 3ZYIB 1U5ZA 1OVSA 1UPSA 1H2LA 2ZMLA 5JOWA 3SMHA 4BA6A 2BFUS 3RI9A 1W06A 2J1TA 4YZ5A 1DZQA 3ZYPA 1RUD3 5LA1A 2YU2A 4S2DA 1OF3A 4FPHA 4E2SA 5FUIA 1PHMA 3U78A 3NRUA 3VHRA 4EN8B 3S0MA 4AVCA 1IQAA 1SLAA 3DYMA 2BWAA 5FP4A 3Q8BA 2RJLA 1H2MA 4UW6A 3U4SA 2CU5A 1C5IA 3N7KA 2VUAA 3NAPB 5I0TA 4K3UA 4DQAA 2EVXA 4LBQB 2Y64A 1AHSA 4Q29A 5JR7B 4L8QA 4J25A 3ON7A 4CZSA 2BNMA 3WR0A 4UI9L 2JDPA 4DB5A 3WF0A 3W59A 3BU7A 1ZRDA 1GOFA 5A7QA 4NRQA 2JDUA 5HCBA 4LKEA 1VB2A 4ES8A 3CZUA 4QU1A 4Z92B 3WW2A 4GZ9A 2VOKA 4QX1A 4CP0A 3QLQA 3JZVA 2PN5A 3HVDA 3VBUA 1TE1B 3AP5A 5JXHA 4MGSA 1ZBA3 5DDJ1 5AC91 2GZWA 4JGYC 1NLRA 4CCKA 5IVVA 3T1MA 1Q8PA 3VBHB 3LEIA 3ZFFA 3JBG1 1ENXA 1O5UA 3B7MA 4RGGA 3A23A 4G3YC 2JXAA 1BBT1 5A1FA 1TNFA 1W2OA 1QJX1 1NXD1 1JXNA 4QD2A 3VN4A 3OTFA 4HSLA 3WW4A 1REFA 2PLV1 4LLOA 5FZ9A 3BPZA 4Q0QA 5LWBA 3TWIA 4CU7A 4Y1ZA 2G9ZA 3T2PA 2G19A 1JUIA 2EA7A 2ILMA 1GV9A 5CFCC 1W0OA 5FZEA 1OF4A 4MV2A 2WJSA 4YGDA 2BNNA 4FP2A 4MXVA 2X05A 2VW0A 4QM9A 3VZNA 1VLNA 5LEJA 3EHKA 3IAQA 2MPFA 2OIIA 3KMHA 2Q8EA 4CA9A 4HOOA 4XXAA 3K4DA 4EV0A 2BUKA 4XACA 5DZFA 2CSGA 2JIJA 2J1VA 2LTNA 2GSYA 2HEYF 5CZKA 1JU4A 3E5XA 1N1YA 4RGKA 1U12A 3VBFB 4AEDC 4OHXA 1RUG2 4H7LA 4GAZA 2R16A 4P9WA 3BALA 3VLBB 4ZONA 5C8WA 1J84A 3LE0A 3I97A 3MFCA 5IWFA 1WMDA 1GWLA 4IV3A 3OUJA 1ZRRA 4CDQA 1RJ7A 1VRH1 3F2ZA 4CEYC 3VBUB 1XYNA 1CPMA 2C0ZA 3J8F1 3ZXLA 1UOFA 1SACA 2VUDA 2VZTA 1WA6X 3OEBA 3W5MA 4LKSA 4KBBA 1OQ1A 2WS91 5FZ4A 2BOJA 3WLUA 1RUC2 2SLIA 3BTAA 4LBNA 1X9TA 2WAAA 5D21A 1PVC2 5AC93 2PHFA 2WT2A 2R6QA 5DAWA 4RL7A 1BMV2 3T2OA 2VNRA 4XBNA 4ZY9A 4EWAA 2WQ8A 2CGOA 5K0UB 3ZXDA 2AUYA 3ILFA 2JJ6A 2FMYA 3KGZA 1Z7S1 1YWKA 4DXSA 2J1UA 1ZBE2 1OXCA 2DTYA 4GH4C 3GDBA 4A6SA 2AC1A 2O1QA 5K7PA 1H9PA 1GOGA 2VQ0A 2HWD1 1KEXA 5A6YA 1RINA 2ZABA 4FVVA 1E57A 2O8QA 4HFSA 2XQXA 4M4RA 5FTTC 3EQEA 3N9PA 1UMIA 3FLPA 4Q26A 2WZPP 2VR4A 4NAMA 4D7SA 2PHLA 2EICA 1RUH2 1Y9QA 1QJZA 1QNYA 5JI9A 1NOVA 1XNTA 2GC2A 3J7NA 5IVCA 4NWVA 3RPQA 4DXRA 1SBDA 2CYFA 4CDXC 3UV9A 1Y9GA 3HMYA 4N53B 4CUGA 4A42A 3WF3A 1CAVB 3BN6A 2V4AA 4YG3A 2QQIA 5I0RA 3KT7A 5HPOA 1HIXA 3AL5A 4INDA 4CCOA 5F5QA 1IKQA 2FCVA 5E89A 3FX3A 4K9SA 2BTVC 1NCRA 4F7ZA 3TEYA 4HPKB 2XR4A 4WBBA 3DPRC 4YW6A 1JW6A 3MLLA 4BXSV 1RUD2 4GULA 2OUHA 4D6QA 1RHI3 1HXS3 4K6BA 3IM0A 4LO8A 5IVFA 1CAWA 2YFUA 4JHTA 2QQUA 2WSUA 4BMBA 2J7MA 5FY9A 1AR91 4FFHA 4AEJA 2ZX2A 4JDMA 1Z0HA 4B1LA 1FYUA 3KCXA 1EUTA 4QQ2A 2H0BA 5F5AA 4P02B 1EAH3 2YC2A 5T50A 3O1RA 1JODA 2VH9A 4CVUA 3INAA 1AXKA 1UY2A 4KG8A 3NW4A 2GNMA 2VOWA 4FI9A 4QPIA 3IIIA 5FY4A 3CHXA 1R082 1CQ9A 1KFUL 5T52A 1CESA 1IPKA 4CUAA 3BI3A 4XVHA 1C4RA 1EV13 1OURA 3IPVB 1COV1 3WVJA 4BK4A 1HV1A 2VTXJ 3MW4A 1NZCA 1RUI2 4XPVA 4CDUB 5JWPA 5LA9A 1PGW1 1W9FA 1W9YA 1ZNPA 2BW8A 5HV4A 1ZRFA 5FMDA 3VBRB 4JV4A 2OKXA 1ZA7A 3VDCA 2E53A 2B9VA 3KT4A 4XFFA 1VBB2 2C9KA 2YHJA 2QTWB 4MGKE 2VCBA 1O5LA 4I0BA 1AR81 4BU2A 4CUBA 5IATA 1O4TA 3SCFA 1NUKA 3GZAA 2Y34A 2JD9A 1MZ6A 2C1FA 1GZWA 2HJIA 2Z5WA 4NUBA 3FE5A 2Q1MA 4FPCA 1I1EA 1OFSA 4CYDA 1BLZA 3VGIA 1R1ZA 1PVC1 3VBSB 4Z07A 1URXA 4UW3A 3ZDVA 2JG8C 4QB2A 4ZU4A 5LASA 3NSTA 1HQNA 1TME3 2BQPA 4XFBA 2Q5TA 4XF9A 1AR62 1JHNA 5DAVA 1JYTA 1SPPB 1UL9A 3WDWA 4G4FA 3NNJA 3SKVA 3HOBA 1PVC3 2ZMKA 5AC92 1X9PA 1BMV1 1VMJA 3RYRA 2JB8A 4AFBA 4C1XA 3MHZA 4H3WA 2W1UA 4KH9A 4COVA 3B01A 5FPXA 4EZHA 3VHNA 1PO23 4ORFA 3VKMA 2FDIA 2EALA 2K0GA 5A32A 3APBA 5GLZA 2DWRA 3QOPA 4LNVA 3ITQA 4JKLA 3AYCA 5AVPA 5LATA 3AKQA 2GN3A 4RR3C 4COWA 4R4ZA 1OOPB 1UQXA 1V00A 2R061 4KWJA 4XF4A 4D7TA 3BKZA 4URTA 5LBBA 5DMYA 1ST8A 1JZ6A 1DLCA 3H8UA 5L9RA 3WV6A 1JS9A 2D98A 4OZOA 4Z82A 2BRTA 4COUA 1W8FA 3AZXA 1ZBA1 1OA2A 5DDJ3 1OA3A 1XJAA 3VDDB 3ZFEC 1RUH1 1DBNA 2ZKLA 2Z69A 1S0EA 3Q8FA 5HI0A 4XYXA 1WCUA 3KSCA 4FFFA 4LE3A 4P9IA 3PIGA 5FYUA 4BLIA 2DCYA 3ACHA 4QM8A 2TBVA 3K4AA 3ZYRA 2GN7A 3X29B 3AJYA 2NQYA 2VZVA 4ONUA 1SHWB 1OI6A 1WMFA 4CE8A 1AJOA 1RL3A 4AI3A 4D6SA 2P34A 1LGNA 1X50A 1UZWA 3FHAA 2RV9A 4OHZA 4IGOA 4ARXA 2V4VA 1ZREA 2LS6A 1DQ0A 3NV1A 1TZOA 3TN92 4KG0A 1ND3B 1HRI1 2A73B 4NE9A 2ZX1A 4NPMA 2O8OA 1HXS2 2PELA 1N3OA 4AVSA 5FYZA 5M0TA 1NLSA 1NY71 2A1XA 3AFGA 2YGLA 2RR12 2JDZA 4JZRA 4GIQA 1CJDA 2HWB3 2OS2A 4PIXA 2WNEA 4Y5TA 3LGRA 1PM4A 1FATA 3U37A 4QKNA 5C3SA 3JB8A 3OPZA 3MIFA 4NHYA 4YYOA 2XLFA 3W20A 2DU1A 3PU3A 3RRDA 1ZRCA 1DGWA 4UBHA 4XUTA 1YRZA 2XHNA 5GALA 5CKMA 3J26N 3PDQA 2VBPA 4Y24A 5BNOB 4ATFA 4Q4W2 2ZTNA 4FFGA 4YVWC 3ZXJA 4JAAA 2B9UA 3EXUA 4UFMA 5FRAA 1AR82 3A0NA 1CVNA 1WKYA 2P3JA 4KWKA 1D4M2 4QX2A 4NJ4A 4R9BA 4XE9A 5FDBA 1AYN1 5FZ6A 3KV9A 5I8SA 3NO8A 3V0AB 2XBO2 4Q1RA 4XCAA 3TOJA 4QPIB 2R0HA 3KGLA 3VDDC 4FXKB 3ZFEB 5LY1A 5KC5A 1B35C 1JZ3A 4DPNA 4L2NA 1EAH2 4Q4Y1 3HBZA 1XRUA 4FPJA 4ZU5A 1MS1A 2HWF2 3SXWA 1PZ8A 2OA2A 2E33A 4FAHA 2NM1A 5J96B 2PFWA 1UIJA 2JX9A 3NKTA 3PHMA 2ADDA 3N7LA 4QXHA 5FZKA 2LW8A 1YJLA 2IUWA 3ABZA 3KZ4C 3VZOA 3LCPA 1OSGA 2J1RA 2PHXA 1LHOA 3LIHA 4XHXA 3WD5A 1MQTC 2ZA9A 4AQSA 1XNAA 4LK6A 4Q8KA 5KC6A 5ACA1 1SLBA 1R091 4HKOA 5IJRA 5C9AA 2VTFA 4R9DA 3OB8A 4W6YA 5FZ8A 3K46A 1AR92 1UYXA 3WQ7A 4JCKA 2VE1A 2D3RA 2VMIA 1ONAA 2E7QA 4N9IA 3OSDA 2OQ7A 4CDXB 1K5MB 2D6KA 5I0DA 1AXYA 5A7SA 5JZGA 1RITA 3WF1A 2YBKA 3HAGA 1GKBA 1QOTA 4FPOB 1W8UA 2ZX4A 1FOD3 3PURA 5CIRA 3V0AA 3I2OA 3WP5A 3H9AA 1PO11 1A8DA 3P5BA 5ABJC 4LO4B 1HB2A 3OUHA 4COYA 4AGVA 4PQQA 2VMFA 4CP2A 4ZS3A 3AL6A 3L2HA 4BCUA 2WUHA 1WBFA 2ARBA 5J09A 2VO5A 2X09A 3ZXFA 2X8KA 3MEPA 1Q8VA 1CAWB 2NMOA 4XFGA 1Q5OA 2EXJA 2R072 4M01A 3WDXA 1H2KA 3UGGA 3M4FA 3MLJA 1MS5A 2P3YA 1AL21 4MLOA 5FPAA 4B4QA 1NY72 5F2WA 3PJYA 1JZ8A 1VRBA 2WT1A 4GA9A 5J36A 2A3YA 2CY6A 4IQPA 5CAZA 1BBT2 3MZHA 2Y6KA 2XLGA 4OHVA 4DRVA 3M2MA 2QQPA 4YW4A 1U5IA 1US3A 2YPJA 2WRAA 4ZZ5A 4LIUA 3ZN6B 1S0JA 3JBG3 2QE3A 2ZGLA 3BOWA 4O9GA 4IE5A 2D7FA 1GSLA 4W65A 1QJY3 1VP6A 1L7RA 1RUF2 5IT6A 2DVAA 2W95A 1R1A2 2MEV3 2PHTA 3BODA 5FKBA 2E9QA 1VAKA 3WCRA 4CCMA 1I5PA 5CBLA 1OC1A 5DG1A 5H9PA 2WO7A 4KNCA 1ENQA 1Q8OA 2B45X 1XC6A 3DPRB 1SEFA 4K8RB 3DGTA 2B42B 3ME2A 5F6LB 2WNVC 4HKLA 1TVGA 4V1PA 1R083 3K3OA 2P1BA 1QQP3 4QHBA 3U1XA 5DUVA 2D5HA 3O1SA 1S2KA 1W2TA 4IEOA 4D69A 5EP9A 4R52A 5FP8A 4FPFA 5LA0A 1VBC2 4YSFA 3LOBA 1K42A 3IWZA 4XJWA 3E6CC 4TSVA 1LHVA 1VR3A 2WQZC 1G9BA 3AZZA 2NPIA 4QWNA 3RVHA 2A6WA 1WLCA 4HVOA 1IZ3A 1UZZA 1OPMA 3BPSA 3J4UH 4XUQA 1JOJA 4YG0A 4FPYA 3ACGA 4AI9A 4E8DA 2Y8KA 5BY5A 3LEGA 3D82A 3A21A 4N7UA 4AVBA 5FO9B 4Q4V2 3MFAA 2PMWB 3SEPA 3AYEA 2P17A 5FZ3A 4LIVA 3LSDA 3IDCB 4PDWC 4OZXA 4X6RB 3ZXEA 1L7LA 4A3XA 4J1WA 2GNTA 4NIGA 3FUOA 2EXHA 4MGYE 2E63A 4CXWA 5G05L 3IT8A 5FLHA 4N90A 4XF0A 2HEWF 5L7OC 4UT5A 1ZZ6A 2LRPA 1XE0A 4HXCA 4IE7A 3NNFA 5FPUA 1FMD2 4BISA 3F95A 1HXS1 5A3NA 2DCTA 4TWTA 2RMU3 3GNEA 3ECQA 4K20A 1D4M3 2W47A 4AVTA 4CTEA 2XJQA 2A6XA 1W9WA 4XUOA 1J1TA 1AL23 2Z2SB 2QQNA 4IDZA 4L92A 1E5IA 3ELNA 3WUDA 4GMP3 1NQDA 1TMF2 1C57A 5KHIA 5CG9A 2VZUA 1GZ9A 3FHIB 4WM8C 4HANA 1FV3A 4TLFA 2J1SA 4JRAA 5FQ0A 1HB3A 1SQ4A 3OD0A 3FBMA 4GMP1 4XMAA 3D8CA 4DUWA 3MF9A 4Q0UA 3V0BB 5K4LA 4A45A 1ZZ9A 2ATFA 2XWJB 5D8AA 3TNQA 5CKNA 1QXJA 2BFUL 4WVMA 3LDBA 3V56A 1PNFA 5EJ3A 3LSEA 5EXOA 1VBD1 2DUOA 3CMGA 2VY0A 1U5YA 2CDOA 1POV3 3R05A 1IPJA 1W9SA 1TEIA 4XMIA 5FYMA 1F5FA 1RJ8A 1S2BA 1QDOA 1UZVA 1XYOA 1ULFA 4QPIC 4QPWA 4RGAA 2GNDA 4QQLA 1SDWA 4LORA 4KWUA 1VBD3 5GLVA 4HVQA 1WBLA 4MOAA 1D0GA 2JECA 3B9IA 1HN1A 1AR93 3JBG2 4Q27A 3C7FA 3D3AA 5FYTA 2QZ2A 3PLQA 3ZOIA 3N9QA 3VBRC 4LXLA 4RSUA 1F31A 1QU0A 2QQWA 3ZSEA 1KRIA 5JXGA 1W99A 3WHUA 2ORXA 1CIWA 3GXUA 3OEAA 1R092 4NWWA 4Q4X1 4CPBD 2GDFA 4C0HA 1TNRA 2DV9A 1ASJ3 3MUY1 4UFHA 3LFIA 4FPGA 1VIWB 2DURA 3FHQA 4PHZA 1QJU2 3JU9A 4Y26A 2GC1A 1GICA 2HYXA 2IWGB 4WV8A 5ISLA 2JENA 2WNUA 5CB7A 4EWEA 3LPFA 5CKQA 2ZGSA 1HDKA 3I2FA 3UGFA 1NXMA 1KS5A 4CDXA 2Y0OA 2ZGKA 2P4EA 2E7AA 4O7XA 2L9LA 5T5LA 2D3SA 1BQPA 4Q4V1 4XXPA 3QBQA 3SISA 2JE7A 5GLUA 1JU3A 5ACA3 5FOBB 5L73A 1CD3G 3AKSA 3U11A 5H9SA 3LPGA 1DDLA 2QDNA 5IVJA 4WZCA 3CIHA 1LESA 1NA1B 4MADA 1OUSA 4LHNA 2KM2A 4UFJA 3AYDA 4OVEA 2MEV2 1R1A3 3WUCA 4RS5A 1RUD1 1DZTA 2JICA 1QWRA 1RVF3 1E5RA 4BM8A 4BWOA 1A3KA 1PO22 2BBAA 1HX6A 2NYYA 4Y3OA 5JCTA 1JZ4A 4NPLA 4IE0A 2BGPA 1DGRN 5JSRA 3FL7A 5CEHA 5L19A 1KJRA 2WZR3 4KU8A 2W1SA 2BVVA 4CCCA 1PZ7A 3ZN4A 5KXEA 4IW3A 3WDVA 4AFDA 1RIRA 3O5SA 1DLLA 2FDGA 2B39A 5F32A 4E2QA 2WNVB 1MS9A 5B2GB 1WA4A 5CNAA 2R073 4FCAA 3I4IA 4IV3B 2VCCA 3SH5A 4AXOA 4CDQB 4Z1VA 4K40A 1XPWA 4BHPA 3AMQA 2I45A 3BCWA 3ALQA 2KD7A 1EPWA 4R9AA 3IIAA 3GBWA 2UY9A 3HQUA 5F7UA 3VBHC 1OKOA 4OHWA 4DFSA 2XGXA 3I8TA 3ILNA 3GCWA 5GJ6A 5EWSA 3WW3A 5BNOA 4ITCA 5C5TA 4B7EA 3RZMA 3O0VA 4XCBA 4NIHA 4Q4V3 5JVVA 1Y43B 3W9AA 2JDMA 4Q1PA 5IFTA 2VAUA 3AP7A 1ZX5A 4D0QA 2EF6A 3ZSJA 4CEWA 4CEWC 4MXWA 3MIGA 5JZGC 2WFF1 1W8ZA 4OFGA 5H9QA 4B3NA 1SFNA 5FPVA 1JN2P 1I6XA 1ZZ7A 3C3VA 2BJSA 1VAMA 4LOTA 5C8CC 1C3HA 1F8VA 1QQP2 5FPZA 1KXGA 3UKTA 3UT0A 4DEQA 3PUAA 3RJ2X 3ZPOA 3KCCA 4AYUA 2B5HA 3KV5A 2ZGNA 3OD4A 1OQDA 1SLCA 1MACA 1S0IA 1OLRA 2WNVA 4I0AA 1H2NA 3R4SA 5FYCA 5FZ0A 2WZ8A 3ZR5A 5JMOA 3VKOA 4R8HA 3I49A 1QJU1 1ULPA 2WLPA 3SH3A 1N1VA 2HWE1 4MGZE 4OLLA 1RUF3 5LBEA 3VZJA 3ZVXA 1GNZA 2YXSA 4AAXA 1X8EA 3O12A 2R32A 2B8MA 3RZJA 1FPN1 3GCXA 2WSVA 5FZOB 2O0OA 2G4IA 3LQCA 5A3PA 1H9WA 3GBFA 4TXWA 5FMOS 1F4AA 3N36A 5BNNC 5EHDA 2DVFA 4BDVB 4GD4A 2VZQA 1F35A 2Q1FA 2YV8A 4P9YA 4Y22B 3T4VA 4BIOA 1VBA2 2ET1A 2VMGA 4P9XA 5C3PA 3ST7A 2ZEYA 4N9HA 4HK9A 4YVSC 5LK7B 1VAVA 1Q56A 4ZXEA 4W8JA 2C9AA 3HN3A 3QD6A 4GJZA 5F3CA 2HWC3 2RG4A 2R30A 2RS13 1DG6A 1ZYBA 3HT2A 3SQOA 3P6BA 4JKKA 5FY7A 2OVUA 1PNGA 1XNKA 3WG1A 1SMVA 2G9FA 3A4UA 4D7YA 1BCXA 4Y1YA 3WT3A 1Z78A 2W9XA 4K8FA 4AQ6A 3USUB 4CDUA 1JOBA 2ERFA 4AL9A 3D6EA 1F15A 4IUGA 1CAVA 1DQ2A 3ZKUA 1UZYA 2AYHA 2JG8A 1GR3A 4LO5B 4F83A 5A6ZA 1V6KA 2NLRA 4QPGA 4NHXA 3WDTA 1PIV2 4K1ZA 4AFMA 4AZZA 3WINE 2P37A 2ZX3A 4N43A 3KVAA 4DY5A 1QJU3 5T54A 1AVBA 1YO8A 4GWNA 1C5HA 4PQ9A 2WINB 4Y1XA 4MGTA 1VE0A 2DCJA 4MUVA 3C8XA 3ETQA 4Q0VA 3ASIA 4C90A 2YB7A 3ZFGB 1RUI3 3JD73 5CFDB 3TYJA 3LEMA 1W28A 3P1IA 4MYEA 2GP3A 4PDWA 5FXZA 4FT8A 3PMEA 4YVSB 2FZ2A 2XBO1 3LA7A 2WFPA 2VCMA 4QDSA 2ZEZA 3POBA 1RUG1 2VMDA 2Q8OA 3RYKA 5JIUA 2RDNA 1RUJ1 2DCKA 4QQPA 1RVF2 4QXKA 1W6OB 4XF3A 4BB3A 1VRH2 4MVTA 5F3GA 4AW7A 5JMCA 2Y6JA 2D6OX 5JPMB 1LHUA 4CDWA 4QX3A 3ZFEA 1MEC2 1W04A 4BLJA 4CU9A 4LPLA 1QNWA 1OHFA 4YPJA 3VBSC 4TTGA 2BNOA 4QX8A 2UYAA 4LHLA 2Y33A 1UKRA 1ASJ2 5F8PA 5FZHA 3GYDA 1LU2A 3CU7A 3MGUA 1JBCA 1K45A 1RC6A 5FO8B 1V9U3 1Q8SA 3MBWA 4P08A 5L9BA 2V72A 4NRPA 2WNOA 3ZKYA 3FJSA 1JYCA 5IUQA 4UYBA 1U5XA 5A6QA 1GLHA 1S0GA 2BV4A 4YLZA 4A41A 2MEV1 5F3EA 3THDA 4CEWB 4EZ4A 2VBBA 4JRLA 1CAUA 4ASKA 1I5ZA 1GWKA 3Q8EA 2XMLA 4XJ9A 3T0AA 4I3PA 3C7GA 1Z7S3 3JD71 4XAEA 3BB6A 5E1RA 1R093 4BQ4A 3DCQA 5J37A 3E5QA 4IEVA 1RTVA 1PGL2 3M3CA 4PI0A 2I07B 4HONA 2BZDA 4LEJA 1IGOA 3VL8A 2VZOA 1MS8A 2ZGMA 2VVFA 2EXIA 2K9ZA 3BU0A 4JGYA 4FPLA 1UW8A 4Q0SA 4XZPA 3RGBA 3RS6A 4IV3C 5GKAC 2OW4A 4W6WA 4CDQC 4CEYA 1O3RA 4WM7A 4N53A 3ZPYA 4KGQA 1O3SA 2ET7A 1UNBA 5C3QA 2P6CA 3WDYA 1BEV1 2WDBA 1EV12 3D0JA 5FZOA 3GZUC 5HBAA 4YG6A 4P9LA 5KXCA 5IK5A 4A7YA 3V65A 2CAUA 2VC9A 3ZSLA 4DZGA 2BERA 3I3BA 4UW4A 1B35A 4KQ7A 4XDOA 4Y4YA 2HWE3 3H3LA 3LAGA 1UY4A 5B4NA 4FTBA 1WZXA 1JUHA 3WQBA 2A7AA 1WD3A 2HBUA 4FAGA 1LAJA 2RS53 3T2TA 1ZBE1 4FBFA 3HQRA 3L2YA 4BJ0A 2FBEA 2PLV3 1QJX3 3D5OA 1CAXA 2CHHA 3WDUA 3LF7A 1OKQA 5GZGA 3OBAA 3TRSB 1DYPA 2K46A 4OQ9A 3C7EA 1BVP1 3MICA 3MI8A 2GMEA 4IGPA 2BGOA 4MHRA 1NCQB 2JG9C 1RUOA 2RS12 3POWA 1N47A 3POGA 2A3WA 4IE6A 4LULA 4YW2A 1IS3A 4Z8BA 3NL1A 1W6NA 1JHJA 3O1TA 4U2AA 3JUUA 3WZ1A 3M1HA 1FXZA 1C8M3 5FLJA 4C0BA 2ZAAA 2Y6GA 3FWEA 5ERLA 2Y60A 4KWLA 3CQOA 1BJQA 1AX0A 2ZGTA 1AL0G 2VBDA 4FXGB 4OI1A 3U0ZA 3BIEA 3KB5A 2W1QA 2A5ZA 3VBOC 1W03A 5FWEA 1MEC1 4CSWA 1CX4A 3EBRA 3RZGA 1UY1A 4NVPA 4DY3A 3T4HB 1D7PM 1RUE2 1N3PA 2GC3A 3DECA 1VBE3 1W8WA 5F5CA 3BTXA 4JGZB 3J7HA 4AQ2A 4DIQA 1WCKA 2EIEA 4JTNA 3I2GA 1SLLA 3I2KA 1VALA 5EPAA 1YNAA 2W3JA 3LFMA 1SPPA 2XKOA 3N35A 4HMZA 1J58A 4XTMA 4C91A 2GALA 1OA4A 2WO3A 3W5NA 1PIV1 4GXLA 4HZFA 3USUA 4KBZA 1A78A 2ZJCA 2XJVA 1R1A1 2YUEA 1LRHA 2FDHA 3HD8B 3MIHA 3AMPA 1HRV2 5EFUA 3NAPC 2BEOA 2JKXA 3KQRA 3NAPA 3PL0A 5D1IA 4W50A 3RZHA 1OH3A 1CIYA 2HYKA 1XE8A 1G9DA 2WQ4A 3OPWA 3EMRA 4AQTA 5C6CA 4RHV1 3AJZA 1W05A 1WW7A 2JE9A 4CCNA 1MZFA 3RSJA 2J22A 3AP4A 3H7YA 3MPPG 1NCRB 1Y9MA 1SCSA 1XOYA 3QH7A 4LBOA 3VDBA 2YG0A 1YQ5A 4XFCA 4AEDA 1QJY1 4QDRA 1XE7A 3GZTB 4FPKA 3ZXGA 1QH7A 4Y20B 2VOXA 4QMAA 4XQWA 3HQXA 5FZGA 5EYYA 4ZKTB 5F6KA 1IG3A 1DF0A 1LHWA 3JCIA 5A6XA 2A6ZA 1V9U2 1K3IA 3WCSA 4LOSA 4B4RA 3MLKA 5C71A 4RYDA 5FR3A 2VZPA 3V64A 2XOMA 2D43A 2LM3A 2JDAA 2ZEWA 3H8OA 1XSRA 3U75A 2DDUA 4Y33A 4QPYA 2ZGRA 4HT1T 1ND3C 5FIXA 1ND3A 4FFIA 4JGYB 1S4CA 1X82A 5JLVA 2QQLA 1TME2 4KU7A 1AUYA 3LDRA 2AENA 3H1YA 3OUIA 4GH4A 4M3CF 3GGLA 4P9JA 1PO13 1ZZ8A 1BKZA 2XJSA 5A3UA 1QOOA 4UAPA 4XDQA 2CAVA 5C3OA 1RUH3 1AJKA 2RDQA 1QXRA 2ZACA 1B35B 1PX4A 2RS51 2W5FA 4NPRA 5FREA 3H42B 4QB1A 2WR9A 1VBB3 2JDHA 1WGPA 2DVDA 2RM21 2ZGOA 5GZCA 2R063 2WNUB 4BQ1A 1F4HA 1YYNA 1RMU2 2XUEA 1OBNA 4PLOA 5FWJA 4LMFA 2DUQA 4X6QB 2R1DA 4XJUA 5SV8A 1RUC1 3H1WA 3KLSA 1WCSA 4YZ2A 2YGMA 2AEZA 2D97A 2OX0A 3ACFA 4FQZA 3UK9A 3UKNA 1NCQC 5GM0A 3RDIA 3AB0A 3UETA 1NCQA 4XFIA 3RWNA 5CU1A 3RZZA 5AVAA 4JTOA 4MGIE 3I2DA 5FP9A 3HIFA 1W9TA 4RQPC 5JDBA 2PLV2 1IG0A 3O14A 4HK8A 1ALYA 2VQUA 5JOYA 1H8VA 1R64A 4HVRA 5BNNB 5FZCA 2FDJA 2QKDA 3I59B 1W3XA 1RXGA 3EJKA 5GLWA 3UGHA 3R6SA 1COV3 3VD3A 1AF9A 2W92A 3H8RA 4XAAA 3M3OA 1QEXA 5L9VA 3A7QA 1W6PA 2XJRA 5BNQA 4J6GA 1LOFA 2UWBA 5J1XA 5CISA 4RHV2 2OYZA 5EIYB 4Q4X2 3PIJA 4YM1A 1ND2B 2A6YA 3VV1A 1QJFA 1C8M2 3E5UA 4Y5Z0 3B93A 2P2KA 1FNZA 1Y3TA 4LA2A 4RFT0 2A6VA 3PNAA 5FV3A 5KHGA 1ULCA 2RM23 2VGDA 4QKFA 2RMU1 5FCCA 2RJ2A 4MG2A 1VBE2 1PMHX 2IZWA 2E6VA 3NVCA 3R4DB 2AH2A 3AMNA 1LEMA 4HPKA 4EQVA 3S30A 3MF6A 4BYYA 2XBO3 2RJKA 1VB4A 1OLMA 1OT5A 4M3CA 2O14A 2ZGQA 1YCIA 3NV3A 4QXBA 2E32A 4CP1A 1QQP1 4TLGA 2DUPA 1UYPA 1XNDA 1UOBA 4KGGA 3O1MA 2CGNA 4I3GA 1PK6A 2WZEA 3D0SA 2V5YA 1STMA 1OQEA 3VL9A 3ES4A 1H30A 3CZJA 5C4WB 2PHWA 2YYOA 3HT1A 3KF5A 3IPVA 1W8TA 2P3KA 2X10A 1E5HA 3UESA 4CUCA 1VBC3 5J3UA 4ZPIA 5LY2A 1LNSA 4GALA 4RFRB 5A32B 1NAEA 5DPNA 3K51A 4JGZA 2ZHLA 2JB4A 1YHFA 5I0SA 3WX5A 1ND2A 4HN0A 4K21A 5A33B 1QJX2 4JKMA 5APAA 1E5SA 2HWD2 1OMIA 2OZJA 1CPNA 3PJQA 1LU1A 3B3QE 2VNGA 3SHRA 5LCWL 1HKDA 1S1AA 1W2NA 2FCTA 4DXZA 2RS52 2GNBA 5C3RA 1GMMA 4PBOA 1FPN2 1LOFC 5FZBA 4OUSA 4LKDA 3WP4A 3W21A 2VD7A 3VBOA 1DIWA 3VBSA 1APNA 2OT7A 3IN9A 1JOPA 3PVNA 3HEIA 2HBTA 5DZEA 2XVGA 3GBGA 5LBFA 3WNXA 3ES1A 4DEVA 4BQXA 1W2UA 3O0WA 1IS4A 4RA0A 2WLQA 4Q0PA 4RD7A 1UOJA 2WBKA 2QQKA 3ZFFC 1NE6A 1XYPA 5KWRA 3N9NA 4ZZ8A 1D0HA 4DRRA 5FUNA 4XABA 4UW5A 3KVBA 3I3DA 4GMP0 5ANNA 3NNLA 3U10A 1L7QA 2UWCA 5KR7A 1S0CA 3JQWA 4ES9A 2ZHKA 1GP6A 5CVRA 4AWDA 2OZ6A 1QKQA 3JXSA 5C9AC 2WNUC 2WN3A 3NNMA 1WLWA 4LITA 5HCHA 2B7YA 4LKFA 1D2QA 3QH6A 1ULOA 2F4LA 2WT0A 1COV2 1ULDA 3ACLA 4LQRA 3AK0A 3LA2A 4PF1A 5A7PA 1EP0A 1OD5A 4QX5A 3S7EA 4F8AA 4GB31 4GWJA 3AYAA 3DEMA 4Q4W3 2B46X 4AVAA 1OLQA 1PK6C 2GH8A 5FZ1A 4YZ1A 3SEEA 3MYXA 3DL3A 5G04L 1D2SA 1JYWA 4GJYA 4PJYA 4AEDB 3SH4A 2HEVF 1KFXL 3NV4A 4R4XA 4YZ4A 4YVWA 4IXLA 3VBFC 2CWMA 2BVBA 4L97A 4YNIA 4A4AA 1H8TA 1GFF2 3DKQA 3ZFGA 4GH4B 1H8TC 4JGZC 1RGSA 2R7EB 2W46A 5KXBA 1HN0A 3AXDA 4LJHA 4M0HA 1NG0A 3OBZA 5E88A 1OH4A 3OGVA 4DMIA 1W6PB 5IFPA 4H14A 3AM2A 1DGRA 3DV8A 5T55A 3LDKA 1H1IA 4Y5SA 5FYSA 3ZYFA 1LOAA 3AMHA 2X53S 3I2IA 4ZS2A 1H1MA 2G9GA 5A1LA 4L9BA 4IE4A 5LW9A 1AR83 5FXWA 2EAKA 3ZFFB 5HCAA 2PHDA 4WVMB 2FZ1A 3B5LB 2VPVA 1BK1A 5F39A 5A33A 4IEXA 4FOWA 5IVEA 4NROA 4LE4A 2YC4A 5BNOC 4NHLA 1UYYA 4AFCA 2PHUA 1WW5A 2R043 3C2UA 4META 5DUUA 1O59A 4M4PA 5E6HA 4CDUC 4IGQA 3VBOB 3CKHA 4MZUA 4O61A 4GKXA 4QQHA 4RN5A 1XSQA 1RUI1 1GZCA 4HBNA 1US2A 2PQQA 3TEWA 3MO4A 1CZSA 3MIBA 3H50A 4I01A 4X8NA 1UIKA 1R081 4MGQA 5KHHA 3ZXKA 1UKGA 1GBGA 1HV0A 2CWSA 2BWCA 3OBTA 1PMIA 3I3QA 1PMJX 3WF2A 2PTMA 5EJZB 3VHPA 3AP6A 1CWPA 3U4XA 4Q2FA 2VZ1A 2ZHMA 3VKLA 3DPRA 4AHZA 2XXZA 3M3EA 5IYYA 2DYCA 4PLMA 5B4XA 3Q8CA 1FOD1 5FYVA 2VZSA 2HWB1 1NE4A 3N7MA 1N1TA 3VD5A 4CPBA 1NYWA 5JUVA 1BEV2 2GC0A 4KL1A 5LA2A 5JR2A 2GP5A 4MO3M 5DXDA 1YEWA 4FO9A 4H7MA 4UOJA 2ARAA 1KJLA 2ZKNA 2AGSA 4E4ZA 5A3LA 2HKXA 3IDEA 1YC61 3VBRA 1EUUA 4OCTA 1GWMA 3FBYA 4ZU7A 1W3VA 2QCSB 2X5IA 3AKTA 2VXRA 1LCLA 3POSA 3RWKX 3ZIWA 5BNPB 4M3CB 3KS7A 4LLFA 5LK5A 2GAUA 2HWC1 2YBSA 4BOWA 1JZ5A 3ZYGA 1MVEA 4D3WA 2HWD3 3GALA 2VW1A 3H7JA 1HW5A 1V6NA 4JDNA 2YU1A 4XUNA 1A6CA 1HRI3 3K3NA 3CEWA 2XVKA 1O4ZA 3B02A 2ZX0A 4Z2WA 1O3TA 1L3JA 5IHRA 2XQRA 3ZSMA 4CCEA 1CZVA 4GWMA 2WN2A 1ZBE3 2XJPA 3NNGA 3OGGA 4IV1A 2QZ3A 3MDPA 1V6LA 2V73A 3RMYA 4Q4Y3 5FYBA 1J59A 4XJ8A 4YM3A 3CJIC 5F3IA 2XKPA 5I0UA 4L0PA 4QKDA 5F9TA 1V0AA 1P8JA 3I2JA 4AK3A 4EYUA 2BU9A 4IESA 3HN1A 4PBPA 1QXPA 2RS11 4F3JA 2RS31 5FKCA 4AR2A 3KV6A 2JD4A 2EIDA 2C6SA 1O6UA 3KV4A 3HPNA 5FBJA 4LUMA 1VPHA 1XB9A 2BBVA 3TEXA 2VM9A 1VRH3 5GZEA 3S6PA 2X29A 3OPTA 5SV5A 3M3QA 3FFZA 4JX0A 4P9GA 4MX3A 1UOGA 2VUJA 3K2OA 1PX3A 2FHRA 2HWF1 5FQ0B 3ZO0B 1GQGA 2FMDA 1UCXA 3ILRA 3OJBA 3OGRA 3S5QA 4FSJA 1S0FA 1LHNA 3V0BA 3MUZ1 1DP0A 2WA3A 3DYPA 1GU3A 3FZ3A 3LA3A 4XBLA 5C5UA 1XU1A 4WM8B 4K7JA 2JEMA 4GQ7A 2WWUA 1DGWX 5DG2A 2IC1A 1JZ2A 1H4GA 2DFCA 4NIDA 1UMZA 5FJHA 4NMIA 4LBKA 5K8SA 3WP6A 5FZLA 3OY8B 3ZYJB 3FN9A 3UNPA 2PAEA 1IKPA 5A7WA 1Q3EA 2WZR2 5BNNA 4OUMA 3ZYHA 2CL2A 3WSOA 1BYHA 1GUIA 1QMJA 3AX4A 3WW1A 2H6CA 3CL1A 5DN2A 2QFEA 2D6LX 4BQ2A 1SLTA 1YJKA 1RUE3 5FOJB 2QNKA 1ENSA 1WUVA 4JC1A 1WMXA 2VNOA 5JOXA 2QQMA 3NMBA 2D40A 5AFEA 2R062 5C4WC 3FUQA 4LT5A 5A3MA 1O91A 5BV6A 4Q5OA 3K4ZA 1SBFA 3WNKA 2A75A 1W39A 2WS93 3B9CA 4YFZA 2QUOA 1NA1A 1FMD3 5FY1A 4LR4A 4QT6A 2VOVA 5BPXA 5EZWA 1ND2C 1VMFA 3BOPA 3URFA 1JH5A 1HB1A 4QKBA 5C33A 3RZLA 2VVEA 2Y6HA 3LWCA 1SDDB 1M06G 3VZLA 5IVBA 1AL22 3AVRA 1EY2A 5FY8A 4LTAA 5DABA 3RI8A 1TMF3 2BDRA 3AZYA 2VG9A 3POIA 1N1SA 2ZGUA 1MZEA 3PUHA 4HLTA 5A70A 5T5JA 1VMHA 4ASLA 1H1AA 1X8MA 1YQ2A 3KWVA 1F5JA 1H4HA 4EWDA 2Q8DA 4EN7B 1AX2A 5ABJA 2ZZQA 2WZR1 4LO7A 2WFF3 2WA4A 5HXVA 2TNFA 2D3PA 2GU9A 3ZR6A 2J1AA 3GM8A 3ETPA 1OOPA 2NP0A 1FX5A 1NT0A 1AYM2 1OD3A 3ZIXA 4OQ8A 2VQAA 4PIZA 4WM7C 5A3WA 5I93A 2VMEA 3B69A 3M8LA 2GH2A 4XEZA 1BVVA 1JMUB 2P5BA 3WNLA 4OHYA 3CLPA 1FAYA 4N43B 3CNAA 3PU8A 4A7ZA 1W0PA 2ZAHA 3MW3A 2QQOA 4UBGA 1VBE1 3EB7A 3VDDA 4ATEA 5ACA2 5I8TA 4D94A 1GYKA 1QDCA 4PI2A 3H8XA 1DGLA 1A34A 2YFZA 4CU6A 3OYWA 4LA3A 3J8F3 3LB9A 4QXCA 3IKWA 3WNMA 1GZTA 1GP5A 3BYWA 1RHI2 3BIWE 5FYIA 3OBRA 3BTZA 1PGSA 3QCWA 1Q43A 2XLAA 5FLIA 5FZMA 4WM8A 1ODNA 3POFA 2EXKA 3OF1A 1ENRA 5JXJA 2JG9B 1J83A 4YM2A 4EN6B 1J1LA 2WKKA 5FMCA 2VTXA 1YXWA 5GZDA 4J1XA 5JXIA 1J3QA 1W6MA 1BHGA 1N3QA 2ES3A 1CN1A 3OGJA 1POQA 3KCYA 4WVVA 4B29A 3TN93 3WG2A 3P3PA 3CO2A 3HNYM 4HETA 2BYVE 3RJRA 4EN0A 3JQXA 4E4SA 2HWC2 1RMU3 4G9SB 5JOZA 1XNBA 4MXWB 3JB4C 3U07A 3VHOA 5J98B 4AVVA 4LBQA 2W68A 2BOIA 3HBKA 2QDRA 2VMHA 4DXTA 1LULA 3VZMA 1QF3A 4QX7A 4P5YA 2Q0AA 3W58A 3CJIB 2FD8A 1MPXA 2N7GA 2DFBA 1BEV3 5I91A 3AP9A 4KI5M 2AACA 1G6NA 2Z4FA 4R9CA 2C24A 2Y38A 4UF0B 1GQHA 1MQTB 5EYXA 1NX9A 1W8HA 2ETEA 1LJ7A 3ZDSA 4AOCA 5J48A 4ISRA 4CU8A 1B09A 1AXZA 1UYZA 4E8CA 2DU0A 1IOAA 4PT6A 3VBHA 5C8CB 1SZBA 4SBVA 3H3ZA 5L7OA 5IAXA 2MHFA 4AF9A 4PLNA 4M00A 1XBFA 2HH9A 1AR72 2RDSA 3N9MA 3WEZA 3T0DA 4XDPA 4FOYA 1PM7A 1WW4A 1HJGA 3WG4A 5A7WB 4EN9B 1RXFA 4P5HA 3FC0A 4A3ZA 1JYXA 1A8MA 2OXBA 3VZKA 4BIFA 5BNPA 1HRI2 2P3IA 4O9EA 3ZLIA 4RHV3 4XILA 5KHKA 2DTWA 3T09A 2ZS6B 5EJ1B 2UU8A 4AI8A 3HJRA 4BH9A 2QQJA 2V5DA 2D6MA 3POYA 2VZRA 2E31A 2W87A 3WHTA 2J42A 1O8PA 3R4UA 3IDBB 1WLDA 2VU9A 2ZGPA 5D2AA 3THPA 2Y6LA 4UFIA 1LEDA 1NCRC 1ZRIA 4QHZA 1DYKA 3J7MA 1TQ5A 3L9JT 4LHKA 5FZIA 3CJIA 4A2UA 5DAXA 1NA1C 3VBFA 3WQ0A 4A44A 2DVBA 1WW6A 1UAIA 2ZOEB 4PDWB 4S2FA 5DZGA 2IVIB 2QQVA 1ZA4A 3PVEA 5JIAA 5FMBA 1UU4A 1FI2A 4S2HA 5JI7A 1CR7A 3T1LA 3VB9A 4FTSA 2IXHA 2TUNA 2WO2A 5FPBA 4YW3A 3C7HA 3JD72 1YUDA 5FUPA 4AHXA 5T5OA 1UN1A 3HNMA 5E16A 1QJEA 3J9SA 4YRDA 5T5PA 3ZM8A 2DVGA 1RHI1 1H6YA 3SC7X 4OUEA 5L7OB 5FZ7A 1NZIA 1V6IA 5EQUA 2Q30A 4BQWA 5E8AA 3PTYA 2JWPA 2EIBA 4B1MA 2CTVA 1UX6A 1LGCA 4RS5B 1TMF1 1WCDJ 5FY0A 2AZ5A 3WF4A 2SBAA 5CFDA 3KF3A 4CCDA 4ISQA 1OOPC 1HQLA 1K12A 1HQWA 3CDZB 3LOIA 2RR13 3RG0A 1SFYA 5AFBA 1WWYA 1W8OA 4AI0A 4I2OA 2CNAA 3IBMA 1HJFA 1G86A 4W4ZA 2PAMA 5DUXA 4COZA 4C8DA 1RUE1 2VW2A 4AE2A 1AYM3 1G8WA 2XDVA 4XBQA 4XJZA 3N4MA 2RHPA 1X36A 2DCZA 4GB33 1F2NA 1O4YA 1KD7A 3DXTA 3OY8A 4QAWA 5LB6A 4XHBA 1V6MA 2GMPA 2NZ9A 3Q9OA 5BNPC 5K0UC 3NJYA 1ASJ1 5CYYA 3WNPA 5CFCA 1BBT3 1K5MA 1UO9A 4UFLA 4YGCA 2QBXA 5DQ0A 1LR5A 2JG8B 3ZYBA 1S0DA 2BP6A 4HSJA 4LBLA 1YI9A 4N43C 4OMDA 2V09A 4CCJA 1NLQA 2JDKA 2R041 3THTA 2A70A 5C8CA 4XUPA 5HCFA 3AZVA 1KGYA 1O7FA 2XL7A 4QQOA 3HWJA 1M4WA 3A0KA 4I02A 1G9CA 3E6DA 1W6MB 2IXIA 2Z42A 4QDQA 1ZZBA 3CF6E 3VKFC 2UURA 3PUQA 1FT9A 4Q4W1 5D8AC 4BPZA 5A3TA 5JAXA 3PVBB 1QHDA 5FFOC 4V2VA 1DQ6A 4Y1UA 4BQ5A 2ADEA 4RR3A 4BMEA 4N53C 1FOD2 2VUCA 3LEKA 1D4VB 3AFKA 3PTRB 2ZBJA 1GOHA 1TG7A 2LUWA 4NO4A 2R49A 1V6JA 2UWAA 2WWSA 1MEC3 2B4KA 1AR71 4OI4A 3SCHA 1YQ8A 4KMQA 3GHNA 1LODA 4GWIA 4OULA 4UWDA 4Z2AA 2RS33 3VDAA 1W2AX 2WS92 5I8YA 4LUKA 2D44A 1ZVFA 5FO7B 4BZ4A 3G7DA 1LKNA 1UU6A 5FPLA 3POJA 5FK8A 1UY3A 2YY1A 4WZFA 1O8SA 5FZDA 4DOUA 1C1LA 3H3UA 5JSPA 2D6PA 2H6BA 1REEA 2ORZA 3EYPA 4SLIA 4XOGA 1FV2A 2IXCA 1YI7A 3FLTA 4IERA 4AEMA 5LRSA 1GNHA 4TZDA 3WY6A 2W1WA 4CCLA 4XIKA 4YW7A 1YQ6A 1TME1 1FNYA 5IK4A 2I2SA 4Y22A 2JE8A 4B8EA 4H55A 3DN7A 3S57A 4K1YA 4QB6A 1WCQA 5HXMA 2W52A 4AG4A 1X33A 3O0XA 3T3YA 1UY0A 2ID4A 3OYWB 3BVCA 4JQRA 4CP9B 5FBZA 1JI6A 1Y7BA 3KM5A 4AGRA 3U14A 3O1VA 1MR5A 1VBA1 4ARYA 1S55A 1XNCA 1BZWA 1VBC1 3ACIA 4XFAA 4YW5A 4Y4RA 1HRV1 1Y4WA 5FAXA 4XTPA 4E2GA 1LB2A 1CZTA 1D4M1 1RMU1 2DBNA 3WG3A 2HWB2 4HKWA 5FZFA 4XURA 5FXVA 1EYBA 2Y0IA 5D8AB 1JYVA 4AI1A 2J1EA 1H6XA 2BPA2 1SFPA 2R1BA 3AKRA 4P14A 4PCRA 2DBIA 1YFYA 3O1UA 5BXXA 1MVQA 3N7JA 3T0BA 4E4HA 4ZHNA 4NR1A 2ENRA 2AR6A 2LALA 2R071 3C7OA 4HL0A 4YGEA 3RYPA 4BK5A 3GJBA 5BYNA 1WLTA 4NHKA 3BTYA 1OFNA 2MNGA 4XZUG 3J8F2 3KHCA 5FYYA 1S2EA 1LOEA 3WOGA 4JDOA 2FQPA 3H1MA 2K2SA 1V9U1 2X5IB 3B00A 3N9LA 3OCPA 4JQTA 4ZXKA 4NIIA 3O7OA 4CDWC 1W90A 5FP3A 1AYN3 1POV0 1GZWB 2XB6C 5A3OA 1OVPA 2VNVA 4N8MA 2UYBA 3K75B 1MS3A 1V6OA 3MW2A 2PXJA 5CFDC 4RR3B 4EROA 3DKWA 1MS4A 1S0BA 3MV01 4IEWA 3WQ1A 3E6BA 1YIFA 2Q8CA 1DU3D 4IV1C 3IMNA 1PGW2 3RNSA 1RUJ2 1UU5A 2FDFA 5A1AA 4NHMA 1KDMA 4O65A 5F1RA 2E51A 2G1MA 2YPDA 2Z79A 2HWE2 1X7NA 4WVZA 5JPNB 1UF2C 4AHYA 1GNYA 3NJZA 1REDA 3LD8A 3ZMOA 1PO12 3IAPA 4FPEA 4QGNA 1LTEA 3FLRA 4QPGC 4MSVA 3WXPA 3OG2A 3SLIA 2I74A 1DFQA 1RYYA 2F6BA 1V70A 2NN8A 3LZZA 4I30A 5C70A 4UFKA 5JSOA 4NIAA 2QVSB 3VD9A 3IB3A 2ZCWA 2HLEA 4LK7A 4DNYA 2C5DA 1LENA 4YVWB 2AEYA 3ZX7A 1DQ1A 2XJTA 1QOSA 2ZMNA 1CONA 4QU2A 4IEQA 5FK7A 4ASMB 4C1WA 4M3CE 4QX0A 3UL2A 3UYJA 3CJXA 3LKJA 4IETA 4RQPA 1RUC3 3MIDA 3SCGA 1BK0A 1SLIA 2FCUA 1YLLA 2XJUA 1AR73 2VJXA 4IEYA 1HRV3 3USSA 3E97A 1UWWA 2AREA 2WFF2 4A7KA 4DUVA 3ENRA 4EE2A 2PQSA 5T3NA 4Q8LA 2W2IA 1K5JA 4XF1A 1QIQA 5A80A 1J3PA 5A7NA 3M3IA 2PHRA 3ZN5A 2ZPXA 3UKVA 1G9FA 4CXXA 1PZ9A 1ULEA 5F5IA 4DO0A 4NRMA 4XJAA 3AKPA 3N3HA 3AXEA 2NMNA 5FYHA 2CV6A 4CEYB 1T6BX 3VBUC 2WO1A 3GHMA 5KHJA 4XIOA 1JYNA 5DAPA 1VBB1 3M7AA 2QJVA 4LHSA 4MHUA 1KDKA 5KXDA 3WNNA 4PIYA 4V2WA 1PGL1 3RZKA 1BXHA 1ULGA 2YDEA 1C8M1 1QH6A 1MZ5A 4QHOA 3I54A 4UXAA 2RS32 4AFAA 3AVSA 1ACCA 5C7GA 3BUCA 3EO6A 1MQTA 2RM22 4URAA 5CADA 3ORJA 1HLCA 1KITA 2IFRA 1J3RA 2WABA 2W91A 3K48A 2GMMA 2XHKA 3B94A 1CAXB 2WIIB 3GF6A 1KS4A 3MV11 5K0UA 4CP9A 3A22A 2YBPA 3T30A 3BGAA 1LOGA 2HWF3 5CFCB 1IS6A 1WD4A 3AC0A 1IHMA 4LO6B 4NOTA 4X8PA 1K5MC 5TSWA 3I3MA 3THCA 1RUNA 2FDKA 1VBD2 2VXJA 1PO21 2DF7A 1PVXA 4IEUA 2RVAA 3N9OA 5IK7A 2RDRA 2RR11 2YC0A 4A6OA 2XG3A 1T2XA 2D6NA 3I3EA 2XWBB 4FOVA 2E7TA 2TEPA 5F2SA 1VBA3 4GB32 3TAYA 1AYM1 5FMOL 4AI2A 4XFHA 1OPOA 3O1PA 1UZ0A 1OLME 1YFWA 5FXXA 3ZFGC 4YW1A 3NQHA 3SKJE 2PYTA 1DYOA 1C1FA 1OUXA 3CBNA 1U0AA 1LOBA 2W94A 3P3NA 3PMSA 1G7YA 3PVOA 5F37A 1ZBA2 1W8NA 2VOTA 1WMEA 2JDYA 2X5IC 4IEZA 4NAOA 5DAQA 2A3XA 4XW3A 1UD1A 2Y26A 2P6HA 3MIEA 2WC2A 5EV7A 1CJPA 5IK8A 1IPSA 1ODMA 4H2AA 2C26A 3HNBM 5IW0A 4Y1VA 4QGLA 2A71A 5C9AB 2LROA 1H8TB 4HG6B 5GLTA 3S7IA 4YVSA 1VJ2A 1I9RA 4BQ3A 1NKGA 4DS0A 4CRQA 3AMMA 3T2QA 2RMU2 1JZ7A 1PIV3 4GKYA 1YFUA 4OYUA 3KT1A 1JTZX 1LECA 3DUIA 2ZXQA 4IV1B 2XONA 4XQDA 4YFWA 5ANQA 2EIGA 2ARCA 3UJOA 5C4WA 2ARXA 5FY5A 4I09A 4DUXA 3NJVA 3QACA 1GANA 2W39A 3POEA 2CDPA 2XPJA 2JG9A 4HN1A 3TEZA 4QGMA
chains in the Genus database with same CATH topology
1DCSA 1RXFA 1W2AX 5C3OA 5C3SA 4XAEA 1ODNA 1W3XA 1W05A 1HJFA 1RXGA 1OC1A 1W2OA 4RGKA 1W28A 2WO7A 1IPSA 1ODMA 1BK0A 1HB1A 1E5HA 1OBNA 1QJEA 2VE1A 1E5IA 1BLZA 1UOGA 2BJSA 2VCMA 2VBPA 1UZWA 3ON7A 3OOXA 2JB4A 2Y60A 2DBNA 2IVIB 1W06A 3ZKUA 1E5RA 5C3PA 1UOFA 5APAA 3ZKYA 1E5SA 1W3VA 1WA6X 2VBDA 2BRTA 1W9YA 2BU9A 4BB3A 1HB3A 1UO9A 1QIQA 2Y6FA 3ZOIA 1HB2A 1GP6A 1QJFA 1W03A 1GP4A 1GP5A 1W2NA 2IVJA 2DBIA 2VBBA 5C3RA 1HB4A 1UNBA 1UOBA 1W04A 2JB8A 2CSGA 5C3QA 2VAUA 1HJGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DCS A;  1RXF A;  1W2A X;  5C3O A;  5C3S A;  4XAE A;  1ODN A;  1W3X A;  1W05 A;  1HJF A;  1RXG A;  1OC1 A;  1W2O A;  4RGK A;  1W28 A;  2WO7 A;  1IPS A;  1ODM A;  1BK0 A;  1HB1 A;  1E5H A;  1OBN A;  1QJE A;  2VE1 A;  1E5I A;  1BLZ A;  1UOG A;  2BJS A;  2VCM A;  2VBP A;  1UZW A;  3ON7 A;  3OOX A;  2JB4 A;  2Y60 A;  2DBN A;  2IVI B;  1W06 A;  3ZKU A;  1E5R A;  5C3P A;  1UOF A;  5APA A;  3ZKY A;  1E5S A;  1W3V A;  1WA6 X;  2VBD A;  2BRT A;  1W9Y A;  2BU9 A;  4BB3 A;  1HB3 A;  1UO9 A;  1QIQ A;  2Y6F A;  3ZOI A;  1HB2 A;  1GP6 A;  1QJF A;  1W03 A;  1GP4 A;  1GP5 A;  1W2N A;  2IVJ A;  2DBI A;  2VBB A;  5C3R A;  1HB4 A;  1UNB A;  1UOB A;  1W04 A;  2JB8 A;  2CSG A;  5C3Q A;  2VAU A;  1HJG A; 
#chains in the Genus database with same CATH topology
 2W0X A;  1UXZ A;  2VQT A;  3WNO A;  1C8N A;  2BGC A;  3IMM A;  5FP7 A;  5ABJ B;  1W6Q B;  4JVA A;  4B7K A;  4IEP A;  1T6G C;  1AR6 1;  4NN0 A;  1DHK B;  1JYI A;  4RS5 C;  3I2H A;  2IXL A;  4PF5 A;  5IAV A;  1UPI A;  4OMC A;  2F4P A;  4Q4X 3;  5FJK A;  4B4P A;  3I7D A;  3J7L A;  4AEK A;  2ZZJ A;  3D4K A;  4ET7 A;  2CGP A;  3G6J B;  2XUM A;  1IS5 A;  3ROU A;  1Q8Q A;  3NJX A;  3NWK A;  5H9R A;  2XH6 A;  4E4D X;  4WVW A;  4P00 B;  4U36 A;  2JKB A;  2YZ4 A;  3DYO A;  1IQD C;  5A7O A;  3SIT A;  3ZSK A;  1XXN A;  1SCR A;  1XQN A;  2IVJ A;  3IZO A;  1GP4 A;  4S2G A;  1W0N A;  4YWA A;  3NV2 A;  3Q8A A;  4E9K A;  4FTE A;  2Q1Z B;  1EPZ A;  1SG3 A;  1HB4 A;  2WL1 A;  4FQ4 A;  4TYS A;  1FPN 3;  3TB0 A;  5KBF A;  2W08 A;  1CX1 A;  3M70 A;  4BE3 A;  3O1O A;  1UMH A;  3DF0 A;  1YIP A;  3H0O A;  3T08 A;  2VZ3 A;  3KD4 A;  2D5F A;  1AYN 2;  4L11 A;  3SNM A;  2OPW A;  3IDA A;  1QY4 A;  4AGG A;  1DZR A;  2VUL A;  4OI2 A;  2VMC A;  3GJA A;  4EJR A;  1NQJ A;  4IL7 A;  2RE9 A;  1CGP A;  5IVY A;  4OI0 A;  5LRR A;  5GZF A;  3I59 A;  2IXK A;  3TBD A;  2VL4 A;  3RMX A;  2WWJ A;  2YRO A;  3FMG A;  1Z7S 2;  1EAH 1;  4Q4Y 2;  2IFW A;  1ZM1 A;  1DCS A;  1YQC A;  4E27 A;  1SBE A;  3MPB A;  2PAK A;  1LOC A;  2JIG A;  2IXJ A;  4N7I A;  5CA6 A;  2XL9 A;  3TN9 1;  1ZZC A;  2UY8 A;  5J7M A;  1O3Q A;  3PUS A;  1RUF 1;  1EV1 1;  2VCA A;  4XC9 A;  1DQ4 A;  3LIG A;  2ZHN A;  3OOX A;  1RB8 G;  1YFX A;  1POV 1;  2WAO A;  4W6X A;  2KA3 A;  2OQ6 A;  2KXL A;  2OPK A;  1F9K A;  5FZA A;  1QGL A;  2WYF A;  5L36 A;  4MH0 E;  1AX1 A;  3KQ4 B;  1G9A A;  3VD4 A;  5JZG B;  4AHW A;  2VVD A;  2H0V A;  3PUI A;  1H0B A;  4QPG B;  1W6O A;  4D6R A;  3VUO A;  4FOQ A;  4CXY A;  1UXX X;  1AR6 3;  1RVF 1;  3HR9 A;  3OGS A;  4LBQ D;  1AZD A;  3R0R A;  4TN7 A;  2ZEX A;  5LBC A;  1I3H A;  1RUJ 3;  2XVL A;  3KHB A;  4YAR A;  3FFQ A;  4XQ4 A;  3ZXA C;  1RUG 3;  3NKG A;  3ZMN A;  4BXF A;  1QJY 2;  2D93 A;  2JDN A;  1W6Q A;  3RFR A;  2C4X A;  3UJQ A;  4M0N A;  1XU2 A;  4RQP B;  3VD7 A;  1W6N B;  3RQ0 A;  5LZ6 A;  4D8M A;  5K9Y A;  3S5A A;  1DQ5 A;  4WM7 B;  2WYS A;  2VEC A;  1LGB A;  5LEK A;  3VKN A;  4LBJ A;  3DXU A;  3TNP B;  1PK6 B;  4BQY A;  5BUV A;  2Y6F A;  3AZW A;  2PA7 A;  3GZE A;  4YGB A;  2R0F A;  3ATG A;  4I0W B;  5CG8 A;  3WP3 A;  1C28 A;  5HV0 A;  4LBM A;  3K77 A;  1KQR A;  4JHZ A;  4UF0 A;  2YMZ A;  3ZN6 A;  4AAP A;  4DIN B;  2Q4S A;  4CDW B;  1CAU B;  4FP3 A;  4L99 A;  3E1F 1;  1MS0 A;  2F17 A;  2OUJ A;  4YM0 A;  2EAA A;  1GQP A;  4XET A;  5DUW A;  1FMD 1;  2R04 2;  5DDJ 2;  2KR2 A;  4Y20 A;  4YZ3 A;  1UX7 A;  2E26 A;  3ZYI B;  1U5Z A;  1OVS A;  1UPS A;  1H2L A;  2ZML A;  5JOW A;  3SMH A;  4BA6 A;  2BFU S;  3RI9 A;  1W06 A;  2J1T A;  4YZ5 A;  1DZQ A;  3ZYP A;  1RUD 3;  5LA1 A;  2YU2 A;  4S2D A;  1OF3 A;  4FPH A;  4E2S A;  5FUI A;  1PHM A;  3U78 A;  3NRU A;  3VHR A;  4EN8 B;  3S0M A;  4AVC A;  1IQA A;  1SLA A;  3DYM A;  2BWA A;  5FP4 A;  3Q8B A;  2RJL A;  1H2M A;  4UW6 A;  3U4S A;  2CU5 A;  1C5I A;  3N7K A;  2VUA A;  3NAP B;  5I0T A;  4K3U A;  4DQA A;  2EVX A;  4LBQ B;  2Y64 A;  1AHS A;  4Q29 A;  5JR7 B;  4L8Q A;  4J25 A;  3ON7 A;  4CZS A;  2BNM A;  3WR0 A;  4UI9 L;  2JDP A;  4DB5 A;  3WF0 A;  3W59 A;  3BU7 A;  1ZRD A;  1GOF A;  5A7Q A;  4NRQ A;  2JDU A;  5HCB A;  4LKE A;  1VB2 A;  4ES8 A;  3CZU A;  4QU1 A;  4Z92 B;  3WW2 A;  4GZ9 A;  2VOK A;  4QX1 A;  4CP0 A;  3QLQ A;  3JZV A;  2PN5 A;  3HVD A;  3VBU A;  1TE1 B;  3AP5 A;  5JXH A;  4MGS A;  1ZBA 3;  5DDJ 1;  5AC9 1;  2GZW A;  4JGY C;  1NLR A;  4CCK A;  5IVV A;  3T1M A;  1Q8P A;  3VBH B;  3LEI A;  3ZFF A;  3JBG 1;  1ENX A;  1O5U A;  3B7M A;  4RGG A;  3A23 A;  4G3Y C;  2JXA A;  1BBT 1;  5A1F A;  1TNF A;  1W2O A;  1QJX 1;  1NXD 1;  1JXN A;  4QD2 A;  3VN4 A;  3OTF A;  4HSL A;  3WW4 A;  1REF A;  2PLV 1;  4LLO A;  5FZ9 A;  3BPZ A;  4Q0Q A;  5LWB A;  3TWI A;  4CU7 A;  4Y1Z A;  2G9Z A;  3T2P A;  2G19 A;  1JUI A;  2EA7 A;  2ILM A;  1GV9 A;  5CFC C;  1W0O A;  5FZE A;  1OF4 A;  4MV2 A;  2WJS A;  4YGD A;  2BNN A;  4FP2 A;  4MXV A;  2X05 A;  2VW0 A;  4QM9 A;  3VZN A;  1VLN A;  5LEJ A;  3EHK A;  3IAQ A;  2MPF A;  2OII A;  3KMH A;  2Q8E A;  4CA9 A;  4HOO A;  4XXA A;  3K4D A;  4EV0 A;  2BUK A;  4XAC A;  5DZF A;  2CSG A;  2JIJ A;  2J1V A;  2LTN A;  2GSY A;  2HEY F;  5CZK A;  1JU4 A;  3E5X A;  1N1Y A;  4RGK A;  1U12 A;  3VBF B;  4AED C;  4OHX A;  1RUG 2;  4H7L A;  4GAZ A;  2R16 A;  4P9W A;  3BAL A;  3VLB B;  4ZON A;  5C8W A;  1J84 A;  3LE0 A;  3I97 A;  3MFC A;  5IWF A;  1WMD A;  1GWL A;  4IV3 A;  3OUJ A;  1ZRR A;  4CDQ A;  1RJ7 A;  1VRH 1;  3F2Z A;  4CEY C;  3VBU B;  1XYN A;  1CPM A;  2C0Z A;  3J8F 1;  3ZXL A;  1UOF A;  1SAC A;  2VUD A;  2VZT A;  1WA6 X;  3OEB A;  3W5M A;  4LKS A;  4KBB A;  1OQ1 A;  2WS9 1;  5FZ4 A;  2BOJ A;  3WLU A;  1RUC 2;  2SLI A;  3BTA A;  4LBN A;  1X9T A;  2WAA A;  5D21 A;  1PVC 2;  5AC9 3;  2PHF A;  2WT2 A;  2R6Q A;  5DAW A;  4RL7 A;  1BMV 2;  3T2O A;  2VNR A;  4XBN A;  4ZY9 A;  4EWA A;  2WQ8 A;  2CGO A;  5K0U B;  3ZXD A;  2AUY A;  3ILF A;  2JJ6 A;  2FMY A;  3KGZ A;  1Z7S 1;  1YWK A;  4DXS A;  2J1U A;  1ZBE 2;  1OXC A;  2DTY A;  4GH4 C;  3GDB A;  4A6S A;  2AC1 A;  2O1Q A;  5K7P A;  1H9P A;  1GOG A;  2VQ0 A;  2HWD 1;  1KEX A;  5A6Y A;  1RIN A;  2ZAB A;  4FVV A;  1E57 A;  2O8Q A;  4HFS A;  2XQX A;  4M4R A;  5FTT C;  3EQE A;  3N9P A;  1UMI A;  3FLP A;  4Q26 A;  2WZP P;  2VR4 A;  4NAM A;  4D7S A;  2PHL A;  2EIC A;  1RUH 2;  1Y9Q A;  1QJZ A;  1QNY A;  5JI9 A;  1NOV A;  1XNT A;  2GC2 A;  3J7N A;  5IVC A;  4NWV A;  3RPQ A;  4DXR A;  1SBD A;  2CYF A;  4CDX C;  3UV9 A;  1Y9G A;  3HMY A;  4N53 B;  4CUG A;  4A42 A;  3WF3 A;  1CAV B;  3BN6 A;  2V4A A;  4YG3 A;  2QQI A;  5I0R A;  3KT7 A;  5HPO A;  1HIX A;  3AL5 A;  4IND A;  4CCO A;  5F5Q A;  1IKQ A;  2FCV A;  5E89 A;  3FX3 A;  4K9S A;  2BTV C;  1NCR A;  4F7Z A;  3TEY A;  4HPK B;  2XR4 A;  4WBB A;  3DPR C;  4YW6 A;  1JW6 A;  3MLL A;  4BXS V;  1RUD 2;  4GUL A;  2OUH A;  4D6Q A;  1RHI 3;  1HXS 3;  4K6B A;  3IM0 A;  4LO8 A;  5IVF A;  1CAW A;  2YFU A;  4JHT A;  2QQU A;  2WSU A;  4BMB A;  2J7M A;  5FY9 A;  1AR9 1;  4FFH A;  4AEJ A;  2ZX2 A;  4JDM A;  1Z0H A;  4B1L A;  1FYU A;  3KCX A;  1EUT A;  4QQ2 A;  2H0B A;  5F5A A;  4P02 B;  1EAH 3;  2YC2 A;  5T50 A;  3O1R A;  1JOD A;  2VH9 A;  4CVU A;  3INA A;  1AXK A;  1UY2 A;  4KG8 A;  3NW4 A;  2GNM A;  2VOW A;  4FI9 A;  4QPI A;  3III A;  5FY4 A;  3CHX A;  1R08 2;  1CQ9 A;  1KFU L;  5T52 A;  1CES A;  1IPK A;  4CUA A;  3BI3 A;  4XVH A;  1C4R A;  1EV1 3;  1OUR A;  3IPV B;  1COV 1;  3WVJ A;  4BK4 A;  1HV1 A;  2VTX J;  3MW4 A;  1NZC A;  1RUI 2;  4XPV A;  4CDU B;  5JWP A;  5LA9 A;  1PGW 1;  1W9F A;  1W9Y A;  1ZNP A;  2BW8 A;  5HV4 A;  1ZRF A;  5FMD A;  3VBR B;  4JV4 A;  2OKX A;  1ZA7 A;  3VDC A;  2E53 A;  2B9V A;  3KT4 A;  4XFF A;  1VBB 2;  2C9K A;  2YHJ A;  2QTW B;  4MGK E;  2VCB A;  1O5L A;  4I0B A;  1AR8 1;  4BU2 A;  4CUB A;  5IAT A;  1O4T A;  3SCF A;  1NUK A;  3GZA A;  2Y34 A;  2JD9 A;  1MZ6 A;  2C1F A;  1GZW A;  2HJI A;  2Z5W A;  4NUB A;  3FE5 A;  2Q1M A;  4FPC A;  1I1E A;  1OFS A;  4CYD A;  1BLZ A;  3VGI A;  1R1Z A;  1PVC 1;  3VBS B;  4Z07 A;  1URX A;  4UW3 A;  3ZDV A;  2JG8 C;  4QB2 A;  4ZU4 A;  5LAS A;  3NST A;  1HQN A;  1TME 3;  2BQP A;  4XFB A;  2Q5T A;  4XF9 A;  1AR6 2;  1JHN A;  5DAV A;  1JYT A;  1SPP B;  1UL9 A;  3WDW A;  4G4F A;  3NNJ A;  3SKV A;  3HOB A;  1PVC 3;  2ZMK A;  5AC9 2;  1X9P A;  1BMV 1;  1VMJ A;  3RYR A;  2JB8 A;  4AFB A;  4C1X A;  3MHZ A;  4H3W A;  2W1U A;  4KH9 A;  4COV A;  3B01 A;  5FPX A;  4EZH A;  3VHN A;  1PO2 3;  4ORF A;  3VKM A;  2FDI A;  2EAL A;  2K0G A;  5A32 A;  3APB A;  5GLZ A;  2DWR A;  3QOP A;  4LNV A;  3ITQ A;  4JKL A;  3AYC A;  5AVP A;  5LAT A;  3AKQ A;  2GN3 A;  4RR3 C;  4COW A;  4R4Z A;  1OOP B;  1UQX A;  1V00 A;  2R06 1;  4KWJ A;  4XF4 A;  4D7T A;  3BKZ A;  4URT A;  5LBB A;  5DMY A;  1ST8 A;  1JZ6 A;  1DLC A;  3H8U A;  5L9R A;  3WV6 A;  1JS9 A;  2D98 A;  4OZO A;  4Z82 A;  2BRT A;  4COU A;  1W8F A;  3AZX A;  1ZBA 1;  1OA2 A;  5DDJ 3;  1OA3 A;  1XJA A;  3VDD B;  3ZFE C;  1RUH 1;  1DBN A;  2ZKL A;  2Z69 A;  1S0E A;  3Q8F A;  5HI0 A;  4XYX A;  1WCU A;  3KSC A;  4FFF A;  4LE3 A;  4P9I A;  3PIG A;  5FYU A;  4BLI A;  2DCY A;  3ACH A;  4QM8 A;  2TBV A;  3K4A A;  3ZYR A;  2GN7 A;  3X29 B;  3AJY A;  2NQY A;  2VZV A;  4ONU A;  1SHW B;  1OI6 A;  1WMF A;  4CE8 A;  1AJO A;  1RL3 A;  4AI3 A;  4D6S A;  2P34 A;  1LGN A;  1X50 A;  1UZW A;  3FHA A;  2RV9 A;  4OHZ A;  4IGO A;  4ARX A;  2V4V A;  1ZRE A;  2LS6 A;  1DQ0 A;  3NV1 A;  1TZO A;  3TN9 2;  4KG0 A;  1ND3 B;  1HRI 1;  2A73 B;  4NE9 A;  2ZX1 A;  4NPM A;  2O8O A;  1HXS 2;  2PEL A;  1N3O A;  4AVS A;  5FYZ A;  5M0T A;  1NLS A;  1NY7 1;  2A1X A;  3AFG A;  2YGL A;  2RR1 2;  2JDZ A;  4JZR A;  4GIQ A;  1CJD A;  2HWB 3;  2OS2 A;  4PIX A;  2WNE A;  4Y5T A;  3LGR A;  1PM4 A;  1FAT A;  3U37 A;  4QKN A;  5C3S A;  3JB8 A;  3OPZ A;  3MIF A;  4NHY A;  4YYO A;  2XLF A;  3W20 A;  2DU1 A;  3PU3 A;  3RRD A;  1ZRC A;  1DGW A;  4UBH A;  4XUT A;  1YRZ A;  2XHN A;  5GAL A;  5CKM A;  3J26 N;  3PDQ A;  2VBP A;  4Y24 A;  5BNO B;  4ATF A;  4Q4W 2;  2ZTN A;  4FFG A;  4YVW C;  3ZXJ A;  4JAA A;  2B9U A;  3EXU A;  4UFM A;  5FRA A;  1AR8 2;  3A0N A;  1CVN A;  1WKY A;  2P3J A;  4KWK A;  1D4M 2;  4QX2 A;  4NJ4 A;  4R9B A;  4XE9 A;  5FDB A;  1AYN 1;  5FZ6 A;  3KV9 A;  5I8S A;  3NO8 A;  3V0A B;  2XBO 2;  4Q1R A;  4XCA A;  3TOJ A;  4QPI B;  2R0H A;  3KGL A;  3VDD C;  4FXK B;  3ZFE B;  5LY1 A;  5KC5 A;  1B35 C;  1JZ3 A;  4DPN A;  4L2N A;  1EAH 2;  4Q4Y 1;  3HBZ A;  1XRU A;  4FPJ A;  4ZU5 A;  1MS1 A;  2HWF 2;  3SXW A;  1PZ8 A;  2OA2 A;  2E33 A;  4FAH A;  2NM1 A;  5J96 B;  2PFW A;  1UIJ A;  2JX9 A;  3NKT A;  3PHM A;  2ADD A;  3N7L A;  4QXH A;  5FZK A;  2LW8 A;  1YJL A;  2IUW A;  3ABZ A;  3KZ4 C;  3VZO A;  3LCP A;  1OSG A;  2J1R A;  2PHX A;  1LHO A;  3LIH A;  4XHX A;  3WD5 A;  1MQT C;  2ZA9 A;  4AQS A;  1XNA A;  4LK6 A;  4Q8K A;  5KC6 A;  5ACA 1;  1SLB A;  1R09 1;  4HKO A;  5IJR A;  5C9A A;  2VTF A;  4R9D A;  3OB8 A;  4W6Y A;  5FZ8 A;  3K46 A;  1AR9 2;  1UYX A;  3WQ7 A;  4JCK A;  2VE1 A;  2D3R A;  2VMI A;  1ONA A;  2E7Q A;  4N9I A;  3OSD A;  2OQ7 A;  4CDX B;  1K5M B;  2D6K A;  5I0D A;  1AXY A;  5A7S A;  5JZG A;  1RIT A;  3WF1 A;  2YBK A;  3HAG A;  1GKB A;  1QOT A;  4FPO B;  1W8U A;  2ZX4 A;  1FOD 3;  3PUR A;  5CIR A;  3V0A A;  3I2O A;  3WP5 A;  3H9A A;  1PO1 1;  1A8D A;  3P5B A;  5ABJ C;  4LO4 B;  1HB2 A;  3OUH A;  4COY A;  4AGV A;  4PQQ A;  2VMF A;  4CP2 A;  4ZS3 A;  3AL6 A;  3L2H A;  4BCU A;  2WUH A;  1WBF A;  2ARB A;  5J09 A;  2VO5 A;  2X09 A;  3ZXF A;  2X8K A;  3MEP A;  1Q8V A;  1CAW B;  2NMO A;  4XFG A;  1Q5O A;  2EXJ A;  2R07 2;  4M01 A;  3WDX A;  1H2K A;  3UGG A;  3M4F A;  3MLJ A;  1MS5 A;  2P3Y A;  1AL2 1;  4MLO A;  5FPA A;  4B4Q A;  1NY7 2;  5F2W A;  3PJY A;  1JZ8 A;  1VRB A;  2WT1 A;  4GA9 A;  5J36 A;  2A3Y A;  2CY6 A;  4IQP A;  5CAZ A;  1BBT 2;  3MZH A;  2Y6K A;  2XLG A;  4OHV A;  4DRV A;  3M2M A;  2QQP A;  4YW4 A;  1U5I A;  1US3 A;  2YPJ A;  2WRA A;  4ZZ5 A;  4LIU A;  3ZN6 B;  1S0J A;  3JBG 3;  2QE3 A;  2ZGL A;  3BOW A;  4O9G A;  4IE5 A;  2D7F A;  1GSL A;  4W65 A;  1QJY 3;  1VP6 A;  1L7R A;  1RUF 2;  5IT6 A;  2DVA A;  2W95 A;  1R1A 2;  2MEV 3;  2PHT A;  3BOD A;  5FKB A;  2E9Q A;  1VAK A;  3WCR A;  4CCM A;  1I5P A;  5CBL A;  1OC1 A;  5DG1 A;  5H9P A;  2WO7 A;  4KNC A;  1ENQ A;  1Q8O A;  2B45 X;  1XC6 A;  3DPR B;  1SEF A;  4K8R B;  3DGT A;  2B42 B;  3ME2 A;  5F6L B;  2WNV C;  4HKL A;  1TVG A;  4V1P A;  1R08 3;  3K3O A;  2P1B A;  1QQP 3;  4QHB A;  3U1X A;  5DUV A;  2D5H A;  3O1S A;  1S2K A;  1W2T A;  4IEO A;  4D69 A;  5EP9 A;  4R52 A;  5FP8 A;  4FPF A;  5LA0 A;  1VBC 2;  4YSF A;  3LOB A;  1K42 A;  3IWZ A;  4XJW A;  3E6C C;  4TSV A;  1LHV A;  1VR3 A;  2WQZ C;  1G9B A;  3AZZ A;  2NPI A;  4QWN A;  3RVH A;  2A6W A;  1WLC A;  4HVO A;  1IZ3 A;  1UZZ A;  1OPM A;  3BPS A;  3J4U H;  4XUQ A;  1JOJ A;  4YG0 A;  4FPY A;  3ACG A;  4AI9 A;  4E8D A;  2Y8K A;  5BY5 A;  3LEG A;  3D82 A;  3A21 A;  4N7U A;  4AVB A;  5FO9 B;  4Q4V 2;  3MFA A;  2PMW B;  3SEP A;  3AYE A;  2P17 A;  5FZ3 A;  4LIV A;  3LSD A;  3IDC B;  4PDW C;  4OZX A;  4X6R B;  3ZXE A;  1L7L A;  4A3X A;  4J1W A;  2GNT A;  4NIG A;  3FUO A;  2EXH A;  4MGY E;  2E63 A;  4CXW A;  5G05 L;  3IT8 A;  5FLH A;  4N90 A;  4XF0 A;  2HEW F;  5L7O C;  4UT5 A;  1ZZ6 A;  2LRP A;  1XE0 A;  4HXC A;  4IE7 A;  3NNF A;  5FPU A;  1FMD 2;  4BIS A;  3F95 A;  1HXS 1;  5A3N A;  2DCT A;  4TWT A;  2RMU 3;  3GNE A;  3ECQ A;  4K20 A;  1D4M 3;  2W47 A;  4AVT A;  4CTE A;  2XJQ A;  2A6X A;  1W9W A;  4XUO A;  1J1T A;  1AL2 3;  2Z2S B;  2QQN A;  4IDZ A;  4L92 A;  1E5I A;  3ELN A;  3WUD A;  4GMP 3;  1NQD A;  1TMF 2;  1C57 A;  5KHI A;  5CG9 A;  2VZU A;  1GZ9 A;  3FHI B;  4WM8 C;  4HAN A;  1FV3 A;  4TLF A;  2J1S A;  4JRA A;  5FQ0 A;  1HB3 A;  1SQ4 A;  3OD0 A;  3FBM A;  4GMP 1;  4XMA A;  3D8C A;  4DUW A;  3MF9 A;  4Q0U A;  3V0B B;  5K4L A;  4A45 A;  1ZZ9 A;  2ATF A;  2XWJ B;  5D8A A;  3TNQ A;  5CKN A;  1QXJ A;  2BFU L;  4WVM A;  3LDB A;  3V56 A;  1PNF A;  5EJ3 A;  3LSE A;  5EXO A;  1VBD 1;  2DUO A;  3CMG A;  2VY0 A;  1U5Y A;  2CDO A;  1POV 3;  3R05 A;  1IPJ A;  1W9S A;  1TEI A;  4XMI A;  5FYM A;  1F5F A;  1RJ8 A;  1S2B A;  1QDO A;  1UZV A;  1XYO A;  1ULF A;  4QPI C;  4QPW A;  4RGA A;  2GND A;  4QQL A;  1SDW A;  4LOR A;  4KWU A;  1VBD 3;  5GLV A;  4HVQ A;  1WBL A;  4MOA A;  1D0G A;  2JEC A;  3B9I A;  1HN1 A;  1AR9 3;  3JBG 2;  4Q27 A;  3C7F A;  3D3A A;  5FYT A;  2QZ2 A;  3PLQ A;  3ZOI A;  3N9Q A;  3VBR C;  4LXL A;  4RSU A;  1F31 A;  1QU0 A;  2QQW A;  3ZSE A;  1KRI A;  5JXG A;  1W99 A;  3WHU A;  2ORX A;  1CIW A;  3GXU A;  3OEA A;  1R09 2;  4NWW A;  4Q4X 1;  4CPB D;  2GDF A;  4C0H A;  1TNR A;  2DV9 A;  1ASJ 3;  3MUY 1;  4UFH A;  3LFI A;  4FPG A;  1VIW B;  2DUR A;  3FHQ A;  4PHZ A;  1QJU 2;  3JU9 A;  4Y26 A;  2GC1 A;  1GIC A;  2HYX A;  2IWG B;  4WV8 A;  5ISL A;  2JEN A;  2WNU A;  5CB7 A;  4EWE A;  3LPF A;  5CKQ A;  2ZGS A;  1HDK A;  3I2F A;  3UGF A;  1NXM A;  1KS5 A;  4CDX A;  2Y0O A;  2ZGK A;  2P4E A;  2E7A A;  4O7X A;  2L9L A;  5T5L A;  2D3S A;  1BQP A;  4Q4V 1;  4XXP A;  3QBQ A;  3SIS A;  2JE7 A;  5GLU A;  1JU3 A;  5ACA 3;  5FOB B;  5L73 A;  1CD3 G;  3AKS A;  3U11 A;  5H9S A;  3LPG A;  1DDL A;  2QDN A;  5IVJ A;  4WZC A;  3CIH A;  1LES A;  1NA1 B;  4MAD A;  1OUS A;  4LHN A;  2KM2 A;  4UFJ A;  3AYD A;  4OVE A;  2MEV 2;  1R1A 3;  3WUC A;  4RS5 A;  1RUD 1;  1DZT A;  2JIC A;  1QWR A;  1RVF 3;  1E5R A;  4BM8 A;  4BWO A;  1A3K A;  1PO2 2;  2BBA A;  1HX6 A;  2NYY A;  4Y3O A;  5JCT A;  1JZ4 A;  4NPL A;  4IE0 A;  2BGP A;  1DGR N;  5JSR A;  3FL7 A;  5CEH A;  5L19 A;  1KJR A;  2WZR 3;  4KU8 A;  2W1S A;  2BVV A;  4CCC A;  1PZ7 A;  3ZN4 A;  5KXE A;  4IW3 A;  3WDV A;  4AFD A;  1RIR A;  3O5S A;  1DLL A;  2FDG A;  2B39 A;  5F32 A;  4E2Q A;  2WNV B;  1MS9 A;  5B2G B;  1WA4 A;  5CNA A;  2R07 3;  4FCA A;  3I4I A;  4IV3 B;  2VCC A;  3SH5 A;  4AXO A;  4CDQ B;  4Z1V A;  4K40 A;  1XPW A;  4BHP A;  3AMQ A;  2I45 A;  3BCW A;  3ALQ A;  2KD7 A;  1EPW A;  4R9A A;  3IIA A;  3GBW A;  2UY9 A;  3HQU A;  5F7U A;  3VBH C;  1OKO A;  4OHW A;  4DFS A;  2XGX A;  3I8T A;  3ILN A;  3GCW A;  5GJ6 A;  5EWS A;  3WW3 A;  5BNO A;  4ITC A;  5C5T A;  4B7E A;  3RZM A;  3O0V A;  4XCB A;  4NIH A;  4Q4V 3;  5JVV A;  1Y43 B;  3W9A A;  2JDM A;  4Q1P A;  5IFT A;  2VAU A;  3AP7 A;  1ZX5 A;  4D0Q A;  2EF6 A;  3ZSJ A;  4CEW A;  4CEW C;  4MXW A;  3MIG A;  5JZG C;  2WFF 1;  1W8Z A;  4OFG A;  5H9Q A;  4B3N A;  1SFN A;  5FPV A;  1JN2 P;  1I6X A;  1ZZ7 A;  3C3V A;  2BJS A;  1VAM A;  4LOT A;  5C8C C;  1C3H A;  1F8V A;  1QQP 2;  5FPZ A;  1KXG A;  3UKT A;  3UT0 A;  4DEQ A;  3PUA A;  3RJ2 X;  3ZPO A;  3KCC A;  4AYU A;  2B5H A;  3KV5 A;  2ZGN A;  3OD4 A;  1OQD A;  1SLC A;  1MAC A;  1S0I A;  1OLR A;  2WNV A;  4I0A A;  1H2N A;  3R4S A;  5FYC A;  5FZ0 A;  2WZ8 A;  3ZR5 A;  5JMO A;  3VKO A;  4R8H A;  3I49 A;  1QJU 1;  1ULP A;  2WLP A;  3SH3 A;  1N1V A;  2HWE 1;  4MGZ E;  4OLL A;  1RUF 3;  5LBE A;  3VZJ A;  3ZVX A;  1GNZ A;  2YXS A;  4AAX A;  1X8E A;  3O12 A;  2R32 A;  2B8M A;  3RZJ A;  1FPN 1;  3GCX A;  2WSV A;  5FZO B;  2O0O A;  2G4I A;  3LQC A;  5A3P A;  1H9W A;  3GBF A;  4TXW A;  5FMO S;  1F4A A;  3N36 A;  5BNN C;  5EHD A;  2DVF A;  4BDV B;  4GD4 A;  2VZQ A;  1F35 A;  2Q1F A;  2YV8 A;  4P9Y A;  4Y22 B;  3T4V A;  4BIO A;  1VBA 2;  2ET1 A;  2VMG A;  4P9X A;  5C3P A;  3ST7 A;  2ZEY A;  4N9H A;  4HK9 A;  4YVS C;  5LK7 B;  1VAV A;  1Q56 A;  4ZXE A;  4W8J A;  2C9A A;  3HN3 A;  3QD6 A;  4GJZ A;  5F3C A;  2HWC 3;  2RG4 A;  2R30 A;  2RS1 3;  1DG6 A;  1ZYB A;  3HT2 A;  3SQO A;  3P6B A;  4JKK A;  5FY7 A;  2OVU A;  1PNG A;  1XNK A;  3WG1 A;  1SMV A;  2G9F A;  3A4U A;  4D7Y A;  1BCX A;  4Y1Y A;  3WT3 A;  1Z78 A;  2W9X A;  4K8F A;  4AQ6 A;  3USU B;  4CDU A;  1JOB A;  2ERF A;  4AL9 A;  3D6E A;  1F15 A;  4IUG A;  1CAV A;  1DQ2 A;  3ZKU A;  1UZY A;  2AYH A;  2JG8 A;  1GR3 A;  4LO5 B;  4F83 A;  5A6Z A;  1V6K A;  2NLR A;  4QPG A;  4NHX A;  3WDT A;  1PIV 2;  4K1Z A;  4AFM A;  4AZZ A;  3WIN E;  2P37 A;  2ZX3 A;  4N43 A;  3KVA A;  4DY5 A;  1QJU 3;  5T54 A;  1AVB A;  1YO8 A;  4GWN A;  1C5H A;  4PQ9 A;  2WIN B;  4Y1X A;  4MGT A;  1VE0 A;  2DCJ A;  4MUV A;  3C8X A;  3ETQ A;  4Q0V A;  3ASI A;  4C90 A;  2YB7 A;  3ZFG B;  1RUI 3;  3JD7 3;  5CFD B;  3TYJ A;  3LEM A;  1W28 A;  3P1I A;  4MYE A;  2GP3 A;  4PDW A;  5FXZ A;  4FT8 A;  3PME A;  4YVS B;  2FZ2 A;  2XBO 1;  3LA7 A;  2WFP A;  2VCM A;  4QDS A;  2ZEZ A;  3POB A;  1RUG 1;  2VMD A;  2Q8O A;  3RYK A;  5JIU A;  2RDN A;  1RUJ 1;  2DCK A;  4QQP A;  1RVF 2;  4QXK A;  1W6O B;  4XF3 A;  4BB3 A;  1VRH 2;  4MVT A;  5F3G A;  4AW7 A;  5JMC A;  2Y6J A;  2D6O X;  5JPM B;  1LHU A;  4CDW A;  4QX3 A;  3ZFE A;  1MEC 2;  1W04 A;  4BLJ A;  4CU9 A;  4LPL A;  1QNW A;  1OHF A;  4YPJ A;  3VBS C;  4TTG A;  2BNO A;  4QX8 A;  2UYA A;  4LHL A;  2Y33 A;  1UKR A;  1ASJ 2;  5F8P A;  5FZH A;  3GYD A;  1LU2 A;  3CU7 A;  3MGU A;  1JBC A;  1K45 A;  1RC6 A;  5FO8 B;  1V9U 3;  1Q8S A;  3MBW A;  4P08 A;  5L9B A;  2V72 A;  4NRP A;  2WNO A;  3ZKY A;  3FJS A;  1JYC A;  5IUQ A;  4UYB A;  1U5X A;  5A6Q A;  1GLH A;  1S0G A;  2BV4 A;  4YLZ A;  4A41 A;  2MEV 1;  5F3E A;  3THD A;  4CEW B;  4EZ4 A;  2VBB A;  4JRL A;  1CAU A;  4ASK A;  1I5Z A;  1GWK A;  3Q8E A;  2XML A;  4XJ9 A;  3T0A A;  4I3P A;  3C7G A;  1Z7S 3;  3JD7 1;  4XAE A;  3BB6 A;  5E1R A;  1R09 3;  4BQ4 A;  3DCQ A;  5J37 A;  3E5Q A;  4IEV A;  1RTV A;  1PGL 2;  3M3C A;  4PI0 A;  2I07 B;  4HON A;  2BZD A;  4LEJ A;  1IGO A;  3VL8 A;  2VZO A;  1MS8 A;  2ZGM A;  2VVF A;  2EXI A;  2K9Z A;  3BU0 A;  4JGY A;  4FPL A;  1UW8 A;  4Q0S A;  4XZP A;  3RGB A;  3RS6 A;  4IV3 C;  5GKA C;  2OW4 A;  4W6W A;  4CDQ C;  4CEY A;  1O3R A;  4WM7 A;  4N53 A;  3ZPY A;  4KGQ A;  1O3S A;  2ET7 A;  1UNB A;  5C3Q A;  2P6C A;  3WDY A;  1BEV 1;  2WDB A;  1EV1 2;  3D0J A;  5FZO A;  3GZU C;  5HBA A;  4YG6 A;  4P9L A;  5KXC A;  5IK5 A;  4A7Y A;  3V65 A;  2CAU A;  2VC9 A;  3ZSL A;  4DZG A;  2BER A;  3I3B A;  4UW4 A;  1B35 A;  4KQ7 A;  4XDO A;  4Y4Y A;  2HWE 3;  3H3L A;  3LAG A;  1UY4 A;  5B4N A;  4FTB A;  1WZX A;  1JUH A;  3WQB A;  2A7A A;  1WD3 A;  2HBU A;  4FAG A;  1LAJ A;  2RS5 3;  3T2T A;  1ZBE 1;  4FBF A;  3HQR A;  3L2Y A;  4BJ0 A;  2FBE A;  2PLV 3;  1QJX 3;  3D5O A;  1CAX A;  2CHH A;  3WDU A;  3LF7 A;  1OKQ A;  5GZG A;  3OBA A;  3TRS B;  1DYP A;  2K46 A;  4OQ9 A;  3C7E A;  1BVP 1;  3MIC A;  3MI8 A;  2GME A;  4IGP A;  2BGO A;  4MHR A;  1NCQ B;  2JG9 C;  1RUO A;  2RS1 2;  3POW A;  1N47 A;  3POG A;  2A3W A;  4IE6 A;  4LUL A;  4YW2 A;  1IS3 A;  4Z8B A;  3NL1 A;  1W6N A;  1JHJ A;  3O1T A;  4U2A A;  3JUU A;  3WZ1 A;  3M1H A;  1FXZ A;  1C8M 3;  5FLJ A;  4C0B A;  2ZAA A;  2Y6G A;  3FWE A;  5ERL A;  2Y60 A;  4KWL A;  3CQO A;  1BJQ A;  1AX0 A;  2ZGT A;  1AL0 G;  2VBD A;  4FXG B;  4OI1 A;  3U0Z A;  3BIE A;  3KB5 A;  2W1Q A;  2A5Z A;  3VBO C;  1W03 A;  5FWE A;  1MEC 1;  4CSW A;  1CX4 A;  3EBR A;  3RZG A;  1UY1 A;  4NVP A;  4DY3 A;  3T4H B;  1D7P M;  1RUE 2;  1N3P A;  2GC3 A;  3DEC A;  1VBE 3;  1W8W A;  5F5C A;  3BTX A;  4JGZ B;  3J7H A;  4AQ2 A;  4DIQ A;  1WCK A;  2EIE A;  4JTN A;  3I2G A;  1SLL A;  3I2K A;  1VAL A;  5EPA A;  1YNA A;  2W3J A;  3LFM A;  1SPP A;  2XKO A;  3N35 A;  4HMZ A;  1J58 A;  4XTM A;  4C91 A;  2GAL A;  1OA4 A;  2WO3 A;  3W5N A;  1PIV 1;  4GXL A;  4HZF A;  3USU A;  4KBZ A;  1A78 A;  2ZJC A;  2XJV A;  1R1A 1;  2YUE A;  1LRH A;  2FDH A;  3HD8 B;  3MIH A;  3AMP A;  1HRV 2;  5EFU A;  3NAP C;  2BEO A;  2JKX A;  3KQR A;  3NAP A;  3PL0 A;  5D1I A;  4W50 A;  3RZH A;  1OH3 A;  1CIY A;  2HYK A;  1XE8 A;  1G9D A;  2WQ4 A;  3OPW A;  3EMR A;  4AQT A;  5C6C A;  4RHV 1;  3AJZ A;  1W05 A;  1WW7 A;  2JE9 A;  4CCN A;  1MZF A;  3RSJ A;  2J22 A;  3AP4 A;  3H7Y A;  3MPP G;  1NCR B;  1Y9M A;  1SCS A;  1XOY A;  3QH7 A;  4LBO A;  3VDB A;  2YG0 A;  1YQ5 A;  4XFC A;  4AED A;  1QJY 1;  4QDR A;  1XE7 A;  3GZT B;  4FPK A;  3ZXG A;  1QH7 A;  4Y20 B;  2VOX A;  4QMA A;  4XQW A;  3HQX A;  5FZG A;  5EYY A;  4ZKT B;  5F6K A;  1IG3 A;  1DF0 A;  1LHW A;  3JCI A;  5A6X A;  2A6Z A;  1V9U 2;  1K3I A;  3WCS A;  4LOS A;  4B4R A;  3MLK A;  5C71 A;  4RYD A;  5FR3 A;  2VZP A;  3V64 A;  2XOM A;  2D43 A;  2LM3 A;  2JDA A;  2ZEW A;  3H8O A;  1XSR A;  3U75 A;  2DDU A;  4Y33 A;  4QPY A;  2ZGR A;  4HT1 T;  1ND3 C;  5FIX A;  1ND3 A;  4FFI A;  4JGY B;  1S4C A;  1X82 A;  5JLV A;  2QQL A;  1TME 2;  4KU7 A;  1AUY A;  3LDR A;  2AEN A;  3H1Y A;  3OUI A;  4GH4 A;  4M3C F;  3GGL A;  4P9J A;  1PO1 3;  1ZZ8 A;  1BKZ A;  2XJS A;  5A3U A;  1QOO A;  4UAP A;  4XDQ A;  2CAV A;  5C3O A;  1RUH 3;  1AJK A;  2RDQ A;  1QXR A;  2ZAC A;  1B35 B;  1PX4 A;  2RS5 1;  2W5F A;  4NPR A;  5FRE A;  3H42 B;  4QB1 A;  2WR9 A;  1VBB 3;  2JDH A;  1WGP A;  2DVD A;  2RM2 1;  2ZGO A;  5GZC A;  2R06 3;  2WNU B;  4BQ1 A;  1F4H A;  1YYN A;  1RMU 2;  2XUE A;  1OBN A;  4PLO A;  5FWJ A;  4LMF A;  2DUQ A;  4X6Q B;  2R1D A;  4XJU A;  5SV8 A;  1RUC 1;  3H1W A;  3KLS A;  1WCS A;  4YZ2 A;  2YGM A;  2AEZ A;  2D97 A;  2OX0 A;  3ACF A;  4FQZ A;  3UK9 A;  3UKN A;  1NCQ C;  5GM0 A;  3RDI A;  3AB0 A;  3UET A;  1NCQ A;  4XFI A;  3RWN A;  5CU1 A;  3RZZ A;  5AVA A;  4JTO A;  4MGI E;  3I2D A;  5FP9 A;  3HIF A;  1W9T A;  4RQP C;  5JDB A;  2PLV 2;  1IG0 A;  3O14 A;  4HK8 A;  1ALY A;  2VQU A;  5JOY A;  1H8V A;  1R64 A;  4HVR A;  5BNN B;  5FZC A;  2FDJ A;  2QKD A;  3I59 B;  1W3X A;  1RXG A;  3EJK A;  5GLW A;  3UGH A;  3R6S A;  1COV 3;  3VD3 A;  1AF9 A;  2W92 A;  3H8R A;  4XAA A;  3M3O A;  1QEX A;  5L9V A;  3A7Q A;  1W6P A;  2XJR A;  5BNQ A;  4J6G A;  1LOF A;  2UWB A;  5J1X A;  5CIS A;  4RHV 2;  2OYZ A;  5EIY B;  4Q4X 2;  3PIJ A;  4YM1 A;  1ND2 B;  2A6Y A;  3VV1 A;  1QJF A;  1C8M 2;  3E5U A;  4Y5Z 0;  3B93 A;  2P2K A;  1FNZ A;  1Y3T A;  4LA2 A;  4RFT 0;  2A6V A;  3PNA A;  5FV3 A;  5KHG A;  1ULC A;  2RM2 3;  2VGD A;  4QKF A;  2RMU 1;  5FCC A;  2RJ2 A;  4MG2 A;  1VBE 2;  1PMH X;  2IZW A;  2E6V A;  3NVC A;  3R4D B;  2AH2 A;  3AMN A;  1LEM A;  4HPK A;  4EQV A;  3S30 A;  3MF6 A;  4BYY A;  2XBO 3;  2RJK A;  1VB4 A;  1OLM A;  1OT5 A;  4M3C A;  2O14 A;  2ZGQ A;  1YCI A;  3NV3 A;  4QXB A;  2E32 A;  4CP1 A;  1QQP 1;  4TLG A;  2DUP A;  1UYP A;  1XND A;  1UOB A;  4KGG A;  3O1M A;  2CGN A;  4I3G A;  1PK6 A;  2WZE A;  3D0S A;  2V5Y A;  1STM A;  1OQE A;  3VL9 A;  3ES4 A;  1H30 A;  3CZJ A;  5C4W B;  2PHW A;  2YYO A;  3HT1 A;  3KF5 A;  3IPV A;  1W8T A;  2P3K A;  2X10 A;  1E5H A;  3UES A;  4CUC A;  1VBC 3;  5J3U A;  4ZPI A;  5LY2 A;  1LNS A;  4GAL A;  4RFR B;  5A32 B;  1NAE A;  5DPN A;  3K51 A;  4JGZ A;  2ZHL A;  2JB4 A;  1YHF A;  5I0S A;  3WX5 A;  1ND2 A;  4HN0 A;  4K21 A;  5A33 B;  1QJX 2;  4JKM A;  5APA A;  1E5S A;  2HWD 2;  1OMI A;  2OZJ A;  1CPN A;  3PJQ A;  1LU1 A;  3B3Q E;  2VNG A;  3SHR A;  5LCW L;  1HKD A;  1S1A A;  1W2N A;  2FCT A;  4DXZ A;  2RS5 2;  2GNB A;  5C3R A;  1GMM A;  4PBO A;  1FPN 2;  1LOF C;  5FZB A;  4OUS A;  4LKD A;  3WP4 A;  3W21 A;  2VD7 A;  3VBO A;  1DIW A;  3VBS A;  1APN A;  2OT7 A;  3IN9 A;  1JOP A;  3PVN A;  3HEI A;  2HBT A;  5DZE A;  2XVG A;  3GBG A;  5LBF A;  3WNX A;  3ES1 A;  4DEV A;  4BQX A;  1W2U A;  3O0W A;  1IS4 A;  4RA0 A;  2WLQ A;  4Q0P A;  4RD7 A;  1UOJ A;  2WBK A;  2QQK A;  3ZFF C;  1NE6 A;  1XYP A;  5KWR A;  3N9N A;  4ZZ8 A;  1D0H A;  4DRR A;  5FUN A;  4XAB A;  4UW5 A;  3KVB A;  3I3D A;  4GMP 0;  5ANN A;  3NNL A;  3U10 A;  1L7Q A;  2UWC A;  5KR7 A;  1S0C A;  3JQW A;  4ES9 A;  2ZHK A;  1GP6 A;  5CVR A;  4AWD A;  2OZ6 A;  1QKQ A;  3JXS A;  5C9A C;  2WNU C;  2WN3 A;  3NNM A;  1WLW A;  4LIT A;  5HCH A;  2B7Y A;  4LKF A;  1D2Q A;  3QH6 A;  1ULO A;  2F4L A;  2WT0 A;  1COV 2;  1ULD A;  3ACL A;  4LQR A;  3AK0 A;  3LA2 A;  4PF1 A;  5A7P A;  1EP0 A;  1OD5 A;  4QX5 A;  3S7E A;  4F8A A;  4GB3 1;  4GWJ A;  3AYA A;  3DEM A;  4Q4W 3;  2B46 X;  4AVA A;  1OLQ A;  1PK6 C;  2GH8 A;  5FZ1 A;  4YZ1 A;  3SEE A;  3MYX A;  3DL3 A;  5G04 L;  1D2S A;  1JYW A;  4GJY A;  4PJY A;  4AED B;  3SH4 A;  2HEV F;  1KFX L;  3NV4 A;  4R4X A;  4YZ4 A;  4YVW A;  4IXL A;  3VBF C;  2CWM A;  2BVB A;  4L97 A;  4YNI A;  4A4A A;  1H8T A;  1GFF 2;  3DKQ A;  3ZFG A;  4GH4 B;  1H8T C;  4JGZ C;  1RGS A;  2R7E B;  2W46 A;  5KXB A;  1HN0 A;  3AXD A;  4LJH A;  4M0H A;  1NG0 A;  3OBZ A;  5E88 A;  1OH4 A;  3OGV A;  4DMI A;  1W6P B;  5IFP A;  4H14 A;  3AM2 A;  1DGR A;  3DV8 A;  5T55 A;  3LDK A;  1H1I A;  4Y5S A;  5FYS A;  3ZYF A;  1LOA A;  3AMH A;  2X53 S;  3I2I A;  4ZS2 A;  1H1M A;  2G9G A;  5A1L A;  4L9B A;  4IE4 A;  5LW9 A;  1AR8 3;  5FXW A;  2EAK A;  3ZFF B;  5HCA A;  2PHD A;  4WVM B;  2FZ1 A;  3B5L B;  2VPV A;  1BK1 A;  5F39 A;  5A33 A;  4IEX A;  4FOW A;  5IVE A;  4NRO A;  4LE4 A;  2YC4 A;  5BNO C;  4NHL A;  1UYY A;  4AFC A;  2PHU A;  1WW5 A;  2R04 3;  3C2U A;  4MET A;  5DUU A;  1O59 A;  4M4P A;  5E6H A;  4CDU C;  4IGQ A;  3VBO B;  3CKH A;  4MZU A;  4O61 A;  4GKX A;  4QQH A;  4RN5 A;  1XSQ A;  1RUI 1;  1GZC A;  4HBN A;  1US2 A;  2PQQ A;  3TEW A;  3MO4 A;  1CZS A;  3MIB A;  3H50 A;  4I01 A;  4X8N A;  1UIK A;  1R08 1;  4MGQ A;  5KHH A;  3ZXK A;  1UKG A;  1GBG A;  1HV0 A;  2CWS A;  2BWC A;  3OBT A;  1PMI A;  3I3Q A;  1PMJ X;  3WF2 A;  2PTM A;  5EJZ B;  3VHP A;  3AP6 A;  1CWP A;  3U4X A;  4Q2F A;  2VZ1 A;  2ZHM A;  3VKL A;  3DPR A;  4AHZ A;  2XXZ A;  3M3E A;  5IYY A;  2DYC A;  4PLM A;  5B4X A;  3Q8C A;  1FOD 1;  5FYV A;  2VZS A;  2HWB 1;  1NE4 A;  3N7M A;  1N1T A;  3VD5 A;  4CPB A;  1NYW A;  5JUV A;  1BEV 2;  2GC0 A;  4KL1 A;  5LA2 A;  5JR2 A;  2GP5 A;  4MO3 M;  5DXD A;  1YEW A;  4FO9 A;  4H7M A;  4UOJ A;  2ARA A;  1KJL A;  2ZKN A;  2AGS A;  4E4Z A;  5A3L A;  2HKX A;  3IDE A;  1YC6 1;  3VBR A;  1EUU A;  4OCT A;  1GWM A;  3FBY A;  4ZU7 A;  1W3V A;  2QCS B;  2X5I A;  3AKT A;  2VXR A;  1LCL A;  3POS A;  3RWK X;  3ZIW A;  5BNP B;  4M3C B;  3KS7 A;  4LLF A;  5LK5 A;  2GAU A;  2HWC 1;  2YBS A;  4BOW A;  1JZ5 A;  3ZYG A;  1MVE A;  4D3W A;  2HWD 3;  3GAL A;  2VW1 A;  3H7J A;  1HW5 A;  1V6N A;  4JDN A;  2YU1 A;  4XUN A;  1A6C A;  1HRI 3;  3K3N A;  3CEW A;  2XVK A;  1O4Z A;  3B02 A;  2ZX0 A;  4Z2W A;  1O3T A;  1L3J A;  5IHR A;  2XQR A;  3ZSM A;  4CCE A;  1CZV A;  4GWM A;  2WN2 A;  1ZBE 3;  2XJP A;  3NNG A;  3OGG A;  4IV1 A;  2QZ3 A;  3MDP A;  1V6L A;  2V73 A;  3RMY A;  4Q4Y 3;  5FYB A;  1J59 A;  4XJ8 A;  4YM3 A;  3CJI C;  5F3I A;  2XKP A;  5I0U A;  4L0P A;  4QKD A;  5F9T A;  1V0A A;  1P8J A;  3I2J A;  4AK3 A;  4EYU A;  2BU9 A;  4IES A;  3HN1 A;  4PBP A;  1QXP A;  2RS1 1;  4F3J A;  2RS3 1;  5FKC A;  4AR2 A;  3KV6 A;  2JD4 A;  2EID A;  2C6S A;  1O6U A;  3KV4 A;  3HPN A;  5FBJ A;  4LUM A;  1VPH A;  1XB9 A;  2BBV A;  3TEX A;  2VM9 A;  1VRH 3;  5GZE A;  3S6P A;  2X29 A;  3OPT A;  5SV5 A;  3M3Q A;  3FFZ A;  4JX0 A;  4P9G A;  4MX3 A;  1UOG A;  2VUJ A;  3K2O A;  1PX3 A;  2FHR A;  2HWF 1;  5FQ0 B;  3ZO0 B;  1GQG A;  2FMD A;  1UCX A;  3ILR A;  3OJB A;  3OGR A;  3S5Q A;  4FSJ A;  1S0F A;  1LHN A;  3V0B A;  3MUZ 1;  1DP0 A;  2WA3 A;  3DYP A;  1GU3 A;  3FZ3 A;  3LA3 A;  4XBL A;  5C5U A;  1XU1 A;  4WM8 B;  4K7J A;  2JEM A;  4GQ7 A;  2WWU A;  1DGW X;  5DG2 A;  2IC1 A;  1JZ2 A;  1H4G A;  2DFC A;  4NID A;  1UMZ A;  5FJH A;  4NMI A;  4LBK A;  5K8S A;  3WP6 A;  5FZL A;  3OY8 B;  3ZYJ B;  3FN9 A;  3UNP A;  2PAE A;  1IKP A;  5A7W A;  1Q3E A;  2WZR 2;  5BNN A;  4OUM A;  3ZYH A;  2CL2 A;  3WSO A;  1BYH A;  1GUI A;  1QMJ A;  3AX4 A;  3WW1 A;  2H6C A;  3CL1 A;  5DN2 A;  2QFE A;  2D6L X;  4BQ2 A;  1SLT A;  1YJK A;  1RUE 3;  5FOJ B;  2QNK A;  1ENS A;  1WUV A;  4JC1 A;  1WMX A;  2VNO A;  5JOX A;  2QQM A;  3NMB A;  2D40 A;  5AFE A;  2R06 2;  5C4W C;  3FUQ A;  4LT5 A;  5A3M A;  1O91 A;  5BV6 A;  4Q5O A;  3K4Z A;  1SBF A;  3WNK A;  2A75 A;  1W39 A;  2WS9 3;  3B9C A;  4YFZ A;  2QUO A;  1NA1 A;  1FMD 3;  5FY1 A;  4LR4 A;  4QT6 A;  2VOV A;  5BPX A;  5EZW A;  1ND2 C;  1VMF A;  3BOP A;  3URF A;  1JH5 A;  1HB1 A;  4QKB A;  5C33 A;  3RZL A;  2VVE A;  2Y6H A;  3LWC A;  1SDD B;  1M06 G;  3VZL A;  5IVB A;  1AL2 2;  3AVR A;  1EY2 A;  5FY8 A;  4LTA A;  5DAB A;  3RI8 A;  1TMF 3;  2BDR A;  3AZY A;  2VG9 A;  3POI A;  1N1S A;  2ZGU A;  1MZE A;  3PUH A;  4HLT A;  5A70 A;  5T5J A;  1VMH A;  4ASL A;  1H1A A;  1X8M A;  1YQ2 A;  3KWV A;  1F5J A;  1H4H A;  4EWD A;  2Q8D A;  4EN7 B;  1AX2 A;  5ABJ A;  2ZZQ A;  2WZR 1;  4LO7 A;  2WFF 3;  2WA4 A;  5HXV A;  2TNF A;  2D3P A;  2GU9 A;  3ZR6 A;  2J1A A;  3GM8 A;  3ETP A;  1OOP A;  2NP0 A;  1FX5 A;  1NT0 A;  1AYM 2;  1OD3 A;  3ZIX A;  4OQ8 A;  2VQA A;  4PIZ A;  4WM7 C;  5A3W A;  5I93 A;  2VME A;  3B69 A;  3M8L A;  2GH2 A;  4XEZ A;  1BVV A;  1JMU B;  2P5B A;  3WNL A;  4OHY A;  3CLP A;  1FAY A;  4N43 B;  3CNA A;  3PU8 A;  4A7Z A;  1W0P A;  2ZAH A;  3MW3 A;  2QQO A;  4UBG A;  1VBE 1;  3EB7 A;  3VDD A;  4ATE A;  5ACA 2;  5I8T A;  4D94 A;  1GYK A;  1QDC A;  4PI2 A;  3H8X A;  1DGL A;  1A34 A;  2YFZ A;  4CU6 A;  3OYW A;  4LA3 A;  3J8F 3;  3LB9 A;  4QXC A;  3IKW A;  3WNM A;  1GZT A;  1GP5 A;  3BYW A;  1RHI 2;  3BIW E;  5FYI A;  3OBR A;  3BTZ A;  1PGS A;  3QCW A;  1Q43 A;  2XLA A;  5FLI A;  5FZM A;  4WM8 A;  1ODN A;  3POF A;  2EXK A;  3OF1 A;  1ENR A;  5JXJ A;  2JG9 B;  1J83 A;  4YM2 A;  4EN6 B;  1J1L A;  2WKK A;  5FMC A;  2VTX A;  1YXW A;  5GZD A;  4J1X A;  5JXI A;  1J3Q A;  1W6M A;  1BHG A;  1N3Q A;  2ES3 A;  1CN1 A;  3OGJ A;  1POQ A;  3KCY A;  4WVV A;  4B29 A;  3TN9 3;  3WG2 A;  3P3P A;  3CO2 A;  3HNY M;  4HET A;  2BYV E;  3RJR A;  4EN0 A;  3JQX A;  4E4S A;  2HWC 2;  1RMU 3;  4G9S B;  5JOZ A;  1XNB A;  4MXW B;  3JB4 C;  3U07 A;  3VHO A;  5J98 B;  4AVV A;  4LBQ A;  2W68 A;  2BOI A;  3HBK A;  2QDR A;  2VMH A;  4DXT A;  1LUL A;  3VZM A;  1QF3 A;  4QX7 A;  4P5Y A;  2Q0A A;  3W58 A;  3CJI B;  2FD8 A;  1MPX A;  2N7G A;  2DFB A;  1BEV 3;  5I91 A;  3AP9 A;  4KI5 M;  2AAC A;  1G6N A;  2Z4F A;  4R9C A;  2C24 A;  2Y38 A;  4UF0 B;  1GQH A;  1MQT B;  5EYX A;  1NX9 A;  1W8H A;  2ETE A;  1LJ7 A;  3ZDS A;  4AOC A;  5J48 A;  4ISR A;  4CU8 A;  1B09 A;  1AXZ A;  1UYZ A;  4E8C A;  2DU0 A;  1IOA A;  4PT6 A;  3VBH A;  5C8C B;  1SZB A;  4SBV A;  3H3Z A;  5L7O A;  5IAX A;  2MHF A;  4AF9 A;  4PLN A;  4M00 A;  1XBF A;  2HH9 A;  1AR7 2;  2RDS A;  3N9M A;  3WEZ A;  3T0D A;  4XDP A;  4FOY A;  1PM7 A;  1WW4 A;  1HJG A;  3WG4 A;  5A7W B;  4EN9 B;  1RXF A;  4P5H A;  3FC0 A;  4A3Z A;  1JYX A;  1A8M A;  2OXB A;  3VZK A;  4BIF A;  5BNP A;  1HRI 2;  2P3I A;  4O9E A;  3ZLI A;  4RHV 3;  4XIL A;  5KHK A;  2DTW A;  3T09 A;  2ZS6 B;  5EJ1 B;  2UU8 A;  4AI8 A;  3HJR A;  4BH9 A;  2QQJ A;  2V5D A;  2D6M A;  3POY A;  2VZR A;  2E31 A;  2W87 A;  3WHT A;  2J42 A;  1O8P A;  3R4U A;  3IDB B;  1WLD A;  2VU9 A;  2ZGP A;  5D2A A;  3THP A;  2Y6L A;  4UFI A;  1LED A;  1NCR C;  1ZRI A;  4QHZ A;  1DYK A;  3J7M A;  1TQ5 A;  3L9J T;  4LHK A;  5FZI A;  3CJI A;  4A2U A;  5DAX A;  1NA1 C;  3VBF A;  3WQ0 A;  4A44 A;  2DVB A;  1WW6 A;  1UAI A;  2ZOE B;  4PDW B;  4S2F A;  5DZG A;  2IVI B;  2QQV A;  1ZA4 A;  3PVE A;  5JIA A;  5FMB A;  1UU4 A;  1FI2 A;  4S2H A;  5JI7 A;  1CR7 A;  3T1L A;  3VB9 A;  4FTS A;  2IXH A;  2TUN A;  2WO2 A;  5FPB A;  4YW3 A;  3C7H A;  3JD7 2;  1YUD A;  5FUP A;  4AHX A;  5T5O A;  1UN1 A;  3HNM A;  5E16 A;  1QJE A;  3J9S A;  4YRD A;  5T5P A;  3ZM8 A;  2DVG A;  1RHI 1;  1H6Y A;  3SC7 X;  4OUE A;  5L7O B;  5FZ7 A;  1NZI A;  1V6I A;  5EQU A;  2Q30 A;  4BQW A;  5E8A A;  3PTY A;  2JWP A;  2EIB A;  4B1M A;  2CTV A;  1UX6 A;  1LGC A;  4RS5 B;  1TMF 1;  1WCD J;  5FY0 A;  2AZ5 A;  3WF4 A;  2SBA A;  5CFD A;  3KF3 A;  4CCD A;  4ISQ A;  1OOP C;  1HQL A;  1K12 A;  1HQW A;  3CDZ B;  3LOI A;  2RR1 3;  3RG0 A;  1SFY A;  5AFB A;  1WWY A;  1W8O A;  4AI0 A;  4I2O A;  2CNA A;  3IBM A;  1HJF A;  1G86 A;  4W4Z A;  2PAM A;  5DUX A;  4COZ A;  4C8D A;  1RUE 1;  2VW2 A;  4AE2 A;  1AYM 3;  1G8W A;  2XDV A;  4XBQ A;  4XJZ A;  3N4M A;  2RHP A;  1X36 A;  2DCZ A;  4GB3 3;  1F2N A;  1O4Y A;  1KD7 A;  3DXT A;  3OY8 A;  4QAW A;  5LB6 A;  4XHB A;  1V6M A;  2GMP A;  2NZ9 A;  3Q9O A;  5BNP C;  5K0U C;  3NJY A;  1ASJ 1;  5CYY A;  3WNP A;  5CFC A;  1BBT 3;  1K5M A;  1UO9 A;  4UFL A;  4YGC A;  2QBX A;  5DQ0 A;  1LR5 A;  2JG8 B;  3ZYB A;  1S0D A;  2BP6 A;  4HSJ A;  4LBL A;  1YI9 A;  4N43 C;  4OMD A;  2V09 A;  4CCJ A;  1NLQ A;  2JDK A;  2R04 1;  3THT A;  2A70 A;  5C8C A;  4XUP A;  5HCF A;  3AZV A;  1KGY A;  1O7F A;  2XL7 A;  4QQO A;  3HWJ A;  1M4W A;  3A0K A;  4I02 A;  1G9C A;  3E6D A;  1W6M B;  2IXI A;  2Z42 A;  4QDQ A;  1ZZB A;  3CF6 E;  3VKF C;  2UUR A;  3PUQ A;  1FT9 A;  4Q4W 1;  5D8A C;  4BPZ A;  5A3T A;  5JAX A;  3PVB B;  1QHD A;  5FFO C;  4V2V A;  1DQ6 A;  4Y1U A;  4BQ5 A;  2ADE A;  4RR3 A;  4BME A;  4N53 C;  1FOD 2;  2VUC A;  3LEK A;  1D4V B;  3AFK A;  3PTR B;  2ZBJ A;  1GOH A;  1TG7 A;  2LUW A;  4NO4 A;  2R49 A;  1V6J A;  2UWA A;  2WWS A;  1MEC 3;  2B4K A;  1AR7 1;  4OI4 A;  3SCH A;  1YQ8 A;  4KMQ A;  3GHN A;  1LOD A;  4GWI A;  4OUL A;  4UWD A;  4Z2A A;  2RS3 3;  3VDA A;  1W2A X;  2WS9 2;  5I8Y A;  4LUK A;  2D44 A;  1ZVF A;  5FO7 B;  4BZ4 A;  3G7D A;  1LKN A;  1UU6 A;  5FPL A;  3POJ A;  5FK8 A;  1UY3 A;  2YY1 A;  4WZF A;  1O8S A;  5FZD A;  4DOU A;  1C1L A;  3H3U A;  5JSP A;  2D6P A;  2H6B A;  1REE A;  2ORZ A;  3EYP A;  4SLI A;  4XOG A;  1FV2 A;  2IXC A;  1YI7 A;  3FLT A;  4IER A;  4AEM A;  5LRS A;  1GNH A;  4TZD A;  3WY6 A;  2W1W A;  4CCL A;  4XIK A;  4YW7 A;  1YQ6 A;  1TME 1;  1FNY A;  5IK4 A;  2I2S A;  4Y22 A;  2JE8 A;  4B8E A;  4H55 A;  3DN7 A;  3S57 A;  4K1Y A;  4QB6 A;  1WCQ A;  5HXM A;  2W52 A;  4AG4 A;  1X33 A;  3O0X A;  3T3Y A;  1UY0 A;  2ID4 A;  3OYW B;  3BVC A;  4JQR A;  4CP9 B;  5FBZ A;  1JI6 A;  1Y7B A;  3KM5 A;  4AGR A;  3U14 A;  3O1V A;  1MR5 A;  1VBA 1;  4ARY A;  1S55 A;  1XNC A;  1BZW A;  1VBC 1;  3ACI A;  4XFA A;  4YW5 A;  4Y4R A;  1HRV 1;  1Y4W A;  5FAX A;  4XTP A;  4E2G A;  1LB2 A;  1CZT A;  1D4M 1;  1RMU 1;  2DBN A;  3WG3 A;  2HWB 2;  4HKW A;  5FZF A;  4XUR A;  5FXV A;  1EYB A;  2Y0I A;  5D8A B;  1JYV A;  4AI1 A;  2J1E A;  1H6X A;  2BPA 2;  1SFP A;  2R1B A;  3AKR A;  4P14 A;  4PCR A;  2DBI A;  1YFY A;  3O1U A;  5BXX A;  1MVQ A;  3N7J A;  3T0B A;  4E4H A;  4ZHN A;  4NR1 A;  2ENR A;  2AR6 A;  2LAL A;  2R07 1;  3C7O A;  4HL0 A;  4YGE A;  3RYP A;  4BK5 A;  3GJB A;  5BYN A;  1WLT A;  4NHK A;  3BTY A;  1OFN A;  2MNG A;  4XZU G;  3J8F 2;  3KHC A;  5FYY A;  1S2E A;  1LOE A;  3WOG A;  4JDO A;  2FQP A;  3H1M A;  2K2S A;  1V9U 1;  2X5I B;  3B00 A;  3N9L A;  3OCP A;  4JQT A;  4ZXK A;  4NII A;  3O7O A;  4CDW C;  1W90 A;  5FP3 A;  1AYN 3;  1POV 0;  1GZW B;  2XB6 C;  5A3O A;  1OVP A;  2VNV A;  4N8M A;  2UYB A;  3K75 B;  1MS3 A;  1V6O A;  3MW2 A;  2PXJ A;  5CFD C;  4RR3 B;  4ERO A;  3DKW A;  1MS4 A;  1S0B A;  3MV0 1;  4IEW A;  3WQ1 A;  3E6B A;  1YIF A;  2Q8C A;  1DU3 D;  4IV1 C;  3IMN A;  1PGW 2;  3RNS A;  1RUJ 2;  1UU5 A;  2FDF A;  5A1A A;  4NHM A;  1KDM A;  4O65 A;  5F1R A;  2E51 A;  2G1M A;  2YPD A;  2Z79 A;  2HWE 2;  1X7N A;  4WVZ A;  5JPN B;  1UF2 C;  4AHY A;  1GNY A;  3NJZ A;  1RED A;  3LD8 A;  3ZMO A;  1PO1 2;  3IAP A;  4FPE A;  4QGN A;  1LTE A;  3FLR A;  4QPG C;  4MSV A;  3WXP A;  3OG2 A;  3SLI A;  2I74 A;  1DFQ A;  1RYY A;  2F6B A;  1V70 A;  2NN8 A;  3LZZ A;  4I30 A;  5C70 A;  4UFK A;  5JSO A;  4NIA A;  2QVS B;  3VD9 A;  3IB3 A;  2ZCW A;  2HLE A;  4LK7 A;  4DNY A;  2C5D A;  1LEN A;  4YVW B;  2AEY A;  3ZX7 A;  1DQ1 A;  2XJT A;  1QOS A;  2ZMN A;  1CON A;  4QU2 A;  4IEQ A;  5FK7 A;  4ASM B;  4C1W A;  4M3C E;  4QX0 A;  3UL2 A;  3UYJ A;  3CJX A;  3LKJ A;  4IET A;  4RQP A;  1RUC 3;  3MID A;  3SCG A;  1BK0 A;  1SLI A;  2FCU A;  1YLL A;  2XJU A;  1AR7 3;  2VJX A;  4IEY A;  1HRV 3;  3USS A;  3E97 A;  1UWW A;  2ARE A;  2WFF 2;  4A7K A;  4DUV A;  3ENR A;  4EE2 A;  2PQS A;  5T3N A;  4Q8L A;  2W2I A;  1K5J A;  4XF1 A;  1QIQ A;  5A80 A;  1J3P A;  5A7N A;  3M3I A;  2PHR A;  3ZN5 A;  2ZPX A;  3UKV A;  1G9F A;  4CXX A;  1PZ9 A;  1ULE A;  5F5I A;  4DO0 A;  4NRM A;  4XJA A;  3AKP A;  3N3H A;  3AXE A;  2NMN A;  5FYH A;  2CV6 A;  4CEY B;  1T6B X;  3VBU C;  2WO1 A;  3GHM A;  5KHJ A;  4XIO A;  1JYN A;  5DAP A;  1VBB 1;  3M7A A;  2QJV A;  4LHS A;  4MHU A;  1KDK A;  5KXD A;  3WNN A;  4PIY A;  4V2W A;  1PGL 1;  3RZK A;  1BXH A;  1ULG A;  2YDE A;  1C8M 1;  1QH6 A;  1MZ5 A;  4QHO A;  3I54 A;  4UXA A;  2RS3 2;  4AFA A;  3AVS A;  1ACC A;  5C7G A;  3BUC A;  3EO6 A;  1MQT A;  2RM2 2;  4URA A;  5CAD A;  3ORJ A;  1HLC A;  1KIT A;  2IFR A;  1J3R A;  2WAB A;  2W91 A;  3K48 A;  2GMM A;  2XHK A;  3B94 A;  1CAX B;  2WII B;  3GF6 A;  1KS4 A;  3MV1 1;  5K0U A;  4CP9 A;  3A22 A;  2YBP A;  3T30 A;  3BGA A;  1LOG A;  2HWF 3;  5CFC B;  1IS6 A;  1WD4 A;  3AC0 A;  1IHM A;  4LO6 B;  4NOT A;  4X8P A;  1K5M C;  5TSW A;  3I3M A;  3THC A;  1RUN A;  2FDK A;  1VBD 2;  2VXJ A;  1PO2 1;  2DF7 A;  1PVX A;  4IEU A;  2RVA A;  3N9O A;  5IK7 A;  2RDR A;  2RR1 1;  2YC0 A;  4A6O A;  2XG3 A;  1T2X A;  2D6N A;  3I3E A;  2XWB B;  4FOV A;  2E7T A;  2TEP A;  5F2S A;  1VBA 3;  4GB3 2;  3TAY A;  1AYM 1;  5FMO L;  4AI2 A;  4XFH A;  1OPO A;  3O1P A;  1UZ0 A;  1OLM E;  1YFW A;  5FXX A;  3ZFG C;  4YW1 A;  3NQH A;  3SKJ E;  2PYT A;  1DYO A;  1C1F A;  1OUX A;  3CBN A;  1U0A A;  1LOB A;  2W94 A;  3P3N A;  3PMS A;  1G7Y A;  3PVO A;  5F37 A;  1ZBA 2;  1W8N A;  2VOT A;  1WME A;  2JDY A;  2X5I C;  4IEZ A;  4NAO A;  5DAQ A;  2A3X A;  4XW3 A;  1UD1 A;  2Y26 A;  2P6H A;  3MIE A;  2WC2 A;  5EV7 A;  1CJP A;  5IK8 A;  1IPS A;  1ODM A;  4H2A A;  2C26 A;  3HNB M;  5IW0 A;  4Y1V A;  4QGL A;  2A71 A;  5C9A B;  2LRO A;  1H8T B;  4HG6 B;  5GLT A;  3S7I A;  4YVS A;  1VJ2 A;  1I9R A;  4BQ3 A;  1NKG A;  4DS0 A;  4CRQ A;  3AMM A;  3T2Q A;  2RMU 2;  1JZ7 A;  1PIV 3;  4GKY A;  1YFU A;  4OYU A;  3KT1 A;  1JTZ X;  1LEC A;  3DUI A;  2ZXQ A;  4IV1 B;  2XON A;  4XQD A;  4YFW A;  5ANQ A;  2EIG A;  2ARC A;  3UJO A;  5C4W A;  2ARX A;  5FY5 A;  4I09 A;  4DUX A;  3NJV A;  3QAC A;  1GAN A;  2W39 A;  3POE A;  2CDP A;  2XPJ A;  2JG9 A;  4HN1 A;  3TEZ A;  4QGM A; 
#chains in the Genus database with same CATH homology
 1DCS A;  1RXF A;  1W2A X;  5C3O A;  5C3S A;  4XAE A;  1ODN A;  1W3X A;  1W05 A;  1HJF A;  1RXG A;  1OC1 A;  1W2O A;  4RGK A;  1W28 A;  2WO7 A;  1IPS A;  1ODM A;  1BK0 A;  1HB1 A;  1E5H A;  1OBN A;  1QJE A;  2VE1 A;  1E5I A;  1BLZ A;  1UOG A;  2BJS A;  2VCM A;  2VBP A;  1UZW A;  3ON7 A;  3OOX A;  2JB4 A;  2Y60 A;  2DBN A;  2IVI B;  1W06 A;  3ZKU A;  1E5R A;  5C3P A;  1UOF A;  5APA A;  3ZKY A;  1E5S A;  1W3V A;  1WA6 X;  2VBD A;  2BRT A;  1W9Y A;  2BU9 A;  4BB3 A;  1HB3 A;  1UO9 A;  1QIQ A;  2Y6F A;  3ZOI A;  1HB2 A;  1GP6 A;  1QJF A;  1W03 A;  1GP4 A;  1GP5 A;  1W2N A;  2IVJ A;  2DBI A;  2VBB A;  5C3R A;  1HB4 A;  1UNB A;  1UOB A;  1W04 A;  2JB8 A;  2CSG A;  5C3Q A;  2VAU A;  1HJG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...