1UOFA

Deacetoxycephalosporin c synthase complexed with penicillin g
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
310
structure length
267
Chain Sequence
MDTTVPTFSLAELQQGLHQDEFRRCLRDKGLFYLTDCGLTDTELKSAKDLVIDFFEHGSEAEKRAVTSPVPTMRRGFTGLYSMCYSMGTADNLFPSGDFERIWTQYFDRQYTASRAVAREVLRATGTEPDGGVEAFLDCEPLLRFRYFRMAPHYDLSMVTLIQQTPFVSLQAEVGGAFTDLPYRPDAVLVFCGAIATLVTGGQVKAPRHHVAAPRTSSVFFLRPNADFTFSVPLARECGFDVSLDGETATFQDWIGGNYVNIRRTSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEACETOXYCEPHALOSPORIN C SYNTHETASE
publication title The Structural Basis of Cephalosporin Formation in a Mononuclear Ferrous Enzyme
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Oxidoreductase
total genus 79
structure length 267
sequence length 310
ec nomenclature ec 1.14.20.1: Deacetoxycephalosporin-C synthase.
pdb deposition date 2003-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
A PF14226 DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.330 Mainly Beta Sandwich Jelly Rolls B-lactam Antibiotic, Isopenicillin N Synthase; Chain 1uofA00
1W2OA 1GP5A 5C3SA 4RGKA 1OC1A 5C3PA 2VAUA 1BLZA 1GP6A 2BJSA 2VE1A 1E5RA 1E5SA 1QIQA 5C3OA 1E5HA 1HJGA 5C3QA 1UZWA 1HB2A 1W03A 2VBDA 1UOFA 1OBNA 5APAA 2VBPA 1W3VA 3ZKYA 1WA6X 1HB3A 1W05A 2JB4A 5C3RA 1UOBA 1HB4A 2Y6FA 1GP4A 1UNBA 1HB1A 1UOGA 1BK0A 2Y60A 1DCSA 2VBBA 2VCMA 1W9YA 4XAEA 1E5IA 1QJFA 1RXGA 2JB8A 2IVIB 3ON7A 1IPSA 3ZKUA 2BU9A 1W3XA 2IVJA 2CSGA 4BB3A 1W2AX 1RXFA 2BRTA 1W28A 2WO7A 3ZOIA 2DBIA 1UO9A 1HJFA 1ODMA 1W2NA 2DBNA 1ODNA 3OOXA 1QJEA 1W04A 1W06A
chains in the Genus database with same CATH superfamily
4H14A 1CIWA 3GZTB 3I2FA 5FZKA 3FC0A 1OLMA 2JG8A 2VNRA 4LEJA 3UJOA 4BZ4A 4RGKA 4PBOA 4QX2A 1AL0G 2XUEA 3AFKA 1WLCA 3MIDA 3NV2A 4FQ4A 5E88A 4I0WB 3DXTA 1DHKB 3PIJA 1MZ6A 1UN1A 1RUH2 1W0PA 1XNKA 3U4SA 4CDXB 1NA1C 1WLTA 2DCTA 4JKKA 1IPKA 5F2SA 2HEWF 1EUTA 1ONAA 1JN2P 1ULFA 2WFF2 1R1A3 5LBFA 3SCFA 1S0JA 3QH6A 4AEJA 3RZJA 1MS1A 2O1QA 3ENRA 5GLUA 1W8OA 4Q0UA 2JDAA 2DWRA 2DFCA 4Y22B 4L0PA 3EO6A 1QMJA 1LEMA 4LULA 4IGPA 4OI0A 1NQJA 1BEV3 1SMVA 1UX6A 3HD8B 5J36A 3RZMA 2OX0A 4M4RA 1UY0A 1YQ6A 1RUD3 5ACA3 1KJLA 2BERA 2QJVA 2ZGTA 3LQCA 4XQWA 1GNZA 5K4LA 3BOPA 3HJRA 3J26N 1Z7S1 3KV4A 2WS93 4GMP1 2HYXA 4W65A 4XUOA 5HCHA 5HBAA 1NKGA 4YARA 2BFUS 1H2MA 1H2LA 2X05A 4AHXA 4N90A 1US3A 2XXZA 2E53A 2VZTA 4IUGA 4CE8A 4FOWA 3ZFEB 5CFCC 1DGLA 2AR6A 2RS51 2YYOA 3X29B 4COVA 1VBC1 2O8QA 4IE4A 4XZUG 4K40A 3LOBA 1VBA3 1W8HA 1BK0A 1R082 1SCRA 2VTXJ 4YWAA 4MSVA 4YW5A 5IK7A 1AR81 1W6NB 4Q26A 1BBT1 1COV2 3U78A 1PZ7A 1AYN2 4CPBD 4B8EA 1OFSA 3T0AA 4OUMA 5BNNC 5BXXA 2W1SA 3HOBA 1POV0 2ZGSA 1ZYBA 4QPGA 4MG2A 2DUPA 1H1MA 1MVEA 3KZ4C 3APBA 4HZFA 3W9AA 4BWOA 3AZXA 5A7OA 4XUPA 1H6XA 3H3UA 4XETA 4GALA 4AI9A 2J1SA 2ZX2A 3ZVXA 1UZYA 2ATFA 2XL7A 3WSOA 1TNRA 2XBO1 4BB3A 4IEQA 3R6SA 4XF9A 2VXRA 2JWPA 4M01A 3ZFFC 4HPKB 1LCLA 1GWMA 2IXCA 2VW2A 3MPBA 2BPA2 1RUG2 1HQLA 2GH8A 2Y6JA 1ND2B 2MNGA 4HONA 1RB8G 1Q8QA 1DIWA 4MHUA 5I0TA 2RVAA 4OZXA 1A8DA 2JG8C 1GSLA 1ZM1A 2CGNA 4D8MA 4E4HA 5FPAA 2JXAA 1ODNA 3ACHA 4PF5A 1AZDA 1MPXA 4WZCA 5FPBA 1JOJA 1HLCA 3BU7A 2HWC3 4LR4A 4GB33 3P1IA 5FOBB 3LGRA 5GLWA 5LWBA 1LHOA 3T3YA 3AVSA 3MV01 3WP6A 2HWD1 2UURA 4BA6A 1MS5A 1V9U2 2FDJA 4Q4V1 4CDUC 5CAZA 3GCXA 2VUDA 1FPN2 2D98A 2WT0A 1ENXA 5F3CA 4N53C 1ENSA 1EPZA 2W92A 3A22A 1RC6A 5FPZA 5BNPA 5FZ0A 4PF1A 2OUHA 5CVRA 2GP3A 1RUJ3 3W59A 2R0FA 2ZHLA 2ARCA 3LFIA 1JHJA 2BNMA 2ET7A 4AI3A 2WN2A 3AK0A 2Y64A 4FOQA 5T3NA 4UF0B 3LEIA 1ULOA 4HOOA 1B09A 4Y4RA 3R4SA 4N8MA 5FY5A 1E5SA 3FUQA 1V6MA 3VDBA 5G04L 1Y4WA 2WNVA 3ZYIB 4IV3C 4YZ3A 1Q43A 3GALA 3UT0A 2QZ3A 1MZ5A 2P17A 5L7OA 1RMU2 3VBRA 1HDKA 4C0HA 2FDIA 2QDNA 1W03A 3OPTA 3UL2A 2VZSA 1H4HA 1G9CA 2DU0A 3R4UA 4I3GA 3WDUA 4W4ZA 1QF3A 1WA4A 1K5MA 1RHI1 5IFTA 2D6NA 3JCIA 4E8DA 4BOWA 1AHSA 4N43A 2XB6C 3POBA 3ECQA 4BIFA 2HWF2 2YGLA 4CDQC 1W6MA 3GBWA 1X36A 2QQKA 4P08A 4YVSB 4RN5A 4HETA 1S0IA 1NXD1 4GKXA 3U07A 1IKQA 4BLJA 2KM2A 3BODA 4Q4X1 1QJU3 3VHOA 4RR3A 2XUMA 3WNPA 3Q8AA 1HXS3 1TVGA 1JYCA 1MQTC 1X9TA 2D7FA 1SPPB 2RJ2A 1EPWA 2D5HA 1O3SA 4M3CB 3WCSA 4EJRA 2PN5A 4IEPA 4CCCA 4E9KA 4OFGA 3KT1A 1BZWA 1N1SA 1LHUA 4YM3A 3PNAA 1GYKA 2R7EB 3OPWA 1NE4A 1NZCA 1WCSA 4RHV3 1FAYA 3LF7A 3CF6E 3IDCB 4CP9A 2XLGA 5D8AA 1PIV1 1KDKA 1LHWA 2CNAA 1JTZX 4IV1C 4RGGA 2KR2A 3QH7A 5SV8A 1YFUA 1QDCA 4I30A 4DB5A 1TNFA 4GH4A 4HN0A 5F6LB 1X7NA 4FVVA 4GWJA 2R062 3CJIA 1JI6A 4H3WA 4JRLA 1QOOA 4Q0SA 1PO13 4WM7C 4P9XA 2ZJCA 3HN3A 3VD5A 5FAXA 4AFAA 2E26A 1S4CA 2UYBA 1LR5A 1MEC1 3IIAA 2C26A 4A45A 5CBLA 1NCRC 5FCCA 4LO4B 1H8VA 3SEEA 4BQXA 3NJVA 3NKTA 1W0OA 3N36A 4OVEA 2Q5TA 4BXFA 3O5SA 1QXPA 1W39A 3THCA 5FYVA 4EN9B 1O59A 2RM22 2KXLA 1QOTA 1AX1A 3FN9A 2VXJA 1PK6A 5IUQA 4FOVA 3BI3A 5FKBA 4D6RA 4HK8A 3ZMOA 4D3WA 2FMDA 4PT6A 2ZBJA 3LEKA 2ZPXA 1LHVA 3KWVA 2BGOA 2GN7A 5DAWA 4UT5A 2IXLA 5G05L 4NIDA 3THDA 1V6NA 4EE2A 1RVF2 3D8CA 3RRDA 3VDCA 3I2HA 1W06A 3WW1A 2W1WA 2EF6A 2VUAA 3RDIA 1AJOA 2AEZA 2EALA 2OZ6A 4NAMA 4CEWB 5IVVA 2Y6LA 3LDBA 1LKNA 3LCPA 1JU4A 3FJSA 4HVOA 1OSGA 1OURA 1V0AA 4LK6A 2ARAA 2RDRA 5FZGA 4LBMA 5KC6A 1O3TA 1UW8A 5B4XA 3U4XA 4P9YA 3ZDSA 4HN1A 2JX9A 3ZN5A 4Q4Y3 1YJKA 1IS4A 4KU7A 1O7FA 2GMPA 4O65A 5J3UA 5DG2A 2R073 1LGBA 1AR91 5IJRA 5JLVA 2V73A 2IFWA 4P9JA 1QIQA 2QCSB 4WVZA 4LHSA 4Z07A 5C3OA 1FXZA 1VJ2A 5CZKA 1ZRRA 1VBB3 3JBG1 3ZSMA 4QQPA 2YU1A 1HRI2 4J6GA 4P00B 4LHNA 4DUWA 5DMYA 2MEV2 1JZ2A 3WQ7A 1XOYA 4OI1A 3ILRA 1S55A 4ZHNA 3VBUA 2YB7A 4Y33A 4XTMA 3DPRB 3ZN4A 4BM8A 5JWPA 4HBNA 3CZUA 4RFRB 3OD4A 3F2ZA 4CUCA 4BCUA 1LHNA 5FZOB 3LSEA 2WWUA 2YXSA 1WA6X 4QPWA 3OB8A 1G6NA 4N9HA 2PHUA 2B4KA 3T0BA 2X10A 4Q29A 3HQXA 3RWKX 2XJVA 1TME1 1Q5OA 1UNBA 2C9KA 1KRIA 1NA1B 5TSWA 4V2VA 1YC61 2CL2A 2NPIA 5LA1A 2AH2A 3J4UH 5FYYA 4Z1VA 1DQ0A 3H3LA 3ZFEA 1XNAA 2R30A 5K0UA 4LBLA 4F3JA 4E8CA 5IT6A 1L7RA 4JGYB 2ZGUA 1PO23 3A23A 3N9NA 3O0XA 4PBPA 3LOIA 5ISLA 5GZDA 5EPAA 3KQRA 1JZ6A 1W6NA 2ZEWA 2V5YA 4AZZA 1QQP3 2WO3A 1RUNA 2VM9A 2Y6HA 3D3AA 4MVTA 4K21A 3KV6A 3OBTA 4MGSA 1XJAA 2B9UA 3AKRA 1VRH2 2E7AA 5FRAA 3UKNA 3URFA 4XJ9A 1SCSA 4HSLA 1FOD1 2D43A 2FBEA 1S1AA 3LAGA 4L2NA 4ISQA 2E32A 3P3PA 3R4DB 4CTEA 3I49A 4XFCA 3RYPA 1YIFA 2JE8A 5EFUA 4UFHA 2WNOA 4OHWA 2HH9A 1QKQA 5A7WA 3ZYHA 5CFCB 1OVSA 2ZEXA 2IXIA 1VBD3 3CMGA 1RUF2 3CIHA 2R042 4NR1A 2LALA 3VBOC 4QB2A 1VBE1 3PVEA 1GUIA 2JIGA 3CBNA 2DBNA 5SV5A 3BKZA 3I7DA 3FE5A 3WNMA 1PGL1 4LPLA 4P5HA 4NAOA 4J1XA 4CU7A 2HEVF 2MHFA 3OOXA 5D1IA 5K7PA 5FXVA 1QJEA 4CU6A 4P5YA 2VNOA 4IQPA 4YG3A 4EWAA 3FLTA 4O9EA 3WXPA 5LK5A 4LUKA 2J1TA 4ZU4A 5LEJA 3RPQA 2Z4FA 1CX1A 1OC1A 1BEV2 3CLPA 3IN9A 1GP6A 2VZVA 3NJZA 4FO9A 4I2OA 1AR61 4ZZ5A 1EYBA 1S0GA 1AYN3 1QDOA 4CEYA 3VDAA 1W8WA 1VP6A 2F6BA 1B35A 3A7QA 1O5UA 1HIXA 5IW0A 3OF1A 5C8CA 3EJKA 1W90A 2YBPA 2R6QA 5J1XA 1REEA 5LRSA 1WD3A 3N9LA 3N9QA 4P9GA 1WMDA 1GOHA 1L7LA 4MXWB 5FREA 3F95A 5IYYA 2ETEA 1DFQA 4Z2WA 4EN7B 4RGAA 4ARXA 1H2KA 3AL6A 4P9LA 1DQ6A 2JG8B 4UF0A 1E5HA 2VULA 5H9PA 5A7NA 3TWIA 2ZKLA 3I2IA 2A6ZA 4KG8A 4LIUA 1WCUA 4PLNA 4YFWA 3TEYA 3GZAA 1RUG3 1YXWA 1H4GA 2XQXA 5LATA 2QZ2A 3H42B 2W95A 3AM2A 1POQA 2YU2A 1C8M3 5APAA 1D4VB 1W3VA 1WD4A 4CCMA 3RZHA 2AGSA 3UKTA 1DQ4A 1XRUA 4CDUB 4AQ6A 1ZZ6A 1HRV1 5DUXA 1YYNA 2DU1A 4TWTA 3KS7A 4AR2A 1HKDA 1VRBA 4W50A 3U11A 5BY5A 5KHGA 1WBFA 5EJ3A 5JCTA 1WLWA 3ZXDA 4U2AA 2ENRA 4F83A 1YHFA 3MFCA 1X33A 2NMOA 3POYA 5CYYA 4Y1XA 1AUYA 5J98B 4LK7A 1W9SA 5FR3A 4BMEA 1OPMA 4UFMA 1SPPA 5FZHA 1GICA 3KCYA 3W5NA 2VBBA 1UY1A 3GHMA 4MGTA 4LHLA 1Q8PA 3J7HA 1BVP1 4L8QA 5AVPA 3O1MA 2N7GA 4MHRA 1BMV2 1LTEA 5H9SA 3B94A 2VMHA 2VVDA 1CAXA 5DZFA 3UNPA 3DCQA 5FMOS 3WT3A 4Y20B 4FI9A 2BU9A 3WHUA 1POV3 4S2DA 2DCKA 4GB32 2CGPA 2ZGKA 4CDQB 4AOCA 3I3BA 4YGEA 1LOCA 2BWCA 1K12A 1O8PA 1X50A 2QUOA 5LEKA 4CUBA 1VAKA 2RJLA 4YZ5A 3ZXLA 3LKJA 4FTEA 2RR11 1IS5A 2FCTA 4DXSA 5AVAA 1GZWA 3ZXEA 2X5IA 4BK4A 3IB3A 4OLLA 2VD7A 1RUJ2 4JDOA 4B7EA 3MIBA 5M0TA 4XF0A 2ILMA 5JOYA 1UY4A 1ODMA 2A3YA 5A32A 5FYCA 4ZXEA 1OH3A 4GXLA 4O7XA 5H9QA 4OQ9A 1GR3A 2VOWA 2E7QA 3VHRA 3ZYRA 3FHAA 2WSUA 2WN3A 2PHRA 5FPXA 4IV1B 4DUVA 5KXEA 4CEYC 1W04A 2OW4A 2UU8A 5C8CC 1WLDA 2VNVA 2ZMKA 2Y26A 3PMSA 4X8PA 5KHKA 2JENA 3C7EA 4NO4A 2H6CA 2FCVA 2FMYA 4JGZA 3ZR5A 4E4SA 3WNOA 5EYYA 4ES9A 5GALA 4ZZ8A 3SEPA 2A6VA 1QU0A 5FY8A 2BJSA 4P02B 1REFA 4PIYA 4CEWA 3GBGA 5K9YA 1UOJA 5KWRA 1NCRB 1BVVA 2DCZA 2R0HA 3M3CA 5GKAC 4LO7A 5GZFA 2F4LA 5D2AA 3KD4A 1LU2A 2R063 4LKDA 5JOWA 3JZVA 5BUVA 4UW4A 1QJU2 5FMBA 4MGZE 1JHNA 1E5RA 1HXS2 2JDMA 5LRRA 1PM4A 3ZPOA 4A4AA 2KD7A 5CG8A 1KDMA 1ZBE3 3OBZA 1BJQA 3H0OA 2QQPA 3B5LB 2JICA 3ACIA 2VOXA 5GLTA 1RUE1 1F4HA 5FXWA 3VBFA 2V4AA 3H7YA 1VIWB 1BBT2 1F15A 1UOFA 1XYNA 4RHV2 4AXOA 5LY1A 2ADEA 3EXUA 2RM23 2A6YA 2XONA 3IT8A 3DUIA 4XBQA 3MEPA 3VHPA 4B4QA 1PZ8A 2UYAA 3FLPA 4FP2A 3AVRA 4DIQA 5A6XA 4QXCA 1DGRN 2G1MA 3H1YA 3ZN6A 1XBFA 3OBAA 4C0BA 5FYHA 1OF4A 3Q8EA 1PO12 2ADDA 5DAXA 1FI2A 1QXRA 2A5ZA 2WNVB 5FXXA 3ZYGA 1QGLA 3SCGA 3AKQA 3UYJA 5HXVA 4AG4A 2E51A 2XBO2 1LENA 4LBOA 4AQTA 3PJQA 2XWBB 1D4M3 1UOGA 2BEOA 3LEGA 5F3IA 2B8MA 5CKQA 1K5MB 1V6KA 1NA1A 2CHHA 2Z5WA 2ZOEB 4N43B 5A80A 4ES8A 1GV9A 3PTRB 2HWE1 2VQAA 1W6MB 2VMDA 4IERA 4JAAA 3VBSC 3IDEA 3NAPC 5FZ6A 4FFIA 4AVBA 4A2UA 3IM0A 3T1LA 3QD6A 1UMIA 4MX3A 4AFDA 1OUSA 4LBQA 2D3RA 4EN6B 1WUVA 5A1FA 3AL5A 4AGVA 5FZ8A 1QJX3 1ZBA1 4NIIA 3U75A 2OYZA 2UWBA 3N7MA 1UKRA 3NL1A 3WHTA 2HWD2 3WNKA 2BNOA 4FPHA 2ZTNA 3KQ4B 2XJRA 3M70A 4Q4V2 5A1AA 3BPSA 5D8AB 3SCHA 5JZGC 1G9DA 3GHNA 1Y9MA 5J7MA 5C6CA 2RS13 4XFFA 3AX4A 2A3WA 3RJRA 1S0EA 1OQ1A 3GXUA 5ANQA 2RMU3 1F5JA 3CJIB 3GF6A 2WABA 3T09A 5CADA 3FHQA 3TN91 1C3HA 5F5QA 1W2NA 4Q4Y2 5CFCA 3BIEA 3MI8A 2OIIA 3A21A 3I3DA 4H7LA 3AMQA 2R072 4QX8A 5H9RA 2QQIA 1BHGA 1QJY1 4WM8A 1REDA 3ACGA 4LTAA 3UGFA 4QPIC 4M0HA 4I3PA 1LEDA 2PMWB 1VBB2 2TNFA 4AFCA 2JDUA 3NJYA 4M3CE 4XVHA 1AR73 5BNNA 4XQDA 4XACA 3E5UA 1SQ4A 4S2HA 2G9FA 3PL0A 1AL23 4P9IA 5FXZA 1LOBA 4COUA 3SH3A 5L9VA 1EV13 5FP7A 4DEVA 4FAHA 4QKBA 4XILA 1FMD3 1U5XA 4F7ZA 3UGGA 3VBFC 5A3LA 1CJPA 4PJYA 2X09A 4Z92B 2EXHA 3ZFFA 1JMUB 4Y1UA 1W9WA 2QQMA 3IBMA 3DECA 1UYPA 1VRH3 4PQQA 5CISA 2BV4A 3AYCA 4MXWA 3VBOB 2JDNA 4PQ9A 1AXYA 3LPGA 3TBDA 3RYRA 3VL9A 2VW0A 4GWNA 3OEBA 3UESA 2A6XA 3HAGA 5IAXA 1PO22 4QWNA 1NZIA 1PIV2 4JDMA 1VB2A 5I8YA 3HNMA 3HQUA 4HKOA 4NHMA 4XXPA 3IWZA 5CB7A 3AC0A 4FFHA 3H8OA 1RUF3 1ZRCA 1QQP2 2ZGMA 2R043 1ZA4A 2RS31 2NZ9A 2Y6KA 4IETA 1RGSA 4LNVA 3AP7A 3NW4A 3ROUA 1OOPC 4AHWA 5IVEA 4CDUA 3MW4A 2GDFA 4XZPA 5FY1A 4AK3A 1ULGA 3KT4A 4N53A 1GP4A 1CD3G 2HBUA 5C5TA 3VDDC 2Q30A 4XPVA 5FYTA 2VMIA 1Y7BA 2WZR1 2Q4SA 1RUI1 3VBUB 3MW3A 1UIKA 4OULA 4ASKA 2YHJA 1TZOA 2YROA 5JI7A 3WOGA 4AE2A 1KITA 1EUUA 3KSCA 4Y1VA 3AYDA 4I0BA 1H9PA 1UY2A 4KWJA 1EAH1 1K5JA 3BTAA 2FHRA 2JDHA 3I3QA 3E97A 4CU8A 1VBD2 4AVCA 1APNA 1E5IA 1A78A 1FNZA 3JD73 1UWWA 5L19A 4YM0A 5LBCA 1C57A 4TTGA 4IV3A 2QE3A 4UFLA 3HNBM 4KWKA 3INAA 5E6HA 1FT9A 4HLTA 3M4FA 4XJZA 1IPJA 3OGJA 3POWA 4R4XA 5A3NA 4QDQA 1LOAA 2IXHA 2JDYA 2JECA 4MO3M 3VBHC 2ORZA 5AC93 4Y20A 5JVVA 1YRZA 4P9WA 1H1AA 2J1EA 5K0UB 4AGRA 4G4FA 4YRDA 2GC1A 2CTVA 1V6OA 1JS9A 2D6MA 1IZ3A 2VC9A 2VZOA 4JC1A 3CL1A 4TN7A 4CDQA 2XGXA 5A3PA 2W52A 1CZSA 2GZWA 1HN0A 4WM8C 1DDLA 2HWB3 2RV9A 4MGYE 2WQZC 3PVOA 3ZOIA 1YI9A 5JIUA 2A73B 4XC9A 1RUOA 3SITA 4Q27A 1MQTA 3J8F3 5CU1A 5DUVA 3WLUA 4BISA 1RUC3 4Y26A 3LA2A 5J96B 2GC2A 2VUCA 3LD8A 5ERLA 3BGAA 5LBEA 1FV3A 5FUNA 2E33A 4Y3OA 1MVQA 1YQ2A 4Q4W3 3JBG2 2XVLA 4CCOA 4IV1A 2W0XA 1Z78A 4LKEA 3WR0A 2PLV1 3RZKA 2JE9A 5A7WB 3TEZA 1CZTA 4NE9A 1W8TA 4LKSA 1Y9QA 5KHIA 4WM7A 5FBZA 1C8M2 3FBMA 1NT0A 4K1YA 1UKGA 1NCRA 3QACA 1GQHA 2A71A 3ZMNA 4KU8A 2QBXA 2RJKA 1PVC3 2ZKNA 2K2SA 4E4DX 1LGCA 2LM3A 3NV4A 1UZVA 3U14A 1JOPA 3DKQA 3ME2A 1MS0A 5CKNA 2AZ5A 3WQBA 3FUOA 3B69A 3PUAA 4IEOA 2Y8KA 1F5FA 1ASJ1 2JDPA 1WBLA 2A70A 4L99A 3B00A 3MBWA 2ZA9A 4LO5B 4UW5A 3K3NA 2BFUL 5A3MA 2WL1A 4R4ZA 3ES4A 5DZEA 2I45A 1CWPA 4CEYB 3MF9A 5T52A 1YWKA 1B35B 2XLAA 1Q3EA 3WQ1A 4AF9A 5C8CB 2RDSA 3MLJA 1A34A 2WNUC 1R091 1U5YA 2YC4A 5I0RA 4KG0A 4NHYA 2J22A 3JQWA 4WV8A 1G86A 2VH9A 4CP0A 4CZSA 2ARBA 4MGKE 4TSVA 5FZMA 2WO2A 4YZ4A 5C7GA 5FZ7A 1SLBA 2QKDA 3ZYPA 4AEMA 4W6YA 2QQWA 4FT8A 4XURA 2Y6FA 1NX9A 3QLQA 3AB0A 2YBSA 3K51A 1DQ2A 5BV6A 3SISA 3S30A 2V72A 1NAEA 4FQZA 4XFBA 1O4YA 3PHMA 4R8HA 3CDZB 1GZTA 4HANA 4LO8A 1TE1B 1S0FA 3PLQA 4I09A 4CXXA 3M8LA 2P5BA 1WGPA 4QT6A 1I3HA 2G4IA 2VUJA 2WQ8A 4XJUA 4NRQA 2K9ZA 4QX0A 3MZHA 1Z7S3 4NRMA 4GMP3 4AW7A 4AI8A 4XJ8A 4ORFA 2OXBA 4YYOA 4XUNA 2C5DA 3NNJA 2BOIA 4FCAA 3B7MA 4AQSA 5BNOA 5B4NA 4ZU7A 1G7YA 1DQ5A 3V0AB 5IWFA 2AACA 2QQLA 4KGQA 1N1VA 3ETQA 1O8SA 3TB0A 2RE9A 1OLME 1YO8A 2XHKA 1DYKA 2RS53 4M3CF 4EN8B 1VBC3 1MS8A 4FXGB 4XUQA 5FMDA 2DUQA 4OI4A 4JHTA 1DBNA 1AR83 1W8NA 2PYTA 2WAAA 5I0DA 3C7OA 1HN1A 2XVGA 5DDJ1 4YVWC 1BBT3 2AREA 1SHWB 2R32A 2VZPA 4LIVA 2WJSA 4NWWA 1PNGA 1AYM1 1MZFA 1OA4A 2BGCA 4HK9A 5EYXA 1MS3A 3ZXFA 1CAXB 2ZAHA 4XUTA 5LA0A 1UO9A 1KEXA 1LNSA 5I8TA 5FYIA 5A70A 4UBHA 3RG0A 4FBFA 5FZ3A 1VMJA 3HNYM 4LKFA 3PU3A 3AP4A 2VMFA 4RS5C 3IZOA 1KS4A 2OPWA 1VPHA 3O7OA 4Q1PA 3WDXA 1ZBE2 2WSVA 3M3OA 4KBBA 2XH6A 4QGNA 2XBO3 1TMF1 3OEAA 2ZABA 3OUHA 1GZWB 1VB4A 2X5IB 3DGTA 5FLHA 4YFZA 1OI6A 3DKWA 3P3NA 4ZY9A 2PHFA 4RQPC 1C1FA 3CZJA 1URXA 3NRUA 2E6VA 1K3IA 5T5PA 2WFPA 1AX0A 2WWJA 5A32B 5DAQA 4TXWA 1VE0A 1RUH1 3M7AA 1GWKA 3ZXAC 3WF0A 2DCJA 4GAZA 4YLZA 1KFXL 1W9TA 2PQSA 3IAQA 5F5AA 3D0JA 4QHBA 1ZZ9A 5JI9A 3LE0A 2WFF1 5ABJC 4JTNA 3AJYA 4NROA 1SFPA 2G9ZA 4JGZB 4OUEA 1ALYA 1OVPA 2VGDA 3MF6A 5LBBA 4E27A 1D4M2 2HWD3 1QXJA 2UWCA 4IL7A 5FJKA 1ZRFA 3A4UA 4Q4V3 3AMPA 2K0GA 1W6OB 5FZLA 3VBOA 3KCXA 1NE6A 5FO8B 4QPIB 3E6CC 1SEFA 4AEKA 1HQNA 1SZBA 3QCWA 4HVRA 3B93A 1NY72 1LAJA 3NQHA 4R9DA 1CVNA 1ST8A 3AZWA 3T0DA 5FY4A 4DXRA 4QMAA 1LESA 1YNAA 1JBCA 5F5IA 3BIWE 2I74A 1DGWA 1LULA 1QJX2 4LUMA 2CWMA 1IG3A 3POFA 5LW9A 1Q8OA 1K42A 3VBFB 1O6UA 3C2UA 4CDWA 3ABZA 3FX3A 1RYYA 3W20A 4M0NA 4YGCA 3ZR6A 5CG9A 1R081 2Z69A 5FZ9A 2L9LA 2RR12 3LIGA 5GM0A 5BNOC 4NHKA 2GN3A 2YY1A 1COV1 4YW3A 2RS12 2XLFA 4A7YA 3TEWA 1W9YA 1RHI3 3W5MA 4B29A 2XMLA 2ZEZA 1S2KA 2EA7A 3ZN6B 3ZSEA 5KC5A 5JOZA 2RMU2 3R05A 3CJXA 3C3VA 1QJFA 4XW3A 3LDKA 1AJKA 2MPFA 2VQUA 1SG3A 2VR4A 3NNLA 1N47A 2PHLA 3N4MA 3ILNA 3RWNA 4KL1A 4Q4X3 3LZZA 3MDPA 4FOYA 3AJZA 4RYDA 5J09A 3C7FA 4AEDC 3ZFGC 2PAKA 3HT1A 5I0SA 3N7LA 3M1HA 1ND3C 5FZFA 1S0BA 3BPZA 3JB8A 3UGHA 1GNYA 2IFRA 2Q8DA 1Q56A 3HEIA 1AR72 4QGLA 3S7IA 2UY8A 5IHRA 2X29A 3C7GA 1WW6A 3MO4A 3VV1A 1FYUA 2GP5A 3EMRA 2GNTA 1HV0A 1AL22 4XMAA 1JYTA 1D2SA 1PIV3 3WW2A 3WW4A 1UAIA 3ZYBA 1EV12 4LBQB 4DOUA 1FMD2 1OFNA 4XIKA 5A7PA 5C70A 1O3RA 5F32A 2IXKA 2GU9A 1C4RA 1HW5A 3GBFA 4QKNA 2W2IA 5JXHA 4LLFA 3VHNA 1JZ3A 2E63A 1YI7A 1SBFA 3VZMA 4KBZA 4EV0A 1C8NA 2VZ1A 2WO1A 4HMZA 1MEC3 1U5IA 1ZNPA 4YPJA 4UXAA 3QOPA 1PZ9A 1W2OA 3POSA 1DYPA 2YUEA 5FWEA 1U5ZA 2YPDA 3E6DA 1V9U1 2JG9C 5F6KA 1FPN1 2W3JA 2XJQA 5C3PA 2A3XA 3MV11 3OSDA 4XFGA 3NSTA 4AGGA 4C91A 3WF2A 4QDSA 1GOGA 3NNGA 3ZSLA 2YZ4A 2PHDA 4EYUA 2YC2A 3SKVA 1OQDA 3IIIA 1CAWA 1LOFA 2EXIA 3NO8A 4PLMA 1OKQA 1D0HA 4BQYA 2PA7A 4WM8B 2ZEYA 1FNYA 1MS9A 4C90A 2YGMA 2RDNA 3JU9A 1N1YA 1NLSA 4QKDA 4XOGA 2Q8OA 5JXIA 5EV7A 1K45A 1VAVA 4CSWA 5BNNB 2XVKA 1RMU1 3NNMA 3CU7A 4FPOB 3P5BA 2OPKA 4URTA 3SKJE 2VBDA 3CQOA 4DQAA 4EZ4A 1GFF2 4IESA 1UYZA 1TQ5A 2ET1A 2FQPA 2R1DA 2ZZQA 3E1F1 1N3PA 4JKMA 4SLIA 5T5LA 1I1EA 1OXCA 3L2YA 5FYZA 4M00A 3T1MA 3JD72 5F3GA 4CDWC 2JDZA 2HWF1 2D3SA 1XB9A 3ZFFB 1J3PA 3WG1A 4Z82A 1HB3A 5I8SA 1GBGA 4IW3A 4X6RB 3VZNA 5JPMB 1XC6A 2PFWA 1V70A 3ALQA 3RNSA 3Q8FA 2DDUA 4Y5Z0 1AR93 4Q5OA 3BTZA 2LRPA 4XDPA 5AC92 4DZGA 3WF1A 2NN8A 1YQ5A 4GJYA 2W39A 3POIA 4XFHA 4Y5TA 4MZUA 3JBG3 1UCXA 4K3UA 4CPBA 1OT5A 1O3QA 4M4PA 3GYDA 3EB7A 1DCSA 2B46X 1HQWA 3POEA 2HWB2 3BN6A 5JR7B 4BIOA 3JQXA 4QQ2A 2VY0A 3OJBA 3AFGA 2GAUA 3LDRA 1UIJA 3W21A 2VPVA 1JYXA 1RXGA 1DZRA 1WW7A 2JD4A 3J8F2 3RSJA 3VKMA 3SLIA 4BPZA 1RUC2 3SNMA 1XE7A 3N9OA 4N53B 4MOAA 3ZKUA 5DAVA 2EVXA 2VMCA 3I2DA 1JYVA 5T5OA 1TME3 4D69A 1O5LA 2WNUB 1D0GA 4Q4W2 1SLCA 2J1AA 3LEMA 1PX3A 4OI2A 2CSGA 4UW6A 4UWDA 3WCRA 3V0AA 2JKBA 3O1RA 1ZRDA 2D6LX 2SBAA 3VD3A 3O0VA 4FPKA 2V09A 4EWEA 4Z8BA 1YQCA 1SLTA 4IE0A 1DLCA 3N3HA 3OUIA 2JDKA 2BTVC 2OS2A 5FZBA 4GMP0 4IV3B 5LY2A 4Y1YA 5FOJB 2FDKA 2VCCA 4OYUA 3WG2A 1SACA 4WBBA 3MLLA 4XHBA 2XG3A 1ZZ7A 3O0WA 1DU3D 4ZU5A 1XU2A 3C7HA 3SXWA 5A3UA 2BQPA 1RTVA 3RZLA 1PVC2 2ES3A 3OYWB 1BCXA 3I2OA 1BK1A 3ZXJA 1RVF1 1J83A 1UZ0A 1XXNA 3WNLA 2O14A 4RL7A 4F8AA 3O1PA 1FOD3 3GM8A 3VBSA 1LOFC 2P3YA 3NAPA 5BPXA 4CP1A 5CFDC 1Z0HA 5FUPA 2WZPP 3CO2A 3V64A 3ZYFA 4GJZA 4HKLA 5KXDA 1WMFA 3Q9OA 4HL0A 1G9FA 1MQTB 3WINE 4Y24A 1NYWA 3I54A 1H8TA 2RS32 5FO7B 3RJ2X 1VBE3 4K8FA 3SC7X 1NCQA 1YQ8A 3JXSA 4YVWB 3RFRA 2QNKA 2W94A 2WR9A 1G8WA 2XQRA 3AKPA 3WUCA 4AAPA 4COYA 5JZGA 2BWAA 2F4PA 2Q1FA 1ND2C 2WAOA 1NUKA 2PAMA 3WNXA 3K4AA 1T6BX 5LASA 2PXJA 4NOTA 1HJGA 2QQUA 5CNAA 5DUWA 2EIEA 4MH0E 1HRI1 1ZX5A 1UYYA 3SH5A 2VTXA 2VCAA 4RS5B 4TLGA 5C5UA 4WM7B 1W8UA 2B42B 3S5AA 1IS3A 1MZEA 2DTWA 5A7SA 4YW4A 2QQOA 1AR63 1SLAA 4KI5M 5FYBA 2XKPA 1W6OA 2VG9A 2VMEA 2WUHA 2DF7A 3EHKA 1Z7S2 4QPIA 4WZFA 1I6XA 2JJ6A 2VL4A 2BP6A 4W8JA 2ID4A 1UF2C 4DMIA 1F8VA 5FJHA 4ARYA 2EXKA 1ULEA 1JH5A 5A1LA 5HV4A 4OHVA 1QNYA 5F37A 4IE6A 5LA9A 2H0BA 2RS52 5CA6A 1OQEA 1VBC2 2EAKA 4QXHA 5FMOL 2WYFA 1XYOA 3B02A 4GULA 2VZUA 3MLKA 4IEZA 1AR82 3ATGA 2X8KA 4HVQA 1EY2A 4HKWA 1S2EA 3WF4A 3G7DA 1PNFA 4EN0A 3H8XA 2XR4A 4CXYA 3GJAA 3ZXKA 5FZ4A 3I2GA 3VB9A 2V5DA 2ZGPA 1JODA 2HYKA 3VKFC 3NKGA 4CA9A 1JXNA 1HRV3 3USSA 4QDRA 4KNCA 3POGA 5C9AA 3K4ZA 2WIIB 4JZRA 2Z42A 2R1BA 4FPYA 4I0AA 3PU8A 5FQ0B 4XMIA 1CR7A 1W6PB 1SDDB 2B9VA 2PLV2 3WDYA 4CUGA 4WVWA 4XCAA 4YVSC 4BH9A 5FZAA 1ACCA 3NNFA 1QOSA 4DY3A 5A6ZA 1DZTA 3D5OA 1DYOA 1OUXA 2QQNA 4YG6A 3RVHA 3T2OA 2QTWB 1CAVB 1OOPA 2Z2SB 1DQ1A 5DPNA 4K6BA 4URAA 1ZREA 4IEVA 4META 2ZMLA 3HMYA 3I4IA 1QY4A 5FY7A 4AL9A 1IHMA 3MW2A 2A7AA 4D7TA 3ACFA 5BNOB 5I91A 2CGOA 4NUBA 1I9RA 3VDDA 1Y43B 3SQOA 4FPCA 3H8RA 4H55A 2OUJA 4XAAA 1R1A1 4N9IA 2G9GA 1ZVFA 5C4WA 2RDQA 5DABA 4ASLA 1H8TC 4MADA 2VZRA 2BNNA 3PJYA 2DVAA 2WC2A 1NCQC 1GP5A 1ENRA 3ORJA 4NVPA 1X8MA 1BEV1 2RR13 3ES1A 5DN2A 1BLZA 1J3RA 4QGMA 2J1UA 3ZFGB 2K46A 4AEDB 1RUD1 5ACA1 4Q8KA 1UX7A 1ND3B 2H0VA 4JHZA 4EWDA 3OBRA 2OQ7A 5FMCA 1W0NA 2Y33A 1W9FA 3VBHA 5LA2A 2WS91 4UI9L 1LECA 2FCUA 3RI8A 2GNMA 3PIGA 1XNTA 4Q2FA 5AFBA 3J7LA 2E31A 5FPUA 4PI0A 3V0BA 5EP9A 1GZCA 5DAPA 2ERFA 3FFQA 5LK7B 2DVGA 5GZEA 2Z79A 1DG6A 3OGSA 5JPNB 2GNDA 4MUVA 1UZWA 1VBA1 4XQ4A 2LTNA 3ZX7A 2XWJB 1JW6A 5KR7A 3GDBA 5FKCA 1RHI2 1GOFA 3N7KA 2GMEA 4QB6A 4XDOA 4FTBA 2DYCA 4IGQA 2H6BA 4QU2A 4GWIA 3DYMA 2J1VA 1I5ZA 1KS5A 4I02A 1XU1A 4IEXA 5FP3A 4XCBA 5C33A 5HCFA 4Q4X2 5C3RA 4RSUA 5JSPA 1UOBA 5CKMA 3WY6A 4DXZA 4YZ2A 2OKXA 1U12A 4AI2A 1X82A 2P1BA 3VD4A 3UJQA 4XYXA 4BQ2A 3CHXA 3K3OA 1RUE3 5C9AC 1CIYA 5LZ6A 2ZACA 5LB6A 1KD7A 3FFZA 1GKBA 5JAXA 1CQ9A 4YZ1A 2VCMA 4YW1A 3DL3A 1AYM2 4XAEA 2P6HA 3MHZA 4K20A 4QX5A 2W5FA 4BJ0A 4FFFA 1W8ZA 2UY9A 3BVCA 2D44A 4RFT0 2IVIB 4PLOA 4BHPA 1DF0A 4DO0A 5JDBA 1JZ5A 3S5QA 3MIHA 3BU0A 1KJRA 5FPLA 4JRAA 5T5JA 4DPNA 3LA3A 2HWC1 5A3OA 4GB31 2IVJA 5HCBA 1LRHA 3ZPYA 4CDWB 2ZGQA 1MEC2 2VECA 2AC1A 3ILFA 4ZXKA 3RMXA 4QQOA 1TMF2 4GD4A 3OY8B 1A3KA 2A75A 3S57A 1N1TA 2GMMA 3LFMA 2WNUA 3D0SA 5C4WC 4E2GA 1QHDA 4Q0QA 4ZS3A 2SLIA 3K4DA 1JZ4A 2W68A 4AQ2A 2HWE3 4AVAA 5E89A 1RUJ1 2P3KA 1LODA 2DBIA 4IXLA 5I0UA 4IGOA 3H3ZA 3S0MA 2IXJA 3IAPA 3O1TA 4JTOA 4QX7A 1MS4A 2WWSA 3I8TA 2Q1ZB 4A6OA 2C9AA 4B7KA 4HSJA 2VQ0A 4NIGA 2XOMA 4O61A 2PELA 3ASIA 1IKPA 2BVBA 4R52A 5EHDA 2D6KA 4JGYC 4V2WA 1JOBA 1ZBA3 3WP3A 2D5FA 3PVBB 2BBAA 1CPNA 2DURA 5K8SA 2CV6A 4CP2A 3OYWA 5DG1A 2P2KA 1X8EA 3VKNA 1M06G 4NHXA 3ZSKA 5C71A 3EQEA 5FK7A 5HI0A 5F8PA 2IZWA 1W8FA 1LOEA 4LBJA 4ZKTB 5D21A 3N7JA 1A6CA 1PHMA 1OA3A 4K7JA 3TN93 5IK4A 5HV0A 5JXGA 3NV1A 2WA3A 3POJA 3OD0A 1UL9A 2BW8A 1SLLA 1QJU1 4LMFA 5EWSA 1AR92 1FATA 1QJY3 3WDWA 3WNNA 4E4ZA 1HXS1 3AKSA 4QX3A 5A33B 4YVWA 1VR3A 3WW3A 4LITA 1YEWA 4O9GA 1H0BA 5FZEA 3HR9A 4CCDA 2VQTA 2CAVA 2VVEA 5F39A 2BZDA 4RHV1 4S2GA 3AMNA 4YGBA 5CIRA 2XJUA 1L3JA 4RS5A 5BNQA 1CAWB 3BUCA 5ANNA 3V56A 1WCDJ 2D3PA 1CPMA 2EXJA 2ZGRA 3VZLA 5CFDB 4Y5SA 5HXMA 1JZ7A 4KH9A 1XYPA 4INDA 4YSFA 3JB4C 2VOKA 1PO11 2WRAA 2ZX4A 3AZVA 3T30A 4PIZA 4XEZA 2WKKA 4DFSA 1OLQA 2JD9A 4RQPA 1TME2 4XF3A 1OD5A 4PDWA 4MXVA 3T2PA 3AP6A 5FY9A 4B3NA 5KXBA 3KHCA 3OGVA 4QD2A 4FSJA 2P34A 2Y60A 4XBLA 4PCRA 2R49A 2NM1A 4WVMA 2WYSA 4HXCA 2LW8A 4JKLA 1S0DA 3LA7A 4UYBA 5ABJA 3KMHA 4NMIA 3ZIXA 3OUJA 1V6LA 5KBFA 2FDGA 1F4AA 1ZZBA 1OH4A 2ZZJA 3OGRA 1WZXA 4UFKA 2VJXA 1IQAA 3GZEA 3PUIA 2ZX0A 2RS33 4TLFA 3E6BA 3OPZA 2GNBA 4EROA 5IFPA 4QM8A 1CX4A 3KGLA 3TNQA 4CRQA 4DRRA 1F31A 1W3XA 1IS6A 3BTXA 4BMBA 1XQNA 3IDAA 5E8AA 1JUIA 1VMFA 5IATA 1FOD2 3HBKA 1RITA 2CDPA 4FFGA 3M3QA 4UBGA 2WZR3 4ISRA 1YCIA 1RUI3 5L73A 5FQ0A 2W9XA 4LLOA 5FYUA 3LSDA 2YDEA 1W6PA 5JSOA 2GC0A 1EAH3 3KLSA 1BQPA 2LROA 2NYYA 1JZ8A 4P14A 2P4EA 1W6QB 4FPLA 4XIOA 4IEWA 5A6YA 3K46A 1VBE2 1CAVA 2WA4A 4Q4Y1 4LA3A 2WT1A 2EIDA 1WW5A 4QQLA 3VKLA 3VN4A 4QXKA 1PGL2 4LJHA 2R071 3W58A 4UAPA 1UXZA 1IGOA 3ACLA 4XHXA 4COWA 2P3IA 4KQ7A 4QX1A 3GCWA 3BTYA 2FDHA 4HT1T 1VBB1 4LO6B 3R0RA 3UK9A 1RL3A 1TG7A 4MV2A 4BQ5A 2HJIA 2HLEA 3E5QA 2IUWA 4PHZA 4QQHA 3WVJA 1YIPA 2C4XA 3S7EA 2YG0A 1AR62 1AXZA 2AENA 2B39A 5FPVA 2B45X 3A0NA 4E2SA 3EYPA 1NQDA 3ZFGA 4AEDA 1RINA 1GQPA 2HKXA 1OF3A 1ND3A 4UW3A 1PGW1 1CZVA 1XPWA 4B4PA 3A0KA 4W6WA 5T54A 3WV6A 4ZS2A 2NP0A 3OG2A 2PHWA 3VBSB 1AVBA 4OHYA 2WDBA 4NWVA 1ZZCA 3NAPB 1ZRIA 3NJXA 1LJ7A 3FMGA 4QPGC 2B7YA 2CWSA 3D6EA 4JVAA 3TOJA 4BYYA 2ZHNA 4UFJA 5C3QA 5FO9B 2PLV3 2XHNA 5E1RA 2C1FA 2EIBA 3O12A 4OZOA 5FP4A 3AYEA 5IVCA 1PO21 1XNDA 1G9AA 2QFEA 1OBNA 1H8TB 1WWYA 4HG6B 4PDWC 1NLRA 4XTPA 3VLBB 5F9TA 1BXHA 2FD8A 3MICA 4LBNA 1NCQB 2R16A 3MFAA 2AUYA 2VBPA 2OZJA 1YUDA 1IG0A 1QQP1 4E2QA 2DVFA 3KV5A 1HRV2 3HBZA 2GH2A 3OCPA 5JZGB 3MYXA 1C5IA 3PURA 1W05A 1YFXA 2X53S 5DZGA 4Y4YA 3VGIA 2Q1MA 2VZ3A 2JG9A 2HEYF 4TYSA 3J9SA 3MGUA 4UOJA 5IVBA 1JYIA 1KFUL 1WCKA 1WMEA 5A3TA 2RHPA 2TEPA 4A7ZA 5FBJA 2C24A 4CUAA 2Y38A 1ASJ3 2YBKA 3KF5A 2HBTA 4GIQA 3UKVA 2VMGA 3PMEA 2ZAAA 4D7YA 2WNEA 3I2JA 4COZA 5FV3A 4CCLA 3IPVB 4BDVB 4BQWA 2DTYA 4BQ1A 5FDBA 1VBD1 2J42A 1NLQA 3SMHA 1R093 1WCQA 4CCEA 1CAUA 2PHTA 1U0AA 3S6PA 5FWJA 3O1UA 4FPFA 4XFAA 2PQQA 1QH7A 3ON7A 5BNPC 4Q0VA 4NIHA 3WF3A 5JR2A 3ETPA 3WDVA 4LBQD 3PTYA 2VCBA 1SFNA 3AXEA 4ZPIA 1H2NA 2OA2A 4G9SB 4NHLA 4AHZA 1OKOA 3GJBA 4DS0A 2D97A 2C6SA 4DINB 3K2OA 3DF0A 4XDQA 1G9BA 2D93A 4A6SA 4L97A 3OY8A 2WNVC 4KWLA 3NWKA 2ARXA 4XE9A 2CAUA 1D2QA 5L7OC 1AYN1 1NG0A 3USUB 3DEMA 3VBRC 2BBVA 1XSRA 1HJFA 1J1LA 4G3YC 4BQ3A 5C9AB 2CYFA 3GZUC 5FP9A 2VOVA 2W1UA 4CDXA 2NMNA 4QM9A 1K5MC 2EAAA 4AVVA 2VO5A 1N3QA 1UQXA 2Y34A 3ELNA 4N43C 4AHYA 1STMA 4IE5A 2VNGA 1Q8VA 4J1WA 2VTFA 1XE8A 3VUOA 1CGPA 5IK8A 4YW6A 4ATEA 4RR3C 3PUQA 4Y22A 1OOPB 2W1QA 1NOVA 3ITQA 3AP9A 5DDJ3 5F2WA 1RUG1 4BU2A 4OMCA 1C1LA 1AYM3 1RJ8A 3DV8A 2WQ4A 1C8M1 1V6IA 3VDDB 3I59B 3TAYA 3AYAA 4CCJA 2WINB 4LQRA 4KMQA 4DRVA 1YFWA 5DUUA 5C4WB 2GC3A 2VVFA 5D8AC 3VKOA 5IAVA 4Y1ZA 3ZM8A 4QAWA 1LOGA 1VLNA 1YFYA 2VE1A 4N7IA 4CVUA 4Q1RA 1UU6A 4GH4C 4QKFA 1OHFA 3KHBA 2YC0A 2V4VA 5JIAA 4PIXA 4A3XA 4A44A 1ULPA 1PMJX 3CJIC 3UV9A 1JYNA 5A33A 4JQTA 1TMF3 2C0ZA 1RUE2 1GWLA 4YM1A 3HN1A 4AVSA 3AP5A 3O1SA 1FX5A 3Q8BA 1MACA 1UZZA 2I07B 4OUSA 3T4VA 4FAGA 1YJLA 4MGIE 3VBHB 4YNIA 2AEYA 1LU1A 1T6GC 4DY5A 3I2KA 1HV1A 2J7MA 1RUH3 4WVVA 2QDRA 1LB2A 2XJSA 1DLLA 3N35A 3THTA 3PUSA 1M4WA 1PMHX 1EP0A 1E57A 2NQYA 4BE3A 4C8DA 3V0BB 2JB4A 1UY3A 2W46A 2WFF3 4H2AA 1PK6C 2ZHMA 4JCKA 5CFDA 3RZZA 1CJDA 3FL7A 3HT2A 1POV1 4NJ4A 4B1LA 3PUHA 1RJ7A 5GZGA 5FZCA 3ZDVA 1YLLA 4MLOA 1SBEA 2OQ6A 2YMZA 4LE4A 2DVBA 4B1MA 4GWMA 4LXLA 3HQRA 4QHOA 5E16A 5FY0A 4EQVA 1J59A 4HPKA 3MIFA 2HWE2 5FUIA 3IMNA 4GZ9A 2DUOA 1Y3TA 3HWJA 4IE7A 4XBNA 3GGLA 3T08A 4B4RA 2QVSB 1ND2A 2JB8A 2IWGB 3K75B 3MUY1 4GQ7A 2BYVE 1GZ9A 4I01A 1AX2A 1R1A2 5KHHA 4Z2AA 3NMBA 4YM2A 3G6JB 3IDBB 1J3QA 2W87A 3T2TA 1PX4A 3N9MA 1QNWA 1ZBA2 2KA3A 4FPGA 2XJTA 5AFEA 1HX6A 2PAEA 5GZCA 4LT5A 2JE7A 1UYXA 3BOWA 4BQ4A 2RG4A 3GNEA 4JQRA 4CDXC 5LCWL 2BRTA 1R083 4LA2A 2CU5A 1SDWA 1UMHA 3LB9A 4NPLA 4RD7A 3SHRA 5JUVA 4D0QA 1COV3 1TEIA 1RUD2 3WUDA 1N3OA 4IEUA 5F5CA 5ACA2 1DGWX 2PHXA 3KB5A 5KHJA 3L9JT 3KVBA 2WS92 1ZA7A 1FV2A 4W6XA 3TN92 3LWCA 3TRSB 3WG4A 3KCCA 3MIEA 3KF3A 3TYJA 3MPPG 3VBUC 3WDTA 4DEQA 5BYNA 2VW1A 1W6QA 2R061 1CN1A 3D4KA 4NPRA 2B5HA 2W47A 5IVYA 2FDFA 1LGNA 1QJY2 4LBKA 2Y6GA 1V00A 2ZCWA 1C5HA 5C8WA 5F1RA 4L11A 1ZBE1 2XDVA 4BLIA 2WZEA 1AXKA 4CXWA 4DUXA 4AI0A 4NRPA 1ENQA 4AVTA 1IOAA 1KGYA 1VBA2 2P6CA 3AKTA 5C3SA 3OTFA 2D6OX 3KM5A 1W2UA 2VAUA 2RM21 1XNCA 1US2A 4PI2A 4H7MA 5J37A 3ZFEC 3P6BA 5K0UC 3ZSJA 2Y0OA 4CYDA 5IVFA 1O91A 2ORXA 2WLQA 2O0OA 4YVSA 5FYSA 1XSQA 3OGGA 1ULDA 1NXMA 3AMMA 2NLRA 5FLJA 3ZIWA 3O1VA 2QQVA 4IDZA 3PVNA 2JEMA 1SLIA 1D4M1 1UD1A 4YG0A 5IVJA 2FZ2A 1V9U3 1HB2A 3I97A 5L9BA 4D7SA 5B2GB 4Q0PA 2XL9A 1FPN3 4M3CA 4KWUA 2LUWA 4JDNA 4V1PA 1UPSA 1J1TA 1J58A 2DV9A 3WQ0A 3NV3A 2CDOA 1T2XA 5GJ6A 4LOSA 3ZLIA 5DQ0A 1NY71 4NIAA 3ZKYA 4OCTA 5JMCA 2ZHKA 2TUNA 3SH4A 1DGRA 4LHKA 1OD3A 3RI9A 3CNAA 5FTTC 5JXJA 3DYOA 4K8RB 2HWC2 4QHZA 4ATFA 1XNBA 3H9AA 1QJX1 3NVCA 3I3MA 3RZGA 4OHXA 3BYWA 3THPA 1D7PM 4XJAA 3V65A 1H9WA 3VZOA 1HB1A 3FWEA 3UETA 2AYHA 5HCAA 2OVUA 1C28A 2WZR2 3JUUA 3WEZA 1RMU3 1RUI2 4ITCA 2OT7A 4YW2A 2VOTA 4UFIA 3RMYA 3T4HB 3TEXA 2BUKA 2ZGLA 4FPJA 3FZ3A 2MEV1 2RS11 1EAH2 3KT7A 3H1WA 3DN7A 1IQDC 2PTMA 2RMU1 4QPGB 2HWF3 4S2FA 3IPVA 2ZMNA 3AXDA 4JV4A 4NPMA 3B01A 3J7MA 5DXDA 2W91A 4ZONA 2EIGA 2BDRA 4RQPB 1IPSA 1BKZA 2VU9A 4PDWB 2WLPA 1H30A 1H6YA 1B35C 3H50A 5JOXA 4OQ8A 4X6QB 1OPOA 2A6WA 3VZKA 3WX5A 4WVMB 5FYMA 1W2AX 1RXFA 3H8UA 1AR71 4C1XA 5EZWA 5FZDA 5ABJB 2BGPA 1GLHA 1R64A 1MR5A 2ZX3A 4OHZA 1WKYA 1AL21 5FIXA 5F7UA 1PM7A 4L9BA 4R9BA 3ST7A 4QU1A 1EV11 4R9AA 1FMD1 2XKOA 4AFBA 2BVVA 5CEHA 3QBQA 4R9CA 4XF4A 2VZQA 1GANA 1VAMA 3USUA 4AWDA 1Q8SA 3LIHA 4LE3A 3C8XA 4CU9A 1L7QA 2Q0AA 4DNYA 1VRH1 2YV8A 4Q8LA 3VD9A 4QXBA 2O8OA 2W08A 3N9PA 4XXAA 2GSYA 1Y9GA 3O14A 3AMHA 2CY6A 3RS6A 2ZX1A 5BNPB 2LS6A 1F35A 4K9SA 2YFZA 5A3WA 3M3IA 3ZYJB 1V6JA 5EXOA 5EIYB 1R1ZA 4FXKB 1BYHA 1F2NA 5GLVA 2F17A 1RUF1 1CONA 3FHIB 3DPRA 3K48A 1OLRA 2R041 3L2HA 1I5PA 2ZGNA 4LORA 5FFOC 4BXSV 4FTSA 2WBKA 3IMMA 3I59A 2TBVA 4YGDA 3ZXGA 5HPOA 4TZDA 2QQJA 5FZOA 4K1ZA 4XABA 2ZS6B 2Q8EA 4D94A 3CEWA 5T55A 5L7OB 1RVF3 1UPIA 3VBRB 4A3ZA 5T50A 3HPNA 3VZJA 4A42A 4RA0A 3KGZA 3VD7A 4C1WA 3KV9A 4SBVA 3PDQA 1ASJ2 1JU3A 4FP3A 1OA2A 3U37A 2E7TA 4QPYA 2P3JA 5JMOA 1AF9A 4FPEA 5IK5A 1PGSA 4KGGA 4EZHA 3WP4A 2D40A 3EBRA 3M2MA 2WT2A 1S2BA 4X8NA 1CESA 1QWRA 1W99A 4AI1A 5A6QA 4ONUA 4JGYA 3JD71 1R092 2YFUA 1GU3A 4A7KA 3FLRA 3HVDA 1SBDA 4RR3B 3J7NA 4ASMB 1F9KA 3MIGA 4XJWA 2X5IC 1GQGA 4L92A 1WMXA 4BK5A 1W2TA 1ZZ8A 3I3EA 4AAXA 1JUHA 3RQ0A 1PMIA 1SFYA 2UWAA 2E9QA 1PVXA 5FP8A 5EJ1B 1HB4A 5AC91 3CKHA 2DCYA 2JIJA 4YW7A 3BALA 4XFIA 4CCKA 4CP9B 4QB1A 1J84A 3H1MA 5EQUA 5FLIA 3ZO0B 4N7UA 4MYEA 3O1OA 1HRI3 5L36A 3LPFA 2FZ1A 1WW4A 1UU4A 5J48A 2MEV3 2Q8CA 1X9PA 3B9CA 1QH6A 5FK8A 4D6QA 4GH4B 2HWB1 4CCNA 3U0ZA 1QEXA 3DYPA 3FBYA 1JYWA 1ULCA 2XJPA 4GKYA 3BCWA 1QJZA 4JGZC 3K77A 2ZXQA 3IKWA 3J8F1 2JG9B 1RUC1 1XE0A 4CEWC 1KQRA 2G19A 1DZQA 4LOTA 2P37A 5F3EA 3B9IA 2DFBA 4MGQA 3WP5A 4A41A 2ZGOA 5KXCA 1GMMA 3HIFA 1GNHA 4HFSA 1RIRA 1VMHA 3WG3A 4Q4W1 3BB6A 2A1XA 3B3QE 1H1IA 2D6PA 2I2SA 1O4ZA 2Y0IA 1PK6B 5L9RA 3WZ1A 4NN0A 4D6SA 1P8JA 2IC1A 3TNPB 5DDJ2 5A7QA 3U10A 5FZ1A 5JSRA 5EJZB 1W28A 1A8MA 4AYUA 2JKXA 2WZ8A 3D82A 1CAUB 1UXXX 2WO7A 3Q8CA 3WD5A 1VALA 3RYKA 3H7JA 1OMIA 2DVDA 4AFMA 4ET7A 3AZZA 1KXGA 1UU5A 3DXUA 4GA9A 1BMV1 1PGW2 4DXTA 2EICA 2GALA 3AZYA 3E5XA 3KVAA 5FZIA 5I93A 4U36A 4JX0A 1PVC1 2J1RA 2YPJA 2BOJA 4J25A 1UMZA 3U1XA 3VL8A 1O4TA 1S0CA 3T2QA 2XPJA 3MUZ1 3RGBA 3M3EA 1DP0A 4XF1A 4IEYA 5GLZA 4OMDA 3DPRC
chains in the Genus database with same CATH topology
1W2OA 1GP5A 5C3SA 4RGKA 1OC1A 5C3PA 2VAUA 1BLZA 1GP6A 2BJSA 2VE1A 1E5RA 1E5SA 1QIQA 5C3OA 1E5HA 1HJGA 5C3QA 1UZWA 1HB2A 1W03A 2VBDA 1UOFA 1OBNA 5APAA 2VBPA 1W3VA 3ZKYA 1WA6X 1HB3A 1W05A 2JB4A 5C3RA 1UOBA 1HB4A 2Y6FA 1GP4A 1UNBA 1HB1A 1UOGA 1BK0A 2Y60A 1DCSA 2VBBA 2VCMA 1W9YA 4XAEA 1E5IA 1QJFA 1RXGA 2JB8A 2IVIB 3ON7A 1IPSA 3ZKUA 2BU9A 1W3XA 2IVJA 2CSGA 4BB3A 1W2AX 1RXFA 2BRTA 1W28A 2WO7A 3ZOIA 2DBIA 1UO9A 1HJFA 1ODMA 1W2NA 2DBNA 1ODNA 3OOXA 1QJEA 1W04A 1W06A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W2O A;  1GP5 A;  5C3S A;  4RGK A;  1OC1 A;  5C3P A;  2VAU A;  1BLZ A;  1GP6 A;  2BJS A;  2VE1 A;  1E5R A;  1E5S A;  1QIQ A;  5C3O A;  1E5H A;  1HJG A;  5C3Q A;  1UZW A;  1HB2 A;  1W03 A;  2VBD A;  1UOF A;  1OBN A;  5APA A;  2VBP A;  1W3V A;  3ZKY A;  1WA6 X;  1HB3 A;  1W05 A;  2JB4 A;  5C3R A;  1UOB A;  1HB4 A;  2Y6F A;  1GP4 A;  1UNB A;  1HB1 A;  1UOG A;  1BK0 A;  2Y60 A;  1DCS A;  2VBB A;  2VCM A;  1W9Y A;  4XAE A;  1E5I A;  1QJF A;  1RXG A;  2JB8 A;  2IVI B;  3ON7 A;  1IPS A;  3ZKU A;  2BU9 A;  1W3X A;  2IVJ A;  2CSG A;  4BB3 A;  1W2A X;  1RXF A;  2BRT A;  1W28 A;  2WO7 A;  3ZOI A;  2DBI A;  1UO9 A;  1HJF A;  1ODM A;  1W2N A;  2DBN A;  1ODN A;  3OOX A;  1QJE A;  1W04 A;  1W06 A; 
#chains in the Genus database with same CATH topology
 4H14 A;  1CIW A;  3GZT B;  3I2F A;  5FZK A;  3FC0 A;  1OLM A;  2JG8 A;  2VNR A;  4LEJ A;  3UJO A;  4BZ4 A;  4RGK A;  4PBO A;  4QX2 A;  1AL0 G;  2XUE A;  3AFK A;  1WLC A;  3MID A;  3NV2 A;  4FQ4 A;  5E88 A;  4I0W B;  3DXT A;  1DHK B;  3PIJ A;  1MZ6 A;  1UN1 A;  1RUH 2;  1W0P A;  1XNK A;  3U4S A;  4CDX B;  1NA1 C;  1WLT A;  2DCT A;  4JKK A;  1IPK A;  5F2S A;  2HEW F;  1EUT A;  1ONA A;  1JN2 P;  1ULF A;  2WFF 2;  1R1A 3;  5LBF A;  3SCF A;  1S0J A;  3QH6 A;  4AEJ A;  3RZJ A;  1MS1 A;  2O1Q A;  3ENR A;  5GLU A;  1W8O A;  4Q0U A;  2JDA A;  2DWR A;  2DFC A;  4Y22 B;  4L0P A;  3EO6 A;  1QMJ A;  1LEM A;  4LUL A;  4IGP A;  4OI0 A;  1NQJ A;  1BEV 3;  1SMV A;  1UX6 A;  3HD8 B;  5J36 A;  3RZM A;  2OX0 A;  4M4R A;  1UY0 A;  1YQ6 A;  1RUD 3;  5ACA 3;  1KJL A;  2BER A;  2QJV A;  2ZGT A;  3LQC A;  4XQW A;  1GNZ A;  5K4L A;  3BOP A;  3HJR A;  3J26 N;  1Z7S 1;  3KV4 A;  2WS9 3;  4GMP 1;  2HYX A;  4W65 A;  4XUO A;  5HCH A;  5HBA A;  1NKG A;  4YAR A;  2BFU S;  1H2M A;  1H2L A;  2X05 A;  4AHX A;  4N90 A;  1US3 A;  2XXZ A;  2E53 A;  2VZT A;  4IUG A;  4CE8 A;  4FOW A;  3ZFE B;  5CFC C;  1DGL A;  2AR6 A;  2RS5 1;  2YYO A;  3X29 B;  4COV A;  1VBC 1;  2O8Q A;  4IE4 A;  4XZU G;  4K40 A;  3LOB A;  1VBA 3;  1W8H A;  1BK0 A;  1R08 2;  1SCR A;  2VTX J;  4YWA A;  4MSV A;  4YW5 A;  5IK7 A;  1AR8 1;  1W6N B;  4Q26 A;  1BBT 1;  1COV 2;  3U78 A;  1PZ7 A;  1AYN 2;  4CPB D;  4B8E A;  1OFS A;  3T0A A;  4OUM A;  5BNN C;  5BXX A;  2W1S A;  3HOB A;  1POV 0;  2ZGS A;  1ZYB A;  4QPG A;  4MG2 A;  2DUP A;  1H1M A;  1MVE A;  3KZ4 C;  3APB A;  4HZF A;  3W9A A;  4BWO A;  3AZX A;  5A7O A;  4XUP A;  1H6X A;  3H3U A;  4XET A;  4GAL A;  4AI9 A;  2J1S A;  2ZX2 A;  3ZVX A;  1UZY A;  2ATF A;  2XL7 A;  3WSO A;  1TNR A;  2XBO 1;  4BB3 A;  4IEQ A;  3R6S A;  4XF9 A;  2VXR A;  2JWP A;  4M01 A;  3ZFF C;  4HPK B;  1LCL A;  1GWM A;  2IXC A;  2VW2 A;  3MPB A;  2BPA 2;  1RUG 2;  1HQL A;  2GH8 A;  2Y6J A;  1ND2 B;  2MNG A;  4HON A;  1RB8 G;  1Q8Q A;  1DIW A;  4MHU A;  5I0T A;  2RVA A;  4OZX A;  1A8D A;  2JG8 C;  1GSL A;  1ZM1 A;  2CGN A;  4D8M A;  4E4H A;  5FPA A;  2JXA A;  1ODN A;  3ACH A;  4PF5 A;  1AZD A;  1MPX A;  4WZC A;  5FPB A;  1JOJ A;  1HLC A;  3BU7 A;  2HWC 3;  4LR4 A;  4GB3 3;  3P1I A;  5FOB B;  3LGR A;  5GLW A;  5LWB A;  1LHO A;  3T3Y A;  3AVS A;  3MV0 1;  3WP6 A;  2HWD 1;  2UUR A;  4BA6 A;  1MS5 A;  1V9U 2;  2FDJ A;  4Q4V 1;  4CDU C;  5CAZ A;  3GCX A;  2VUD A;  1FPN 2;  2D98 A;  2WT0 A;  1ENX A;  5F3C A;  4N53 C;  1ENS A;  1EPZ A;  2W92 A;  3A22 A;  1RC6 A;  5FPZ A;  5BNP A;  5FZ0 A;  4PF1 A;  2OUH A;  5CVR A;  2GP3 A;  1RUJ 3;  3W59 A;  2R0F A;  2ZHL A;  2ARC A;  3LFI A;  1JHJ A;  2BNM A;  2ET7 A;  4AI3 A;  2WN2 A;  3AK0 A;  2Y64 A;  4FOQ A;  5T3N A;  4UF0 B;  3LEI A;  1ULO A;  4HOO A;  1B09 A;  4Y4R A;  3R4S A;  4N8M A;  5FY5 A;  1E5S A;  3FUQ A;  1V6M A;  3VDB A;  5G04 L;  1Y4W A;  2WNV A;  3ZYI B;  4IV3 C;  4YZ3 A;  1Q43 A;  3GAL A;  3UT0 A;  2QZ3 A;  1MZ5 A;  2P17 A;  5L7O A;  1RMU 2;  3VBR A;  1HDK A;  4C0H A;  2FDI A;  2QDN A;  1W03 A;  3OPT A;  3UL2 A;  2VZS A;  1H4H A;  1G9C A;  2DU0 A;  3R4U A;  4I3G A;  3WDU A;  4W4Z A;  1QF3 A;  1WA4 A;  1K5M A;  1RHI 1;  5IFT A;  2D6N A;  3JCI A;  4E8D A;  4BOW A;  1AHS A;  4N43 A;  2XB6 C;  3POB A;  3ECQ A;  4BIF A;  2HWF 2;  2YGL A;  4CDQ C;  1W6M A;  3GBW A;  1X36 A;  2QQK A;  4P08 A;  4YVS B;  4RN5 A;  4HET A;  1S0I A;  1NXD 1;  4GKX A;  3U07 A;  1IKQ A;  4BLJ A;  2KM2 A;  3BOD A;  4Q4X 1;  1QJU 3;  3VHO A;  4RR3 A;  2XUM A;  3WNP A;  3Q8A A;  1HXS 3;  1TVG A;  1JYC A;  1MQT C;  1X9T A;  2D7F A;  1SPP B;  2RJ2 A;  1EPW A;  2D5H A;  1O3S A;  4M3C B;  3WCS A;  4EJR A;  2PN5 A;  4IEP A;  4CCC A;  4E9K A;  4OFG A;  3KT1 A;  1BZW A;  1N1S A;  1LHU A;  4YM3 A;  3PNA A;  1GYK A;  2R7E B;  3OPW A;  1NE4 A;  1NZC A;  1WCS A;  4RHV 3;  1FAY A;  3LF7 A;  3CF6 E;  3IDC B;  4CP9 A;  2XLG A;  5D8A A;  1PIV 1;  1KDK A;  1LHW A;  2CNA A;  1JTZ X;  4IV1 C;  4RGG A;  2KR2 A;  3QH7 A;  5SV8 A;  1YFU A;  1QDC A;  4I30 A;  4DB5 A;  1TNF A;  4GH4 A;  4HN0 A;  5F6L B;  1X7N A;  4FVV A;  4GWJ A;  2R06 2;  3CJI A;  1JI6 A;  4H3W A;  4JRL A;  1QOO A;  4Q0S A;  1PO1 3;  4WM7 C;  4P9X A;  2ZJC A;  3HN3 A;  3VD5 A;  5FAX A;  4AFA A;  2E26 A;  1S4C A;  2UYB A;  1LR5 A;  1MEC 1;  3IIA A;  2C26 A;  4A45 A;  5CBL A;  1NCR C;  5FCC A;  4LO4 B;  1H8V A;  3SEE A;  4BQX A;  3NJV A;  3NKT A;  1W0O A;  3N36 A;  4OVE A;  2Q5T A;  4BXF A;  3O5S A;  1QXP A;  1W39 A;  3THC A;  5FYV A;  4EN9 B;  1O59 A;  2RM2 2;  2KXL A;  1QOT A;  1AX1 A;  3FN9 A;  2VXJ A;  1PK6 A;  5IUQ A;  4FOV A;  3BI3 A;  5FKB A;  4D6R A;  4HK8 A;  3ZMO A;  4D3W A;  2FMD A;  4PT6 A;  2ZBJ A;  3LEK A;  2ZPX A;  1LHV A;  3KWV A;  2BGO A;  2GN7 A;  5DAW A;  4UT5 A;  2IXL A;  5G05 L;  4NID A;  3THD A;  1V6N A;  4EE2 A;  1RVF 2;  3D8C A;  3RRD A;  3VDC A;  3I2H A;  1W06 A;  3WW1 A;  2W1W A;  2EF6 A;  2VUA A;  3RDI A;  1AJO A;  2AEZ A;  2EAL A;  2OZ6 A;  4NAM A;  4CEW B;  5IVV A;  2Y6L A;  3LDB A;  1LKN A;  3LCP A;  1JU4 A;  3FJS A;  4HVO A;  1OSG A;  1OUR A;  1V0A A;  4LK6 A;  2ARA A;  2RDR A;  5FZG A;  4LBM A;  5KC6 A;  1O3T A;  1UW8 A;  5B4X A;  3U4X A;  4P9Y A;  3ZDS A;  4HN1 A;  2JX9 A;  3ZN5 A;  4Q4Y 3;  1YJK A;  1IS4 A;  4KU7 A;  1O7F A;  2GMP A;  4O65 A;  5J3U A;  5DG2 A;  2R07 3;  1LGB A;  1AR9 1;  5IJR A;  5JLV A;  2V73 A;  2IFW A;  4P9J A;  1QIQ A;  2QCS B;  4WVZ A;  4LHS A;  4Z07 A;  5C3O A;  1FXZ A;  1VJ2 A;  5CZK A;  1ZRR A;  1VBB 3;  3JBG 1;  3ZSM A;  4QQP A;  2YU1 A;  1HRI 2;  4J6G A;  4P00 B;  4LHN A;  4DUW A;  5DMY A;  2MEV 2;  1JZ2 A;  3WQ7 A;  1XOY A;  4OI1 A;  3ILR A;  1S55 A;  4ZHN A;  3VBU A;  2YB7 A;  4Y33 A;  4XTM A;  3DPR B;  3ZN4 A;  4BM8 A;  5JWP A;  4HBN A;  3CZU A;  4RFR B;  3OD4 A;  3F2Z A;  4CUC A;  4BCU A;  1LHN A;  5FZO B;  3LSE A;  2WWU A;  2YXS A;  1WA6 X;  4QPW A;  3OB8 A;  1G6N A;  4N9H A;  2PHU A;  2B4K A;  3T0B A;  2X10 A;  4Q29 A;  3HQX A;  3RWK X;  2XJV A;  1TME 1;  1Q5O A;  1UNB A;  2C9K A;  1KRI A;  1NA1 B;  5TSW A;  4V2V A;  1YC6 1;  2CL2 A;  2NPI A;  5LA1 A;  2AH2 A;  3J4U H;  5FYY A;  4Z1V A;  1DQ0 A;  3H3L A;  3ZFE A;  1XNA A;  2R30 A;  5K0U A;  4LBL A;  4F3J A;  4E8C A;  5IT6 A;  1L7R A;  4JGY B;  2ZGU A;  1PO2 3;  3A23 A;  3N9N A;  3O0X A;  4PBP A;  3LOI A;  5ISL A;  5GZD A;  5EPA A;  3KQR A;  1JZ6 A;  1W6N A;  2ZEW A;  2V5Y A;  4AZZ A;  1QQP 3;  2WO3 A;  1RUN A;  2VM9 A;  2Y6H A;  3D3A A;  4MVT A;  4K21 A;  3KV6 A;  3OBT A;  4MGS A;  1XJA A;  2B9U A;  3AKR A;  1VRH 2;  2E7A A;  5FRA A;  3UKN A;  3URF A;  4XJ9 A;  1SCS A;  4HSL A;  1FOD 1;  2D43 A;  2FBE A;  1S1A A;  3LAG A;  4L2N A;  4ISQ A;  2E32 A;  3P3P A;  3R4D B;  4CTE A;  3I49 A;  4XFC A;  3RYP A;  1YIF A;  2JE8 A;  5EFU A;  4UFH A;  2WNO A;  4OHW A;  2HH9 A;  1QKQ A;  5A7W A;  3ZYH A;  5CFC B;  1OVS A;  2ZEX A;  2IXI A;  1VBD 3;  3CMG A;  1RUF 2;  3CIH A;  2R04 2;  4NR1 A;  2LAL A;  3VBO C;  4QB2 A;  1VBE 1;  3PVE A;  1GUI A;  2JIG A;  3CBN A;  2DBN A;  5SV5 A;  3BKZ A;  3I7D A;  3FE5 A;  3WNM A;  1PGL 1;  4LPL A;  4P5H A;  4NAO A;  4J1X A;  4CU7 A;  2HEV F;  2MHF A;  3OOX A;  5D1I A;  5K7P A;  5FXV A;  1QJE A;  4CU6 A;  4P5Y A;  2VNO A;  4IQP A;  4YG3 A;  4EWA A;  3FLT A;  4O9E A;  3WXP A;  5LK5 A;  4LUK A;  2J1T A;  4ZU4 A;  5LEJ A;  3RPQ A;  2Z4F A;  1CX1 A;  1OC1 A;  1BEV 2;  3CLP A;  3IN9 A;  1GP6 A;  2VZV A;  3NJZ A;  4FO9 A;  4I2O A;  1AR6 1;  4ZZ5 A;  1EYB A;  1S0G A;  1AYN 3;  1QDO A;  4CEY A;  3VDA A;  1W8W A;  1VP6 A;  2F6B A;  1B35 A;  3A7Q A;  1O5U A;  1HIX A;  5IW0 A;  3OF1 A;  5C8C A;  3EJK A;  1W90 A;  2YBP A;  2R6Q A;  5J1X A;  1REE A;  5LRS A;  1WD3 A;  3N9L A;  3N9Q A;  4P9G A;  1WMD A;  1GOH A;  1L7L A;  4MXW B;  5FRE A;  3F95 A;  5IYY A;  2ETE A;  1DFQ A;  4Z2W A;  4EN7 B;  4RGA A;  4ARX A;  1H2K A;  3AL6 A;  4P9L A;  1DQ6 A;  2JG8 B;  4UF0 A;  1E5H A;  2VUL A;  5H9P A;  5A7N A;  3TWI A;  2ZKL A;  3I2I A;  2A6Z A;  4KG8 A;  4LIU A;  1WCU A;  4PLN A;  4YFW A;  3TEY A;  3GZA A;  1RUG 3;  1YXW A;  1H4G A;  2XQX A;  5LAT A;  2QZ2 A;  3H42 B;  2W95 A;  3AM2 A;  1POQ A;  2YU2 A;  1C8M 3;  5APA A;  1D4V B;  1W3V A;  1WD4 A;  4CCM A;  3RZH A;  2AGS A;  3UKT A;  1DQ4 A;  1XRU A;  4CDU B;  4AQ6 A;  1ZZ6 A;  1HRV 1;  5DUX A;  1YYN A;  2DU1 A;  4TWT A;  3KS7 A;  4AR2 A;  1HKD A;  1VRB A;  4W50 A;  3U11 A;  5BY5 A;  5KHG A;  1WBF A;  5EJ3 A;  5JCT A;  1WLW A;  3ZXD A;  4U2A A;  2ENR A;  4F83 A;  1YHF A;  3MFC A;  1X33 A;  2NMO A;  3POY A;  5CYY A;  4Y1X A;  1AUY A;  5J98 B;  4LK7 A;  1W9S A;  5FR3 A;  4BME A;  1OPM A;  4UFM A;  1SPP A;  5FZH A;  1GIC A;  3KCY A;  3W5N A;  2VBB A;  1UY1 A;  3GHM A;  4MGT A;  4LHL A;  1Q8P A;  3J7H A;  1BVP 1;  4L8Q A;  5AVP A;  3O1M A;  2N7G A;  4MHR A;  1BMV 2;  1LTE A;  5H9S A;  3B94 A;  2VMH A;  2VVD A;  1CAX A;  5DZF A;  3UNP A;  3DCQ A;  5FMO S;  3WT3 A;  4Y20 B;  4FI9 A;  2BU9 A;  3WHU A;  1POV 3;  4S2D A;  2DCK A;  4GB3 2;  2CGP A;  2ZGK A;  4CDQ B;  4AOC A;  3I3B A;  4YGE A;  1LOC A;  2BWC A;  1K12 A;  1O8P A;  1X50 A;  2QUO A;  5LEK A;  4CUB A;  1VAK A;  2RJL A;  4YZ5 A;  3ZXL A;  3LKJ A;  4FTE A;  2RR1 1;  1IS5 A;  2FCT A;  4DXS A;  5AVA A;  1GZW A;  3ZXE A;  2X5I A;  4BK4 A;  3IB3 A;  4OLL A;  2VD7 A;  1RUJ 2;  4JDO A;  4B7E A;  3MIB A;  5M0T A;  4XF0 A;  2ILM A;  5JOY A;  1UY4 A;  1ODM A;  2A3Y A;  5A32 A;  5FYC A;  4ZXE A;  1OH3 A;  4GXL A;  4O7X A;  5H9Q A;  4OQ9 A;  1GR3 A;  2VOW A;  2E7Q A;  3VHR A;  3ZYR A;  3FHA A;  2WSU A;  2WN3 A;  2PHR A;  5FPX A;  4IV1 B;  4DUV A;  5KXE A;  4CEY C;  1W04 A;  2OW4 A;  2UU8 A;  5C8C C;  1WLD A;  2VNV A;  2ZMK A;  2Y26 A;  3PMS A;  4X8P A;  5KHK A;  2JEN A;  3C7E A;  4NO4 A;  2H6C A;  2FCV A;  2FMY A;  4JGZ A;  3ZR5 A;  4E4S A;  3WNO A;  5EYY A;  4ES9 A;  5GAL A;  4ZZ8 A;  3SEP A;  2A6V A;  1QU0 A;  5FY8 A;  2BJS A;  4P02 B;  1REF A;  4PIY A;  4CEW A;  3GBG A;  5K9Y A;  1UOJ A;  5KWR A;  1NCR B;  1BVV A;  2DCZ A;  2R0H A;  3M3C A;  5GKA C;  4LO7 A;  5GZF A;  2F4L A;  5D2A A;  3KD4 A;  1LU2 A;  2R06 3;  4LKD A;  5JOW A;  3JZV A;  5BUV A;  4UW4 A;  1QJU 2;  5FMB A;  4MGZ E;  1JHN A;  1E5R A;  1HXS 2;  2JDM A;  5LRR A;  1PM4 A;  3ZPO A;  4A4A A;  2KD7 A;  5CG8 A;  1KDM A;  1ZBE 3;  3OBZ A;  1BJQ A;  3H0O A;  2QQP A;  3B5L B;  2JIC A;  3ACI A;  2VOX A;  5GLT A;  1RUE 1;  1F4H A;  5FXW A;  3VBF A;  2V4A A;  3H7Y A;  1VIW B;  1BBT 2;  1F15 A;  1UOF A;  1XYN A;  4RHV 2;  4AXO A;  5LY1 A;  2ADE A;  3EXU A;  2RM2 3;  2A6Y A;  2XON A;  3IT8 A;  3DUI A;  4XBQ A;  3MEP A;  3VHP A;  4B4Q A;  1PZ8 A;  2UYA A;  3FLP A;  4FP2 A;  3AVR A;  4DIQ A;  5A6X A;  4QXC A;  1DGR N;  2G1M A;  3H1Y A;  3ZN6 A;  1XBF A;  3OBA A;  4C0B A;  5FYH A;  1OF4 A;  3Q8E A;  1PO1 2;  2ADD A;  5DAX A;  1FI2 A;  1QXR A;  2A5Z A;  2WNV B;  5FXX A;  3ZYG A;  1QGL A;  3SCG A;  3AKQ A;  3UYJ A;  5HXV A;  4AG4 A;  2E51 A;  2XBO 2;  1LEN A;  4LBO A;  4AQT A;  3PJQ A;  2XWB B;  1D4M 3;  1UOG A;  2BEO A;  3LEG A;  5F3I A;  2B8M A;  5CKQ A;  1K5M B;  1V6K A;  1NA1 A;  2CHH A;  2Z5W A;  2ZOE B;  4N43 B;  5A80 A;  4ES8 A;  1GV9 A;  3PTR B;  2HWE 1;  2VQA A;  1W6M B;  2VMD A;  4IER A;  4JAA A;  3VBS C;  3IDE A;  3NAP C;  5FZ6 A;  4FFI A;  4AVB A;  4A2U A;  3IM0 A;  3T1L A;  3QD6 A;  1UMI A;  4MX3 A;  4AFD A;  1OUS A;  4LBQ A;  2D3R A;  4EN6 B;  1WUV A;  5A1F A;  3AL5 A;  4AGV A;  5FZ8 A;  1QJX 3;  1ZBA 1;  4NII A;  3U75 A;  2OYZ A;  2UWB A;  3N7M A;  1UKR A;  3NL1 A;  3WHT A;  2HWD 2;  3WNK A;  2BNO A;  4FPH A;  2ZTN A;  3KQ4 B;  2XJR A;  3M70 A;  4Q4V 2;  5A1A A;  3BPS A;  5D8A B;  3SCH A;  5JZG C;  1G9D A;  3GHN A;  1Y9M A;  5J7M A;  5C6C A;  2RS1 3;  4XFF A;  3AX4 A;  2A3W A;  3RJR A;  1S0E A;  1OQ1 A;  3GXU A;  5ANQ A;  2RMU 3;  1F5J A;  3CJI B;  3GF6 A;  2WAB A;  3T09 A;  5CAD A;  3FHQ A;  3TN9 1;  1C3H A;  5F5Q A;  1W2N A;  4Q4Y 2;  5CFC A;  3BIE A;  3MI8 A;  2OII A;  3A21 A;  3I3D A;  4H7L A;  3AMQ A;  2R07 2;  4QX8 A;  5H9R A;  2QQI A;  1BHG A;  1QJY 1;  4WM8 A;  1RED A;  3ACG A;  4LTA A;  3UGF A;  4QPI C;  4M0H A;  4I3P A;  1LED A;  2PMW B;  1VBB 2;  2TNF A;  4AFC A;  2JDU A;  3NJY A;  4M3C E;  4XVH A;  1AR7 3;  5BNN A;  4XQD A;  4XAC A;  3E5U A;  1SQ4 A;  4S2H A;  2G9F A;  3PL0 A;  1AL2 3;  4P9I A;  5FXZ A;  1LOB A;  4COU A;  3SH3 A;  5L9V A;  1EV1 3;  5FP7 A;  4DEV A;  4FAH A;  4QKB A;  4XIL A;  1FMD 3;  1U5X A;  4F7Z A;  3UGG A;  3VBF C;  5A3L A;  1CJP A;  4PJY A;  2X09 A;  4Z92 B;  2EXH A;  3ZFF A;  1JMU B;  4Y1U A;  1W9W A;  2QQM A;  3IBM A;  3DEC A;  1UYP A;  1VRH 3;  4PQQ A;  5CIS A;  2BV4 A;  3AYC A;  4MXW A;  3VBO B;  2JDN A;  4PQ9 A;  1AXY A;  3LPG A;  3TBD A;  3RYR A;  3VL9 A;  2VW0 A;  4GWN A;  3OEB A;  3UES A;  2A6X A;  3HAG A;  5IAX A;  1PO2 2;  4QWN A;  1NZI A;  1PIV 2;  4JDM A;  1VB2 A;  5I8Y A;  3HNM A;  3HQU A;  4HKO A;  4NHM A;  4XXP A;  3IWZ A;  5CB7 A;  3AC0 A;  4FFH A;  3H8O A;  1RUF 3;  1ZRC A;  1QQP 2;  2ZGM A;  2R04 3;  1ZA4 A;  2RS3 1;  2NZ9 A;  2Y6K A;  4IET A;  1RGS A;  4LNV A;  3AP7 A;  3NW4 A;  3ROU A;  1OOP C;  4AHW A;  5IVE A;  4CDU A;  3MW4 A;  2GDF A;  4XZP A;  5FY1 A;  4AK3 A;  1ULG A;  3KT4 A;  4N53 A;  1GP4 A;  1CD3 G;  2HBU A;  5C5T A;  3VDD C;  2Q30 A;  4XPV A;  5FYT A;  2VMI A;  1Y7B A;  2WZR 1;  2Q4S A;  1RUI 1;  3VBU B;  3MW3 A;  1UIK A;  4OUL A;  4ASK A;  2YHJ A;  1TZO A;  2YRO A;  5JI7 A;  3WOG A;  4AE2 A;  1KIT A;  1EUU A;  3KSC A;  4Y1V A;  3AYD A;  4I0B A;  1H9P A;  1UY2 A;  4KWJ A;  1EAH 1;  1K5J A;  3BTA A;  2FHR A;  2JDH A;  3I3Q A;  3E97 A;  4CU8 A;  1VBD 2;  4AVC A;  1APN A;  1E5I A;  1A78 A;  1FNZ A;  3JD7 3;  1UWW A;  5L19 A;  4YM0 A;  5LBC A;  1C57 A;  4TTG A;  4IV3 A;  2QE3 A;  4UFL A;  3HNB M;  4KWK A;  3INA A;  5E6H A;  1FT9 A;  4HLT A;  3M4F A;  4XJZ A;  1IPJ A;  3OGJ A;  3POW A;  4R4X A;  5A3N A;  4QDQ A;  1LOA A;  2IXH A;  2JDY A;  2JEC A;  4MO3 M;  3VBH C;  2ORZ A;  5AC9 3;  4Y20 A;  5JVV A;  1YRZ A;  4P9W A;  1H1A A;  2J1E A;  5K0U B;  4AGR A;  4G4F A;  4YRD A;  2GC1 A;  2CTV A;  1V6O A;  1JS9 A;  2D6M A;  1IZ3 A;  2VC9 A;  2VZO A;  4JC1 A;  3CL1 A;  4TN7 A;  4CDQ A;  2XGX A;  5A3P A;  2W52 A;  1CZS A;  2GZW A;  1HN0 A;  4WM8 C;  1DDL A;  2HWB 3;  2RV9 A;  4MGY E;  2WQZ C;  3PVO A;  3ZOI A;  1YI9 A;  5JIU A;  2A73 B;  4XC9 A;  1RUO A;  3SIT A;  4Q27 A;  1MQT A;  3J8F 3;  5CU1 A;  5DUV A;  3WLU A;  4BIS A;  1RUC 3;  4Y26 A;  3LA2 A;  5J96 B;  2GC2 A;  2VUC A;  3LD8 A;  5ERL A;  3BGA A;  5LBE A;  1FV3 A;  5FUN A;  2E33 A;  4Y3O A;  1MVQ A;  1YQ2 A;  4Q4W 3;  3JBG 2;  2XVL A;  4CCO A;  4IV1 A;  2W0X A;  1Z78 A;  4LKE A;  3WR0 A;  2PLV 1;  3RZK A;  2JE9 A;  5A7W B;  3TEZ A;  1CZT A;  4NE9 A;  1W8T A;  4LKS A;  1Y9Q A;  5KHI A;  4WM7 A;  5FBZ A;  1C8M 2;  3FBM A;  1NT0 A;  4K1Y A;  1UKG A;  1NCR A;  3QAC A;  1GQH A;  2A71 A;  3ZMN A;  4KU8 A;  2QBX A;  2RJK A;  1PVC 3;  2ZKN A;  2K2S A;  4E4D X;  1LGC A;  2LM3 A;  3NV4 A;  1UZV A;  3U14 A;  1JOP A;  3DKQ A;  3ME2 A;  1MS0 A;  5CKN A;  2AZ5 A;  3WQB A;  3FUO A;  3B69 A;  3PUA A;  4IEO A;  2Y8K A;  1F5F A;  1ASJ 1;  2JDP A;  1WBL A;  2A70 A;  4L99 A;  3B00 A;  3MBW A;  2ZA9 A;  4LO5 B;  4UW5 A;  3K3N A;  2BFU L;  5A3M A;  2WL1 A;  4R4Z A;  3ES4 A;  5DZE A;  2I45 A;  1CWP A;  4CEY B;  3MF9 A;  5T52 A;  1YWK A;  1B35 B;  2XLA A;  1Q3E A;  3WQ1 A;  4AF9 A;  5C8C B;  2RDS A;  3MLJ A;  1A34 A;  2WNU C;  1R09 1;  1U5Y A;  2YC4 A;  5I0R A;  4KG0 A;  4NHY A;  2J22 A;  3JQW A;  4WV8 A;  1G86 A;  2VH9 A;  4CP0 A;  4CZS A;  2ARB A;  4MGK E;  4TSV A;  5FZM A;  2WO2 A;  4YZ4 A;  5C7G A;  5FZ7 A;  1SLB A;  2QKD A;  3ZYP A;  4AEM A;  4W6Y A;  2QQW A;  4FT8 A;  4XUR A;  2Y6F A;  1NX9 A;  3QLQ A;  3AB0 A;  2YBS A;  3K51 A;  1DQ2 A;  5BV6 A;  3SIS A;  3S30 A;  2V72 A;  1NAE A;  4FQZ A;  4XFB A;  1O4Y A;  3PHM A;  4R8H A;  3CDZ B;  1GZT A;  4HAN A;  4LO8 A;  1TE1 B;  1S0F A;  3PLQ A;  4I09 A;  4CXX A;  3M8L A;  2P5B A;  1WGP A;  4QT6 A;  1I3H A;  2G4I A;  2VUJ A;  2WQ8 A;  4XJU A;  4NRQ A;  2K9Z A;  4QX0 A;  3MZH A;  1Z7S 3;  4NRM A;  4GMP 3;  4AW7 A;  4AI8 A;  4XJ8 A;  4ORF A;  2OXB A;  4YYO A;  4XUN A;  2C5D A;  3NNJ A;  2BOI A;  4FCA A;  3B7M A;  4AQS A;  5BNO A;  5B4N A;  4ZU7 A;  1G7Y A;  1DQ5 A;  3V0A B;  5IWF A;  2AAC A;  2QQL A;  4KGQ A;  1N1V A;  3ETQ A;  1O8S A;  3TB0 A;  2RE9 A;  1OLM E;  1YO8 A;  2XHK A;  1DYK A;  2RS5 3;  4M3C F;  4EN8 B;  1VBC 3;  1MS8 A;  4FXG B;  4XUQ A;  5FMD A;  2DUQ A;  4OI4 A;  4JHT A;  1DBN A;  1AR8 3;  1W8N A;  2PYT A;  2WAA A;  5I0D A;  3C7O A;  1HN1 A;  2XVG A;  5DDJ 1;  4YVW C;  1BBT 3;  2ARE A;  1SHW B;  2R32 A;  2VZP A;  4LIV A;  2WJS A;  4NWW A;  1PNG A;  1AYM 1;  1MZF A;  1OA4 A;  2BGC A;  4HK9 A;  5EYX A;  1MS3 A;  3ZXF A;  1CAX B;  2ZAH A;  4XUT A;  5LA0 A;  1UO9 A;  1KEX A;  1LNS A;  5I8T A;  5FYI A;  5A70 A;  4UBH A;  3RG0 A;  4FBF A;  5FZ3 A;  1VMJ A;  3HNY M;  4LKF A;  3PU3 A;  3AP4 A;  2VMF A;  4RS5 C;  3IZO A;  1KS4 A;  2OPW A;  1VPH A;  3O7O A;  4Q1P A;  3WDX A;  1ZBE 2;  2WSV A;  3M3O A;  4KBB A;  2XH6 A;  4QGN A;  2XBO 3;  1TMF 1;  3OEA A;  2ZAB A;  3OUH A;  1GZW B;  1VB4 A;  2X5I B;  3DGT A;  5FLH A;  4YFZ A;  1OI6 A;  3DKW A;  3P3N A;  4ZY9 A;  2PHF A;  4RQP C;  1C1F A;  3CZJ A;  1URX A;  3NRU A;  2E6V A;  1K3I A;  5T5P A;  2WFP A;  1AX0 A;  2WWJ A;  5A32 B;  5DAQ A;  4TXW A;  1VE0 A;  1RUH 1;  3M7A A;  1GWK A;  3ZXA C;  3WF0 A;  2DCJ A;  4GAZ A;  4YLZ A;  1KFX L;  1W9T A;  2PQS A;  3IAQ A;  5F5A A;  3D0J A;  4QHB A;  1ZZ9 A;  5JI9 A;  3LE0 A;  2WFF 1;  5ABJ C;  4JTN A;  3AJY A;  4NRO A;  1SFP A;  2G9Z A;  4JGZ B;  4OUE A;  1ALY A;  1OVP A;  2VGD A;  3MF6 A;  5LBB A;  4E27 A;  1D4M 2;  2HWD 3;  1QXJ A;  2UWC A;  4IL7 A;  5FJK A;  1ZRF A;  3A4U A;  4Q4V 3;  3AMP A;  2K0G A;  1W6O B;  5FZL A;  3VBO A;  3KCX A;  1NE6 A;  5FO8 B;  4QPI B;  3E6C C;  1SEF A;  4AEK A;  1HQN A;  1SZB A;  3QCW A;  4HVR A;  3B93 A;  1NY7 2;  1LAJ A;  3NQH A;  4R9D A;  1CVN A;  1ST8 A;  3AZW A;  3T0D A;  5FY4 A;  4DXR A;  4QMA A;  1LES A;  1YNA A;  1JBC A;  5F5I A;  3BIW E;  2I74 A;  1DGW A;  1LUL A;  1QJX 2;  4LUM A;  2CWM A;  1IG3 A;  3POF A;  5LW9 A;  1Q8O A;  1K42 A;  3VBF B;  1O6U A;  3C2U A;  4CDW A;  3ABZ A;  3FX3 A;  1RYY A;  3W20 A;  4M0N A;  4YGC A;  3ZR6 A;  5CG9 A;  1R08 1;  2Z69 A;  5FZ9 A;  2L9L A;  2RR1 2;  3LIG A;  5GM0 A;  5BNO C;  4NHK A;  2GN3 A;  2YY1 A;  1COV 1;  4YW3 A;  2RS1 2;  2XLF A;  4A7Y A;  3TEW A;  1W9Y A;  1RHI 3;  3W5M A;  4B29 A;  2XML A;  2ZEZ A;  1S2K A;  2EA7 A;  3ZN6 B;  3ZSE A;  5KC5 A;  5JOZ A;  2RMU 2;  3R05 A;  3CJX A;  3C3V A;  1QJF A;  4XW3 A;  3LDK A;  1AJK A;  2MPF A;  2VQU A;  1SG3 A;  2VR4 A;  3NNL A;  1N47 A;  2PHL A;  3N4M A;  3ILN A;  3RWN A;  4KL1 A;  4Q4X 3;  3LZZ A;  3MDP A;  4FOY A;  3AJZ A;  4RYD A;  5J09 A;  3C7F A;  4AED C;  3ZFG C;  2PAK A;  3HT1 A;  5I0S A;  3N7L A;  3M1H A;  1ND3 C;  5FZF A;  1S0B A;  3BPZ A;  3JB8 A;  3UGH A;  1GNY A;  2IFR A;  2Q8D A;  1Q56 A;  3HEI A;  1AR7 2;  4QGL A;  3S7I A;  2UY8 A;  5IHR A;  2X29 A;  3C7G A;  1WW6 A;  3MO4 A;  3VV1 A;  1FYU A;  2GP5 A;  3EMR A;  2GNT A;  1HV0 A;  1AL2 2;  4XMA A;  1JYT A;  1D2S A;  1PIV 3;  3WW2 A;  3WW4 A;  1UAI A;  3ZYB A;  1EV1 2;  4LBQ B;  4DOU A;  1FMD 2;  1OFN A;  4XIK A;  5A7P A;  5C70 A;  1O3R A;  5F32 A;  2IXK A;  2GU9 A;  1C4R A;  1HW5 A;  3GBF A;  4QKN A;  2W2I A;  5JXH A;  4LLF A;  3VHN A;  1JZ3 A;  2E63 A;  1YI7 A;  1SBF A;  3VZM A;  4KBZ A;  4EV0 A;  1C8N A;  2VZ1 A;  2WO1 A;  4HMZ A;  1MEC 3;  1U5I A;  1ZNP A;  4YPJ A;  4UXA A;  3QOP A;  1PZ9 A;  1W2O A;  3POS A;  1DYP A;  2YUE A;  5FWE A;  1U5Z A;  2YPD A;  3E6D A;  1V9U 1;  2JG9 C;  5F6K A;  1FPN 1;  2W3J A;  2XJQ A;  5C3P A;  2A3X A;  3MV1 1;  3OSD A;  4XFG A;  3NST A;  4AGG A;  4C91 A;  3WF2 A;  4QDS A;  1GOG A;  3NNG A;  3ZSL A;  2YZ4 A;  2PHD A;  4EYU A;  2YC2 A;  3SKV A;  1OQD A;  3III A;  1CAW A;  1LOF A;  2EXI A;  3NO8 A;  4PLM A;  1OKQ A;  1D0H A;  4BQY A;  2PA7 A;  4WM8 B;  2ZEY A;  1FNY A;  1MS9 A;  4C90 A;  2YGM A;  2RDN A;  3JU9 A;  1N1Y A;  1NLS A;  4QKD A;  4XOG A;  2Q8O A;  5JXI A;  5EV7 A;  1K45 A;  1VAV A;  4CSW A;  5BNN B;  2XVK A;  1RMU 1;  3NNM A;  3CU7 A;  4FPO B;  3P5B A;  2OPK A;  4URT A;  3SKJ E;  2VBD A;  3CQO A;  4DQA A;  4EZ4 A;  1GFF 2;  4IES A;  1UYZ A;  1TQ5 A;  2ET1 A;  2FQP A;  2R1D A;  2ZZQ A;  3E1F 1;  1N3P A;  4JKM A;  4SLI A;  5T5L A;  1I1E A;  1OXC A;  3L2Y A;  5FYZ A;  4M00 A;  3T1M A;  3JD7 2;  5F3G A;  4CDW C;  2JDZ A;  2HWF 1;  2D3S A;  1XB9 A;  3ZFF B;  1J3P A;  3WG1 A;  4Z82 A;  1HB3 A;  5I8S A;  1GBG A;  4IW3 A;  4X6R B;  3VZN A;  5JPM B;  1XC6 A;  2PFW A;  1V70 A;  3ALQ A;  3RNS A;  3Q8F A;  2DDU A;  4Y5Z 0;  1AR9 3;  4Q5O A;  3BTZ A;  2LRP A;  4XDP A;  5AC9 2;  4DZG A;  3WF1 A;  2NN8 A;  1YQ5 A;  4GJY A;  2W39 A;  3POI A;  4XFH A;  4Y5T A;  4MZU A;  3JBG 3;  1UCX A;  4K3U A;  4CPB A;  1OT5 A;  1O3Q A;  4M4P A;  3GYD A;  3EB7 A;  1DCS A;  2B46 X;  1HQW A;  3POE A;  2HWB 2;  3BN6 A;  5JR7 B;  4BIO A;  3JQX A;  4QQ2 A;  2VY0 A;  3OJB A;  3AFG A;  2GAU A;  3LDR A;  1UIJ A;  3W21 A;  2VPV A;  1JYX A;  1RXG A;  1DZR A;  1WW7 A;  2JD4 A;  3J8F 2;  3RSJ A;  3VKM A;  3SLI A;  4BPZ A;  1RUC 2;  3SNM A;  1XE7 A;  3N9O A;  4N53 B;  4MOA A;  3ZKU A;  5DAV A;  2EVX A;  2VMC A;  3I2D A;  1JYV A;  5T5O A;  1TME 3;  4D69 A;  1O5L A;  2WNU B;  1D0G A;  4Q4W 2;  1SLC A;  2J1A A;  3LEM A;  1PX3 A;  4OI2 A;  2CSG A;  4UW6 A;  4UWD A;  3WCR A;  3V0A A;  2JKB A;  3O1R A;  1ZRD A;  2D6L X;  2SBA A;  3VD3 A;  3O0V A;  4FPK A;  2V09 A;  4EWE A;  4Z8B A;  1YQC A;  1SLT A;  4IE0 A;  1DLC A;  3N3H A;  3OUI A;  2JDK A;  2BTV C;  2OS2 A;  5FZB A;  4GMP 0;  4IV3 B;  5LY2 A;  4Y1Y A;  5FOJ B;  2FDK A;  2VCC A;  4OYU A;  3WG2 A;  1SAC A;  4WBB A;  3MLL A;  4XHB A;  2XG3 A;  1ZZ7 A;  3O0W A;  1DU3 D;  4ZU5 A;  1XU2 A;  3C7H A;  3SXW A;  5A3U A;  2BQP A;  1RTV A;  3RZL A;  1PVC 2;  2ES3 A;  3OYW B;  1BCX A;  3I2O A;  1BK1 A;  3ZXJ A;  1RVF 1;  1J83 A;  1UZ0 A;  1XXN A;  3WNL A;  2O14 A;  4RL7 A;  4F8A A;  3O1P A;  1FOD 3;  3GM8 A;  3VBS A;  1LOF C;  2P3Y A;  3NAP A;  5BPX A;  4CP1 A;  5CFD C;  1Z0H A;  5FUP A;  2WZP P;  3CO2 A;  3V64 A;  3ZYF A;  4GJZ A;  4HKL A;  5KXD A;  1WMF A;  3Q9O A;  4HL0 A;  1G9F A;  1MQT B;  3WIN E;  4Y24 A;  1NYW A;  3I54 A;  1H8T A;  2RS3 2;  5FO7 B;  3RJ2 X;  1VBE 3;  4K8F A;  3SC7 X;  1NCQ A;  1YQ8 A;  3JXS A;  4YVW B;  3RFR A;  2QNK A;  2W94 A;  2WR9 A;  1G8W A;  2XQR A;  3AKP A;  3WUC A;  4AAP A;  4COY A;  5JZG A;  2BWA A;  2F4P A;  2Q1F A;  1ND2 C;  2WAO A;  1NUK A;  2PAM A;  3WNX A;  3K4A A;  1T6B X;  5LAS A;  2PXJ A;  4NOT A;  1HJG A;  2QQU A;  5CNA A;  5DUW A;  2EIE A;  4MH0 E;  1HRI 1;  1ZX5 A;  1UYY A;  3SH5 A;  2VTX A;  2VCA A;  4RS5 B;  4TLG A;  5C5U A;  4WM7 B;  1W8U A;  2B42 B;  3S5A A;  1IS3 A;  1MZE A;  2DTW A;  5A7S A;  4YW4 A;  2QQO A;  1AR6 3;  1SLA A;  4KI5 M;  5FYB A;  2XKP A;  1W6O A;  2VG9 A;  2VME A;  2WUH A;  2DF7 A;  3EHK A;  1Z7S 2;  4QPI A;  4WZF A;  1I6X A;  2JJ6 A;  2VL4 A;  2BP6 A;  4W8J A;  2ID4 A;  1UF2 C;  4DMI A;  1F8V A;  5FJH A;  4ARY A;  2EXK A;  1ULE A;  1JH5 A;  5A1L A;  5HV4 A;  4OHV A;  1QNY A;  5F37 A;  4IE6 A;  5LA9 A;  2H0B A;  2RS5 2;  5CA6 A;  1OQE A;  1VBC 2;  2EAK A;  4QXH A;  5FMO L;  2WYF A;  1XYO A;  3B02 A;  4GUL A;  2VZU A;  3MLK A;  4IEZ A;  1AR8 2;  3ATG A;  2X8K A;  4HVQ A;  1EY2 A;  4HKW A;  1S2E A;  3WF4 A;  3G7D A;  1PNF A;  4EN0 A;  3H8X A;  2XR4 A;  4CXY A;  3GJA A;  3ZXK A;  5FZ4 A;  3I2G A;  3VB9 A;  2V5D A;  2ZGP A;  1JOD A;  2HYK A;  3VKF C;  3NKG A;  4CA9 A;  1JXN A;  1HRV 3;  3USS A;  4QDR A;  4KNC A;  3POG A;  5C9A A;  3K4Z A;  2WII B;  4JZR A;  2Z42 A;  2R1B A;  4FPY A;  4I0A A;  3PU8 A;  5FQ0 B;  4XMI A;  1CR7 A;  1W6P B;  1SDD B;  2B9V A;  2PLV 2;  3WDY A;  4CUG A;  4WVW A;  4XCA A;  4YVS C;  4BH9 A;  5FZA A;  1ACC A;  3NNF A;  1QOS A;  4DY3 A;  5A6Z A;  1DZT A;  3D5O A;  1DYO A;  1OUX A;  2QQN A;  4YG6 A;  3RVH A;  3T2O A;  2QTW B;  1CAV B;  1OOP A;  2Z2S B;  1DQ1 A;  5DPN A;  4K6B A;  4URA A;  1ZRE A;  4IEV A;  4MET A;  2ZML A;  3HMY A;  3I4I A;  1QY4 A;  5FY7 A;  4AL9 A;  1IHM A;  3MW2 A;  2A7A A;  4D7T A;  3ACF A;  5BNO B;  5I91 A;  2CGO A;  4NUB A;  1I9R A;  3VDD A;  1Y43 B;  3SQO A;  4FPC A;  3H8R A;  4H55 A;  2OUJ A;  4XAA A;  1R1A 1;  4N9I A;  2G9G A;  1ZVF A;  5C4W A;  2RDQ A;  5DAB A;  4ASL A;  1H8T C;  4MAD A;  2VZR A;  2BNN A;  3PJY A;  2DVA A;  2WC2 A;  1NCQ C;  1GP5 A;  1ENR A;  3ORJ A;  4NVP A;  1X8M A;  1BEV 1;  2RR1 3;  3ES1 A;  5DN2 A;  1BLZ A;  1J3R A;  4QGM A;  2J1U A;  3ZFG B;  2K46 A;  4AED B;  1RUD 1;  5ACA 1;  4Q8K A;  1UX7 A;  1ND3 B;  2H0V A;  4JHZ A;  4EWD A;  3OBR A;  2OQ7 A;  5FMC A;  1W0N A;  2Y33 A;  1W9F A;  3VBH A;  5LA2 A;  2WS9 1;  4UI9 L;  1LEC A;  2FCU A;  3RI8 A;  2GNM A;  3PIG A;  1XNT A;  4Q2F A;  5AFB A;  3J7L A;  2E31 A;  5FPU A;  4PI0 A;  3V0B A;  5EP9 A;  1GZC A;  5DAP A;  2ERF A;  3FFQ A;  5LK7 B;  2DVG A;  5GZE A;  2Z79 A;  1DG6 A;  3OGS A;  5JPN B;  2GND A;  4MUV A;  1UZW A;  1VBA 1;  4XQ4 A;  2LTN A;  3ZX7 A;  2XWJ B;  1JW6 A;  5KR7 A;  3GDB A;  5FKC A;  1RHI 2;  1GOF A;  3N7K A;  2GME A;  4QB6 A;  4XDO A;  4FTB A;  2DYC A;  4IGQ A;  2H6B A;  4QU2 A;  4GWI A;  3DYM A;  2J1V A;  1I5Z A;  1KS5 A;  4I02 A;  1XU1 A;  4IEX A;  5FP3 A;  4XCB A;  5C33 A;  5HCF A;  4Q4X 2;  5C3R A;  4RSU A;  5JSP A;  1UOB A;  5CKM A;  3WY6 A;  4DXZ A;  4YZ2 A;  2OKX A;  1U12 A;  4AI2 A;  1X82 A;  2P1B A;  3VD4 A;  3UJQ A;  4XYX A;  4BQ2 A;  3CHX A;  3K3O A;  1RUE 3;  5C9A C;  1CIY A;  5LZ6 A;  2ZAC A;  5LB6 A;  1KD7 A;  3FFZ A;  1GKB A;  5JAX A;  1CQ9 A;  4YZ1 A;  2VCM A;  4YW1 A;  3DL3 A;  1AYM 2;  4XAE A;  2P6H A;  3MHZ A;  4K20 A;  4QX5 A;  2W5F A;  4BJ0 A;  4FFF A;  1W8Z A;  2UY9 A;  3BVC A;  2D44 A;  4RFT 0;  2IVI B;  4PLO A;  4BHP A;  1DF0 A;  4DO0 A;  5JDB A;  1JZ5 A;  3S5Q A;  3MIH A;  3BU0 A;  1KJR A;  5FPL A;  4JRA A;  5T5J A;  4DPN A;  3LA3 A;  2HWC 1;  5A3O A;  4GB3 1;  2IVJ A;  5HCB A;  1LRH A;  3ZPY A;  4CDW B;  2ZGQ A;  1MEC 2;  2VEC A;  2AC1 A;  3ILF A;  4ZXK A;  3RMX A;  4QQO A;  1TMF 2;  4GD4 A;  3OY8 B;  1A3K A;  2A75 A;  3S57 A;  1N1T A;  2GMM A;  3LFM A;  2WNU A;  3D0S A;  5C4W C;  4E2G A;  1QHD A;  4Q0Q A;  4ZS3 A;  2SLI A;  3K4D A;  1JZ4 A;  2W68 A;  4AQ2 A;  2HWE 3;  4AVA A;  5E89 A;  1RUJ 1;  2P3K A;  1LOD A;  2DBI A;  4IXL A;  5I0U A;  4IGO A;  3H3Z A;  3S0M A;  2IXJ A;  3IAP A;  3O1T A;  4JTO A;  4QX7 A;  1MS4 A;  2WWS A;  3I8T A;  2Q1Z B;  4A6O A;  2C9A A;  4B7K A;  4HSJ A;  2VQ0 A;  4NIG A;  2XOM A;  4O61 A;  2PEL A;  3ASI A;  1IKP A;  2BVB A;  4R52 A;  5EHD A;  2D6K A;  4JGY C;  4V2W A;  1JOB A;  1ZBA 3;  3WP3 A;  2D5F A;  3PVB B;  2BBA A;  1CPN A;  2DUR A;  5K8S A;  2CV6 A;  4CP2 A;  3OYW A;  5DG1 A;  2P2K A;  1X8E A;  3VKN A;  1M06 G;  4NHX A;  3ZSK A;  5C71 A;  3EQE A;  5FK7 A;  5HI0 A;  5F8P A;  2IZW A;  1W8F A;  1LOE A;  4LBJ A;  4ZKT B;  5D21 A;  3N7J A;  1A6C A;  1PHM A;  1OA3 A;  4K7J A;  3TN9 3;  5IK4 A;  5HV0 A;  5JXG A;  3NV1 A;  2WA3 A;  3POJ A;  3OD0 A;  1UL9 A;  2BW8 A;  1SLL A;  1QJU 1;  4LMF A;  5EWS A;  1AR9 2;  1FAT A;  1QJY 3;  3WDW A;  3WNN A;  4E4Z A;  1HXS 1;  3AKS A;  4QX3 A;  5A33 B;  4YVW A;  1VR3 A;  3WW3 A;  4LIT A;  1YEW A;  4O9G A;  1H0B A;  5FZE A;  3HR9 A;  4CCD A;  2VQT A;  2CAV A;  2VVE A;  5F39 A;  2BZD A;  4RHV 1;  4S2G A;  3AMN A;  4YGB A;  5CIR A;  2XJU A;  1L3J A;  4RS5 A;  5BNQ A;  1CAW B;  3BUC A;  5ANN A;  3V56 A;  1WCD J;  2D3P A;  1CPM A;  2EXJ A;  2ZGR A;  3VZL A;  5CFD B;  4Y5S A;  5HXM A;  1JZ7 A;  4KH9 A;  1XYP A;  4IND A;  4YSF A;  3JB4 C;  2VOK A;  1PO1 1;  2WRA A;  2ZX4 A;  3AZV A;  3T30 A;  4PIZ A;  4XEZ A;  2WKK A;  4DFS A;  1OLQ A;  2JD9 A;  4RQP A;  1TME 2;  4XF3 A;  1OD5 A;  4PDW A;  4MXV A;  3T2P A;  3AP6 A;  5FY9 A;  4B3N A;  5KXB A;  3KHC A;  3OGV A;  4QD2 A;  4FSJ A;  2P34 A;  2Y60 A;  4XBL A;  4PCR A;  2R49 A;  2NM1 A;  4WVM A;  2WYS A;  4HXC A;  2LW8 A;  4JKL A;  1S0D A;  3LA7 A;  4UYB A;  5ABJ A;  3KMH A;  4NMI A;  3ZIX A;  3OUJ A;  1V6L A;  5KBF A;  2FDG A;  1F4A A;  1ZZB A;  1OH4 A;  2ZZJ A;  3OGR A;  1WZX A;  4UFK A;  2VJX A;  1IQA A;  3GZE A;  3PUI A;  2ZX0 A;  2RS3 3;  4TLF A;  3E6B A;  3OPZ A;  2GNB A;  4ERO A;  5IFP A;  4QM8 A;  1CX4 A;  3KGL A;  3TNQ A;  4CRQ A;  4DRR A;  1F31 A;  1W3X A;  1IS6 A;  3BTX A;  4BMB A;  1XQN A;  3IDA A;  5E8A A;  1JUI A;  1VMF A;  5IAT A;  1FOD 2;  3HBK A;  1RIT A;  2CDP A;  4FFG A;  3M3Q A;  4UBG A;  2WZR 3;  4ISR A;  1YCI A;  1RUI 3;  5L73 A;  5FQ0 A;  2W9X A;  4LLO A;  5FYU A;  3LSD A;  2YDE A;  1W6P A;  5JSO A;  2GC0 A;  1EAH 3;  3KLS A;  1BQP A;  2LRO A;  2NYY A;  1JZ8 A;  4P14 A;  2P4E A;  1W6Q B;  4FPL A;  4XIO A;  4IEW A;  5A6Y A;  3K46 A;  1VBE 2;  1CAV A;  2WA4 A;  4Q4Y 1;  4LA3 A;  2WT1 A;  2EID A;  1WW5 A;  4QQL A;  3VKL A;  3VN4 A;  4QXK A;  1PGL 2;  4LJH A;  2R07 1;  3W58 A;  4UAP A;  1UXZ A;  1IGO A;  3ACL A;  4XHX A;  4COW A;  2P3I A;  4KQ7 A;  4QX1 A;  3GCW A;  3BTY A;  2FDH A;  4HT1 T;  1VBB 1;  4LO6 B;  3R0R A;  3UK9 A;  1RL3 A;  1TG7 A;  4MV2 A;  4BQ5 A;  2HJI A;  2HLE A;  3E5Q A;  2IUW A;  4PHZ A;  4QQH A;  3WVJ A;  1YIP A;  2C4X A;  3S7E A;  2YG0 A;  1AR6 2;  1AXZ A;  2AEN A;  2B39 A;  5FPV A;  2B45 X;  3A0N A;  4E2S A;  3EYP A;  1NQD A;  3ZFG A;  4AED A;  1RIN A;  1GQP A;  2HKX A;  1OF3 A;  1ND3 A;  4UW3 A;  1PGW 1;  1CZV A;  1XPW A;  4B4P A;  3A0K A;  4W6W A;  5T54 A;  3WV6 A;  4ZS2 A;  2NP0 A;  3OG2 A;  2PHW A;  3VBS B;  1AVB A;  4OHY A;  2WDB A;  4NWV A;  1ZZC A;  3NAP B;  1ZRI A;  3NJX A;  1LJ7 A;  3FMG A;  4QPG C;  2B7Y A;  2CWS A;  3D6E A;  4JVA A;  3TOJ A;  4BYY A;  2ZHN A;  4UFJ A;  5C3Q A;  5FO9 B;  2PLV 3;  2XHN A;  5E1R A;  2C1F A;  2EIB A;  3O12 A;  4OZO A;  5FP4 A;  3AYE A;  5IVC A;  1PO2 1;  1XND A;  1G9A A;  2QFE A;  1OBN A;  1H8T B;  1WWY A;  4HG6 B;  4PDW C;  1NLR A;  4XTP A;  3VLB B;  5F9T A;  1BXH A;  2FD8 A;  3MIC A;  4LBN A;  1NCQ B;  2R16 A;  3MFA A;  2AUY A;  2VBP A;  2OZJ A;  1YUD A;  1IG0 A;  1QQP 1;  4E2Q A;  2DVF A;  3KV5 A;  1HRV 2;  3HBZ A;  2GH2 A;  3OCP A;  5JZG B;  3MYX A;  1C5I A;  3PUR A;  1W05 A;  1YFX A;  2X53 S;  5DZG A;  4Y4Y A;  3VGI A;  2Q1M A;  2VZ3 A;  2JG9 A;  2HEY F;  4TYS A;  3J9S A;  3MGU A;  4UOJ A;  5IVB A;  1JYI A;  1KFU L;  1WCK A;  1WME A;  5A3T A;  2RHP A;  2TEP A;  4A7Z A;  5FBJ A;  2C24 A;  4CUA A;  2Y38 A;  1ASJ 3;  2YBK A;  3KF5 A;  2HBT A;  4GIQ A;  3UKV A;  2VMG A;  3PME A;  2ZAA A;  4D7Y A;  2WNE A;  3I2J A;  4COZ A;  5FV3 A;  4CCL A;  3IPV B;  4BDV B;  4BQW A;  2DTY A;  4BQ1 A;  5FDB A;  1VBD 1;  2J42 A;  1NLQ A;  3SMH A;  1R09 3;  1WCQ A;  4CCE A;  1CAU A;  2PHT A;  1U0A A;  3S6P A;  5FWJ A;  3O1U A;  4FPF A;  4XFA A;  2PQQ A;  1QH7 A;  3ON7 A;  5BNP C;  4Q0V A;  4NIH A;  3WF3 A;  5JR2 A;  3ETP A;  3WDV A;  4LBQ D;  3PTY A;  2VCB A;  1SFN A;  3AXE A;  4ZPI A;  1H2N A;  2OA2 A;  4G9S B;  4NHL A;  4AHZ A;  1OKO A;  3GJB A;  4DS0 A;  2D97 A;  2C6S A;  4DIN B;  3K2O A;  3DF0 A;  4XDQ A;  1G9B A;  2D93 A;  4A6S A;  4L97 A;  3OY8 A;  2WNV C;  4KWL A;  3NWK A;  2ARX A;  4XE9 A;  2CAU A;  1D2Q A;  5L7O C;  1AYN 1;  1NG0 A;  3USU B;  3DEM A;  3VBR C;  2BBV A;  1XSR A;  1HJF A;  1J1L A;  4G3Y C;  4BQ3 A;  5C9A B;  2CYF A;  3GZU C;  5FP9 A;  2VOV A;  2W1U A;  4CDX A;  2NMN A;  4QM9 A;  1K5M C;  2EAA A;  4AVV A;  2VO5 A;  1N3Q A;  1UQX A;  2Y34 A;  3ELN A;  4N43 C;  4AHY A;  1STM A;  4IE5 A;  2VNG A;  1Q8V A;  4J1W A;  2VTF A;  1XE8 A;  3VUO A;  1CGP A;  5IK8 A;  4YW6 A;  4ATE A;  4RR3 C;  3PUQ A;  4Y22 A;  1OOP B;  2W1Q A;  1NOV A;  3ITQ A;  3AP9 A;  5DDJ 3;  5F2W A;  1RUG 1;  4BU2 A;  4OMC A;  1C1L A;  1AYM 3;  1RJ8 A;  3DV8 A;  2WQ4 A;  1C8M 1;  1V6I A;  3VDD B;  3I59 B;  3TAY A;  3AYA A;  4CCJ A;  2WIN B;  4LQR A;  4KMQ A;  4DRV A;  1YFW A;  5DUU A;  5C4W B;  2GC3 A;  2VVF A;  5D8A C;  3VKO A;  5IAV A;  4Y1Z A;  3ZM8 A;  4QAW A;  1LOG A;  1VLN A;  1YFY A;  2VE1 A;  4N7I A;  4CVU A;  4Q1R A;  1UU6 A;  4GH4 C;  4QKF A;  1OHF A;  3KHB A;  2YC0 A;  2V4V A;  5JIA A;  4PIX A;  4A3X A;  4A44 A;  1ULP A;  1PMJ X;  3CJI C;  3UV9 A;  1JYN A;  5A33 A;  4JQT A;  1TMF 3;  2C0Z A;  1RUE 2;  1GWL A;  4YM1 A;  3HN1 A;  4AVS A;  3AP5 A;  3O1S A;  1FX5 A;  3Q8B A;  1MAC A;  1UZZ A;  2I07 B;  4OUS A;  3T4V A;  4FAG A;  1YJL A;  4MGI E;  3VBH B;  4YNI A;  2AEY A;  1LU1 A;  1T6G C;  4DY5 A;  3I2K A;  1HV1 A;  2J7M A;  1RUH 3;  4WVV A;  2QDR A;  1LB2 A;  2XJS A;  1DLL A;  3N35 A;  3THT A;  3PUS A;  1M4W A;  1PMH X;  1EP0 A;  1E57 A;  2NQY A;  4BE3 A;  4C8D A;  3V0B B;  2JB4 A;  1UY3 A;  2W46 A;  2WFF 3;  4H2A A;  1PK6 C;  2ZHM A;  4JCK A;  5CFD A;  3RZZ A;  1CJD A;  3FL7 A;  3HT2 A;  1POV 1;  4NJ4 A;  4B1L A;  3PUH A;  1RJ7 A;  5GZG A;  5FZC A;  3ZDV A;  1YLL A;  4MLO A;  1SBE A;  2OQ6 A;  2YMZ A;  4LE4 A;  2DVB A;  4B1M A;  4GWM A;  4LXL A;  3HQR A;  4QHO A;  5E16 A;  5FY0 A;  4EQV A;  1J59 A;  4HPK A;  3MIF A;  2HWE 2;  5FUI A;  3IMN A;  4GZ9 A;  2DUO A;  1Y3T A;  3HWJ A;  4IE7 A;  4XBN A;  3GGL A;  3T08 A;  4B4R A;  2QVS B;  1ND2 A;  2JB8 A;  2IWG B;  3K75 B;  3MUY 1;  4GQ7 A;  2BYV E;  1GZ9 A;  4I01 A;  1AX2 A;  1R1A 2;  5KHH A;  4Z2A A;  3NMB A;  4YM2 A;  3G6J B;  3IDB B;  1J3Q A;  2W87 A;  3T2T A;  1PX4 A;  3N9M A;  1QNW A;  1ZBA 2;  2KA3 A;  4FPG A;  2XJT A;  5AFE A;  1HX6 A;  2PAE A;  5GZC A;  4LT5 A;  2JE7 A;  1UYX A;  3BOW A;  4BQ4 A;  2RG4 A;  3GNE A;  4JQR A;  4CDX C;  5LCW L;  2BRT A;  1R08 3;  4LA2 A;  2CU5 A;  1SDW A;  1UMH A;  3LB9 A;  4NPL A;  4RD7 A;  3SHR A;  5JUV A;  4D0Q A;  1COV 3;  1TEI A;  1RUD 2;  3WUD A;  1N3O A;  4IEU A;  5F5C A;  5ACA 2;  1DGW X;  2PHX A;  3KB5 A;  5KHJ A;  3L9J T;  3KVB A;  2WS9 2;  1ZA7 A;  1FV2 A;  4W6X A;  3TN9 2;  3LWC A;  3TRS B;  3WG4 A;  3KCC A;  3MIE A;  3KF3 A;  3TYJ A;  3MPP G;  3VBU C;  3WDT A;  4DEQ A;  5BYN A;  2VW1 A;  1W6Q A;  2R06 1;  1CN1 A;  3D4K A;  4NPR A;  2B5H A;  2W47 A;  5IVY A;  2FDF A;  1LGN A;  1QJY 2;  4LBK A;  2Y6G A;  1V00 A;  2ZCW A;  1C5H A;  5C8W A;  5F1R A;  4L11 A;  1ZBE 1;  2XDV A;  4BLI A;  2WZE A;  1AXK A;  4CXW A;  4DUX A;  4AI0 A;  4NRP A;  1ENQ A;  4AVT A;  1IOA A;  1KGY A;  1VBA 2;  2P6C A;  3AKT A;  5C3S A;  3OTF A;  2D6O X;  3KM5 A;  1W2U A;  2VAU A;  2RM2 1;  1XNC A;  1US2 A;  4PI2 A;  4H7M A;  5J37 A;  3ZFE C;  3P6B A;  5K0U C;  3ZSJ A;  2Y0O A;  4CYD A;  5IVF A;  1O91 A;  2ORX A;  2WLQ A;  2O0O A;  4YVS A;  5FYS A;  1XSQ A;  3OGG A;  1ULD A;  1NXM A;  3AMM A;  2NLR A;  5FLJ A;  3ZIW A;  3O1V A;  2QQV A;  4IDZ A;  3PVN A;  2JEM A;  1SLI A;  1D4M 1;  1UD1 A;  4YG0 A;  5IVJ A;  2FZ2 A;  1V9U 3;  1HB2 A;  3I97 A;  5L9B A;  4D7S A;  5B2G B;  4Q0P A;  2XL9 A;  1FPN 3;  4M3C A;  4KWU A;  2LUW A;  4JDN A;  4V1P A;  1UPS A;  1J1T A;  1J58 A;  2DV9 A;  3WQ0 A;  3NV3 A;  2CDO A;  1T2X A;  5GJ6 A;  4LOS A;  3ZLI A;  5DQ0 A;  1NY7 1;  4NIA A;  3ZKY A;  4OCT A;  5JMC A;  2ZHK A;  2TUN A;  3SH4 A;  1DGR A;  4LHK A;  1OD3 A;  3RI9 A;  3CNA A;  5FTT C;  5JXJ A;  3DYO A;  4K8R B;  2HWC 2;  4QHZ A;  4ATF A;  1XNB A;  3H9A A;  1QJX 1;  3NVC A;  3I3M A;  3RZG A;  4OHX A;  3BYW A;  3THP A;  1D7P M;  4XJA A;  3V65 A;  1H9W A;  3VZO A;  1HB1 A;  3FWE A;  3UET A;  2AYH A;  5HCA A;  2OVU A;  1C28 A;  2WZR 2;  3JUU A;  3WEZ A;  1RMU 3;  1RUI 2;  4ITC A;  2OT7 A;  4YW2 A;  2VOT A;  4UFI A;  3RMY A;  3T4H B;  3TEX A;  2BUK A;  2ZGL A;  4FPJ A;  3FZ3 A;  2MEV 1;  2RS1 1;  1EAH 2;  3KT7 A;  3H1W A;  3DN7 A;  1IQD C;  2PTM A;  2RMU 1;  4QPG B;  2HWF 3;  4S2F A;  3IPV A;  2ZMN A;  3AXD A;  4JV4 A;  4NPM A;  3B01 A;  3J7M A;  5DXD A;  2W91 A;  4ZON A;  2EIG A;  2BDR A;  4RQP B;  1IPS A;  1BKZ A;  2VU9 A;  4PDW B;  2WLP A;  1H30 A;  1H6Y A;  1B35 C;  3H50 A;  5JOX A;  4OQ8 A;  4X6Q B;  1OPO A;  2A6W A;  3VZK A;  3WX5 A;  4WVM B;  5FYM A;  1W2A X;  1RXF A;  3H8U A;  1AR7 1;  4C1X A;  5EZW A;  5FZD A;  5ABJ B;  2BGP A;  1GLH A;  1R64 A;  1MR5 A;  2ZX3 A;  4OHZ A;  1WKY A;  1AL2 1;  5FIX A;  5F7U A;  1PM7 A;  4L9B A;  4R9B A;  3ST7 A;  4QU1 A;  1EV1 1;  4R9A A;  1FMD 1;  2XKO A;  4AFB A;  2BVV A;  5CEH A;  3QBQ A;  4R9C A;  4XF4 A;  2VZQ A;  1GAN A;  1VAM A;  3USU A;  4AWD A;  1Q8S A;  3LIH A;  4LE3 A;  3C8X A;  4CU9 A;  1L7Q A;  2Q0A A;  4DNY A;  1VRH 1;  2YV8 A;  4Q8L A;  3VD9 A;  4QXB A;  2O8O A;  2W08 A;  3N9P A;  4XXA A;  2GSY A;  1Y9G A;  3O14 A;  3AMH A;  2CY6 A;  3RS6 A;  2ZX1 A;  5BNP B;  2LS6 A;  1F35 A;  4K9S A;  2YFZ A;  5A3W A;  3M3I A;  3ZYJ B;  1V6J A;  5EXO A;  5EIY B;  1R1Z A;  4FXK B;  1BYH A;  1F2N A;  5GLV A;  2F17 A;  1RUF 1;  1CON A;  3FHI B;  3DPR A;  3K48 A;  1OLR A;  2R04 1;  3L2H A;  1I5P A;  2ZGN A;  4LOR A;  5FFO C;  4BXS V;  4FTS A;  2WBK A;  3IMM A;  3I59 A;  2TBV A;  4YGD A;  3ZXG A;  5HPO A;  4TZD A;  2QQJ A;  5FZO A;  4K1Z A;  4XAB A;  2ZS6 B;  2Q8E A;  4D94 A;  3CEW A;  5T55 A;  5L7O B;  1RVF 3;  1UPI A;  3VBR B;  4A3Z A;  5T50 A;  3HPN A;  3VZJ A;  4A42 A;  4RA0 A;  3KGZ A;  3VD7 A;  4C1W A;  3KV9 A;  4SBV A;  3PDQ A;  1ASJ 2;  1JU3 A;  4FP3 A;  1OA2 A;  3U37 A;  2E7T A;  4QPY A;  2P3J A;  5JMO A;  1AF9 A;  4FPE A;  5IK5 A;  1PGS A;  4KGG A;  4EZH A;  3WP4 A;  2D40 A;  3EBR A;  3M2M A;  2WT2 A;  1S2B A;  4X8N A;  1CES A;  1QWR A;  1W99 A;  4AI1 A;  5A6Q A;  4ONU A;  4JGY A;  3JD7 1;  1R09 2;  2YFU A;  1GU3 A;  4A7K A;  3FLR A;  3HVD A;  1SBD A;  4RR3 B;  3J7N A;  4ASM B;  1F9K A;  3MIG A;  4XJW A;  2X5I C;  1GQG A;  4L92 A;  1WMX A;  4BK5 A;  1W2T A;  1ZZ8 A;  3I3E A;  4AAX A;  1JUH A;  3RQ0 A;  1PMI A;  1SFY A;  2UWA A;  2E9Q A;  1PVX A;  5FP8 A;  5EJ1 B;  1HB4 A;  5AC9 1;  3CKH A;  2DCY A;  2JIJ A;  4YW7 A;  3BAL A;  4XFI A;  4CCK A;  4CP9 B;  4QB1 A;  1J84 A;  3H1M A;  5EQU A;  5FLI A;  3ZO0 B;  4N7U A;  4MYE A;  3O1O A;  1HRI 3;  5L36 A;  3LPF A;  2FZ1 A;  1WW4 A;  1UU4 A;  5J48 A;  2MEV 3;  2Q8C A;  1X9P A;  3B9C A;  1QH6 A;  5FK8 A;  4D6Q A;  4GH4 B;  2HWB 1;  4CCN A;  3U0Z A;  1QEX A;  3DYP A;  3FBY A;  1JYW A;  1ULC A;  2XJP A;  4GKY A;  3BCW A;  1QJZ A;  4JGZ C;  3K77 A;  2ZXQ A;  3IKW A;  3J8F 1;  2JG9 B;  1RUC 1;  1XE0 A;  4CEW C;  1KQR A;  2G19 A;  1DZQ A;  4LOT A;  2P37 A;  5F3E A;  3B9I A;  2DFB A;  4MGQ A;  3WP5 A;  4A41 A;  2ZGO A;  5KXC A;  1GMM A;  3HIF A;  1GNH A;  4HFS A;  1RIR A;  1VMH A;  3WG3 A;  4Q4W 1;  3BB6 A;  2A1X A;  3B3Q E;  1H1I A;  2D6P A;  2I2S A;  1O4Z A;  2Y0I A;  1PK6 B;  5L9R A;  3WZ1 A;  4NN0 A;  4D6S A;  1P8J A;  2IC1 A;  3TNP B;  5DDJ 2;  5A7Q A;  3U10 A;  5FZ1 A;  5JSR A;  5EJZ B;  1W28 A;  1A8M A;  4AYU A;  2JKX A;  2WZ8 A;  3D82 A;  1CAU B;  1UXX X;  2WO7 A;  3Q8C A;  3WD5 A;  1VAL A;  3RYK A;  3H7J A;  1OMI A;  2DVD A;  4AFM A;  4ET7 A;  3AZZ A;  1KXG A;  1UU5 A;  3DXU A;  4GA9 A;  1BMV 1;  1PGW 2;  4DXT A;  2EIC A;  2GAL A;  3AZY A;  3E5X A;  3KVA A;  5FZI A;  5I93 A;  4U36 A;  4JX0 A;  1PVC 1;  2J1R A;  2YPJ A;  2BOJ A;  4J25 A;  1UMZ A;  3U1X A;  3VL8 A;  1O4T A;  1S0C A;  3T2Q A;  2XPJ A;  3MUZ 1;  3RGB A;  3M3E A;  1DP0 A;  4XF1 A;  4IEY A;  5GLZ A;  4OMD A;  3DPR C; 
#chains in the Genus database with same CATH homology
 1W2O A;  1GP5 A;  5C3S A;  4RGK A;  1OC1 A;  5C3P A;  2VAU A;  1BLZ A;  1GP6 A;  2BJS A;  2VE1 A;  1E5R A;  1E5S A;  1QIQ A;  5C3O A;  1E5H A;  1HJG A;  5C3Q A;  1UZW A;  1HB2 A;  1W03 A;  2VBD A;  1UOF A;  1OBN A;  5APA A;  2VBP A;  1W3V A;  3ZKY A;  1WA6 X;  1HB3 A;  1W05 A;  2JB4 A;  5C3R A;  1UOB A;  1HB4 A;  2Y6F A;  1GP4 A;  1UNB A;  1HB1 A;  1UOG A;  1BK0 A;  2Y60 A;  1DCS A;  2VBB A;  2VCM A;  1W9Y A;  4XAE A;  1E5I A;  1QJF A;  1RXG A;  2JB8 A;  2IVI B;  3ON7 A;  1IPS A;  3ZKU A;  2BU9 A;  1W3X A;  2IVJ A;  2CSG A;  4BB3 A;  1W2A X;  1RXF A;  2BRT A;  1W28 A;  2WO7 A;  3ZOI A;  2DBI A;  1UO9 A;  1HJF A;  1ODM A;  1W2N A;  2DBN A;  1ODN A;  3OOX A;  1QJE A;  1W04 A;  1W06 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...