1UOFA

Deacetoxycephalosporin c synthase complexed with penicillin g
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
310
structure length
267
Chain Sequence
b'MDTTVPTFSLAELQQGLHQDEFRRCLRDKGLFYLTDCGLTDTELKSAKDLVIDFFEHGSEAEKRAVTSPVPTMRRGFTGLYSMCYSMGTADNLFPSGDFERIWTQYFDRQYTASRAVAREVLRATGTEPDGGVEAFLDCEPLLRFRYFRMAPHYDLSMVTLIQQTPFVSLQAEVGGAFTDLPYRPDAVLVFCGAIATLVTGGQVKAPRHHVAAPRTSSVFFLRPNADFTFSVPLARECGFDVSLDGETATFQDWIGGNYVNIRRTSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEACETOXYCEPHALOSPORIN C SYNTHETASE
publication title The Structural Basis of Cephalosporin Formation in a Mononuclear Ferrous Enzyme
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Oxidoreductase
total genus 79
structure length 267
sequence length 310
ec nomenclature ec 1.14.20.1: Deacetoxycephalosporin-C synthase.
pdb deposition date 2003-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
A PF14226 DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.330 Mainly Beta Sandwich Jelly Rolls B-lactam Antibiotic, Isopenicillin N Synthase; Chain 1uofA00
5C3PA 1GP4A 1HB2A 1ODMA 1RXFA 2Y60A 1W04A 2BJSA 1W28A 1HJFA 1ODNA 1GP6A 1W03A 5C3QA 2JB8A 1DCSA 1OC1A 2IVIB 1UOGA 2VE1A 1GP5A 2Y6FA 1W9YA 2VBBA 2JB4A 1HJGA 1E5RA 2VBPA 1W2NA 4RGKA 1BLZA 1HB4A 1OBNA 4BB3A 1QIQA 2BRTA 1QJFA 2DBIA 5C3RA 3OOXA 1BK0A 1W06A 2VBDA 3ZKUA 2WO7A 3ON7A 1W2OA 1W2AX 1HB3A 3ZOIA 1E5SA 2BU9A 2CSGA 3ZKYA 5C3OA 1UO9A 1UOFA 4XAEA 1UNBA 1WA6X 2DBNA 1W3XA 1HB1A 2VCMA 1W3VA 1E5HA 2IVJA 1W05A 1QJEA 1IPSA 2VAUA 1UOBA 1UZWA 1RXGA 5APAA 1E5IA 5C3SA
chains in the Genus database with same CATH superfamily
1NA1B 1QJZA 2YY1A 1UWWA 4Y3OA 5BXXA 1GQPA 3Q8EA 3RVHA 1VBC3 5JPMB 1VBA2 2WL1A 3ZYHA 4MSVA 3LIHA 1MZ6A 2C26A 1S2KA 2HWE1 5ANNA 1REEA 3AXEA 2W46A 5BNNA 2X5IA 1RB8G 3SKVA 1JYNA 2A6VA 1GP6A 3AC0A 4KG0A 3WDXA 1V6KA 1KXGA 3K46A 3DECA 2XVKA 2VUAA 4DMIA 3NJZA 4WVZA 4O9EA 4AGRA 2VO5A 1Q8OA 3ZLIA 4TYSA 3JD72 4IV3A 4XFFA 4Y20A 3WR0A 5ABJC 3JQWA 1HDKA 1VP6A 5FBJA 3I97A 5EYXA 4B4RA 4QU2A 2R063 2Y6FA 1AX0A 3CBNA 3LB9A 4ZKTB 1FPN1 4YRDA 1X33A 1YI9A 3BOPA 1J59A 5A1FA 3GM8A 1GZTA 4HK8A 2NZ9A 4XUQA 4YG6A 1LENA 3VBUB 3PVNA 1WCQA 3WT3A 2XL9A 2WS92 5C9AB 3WNKA 4D7YA 4AI3A 4AHZA 4AXOA 1LGBA 1OD5A 1XYNA 4XFHA 5CKNA 5LRSA 2WO3A 3KVBA 1JS9A 1O4ZA 2HWE3 4AFCA 1Z7S2 2EAAA 1XXNA 1RUE2 1BVP1 5A7QA 1PGW1 1KDKA 1AF9A 4WVWA 4LK6A 1UZYA 4B4QA 3POYA 2ZHKA 3WXPA 1V6MA 5HBAA 4URAA 1W6NB 3RZZA 2D6NA 2RDNA 2D40A 3FE5A 2Q30A 1BK1A 1GLHA 2PHFA 1F4HA 4OCTA 1OLQA 1UD1A 4AG4A 1GNHA 1FPN3 4P9IA 1BHGA 1S1AA 2ZGOA 3AMHA 3K51A 1K45A 1XNAA 3SC7X 3VBSC 4F3JA 4O7XA 5FREA 4XAEA 2J1RA 1SBDA 3URFA 4Q8KA 5CEHA 3I2KA 2ZGRA 2BERA 1F15A 1MZ5A 2FDKA 5F3CA 3GXUA 1PM7A 5BV6A 1W3XA 1L7QA 4NRMA 5FRAA 1YYNA 4NHXA 2P2KA 1YFUA 2WA4A 2QQKA 3O0WA 4QB6A 5CBLA 5FYYA 3O1RA 3UNPA 3B7MA 4MX3A 1OHFA 3AL5A 3N9LA 3ZFEB 1UAIA 1OKQA 1R1ZA 1HX6A 4N53A 4AI9A 1AJKA 1CJDA 4QM9A 1VLNA 1R082 2AYHA 5LBFA 1AR72 2JDNA 2Z79A 1NYWA 3LEIA 1VBB1 2JG8A 5EQUA 3ZXKA 2EXKA 4IESA 1ZZCA 4QQOA 2D43A 2DV9A 1IHMA 2GAUA 3RYRA 1DYKA 5EWSA 4OZOA 1SLCA 4MGIE 5D21A 3QH7A 2YMZA 5J7MA 2ENRA 3RRDA 3AZXA 3POWA 4AGVA 1PM4A 4LORA 1RUC1 3ZYJB 1KJRA 2R30A 3KV4A 1DIWA 5BNPC 3H3LA 3M1HA 4KQ7A 3UV9A 2XONA 3CO2A 2WR9A 5L7OB 5JPNB 2DTWA 4BQYA 3FMGA 2WZ8A 3ATGA 5C5UA 4K9SA 4HSJA 3C7FA 2FCVA 1W6OB 2D97A 3OD4A 3RMYA 4CP0A 3TEWA 1AXZA 4MGQA 4IGPA 2JX9A 3KT7A 4COUA 3OPTA 4OMCA 3DPRB 4Q0QA 4DUWA 2RS13 1VBB3 4QXKA 4FPKA 3O7OA 4H3WA 4AW7A 1H2LA 1SACA 4I3PA 1BCXA 1ENQA 4IEWA 1JYVA 4AI1A 3PURA 1SEFA 1IPKA 1U5XA 3BKZA 1QH7A 4ONUA 5JSPA 2HWE2 1LU1A 4P9XA 5A7WB 1X9TA 1MS4A 1GZ9A 1O4TA 1RUC3 2FBEA 4I0AA 3T30A 3RZGA 4YSFA 3KWVA 4KI5M 2P4EA 1W8NA 2ZX3A 2DTYA 1OH4A 5JI9A 2GU9A 2P17A 3JZVA 3SCHA 1R64A 1J83A 2E31A 3CZUA 5FTTC 5I8SA 2VZRA 4HKWA 2IXCA 2VD7A 1FPN2 2BOJA 2QFEA 2R7EB 4C8DA 3KD4A 2XHNA 4DRRA 5C71A 3VBOC 1W8ZA 4DNYA 5C3RA 3D8CA 4P00B 2RJLA 2HWF1 3NKTA 3VBSA 5F9TA 1J3QA 2W08A 4ASMB 1G7YA 3IM0A 3LQCA 3R0RA 3KQRA 4TN7A 4GB33 1KFUL 1FXZA 4GIQA 4BMBA 4GJYA 5IK4A 4NPRA 5FWEA 2XWBB 3T2QA 2VCAA 4DIQA 2CU5A 1ULOA 1PGW2 1Q5OA 1OA4A 5A3NA 1YUDA 1WMEA 5C3OA 3NAPA 5FZ1A 3B9IA 1V6NA 3ZSEA 1PNFA 4PLMA 4EN8B 4FBFA 3LCPA 1V00A 3G6JB 1W2TA 3M2MA 5CA6A 4Q5OA 1RUOA 4OMDA 4FFIA 2ZHNA 3WP5A 4I30A 3PDQA 2ZMLA 2CYFA 2VTXJ 3HNMA 3DN7A 5FPLA 1SHWB 4IE5A 4AVAA 1OD3A 2W68A 2ZJCA 1VMFA 4LBQD 4V1PA 3THCA 3Q8AA 2HWF3 1NUKA 1RIRA 4HFSA 3EO6A 3VLBB 1XE7A 1CIWA 5BNPA 5GZGA 3AP9A 3BU7A 2RE9A 3O0VA 1W0NA 4P9LA 4D0QA 1AHSA 4Q29A 4FQ4A 5IVCA 1GFF2 1ZM1A 4QPWA 3N9QA 4JKLA 1SBEA 4QX2A 4Y4YA 3ZFGB 3CLPA 1CQ9A 3W5NA 4GWJA 4YG0A 1ND3B 3CNAA 1QF3A 4XFBA 5A6QA 2I2SA 4FOQA 4CU7A 2VNRA 3LA7A 5FY9A 3OBRA 2VPVA 1VBB2 1TMF2 3H8OA 3WUDA 3LAGA 1W0OA 1JU3A 2EAKA 2ZX4A 5BNOC 5K0UC 1EAH1 2BGOA 2QZ3A 1HB2A 2J1AA 2EF6A 1SQ4A 5FPXA 4YLZA 3FUOA 1RUC2 4LBKA 1MQTC 2A6XA 1W9SA 2WNUB 5FO8B 3MICA 3HD8B 3S6PA 1GQHA 4QPIA 4BK5A 5E89A 2EA7A 1OUSA 4IERA 3H3ZA 3ILRA 4AK3A 1QH6A 2FDIA 5FZOA 3VBRB 5EV7A 5CB7A 2VZPA 4YZ3A 5EJ1B 1PZ8A 2ATFA 2ZOEB 5I93A 2QJVA 2VVDA 4N7IA 1UZVA 1W9YA 2AEZA 2O1QA 2AUYA 4QQLA 3VBOA 1YIFA 4ZS3A 5LK5A 5E16A 3TN91 2A71A 1BVVA 1E5RA 1ZA4A 2VMEA 5F8PA 1OXCA 1PK6C 1JZ8A 5FYBA 1EAH3 2YGMA 3ZDVA 5FZDA 4K1ZA 4YGEA 5LRRA 2WWUA 4WBBA 3KT4A 1FAYA 2ORXA 2Q5TA 4Q4W1 4A7KA 2PAEA 1ND2B 2GNBA 3OPZA 1UKGA 4DZGA 2W1WA 3AKRA 3FX3A 2VVFA 4XTMA 4A6SA 2RHPA 4H55A 3FL7A 2LS6A 2PQQA 4R9BA 5J3UA 2PHLA 1WD4A 3T1MA 5FOJB 3J7LA 3N7KA 1VAMA 4JQRA 4LLOA 3W5MA 1ZZ6A 3AZWA 5AVPA 4XYXA 3SISA 2H6BA 4XACA 2WN2A 1QJY2 3NV1A 3HAGA 4A2UA 1S0BA 5L36A 2UYAA 4HVOA 2XOMA 3EMRA 4META 5FZIA 5HCFA 1WKYA 3TN93 4D6QA 3ZN6B 2AR6A 3VB9A 4FPGA 4NUBA 3AVSA 4XF0A 1LECA 2C9AA 3OBAA 1C1LA 3B02A 3M7AA 4XFCA 4UFKA 3ABZA 1W6QA 4N43B 3LF7A 4Q4W3 3RMXA 5LA9A 3WD5A 4A44A 1H1IA 3FC0A 1FNYA 2YG0A 2V09A 5FKBA 3E6DA 4AE2A 1OQDA 1VMJA 4CEYA 2FMDA 4LBJA 1FOD1 2DCZA 3IIAA 2WAAA 3Q8FA 1ZNPA 1NY71 5FP3A 3RQ0A 3ZXDA 3ZN5A 2VMDA 3IAQA 5K0UA 5BNOA 1N1VA 1K5JA 4Y1UA 1W8TA 5F2WA 5DUVA 3WNMA 1SPPA 3NNFA 2R1BA 1OOPB 4XQDA 5K9YA 2HWD3 3AXDA 4HBNA 3AJZA 3WG3A 4HMZA 1MQTA 3H8RA 2PXJA 2VMIA 2VTXA 3K2OA 4FP2A 5JI7A 1I9RA 1QNWA 4AAPA 1ZVFA 5FMDA 1QGLA 3WF4A 1DZTA 4YW4A 3NO8A 4HPKB 1VB2A 1A3KA 2B39A 3OGJA 3MI8A 4QPGA 2CGOA 3M3CA 3AVRA 3GZUC 5GM0A 1FOD3 3IKWA 1C3HA 2P5BA 3ZVXA 1PVXA 3NRUA 4K21A 4QDQA 3UESA 5FPUA 4AVCA 1EAH2 1PK6A 1Q8PA 5DZFA 1LAJA 4ZXEA 3VUOA 2WNOA 5LZ6A 2BV4A 3A0NA 2ET1A 3W59A 4JTOA 3MHZA 1L7RA 4MGYE 1C1FA 2LALA 5EIYB 1J58A 1CZTA 2DVFA 3ILNA 4B7KA 5KXEA 2OA2A 3VBFB 2LW8A 2R6QA 4P02B 3FHAA 5CKMA 4HKOA 1FI2A 4OLLA 4NHLA 1FT9A 1W8UA 3ZSKA 5GALA 5LY1A 5IW0A 4V2WA 1HB4A 1NCRB 4M4RA 3RFRA 5FP4A 3SQOA 4ASKA 1NA1C 2JD9A 2ZMKA 3MLKA 3AJYA 4RR3B 3VHRA 1QJFA 4R4XA 3TN92 3NJVA 5BUVA 1HKDA 4DY5A 5JWPA 1A78A 2BQPA 2QQUA 4KU8A 1BK0A 1H8TB 2XMLA 2Q1MA 5G05L 3UKVA 2VOVA 3OD0A 1M06G 1BZWA 1W6PB 1AX2A 1TE1B 1OQEA 4Q4W2 1QJX1 2EXIA 2ZGQA 4C0BA 4MH0E 5C6CA 3NL1A 3UJOA 1W90A 3ZSJA 4FOWA 4CCJA 4FP3A 3OSDA 5H9SA 1CN1A 2VZUA 3U11A 2XJTA 1BYHA 4YM0A 5C8CA 2UU8A 5G04L 4C1WA 2PMWB 3EXUA 3FBMA 3O14A 3U4XA 2DVDA 3KM5A 2GN3A 4FTEA 1KJLA 3QACA 2DBNA 5FLHA 3VBUC 4F83A 4Q4V1 1V6LA 3AK0A 4EV0A 1Z0HA 4GH4C 4RQPA 4YG3A 3VDAA 2WN3A 3AL6A 5C9AC 4QX1A 3VBHA 1G9DA 3LPFA 4JKKA 1O3QA 1JUIA 2W92A 1UX7A 5FY1A 5F7UA 3ROUA 1SG3A 3IBMA 3AZYA 3Q8BA 4AFBA 1KGYA 3ZMNA 3WINE 3CQOA 1W39A 3AZZA 2OPKA 1CONA 3J26N 3JBG3 2ZX1A 1ULFA 3KHCA 4CP9A 3S5QA 3ZFFB 4YM3A 3TNPB 4JHTA 1QJX3 5CG9A 2ZGLA 3A22A 1K5MB 2P3IA 4ES9A 4B4PA 2XUMA 2J1VA 2ARXA 4KBZA 1CZSA 2YHJA 1H0BA 2GNMA 3I3DA 4NHYA 1SPPB 5FK8A 2BVVA 1BQPA 1STMA 1NY72 2JICA 2VULA 3M3QA 3V0AA 2VZSA 5C3SA 3BVCA 3AYCA 1IGOA 1G8WA 3EJKA 4OZXA 5CVRA 1OLME 1UU6A 3S7IA 3H9AA 2A3WA 4QHBA 1N3QA 4JAAA 5FXVA 2XVGA 1XU2A 1WGPA 4LBMA 4BQ1A 1T2XA 5CKQA 2ZEYA 4B1MA 2ZZJA 5EXOA 4OVEA 4B1LA 5A33B 4R4ZA 4WV8A 1W28A 1XNTA 2WIIB 3B9CA 1U12A 4NRPA 3DV8A 2NMOA 1WLDA 3T09A 4CRQA 4E4DX 4QKDA 1YO8A 3LE0A 4BZ4A 1DU3D 1GNYA 4UYBA 3E5QA 1OF4A 4WM7B 3SEPA 5A3LA 4NE9A 3ZN4A 4BLJA 1TVGA 5T54A 2VE1A 1NA1A 1YXWA 3RDIA 3VDCA 4H14A 3ZDSA 3AP7A 2Q4SA 2RDQA 2XB6C 5FXWA 4G4FA 2EVXA 4X6QB 4CTEA 5I0TA 5JZGA 4LHSA 4CPBA 1LGCA 2CGNA 1GSLA 4ZU5A 5FYVA 3WQBA 3DUIA 1JN2P 3P5BA 1PX3A 4ZZ8A 4QKBA 2WLQA 4S2DA 4CUAA 5LW9A 4MG2A 1ZYBA 3PIJA 3Q8CA 3U75A 3W21A 4J6GA 5L7OC 4PDWB 4IGOA 1QJU1 4TLFA 5FLIA 4DXRA 4E2QA 2BRTA 1RITA 4MXWB 2IXHA 3RZJA 2UYBA 5DAVA 4XOGA 5FQ0B 2OYZA 1H6XA 4LKFA 4NPLA 3WVJA 5GLTA 1H1MA 1VBA3 2RS31 4KMQA 5AC91 4RS5B 3NV3A 4XMAA 1LGNA 2W1QA 1W2OA 3DPRC 4IGQA 4NHMA 3VBUA 4COWA 5IK5A 3WDUA 4CSWA 1HW5A 1W2AX 4M0NA 3V64A 3VD3A 5C9AA 1N3OA 2RM21 4CDWA 4EWDA 1QEXA 3KV9A 2R041 4FSJA 3VD7A 1C5IA 2K2SA 1NT0A 2C6SA 3PVOA 1RUNA 4G3YC 5A6XA 4IV3C 1D2QA 2YGLA 4HLTA 1WLWA 2VCCA 5LBBA 5C4WB 3C2UA 2UY8A 4BOWA 2NP0A 2E7QA 2MEV1 2WZPP 4AQ6A 1QJX2 4DB5A 3DEMA 1DGRN 5FJKA 2TUNA 3KGZA 5JLVA 1YIPA 5FZ0A 4A41A 4AQSA 2KXLA 3O1PA 3OJBA 1QJU3 2VR4A 4XMIA 2GC3A 1PO21 3PU8A 5C5TA 4RQPB 4D69A 3KGLA 4I3GA 2ZACA 5KHJA 3ZXGA 1V70A 1IS5A 1TZOA 3WG2A 4DUVA 4HETA 1DZQA 2WO2A 3R4UA 5DDJ1 1J1LA 1H2KA 2P34A 2RS33 5FV3A 2R0FA 4Q4V2 2Q8EA 4JGYB 4RHV2 1QJEA 2DDUA 1W6MB 2C5DA 2QQIA 3A0KA 4V2VA 3GF6A 3MO4A 2RM23 2R043 4COVA 3HIFA 1B09A 4JGZB 4NOTA 4DUXA 1DYPA 4NPMA 2F6BA 2DWRA 4IUGA 2AC1A 4YM1A 2FZ2A 5F37A 1GV9A 1AR71 3MW4A 4Z1VA 1W9WA 2MEV3 3ZFEA 3GJAA 3ZR5A 1YFWA 3V0AB 3TRSB 2PFWA 1XC6A 3RG0A 1MVQA 1IQAA 2A70A 4NO4A 1ODMA 1QXRA 1QOOA 4QAWA 3HPNA 3PMEA 4JDOA 1PO23 1ULGA 4GWIA 2VW0A 5IFTA 1W04A 3HBZA 2BTVC 4MHUA 5EPAA 5LBCA 2A75A 2XUEA 1E57A 2E33A 4YW7A 1YQ2A 2BWAA 2W94A 1UOJA 2A3YA 4QMAA 3U14A 5CFDB 2QQWA 4IEXA 4GQ7A 1W03A 4D7TA 1C8M1 5DAQA 4ARXA 1YQ8A 4Y5SA 1JZ3A 1DCSA 2WKKA 1DP0A 2BBVA 2HEWF 3NNJA 4AOCA 4F7ZA 3I8TA 2XJQA 3H7JA 2PELA 3FHQA 2YC0A 5FY0A 4M4PA 5L7OA 1AR81 3UK9A 2X53S 4NJ4A 1HLCA 5ACA1 2JG8C 1AR73 1SZBA 5IWFA 3ZFGC 1WCSA 4XQWA 4L99A 1DGWX 1W6OA 1ZA7A 2GZWA 5JZGB 5JOZA 2G4IA 3LKJA 1VB4A 3LEMA 3U1XA 3VN4A 2O0OA 1G86A 4QDSA 3JB8A 1CAUB 3DPRA 4ISQA 4Q26A 4E4HA 1MEC1 5CFCB 1GWLA 4GKYA 2Q8DA 3VZKA 1CX4A 1UYZA 4HVQA 5J96B 3BPSA 1N1SA 2ZEWA 2EIDA 3J4UH 3OBZA 4Q8LA 3MLJA 2OW4A 4P08A 1YJLA 3CU7A 4M3CE 5CU1A 3UGFA 3ALQA 5A7WA 1C8M3 2YFUA 3SHRA 3GHNA 1X9PA 4MUVA 1POV1 5A3OA 5F5AA 3PNAA 3WNXA 3RZMA 3WF3A 1QJU2 3BTAA 1PMJX 1AR61 1AR83 2DFBA 3IWZA 3LGRA 3VZJA 4RN5A 1ZZBA 4EE2A 4S2GA 4F8AA 5ACA3 5CIRA 4AYUA 4WZFA 1MS1A 3OUJA 1FMD1 1H4HA 2ZGKA 3T1LA 1GZWB 3U78A 2ZGNA 4Y4RA 4CDWB 1MACA 3VHNA 2RV9A 2RS32 5AC92 5H9PA 1DHKB 4LIUA 3N7MA 4UOJA 3WF2A 3VKMA 1SLLA 3S5AA 2XDVA 2WA3A 3PJQA 2ZXQA 1OFNA 2P3KA 2YBKA 2P3YA 4LPLA 2RM22 4MVTA 4CCKA 5J1XA 4Z92B 4IETA 2R042 5HV0A 1OQ1A 2E26A 3MYXA 1F2NA 3ACGA 3KSCA 2JDUA 1DQ2A 4PLOA 4XJUA 5KHIA 1ND2C 3SNMA 4IE6A 3FLPA 1SLTA 2MEV2 3B3QE 3PU3A 5FP8A 5F5QA 3EB7A 2PHDA 2PQSA 2WJSA 3N3HA 4AVVA 1POV3 5KXBA 3T4HB 2VNVA 4PJYA 5FIXA 5FYCA 2Y34A 1PO22 1HQWA 2BNMA 1ULDA 3E1F1 4R52A 3H1WA 2RVAA 3DYMA 2HYKA 5A6YA 1X7NA 1IG0A 2LUWA 4XUOA 5A6ZA 2WO1A 1QKQA 2RJ2A 4AL9A 4BU2A 5LCWL 4AVTA 1URXA 1Y4WA 1W9TA 2J1SA 3D6EA 4KU7A 4P9JA 3N7JA 5DDJ2 3ZR6A 2W1SA 4NAMA 2QQJA 2VZOA 1C4RA 3CJXA 4D7SA 5JMOA 3MIDA 2W2IA 1W8FA 4LA3A 5C3PA 2BOIA 1EV11 2PHXA 4I0BA 4PT6A 2H0VA 2X29A 3NAPC 2Y60A 5A7SA 2XLFA 4D8MA 4HN1A 4Y1VA 3NJXA 2Y0OA 3VD9A 2DUOA 4XIKA 5JIAA 1R091 1TMF1 2ETEA 4LBLA 4KWLA 1OFSA 3ZFGA 1ODNA 1XNDA 2CV6A 1DDLA 2ZEZA 1ND3A 2ET7A 3LWCA 1JOJA 4B29A 2XQXA 2Y26A 3WNPA 4UF0B 5A3TA 2OKXA 1VR3A 5D8AB 2WQ8A 3FN9A 4EWAA 1ZRDA 3OGSA 3D4KA 3U10A 3WEZA 4Y1YA 2ZBJA 3O12A 1YHFA 1C28A 2LRPA 1RMU1 4UFLA 5JCTA 1MS5A 2JB4A 1XYOA 2IXLA 1LCLA 2KD7A 4BJ0A 2XPJA 1OOPC 4NVPA 1V0AA 2CDOA 2AGSA 1C8M2 4H7LA 5F39A 2WNUA 3JUUA 5FCCA 2QKDA 5F32A 2W3JA 1GMMA 1UN1A 2PN5A 5KWRA 1AR82 5T3NA 4YW6A 2SBAA 3NNMA 3UYJA 4YVSB 3VBRA 5ACA2 1CAXB 5DUWA 4UW3A 1TMF3 2CWSA 3K4DA 3LDRA 4A45A 5IAVA 4OI4A 4LBNA 1J1TA 3OOXA 4M00A 3ZXEA 1D4M1 1GANA 1GOFA 4PIXA 3BB6A 4ZS2A 1EPZA 2R16A 4BXSV 1EY2A 3VL8A 2WO7A 2GN7A 3ACHA 1MEC2 1UIKA 5KXCA 1BMV1 1OMIA 1OPMA 2WFF1 1A8MA 3A7QA 4QPIC 4FO9A 4W4ZA 5FBZA 2D6KA 1Y7BA 4LO4B 1O3SA 1HQNA 1WZXA 4YW5A 4XZUG 1ND2A 5BNQA 4PQQA 1NG0A 1RUH1 4BQ4A 2Y0IA 4CXYA 1V9U1 2OZ6A 3RPQA 3VBFC 2DCTA 1QJY1 4FVVA 5KC5A 2VGDA 2VZQA 1JYCA 2VCMA 3B5LB 3MLLA 4L92A 3UT0A 5FUIA 4DQAA 1U5ZA 3OGVA 1UZ0A 2QBXA 1AR62 2B9UA 4E4SA 2VXRA 2TBVA 3LPGA 1S0CA 1YEWA 4MO3M 1G9AA 1FMD2 2GMPA 3N36A 4GWMA 4AFMA 3K75B 3VDDB 4AWDA 1D4M3 1QWRA 3ACLA 4RR3C 2VQAA 1JOBA 1JTZX 3I49A 4LE3A 3THDA 5CADA 3ZN6A 1GZCA 4PBOA 1F9KA 5FPZA 3WLUA 1VRBA 1QQP1 1WD3A 3W20A 3TEZA 3ECQA 3N35A 1NLQA 1RUI1 2EIBA 4ZPIA 3DKQA 3GALA 4L9BA 1AYN1 4N43A 3AYAA 1T6BX 5APAA 5IK8A 2WC2A 1RUH3 3DXTA 3AKPA 4XFGA 1V9U3 5GJ6A 5I91A 2QUOA 4S2HA 3DXUA 1QJY3 3OB8A 2JG9B 5A32B 3C7OA 1L7LA 3CJIB 3MUY1 2VNOA 1MPXA 4N8MA 4XAAA 3SXWA 1JYXA 4GAZA 4YARA 2VZTA 2VXJA 1UYXA 4DOUA 3AMQA 1F8VA 3B94A 2XHKA 1S2EA 4LMFA 4QB2A 2BGCA 4FPLA 4XFAA 1WCKA 3WV6A 4BQ5A 5GZCA 2CAVA 3VKLA 3IZOA 4L8QA 1NLSA 1SFYA 4UXAA 1OOPA 1HJFA 4UW6A 3ASIA 3LSEA 5FZ9A 4XILA 5KHGA 4OI2A 4QU1A 1EV12 5CNAA 5DG2A 2HLEA 2HEYF 4BM8A 1PVC1 4CEYC 4IL7A 1GQGA 2E51A 1SFNA 4IV1B 2EALA 2WUHA 5DQ0A 5FKCA 2NN8A 1RUI3 1LHOA 2X09A 4XXAA 5FAXA 5GZFA 4ET7A 1K5MC 4HPKA 1AYN3 3D82A 1AX1A 5L19A 1JZ4A 5JOWA 1K12A 1R092 4Z2WA 2QDRA 3E97A 5LA2A 3F95A 4ZZ5A 1HJGA 3ZYPA 2PHWA 2FD8A 2DUPA 3MEPA 2IZWA 4YW1A 5FK7A 3IDBB 4AEJA 2ES3A 1CAWB 1OSGA 2G1MA 3K48A 2BBAA 2D6OX 1I1EA 3T2TA 2YZ4A 5EJZB 2ZHLA 4X8NA 3WNNA 1WBFA 2QQVA 4DXZA 1RMU2 3VL9A 1O8PA 4I01A 5K7PA 3LDBA 4QGMA 4QX8A 4XC9A 4NIHA 4L97A 5T55A 2VECA 2YBPA 5ISLA 4PIYA 2WQ4A 3SH5A 3HT1A 1S0FA 1KS5A 2B5HA 2PLV1 2XQRA 1XU1A 3FFQA 4QPGC 1XNKA 1HRI1 2VMCA 2YXSA 5A3MA 2Z42A 4FOVA 1BBT1 4FPFA 3VBFA 4AEKA 2BPA2 4UBGA 3NQHA 4CUCA 4X8PA 5KBFA 4P14A 1JYIA 1P8JA 3ZMOA 5FZBA 2R071 4RFT0 5EP9A 1NCRA 4Y5Z0 1D0GA 4UBHA 3OPWA 3VV1A 2Q1FA 1WMXA 5FUNA 1RJ7A 3JCIA 1D4M2 2IUWA 4BQWA 5IK7A 1O6UA 4W6XA 2FDHA 4RR3A 1WW4A 4QB1A 3DL3A 4W8JA 1BMV2 1AL21 2WFF2 1H8TA 4LBQB 1VBE1 4CCNA 3ZYGA 4DFSA 2JENA 4A4AA 3SITA 1W6PA 2Y6LA 2VZ3A 3V0BB 3MW2A 1NKGA 4RA0A 4OHZA 2ZKNA 1ZREA 3OEAA 1XBFA 2BUKA 4URTA 3W9AA 2PLV3 4CU9A 1RUH2 2XJPA 4DO0A 1V9U2 4AEMA 4IE4A 1AR91 1BBT3 1SLBA 2CNAA 1UY3A 1GKBA 1BJQA 3OF1A 4GKXA 3NV2A 3FWEA 3S57A 1H2MA 3KVAA 3FLRA 4RS5C 4MXVA 5JSRA 2R073 4JHZA 5FZMA 1ONAA 1POV0 1CPNA 2BEOA 4OUMA 4ZONA 2XJSA 3NNGA 3BGAA 4FFHA 3IDEA 4KH9A 4QT6A 3VDBA 5A3WA 1RL3A 2XKPA 1WW6A 1IQDC 1MS8A 2JJ6A 1UF2C 4IE7A 4B8EA 3VD4A 1AL23 1J84A 1US3A 4ZHNA 2ARBA 1QQP2 3PMSA 2AEYA 5C4WC 1S0JA 2A3XA 3CL1A 3LFIA 5C8CC 4FFFA 4AAXA 1CPMA 2WZR1 1RUI2 2Y6HA 3J7NA 3ZFFA 3G7DA 1AYN2 4IEQA 2KM2A 1K5MA 2Y64A 1R1A2 4LO8A 2BJSA 3KHBA 2CL2A 3O5SA 3I2FA 4UFIA 4MOAA 3K4ZA 2VL4A 5DAWA 1LB2A 4XIOA 4RQPC 3DKWA 1AR93 1KRIA 4KBBA 2CTVA 1UY2A 1H4GA 2D6LX 3VBHC 1S4CA 3QH6A 4C91A 1ST8A 1RVF1 5SV5A 3CDZB 1APNA 1OC1A 2P37A 4Q1PA 3I59B 3POBA 1EPWA 3HEIA 4HZFA 4JGYC 5L73A 1X82A 1LNSA 3VKFC 2ADDA 4CUGA 1ENRA 1UKRA 3E6BA 3HN1A 3BIEA 5T52A 2WLPA 4JGZC 1XNBA 4LO6B 5IUQA 3OEBA 4XUPA 4SBVA 2VBPA 5A33A 3BTXA 1NZCA 1PVC2 5FOBB 1PMHX 4JDNA 1D2SA 1JW6A 5FYMA 1M4WA 5GKAC 1LOFA 2VW2A 2AZ5A 2FQPA 4WM7A 3IAPA 1LEDA 1QIQA 1MS9A 1TNFA 5TSWA 4YZ5A 1FNZA 1EUUA 5HPOA 2DCYA 3KS7A 3GDBA 5HV4A 2XR4A 5AVAA 3POEA 5DZGA 2W5FA 4COYA 4AEDA 1UZZA 1RVF3 2AREA 5CFDC 1LOCA 4HKLA 4CP9B 5IATA 4U2AA 4YGBA 1MZFA 3T2OA 4LKEA 5HCAA 1O5LA 3I3BA 1N1YA 1JHJA 1WMFA 2UWBA 4DEVA 4YZ2A 4PDWA 2PLV2 2WNEA 3POFA 1HRI2 4MXWA 4M3CF 1BBT2 5C33A 2YFZA 1IKQA 4JVAA 5FQ0A 2JD4A 3O1MA 2A73B 5F3EA 4TSVA 5IVBA 5JZGC 1REFA 3GZTB 3RJRA 2R072 1LESA 4RS5A 3ZIXA 3BTYA 2WINB 5IT6A 1HN0A 3MDPA 3W58A 3ES1A 1OI6A 3I2DA 5CFCC 5J98B 3I3QA 3A21A 4IEUA 2V73A 4GMP1 1AJOA 1N3PA 4BYYA 3RJ2X 1AL22 1W8HA 2RS51 2DVGA 4KGQA 1VBE2 4LKDA 4OUSA 1HXS1 2I74A 4HL0A 2GMEA 3ZO0B 2C24A 2KA3A 5C4WA 3WCSA 2EICA 3WDYA 4GD4A 4M3CA 4AF9A 1GWKA 4ATEA 4OI1A 4GJZA 3VKNA 2BP6A 1N47A 5ERLA 2D5HA 3T2PA 3ZYIB 1GOHA 2JDMA 2HH9A 1RXGA 5FZEA 3WY6A 4LHKA 1YJKA 4U36A 2XVLA 1UW8A 1AR92 1JXNA 3D5OA 4RHV1 2FDJA 3AKSA 1LHUA 3E5XA 4CDWC 1LHWA 1OH3A 1PZ9A 1GR3A 4WVMB 4BK4A 4FCAA 1QMJA 2JE9A 3CKHA 4IEYA 3USUB 2JDAA 3UGHA 3PUQA 4YNIA 2Y6KA 3T08A 4MV2A 3D0JA 4JGYA 1OUXA 3NSTA 3MPBA 3RI9A 4B7EA 4Q2FA 1VRH1 4AVBA 1W6MA 2G9ZA 3B69A 5I0DA 5CG8A 3KB5A 3AKTA 4GMP3 4XEZA 3WW4A 2RS53 4PI2A 3FLTA 4JGZA 3RWNA 3WZ1A 5HCHA 2FCTA 1HXS3 1UYPA 4GALA 5FZCA 4HONA 3T0DA 3HQRA 2WZR2 1D4VB 1X8EA 5JMCA 3VZMA 3O1TA 2IVIB 2OZJA 2DVAA 4LE4A 2FMYA 3ME2A 1GP5A 2PHTA 4XTPA 1SFPA 5FLJA 4ES8A 1G9BA 1JOPA 1K42A 1VALA 3SCGA 3POSA 4Q4V3 2B46X 1QDOA 4RHV3 3SH4A 1LJ7A 3C3VA 4Y26A 1RVF2 5GLWA 2OQ7A 2YUEA 5CFDA 4ASLA 4YFZA 3VZLA 5CYYA 3MIFA 2ZCWA 3AMPA 1VRH3 3ZFEC 2B4KA 4EYUA 4CUBA 1Q43A 1CJPA 4LO7A 3MFAA 3QD6A 4I2OA 1V6JA 2D98A 4A6OA 1YWKA 2WYFA 5FXXA 5FMBA 1CR7A 5LY2A 4PHZA 4HOOA 2AH2A 4FPJA 4YW2A 3HMYA 5FR3A 4AEDB 1U5IA 2ZAAA 3BU0A 4P9WA 1DZRA 1NCQB 2CHHA 2KR2A 3FUQA 1W0PA 2V4AA 3ZYBA 4QX0A 1CAUA 2BWCA 5D8AC 3HJRA 4RD7A 3S7EA 3WQ7A 1WW5A 1YQCA 2Y8KA 2IXIA 5CFCA 4Q0VA 1ALYA 2ZTNA 5A1LA 1DYOA 4AHWA 1NXD1 2XG3A 5IVYA 2WNVB 2Y33A 3P1IA 3HQUA 5LA0A 3CIHA 3QLQA 3U0ZA 4LHLA 2ADEA 1XSRA 4YW3A 4LOTA 4LHNA 4HVRA 1JYWA 1JH5A 1ZRIA 2I07B 4LNVA 4CE8A 4NIAA 4YZ1A 1G6NA 1FATA 2VQ0A 5J36A 1PGL1 1ULCA 2ZX0A 3VZOA 5IVFA 3M3OA 1LULA 2CAUA 4O9GA 4YVSC 3Q9OA 5DUXA 5B2GB 2ZA9A 1NLRA 1NE4A 4UFHA 4I09A 2IVJA 2FHRA 3H8XA 2GH8A 1QOSA 4IEOA 4BA6A 4PF1A 2Y6GA 3NNLA 1GZWA 1J3RA 5LBEA 1AL0G 2D6MA 3TWIA 1UMHA 4S2FA 2VM9A 3OYWB 4OHXA 5ANQA 2YROA 5KXDA 4M3CB 1S2BA 2RR11 3ETQA 4GWNA 4I0WB 1ASJ1 1ULEA 4CDUB 3R6SA 3BALA 1PNGA 2RS52 4XJWA 1WW7A 3GZAA 4K40A 1GWMA 5BY5A 3ELNA 1ZRFA 1HXS2 1HV1A 2WABA 2AENA 3AM2A 3BCWA 1YC61 2JDZA 2YPJA 4LIVA 3I7DA 3HT2A 3AB0A 3L2YA 4C1XA 3I4IA 5LEJA 3H1MA 3DF0A 1GP4A 5I8YA 4QM8A 1CIYA 1BEV1 4LTAA 5FYHA 4AVSA 1B35B 3LFMA 4MGZE 1C57A 4QD2A 4W65A 3ZXFA 4FAGA 5AC93 3B00A 1I5ZA 4A7YA 2VU9A 2Z2SB 3P6BA 4MLOA 2GC2A 1JYTA 3K3NA 3OY8B 1Y9QA 3M70A 2Q1ZB 3PUAA 4JRAA 5FYTA 5J09A 3AYDA 4CPBD 1COV2 5FPBA 4QQ2A 4FTSA 4AI0A 4XF4A 2MNGA 5C3QA 4NIGA 3GZEA 3MUZ1 5F2SA 4ATFA 1RUF1 2VJXA 2VQTA 1DLLA 3RNSA 1VRH2 1A6CA 2RR13 2ZABA 4N9HA 5FZ4A 2RMU1 4CDQB 4XDQA 1ASJ3 4OFGA 2O8QA 3T3YA 2QE3A 1LODA 1ULPA 2E32A 1LHVA 3TB0A 2ARAA 2VMFA 3CHXA 1OA3A 1BXHA 2B8MA 2BFUS 2P6HA 2YU2A 3WW3A 1BLZA 1XYPA 1H8VA 2YBSA 3ZPOA 1BEV3 2A6WA 2JE7A 4Q4Y1 4TLGA 1SLAA 4EQVA 4LO5B 4XF9A 3CJIC 5DDJ3 4BB3A 4Q0UA 2JECA 4UF0A 5DN2A 5T5LA 5D8AA 2GDFA 2W9XA 5LA1A 1RUD1 4K3UA 3WHUA 3PLQA 1NZIA 3BODA 5CISA 1C5HA 1VBC1 1GU3A 2VNGA 3M3IA 5A3UA 3D3AA 2W87A 5I0SA 4QHOA 2BNNA 4HT1T 3ZIWA 4QXCA 1QXPA 4DY3A 5H9RA 3ZKUA 2WFPA 4R9AA 4UFMA 3ON7A 1NOVA 5FY8A 4FOYA 2VH9A 1XB9A 3KF3A 1O91A 1PHMA 3ZX7A 4Z8BA 1IKPA 1UL9A 2JKXA 3JQXA 3T4VA 5FZ3A 1ND3C 1X36A 5BPXA 3ZSLA 2IWGB 2YDEA 3IMMA 2CSGA 2GC0A 4YVSA 3V65A 5FZ7A 1CAXA 1SLIA 3TNQA 2DURA 1H9PA 2Q0AA 3GJBA 2R061 1YFYA 4XJZA 4Q4Y3 1ZRCA 3ZPYA 4LXLA 1XOYA 1ZBA1 2D3PA 2FCUA 4Z07A 4Q4X1 4YVWB 5LWBA 1A34A 3SLIA 5KC6A 2OUHA 1RUD3 1Y9GA 2WNUC 2WBKA 3AZVA 4K8FA 2ORZA 3J9SA 5DABA 5EZWA 3GHMA 3I2HA 3RI8A 4FPHA 1OLRA 2IFRA 3NW4A 1GNZA 1LKNA 3N7LA 3ES4A 3KV6A 3T0AA 4MGSA 3VBRC 4BQ2A 5IVEA 4TTGA 3HOBA 3ORJA 5J37A 2ZGUA 3N9OA 1MR5A 3WQ1A 2K46A 1EUTA 2VOKA 4UAPA 1PGL2 1PGSA 3MPPG 4UT5A 5F3IA 2W91A 3GBWA 4W6WA 2P6CA 3BUCA 1OA2A 5DPNA 2PHRA 2BZDA 3SEEA 4RSUA 1E5IA 1AUYA 1MEC3 1G9FA 2N7GA 1DQ0A 3SKJE 2D6PA 4KL1A 3POJA 2BFUL 1OURA 1A8DA 4OULA 4AI2A 1LOBA 2IC1A 3VDDA 1ZBA3 2UURA 4I02A 3R4SA 4AI8A 4Q4X3 4TZDA 2E63A 2WRAA 1O3TA 1CAVB 4Q0PA 1AXKA 2RR12 3KCYA 1Q8SA 3EHKA 3H8UA 3OCPA 1ASJ2 4OHVA 4XQ4A 4GH4B 3ZXJA 1Z78A 2B9VA 4P9YA 5CAZA 5FPVA 3FFZA 4QX7A 5A7NA 1D0HA 3WP6A 2DU0A 1SMVA 1US2A 1AR63 2Z4FA 5LASA 1VBD1 5IHRA 5JAXA 1H6YA 3USSA 1Q3EA 5FMOS 1BEV2 2WQZC 3THTA 5LEKA 2PA7A 1FMD3 4GMP0 1OT5A 3ACFA 3U37A 2QQMA 4OI0A 2OXBA 2EIGA 2JG9A 4FQZA 3PTYA 2CDPA 1AXYA 3CJIA 1QNYA 5A32A 3I2OA 2VUDA 1KQRA 4J1XA 3FZ3A 4L0PA 4E9KA 3OGRA 4XBNA 3WSOA 2XWJB 5DUUA 4CEWB 1W2NA 2B42B 2GMMA 2XXZA 4RGKA 4N43C 4BPZA 3SCFA 5A1AA 2V4VA 3L9JT 4A7ZA 1RUF2 1ENXA 3GBFA 3WDWA 1OBNA 4FPCA 2RMU2 4BH9A 4DEQA 3WP4A 3KV5A 1RUJ1 4JDMA 5I8TA 4WM8B 1ACCA 4A3ZA 4IV1A 1YRZA 2JEMA 2PYTA 3WP3A 5DAXA 3MBWA 2XJVA 1S0IA 1DFQA 5SV8A 4BQ3A 4LUMA 1VBD3 2A5ZA 2V5YA 5DAPA 3I3EA 1W06A 3X29B 3AP5A 2VOTA 1W8OA 1FX5A 4Q4Y2 3OUHA 3EQEA 2MPFA 5GLZA 5HXVA 3O1UA 3HVDA 1CAWA 3KZ4C 4JQTA 3CF6E 1DQ1A 2YYOA 1NE6A 3L2HA 2PAKA 4AHXA 4CP1A 2OQ6A 1RUD2 2RS11 3IPVB 4HXCA 4LR4A 4ARYA 4CDXB 4XJAA 4NR1A 1Q56A 3GCWA 4CU6A 1EV13 4JV4A 1T6GC 1VBC2 3HWJA 4JX0A 1I3HA 4BHPA 1UOFA 2HBTA 1D7PM 1UNBA 1QDCA 5D1IA 4EZHA 1UQXA 4W50A 4Y22B 3WHTA 1YQ6A 1R093 1UXXX 2IXKA 4IQPA 5GLVA 2JXAA 3HQXA 1RUJ3 4L11A 2R0HA 2Z5WA 3ST7A 3RZHA 5FFOC 3IN9A 3WNOA 1KDMA 1UU4A 3EBRA 4R9DA 4OHYA 5ABJA 4XHBA 4MHRA 2B45X 4GZ9A 4P5YA 1JU4A 2R062 3BN6A 5EFUA 3UKNA 1RMU3 5FMOL 1IS3A 2SLIA 1ZBA2 1L3JA 1Q8VA 1IPSA 4Q4X2 2O14A 3C7HA 3AYEA 3B01A 4L2NA 5FZHA 4EN9B 1OF3A 1UOBA 1RUG1 3H7YA 1N1TA 1JZ5A 5BNNB 2NMNA 2X5IB 4QGNA 4LBQA 4CVUA 2A7AA 4GB31 4EN7B 4FPYA 1XE8A 1RGSA 3RWKX 1H9WA 4UI9L 1TQ5A 2WT1A 1YCIA 5FY7A 3V0BA 1HQLA 5FO7B 4DRVA 1JODA 1BKZA 3VGIA 2HBUA 4IW3A 4Y20B 3NV4A 4IV3B 3UJQA 4AQ2A 5IVJA 1DGLA 1WA4A 1NCRC 2X8KA 4KG8A 2C0ZA 2ZHMA 4Y24A 2BVBA 1XRUA 1RXFA 2CY6A 2GP3A 1GOGA 2K0GA 1NQDA 2D3RA 3PUHA 4PCRA 1ZRRA 3P3NA 3MV01 4QXHA 2QQPA 1F5JA 4WVVA 3UETA 1H8TC 2WFF3 1HN1A 5IAXA 2GNTA 2EXHA 1IS4A 2YPDA 2YU1A 2ZGPA 3DCQA 2HJIA 3IIIA 3LDKA 4R8HA 1RINA 3LSDA 1WLTA 2MHFA 1DBNA 4YWAA 4A3XA 4XUTA 1VPHA 5M0TA 5DMYA 1F4AA 1PIV1 1R1A1 1RUG3 2OVUA 5E1RA 5KR7A 4FPOB 1UOGA 4DXTA 3I2JA 2XL7A 3PIGA 4HK9A 5FYZA 3AX4A 3MFCA 4H7MA 1Y3TA 4XBLA 3KLSA 4AGGA 2ZAHA 2Q8CA 2PAMA 2BYVE 2OUJA 3AMMA 1VBD2 4IDZA 3KT1A 5A70A 5LB6A 4BE3A 5J48A 5L9VA 3RZKA 2F4LA 4QX3A 5JIUA 3LD8A 3WG4A 1KS4A 2C9KA 1LOGA 2DVBA 1UPIA 1XPWA 2VC9A 4JRLA 5K4LA 2ILMA 4YFWA 1C8NA 4D6SA 4K8RB 1TG7A 2IFWA 4QGLA 1TME1 4NWVA 2P3JA 2NYYA 4XF1A 4OQ9A 4BMEA 3MIHA 4Y1ZA 3PVEA 1RHI1 2C4XA 3JU9A 3R4DB 5GLUA 3I59A 2DBIA 2XH6A 1QQP3 4NMIA 3NVCA 2VVEA 2B7YA 1CX1A 5FY4A 3ZFFC 1MVEA 3I54A 3KCCA 4JKMA 4CA9A 3SMHA 1PIV3 1R1A3 1RUJ2 1EP0A 1KEXA 2QDNA 2WZEA 4FTBA 1HB3A 4XCBA 4XW3A 3ZOIA 4N53B 5FJHA 3INAA 1UU5A 3M8LA 3WQ0A 2XLGA 2ZPXA 3U07A 2QVSB 2BU9A 3VD5A 3ZXLA 4EJRA 2QNKA 3ZKYA 3MF6A 3FBYA 4QXBA 1UO9A 1LHNA 2GNDA 1ENSA 2JG8B 3C7EA 2TNFA 3LEGA 2NM1A 2ZKLA 2A6YA 3MF9A 1SBFA 1XNCA 2NQYA 3LOIA 3I2IA 3DYPA 4LJHA 4R9CA 1OLMA 4QWNA 3N4MA 1S0GA 3E5UA 2ZGTA 4J1WA 1TME3 4GXLA 4QQPA 3U4SA 2Z69A 3ITQA 1UXZA 5B4NA 2RS12 2W52A 1RHI3 4XPVA 3WW1A 2JIGA 4AFDA 2WSVA 1PVC3 1O4YA 4LA2A 1O8SA 3ZXAC 3ZM8A 2BW8A 3NKGA 1LOFC 2W95A 5ABJB 1DG6A 1H30A 2RDSA 1W05A 4WM7C 1I5PA 3QOPA 1DGRA 1SDWA 2G9FA 1V6IA 1VJ2A 4P9GA 1DQ6A 3ACIA 4OQ8A 2ARCA 5FYIA 2WYSA 4Y1XA 4D6RA 3PTRB 2ID4A 1CVNA 5JUVA 3BPZA 3GYDA 1IPJA 3EYPA 4IXLA 2R1DA 1RYYA 5A7PA 4CZSA 4IEPA 2VOXA 4AEDC 4DPNA 5KHKA 1OVPA 4LK7A 2JWPA 4CCLA 1KD7A 3RYPA 3O1VA 1FV3A 1NCQC 1VMHA 1AYM1 2OS2A 1UY0A 2DYCA 2HKXA 4J25A 4BWOA 2V5DA 4CCCA 1X8MA 1UX6A 3TEYA 2CGPA 1NAEA 2DU1A 2AACA 4FPEA 4CP2A 5L9RA 2WNVC 1UY4A 2E9QA 4ISRA 4FXKB 1JZ2A 1RUG2 4QKFA 3LIGA 1UMIA 1LOEA 4PDWC 1W9FA 1F5FA 4ORFA 4AR2A 4GB32 2J1EA 4X6RB 5T5OA 1PMIA 2BGPA 1HRI3 4ZXKA 1YNAA 1JMUB 4O65A 4XF3A 3O1OA 5FMCA 4LOSA 3BTZA 1H2NA 2YC4A 4RYDA 3K4AA 3ZSMA 3J7HA 5A3PA 4K6BA 1UIJA 5IFPA 1O3RA 4OYUA 1S0EA 3HBKA 4MZUA 4BQXA 2NLRA 5FUPA 5FP9A 4AHYA 1XQNA 3S0MA 5JR2A 2YC2A 3IT8A 1JUHA 2QTWB 1VIWB 2W39A 4N7UA 1MS3A 4QDRA 1U0AA 2D5FA 3DGTA 3USUA 3VBSB 2VTFA 1GBGA 3ETPA 5FDBA 1ZBE1 2VBBA 1AYM3 1VBE3 2JDYA 1LOAA 3MIEA 5GZDA 4H2AA 3OTFA 5JVVA 2VZVA 1DQ5A 2LTNA 5F3GA 4CDUC 2UWAA 5T50A 4XABA 3MGUA 2J1UA 3SH3A 1PIV2 2HWD1 2HWF2 1JI6A 4UWDA 2HEVF 4E2SA 3BI3A 4DXSA 3UGGA 1CESA 1Y43B 4XXPA 4HG6B 1NX9A 1JHNA 1W8WA 3NAPB 1SCSA 4Y33A 4BLIA 1B35C 5A7OA 2WT0A 1MS0A 4Q27A 1K3IA 2D3SA 1POQA 5FZLA 5JR7B 2JKBA 2Y6JA 5LK7B 2VBDA 5FZFA 1TME2 4B3NA 1X50A 3PHMA 1S55A 4WVMA 5HI0A 1VAVA 3P3PA 4YZ4A 5DXDA 3QBQA 2QQOA 1RHI2 3BYWA 3CMGA 5KHHA 1RC6A 1ZBE3 4YGCA 5BNPB 2XBO1 5FYUA 4CDQC 4IEVA 4NRQA 4IE0A 2Q8OA 3VZNA 2WZR3 3HN3A 4LEJA 3GGLA 3WNLA 4FFGA 2UWCA 2ZGSA 4MGKE 1AZDA 3O1SA 3LA2A 5C8WA 4TXWA 4XJ9A 1UMZA 2V72A 1XSQA 2TEPA 3H1YA 5FZKA 4TWTA 2VZ1A 3PL0A 3AFGA 2W47A 3HNYM 5IYYA 2ZMNA 3ENRA 1RJ8A 2J42A 3MZHA 1E5HA 3TYJA 1UCXA 5AFBA 5JOYA 1NCQA 5FZAA 1QXJA 4CXXA 1IOAA 4XJ8A 5I0UA 1UYYA 1RTVA 5FZ8A 1H1AA 1G9CA 2VQUA 4K20A 1JBCA 5F5IA 4KGGA 2WNVA 2VAUA 3MIBA 2H0BA 5C70A 2H6CA 3AKQA 3ILFA 2DCKA 5EJ3A 4XDOA 2OPWA 4XDPA 4EWEA 4QPIB 2ZX2A 5HXMA 2XBO3 2VOWA 3FJSA 3RZLA 1AVBA 2EIEA 2VY0A 4OUEA 2G9GA 2HWC1 5FZOB 4PI0A 4XHXA 4EZ4A 4N90A 2X10A 1Q8QA 1LEMA 2QZ2A 2E7TA 4AZZA 4DS0A 3KMHA 3K77A 4O61A 4UW4A 2FZ1A 2VMGA 1CD3G 3HR9A 2EXJA 2J1TA 4PLNA 3BOWA 4YM2A 4E8DA 4EN0A 5JSOA 3VBOB 4LKSA 3GNEA 5DZEA 5K8SA 2R49A 1F31A 4QHZA 1O59A 3GBGA 4JTNA 4K1YA 4E2GA 4PIZA 5JOXA 1AYM2 3GCXA 4YVWC 5F6LB 2HWB1 2VUCA 3OYWA 5A80A 4ITCA 1QY4A 3WF0A 2W0XA 3OGGA 1ZX5A 4XFIA 2X05A 4CDUA 4BISA 3N9MA 4K7JA 4CCDA 4CCOA 1J3PA 4LBOA 1IZ3A 5JDBA 2GC1A 3JBG1 2F17A 1PZ7A 3FHIB 3OBTA 5FY5A 1REDA 3C8XA 2HWC3 1B35A 5FYSA 1Y9MA 4Y5TA 1COV1 4XCAA 5JXJA 4PF5A 5IJRA 4HANA 5I0RA 2WT2A 2WWJA 3F2ZA 5C7GA 2IXJA 4Q1RA 1NXMA 2OIIA 2ZEXA 3OY8A 3R05A 4CU8A 3E6CC 1FYUA 1WWYA 4LUKA 1OKOA 2PTMA 1ZBE2 2K9ZA 2O8OA 4YYOA 2HWB3 5E6HA 3QCWA 4QKNA 3WCRA 1HRV1 4N9IA 3VKOA 1VE0A 2GSYA 2VUJA 2Y38A 3N9PA 4NROA 3B93A 4XUNA 4CDQA 1W2UA 3BIWE 1W6QB 1GICA 3LZZA 4JCKA 4XVHA 1DLCA 2HWD2 1HV0A 4P5HA 2G19A 5EYYA 2VMHA 3WOGA 5IVVA 2XLAA 1QHDA 4CCMA 4D3WA 3RSJA 2J22A 3APBA 3WUCA 4CEYB 4ZY9A 2FDFA 1W99A 4EN6B 1E5SA 1XJAA 2YB7A 2NPIA 1COV3 3CZJA 3A23A 4C90A 3LEKA 5FP7A 3IDAA 4FAHA 4NIDA 4MYEA 5BNOB 5K0UB 2PHUA 4RGAA 1JZ6A 5T5JA 2LM3A 3MIGA 1FOD2 5JXIA 4YGDA 3C7GA 4BDVB 1HB1A 2I45A 2D44A 2DF7A 1NQJA 1SCRA 1WMDA 4CEWC 1MZEA 4IEZA 4M0HA 5D2AA 3NMBA 1MQTB 2CWMA 3JB4C 1W3VA 3M4FA 2XBO2 3RS6A 5H9QA 4BCUA 1HRV3 3POIA 5FZGA 1QOTA 5HCBA 4NHKA 3RGBA 2GH2A 4A42A 3PUIA 4WM8C 1UPSA 4BIOA 3ZYFA 2LROA 3J8F1 2E7AA 2GALA 3I2GA 4LT5A 3LOBA 1PO11 4NN0A 4UW5A 5JXGA 3OUIA 4QPGB 4MGTA 2WSUA 1U5YA 2QQNA 3AP4A 4RGGA 3TAYA 1JZ7A 1ZZ8A 3VHPA 1WUVA 5FWJA 5DG1A 1UZWA 2GP5A 4JZRA 3D0SA 2E6VA 1VBA1 4BXFA 4YVWA 1PK6B 2JIJA 3CEWA 3IDCB 4Z2AA 2W1UA 4W6YA 5AFEA 3ZYRA 2JE8A 2RJKA 1FV2A 2D7FA 1TNRA 1F35A 3JXSA 2WAOA 3OG2A 4OHWA 4CDXC 4E4ZA 3KQ4B 2WDBA 4Z82A 4FXGB 1LU2A 2ZGMA 4AFAA 3WW2A 2ERFA 3LA3A 3JD71 4ZU7A 3IMNA 4FT8A 4MADA 1CGPA 4QX5A 1O7FA 1SDDB 2OT7A 2VCBA 2HWC2 2R32A 1OVSA 3J8F3 5JXHA 4COZA 3I3MA 1WLCA 2C1FA 3UKTA 1O5UA 1PO13 1DQ4A 3AMNA 2F4PA 2XJUA 5FPAA 1V6OA 1TEIA 3AFKA 3J7MA 4INDA 4NWWA 1IG3A 4RFRB 1ZZ7A 2JB8A 4WZCA 2WS91 5F1RA 4CCEA 2A6ZA 2VW1A 5T5PA 3MW3A 5FZ6A 2ZS6B 4LULA 4KNCA 2HWB2 4E27A 3O0XA 1CAVA 2JDKA 1KFXL 2RDRA 2D93A 4QPYA 5BNNC 2X5IC 5FO9B 1DF0A 1Z7S1 2DCJA 2J7MA 4GH4A 1RUE1 1LR5A 1OPOA 2UY9A 3H50A 4FI9A 4PBPA 3JD73 3A4UA 3JBG2 4KWKA 3RYKA 5C8CB 5L9BA 1XE0A 3H3UA 4NIIA 4EROA 1GUIA 3WF1A 4BIFA 2QCSB 3VDDC 4GA9A 1CWPA 1IS6A 1YLLA 4CYDA 3PVBB 4LQRA 4GULA 1W6NA 3MV11 2HYXA 2P1BA 3UL2A 3KCXA 2A1XA 3KF5A 3VHOA 3VBHB 4XE9A 2WS93 3THPA 4ZU4A 4XURA 3WG1A 4CEWA 4UFJA 5F6KA 4SLIA 1HRV2 1GYKA 1YFXA 1Z7S3 2QQLA 2WWSA 2XKOA 4LLFA 1WCDJ 2YV8A 1RUE3 3AP6A 1I6XA 4NAOA 4WM8A 1HIXA 5E8AA 3TBDA 1LTEA 2JG9C 1WA6X 5B4XA 4HN0A 2DFCA 5BYNA 1DGWA 2BDRA 2DUQA 3H0OA 3TEXA 3WDVA 1PX4A 1LRHA 1R081 2XGXA 4KWUA 4XBQA 3DYOA 3N9NA 3T0BA 4CXWA 1UY1A 5GZEA 5F5CA 1CZVA 4G9SB 4D94A 3TOJA 1S0DA 3NJYA 3NWKA 2RG4A 5CZKA 4JC1A 3V56A 2ZZQA 4HSLA 3HNBM 4Q0SA 4XETA 1RUF3 3IPVA 3POGA 4C0HA 4CDXA 4LITA 4E8CA 3S30A 2RMU3 1EYBA 1YI7A 2L9LA 3K3OA 4XZPA 3WX5A 4AQTA 5EHDA 2VG9A 4IV1C 4YPJA 3WDTA 2JDHA 1WCUA 3PUSA 1YQ5A 1VAKA 4KWJA 5E88A 2OX0A 2BNOA 3H42B 3M3EA 4Y22A 5FXZA 4DINB 3IB3A 5LATA 3PJYA 2FDGA 4N53C 3J8F2 1ZZ9A 4QQHA 1QU0A 2XJRA 2JDPA 1KITA 1PO12 1WBLA 4M01A 4PQ9A 2E53A 4RL7A 1R083
chains in the Genus database with same CATH topology
5C3PA 1GP4A 1HB2A 1ODMA 1RXFA 2Y60A 1W04A 2BJSA 1W28A 1HJFA 1ODNA 1GP6A 1W03A 5C3QA 2JB8A 1DCSA 1OC1A 2IVIB 1UOGA 2VE1A 1GP5A 2Y6FA 1W9YA 2VBBA 2JB4A 1HJGA 1E5RA 2VBPA 1W2NA 4RGKA 1BLZA 1HB4A 1OBNA 4BB3A 1QIQA 2BRTA 1QJFA 2DBIA 5C3RA 3OOXA 1BK0A 1W06A 2VBDA 3ZKUA 2WO7A 3ON7A 1W2OA 1W2AX 1HB3A 3ZOIA 1E5SA 2BU9A 2CSGA 3ZKYA 5C3OA 1UO9A 1UOFA 4XAEA 1UNBA 1WA6X 2DBNA 1W3XA 1HB1A 2VCMA 1W3VA 1E5HA 2IVJA 1W05A 1QJEA 1IPSA 2VAUA 1UOBA 1UZWA 1RXGA 5APAA 1E5IA 5C3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C3P A;  1GP4 A;  1HB2 A;  1ODM A;  1RXF A;  2Y60 A;  1W04 A;  2BJS A;  1W28 A;  1HJF A;  1ODN A;  1GP6 A;  1W03 A;  5C3Q A;  2JB8 A;  1DCS A;  1OC1 A;  2IVI B;  1UOG A;  2VE1 A;  1GP5 A;  2Y6F A;  1W9Y A;  2VBB A;  2JB4 A;  1HJG A;  1E5R A;  2VBP A;  1W2N A;  4RGK A;  1BLZ A;  1HB4 A;  1OBN A;  4BB3 A;  1QIQ A;  2BRT A;  1QJF A;  2DBI A;  5C3R A;  3OOX A;  1BK0 A;  1W06 A;  2VBD A;  3ZKU A;  2WO7 A;  3ON7 A;  1W2O A;  1W2A X;  1HB3 A;  3ZOI A;  1E5S A;  2BU9 A;  2CSG A;  3ZKY A;  5C3O A;  1UO9 A;  1UOF A;  4XAE A;  1UNB A;  1WA6 X;  2DBN A;  1W3X A;  1HB1 A;  2VCM A;  1W3V A;  1E5H A;  2IVJ A;  1W05 A;  1QJE A;  1IPS A;  2VAU A;  1UOB A;  1UZW A;  1RXG A;  5APA A;  1E5I A;  5C3S A; 
#chains in the Genus database with same CATH topology
 1NA1 B;  1QJZ A;  2YY1 A;  1UWW A;  4Y3O A;  5BXX A;  1GQP A;  3Q8E A;  3RVH A;  1VBC 3;  5JPM B;  1VBA 2;  2WL1 A;  3ZYH A;  4MSV A;  3LIH A;  1MZ6 A;  2C26 A;  1S2K A;  2HWE 1;  5ANN A;  1REE A;  3AXE A;  2W46 A;  5BNN A;  2X5I A;  1RB8 G;  3SKV A;  1JYN A;  2A6V A;  1GP6 A;  3AC0 A;  4KG0 A;  3WDX A;  1V6K A;  1KXG A;  3K46 A;  3DEC A;  2XVK A;  2VUA A;  4DMI A;  3NJZ A;  4WVZ A;  4O9E A;  4AGR A;  2VO5 A;  1Q8O A;  3ZLI A;  4TYS A;  3JD7 2;  4IV3 A;  4XFF A;  4Y20 A;  3WR0 A;  5ABJ C;  3JQW A;  1HDK A;  1VP6 A;  5FBJ A;  3I97 A;  5EYX A;  4B4R A;  4QU2 A;  2R06 3;  2Y6F A;  1AX0 A;  3CBN A;  3LB9 A;  4ZKT B;  1FPN 1;  4YRD A;  1X33 A;  1YI9 A;  3BOP A;  1J59 A;  5A1F A;  3GM8 A;  1GZT A;  4HK8 A;  2NZ9 A;  4XUQ A;  4YG6 A;  1LEN A;  3VBU B;  3PVN A;  1WCQ A;  3WT3 A;  2XL9 A;  2WS9 2;  5C9A B;  3WNK A;  4D7Y A;  4AI3 A;  4AHZ A;  4AXO A;  1LGB A;  1OD5 A;  1XYN A;  4XFH A;  5CKN A;  5LRS A;  2WO3 A;  3KVB A;  1JS9 A;  1O4Z A;  2HWE 3;  4AFC A;  1Z7S 2;  2EAA A;  1XXN A;  1RUE 2;  1BVP 1;  5A7Q A;  1PGW 1;  1KDK A;  1AF9 A;  4WVW A;  4LK6 A;  1UZY A;  4B4Q A;  3POY A;  2ZHK A;  3WXP A;  1V6M A;  5HBA A;  4URA A;  1W6N B;  3RZZ A;  2D6N A;  2RDN A;  2D40 A;  3FE5 A;  2Q30 A;  1BK1 A;  1GLH A;  2PHF A;  1F4H A;  4OCT A;  1OLQ A;  1UD1 A;  4AG4 A;  1GNH A;  1FPN 3;  4P9I A;  1BHG A;  1S1A A;  2ZGO A;  3AMH A;  3K51 A;  1K45 A;  1XNA A;  3SC7 X;  3VBS C;  4F3J A;  4O7X A;  5FRE A;  4XAE A;  2J1R A;  1SBD A;  3URF A;  4Q8K A;  5CEH A;  3I2K A;  2ZGR A;  2BER A;  1F15 A;  1MZ5 A;  2FDK A;  5F3C A;  3GXU A;  1PM7 A;  5BV6 A;  1W3X A;  1L7Q A;  4NRM A;  5FRA A;  1YYN A;  4NHX A;  2P2K A;  1YFU A;  2WA4 A;  2QQK A;  3O0W A;  4QB6 A;  5CBL A;  5FYY A;  3O1R A;  3UNP A;  3B7M A;  4MX3 A;  1OHF A;  3AL5 A;  3N9L A;  3ZFE B;  1UAI A;  1OKQ A;  1R1Z A;  1HX6 A;  4N53 A;  4AI9 A;  1AJK A;  1CJD A;  4QM9 A;  1VLN A;  1R08 2;  2AYH A;  5LBF A;  1AR7 2;  2JDN A;  2Z79 A;  1NYW A;  3LEI A;  1VBB 1;  2JG8 A;  5EQU A;  3ZXK A;  2EXK A;  4IES A;  1ZZC A;  4QQO A;  2D43 A;  2DV9 A;  1IHM A;  2GAU A;  3RYR A;  1DYK A;  5EWS A;  4OZO A;  1SLC A;  4MGI E;  5D21 A;  3QH7 A;  2YMZ A;  5J7M A;  2ENR A;  3RRD A;  3AZX A;  3POW A;  4AGV A;  1PM4 A;  4LOR A;  1RUC 1;  3ZYJ B;  1KJR A;  2R30 A;  3KV4 A;  1DIW A;  5BNP C;  3H3L A;  3M1H A;  4KQ7 A;  3UV9 A;  2XON A;  3CO2 A;  2WR9 A;  5L7O B;  5JPN B;  2DTW A;  4BQY A;  3FMG A;  2WZ8 A;  3ATG A;  5C5U A;  4K9S A;  4HSJ A;  3C7F A;  2FCV A;  1W6O B;  2D97 A;  3OD4 A;  3RMY A;  4CP0 A;  3TEW A;  1AXZ A;  4MGQ A;  4IGP A;  2JX9 A;  3KT7 A;  4COU A;  3OPT A;  4OMC A;  3DPR B;  4Q0Q A;  4DUW A;  2RS1 3;  1VBB 3;  4QXK A;  4FPK A;  3O7O A;  4H3W A;  4AW7 A;  1H2L A;  1SAC A;  4I3P A;  1BCX A;  1ENQ A;  4IEW A;  1JYV A;  4AI1 A;  3PUR A;  1SEF A;  1IPK A;  1U5X A;  3BKZ A;  1QH7 A;  4ONU A;  5JSP A;  2HWE 2;  1LU1 A;  4P9X A;  5A7W B;  1X9T A;  1MS4 A;  1GZ9 A;  1O4T A;  1RUC 3;  2FBE A;  4I0A A;  3T30 A;  3RZG A;  4YSF A;  3KWV A;  4KI5 M;  2P4E A;  1W8N A;  2ZX3 A;  2DTY A;  1OH4 A;  5JI9 A;  2GU9 A;  2P17 A;  3JZV A;  3SCH A;  1R64 A;  1J83 A;  2E31 A;  3CZU A;  5FTT C;  5I8S A;  2VZR A;  4HKW A;  2IXC A;  2VD7 A;  1FPN 2;  2BOJ A;  2QFE A;  2R7E B;  4C8D A;  3KD4 A;  2XHN A;  4DRR A;  5C71 A;  3VBO C;  1W8Z A;  4DNY A;  5C3R A;  3D8C A;  4P00 B;  2RJL A;  2HWF 1;  3NKT A;  3VBS A;  5F9T A;  1J3Q A;  2W08 A;  4ASM B;  1G7Y A;  3IM0 A;  3LQC A;  3R0R A;  3KQR A;  4TN7 A;  4GB3 3;  1KFU L;  1FXZ A;  4GIQ A;  4BMB A;  4GJY A;  5IK4 A;  4NPR A;  5FWE A;  2XWB B;  3T2Q A;  2VCA A;  4DIQ A;  2CU5 A;  1ULO A;  1PGW 2;  1Q5O A;  1OA4 A;  5A3N A;  1YUD A;  1WME A;  5C3O A;  3NAP A;  5FZ1 A;  3B9I A;  1V6N A;  3ZSE A;  1PNF A;  4PLM A;  4EN8 B;  4FBF A;  3LCP A;  1V00 A;  3G6J B;  1W2T A;  3M2M A;  5CA6 A;  4Q5O A;  1RUO A;  4OMD A;  4FFI A;  2ZHN A;  3WP5 A;  4I30 A;  3PDQ A;  2ZML A;  2CYF A;  2VTX J;  3HNM A;  3DN7 A;  5FPL A;  1SHW B;  4IE5 A;  4AVA A;  1OD3 A;  2W68 A;  2ZJC A;  1VMF A;  4LBQ D;  4V1P A;  3THC A;  3Q8A A;  2HWF 3;  1NUK A;  1RIR A;  4HFS A;  3EO6 A;  3VLB B;  1XE7 A;  1CIW A;  5BNP A;  5GZG A;  3AP9 A;  3BU7 A;  2RE9 A;  3O0V A;  1W0N A;  4P9L A;  4D0Q A;  1AHS A;  4Q29 A;  4FQ4 A;  5IVC A;  1GFF 2;  1ZM1 A;  4QPW A;  3N9Q A;  4JKL A;  1SBE A;  4QX2 A;  4Y4Y A;  3ZFG B;  3CLP A;  1CQ9 A;  3W5N A;  4GWJ A;  4YG0 A;  1ND3 B;  3CNA A;  1QF3 A;  4XFB A;  5A6Q A;  2I2S A;  4FOQ A;  4CU7 A;  2VNR A;  3LA7 A;  5FY9 A;  3OBR A;  2VPV A;  1VBB 2;  1TMF 2;  3H8O A;  3WUD A;  3LAG A;  1W0O A;  1JU3 A;  2EAK A;  2ZX4 A;  5BNO C;  5K0U C;  1EAH 1;  2BGO A;  2QZ3 A;  1HB2 A;  2J1A A;  2EF6 A;  1SQ4 A;  5FPX A;  4YLZ A;  3FUO A;  1RUC 2;  4LBK A;  1MQT C;  2A6X A;  1W9S A;  2WNU B;  5FO8 B;  3MIC A;  3HD8 B;  3S6P A;  1GQH A;  4QPI A;  4BK5 A;  5E89 A;  2EA7 A;  1OUS A;  4IER A;  3H3Z A;  3ILR A;  4AK3 A;  1QH6 A;  2FDI A;  5FZO A;  3VBR B;  5EV7 A;  5CB7 A;  2VZP A;  4YZ3 A;  5EJ1 B;  1PZ8 A;  2ATF A;  2ZOE B;  5I93 A;  2QJV A;  2VVD A;  4N7I A;  1UZV A;  1W9Y A;  2AEZ A;  2O1Q A;  2AUY A;  4QQL A;  3VBO A;  1YIF A;  4ZS3 A;  5LK5 A;  5E16 A;  3TN9 1;  2A71 A;  1BVV A;  1E5R A;  1ZA4 A;  2VME A;  5F8P A;  1OXC A;  1PK6 C;  1JZ8 A;  5FYB A;  1EAH 3;  2YGM A;  3ZDV A;  5FZD A;  4K1Z A;  4YGE A;  5LRR A;  2WWU A;  4WBB A;  3KT4 A;  1FAY A;  2ORX A;  2Q5T A;  4Q4W 1;  4A7K A;  2PAE A;  1ND2 B;  2GNB A;  3OPZ A;  1UKG A;  4DZG A;  2W1W A;  3AKR A;  3FX3 A;  2VVF A;  4XTM A;  4A6S A;  2RHP A;  4H55 A;  3FL7 A;  2LS6 A;  2PQQ A;  4R9B A;  5J3U A;  2PHL A;  1WD4 A;  3T1M A;  5FOJ B;  3J7L A;  3N7K A;  1VAM A;  4JQR A;  4LLO A;  3W5M A;  1ZZ6 A;  3AZW A;  5AVP A;  4XYX A;  3SIS A;  2H6B A;  4XAC A;  2WN2 A;  1QJY 2;  3NV1 A;  3HAG A;  4A2U A;  1S0B A;  5L36 A;  2UYA A;  4HVO A;  2XOM A;  3EMR A;  4MET A;  5FZI A;  5HCF A;  1WKY A;  3TN9 3;  4D6Q A;  3ZN6 B;  2AR6 A;  3VB9 A;  4FPG A;  4NUB A;  3AVS A;  4XF0 A;  1LEC A;  2C9A A;  3OBA A;  1C1L A;  3B02 A;  3M7A A;  4XFC A;  4UFK A;  3ABZ A;  1W6Q A;  4N43 B;  3LF7 A;  4Q4W 3;  3RMX A;  5LA9 A;  3WD5 A;  4A44 A;  1H1I A;  3FC0 A;  1FNY A;  2YG0 A;  2V09 A;  5FKB A;  3E6D A;  4AE2 A;  1OQD A;  1VMJ A;  4CEY A;  2FMD A;  4LBJ A;  1FOD 1;  2DCZ A;  3IIA A;  2WAA A;  3Q8F A;  1ZNP A;  1NY7 1;  5FP3 A;  3RQ0 A;  3ZXD A;  3ZN5 A;  2VMD A;  3IAQ A;  5K0U A;  5BNO A;  1N1V A;  1K5J A;  4Y1U A;  1W8T A;  5F2W A;  5DUV A;  3WNM A;  1SPP A;  3NNF A;  2R1B A;  1OOP B;  4XQD A;  5K9Y A;  2HWD 3;  3AXD A;  4HBN A;  3AJZ A;  3WG3 A;  4HMZ A;  1MQT A;  3H8R A;  2PXJ A;  2VMI A;  2VTX A;  3K2O A;  4FP2 A;  5JI7 A;  1I9R A;  1QNW A;  4AAP A;  1ZVF A;  5FMD A;  1QGL A;  3WF4 A;  1DZT A;  4YW4 A;  3NO8 A;  4HPK B;  1VB2 A;  1A3K A;  2B39 A;  3OGJ A;  3MI8 A;  4QPG A;  2CGO A;  3M3C A;  3AVR A;  3GZU C;  5GM0 A;  1FOD 3;  3IKW A;  1C3H A;  2P5B A;  3ZVX A;  1PVX A;  3NRU A;  4K21 A;  4QDQ A;  3UES A;  5FPU A;  4AVC A;  1EAH 2;  1PK6 A;  1Q8P A;  5DZF A;  1LAJ A;  4ZXE A;  3VUO A;  2WNO A;  5LZ6 A;  2BV4 A;  3A0N A;  2ET1 A;  3W59 A;  4JTO A;  3MHZ A;  1L7R A;  4MGY E;  1C1F A;  2LAL A;  5EIY B;  1J58 A;  1CZT A;  2DVF A;  3ILN A;  4B7K A;  5KXE A;  2OA2 A;  3VBF B;  2LW8 A;  2R6Q A;  4P02 B;  3FHA A;  5CKM A;  4HKO A;  1FI2 A;  4OLL A;  4NHL A;  1FT9 A;  1W8U A;  3ZSK A;  5GAL A;  5LY1 A;  5IW0 A;  4V2W A;  1HB4 A;  1NCR B;  4M4R A;  3RFR A;  5FP4 A;  3SQO A;  4ASK A;  1NA1 C;  2JD9 A;  2ZMK A;  3MLK A;  3AJY A;  4RR3 B;  3VHR A;  1QJF A;  4R4X A;  3TN9 2;  3NJV A;  5BUV A;  1HKD A;  4DY5 A;  5JWP A;  1A78 A;  2BQP A;  2QQU A;  4KU8 A;  1BK0 A;  1H8T B;  2XML A;  2Q1M A;  5G05 L;  3UKV A;  2VOV A;  3OD0 A;  1M06 G;  1BZW A;  1W6P B;  1AX2 A;  1TE1 B;  1OQE A;  4Q4W 2;  1QJX 1;  2EXI A;  2ZGQ A;  4C0B A;  4MH0 E;  5C6C A;  3NL1 A;  3UJO A;  1W90 A;  3ZSJ A;  4FOW A;  4CCJ A;  4FP3 A;  3OSD A;  5H9S A;  1CN1 A;  2VZU A;  3U11 A;  2XJT A;  1BYH A;  4YM0 A;  5C8C A;  2UU8 A;  5G04 L;  4C1W A;  2PMW B;  3EXU A;  3FBM A;  3O14 A;  3U4X A;  2DVD A;  3KM5 A;  2GN3 A;  4FTE A;  1KJL A;  3QAC A;  2DBN A;  5FLH A;  3VBU C;  4F83 A;  4Q4V 1;  1V6L A;  3AK0 A;  4EV0 A;  1Z0H A;  4GH4 C;  4RQP A;  4YG3 A;  3VDA A;  2WN3 A;  3AL6 A;  5C9A C;  4QX1 A;  3VBH A;  1G9D A;  3LPF A;  4JKK A;  1O3Q A;  1JUI A;  2W92 A;  1UX7 A;  5FY1 A;  5F7U A;  3ROU A;  1SG3 A;  3IBM A;  3AZY A;  3Q8B A;  4AFB A;  1KGY A;  3ZMN A;  3WIN E;  3CQO A;  1W39 A;  3AZZ A;  2OPK A;  1CON A;  3J26 N;  3JBG 3;  2ZX1 A;  1ULF A;  3KHC A;  4CP9 A;  3S5Q A;  3ZFF B;  4YM3 A;  3TNP B;  4JHT A;  1QJX 3;  5CG9 A;  2ZGL A;  3A22 A;  1K5M B;  2P3I A;  4ES9 A;  4B4P A;  2XUM A;  2J1V A;  2ARX A;  4KBZ A;  1CZS A;  2YHJ A;  1H0B A;  2GNM A;  3I3D A;  4NHY A;  1SPP B;  5FK8 A;  2BVV A;  1BQP A;  1STM A;  1NY7 2;  2JIC A;  2VUL A;  3M3Q A;  3V0A A;  2VZS A;  5C3S A;  3BVC A;  3AYC A;  1IGO A;  1G8W A;  3EJK A;  4OZX A;  5CVR A;  1OLM E;  1UU6 A;  3S7I A;  3H9A A;  2A3W A;  4QHB A;  1N3Q A;  4JAA A;  5FXV A;  2XVG A;  1XU2 A;  1WGP A;  4LBM A;  4BQ1 A;  1T2X A;  5CKQ A;  2ZEY A;  4B1M A;  2ZZJ A;  5EXO A;  4OVE A;  4B1L A;  5A33 B;  4R4Z A;  4WV8 A;  1W28 A;  1XNT A;  2WII B;  3B9C A;  1U12 A;  4NRP A;  3DV8 A;  2NMO A;  1WLD A;  3T09 A;  4CRQ A;  4E4D X;  4QKD A;  1YO8 A;  3LE0 A;  4BZ4 A;  1DU3 D;  1GNY A;  4UYB A;  3E5Q A;  1OF4 A;  4WM7 B;  3SEP A;  5A3L A;  4NE9 A;  3ZN4 A;  4BLJ A;  1TVG A;  5T54 A;  2VE1 A;  1NA1 A;  1YXW A;  3RDI A;  3VDC A;  4H14 A;  3ZDS A;  3AP7 A;  2Q4S A;  2RDQ A;  2XB6 C;  5FXW A;  4G4F A;  2EVX A;  4X6Q B;  4CTE A;  5I0T A;  5JZG A;  4LHS A;  4CPB A;  1LGC A;  2CGN A;  1GSL A;  4ZU5 A;  5FYV A;  3WQB A;  3DUI A;  1JN2 P;  3P5B A;  1PX3 A;  4ZZ8 A;  4QKB A;  2WLQ A;  4S2D A;  4CUA A;  5LW9 A;  4MG2 A;  1ZYB A;  3PIJ A;  3Q8C A;  3U75 A;  3W21 A;  4J6G A;  5L7O C;  4PDW B;  4IGO A;  1QJU 1;  4TLF A;  5FLI A;  4DXR A;  4E2Q A;  2BRT A;  1RIT A;  4MXW B;  2IXH A;  3RZJ A;  2UYB A;  5DAV A;  4XOG A;  5FQ0 B;  2OYZ A;  1H6X A;  4LKF A;  4NPL A;  3WVJ A;  5GLT A;  1H1M A;  1VBA 3;  2RS3 1;  4KMQ A;  5AC9 1;  4RS5 B;  3NV3 A;  4XMA A;  1LGN A;  2W1Q A;  1W2O A;  3DPR C;  4IGQ A;  4NHM A;  3VBU A;  4COW A;  5IK5 A;  3WDU A;  4CSW A;  1HW5 A;  1W2A X;  4M0N A;  3V64 A;  3VD3 A;  5C9A A;  1N3O A;  2RM2 1;  4CDW A;  4EWD A;  1QEX A;  3KV9 A;  2R04 1;  4FSJ A;  3VD7 A;  1C5I A;  2K2S A;  1NT0 A;  2C6S A;  3PVO A;  1RUN A;  4G3Y C;  5A6X A;  4IV3 C;  1D2Q A;  2YGL A;  4HLT A;  1WLW A;  2VCC A;  5LBB A;  5C4W B;  3C2U A;  2UY8 A;  4BOW A;  2NP0 A;  2E7Q A;  2MEV 1;  2WZP P;  4AQ6 A;  1QJX 2;  4DB5 A;  3DEM A;  1DGR N;  5FJK A;  2TUN A;  3KGZ A;  5JLV A;  1YIP A;  5FZ0 A;  4A41 A;  4AQS A;  2KXL A;  3O1P A;  3OJB A;  1QJU 3;  2VR4 A;  4XMI A;  2GC3 A;  1PO2 1;  3PU8 A;  5C5T A;  4RQP B;  4D69 A;  3KGL A;  4I3G A;  2ZAC A;  5KHJ A;  3ZXG A;  1V70 A;  1IS5 A;  1TZO A;  3WG2 A;  4DUV A;  4HET A;  1DZQ A;  2WO2 A;  3R4U A;  5DDJ 1;  1J1L A;  1H2K A;  2P34 A;  2RS3 3;  5FV3 A;  2R0F A;  4Q4V 2;  2Q8E A;  4JGY B;  4RHV 2;  1QJE A;  2DDU A;  1W6M B;  2C5D A;  2QQI A;  3A0K A;  4V2V A;  3GF6 A;  3MO4 A;  2RM2 3;  2R04 3;  4COV A;  3HIF A;  1B09 A;  4JGZ B;  4NOT A;  4DUX A;  1DYP A;  4NPM A;  2F6B A;  2DWR A;  4IUG A;  2AC1 A;  4YM1 A;  2FZ2 A;  5F37 A;  1GV9 A;  1AR7 1;  3MW4 A;  4Z1V A;  1W9W A;  2MEV 3;  3ZFE A;  3GJA A;  3ZR5 A;  1YFW A;  3V0A B;  3TRS B;  2PFW A;  1XC6 A;  3RG0 A;  1MVQ A;  1IQA A;  2A70 A;  4NO4 A;  1ODM A;  1QXR A;  1QOO A;  4QAW A;  3HPN A;  3PME A;  4JDO A;  1PO2 3;  1ULG A;  4GWI A;  2VW0 A;  5IFT A;  1W04 A;  3HBZ A;  2BTV C;  4MHU A;  5EPA A;  5LBC A;  2A75 A;  2XUE A;  1E57 A;  2E33 A;  4YW7 A;  1YQ2 A;  2BWA A;  2W94 A;  1UOJ A;  2A3Y A;  4QMA A;  3U14 A;  5CFD B;  2QQW A;  4IEX A;  4GQ7 A;  1W03 A;  4D7T A;  1C8M 1;  5DAQ A;  4ARX A;  1YQ8 A;  4Y5S A;  1JZ3 A;  1DCS A;  2WKK A;  1DP0 A;  2BBV A;  2HEW F;  3NNJ A;  4AOC A;  4F7Z A;  3I8T A;  2XJQ A;  3H7J A;  2PEL A;  3FHQ A;  2YC0 A;  5FY0 A;  4M4P A;  5L7O A;  1AR8 1;  3UK9 A;  2X53 S;  4NJ4 A;  1HLC A;  5ACA 1;  2JG8 C;  1AR7 3;  1SZB A;  5IWF A;  3ZFG C;  1WCS A;  4XQW A;  4L99 A;  1DGW X;  1W6O A;  1ZA7 A;  2GZW A;  5JZG B;  5JOZ A;  2G4I A;  3LKJ A;  1VB4 A;  3LEM A;  3U1X A;  3VN4 A;  2O0O A;  1G86 A;  4QDS A;  3JB8 A;  1CAU B;  3DPR A;  4ISQ A;  4Q26 A;  4E4H A;  1MEC 1;  5CFC B;  1GWL A;  4GKY A;  2Q8D A;  3VZK A;  1CX4 A;  1UYZ A;  4HVQ A;  5J96 B;  3BPS A;  1N1S A;  2ZEW A;  2EID A;  3J4U H;  3OBZ A;  4Q8L A;  3MLJ A;  2OW4 A;  4P08 A;  1YJL A;  3CU7 A;  4M3C E;  5CU1 A;  3UGF A;  3ALQ A;  5A7W A;  1C8M 3;  2YFU A;  3SHR A;  3GHN A;  1X9P A;  4MUV A;  1POV 1;  5A3O A;  5F5A A;  3PNA A;  3WNX A;  3RZM A;  3WF3 A;  1QJU 2;  3BTA A;  1PMJ X;  1AR6 1;  1AR8 3;  2DFB A;  3IWZ A;  3LGR A;  3VZJ A;  4RN5 A;  1ZZB A;  4EE2 A;  4S2G A;  4F8A A;  5ACA 3;  5CIR A;  4AYU A;  4WZF A;  1MS1 A;  3OUJ A;  1FMD 1;  1H4H A;  2ZGK A;  3T1L A;  1GZW B;  3U78 A;  2ZGN A;  4Y4R A;  4CDW B;  1MAC A;  3VHN A;  2RV9 A;  2RS3 2;  5AC9 2;  5H9P A;  1DHK B;  4LIU A;  3N7M A;  4UOJ A;  3WF2 A;  3VKM A;  1SLL A;  3S5A A;  2XDV A;  2WA3 A;  3PJQ A;  2ZXQ A;  1OFN A;  2P3K A;  2YBK A;  2P3Y A;  4LPL A;  2RM2 2;  4MVT A;  4CCK A;  5J1X A;  4Z92 B;  4IET A;  2R04 2;  5HV0 A;  1OQ1 A;  2E26 A;  3MYX A;  1F2N A;  3ACG A;  3KSC A;  2JDU A;  1DQ2 A;  4PLO A;  4XJU A;  5KHI A;  1ND2 C;  3SNM A;  4IE6 A;  3FLP A;  1SLT A;  2MEV 2;  3B3Q E;  3PU3 A;  5FP8 A;  5F5Q A;  3EB7 A;  2PHD A;  2PQS A;  2WJS A;  3N3H A;  4AVV A;  1POV 3;  5KXB A;  3T4H B;  2VNV A;  4PJY A;  5FIX A;  5FYC A;  2Y34 A;  1PO2 2;  1HQW A;  2BNM A;  1ULD A;  3E1F 1;  4R52 A;  3H1W A;  2RVA A;  3DYM A;  2HYK A;  5A6Y A;  1X7N A;  1IG0 A;  2LUW A;  4XUO A;  5A6Z A;  2WO1 A;  1QKQ A;  2RJ2 A;  4AL9 A;  4BU2 A;  5LCW L;  4AVT A;  1URX A;  1Y4W A;  1W9T A;  2J1S A;  3D6E A;  4KU7 A;  4P9J A;  3N7J A;  5DDJ 2;  3ZR6 A;  2W1S A;  4NAM A;  2QQJ A;  2VZO A;  1C4R A;  3CJX A;  4D7S A;  5JMO A;  3MID A;  2W2I A;  1W8F A;  4LA3 A;  5C3P A;  2BOI A;  1EV1 1;  2PHX A;  4I0B A;  4PT6 A;  2H0V A;  2X29 A;  3NAP C;  2Y60 A;  5A7S A;  2XLF A;  4D8M A;  4HN1 A;  4Y1V A;  3NJX A;  2Y0O A;  3VD9 A;  2DUO A;  4XIK A;  5JIA A;  1R09 1;  1TMF 1;  2ETE A;  4LBL A;  4KWL A;  1OFS A;  3ZFG A;  1ODN A;  1XND A;  2CV6 A;  1DDL A;  2ZEZ A;  1ND3 A;  2ET7 A;  3LWC A;  1JOJ A;  4B29 A;  2XQX A;  2Y26 A;  3WNP A;  4UF0 B;  5A3T A;  2OKX A;  1VR3 A;  5D8A B;  2WQ8 A;  3FN9 A;  4EWA A;  1ZRD A;  3OGS A;  3D4K A;  3U10 A;  3WEZ A;  4Y1Y A;  2ZBJ A;  3O12 A;  1YHF A;  1C28 A;  2LRP A;  1RMU 1;  4UFL A;  5JCT A;  1MS5 A;  2JB4 A;  1XYO A;  2IXL A;  1LCL A;  2KD7 A;  4BJ0 A;  2XPJ A;  1OOP C;  4NVP A;  1V0A A;  2CDO A;  2AGS A;  1C8M 2;  4H7L A;  5F39 A;  2WNU A;  3JUU A;  5FCC A;  2QKD A;  5F32 A;  2W3J A;  1GMM A;  1UN1 A;  2PN5 A;  5KWR A;  1AR8 2;  5T3N A;  4YW6 A;  2SBA A;  3NNM A;  3UYJ A;  4YVS B;  3VBR A;  5ACA 2;  1CAX B;  5DUW A;  4UW3 A;  1TMF 3;  2CWS A;  3K4D A;  3LDR A;  4A45 A;  5IAV A;  4OI4 A;  4LBN A;  1J1T A;  3OOX A;  4M00 A;  3ZXE A;  1D4M 1;  1GAN A;  1GOF A;  4PIX A;  3BB6 A;  4ZS2 A;  1EPZ A;  2R16 A;  4BXS V;  1EY2 A;  3VL8 A;  2WO7 A;  2GN7 A;  3ACH A;  1MEC 2;  1UIK A;  5KXC A;  1BMV 1;  1OMI A;  1OPM A;  2WFF 1;  1A8M A;  3A7Q A;  4QPI C;  4FO9 A;  4W4Z A;  5FBZ A;  2D6K A;  1Y7B A;  4LO4 B;  1O3S A;  1HQN A;  1WZX A;  4YW5 A;  4XZU G;  1ND2 A;  5BNQ A;  4PQQ A;  1NG0 A;  1RUH 1;  4BQ4 A;  2Y0I A;  4CXY A;  1V9U 1;  2OZ6 A;  3RPQ A;  3VBF C;  2DCT A;  1QJY 1;  4FVV A;  5KC5 A;  2VGD A;  2VZQ A;  1JYC A;  2VCM A;  3B5L B;  3MLL A;  4L92 A;  3UT0 A;  5FUI A;  4DQA A;  1U5Z A;  3OGV A;  1UZ0 A;  2QBX A;  1AR6 2;  2B9U A;  4E4S A;  2VXR A;  2TBV A;  3LPG A;  1S0C A;  1YEW A;  4MO3 M;  1G9A A;  1FMD 2;  2GMP A;  3N36 A;  4GWM A;  4AFM A;  3K75 B;  3VDD B;  4AWD A;  1D4M 3;  1QWR A;  3ACL A;  4RR3 C;  2VQA A;  1JOB A;  1JTZ X;  3I49 A;  4LE3 A;  3THD A;  5CAD A;  3ZN6 A;  1GZC A;  4PBO A;  1F9K A;  5FPZ A;  3WLU A;  1VRB A;  1QQP 1;  1WD3 A;  3W20 A;  3TEZ A;  3ECQ A;  3N35 A;  1NLQ A;  1RUI 1;  2EIB A;  4ZPI A;  3DKQ A;  3GAL A;  4L9B A;  1AYN 1;  4N43 A;  3AYA A;  1T6B X;  5APA A;  5IK8 A;  2WC2 A;  1RUH 3;  3DXT A;  3AKP A;  4XFG A;  1V9U 3;  5GJ6 A;  5I91 A;  2QUO A;  4S2H A;  3DXU A;  1QJY 3;  3OB8 A;  2JG9 B;  5A32 B;  3C7O A;  1L7L A;  3CJI B;  3MUY 1;  2VNO A;  1MPX A;  4N8M A;  4XAA A;  3SXW A;  1JYX A;  4GAZ A;  4YAR A;  2VZT A;  2VXJ A;  1UYX A;  4DOU A;  3AMQ A;  1F8V A;  3B94 A;  2XHK A;  1S2E A;  4LMF A;  4QB2 A;  2BGC A;  4FPL A;  4XFA A;  1WCK A;  3WV6 A;  4BQ5 A;  5GZC A;  2CAV A;  3VKL A;  3IZO A;  4L8Q A;  1NLS A;  1SFY A;  4UXA A;  1OOP A;  1HJF A;  4UW6 A;  3ASI A;  3LSE A;  5FZ9 A;  4XIL A;  5KHG A;  4OI2 A;  4QU1 A;  1EV1 2;  5CNA A;  5DG2 A;  2HLE A;  2HEY F;  4BM8 A;  1PVC 1;  4CEY C;  4IL7 A;  1GQG A;  2E51 A;  1SFN A;  4IV1 B;  2EAL A;  2WUH A;  5DQ0 A;  5FKC A;  2NN8 A;  1RUI 3;  1LHO A;  2X09 A;  4XXA A;  5FAX A;  5GZF A;  4ET7 A;  1K5M C;  4HPK A;  1AYN 3;  3D82 A;  1AX1 A;  5L19 A;  1JZ4 A;  5JOW A;  1K12 A;  1R09 2;  4Z2W A;  2QDR A;  3E97 A;  5LA2 A;  3F95 A;  4ZZ5 A;  1HJG A;  3ZYP A;  2PHW A;  2FD8 A;  2DUP A;  3MEP A;  2IZW A;  4YW1 A;  5FK7 A;  3IDB B;  4AEJ A;  2ES3 A;  1CAW B;  1OSG A;  2G1M A;  3K48 A;  2BBA A;  2D6O X;  1I1E A;  3T2T A;  2YZ4 A;  5EJZ B;  2ZHL A;  4X8N A;  3WNN A;  1WBF A;  2QQV A;  4DXZ A;  1RMU 2;  3VL9 A;  1O8P A;  4I01 A;  5K7P A;  3LDB A;  4QGM A;  4QX8 A;  4XC9 A;  4NIH A;  4L97 A;  5T55 A;  2VEC A;  2YBP A;  5ISL A;  4PIY A;  2WQ4 A;  3SH5 A;  3HT1 A;  1S0F A;  1KS5 A;  2B5H A;  2PLV 1;  2XQR A;  1XU1 A;  3FFQ A;  4QPG C;  1XNK A;  1HRI 1;  2VMC A;  2YXS A;  5A3M A;  2Z42 A;  4FOV A;  1BBT 1;  4FPF A;  3VBF A;  4AEK A;  2BPA 2;  4UBG A;  3NQH A;  4CUC A;  4X8P A;  5KBF A;  4P14 A;  1JYI A;  1P8J A;  3ZMO A;  5FZB A;  2R07 1;  4RFT 0;  5EP9 A;  1NCR A;  4Y5Z 0;  1D0G A;  4UBH A;  3OPW A;  3VV1 A;  2Q1F A;  1WMX A;  5FUN A;  1RJ7 A;  3JCI A;  1D4M 2;  2IUW A;  4BQW A;  5IK7 A;  1O6U A;  4W6X A;  2FDH A;  4RR3 A;  1WW4 A;  4QB1 A;  3DL3 A;  4W8J A;  1BMV 2;  1AL2 1;  2WFF 2;  1H8T A;  4LBQ B;  1VBE 1;  4CCN A;  3ZYG A;  4DFS A;  2JEN A;  4A4A A;  3SIT A;  1W6P A;  2Y6L A;  2VZ3 A;  3V0B B;  3MW2 A;  1NKG A;  4RA0 A;  4OHZ A;  2ZKN A;  1ZRE A;  3OEA A;  1XBF A;  2BUK A;  4URT A;  3W9A A;  2PLV 3;  4CU9 A;  1RUH 2;  2XJP A;  4DO0 A;  1V9U 2;  4AEM A;  4IE4 A;  1AR9 1;  1BBT 3;  1SLB A;  2CNA A;  1UY3 A;  1GKB A;  1BJQ A;  3OF1 A;  4GKX A;  3NV2 A;  3FWE A;  3S57 A;  1H2M A;  3KVA A;  3FLR A;  4RS5 C;  4MXV A;  5JSR A;  2R07 3;  4JHZ A;  5FZM A;  1ONA A;  1POV 0;  1CPN A;  2BEO A;  4OUM A;  4ZON A;  2XJS A;  3NNG A;  3BGA A;  4FFH A;  3IDE A;  4KH9 A;  4QT6 A;  3VDB A;  5A3W A;  1RL3 A;  2XKP A;  1WW6 A;  1IQD C;  1MS8 A;  2JJ6 A;  1UF2 C;  4IE7 A;  4B8E A;  3VD4 A;  1AL2 3;  1J84 A;  1US3 A;  4ZHN A;  2ARB A;  1QQP 2;  3PMS A;  2AEY A;  5C4W C;  1S0J A;  2A3X A;  3CL1 A;  3LFI A;  5C8C C;  4FFF A;  4AAX A;  1CPM A;  2WZR 1;  1RUI 2;  2Y6H A;  3J7N A;  3ZFF A;  3G7D A;  1AYN 2;  4IEQ A;  2KM2 A;  1K5M A;  2Y64 A;  1R1A 2;  4LO8 A;  2BJS A;  3KHB A;  2CL2 A;  3O5S A;  3I2F A;  4UFI A;  4MOA A;  3K4Z A;  2VL4 A;  5DAW A;  1LB2 A;  4XIO A;  4RQP C;  3DKW A;  1AR9 3;  1KRI A;  4KBB A;  2CTV A;  1UY2 A;  1H4G A;  2D6L X;  3VBH C;  1S4C A;  3QH6 A;  4C91 A;  1ST8 A;  1RVF 1;  5SV5 A;  3CDZ B;  1APN A;  1OC1 A;  2P37 A;  4Q1P A;  3I59 B;  3POB A;  1EPW A;  3HEI A;  4HZF A;  4JGY C;  5L73 A;  1X82 A;  1LNS A;  3VKF C;  2ADD A;  4CUG A;  1ENR A;  1UKR A;  3E6B A;  3HN1 A;  3BIE A;  5T52 A;  2WLP A;  4JGZ C;  1XNB A;  4LO6 B;  5IUQ A;  3OEB A;  4XUP A;  4SBV A;  2VBP A;  5A33 A;  3BTX A;  1NZC A;  1PVC 2;  5FOB B;  1PMH X;  4JDN A;  1D2S A;  1JW6 A;  5FYM A;  1M4W A;  5GKA C;  1LOF A;  2VW2 A;  2AZ5 A;  2FQP A;  4WM7 A;  3IAP A;  1LED A;  1QIQ A;  1MS9 A;  1TNF A;  5TSW A;  4YZ5 A;  1FNZ A;  1EUU A;  5HPO A;  2DCY A;  3KS7 A;  3GDB A;  5HV4 A;  2XR4 A;  5AVA A;  3POE A;  5DZG A;  2W5F A;  4COY A;  4AED A;  1UZZ A;  1RVF 3;  2ARE A;  5CFD C;  1LOC A;  4HKL A;  4CP9 B;  5IAT A;  4U2A A;  4YGB A;  1MZF A;  3T2O A;  4LKE A;  5HCA A;  1O5L A;  3I3B A;  1N1Y A;  1JHJ A;  1WMF A;  2UWB A;  4DEV A;  4YZ2 A;  4PDW A;  2PLV 2;  2WNE A;  3POF A;  1HRI 2;  4MXW A;  4M3C F;  1BBT 2;  5C33 A;  2YFZ A;  1IKQ A;  4JVA A;  5FQ0 A;  2JD4 A;  3O1M A;  2A73 B;  5F3E A;  4TSV A;  5IVB A;  5JZG C;  1REF A;  3GZT B;  3RJR A;  2R07 2;  1LES A;  4RS5 A;  3ZIX A;  3BTY A;  2WIN B;  5IT6 A;  1HN0 A;  3MDP A;  3W58 A;  3ES1 A;  1OI6 A;  3I2D A;  5CFC C;  5J98 B;  3I3Q A;  3A21 A;  4IEU A;  2V73 A;  4GMP 1;  1AJO A;  1N3P A;  4BYY A;  3RJ2 X;  1AL2 2;  1W8H A;  2RS5 1;  2DVG A;  4KGQ A;  1VBE 2;  4LKD A;  4OUS A;  1HXS 1;  2I74 A;  4HL0 A;  2GME A;  3ZO0 B;  2C24 A;  2KA3 A;  5C4W A;  3WCS A;  2EIC A;  3WDY A;  4GD4 A;  4M3C A;  4AF9 A;  1GWK A;  4ATE A;  4OI1 A;  4GJZ A;  3VKN A;  2BP6 A;  1N47 A;  5ERL A;  2D5H A;  3T2P A;  3ZYI B;  1GOH A;  2JDM A;  2HH9 A;  1RXG A;  5FZE A;  3WY6 A;  4LHK A;  1YJK A;  4U36 A;  2XVL A;  1UW8 A;  1AR9 2;  1JXN A;  3D5O A;  4RHV 1;  2FDJ A;  3AKS A;  1LHU A;  3E5X A;  4CDW C;  1LHW A;  1OH3 A;  1PZ9 A;  1GR3 A;  4WVM B;  4BK4 A;  4FCA A;  1QMJ A;  2JE9 A;  3CKH A;  4IEY A;  3USU B;  2JDA A;  3UGH A;  3PUQ A;  4YNI A;  2Y6K A;  3T08 A;  4MV2 A;  3D0J A;  4JGY A;  1OUX A;  3NST A;  3MPB A;  3RI9 A;  4B7E A;  4Q2F A;  1VRH 1;  4AVB A;  1W6M A;  2G9Z A;  3B69 A;  5I0D A;  5CG8 A;  3KB5 A;  3AKT A;  4GMP 3;  4XEZ A;  3WW4 A;  2RS5 3;  4PI2 A;  3FLT A;  4JGZ A;  3RWN A;  3WZ1 A;  5HCH A;  2FCT A;  1HXS 3;  1UYP A;  4GAL A;  5FZC A;  4HON A;  3T0D A;  3HQR A;  2WZR 2;  1D4V B;  1X8E A;  5JMC A;  3VZM A;  3O1T A;  2IVI B;  2OZJ A;  2DVA A;  4LE4 A;  2FMY A;  3ME2 A;  1GP5 A;  2PHT A;  4XTP A;  1SFP A;  5FLJ A;  4ES8 A;  1G9B A;  1JOP A;  1K42 A;  1VAL A;  3SCG A;  3POS A;  4Q4V 3;  2B46 X;  1QDO A;  4RHV 3;  3SH4 A;  1LJ7 A;  3C3V A;  4Y26 A;  1RVF 2;  5GLW A;  2OQ7 A;  2YUE A;  5CFD A;  4ASL A;  4YFZ A;  3VZL A;  5CYY A;  3MIF A;  2ZCW A;  3AMP A;  1VRH 3;  3ZFE C;  2B4K A;  4EYU A;  4CUB A;  1Q43 A;  1CJP A;  4LO7 A;  3MFA A;  3QD6 A;  4I2O A;  1V6J A;  2D98 A;  4A6O A;  1YWK A;  2WYF A;  5FXX A;  5FMB A;  1CR7 A;  5LY2 A;  4PHZ A;  4HOO A;  2AH2 A;  4FPJ A;  4YW2 A;  3HMY A;  5FR3 A;  4AED B;  1U5I A;  2ZAA A;  3BU0 A;  4P9W A;  1DZR A;  1NCQ B;  2CHH A;  2KR2 A;  3FUQ A;  1W0P A;  2V4A A;  3ZYB A;  4QX0 A;  1CAU A;  2BWC A;  5D8A C;  3HJR A;  4RD7 A;  3S7E A;  3WQ7 A;  1WW5 A;  1YQC A;  2Y8K A;  2IXI A;  5CFC A;  4Q0V A;  1ALY A;  2ZTN A;  5A1L A;  1DYO A;  4AHW A;  1NXD 1;  2XG3 A;  5IVY A;  2WNV B;  2Y33 A;  3P1I A;  3HQU A;  5LA0 A;  3CIH A;  3QLQ A;  3U0Z A;  4LHL A;  2ADE A;  1XSR A;  4YW3 A;  4LOT A;  4LHN A;  4HVR A;  1JYW A;  1JH5 A;  1ZRI A;  2I07 B;  4LNV A;  4CE8 A;  4NIA A;  4YZ1 A;  1G6N A;  1FAT A;  2VQ0 A;  5J36 A;  1PGL 1;  1ULC A;  2ZX0 A;  3VZO A;  5IVF A;  3M3O A;  1LUL A;  2CAU A;  4O9G A;  4YVS C;  3Q9O A;  5DUX A;  5B2G B;  2ZA9 A;  1NLR A;  1NE4 A;  4UFH A;  4I09 A;  2IVJ A;  2FHR A;  3H8X A;  2GH8 A;  1QOS A;  4IEO A;  4BA6 A;  4PF1 A;  2Y6G A;  3NNL A;  1GZW A;  1J3R A;  5LBE A;  1AL0 G;  2D6M A;  3TWI A;  1UMH A;  4S2F A;  2VM9 A;  3OYW B;  4OHX A;  5ANQ A;  2YRO A;  5KXD A;  4M3C B;  1S2B A;  2RR1 1;  3ETQ A;  4GWN A;  4I0W B;  1ASJ 1;  1ULE A;  4CDU B;  3R6S A;  3BAL A;  1PNG A;  2RS5 2;  4XJW A;  1WW7 A;  3GZA A;  4K40 A;  1GWM A;  5BY5 A;  3ELN A;  1ZRF A;  1HXS 2;  1HV1 A;  2WAB A;  2AEN A;  3AM2 A;  3BCW A;  1YC6 1;  2JDZ A;  2YPJ A;  4LIV A;  3I7D A;  3HT2 A;  3AB0 A;  3L2Y A;  4C1X A;  3I4I A;  5LEJ A;  3H1M A;  3DF0 A;  1GP4 A;  5I8Y A;  4QM8 A;  1CIY A;  1BEV 1;  4LTA A;  5FYH A;  4AVS A;  1B35 B;  3LFM A;  4MGZ E;  1C57 A;  4QD2 A;  4W65 A;  3ZXF A;  4FAG A;  5AC9 3;  3B00 A;  1I5Z A;  4A7Y A;  2VU9 A;  2Z2S B;  3P6B A;  4MLO A;  2GC2 A;  1JYT A;  3K3N A;  3OY8 B;  1Y9Q A;  3M70 A;  2Q1Z B;  3PUA A;  4JRA A;  5FYT A;  5J09 A;  3AYD A;  4CPB D;  1COV 2;  5FPB A;  4QQ2 A;  4FTS A;  4AI0 A;  4XF4 A;  2MNG A;  5C3Q A;  4NIG A;  3GZE A;  3MUZ 1;  5F2S A;  4ATF A;  1RUF 1;  2VJX A;  2VQT A;  1DLL A;  3RNS A;  1VRH 2;  1A6C A;  2RR1 3;  2ZAB A;  4N9H A;  5FZ4 A;  2RMU 1;  4CDQ B;  4XDQ A;  1ASJ 3;  4OFG A;  2O8Q A;  3T3Y A;  2QE3 A;  1LOD A;  1ULP A;  2E32 A;  1LHV A;  3TB0 A;  2ARA A;  2VMF A;  3CHX A;  1OA3 A;  1BXH A;  2B8M A;  2BFU S;  2P6H A;  2YU2 A;  3WW3 A;  1BLZ A;  1XYP A;  1H8V A;  2YBS A;  3ZPO A;  1BEV 3;  2A6W A;  2JE7 A;  4Q4Y 1;  4TLG A;  1SLA A;  4EQV A;  4LO5 B;  4XF9 A;  3CJI C;  5DDJ 3;  4BB3 A;  4Q0U A;  2JEC A;  4UF0 A;  5DN2 A;  5T5L A;  5D8A A;  2GDF A;  2W9X A;  5LA1 A;  1RUD 1;  4K3U A;  3WHU A;  3PLQ A;  1NZI A;  3BOD A;  5CIS A;  1C5H A;  1VBC 1;  1GU3 A;  2VNG A;  3M3I A;  5A3U A;  3D3A A;  2W87 A;  5I0S A;  4QHO A;  2BNN A;  4HT1 T;  3ZIW A;  4QXC A;  1QXP A;  4DY3 A;  5H9R A;  3ZKU A;  2WFP A;  4R9A A;  4UFM A;  3ON7 A;  1NOV A;  5FY8 A;  4FOY A;  2VH9 A;  1XB9 A;  3KF3 A;  1O91 A;  1PHM A;  3ZX7 A;  4Z8B A;  1IKP A;  1UL9 A;  2JKX A;  3JQX A;  3T4V A;  5FZ3 A;  1ND3 C;  1X36 A;  5BPX A;  3ZSL A;  2IWG B;  2YDE A;  3IMM A;  2CSG A;  2GC0 A;  4YVS A;  3V65 A;  5FZ7 A;  1CAX A;  1SLI A;  3TNQ A;  2DUR A;  1H9P A;  2Q0A A;  3GJB A;  2R06 1;  1YFY A;  4XJZ A;  4Q4Y 3;  1ZRC A;  3ZPY A;  4LXL A;  1XOY A;  1ZBA 1;  2D3P A;  2FCU A;  4Z07 A;  4Q4X 1;  4YVW B;  5LWB A;  1A34 A;  3SLI A;  5KC6 A;  2OUH A;  1RUD 3;  1Y9G A;  2WNU C;  2WBK A;  3AZV A;  4K8F A;  2ORZ A;  3J9S A;  5DAB A;  5EZW A;  3GHM A;  3I2H A;  3RI8 A;  4FPH A;  1OLR A;  2IFR A;  3NW4 A;  1GNZ A;  1LKN A;  3N7L A;  3ES4 A;  3KV6 A;  3T0A A;  4MGS A;  3VBR C;  4BQ2 A;  5IVE A;  4TTG A;  3HOB A;  3ORJ A;  5J37 A;  2ZGU A;  3N9O A;  1MR5 A;  3WQ1 A;  2K46 A;  1EUT A;  2VOK A;  4UAP A;  1PGL 2;  1PGS A;  3MPP G;  4UT5 A;  5F3I A;  2W91 A;  3GBW A;  4W6W A;  2P6C A;  3BUC A;  1OA2 A;  5DPN A;  2PHR A;  2BZD A;  3SEE A;  4RSU A;  1E5I A;  1AUY A;  1MEC 3;  1G9F A;  2N7G A;  1DQ0 A;  3SKJ E;  2D6P A;  4KL1 A;  3POJ A;  2BFU L;  1OUR A;  1A8D A;  4OUL A;  4AI2 A;  1LOB A;  2IC1 A;  3VDD A;  1ZBA 3;  2UUR A;  4I02 A;  3R4S A;  4AI8 A;  4Q4X 3;  4TZD A;  2E63 A;  2WRA A;  1O3T A;  1CAV B;  4Q0P A;  1AXK A;  2RR1 2;  3KCY A;  1Q8S A;  3EHK A;  3H8U A;  3OCP A;  1ASJ 2;  4OHV A;  4XQ4 A;  4GH4 B;  3ZXJ A;  1Z78 A;  2B9V A;  4P9Y A;  5CAZ A;  5FPV A;  3FFZ A;  4QX7 A;  5A7N A;  1D0H A;  3WP6 A;  2DU0 A;  1SMV A;  1US2 A;  1AR6 3;  2Z4F A;  5LAS A;  1VBD 1;  5IHR A;  5JAX A;  1H6Y A;  3USS A;  1Q3E A;  5FMO S;  1BEV 2;  2WQZ C;  3THT A;  5LEK A;  2PA7 A;  1FMD 3;  4GMP 0;  1OT5 A;  3ACF A;  3U37 A;  2QQM A;  4OI0 A;  2OXB A;  2EIG A;  2JG9 A;  4FQZ A;  3PTY A;  2CDP A;  1AXY A;  3CJI A;  1QNY A;  5A32 A;  3I2O A;  2VUD A;  1KQR A;  4J1X A;  3FZ3 A;  4L0P A;  4E9K A;  3OGR A;  4XBN A;  3WSO A;  2XWJ B;  5DUU A;  4CEW B;  1W2N A;  2B42 B;  2GMM A;  2XXZ A;  4RGK A;  4N43 C;  4BPZ A;  3SCF A;  5A1A A;  2V4V A;  3L9J T;  4A7Z A;  1RUF 2;  1ENX A;  3GBF A;  3WDW A;  1OBN A;  4FPC A;  2RMU 2;  4BH9 A;  4DEQ A;  3WP4 A;  3KV5 A;  1RUJ 1;  4JDM A;  5I8T A;  4WM8 B;  1ACC A;  4A3Z A;  4IV1 A;  1YRZ A;  2JEM A;  2PYT A;  3WP3 A;  5DAX A;  3MBW A;  2XJV A;  1S0I A;  1DFQ A;  5SV8 A;  4BQ3 A;  4LUM A;  1VBD 3;  2A5Z A;  2V5Y A;  5DAP A;  3I3E A;  1W06 A;  3X29 B;  3AP5 A;  2VOT A;  1W8O A;  1FX5 A;  4Q4Y 2;  3OUH A;  3EQE A;  2MPF A;  5GLZ A;  5HXV A;  3O1U A;  3HVD A;  1CAW A;  3KZ4 C;  4JQT A;  3CF6 E;  1DQ1 A;  2YYO A;  1NE6 A;  3L2H A;  2PAK A;  4AHX A;  4CP1 A;  2OQ6 A;  1RUD 2;  2RS1 1;  3IPV B;  4HXC A;  4LR4 A;  4ARY A;  4CDX B;  4XJA A;  4NR1 A;  1Q56 A;  3GCW A;  4CU6 A;  1EV1 3;  4JV4 A;  1T6G C;  1VBC 2;  3HWJ A;  4JX0 A;  1I3H A;  4BHP A;  1UOF A;  2HBT A;  1D7P M;  1UNB A;  1QDC A;  5D1I A;  4EZH A;  1UQX A;  4W50 A;  4Y22 B;  3WHT A;  1YQ6 A;  1R09 3;  1UXX X;  2IXK A;  4IQP A;  5GLV A;  2JXA A;  3HQX A;  1RUJ 3;  4L11 A;  2R0H A;  2Z5W A;  3ST7 A;  3RZH A;  5FFO C;  3IN9 A;  3WNO A;  1KDM A;  1UU4 A;  3EBR A;  4R9D A;  4OHY A;  5ABJ A;  4XHB A;  4MHR A;  2B45 X;  4GZ9 A;  4P5Y A;  1JU4 A;  2R06 2;  3BN6 A;  5EFU A;  3UKN A;  1RMU 3;  5FMO L;  1IS3 A;  2SLI A;  1ZBA 2;  1L3J A;  1Q8V A;  1IPS A;  4Q4X 2;  2O14 A;  3C7H A;  3AYE A;  3B01 A;  4L2N A;  5FZH A;  4EN9 B;  1OF3 A;  1UOB A;  1RUG 1;  3H7Y A;  1N1T A;  1JZ5 A;  5BNN B;  2NMN A;  2X5I B;  4QGN A;  4LBQ A;  4CVU A;  2A7A A;  4GB3 1;  4EN7 B;  4FPY A;  1XE8 A;  1RGS A;  3RWK X;  1H9W A;  4UI9 L;  1TQ5 A;  2WT1 A;  1YCI A;  5FY7 A;  3V0B A;  1HQL A;  5FO7 B;  4DRV A;  1JOD A;  1BKZ A;  3VGI A;  2HBU A;  4IW3 A;  4Y20 B;  3NV4 A;  4IV3 B;  3UJQ A;  4AQ2 A;  5IVJ A;  1DGL A;  1WA4 A;  1NCR C;  2X8K A;  4KG8 A;  2C0Z A;  2ZHM A;  4Y24 A;  2BVB A;  1XRU A;  1RXF A;  2CY6 A;  2GP3 A;  1GOG A;  2K0G A;  1NQD A;  2D3R A;  3PUH A;  4PCR A;  1ZRR A;  3P3N A;  3MV0 1;  4QXH A;  2QQP A;  1F5J A;  4WVV A;  3UET A;  1H8T C;  2WFF 3;  1HN1 A;  5IAX A;  2GNT A;  2EXH A;  1IS4 A;  2YPD A;  2YU1 A;  2ZGP A;  3DCQ A;  2HJI A;  3III A;  3LDK A;  4R8H A;  1RIN A;  3LSD A;  1WLT A;  2MHF A;  1DBN A;  4YWA A;  4A3X A;  4XUT A;  1VPH A;  5M0T A;  5DMY A;  1F4A A;  1PIV 1;  1R1A 1;  1RUG 3;  2OVU A;  5E1R A;  5KR7 A;  4FPO B;  1UOG A;  4DXT A;  3I2J A;  2XL7 A;  3PIG A;  4HK9 A;  5FYZ A;  3AX4 A;  3MFC A;  4H7M A;  1Y3T A;  4XBL A;  3KLS A;  4AGG A;  2ZAH A;  2Q8C A;  2PAM A;  2BYV E;  2OUJ A;  3AMM A;  1VBD 2;  4IDZ A;  3KT1 A;  5A70 A;  5LB6 A;  4BE3 A;  5J48 A;  5L9V A;  3RZK A;  2F4L A;  4QX3 A;  5JIU A;  3LD8 A;  3WG4 A;  1KS4 A;  2C9K A;  1LOG A;  2DVB A;  1UPI A;  1XPW A;  2VC9 A;  4JRL A;  5K4L A;  2ILM A;  4YFW A;  1C8N A;  4D6S A;  4K8R B;  1TG7 A;  2IFW A;  4QGL A;  1TME 1;  4NWV A;  2P3J A;  2NYY A;  4XF1 A;  4OQ9 A;  4BME A;  3MIH A;  4Y1Z A;  3PVE A;  1RHI 1;  2C4X A;  3JU9 A;  3R4D B;  5GLU A;  3I59 A;  2DBI A;  2XH6 A;  1QQP 3;  4NMI A;  3NVC A;  2VVE A;  2B7Y A;  1CX1 A;  5FY4 A;  3ZFF C;  1MVE A;  3I54 A;  3KCC A;  4JKM A;  4CA9 A;  3SMH A;  1PIV 3;  1R1A 3;  1RUJ 2;  1EP0 A;  1KEX A;  2QDN A;  2WZE A;  4FTB A;  1HB3 A;  4XCB A;  4XW3 A;  3ZOI A;  4N53 B;  5FJH A;  3INA A;  1UU5 A;  3M8L A;  3WQ0 A;  2XLG A;  2ZPX A;  3U07 A;  2QVS B;  2BU9 A;  3VD5 A;  3ZXL A;  4EJR A;  2QNK A;  3ZKY A;  3MF6 A;  3FBY A;  4QXB A;  1UO9 A;  1LHN A;  2GND A;  1ENS A;  2JG8 B;  3C7E A;  2TNF A;  3LEG A;  2NM1 A;  2ZKL A;  2A6Y A;  3MF9 A;  1SBF A;  1XNC A;  2NQY A;  3LOI A;  3I2I A;  3DYP A;  4LJH A;  4R9C A;  1OLM A;  4QWN A;  3N4M A;  1S0G A;  3E5U A;  2ZGT A;  4J1W A;  1TME 3;  4GXL A;  4QQP A;  3U4S A;  2Z69 A;  3ITQ A;  1UXZ A;  5B4N A;  2RS1 2;  2W52 A;  1RHI 3;  4XPV A;  3WW1 A;  2JIG A;  4AFD A;  2WSV A;  1PVC 3;  1O4Y A;  4LA2 A;  1O8S A;  3ZXA C;  3ZM8 A;  2BW8 A;  3NKG A;  1LOF C;  2W95 A;  5ABJ B;  1DG6 A;  1H30 A;  2RDS A;  1W05 A;  4WM7 C;  1I5P A;  3QOP A;  1DGR A;  1SDW A;  2G9F A;  1V6I A;  1VJ2 A;  4P9G A;  1DQ6 A;  3ACI A;  4OQ8 A;  2ARC A;  5FYI A;  2WYS A;  4Y1X A;  4D6R A;  3PTR B;  2ID4 A;  1CVN A;  5JUV A;  3BPZ A;  3GYD A;  1IPJ A;  3EYP A;  4IXL A;  2R1D A;  1RYY A;  5A7P A;  4CZS A;  4IEP A;  2VOX A;  4AED C;  4DPN A;  5KHK A;  1OVP A;  4LK7 A;  2JWP A;  4CCL A;  1KD7 A;  3RYP A;  3O1V A;  1FV3 A;  1NCQ C;  1VMH A;  1AYM 1;  2OS2 A;  1UY0 A;  2DYC A;  2HKX A;  4J25 A;  4BWO A;  2V5D A;  4CCC A;  1X8M A;  1UX6 A;  3TEY A;  2CGP A;  1NAE A;  2DU1 A;  2AAC A;  4FPE A;  4CP2 A;  5L9R A;  2WNV C;  1UY4 A;  2E9Q A;  4ISR A;  4FXK B;  1JZ2 A;  1RUG 2;  4QKF A;  3LIG A;  1UMI A;  1LOE A;  4PDW C;  1W9F A;  1F5F A;  4ORF A;  4AR2 A;  4GB3 2;  2J1E A;  4X6R B;  5T5O A;  1PMI A;  2BGP A;  1HRI 3;  4ZXK A;  1YNA A;  1JMU B;  4O65 A;  4XF3 A;  3O1O A;  5FMC A;  4LOS A;  3BTZ A;  1H2N A;  2YC4 A;  4RYD A;  3K4A A;  3ZSM A;  3J7H A;  5A3P A;  4K6B A;  1UIJ A;  5IFP A;  1O3R A;  4OYU A;  1S0E A;  3HBK A;  4MZU A;  4BQX A;  2NLR A;  5FUP A;  5FP9 A;  4AHY A;  1XQN A;  3S0M A;  5JR2 A;  2YC2 A;  3IT8 A;  1JUH A;  2QTW B;  1VIW B;  2W39 A;  4N7U A;  1MS3 A;  4QDR A;  1U0A A;  2D5F A;  3DGT A;  3USU A;  3VBS B;  2VTF A;  1GBG A;  3ETP A;  5FDB A;  1ZBE 1;  2VBB A;  1AYM 3;  1VBE 3;  2JDY A;  1LOA A;  3MIE A;  5GZD A;  4H2A A;  3OTF A;  5JVV A;  2VZV A;  1DQ5 A;  2LTN A;  5F3G A;  4CDU C;  2UWA A;  5T50 A;  4XAB A;  3MGU A;  2J1U A;  3SH3 A;  1PIV 2;  2HWD 1;  2HWF 2;  1JI6 A;  4UWD A;  2HEV F;  4E2S A;  3BI3 A;  4DXS A;  3UGG A;  1CES A;  1Y43 B;  4XXP A;  4HG6 B;  1NX9 A;  1JHN A;  1W8W A;  3NAP B;  1SCS A;  4Y33 A;  4BLI A;  1B35 C;  5A7O A;  2WT0 A;  1MS0 A;  4Q27 A;  1K3I A;  2D3S A;  1POQ A;  5FZL A;  5JR7 B;  2JKB A;  2Y6J A;  5LK7 B;  2VBD A;  5FZF A;  1TME 2;  4B3N A;  1X50 A;  3PHM A;  1S55 A;  4WVM A;  5HI0 A;  1VAV A;  3P3P A;  4YZ4 A;  5DXD A;  3QBQ A;  2QQO A;  1RHI 2;  3BYW A;  3CMG A;  5KHH A;  1RC6 A;  1ZBE 3;  4YGC A;  5BNP B;  2XBO 1;  5FYU A;  4CDQ C;  4IEV A;  4NRQ A;  4IE0 A;  2Q8O A;  3VZN A;  2WZR 3;  3HN3 A;  4LEJ A;  3GGL A;  3WNL A;  4FFG A;  2UWC A;  2ZGS A;  4MGK E;  1AZD A;  3O1S A;  3LA2 A;  5C8W A;  4TXW A;  4XJ9 A;  1UMZ A;  2V72 A;  1XSQ A;  2TEP A;  3H1Y A;  5FZK A;  4TWT A;  2VZ1 A;  3PL0 A;  3AFG A;  2W47 A;  3HNY M;  5IYY A;  2ZMN A;  3ENR A;  1RJ8 A;  2J42 A;  3MZH A;  1E5H A;  3TYJ A;  1UCX A;  5AFB A;  5JOY A;  1NCQ A;  5FZA A;  1QXJ A;  4CXX A;  1IOA A;  4XJ8 A;  5I0U A;  1UYY A;  1RTV A;  5FZ8 A;  1H1A A;  1G9C A;  2VQU A;  4K20 A;  1JBC A;  5F5I A;  4KGG A;  2WNV A;  2VAU A;  3MIB A;  2H0B A;  5C70 A;  2H6C A;  3AKQ A;  3ILF A;  2DCK A;  5EJ3 A;  4XDO A;  2OPW A;  4XDP A;  4EWE A;  4QPI B;  2ZX2 A;  5HXM A;  2XBO 3;  2VOW A;  3FJS A;  3RZL A;  1AVB A;  2EIE A;  2VY0 A;  4OUE A;  2G9G A;  2HWC 1;  5FZO B;  4PI0 A;  4XHX A;  4EZ4 A;  4N90 A;  2X10 A;  1Q8Q A;  1LEM A;  2QZ2 A;  2E7T A;  4AZZ A;  4DS0 A;  3KMH A;  3K77 A;  4O61 A;  4UW4 A;  2FZ1 A;  2VMG A;  1CD3 G;  3HR9 A;  2EXJ A;  2J1T A;  4PLN A;  3BOW A;  4YM2 A;  4E8D A;  4EN0 A;  5JSO A;  3VBO B;  4LKS A;  3GNE A;  5DZE A;  5K8S A;  2R49 A;  1F31 A;  4QHZ A;  1O59 A;  3GBG A;  4JTN A;  4K1Y A;  4E2G A;  4PIZ A;  5JOX A;  1AYM 2;  3GCX A;  4YVW C;  5F6L B;  2HWB 1;  2VUC A;  3OYW A;  5A80 A;  4ITC A;  1QY4 A;  3WF0 A;  2W0X A;  3OGG A;  1ZX5 A;  4XFI A;  2X05 A;  4CDU A;  4BIS A;  3N9M A;  4K7J A;  4CCD A;  4CCO A;  1J3P A;  4LBO A;  1IZ3 A;  5JDB A;  2GC1 A;  3JBG 1;  2F17 A;  1PZ7 A;  3FHI B;  3OBT A;  5FY5 A;  1RED A;  3C8X A;  2HWC 3;  1B35 A;  5FYS A;  1Y9M A;  4Y5T A;  1COV 1;  4XCA A;  5JXJ A;  4PF5 A;  5IJR A;  4HAN A;  5I0R A;  2WT2 A;  2WWJ A;  3F2Z A;  5C7G A;  2IXJ A;  4Q1R A;  1NXM A;  2OII A;  2ZEX A;  3OY8 A;  3R05 A;  4CU8 A;  3E6C C;  1FYU A;  1WWY A;  4LUK A;  1OKO A;  2PTM A;  1ZBE 2;  2K9Z A;  2O8O A;  4YYO A;  2HWB 3;  5E6H A;  3QCW A;  4QKN A;  3WCR A;  1HRV 1;  4N9I A;  3VKO A;  1VE0 A;  2GSY A;  2VUJ A;  2Y38 A;  3N9P A;  4NRO A;  3B93 A;  4XUN A;  4CDQ A;  1W2U A;  3BIW E;  1W6Q B;  1GIC A;  3LZZ A;  4JCK A;  4XVH A;  1DLC A;  2HWD 2;  1HV0 A;  4P5H A;  2G19 A;  5EYY A;  2VMH A;  3WOG A;  5IVV A;  2XLA A;  1QHD A;  4CCM A;  4D3W A;  3RSJ A;  2J22 A;  3APB A;  3WUC A;  4CEY B;  4ZY9 A;  2FDF A;  1W99 A;  4EN6 B;  1E5S A;  1XJA A;  2YB7 A;  2NPI A;  1COV 3;  3CZJ A;  3A23 A;  4C90 A;  3LEK A;  5FP7 A;  3IDA A;  4FAH A;  4NID A;  4MYE A;  5BNO B;  5K0U B;  2PHU A;  4RGA A;  1JZ6 A;  5T5J A;  2LM3 A;  3MIG A;  1FOD 2;  5JXI A;  4YGD A;  3C7G A;  4BDV B;  1HB1 A;  2I45 A;  2D44 A;  2DF7 A;  1NQJ A;  1SCR A;  1WMD A;  4CEW C;  1MZE A;  4IEZ A;  4M0H A;  5D2A A;  3NMB A;  1MQT B;  2CWM A;  3JB4 C;  1W3V A;  3M4F A;  2XBO 2;  3RS6 A;  5H9Q A;  4BCU A;  1HRV 3;  3POI A;  5FZG A;  1QOT A;  5HCB A;  4NHK A;  3RGB A;  2GH2 A;  4A42 A;  3PUI A;  4WM8 C;  1UPS A;  4BIO A;  3ZYF A;  2LRO A;  3J8F 1;  2E7A A;  2GAL A;  3I2G A;  4LT5 A;  3LOB A;  1PO1 1;  4NN0 A;  4UW5 A;  5JXG A;  3OUI A;  4QPG B;  4MGT A;  2WSU A;  1U5Y A;  2QQN A;  3AP4 A;  4RGG A;  3TAY A;  1JZ7 A;  1ZZ8 A;  3VHP A;  1WUV A;  5FWJ A;  5DG1 A;  1UZW A;  2GP5 A;  4JZR A;  3D0S A;  2E6V A;  1VBA 1;  4BXF A;  4YVW A;  1PK6 B;  2JIJ A;  3CEW A;  3IDC B;  4Z2A A;  2W1U A;  4W6Y A;  5AFE A;  3ZYR A;  2JE8 A;  2RJK A;  1FV2 A;  2D7F A;  1TNR A;  1F35 A;  3JXS A;  2WAO A;  3OG2 A;  4OHW A;  4CDX C;  4E4Z A;  3KQ4 B;  2WDB A;  4Z82 A;  4FXG B;  1LU2 A;  2ZGM A;  4AFA A;  3WW2 A;  2ERF A;  3LA3 A;  3JD7 1;  4ZU7 A;  3IMN A;  4FT8 A;  4MAD A;  1CGP A;  4QX5 A;  1O7F A;  1SDD B;  2OT7 A;  2VCB A;  2HWC 2;  2R32 A;  1OVS A;  3J8F 3;  5JXH A;  4COZ A;  3I3M A;  1WLC A;  2C1F A;  3UKT A;  1O5U A;  1PO1 3;  1DQ4 A;  3AMN A;  2F4P A;  2XJU A;  5FPA A;  1V6O A;  1TEI A;  3AFK A;  3J7M A;  4IND A;  4NWW A;  1IG3 A;  4RFR B;  1ZZ7 A;  2JB8 A;  4WZC A;  2WS9 1;  5F1R A;  4CCE A;  2A6Z A;  2VW1 A;  5T5P A;  3MW3 A;  5FZ6 A;  2ZS6 B;  4LUL A;  4KNC A;  2HWB 2;  4E27 A;  3O0X A;  1CAV A;  2JDK A;  1KFX L;  2RDR A;  2D93 A;  4QPY A;  5BNN C;  2X5I C;  5FO9 B;  1DF0 A;  1Z7S 1;  2DCJ A;  2J7M A;  4GH4 A;  1RUE 1;  1LR5 A;  1OPO A;  2UY9 A;  3H50 A;  4FI9 A;  4PBP A;  3JD7 3;  3A4U A;  3JBG 2;  4KWK A;  3RYK A;  5C8C B;  5L9B A;  1XE0 A;  3H3U A;  4NII A;  4ERO A;  1GUI A;  3WF1 A;  4BIF A;  2QCS B;  3VDD C;  4GA9 A;  1CWP A;  1IS6 A;  1YLL A;  4CYD A;  3PVB B;  4LQR A;  4GUL A;  1W6N A;  3MV1 1;  2HYX A;  2P1B A;  3UL2 A;  3KCX A;  2A1X A;  3KF5 A;  3VHO A;  3VBH B;  4XE9 A;  2WS9 3;  3THP A;  4ZU4 A;  4XUR A;  3WG1 A;  4CEW A;  4UFJ A;  5F6K A;  4SLI A;  1HRV 2;  1GYK A;  1YFX A;  1Z7S 3;  2QQL A;  2WWS A;  2XKO A;  4LLF A;  1WCD J;  2YV8 A;  1RUE 3;  3AP6 A;  1I6X A;  4NAO A;  4WM8 A;  1HIX A;  5E8A A;  3TBD A;  1LTE A;  2JG9 C;  1WA6 X;  5B4X A;  4HN0 A;  2DFC A;  5BYN A;  1DGW A;  2BDR A;  2DUQ A;  3H0O A;  3TEX A;  3WDV A;  1PX4 A;  1LRH A;  1R08 1;  2XGX A;  4KWU A;  4XBQ A;  3DYO A;  3N9N A;  3T0B A;  4CXW A;  1UY1 A;  5GZE A;  5F5C A;  1CZV A;  4G9S B;  4D94 A;  3TOJ A;  1S0D A;  3NJY A;  3NWK A;  2RG4 A;  5CZK A;  4JC1 A;  3V56 A;  2ZZQ A;  4HSL A;  3HNB M;  4Q0S A;  4XET A;  1RUF 3;  3IPV A;  3POG A;  4C0H A;  4CDX A;  4LIT A;  4E8C A;  3S30 A;  2RMU 3;  1EYB A;  1YI7 A;  2L9L A;  3K3O A;  4XZP A;  3WX5 A;  4AQT A;  5EHD A;  2VG9 A;  4IV1 C;  4YPJ A;  3WDT A;  2JDH A;  1WCU A;  3PUS A;  1YQ5 A;  1VAK A;  4KWJ A;  5E88 A;  2OX0 A;  2BNO A;  3H42 B;  3M3E A;  4Y22 A;  5FXZ A;  4DIN B;  3IB3 A;  5LAT A;  3PJY A;  2FDG A;  4N53 C;  3J8F 2;  1ZZ9 A;  4QQH A;  1QU0 A;  2XJR A;  2JDP A;  1KIT A;  1PO1 2;  1WBL A;  4M01 A;  4PQ9 A;  2E53 A;  4RL7 A;  1R08 3; 
#chains in the Genus database with same CATH homology
 5C3P A;  1GP4 A;  1HB2 A;  1ODM A;  1RXF A;  2Y60 A;  1W04 A;  2BJS A;  1W28 A;  1HJF A;  1ODN A;  1GP6 A;  1W03 A;  5C3Q A;  2JB8 A;  1DCS A;  1OC1 A;  2IVI B;  1UOG A;  2VE1 A;  1GP5 A;  2Y6F A;  1W9Y A;  2VBB A;  2JB4 A;  1HJG A;  1E5R A;  2VBP A;  1W2N A;  4RGK A;  1BLZ A;  1HB4 A;  1OBN A;  4BB3 A;  1QIQ A;  2BRT A;  1QJF A;  2DBI A;  5C3R A;  3OOX A;  1BK0 A;  1W06 A;  2VBD A;  3ZKU A;  2WO7 A;  3ON7 A;  1W2O A;  1W2A X;  1HB3 A;  3ZOI A;  1E5S A;  2BU9 A;  2CSG A;  3ZKY A;  5C3O A;  1UO9 A;  1UOF A;  4XAE A;  1UNB A;  1WA6 X;  2DBN A;  1W3X A;  1HB1 A;  2VCM A;  1W3V A;  1E5H A;  2IVJ A;  1W05 A;  1QJE A;  1IPS A;  2VAU A;  1UOB A;  1UZW A;  1RXG A;  5APA A;  1E5I A;  5C3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...