1UOFA

Deacetoxycephalosporin c synthase complexed with penicillin g
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
310
structure length
267
Chain Sequence
MDTTVPTFSLAELQQGLHQDEFRRCLRDKGLFYLTDCGLTDTELKSAKDLVIDFFEHGSEAEKRAVTSPVPTMRRGFTGLYSMCYSMGTADNLFPSGDFERIWTQYFDRQYTASRAVAREVLRATGTEPDGGVEAFLDCEPLLRFRYFRMAPHYDLSMVTLIQQTPFVSLQAEVGGAFTDLPYRPDAVLVFCGAIATLVTGGQVKAPRHHVAAPRTSSVFFLRPNADFTFSVPLARECGFDVSLDGETATFQDWIGGNYVNIRRTSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structural Basis of Cephalosporin Formation in a Mononuclear Ferrous Enzyme
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Oxidoreductase
molecule keywords DEACETOXYCEPHALOSPORIN C SYNTHETASE
total genus 79
structure length 267
sequence length 310
ec nomenclature ec 1.14.20.1: Deacetoxycephalosporin-C synthase.
pdb deposition date 2003-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
A PF14226 DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.330 Mainly Beta Sandwich Jelly Rolls B-lactam Antibiotic, Isopenicillin N Synthase; Chain 1uofA00
1HJFA 1QJEA 1BLZA 1QJFA 3ON7A 2WO7A 3ZKYA 1OBNA 1ODMA 1W06A 1W28A 1BK0A 4BB3A 1HB4A 1E5RA 1WA6X 1RXFA 2BJSA 2JB8A 3ZOIA 5C3PA 5C3RA 2BRTA 1E5IA 1HB3A 3OOXA 5APAA 1UO9A 1HB1A 2JB4A 2VBPA 1W03A 2VE1A 1W9YA 2DBNA 2IVIB 1HB2A 1W2OA 5C3QA 1W2AX 2Y60A 2VAUA 1QIQA 1UOGA 5C3OA 1E5HA 3ZKUA 1GP4A 1W04A 2VBDA 2VCMA 4RGKA 2CSGA 1IPSA 1UOFA 1UZWA 1ODNA 1GP5A 1W3XA 1GP6A 1HJGA 1W3VA 2DBIA 5C3SA 1DCSA 1OC1A 1E5SA 1RXGA 2BU9A 1W05A 2IVJA 2Y6FA 1W2NA 1UNBA 1UOBA 4XAEA 2VBBA
chains in the Genus database with same CATH superfamily
1A8DA 2W1UA 2XJSA 1G9CA 3T3YA 2R0FA 5DZFA 1C1LA 2ADDA 2GDFA 5JMOA 1JTZX 4GJZA 1ZZ6A 2LALA 2VBPA 3MBWA 2CYFA 1NAEA 1C8NA 3KVBA 1XOYA 1LOFC 1POV0 5LA0A 5C5UA 1DHKB 2PLV3 4D3WA 1PK6A 5BY5A 2JDAA 2QNKA 5JAXA 1RVF1 3ASIA 1WA4A 2HWE1 1HRI3 2ZMLA 2XJQA 4FP2A 4HONA 2YC0A 5ACA3 3HWJA 3AZXA 2IXHA 2LTNA 1V0AA 2V5YA 5FZ9A 5L36A 2QE3A 3M4FA 2V09A 3OBTA 5ANQA 2I45A 3RPQA 1UKRA 3D4KA 4BLIA 4CCKA 2XBO3 4N9IA 5C8CA 4IGPA 1VBD3 1VJ2A 4KGQA 2RR11 3MPBA 3VZMA 1H8TA 3B9CA 1SG3A 4WZCA 2HWE2 1V6NA 5APAA 3I2IA 1LOCA 2OW4A 4R9DA 3BUCA 1ACCA 1UX6A 1GQGA 5G04L 3ZFFC 1RL3A 3TRSB 4QKBA 4GWMA 1RUI3 4LO5B 3J26N 3WEZA 1QJZA 2G9GA 3FFQA 4MO3M 4QKFA 3THTA 4Y1ZA 3U0ZA 1GP6A 1QY4A 4CDWC 4QD2A 2IXIA 1VBC3 1W6MA 2Q5TA 3O1UA 4FPYA 2ORZA 3HNBM 3OPTA 4QPIA 3UV9A 2QQPA 1TQ5A 2WNUA 1Z78A 2JKXA 4U36A 3WNLA 5J37A 4IE4A 1DFQA 4J1WA 2XVGA 4YM0A 1N1TA 5GZEA 3UGGA 2XDVA 3SKVA 3WF4A 1EPWA 2WUHA 2GZWA 3HBKA 3DGTA 1PX3A 4GMP0 4LE3A 2TEPA 3ZYJB 3DYOA 3WLUA 2VE1A 3CZUA 4FT8A 1UMHA 2LRPA 3AM2A 2PA7A 2XJTA 3QOPA 2JDUA 5EFUA 5FPXA 3USUA 4FPJA 3CLPA 1ZA4A 2W52A 2XBO1 3FL7A 1RUE1 4DOUA 3ZN4A 3O1SA 3VBSB 4CP1A 3ZR5A 3L2YA 5DN2A 3FUOA 4U2AA 4COWA 1G9DA 2Y6FA 1TNRA 3KHBA 4AVAA 3KCCA 2JKBA 2B5HA 4AVSA 4PIYA 5GJ6A 4YM3A 5FUNA 2NMOA 2H0BA 1AJKA 2WSUA 2VY0A 1TG7A 2YUEA 3ORJA 4Z92B 3LIHA 2RMU2 3B02A 2JG9B 5I0RA 2WKKA 2RDQA 1LOEA 3LZZA 4IE7A 4XXAA 2B39A 2YFUA 5CVRA 5FPZA 1HB2A 2O8OA 2ZGMA 2A6XA 4LHKA 2Y60A 4CCNA 3WW1A 4L2NA 1BCXA 2N7GA 2K2SA 2VJXA 4NHKA 1RJ8A 4PBOA 3J8F2 1GUIA 3KT7A 2NYYA 3FZ3A 1H2MA 4UFIA 1T6GC 1AHSA 1WWYA 2CSGA 2P3KA 4ZS2A 2C24A 2ARAA 5FY4A 4Y26A 2XUMA 1XB9A 1CD3G 5B4XA 3GDBA 3SHRA 2FHRA 2FDJA 1COV1 1G6NA 4O61A 1NCQA 3J7LA 2VOWA 4YVSB 1MZ6A 2J1RA 4LLOA 4QPGC 3U4XA 5I91A 1AR61 2WA3A 4CEWB 1RUF1 2D7FA 4QX8A 1OI6A 4CP9A 2WS92 3LEMA 1UY3A 1A8MA 1EAH1 1QH6A 5JXJA 1W6NB 4UOJA 5EIYB 1XNDA 2UYAA 4BQ4A 4KWUA 4KWLA 1OOPB 4Y5TA 4BE3A 1RUNA 1JZ6A 2EIBA 2ZS6B 3BB6A 4XF0A 1C3HA 3TWIA 3RZHA 5A7QA 5FWEA 2W9XA 5FPVA 1AR62 3ZXDA 1AF9A 3ZFFB 4DNYA 1HV0A 1OKQA 1OBNA 2ETEA 3CHXA 3H3UA 3B93A 1H2KA 2VZSA 4NVPA 2D6NA 3PVNA 2GAUA 1ULCA 5FFOC 1VMJA 5FZCA 1UZZA 1DYPA 1O4ZA 4CDWB 4EN0A 1YJLA 3MO4A 3O1MA 4CEYB 4P5YA 4Q4Y1 2DVAA 3BN6A 1W2AX 3KF5A 4CUCA 4WM8C 3VZJA 4E4ZA 2Q1ZB 1IKQA 4LKSA 4LIVA 4CU9A 1PZ8A 1QKQA 1F5FA 2RMU3 3VBHA 1IS5A 3EBRA 1NXD1 2BNOA 3LOIA 3VKLA 4XAEA 1AR63 4YZ5A 3IM0A 2JICA 1V9U1 5F3GA 4UWDA 1KJRA 3RSJA 1KITA 4K21A 1HQNA 2I74A 2GNDA 4OI2A 4QM8A 1JZ3A 4ES8A 4Q0VA 4PDWC 1RHI1 4JVAA 3MFAA 1PVC3 2VCCA 4OCTA 4UBHA 4AHYA 3N9PA 4R4ZA 2UYBA 4CUAA 2VR4A 5EQUA 5FYSA 3OD4A 4KG8A 3HMYA 5FJKA 3HEIA 3N9NA 3W58A 2MNGA 2R32A 2YDEA 4FQZA 4ZXKA 4AG4A 2JG9C 3E1F1 4AI9A 1GWKA 2R1BA 1HRI2 4DY5A 5F3CA 2XHNA 1QJX3 1H1MA 2EF6A 3CO2A 4M3CB 3KLSA 5T55A 1CQ9A 1AL23 1OF3A 4MXVA 4Z8BA 1TVGA 1UPSA 2R062 2J22A 3MEPA 5EWSA 3JXSA 1G8WA 5F3EA 3AMQA 4LHNA 5EXOA 4YSFA 5C4WC 5J48A 1W28A 4FOYA 3FLTA 4GH4B 3IPVA 5L9BA 1DQ1A 3APBA 5DQ0A 1WMFA 3ZN6A 4F3JA 1W8TA 5T5JA 3LD8A 2ZEYA 3VBUB 3KV4A 4OHZA 4HOOA 5IFTA 2B8MA 5CFDA 1PVC2 4ZZ8A 4XZUG 1RMU3 3SH4A 1UKGA 4OUMA 3WNPA 2E32A 1STMA 3LKJA 4XCAA 3N9MA 4CEWC 5FZ0A 1RUG3 4Q1RA 4BMBA 5JZGA 4FOVA 4FFIA 4ISRA 1Q56A 1MVEA 1R1ZA 4YNIA 4YVWC 2RS13 3KWVA 4QHOA 3A23A 1I5ZA 4LMFA 1KRIA 4FP3A 1CAUB 1S0GA 3HN3A 1BBT3 4JGYA 4OHWA 4AXOA 2VZOA 4XTMA 2R042 1HRV3 5CA6A 1JXNA 4AVVA 1N47A 3D0SA 4C90A 5AFBA 2VMHA 5A7NA 5KXDA 2WWSA 1AYM3 2BGCA 1ZBE3 2JXAA 2A75A 3SQOA 3RJRA 2ORXA 4S2HA 3V0BB 4JAAA 3S0MA 1FMD2 2DF7A 3ABZA 4FPFA 3OEAA 1OF4A 5FMBA 1ODNA 5BV6A 4NN0A 4P9XA 1HXS1 5FYBA 3KV5A 2RS32 5SV8A 2CWMA 2R6QA 3MW2A 3RZZA 1BJQA 1OQEA 1Y9GA 2WA4A 4JGZA 5E8AA 1CAWB 2IFRA 1S1AA 2GNTA 1D0GA 3NNGA 4Q4W1 4RR3C 4XJAA 5FZFA 3ZYIB 3UT0A 4AI0A 2HLEA 1RXFA 3J9SA 1RGSA 1WLWA 4N8MA 1I3HA 5KC5A 2JDKA 4E2SA 3POWA 4NPMA 5FUIA 2XXZA 1VRH1 3AMNA 3IZOA 1OKOA 2Y26A 2A7AA 1WW6A 1PGW2 2YV8A 2DTWA 1BQPA 4FPHA 1BEV3 4YYOA 2P5BA 4QGLA 2Y6KA 1U12A 1PM4A 5DXDA 1WCDJ 3LOBA 1DGRN 1RUH2 4QX5A 1FPN3 4XUTA 4PDWB 3ECQA 3NV4A 1K42A 3LPFA 1ZRFA 1JW6A 1RUC1 3I2GA 1OOPA 2D6KA 4W6WA 1JU4A 1N3OA 3S6PA 1F8VA 1HXS3 2ZABA 4CU8A 3M3OA 5LY2A 4YFZA 4YG3A 1C57A 4OMCA 1NT0A 5FWJA 3WG2A 2B42B 2IXKA 3AP9A 3GCWA 2VM9A 2K0GA 2Q8EA 4P00B 2VNRA 4L11A 4EQVA 3BALA 1QOOA 1IKPA 4E4HA 4CP0A 1ZBA1 2Z4FA 2RS51 3ES1A 1GOHA 4IXLA 4XBQA 5CU1A 1UN1A 4RGKA 3VBFB 5K9YA 4IESA 4IEZA 3T1LA 4Q1PA 1PO22 4D8MA 4AQSA 3M3EA 2VUCA 1CONA 2BFUS 4LO6B 4MSVA 4N53C 4XEZA 5D8AC 2L9LA 2YBSA 4CXXA 3GZUC 3TN93 3I59A 3VN4A 5B2GB 5F8PA 3WDWA 1AYM2 2PAKA 1PZ7A 3ZYRA 2V4VA 2QZ2A 2VC9A 5BUVA 3AVSA 5C3PA 5JPMB 1CJDA 4NPLA 1PVC1 3EXUA 5FYTA 1SQ4A 3ATGA 5DDJ3 2BEOA 1EUUA 2XJRA 4M4PA 4GALA 1VMHA 4QB2A 4FI9A 5K4LA 1N3PA 3ZFEB 2LM3A 2DUQA 2PELA 2X8KA 4JRLA 4H7MA 4QX3A 1HDKA 5EHDA 2BZDA 3ZLIA 3AC0A 4XDQA 3ZO0B 3E5XA 3N9OA 2Q1MA 5FRAA 3SISA 1B09A 5K7PA 1CR7A 1ND3A 4CXYA 4DEVA 2XKPA 3PDQA 5DG1A 2R1DA 2YBKA 5TSWA 3T09A 4F7ZA 2W39A 1L3JA 1QJU1 3EB7A 4MZUA 2CHHA 4BWOA 1JOJA 3VZOA 5LY1A 3C7OA 1ZRRA 2FDKA 1O4TA 2H6BA 3MI8A 1AVBA 2QBXA 4XBNA 1CJPA 3H0OA 3ILRA 4FQ4A 1DQ2A 3MF6A 1FT9A 4PQQA 2OIIA 1Y43B 1Q43A 1VE0A 3FBYA 1S0FA 1YXWA 2ZTNA 2KM2A 1DLLA 4JCKA 5BNNB 1SBFA 1OURA 2XLFA 3B5LB 1HV1A 3IWZA 3KF3A 4OVEA 4UF0B 4UFMA 1YFXA 3A4UA 3VL9A 4A44A 3H8XA 4FTSA 5CKNA 4WBBA 4DRRA 1RTVA 1GZ9A 3AYDA 4A6SA 1RUJ2 2DCZA 2P6HA 2Y6JA 3KV9A 3J7HA 3MHZA 2HWF3 2BJSA 2VZPA 3OPWA 2W5FA 3EMRA 3OF1A 1W39A 5BNPA 3CDZB 5A33B 2WZPP 3DPRC 1KFUL 3KQRA 5J96B 4MGIE 4CDXB 1RUC3 3OBZA 2BVBA 3SEPA 5IVBA 1US3A 4XC9A 3TN92 3VB9A 4OI0A 5F5CA 5FZLA 4WZFA 5LBBA 3AXEA 5BNPB 2JDNA 1W99A 3W9AA 3JB4C 4B1MA 4K6BA 4CZSA 3S57A 2GU9A 5IVJA 3AFKA 3HQXA 1KS4A 1CAUA 2F4LA 1E5SA 2YMZA 4XJ8A 5CNAA 3OD0A 5FZ4A 2RJKA 3FUQA 3KV6A 1E57A 3D8CA 5T5LA 4DMIA 1ND2C 3NV2A 3JQWA 2WO1A 2P6CA 1W9FA 1DZRA 2AENA 2ZJCA 4EZ4A 2PHFA 4CEYA 1FYUA 4I02A 3VBOC 2RDRA 4K3UA 2C26A 3I54A 4HN1A 5F3IA 3MUZ1 3S7EA 1JN2P 2W95A 2XBO2 3K51A 3OGGA 3U78A 3N9QA 4N53B 5D8AB 4ZXEA 3RZKA 4QKNA 1DYKA 2VVDA 4OLLA 2Q0AA 2HEYF 1PGSA 4C91A 2VMEA 1LB2A 1NY71 1OA3A 4CCJA 5C8WA 2WZ8A 1H8VA 4IGQA 4L9BA 2DVDA 5CAZA 4AF9A 2JE8A 1D4M2 3NRUA 1OFSA 4Q4V1 2VO5A 3CBNA 1XE7A 3RVHA 2VVEA 5IVVA 4KWJA 4IEQA 3WQ7A 3PVBB 3ZKYA 2K9ZA 2AEYA 2OXBA 1VBC2 1AL21 1V70A 4UW5A 5GKAC 3ZOIA 3BYWA 3P5BA 4L92A 1RUOA 1GZWA 1OUXA 5DAPA 1D0HA 1EAH2 2JG8C 2CWSA 2VXJA 4LUMA 4KMQA 1YYNA 3LPGA 3V56A 1SHWB 3VDDA 4BMEA 1S0IA 2VTXA 4BCUA 4BIOA 3T0BA 5FLIA 1N1YA 1HLCA 3T1MA 2VAUA 1XNAA 5FPBA 1OUSA 1BHGA 1E5HA 2VG9A 3G7DA 4MXWA 2PHUA 2VMDA 5A32B 1G7YA 3WP4A 3CNAA 5DMYA 2KD7A 1SLAA 4JC1A 3WW3A 4XF4A 3MLJA 5A3UA 3ZSKA 1UU6A 2VUAA 4NRPA 3TOJA 3I59B 1TME1 4I2OA 4LT5A 4LQRA 5DAXA 3VBUC 5IK8A 5A7PA 4G3YC 5E6HA 5A32A 1HIXA 2VZUA 3KT4A 4NRQA 3B01A 1QDCA 1OD5A 2B9VA 4UW4A 1OLRA 1RUH3 3VBOA 2X09A 4H2AA 1W0NA 3VDDB 4OHVA 2LROA 4L97A 1R1A3 3EO6A 4AW7A 4A7KA 3AFGA 3OUJA 4IERA 4QGMA 3ZPOA 1ND2A 2Z69A 1W9YA 2AUYA 3GZEA 2Y64A 3VKNA 4KH9A 1AR81 2VMGA 2IC1A 3KCXA 2PLV2 4JDNA 4BISA 5JOWA 5FOJB 4LO8A 2KR2A 3AYEA 4AQTA 2OX0A 3TBDA 3I2FA 3VBSA 1MPXA 1QQP3 1V6LA 1JMUB 3GCXA 3M3IA 3UGHA 5JR2A 1C28A 5FMOS 3OBAA 3CJIC 2HWB2 4QQLA 3O1PA 2NLRA 2EVXA 1HJFA 2P37A 3KD4A 5E88A 1COV2 4IW3A 3DPRA 4Q4W2 5A3WA 1ULEA 2P3JA 4P5HA 1CIYA 1CGPA 5FYZA 1KJLA 5BNPC 3O1RA 4MV2A 2HH9A 1PO12 4OUSA 1WCSA 2PHWA 4FXGB 1C4RA 4XUQA 1RHI2 1OT5A 3PUAA 1YI9A 4ZZ5A 2KXLA 1HXS2 5JR7B 1FV2A 2C9AA 3IAQA 1MR5A 1XNCA 4LO7A 2EIEA 2HEVF 5C7GA 1WLTA 4QPIB 4S2GA 5DDJ2 2XJVA 5EZWA 3PJQA 3OEBA 4LPLA 1S55A 4HKWA 2OPWA 3LA3A 4K7JA 2A3XA 1VRBA 5FYIA 2W1SA 2BFUL 2XJUA 3HR9A 4IE6A 5L19A 4E4SA 1SLCA 1H1IA 4INDA 1MS8A 1QXPA 4DZGA 5IK5A 1UX7A 1DBNA 3KMHA 1WCUA 5ACA2 3C7EA 2QQJA 4M00A 4A45A 5CFCB 2HWE3 5IAVA 3WP3A 4BDVB 3POBA 2BNNA 4P02B 4BA6A 1UZYA 1Q8QA 4IEOA 5A33A 2DURA 4AAPA 1EV11 1R083 2UWCA 3ZYHA 2W47A 4N43C 2ZHNA 5H9QA 4AFDA 2WQZC 1ND3C 4RHV3 4Z2AA 5F5IA 5A6QA 4XF3A 4XVHA 3HT1A 4ZS3A 1WW7A 4FPOB 1W3VA 3HQRA 3AL6A 1Z7S3 2WO2A 2UWAA 2CGNA 3LB9A 2QJVA 1IS4A 3UK9A 4E9KA 1GZCA 5BNNA 1SPPB 3PUIA 3DN7A 5JZGB 1GWMA 5A70A 1C8M3 5LA2A 4N7UA 3WR0A 5LB6A 2CAVA 2WFF3 2WBKA 1ULFA 1TME3 4RL7A 1ZBA2 2ZMKA 1XE0A 3I2OA 2YROA 3I3QA 3DEMA 1VBE3 1UO9A 3NKGA 4META 2G4IA 3AZYA 1WLCA 3HOBA 4MGYE 3POSA 5FZIA 4NMIA 5A3OA 5LW9A 5C5TA 1EYBA 1UW8A 5FY7A 1RJ7A 1DQ5A 3WNNA 2BTVC 5AFEA 3HNMA 4EN9B 5L7OB 3O1OA 5FZDA 1W04A 1JYNA 3OBRA 3ZSJA 3C7GA 1NLSA 4UW6A 1VBB1 2RDNA 2W1WA 1OSGA 2YC4A 3AB0A 3VBRB 3WF1A 4DUVA 2Y6LA 5M0TA 1VPHA 4M3CA 5CADA 4C8DA 1RMU2 1UYXA 2W0XA 3SLIA 4QX7A 1AX1A 2G1MA 3R4UA 3URFA 3FE5A 1UZVA 2XL7A 5FZ8A 3UL2A 3AMHA 3ZFEA 3CMGA 4QDRA 5I8TA 1H9PA 4LBJA 3JB8A 1PIV1 2ZX1A 1ZBA3 4X6RB 4BM8A 1H6XA 2AC1A 3MIHA 1GBGA 2YU1A 4LBMA 3HAGA 3SITA 3CJIB 2BYVE 2E7TA 2EXKA 4XUPA 5E1RA 4RSUA 4ORFA 3GBFA 1PO13 4AAXA 3A0NA 3C7HA 2E7QA 1AR83 4DPNA 3IDEA 4TWTA 5C8CB 2B45X 3VBFA 2Y38A 1FXZA 4CCDA 1UOBA 4IEPA 2NQYA 4XHXA 1FPN1 2ZZJA 4CCEA 1LCLA 1R1A1 1DDLA 1R082 2J7MA 2WNVA 3NL1A 3PNAA 1N3QA 2DVFA 4DXZA 4DXRA 2XWJB 1JZ2A 4PHZA 2GC0A 4RR3A 4EROA 4B3NA 4CCCA 2WR9A 2NM1A 4JGZC 4M01A 3AP6A 3SCFA 1PK6B 4MGQA 2JJ6A 3HNYM 5FMCA 3IDCB 3FLPA 3MV11 1LOBA 2Z5WA 4LOTA 3WZ1A 4AFMA 4AQ6A 1YWKA 4COYA 3NJYA 4EN8B 3OGVA 1FAYA 5I0SA 4NAOA 1YHFA 5C3SA 1LENA 1ZM1A 4KBZA 4IEWA 2XKOA 2YBPA 4LO4B 4YG0A 4CDXC 1PHMA 3MUY1 3OY8B 5KHGA 1ZNPA 3K2OA 4XJWA 3KCYA 3UJQA 1XBFA 4R9BA 1YQ2A 2ARXA 1JI6A 1S2EA 2UY8A 1BLZA 2XQRA 1Z0HA 1REEA 3BVCA 2GN7A 3ON7A 4GIQA 4X8PA 2X05A 4ARXA 2RS33 1ULOA 3HBZA 4YARA 2EXIA 2DU0A 4AVBA 4IV3C 5JOZA 2HYKA 1HB3A 3F2ZA 4JGYC 3VZKA 2EXHA 3AL5A 1V9U3 2OUJA 3WHTA 3WNOA 1ZRDA 4YVWA 3WNKA 3N9LA 3FJSA 1CAVB 4AZZA 2VUDA 1XYOA 1GOFA 2ZKLA 5JZGC 3E6DA 3Q8FA 1WW5A 1G9AA 1Y7BA 1HRV1 1NCQB 4WV8A 4YVSA 5A6ZA 1NLRA 1IPSA 1Y9MA 3VBOB 1OMIA 5KR7A 4FSJA 2ADEA 1BBT1 3POYA 3T4HB 5CFDC 3MFCA 1RYYA 2D3PA 4COVA 3I2HA 4B7EA 4AYUA 4Y4YA 4CTEA 4IQPA 1GKBA 3RMYA 2CGOA 3WDYA 1CPNA 2O14A 5IK4A 2WN3A 3ROUA 3T08A 1AXZA 2P4EA 4CXWA 1UMIA 1BK0A 5BNOC 1KGYA 4LKDA 2X53S 2XR4A 3R0RA 4HMZA 5HCFA 4UT5A 1U5ZA 1X9PA 1W8OA 4NWWA 1NE4A 2YGMA 5DAQA 3ZR6A 1REFA 4I30A 2Q1FA 4NHLA 5EPAA 4RFT0 1W9WA 1VALA 4GKYA 3UKVA 5HXMA 1XU2A 4Z82A 4CUBA 2PHLA 1EUTA 3NAPA 4IV1A 5F2SA 4UFKA 5FDBA 1NZCA 2OUHA 4YZ2A 4P9WA 1DQ4A 2B7YA 3H8OA 1PO21 1S2BA 2LS6A 1H4GA 2ZMNA 4YFWA 3AX4A 3M3QA 2XVKA 4QB6A 1LNSA 2VTXJ 2C0ZA 2XH6A 5FPAA 2ET7A 1OLQA 1WA6X 4Q4Y3 4A3XA 1Y4WA 1SBEA 2XHKA 3WQ0A 4BK4A 1XRUA 3MIEA 4DFSA 4OQ8A 1SCSA 1XSQA 2GH8A 5FP8A 3RYRA 3MICA 5FQ0A 2VPVA 4KI5M 3RS6A 4PF1A 5IATA 1GZTA 1XU1A 2I07B 2WNUB 3VV1A 5JPNB 3K3NA 3ENRA 1D7PM 2B4KA 3SC7X 1CAWA 4YLZA 3TNQA 3IMNA 2DVGA 5DZGA 1WW4A 3A22A 3ITQA 4IEUA 4NRMA 5FY0A 3CL1A 3U75A 1O3SA 5E16A 4AI8A 3TN91 2VMCA 1JZ7A 2LUWA 5L9VA 1QEXA 3LAGA 5FO7B 5FUPA 1RUF2 1DYOA 1GMMA 1U5IA 2OQ6A 2YZ4A 3JD72 4RA0A 1J3RA 4LHSA 2ZHLA 2D97A 5FP7A 1HKDA 3RYKA 1VRH3 1J3PA 3J7MA 3PMSA 3ELNA 1V00A 5ABJC 4I01A 3IN9A 1UZWA 4XMIA 1MZFA 4YGCA 3TAYA 5IVCA 1RUH1 5KBFA 1MACA 2GP5A 3LDBA 4EV0A 1PM7A 4AFCA 1WCKA 4GAZA 3AMMA 4RHV2 3V65A 1RUJ1 3GF6A 1L7LA 1WMDA 4XBLA 2Z42A 2VQTA 3O1VA 1R093 2ZCWA 1VIWB 2GNMA 4W6XA 2C4XA 2WL1A 3ZXLA 1E5RA 3ZYBA 3RWKX 1VB2A 2JB8A 2DTYA 3OPZA 4MHRA 1YUDA 5K0UB 3VDBA 3WD5A 5FXZA 5F7UA 2RVAA 1EV12 3KS7A 2VOTA 2ILMA 2RDSA 5JMCA 5DUWA 3EHKA 3CIHA 2VCAA 2DCJA 1UOGA 5FP4A 3I3DA 3I3MA 1X8MA 1RITA 4PCRA 1SBDA 4PI0A 5BNOB 1FOD1 1HW5A 4UAPA 4G4FA 1C5IA 1QWRA 2Y6HA 4JZRA 1GLHA 2HBUA 4NJ4A 2R0HA 3O14A 4A41A 5JXHA 1X82A 1K12A 4CVUA 1UOJA 3QLQA 4W4ZA 4JTOA 1POV1 5A6YA 1ENXA 5F6LB 1XYPA 4NPRA 1W03A 1POV3 5CIRA 1W6QA 4GB32 3WT3A 4DXSA 1H6YA 4AI2A 4BH9A 5LCWL 1NX9A 5FZ6A 4OMDA 2VQ0A 2VZ1A 4NWVA 1SPPA 3CEWA 4LBQD 2QQNA 4JKMA 2O8QA 3IBMA 4RQPB 4GMP3 1NE6A 1DZTA 4Z1VA 2HJIA 3ZXFA 4NE9A 2WLPA 3BTZA 1XSRA 4HSJA 5FZ7A 3PHMA 3UETA 1RB8G 5FY9A 2ZHMA 4A7ZA 1F31A 4HZFA 1PMJX 1RUE3 1YFUA 3KZ4C 2E53A 1AR82 4GQ7A 3LIGA 2W92A 2WRAA 5FCCA 3T4VA 3IT8A 2IZWA 2QUOA 1URXA 2GMPA 1GSLA 4UW3A 1LEMA 4OZOA 1VLNA 2QVSB 3SMHA 3V64A 3VDCA 3WHUA 1WGPA 3B3QE 3NV1A 2C9KA 2RR13 3UGFA 4H7LA 4CDWA 1LU2A 1XPWA 2RM23 1WUVA 4XJ9A 4Y4RA 1VBD1 3K75B 1W2UA 3MZHA 1W8NA 4HVQA 1TEIA 2Y0OA 3ACHA 1ZZ8A 4HKOA 3DYMA 3GHNA 1ST8A 3UESA 3VD7A 2NMNA 1PIV2 3ETPA 1JZ5A 2UU8A 5A3TA 5A7OA 5KHIA 5ACA1 1O3TA 4GMP1 2D6PA 3U14A 1WLDA 5A1AA 1D2QA 2ZGQA 4JQRA 3ES4A 1H0BA 5C8CC 4O9EA 4ZU5A 3TYJA 2R063 1SLBA 3NSTA 3C3VA 1YCIA 4D6SA 5ABJA 4LTAA 1GQHA 3GBWA 4CCMA 4ZU7A 4YRDA 3OCPA 5LK5A 3PUHA 2PAEA 1R091 5F39A 3EJKA 2J1VA 2BWAA 1Y9QA 1ZVFA 2VZTA 4Q0UA 1DCSA 4JGZB 1VAKA 1RXGA 3VGIA 1PK6C 3VZLA 3V0AA 5F6KA 4IEXA 4LULA 1C8M2 1I9RA 3ILFA 2FCTA 1UU5A 4GWJA 5A3PA 1GOGA 2E6VA 1U5XA 4AEKA 2ERFA 1IQAA 4FOQA 4KWKA 4YWAA 4XIKA 5HBAA 1KEXA 4D94A 3JQXA 4EE2A 3U37A 1YNAA 1LECA 2PYTA 3M7AA 1OA4A 4M4RA 5H9RA 3WINE 1K3IA 2VZQA 4B4QA 1JS9A 4DY3A 5IW0A 3ME2A 3FN9A 3VLBB 4IETA 4A4AA 2YC2A 1W8ZA 3HIFA 4YW5A 4E27A 1LR5A 4UFLA 3BU0A 4LA2A 5C4WB 5FY8A 4CA9A 4W50A 1BK1A 1G9BA 1HQWA 3NQHA 2X29A 1FMD3 1OHFA 2NZ9A 4SLIA 2FD8A 1O7FA 1D4M3 4DB5A 1QJFA 1V6KA 1XJAA 1ZX5A 3POEA 5EYYA 4DXTA 4R9AA 1JH5A 2WS93 1O8PA 1NA1A 5FO8B 5FYYA 2PMWB 4MLOA 5CFDB 5AVPA 1ENQA 3ZYFA 2R043 5IK7A 4B4RA 2EICA 2WFF1 1A3KA 2YPDA 1GR3A 1SEFA 3AP7A 3MLLA 3NNFA 4HLTA 4IV1C 3IPVB 4WVZA 5HCBA 3NAPC 2BBVA 1NXMA 2RMU1 3RZGA 4JDOA 3WUCA 3W5MA 1J1TA 1V6MA 4XETA 1Z7S1 3C8XA 2QDNA 4JHZA 1KDMA 4LBQA 1AJOA 2IXLA 4XFBA 5FK8A 1QNWA 3J8F3 3N7LA 2ENRA 3I4IA 4W6YA 4AI3A 5IHRA 4MGTA 1OQ1A 5BNOA 5I93A 3WG1A 1LEDA 1JODA 2UWBA 4JV4A 1W6MB 4XMAA 1UQXA 3WX5A 3H8RA 3UNPA 2QQWA 2A3YA 2VD7A 4XDPA 4UBGA 3ZIWA 1ULPA 3WSOA 1UCXA 4ISQA 2LW8A 5JWPA 4C0BA 3WDVA 4YVSC 4AWDA 3VDAA 4QPGB 1X7NA 2IXJA 2WWJA 4RR3B 4WVWA 2VULA 3USSA 1NQJA 4HK9A 4BK5A 1LULA 1QJY1 1SMVA 3M70A 4QPYA 4DO0A 4QHBA 3AK0A 5C6CA 4IV3A 5JIUA 4YM1A 5IYYA 3IB3A 4XILA 3H3ZA 1BZWA 4M3CF 1ZZCA 3SKJE 4I09A 2WZR1 3NMBA 5FYUA 1UMZA 2BOJA 5FMDA 3N3HA 3DYPA 3K4DA 5EYXA 4CDXA 4E8DA 5FZGA 2XMLA 5JOXA 4QHZA 2GMMA 2V4AA 3P6BA 1R092 2A5ZA 4LBKA 1GANA 1W6OB 2GMEA 4ATEA 4XIOA 2IUWA 3O12A 4MHUA 4A3ZA 3N7JA 1O5UA 3KM5A 1SACA 2PXJA 1AL0G 3LEIA 1Q5OA 4AVCA 2R30A 1WZXA 5GZFA 2WSVA 4R52A 1DGWA 1FI2A 4DQAA 3PMEA 1XYNA 2HKXA 4NAMA 2DUOA 4KGGA 3T2TA 5EJZB 3L2HA 2WNVC 2X5IB 3I7DA 2RJLA 3VBRA 4OI1A 3MW4A 4Q0SA 1KD7A 4FO9A 4YPJA 3VHRA 3VBFC 1J84A 3ZIXA 2BP6A 2VOKA 4ITCA 1MEC2 1V6IA 3MDPA 4QXBA 1W6NA 4OZXA 5FLHA 5FQ0B 3NNJA 4FTEA 1PGL1 4I0AA 5HV0A 3IIIA 4BQYA 2IVIB 5T54A 3FHQA 4Y24A 4Q4W3 5K0UA 5AVAA 1SLIA 1TMF3 1MS0A 2ET1A 5FZOA 3S5AA 2VBDA 2VCMA 3I2JA 4K1YA 4B1LA 5JI7A 3B69A 4J25A 5E89A 1JHNA 3O1TA 1PMHX 4P9GA 3LFIA 1BKZA 1LAJA 2UURA 1Y3TA 4MGKE 5DUXA 2ZGKA 1M4WA 3W21A 3VL8A 3ZFEC 2R071 3E5QA 1NUKA 4IV1B 4XZPA 5GM0A 3A7QA 3S7IA 5KHKA 3PUQA 2YHJA 1YQ6A 2EXJA 4PF5A 2WFPA 5I0TA 3DF0A 1DGWX 4P9LA 4QX1A 1ENSA 5FZBA 1SCRA 2GC3A 2OVUA 3WY6A 4QPWA 5HCAA 1MS3A 2VZVA 3O0WA 5GLTA 1RUE2 4LBLA 2Q8CA 3ZMOA 3RFRA 1VBC1 4XDOA 5FY5A 3BI3A 3R05A 3PU8A 4Q4V3 4LORA 3SEEA 1VP6A 1FATA 3ST7A 4AK3A 1QH7A 2WYFA 5FLJA 1K5MA 1GYKA 1NY72 4CDQA 1J83A 1VBB3 2BU9A 4AI1A 4BPZA 2ZAAA 1RMU1 3M3CA 5GZGA 2E33A 3AZVA 3LGRA 1AR71 1DLCA 1QHDA 2AGSA 2G9ZA 2B46X 2WT0A 1W6QB 2SLIA 4V2VA 5LASA 5T5OA 4NIIA 5BNNC 5FZOB 3ZYPA 1GZWB 3ZMNA 5AC91 4EJRA 2VMIA 5A1FA 4QB1A 2BBAA 5EJ1B 4XYXA 5BNQA 1LODA 3X29B 2WIIB 4N43A 4A2UA 4ONUA 2VQUA 2VXRA 4Q4Y2 3H3LA 4CP2A 1WMEA 2ZA9A 3OY8A 4HFSA 3DPRB 4QXHA 2E26A 3NW4A 4L99A 4TYSA 3THPA 1YFYA 2PQSA 4LNVA 1WD3A 1TMF2 2A3WA 2VUJA 3OG2A 3NNMA 5C9AB 3GZTB 4MG2A 2ZGRA 3D3AA 4HSLA 3AZZA 1DF0A 4L0PA 1FNZA 4JKKA 1Q3EA 4LIUA 3VD3A 4YW1A 1W0OA 1MS9A 4UFHA 1VB4A 2JDYA 5LATA 5FP3A 1OD3A 1P8JA 5JIAA 3VD4A 1AXKA 2GC1A 1C1FA 3I49A 1SZBA 2WNVB 4DUXA 3JBG2 4HKLA 1RUF3 2X5IC 2P2KA 2XG3A 1W0PA 5GLUA 2A6WA 1MQTB 3WOGA 4Y20A 3PIJA 3BGAA 3D5OA 1B35A 4MGZE 1COV3 3D6EA 2RV9A 1APNA 1OVSA 5T5PA 1W05A 2WO3A 3QH6A 3THCA 2VL4A 4AEMA 3WF3A 1UNBA 2PHXA 4NHXA 5GLWA 3TNPB 3I2DA 3SNMA 2ZX0A 1W06A 2V5DA 3WW4A 3CJIA 2ZBJA 1PO23 4FAGA 2I2SA 5D2AA 4MXWB 1WCQA 2D44A 5EJ3A 5C70A 2CTVA 2WABA 3RZJA 3VBSC 1GNZA 1FOD2 1W6PB 3A0KA 4RGGA 2XVLA 4YZ1A 4YZ4A 4AHWA 1W2OA 3MIDA 3OB8A 1LU1A 4X8NA 1IS6A 2WINB 2W1QA 2D3RA 3OUHA 2NPIA 5FXVA 4AEDC 3POFA 4HN0A 4ASKA 1BVP1 2JDZA 2Q4SA 3LSDA 3E6CC 3WW2A 4IEYA 4ES9A 2XLAA 3WF2A 2HWC2 3WUDA 1YFWA 1MS4A 2W91A 4FOWA 3FMGA 2XQXA 1YJKA 1YI7A 3ACFA 4WVMA 1UZ0A 4GWIA 3VHPA 4LLFA 1ODMA 2H6CA 4MVTA 2E63A 1ULDA 4YM2A 4XQWA 4EWAA 5B4NA 3VBUA 4BQ2A 4BYYA 5GLVA 2XPJA 4FPKA 5LBFA 1J58A 5BXXA 2GP3A 3Q8AA 3PLQA 2EALA 4QAWA 4XPVA 5LRRA 2TNFA 1W90A 4WVMB 3QBQA 2JDMA 2OPKA 1UOFA 3KGZA 3VDDC 1NG0A 2CNAA 3DCQA 4Q0PA 4E2QA 2JG8A 4QT6A 4RGAA 4NUBA 2DUPA 3DKQA 3I3EA 4CE8A 1ZRIA 2WN2A 3SH5A 3OJBA 3ZXAC 5FBZA 3NAPB 4HBNA 4TLGA 1Q8OA 4AEJA 4EWDA 4Q8KA 2YU2A 4PIXA 5FXWA 5AC92 4OULA 5FPUA 2R073 1ULGA 3BPZA 3SCGA 1ASJ1 1AXYA 5FTTC 4K40A 4A7YA 4BXFA 2ZAHA 5JXGA 4BZ4A 3H7JA 4TXWA 3HJRA 3QD6A 4QDSA 5HV4A 2YYOA 4Y22A 3WV6A 4YZ3A 2BQPA 3DUIA 5JLVA 2FZ2A 1GP4A 4LKEA 2TBVA 4XFIA 1O91A 5GALA 3MYXA 2BDRA 2W68A 2UY9A 2P3YA 5F5QA 1TMF1 5FPLA 1LRHA 2DBIA 4TLFA 3RZMA 2W2IA 2VNVA 1NCRB 4Q27A 1OPMA 3BOWA 3T0AA 3VBHB 4Y5Z0 5IVFA 4P14A 3U4SA 4CEYC 4LEJA 5LA9A 1FX5A 1X36A 3WXPA 2ZOEB 5FKCA 1FOD3 3OSDA 4EZHA 4DUWA 3NNLA 1CZTA 4LE4A 4CCOA 2CU5A 1IZ3A 3JD71 3RI8A 2WWUA 3IAPA 4Q5OA 2RS11 1UYPA 3KGLA 5F9TA 3LF7A 1OVPA 3WCRA 3BU7A 4D69A 4SBVA 1V6JA 1VBA1 2MEV1 3ZKUA 5LWBA 5KHJA 1IG0A 3MLKA 5J09A 2IWGB 3HN1A 3VUOA 3RQ0A 2WT1A 1XXNA 4LUKA 2VOVA 2GN3A 1RC6A 1LGCA 2F17A 2CV6A 2WAOA 4FPGA 4E4DX 1ND3B 3LEGA 5H9SA 3ACGA 3P1IA 2A71A 1LGNA 1DU3D 2C6SA 1VBA2 3D82A 3MPPG 4WM7C 1W8FA 2JD9A 2PN5A 4QX2A 5DAVA 1JBCA 5FKBA 3W20A 1ONAA 1LHVA 2QQIA 1SFPA 3AVRA 3CKHA 4JHTA 4QGNA 4WM8A 4DIQA 3BCWA 4O9GA 5CKMA 1EAH3 3LDRA 2ZGPA 1UWWA 4O65A 4QQOA 1RUG1 2BW8A 4J6GA 3RZLA 2CDOA 3LQCA 3PIGA 4YW6A 1UYZA 1CZSA 1JU3A 1H4HA 1UIJA 2BV4A 2QFEA 3B9IA 4GH4C 1OXCA 4BQ3A 1WKYA 1F2NA 1L7QA 5BPXA 4FXKB 3AKTA 3FBMA 2DVBA 1Q8PA 5C3RA 5JXIA 2P17A 4RQPA 4NIHA 4X6QB 4XUOA 1S0BA 5JCTA 4KU7A 3I8TA 4GKXA 2HWD3 1O3RA 4LITA 5A3LA 1JZ4A 3NKTA 1ZRCA 3OYWB 5A3NA 4RS5A 2OKXA 1H2NA 1CAVA 3RJ2X 3VKOA 5LRSA 1M06G 1REDA 3GJAA 3LWCA 5F1RA 2D43A 4YVWB 4BXSV 3J8F1 1LKNA 3IIAA 4AHZA 1PX4A 2BNMA 3O0XA 5T3NA 2FBEA 3AYCA 1CWPA 3ZSLA 3TEZA 4LJHA 2FMDA 2PHTA 1AZDA 4QXKA 3ZXJA 2P3IA 2VNGA 2P34A 2HYXA 1ASJ2 1HX6A 2OZJA 3LSEA 3MIGA 1ZZBA 1JHJA 1MS5A 1O4YA 4XXPA 4AFBA 2D5HA 2W08A 4RD7A 1LHWA 2YB7A 3ZDSA 1W9TA 2SBAA 1DGLA 4KL1A 4D6RA 2QQUA 4JKLA 4N53A 2WQ4A 2J1EA 5D8AA 1AYN1 1RVF2 3ZN6B 4CPBA 2OT7A 2WS91 4BHPA 2JIGA 4MOAA 2JD4A 4URTA 4D7TA 1OA2A 1R64A 4XCBA 4BJ0A 5LEKA 2RS31 4XFGA 1LHNA 4CYDA 1X8EA 5CEHA 1YEWA 2JX9A 5JVVA 2EIGA 1EPZA 1VBA3 4CSWA 1PZ9A 1Z7S2 1NQDA 5D21A 2WZR2 2YXSA 2AYHA 5FZ3A 1SDWA 4Y1YA 1QF3A 3H1YA 4RFRB 2YG0A 3NJVA 1QXRA 1LJ7A 4XE9A 2QQVA 2VZ3A 4NOTA 2RS12 2HWF2 4QU2A 1OOPC 1NCRA 1OH4A 2HBTA 3CQOA 2WZEA 5DG2A 4ZKTB 2AREA 1JYXA 2A6ZA 2PFWA 4MGSA 2ZPXA 4OQ9A 1AUYA 2VQAA 4IE0A 4PLNA 4XFAA 3ZN5A 3QACA 3WDXA 3ZFGB 2J1TA 1K5JA 3QCWA 2BVVA 2XGXA 4N9HA 3UKNA 4AVTA 3BTYA 1H8TB 2VCBA 3ZFGA 5GZDA 5C3QA 3NJZA 2JEMA 4B4PA 5C9AC 1JYIA 4YGEA 1SLTA 1WMXA 4K8RB 1KQRA 3R6SA 1YQ5A 3ZXKA 2E31A 4WM7B 4JGYB 4DINB 2WT2A 4QX0A 3KB5A 4CDUC 5FO9B 3WVJA 4I0WB 1OFNA 4JRAA 3RWNA 2FDFA 1QJEA 2PAMA 4Y1VA 1UIKA 4GA9A 5FYVA 3JD73 5DABA 3T2PA 3RI9A 3NVCA 2HWC3 1UL9A 4Y3OA 1EP0A 2RS52 2WAAA 4I0BA 1BVVA 4BQWA 5KWRA 3Q8BA 2PQQA 1HB1A 2XWBB 2ZGTA 2BWCA 3N7KA 5IVYA 4ZU4A 5CG8A 2BOIA 3H1MA 1TNFA 4K1ZA 4MYEA 2FDHA 2PHDA 3E97A 5FBJA 1YQ8A 4DS0A 3B94A 5CFCC 5DPNA 2W94A 4Z07A 3VKMA 1HJGA 5T52A 2WYSA 1OC1A 3B00A 3ZXEA 4QU1A 4BU2A 5JUVA 4XJZA 4Z2WA 2GNBA 3F95A 4XFCA 3KSCA 4IL7A 1UF2C 2CY6A 2FDIA 3VD9A 3RYPA 3LDKA 3WP6A 4AEDB 4AE2A 3KVAA 3WDUA 1S0JA 2DV9A 1OLMA 1F4HA 3OYWA 1TZOA 1MEC1 2DCYA 4CEWA 4FBFA 4EYUA 1PIV3 1VAMA 2HWC1 2YGLA 1UXZA 1DP0A 1HN0A 1QIQA 4QKDA 4YG6A 5DAWA 4JX0A 3KT1A 4Q4X3 1WBLA 5CFCA 2DU1A 3PVEA 1GNYA 4YW7A 2G9FA 1AR72 3AKRA 2QTWB 3PVOA 3RDIA 4Q8LA 1AL22 3ACLA 1XC6A 2TUNA 5C4WA 2VBBA 4XW3A 2JDPA 4ZONA 4JQTA 4CPBD 4B8EA 5C33A 4WM8B 2D40A 1GV9A 3KQ4B 2JG9A 5FZHA 3CU7A 2DCKA 5FR3A 5LZ6A 1UXXX 1VBE1 4CDUA 3TB0A 1KFXL 4NO4A 4H55A 5HXVA 4TTGA 3V0AB 4WVVA 4PDWA 4LHLA 5IFPA 3FX3A 2E7AA 1O3QA 1QJX1 3GGLA 4Q4X2 5C9AA 4CCLA 3ZFGC 1QJY3 3RMXA 1UU4A 1Q8VA 1AX0A 3JBG3 4BQ1A 3G6JB 3ZDVA 3DKWA 2EAKA 4OI4A 1V9U2 3MIBA 1JOPA 3DECA 2R49A 1F35A 1RHI3 4RHV1 5DUUA 5ABJB 2VOXA 1NCRC 3FFZA 3VBHC 4HVRA 2GSYA 4XTPA 3JUUA 2GH2A 1CPMA 5FZ1A 2HWB1 4H3WA 3WG4A 1IS3A 1GP5A 1OLME 1QQP2 3PTYA 2RE9A 4TZDA 4HG6B 3L9JT 1MS1A 4ARYA 1JYWA 4YW2A 3FWEA 4XHBA 5FYCA 2EA7A 3VHNA 4PLMA 4XFHA 4KU8A 3AJYA 3SXWA 1W8HA 1X33A 4K8FA 2CAUA 2WO7A 1YC61 5CKQA 4ET7A 2QKDA 2FZ1A 5IT6A 1BXHA 4XUNA 4GZ9A 2R7EB 2JECA 2ARBA 5FJHA 5I8SA 3H1WA 2AH2A 1YIPA 3JCIA 4OFGA 4XURA 4ZY9A 1QMJA 1MZ5A 1ZA7A 3BIWE 3RRDA 1O59A 4UI9L 2AR6A 1IQDC 4RN5A 2GALA 3LA7A 5IVEA 1XNBA 4XQ4A 1A78A 2R16A 1D4VB 3AP4A 4GD4A 4QDQA 4EWEA 5CG9A 3OTFA 1K45A 1F15A 2H0VA 2JG8B 2RM22 4UF0A 2MPFA 4HANA 1O5LA 3QH7A 5LA1A 3H9AA 4RS5C 5EP9A 3AZWA 4QPGA 1RIRA 3MW3A 1NCQC 2VNOA 2Y0IA 3OGSA 1FNYA 3K4ZA 1GNHA 1X50A 4HK8A 1IPKA 2A1XA 3N7MA 1E5IA 1O6UA 3OOXA 2ZHKA 4RQPC 4FTBA 2JENA 4B7KA 3WDTA 1S0CA 4CU7A 2RG4A 1BEV2 3SH3A 1XQNA 1ZREA 1F5JA 2O0OA 4GH4A 3Q9OA 2JE7A 4D0QA 1QOSA 4D7YA 5LEJA 1MEC3 1US2A 2ZGNA 4LBQB 3C7FA 4NIAA 3VHOA 4OHYA 2JE9A 4V1PA 3K46A 5GZCA 2Z79A 4R4XA 3NO8A 5FZKA 2IVJA 4YW3A 4D6QA 4JDMA 3OUIA 5FZAA 4Q29A 4L8QA 1CX4A 1ZZ7A 3OGRA 4WM7A 2E51A 2ZGUA 1U5YA 2BRTA 2D93A 5FV3A 2ARCA 1VRH2 3POIA 1CN1A 3LCPA 4BOWA 4E8CA 2DBNA 1NZIA 4COZA 1CZVA 3N4MA 3O0VA 1N1VA 2WFF2 1QJX2 1PNGA 1YIFA 2VGDA 2W3JA 4HXCA 4Q4X1 2Z2SB 2Y34A 1UPIA 2Y8KA 5IAXA 3PURA 2F4PA 1LOAA 1W3XA 1CAXA 1UY0A 1VMFA 3AKQA 4LK6A 1G9FA 1NYWA 4FPEA 4Q0QA 3JZVA 3S30A 1VBD2 5KHHA 1IG3A 1W9SA 2OA2A 4E2GA 4GWNA 4Y33A 4IEVA 4F8AA 1O8SA 4Y20B 4H14A 2Y6GA 2ZXQA 1UD1A 1B35B 2WNEA 4XACA 5FREA 3T30A 3O5SA 2WNUC 1KXGA 4QPIC 2Q8OA 4PJYA 2K46A 4XF9A 4DEQA 2JB4A 5A3MA 2XJPA 2OQ7A 4AGRA 1GFF2 1I1EA 2GC2A 2XLGA 2QQLA 1QOTA 2O1QA 2YPJA 3BODA 4TN7A 3ZFFA 3HT2A 4MADA 5A6XA 1LTEA 2IXCA 2ZGSA 3BKZA 3TEXA 3GJBA 2KA3A 2B9UA 3VD5A 4Y1XA 1LHUA 1H8TC 2E9QA 2V73A 5KXBA 3A21A 2QQKA 4PBPA 2QZ3A 4FPLA 1RUI1 4Q26A 4XJUA 1W8WA 3EYPA 1H30A 1CVNA 3PUSA 5IUQA 4CUGA 1GICA 4AHXA 2NN8A 4CDUB 5JOYA 4AGVA 4C0HA 1J59A 3CJXA 5J3UA 1ND2B 4M0NA 3UYJA 1T2XA 4YGBA 1MZEA 4RS5B 4V2WA 2ATFA 4EN7B 2W87A 3C2UA 1PGL2 1RUJ3 5HPOA 2A6VA 1H9WA 3Q8EA 4FFFA 2MEV2 4QMAA 5F5AA 2HWD2 1SFNA 4XFFA 3FC0A 4YW4A 1LOFA 2J1UA 4P08A 1NA1B 2YY1A 2QDRA 1AYM1 5A7WA 1F4AA 3IDAA 1XNTA 4I3GA 2J1SA 3D0JA 4C1XA 4UYBA 1HRI1 3H42B 4HVOA 1K5MB 3HD8B 3DV8A 1ALYA 2DFBA 1RUC2 4Y22B 4ZPIA 3TEYA 5L7OC 4YGDA 3H8UA 3ZXGA 1HB4A 5K8SA 3T0DA 1RVF3 1OH3A 2XOMA 1DG6A 1HRV2 2D6LX 4BLJA 1UAIA 1OPOA 4K20A 4R9CA 3WNMA 5J36A 4XF1A 3I2KA 1VR3A 3AP5A 3MV01 4UXAA 3ZYGA 1LESA 1QXJA 3INAA 4NIGA 3OGJA 3R4DB 4R8HA 4FVVA 2OS2A 4AEDA 1RUG2 1AR91 1PVXA 1TME2 2JIJA 1WBFA 3B7MA 4P9JA 5L9RA 5CBLA 1LGBA 2QQOA 2WLQA 4AQ2A 3ALQA 1AYN2 1MVQA 3AKPA 3GHMA 2DCTA 4IGOA 3SCHA 1QJY2 1YRZA 3T2OA 4AFAA 2RJ2A 3USUB 2ID4A 5FZMA 3W59A 2VW0A 3AXDA 5JSOA 2X10A 5J98B 5F37A 1A34A 1AR92 1AX2A 3NV3A 3W5NA 1FMD1 2VMFA 3AJZA 4MUVA 4S2FA 1B35C 1RUD1 5JSPA 4KG0A 4UFJA 2A73B 1F9KA 2RHPA 3ACIA 4M0HA 5C71A 5KXEA 1FPN2 2ZZQA 4XOGA 1RUD3 1W8UA 2X5IA 2HEWF 5FIXA 1UY4A 5DUVA 1R081 3BPSA 2G19A 3UJOA 4KNCA 1DQ0A 4J1XA 2OYZA 3MF9A 4FAHA 4GJYA 5G05L 4MH0E 5EV7A 1J1LA 2D6MA 2J1AA 4ATFA 4NHYA 4MX3A 3U11A 1AYN3 1QJU2 4S2DA 5KC6A 2DWRA 4HPKA 1HQLA 3NJXA 2ZGOA 2RS53 1D2SA 3S5QA 4Q2FA 2A6YA 5FYHA 2WC2A 4LXLA 1DGRA 5ANNA 4IDZA 1W6OA 4LBNA 1I6XA 3WQ1A 4ASLA 1X9TA 4Y5SA 4OUEA 2DDUA 5KXCA 1PGW1 1TE1B 1AR93 3IMMA 2VW2A 1BYHA 3PL0A 3GM8A 4A6OA 3ZM8A 2AEZA 5HCHA 4N7IA 2XUEA 1JUIA 3T2QA 2D6OX 4D7SA 1MQTA 3MGUA 1CAXB 1XNKA 3MIFA 4GULA 4OHXA 1LOGA 2R061 1YO8A 2VECA 4LBOA 4P9YA 1EY2A 1NKGA 4BIFA 5FXXA 2ZGLA 3U10A 4NHMA 1ZZ9A 1PNFA 2PTMA 2Q8DA 1SDDB 3VZNA 4PT6A 2D3SA 4K9SA 4M3CE 4URAA 2XONA 3I3BA 4HPKB 2BGPA 1G86A 1QQP1 2BPA2 4GB33 4CRQA 5AC93 4CDQC 2FCVA 1K5MC 5FAXA 1QNYA 3K77A 2A70A 3NWKA 3I97A 3FHAA 3JBG1 3U07A 5FY1A 3WG3A 2WDBA 3AKSA 1AR73 3PJYA 4PIZA 2J42A 1KDKA 1QDOA 3CZJA 3THDA 2F6BA 2V72A 4COUA 3K3OA 2QCSB 4QQHA 5I0DA 1SFYA 2DFCA 1QGLA 1A6CA 4A42A 3K48A 2AZ5A 1S4CA 3U1XA 1XE8A 3BTXA 5IWFA 1DIWA 4F83A 2MHFA 3PU3A 4QQPA 4NIDA 2ZEWA 3UKTA 4ASMB 2FCUA 1ZBE1 1J3QA 5FK7A 3J4UH 3WCSA 1GWLA 1BEV1 5ERLA 5DZEA 5FMOL 4XQDA 2AACA 2VVFA 4I3PA 1W6PA 2ZACA 1QU0A 2IFWA 3P3NA 5C3OA 1DQ6A 2XL9A 4CU6A 4IE5A 4IUGA 1IPJA 2ZKNA 4HT1T 4LOSA 1POQA 1JYTA 1CESA 4LK7A 1SLLA 1NOVA 1IHMA 4KQ7A 1H2LA 4NR1A 2C1FA 5K0UC 1NLQA 1OQDA 5SV5A 5F32A 3RG0A 5JI9A 1ZBE2 4QWNA 4BQXA 4Y1UA 1YQCA 2QQMA 4LA3A 3O7OA 4GB31 5A1LA 1VBE2 2ZX3A 4QXCA 1C5HA 4PI2A 3VBRC 4BQ5A 4ZHNA 1RUD2 3M8LA 1BMV2 2Y33A 4JTNA 1YLLA 2BERA 2D98A 3E5UA 2ZX2A 3EQEA 3FHIB 3LA2A 5LBEA 1UY2A 1CIWA 1T6BX 1S0DA 2BUKA 3R4SA 4FCAA 1KS5A 2ZEZA 3P3PA 5GLZA 3GXUA 3E6BA 3GNEA 2JDHA 3GBGA 5T50A 3AMPA 3H7YA 1V6OA 1HN1A 2FQPA 4B29A 5HI0A 2MEV3 1PO11 3ZSEA 1BMV1 4G9SB 2JWPA 2CL2A 4NROA 3WP5A 3HPNA 1ASJ3 5LK7B 4XABA 2HWF1 4FFGA 5JDBA 2C5DA 2VTFA 1S2KA 1MQTC 2WJSA 4KBBA 4LKFA 2VH9A 4W65A 3WQBA 5A7SA 3GALA 3ZX7A 4XAAA 1N1SA 1IGOA 2D5FA 3BTAA 2RR12 3LE0A 1WD4A 1Q8SA 5F2WA 3WF0A 4CP9B 2PLV1 1JUHA 5CISA 3JU9A 4C1WA 2WZR3 1R1A2 4QM9A 2BGOA 5J1XA 4TSVA 3BIEA 4GXLA 5ISLA 5I8YA 3GYDA 1L7RA 1W2TA 1JYVA 1CX1A 1PMIA 5I0UA 3HQUA 3H50A 3ZPYA 2FMYA 4AL9A 1EV13 4CDQB 2VU9A 5JSRA 2ZX4A 5J7MA 3POGA 3ZVXA 3N36A 3CF6E 3V0BA 2XB6C 3GZAA 2ES3A 2EIDA 3N35A 4FFHA 4PLOA 5FZEA 3IKWA 2W46A 1RINA 4QQ2A 4N90A 2DYCA 2P1BA 2OZ6A 2HWB3 3IDBB 3LEKA 3RNSA 4AOCA 1JYCA 1ENRA 2CDPA 2HWD1 3DXUA 4RYDA 3AYAA 1VBB2 1C8M1 2FDGA 3FLRA 1I5PA 3POJA 4IV3B 4N43B 5DDJ1 3WNXA 4AGGA 5FOBB 3DXTA 1D4M1 1IOAA 1VAVA 1RUI2 4HL0A 5FP9A 1ZYBA 1W2NA 2WQ8A 4Q4V2 1UY1A 2VZRA 4AR2A 1JZ8A 5CZKA 5A7WB 2PHRA 5LBCA 4LR4A 4W8JA 4HETA 1S0EA 4O7XA 5H9PA 2ZEXA 4FPCA 1LHOA 1NA1C 3HVDA 4BB3A 3KHCA 1GU3A 3BOPA 1UYYA 3M1HA 3Q8CA 1FV3A 2Q30A 3ILNA 3RGBA 3LFMA 3VKFC 2WNOA 3ETQA 2R072 1QJU3 1DZQA 1BBT2 2EAAA 2NP0A 1H1AA 2YFZA 4DRVA 2R041 5L73A 1GQPA 5D1IA 3DL3A 5A80A 4EN6B 3J7NA 3K4AA 3M2MA 2CGPA 5CB7A 4P9IA 4OYUA 5IJRA 4PQ9A 5BYNA 1U0AA 3TEWA 2RM21 3PTRB 5CYYA 1JOBA 5L7OA 5FYMA 2VW1A 3ZSMA
chains in the Genus database with same CATH topology
1HJFA 1QJEA 1BLZA 1QJFA 3ON7A 2WO7A 3ZKYA 1OBNA 1ODMA 1W06A 1W28A 1BK0A 4BB3A 1HB4A 1E5RA 1WA6X 1RXFA 2BJSA 2JB8A 3ZOIA 5C3PA 5C3RA 2BRTA 1E5IA 1HB3A 3OOXA 5APAA 1UO9A 1HB1A 2JB4A 2VBPA 1W03A 2VE1A 1W9YA 2DBNA 2IVIB 1HB2A 1W2OA 5C3QA 1W2AX 2Y60A 2VAUA 1QIQA 1UOGA 5C3OA 1E5HA 3ZKUA 1GP4A 1W04A 2VBDA 2VCMA 4RGKA 2CSGA 1IPSA 1UOFA 1UZWA 1ODNA 1GP5A 1W3XA 1GP6A 1HJGA 1W3VA 2DBIA 5C3SA 1DCSA 1OC1A 1E5SA 1RXGA 2BU9A 1W05A 2IVJA 2Y6FA 1W2NA 1UNBA 1UOBA 4XAEA 2VBBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HJF A;  1QJE A;  1BLZ A;  1QJF A;  3ON7 A;  2WO7 A;  3ZKY A;  1OBN A;  1ODM A;  1W06 A;  1W28 A;  1BK0 A;  4BB3 A;  1HB4 A;  1E5R A;  1WA6 X;  1RXF A;  2BJS A;  2JB8 A;  3ZOI A;  5C3P A;  5C3R A;  2BRT A;  1E5I A;  1HB3 A;  3OOX A;  5APA A;  1UO9 A;  1HB1 A;  2JB4 A;  2VBP A;  1W03 A;  2VE1 A;  1W9Y A;  2DBN A;  2IVI B;  1HB2 A;  1W2O A;  5C3Q A;  1W2A X;  2Y60 A;  2VAU A;  1QIQ A;  1UOG A;  5C3O A;  1E5H A;  3ZKU A;  1GP4 A;  1W04 A;  2VBD A;  2VCM A;  4RGK A;  2CSG A;  1IPS A;  1UOF A;  1UZW A;  1ODN A;  1GP5 A;  1W3X A;  1GP6 A;  1HJG A;  1W3V A;  2DBI A;  5C3S A;  1DCS A;  1OC1 A;  1E5S A;  1RXG A;  2BU9 A;  1W05 A;  2IVJ A;  2Y6F A;  1W2N A;  1UNB A;  1UOB A;  4XAE A;  2VBB A; 
#chains in the Genus database with same CATH topology
 1A8D A;  2W1U A;  2XJS A;  1G9C A;  3T3Y A;  2R0F A;  5DZF A;  1C1L A;  2ADD A;  2GDF A;  5JMO A;  1JTZ X;  4GJZ A;  1ZZ6 A;  2LAL A;  2VBP A;  3MBW A;  2CYF A;  1NAE A;  1C8N A;  3KVB A;  1XOY A;  1LOF C;  1POV 0;  5LA0 A;  5C5U A;  1DHK B;  2PLV 3;  4D3W A;  1PK6 A;  5BY5 A;  2JDA A;  2QNK A;  5JAX A;  1RVF 1;  3ASI A;  1WA4 A;  2HWE 1;  1HRI 3;  2ZML A;  2XJQ A;  4FP2 A;  4HON A;  2YC0 A;  5ACA 3;  3HWJ A;  3AZX A;  2IXH A;  2LTN A;  1V0A A;  2V5Y A;  5FZ9 A;  5L36 A;  2QE3 A;  3M4F A;  2V09 A;  3OBT A;  5ANQ A;  2I45 A;  3RPQ A;  1UKR A;  3D4K A;  4BLI A;  4CCK A;  2XBO 3;  4N9I A;  5C8C A;  4IGP A;  1VBD 3;  1VJ2 A;  4KGQ A;  2RR1 1;  3MPB A;  3VZM A;  1H8T A;  3B9C A;  1SG3 A;  4WZC A;  2HWE 2;  1V6N A;  5APA A;  3I2I A;  1LOC A;  2OW4 A;  4R9D A;  3BUC A;  1ACC A;  1UX6 A;  1GQG A;  5G04 L;  3ZFF C;  1RL3 A;  3TRS B;  4QKB A;  4GWM A;  1RUI 3;  4LO5 B;  3J26 N;  3WEZ A;  1QJZ A;  2G9G A;  3FFQ A;  4MO3 M;  4QKF A;  3THT A;  4Y1Z A;  3U0Z A;  1GP6 A;  1QY4 A;  4CDW C;  4QD2 A;  2IXI A;  1VBC 3;  1W6M A;  2Q5T A;  3O1U A;  4FPY A;  2ORZ A;  3HNB M;  3OPT A;  4QPI A;  3UV9 A;  2QQP A;  1TQ5 A;  2WNU A;  1Z78 A;  2JKX A;  4U36 A;  3WNL A;  5J37 A;  4IE4 A;  1DFQ A;  4J1W A;  2XVG A;  4YM0 A;  1N1T A;  5GZE A;  3UGG A;  2XDV A;  3SKV A;  3WF4 A;  1EPW A;  2WUH A;  2GZW A;  3HBK A;  3DGT A;  1PX3 A;  4GMP 0;  4LE3 A;  2TEP A;  3ZYJ B;  3DYO A;  3WLU A;  2VE1 A;  3CZU A;  4FT8 A;  1UMH A;  2LRP A;  3AM2 A;  2PA7 A;  2XJT A;  3QOP A;  2JDU A;  5EFU A;  5FPX A;  3USU A;  4FPJ A;  3CLP A;  1ZA4 A;  2W52 A;  2XBO 1;  3FL7 A;  1RUE 1;  4DOU A;  3ZN4 A;  3O1S A;  3VBS B;  4CP1 A;  3ZR5 A;  3L2Y A;  5DN2 A;  3FUO A;  4U2A A;  4COW A;  1G9D A;  2Y6F A;  1TNR A;  3KHB A;  4AVA A;  3KCC A;  2JKB A;  2B5H A;  4AVS A;  4PIY A;  5GJ6 A;  4YM3 A;  5FUN A;  2NMO A;  2H0B A;  1AJK A;  2WSU A;  2VY0 A;  1TG7 A;  2YUE A;  3ORJ A;  4Z92 B;  3LIH A;  2RMU 2;  3B02 A;  2JG9 B;  5I0R A;  2WKK A;  2RDQ A;  1LOE A;  3LZZ A;  4IE7 A;  4XXA A;  2B39 A;  2YFU A;  5CVR A;  5FPZ A;  1HB2 A;  2O8O A;  2ZGM A;  2A6X A;  4LHK A;  2Y60 A;  4CCN A;  3WW1 A;  4L2N A;  1BCX A;  2N7G A;  2K2S A;  2VJX A;  4NHK A;  1RJ8 A;  4PBO A;  3J8F 2;  1GUI A;  3KT7 A;  2NYY A;  3FZ3 A;  1H2M A;  4UFI A;  1T6G C;  1AHS A;  1WWY A;  2CSG A;  2P3K A;  4ZS2 A;  2C24 A;  2ARA A;  5FY4 A;  4Y26 A;  2XUM A;  1XB9 A;  1CD3 G;  5B4X A;  3GDB A;  3SHR A;  2FHR A;  2FDJ A;  1COV 1;  1G6N A;  4O61 A;  1NCQ A;  3J7L A;  2VOW A;  4YVS B;  1MZ6 A;  2J1R A;  4LLO A;  4QPG C;  3U4X A;  5I91 A;  1AR6 1;  2WA3 A;  4CEW B;  1RUF 1;  2D7F A;  4QX8 A;  1OI6 A;  4CP9 A;  2WS9 2;  3LEM A;  1UY3 A;  1A8M A;  1EAH 1;  1QH6 A;  5JXJ A;  1W6N B;  4UOJ A;  5EIY B;  1XND A;  2UYA A;  4BQ4 A;  4KWU A;  4KWL A;  1OOP B;  4Y5T A;  4BE3 A;  1RUN A;  1JZ6 A;  2EIB A;  2ZS6 B;  3BB6 A;  4XF0 A;  1C3H A;  3TWI A;  3RZH A;  5A7Q A;  5FWE A;  2W9X A;  5FPV A;  1AR6 2;  3ZXD A;  1AF9 A;  3ZFF B;  4DNY A;  1HV0 A;  1OKQ A;  1OBN A;  2ETE A;  3CHX A;  3H3U A;  3B93 A;  1H2K A;  2VZS A;  4NVP A;  2D6N A;  3PVN A;  2GAU A;  1ULC A;  5FFO C;  1VMJ A;  5FZC A;  1UZZ A;  1DYP A;  1O4Z A;  4CDW B;  4EN0 A;  1YJL A;  3MO4 A;  3O1M A;  4CEY B;  4P5Y A;  4Q4Y 1;  2DVA A;  3BN6 A;  1W2A X;  3KF5 A;  4CUC A;  4WM8 C;  3VZJ A;  4E4Z A;  2Q1Z B;  1IKQ A;  4LKS A;  4LIV A;  4CU9 A;  1PZ8 A;  1QKQ A;  1F5F A;  2RMU 3;  3VBH A;  1IS5 A;  3EBR A;  1NXD 1;  2BNO A;  3LOI A;  3VKL A;  4XAE A;  1AR6 3;  4YZ5 A;  3IM0 A;  2JIC A;  1V9U 1;  5F3G A;  4UWD A;  1KJR A;  3RSJ A;  1KIT A;  4K21 A;  1HQN A;  2I74 A;  2GND A;  4OI2 A;  4QM8 A;  1JZ3 A;  4ES8 A;  4Q0V A;  4PDW C;  1RHI 1;  4JVA A;  3MFA A;  1PVC 3;  2VCC A;  4OCT A;  4UBH A;  4AHY A;  3N9P A;  4R4Z A;  2UYB A;  4CUA A;  2VR4 A;  5EQU A;  5FYS A;  3OD4 A;  4KG8 A;  3HMY A;  5FJK A;  3HEI A;  3N9N A;  3W58 A;  2MNG A;  2R32 A;  2YDE A;  4FQZ A;  4ZXK A;  4AG4 A;  2JG9 C;  3E1F 1;  4AI9 A;  1GWK A;  2R1B A;  1HRI 2;  4DY5 A;  5F3C A;  2XHN A;  1QJX 3;  1H1M A;  2EF6 A;  3CO2 A;  4M3C B;  3KLS A;  5T55 A;  1CQ9 A;  1AL2 3;  1OF3 A;  4MXV A;  4Z8B A;  1TVG A;  1UPS A;  2R06 2;  2J22 A;  3MEP A;  5EWS A;  3JXS A;  1G8W A;  5F3E A;  3AMQ A;  4LHN A;  5EXO A;  4YSF A;  5C4W C;  5J48 A;  1W28 A;  4FOY A;  3FLT A;  4GH4 B;  3IPV A;  5L9B A;  1DQ1 A;  3APB A;  5DQ0 A;  1WMF A;  3ZN6 A;  4F3J A;  1W8T A;  5T5J A;  3LD8 A;  2ZEY A;  3VBU B;  3KV4 A;  4OHZ A;  4HOO A;  5IFT A;  2B8M A;  5CFD A;  1PVC 2;  4ZZ8 A;  4XZU G;  1RMU 3;  3SH4 A;  1UKG A;  4OUM A;  3WNP A;  2E32 A;  1STM A;  3LKJ A;  4XCA A;  3N9M A;  4CEW C;  5FZ0 A;  1RUG 3;  4Q1R A;  4BMB A;  5JZG A;  4FOV A;  4FFI A;  4ISR A;  1Q56 A;  1MVE A;  1R1Z A;  4YNI A;  4YVW C;  2RS1 3;  3KWV A;  4QHO A;  3A23 A;  1I5Z A;  4LMF A;  1KRI A;  4FP3 A;  1CAU B;  1S0G A;  3HN3 A;  1BBT 3;  4JGY A;  4OHW A;  4AXO A;  2VZO A;  4XTM A;  2R04 2;  1HRV 3;  5CA6 A;  1JXN A;  4AVV A;  1N47 A;  3D0S A;  4C90 A;  5AFB A;  2VMH A;  5A7N A;  5KXD A;  2WWS A;  1AYM 3;  2BGC A;  1ZBE 3;  2JXA A;  2A75 A;  3SQO A;  3RJR A;  2ORX A;  4S2H A;  3V0B B;  4JAA A;  3S0M A;  1FMD 2;  2DF7 A;  3ABZ A;  4FPF A;  3OEA A;  1OF4 A;  5FMB A;  1ODN A;  5BV6 A;  4NN0 A;  4P9X A;  1HXS 1;  5FYB A;  3KV5 A;  2RS3 2;  5SV8 A;  2CWM A;  2R6Q A;  3MW2 A;  3RZZ A;  1BJQ A;  1OQE A;  1Y9G A;  2WA4 A;  4JGZ A;  5E8A A;  1CAW B;  2IFR A;  1S1A A;  2GNT A;  1D0G A;  3NNG A;  4Q4W 1;  4RR3 C;  4XJA A;  5FZF A;  3ZYI B;  3UT0 A;  4AI0 A;  2HLE A;  1RXF A;  3J9S A;  1RGS A;  1WLW A;  4N8M A;  1I3H A;  5KC5 A;  2JDK A;  4E2S A;  3POW A;  4NPM A;  5FUI A;  2XXZ A;  1VRH 1;  3AMN A;  3IZO A;  1OKO A;  2Y26 A;  2A7A A;  1WW6 A;  1PGW 2;  2YV8 A;  2DTW A;  1BQP A;  4FPH A;  1BEV 3;  4YYO A;  2P5B A;  4QGL A;  2Y6K A;  1U12 A;  1PM4 A;  5DXD A;  1WCD J;  3LOB A;  1DGR N;  1RUH 2;  4QX5 A;  1FPN 3;  4XUT A;  4PDW B;  3ECQ A;  3NV4 A;  1K42 A;  3LPF A;  1ZRF A;  1JW6 A;  1RUC 1;  3I2G A;  1OOP A;  2D6K A;  4W6W A;  1JU4 A;  1N3O A;  3S6P A;  1F8V A;  1HXS 3;  2ZAB A;  4CU8 A;  3M3O A;  5LY2 A;  4YFZ A;  4YG3 A;  1C57 A;  4OMC A;  1NT0 A;  5FWJ A;  3WG2 A;  2B42 B;  2IXK A;  3AP9 A;  3GCW A;  2VM9 A;  2K0G A;  2Q8E A;  4P00 B;  2VNR A;  4L11 A;  4EQV A;  3BAL A;  1QOO A;  1IKP A;  4E4H A;  4CP0 A;  1ZBA 1;  2Z4F A;  2RS5 1;  3ES1 A;  1GOH A;  4IXL A;  4XBQ A;  5CU1 A;  1UN1 A;  4RGK A;  3VBF B;  5K9Y A;  4IES A;  4IEZ A;  3T1L A;  4Q1P A;  1PO2 2;  4D8M A;  4AQS A;  3M3E A;  2VUC A;  1CON A;  2BFU S;  4LO6 B;  4MSV A;  4N53 C;  4XEZ A;  5D8A C;  2L9L A;  2YBS A;  4CXX A;  3GZU C;  3TN9 3;  3I59 A;  3VN4 A;  5B2G B;  5F8P A;  3WDW A;  1AYM 2;  2PAK A;  1PZ7 A;  3ZYR A;  2V4V A;  2QZ2 A;  2VC9 A;  5BUV A;  3AVS A;  5C3P A;  5JPM B;  1CJD A;  4NPL A;  1PVC 1;  3EXU A;  5FYT A;  1SQ4 A;  3ATG A;  5DDJ 3;  2BEO A;  1EUU A;  2XJR A;  4M4P A;  4GAL A;  1VMH A;  4QB2 A;  4FI9 A;  5K4L A;  1N3P A;  3ZFE B;  2LM3 A;  2DUQ A;  2PEL A;  2X8K A;  4JRL A;  4H7M A;  4QX3 A;  1HDK A;  5EHD A;  2BZD A;  3ZLI A;  3AC0 A;  4XDQ A;  3ZO0 B;  3E5X A;  3N9O A;  2Q1M A;  5FRA A;  3SIS A;  1B09 A;  5K7P A;  1CR7 A;  1ND3 A;  4CXY A;  4DEV A;  2XKP A;  3PDQ A;  5DG1 A;  2R1D A;  2YBK A;  5TSW A;  3T09 A;  4F7Z A;  2W39 A;  1L3J A;  1QJU 1;  3EB7 A;  4MZU A;  2CHH A;  4BWO A;  1JOJ A;  3VZO A;  5LY1 A;  3C7O A;  1ZRR A;  2FDK A;  1O4T A;  2H6B A;  3MI8 A;  1AVB A;  2QBX A;  4XBN A;  1CJP A;  3H0O A;  3ILR A;  4FQ4 A;  1DQ2 A;  3MF6 A;  1FT9 A;  4PQQ A;  2OII A;  1Y43 B;  1Q43 A;  1VE0 A;  3FBY A;  1S0F A;  1YXW A;  2ZTN A;  2KM2 A;  1DLL A;  4JCK A;  5BNN B;  1SBF A;  1OUR A;  2XLF A;  3B5L B;  1HV1 A;  3IWZ A;  3KF3 A;  4OVE A;  4UF0 B;  4UFM A;  1YFX A;  3A4U A;  3VL9 A;  4A44 A;  3H8X A;  4FTS A;  5CKN A;  4WBB A;  4DRR A;  1RTV A;  1GZ9 A;  3AYD A;  4A6S A;  1RUJ 2;  2DCZ A;  2P6H A;  2Y6J A;  3KV9 A;  3J7H A;  3MHZ A;  2HWF 3;  2BJS A;  2VZP A;  3OPW A;  2W5F A;  3EMR A;  3OF1 A;  1W39 A;  5BNP A;  3CDZ B;  5A33 B;  2WZP P;  3DPR C;  1KFU L;  3KQR A;  5J96 B;  4MGI E;  4CDX B;  1RUC 3;  3OBZ A;  2BVB A;  3SEP A;  5IVB A;  1US3 A;  4XC9 A;  3TN9 2;  3VB9 A;  4OI0 A;  5F5C A;  5FZL A;  4WZF A;  5LBB A;  3AXE A;  5BNP B;  2JDN A;  1W99 A;  3W9A A;  3JB4 C;  4B1M A;  4K6B A;  4CZS A;  3S57 A;  2GU9 A;  5IVJ A;  3AFK A;  3HQX A;  1KS4 A;  1CAU A;  2F4L A;  1E5S A;  2YMZ A;  4XJ8 A;  5CNA A;  3OD0 A;  5FZ4 A;  2RJK A;  3FUQ A;  3KV6 A;  1E57 A;  3D8C A;  5T5L A;  4DMI A;  1ND2 C;  3NV2 A;  3JQW A;  2WO1 A;  2P6C A;  1W9F A;  1DZR A;  2AEN A;  2ZJC A;  4EZ4 A;  2PHF A;  4CEY A;  1FYU A;  4I02 A;  3VBO C;  2RDR A;  4K3U A;  2C26 A;  3I54 A;  4HN1 A;  5F3I A;  3MUZ 1;  3S7E A;  1JN2 P;  2W95 A;  2XBO 2;  3K51 A;  3OGG A;  3U78 A;  3N9Q A;  4N53 B;  5D8A B;  4ZXE A;  3RZK A;  4QKN A;  1DYK A;  2VVD A;  4OLL A;  2Q0A A;  2HEY F;  1PGS A;  4C91 A;  2VME A;  1LB2 A;  1NY7 1;  1OA3 A;  4CCJ A;  5C8W A;  2WZ8 A;  1H8V A;  4IGQ A;  4L9B A;  2DVD A;  5CAZ A;  4AF9 A;  2JE8 A;  1D4M 2;  3NRU A;  1OFS A;  4Q4V 1;  2VO5 A;  3CBN A;  1XE7 A;  3RVH A;  2VVE A;  5IVV A;  4KWJ A;  4IEQ A;  3WQ7 A;  3PVB B;  3ZKY A;  2K9Z A;  2AEY A;  2OXB A;  1VBC 2;  1AL2 1;  1V70 A;  4UW5 A;  5GKA C;  3ZOI A;  3BYW A;  3P5B A;  4L92 A;  1RUO A;  1GZW A;  1OUX A;  5DAP A;  1D0H A;  1EAH 2;  2JG8 C;  2CWS A;  2VXJ A;  4LUM A;  4KMQ A;  1YYN A;  3LPG A;  3V56 A;  1SHW B;  3VDD A;  4BME A;  1S0I A;  2VTX A;  4BCU A;  4BIO A;  3T0B A;  5FLI A;  1N1Y A;  1HLC A;  3T1M A;  2VAU A;  1XNA A;  5FPB A;  1OUS A;  1BHG A;  1E5H A;  2VG9 A;  3G7D A;  4MXW A;  2PHU A;  2VMD A;  5A32 B;  1G7Y A;  3WP4 A;  3CNA A;  5DMY A;  2KD7 A;  1SLA A;  4JC1 A;  3WW3 A;  4XF4 A;  3MLJ A;  5A3U A;  3ZSK A;  1UU6 A;  2VUA A;  4NRP A;  3TOJ A;  3I59 B;  1TME 1;  4I2O A;  4LT5 A;  4LQR A;  5DAX A;  3VBU C;  5IK8 A;  5A7P A;  4G3Y C;  5E6H A;  5A32 A;  1HIX A;  2VZU A;  3KT4 A;  4NRQ A;  3B01 A;  1QDC A;  1OD5 A;  2B9V A;  4UW4 A;  1OLR A;  1RUH 3;  3VBO A;  2X09 A;  4H2A A;  1W0N A;  3VDD B;  4OHV A;  2LRO A;  4L97 A;  1R1A 3;  3EO6 A;  4AW7 A;  4A7K A;  3AFG A;  3OUJ A;  4IER A;  4QGM A;  3ZPO A;  1ND2 A;  2Z69 A;  1W9Y A;  2AUY A;  3GZE A;  2Y64 A;  3VKN A;  4KH9 A;  1AR8 1;  2VMG A;  2IC1 A;  3KCX A;  2PLV 2;  4JDN A;  4BIS A;  5JOW A;  5FOJ B;  4LO8 A;  2KR2 A;  3AYE A;  4AQT A;  2OX0 A;  3TBD A;  3I2F A;  3VBS A;  1MPX A;  1QQP 3;  1V6L A;  1JMU B;  3GCX A;  3M3I A;  3UGH A;  5JR2 A;  1C28 A;  5FMO S;  3OBA A;  3CJI C;  2HWB 2;  4QQL A;  3O1P A;  2NLR A;  2EVX A;  1HJF A;  2P37 A;  3KD4 A;  5E88 A;  1COV 2;  4IW3 A;  3DPR A;  4Q4W 2;  5A3W A;  1ULE A;  2P3J A;  4P5H A;  1CIY A;  1CGP A;  5FYZ A;  1KJL A;  5BNP C;  3O1R A;  4MV2 A;  2HH9 A;  1PO1 2;  4OUS A;  1WCS A;  2PHW A;  4FXG B;  1C4R A;  4XUQ A;  1RHI 2;  1OT5 A;  3PUA A;  1YI9 A;  4ZZ5 A;  2KXL A;  1HXS 2;  5JR7 B;  1FV2 A;  2C9A A;  3IAQ A;  1MR5 A;  1XNC A;  4LO7 A;  2EIE A;  2HEV F;  5C7G A;  1WLT A;  4QPI B;  4S2G A;  5DDJ 2;  2XJV A;  5EZW A;  3PJQ A;  3OEB A;  4LPL A;  1S55 A;  4HKW A;  2OPW A;  3LA3 A;  4K7J A;  2A3X A;  1VRB A;  5FYI A;  2W1S A;  2BFU L;  2XJU A;  3HR9 A;  4IE6 A;  5L19 A;  4E4S A;  1SLC A;  1H1I A;  4IND A;  1MS8 A;  1QXP A;  4DZG A;  5IK5 A;  1UX7 A;  1DBN A;  3KMH A;  1WCU A;  5ACA 2;  3C7E A;  2QQJ A;  4M00 A;  4A45 A;  5CFC B;  2HWE 3;  5IAV A;  3WP3 A;  4BDV B;  3POB A;  2BNN A;  4P02 B;  4BA6 A;  1UZY A;  1Q8Q A;  4IEO A;  5A33 A;  2DUR A;  4AAP A;  1EV1 1;  1R08 3;  2UWC A;  3ZYH A;  2W47 A;  4N43 C;  2ZHN A;  5H9Q A;  4AFD A;  2WQZ C;  1ND3 C;  4RHV 3;  4Z2A A;  5F5I A;  5A6Q A;  4XF3 A;  4XVH A;  3HT1 A;  4ZS3 A;  1WW7 A;  4FPO B;  1W3V A;  3HQR A;  3AL6 A;  1Z7S 3;  2WO2 A;  2UWA A;  2CGN A;  3LB9 A;  2QJV A;  1IS4 A;  3UK9 A;  4E9K A;  1GZC A;  5BNN A;  1SPP B;  3PUI A;  3DN7 A;  5JZG B;  1GWM A;  5A70 A;  1C8M 3;  5LA2 A;  4N7U A;  3WR0 A;  5LB6 A;  2CAV A;  2WFF 3;  2WBK A;  1ULF A;  1TME 3;  4RL7 A;  1ZBA 2;  2ZMK A;  1XE0 A;  3I2O A;  2YRO A;  3I3Q A;  3DEM A;  1VBE 3;  1UO9 A;  3NKG A;  4MET A;  2G4I A;  3AZY A;  1WLC A;  3HOB A;  4MGY E;  3POS A;  5FZI A;  4NMI A;  5A3O A;  5LW9 A;  5C5T A;  1EYB A;  1UW8 A;  5FY7 A;  1RJ7 A;  1DQ5 A;  3WNN A;  2BTV C;  5AFE A;  3HNM A;  4EN9 B;  5L7O B;  3O1O A;  5FZD A;  1W04 A;  1JYN A;  3OBR A;  3ZSJ A;  3C7G A;  1NLS A;  4UW6 A;  1VBB 1;  2RDN A;  2W1W A;  1OSG A;  2YC4 A;  3AB0 A;  3VBR B;  3WF1 A;  4DUV A;  2Y6L A;  5M0T A;  1VPH A;  4M3C A;  5CAD A;  4C8D A;  1RMU 2;  1UYX A;  2W0X A;  3SLI A;  4QX7 A;  1AX1 A;  2G1M A;  3R4U A;  3URF A;  3FE5 A;  1UZV A;  2XL7 A;  5FZ8 A;  3UL2 A;  3AMH A;  3ZFE A;  3CMG A;  4QDR A;  5I8T A;  1H9P A;  4LBJ A;  3JB8 A;  1PIV 1;  2ZX1 A;  1ZBA 3;  4X6R B;  4BM8 A;  1H6X A;  2AC1 A;  3MIH A;  1GBG A;  2YU1 A;  4LBM A;  3HAG A;  3SIT A;  3CJI B;  2BYV E;  2E7T A;  2EXK A;  4XUP A;  5E1R A;  4RSU A;  4ORF A;  3GBF A;  1PO1 3;  4AAX A;  3A0N A;  3C7H A;  2E7Q A;  1AR8 3;  4DPN A;  3IDE A;  4TWT A;  5C8C B;  2B45 X;  3VBF A;  2Y38 A;  1FXZ A;  4CCD A;  1UOB A;  4IEP A;  2NQY A;  4XHX A;  1FPN 1;  2ZZJ A;  4CCE A;  1LCL A;  1R1A 1;  1DDL A;  1R08 2;  2J7M A;  2WNV A;  3NL1 A;  3PNA A;  1N3Q A;  2DVF A;  4DXZ A;  4DXR A;  2XWJ B;  1JZ2 A;  4PHZ A;  2GC0 A;  4RR3 A;  4ERO A;  4B3N A;  4CCC A;  2WR9 A;  2NM1 A;  4JGZ C;  4M01 A;  3AP6 A;  3SCF A;  1PK6 B;  4MGQ A;  2JJ6 A;  3HNY M;  5FMC A;  3IDC B;  3FLP A;  3MV1 1;  1LOB A;  2Z5W A;  4LOT A;  3WZ1 A;  4AFM A;  4AQ6 A;  1YWK A;  4COY A;  3NJY A;  4EN8 B;  3OGV A;  1FAY A;  5I0S A;  4NAO A;  1YHF A;  5C3S A;  1LEN A;  1ZM1 A;  4KBZ A;  4IEW A;  2XKO A;  2YBP A;  4LO4 B;  4YG0 A;  4CDX C;  1PHM A;  3MUY 1;  3OY8 B;  5KHG A;  1ZNP A;  3K2O A;  4XJW A;  3KCY A;  3UJQ A;  1XBF A;  4R9B A;  1YQ2 A;  2ARX A;  1JI6 A;  1S2E A;  2UY8 A;  1BLZ A;  2XQR A;  1Z0H A;  1REE A;  3BVC A;  2GN7 A;  3ON7 A;  4GIQ A;  4X8P A;  2X05 A;  4ARX A;  2RS3 3;  1ULO A;  3HBZ A;  4YAR A;  2EXI A;  2DU0 A;  4AVB A;  4IV3 C;  5JOZ A;  2HYK A;  1HB3 A;  3F2Z A;  4JGY C;  3VZK A;  2EXH A;  3AL5 A;  1V9U 3;  2OUJ A;  3WHT A;  3WNO A;  1ZRD A;  4YVW A;  3WNK A;  3N9L A;  3FJS A;  1CAV B;  4AZZ A;  2VUD A;  1XYO A;  1GOF A;  2ZKL A;  5JZG C;  3E6D A;  3Q8F A;  1WW5 A;  1G9A A;  1Y7B A;  1HRV 1;  1NCQ B;  4WV8 A;  4YVS A;  5A6Z A;  1NLR A;  1IPS A;  1Y9M A;  3VBO B;  1OMI A;  5KR7 A;  4FSJ A;  2ADE A;  1BBT 1;  3POY A;  3T4H B;  5CFD C;  3MFC A;  1RYY A;  2D3P A;  4COV A;  3I2H A;  4B7E A;  4AYU A;  4Y4Y A;  4CTE A;  4IQP A;  1GKB A;  3RMY A;  2CGO A;  3WDY A;  1CPN A;  2O14 A;  5IK4 A;  2WN3 A;  3ROU A;  3T08 A;  1AXZ A;  2P4E A;  4CXW A;  1UMI A;  1BK0 A;  5BNO C;  1KGY A;  4LKD A;  2X53 S;  2XR4 A;  3R0R A;  4HMZ A;  5HCF A;  4UT5 A;  1U5Z A;  1X9P A;  1W8O A;  4NWW A;  1NE4 A;  2YGM A;  5DAQ A;  3ZR6 A;  1REF A;  4I30 A;  2Q1F A;  4NHL A;  5EPA A;  4RFT 0;  1W9W A;  1VAL A;  4GKY A;  3UKV A;  5HXM A;  1XU2 A;  4Z82 A;  4CUB A;  2PHL A;  1EUT A;  3NAP A;  4IV1 A;  5F2S A;  4UFK A;  5FDB A;  1NZC A;  2OUH A;  4YZ2 A;  4P9W A;  1DQ4 A;  2B7Y A;  3H8O A;  1PO2 1;  1S2B A;  2LS6 A;  1H4G A;  2ZMN A;  4YFW A;  3AX4 A;  3M3Q A;  2XVK A;  4QB6 A;  1LNS A;  2VTX J;  2C0Z A;  2XH6 A;  5FPA A;  2ET7 A;  1OLQ A;  1WA6 X;  4Q4Y 3;  4A3X A;  1Y4W A;  1SBE A;  2XHK A;  3WQ0 A;  4BK4 A;  1XRU A;  3MIE A;  4DFS A;  4OQ8 A;  1SCS A;  1XSQ A;  2GH8 A;  5FP8 A;  3RYR A;  3MIC A;  5FQ0 A;  2VPV A;  4KI5 M;  3RS6 A;  4PF1 A;  5IAT A;  1GZT A;  1XU1 A;  2I07 B;  2WNU B;  3VV1 A;  5JPN B;  3K3N A;  3ENR A;  1D7P M;  2B4K A;  3SC7 X;  1CAW A;  4YLZ A;  3TNQ A;  3IMN A;  2DVG A;  5DZG A;  1WW4 A;  3A22 A;  3ITQ A;  4IEU A;  4NRM A;  5FY0 A;  3CL1 A;  3U75 A;  1O3S A;  5E16 A;  4AI8 A;  3TN9 1;  2VMC A;  1JZ7 A;  2LUW A;  5L9V A;  1QEX A;  3LAG A;  5FO7 B;  5FUP A;  1RUF 2;  1DYO A;  1GMM A;  1U5I A;  2OQ6 A;  2YZ4 A;  3JD7 2;  4RA0 A;  1J3R A;  4LHS A;  2ZHL A;  2D97 A;  5FP7 A;  1HKD A;  3RYK A;  1VRH 3;  1J3P A;  3J7M A;  3PMS A;  3ELN A;  1V00 A;  5ABJ C;  4I01 A;  3IN9 A;  1UZW A;  4XMI A;  1MZF A;  4YGC A;  3TAY A;  5IVC A;  1RUH 1;  5KBF A;  1MAC A;  2GP5 A;  3LDB A;  4EV0 A;  1PM7 A;  4AFC A;  1WCK A;  4GAZ A;  3AMM A;  4RHV 2;  3V65 A;  1RUJ 1;  3GF6 A;  1L7L A;  1WMD A;  4XBL A;  2Z42 A;  2VQT A;  3O1V A;  1R09 3;  2ZCW A;  1VIW B;  2GNM A;  4W6X A;  2C4X A;  2WL1 A;  3ZXL A;  1E5R A;  3ZYB A;  3RWK X;  1VB2 A;  2JB8 A;  2DTY A;  3OPZ A;  4MHR A;  1YUD A;  5K0U B;  3VDB A;  3WD5 A;  5FXZ A;  5F7U A;  2RVA A;  1EV1 2;  3KS7 A;  2VOT A;  2ILM A;  2RDS A;  5JMC A;  5DUW A;  3EHK A;  3CIH A;  2VCA A;  2DCJ A;  1UOG A;  5FP4 A;  3I3D A;  3I3M A;  1X8M A;  1RIT A;  4PCR A;  1SBD A;  4PI0 A;  5BNO B;  1FOD 1;  1HW5 A;  4UAP A;  4G4F A;  1C5I A;  1QWR A;  2Y6H A;  4JZR A;  1GLH A;  2HBU A;  4NJ4 A;  2R0H A;  3O14 A;  4A41 A;  5JXH A;  1X82 A;  1K12 A;  4CVU A;  1UOJ A;  3QLQ A;  4W4Z A;  4JTO A;  1POV 1;  5A6Y A;  1ENX A;  5F6L B;  1XYP A;  4NPR A;  1W03 A;  1POV 3;  5CIR A;  1W6Q A;  4GB3 2;  3WT3 A;  4DXS A;  1H6Y A;  4AI2 A;  4BH9 A;  5LCW L;  1NX9 A;  5FZ6 A;  4OMD A;  2VQ0 A;  2VZ1 A;  4NWV A;  1SPP A;  3CEW A;  4LBQ D;  2QQN A;  4JKM A;  2O8Q A;  3IBM A;  4RQP B;  4GMP 3;  1NE6 A;  1DZT A;  4Z1V A;  2HJI A;  3ZXF A;  4NE9 A;  2WLP A;  3BTZ A;  1XSR A;  4HSJ A;  5FZ7 A;  3PHM A;  3UET A;  1RB8 G;  5FY9 A;  2ZHM A;  4A7Z A;  1F31 A;  4HZF A;  1PMJ X;  1RUE 3;  1YFU A;  3KZ4 C;  2E53 A;  1AR8 2;  4GQ7 A;  3LIG A;  2W92 A;  2WRA A;  5FCC A;  3T4V A;  3IT8 A;  2IZW A;  2QUO A;  1URX A;  2GMP A;  1GSL A;  4UW3 A;  1LEM A;  4OZO A;  1VLN A;  2QVS B;  3SMH A;  3V64 A;  3VDC A;  3WHU A;  1WGP A;  3B3Q E;  3NV1 A;  2C9K A;  2RR1 3;  3UGF A;  4H7L A;  4CDW A;  1LU2 A;  1XPW A;  2RM2 3;  1WUV A;  4XJ9 A;  4Y4R A;  1VBD 1;  3K75 B;  1W2U A;  3MZH A;  1W8N A;  4HVQ A;  1TEI A;  2Y0O A;  3ACH A;  1ZZ8 A;  4HKO A;  3DYM A;  3GHN A;  1ST8 A;  3UES A;  3VD7 A;  2NMN A;  1PIV 2;  3ETP A;  1JZ5 A;  2UU8 A;  5A3T A;  5A7O A;  5KHI A;  5ACA 1;  1O3T A;  4GMP 1;  2D6P A;  3U14 A;  1WLD A;  5A1A A;  1D2Q A;  2ZGQ A;  4JQR A;  3ES4 A;  1H0B A;  5C8C C;  4O9E A;  4ZU5 A;  3TYJ A;  2R06 3;  1SLB A;  3NST A;  3C3V A;  1YCI A;  4D6S A;  5ABJ A;  4LTA A;  1GQH A;  3GBW A;  4CCM A;  4ZU7 A;  4YRD A;  3OCP A;  5LK5 A;  3PUH A;  2PAE A;  1R09 1;  5F39 A;  3EJK A;  2J1V A;  2BWA A;  1Y9Q A;  1ZVF A;  2VZT A;  4Q0U A;  1DCS A;  4JGZ B;  1VAK A;  1RXG A;  3VGI A;  1PK6 C;  3VZL A;  3V0A A;  5F6K A;  4IEX A;  4LUL A;  1C8M 2;  1I9R A;  3ILF A;  2FCT A;  1UU5 A;  4GWJ A;  5A3P A;  1GOG A;  2E6V A;  1U5X A;  4AEK A;  2ERF A;  1IQA A;  4FOQ A;  4KWK A;  4YWA A;  4XIK A;  5HBA A;  1KEX A;  4D94 A;  3JQX A;  4EE2 A;  3U37 A;  1YNA A;  1LEC A;  2PYT A;  3M7A A;  1OA4 A;  4M4R A;  5H9R A;  3WIN E;  1K3I A;  2VZQ A;  4B4Q A;  1JS9 A;  4DY3 A;  5IW0 A;  3ME2 A;  3FN9 A;  3VLB B;  4IET A;  4A4A A;  2YC2 A;  1W8Z A;  3HIF A;  4YW5 A;  4E27 A;  1LR5 A;  4UFL A;  3BU0 A;  4LA2 A;  5C4W B;  5FY8 A;  4CA9 A;  4W50 A;  1BK1 A;  1G9B A;  1HQW A;  3NQH A;  2X29 A;  1FMD 3;  1OHF A;  2NZ9 A;  4SLI A;  2FD8 A;  1O7F A;  1D4M 3;  4DB5 A;  1QJF A;  1V6K A;  1XJA A;  1ZX5 A;  3POE A;  5EYY A;  4DXT A;  4R9A A;  1JH5 A;  2WS9 3;  1O8P A;  1NA1 A;  5FO8 B;  5FYY A;  2PMW B;  4MLO A;  5CFD B;  5AVP A;  1ENQ A;  3ZYF A;  2R04 3;  5IK7 A;  4B4R A;  2EIC A;  2WFF 1;  1A3K A;  2YPD A;  1GR3 A;  1SEF A;  3AP7 A;  3MLL A;  3NNF A;  4HLT A;  4IV1 C;  3IPV B;  4WVZ A;  5HCB A;  3NAP C;  2BBV A;  1NXM A;  2RMU 1;  3RZG A;  4JDO A;  3WUC A;  3W5M A;  1J1T A;  1V6M A;  4XET A;  1Z7S 1;  3C8X A;  2QDN A;  4JHZ A;  1KDM A;  4LBQ A;  1AJO A;  2IXL A;  4XFB A;  5FK8 A;  1QNW A;  3J8F 3;  3N7L A;  2ENR A;  3I4I A;  4W6Y A;  4AI3 A;  5IHR A;  4MGT A;  1OQ1 A;  5BNO A;  5I93 A;  3WG1 A;  1LED A;  1JOD A;  2UWB A;  4JV4 A;  1W6M B;  4XMA A;  1UQX A;  3WX5 A;  3H8R A;  3UNP A;  2QQW A;  2A3Y A;  2VD7 A;  4XDP A;  4UBG A;  3ZIW A;  1ULP A;  3WSO A;  1UCX A;  4ISQ A;  2LW8 A;  5JWP A;  4C0B A;  3WDV A;  4YVS C;  4AWD A;  3VDA A;  4QPG B;  1X7N A;  2IXJ A;  2WWJ A;  4RR3 B;  4WVW A;  2VUL A;  3USS A;  1NQJ A;  4HK9 A;  4BK5 A;  1LUL A;  1QJY 1;  1SMV A;  3M70 A;  4QPY A;  4DO0 A;  4QHB A;  3AK0 A;  5C6C A;  4IV3 A;  5JIU A;  4YM1 A;  5IYY A;  3IB3 A;  4XIL A;  3H3Z A;  1BZW A;  4M3C F;  1ZZC A;  3SKJ E;  4I09 A;  2WZR 1;  3NMB A;  5FYU A;  1UMZ A;  2BOJ A;  5FMD A;  3N3H A;  3DYP A;  3K4D A;  5EYX A;  4CDX A;  4E8D A;  5FZG A;  2XML A;  5JOX A;  4QHZ A;  2GMM A;  2V4A A;  3P6B A;  1R09 2;  2A5Z A;  4LBK A;  1GAN A;  1W6O B;  2GME A;  4ATE A;  4XIO A;  2IUW A;  3O12 A;  4MHU A;  4A3Z A;  3N7J A;  1O5U A;  3KM5 A;  1SAC A;  2PXJ A;  1AL0 G;  3LEI A;  1Q5O A;  4AVC A;  2R30 A;  1WZX A;  5GZF A;  2WSV A;  4R52 A;  1DGW A;  1FI2 A;  4DQA A;  3PME A;  1XYN A;  2HKX A;  4NAM A;  2DUO A;  4KGG A;  3T2T A;  5EJZ B;  3L2H A;  2WNV C;  2X5I B;  3I7D A;  2RJL A;  3VBR A;  4OI1 A;  3MW4 A;  4Q0S A;  1KD7 A;  4FO9 A;  4YPJ A;  3VHR A;  3VBF C;  1J84 A;  3ZIX A;  2BP6 A;  2VOK A;  4ITC A;  1MEC 2;  1V6I A;  3MDP A;  4QXB A;  1W6N A;  4OZX A;  5FLH A;  5FQ0 B;  3NNJ A;  4FTE A;  1PGL 1;  4I0A A;  5HV0 A;  3III A;  4BQY A;  2IVI B;  5T54 A;  3FHQ A;  4Y24 A;  4Q4W 3;  5K0U A;  5AVA A;  1SLI A;  1TMF 3;  1MS0 A;  2ET1 A;  5FZO A;  3S5A A;  2VBD A;  2VCM A;  3I2J A;  4K1Y A;  4B1L A;  5JI7 A;  3B69 A;  4J25 A;  5E89 A;  1JHN A;  3O1T A;  1PMH X;  4P9G A;  3LFI A;  1BKZ A;  1LAJ A;  2UUR A;  1Y3T A;  4MGK E;  5DUX A;  2ZGK A;  1M4W A;  3W21 A;  3VL8 A;  3ZFE C;  2R07 1;  3E5Q A;  1NUK A;  4IV1 B;  4XZP A;  5GM0 A;  3A7Q A;  3S7I A;  5KHK A;  3PUQ A;  2YHJ A;  1YQ6 A;  2EXJ A;  4PF5 A;  2WFP A;  5I0T A;  3DF0 A;  1DGW X;  4P9L A;  4QX1 A;  1ENS A;  5FZB A;  1SCR A;  2GC3 A;  2OVU A;  3WY6 A;  4QPW A;  5HCA A;  1MS3 A;  2VZV A;  3O0W A;  5GLT A;  1RUE 2;  4LBL A;  2Q8C A;  3ZMO A;  3RFR A;  1VBC 1;  4XDO A;  5FY5 A;  3BI3 A;  3R05 A;  3PU8 A;  4Q4V 3;  4LOR A;  3SEE A;  1VP6 A;  1FAT A;  3ST7 A;  4AK3 A;  1QH7 A;  2WYF A;  5FLJ A;  1K5M A;  1GYK A;  1NY7 2;  4CDQ A;  1J83 A;  1VBB 3;  2BU9 A;  4AI1 A;  4BPZ A;  2ZAA A;  1RMU 1;  3M3C A;  5GZG A;  2E33 A;  3AZV A;  3LGR A;  1AR7 1;  1DLC A;  1QHD A;  2AGS A;  2G9Z A;  2B46 X;  2WT0 A;  1W6Q B;  2SLI A;  4V2V A;  5LAS A;  5T5O A;  4NII A;  5BNN C;  5FZO B;  3ZYP A;  1GZW B;  3ZMN A;  5AC9 1;  4EJR A;  2VMI A;  5A1F A;  4QB1 A;  2BBA A;  5EJ1 B;  4XYX A;  5BNQ A;  1LOD A;  3X29 B;  2WII B;  4N43 A;  4A2U A;  4ONU A;  2VQU A;  2VXR A;  4Q4Y 2;  3H3L A;  4CP2 A;  1WME A;  2ZA9 A;  3OY8 A;  4HFS A;  3DPR B;  4QXH A;  2E26 A;  3NW4 A;  4L99 A;  4TYS A;  3THP A;  1YFY A;  2PQS A;  4LNV A;  1WD3 A;  1TMF 2;  2A3W A;  2VUJ A;  3OG2 A;  3NNM A;  5C9A B;  3GZT B;  4MG2 A;  2ZGR A;  3D3A A;  4HSL A;  3AZZ A;  1DF0 A;  4L0P A;  1FNZ A;  4JKK A;  1Q3E A;  4LIU A;  3VD3 A;  4YW1 A;  1W0O A;  1MS9 A;  4UFH A;  1VB4 A;  2JDY A;  5LAT A;  5FP3 A;  1OD3 A;  1P8J A;  5JIA A;  3VD4 A;  1AXK A;  2GC1 A;  1C1F A;  3I49 A;  1SZB A;  2WNV B;  4DUX A;  3JBG 2;  4HKL A;  1RUF 3;  2X5I C;  2P2K A;  2XG3 A;  1W0P A;  5GLU A;  2A6W A;  1MQT B;  3WOG A;  4Y20 A;  3PIJ A;  3BGA A;  3D5O A;  1B35 A;  4MGZ E;  1COV 3;  3D6E A;  2RV9 A;  1APN A;  1OVS A;  5T5P A;  1W05 A;  2WO3 A;  3QH6 A;  3THC A;  2VL4 A;  4AEM A;  3WF3 A;  1UNB A;  2PHX A;  4NHX A;  5GLW A;  3TNP B;  3I2D A;  3SNM A;  2ZX0 A;  1W06 A;  2V5D A;  3WW4 A;  3CJI A;  2ZBJ A;  1PO2 3;  4FAG A;  2I2S A;  5D2A A;  4MXW B;  1WCQ A;  2D44 A;  5EJ3 A;  5C70 A;  2CTV A;  2WAB A;  3RZJ A;  3VBS C;  1GNZ A;  1FOD 2;  1W6P B;  3A0K A;  4RGG A;  2XVL A;  4YZ1 A;  4YZ4 A;  4AHW A;  1W2O A;  3MID A;  3OB8 A;  1LU1 A;  4X8N A;  1IS6 A;  2WIN B;  2W1Q A;  2D3R A;  3OUH A;  2NPI A;  5FXV A;  4AED C;  3POF A;  4HN0 A;  4ASK A;  1BVP 1;  2JDZ A;  2Q4S A;  3LSD A;  3E6C C;  3WW2 A;  4IEY A;  4ES9 A;  2XLA A;  3WF2 A;  2HWC 2;  3WUD A;  1YFW A;  1MS4 A;  2W91 A;  4FOW A;  3FMG A;  2XQX A;  1YJK A;  1YI7 A;  3ACF A;  4WVM A;  1UZ0 A;  4GWI A;  3VHP A;  4LLF A;  1ODM A;  2H6C A;  4MVT A;  2E63 A;  1ULD A;  4YM2 A;  4XQW A;  4EWA A;  5B4N A;  3VBU A;  4BQ2 A;  4BYY A;  5GLV A;  2XPJ A;  4FPK A;  5LBF A;  1J58 A;  5BXX A;  2GP3 A;  3Q8A A;  3PLQ A;  2EAL A;  4QAW A;  4XPV A;  5LRR A;  2TNF A;  1W90 A;  4WVM B;  3QBQ A;  2JDM A;  2OPK A;  1UOF A;  3KGZ A;  3VDD C;  1NG0 A;  2CNA A;  3DCQ A;  4Q0P A;  4E2Q A;  2JG8 A;  4QT6 A;  4RGA A;  4NUB A;  2DUP A;  3DKQ A;  3I3E A;  4CE8 A;  1ZRI A;  2WN2 A;  3SH5 A;  3OJB A;  3ZXA C;  5FBZ A;  3NAP B;  4HBN A;  4TLG A;  1Q8O A;  4AEJ A;  4EWD A;  4Q8K A;  2YU2 A;  4PIX A;  5FXW A;  5AC9 2;  4OUL A;  5FPU A;  2R07 3;  1ULG A;  3BPZ A;  3SCG A;  1ASJ 1;  1AXY A;  5FTT C;  4K40 A;  4A7Y A;  4BXF A;  2ZAH A;  5JXG A;  4BZ4 A;  3H7J A;  4TXW A;  3HJR A;  3QD6 A;  4QDS A;  5HV4 A;  2YYO A;  4Y22 A;  3WV6 A;  4YZ3 A;  2BQP A;  3DUI A;  5JLV A;  2FZ2 A;  1GP4 A;  4LKE A;  2TBV A;  4XFI A;  1O91 A;  5GAL A;  3MYX A;  2BDR A;  2W68 A;  2UY9 A;  2P3Y A;  5F5Q A;  1TMF 1;  5FPL A;  1LRH A;  2DBI A;  4TLF A;  3RZM A;  2W2I A;  2VNV A;  1NCR B;  4Q27 A;  1OPM A;  3BOW A;  3T0A A;  3VBH B;  4Y5Z 0;  5IVF A;  4P14 A;  3U4S A;  4CEY C;  4LEJ A;  5LA9 A;  1FX5 A;  1X36 A;  3WXP A;  2ZOE B;  5FKC A;  1FOD 3;  3OSD A;  4EZH A;  4DUW A;  3NNL A;  1CZT A;  4LE4 A;  4CCO A;  2CU5 A;  1IZ3 A;  3JD7 1;  3RI8 A;  2WWU A;  3IAP A;  4Q5O A;  2RS1 1;  1UYP A;  3KGL A;  5F9T A;  3LF7 A;  1OVP A;  3WCR A;  3BU7 A;  4D69 A;  4SBV A;  1V6J A;  1VBA 1;  2MEV 1;  3ZKU A;  5LWB A;  5KHJ A;  1IG0 A;  3MLK A;  5J09 A;  2IWG B;  3HN1 A;  3VUO A;  3RQ0 A;  2WT1 A;  1XXN A;  4LUK A;  2VOV A;  2GN3 A;  1RC6 A;  1LGC A;  2F17 A;  2CV6 A;  2WAO A;  4FPG A;  4E4D X;  1ND3 B;  3LEG A;  5H9S A;  3ACG A;  3P1I A;  2A71 A;  1LGN A;  1DU3 D;  2C6S A;  1VBA 2;  3D82 A;  3MPP G;  4WM7 C;  1W8F A;  2JD9 A;  2PN5 A;  4QX2 A;  5DAV A;  1JBC A;  5FKB A;  3W20 A;  1ONA A;  1LHV A;  2QQI A;  1SFP A;  3AVR A;  3CKH A;  4JHT A;  4QGN A;  4WM8 A;  4DIQ A;  3BCW A;  4O9G A;  5CKM A;  1EAH 3;  3LDR A;  2ZGP A;  1UWW A;  4O65 A;  4QQO A;  1RUG 1;  2BW8 A;  4J6G A;  3RZL A;  2CDO A;  3LQC A;  3PIG A;  4YW6 A;  1UYZ A;  1CZS A;  1JU3 A;  1H4H A;  1UIJ A;  2BV4 A;  2QFE A;  3B9I A;  4GH4 C;  1OXC A;  4BQ3 A;  1WKY A;  1F2N A;  1L7Q A;  5BPX A;  4FXK B;  3AKT A;  3FBM A;  2DVB A;  1Q8P A;  5C3R A;  5JXI A;  2P17 A;  4RQP A;  4NIH A;  4X6Q B;  4XUO A;  1S0B A;  5JCT A;  4KU7 A;  3I8T A;  4GKX A;  2HWD 3;  1O3R A;  4LIT A;  5A3L A;  1JZ4 A;  3NKT A;  1ZRC A;  3OYW B;  5A3N A;  4RS5 A;  2OKX A;  1H2N A;  1CAV A;  3RJ2 X;  3VKO A;  5LRS A;  1M06 G;  1RED A;  3GJA A;  3LWC A;  5F1R A;  2D43 A;  4YVW B;  4BXS V;  3J8F 1;  1LKN A;  3IIA A;  4AHZ A;  1PX4 A;  2BNM A;  3O0X A;  5T3N A;  2FBE A;  3AYC A;  1CWP A;  3ZSL A;  3TEZ A;  4LJH A;  2FMD A;  2PHT A;  1AZD A;  4QXK A;  3ZXJ A;  2P3I A;  2VNG A;  2P34 A;  2HYX A;  1ASJ 2;  1HX6 A;  2OZJ A;  3LSE A;  3MIG A;  1ZZB A;  1JHJ A;  1MS5 A;  1O4Y A;  4XXP A;  4AFB A;  2D5H A;  2W08 A;  4RD7 A;  1LHW A;  2YB7 A;  3ZDS A;  1W9T A;  2SBA A;  1DGL A;  4KL1 A;  4D6R A;  2QQU A;  4JKL A;  4N53 A;  2WQ4 A;  2J1E A;  5D8A A;  1AYN 1;  1RVF 2;  3ZN6 B;  4CPB A;  2OT7 A;  2WS9 1;  4BHP A;  2JIG A;  4MOA A;  2JD4 A;  4URT A;  4D7T A;  1OA2 A;  1R64 A;  4XCB A;  4BJ0 A;  5LEK A;  2RS3 1;  4XFG A;  1LHN A;  4CYD A;  1X8E A;  5CEH A;  1YEW A;  2JX9 A;  5JVV A;  2EIG A;  1EPZ A;  1VBA 3;  4CSW A;  1PZ9 A;  1Z7S 2;  1NQD A;  5D21 A;  2WZR 2;  2YXS A;  2AYH A;  5FZ3 A;  1SDW A;  4Y1Y A;  1QF3 A;  3H1Y A;  4RFR B;  2YG0 A;  3NJV A;  1QXR A;  1LJ7 A;  4XE9 A;  2QQV A;  2VZ3 A;  4NOT A;  2RS1 2;  2HWF 2;  4QU2 A;  1OOP C;  1NCR A;  1OH4 A;  2HBT A;  3CQO A;  2WZE A;  5DG2 A;  4ZKT B;  2ARE A;  1JYX A;  2A6Z A;  2PFW A;  4MGS A;  2ZPX A;  4OQ9 A;  1AUY A;  2VQA A;  4IE0 A;  4PLN A;  4XFA A;  3ZN5 A;  3QAC A;  3WDX A;  3ZFG B;  2J1T A;  1K5J A;  3QCW A;  2BVV A;  2XGX A;  4N9H A;  3UKN A;  4AVT A;  3BTY A;  1H8T B;  2VCB A;  3ZFG A;  5GZD A;  5C3Q A;  3NJZ A;  2JEM A;  4B4P A;  5C9A C;  1JYI A;  4YGE A;  1SLT A;  1WMX A;  4K8R B;  1KQR A;  3R6S A;  1YQ5 A;  3ZXK A;  2E31 A;  4WM7 B;  4JGY B;  4DIN B;  2WT2 A;  4QX0 A;  3KB5 A;  4CDU C;  5FO9 B;  3WVJ A;  4I0W B;  1OFN A;  4JRA A;  3RWN A;  2FDF A;  1QJE A;  2PAM A;  4Y1V A;  1UIK A;  4GA9 A;  5FYV A;  3JD7 3;  5DAB A;  3T2P A;  3RI9 A;  3NVC A;  2HWC 3;  1UL9 A;  4Y3O A;  1EP0 A;  2RS5 2;  2WAA A;  4I0B A;  1BVV A;  4BQW A;  5KWR A;  3Q8B A;  2PQQ A;  1HB1 A;  2XWB B;  2ZGT A;  2BWC A;  3N7K A;  5IVY A;  4ZU4 A;  5CG8 A;  2BOI A;  3H1M A;  1TNF A;  4K1Z A;  4MYE A;  2FDH A;  2PHD A;  3E97 A;  5FBJ A;  1YQ8 A;  4DS0 A;  3B94 A;  5CFC C;  5DPN A;  2W94 A;  4Z07 A;  3VKM A;  1HJG A;  5T52 A;  2WYS A;  1OC1 A;  3B00 A;  3ZXE A;  4QU1 A;  4BU2 A;  5JUV A;  4XJZ A;  4Z2W A;  2GNB A;  3F95 A;  4XFC A;  3KSC A;  4IL7 A;  1UF2 C;  2CY6 A;  2FDI A;  3VD9 A;  3RYP A;  3LDK A;  3WP6 A;  4AED B;  4AE2 A;  3KVA A;  3WDU A;  1S0J A;  2DV9 A;  1OLM A;  1F4H A;  3OYW A;  1TZO A;  1MEC 1;  2DCY A;  4CEW A;  4FBF A;  4EYU A;  1PIV 3;  1VAM A;  2HWC 1;  2YGL A;  1UXZ A;  1DP0 A;  1HN0 A;  1QIQ A;  4QKD A;  4YG6 A;  5DAW A;  4JX0 A;  3KT1 A;  4Q4X 3;  1WBL A;  5CFC A;  2DU1 A;  3PVE A;  1GNY A;  4YW7 A;  2G9F A;  1AR7 2;  3AKR A;  2QTW B;  3PVO A;  3RDI A;  4Q8L A;  1AL2 2;  3ACL A;  1XC6 A;  2TUN A;  5C4W A;  2VBB A;  4XW3 A;  2JDP A;  4ZON A;  4JQT A;  4CPB D;  4B8E A;  5C33 A;  4WM8 B;  2D40 A;  1GV9 A;  3KQ4 B;  2JG9 A;  5FZH A;  3CU7 A;  2DCK A;  5FR3 A;  5LZ6 A;  1UXX X;  1VBE 1;  4CDU A;  3TB0 A;  1KFX L;  4NO4 A;  4H55 A;  5HXV A;  4TTG A;  3V0A B;  4WVV A;  4PDW A;  4LHL A;  5IFP A;  3FX3 A;  2E7A A;  1O3Q A;  1QJX 1;  3GGL A;  4Q4X 2;  5C9A A;  4CCL A;  3ZFG C;  1QJY 3;  3RMX A;  1UU4 A;  1Q8V A;  1AX0 A;  3JBG 3;  4BQ1 A;  3G6J B;  3ZDV A;  3DKW A;  2EAK A;  4OI4 A;  1V9U 2;  3MIB A;  1JOP A;  3DEC A;  2R49 A;  1F35 A;  1RHI 3;  4RHV 1;  5DUU A;  5ABJ B;  2VOX A;  1NCR C;  3FFZ A;  3VBH C;  4HVR A;  2GSY A;  4XTP A;  3JUU A;  2GH2 A;  1CPM A;  5FZ1 A;  2HWB 1;  4H3W A;  3WG4 A;  1IS3 A;  1GP5 A;  1OLM E;  1QQP 2;  3PTY A;  2RE9 A;  4TZD A;  4HG6 B;  3L9J T;  1MS1 A;  4ARY A;  1JYW A;  4YW2 A;  3FWE A;  4XHB A;  5FYC A;  2EA7 A;  3VHN A;  4PLM A;  4XFH A;  4KU8 A;  3AJY A;  3SXW A;  1W8H A;  1X33 A;  4K8F A;  2CAU A;  2WO7 A;  1YC6 1;  5CKQ A;  4ET7 A;  2QKD A;  2FZ1 A;  5IT6 A;  1BXH A;  4XUN A;  4GZ9 A;  2R7E B;  2JEC A;  2ARB A;  5FJH A;  5I8S A;  3H1W A;  2AH2 A;  1YIP A;  3JCI A;  4OFG A;  4XUR A;  4ZY9 A;  1QMJ A;  1MZ5 A;  1ZA7 A;  3BIW E;  3RRD A;  1O59 A;  4UI9 L;  2AR6 A;  1IQD C;  4RN5 A;  2GAL A;  3LA7 A;  5IVE A;  1XNB A;  4XQ4 A;  1A78 A;  2R16 A;  1D4V B;  3AP4 A;  4GD4 A;  4QDQ A;  4EWE A;  5CG9 A;  3OTF A;  1K45 A;  1F15 A;  2H0V A;  2JG8 B;  2RM2 2;  4UF0 A;  2MPF A;  4HAN A;  1O5L A;  3QH7 A;  5LA1 A;  3H9A A;  4RS5 C;  5EP9 A;  3AZW A;  4QPG A;  1RIR A;  3MW3 A;  1NCQ C;  2VNO A;  2Y0I A;  3OGS A;  1FNY A;  3K4Z A;  1GNH A;  1X50 A;  4HK8 A;  1IPK A;  2A1X A;  3N7M A;  1E5I A;  1O6U A;  3OOX A;  2ZHK A;  4RQP C;  4FTB A;  2JEN A;  4B7K A;  3WDT A;  1S0C A;  4CU7 A;  2RG4 A;  1BEV 2;  3SH3 A;  1XQN A;  1ZRE A;  1F5J A;  2O0O A;  4GH4 A;  3Q9O A;  2JE7 A;  4D0Q A;  1QOS A;  4D7Y A;  5LEJ A;  1MEC 3;  1US2 A;  2ZGN A;  4LBQ B;  3C7F A;  4NIA A;  3VHO A;  4OHY A;  2JE9 A;  4V1P A;  3K46 A;  5GZC A;  2Z79 A;  4R4X A;  3NO8 A;  5FZK A;  2IVJ A;  4YW3 A;  4D6Q A;  4JDM A;  3OUI A;  5FZA A;  4Q29 A;  4L8Q A;  1CX4 A;  1ZZ7 A;  3OGR A;  4WM7 A;  2E51 A;  2ZGU A;  1U5Y A;  2BRT A;  2D93 A;  5FV3 A;  2ARC A;  1VRH 2;  3POI A;  1CN1 A;  3LCP A;  4BOW A;  4E8C A;  2DBN A;  1NZI A;  4COZ A;  1CZV A;  3N4M A;  3O0V A;  1N1V A;  2WFF 2;  1QJX 2;  1PNG A;  1YIF A;  2VGD A;  2W3J A;  4HXC A;  4Q4X 1;  2Z2S B;  2Y34 A;  1UPI A;  2Y8K A;  5IAX A;  3PUR A;  2F4P A;  1LOA A;  1W3X A;  1CAX A;  1UY0 A;  1VMF A;  3AKQ A;  4LK6 A;  1G9F A;  1NYW A;  4FPE A;  4Q0Q A;  3JZV A;  3S30 A;  1VBD 2;  5KHH A;  1IG3 A;  1W9S A;  2OA2 A;  4E2G A;  4GWN A;  4Y33 A;  4IEV A;  4F8A A;  1O8S A;  4Y20 B;  4H14 A;  2Y6G A;  2ZXQ A;  1UD1 A;  1B35 B;  2WNE A;  4XAC A;  5FRE A;  3T30 A;  3O5S A;  2WNU C;  1KXG A;  4QPI C;  2Q8O A;  4PJY A;  2K46 A;  4XF9 A;  4DEQ A;  2JB4 A;  5A3M A;  2XJP A;  2OQ7 A;  4AGR A;  1GFF 2;  1I1E A;  2GC2 A;  2XLG A;  2QQL A;  1QOT A;  2O1Q A;  2YPJ A;  3BOD A;  4TN7 A;  3ZFF A;  3HT2 A;  4MAD A;  5A6X A;  1LTE A;  2IXC A;  2ZGS A;  3BKZ A;  3TEX A;  3GJB A;  2KA3 A;  2B9U A;  3VD5 A;  4Y1X A;  1LHU A;  1H8T C;  2E9Q A;  2V73 A;  5KXB A;  3A21 A;  2QQK A;  4PBP A;  2QZ3 A;  4FPL A;  1RUI 1;  4Q26 A;  4XJU A;  1W8W A;  3EYP A;  1H30 A;  1CVN A;  3PUS A;  5IUQ A;  4CUG A;  1GIC A;  4AHX A;  2NN8 A;  4CDU B;  5JOY A;  4AGV A;  4C0H A;  1J59 A;  3CJX A;  5J3U A;  1ND2 B;  4M0N A;  3UYJ A;  1T2X A;  4YGB A;  1MZE A;  4RS5 B;  4V2W A;  2ATF A;  4EN7 B;  2W87 A;  3C2U A;  1PGL 2;  1RUJ 3;  5HPO A;  2A6V A;  1H9W A;  3Q8E A;  4FFF A;  2MEV 2;  4QMA A;  5F5A A;  2HWD 2;  1SFN A;  4XFF A;  3FC0 A;  4YW4 A;  1LOF A;  2J1U A;  4P08 A;  1NA1 B;  2YY1 A;  2QDR A;  1AYM 1;  5A7W A;  1F4A A;  3IDA A;  1XNT A;  4I3G A;  2J1S A;  3D0J A;  4C1X A;  4UYB A;  1HRI 1;  3H42 B;  4HVO A;  1K5M B;  3HD8 B;  3DV8 A;  1ALY A;  2DFB A;  1RUC 2;  4Y22 B;  4ZPI A;  3TEY A;  5L7O C;  4YGD A;  3H8U A;  3ZXG A;  1HB4 A;  5K8S A;  3T0D A;  1RVF 3;  1OH3 A;  2XOM A;  1DG6 A;  1HRV 2;  2D6L X;  4BLJ A;  1UAI A;  1OPO A;  4K20 A;  4R9C A;  3WNM A;  5J36 A;  4XF1 A;  3I2K A;  1VR3 A;  3AP5 A;  3MV0 1;  4UXA A;  3ZYG A;  1LES A;  1QXJ A;  3INA A;  4NIG A;  3OGJ A;  3R4D B;  4R8H A;  4FVV A;  2OS2 A;  4AED A;  1RUG 2;  1AR9 1;  1PVX A;  1TME 2;  2JIJ A;  1WBF A;  3B7M A;  4P9J A;  5L9R A;  5CBL A;  1LGB A;  2QQO A;  2WLQ A;  4AQ2 A;  3ALQ A;  1AYN 2;  1MVQ A;  3AKP A;  3GHM A;  2DCT A;  4IGO A;  3SCH A;  1QJY 2;  1YRZ A;  3T2O A;  4AFA A;  2RJ2 A;  3USU B;  2ID4 A;  5FZM A;  3W59 A;  2VW0 A;  3AXD A;  5JSO A;  2X10 A;  5J98 B;  5F37 A;  1A34 A;  1AR9 2;  1AX2 A;  3NV3 A;  3W5N A;  1FMD 1;  2VMF A;  3AJZ A;  4MUV A;  4S2F A;  1B35 C;  1RUD 1;  5JSP A;  4KG0 A;  4UFJ A;  2A73 B;  1F9K A;  2RHP A;  3ACI A;  4M0H A;  5C71 A;  5KXE A;  1FPN 2;  2ZZQ A;  4XOG A;  1RUD 3;  1W8U A;  2X5I A;  2HEW F;  5FIX A;  1UY4 A;  5DUV A;  1R08 1;  3BPS A;  2G19 A;  3UJO A;  4KNC A;  1DQ0 A;  4J1X A;  2OYZ A;  3MF9 A;  4FAH A;  4GJY A;  5G05 L;  4MH0 E;  5EV7 A;  1J1L A;  2D6M A;  2J1A A;  4ATF A;  4NHY A;  4MX3 A;  3U11 A;  1AYN 3;  1QJU 2;  4S2D A;  5KC6 A;  2DWR A;  4HPK A;  1HQL A;  3NJX A;  2ZGO A;  2RS5 3;  1D2S A;  3S5Q A;  4Q2F A;  2A6Y A;  5FYH A;  2WC2 A;  4LXL A;  1DGR A;  5ANN A;  4IDZ A;  1W6O A;  4LBN A;  1I6X A;  3WQ1 A;  4ASL A;  1X9T A;  4Y5S A;  4OUE A;  2DDU A;  5KXC A;  1PGW 1;  1TE1 B;  1AR9 3;  3IMM A;  2VW2 A;  1BYH A;  3PL0 A;  3GM8 A;  4A6O A;  3ZM8 A;  2AEZ A;  5HCH A;  4N7I A;  2XUE A;  1JUI A;  3T2Q A;  2D6O X;  4D7S A;  1MQT A;  3MGU A;  1CAX B;  1XNK A;  3MIF A;  4GUL A;  4OHX A;  1LOG A;  2R06 1;  1YO8 A;  2VEC A;  4LBO A;  4P9Y A;  1EY2 A;  1NKG A;  4BIF A;  5FXX A;  2ZGL A;  3U10 A;  4NHM A;  1ZZ9 A;  1PNF A;  2PTM A;  2Q8D A;  1SDD B;  3VZN A;  4PT6 A;  2D3S A;  4K9S A;  4M3C E;  4URA A;  2XON A;  3I3B A;  4HPK B;  2BGP A;  1G86 A;  1QQP 1;  2BPA 2;  4GB3 3;  4CRQ A;  5AC9 3;  4CDQ C;  2FCV A;  1K5M C;  5FAX A;  1QNY A;  3K77 A;  2A70 A;  3NWK A;  3I97 A;  3FHA A;  3JBG 1;  3U07 A;  5FY1 A;  3WG3 A;  2WDB A;  3AKS A;  1AR7 3;  3PJY A;  4PIZ A;  2J42 A;  1KDK A;  1QDO A;  3CZJ A;  3THD A;  2F6B A;  2V72 A;  4COU A;  3K3O A;  2QCS B;  4QQH A;  5I0D A;  1SFY A;  2DFC A;  1QGL A;  1A6C A;  4A42 A;  3K48 A;  2AZ5 A;  1S4C A;  3U1X A;  1XE8 A;  3BTX A;  5IWF A;  1DIW A;  4F83 A;  2MHF A;  3PU3 A;  4QQP A;  4NID A;  2ZEW A;  3UKT A;  4ASM B;  2FCU A;  1ZBE 1;  1J3Q A;  5FK7 A;  3J4U H;  3WCS A;  1GWL A;  1BEV 1;  5ERL A;  5DZE A;  5FMO L;  4XQD A;  2AAC A;  2VVF A;  4I3P A;  1W6P A;  2ZAC A;  1QU0 A;  2IFW A;  3P3N A;  5C3O A;  1DQ6 A;  2XL9 A;  4CU6 A;  4IE5 A;  4IUG A;  1IPJ A;  2ZKN A;  4HT1 T;  4LOS A;  1POQ A;  1JYT A;  1CES A;  4LK7 A;  1SLL A;  1NOV A;  1IHM A;  4KQ7 A;  1H2L A;  4NR1 A;  2C1F A;  5K0U C;  1NLQ A;  1OQD A;  5SV5 A;  5F32 A;  3RG0 A;  5JI9 A;  1ZBE 2;  4QWN A;  4BQX A;  4Y1U A;  1YQC A;  2QQM A;  4LA3 A;  3O7O A;  4GB3 1;  5A1L A;  1VBE 2;  2ZX3 A;  4QXC A;  1C5H A;  4PI2 A;  3VBR C;  4BQ5 A;  4ZHN A;  1RUD 2;  3M8L A;  1BMV 2;  2Y33 A;  4JTN A;  1YLL A;  2BER A;  2D98 A;  3E5U A;  2ZX2 A;  3EQE A;  3FHI B;  3LA2 A;  5LBE A;  1UY2 A;  1CIW A;  1T6B X;  1S0D A;  2BUK A;  3R4S A;  4FCA A;  1KS5 A;  2ZEZ A;  3P3P A;  5GLZ A;  3GXU A;  3E6B A;  3GNE A;  2JDH A;  3GBG A;  5T50 A;  3AMP A;  3H7Y A;  1V6O A;  1HN1 A;  2FQP A;  4B29 A;  5HI0 A;  2MEV 3;  1PO1 1;  3ZSE A;  1BMV 1;  4G9S B;  2JWP A;  2CL2 A;  4NRO A;  3WP5 A;  3HPN A;  1ASJ 3;  5LK7 B;  4XAB A;  2HWF 1;  4FFG A;  5JDB A;  2C5D A;  2VTF A;  1S2K A;  1MQT C;  2WJS A;  4KBB A;  4LKF A;  2VH9 A;  4W65 A;  3WQB A;  5A7S A;  3GAL A;  3ZX7 A;  4XAA A;  1N1S A;  1IGO A;  2D5F A;  3BTA A;  2RR1 2;  3LE0 A;  1WD4 A;  1Q8S A;  5F2W A;  3WF0 A;  4CP9 B;  2PLV 1;  1JUH A;  5CIS A;  3JU9 A;  4C1W A;  2WZR 3;  1R1A 2;  4QM9 A;  2BGO A;  5J1X A;  4TSV A;  3BIE A;  4GXL A;  5ISL A;  5I8Y A;  3GYD A;  1L7R A;  1W2T A;  1JYV A;  1CX1 A;  1PMI A;  5I0U A;  3HQU A;  3H50 A;  3ZPY A;  2FMY A;  4AL9 A;  1EV1 3;  4CDQ B;  2VU9 A;  5JSR A;  2ZX4 A;  5J7M A;  3POG A;  3ZVX A;  3N36 A;  3CF6 E;  3V0B A;  2XB6 C;  3GZA A;  2ES3 A;  2EID A;  3N35 A;  4FFH A;  4PLO A;  5FZE A;  3IKW A;  2W46 A;  1RIN A;  4QQ2 A;  4N90 A;  2DYC A;  2P1B A;  2OZ6 A;  2HWB 3;  3IDB B;  3LEK A;  3RNS A;  4AOC A;  1JYC A;  1ENR A;  2CDP A;  2HWD 1;  3DXU A;  4RYD A;  3AYA A;  1VBB 2;  1C8M 1;  2FDG A;  3FLR A;  1I5P A;  3POJ A;  4IV3 B;  4N43 B;  5DDJ 1;  3WNX A;  4AGG A;  5FOB B;  3DXT A;  1D4M 1;  1IOA A;  1VAV A;  1RUI 2;  4HL0 A;  5FP9 A;  1ZYB A;  1W2N A;  2WQ8 A;  4Q4V 2;  1UY1 A;  2VZR A;  4AR2 A;  1JZ8 A;  5CZK A;  5A7W B;  2PHR A;  5LBC A;  4LR4 A;  4W8J A;  4HET A;  1S0E A;  4O7X A;  5H9P A;  2ZEX A;  4FPC A;  1LHO A;  1NA1 C;  3HVD A;  4BB3 A;  3KHC A;  1GU3 A;  3BOP A;  1UYY A;  3M1H A;  3Q8C A;  1FV3 A;  2Q30 A;  3ILN A;  3RGB A;  3LFM A;  3VKF C;  2WNO A;  3ETQ A;  2R07 2;  1QJU 3;  1DZQ A;  1BBT 2;  2EAA A;  2NP0 A;  1H1A A;  2YFZ A;  4DRV A;  2R04 1;  5L73 A;  1GQP A;  5D1I A;  3DL3 A;  5A80 A;  4EN6 B;  3J7N A;  3K4A A;  3M2M A;  2CGP A;  5CB7 A;  4P9I A;  4OYU A;  5IJR A;  4PQ9 A;  5BYN A;  1U0A A;  3TEW A;  2RM2 1;  3PTR B;  5CYY A;  1JOB A;  5L7O A;  5FYM A;  2VW1 A;  3ZSM A; 
#chains in the Genus database with same CATH homology
 1HJF A;  1QJE A;  1BLZ A;  1QJF A;  3ON7 A;  2WO7 A;  3ZKY A;  1OBN A;  1ODM A;  1W06 A;  1W28 A;  1BK0 A;  4BB3 A;  1HB4 A;  1E5R A;  1WA6 X;  1RXF A;  2BJS A;  2JB8 A;  3ZOI A;  5C3P A;  5C3R A;  2BRT A;  1E5I A;  1HB3 A;  3OOX A;  5APA A;  1UO9 A;  1HB1 A;  2JB4 A;  2VBP A;  1W03 A;  2VE1 A;  1W9Y A;  2DBN A;  2IVI B;  1HB2 A;  1W2O A;  5C3Q A;  1W2A X;  2Y60 A;  2VAU A;  1QIQ A;  1UOG A;  5C3O A;  1E5H A;  3ZKU A;  1GP4 A;  1W04 A;  2VBD A;  2VCM A;  4RGK A;  2CSG A;  1IPS A;  1UOF A;  1UZW A;  1ODN A;  1GP5 A;  1W3X A;  1GP6 A;  1HJG A;  1W3V A;  2DBI A;  5C3S A;  1DCS A;  1OC1 A;  1E5S A;  1RXG A;  2BU9 A;  1W05 A;  2IVJ A;  2Y6F A;  1W2N A;  1UNB A;  1UOB A;  4XAE A;  2VBB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...