5J98B

Crystal structure of slow bee paralysis virus at 2.6a resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
260
structure length
260
Chain Sequence
MDRPEGSEERTVQTSNVVLGETNIESQDIASKEYSPTWDRLASSEVSDEYPMLTDRWLFWKSVKWEVNDSAFGKMLVQEKFPQSWVQMDVNVNNIPRYTNIPNFIPFNIHQYMRADFEVKIYVNPNDFVSGWLIMAFLYQGSEMFDYKLRRNPAALMQMPHVLVNVGAANEATLKIPYRYVRPFMRCKDILRGDNLITGVTEPLNMGVLFVEVLIPFRTSAASSAPKSLDVSLFVKMTNAKFTGMVDGSIALLSKPIALP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Virion Structure of Iflavirus Slow Bee Paralysis Virus at 2.6-Angstrom Resolution.
pubmed doi rcsb
molecule tags Virus
molecule keywords VP1
total genus 53
structure length 260
sequence length 260
ec nomenclature
pdb deposition date 2016-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5j98B00
1QJY3 1RMU2 3CJIC 4YVWC 4Q4X1 4RR3B 5K0UA 3VDDB 1RUD3 4N53C 2R073 2IZWA 1PGW2 1RVF1 1ZBE2 3ZXAC 1SMVA 2HWE3 5DDJ3 2WS92 1RUH2 4PDWA 1VBD1 2R063 1B35C 5BNPC 5JZGC 4CDQA 1NCQA 5CFCB 1C8M2 2R061 3DPRB 4IV1A 1EAH3 1HRI2 2WS91 5L7OB 4CDUA 1ND2B 2WZR2 1NG0A 5C9AB 2PLV1 2WLPA 1MQTC 1E57A 4IV3A 1C8M1 1RMU1 2R062 4CEWB 5K0UB 4GH4A 5A33B 4EJRA 1ND2A 1RUC1 1EAH2 1HRI3 1PGW1 1VAKA 4JGYA 5FMOL 3VBSA 5ABJB 4CDQC 1NCQC 5GKAC 2RS51 5C4WB 4FTSA 3VBOB 1CJDA 1VRH2 1RUH1 1VBE2 1X36A 3VBUB 5C8CA 1K5MC 1FMD3 5D8AA 4IV3C 1RHI3 3NAPB 4GH4C 2MEV1 1RUI2 4Q4X3 1VRH3 4SBVA 4Y5Z0 1FPN2 1RUJ1 1MEC3 4CEYC 4QPIC 4JGZB 1ND3A 2RS12 1EV11 1M06G 1RUF3 1AR82 2RS33 5BNOB 3VBSB 1RUG2 1QJU1 1OOPB 1EV12 1RUC3 4Q4W2 1AR62 4RHV2 2TBVA 3ZFFC 5AC92 4GB33 1RUI1 1PIV2 1A6CA 1QJU2 4IV1B 1R1A3 5L7OA 1ASJ2 4N43C 5AC91 1PVC1 5AC93 1RUH3 1RUD1 4GB32 1AYM2 3J8F3 1PO13 4BCUA 1R092 1R1A2 1PVC2 4QPGC 5C8CC 1V9U3 1AR61 4Q4W1 4WM8A 4YVSA 1H8TA 1RUE1 2WWSA 1COV2 2RM23 3VBFA 5ABJA 1NA1A 1PIV1 2HWF3 1PO12 1ZBA3 1VB2A 3JBG2 2X5IA 4WM8B 1ZBA1 1QJX1 1HRV2 1HX6A 2RS31 1QJZA 3ZFGA 4GB31 1BEV1 3VBRC 2FZ2A 1AYM1 2HWF2 1FMD2 3ZFEC 1ZBA2 4Q4Y3 1NY72 4RS5A 1HRV1 2RS53 1QQP3 1PO22 1HRV3 1F2NA 1BEV2 1NCRB 1AR93 3M8LA 1FMD1 4CEYA 4CDWC 1COV1 3ZFFB 3VBUA 5C8CB 1ND3C 1AYN1 1OOPC 5CFCA 3VBSC 2HWB1 1FOD1 1OPOA 4PDWB 3ZFEB 2RS13 1RMU3 1POV0 1VBA3 5C9AA 4CEWC 1RUJ3 2R042 2ZAHA 1TMF3 3LOBA 4FTBA 2RS32 4QPIB 1AL0G 4N43B 4CEYB 2HWF1 1AR73 1HXS1 3VBRB 5ACA3 1Z7S1 3DPRC 4NWWA 1RUF1 4QPGA 2BFUS 2RM21 4RQPA 4N43A 1B35B 5CFDA 4CDXA 3IDEA 1QJU3 4PDWC 1QJX3 5BNOC 5JZGA 1AYN2 4Q4V2 1W39A 4NWVA 1R081 4RR3A 3NAPA 1QJY2 4CDWB 1NCRC 3TN93 1MEC1 1POV3 4Q4V1 3TN91 1ZBE3 3VDDA 1POV1 1H8TC 2PLV3 1AYN3 4CDXC 5CFDC 4Q4V3 3ZFEA 2QQPA 1V9U2 2WS93 3VBHB 1FOD3 1C8NA 3JB4C 5A32B 2BPA2 3JD73 3TN92 2RM22 2Y26A 1X33A 4CDXB 5CFDB 1H8TB 1C8M3 1VBC2 5L7OC 1K5MA 1RUI3 1VBB1 1R082 1Z7S3 4Q4X2 3JB8A 2WFF2 1FPN3 1VBC1 1MEC2 1AR71 1HXS3 5ACA1 4FTEA 1TME2 2HWE1 2BBVA 1MQTB 2WFF3 1ND2C 4N53A 1AL23 1TME1 1AR63 4Q4W3 4Z92B 1VBD3 5J98B 2R043 1EAH1 5C4WC 2HWB3 2VQ0A 1NCQB 1ND3B 1IHMA 1K5MB 1AR72 5ACA2 2XBO2 3VBOC 2WZR1 5BNOA 2BFUL 2HWC1 1AR83 5BNPA 2XBO1 2MEV2 4IV1C 2X5IC 1RUC2 5BNNA 4RHV3 2HWC2 1COV3 1VRH1 4WM8C 1VBE1 3J8F1 2PLV2 3CJIA 2MEV3 4YVWA 4IV3B 5JZGB 5BNPB 1RVF3 4QPIA 1GFF2 1D4M3 3VBHA 3J8F2 1RUD2 1D4M1 4QPGB 2R072 1BBT3 1CD3G 2RS52 1PO23 1VB4A 4RR3C 4JGYB 5K0UC 1AR92 1D4M2 1DDLA 5D8AB 2RR13 4CDUC 4YVSB 1AR81 4Y4YA 2FZ1A 4JGZA 3VBUC 1RUG1 1AR91 2WZR3 1OOPA 5CFCC 1FPN1 1B35A 4RHV1 1RUJ2 3VBFC 1TMF2 4GMP1 4RQPC 1R1A1 4AEDA 4WM7C 1AL22 2R071 2RS11 1QQP2 5FMOS 1TMF1 3JD71 3ZFGC 3ZFFA 1NOVA 5BNNC 1PO11 4JGZC 1AL21 1RUE3 1VBE3 3JBG1 1WCDJ 3VBOA 1QJX2 1R091 1EV13 2RMU2 4WM7A 1PIV3 3HAGA 4GH4B 3NAPC 1ASJ1 1RUE2 3VBRA 1PGL1 1PO21 2HWD1 1ASJ3 4N53B 2HWC3 1QQP1 3VDDC 5DDJ1 3JD72 3VBFB 1AYM3 4CDQB 4AEDB 1RUF2 4GMP3 5ABJC 1BMV2 5C4WA 1NA1C 2X5IB 1PVC3 1F8VA 4RS5B 4RFT0 1NY71 5DDJ2 3S6PA 2R041 5BNNB 2RMU1 3ZFGB 5C9AC 4CEWA 1BBT2 1HXS2 2ZZQA 1AUYA 3JBG3 1HQNA 1PGL2 4AEDC 2HWD2 3DPRA 4RQPB 1FOD2 1NCRA 5A33A 1BBT1 1V9U1 2GH8A 2RR12 1R093 1VBC3 1BMV1 4YVSC 4GMP0 1QJY1 2HWD3 4CDUB 1RHI1 2GSYA 5FOJB 1R083 1BEV3 1Z7S2 2RR11 3CJIB 4YVWB 4JGYC 2XPJA 2ZTNA 5J96B 4FSJA 2HWB2 2WFF1 1RHI2 1RB8G 1MQTA 2DF7A 1NA1B 4Q4Y1 5A32A 1TME3 1VBA2 2BUKA 1ZBE1 3FBMA 4Q4Y2 4WM7B 4LLFA 1VBB2 1VBA1 2RMU3 1VBD2 4CDWA 5D8AC 1HRI1 4RS5C 3VBHC 5LK7B 1OHFA 1RUG3 2HWE2 1VBB3 1RVF2 2XBO3
chains in the Genus database with same CATH superfamily
1RMU2 5L9RA 5IK4A 5KHGA 4A45A 4XAEA 2VZTA 3VDDB 4FAGA 4XPVA 5GM0A 5LA2A 5F37A 2VOVA 2DV9A 1Q8VA 1AVBA 2QDNA 2R073 2YC0A 1RVF1 1ZBE2 1CIWA 2TNFA 4A44A 4I01A 1SMVA 5FYSA 3SH4A 2HYXA 4YM0A 3ZYBA 4Q29A 1N47A 2IC1A 1VBD1 4PDWA 3LOIA 2BGPA 1B35C 4R4XA 5GLVA 2PAEA 4CDQA 2QQLA 1C8M2 1LU1A 2Q5TA 3DPRB 1OMIA 4L9BA 2Q8CA 1HRI2 2O8OA 2WS91 5FK7A 4CDUA 4URTA 5LCWL 4BQ5A 3LEMA 3HN1A 3I49A 1ND2B 2WZR2 4AVVA 2ARAA 1YQ5A 1NG0A 3K4ZA 4NVPA 1YWKA 1WUVA 4P5HA 2RE9A 2VQTA 3WHTA 4AGRA 4YWAA 1C8M1 1RMU1 4XVHA 3NJYA 4AF9A 1GZCA 3C7GA 4P08A 4UW5A 1O3QA 3UT0A 4AQSA 4IERA 5GLTA 3KHBA 4P5YA 3ZMNA 1EAH2 1PGW1 4A41A 1FNZA 4XBLA 4DRRA 5FPAA 3L2YA 3POEA 4JZRA 5GKAC 5M0TA 4FTSA 1OXCA 5FUNA 2WL1A 2OZJA 3I59B 2J22A 4JVAA 1MS8A 1XE7A 1DZTA 5FQ0A 4COUA 2RDRA 4XTMA 5KHKA 5B4NA 2H6BA 1RHI3 1A8DA 4QHBA 4WBBA 3I2OA 2GNBA 4CU8A 4ASLA 2WSUA 1XU1A 5FBZA 1NX9A 1RUI2 3NW4A 4EWEA 4HOOA 4RD7A 4XUQA 4Y5Z0 4CSWA 2R30A 3NVCA 4FP3A 5FLJA 2Q1ZB 4MOAA 1JZ2A 1KDKA 4ZHNA 3PIGA 3H8UA 4HVRA 4ITCA 4MVTA 4QPIC 1OLRA 1KDMA 1OLQA 1HQWA 1IS3A 1EV11 2YU2A 4LE4A 2QBXA 4Q5OA 4DINB 5A6YA 1AR82 2VTFA 1GSLA 5FZKA 5LASA 5BNOB 3PHMA 1RUG2 1J3QA 1UY0A 2LUWA 4QD2A 4RN5A 3PU8A 4QX5A 2QQJA 1EV12 1RUC3 3F2ZA 3POWA 4RHV2 3T1LA 5C8WA 2BU9A 1V6IA 4DFSA 4GB33 4NHKA 2QQKA 1RUI1 3CQOA 1A6CA 3ZXLA 2J1SA 1WCQA 1VE0A 2B5HA 3VKMA 2ZHKA 1R1A3 4E4HA 1PM4A 3CIHA 3M7AA 5KXCA 1MS0A 1UY3A 4N43C 5I0TA 4EROA 5AC91 5L7OA 1UY1A 4Q0UA 3CL1A 4KBBA 3M3EA 1OKQA 1SHWB 4QMAA 1AX2A 4A7YA 3O5SA 4EQVA 5IK7A 1WA4A 2ARCA 1XJAA 1LOEA 3AXDA 3NNJA 1WZXA 2GNMA 2XHNA 3APBA 5EJ3A 1LESA 1SBDA 3B9IA 4LHKA 1UPIA 4U36A 5I8TA 2MPFA 1YNAA 5CG8A 1CX1A 2ZKLA 1JOPA 4I09A 4L97A 3C7HA 1R092 2K0GA 1DG6A 2XWBB 2ZX1A 4QM8A 2YU1A 3WOGA 2RHPA 3IPVB 3WQ0A 3GZAA 5FWEA 3VD9A 4HKOA 3T08A 2W9XA 3P5BA 2IWGB 1TE1B 3MIFA 1DQ5A 4WM8A 2ZGNA 2JDZA 2VMEA 4YVSA 1BCXA 2E51A 2XJRA 4QHZA 4XFAA 1COV2 3ENRA 2YHJA 5LY2A 3W58A 5FK8A 3ZYRA 2D6LX 1A34A 1BQPA 3WT3A 2DU0A 1FV2A 1W0OA 2X5IA 4YZ2A 1CAWA 2WSVA 4GWNA 4Q2FA 4XACA 1J3PA 3ZXEA 2OUJA 3WDWA 4IEVA 5DABA 1BLZA 3ILNA 3WY6A 4W50A 2XONA 3ZFGA 1GWKA 3WQBA 1HB2A 5FY0A 4C91A 2FZ2A 2VH9A 4R9AA 2ZAAA 1EPZA 1QOSA 2QDRA 5JVVA 3WR0A 1LENA 1NY72 4UI9L 5HV4A 3RZHA 2RS53 1JMUB 4AHXA 4ET7A 1WWYA 1KGYA 3ACFA 2Q0AA 3KV6A 1X82A 4JRAA 5J36A 1HRV3 1F2NA 5C3OA 3I2GA 2D6PA 1BEV2 4JKLA 2XG3A 3TWIA 4FPYA 1YQCA 1NCRB 1AR93 4QQPA 3M8LA 1W2NA 2EF6A 1A8MA 2D3SA 2H0BA 2VMCA 5ANQA 1G9BA 4IQPA 4M3CF 4AG4A 4R8HA 3VBUA 1ND3C 2KA3A 5C8CB 5CFCA 3POGA 1H2KA 2BGCA 3D0SA 4YNIA 1VLNA 3ZFEB 1O8PA 4QB2A 3VD7A 3OEAA 3OGSA 3LD8A 3J7HA 1TMF3 3KD4A 1OURA 4LBKA 4JQRA 3LOBA 4PI0A 1ZA7A 2XJPA 5IJRA 4QPIB 4CP2A 2JG9C 4L92A 4QDRA 1XNAA 4LK6A 4LBJA 3ST7A 1JODA 1NXD1 2VMDA 3WW4A 3ZIWA 1YFWA 5JXJA 2N7GA 5CFDA 4CDXA 3LEIA 3EMRA 5JAXA 4IGQA 2WZEA 5EFUA 5I8SA 2FMYA 2Y0IA 4Q0VA 1SLAA 4P00B 5JZGA 3KF5A 2UY9A 2VD7A 3HT1A 2VZQA 3KWVA 4AVAA 4NRMA 1O4YA 1NYWA 4CDWB 4Z1VA 4NMIA 4LHLA 3ZSKA 2CAUA 1POV3 2ZGQA 1U5YA 5JIUA 2W1SA 3J4UH 3MIGA 2VGDA 3TN91 3V65A 3VZNA 3WW2A 2PLV3 4WVMA 4JC1A 4EZHA 1AX0A 4IW3A 4X6RB 5DG1A 2YYOA 5FYHA 4EZ4A 4YFZA 4EYUA 2YC2A 2DUOA 2NMOA 4G9SB 1C8NA 1IPJA 5A32B 4TLGA 4EV0A 2O1QA 5JR7B 1XSRA 3OD0A 4K8RB 3TN92 1VMJA 2LM3A 5FWJA 2FD8A 4CDXB 5CFDB 3TAYA 4CPBD 4D6SA 2WNUA 3RYKA 1PVXA 3OGJA 2A70A 1K5MA 2W08A 4Z2AA 3MLLA 5H9SA 2VZPA 2XJQA 5FP7A 4Q4X2 1VBB1 4XUPA 2RJ2A 5FYIA 1ZZ9A 3S30A 1H2LA 1W8UA 1L7LA 1IQAA 1ZZBA 4GXLA 4YGBA 5JOWA 2A6VA 5JXGA 4KWKA 3NJZA 4I0BA 4FFGA 1MEC2 3AJZA 3R4SA 1UQXA 4EN9B 3T2OA 5F39A 5A7QA 4A2UA 1SLIA 5FZ1A 1XXNA 2VY0A 5DUVA 3I97A 2JG9A 1ZA4A 4OZXA 3U14A 2WO1A 4OUSA 4XTPA 1OLMA 5A7OA 4LMFA 1G8WA 4LBQA 3MLKA 1W8ZA 2KXLA 1W06A 2PHWA 3VUOA 2PELA 3WQ1A 3V0BA 2QE3A 2W5FA 2WLQA 3A7QA 3I2HA 1AR63 1FYUA 1W0NA 4Q4W3 3IAQA 2X29A 4DNYA 1JZ4A 3PTYA 4H14A 1IOAA 1ULOA 4BLJA 3WCSA 2VQAA 2NQYA 3WW1A 2GH2A 4OVEA 3O1UA 2YG0A 1OI6A 1NLSA 3F95A 1FX5A 2ZS6B 4Z2WA 5C4WC 3MUZ1 2R32A 2AEYA 2DTYA 1QXRA 1AR72 1H2MA 5FYVA 5LBEA 2XUEA 1ULCA 2YUEA 4QQLA 5KHJA 2NP0A 3PMEA 2ZGMA 4E4ZA 4NRPA 1REDA 5BNOA 1Y4WA 2JIJA 3WG2A 1E5HA 1S4CA 4DB5A 3ZYJB 2DBIA 1W6NB 4AFMA 1J59A 4UOJA 1SEFA 4PJYA 4ZPIA 2BQPA 3MW2A 1YQ2A 2PHUA 3Q8FA 4LNVA 3IMNA 2Y0OA 2X5IC 1RUC2 4DQAA 4RHV3 5BNQA 3AVSA 1GYKA 4CA9A 1N3PA 2VO5A 1C57A 1LKNA 1C1FA 3LSDA 3S7IA 4D0QA 2P2KA 3UNPA 4OHZA 1SLBA 2JD4A 1NZCA 1JUIA 2PLV2 3BALA 5FZDA 3WEZA 2Z2SB 2X10A 4IV3B 2WYFA 3KCCA 4W6XA 3USSA 3BB6A 4E4DX 4MGSA 2XDVA 4DY3A 5FYUA 1PK6C 5FYCA 3ACGA 2CV6A 1RUD2 2X05A 4BWOA 1RIRA 3DF0A 1JTZX 3I2JA 5J7MA 1DP0A 3UJQA 1IG3A 3H3LA 5EIYB 1HKDA 1LAJA 4RR3C 4Y1ZA 5IK5A 1L7RA 3NNFA 5EHDA 2FDFA 2EXIA 5K0UC 4Y1VA 2LALA 1LOBA 2ZX4A 5D8AB 2PFWA 3OTFA 4CCOA 1EP0A 3ZSEA 2RR13 4CDUC 2XGXA 1QF3A 2BOIA 2Y6GA 2VL4A 4MSVA 4LUMA 3LWCA 3JQWA 3UL2A 2XH6A 1N1SA 3IAPA 5TSWA 4FPLA 2D3PA 5A7NA 4CCEA 2BP6A 3ZXDA 2JDHA 5CNAA 4XW3A 1UD1A 5CYYA 1G6NA 2H6CA 3KV4A 4YZ3A 3RJ2X 4AEDA 1C28A 2OPKA 4WM7C 2D7FA 1OQ1A 2HH9A 2P37A 1AL22 2QQMA 4LBQB 1O3RA 4XEZA 3THCA 2IXHA 5FPBA 4A6SA 5DUWA 4D8MA 1GKBA 2ATFA 2CHHA 3JD71 4YW6A 3RNSA 3AKQA 3ZXGA 3IB3A 2A7AA 4Y20B 3WNLA 4XE9A 4JGZC 5C5TA 2W39A 1AL21 2XLGA 3CKHA 3JBG1 5FUIA 3WNOA 2V4VA 2WBKA 4TWTA 5IFPA 3Q9OA 5DAWA 2VVEA 5FP8A 5FZEA 4CXYA 1O3SA 1VP6A 2L9LA 2V09A 4LKDA 2WAOA 3ZLIA 2YDEA 2EAKA 3O7OA 2CDPA 4NUBA 3DYPA 1W6OA 4GH4B 2P4EA 1G9AA 3NAPC 3NNMA 4JKMA 5FQ0B 2YFZA 4QKFA 1XQNA 1ASJ3 1UOFA 3LIHA 3LPGA 4N53B 3ZR6A 2PHRA 4IETA 4IE4A 3VDDC 1H6XA 1N1YA 1NE6A 4UAPA 3JD72 3IN9A 2Y6JA 2NLRA 3CF6E 4AI9A 1DYOA 1H4GA 2E31A 4JDMA 4QAWA 4YFWA 3E5UA 5BUVA 3LB9A 4GALA 2W47A 4OHWA 5FMBA 3RG0A 4RYDA 3I2IA 1NA1C 2WNOA 1D4VB 2PHXA 2X5IB 4ZY9A 1PVC3 2BJSA 4BB3A 3AP9A 2A6WA 1D0GA 1J84A 2UWCA 4RS5B 4SLIA 3ZN6B 1F8VA 4J1XA 2VAUA 4CYDA 2J7MA 5K9YA 3EHKA 3C7FA 4LO8A 2QUOA 3ZFGB 3S5AA 5C9AC 4CEWA 4YG0A 1RJ7A 1MACA 3UESA 4H7MA 2YC4A 5HCHA 2EIBA 1UU4A 1US3A 3AYEA 3DPRA 3A4UA 1TVGA 2V73A 1FOD2 1NCRA 3FX3A 3SISA 1ZM1A 4WZCA 2WNUB 5IVBA 1CGPA 1W9YA 4PLNA 1W6QB 1IZ3A 1SCSA 1YO8A 3MIHA 4Y24A 3THTA 1VBC3 2B9UA 1WLCA 1ALYA 1IPKA 4YVSC 5JMCA 4D69A 2PXJA 2XJVA 2LRPA 1RHI1 1JHNA 1J1TA 3K46A 4QX7A 1CZSA 4HXCA 5ISLA 4E2SA 4E8DA 1UO9A 5L19A 3S57A 2R0HA 1K5JA 4YW1A 3WP5A 2WFF1 2FDIA 3D6EA 2ET7A 1ZRDA 1RB8G 1NUKA 2J1VA 2CYFA 1VMHA 4V2WA 2NMNA 1M4WA 5JXIA 5DZGA 2Z42A 1GP6A 3FHIB 1Q3EA 4PQ9A 1YFUA 2XL7A 1WMEA 4LA3A 5HPOA 4M0NA 1XE8A 2BUKA 4MYEA 1ZBE1 4I3PA 4Z07A 3FFZA 4JTOA 1LHVA 1LOFA 3O1TA 2K2SA 4E2QA 4PLMA 2LW8A 1VALA 1VBA1 5EV7A 1DHKB 4YZ4A 1DYPA 2XJUA 4CDWA 2WZPP 4F83A 3X29B 4MGYE 4LBLA 4YG6A 4NOTA 2X53S 2V5YA 3AFKA 5I8YA 1WCSA 1LGCA 5HXMA 1HRI1 1OH4A 3GBGA 4C8DA 1QDOA 1Q43A 3A0KA 1OHFA 4KGQA 3DYOA 1O4ZA 3AZYA 1Y7BA 2GC0A 3CZJA 1RVF2 4Y1YA 3KCYA 2VNRA 4RGGA 1JZ6A 3CJIC 4YVWC 3AMQA 1QY4A 4LHNA 1IGOA 1QIQA 2VZ3A 4IXLA 3NNLA 4MV2A 4UT5A 5FZOA 5K0UA 4CVUA 1CAWB 1KS4A 2UURA 2IZWA 1PGW2 4HKLA 2WQ8A 4J6GA 2VMFA 4RSUA 3SEPA 4B4QA 2HWE3 4XJAA 1J58A 1YQ8A 5SV8A 4IEUA 2WS92 5LEKA 2AREA 2ENRA 4XMIA 1W6PA 3U10A 3CU7A 3ZPYA 1UOBA 4GIQA 3GDBA 2W52A 3LCPA 1OKOA 2VMIA 2J1RA 3BPZA 4UBGA 4A7KA 1NCQA 3GXUA 2MNGA 1XYOA 2R061 4AQTA 1YI7A 1OQDA 4TXWA 1VAVA 5FLIA 5AVPA 1H30A 5FZIA 4BDVB 3PMSA 2Q1FA 3EQEA 1CESA 2JXAA 2VNOA 5FZMA 2UY8A 3TRSB 3C7EA 3O12A 3AVRA 2R062 4QQ2A 5T5OA 3KVAA 5FO9B 5K0UB 5C3RA 3DXUA 5SV5A 3SNMA 1W3VA 1XOYA 1ND2A 2OW4A 1JH5A 1GP4A 3GZUC 1VAKA 1PMHX 2XVGA 3MUY1 4ZONA 3VBSA 4YW4A 5LK5A 3VKFC 4W4ZA 5B2GB 4K1ZA 4XF9A 2RS51 4XFHA 4DS0A 4EWAA 3FBYA 3HVDA 3NQHA 5DAPA 1CJDA 1VRH2 3PL0A 3RVHA 3FWEA 4AVTA 1VBE2 1JYIA 4EWDA 2ZEYA 5EYXA 4JDNA 1HB1A 4TYSA 4XC9A 4MX3A 1W05A 3IMMA 1EYBA 2BGOA 4XURA 2J1TA 2JWPA 4I02A 1Q8QA 2B8MA 2UU8A 5LRSA 3N7LA 2VCMA 4HK9A 2XKOA 1DQ1A 2BBAA 1VAMA 2EAAA 3WNXA 1J83A 3OF1A 1JN2P 5FZGA 3DV8A 5A1FA 5C5UA 2OYZA 1YYNA 4UWDA 2R1BA 3D8CA 3I3EA 1S0EA 1BK0A 1W6MB 4ZU7A 3KS7A 1VR3A 2JKXA 4ISQA 2Y6LA 4Y3OA 3WCRA 2K46A 2FDJA 4YGEA 4LXLA 1UPSA 4AAPA 1FNYA 5A3MA 3OUHA 2SBAA 4HVOA 3IT8A 2WN3A 2JD9A 2HEWF 2WFPA 5GLZA 2CU5A 1ZX5A 3R6SA 3RDIA 1UMZA 4MG2A 5K8SA 5AC92 2D3RA 2VECA 4HFSA 4HONA 4HBNA 4ZXEA 2ZMLA 1WLWA 4QX1A 4XCBA 5CKNA 1OA4A 3KMHA 4RGAA 3KV5A 3M70A 3MFAA 4DO0A 1ASJ2 5D2AA 1O6UA 5CAZA 4DPNA 1XU2A 4NHYA 5F3GA 5FIXA 5L9VA 1ZRFA 2Q4SA 1U12A 2VUCA 4ZKTB 1G7YA 1RUD1 3HQUA 5FZ8A 1K45A 2IXKA 3O1MA 3WUCA 5F6LB 3UKTA 3J8F3 2WO2A 4XMAA 2WAAA 1UXXX 4FQ4A 5E88A 2WR9A 1LU2A 3D0JA 1R1A2 2QVSB 5A7WA 3AZZA 5A1LA 2Y60A 2CGPA 2RJLA 3MLJA 2ORXA 4PBPA 4P9GA 4EN0A 1H8TA 1RUE1 4Q0PA 5GZGA 2DCZA 5E89A 3EB7A 2RM23 4AFCA 4NIGA 2I45A 1OUSA 2HWF3 1PO12 2IVJA 2AZ5A 1S0DA 1H6YA 1ZYBA 2QFEA 1V0AA 4WM8B 4Z8BA 1ZBA1 2D5HA 1QJX1 3FJSA 4PHZA 1US2A 5A7SA 5AVAA 1LHNA 4BMBA 1W6QA 1HX6A 2LTNA 1RITA 1DLCA 3KSCA 2IXIA 3NMBA 3PJYA 4IL7A 1QJZA 2ZGOA 4YGCA 3U78A 4GB31 4YW5A 1BEV1 1O3TA 2AACA 4HANA 3AYDA 5CA6A 1FMD2 4KMQA 1ZBA2 2FDHA 1KJLA 5A80A 3ZYGA 1QQP3 1PO22 3D82A 2VOTA 4QQHA 1SQ4A 2BV4A 3L2HA 3WDUA 3WSOA 1YIFA 2KR2A 3RWNA 1FMD1 4CEYA 4XOGA 1REEA 3GCXA 1AHSA 4A7ZA 5DAQA 3LZZA 2JB4A 1PZ8A 2WIIB 5EP9A 1ACCA 2A6ZA 4XFFA 1X7NA 2F6BA 2NN8A 2VBDA 4PIXA 5A70A 3SEEA 3VBSC 4QDQA 3ACIA 1F9KA 2FHRA 1RJ8A 4YRDA 1DGWA 1RUJ3 2R042 2QQVA 5IVYA 3GJAA 3WUDA 3MF9A 5DPNA 4FTBA 3MYXA 5JPMB 4O9EA 1O7FA 1OF4A 4IEQA 1AL0G 1CAXA 2W68A 4IEOA 3OGGA 1AR73 1HXS1 4CUCA 1Z7S1 2VG9A 3T4HB 2JDKA 2VBPA 2WKKA 3DPRC 4QPYA 2Z5WA 2D93A 1RUF1 1WD3A 5F7UA 3TEXA 1OA3A 1NXMA 1V6OA 2RM21 1UX6A 2D98A 1QDCA 2VW2A 1I1EA 4IDZA 3IDEA 4ISRA 1LJ7A 4QGNA 5LEJA 3N7KA 4OCTA 3HD8B 3QLQA 1OH3A 5JXHA 1CR7A 1QJX3 2VZVA 4QQOA 1Z78A 4YARA 2XWJB 3K4DA 3H8RA 1R081 1HIXA 4E2GA 5F32A 2QZ3A 4FVVA 5FZOB 2XJTA 5FZ7A 2BNMA 3PVOA 1Y3TA 2YB7A 1N3QA 4O9GA 1LEDA 3HN3A 1D2QA 1UN1A 2OUHA 1MEC1 2VVFA 2W1WA 4BXFA 1UAIA 1EUUA 2PHFA 4L11A 3S7EA 4DEQA 3PUSA 5E8AA 2B45X 1ZBE3 1LTEA 4N8MA 5D21A 2WT1A 3VDDA 5FZ4A 5CISA 4Q4V3 3MICA 4RFRB 1OT5A 2QQPA 2AEZA 3IZOA 2VU9A 1ULFA 2WS93 1XNCA 2V4AA 2JEMA 3HNYM 3PVEA 1UWWA 3JB4C 4IESA 4JTNA 5CVRA 2EXHA 2BPA2 1ZNPA 1QNWA 4K1YA 1CAVB 2RM22 3ZKYA 3B00A 1X33A 3CBNA 3BIWE 2ZKNA 1H8TB 1C8M3 2BVBA 1FV3A 5FP3A 3R0RA 5T3NA 2PHLA 3ZIXA 4FPCA 1LB2A 1R082 1UXZA 1YLLA 1DYKA 1OFSA 3JB8A 4AZZA 3J9SA 4NHMA 3ZX7A 2WINB 1H9WA 3T0BA 4P9YA 1AR71 1HXS3 3U1XA 3AP4A 4XJZA 2R49A 2KD7A 2ZMNA 2Q30A 3EJKA 3VV1A 1U5IA 4QXCA 5IVEA 2HWE1 3NJXA 1F4AA 1HN0A 3HR9A 4LBOA 4M3CE 4K8FA 1LOGA 1MQTB 3WF2A 2BBVA 5LW9A 4FPJA 3IIAA 2DDUA 2EIGA 4N53A 4F8AA 3W5NA 4XFGA 2K9ZA 4UF0B 3OCPA 1AL23 4HL0A 4CCMA 4Z92B 4MHRA 4I2OA 3LA2A 1J1LA 4D7TA 4QGMA 2P3IA 1H1MA 2R043 5G05L 1C1LA 3FC0A 1EAH1 4LIVA 1JI6A 1YXWA 4FXGB 5FZFA 2CWSA 4XDPA 3U4SA 2GMPA 1IHMA 3RRDA 5ACA2 1ENXA 3H3UA 1XBFA 1S0JA 1X50A 5FYZA 3SXWA 5LRRA 5FY4A 2WZR1 2BNOA 5IFTA 4LEJA 2BFUL 3NV3A 3JCIA 4K6BA 1AR83 5BNPA 2ZJCA 5F6KA 1IKQA 5FY7A 1O59A 3UKVA 2MEV2 3C2UA 3NKGA 4IV1C 4JX0A 2AH2A 4N90A 4FPHA 1V6LA 1COV3 2G4IA 4DXSA 1UKGA 3QBQA 1WCKA 3WDYA 5JSPA 4WM8C 3RZZA 2JICA 2YGLA 2IXJA 3I54A 3ILFA 5CB7A 3GHMA 2C1FA 5F2WA 4TTGA 2Y64A 3HIFA 4DUXA 4K3UA 2ZA9A 3T3YA 1K3IA 2C24A 3RZGA 2VVDA 2FQPA 2DURA 3WXPA 3AKRA 2EXJA 4B4PA 3VZLA 1GWMA 4HPKB 5JWPA 5FYYA 4O61A 1DQ2A 4YPJA 5JOYA 5DAXA 4BK5A 1D4M1 2ZX3A 2D44A 4QPGB 2R072 1GZWA 2HEYF 4Q1RA 4EE2A 3POYA 3THPA 3E6DA 4AHZA 1UZWA 1VB4A 2ILMA 1W03A 2DVDA 4K40A 1OLME 4XJWA 3SHRA 1AR92 1D4M2 4B7KA 4QGLA 5EWSA 1GNZA 4AVSA 2JENA 1JXNA 1YFXA 4C1WA 4YVSB 4JHZA 3LIGA 4ARYA 5FP4A 3AKTA 4Y4YA 3V0BB 4AFBA 2DCYA 3WP4A 4PI2A 4A6OA 3VBUC 1RUG1 1AR91 1S0FA 2GNDA 2WZR3 1OOPA 3FLRA 2PHTA 4AFAA 5T5PA 5JSOA 1B35A 4RHV1 1TMF2 4BYYA 1LHWA 2B39A 4O65A 3MPBA 2QJVA 5A3TA 3GZEA 4Q8LA 2AUYA 2R071 4ARXA 4NJ4A 1DFQA 4ATEA 3DGTA 1LRHA 1TMF1 4BA6A 3WG3A 1ZZ7A 3BU7A 1LOAA 4AR2A 4IGPA 4MGQA 4FOWA 4NN0A 5BNNC 3UGFA 4NPRA 1JOJA 3U4XA 3Q8BA 1RUE3 4LLOA 1ODMA 1GQPA 1WCDJ 2ES3A 1GP5A 3MIDA 3VBOA 3TNPB 2W92A 1QWRA 1CN1A 3MO4A 5G04L 3VZMA 3POFA 4XFCA 4XQDA 1YQ6A 5E1RA 3VKNA 2BEOA 1W3XA 2F4LA 2E9QA 3I2KA 3GBWA 3RI8A 1FATA 4LJHA 4XXAA 5JLVA 5KR7A 1RTVA 5LBFA 2VUDA 3M4FA 4KH9A 3RS6A 3LA3A 1QHDA 3NV2A 3VHNA 2VMGA 3RZMA 3GALA 5F3IA 3T30A 3RI9A 1QQP1 1O4TA 1ULEA 3OUJA 1PZ7A 2ZGTA 4XQWA 4Y5SA 4YM1A 1W28A 5KHHA 4CDQB 4NIIA 3I3MA 3ELNA 3UV9A 5JOZA 1BMV2 4MGKE 1ENQA 4QWNA 1H2NA 3CMGA 4CUBA 4LTAA 2UYBA 2YBSA 4KWUA 4V2VA 5LB6A 4D94A 3N3HA 1NY71 2A3WA 2CDOA 3E97A 4J1WA 3S6PA 1JZ5A 3H8XA 2Z69A 3DCQA 5BNNB 2CGOA 1PNFA 2RMU1 3O1RA 4CU9A 3UGHA 1YIPA 2NM1A 5BPXA 1NKGA 4XCAA 4CRQA 4ZS2A 1APNA 5GZCA 4NIDA 1UOJA 4QKDA 5BYNA 4DUWA 3JBG3 1JHJA 4HN0A 2HWD2 2B7YA 4R9CA 4KU8A 2PAMA 3GZTB 2BNNA 1AF9A 2LS6A 3KM5A 1LHOA 1PMJX 1DBNA 5A33A 2D6NA 1BBT1 1V9U1 2OT7A 4OFGA 5CBLA 3KHCA 2VMHA 3H0OA 5FYTA 1MS9A 4UFJA 3MDPA 4BQ4A 1CVNA 2BW8A 3HPNA 5A6ZA 5KBFA 1BMV1 4GMP0 1R64A 1NQDA 4QB6A 1QJY1 3FL7A 2GSYA 3GGLA 3MV01 5KC5A 1R083 3OSDA 2A73B 4UFKA 5J1XA 4PIZA 4XF4A 3BCWA 2BYVE 4FSJA 4LKSA 3HT2A 1I6XA 1W8TA 4BQ2A 4AI3A 2BOJA 4B1MA 1MQTA 2W1UA 1NA1B 3SLIA 4Q4Y1 1MVQA 5A32A 4NPMA 2P3JA 3LEGA 1VBA2 5LY1A 1N3OA 1W8WA 1OBNA 3JUUA 1W2UA 3VKLA 2QNKA 2JDYA 4L0PA 3FBMA 3O1PA 4N9IA 4XZPA 2ZX2A 5KWRA 4Q4Y2 2ZABA 1O8SA 4WM7B 1Q56A 1C5IA 3CDZB 2E7QA 1VBB2 4R9DA 4XHXA 1YC61 1ENRA 2RMU3 1HB3A 1UZZA 1NQJA 1JZ7A 3FFQA 2R16A 1VMFA 4OLLA 5D8AC 1S2EA 3INAA 4CXWA 2A6YA 1WKYA 4CTEA 4RL7A 3GBFA 1A3KA 2OZ6A 3VBHC 4LITA 4E27A 5FZ3A 3OD4A 2E53A 3ZSJA 4XF1A 2HLEA 3OUIA 1LCLA 2ZHNA 2OS2A 1DQ6A 3LDBA 2WWJA 1SFNA 4YW2A 4AWDA 4Q4X1 4RR3B 3LF7A 1RUD3 4ZZ5A 4OI4A 3W20A 1ZVFA 1ZREA 3IPVA 3ZXAC 2Y33A 3B3QE 5HBAA 4AI1A 4AE2A 2WNUC 5C71A 3ETQA 5FREA 1YI9A 5CADA 4XF0A 2W94A 2VCCA 3M2MA 1DLLA 5BNPC 1PX4A 2OPWA 1WW7A 3QH6A 4COZA 1W8FA 2E32A 3R4DB 4IV1A 1EAH3 1YUDA 2V5DA 3W9AA 1LHUA 1QJFA 5L73A 3VDAA 2XQRA 5C9AB 1JYNA 2WLPA 1MQTC 1E57A 4IV3A 2X09A 5BXXA 3T2PA 1MZ5A 2GMMA 3P1IA 3OPZA 1UYZA 4GH4A 4UF0A 5A33B 5FO8B 2W95A 4EJRA 3O1VA 4GQ7A 5FYMA 4TZDA 5F8PA 1HRI3 4LE3A 5FMOL 3RPQA 4G3YC 4BIOA 4AI0A 4AAXA 2WJSA 4KWJA 1HN1A 3HMYA 4CDQC 1SLTA 5A3NA 4LO6B 1GQHA 4FI9A 4FAHA 5C4WB 4FPFA 4P14A 5F1RA 3QACA 2BDRA 2P1BA 1UNBA 4YM3A 5IT6A 1BYHA 3H9AA 3ZKUA 3KVBA 3VBUB 3AKPA 4M4PA 5C8CA 1FMD3 4COVA 5D8AA 1QU0A 4IV3C 1RL3A 3VB9A 5LA0A 2GN7A 3NAPB 2JDMA 4GH4C 3Q8CA 2DBNA 1IPSA 3ES4A 3WG1A 4Q4X3 2QTWB 3MIBA 5JMOA 2O14A 4PF5A 4TSVA 3ACLA 3E6BA 2D6MA 2W3JA 4GJYA 1FPN2 2CTVA 1I9RA 4SBVA 4YW3A 2JDUA 1RUJ1 5C70A 1CZVA 2BTVC 2VZ1A 1YHFA 4CEYC 4I0WB 4YSFA 4K9SA 4JGZB 3I8TA 4BE3A 4A3XA 3AZXA 3RQ0A 5C7GA 1M06G 1RUF3 1UX7A 2RS33 5FZLA 1RC6A 3U0ZA 1E5IA 2GALA 3VZOA 4GZ9A 4EN8B 3R05A 4Q4W2 1AR62 3P6BA 2X8KA 1XYPA 4W6YA 5AFBA 1BVP1 1KFXL 5LBBA 2G1MA 1BJQA 1O91A 4A42A 1XB9A 1SDDB 3IDBB 1QJU2 1UW8A 1NLQA 1PK6A 4AYUA 3FUOA 2YV8A 4HK8A 3A22A 3SCHA 3ZPOA 1U5ZA 3K3NA 3OYWA 2TEPA 4AK3A 1PVC1 3N9MA 1STMA 2WDBA 5AC93 4X8NA 4XFIA 4GB32 2D6KA 1QXJA 4XDQA 1C3HA 4I3GA 1MZEA 3MHZA 4LO4B 3USUB 1B09A 5FLHA 5FPUA 5A3LA 2Z79A 4MZUA 2WNVA 4BCUA 1Y9QA 3AX4A 1F35A 4MADA 5FPVA 1DCSA 1PVC2 2YPJA 1SCRA 3POBA 3PU3A 4QPGC 5FZAA 1KFUL 2DVBA 5C8CC 1GANA 2DFCA 4Y22A 5C3SA 4DXTA 1AR61 4Q4W1 4W8JA 2WWSA 1MPXA 1W04A 2AGSA 2RVAA 1QGLA 1SG3A 3OBTA 4FFFA 4HZFA 4Q26A 4PQQA 3VBFA 3VHPA 1WW5A 1K42A 2R0FA 1CWPA 1LGBA 1HV1A 3JBG2 3K4AA 3WG4A 4BXSV 3ILRA 3Q8AA 2CNAA 2JG9B 2RDNA 2VOXA 2XJSA 4IE0A 1C5HA 1KXGA 5FO7B 4AHWA 4WZFA 3AFGA 4H55A 4COYA 2RS31 1BZWA 5F9TA 3DKWA 4TLFA 3VBRC 2HWF2 1RYYA 5F2SA 4OHVA 3ZFEC 2WWUA 1HRV1 1ULPA 3IDAA 2ADEA 4QB1A 4RS5A 1GOFA 1Z0HA 2DU1A 3QH7A 2YY1A 5FV3A 5A3WA 3CEWA 3E1F1 2QQIA 3IBMA 4XBQA 4KG8A 5ANNA 5T50A 4ASMB 4CDWC 3ZFFB 5JUVA 1W9FA 1AYN1 1GNHA 3ATGA 1OOPC 4ZXKA 1OD3A 1T6GC 2RV9A 2VZUA 4KBZA 1ZZ6A 1FOD1 2BVVA 4PT6A 5DG2A 3BTZA 1OPOA 3AJYA 1DIWA 4R9BA 2KM2A 2RS13 1RMU3 1S0CA 1YJKA 1POV0 1VBA3 1ZZ8A 2PAKA 3KB5A 3O0XA 4BIFA 2ZAHA 2AR6A 2P34A 3N9OA 3T0DA 5GZDA 2RS32 5FMDA 3CO2A 3PVNA 4N43B 2ID4A 1ODNA 2HWF1 1JW6A 5ACA3 3K2OA 3AL5A 1QXPA 1W2TA 4B8EA 4XETA 2WQ4A 4NWWA 3ZXKA 1EY2A 3ROUA 4QPGA 4FQZA 1SFYA 2J42A 4MHUA 2BFUS 4RQPA 3KF3A 1CAXB 1B35B 2ZPXA 2QCSB 2OKXA 1KD7A 3LEKA 1QJU3 4AQ2A 3A23A 4F3JA 4CCNA 5FP9A 4MGTA 1V6KA 1AYN2 4FPGA 1W39A 1HJFA 4NWVA 5J09A 2YFUA 4Y4RA 2GMEA 4MH0E 4RR3A 3A21A 1P8JA 2W0XA 3EBRA 3LPFA 1GMMA 1GUIA 1NCRC 4FPOB 3TN93 2SLIA 2I07B 3AP6A 4UFMA 3WW3A 4YM2A 1Q8PA 1POV1 1H8TC 2B4KA 2ZGPA 4DY5A 1SPPA 2DCKA 3MW4A 4CDXC 5CFDC 5JCTA 3ZFEA 1I5ZA 2IUWA 2CY6A 3GF6A 4GKYA 1V9U2 1DZQA 1U5XA 3JD73 1POQA 5T5JA 2VZOA 2Y26A 3MW3A 3N9PA 3L9JT 3W21A 2GC3A 3NJVA 1QOTA 4ORFA 5L7OC 5IAXA 5JI9A 1H4HA 4BJ0A 2DVFA 3LDRA 5FZCA 1RUI3 1Z7S3 3VHOA 1G9CA 2BRTA 2C6SA 3ZYHA 4BU2A 2XR4A 2WFF2 1QNYA 3ETPA 2WO7A 4KI5M 2ZGLA 3TEWA 1UF2C 4YG3A 5ACA1 3GJBA 4ES9A 1MS1A 1NAEA 3HNBM 5K7PA 4P02B 3O14A 5A7PA 3WP3A 4JRLA 4KNCA 2IXCA 2JE7A 1X8MA 2W91A 2WYSA 3NV4A 3EXUA 5C3QA 3WF0A 4QPWA 4UXAA 4S2HA 5GALA 3KT7A 3LFMA 1OC1A 2JDPA 2EVXA 1WA6X 1TME1 3OB8A 1E5RA 3O0WA 4LOTA 2DFBA 3QOPA 5GJ6A 2BWAA 3T1MA 2HKXA 5J98B 4FT8A 4INDA 2NYYA 4Y5TA 3BI3A 1GOGA 1H9PA 1CX4A 3NRUA 4C0HA 3HQRA 2HWB3 3I3QA 1D0HA 1PM7A 2VQ0A 3FHAA 1LOCA 4NR1A 1K5MB 5I0UA 4XABA 3SKVA 4Q0SA 1GOHA 2XBO2 3H7JA 1MVEA 3VBOC 2VCAA 4WVZA 1WBLA 4YW7A 1KQRA 1W9SA 4H7LA 5FMCA 3VD4A 3K77A 2ZXQA 2VUAA 2VW0A 2XBO1 5JI7A 2EIDA 5BV6A 2IFRA 1RINA 3KCXA 5A3UA 5IVJA 4CE8A 2HBUA 3EO6A 1OQEA 5CU1A 3ZYFA 1QOOA 1KITA 5DZFA 2D43A 4K20A 1CJPA 2OXBA 2VR4A 3VD3A 1VBE1 3J8F1 5ERLA 4GJZA 4UBHA 2MEV3 5FZHA 1RXFA 5DXDA 5FOBB 5JZGB 1DQ0A 1RVF3 2JIGA 1CPNA 3BODA 4LBNA 1GFF2 4UFLA 2D5FA 5FRAA 5DAVA 3B01A 5FXZA 1W99A 1NZIA 2C4XA 3G7DA 3J8F2 4JQTA 2PTMA 1BBT3 4UW6A 1RUNA 4Y22B 1CD3G 3GHNA 2RS52 2VJXA 3B93A 5I91A 3DKQA 4FPEA 2O0OA 2P5BA 4O7XA 4HKWA 4XJ8A 5C33A 1G9FA 2A6XA 4AQ6A 2GN3A 2HJIA 1LULA 1UU5A 1XE0A 2AC1A 2JKBA 3BTAA 3M3OA 4JGYB 3POJA 4IEWA 3A0NA 5FXVA 3HJRA 4HT1T 5EXOA 5FPXA 4PBOA 3AM2A 1WW6A 1CQ9A 3ABZA 3OEBA 1HQLA 1UOGA 1AR81 4CP1A 5F3EA 1Q8SA 4JGZA 3PUIA 3FZ3A 3RGBA 5J3UA 3D4KA 2E7TA 1FPN1 5IYYA 3ZM8A 3VBFC 4MXWA 4DXZA 4AW7A 3T09A 2YPDA 4GMP1 4RQPC 4CUGA 3MV11 1FT9A 1KS5A 2UWAA 4OZOA 5DN2A 3UJOA 5JOXA 1EPWA 1JYVA 1QQP2 1WMXA 2JDNA 1F15A 2FCVA 3WNNA 4OI0A 4CCDA 3ZFGC 3ZFFA 4QDSA 3S5QA 2VXRA 5T52A 5JPNB 1PO11 2OIIA 3IDCB 2ZZJA 1E5SA 4QX2A 4OQ9A 3FUQA 5I0DA 1VBE3 2VOWA 1F5FA 4WVVA 2WNVC 1CONA 1NT0A 1W2AX 1W8OA 3I59A 1QJX2 2BZDA 2CL2A 5FZBA 3VD5A 3V0AA 3OPWA 1Q8OA 2G9GA 2R7EB 1R091 1EV13 1X9TA 2RMU2 3BVCA 3VDCA 3N7MA 5FCCA 2AENA 2C0ZA 1WLDA 3QCWA 4WM7A 3CNAA 3U75A 1D7PM 3UKNA 4BPZA 1OD5A 3USUA 3E5QA 5CEHA 1PIV3 3FMGA 3HAGA 3WD5A 2WQZC 5HCAA 5HI0A 1ASJ1 4P9IA 1IKPA 1RUE2 2WABA 1PGL1 4JKKA 3O1OA 2WO3A 2XL9A 1WCUA 2E63A 1WLTA 2A75A 3K48A 4OMDA 4QXBA 2HWD1 1CIYA 2ZGKA 4XUOA 3WDXA 2ZCWA 4XQ4A 4I0AA 4AEJA 5E16A 3LE0A 3PUHA 3LDKA 1UZVA 2HWC3 2VQUA 4I30A 4QKNA 2XOMA 1WW4A 2ET1A 4PF1A 4XUNA 3VBFB 1AYM3 1OUXA 2XB6C 1MS5A 1X9PA 4UFIA 4AEDB 4BOWA 1EUTA 1GZWB 2W1QA 2ZACA 4HMZA 3VL9A 4BQ3A 1VJ2A 4OHYA 5C4WA 3WZ1A 4CPBA 3PIJA 3B02A 4AOCA 4RFT0 2G9FA 2JX9A 4FOYA 5A3PA 3ZXFA 4BQXA 3ORJA 4BM8A 2DTWA 2C5DA 5CG9A 2FCUA 1UL9A 1WMFA 1SPPB 3WF3A 1YJLA 1BBT2 1HXS2 1VPHA 2ZZQA 3KQ4B 1HQNA 1PGL2 4NHLA 4AEDC 4ZU5A 4NIAA 1S2KA 3JZVA 3GYDA 1YEWA 3RYRA 3ZN6A 1O5UA 3KLSA 2W46A 4KU7A 2D6OX 2GH8A 1W90A 3HOBA 5FJHA 4M0HA 4IE7A 4DIQA 4HSLA 1OVPA 1R093 5LA1A 3PDQA 3BYWA 1T6BX 3V64A 3M3CA 2DYCA 3KZ4C 5F5QA 3ZN5A 4CDUB 5FY9A 4HSJA 4AHYA 5FY5A 2ERFA 1Z7S2 1AX1A 3BIEA 3CJIB 4YVWB 2ZX0A 4FCAA 4B1LA 2GP5A 4LOSA 1VIWB 2ZTNA 4XAAA 4CU7A 4UYBA 1GNYA 2ZBJA 1BKZA 4HLTA 4CCCA 3MEPA 4MXWB 1Y9MA 5HCFA 2CAVA 2QQUA 3H50A 1GZ9A 4PIYA 2DF7A 1HLCA 2PMWB 4LKFA 4JDOA 4XBNA 3AP7A 5EZWA 1PK6B 4FFHA 1X8EA 4MGIE 1CAUB 2C9AA 1CZTA 1DGLA 1GU3A 3CZUA 4UW3A 4HN1A 2Q1MA 2C9KA 1DU3D 1H1AA 1JBCA 2Y6HA 4LLFA 3U11A 2H0VA 2F17A 3ZYPA 2DCTA 1S0BA 4WVWA 3O1SA 4OYUA 3PURA 3W59A 1S0GA 5JIAA 3M3IA 3AYAA 2VNVA 3PVBB 4QT6A 1ULDA 1O5LA 1XC6A 3H3ZA 1K12A 2VULA 1QKQA 3VKOA 4G4FA 4Y33A 5CZKA 2EALA 2ZOEB 4S2DA 1KEXA 1OSGA 4M3CA 5HCBA 1URXA 2Z4FA 3ZXJA 4DOUA 4DZGA 1TZOA 2IFWA 4KQ7A 1ZRIA 2VTXA 1QJY3 3NNGA 4A4AA 2VNGA 2XKPA 2BWCA 4ZZ8A 5KXEA 2ZGRA 1QEXA 1BXHA 2LROA 4YZ1A 1BHGA 4N53C 4LO7A 1TQ5A 2XXZA 2RDSA 3POIA 2XVLA 3HEIA 5I0RA 3NSTA 1JZ8A 1HB4A 1MR5A 3PUQA 5DDJ3 2P3YA 1F5JA 2XHKA 1RUH2 5EPAA 1NLRA 4AGVA 3ME2A 1FI2A 2R063 2W2IA 3HBKA 3OYWB 4MO3M 4EN6B 2OX0A 5JZGC 1AXYA 4CUAA 5IVCA 4QHOA 3VL8A 1G86A 5CFCB 3N4MA 5A3OA 5FR3A 5HXVA 2ZGSA 3K3OA 1QH6A 3I2FA 5L7OB 2VTXJ 1JOBA 2PQSA 1GWLA 1TEIA 1MZFA 2D97A 2PLV1 4XFBA 4NRQA 2PQQA 2JB8A 3ON7A 5FXXA 1A78A 3OGVA 1XNDA 3N7JA 1OFNA 5IUQA 1SACA 4CEWB 5IATA 3T0AA 1OVSA 2RDQA 1ST8A 4Y1XA 1H0BA 5T5LA 2XLFA 2Y6FA 1RUC1 5ABJB 4JGYA 4C0BA 2VC9A 3KGLA 4E8CA 1NCQC 4ZU4A 2WRAA 3P3PA 5BY5A 3VBOB 3DEMA 4KG0A 1RUH1 4AXOA 3N9NA 2WT0A 4YZ5A 5J37A 3NKTA 4TN7A 1X36A 2ETEA 4LR4A 1K5MC 3IIIA 3OY8B 4FOQA 1BVVA 2J1UA 2OVUA 3AXEA 2MEV1 3UGGA 3TBDA 3KQRA 1PNGA 1SBEA 2YBKA 3TB0A 4D6QA 4Z82A 2JG8C 1VRH3 2FDKA 5H9RA 2AYHA 1WBFA 5FZ9A 5LATA 3POSA 1MEC3 4BLIA 3IM0A 1LR5A 2D40A 3LFIA 1HJGA 3OGRA 3BUCA 1UZ0A 5FZ0A 5FBJA 3B69A 1ND3A 4GKXA 2RS12 5EJ1B 3DUIA 4CCLA 1IS4A 4OULA 2O8QA 5B4XA 3FLPA 4R52A 4DUVA 1KJRA 4FO9A 4XHBA 1JYCA 4M00A 1KRIA 3OOXA 3VBSB 1D2SA 1LODA 1QJU1 3AK0A 4Q1PA 1OOPB 1SFPA 3N9LA 4XJ9A 2TBVA 5T54A 2WZ8A 3ZFFC 1UYYA 1V6NA 5A1AA 1S1AA 2ARXA 1W6MA 3B9CA 1PIV2 3J26N 1R1ZA 3WF1A 4GWJA 5FDBA 4IV1B 2YBPA 3MPPG 1ZRRA 2OQ6A 4GD4A 5H9QA 3ZOIA 3UK9A 2B46X 4OI1A 4Y1UA 4JHTA 4NAMA 4XDOA 3RMYA 4BISA 4NIHA 3KV9A 3Q8EA 2BERA 4AVBA 3I7DA 1RUH3 2Y38A 3PLQA 1UYPA 5HV0A 1QH7A 2MHFA 2QQNA 2VE1A 2G9ZA 4OUEA 4QX8A 4R4ZA 5F5IA 4AL9A 4BMEA 1AYM2 2VXJA 3MBWA 1PO13 4FBFA 3DL3A 1AJKA 2Y8KA 5IAVA 1IS6A 1UU6A 3QD6A 3SCFA 4AGGA 1TNFA 1V9U3 1YCIA 2VW1A 1IQDC 3BKZA 4NPLA 2Y34A 3B5LB 3N36A 3N9QA 1XSQA 2ZHLA 4NHXA 1F4HA 3RZJA 3URFA 1UCXA 4Y26A 1GR3A 3D5OA 1XNKA 1NA1A 1PIV1 5FJKA 2J1AA 4BQYA 5KC6A 1ZBA3 3ZN4A 2WNEA 2XMLA 1VB2A 4BK4A 3AB0A 5I93A 4RA0A 3MI8A 5C6CA 3AC0A 1C4RA 3AYCA 4IEXA 3JU9A 3WVJA 4ONUA 1HRV2 3R4UA 1PHMA 3GCWA 2FDGA 2I2SA 1SDWA 5DUXA 4B4RA 1XNTA 4CXXA 4XF3A 3D3AA 4NO4A 1AYM1 1LNSA 4GA9A 5FYBA 3WF4A 4Q4Y3 2A3XA 3LA7A 4LQRA 4UFHA 4Q27A 3SC7X 1JZ3A 5DMYA 3V0AB 1GV9A 2WT2A 2Q8EA 3I3BA 2EA7A 5C3PA 4QX3A 2QQOA 4LO5B 1DGRA 1N1VA 3AZWA 3OY8A 3SH5A 3WNKA 4DEVA 1ONAA 1UZYA 2JE9A 4RGKA 4X8PA 4PLOA 3TEZA 1COV1 1OA2A 3FN9A 1G9DA 2VPVA 2CGNA 3WHUA 1S2BA 2YROA 4XIOA 2HWB1 3OBAA 5JDBA 4QXKA 4PDWB 5A6XA 1W8NA 3O0VA 5F5CA 4CCKA 5C9AA 1I3HA 4S2GA 5FPZA 4CEWC 3CLPA 4IE6A 1FXZA 4GULA 3PJQA 3ZO0B 4DMIA 2Q8DA 1IG0A 3TYJA 1TNRA 5F5AA 3H7YA 3ZR5A 1XRUA 3NV1A 2B9VA 4CEYB 3VBRB 5FTTC 4QX0A 3SCGA 2A71A 4B29A 3C7OA 3LQCA 2QZ2A 4N43A 3GM8A 3VLBB 2DVGA 4PDWC 2DWRA 4XYXA 2PA7A 2XUMA 2E26A 2R6QA 2TUNA 3TNQA 4FP2A 5BNOC 1CPMA 4Q4V2 4W6WA 5L9BA 3NAPA 3NWKA 1QJY2 3SQOA 4HPKA 1J3RA 3BOWA 1UY2A 2PYTA 3DYMA 3ZMOA 3LGRA 1DZRA 3NO8A 4CU6A 4Q4V1 4OUMA 1HV0A 2IVIB 3HBZA 3I2DA 5DQ0A 1AYN3 3T2QA 4L2NA 3E6CC 2F4PA 3SH3A 5IWFA 3BTXA 3VBHB 3WP6A 1FOD3 2HEVF 4Y20A 5FFOC 1LGNA 4V1PA 2E33A 1SLLA 2WA3A 4ES8A 2JG8A 4IGOA 4K21A 1QMJA 5GZFA 5KHIA 5EQUA 1F31A 3AMHA 3RFRA 4P9XA 1VBC2 3T2TA 1JU4A 2DVAA 3BN6A 3KGZA 5LZ6A 5FZ6A 5I0SA 3WV6A 4OQ8A 1PGSA 3AKSA 1DF0A 1W6OB 2V72A 2P6CA 4JCKA 3UYJA 2DCJA 1FPN3 1AZDA 1VBC1 3LSEA 3THDA 3RJRA 1TG7A 3IWZA 5H9PA 4AEKA 3VGIA 3AZVA 4FTEA 1UKRA 5LA9A 4FOVA 2I74A 3J7NA 4GAZA 4CCJA 1TME2 1JYTA 3FLTA 3JQXA 5KXBA 1MZ6A 2J1EA 2WFF3 3NL1A 4LBQD 1FAYA 1ND2C 2JG8B 3AL6A 3K51A 4BH9A 4LIUA 5ABJA 2NZ9A 2EXKA 5FKCA 1WMDA 4MLOA 1VBD3 1YFYA 2GNTA 3ZSMA 3PTRB 1CAVA 2GAUA 2RG4A 4XJUA 4X6QB 3ZSLA 2WUHA 1NCQB 1ND3B 4LKEA 5DZEA 1W6NA 1PMIA 3ECQA 4JAAA 5IVFA 1N1TA 2DUPA 3OJBA 3C8XA 5K4LA 2ZHMA 1DGWX 2YGMA 3HQXA 4MGZE 3FE5A 4MUVA 1UY4A 4KGGA 2HWC1 2FBEA 3BU0A 4N7IA 3OG2A 3M1HA 2A5ZA 1AXKA 5LBCA 2A1XA 3FHQA 5GLUA 4BQWA 1ZRCA 4DXRA 2EICA 5CIRA 4XXPA 5BNNA 1U0AA 2HWC2 4FXKB 4HETA 1V70A 4AI2A 3G6JB 2G19A 2GC2A 4IE5A 3ALQA 3J7LA 4N9HA 2YMZA 5E6HA 4BQ1A 1JU3A 2XVKA 3ACHA 3BOPA 2FMDA 3SITA 2VZRA 1VRH1 5FPLA 4YLZA 3S0MA 4Q8KA 5D1IA 4GWIA 3CJIA 4YVWA 4LK7A 3W5MA 4FPKA 2E7AA 1JYXA 5BNPB 1MS3A 2UWBA 1LEMA 3JXSA 3OBZA 4QPIA 4CP9A 3WDVA 4F7ZA 1D4M3 4M4RA 3TOJA 4ZS3A 1RUOA 1ENSA 3K75B 1UMHA 3DXTA 4M01A 2JDAA 3VBHA 4B7EA 1LECA 4DRVA 1DGRN 1RGSA 1I5PA 4EN7B 1PO23 4IEZA 3H1YA 2ADDA 4AEMA 2WNVB 4IEYA 2GP3A 3TEYA 5FKBA 1W9TA 2VM9A 1DDLA 4NE9A 1JS9A 1PZ9A 3AMPA 3HNMA 3RSJA 4LPLA 3VDBA 2VCBA 1W6PB 2JJ6A 2EIEA 2YZ4A 1W2OA 2IXLA 2QKDA 5L36A 4AVCA 1Y9GA 2FZ1A 3KT1A 3M3QA 4KL1A 2HBTA 4NAOA 4UW4A 2VOKA 3T4VA 5CFCC 3WQ7A 1WGPA 4CP9B 2GC1A 2ZEXA 1REFA 1RUJ2 5IW0A 3MFCA 1UYXA 1SZBA 4JV4A 1JUHA 4LA2A 4M3CB 3WLUA 3B94A 1R1A1 1ULGA 3MGUA 3AMMA 5F3CA 5JSRA 3MF6A 3H1MA 2RS11 4IEPA 3U37A 2FCTA 5FMOS 1AXZA 2ZEZA 5LWBA 5CKMA 3B7MA 1GQGA 3WNMA 3E5XA 1V6JA 4D7YA 1H1IA 3J7MA 1SBFA 1NOVA 3DN7A 4COWA 2OA2A 1W0PA 4D7SA 1W9WA 2ZMKA 3AP5A 4FFIA 3U07A 2ZEWA 4WVMB 4H3WA 1CAUA 2P17A 2QQWA 5A7WB 3WDTA 1RXGA 5IHRA 1GZTA 5FY8A 3WINE 2NPIA 4C1XA 5IK8A 3SKJE 4LULA 3DECA 2P3KA 1LOFC 4A3ZA 4ATFA 4E9KA 3WNPA 3LAGA 1PX3A 4H2AA 4XILA 3PNAA 4OHXA 5J48A 3RZKA 1L3JA 2Q8OA 3VBRA 3BTYA 4D6RA 1PO21 3ES1A 4XZUG 4OI2A 5FUPA 3H42B 1NE4A 1ZZCA 1SLCA 2VUJA 4XIKA 5EYYA 3HWJA 1UMIA 3ZVXA 4LBMA 1UIJA 4YGDA 1AJOA 2ORZA 5DDJ1 3RWKX 2W87A 1OPMA 1GBGA 2OQ7A 2JECA 1T2XA 1RUF2 3AMNA 4L99A 3EYPA 4URAA 4HVQA 2WC2A 4GMP3 4MXVA 3ZDSA 5ABJC 5KXDA 2UYAA 2C26A 4OMCA 1OF3A 5FXWA 2A3YA 1L7QA 2ZGUA 5DDJ2 1QJEA 3P3NA 3ZYIB 1XPWA 2GDFA 2R041 4KWLA 4QKBA 4QU2A 3VHRA 2WN2A 4META 1VRBA 4C90A 5GZEA 1GLHA 3PUAA 5JR2A 1IS5A 4N7UA 5CKQA 3N35A 4S2FA 3CJXA 3LKJA 1AUYA 4LUKA 1V00A 3VZKA 3ITQA 3WX5A 3H8OA 2P6HA 3ZDVA 4LORA 4RQPB 1MS4A 5FAXA 1S55A 2RJKA 4D3WA 4QU1A 1HW5A 5FY1A 4LHSA 4BHPA 1GICA 4J25A 3BPSA 2RR12 1HDKA 3SMHA 1Q5OA 3VN4A 3BGAA 4P9JA 2WA4A 3OPTA 2XQXA 4CP0A 1W8HA 2GU9A 2HWD3 4HG6B 1UIKA 4WV8A 5FOJB 1Y43B 1JYWA 1BEV3 4E4SA 2RR11 4ASKA 4JGYC 2XPJA 5J96B 1YRZA 3ASIA 3IKWA 1BK1A 4AI8A 4LT5A 2XLAA 3OBRA 2HWB2 3KT4A 3C3VA 4QM9A 1RHI2 1H8VA 5T55A 2CWMA 4P9WA 2VBBA 4BZ4A 3RZLA 3I4IA 5A6QA 1TME3 4K7JA 4B3NA 4W65A 4YYOA 3CHXA 3UETA 5GLWA 2R1DA 2GZWA 5IVVA 3H1WA 3RYPA 5AFEA 1WD4A 1DQ4A 2JE8A 4P9LA 2PHDA 4Q0QA 2HYKA 2CSGA 5EJZB 3RMXA 1VBD2 4CZSA 4U2AA 3MZHA 3VZJA 4L8QA 2VZSA 1S0IA 2DUQA 3I3DA 4PCRA 2E6VA 2PN5A 4NROA 1XNBA 2ARBA 3GNEA 4AFDA 4RS5C 4QXHA 2Y6KA 5APAA 5LK7B 2YXSA 2B42B 1RUG3 4GWMA 1XYNA 2HWE2 5DUUA 1VBB3 3MIEA 4IUGA 3V56A 1V6MA 2XBO3 4XUTA
chains in the Genus database with same CATH topology
1RMU2 5IK4A 5KHGA 3VDDB 4FAGA 4XPVA 5GM0A 2VOVA 2DV9A 1Q8VA 1AVBA 2QDNA 2R073 2YC0A 1RVF1 1ZBE2 1CIWA 2TNFA 4I01A 1SMVA 3SH4A 4YM0A 4Q29A 1N47A 2IC1A 1VBD1 4PDWA 3LOIA 1B35C 4R4XA 5GLVA 2PAEA 4CDQA 1C8M2 1LU1A 2Q5TA 3DPRB 1OMIA 4L9BA 1HRI2 2O8OA 2WS91 4CDUA 4URTA 3HN1A 1ND2B 2WZR2 4AVVA 1NG0A 4NVPA 1YWKA 1WUVA 4P5HA 2RE9A 4AGRA 3WHTA 4AF9A 1C8M1 1RMU1 1GZCA 4UW5A 1O3QA 4AQSA 4IERA 5GLTA 3ZMNA 1EAH2 1PGW1 1FNZA 4XBLA 4DRRA 3L2YA 5GKAC 4FTSA 2WL1A 2OZJA 3I59B 4JVAA 1MS8A 1XE7A 1DZTA 5FQ0A 4COUA 4XTMA 5KHKA 2H6BA 1RHI3 1A8DA 4QHBA 4WBBA 2GNBA 4ASLA 2WSUA 1XU1A 5FBZA 3NW4A 1RUI2 4EWEA 4RD7A 4Y5Z0 2R30A 3NVCA 4FP3A 5FLJA 2Q1ZB 1KDKA 3H8UA 4HVRA 4ITCA 4MVTA 4QPIC 1OLRA 1KDMA 1OLQA 1HQWA 1IS3A 1EV11 4LE4A 4DINB 1AR82 1GSLA 5BNOB 3PHMA 1RUG2 1J3QA 2LUWA 4QD2A 4QX5A 1EV12 1RUC3 3POWA 3T1LA 4RHV2 5C8WA 1V6IA 4DFSA 4GB33 4NHKA 1RUI1 1A6CA 3ZXLA 2B5HA 3VKMA 2ZHKA 1R1A3 5L7OA 3M7AA 5KXCA 1MS0A 4N43C 5I0TA 4EROA 5AC91 4Q0UA 3CL1A 4KBBA 3M3EA 1OKQA 4QMAA 4A7YA 1AX2A 3O5SA 5IK7A 1WA4A 1LOEA 3AXDA 2GNMA 3APBA 5EJ3A 5I8TA 1LESA 1SBDA 3B9IA 4LHKA 1UPIA 4U36A 5CG8A 2MPFA 1YNAA 2ZKLA 4I09A 4L97A 2ZX1A 1R092 1DG6A 2K0GA 2XWBB 4QM8A 3WOGA 3WQ0A 2RHPA 3IPVB 5I0SA 3GZAA 4HKOA 2IWGB 1TE1B 3MIFA 1DQ5A 4WM8A 2ZGNA 2JDZA 4YVSA 1BCXA 2E51A 2XJRA 3W58A 4XFAA 1COV2 3ENRA 2YHJA 3ZYRA 2D6LX 1BQPA 3WT3A 2DU0A 1FV2A 1W0OA 2X5IA 4YZ2A 1CAWA 2WSVA 4GWNA 4Q2FA 1J3PA 3ZXEA 2OUJA 3WDWA 4IEVA 3ILNA 3WY6A 3ZFGA 4C91A 2FZ2A 2VH9A 4R9AA 2ZAAA 1EPZA 1QOSA 2QDRA 5JVVA 3WR0A 1LENA 1NY72 2RS53 4AHXA 2Q0AA 1X82A 4JRAA 5J36A 1HRV3 1F2NA 2D6PA 1BEV2 3TWIA 2XG3A 4FPYA 1NCRB 1AR93 4QQPA 3M8LA 2EF6A 1A8MA 2D3SA 2H0BA 1G9BA 4IQPA 4M3CF 4AG4A 4R8HA 3VBUA 1ND3C 2KA3A 5C8CB 5CFCA 1H2KA 2BGCA 3D0SA 4YNIA 1VLNA 3ZFEB 1TMF3 3KD4A 4LBKA 4JQRA 3LOBA 2XJPA 4QPIB 4CP2A 2JG9C 4L92A 4LBJA 3ST7A 1NXD1 3WW4A 3ZIWA 1YFWA 2N7GA 5CFDA 4CDXA 5JAXA 5EFUA 5I8SA 2FMYA 2Y0IA 4Q0VA 1SLAA 5JZGA 2UY9A 3HT1A 4AVAA 1O4YA 1NYWA 4CDWB 4Z1VA 4LHLA 3ZSKA 2CAUA 1POV3 2ZGQA 1U5YA 5JIUA 3J4UH 3MIGA 2VGDA 3TN91 3V65A 3VZNA 3WW2A 2PLV3 4WVMA 4JC1A 1AX0A 4X6RB 5DG1A 4YFZA 2YYOA 2DUOA 2NMOA 4G9SB 1C8NA 1IPJA 5A32B 4EV0A 2O1QA 5JR7B 3OD0A 3TN92 2LM3A 4CDXB 5CFDB 3TAYA 2WNUA 3RYKA 1PVXA 3OGJA 2A70A 1K5MA 2W08A 3MLLA 5H9SA 2XJQA 4Q4X2 1VBB1 1ZZ9A 3S30A 1H2LA 1IQAA 1ZZBA 4GXLA 4YGBA 5JOWA 2A6VA 4KWKA 3NJZA 4I0BA 1MEC2 3AJZA 3R4SA 4EN9B 4A2UA 1SLIA 1XXNA 2VY0A 5DUVA 2JG9A 1ZA4A 4OZXA 4XTPA 4OUSA 1G8WA 4LBQA 3MLKA 2KXLA 2PHWA 3VUOA 2PELA 3WQ1A 3V0BA 2QE3A 2WLQA 1AR63 1FYUA 4Q4W3 2X29A 3PTYA 4H14A 1IOAA 4BLJA 3WCSA 2VQAA 2NQYA 3WW1A 2GH2A 4OVEA 1OI6A 1NLSA 1FX5A 2ZS6B 4Z2WA 5C4WC 2R32A 2DTYA 1QXRA 1AR72 1H2MA 1ULCA 2YUEA 4QQLA 5KHJA 2NP0A 3PMEA 2ZGMA 4E4ZA 1REDA 5BNOA 3WG2A 4DB5A 3ZYJB 1W6NB 4AFMA 1J59A 1SEFA 4PJYA 2BQPA 3MW2A 2PHUA 4LNVA 3IMNA 2Y0OA 2X5IC 1RUC2 4DQAA 4RHV3 5BNQA 1GYKA 1N3PA 1LKNA 1C57A 1C1FA 3LSDA 3S7IA 2P2KA 4OHZA 1SLBA 2JD4A 1NZCA 1JUIA 2PLV2 3BALA 2Z2SB 4IV3B 3KCCA 4W6XA 3USSA 3BB6A 4E4DX 4DY3A 1PK6C 2CV6A 1RUD2 4BWOA 1RIRA 3DF0A 1JTZX 5J7MA 3UJQA 1HKDA 4RR3C 4Y1ZA 5IK5A 2EXIA 5K0UC 4Y1VA 2LALA 1LOBA 2ZX4A 5D8AB 2PFWA 3OTFA 1EP0A 3ZSEA 2RR13 4CDUC 2XGXA 1QF3A 4MSVA 3UL2A 4LUMA 3LWCA 3JQWA 2XH6A 1N1SA 5TSWA 4FPLA 2D3PA 3ZXDA 5CNAA 4XW3A 1UD1A 1G6NA 2H6CA 4YZ3A 3RJ2X 4AEDA 1C28A 2OPKA 4WM7C 2D7FA 1OQ1A 2P37A 1AL22 4LBQB 1O3RA 4XEZA 2IXHA 5DUWA 1GKBA 2ATFA 3JD71 3RNSA 3AKQA 3ZXGA 2A7AA 4Y20B 4XE9A 4JGZC 2W39A 1AL21 2XLGA 3JBG1 4TWTA 3Q9OA 2VVEA 1O3SA 1VP6A 2V09A 2YDEA 2EAKA 3O7OA 1G9AA 1W6OA 4GH4B 3NAPC 5FQ0B 1XQNA 1ASJ3 4N53B 2PHRA 4IETA 3VDDC 1N1YA 1NE6A 3JD72 3IN9A 3CF6E 2NLRA 4JDMA 1H4GA 4YFWA 5BUVA 3E5UA 3LB9A 4GALA 4OHWA 3RG0A 1NA1C 1D4VB 2PHXA 2X5IB 1PVC3 3AP9A 2A6WA 1D0GA 2UWCA 4RS5B 4SLIA 3ZN6B 1F8VA 4J1XA 4CYDA 5K9YA 3EHKA 4LO8A 2QUOA 3ZFGB 5C9AC 4CEWA 4YG0A 1RJ7A 1MACA 4H7MA 1UU4A 3AYEA 3DPRA 3A4UA 2V73A 1FOD2 1NCRA 3FX3A 3SISA 1ZM1A 4WZCA 2WNUB 1CGPA 4PLNA 1W6QB 1IZ3A 1SCSA 1YO8A 3MIHA 4Y24A 3THTA 1VBC3 2B9UA 1WLCA 1ALYA 1IPKA 4YVSC 5JMCA 4D69A 2XJVA 1RHI1 1JHNA 1J1TA 4E2SA 5L19A 2R0HA 4YW1A 3WP5A 2WFF1 3D6EA 2ET7A 1ZRDA 1RB8G 2CYFA 2NMNA 1M4WA 5DZGA 2Z42A 3FHIB 4PQ9A 1Q3EA 1YFUA 2XL7A 1WMEA 4LA3A 4M0NA 1XE8A 2BUKA 4MYEA 1ZBE1 4I3PA 4Z07A 3FFZA 4JTOA 1LHVA 1LOFA 2K2SA 4E2QA 4PLMA 5EV7A 1VALA 1VBA1 1DHKB 4YZ4A 1DYPA 2XJUA 4CDWA 2WZPP 4F83A 3X29B 4MGYE 4LBLA 4YG6A 4NOTA 2X53S 2V5YA 3AFKA 5I8YA 1WCSA 1LGCA 1HRI1 3GBGA 1QDOA 1Q43A 3A0KA 1OHFA 4KGQA 1O4ZA 3AZYA 1Y7BA 2GC0A 1RVF2 4Y1YA 3KCYA 2VNRA 4RGGA 3CJIC 4YVWC 3AMQA 1QY4A 4LHNA 1IGOA 4MV2A 4IXLA 5K0UA 1CAWB 1KS4A 2UURA 2IZWA 1PGW2 4HKLA 4J6GA 4RSUA 4B4QA 2HWE3 4XJAA 1J58A 5SV8A 4IEUA 2WS92 5LEKA 2AREA 2ENRA 4XMIA 1W6PA 3U10A 3CU7A 3ZPYA 4GIQA 4A7KA 2W52A 3LCPA 2VMIA 3BPZA 4UBGA 1NCQA 2MNGA 1XYOA 2R061 4AQTA 1YI7A 1OQDA 1VAVA 5FLIA 5AVPA 1H30A 3PMSA 3EQEA 1CESA 2JXAA 2VNOA 2UY8A 3TRSB 3O12A 4QQ2A 5FO9B 2R062 5T5OA 5K0UB 5SV5A 3SNMA 1ND2A 2OW4A 1JH5A 3GZUC 1VAKA 3VBSA 2XVGA 5B2GB 4YW4A 5LK5A 3VKFC 4K1ZA 4XF9A 2RS51 4XFHA 4DS0A 4EWAA 3FBYA 4AVTA 1CJDA 1VRH2 3FWEA 1VBE2 1JYIA 4EWDA 5EYXA 4JDNA 4TYSA 4MX3A 1EYBA 4I02A 1Q8QA 2B8MA 2UU8A 5LRSA 3N7LA 4HK9A 2XKOA 1DQ1A 2EAAA 1VAMA 3WNXA 3OF1A 1JN2P 3DV8A 2OYZA 1YYNA 2R1BA 3D8CA 1S0EA 1W6MB 4ZU7A 3KS7A 1VR3A 4ISQA 3WCRA 4YGEA 1UPSA 1FNYA 5A3MA 2SBAA 4HVOA 3IT8A 2HEWF 2WFPA 5GLZA 1ZX5A 3R6SA 3RDIA 1UMZA 5K8SA 5AC92 2D3RA 2VECA 4HFSA 4HBNA 2ZMLA 1WLWA 1OA4A 3KMHA 4RGAA 3M70A 3MFAA 1ASJ2 5CAZA 4DPNA 1XU2A 1ZRFA 2Q4SA 1U12A 4ZKTB 1G7YA 1RUD1 2IXKA 3WUCA 5F6LB 3UKTA 3J8F3 4XMAA 5E88A 4FQ4A 1LU2A 3D0JA 1R1A2 2QVSB 3AZZA 2CGPA 2RJLA 3MLJA 4PBPA 4P9GA 4EN0A 1H8TA 1RUE1 4Q0PA 5GZGA 2DCZA 5E89A 2RM23 4AFCA 2I45A 2HWF3 1PO12 2AZ5A 1S0DA 1ZYBA 2QFEA 4WM8B 4Z8BA 1ZBA1 2D5HA 1QJX1 3FJSA 5AVAA 1LHNA 4BMBA 1W6QA 1HX6A 2LTNA 1RITA 3KSCA 2IXIA 3PJYA 4IL7A 1QJZA 2ZGOA 4YGCA 4GB31 4YW5A 1BEV1 1O3TA 4HANA 3AYDA 5CA6A 1FMD2 1ZBA2 1KJLA 3ZYGA 1QQP3 1PO22 3D82A 4QQHA 1SQ4A 3L2HA 3WDUA 1YIFA 3RWNA 1FMD1 4CEYA 4XOGA 1REEA 1AHSA 4A7ZA 3LZZA 1PZ8A 2WIIB 2A6ZA 4XFFA 1X7NA 2F6BA 2NN8A 4PIXA 3VBSC 1F9KA 2FHRA 1RJ8A 4YRDA 1DGWA 1RUJ3 2R042 3WUDA 3MF9A 4FTBA 3MYXA 5JPMB 4O9EA 1O7FA 4IEQA 1AL0G 1CAXA 2W68A 4IEOA 3OGGA 1AR73 1HXS1 1Z7S1 2VG9A 2WKKA 3DPRC 4QPYA 2Z5WA 2D93A 1RUF1 1WD3A 1OA3A 1NXMA 1V6OA 2RM21 1UX6A 2D98A 1QDCA 2VW2A 1I1EA 3IDEA 4ISRA 1LJ7A 4QGNA 5LEJA 3N7KA 3HD8B 3QLQA 1CR7A 1QJX3 4QQOA 4YARA 1Z78A 2XWJB 1R081 1HIXA 4E2GA 2QZ3A 4FVVA 2XJTA 2BNMA 3PVOA 1Y3TA 4O9GA 1N3QA 1LEDA 4DNYA 1D2QA 1UN1A 2OUHA 1MEC1 2VVFA 1UAIA 4L11A 2PHFA 3S7EA 5E8AA 2B45X 1ZBE3 1LTEA 3VDDA 2WT1A 4Q4V3 3MICA 2QQPA 2VU9A 2WS93 1ULFA 1XNCA 3PVEA 2JEMA 5CVRA 3JB4C 4IESA 4JTNA 2BPA2 2EXHA 1ZNPA 1QNWA 4K1YA 1CAVB 2RM22 3B00A 1X33A 3BIWE 2ZKNA 1H8TB 1C8M3 2BVBA 1FV3A 3R0RA 5T3NA 2PHLA 3ZIXA 4FPCA 1LB2A 1R082 1YLLA 1DYKA 1OFSA 3JB8A 3J9SA 4NHMA 3ZX7A 2WINB 1H9WA 4P9YA 1AR71 1HXS3 3AP4A 4XJZA 2R49A 2ZMNA 2Q30A 3EJKA 3VV1A 1U5IA 2HWE1 4M3CE 3HR9A 4LBOA 4K8FA 1LOGA 1MQTB 2BBVA 4FPJA 3IIAA 2EIGA 4N53A 4F8AA 4XFGA 2K9ZA 3OCPA 1AL23 4HL0A 4Z92B 4I2OA 3LA2A 1J1LA 4D7TA 4QGMA 2P3IA 1H1MA 2R043 1C1LA 3FC0A 1EAH1 1YXWA 4FXGB 2CWSA 1IHMA 2GMPA 3RRDA 5ACA2 1ENXA 3H3UA 1S0JA 1X50A 3SXWA 5LRRA 2WZR1 2BNOA 4LEJA 2BFUL 3NV3A 3JCIA 4K6BA 1AR83 5BNPA 2ZJCA 5F6KA 1IKQA 3UKVA 2MEV2 3C2UA 3NKGA 4IV1C 2AH2A 4N90A 4FPHA 1V6LA 1COV3 2G4IA 1UKGA 3QBQA 1WCKA 3WDYA 5JSPA 4WM8C 3RZZA 2JICA 2YGLA 2IXJA 3I54A 3ILFA 5CB7A 3GHMA 2C1FA 3HIFA 4K3UA 2ZA9A 2VVDA 2FQPA 2DURA 3WXPA 3AKRA 2EXJA 4B4PA 3VZLA 4HPKB 5JWPA 5JOYA 1DQ2A 1D4M1 2ZX3A 2D44A 4QPGB 2R072 1GZWA 2HEYF 4Q1RA 3POYA 3THPA 3E6DA 4AHZA 1VB4A 2ILMA 2DVDA 4K40A 4XJWA 3SHRA 1AR92 1D4M2 4B7KA 4QGLA 5EWSA 1GNZA 4AVSA 2JENA 1JXNA 1YFXA 4C1WA 4YVSB 3AKTA 4Y4YA 3V0BB 4AFBA 2DCYA 3WP4A 3VBUC 1RUG1 1AR91 1S0FA 2GNDA 2WZR3 1OOPA 3FLRA 2PHTA 4AFAA 5T5PA 5JSOA 1B35A 4RHV1 1TMF2 4BYYA 1LHWA 2B39A 3MPBA 2QJVA 4Q8LA 2AUYA 2R071 1DFQA 4ATEA 3DGTA 1LRHA 1TMF1 4BA6A 3WG3A 1ZZ7A 3BU7A 1LOAA 4FOWA 4NN0A 5BNNC 4NPRA 1JOJA 3U4XA 4LLOA 1RUE3 2ES3A 1WCDJ 3MIDA 3VBOA 3TNPB 1QWRA 1CN1A 3VZMA 4XFCA 4XQDA 3VKNA 5E1RA 2BEOA 2E9QA 3GBWA 3RI8A 1FATA 5JLVA 4XXAA 1RTVA 3M4FA 4KH9A 3RS6A 3LA3A 1QHDA 3NV2A 3VHNA 2VMGA 3GALA 3RI9A 1QQP1 1O4TA 1ULEA 4YM1A 1PZ7A 2ZGTA 4XQWA 5AFEA 5KHHA 4CDQB 3ELNA 3UV9A 5JOZA 1BMV2 4MGKE 1ENQA 1H2NA 4LTAA 2UYBA 4D94A 3N3HA 1NY71 2A3WA 4J1WA 3E97A 3S6PA 2Z69A 5BNNB 2CGOA 1PNFA 2RMU1 1YIPA 2NM1A 5BPXA 4CRQA 5GZCA 1APNA 5BYNA 3JBG3 4HN0A 2HWD2 2B7YA 4R9CA 4KU8A 2PAMA 3GZTB 2BNNA 1AF9A 3KM5A 1LHOA 1DBNA 5A33A 2D6NA 1BBT1 1V9U1 4OFGA 5CBLA 2VMHA 3H0OA 1MS9A 3MDPA 5KBFA 1CVNA 2BW8A 1BMV1 4GMP0 1NQDA 1QJY1 2GSYA 5KC5A 1R083 2A73B 4PIZA 4XF4A 3BCWA 2BYVE 4FSJA 3HT2A 1I6XA 4AI3A 1MQTA 1NA1B 3SLIA 4Q4Y1 1MVQA 5A32A 2P3JA 1VBA2 1N3OA 3JUUA 1W2UA 3VKLA 2QNKA 3FBMA 4N9IA 4XZPA 2ZX2A 5KWRA 4Q4Y2 2ZABA 4WM7B 1Q56A 1C5IA 2E7QA 1VBB2 4R9DA 4XHXA 1ENRA 2RMU3 1UZZA 1NQJA 3FFQA 2R16A 4OLLA 5D8AC 3INAA 2A6YA 4CTEA 4RL7A 3GBFA 1A3KA 2OZ6A 3VBHC 4E27A 3OD4A 2E53A 3ZSJA 4XF1A 1LCLA 2ZHNA 1DQ6A 4YW2A 1SFNA 4AWDA 4Q4X1 4RR3B 1RUD3 4OI4A 1ZVFA 1ZREA 3IPVA 3ZXAC 3B3QE 5HBAA 4AI1A 4AE2A 2WNUC 3ETQA 5FREA 1YI9A 5CADA 4XF0A 3M2MA 1DLLA 5BNPC 1WW7A 3QH6A 4COZA 3R4DB 4IV1A 1EAH3 1YUDA 3W9AA 1LHUA 5L73A 5C9AB 2WLPA 1MQTC 1E57A 4IV3A 5BXXA 1MZ5A 2GMMA 3OPZA 4GH4A 5FO8B 5A33B 4EJRA 4GQ7A 4TZDA 5FMOL 1HRI3 4LE3A 3RPQA 4BIOA 4G3YC 4AI0A 2WJSA 4KWJA 4CDQC 3HMYA 1SLTA 4LO6B 1GQHA 4FAHA 5C4WB 4FPFA 4P14A 5F1RA 3QACA 4YM3A 5IT6A 1BYHA 3H9AA 3VBUB 3AKPA 5C8CA 1FMD3 4COVA 5D8AA 1QU0A 4IV3C 1RL3A 2GN7A 3NAPB 4GH4C 3ES4A 3WG1A 4Q4X3 3MIBA 4PF5A 4TSVA 3ACLA 3E6BA 2D6MA 4SBVA 4YW3A 1FPN2 2CTVA 1I9RA 1RUJ1 2BTVC 1YHFA 4CEYC 4I0WB 4YSFA 4K9SA 4JGZB 3I8TA 4BE3A 4A3XA 3AZXA 3RQ0A 1M06G 1RUF3 2RS33 1RC6A 3U0ZA 2GALA 3VZOA 4EN8B 3R05A 4Q4W2 1AR62 2X8KA 1XYPA 4W6YA 5AFBA 1BVP1 1KFXL 1BJQA 1O91A 3IDBB 4AYUA 1QJU2 1UW8A 1PK6A 3FUOA 2YV8A 4HK8A 3SCHA 1U5ZA 3OYWA 2TEPA 4AK3A 1PVC1 5AC93 4X8NA 4XFIA 4GB32 2D6KA 1QXJA 4XDQA 1C3HA 4I3GA 1MZEA 4LO4B 3USUB 1B09A 5FLHA 5A3LA 2Z79A 4MZUA 2WNVA 4BCUA 1Y9QA 3AX4A 3ZSMA 1PVC2 2YPJA 4QPGC 1SCRA 5C8CC 1KFUL 2DVBA 1GANA 2DFCA 4Y22A 1AR61 4Q4W1 2WWSA 2AGSA 3OBTA 4HZFA 1QGLA 4Q26A 3VBFA 5ABJA 3VHPA 1WW5A 2R0FA 1LGBA 1HV1A 3JBG2 3WG4A 3ILRA 2CNAA 2JG9B 2VOXA 2XJSA 4AHWA 1C5HA 1KXGA 5FO7B 4WZFA 3AFGA 4H55A 4COYA 2RS31 1BZWA