5J98B

Crystal structure of slow bee paralysis virus at 2.6a resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
260
structure length
260
Chain Sequence
MDRPEGSEERTVQTSNVVLGETNIESQDIASKEYSPTWDRLASSEVSDEYPMLTDRWLFWKSVKWEVNDSAFGKMLVQEKFPQSWVQMDVNVNNIPRYTNIPNFIPFNIHQYMRADFEVKIYVNPNDFVSGWLIMAFLYQGSEMFDYKLRRNPAALMQMPHVLVNVGAANEATLKIPYRYVRPFMRCKDILRGDNLITGVTEPLNMGVLFVEVLIPFRTSAASSAPKSLDVSLFVKMTNAKFTGMVDGSIALLSKPIALP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords VP1
publication title Virion Structure of Iflavirus Slow Bee Paralysis Virus at 2.6-Angstrom Resolution.
pubmed doi rcsb
total genus 53
structure length 260
sequence length 260
ec nomenclature
pdb deposition date 2016-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5j98B00
1MQTA 4JGYA 5DDJ3 2RS52 3M8LA 3JB8A 4CDUA 4Q4X2 4Q4V3 1VRH3 1EV12 3JBG3 1NCQC 3VBRC 1EAH3 4QPIB 4WM8A 4AEDB 1EV13 2WWSA 2HWC2 1SMVA 5JZGB 2Y26A 1PO11 2RMU1 2R041 1M06G 1AR63 1NCRB 4RR3C 4RQPA 2HWB1 1QJX1 1W39A 1RUE3 1R1A2 3VBUA 5GKAC 4IV1C 4PDWA 2RS13 1RHI3 1ND2B 4Q4W1 4CEWA 2X5IB 3TN92 2TBVA 2IZWA 1AR71 1RUG1 3TN93 3VBOA 2R042 4CDWB 5ABJA 1AR81 3VDDC 2R063 1OOPA 1PGL1 5AC91 1E57A 2WZR1 3VBHA 1FMD2 4YVWA 3VBSB 1RUF3 1RUJ1 5L7OC 1FMD3 3ZFEC 1C8M3 2RM21 2MEV3 3J8F3 4YVSC 1AR72 5FOJB 3CJIC 2HWE2 1PGW1 4CEYA 1POV0 1NY71 2HWE3 4JGYC 1RUD2 4Z92B 5AC92 1ASJ3 4CDUC 1RUD3 5CFCB 2RM22 3VBFA 4RHV2 1NCQB 3VBRB 1RUC1 4WM8C 4RR3A 1VBB3 4WM7B 4RHV3 1FPN3 1CD3G 1V9U1 1COV1 4GMP0 3JD72 5J98B 3ZFFA 3DPRA 2ZAHA 1Z7S1 3JB4C 1K5MA 2WS91 1AR91 3ZFGB 1PO23 4RQPC 1VBA2 3ZXAC 2XBO3 3VBUC 2PLV1 1AYN1 1VBE2 1QJU3 4IV1B 2WFF2 4PDWC 5DDJ1 1H8TB 4N43A 1VBE3 2WFF3 4N53A 4Q4V1 4CEWC 1VRH1 1FOD3 4GH4A 1AYM3 1NA1B 1B35C 2ZZQA 5CFDB 3VBOC 1RB8G 3LOBA 1Z7S2 4BCUA 1EAH1 1EV11 2WS92 1F2NA 1AR92 5C9AC 3VDDB 5BNOA 1OOPC 5D8AA 1PIV3 2PLV2 3CJIA 3VBHC 4YVWC 5DDJ2 1TMF2 4CDXB 5C4WA 3ZFEB 5A32A 2HWD2 5BNNA 1TMF3 4Q4V2 1R093 1VRH2 4FTBA 1NOVA 1R083 2HWD3 4YVSB 4NWVA 4CDQC 1R1A1 3JBG2 1NG0A 2RS11 1RMU3 4CEYC 1EAH2 1RHI1 1MQTB 4JGYB 1BEV3 3IDEA 3TN91 4CDUB 1VBC2 1AR62 2R061 4QPIA 1RUH3 4AEDA 3VBFC 1PVC3 1VBC3 1RUE2 1POV3 1RUF1 1MEC3 2RS12 3ZFFC 1ZBE3 1FMD1 3DPRC 1RHI2 5K0UB 2MEV1 1K5MC 1AL23 3J8F1 1RVF2 2GH8A 1RVF3 1B35A 2HWE1 4JGZA 2R062 2X5IA 4GMP3 4N43C 5C9AA 2BBVA 1ASJ1 4N53C 5C8CB 1RUD1 1TME3 1RUF2 1X36A 4FSJA 4GH4C 4RS5C 2RR12 1C8M2 3VBOB 2RR13 2MEV2 3J8F2 1VBB1 5ABJB 4RHV1 5ACA3 5BNOC 5D8AC 4CDQA 1ND3C 4QPGC 2BPA2 4YVWB 3JD71 1HXS2 5C4WC 1RUI3 1ASJ2 1PO21 5BNNC 1HXS3 2XBO1 4Y4YA 2HWB3 1OHFA 1VBA1 1QJU1 1VBE1 3FBMA 1VBB2 2WFF1 1FPN2 2FZ2A 1AYM1 2R073 1IHMA 5A33A 4QPIC 1PO22 4AEDC 1QJY2 1OPOA 2XBO2 1PIV1 4Q4Y3 1D4M3 4RR3B 1QJY3 1QJU2 4SBVA 3ZFFB 1BBT2 4IV3A 1TMF1 1R091 1FOD2 1R081 1BBT3 1AYM2 1K5MB 2HWD1 4GB33 5LK7B 1RMU1 4RS5A 3JBG1 1DDLA 1H8TA 4JGZC 1BEV1 1QJZA 2X5IC 1HQNA 1PIV2 1HRI3 1HRV3 2HWF2 4N53B 1HX6A 3NAPA 5BNPA 1ND3A 4QPGA 2HWF3 1RUH1 1PVC1 1R092 1VBC1 1R082 1AR61 1VBD3 1POV1 5L7OB 4Y5Z0 1RUE1 1MEC1 5BNOB 1RMU2 3VBSC 3CJIB 1V9U3 1COV3 4CDXA 4NWWA 1BEV2 1AL21 1RVF1 1QQP2 1ZBA3 1RUH2 2ZTNA 2XPJA 1PVC2 1CJDA 1QQP3 4GMP1 1TME1 1MEC2 4WM8B 1ZBE2 2RS32 2RS53 5JZGA 5CFCC 2RS33 4Q4X3 2RR11 1AL22 1C8M1 4RFT0 5FMOS 5ACA1 1NCRA 4WM7C 1X33A 4RQPB 3VBUB 2HWC3 5K0UA 4IV3C 1RUI1 1C8NA 4PDWB 1ND2A 1HXS1 1TME2 2GSYA 5FMOL 3ZFGC 1F8VA 4CEWB 2VQ0A 3S6PA 1R1A3 1VAKA 1B35B 2WLPA 4CDWA 1H8TC 5ACA2 4JGZB 1WCDJ 5C8CA 5C9AB 1FPN1 1OOPB 2R071 1NA1C 3VBSA 3NAPC 5CFDC 5BNPC 1PO12 2RMU2 3VBHB 1RUI2 4EJRA 1PO13 2RMU3 4Q4Y1 1D4M1 1QJX2 2HWB2 2R043 1GFF2 1QJY1 1QJX3 4CDQB 4CDXC 4CEYB 1BBT1 4Q4W2 4GB31 1FOD1 4LLFA 2R072 3HAGA 4Q4W3 1RUG2 2BFUS 5CFCA 1AL0G 1AR73 1RUG3 1AR82 1NCQA 3VBRA 1MQTC 4Q4Y2 1D4M2 1HRI1 1HRV1 4WM7A 3VBFB 1PGL2 1AR83 2WZR2 1VB2A 2HWF1 1RUJ2 2BFUL 5JZGC 5AC93 2WZR3 1VBD1 1RUJ3 3DPRB 4FTSA 5A33B 3ZFGA 1BMV1 4GB32 1NCRC 2RM23 2BUKA 1PGW2 1NY72 4IV1A 3JD73 1AUYA 4IV3B 5K0UC 1HRI2 1HRV2 1ND2C 4N43B 5J96B 2FZ1A 1ZBA1 1NA1A 5CFDA 4GH4B 1VBA3 2QQPA 1QQP1 2DF7A 1VBD2 4RS5B 4CDWC 4FTEA 1RUC2 1BMV2 3VDDA 5C8CC 2RS51 1RUC3 1V9U2 1COV2 5D8AB 1A6CA 1ZBE1 2RS31 4Q4X1 3NAPB 5BNPB 1ND3B 4QPGB 5L7OA 1VB4A 3ZFEA 5ABJC 1Z7S3 5C4WB 5A32B 2WS93 1ZBA2 1AR93 4YVSA 5BNNB 1AYN2 2HWC1 2PLV3 1AYN3
chains in the Genus database with same CATH superfamily
3DGTA 1WW7A 4W65A 1AX0A 5DAPA 3VZNA 2KXLA 4BIFA 1BYHA 3AKRA 3M8LA 1OC1A 5JPMB 3HT1A 4Q0PA 1GICA 3EMRA 1FXZA 4LBQB 3T2TA 4XIKA 4AWDA 1WMXA 3H3ZA 5EHDA 2ZMKA 3JBG3 1XXNA 3SH5A 3VBRC 1QOTA 1SDWA 2VD7A 4AEDB 3I7DA 4R9DA 4FQ4A 5HPOA 4XYXA 3WF1A 1M4WA 5GZEA 1SMVA 4GQ7A 4KNCA 4YWAA 2D6OX 5FZ0A 1A8DA 2EIBA 2VM9A 4IEQA 4O61A 1G9BA 2AACA 3FHQA 4QDQA 2BVVA 1LNSA 3LKJA 3UESA 3T3YA 3UJQA 1NCRB 3N9LA 3N4MA 1W39A 4AVSA 1R1A2 4GXLA 5F3IA 3VBUA 1H2MA 3U4XA 3OEBA 4XJUA 2SBAA 3B93A 4PDWA 1OBNA 2JE9A 5I8SA 1K12A 2RS13 4OLLA 3WDYA 4XOGA 4BYYA 1ND2B 5T50A 4F8AA 2JDUA 1VMJA 4LBLA 4XAEA 3TN92 3RZHA 2TBVA 1RTVA 2GC3A 1GZTA 1STMA 1XRUA 1X8MA 5FPVA 5J3UA 3DUIA 3TN93 1XB9A 3C7EA 3CHXA 1U5YA 4RN5A 1VIWB 3I2HA 4CDWB 2I07B 3TWIA 5FZ6A 2VCBA 4B4PA 2QQNA 1JU3A 1XNDA 2VOWA 3R0RA 3POJA 5FYBA 4F83A 1UY1A 5JIAA 2WZR1 5E8AA 5B4XA 1SFPA 3R4UA 1QNWA 1YCIA 3N36A 1QKQA 1RUJ1 4AVBA 4L8QA 5HCBA 3IPVB 4XFBA 3WP5A 4YZ5A 5A3PA 5L7OC 1QXPA 3WNOA 2AYHA 3CKHA 4XDQA 3WP3A 1H4HA 5FOJB 1AR72 5FAXA 1GWLA 2NLRA 2HWE2 2K2SA 3T0DA 2GDFA 2ZACA 1MPXA 2HWE3 3ZO0B 4AYUA 1O3RA 3V0BB 2YZ4A 2FDGA 2J42A 1KEXA 4YZ2A 4QQOA 2XLGA 3T4VA 1ASJ3 4YSFA 3LA3A 5AC92 4PI2A 4D94A 3ELNA 1YFWA 3W9AA 5JI7A 4XHBA 1DQ2A 1F5FA 4UBHA 2ARAA 5FUPA 4Y26A 3WXPA 3A4UA 1LGCA 4KWJA 3ZYFA 2VL4A 3AYEA 4XTMA 2RJ2A 5KHJA 3WF4A 2CYFA 1FPN3 2BP6A 5EQUA 1V9U1 4GMP0 2ZAHA 1JZ2A 5JOYA 3RMYA 1W8UA 1Z7S1 1CAWA 3WSOA 1W6QA 4Y5TA 5FZKA 2OS2A 1AR91 1S0DA 1F4HA 3AMQA 1PO23 4B3NA 4ZKTB 2XBO3 3VBUC 1JZ8A 2WL1A 1AYN1 5BY5A 3PVNA 3I3DA 1W0PA 4PDWC 1UF2C 1WCQA 4IDZA 4RL7A 5A80A 3EO6A 5K8SA 4AG4A 1NXMA 5BYNA 1XNCA 2ARCA 3S30A 3S7IA 4H3WA 1PZ9A 3PL0A 1UOGA 1QNYA 4JC1A 1D0HA 1KJRA 1DIWA 1XE8A 1HW5A 5B4NA 1UOJA 1MVEA 5KXEA 3LOBA 2P6CA 3KT7A 4CP1A 3ZVXA 2DWRA 5LASA 4UFHA 1G7YA 4S2FA 3VDDB 3AZWA 1KXGA 2ZEWA 3M3CA 1QWRA 3VZJA 2HH9A 4AI8A 3CJIA 4MGZE 2LS6A 1MS3A 3ITQA 2QCSB 1JUIA 4BU2A 2IC1A 3AFGA 3KF5A 3WEZA 4FCAA 3INAA 2D6MA 2DV9A 3ZFEB 3KCCA 1OFNA 3PUAA 3GCXA 1I5PA 2XB6C 3MFAA 4A7KA 1NOVA 2D97A 3ZXEA 1N1VA 5K9YA 3KGZA 3AMNA 1W6MA 3POIA 4CDQC 1R1A1 2RJLA 5F37A 1NG0A 2RS11 1WCUA 1KJLA 3OBTA 4LUMA 3CBNA 3EXUA 1GMMA 3FL7A 1CQ9A 2VNOA 3C7HA 3SHRA 4BHPA 4BE3A 4XTPA 4MGTA 4XACA 5A3OA 5LBBA 5JPNB 4MXWA 4QDRA 3TN91 1W28A 4LIUA 4CDUB 2X8KA 1KFXL 5DABA 4OVEA 2QQKA 1VBC2 5T54A 3WQBA 2YROA 3LAGA 3MPPG 1RUH3 4P00B 2GN3A 3NMBA 4XFCA 1PVC3 1VBC3 1RUE2 2BU9A 5FZCA 3ZXGA 3IAQA 1ODMA 1GLHA 3AZYA 5LA9A 4AHWA 3D5OA 4AEMA 3TEXA 4L97A 5FZAA 3GALA 5LRRA 2VGDA 2XJPA 3AM2A 5H9PA 3ORJA 2C5DA 3TEZA 5CEHA 3T0AA 2J7MA 5K0UB 5DMYA 2CGOA 2ZEZA 2GH8A 4PCRA 4BLIA 2VOKA 4LNVA 4MH0E 4R9CA 3GZUC 4HKOA 1DU3D 1B35A 3VKMA 4DO0A 2HWE1 1WUVA 1NXD1 1D2SA 2HYXA 2R062 2WINB 1RJ8A 4OI4A 3C3VA 5CVRA 4CUCA 2X5IA 5C3OA 1JTZX 3SISA 5AFBA 2Q1FA 1ASJ1 1H30A 1RJ7A 4HETA 4MV2A 3CDZB 1VAVA 4QU2A 1X36A 1TME3 1RUF2 4BLJA 4DY5A 3JUUA 4M00A 4B4RA 4DEVA 4JDNA 3SITA 3I3MA 4KU7A 3EB7A 1C8M2 2J1UA 5FUNA 2XWBB 1LHWA 2JJ6A 2VMGA 3VN4A 2HEYF 5ABJB 4RGKA 1GP5A 1E5SA 2VY0A 4N7IA 3QBQA 5I0UA 1XSRA 1UZYA 3NNGA 2BPA2 3N9MA 2K9ZA 2A70A 1BHGA 1I6XA 4YVWB 1YFUA 5T5LA 1JZ7A 1HXS2 4J6GA 3WT3A 3ILNA 2LTNA 1RUI3 1PO21 4URTA 2JD4A 1HXS3 2XBO1 5DAWA 4E4ZA 3TYJA 4KGGA 2VZ1A 3AXDA 2Q0AA 2ZEXA 1HJFA 2PQSA 3EJKA 3OBRA 5HI0A 2WT2A 2Q8DA 3JCIA 5IFPA 2DU0A 1Y7BA 3ZLIA 5BNQA 1JS9A 2VAUA 3I4IA 4NPMA 3O12A 1T6GC 4CPBD 4ET7A 4KI5M 1HV0A 2FZ2A 4QPYA 3I2IA 5FIXA 5IW0A 5JXIA 4N90A 2JICA 4LTAA 1E5HA 2G9ZA 1NQDA 5J48A 1RUNA 5JCTA 3MHZA 4FO9A 3RWNA 4LKEA 2WAAA 3VKOA 4GZ9A 2VTFA 3J7NA 4AAPA 3KB5A 1QJY2 1EUTA 1QH6A 4PIZA 1ULFA 4XCAA 4XQWA 3ZN6A 1D4M3 1UYPA 1GP4A 1UAIA 5DAVA 1QJY3 3PVOA 2VH9A 4R8HA 1GV9A 3OGJA 1LRHA 1ULDA 4XUQA 4COYA 3ZFFB 2V72A 4BDVB 3BI3A 4ORFA 1RIRA 2EIGA 2YC4A 3GM8A 4LBQD 3H42B 1LEDA 1K5MB 3J4UH 5FY4A 1L7RA 2AGSA 3BKZA 1GWKA 4FOWA 5FR3A 4CZSA 1ZRRA 3T09A 3UGFA 5IVJA 1VE0A 3KV4A 5H9SA 2AENA 1CAXA 1QJZA 3E6DA 4Y1UA 3KF3A 4LUKA 2X5IC 4DXSA 5CISA 1PIV2 3B00A 3WD5A 3AP9A 1HRI3 4N53B 1APNA 1U0AA 4CPBA 1LOFA 4XCBA 3Q8CA 2VU9A 3ES4A 1YJKA 4QD2A 2XL7A 1IQAA 4LA2A 1RUH1 1LULA 2DVBA 1PVC1 1VBC1 4NHLA 3U37A 1UXXX 4CP0A 5L7OB 3OGVA 4BMBA 3PU3A 4QX0A 5DAQA 4Y5Z0 5FUIA 1RUE1 4NOTA 5BNOB 3MF6A 5JMOA 5FMBA 4JAAA 1O5UA 3ZXLA 1HN0A 3GDBA 3RNSA 4M3CE 3VBSC 5FREA 1K42A 1MZ6A 1COV3 2R0FA 3WDVA 2Z69A 1BEV2 4OHYA 1CR7A 4LR4A 5C5TA 2NP0A 2W5FA 1D2QA 3VB9A 3OBAA 3HBKA 1V6LA 2VCAA 1NYWA 2W47A 4XJWA 4YNIA 2PHLA 4LBQA 4JRAA 2W08A 2Y6KA 1SFYA 1CJDA 1OKOA 4WZFA 3ZX7A 3O5SA 5FZFA 1TME1 1GZWB 2QBXA 3M2MA 1G86A 1N1TA 5FYSA 2O1QA 3SXWA 3ABZA 2XVGA 2QQVA 1O6UA 4XVHA 1SDDB 1XSQA 1YC61 4Q4X3 1VRBA 3LWCA 2XJSA 1C8M1 4HFSA 1UY0A 1NCRA 1W8HA 5F5QA 2R6QA 1JZ4A 3C8XA 3WNKA 1HQLA 1R64A 4IE4A 1Q43A 2DBNA 3AP7A 3VBUB 2WNVA 1C1LA 3C7FA 1T6BX 1L7QA 2Z5WA 2G9FA 1RUI1 3RQ0A 2EXJA 1DP0A 3KT1A 4PDWB 2TUNA 1ND2A 1HXS1 1MACA 1OUSA 2GSYA 3OB8A 4NE9A 3WDWA 4E4DX 2JB8A 2Q5TA 4MADA 5LY1A 2WYSA 3JZVA 2WNOA 4HONA 3LPGA 1CGPA 4ASMB 4GWNA 4K8RB 5ERLA 3GBFA 1VAKA 4DZGA 3SMHA 4NPLA 4CDWA 5FPXA 4Z2AA 3PJQA 1G8WA 3KQ4B 1REFA 2E31A 1DGRN 1MS4A 4QB6A 3J7HA 2V4VA 4LBOA 3FHIB 4LHKA 1ONAA 3OEAA 1IKQA 4V1PA 5CB7A 3KV5A 3IM0A 2PHDA 3IPVA 3ZPYA 1HV1A 4AFDA 2SLIA 3SEEA 4OYUA 1SPPB 4IEWA 4AF9A 1D4M1 3V0AA 1QJY1 1W2AX 3ACHA 1W9FA 4IEXA 2WSUA 2XJRA 2EIDA 2PAEA 4QB2A 2QTWB 4L11A 3LDBA 3OPZA 4IUGA 4PI0A 1GWMA 4CDQB 4NRQA 4YG0A 3V0BA 1LU2A 2OT7A 4MUVA 5FY5A 5JAXA 3F2ZA 3MBWA 1S4CA 3VZLA 5LA1A 3H7YA 3CEWA 2HYKA 2WDBA 1OA3A 3ETQA 3OSDA 3DYOA 5HBAA 5HCAA 4NUBA 2ZOEB 5A3WA 3MICA 2YG0A 3WW4A 1F31A 4B8EA 1YWKA 4Q5OA 2QQUA 4XXPA 3WCSA 3ACGA 3BGAA 2HJIA 1HRI1 3FBYA 3O7OA 4HVRA 1KFUL 2EXHA 1QMJA 3V56A 1PGL2 3LFMA 3NJYA 2W2IA 4QU1A 1QIQA 1CN1A 4JZRA 2JG9C 3CNAA 1H2NA 2WFPA 4LHSA 4QX3A 3UGGA 4C91A 1N3QA 5C8WA 1H0BA 3WZ1A 4AGVA 3W58A 4QKNA 4FTSA 3RJRA 1UU5A 2QZ2A 3WNNA 1ENXA 5A33B 2ZCWA 4GB32 4NHYA 1NCRC 5JMCA 1W6QB 4JDOA 4DFSA 4W4ZA 2XQRA 4JQRA 2BUKA 3L2HA 1DGWX 1HB4A 1AX2A 2ZGTA 1ODNA 1Y9GA 1NLSA 1PGW2 1UU4A 3IDAA 3N7JA 4EZ4A 1NY72 1H1MA 4YARA 2Q8OA 4YW1A 2WNVC 1IS4A 1TZOA 2WZ8A 1F5JA 1DQ0A 4OI0A 4IV3B 4HOOA 2E7QA 1HRV2 4NAOA 1ND2C 4NAMA 5HXMA 1US3A 1KS5A 3PMSA 3PMEA 1XJAA 5EJ1B 1UPSA 5FYIA 4Z07A 1CVNA 4UW3A 1H9WA 4D7TA 2YBPA 1VBD2 2OVUA 4CDWC 1RUC2 5I0RA 3MIFA 4UFIA 3LD8A 3VDDA 5FY1A 3AYAA 3BTAA 3RI9A 4HPKA 4GD4A 1RUC3 4HG6B 1UKGA 3I2KA 5LEKA 3KCXA 1A6CA 4Q4X1 4ZY9A 5BNPB 2JDPA 4ZXEA 3MLJA 1UYYA 2JDYA 4IESA 3AYDA 3HMYA 3ZFEA 5KBFA 1LGNA 2RDSA 2YUEA 1CAVB 1N47A 4AQSA 1ZZ6A 1PM4A 2BGCA 2WS93 1O59A 4KL1A 4ZPIA 4K20A 3H1MA 4COZA 1SLTA 3O0WA 3L2YA 3B9IA 4XMIA 3B5LB 2PLV3 2YGLA 4CDUA 2GC2A 5FYUA 2D3SA 1VRH3 3H50A 4H2AA 2P34A 2IVIB 4AW7A 2YY1A 2TNFA 2ZS6B 2ADDA 4LHLA 1ZNPA 1OQ1A 1EAH3 5EIYB 2ZX1A 1O4ZA 1W0NA 4WM8A 1F9KA 4BQ4A 2BOIA 5T5JA 2HWC2 3WNXA 5CZKA 3IKWA 1WW6A 4OHWA 1LEMA 3M70A 1PMJX 1YIFA 2MPFA 4QGLA 1O8PA 1UD1A 2PFWA 2LW8A 1AR63 1ZRCA 3I3EA 4J1XA 4UFJA 1I3HA 2OYZA 3UL2A 2WAOA 3WW3A 1N3PA 4TTGA 1AF9A 3K48A 3ZXJA 1DHKB 1RHI3 2P3IA 1J3PA 4WZCA 4A42A 2X5IB 2WLQA 4LMFA 5KHHA 3J9SA 5FZIA 3AC0A 4AFMA 4W6XA 2A6ZA 5E16A 3WW2A 2ZKLA 4AEKA 5KHGA 1YRZA 1ST8A 2AH2A 1UMIA 2W3JA 2PAKA 1UZZA 4N8MA 5ABJA 3TB0A 2IXHA 5IK8A 3VDDC 5DUVA 3VD9A 1V6OA 4DEQA 1A3KA 4OZOA 1PGL1 1LODA 3APBA 2WO1A 4JX0A 1Q3EA 3BB6A 3WW1A 4CYDA 4YVWA 3NJZA 3VBSB 3K46A 3TEYA 4XF9A 3SCHA 3BALA 1W8OA 2HEVF 3PIJA 3UK9A 3ZFEC 3FUQA 3N9PA 2LALA 2VVFA 3I8TA 3X29B 4DXZA 4BQ3A 5C3RA 3TAYA 1U5ZA 2DTWA 1CZTA 4LHNA 1PGW1 3UETA 4QT6A 1RL3A 2BW8A 4CEYA 1NY71 5A3TA 4JQTA 1D7PM 1W3VA 1VPHA 2QQJA 3G7DA 3ZXDA 2YU2A 4ASKA 2NZ9A 3RZKA 1B09A 3IIAA 4B7KA 1NX9A 4FOVA 4CDUC 3WUCA 4CCJA 2EAAA 2A7AA 2JIJA 2QFEA 4QM9A 4YW3A 4SLIA 2YFUA 2AC1A 2PA7A 3KVBA 1NCQB 4P9GA 1RUC1 4RHV2 3VBFA 2YYOA 5J7MA 4WM8C 4PQ9A 4RHV3 1VJ2A 2CV6A 1FV3A 5C6CA 1CD3G 3PNAA 3ZFFA 5ANQA 4WVZA 2V5DA 3JB4C 1JMUB 3OD0A 4RSUA 5LB6A 4OQ8A 1K5MA 2WS91 4NPRA 5A7PA 1AJOA 3M3OA 3U14A 5KC5A 2ES3A 2YPDA 1IG3A 3M4FA 3WF0A 4Y33A 5A1AA 1DGWA 2PLV1 4DNYA 3WV6A 2WYFA 4J1WA 1SCSA 2WBKA 5B2GB 1VBE2 1S2KA 2WFF2 2WRAA 1DF0A 1LAJA 5LBEA 1QOSA 1CZVA 1VBE3 3D82A 4N43A 4XABA 1CAXB 2WFF3 4N53A 1QF3A 3LPFA 1MR5A 4CEWC 1VRH1 3RI8A 1FOD3 1SLAA 3KCYA 4GH4A 1H9PA 2D6NA 2IXLA 4IQPA 4EROA 2A3YA 1LESA 1Z7S2 4BCUA 1GBGA 1EAH1 3ZYHA 2WZPP 2DFBA 1F2NA 1AR92 1Y43B 5C9AC 3AB0A 1NZIA 1ZA4A 2JKBA 2VC9A 5BNOA 1AHSA 2YMZA 4Q26A 3VHNA 3OG2A 5DAXA 2W39A 2XQXA 3AYCA 2VMIA 4YVWC 2YPJA 2XUEA 3DCQA 1TMF2 3DEMA 1J1TA 2W9XA 4Y1ZA 1OLQA 1N1SA 5FZGA 5BNNA 1TMF3 3EQEA 3ZYPA 4FTBA 4Q29A 4UFLA 2BYVE 1R083 3SKJE 1LHVA 1S2EA 3PVBB 4O9EA 4AVAA 1MS9A 2ORXA 4EV0A 1JYXA 3JBG2 3TNQA 2F17A 4CEYC 4XC9A 3L9JT 3OPWA 3NW4A 5KR7A 1RHI1 2EAKA 1X50A 2XVLA 1SBEA 1GZWA 1VP6A 3QD6A 2IUWA 4JGYB 2XDVA 5C3QA 5JXJA 5FZLA 3UYJA 1JHJA 3T4HB 3IDEA 2N7GA 4QX8A 4LULA 3VD3A 1SHWB 4BOWA 2JG9B 4K7JA 3KHBA 4XFIA 1WMDA 3AL5A 4IGOA 4BXSV 2HBTA 2LRPA 5I93A 3VBFC 4UI9L 3I2GA 3KVAA 4Q8KA 4FQZA 5I0TA 4CCCA 1ZVFA 1POV3 4K21A 1SZBA 2ZMNA 3N35A 3ETPA 3WDTA 5FY8A 4HBNA 1MEC3 1F15A 3GJBA 4Y20B 4Q2FA 3LA7A 4S2DA 2RS12 5FCCA 1ZBE3 3ZFFC 5C7GA 2B4KA 3TNPB 3VHRA 2W1WA 4FI9A 2WNVB 2ZGSA 4Q27A 3H7JA 3ECQA 3O1RA 5F7UA 2IWGB 3ES1A 1K5MC 4RYDA 5JI9A 2C6SA 2XJUA 5FV3A 1G9CA 4ISQA 3UKNA 3WHUA 1WMFA 4KBBA 4Y1YA 5F8PA 1UN1A 3Q8AA 4YM1A 4I0AA 1S0FA 1PZ7A 2UYBA 3SH3A 1JODA 3LDRA 4LITA 4N43C 4JHTA 5ANNA 5AVPA 2WO7A 2OQ7A 4N53C 3J26N 4N7UA 4FFHA 3ENRA 2VTXJ 4GH4C 3BUCA 5A3NA 3E97A 4OZXA 2WABA 4RS5C 5FWEA 3PU8A 4MGIE 5G05L 5FPLA 1RITA 1SPPA 4WBBA 1G9AA 4RHV1 4QQHA 5BNOC 2YHJA 3UJOA 4HL0A 3V0AB 4K3UA 2WUHA 1GNHA 1IZ3A 4WVMA 3ZR6A 4XW3A 3CZUA 4YW2A 4CDQA 1ND3C 4QMAA 4QPGC 5IWFA 1Z0HA 2Y8KA 2OPKA 3PURA 4GALA 5KXCA 4QPWA 1BZWA 2IXIA 5DUUA 5LK5A 2QVSB 3Q8FA 1ASJ2 5FP8A 1JZ5A 4K40A 3POFA 5BNNC 4FFGA 5FLHA 4P14A 5KXDA 1KDMA 2RE9A 4I09A 4MZUA 3BIWE 2HWB3 2OZ6A 2Q30A 1OHFA 2NYYA 2GNBA 2IFWA 4EQVA 3WUDA 5FMCA 1PX4A 5HXVA 3BTXA 3F95A 1VBE1 5GLWA 2Z4FA 2ET7A 2ZGQA 2B7YA 2WFF1 1SBFA 4YG3A 3ZMOA 1YQ6A 2VZQA 1FPN2 3NNLA 2PELA 3A22A 1O3QA 1OPMA 5GLZA 1PGSA 1Y3TA 2C26A 1SG3A 4XF1A 5T5OA 4DQAA 1OI6A 4D3WA 4HSJA 1IHMA 2GNDA 1PNFA 2YGMA 5FYYA 5A33A 1UZVA 1ULPA 1DQ6A 1IGOA 1PO22 1BQPA 1ZRIA 4OULA 4PF1A 5HCFA 4ATEA 4CVUA 1NE6A 2XBO2 1W8NA 3KQRA 3USSA 4AI1A 1QU0A 3MDPA 4AZZA 4H14A 4UT5A 3CLPA 4SBVA 4YRDA 4CCNA 4IV3A 3H0OA 4FP2A 4UW4A 2NQYA 2FDIA 1TMF1 4FFIA 2VR4A 3GBGA 1CX1A 4M4PA 1R081 3S5AA 1W8ZA 4A3XA 5FQ0B 3VLBB 2R30A 1LR5A 2AEYA 2VOVA 5LK7B 2A5ZA 2RV9A 4Z8BA 5GJ6A 3T1MA 4NR1A 5GLTA 5DZGA 1EPZA 1BKZA 3JBG1 1H8TA 1ULCA 2XHKA 4CSWA 1FNZA 5CADA 1ZA7A 4CA9A 1NUKA 1W0OA 4HZFA 2WZEA 1IS3A 2CDOA 2HWF2 3PUIA 4HPKB 2PHFA 1HX6A 5BNPA 1Y9MA 3AK0A 4PBOA 2HWF3 2RVAA 5FY7A 4ATFA 1H1IA 2EICA 1CAVA 4P5YA 4UFKA 1A34A 1POV1 4LJHA 4TLFA 2WT0A 1JW6A 4LBNA 2VZPA 1XOYA 3HJRA 1MEC1 3KS7A 4A45A 1GKBA 1JYCA 2B46X 4DUVA 1UIJA 4CDXA 1PZ8A 3OPTA 5IVCA 4XZPA 3VDAA 3PLQA 1CZSA 1OVSA 2CY6A 5EXOA 1TEIA 2D5FA 4KQ7A 4AHZA 4A6SA 1GZCA 5JIUA 4BQYA 2VBDA 1OKQA 3MGUA 1C5HA 3WP4A 4FXKB 4NRPA 1RUH2 1WZXA 2XPJA 1ZZBA 1PVC2 4D6RA 2X05A 1XYOA 2PAMA 1XYPA 1RXGA 1MZEA 4O7XA 5E6HA 3WX5A 2A1XA 3NV4A 4CUBA 1O91A 3WDUA 4WM8B 1CIWA 2RS53 2VVEA 2A75A 3C7OA 2J22A 1JZ6A 4M0NA 5BUVA 2RG4A 1NKGA 1YHFA 4K9SA 4V2VA 3RGBA 4XZUG 1IQDC 2VPVA 2C4XA 3O1MA 1W9SA 4YLZA 5FMOS 1H4GA 4BQ2A 4WM7C 5JOWA 1X33A 4XETA 4XJZA 2RJKA 3ATGA 3B01A 2VQUA 4FPYA 3EYPA 4LBMA 4I0WB 2NPIA 2DUPA 1UL9A 4IV3C 1XNAA 1QGLA 1CPNA 3CF6E 5FMOL 1TME2 2P1BA 3I2DA 3PIGA 2AZ5A 2C24A 1DGLA 1OH4A 4ZONA 4CEWB 4QM8A 3VDBA 3LOIA 4BB3A 2ZEYA 1K45A 2WIIB 1H8TC 4JGZB 3O14A 5C8CA 5C9AB 5FYTA 1FPN1 4U2AA 4JRLA 3VBSA 5CFDC 4AGGA 5BNPC 4HT1T 1PO12 5JOZA 1RUI2 1UYXA 2WQ4A 3A0KA 4Y22B 5IK5A 1PO13 5EZWA 1LOEA 2CAVA 1QJX2 2JWPA 2R043 2B5HA 3NKGA 4LO4B 4FAHA 4GJZA 2E33A 3PUHA 5CYYA 2UWBA 2YBKA 3VL9A 1QJX3 5CIRA 3H3LA 4MSVA 3RZZA 4GKYA 3WHTA 4CDXC 4CEYB 5CG8A 5LEJA 2AREA 1K5JA 2XJQA 4XXAA 3THTA 1WBFA 3OY8B 3UT0A 1I9RA 2DCYA 2WO3A 2BOJA 2VZSA 3SCFA 4YYOA 3FC0A 3HAGA 5LW9A 4ZS3A 3RZMA 1RUG2 2O8QA 2BFUS 2D6KA 4OFGA 3WG1A 2DURA 4M0HA 4DUXA 1RUG3 2XUMA 3FN9A 4AXOA 1AR82 1NCQA 1MQTC 1D4M2 2D40A 3DXTA 3VBFB 1AR83 3OOXA 2C9AA 1G9FA 4LPLA 4UFMA 1H8VA 1X82A 4BWOA 3FWEA 3W20A 2K0GA 2HWF1 2XKOA 1W6PB 2JB4A 2BFUL 3FFQA 3RFRA 1AZDA 1OT5A 5A7WB 3SEPA 1U12A 1ZYBA 3FE5A 5IJRA 3ZYBA 2WO2A 4AQ2A 3HOBA 1BMV1 1WA6X 1OLMA 1UCXA 4KBZA 2C1FA 2RM23 1J59A 1LENA 4ZZ8A 4QKBA 2JDKA 3IWZA 4QQPA 1CONA 2YFZA 3QACA 4X8NA 4UOJA 3JQXA 2WQ8A 1CIYA 4TYSA 3AP5A 3RZLA 3BYWA 4A3ZA 3FJSA 1WBLA 3JD73 3LE0A 1HRI2 4A6OA 1SQ4A 3AZZA 4IEYA 3VD4A 3DECA 4N43B 3SLIA 4BQ1A 2XR4A 1KS4A 1VBA3 4GH4B 2QQPA 1FI2A 1AJKA 2VTXA 1ALYA 4RS5B 5IHRA 2UY8A 2XOMA 2ZX4A 4CXYA 2ETEA 2QQMA 2AR6A 5FLJA 3ZYRA 2WWUA 5C8CC 2B9UA 2RS51 1UWWA 2A73B 1Q5OA 5DXDA 2D3PA 1COV2 1GR3A 5T52A 5F5CA 4OHVA 1ND3B 4QPGB 2WSVA 3SKVA 2W91A 3POEA 3O1OA 2OZJA 1UXZA 1PM7A 4OMCA 1V00A 4HK8A 4HXCA 3LCPA 5BNNB 3WQ1A 1NZCA 1O4YA 2MHFA 1V6MA 5FP7A 1Y4WA 3OJBA 3VL8A 3KM5A 2GU9A 4ZZ5A 2C0ZA 3KV6A 5FZ4A 5J09A 3AJZA 4QWNA 2OKXA 4JGYA 1W8TA 3I49A 3BTYA 5DDJ3 3USUB 4QXBA 2E63A 1PMHX 3MV11 4RGGA 3JB8A 3P6BA 4OMDA 1HLCA 4FPEA 1W8WA 2Y33A 3NV2A 1AXYA 3BODA 3N9QA 4Q4X2 4Q4V3 2ZGUA 2JG9A 4CU9A 4CUGA 3T2QA 5FO9B 4MG2A 1QJEA 3VKNA 3SH4A 5LCWL 4FPCA 1JYNA 1NCQC 2W95A 3I2JA 3MYXA 4IXLA 1OA4A 4MLOA 4XFAA 1HIXA 2XL9A 3UGHA 2WWSA 4DRRA 3SC7X 4Y20A 4E4SA 2Z79A 5FKCA 4CCKA 4UYBA 3LEKA 4Y1VA 5J1XA 1V0AA 2HBUA 1WGPA 2VW1A 4AL9A 4AVVA 5JZGB 1WLCA 1PO11 4BH9A 5A7NA 2BTVC 4Y1XA 2D7FA 2R041 3WQ7A 4LE3A 2ATFA 1M06G 4Q0VA 4LO5B 5LATA 4RR3C 1QJX1 5FPUA 3OF1A 4E4HA 4ITCA 4A44A 2BEOA 2H6CA 3U11A 3R05A 2VCMA 3CQOA 2JD9A 4P9YA 2D6PA 3VDCA 3MLKA 3RZGA 2VMDA 3BVCA 3E5QA 1DZQA 3EBRA 3Q9OA 5HV0A 3BTZA 2V09A 2Y6FA 3I2OA 1ENSA 1XU1A 3OCPA 4QGMA 4YPJA 4AFBA 1FYUA 1IPKA 1RUG1 2G9GA 2OUJA 2VUAA 2W94A 2VECA 2Q8CA 4ARXA 3D0SA 3JU9A 4GWJA 1CWPA 1AR81 1DQ1A 5D21A 3LEMA 1PK6A 3RSJA 4HANA 5DQ0A 1E57A 3N7KA 1W2TA 4FVVA 4KMQA 3FZ3A 3VBHA 2PHUA 4WVMB 1S2BA 1V70A 2G4IA 3S0MA 2W92A 3LZZA 4KGQA 1CX4A 4PLMA 2RM21 4F7ZA 1CJPA 5IVVA 3POWA 2VO5A 2MEV3 3J8F3 4I0BA 1DQ4A 2ZGRA 3ZIXA 5L19A 3PTRB 4IEOA 2RDQA 2WR9A 4XQDA 1C57A 2EA7A 2WA3A 1POV0 2VE1A 5F9TA 2RHPA 2BGOA 3MW3A 3IMMA 3NJXA 4FP3A 4BZ4A 1Y9QA 2QQIA 4JGYC 4PBPA 4XE9A 4Y4RA 4AHYA 4ZU7A 1RUD2 1C3HA 4Z92B 2OW4A 4LLOA 4YM0A 4L99A 1RUD3 2VUJA 3ZXFA 2VNGA 3J7MA 3MLLA 4I01A 1WLTA 3OUJA 1EP0A 4QXCA 1A8MA 2P3JA 4AVTA 3RYPA 4NMIA 1DLLA 4NIIA 2Y6LA 4E8CA 1V6JA 2I45A 1S0CA 5L36A 2O14A 4P5HA 3H9AA 3ME2A 1BVVA 1VBB3 4WM7B 4FPOB 2FDJA 2PN5A 1Z78A 2VZOA 5EFUA 5L9RA 3LSDA 1COV1 1W06A 4OUMA 3VGIA 3DPRA 2VBPA 1UY2A 3WR0A 2ZHNA 4KWLA 1VMFA 2IFRA 2EF6A 1QDCA 1W2OA 1XE7A 2YC0A 5FQ0A 1VMHA 4QX5A 4CRQA 1REEA 4MOAA 4PHZA 4JHZA 3I59A 4XJAA 5A6XA 3POGA 1QDOA 1UQXA 4YW4A 5LBFA 3WF3A 4XHXA 1QJU3 4IV1B 3MO4A 5DDJ1 1BCXA 1NAEA 3VHPA 3FLPA 3IB3A 3E1F1 1H8TB 2Y64A 4LQRA 1DLCA 1AXKA 4CXWA 2OX0A 2DBIA 2EIEA 1SCRA 3BN6A 4Q4V1 2VMCA 4CEWA 2ZX3A 4OI2A 1RXFA 1AYM3 3K77A 3KHCA 3B7MA 2ENRA 4K6BA 5CFDB 2ZZQA 5LBCA 1RB8G 2KD7A 1WLDA 3H1WA 1C4RA 1LOGA 3DF0A 1XE0A 1EY2A 3O1SA 1NLQA 1YUDA 2P2KA 2WS92 3KT4A 3ZKYA 3ZKUA 1MS0A 5D8AA 1PK6C 3MIEA 4D8MA 4IGQA 1L7LA 2PLV2 4LOSA 2PTMA 4Y5SA 5GALA 4BIOA 3VBHC 4R9BA 1XC6A 4MYEA 3MEPA 4CDXB 3WF2A 2ZZJA 4Q0SA 1KQRA 5A1LA 1WD3A 1R093 1VRH2 2AEZA 4X6RB 3U1XA 1E5RA 1GOFA 4XUOA 4GULA 4XEZA 4YVSB 4IE5A 1J58A 4JV4A 1RMU3 4HKWA 1EAH2 3T0BA 3P3PA 2KR2A 3UKVA 1PVXA 1MQTB 1H2LA 4D7YA 5JDBA 5T5PA 1GANA 2CDPA 4AHXA 4L2NA 4ZU4A 4AQ6A 3RRDA 1AR62 4XUPA 4QPIA 2UY9A 4KWUA 1XYNA 1K3IA 4BK4A 2P3YA 4GWMA 3HVDA 2Y0IA 3H8RA 3PDQA 4IEZA 5CKNA 1SLIA 1MZFA 2VMEA 1JOBA 2B39A 1WD4A 3DPRC 1RHI2 5EJ3A 3ALQA 3MFCA 4KH9A 4BA6A 2MEV1 3J8F1 1AL23 2ZA9A 3BOWA 1OXCA 2VNVA 2BV4A 4LO7A 1X9TA 4LORA 4AI2A 1ZZCA 2ZABA 4LO6B 2JEMA 2R0HA 4Y24A 1SACA 2CAUA 4XBNA 1TG7A 3HNYM 3K4ZA 3NSTA 4JGZA 1QEXA 3IIIA 4META 4INDA 4R52A 5C9AA 2BBVA 4YW6A 5F1RA 5C8CB 4DXTA 1RUD1 2YC2A 4PJYA 5KHKA 1SLLA 2DTYA 2GZWA 2XXZA 1OFSA 2XGXA 5A6QA 4GWIA 2RR12 2X10A 4Y22A 3VBOB 2BERA 4MO3M 4QX2A 1ULOA 1XNKA 4E9KA 2XJTA 2RR13 3CZJA 4D7SA 1VBB1 5T55A 3OYWA 5ACA3 4HVOA 4ISRA 4AI3A 4CU7A 4IE6A 5JSRA 2J1EA 5D8AC 4DMIA 5FP9A 2X53S 5IK7A 2H6BA 3VD5A 2H0BA 5JR2A 1BVP1 3MIDA 3GZAA 2W1UA 1KGYA 5C3PA 4Q0UA 3VKFC 1IG0A 3I3BA 3OY8A 3SNMA 1GQHA 2DFCA 4R4XA 2ARXA 3H1YA 2QQWA 2VOTA 4Y4YA 1OD5A 4OI1A 2BWCA 5FYMA 2J1RA 2BDRA 3O1UA 1QJU1 5SV5A 2VVDA 1FV2A 2XONA 1GYKA 3KWVA 3S5QA 1KD7A 2B9VA 2F4LA 2R49A 3FBMA 4IEVA 4L92A 2BGPA 2P37A 4A7ZA 5FZ3A 4OQ9A 2ARBA 4C0BA 5EV7A 5CBLA 1AYM1 2HKXA 2GNTA 1W6PA 3MI8A 4KG0A 4DINB 3Q8BA 4M3CF 5A7WA 2R073 1VR3A 4BQ5A 1YYNA 2QQLA 2X09A 3AZVA 4I3GA 3RVHA 2PQQA 3ZOIA 4ES8A 1IOAA 5GM0A 1UU6A 1HKDA 2E53A 4QPIC 1WW5A 3HN3A 1YEWA 4YGCA 1OMIA 1J3RA 3I3QA 2H0VA 1LU1A 3LIGA 2DCZA 2ZKNA 4Q4Y3 5F5IA 3ZPOA 4RR3B 4BQXA 1F4AA 4P9XA 1S0BA 3PTYA 3D6EA 5EP9A 4TWTA 3NVCA 1UYZA 2XLFA 5I8TA 1R091 3KSCA 1FOD2 1YLLA 3V65A 3ZIWA 2QE3A 2PMWB 2ZGMA 2X29A 3LSEA 1RMU1 5IYYA 4RS5A 4Q8LA 2VW2A 4P02B 4UF0B 3NWKA 5HCHA 1DDLA 1X7NA 3MW4A 4JGZC 1TNFA 2IXKA 4O65A 4C90A 1UZ0A 3M1HA 4K8FA 3THDA 1GQGA 1HB3A 1HQNA 3CL1A 4UBGA 4E2SA 1SFNA 3O1VA 3KV9A 4J25A 5I8YA 2ZHKA 1OSGA 4N9HA 1ND3A 1TQ5A 4QPGA 3IT8A 2E7AA 4EE2A 2WNUB 1BXHA 3HR9A 3K4DA 3C2UA 4UWDA 3MIBA 1R082 1AR61 3ACIA 3NV1A 1YQCA 5A6ZA 1YI7A 2JXAA 2IXCA 2TEPA 5JXGA 1W04A 2ZGLA 4Z1VA 1MS1A 3CIHA 1O8SA 3O0VA 1J3QA 1C5IA 1V9U3 4O9GA 1RINA 2UWCA 4NWWA 5E1RA 1UY4A 4AI0A 4CP9A 4DPNA 3H8OA 1AL21 3USUA 5EJZB 2VOXA 5FFOC 3MIHA 5C71A 1JZ3A 2BJSA 3B3QE 1TNRA 5FZHA 3ZM8A 2JENA 4XBQA 1QQP2 4XPVA 1VALA 1ZBA3 3TRSB 4YW5A 4MX3A 2ZTNA 4K1ZA 1KITA 3GHNA 1QQP3 4Q1PA 1DBNA 3UNPA 2E51A 1LB2A 2ZBJA 4AFAA 3DXUA 4JKMA 5J36A 1MEC2 3D4KA 2Z42A 3IMNA 3JQWA 1ZBE2 1JBCA 3ON7A 4MVTA 5JZGA 3T08A 5JVVA 5FZ8A 5CFCC 4D6QA 4L0PA 3U07A 4RFRB 2WKKA 2RR11 1R1ZA 1Q8OA 4RFT0 4AGRA 3R4DB 5ACA1 2DDUA 4RA0A 4YM2A 2ZAAA 3PUSA 1J84A 3CJXA 2GP3A 4I30A 1W9YA 4HN1A 3RYKA 1KDKA 3D0JA 4HLTA 4QXHA 3LA2A 4XJ9A 3ZN5A 3R6SA 4CCMA 5L9VA 1VAMA 1T2XA 5F32A 1HB2A 4OCTA 4JTOA 3ZFGC 4IEUA 4A4AA 2WN2A 3D3AA 1F35A 5FXZA 3M3EA 3TEWA 1F8VA 4ZS2A 2FDFA 1Q8QA 5JSPA 4U36A 3D8CA 3DL3A 4IE7A 3NV3A 3IDBB 5AFEA 1R1A3 4MXVA 3WVJA 1YQ8A 4P9WA 3AKPA 1WCDJ 2G19A 3BU0A 3QCWA 2VQAA 1W03A 1RGSA 2XLAA 4QKDA 1W6NA 3DKWA 2R071 1PK6B 1NA1C 2J1SA 4H55A 3BPSA 4BXFA 2RMU2 3VBHB 3WP6A 3AX4A 5KC6A 3NNJA 4H7MA 5FXVA 3U4SA 3NL1A 1X9PA 2RMU3 4Q4Y1 2HWB2 1GNZA 3IN9A 4JKKA 4URAA 1ZRDA 5FWJA 2CWSA 5JLVA 2CU5A 4EN9B 5GZDA 3K4AA 1BK1A 2PHRA 2JDZA 4FFFA 4DB5A 1XU2A 2ILMA 4XFHA 4ZU5A 3ZXKA 2VW0A 2OQ6A 2BZDA 4Q4W2 2L9LA 3HNMA 2EALA 4YZ3A 5G04L 5C70A 1FOD1 3K2OA 1GOHA 4LLFA 3RYRA 3W5MA 4Q4W3 4NN0A 1UMZA 5FPAA 5IT6A 3N9OA 2VBBA 1MS8A 4XDPA 4PQQA 4NVPA 1AR73 3WCRA 3G6JB 1UZWA 3VUOA 4CXXA 4WM7A 2NM1A 2XMLA 4AVCA 2DVAA 3U10A 5DPNA 2R16A 4COVA 2GMMA 4FPJA 5JZGC 2JG8A 5AC93 2Y6HA 5KXBA 3DPRB 4GA9A 1UOFA 2ZHMA 5J37A 1LHOA 5KHIA 5F2SA 5CKMA 3HEIA 4KG8A 1GQPA 1QXJA 3DYPA 4FT8A 2CGPA 4IETA 4N9IA 3WNLA 4TLGA 3FUOA 5FK8A 2DCJA 4NHMA 5JR7B 5FZDA 4AI9A 3GJAA 3I59B 1JU4A 4IV1A 5HV4A 3GZTB 3A21A 4OHXA 5C3SA 5DN2A 4D69A 1FT9A 4W50A 3N7MA 2PHXA 3R4SA 5FZBA 3H8UA 4P9LA 2ADEA 4FOQA 5JWPA 3AP4A 4LBKA 3RWKX 3RZJA 1OD3A 2FZ1A 2B45X 2FMDA 1ZBA1 2E9QA 2VXRA 4JDMA 3QH7A 1W99A 4RD7A 3GXUA 5CFDA 4DIQA 1HB1A 5FMDA 3ZSMA 1QQP1 2CWMA 2DF7A 4PLOA 1H6XA 4FTEA 2VCCA 1BMV2 3AL6A 3DV8A 2PYTA 4FPHA 1BK0A 2GN7A 2VUCA 2QDRA 4R4ZA 2FBEA 4BMEA 3NQHA 2FDHA 3P3NA 5D8AB 3AVRA 1ZBE1 4COUA 3B69A 3NAPB 3WQ0A 1WLWA 3LFIA 5FZ1A 5GZCA 1W2UA 2CHHA 3P1IA 1VB4A 1D4VB 3MF9A 1JH5A 3ZYJB 1OUXA 4YG6A 4XF4A 3E6BA 1IKPA 3GBWA 4YVSA 1XNBA 2QDNA 3WDXA 1ULEA 4UAPA 2OXBA 3KLSA 4XFFA 3GGLA 1MQTA 2YXSA 4CP2A 4GJYA 1U5IA 2RS52 2JDNA 5IFTA 2BQPA 2FCVA 2FQPA 4JVAA 1BLZA 4BM8A 4C1WA 1BJQA 5APAA 1PNGA 3OTFA 5FBZA 5K4LA 5JOXA 2V73A 4TSVA 2ZXQA 2KM2A 5FZ9A 1EV12 5IVYA 1UX6A 2IVJA 4Z82A 5A7QA 4QPIB 1D0GA 2Y34A 3ILRA 1EV13 4G4FA 2FCUA 1UMHA 5A3MA 3H3UA 2ZX0A 5FZOA 2JG8C 3LF7A 1JN2P 2A3XA 2Y26A 5BPXA 1EPWA 2P6HA 4OHZA 2E26A 1O4TA 2RMU1 1NT0A 3IZOA 3DKQA 3SQOA 1GUIA 2GMEA 4RQPA 1CAUA 2HWB1 3FLRA 2UWAA 1RUE3 2A6WA 4UXAA 4NIAA 5GKAC 3OUHA 2CL2A 4IV1C 4NO4A 5DUWA 3T30A 3ZYGA 5IAXA 4BISA 4TXWA 5I0SA 2VUDA 3AXEA 3I54A 2WC2A 3B02A 4Q4W1 1FNYA 2GALA 2GAUA 4BPZA 4XF3A 4LBJA 2IZWA 1AR71 4B1MA 4PLNA 2D6LX 2YV8A 3VBOA 2JKXA 4DS0A 2FMYA 2OA2A 3POYA 1Q8PA 2R042 3E5XA 1UOBA 2R063 5FZEA 3HBZA 1OOPA 2VZTA 3DYMA 5FKBA 4EYUA 2IXJA 3HNBM 2BWAA 3OYWB 2NMOA 1UW8A 1GNYA 2EVXA 2FCTA 2JDMA 4QDSA 5AC91 3FX3A 1IPJA 1FMD2 2DU1A 1RUF3 2FHRA 3NNFA 2HEWF 2WQZC 2PHWA 4QX7A 4YM3A 2A6YA 3W21A 1WMEA 1FMD3 2JECA 1W6OA 1C8M3 1I5ZA 3GCWA 5AVAA 5JSOA 4TZDA 2A6XA 4XUTA 5JXHA 1LOCA 4MGQA 2HLEA 4YVSC 3CJIC 3S7EA 4W8JA 4CU6A 2JDHA 2QKDA 4XDOA 5FYVA 4ZHNA 3ACFA 5FLIA 1HN1A 1V6IA 2J1VA 2ZJCA 2NN8A 5FYHA 3WG3A 1A78A 2WJSA 5D1IA 5K7PA 3BCWA 3AMHA 5FXWA 3BPZA 3PJYA 3E5UA 2Q8EA 4DUWA 1ULGA 1EUUA 5CFCB 2LM3A 2VZVA 2YBSA 3POBA 2QZ3A 2VJXA 2R1BA 2WN3A 4RGAA 2RM22 5EYXA 4QXKA 3VBRB 4M3CB 3T1LA 1QH7A 1QXRA 2BBAA 2F6BA 3CO2A 4MGSA 3KGLA 4QGNA 2VMHA 4RR3A 2V4AA 1KRIA 4Z2WA 5F3EA 3RJ2X 1UNBA 2CGNA 2UU8A 3JD72 5J98B 1Q8VA 3SCGA 3P5BA 4XFGA 5GZFA 2OUHA 1NE4A 5GZGA 3AP6A 3N3HA 4YGDA 5FO8B 5DUXA 3N7LA 3FHAA 4OUSA 3ZFGB 3LB9A 4RQPC 1VBA2 5FP3A 3ZXAC 3HPNA 2DUOA 2ZGOA 4UF0A 2BNNA 4IGPA 2O0OA 1OLRA 1TE1B 2GNMA 4LA3A 1JUHA 3K3NA 1ZZ9A 4CCOA 3BIEA 1LJ7A 3NKTA 2Q1ZB 3T2PA 3AKQA 3WOGA 1OQDA 3ASIA 5LZ6A 2WNUA 4DY3A 5EPAA 1NA1B 1B35C 2KA3A 3CU7A 3LIHA 4IL7A 3VBOC 5JUVA 4CU8A 3U0ZA 4HSLA 3MPBA 4BJ0A 1W3XA 1P8JA 2E6VA 1EV11 3PUQA 3CMGA 2VXJA 4FPGA 4QHOA 1LOBA 5E89A 3O1PA 1FX5A 1DGRA 1OOPC 1REDA 1Q8SA 1WW4A 2XHNA 3ILFA 3IDCB 5LY2A 3WLUA 1DQ5A 2E32A 1PIV3 4QX1A 4S2HA 1XQNA 4R9AA 5DZEA 1MS5A 4NHKA 4EN6B 4FPKA 2ID4A 3ZSJA 3AKTA 5DDJ2 1JYIA 5F2WA 3RDIA 5GLVA 5C4WA 2ZX2A 5FXXA 2Y6GA 2EXKA 5FRAA 4CP9B 1O5LA 4I02A 5A32A 2HWD2 5EWSA 2VNRA 3JXSA 4FPLA 4Q4V2 4JTNA 4XJ8A 5TSWA 1G6NA 5H9RA 3AMMA 4LO8A 1X8EA 2HWD3 1ENQA 3BU7A 1S0IA 3FMGA 3VKLA 1UO9A 4MGYE 4NWVA 3A0NA 5FOBB 2D43A 3LDKA 4LOTA 1I1EA 1DZRA 5CAZA 3OGSA 1YIPA 5FYCA 1DYKA 4PIYA 4XUNA 3N9NA 1BEV3 4IW3A 2WNEA 4GAZA 1SEFA 3MW2A 4B7EA 5I0DA 4YZ4A 1LKNA 2G1MA 5FJKA 5LWBA 2MNGA 4P08A 5LRSA 2Y6JA 1G9DA 1JOPA 3ZR5A 2R061 1W90A 4AEDA 2VZ3A 3W59A 4YZ1A 2VMFA 1W9TA 4G3YC 3RPQA 5F5AA 3ST7A 2V5YA 3GZEA 5EYYA 2UURA 3KZ4C 1RUF1 2DVFA 5A7SA 5IVBA 1DYPA 4B29A 5C33A 1C1FA 3LEGA 4XIOA 1FMD1 1E5IA 2JX9A 4LIVA 3WNMA 3C7GA 4NIGA 4LE4A 1DG6A 1Q56A 1RVF2 3MUY1 4PF5A 4LEJA 2J1TA 3URFA 2YB7A 1RVF3 2R7EB 4MHRA 4AAXA 2DVGA 1TVGA 1PHMA 1UPIA 4A2UA 1LECA 1L3JA 1LTEA 3V64A 4LKDA 1ACCA 1WWYA 3IAPA 1JYWA 4GMP3 2W68A 1AX1A 3E6CC 1ZRFA 2C9KA 5FP4A 3AVSA 4XBLA 4FSJA 1CESA 1W6NB 1H1AA 2WNUC 3M3IA 3VHOA 3EHKA 2DYCA 2MEV2 2AUYA 3J8F2 4FOYA 4NRMA 1LHNA 1OF4A 3MZHA 5CA6A 4JCKA 2GP5A 1XNTA 4I3PA 4C0HA 2OIIA 2GMPA 1IPSA 3OBZA 1LOFC 1YI9A 3JD71 5ISLA 3ZSEA 2W46A 4TN7A 1YFXA 2YU1A 4C8DA 1US2A 4LT5A 4ZXKA 2ZPXA 5C4WC 2VULA 3AZXA 3NJVA 2QUOA 2P4EA 2DUQA 3AMPA 3GHMA 2ZGKA 2P5BA 3QLQA 4IERA 4P9JA 4PIXA 4EWAA 1RC6A 3GNEA 4YW7A 1VBA1 3FFZA 2WA4A 2D93A 3RS6A 5IK4A 4IEPA 4AR2A 4NROA 2W1SA 2XH6A 4FBFA 1H6YA 1OH3A 4FXGB 2ZMLA 1V6KA 1VBB2 1JOJA 2ZHLA 1YXWA 1WCSA 5FY9A 1JYTA 2J1AA 2Z2SB 3HN1A 3POSA 1FATA 1ZREA 4IE0A 2OPWA 4K1YA 1ENRA 5DG1A 2JG8B 5F3CA 4HK9A 1S0JA 2VG9A 5FPBA 4I2OA 2B42B 2D98A 5CU1A 2LROA 2WWJA 2I74A 1AXZA 5CKQA 4AEDC 1OPOA 3VZKA 2FDKA 3OGGA 1PIV1 1FAYA 1ZZ7A 3I2FA 1IS5A 4BK5A 2A71A 5BXXA 1QJU2 1SLBA 4CUAA 4F3JA 3A7QA 1BBT2 1RUOA 1YQ2A 3U75A 4CCEA 5FYZA 1BBT3 1CAWB 1AYM2 4Q1RA 1S55A 2HWD1 3ACLA 4GB33 3M7AA 2FD8A 2R32A 4NIHA 4AK3A 1WCKA 5A70A 2R1DA 4DOUA 3GF6A 4XILA 4LK7A 5A3UA 3OGRA 1BEV1 3WY6A 1J83A 2RDNA 3ZSKA 3M3QA 4ASLA 2CSGA 1HRV3 3ROUA 4QQ2A 2Y60A 3LGRA 4AEJA 1LCLA 3NAPA 3MV01 3RMXA 1S1AA 3O1TA 1O3SA 4ES9A 3H8XA 3UV9A 5FBJA 1R092 3LEIA 3QH6A 4YGBA 3U78A 4EZHA 1VBD3 3NO8A 4LKFA 4M4RA 2VZUA 4AE2A 2JE8A 2JE7A 2CNAA 1S0GA 4WV8A 4XF0A 5IVFA 3K51A 4QB1A 5I91A 4LKSA 3I97A 2PHTA 3NRUA 1RMU2 1OA2A 1IS6A 3MUZ1 5FPZA 4EWEA 3K3OA 4DXRA 1YJLA 3CJIB 1CPMA 1O7FA 2Y38A 2JIGA 1GSLA 4JKLA 5SV8A 2D44A 2QQOA 5LA2A 1URXA 1POQA 3PVEA 1W8FA 2I2SA 3HQUA 4D0QA 1RVF1 5T3NA 4CCLA 3KMHA 4EN0A 2P17A 1SBDA 3QOPA 1W6MB 4X6QB 1LHUA 1U5XA 3VZOA 4EN7B 5IAVA 2ET1A 4GMP1 2WT1A 1LOAA 1OVPA 3WG4A 1XPWA 2NMNA 2ERFA 4Q0QA 1YQ5A 5A7OA 3WINE 2JDAA 2RS32 3HQRA 4AFCA 4B1LA 4MXWB 3IBMA 3RG0A 5E88A 2RS33 3HD8B 5FZOB 1J1LA 1OF3A 4E2GA 1AL22 3BOPA 2BRTA 1PMIA 1HJGA 2XVKA 5D2AA 4LK6A 1QY4A 2GC1A 3O0XA 1NLRA 4RQPB 1CAUB 2F4PA 5FZMA 3ZYIB 2XG3A 2HWC3 4Y3OA 2VQTA 3VD7A 1YFYA 1SLCA 5K0UA 1N1YA 4UW6A 1ZX5A 1DZTA 1C8NA 1MVQA 4X8PA 2BNOA 2K46A 5F3GA 5L73A 1V6NA 4AOCA 2QNKA 3J7LA 3NNMA 4WVVA 4EN8B 4E2QA 2VQ0A 3ZSLA 4B4QA 2XKPA 3A23A 4NIDA 4L9BA 5FZ7A 2Q1MA 3S6PA 2XJVA 2WLPA 4GIQA 1B35B 1WA4A 4S2GA 5ACA2 3S57A 5F39A 3HQXA 1O3TA 3AFKA 4BQWA 5F6LB 1GU3A 1JHNA 1OOPB 1S0EA 3NAPC 4YFZA 4KU8A 5FY0A 2RDRA 3HIFA 4FPFA 1MZ5A 1OQEA 2P3KA 1DFQA 3HWJA 2ZGNA 4EJRA 1ZM1A 3LQCA 5IVEA 2Q4SA 4CTEA 1HQWA 1AVBA 5A3LA 1W6OB 4AQTA 1GFF2 4YFWA 3TBDA 3WG2A 3W5NA 1JXNA 1DYOA 1UY3A 1QOOA 4G9SB 4A7YA 4QHBA 1GZ9A 4QKFA 3PHMA 4M01A 4COWA 1XBFA 5BV6A 1PX3A 1RYYA 4ONUA 5FDBA 4MHUA 4P9IA 2QJVA 5C5UA 3HT2A 4C1XA 1EYBA 1BBT1 5KWRA 1NQJA 4WVWA 3UKTA 3THCA 2EXIA 4GB31 3THPA 4ARYA 3TOJA 3VV1A 2R072 4W6WA 2W87A 5A1FA 1W2NA 4YGEA 5M0TA 5CFCA 1AL0G 2DVDA 4XAAA 5FK7A 4XURA 3B94A 4UW5A 4QQLA 3VBRA 1H2KA 4M3CA 4OUEA 5H9QA 5IUQA 4Q4Y2 3ZDVA 1HRV1 2ORZA 2D3RA 2LUWA 2D5HA 4H7LA 2E7TA 5DG2A 5IATA 2WZR2 1QJFA 1VB2A 4HVQA 2DCTA 4V2WA 1RUJ2 2BVBA 2W0XA 4KWKA 1YO8A 2WZR3 1C28A 4HMZA 1VBD1 2VZRA 1RUJ3 3KD4A 4MGKE 4W6YA 4EWDA 1UX7A 1WKYA 3ZFGA 3OD4A 4QHZA 3ZDSA 4DRVA 2GH2A 5CNAA 4NJ4A 3ZN4A 1GOGA 3GYDA 2DCKA 3ZMNA 1JI6A 2B8MA 3ZN6B 4E27A 3AJYA 5CG9A 3K75B 2O8OA 1HDKA 5LA0A 1AUYA 5K0UC 1UKRA 4PT6A 2W1QA 1YNAA 4QAWA 1ZZ8A 3Q8EA 3T2OA 2W52A 5J96B 2XWJB 4D6SA 1W9WA 4CE8A 1GP6A 1NA1A 1VLNA 1OURA 3FLTA 1N3OA 3B9CA 4XMAA 4FAGA 4A41A 4E8DA 2UYAA 3WNPA 2BNMA 5L9BA 1V9U2 5F6KA 2RS31 4CCDA 4LXLA 1W05A 4HN0A 2A3WA 1UIKA 5L7OA 2A6VA 3VZMA 2GC0A 2Y0OA 3OUIA 1DCSA 3MIGA 5ABJC 2ZGPA 4XQ4A 1Z7S3 5DZFA 2PXJA 3DN7A 2CTVA 5C4WB 5FTTC 4GKXA 5FO7B 5A32B 4HKLA 5A6YA 3AKSA 1ZBA2 1AR93 2YDEA 5FJHA 1AYN2 1LGBA 2HWC1 1JYVA 5GLUA 1QHDA 4NHXA 1OLME 1AYN3
chains in the Genus database with same CATH topology
3DGTA 1WW7A 4W65A 1AX0A 3VZNA 4BIFA 2KXLA 1BYHA 3AKRA 3M8LA 5JPMB 3HT1A 4Q0PA 1GICA 1FXZA 4LBQB 3T2TA 4XIKA 4AWDA 3H3ZA 2ZMKA 3JBG3 1XXNA 3SH5A 3VBRC 1QOTA 1SDWA 4AEDB 3I7DA 4R9DA 4FQ4A 4XYXA 1M4WA 5GZEA 1SMVA 4GQ7A 4KNCA 2D6OX 1A8DA 4IEQA 1G9BA 2BVVA 3LKJA 3UJQA 3N4MA 1NCRB 1W39A 4AVSA 1R1A2 4GXLA 3VBUA 1H2MA 3U4XA 4XJUA 2SBAA 3B93A 4PDWA 2JE9A 5I8SA 2RS13 4OLLA 3WDYA 4XOGA 4BYYA 1ND2B 5T50A 4F8AA 4LBLA 3TN92 2TBVA 1RTVA 2GC3A 1XRUA 1X8MA 5J3UA 3DUIA 3TN93 1U5YA 1VIWB 4CDWB 2I07B 3TWIA 4B4PA 3R0RA 1XNDA 2VOWA 4F83A 5JIAA 2WZR1 5E8AA 3R4UA 1QNWA 1YCIA 3N36A 1QKQA 1RUJ1 4AVBA 4L8QA 5HCBA 3IPVB 4XFBA 3WP5A 4YZ5A 5L7OC 1QXPA 2AYHA 4XDQA 3WP3A 1H4HA 5FOJB 1AR72 5FAXA 2NLRA 2HWE2 2K2SA 2GDFA 2ZACA 2HWE3 3ZO0B 4AYUA 1O3RA 3V0BB 2YZ4A 4YZ2A 4QQOA 2XLGA 5AC92 1ASJ3 4YSFA 3LA3A 4D94A 3ELNA 1YFWA 3W9AA 5JI7A 4XHBA 1DQ2A 1F5FA 4UBHA 4Y26A 3WXPA 3A4UA 1LGCA 4KWJA 3AYEA 4XTMA 5KHJA 2CYFA 1FPN3 1V9U1 4GMP0 2ZAHA 5JOYA 3RMYA 1Z7S1 1CAWA 1W6QA 1AR91 1S0DA 3AMQA 1PO23 4B3NA 4ZKTB 2XBO3 3VBUC 2WL1A 1AYN1 5BY5A 3PVNA 1W0PA 4PDWC 1UF2C 4RL7A 3EO6A 5K8SA 4AG4A 1NXMA 5BYNA 1XNCA 3S30A 3S7IA 4H3WA 1PZ9A 1QNYA 4JC1A 1D0HA 1KJRA 1DIWA 1XE8A 1HW5A 5KXEA 1MVEA 3LOBA 3KT7A 4CP1A 3ZVXA 2DWRA 1G7YA 4S2FA 3VDDB 3AZWA 1KXGA 3M3CA 1QWRA 3VZJA 4AI8A 3CJIA 4MGZE 1MS3A 2QCSB 1JUIA 2IC1A 3AFGA 4FCAA 3INAA 2D6MA 2DV9A 3ZFEB 3KCCA 1OFNA 4A7KA 3MFAA 2XB6C 1NOVA 2D97A 3ZXEA 1N1VA 5K9YA 3KGZA 3AMNA 1W6MA 4CDQC 1R1A1 2RJLA 1NG0A 2RS11 1KJLA 3OBTA 4LUMA 3EXUA 1CQ9A 2VNOA 3SHRA 4BHPA 4BE3A 4XTPA 5JPNB 4MXWA 3TN91 4CDUB 2X8KA 1KFXL 4OVEA 1VBC2 5T54A 2YROA 3LAGA 3MPPG 1RUH3 2GN3A 4XFCA 1PVC3 1VBC3 1RUE2 1GLHA 3AZYA 4AHWA 3D5OA 4AEMA 4L97A 5LRRA 3GALA 2VGDA 2XJPA 3AM2A 5H9PA 2C5DA 5K0UB 2CGOA 2GH8A 4PCRA 4BLIA 2VOKA 4LNVA 4MH0E 4R9CA 3GZUC 4HKOA 1DU3D 1B35A 3VKMA 2HWE1 1WUVA 1NXD1 1D2SA 2R062 2WINB 1RJ8A 4OI4A 3C3VA 5CVRA 2X5IA 1JTZX 3SISA 5AFBA 4HETA 1ASJ1 1H30A 1RJ7A 4MV2A 4BLJA 4QU2A 1VAVA 4DY5A 1X36A 1TME3 1RUF2 3JUUA 4M00A 4B4RA 4JDNA 3SITA 4KU7A 1C8M2 2XWBB 1LHWA 2JJ6A 2VMGA 3VN4A 2HEYF 5ABJB 2VY0A 4N7IA 3QBQA 5I0UA 1UZYA 2BPA2 2K9ZA 2A70A 1I6XA 4YVWB 1YFUA 5T5LA 1HXS2 4J6GA 3WT3A 3ILNA 2LTNA 1RUI3 1PO21 4URTA 2JD4A 1HXS3 2XBO1 4E4ZA 3TYJA 4KGGA 3AXDA 2Q0AA 3EJKA 3OBRA 5HI0A 2WT2A 3JCIA 2DU0A 1Y7BA 5BNQA 3I4IA 3O12A 1T6GC 1HV0A 2FZ2A 4QPYA 4N90A 2JICA 4LTAA 1NQDA 5J48A 1RUNA 5JCTA 4FO9A 3RWNA 3VKOA 3KB5A 1QJY2 1QH6A 4PIZA 1ULFA 4XQWA 3ZN6A 1D4M3 1UAIA 1QJY3 3PVOA 2VH9A 4R8HA 1GV9A 3OGJA 1LRHA 1ULDA 4COYA 3ZFFB 4ORFA 1RIRA 2EIGA 4LBQD 1LEDA 1K5MB 3J4UH 2AGSA 4FOWA 4CZSA 1ZRRA 5H9SA 2AENA 1CAXA 1QJZA 3E6DA 4Y1UA 4LUKA 2X5IC 1PIV2 3B00A 3WD5A 3AP9A 1HRI3 4N53B 1APNA 1U0AA 1LOFA 2VU9A 3ES4A 1YJKA 4QD2A 2XL7A 1IQAA 4LA2A 1RUH1 1LULA 2DVBA 1PVC1 1VBC1 4NHLA 4CP0A 5L7OB 4BMBA 4Y5Z0 1RUE1 4NOTA 5BNOB 3MF6A 4JAAA 1O5UA 3ZXLA 3VBSC 3RNSA 4M3CE 5FREA 1MZ6A 1COV3 2R0FA 3WDVA 2Z69A 1BEV2 4OHYA 1CR7A 4LR4A 2NP0A 1D2QA 1V6LA 1NYWA 4XJWA 4YNIA 2PHLA 4LBQA 4JRAA 2W08A 1SFYA 1CJDA 4WZFA 3ZX7A 3O5SA 1TME1 1GZWB 3M2MA 1G86A 1N1TA 2O1QA 3SXWA 2XVGA 4Q4X3 3LWCA 2XJSA 1C8M1 4HFSA 1NCRA 5F5QA 2R6QA 1HQLA 1Q43A 3AP7A 3VBUB 2WNVA 1C1LA 2Z5WA 2G9FA 1RUI1 3RQ0A 2EXJA 3KT1A 4PDWB 2TUNA 1ND2A 1HXS1 1MACA 2GSYA 3WDWA 4E4DX 2Q5TA 3JZVA 1CGPA 4ASMB 4GWNA 3GBFA 1VAKA 4DZGA 3SMHA 4CDWA 5FPXA 3PJQA 1G8WA 1REFA 1DGRN 1MS4A 4LBOA 3FHIB 4LHKA 1ONAA 5CB7A 1IKQA 4V1PA 3IM0A 2PHDA 3IPVA 3ZPYA 1HV1A 4AFDA 2SLIA 3V0AA 4IEWA 4AF9A 1D4M1 1QJY1 4IEXA 2WSUA 2XJRA 2PAEA 4L11A 3OPZA 4CDQB 4YG0A 3V0BA 1LU2A 4MUVA 5JAXA 3VZLA 3H7YA 3CEWA 2HYKA 1OA3A 3ETQA 5HBAA 5HCAA 2ZOEB 3MICA 3WW4A 4B8EA 1F31A 1YWKA 4XXPA 3WCSA 3O7OA 2HJIA 1HRI1 3FBYA 3V56A 4HVRA 1KFUL 2EXHA 1QMJA 1PGL2 1CN1A 2JG9C 3CNAA 1H2NA 2WFPA 4C91A 1N3QA 5C8WA 1H0BA 3WZ1A 4AGVA 3W58A 4FTSA 3RJRA 1UU5A 2QZ2A 1ENXA 5A33B 2ZCWA 4GB32 1NCRC 1W6QB 4JDOA 4DFSA 4JQRA 2BUKA 3L2HA 1DGWX 1AX2A 2ZGTA 1NLSA 1PGW2 1UU4A 3N7JA 1NY72 1H1MA 4YARA 2Q8OA 4YW1A 2WNVC 1IS4A 1F5JA 1DQ0A 4OI0A 4IV3B 2E7QA 1HRV2 1ND2C 1KS5A 3PMSA 3PMEA 1UPSA 4Z07A 1CVNA 4UW3A 1H9WA 1VBD2 2OVUA 4CDWC 1RUC2 5I0RA 3MIFA 3VDDA 3AYAA 3BTAA 3RI9A 4HPKA 1RUC3 1UKGA 5LEKA 3KCXA 1A6CA 4Q4X1 5BNPB 3MLJA 4IESA 3AYDA 3HMYA 3ZFEA 5KBFA 1LGNA 2YUEA 1CAVB 1N47A 4AQSA 1ZZ6A 2BGCA 2WS93 4KL1A 4K20A 3H1MA 4COZA 1SLTA 3O0WA 3L2YA 3B9IA 4XMIA 3B5LB 2PLV3 2YGLA 4CDUA 2GC2A 2D3SA 1VRH3 3H50A 2P34A 4AW7A 2YY1A 2TNFA 2ZS6B 4LHLA 1ZNPA 1OQ1A 1EAH3 2ZX1A 1O4ZA 4WM8A 1F9KA 5T5JA 2HWC2 3WNXA 3IKWA 1WW6A 4OHWA 1LEMA 3M70A 1YIFA 2MPFA 4QGLA 1UD1A 2PFWA 1AR63 1ZRCA 4J1XA 1I3HA 2OYZA 3UL2A 3WW3A 1N3PA 1AF9A 3K48A 3ZXJA 1DHKB 1RHI3 2P3IA 1J3PA 4WZCA 4CEWA 2X5IB 2WLQA 5KHHA 3J9SA 4AFMA 4W6XA 2A6ZA 5E16A 3WW2A 2ZKLA 4AEKA 5KHGA 1YRZA 2AH2A 2PAKA 1UZZA 5ABJA 5IK8A 3TB0A 2IXHA 3VDDC 5DUVA 1V6OA 1A3KA 1PGL1 1LODA 3APBA 3WW1A 1Q3EA 3BB6A 4CYDA 4YVWA 3NJZA 3VBSB 4XF9A 3SCHA 3BALA 2HEVF 3ZFEC 3UK9A 3FUQA 2LALA 2VVFA 3I8TA 3X29B 4DXZA 3TAYA 1U5ZA 2DTWA 4LHNA 1PGW1 4CEYA 4QT6A 1RL3A 2BW8A 1NY71 3G7DA 3ZXDA 2NZ9A 1B09A 3IIAA 4B7KA 4FOVA 4CDUC 3WUCA 2EAAA 2A7AA 4YW3A 2QFEA 4QM9A 4SLIA 3VBFA 2PA7A 4RHV2 1NCQB 4P9GA 1RUC1 2YYOA 5J7MA 4WM8C 4PQ9A 4RHV3 1VJ2A 2CV6A 1FV3A 5C6CA 1CD3G 3PNAA 3ZFFA 4WVZA 3JB4C 3OD0A 4RSUA 1K5MA 2WS91 4NPRA 1AJOA 3M3OA 5KC5A 2ES3A 3M4FA 1DGWA 2PLV1 4DNYA 3WV6A 4J1WA 5B2GB 1SCSA 1VBE2 1S2KA 2WFF2 1DF0A 1QOSA 3D82A 1VBE3 4N43A 1CAXB 2WFF3 4N53A 1QF3A 1MR5A 4CEWC 1VRH1 3RI8A 1FOD3 1SLAA 3KCYA 4GH4A 1H9PA 2D6NA 2IXLA 4IQPA 4EROA 2A3YA 1LESA 1Z7S2 4BCUA 1GBGA 1EAH1 2WZPP 2DFBA 1F2NA 1AR92 1Y43B 5C9AC 3AB0A 2JKBA 1ZA4A 5BNOA 1AHSA 2YMZA 4Q26A 3VHNA 2W39A 3AYCA 2VMIA 4YVWC 2YPJA 1TMF2 1J1TA 4Y1ZA 1OLQA 1N1SA 5BNNA 1TMF3 3EQEA 3ZYPA 4FTBA 4Q29A 2BYVE 1R083 1LHVA 3PVBB 4AVAA 4O9EA 1MS9A 4EV0A 3JBG2 3TNQA 4CEYC 3L9JT 3NW4A 1RHI1 2EAKA 1X50A 2XVLA 1SBEA 1GZWA 1VP6A 3QD6A 4JGYB 3IDEA 2N7GA 4LULA 4BOWA 2JG9B 4K7JA 4XFIA 1WMDA 5I93A 3VBFC 4FQZA 5I0TA 1ZVFA 1POV3 4K21A 2ZMNA 3N35A 3WDTA 4HBNA 1MEC3 4Y20B 4Q2FA 3LA7A 4S2DA 2RS12 5FCCA 1ZBE3 3ZFFC 3VHRA 3TNPB 2WNVB 2ZGSA 4Q27A 3H7JA 3ECQA 2IWGB 3ES1A 1K5MC 5JI9A 2XJUA 1G9CA 4ISQA 3UKNA 3WHUA 1WMFA 4KBBA 4Y1YA 1UN1A 4YM1A 4I0AA 1S0FA 1PZ7A 2UYBA 3SH3A 4N43C 5AVPA 4N53C 3J26N 4N7UA 3ENRA 4GH4C 3E97A 4OZXA 4RS5C 4MGIE 1RITA 4WBBA 1G9AA 4RHV1 4QQHA 5BNOC 2YHJA 3UJOA 4HL0A 3V0AB 4K3UA 1GNHA 1IZ3A 4WVMA 4XW3A 4YW2A 4CDQA 1ND3C 4QMAA 4QPGC 1Z0HA 4GALA 2OPKA 5KXCA 1BZWA 2IXIA 5DUUA 5LK5A 2QVSB 1ASJ2 4K40A 5BNNC 5FLHA 5KXDA 4P14A 1KDMA 2RE9A 4I09A 4MZUA 3BIWE 2HWB3 2OZ6A 2Q30A 1OHFA 2NYYA 2GNBA 2IFWA 3WUDA 5HXVA 5GLWA 1VBE1 2ET7A 2ZGQA 2B7YA 2WFF1 1SBFA 4YG3A 3ZMOA 1FPN2 1O3QA 2PELA 1OPMA 5GLZA 1PGSA 1Y3TA 4XF1A 5T5OA 4DQAA 1OI6A 4D3WA 4HSJA 1IHMA 2GNDA 1PNFA 2YGMA 5A33A 1DQ6A 1IGOA 1PO22 1BQPA 4OULA 5HCFA 4ATEA 5F9TA 1NE6A 2XBO2 3KQRA 3USSA 4AI1A 1QU0A 3MDPA 4H14A 3CLPA 4SBVA 4YRDA 4IV3A 3H0OA 4FP2A 4UW4A 2NQYA 1TMF1 3GBGA 1R081 4A3XA 5FQ0B 3VLBB 2R30A 1LR5A 2VOVA 5LK7B 2A5ZA 4Z8BA 5GJ6A 3T1MA 4NR1A 5GLTA 5DZGA 1EPZA 1BKZA 3JBG1 1H8TA 1ULCA 2XHKA 1FNZA 5CADA 1W0OA 4HZFA 1IS3A 2HWF2 4HPKB 2PHFA 1HX6A 5BNPA 3AK0A 4PBOA 2HWF3 4ATFA 1H1IA 1CAVA 1POV1 4TLFA 2WT0A 1JW6A 4LBNA 1MEC1 3KS7A 1GKBA 1JYCA 2B46X 1UIJA 4CDXA 1PZ8A 4XZPA 3PLQA 2CY6A 5EXOA 1TEIA 2D5FA 4KQ7A 4AHZA 1GZCA 5JIUA 1OKQA 3MGUA 1C5HA 3WP4A 4FXKB 1RUH2 2XPJA 1ZZBA 1PVC2 1XYOA 2PAMA 1XYPA 1MZEA 3WX5A 3NV4A 1O91A 3WDUA 4WM8B 1CIWA 2RS53 2VVEA 2A75A 4M0NA 5BUVA 4K9SA 1YHFA 2VPVA 4YLZA 5FMOS 1H4GA 4WM7C 5JOWA 1X33A 4XETA 4XJZA 2RJKA 3ATGA 3B01A 4FPYA 4LBMA 4I0WB 2NPIA 2DUPA 1UL9A 4IV3C 1QGLA 1CPNA 3CF6E 5FMOL 1TME2 3I2DA 2AZ5A 1DGLA 4CEWB 4QM8A 3LOIA 2WIIB 1H8TC 4JGZB 3O14A 5C8CA 5C9AB 1FPN1 4U2AA 4JRLA 3VBSA 5CFDC 4AGGA 5BNPC 4HT1T 1PO12 5JOZA 1RUI2 3A0KA 2WQ4A 4Y22B 5IK5A 1PO13 5EZWA 1LOEA 2CAVA 1QJX2 2R043 3NKGA 2B5HA 4LO4B 4FAHA 2UWBA 3VL9A 1QJX3 5CIRA 4MSVA 3RZZA 4GKYA 3WHTA 4CDXC 4CEYB 5CG8A 5LEJA 2AREA 2XJQA 4XXAA 3THTA 1WBFA 3OY8B 1I9RA 2DCYA 3SCFA 4YYOA 3FC0A 3HAGA 1RUG2 2O8QA 2BFUS 2D6KA 4OFGA 3WG1A 2DURA 4M0HA 1RUG3 2XUMA 4AXOA 1AR82 1NCQA 1MQTC 1D4M2 2D40A 3VBFB 1AR83 2C9AA 1G9FA 4BWOA 1H8VA 1X82A 3FWEA 2K0GA 2HWF1 2XKOA 1W6PB 2BFUL 3FFQA 1AZDA 1U12A 1ZYBA 3FE5A 4AQ2A 1BMV1 1UCXA 2C1FA 2RM23 1J59A 1LENA 3IWZA 4QQPA 1CONA 4X8NA 3QACA 3JQXA 4TYSA 3AP5A 3FJSA 1WBLA 3JD73 1HRI2 1SQ4A 3AZZA 4IEYA 4N43B 3SLIA 4BQ1A 1KS4A 1VBA3 4GH4B 2QQPA 1FI2A 1AJKA 4RS5B 1ALYA 2UY8A 2ZX4A 2ETEA 5FLJA 2AR6A 3ZYRA 5C8CC 2B9UA 2RS51 2A73B 1Q5OA 5DXDA 2D3PA 1COV2 1GR3A 5T52A 4OHVA 1ND3B 4QPGB 2WSVA 2OZJA 1PM7A 1V00A 4HK8A 3LCPA 5BNNB 3WQ1A 1NZCA 1O4YA 2MHFA 1V6MA 3VL8A 3OJBA 3KM5A 2GU9A 2C0ZA 5J09A 3AJZA 4JGYA 5DDJ3 3USUB 2E63A 4RGGA 3JB8A 1HLCA 4FPEA 3NV2A 4Q4X2 1AXYA 3BODA 4Q4V3 2ZGUA 2JG9A 5FO9B 3VKNA 3SH4A 4FPCA 1NCQC 4IXLA 4MLOA 3MYXA 4XFAA 1OA4A 1HIXA 2XL9A 2WWSA 4DRRA 4Y20A 4E4SA 2Z79A 4Y1VA 5JZGB 4AVVA 2VW1A 1WGPA 1WLCA 1PO11 4BH9A 2BTVC 4Y1XA 2D7FA 2R041 3WQ7A 4LE3A 2ATFA 1M06G 4Q0VA 4LO5B 4RR3C 1QJX1 3OF1A 4ITCA 2BEOA 2H6CA 3U11A 3R05A 4P9YA 2D6PA 3MLKA 3E5QA 1DZQA 3EBRA 3Q9OA 2V09A 1ENSA 1XU1A 3OCPA 4QGMA 4AFBA 1FYUA 1IPKA 1RUG1 2G9GA 2OUJA 2VUAA 2VECA 3D0SA 3JU9A 1AR81 1DQ1A 1PK6A 3RSJA 4HANA 1E57A 3N7KA 4FVVA 3FZ3A 3VBHA 2PHUA 4WVMB 1S2BA 1V70A 2G4IA 3S0MA 3LZZA 4KGQA 1CX4A 4PLMA 2RM21 4F7ZA 1CJPA 3POWA 2MEV3 3J8F3 4I0BA 1DQ4A 2ZGRA 3ZIXA 5L19A 4IEOA 4XQDA 1C57A 2EA7A 2WA3A 1POV0 2RHPA 3MW3A 4BZ4A 4FP3A 4D7TA 1Y9QA 4XE9A 4JGYC 4PBPA 4AHYA 4ZU7A 1RUD2 1C3HA 4Z92B 2OW4A 4LLOA 4YM0A 4L99A 1RUD3 2VUJA 3ZXFA 2VNGA 3MLLA 4I01A 1WLTA 1EP0A 4AVTA 1A8MA 2P3JA 3RYPA 1DLLA 1V6JA 2I45A 1S0CA 5L36A 4P5HA 3H9AA 3ME2A 1BVVA 1VBB3 4WM7B 4FPOB 2PN5A 1Z78A 5EFUA 3LSDA 1COV1 4OUMA 3VGIA 3DPRA 3WR0A 2ZHNA 4KWLA 2IFRA 2EF6A 1QDCA 1XE7A 2YC0A 5FQ0A 4QX5A 4CRQA 1REEA 3I59A 4XJAA 1QDOA 4YW4A 4XHXA 1QJU3 4IV1B 5DDJ1 1BCXA 3VHPA 3FLPA 1H8TB 1AXKA 1SCRA 4Q4V1 2ZX3A 4OI2A 1AYM3 3B7MA 2ENRA 4K6BA 5CFDB 2ZZQA 1RB8G 1WLDA 3H1WA 1C4RA 1LOGA 3DF0A 1EY2A 2P2KA 1YUDA 2WS92 3KT4A 1MS0A 5D8AA 1PK6C 3MIEA 2PLV2 2PTMA 5GALA 4BIOA 3VBHC 4R9BA 4MYEA 3MEPA 4CDXB 2ZZJA 4Q0SA 1KQRA 1WD3A 1R093 1VRH2 4X6RB 4GULA 4XEZA 4YVSB 1J58A 4JV4A 1RMU3 4HKWA 1EAH2 3P3PA 3UKVA 1PVXA 1MQTB 1H2LA 4D7YA 5JDBA 5T5PA 1GANA 4AHXA 4L2NA 4ZU4A 4AQ6A 3RRDA 1AR62 4QPIA 2UY9A 1XYNA 4GWMA 2Y0IA 4IEZA 1SLIA 1MZFA 2B39A 1WD4A 3DPRC 1RHI2 5EJ3A 3ALQA 3MFCA 4KH9A