1V00A

Erythrina cristagalli lectin
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
239
structure length
239
Chain Sequence
VETISFSFSEFEPGNNDLTLQGAAIITQSGVLQLTKINQNGMPAWDSTGRTLYTKPVHIWDMTTGTVASFETRFSFSIEQPYTRPLPADGLVFFMGPTKSKPAQGYGYLGVFNNSKQDNSYQTLAVEFDTFSNPWDPPQVPHIGIDVNSIRSIKTQPFQLDNGQVANVVIKYDASSKILLAVLVYPSSGAIYTIAEIVDVKQVLPEWVDVGLSGATGAQRDAAETHDVYSWSFHASLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords LECTIN (ECL)
publication title Crystal Structures of Erythrina Cristagalli Lectin with Bound N-Linked Oligosaccharide and Lactose
pubmed doi rcsb
source organism Erythrina crista-galli
total genus 57
structure length 239
sequence length 239
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1v00A00
1W6OA 2R0FA 3PVOA 1LENA 1LULA 4AVTA 2R1BA 2UU8A 1URXA 2YXSA 2EXHA 3ILFA 1CPMA 4FPKA 2UWCA 4GXLA 1UL9A 1LTEA 2DU1A 2BQPA 4LBJA 1WLDA 1TEIA 2WSUA 2PHFA 2WJSA 3WG1A 1GV9A 3V0BB 1G9CA 4ZKTB 4YW5A 2GDFA 1WLCA 5JOZA 3PMEA 4XJ9A 3ZSKA 3WDWA 3AP9A 2GN7A 3AZZA 3WG2A 4YZ4A 1N1VA 2ES3A 3B00A 3FBYA 1QNYA 5HCBA 5H9PA 2E6VA 5CA6A 1X50A 4Q26A 2ARBA 5DG2A 1WUVA 2YMZA 1HQWA 1DZQA 2ZMNA 4RL7A 2D6MA 2GMPA 1GNHA 1SBEA 4Q8LA 1GYKA 5E89A 1YXWA 3RQ0A 3OY8B 2R16A 2A6WA 1SLIA 3AYAA 3MW3A 3R4UA 3WCSA 3WDXA 2CTVA 4R9AA 5JMCA 1BQPA 1J1TA 3KM5A 4BMBA 1VALA 1ULGA 2EIGA 2SLIA 3GNEA 1N3OA 1C57A 2W52A 1SCRA 4FPGA 4CTEA 4XIKA 4JRAA 3ZXJA 4OZXA 2ZMKA 3BIWE 4NO4A 4P14A 1Z0HA 4CZSA 3AX4A 4BOWA 2UURA 2VY0A 5T55A 4FOYA 3APBA 4FOVA 4M3CF 3JUUA 3RS6A 4Q2FA 4YM3A 1W6OB 5GLZA 1W0PA 3M3QA 1VLNA 1DQ1A 1LODA 2FHRA 2VW0A 3ZXLA 3A4UA 1KDKA 2NM1A 5CBLA 1NXD1 1H30A 4ITCA 1G8WA 3ZXEA 5KXCA 2TEPA 4YFZA 4ASMB 2P3KA 4U36A 3AZYA 2AYHA 1V6OA 4YM2A 1Z78A 3H0OA 3VKFC 2R0HA 4XILA 1V6KA 3INAA 1N1TA 2VUAA 2XG3A 1G7YA 3OGGA 1S1AA 1GZWA 3IMNA 5JOYA 3ZSMA 4GWNA 1AF9A 2JECA 3AP7A 1AVBA 4DS0A 1DQ0A 1WD3A 4YZ1A 4XJZA 3WG3A 3O0XA 3M3EA 3NWKA 3RRDA 1ULCA 1KRIA 1UZZA 3FLRA 4FOQA 4FPOB 2V5YA 4FOWA 5KXEA 2JE7A 2JJ6A 1W0OA 1SLCA 1ENRA 3WDVA 3U4XA 5SV8A 1AXZA 1ULEA 2B7YA 2NN8A 1PZ7A 2YZ4A 2NP0A 4NOTA 2CWMA 1UMZA 4FPJA 1ULFA 4XXPA 4LBQD 4PBPA 1AX0A 4XJUA 1LOAA 3N7KA 1CPNA 4WVWA 1AJOA 1F9KA 4LBLA 4ZXKA 4Y20B 4Y1YA 1OKQA 1UKGA 4YGBA 4YZ2A 2VW2A 2ZHMA 2LTNA 1DQ2A 5EYYA 2E7QA 1V00A 2CWSA 4UW3A 4H55A 1IS6A 1QF3A 3AXEA 3VKOA 3WUCA 1LGBA 1FV3A 4FQZA 4XBNA 3B3QE 2DU0A 3N3HA 1YO8A 2A70A 1CESA 2GNTA 4D69A 3VUOA 3FUQA 1MS9A 2GNBA 4Y1UA 1LJ7A 5H9QA 3UL2A 4KBBA 5FRAA 4LBMA 1V6IA 3QLQA 1MS4A 1QMJA 1MS0A 1FNYA 2OVUA 2ZGOA 1CVNA 1GANA 5IK8A 2D3RA 4MYEA 2CNAA 3WHUA 1S0EA 2A6VA 1YI7A 4R9BA 1EPWA 1IS5A 1W6NA 1JBCA 1BXHA 4PBOA 5IK5A 1LU2A 3WG4A 1G9BA 3AFKA 1LECA 1RINA 2D6LX 4RA0A 4PQ9A 5GLUA 2ZHNA 2Q5TA 4Y1XA 2P37A 4AGRA 1LEDA 5EXOA 3AP5A 3L2YA 3FLPA 1A78A 1OFSA 2ZHLA 5GM0A 2D44A 1IKQA 1UN1A 1UAIA 5T52A 1GSLA 3N35A 3ATGA 2WT1A 2ZACA 3AZXA 3T1LA 3ENRA 4AGGA 1MVEA 3POYA 1O4ZA 1H9PA 3N7LA 3ZSJA 1GBGA 1WW6A 5JOWA 5DZGA 4PF5A 1N1SA 4XMIA 1MS1A 3R05A 5DXDA 2W39A 3USUB 2W08A 4YW2A 4WV8A 4JC1A 4YGDA 2HYKA 2JD4A 2GNMA 5E88A 1DIWA 4AVVA 4K21A 2ZMLA 1DYKA 3POWA 3TAYA 4WVVA 3WHTA 1ZM1A 1WBLA 2ARXA 1LOCA 1CR7A 2GNDA 2ZKNA 4GALA 4W65A 4XJ8A 1MR5A 5T54A 4K1ZA 2PELA 1QDCA 3MW2A 5DZEA 2D6OX 1W6PA 1DBNA 1Q8SA 1MS8A 3DGTA 1Q8OA 2W68A 3B9CA 1Y7BA 4C1WA 2ZGSA 2C9AA 3ASIA 1S0JA 4YG0A 1SFYA 1YYNA 4FPLA 4Q1PA 1U0AA 3IPVA 1V6NA 1G9AA 1KITA 2YROA 3FUOA 2PHTA 5AVAA 1I1EA 5DUVA 1SLBA 4YGEA 1HDKA 2A3XA 1AZDA 1HQLA 4XXAA 4AGVA 2A3WA 2DVDA 4R9CA 5T50A 4BQ1A 1ENQA 1WBFA 2DYCA 1LHUA 5IUQA 4P9YA 2WQZC 3A0NA 3BOPA 3AZWA 3AYEA 3FFZA 3OBRA 4XJWA 3VKNA 5IK4A 3AP4A 4XTPA 3IKWA 3HN1A 4Y22A 2DTWA 4WZFA 2P2KA 1LOFC 1ONAA 1V6JA 1FV2A 3JU9A 3V65A 2ZGMA 4LBKA 1S0BA 2EAKA 4FPFA 3M1HA 2ZGTA 3FLTA 2P3JA 2UWBA 3Q9OA 4YG3A 1KJRA 3V0AA 3WDTA 2C5DA 3D5OA 3LSEA 1LOEA 3M2MA 4XIOA 5CAZA 3DUIA 4AWDA 4M3CA 4LBQA 1IKPA 2LALA 5H9RA 3ZYRA 1MZ6A 1QU0A 4UW6A 3ILRA 1APNA 4YM0A 2NYYA 3TB0A 1IOAA 2CYFA 5DUWA 5F5QA 2Z42A 3WLUA 2DVAA 1C4RA 2A5ZA 2AREA 5BYNA 5GJ6A 4DQAA 1JYIA 1RIRA 1LOFA 4Q27A 3RSJA 4FVVA 5T5OA 1W6MA 3LCPA 3OJBA 4Q8KA 3PVNA 2SBAA 3ZVXA 2ZAAA 3VV1A 2EXKA 2XB6C 1GZCA 1DQ4A 2AH2A 2YY1A 2ZGPA 2ZGNA 4GKYA 1LHWA 1S0DA 1IS3A 3C2UA 2PHWA 5HCAA 1S0IA 1S0FA 2WKKA 4YLZA 5F9TA 2VW1A 5DUUA 4BPZA 3NV1A 4Y1VA 3WZ1A 3BTAA 4XBQA 5JOXA 1VAVA 1KJLA 3NV3A 1N3PA 3V0BA 4YW4A 2ZGKA 4Y26A 2R1DA 3SLIA 4BM8A 1SACA 4FPYA 2WNEA 4Y22B 1AXYA 3ILNA 1IS4A 1RITA 4R9DA 3BODA 2A6YA 1YIFA 2A3YA 4Y1ZA 4M01A 2DVBA 1QOTA 5IT6A 2GMMA 4YW1A 1Q56A 4YGCA 3AZVA 4XE9A 3W59A 4CRQA 3V0AB 5EWSA 1DGLA 1A3KA 3WVJA 3OY8A 4ISRA 1HLCA 4GWMA 4PCRA 1MS3A 1PZ8A 3SH4A 1CIWA 1CQ9A 2A6XA 1D0HA 1I3HA 2D7FA 3MPPG 1Q8VA 3I8TA 1GICA 3WV6A 1GZWB 1G86A 1HKDA 2CY6A 1VIWB 2PHXA 3LSDA 2WLQA 1UPSA 4GKXA 5GZDA 3IN9A 3WUDA 2ZZJA 3KQRA 1C1FA 4YZ5A 2WT0A 2E51A 1Q8PA 5CNAA 3WCRA 1LGNA 2A75A 2E53A 2AENA 3B69A 1DLLA 2NMOA 4M00A 3I4IA 3VKMA 5HCFA 1XQNA 2P34A 5E8AA 4AYUA 1AJKA 3N7MA 4DPNA 1UZYA 3QCWA 1GLHA 1AX1A 1JN2P 1C1LA 2ZGRA 3HMYA 1KQRA 2DUQA 2ZABA 1JHNA 4XTMA 1DQ5A 5DUXA 4ATFA 2P3IA 1PZ9A 4XYXA 2VH9A 1LOBA 3AXDA 1OQ1A 3D4KA 4GA9A 4LBOA 1GKBA 5H9SA 4DRRA 3POSA 1FX5A 1MS5A 1MZ5A 1SLAA 2ZGLA 1JXNA 2D6PA 5GLTA 1H9WA 4XMAA 4YM1A 4FPEA 5DG1A 3T2TA 3AP6A 5GZFA 4TZDA 2PHRA 2D3SA 2EXJA 3AK0A 4BLJA 2WT2A 1SLLA 2ZBJA 1A8DA 1FYUA 2WSVA 2RHPA 2ZHKA 3CNAA 4M3CE 3MEPA 1AXKA 2ZGQA 4IQPA 4K20A 3AJYA 1FAYA 4YFWA 5DZFA 3AYCA 5L73A 1W6QA 3SH3A 4FP3A 3W58A 3AYDA 3PVEA 4XBLA 4XDQA 3WDUA 1WLWA 2AR6A 2JKBA 4C1XA 2V73A 2GMEA 1LCLA 1WCSA 1G9DA 2DURA 2A7AA 3R4SA 1MACA 1DYPA 1SCSA 1W6NB 2D6NA 5JLVA 1MVQA 1NLSA 3N7JA 1LGCA 1JYCA 1O4YA 3RG0A 2AGSA 3NV4A 1JOJA 1R1ZA 5LK5A 1AX2A 2AUYA 3UJQA 1QKQA 3OBTA 1QNWA 5EYXA 3OYWA 3N36A 3D6EA 1LESA 1BYHA 3ZSLA 3B01A 3GALA 1CONA 3M3CA 3PJQA 1WW5A 3HR9A 5GLVA 4I30A 3RMXA 4ATEA 4Y20A 2JDZA 2CL2A 2A6ZA 3O12A 1JW6A 5CB7A 5GZGA 1LHVA 2EXIA 4JCKA 1QOSA 2I2SA 1ULDA 2UWAA 2DUPA 1SBDA 4Z8BA 1S0GA 4LBNA 2DWRA 2DUOA 4YW3A 4U2AA 1ENSA 4Y24A 2KM2A 3SNMA 5T5JA 3WNXA 5T5PA 2D43A 3IM0A 3O0VA 1KDMA 1QOOA 4XOGA 3AJZA 3OPZA 1Q8QA 5FREA 5JVVA 2VXRA 2A71A 1GZ9A 3WDYA 2DVFA 3ZPYA 2GN3A 1CN1A 4XZPA 2EALA 2H0BA 1F31A 4XHBA 1BZWA 1W6PB 3UK9A 1WD4A 4FQ4A 1B09A 4Q1RA 2EF6A 5T5LA 1UX6A 1W6QB 3ZXKA 2G4IA 1CJPA 1FATA 3VKLA 1DQ6A 3RMYA 1VAMA 4TYSA 3IPVB 4HANA 5GZCA 2OUJA 2R49A 3T1MA 1SBFA 2D6KA 4YG6A 4YZ3A 4BMEA 2E7TA 1V6MA 1LOGA 2DTYA 2ZGUA 4UW4A 5KXDA 4F83A 4P9XA 4BLIA 4DFSA 3UJOA 1DHKB 3O5SA 2DV9A 1N3QA 3ZXFA 4XHXA 1WW4A 4AVSA 3A0KA 5GLWA 5GZEA 1BKZA 2ENRA 2ERFA 2NZ9A 3M3OA 1N1YA 4L8QA 3SH5A 1V6LA 4HL0A 2ZA9A 3OYWB 3O0WA 4SLIA 1LU1A 2PHUA 1QDOA 3USUA 1JUIA 2VU9A 3MW4A 4P9WA 1ZA4A 3SITA 5IK7A 2NMNA 4UW5A 1YRZA 2JE9A 4FPHA 4DRVA 4M3CB 3SISA 1LEMA 4LBQB 4FPCA 3V64A 2DVGA 5KXBA 1DFQA 4ISQA 5GALA 1LHNA 1N47A 1FNZA 2YV8A 1G9FA 1D2SA 1LHOA 1S0CA 1QGLA 2FMDA 3NV2A 1GNZA 1F5FA 5JDBA 2OUHA 1WW7A 3ZYPA 2GALA 4XJAA 3WOGA 1BJQA 4K1YA 4FP2A 2D3PA 1W6MB 1SLTA 2OW4A
chains in the Genus database with same CATH superfamily
3K4AA 1X33A 1XYNA 1NA1A 2WR9A 3CO2A 3PIGA 5D1IA 4ZS3A 3ZFEA 1LULA 1PGW2 3FJSA 3BCWA 2Y60A 2R1BA 1ACCA 1GFF2 2BTVC 3ILFA 4Z2AA 1CPMA 1RL3A 2UWCA 1OUXA 4FPKA 1QY4A 1NQJA 1LTEA 2XL7A 2BQPA 2R073 1HW5A 2WJSA 3FL7A 4HK9A 3WG1A 4EN7B 4R4XA 2Y0IA 1GV9A 3TNQA 2V72A 4L0PA 5FY5A 4EE2A 1OVPA 3JB8A 3VZKA 1G9CA 1UQXA 5C7GA 3I2HA 1WLCA 5JOZA 3PMEA 4ZXEA 2K9ZA 1DZRA 5GKAC 4GWJA 2QQOA 4D3WA 3B00A 2ES3A 3ZLIA 4CDQA 4GH4B 2RDRA 2VOKA 3M4FA 5ANNA 5H9PA 3ZN6B 4F7ZA 5FYCA 4Q26A 2WWUA 2BZDA 2DCZA 2VM9A 3IIIA 4CP9A 2GMPA 4RFT0 3W20A 4AQTA 2W0XA 2R16A 1SLIA 1W39A 2QE3A 2W47A 1UWWA 2WZR2 3MW3A 3WINE 5KC5A 5JMCA 4LTAA 1YJLA 4LOSA 4QD2A 1VJ2A 3MDPA 3K77A 2RS52 2SLIA 3S5QA 1N3OA 4E8CA 2W1QA 3DEMA 3FFQA 1W28A 4KMQA 3TEXA 4B7EA 3NRUA 3MFAA 4FPGA 4IEZA 5FBZA 1GNYA 3ORJA 2E7AA 1RUC1 2P1BA 4X8NA 3BIWE 1QJY1 1Z0HA 4CP0A 4F8AA 4Z2WA 1VBB1 3CLPA 3NJYA 3POEA 4M3CF 4XQ4A 4BQ2A 4YVWA 4XQDA 4I2OA 5JZGC 4MGZE 4DO0A 1S2KA 4ASLA 2DF7A 2BV4A 3NNMA 1AYN2 1LODA 2VW0A 4IV3C 4LLFA 3TOJA 2RS12 1JZ2A 4W6YA 1NXD1 4C8DA 1H30A 4ITCA 1G8WA 3ZXEA 2TEPA 1OFNA 2ZJCA 3K46A 1J3RA 2P3KA 1RUE3 4Q4Y1 2UY9A 4U36A 1U12A 4BIOA 4E2SA 1POQA 4J1XA 1BLZA 1GP4A 1AYM1 3UYJA 3VKFC 3PL0A 4J6GA 4JGYC 2R0HA 3MF9A 5AVPA 4XILA 3AL6A 1QH6A 2PA7A 4DOUA 4HXCA 3N9PA 1OLME 4FAGA 3ZMNA 1G7YA 4UFIA 2W3JA 1OPMA 3UV9A 3ZSMA 1AF9A 2JECA 3VBRB 1AVBA 4DS0A 4PDWC 2CGPA 4XJZA 1LAJA 3WG3A 4GB32 2VZTA 2BGPA 2Y0OA 2VQAA 3NWKA 1XU2A 3FLRA 4AHZA 3WR0A 2CGOA 5LK7B 1BEV2 1DZTA 1HRI2 4GH4C 3AMQA 3U75A 4KL1A 3LDRA 3U4XA 5A6QA 1PZ7A 3CF6E 2VBBA 3DYMA 2YBKA 2HKXA 4NOTA 2CWMA 1OMIA 4Y5SA 1CAUA 5E16A 4FPJA 1ULFA 3QBQA 4FXKB 4LBQD 4J1WA 4XJUA 2DFCA 4JGYA 4MX3A 2HWC2 2O1QA 1XYPA 2EA7A 1HXS3 2VJXA 4IL7A 4LBLA 4Y20B 4BXSV 1DGWX 1UKGA 2B9VA 1DDLA 1OC1A 1CZVA 2VW2A 3I7DA 3E5UA 3KVBA 1DQ2A 4H14A 4QPIA 5EYYA 1CIYA 5FXZA 5FZ9A 1IS6A 3AXEA 4OI2A 4IW3A 3LEKA 4BB3A 1LGBA 1FV3A 4RS5A 2UYAA 4PHZA 3ES4A 3VBSC 1Y43B 2VCCA 2Z79A 3ELNA 2QQKA 3ZR6A 4BH9A 1HQNA 5HXVA 4YW6A 4QGMA 2GNBA 4LITA 5A6YA 1RXFA 4S2HA 3T0AA 3UL2A 4LBMA 3UT0A 3PLQA 1MS4A 1QMJA 1MS0A 1RVF1 2OYZA 2HWE2 2H6BA 3DCQA 1RUG3 1W3VA 4I01A 4Z1VA 1POV0 2D3RA 2LS6A 3U37A 4MGIE 3C7GA 1TVGA 4XW3A 4O61A 1RHI3 4QX8A 1YC61 1VRH1 3HD8B 3RPQA 1OXCA 4H7MA 4ZPIA 1ZZCA 2XDVA 3FHAA 4GD4A 5EV7A 3WG4A 3THCA 1IGOA 2PFWA 3MZHA 3I2IA 3WF0A 4EN8B 4PQ9A 4Y1XA 3PJYA 2O14A 4PI2A 1U5IA 2HH9A 5EXOA 3NVCA 5C5TA 2QQIA 2XLAA 4M0HA 3VBSA 2JG8B 4FFHA 3FLPA 1S2BA 4QQ2A 1UN1A 2PTMA 1GSLA 5IVBA 3D82A 3AZXA 2BFUS 4MADA 3OUJA 1GZTA 3IWZA 3N7LA 1GBGA 4MVTA 1WW6A 1Y9QA 4QHBA 2EICA 2I45A 5DZGA 4PF5A 1H1IA 1N1SA 2VZQA 2PHDA 1ZZ6A 4YW2A 1UOBA 4AAPA 2JD4A 5E88A 4M0NA 3I2DA 1IQAA 1ZM1A 1NCQC 2ADDA 2VZSA 2B39A 1CR7A 2ZKNA 5B4XA 4XJ8A 1PMHX 2FCTA 2VZRA 2WS92 3MW2A 4AEDC 1W6PA 1Q8SA 1Q8OA 2W68A 4GAZA 4IE7A 4Q0QA 3VDCA 4C1WA 3QOPA 5BNOB 1VB2A 1VAKA 2ADEA 4FPLA 4XQWA 5DMYA 5IVFA 2DFBA 4Q1PA 2Y6HA 2WNUB 2C24A 4FSJA 1V6NA 3BGAA 3RYPA 1KITA 1JZ7A 2OQ7A 2PHTA 2WFF1 2QZ2A 3FUOA 1SLBA 2WNOA 1PO13 1KGYA 2A3XA 3LEMA 4YGEA 3KZ4C 4XXAA 3T2QA 3SKJE 1W05A 1WBFA 4Q0UA 4OI0A 3H3ZA 2WQ4A 3AZWA 2FCVA 4XJWA 4XAEA 1PMIA 3OUHA 3IKWA 5TSWA 5CFCC 1NLQA 4Y22A 1OLRA 2VMDA 1VMJA 3G6JB 1QJU2 3ON7A 5FZFA 2XVGA 2XBO2 1V6JA 3JQWA 2VMIA 2HWD1 1YFUA 2VMCA 4LBKA 1E5HA 1OQEA 1S4CA 4MH0E 4AEDA 4LT5A 2GP5A 3Q9OA 1W2OA 1UNBA 1UY1A 3BOWA 2C5DA 1LOEA 1H0BA 2WO3A 2DBNA 1PMJX 5CAZA 4RR3B 4XUPA 3ZFFA 4LBQA 2Q1FA 1ZX5A 4BQYA 3ACIA 4AFBA 5F8PA 4JTOA 1C5IA 3H1MA 5F5QA 4QHOA 2Z42A 2CAUA 1VBC1 4OULA 3RYKA 2RS31 2XJTA 1C4RA 4A7KA 2A5ZA 5BYNA 3LAGA 4DQAA 5A3NA 3K48A 4P5YA 2HYXA 2XQXA 2BP6A 3JXSA 3O1VA 1UY2A 1W6MA 1OPOA 1Z7S3 2W95A 4P9JA 5D8AB 5KBFA 4KG0A 4LLOA 3ZVXA 2G19A 3VV1A 2FBEA 1ZVFA 4GJZA 2YY1A 2VGDA 1FPN1 1I9RA 3ZXAC 3HQXA 1V9U1 3LOBA 1OHFA 2JDAA 2PHWA 3OGJA 1S0FA 4FXGB 3UGGA 5DUUA 2G9ZA 4Y1VA 4QX1A 1VAVA 4HMZA 5FPZA 1VBE1 1ODMA 2ZGKA 1TNRA 4UXAA 4AQ6A 2ARCA 4Y26A 3N9OA 1XJAA 3ETQA 3LA2A 1COV2 2H0VA 2R1DA 3DF0A 4BM8A 2JG9A 4HVQA 5A3LA 1SACA 2WNUC 4LKFA 1IS4A 2VCAA 4R9DA 2OZ6A 3HEIA 1NYWA 1GQPA 1NE6A 1TME1 3O1OA 4NRMA 2RMU3 2ZX0A 3NKTA 2DVBA 1QOTA 1MZEA 3AM2A 1RUOA 4V2WA 2BJSA 2QQLA 2X8KA 2KR2A 3H1WA 1Q56A 5F3GA 4K8RB 4XE9A 1WCDJ 1PO22 4NIGA 3POIA 5JIUA 3OY8A 1F8VA 1HLCA 4GWMA 1E5RA 1NX9A 3DPRA 3VBOB 5C3RA 1W8HA 4HSJA 3H1YA 4XUQA 1I3HA 3MPPG 5JXHA 1Q8VA 1UMIA 4CDUB 3GCWA 1C8M1 1RTVA 1G86A 3VZNA 2YG0A 1WLTA 4R4ZA 1VIWB 2PHXA 4IE0A 2WLQA 4KU8A 1BBT3 5GZDA 1JOBA 1LR5A 3KV6A 4YZ5A 1PM4A 4LO4B 1R092 3SCGA 4CEYA 5HCHA 5CNAA 5IVJA 1SPPB 2F4LA 1NUKA 5LEJA 5FUPA 4DY5A 1OH4A 2IUWA 4MGYE 5K0UB 1WMXA 1H2NA 3GXUA 4AE2A 4EROA 3JD72 1C1LA 2WABA 1B35C 3MO4A 2ZABA 4DXZA 3TBDA 3LEIA 2QJVA 1PVC2 1LOBA 3MYXA 1OQ1A 4GA9A 1UU5A 4K3UA 4LBOA 4URTA 4LHSA 1FMD2 1IG0A 1JXNA 3WQ7A 1XNDA 5DG1A 4UBHA 3AP6A 4XPVA 3FN9A 3O1RA 4BLJA 1UD1A 2EXJA 2JDHA 4O9GA 3Q8CA 2VD7A 4Y33A 1SLLA 2PLV3 3I2JA 4BHPA 5CFDB 1FYUA 2X29A 2RHPA 2WO2A 3CNAA 2WZEA 5DPNA 3MEPA 4DB5A 3LF7A 2WL1A 4K20A 5C8CB 5DZFA 4E2QA 3AYCA 3WP6A 1QEXA 1EV13 4IE6A 5LW9A 3KCYA 1BMV2 5FZ3A 3ZN4A 4B4RA 1O3TA 2JKBA 4XF1A 4MXWA 4C1XA 5FK8A 2GMEA 3E5QA 2A7AA 4AXOA 3U07A 1MACA 2RR11 5JLVA 1MEC3 1AHSA 2VULA 5C5UA 2AEYA 1VBA2 5DQ0A 3K3NA 3EO6A 4DZGA 5AFEA 2ZS6B 4YVSC 3EMRA 3GCXA 1AX2A 1ZBA3 3UJQA 3O1PA 1R1A3 4UAPA 1QNWA 4CXYA 5BV6A 2QQNA 1GWKA 2EIDA 4EZHA 1D0GA 1VRBA 2P6CA 4AI0A 3B01A 5FDBA 1CONA 4B1MA 1VBD3 3PJQA 1WW5A 5GLVA 3RMXA 1PIV3 1X82A 3J7HA 3PIJA 3ZIXA 4A41A 4ATEA 1ND3A 2HLEA 4I02A 3J8F1 3NJVA 5GZGA 4XF0A 1LHVA 1RUF3 2OPKA 1TMF2 4JCKA 1QOSA 4LIVA 4PI0A 4N43B 2UWAA 3OGVA 5LEKA 4Z8BA 1S0GA 4HVRA 2DUOA 4YW3A 3AMNA 5ISLA 5BNPB 4QX2A 2KM2A 1U5XA 3ZXGA 4S2FA 3NQHA 5FQ0A 3N9MA 1KDMA 1QOOA 5K0UC 3AFGA 4XOGA 2JDPA 3AJZA 3KCCA 4ZONA 5AC92 3LFIA 1Q8QA 4V1PA 2BWAA 2C9KA 3CL1A 2WIIB 4O7XA 3SC7X 3ACFA 1QXJA 3ZYIB 1CN1A 4Q29A 2EALA 4XZPA 3VD7A 2H0BA 1F31A 2VVFA 3K4ZA 4GMP3 3ZFGC 5J09A 3KVAA 1NCRA 1XBFA 2EF6A 2VXJA 3WF4A 5A70A 3CMGA 4UFJA 4Q4W3 2OUJA 2HWF3 3WNPA 5FZ6A 5F32A 1RUE1 1OD5A 2JKXA 2VMFA 1QQP2 4QQPA 2XHNA 5FYZA 3O7OA 3BTYA 4CDXC 4MGTA 1LOGA 2ZGUA 1AR63 2Y64A 3MFCA 3Q8BA 1RUC2 4CCLA 3IB3A 1KFXL 4BLIA 4DFSA 4F83A 4I0AA 5C8CC 3I54A 1UYXA 4P00B 4FTEA 4J25A 2Z5WA 1D4VB 1VBB2 1YQCA 4XDPA 3A0KA 5BUVA 3SH5A 4COWA 2RJKA 2NZ9A 2YBSA 3M3OA 3NAPA 4NUBA 1HRV1 3DV8A 4Q4X3 5FZMA 1HIXA 4SLIA 2XR4A 3I3DA 4E4SA 1XYOA 3HNYM 3HBKA 1UYYA 3USUA 4EWDA 1QJX1 1ZA4A 4WZCA 5KHKA 4UW5A 1UPIA 1YRZA 4L9BA 1CAXA 2FZ1A 2VE1A 3J9SA 3PTYA 1AR73 2VBPA 5LBBA 3V64A 4BQ4A 5HXMA 3WXPA 5FK7A 2R063 4Q4Y2 5GALA 2Q0AA 1RUD3 4QPYA 5G05L 1AYM2 2FMDA 3AKTA 2OA2A 2XKPA 1RUJ3 4GQ7A 1DGRN 2OUHA 2WYFA 4G9SB 5FYSA 4UF0A 3ZYPA 3ZYHA 1O91A 1PK6A 4FP2A 4OMCA 5F3CA 1SLTA 2OW4A 1W6OA 4NHMA 2R0FA 2ILMA 5BNPC 3MBWA 3PVOA 4C90A 5C9AC 3AKRA 3IAQA 4OHZA 1AR81 2UU8A 4Q0PA 3K2OA 5F1RA 1UL9A 3B9IA 3L2HA 1UY3A 4OHWA 3ZM8A 1OBNA 3LPGA 3WW4A 2PHFA 1RUG1 4LKDA 3A21A 3IMMA 2G1MA 5FWJA 4Y4YA 4CEWA 2P5BA 3GBFA 4ZZ8A 4CE8A 2VOVA 2GDFA 4LO6B 5FPXA 4XJ9A 3OBZA 2AACA 3ZSKA 5CG9A 1XOYA 4GZ9A 5FZOA 4IV1A 5FPLA 3GHMA 4EN9B 1N1VA 2RM23 3LFMA 5EQUA 5HCBA 4FI9A 5E1RA 4JX0A 4JGZC 2HJIA 5DG2A 3BU0A 3SCHA 5K7PA 4LR4A 1DZQA 2TUNA 4JHZA 4RL7A 2D6MA 4RGGA 2FD8A 5E89A 1YXWA 2A6WA 3AYAA 3WDXA 1UX7A 1C3HA 4R9AA 3KT4A 3NNLA 5LA1A 3TEZA 1J1TA 4BMBA 2IXCA 3GNEA 1C57A 2W52A 1SCRA 4RQPB 4WVMB 1NT0A 1GP6A 1UZVA 3FZ3A 4XIKA 3ZXJA 4N7IA 1W2NA 4NO4A 4A3XA 2HWB2 3E97A 1K45A 1UIJA 1UW8A 1VRH2 2XL9A 1NY71 4HONA 5A3OA 2C1FA 1XNAA 2RVAA 4O65A 3APBA 4FOVA 5FZEA 3JUUA 2IXHA 4Q2FA 4COUA 4JGZA 5FZDA 1OQDA 3MIDA 3ZFEB 2QBXA 2VTFA 3VBUA 1G6NA 1QJFA 3POFA 4Q4V1 1DQ1A 1W8UA 1HB3A 4CDWB 4LE3A 3S5AA 3VBFC 4LHNA 5KWRA 3OPWA 4QX7A 4AHYA 5KXCA 4QWNA 4XUNA 4IEQA 2OT7A 2ZXQA 3L9JT 5IHRA 1OUSA 1PO11 2VUDA 4UFLA 5FCCA 1V6OA 5C3OA 3BI3A 4MO3M 1Q5OA 3HNMA 4YM2A 3KGLA 4AOCA 2PXJA 2WO7A 5A1FA 1PX3A 3HIFA 3EB7A 2VZ1A 4D94A 5C33A 1O59A 1N1TA 4AAXA 2YDEA 5BNQA 2XJRA 4MGSA 1GZWA 5FZ1A 4R8HA 3AP7A 1IPJA 4FFIA 2PAMA 4ZZ5A 1WD3A 1AL22 2E63A 1OF4A 2IVIB 1C28A 4OLLA 2MEV1 3KCXA 1EAH1 2PYTA 5FXVA 1WMFA 2IVJA 4FPOB 5CZKA 5FYIA 2IFWA 4E4DX 4FOWA 2JE7A 2LUWA 4ZY9A 1O3SA 1F2NA 2WAAA 5SV8A 1AXZA 2B7YA 3ZSEA 2NN8A 3ACLA 1JYVA 2WFF2 2NP0A 2Y6FA 4BWOA 5I8TA 4BK4A 4W8JA 2Y38A 4META 4A3ZA 4PBPA 2IXJA 1AX0A 1RGSA 3ZYJB 2R041 2XUEA 4KGGA 3TYJA 3VZJA 3N7KA 4TWTA 1DGWA 4MHRA 4CCCA 2RS53 4WVWA 2ARAA 1F9KA 1RUI1 1Y9MA 2TBVA 4ZXKA 1MQTA 3VD5A 1JI6A 1IQDC 2TNFA 4IEPA 4YVWB 4YGBA 2J42A 2OX0A 2ZHMA 3WNMA 3BN6A 2E7QA 2HWD2 3QACA 2XONA 2BUKA 5FPUA 3VKOA 5JMOA 2QTWB 4NIAA 4FQZA 3THTA 5LA0A 3B3QE 2DU0A 5FP7A 3DKQA 3OTFA 2A70A 1CESA 1YFYA 1HJGA 4Y1UA 1F35A 1MS9A 2WC2A 3KV4A 5FRAA 4EN6B 1RUNA 5I0SA 3QLQA 4MXVA 3U0ZA 2NQYA 1AYN3 5LRRA 2RS13 4AK3A 4Z92B 1S0EA 2A6VA 4R9BA 1EPWA 1IS5A 1W6NA 3IDBB 4ZS2A 4KWUA 4PBOA 3UESA 1VBC2 4HETA 5G04L 2RS32 1H1AA 4PIZA 5FZLA 4UBGA 1G9BA 3AFKA 1LECA 4IEVA 4RA0A 4X6RB 5EJ1B 3MHZA 2ZHNA 2Q5TA 1KXGA 1SMVA 2P37A 4UT5A 2QQWA 4AGRA 1YNAA 1UIKA 3POJA 4FTSA 4RN5A 3HN3A 4EYUA 1OI6A 3N9QA 2K46A 1OA3A 2RJLA 4JV4A 4LKSA 4QKFA 3SMHA 3VZMA 5GM0A 1T2XA 4NHKA 4YPJA 2OXBA 3UKTA 1WWYA 1V9U2 3GBWA 5JAXA 3ENRA 3DYOA 4MZUA 4GB33 3KHCA 3ZSJA 5DABA 4OUSA 1CAUB 1D7PM 2VR4A 1VBE2 3P1IA 4TN7A 1BEV3 1MS1A 2B46X 1IZ3A 4N7UA 2YPDA 2W39A 5CISA 2W08A 1YI9A 4AVVA 1H6YA 5A7QA 1TNFA 2ZMLA 3CJIC 3TAYA 4XF4A 1RC6A 3WHTA 3WSOA 5HBAA 5D2AA 1CX4A 4QPIB 1TME2 5FMBA 5LBCA 4W65A 1MR5A 2E9QA 2ZKLA 4LO5B 4A6OA 4RS5B 1QDCA 1RB8G 2HWC3 2WA3A 3U4SA 5L7OC 4I09A 3B9CA 3H50A 4CCJA 5FMDA 2FDHA 4COZA 4QKDA 1S0JA 5CU1A 1H4GA 2LM3A 2Q8EA 1BK1A 3IPVA 1G9AA 4HPKB 5AVAA 1C8M2 3N9LA 1ULOA 3LD8A 4YYOA 4I3PA 2DVDA 5FR3A 3AB0A 1X9TA 1ENQA 3P5BA 4IGPA 4E8DA 2WQZC 2VTXA 1ZRDA 3OBRA 3VKNA 3P3NA 2JICA 2XJPA 1PNFA 2HWE3 2LW8A 3AP4A 3CJIA 4GIQA 1YJKA 3EJKA 3HN1A 4CU8A 2DTWA 3GDBA 1EV11 3OCPA 1LOFC 1ONAA 5FZ7A 2W2IA 1FV2A 3WW1A 1IG3A 3JU9A 3I59B 3VHOA 3QH6A 2ZEXA 3RZJA 4URAA 1ZYBA 2GP3A 3I3QA 3FLTA 3VDDB 5L7OA 1H6XA 2B45X 4IESA 1YWKA 3KF5A 1J1LA 3WDTA 4I0BA 5FZ4A 4CPBA 5KR7A 1MEC1 2GSYA 3RZKA 4XFCA 1HJFA 3A23A 4MGQA 3D0JA 4M3CA 2GC3A 2ID4A 1T6GC 1UY0A 2WBKA 3H8RA 2LALA 1BCXA 3ILRA 1APNA 4YM0A 3J7LA 3J7NA 1ZBA1 3TB0A 4OFGA 4CSWA 1GOFA 3RZHA 5L9VA 1JZ8A 5JZGA 2YFUA 3ZXDA 1XC6A 2DVAA 5A7WB 4IV3A 2AREA 1VBD1 2V5DA 1W9SA 1ND2B 1LOFA 2W91A 4Q27A 2VNOA 3LQCA 3C7OA 5A7SA 1RUF1 2OPWA 3NL1A 4HN1A 5J48A 2G9GA 5JWPA 2JDMA 2EXKA 3O1UA 1AL0G 2VMGA 5LBEA 1CAWB 5LY2A 3H8XA 3G7DA 1WCQA 2RR12 3GZAA 4AVCA 3THPA 1FOD2 2D97A 4YLZA 2IXIA 3KV5A 4C0BA 2WS93 4COVA 3T3YA 2VNVA 5FZBA 3VL9A 5EJZB 4OHVA 1R081 1KJLA 4YW4A 1W2TA 4PDWA 2P4EA 1D2QA 2ZOEB 1ST8A 3UNPA 3PUAA 3HPNA 4QHZA 3KT1A 5IFPA 4FPYA 2WNEA 4FFGA 4Y22B 3POBA 1OOPB 1AXYA 3CJXA 5IVVA 3ILNA 2WUHA 4HT1T 3LKJA 2A6YA 1AR91 1YIFA 3DYPA 4GH4A 3ZN6A 2UYBA 1JZ5A 3J8F2 1NKGA 1QWRA 3C8XA 4K6BA 4XETA 3B02A 5FKCA 5IT6A 1OD3A 3W59A 1W8NA 4N8MA 5F7UA 3WVJA 2ZX2A 1QJU3 4P02B 4PCRA 1K3IA 2XBO3 3SH4A 3ZFFB 5LY1A 5J1XA 2WYSA 2BOIA 3I8TA 5EPAA 3LDKA 1RMU1 4E27A 1HKDA 2CY6A 3OEAA 3LSDA 1XB9A 3SHRA 3P6BA 4JZRA 1ASJ1 2WT0A 1Q8PA 4C0HA 4FCAA 4QAWA 2AENA 1DLLA 3VKMA 3I4IA 3RZMA 2A1XA 2JDKA 2P34A 2VNGA 2WNVB 3CZUA 3DXTA 4AYUA 1JMUB 3U14A 4DPNA 3VBRC 4CU6A 1GLHA 2WN3A 1AX1A 1CWPA 2D5HA 2R061 3ZR5A 5FZKA 1KQRA 1W03A 4Y3OA 1K5MB 1JHNA 3LIGA 2YU2A 3CDZB 3BYWA 1DQ5A 4RD7A 4XTMA 5DUXA 4F3JA 4DUWA 5FY8A 4DRRA 1RUJ1 3OD4A 5LB6A 2QCSB 1SLAA 4BXFA 4QU2A 4LK7A 2XMLA 2O8OA 2VPVA 4IEXA 4FPEA 2BWCA 4HFSA 1HRV2 3WF1A 4TZDA 2XLGA 3AK0A 3WQ1A 2ZBJA 2JG9B 1A8DA 3ZYGA 4UFHA 1WZXA 4XFFA 1AXKA 1QJX2 3PURA 3AJYA 4UWDA 4M4PA 1W2AX 1W6QA 5CIRA 3VHRA 2K2SA 3TN91 3PVEA 2BVBA 2N7GA 3WDUA 4FT8A 1QHDA 3AKSA 2ZEYA 3VBRA 3K3OA 1COV3 5IAVA 4WVZA 4CCEA 2VBDA 2DURA 3R4SA 1DYPA 3MUY1 4XUTA 2D6NA 1OOPC 4G3YC 3N7JA 1LGCA 1H8TB 2AGSA 2VZVA 2ATFA 4MHUA 3USSA 2JEMA 1DU3D 2YGMA 2VUCA 1GQHA 1JOJA 3NV4A 3Q8EA 1X8EA 4IETA 4JQRA 5LK5A 1NCQA 1PO23 1CAVB 1QKQA 2RDNA 4JRLA 5EYXA 1UU4A 4Q0SA 3ZDSA 5CKNA 3OBAA 1I5ZA 3D6EA 5FMOL 5LRSA 5L9RA 1AR82 4OI4A 4OMDA 2WQ8A 5KC6A 4Y20A 3O12A 1R093 2O8QA 2DUPA 4P5HA 4PIXA 2DWRA 3WF2A 1DYOA 1SZBA 3LIHA 4N53B 5FV3A 2JG8C 3IZOA 4Y24A 2XKOA 3WNXA 1O8PA 1W9WA 5T5PA 2D43A 2WNVC 4NAOA 4QQLA 4QX3A 3SXWA 4E2GA 3F2ZA 1W99A 2H6CA 3AKQA 4AEKA 1NOVA 2XGXA 4W4ZA 3JD73 4HVOA 4NMIA 3T4VA 1GQGA 2QUOA 3JBG1 5CFCA 5FREA 5FYTA 3MLLA 5JVVA 2VXRA 3S30A 5DDJ1 1GZ9A 3WP3A 4E9KA 3M70A 3WDYA 2DVFA 4AQ2A 2GN3A 1K5MC 1PVC3 3NNGA 4XHBA 3ZN5A 3A7QA 4QPWA 3ZKUA 4CU7A 4RHV1 1FMD3 4Q1RA 4YARA 1UX6A 2QNKA 3ZXKA 4L11A 1IPSA 1FATA 2E33A 2QVSB 1DQ6A 3RMYA 3KSCA 3BB6A 3J26N 4TYSA 3VKLA 4HANA 2I74A 3T1MA 4ZU7A 4DIQA 2D6KA 1D4M2 4YG6A 2D5FA 4CUAA 2JG8A 3KHBA 4NAMA 1V6MA 4DEQA 4CCOA 5BNOC 1QH7A 1VB4A 1DHKB 2X09A 3O5SA 1N3QA 3EYPA 3HNBM 4DXRA 3ALQA 1WW4A 4GMP0 5FAXA 5LATA 2J1VA 1BKZA 2ENRA 3I3MA 4L8QA 4AHXA 1K5JA 4YSFA 4HL0A 3OF1A 2VQUA 2ZA9A 2Y6LA 1RYYA 1UXXX 3EQEA 1TZOA 3LZZA 5FZ0A 1LU1A 1VBA3 5T3NA 2PHUA 1H8TC 1JUIA 4Q4V2 2VU9A 3PUIA 5JPMB 3THDA 3SITA 3FHQA 4LPLA 5IK7A 2NMNA 3U78A 4FPHA 1ND3B 4K7JA 4AR2A 3QD6A 3UKNA 2FCUA 1LEMA 3VL8A 3T08A 4FPCA 2ZX3A 1OLMA 5IVCA 4NWWA 4LO8A 2WA4A 2BU9A 2VVDA 3M8LA 2GAUA 2UY8A 1N47A 1TE1B 2YV8A 3KV9A 5J3UA 1E5SA 5B2GB 1LHOA 1S0CA 1QGLA 3RZLA 2NPIA 1GNZA 1ZBE1 5C4WB 4RR3C 5JDBA 1TMF3 1TG7A 4COYA 2RS51 3Q8AA 2WNUA 4OQ8A 4UOJA 2W87A 5LBFA 1BJQA 4K1YA 5A6ZA 1EP0A 3HT1A 2VMHA 3AP9A 2WZ8A 3RZZA 3T2PA 5LCWL 4PT6A 3E6BA 4OVEA 5A7NA 5T52A 2MEV2 3S7IA 2JXAA 3HJRA 1EAH2 2XWJB 4IEOA 3WY6A 1XPWA 2EXHA 1ZREA 5FPBA 2DU1A 4D6SA 4OUMA 4AHWA 1WLDA 3AVRA 5D8AC 2XJVA 2WSUA 4DMIA 3EBRA 4A45A 5ACA2 2J22A 3V0BB 3TRSB 4AL9A 4ZKTB 4OZOA 2R042 4RR3A 4IGQA 1W90A 4OCTA 2GN7A 1RUH2 5IVYA 2LROA 5F5CA 3NAPB 1RUI2 4OYUA 1F4HA 1QQP3 5FY1A 4AEMA 2E6VA 3OPTA 4AI9A 1X50A 3WNOA 2ARBA 2R071 1RUC3 2L9LA 1GR3A 2ZMNA 3H42B 4Q8LA 2Y33A 5IAXA 1VBB3 1B35A 3VD9A 4PLMA 4OUEA 3WCSA 1W04A 4WM7B 3HT2A 4DY3A 1CGPA 1ULGA 5KHGA 5D8AA 1M06G 2FDJA 4C91A 2PMWB 4BU2A 3V56A 3R4DB 4AEJA 2FDGA 5F6KA 1YFXA 4JRAA 4OZXA 1BEV1 1GMMA 2IC1A 1U5YA 4CUGA 3VBOC 3AX4A 1W8ZA 2X05A 1H2LA 1XE7A 4BOWA 1O3QA 4FOYA 4NIIA 4QPGB 3VBHB 4Q4Y3 5CVRA 1W6OB 2CGNA 5GLZA 1W0PA 1PX4A 1AYM3 2BOJA 1VLNA 1Y3TA 1ZNPA 5EZWA 3ES1A 1OURA 1V70A 3K4DA 4JKKA 5C4WC 3LA3A 1DF0A 1KDKA 3ZIWA 1EYBA 2NM1A 4CXXA 5CBLA 4NIHA 1REDA 5ABJB 5A1LA 4A6SA 5E6HA 2XLFA 3ACGA 4YVSA 3UGFA 4YFZA 1PVXA 4KWLA 4LNVA 5IVEA 1X36A 2AYHA 3IIAA 4CEWB 4FAHA 1JU4A 2J1SA 3ABZA 3H0OA 3WT3A 3VBOA 4JDNA 5FZOB 1ENXA 4BA6A 4IV1B 3CQOA 5A1AA 4CDUA 4RYDA 3OGGA 1BHGA 1S1AA 3T09A 4GWNA 4WM8B 1UCXA 3PHMA 4IEWA 3NNJA 5CFDC 2JDNA 2ZAHA 3O0XA 3RRDA 5FKBA 1SPPA 3KF3A 4FOQA 3RZGA 1KRIA 3CHXA 4LA2A 4XFGA 2V5YA 1QJY2 3C7FA 1Y4WA 1W0OA 4QXHA 5K0UA 1SLCA 2V4AA 3WDVA 1XNTA 1YUDA 1WCKA 5F3EA 4BIFA 2FZ2A 3D3AA 3ZYBA 4LEJA 1UMZA 4DUXA 3FMGA 4IE4A 4NR1A 1W2UA 3ZFGA 1Y9GA 1LOAA 2XJSA 4WM7C 2AC1A 1CPNA 1GWMA 5JI9A 3FE5A 3AMPA 3E1F1 1S55A 2XXZA 4XFIA 2Y34A 4IE5A 3E6DA 4Y1YA 4YZ2A 3QH7A 2RDSA 2LTNA 4NVPA 5CYYA 1V00A 2CWSA 2HWB3 1QF3A 2Z2SB 4H55A 1VRH3 5CFDA 3VBUB 1ALYA 3WUCA 3EHKA 1PNGA 3OOXA 4CDXA 5A33B 5LWBA 4AQSA 1O5LA 5C8CA 5H9QA 4AFCA 5LA9A 4KBBA 5DN2A 1GUIA 1HXS1 4P9IA 2OVUA 5FP9A 2OZJA 3NSTA 3WD5A 4N43C 3WQ0A 3ITQA 4NPMA 4LIUA 5ANQA 2C0ZA 4MYEA 1RJ8A 4QB1A 4NJ4A 3ZX7A 1YI7A 1JBCA 1WGPA 1DLCA 1BXHA 1YLLA 2K0GA 3B93A 5I8SA 2MHFA 3U1XA 4W50A 4JTNA 2PN5A 1H2KA 1KD7A 1SG3A 2GU9A 1RINA 2D6LX 2XVKA 5FJKA 5M0TA 5C3SA 4X8PA 2VL4A 3BU7A 1XE8A 2XUMA 4HOOA 4PLOA 2C26A 3AP5A 4TLFA 2YBPA 4D6RA 5BNNB 1A34A 1SHWB 1F4AA 4KI5M 4ASKA 4D7SA 1A78A 1OFSA 1QJU1 1IKQA 1RHI1 1UAIA 3K75B 1OT5A 3MIEA 2RJ2A 3N35A 1QXRA 3ATGA 2ZACA 4V2VA 2WWJA 1I5PA 5I0UA 3T1LA 3UKVA 1AL23 5A32B 1MVEA 4IERA 1HV0A 4WM8C 1O4ZA 5FP4A 3MICA 3VD3A 1H9PA 1LNSA 3AC0A 4N43A 3UGHA 3O1TA 3BTZA 1W8WA 2JB8A 4CCKA 4CCDA 1R082 2Z4FA 4PJYA 5BNPA 2CSGA 2X5IB 2YPJA 4HKLA 4LUMA 4WV8A 5FLHA 4YGDA 4XFAA 5FZGA 2GNMA 5A3UA 5C9AA 4K21A 3POWA 1DYKA 5J98B 2WFF3 1HN1A 4XF3A 2R7EB 4JKLA 5FJHA 5F3IA 1LOCA 2QDNA 1W8OA 3LB9A 3MLKA 5FXWA 2GNDA 1AR92 4A42A 5A3WA 4K1ZA 2PELA 1RVF2 4CP1A 4ONUA 3U10A 1ODNA 1EUTA 1MS8A 3DGTA 2ZGSA 3ASIA 2IXKA 4YG0A 4A7YA 4YNIA 2VC9A 4IXLA 1SFYA 4EWEA 4L97A 1YYNA 2JD9A 2HWD3 3E5XA 3ME2A 3E6CC 1U0AA 5F37A 3H8OA 4QB2A 4AI8A 4Y5Z0 1JZ4A 5EIYB 1I1EA 2BEOA 1NQDA 1RMU2 4QKBA 4AGVA 2Y6KA 4FFFA 2A3WA 4R9CA 2OKXA 4BQ1A 2R30A 1NA1B 2DYCA 3GHNA 5IUQA 4P9YA 3BOPA 1ASJ2 3I3BA 1L7RA 3MIFA 3FFZA 1OF3A 2IFRA 3PVBB 3VGIA 4UFMA 3V65A 2ZGMA 2Y6GA 1S0BA 4XZUG 1VBC3 3NO8A 3M1HA 2RS33 1J3QA 2ZGTA 2QQUA 3ACHA 4YG3A 2OQ6A 2W92A 3V0AA 4QDSA 3TEYA 4XIOA 3DUIA 4AWDA 3P3PA 4XDOA 4P9GA 4TXWA 1RUJ2 1IKPA 1YQ5A 5H9RA 3ZYRA 4CDQB 2GZWA 2YHJA 5CKQA 4M4RA 5FLIA 2VOTA 4BDVB 2CYFA 3NKGA 5DUWA 4AFAA 3R6SA 1Q43A 1ZZ9A 5FIXA 4CP9B 4ET7A 3BIEA 2BNNA 5D21A 3S6PA 3PU8A 3CEWA 1W3XA 2EIEA 5A80A 1RIRA 2VG9A 2W46A 3VBFA 5T5OA 1VBE3 3GM8A 3TN92 1O5UA 2J1EA 3PVNA 1R091 2SBAA 4O9EA 2X5IC 1ZRIA 5L9BA 4OQ9A 1GZCA 1DQ4A 2AH2A 2ZGNA 2WZR3 3MF6A 3CKHA 2W1UA 1TME3 2GC1A 4LMFA 5HCAA 3H9AA 2WKKA 1W8FA 3ZDVA 3GGLA 3NV1A 1GWLA 3H3LA 3WZ1A 4KGQA 4HN0A 5JOXA 1HN0A 2ZZQA 4BJ0A 2YC2A 3ZMOA 3PUSA 4RQPC 1Z7S1 5FYHA 2BGOA 2CV6A 3I49A 4H2AA 2PHLA 1HB2A 2DCKA 4Z07A 4LUKA 1OSGA 1C8M3 1YCIA 3MIBA 3JQXA 3MLJA 5CG8A 2A3YA 3K51A 3W21A 3S0MA 4LULA 4Y1ZA 3VB9A 4KWKA 4M01A 3PMSA 5FYVA 2WRAA 2VZ3A 1XU1A 2GMMA 3H7JA 1XXNA 3ZFEC 4YW1A 4YGCA 3AZVA 4XFHA 1DGLA 3T0DA 4ISRA 3VDAA 3JB4C 1PZ8A 3LOIA 4AVAA 4CDWC 1CIWA 1CQ9A 1FI2A 3BKZA 1D0HA 2D7FA 3MUZ1 3WV6A 3JBG2 4HZFA 3ZOIA 5FYYA 3DL3A 1JS9A 4CZSA 2WN2A 1UPSA 2RMU1 4GKXA 3IN9A 4WVMA 2ZZJA 3KQRA 5DDJ2 2E51A 5FFOC 4LXLA 4XF9A 3MI8A 4RHV2 3B69A 2NMOA 1FPN2 1W9FA 2QQJA 5HCFA 1XQNA 1CZSA 5BPXA 3RNSA 4CDQC 5E8AA 4DEVA 1A6CA 1UMHA 2DCTA 3RFRA 1AJKA 1U5ZA 2ET1A 3IDEA 3RGBA 3UETA 3N7MA 4GULA 4E4ZA 1HB1A 4S2GA 4KG8A 5IYYA 5IATA 3IBMA 3HMYA 4XAAA 4ARXA 1O8SA 2DUQA 1BBT1 4JAAA 3OGRA 1HRI3 4JGYB 4CDWA 1PZ9A 1JUHA 3EXUA 4TTGA 1SFNA 5FZAA 3D4KA 1TMF1 5H9SA 4LQRA 4TSVA 3POSA 3MPBA 4CXWA 1MS5A 5FZIA 1MZ5A 2QFEA 2ZGLA 5J96B 5GLTA 1NE4A 4XMAA 2ZX4A 3ZYFA 5A3TA 2RR13 4PDWB 2WT2A 5FYBA 2V4VA 3J4UH 1FOD3 5FMOS 2ZHKA 4MSVA 2B4KA 5IWFA 2ZGQA 2F6BA 1BVP1 4YFWA 1J59A 5L73A 1REFA 3AYDA 3GYDA 4XBLA 4XDQA 4YVWC 1S2EA 2AR6A 2Q30A 1NZIA 2V73A 1LCLA 3T4HB 4QDRA 2EAAA 5HV0A 4IGOA 1MVQA 5JXJA 2PLV1 1ZA7A 3M3IA 5I8YA 3J8F3 1ZBE2 1UOGA 1SEFA 4A4AA 2Q4SA 4BISA 1O6UA 1R1ZA 3IDCB 1QQP1 2AUYA 4YW7A 4KQ7A 3OBTA 5FOJB 3BVCA 1YQ8A 3OYWA 3NJXA 3N36A 5B4NA 3VBSB 4Z82A 3ZSLA 4QXCA 3VZOA 5F2WA 1J84A 2P17A 3M3CA 3PTRB 3HR9A 4I30A 5FP8A 1H4HA 4CA9A 4CUBA 4K9SA 2W1WA 1JYWA 1OA2A 5CB7A 3CIHA 2I2SA 1ULDA 3PUHA 4KWJA 1SBDA 1T6BX 2KXLA 3HOBA 1WA4A 2WLPA 3VN4A 1R1A1 5HPOA 1ENSA 4HK8A 3O0VA 3ZO0B 5C70A 2CAVA 1PIV1 4NIDA 5DAPA 1LRHA 1HB4A 2BGCA 3VZLA 3ZPYA 4RFRB 2R072 1PGL1 3WW3A 1BZWA 1W6PB 3U11A 3UK9A 4QB6A 1CJDA 1WD4A 1B09A 5F6LB 4ZU5A 5T5LA 1W6QB 2V09A 2QQPA 1CJPA 5APAA 1HRV3 1VAMA 5GZCA 4QPIC 5A3MA 2R49A 1LB2A 4PF1A 4N9HA 2XJQA 2P3YA 4MGKE 4RS5C 2VCBA 4BMEA 1HX6A 2J1UA 2E7TA 5C3QA 1QJX3 4AFMA 1QIQA 3I2KA 4KBZA 2JB4A 2DBIA 4UW4A 4GMP1 3UJOA 2VQ0A 4AVSA 5GZEA 1NCQB 1VE0A 2ERFA 3GJAA 4ES9A 4Q4W1 5K4LA 1REEA 2FQPA 4AEDB 2HWF1 1H1MA 1AUYA 1XNKA 3VHNA 4P9WA 3MW4A 1UYPA 5FUNA 3RI9A 1F5JA 2F17A 4HKWA 5FOBB 1AR61 2DCJA 4I0WB 1MPXA 4LBQB 4IDZA 4D0QA 4EV0A 2D98A 2FDKA 3HWJA 4CVUA 3VLBB 1JZ6A 2VVEA 1JODA 1DFQA 3S57A 4ISQA 3VDDC 4HSLA 1AR83 2R6QA 1OLQA 4Q4X1 1D2SA 2W94A 3BALA 3GJBA 3NV2A 2Q8CA 5I0TA 3KD4A 1WW7A 5CFCB 3FBMA 4WBBA 1H8VA 2GALA 3TEWA 4CP2A 4HPKA 1K12A 1XSRA 4LK6A 5CEHA 3R0RA 2D3PA 1W6MB 3PDQA 4MOAA 2OIIA 1AR71 3KMHA 1YIPA 2HWB1 4RSUA 5JR7B 1LENA 4AVTA 1RUE2 4QU1A 2NLRA 1YQ6A 3NMBA 4AI3A 1URXA 2B42B 2YXSA 1RUD1 3LWCA 5AC93 2IZWA 4JVAA 5FO9B 1ND2C 1X8MA 2JDUA 4GXLA 4NPRA 4D7TA 2O0OA 4LBJA 3O1SA 3I59A 1QXPA 1TEIA 4NRPA 1JYTA 3H7YA 3VDDA 4JKMA 4XUOA 3TWIA 5LASA 5A6XA 2ORXA 1DCSA 4YW5A 2BYVE 1WMEA 4Y4RA 3WF3A 4AFDA 4QDQA 3ECQA 5FY9A 2XHKA 4HLTA 3WDWA 3AZZA 1D4M3 2XWBB 4JDOA 4YZ4A 3FBYA 3WG2A 2WO1A 5FZ8A 1QNYA 3AMHA 3B7MA 1E5IA 5CA6A 2JIJA 2YC0A 2JDYA 1WUVA 3C7EA 2YMZA 1HQWA 5J7MA 3CBNA 2VMEA 1BK0A 1GNHA 1SBEA 3MV11 1GYKA 1NLRA 5A7WA 3RQ0A 3OY8B 3R4UA 3DPRB 1ZRRA 2QZ3A 2CTVA 1KS4A 3B94A 1ND2A 1BQPA 5HI0A 1UZWA 3KM5A 2WINB 1AL21 1VALA 4NE9A 2BPA2 2EIGA 3AMMA 1HXS2 1NZCA 2RM21 1J83A 4Q4V3 3SKVA 4BQ3A 2A73B 4CTEA 1YEWA 3SEPA 1CAWA 2ZMKA 4P14A 4CEYB 5FPAA 2QQVA 2Y26A 2UURA 2VY0A 5T55A 4ZU4A 3ZFFC 3BUCA 2I07B 1H2MA 1VR3A 1P8JA 3RS6A 4B29A 5C6CA 4YM3A 1A8MA 5DAQA 3I2FA 1K42A 3M3QA 1UO9A 4K8FA 5C3PA 5FYUA 2HBTA 3KLSA 4N90A 1RUG2 4LKEA 5JI7A 3ZXLA 2FHRA 4RGKA 3A4UA 2HEWF 1CD3G 1OA4A 1OOPA 4NPLA 1O4TA 1RHI2 3RWKX 4B4PA 2D40A 2GC2A 1UOFA 2VZOA 1JTZX 4ASMB 4P08A 1UOJA 2MEV3 3AZYA 1QJZA 1C8NA 1EAH3 1X9PA 2RG4A 1VP6A 4B7KA 4LOTA 1JH5A 2E26A 2QKDA 1Z78A 1R64A 2XPJA 5IFTA 1XE0A 2Z69A 3OGSA 1CZTA 1V6KA 3HVDA 4W6WA 3INAA 2X10A 3KS7A 2VUAA 2VECA 2XG3A 1PGSA 3MGUA 5ACA3 5F5IA 2RV9A 3IMNA 5JOYA 2ORZA 2PQQA 3KQ4B 1DQ0A 1UXZA 4MXWB 4YZ1A 3C7HA 4AF9A 1PGW1 2KA3A 2R043 2VZUA 4L92A 5KHIA 1B35B 1TQ5A 4LA3A 2JG9C 3M3EA 1OKOA 1RUH3 1ULCA 1UZZA 1RUI3 2C6SA 2XQRA 4NWVA 2Q8DA 3C3VA 2J1RA 2RE9A 1JYXA 5KXEA 2WNVA 2JJ6A 4XURA 2QDRA 1ENRA 1NY72 1ULEA 2YZ4A 3F95A 1NG0A 2ZEZA 2ZEWA 3POGA 1EY2A 2XJUA 3BPZA 3NJZA 3OD0A 4XXPA 5K9YA 1K5MA 1LKNA 1OVSA 3DPRC 3WP5A 3WNLA 5HV4A 4D7YA 5JIAA 5I93A 1POV3 4QQHA 1O7FA 1AJOA 5KHHA 4YRDA 2EVXA 1OKQA 1IHMA 1ZZ8A 3VDBA 5JSPA 4XEZA 4W6XA 2XH6A 4UW3A 2J1AA 3NNFA 4LHKA 2XOMA 4XBNA 4CEYC 1E57A 2CU5A 2BVVA 3N3HA 4OHYA 1PO12 1YO8A 3J7MA 2WZR1 1W9TA 2JENA 2GNTA 4OI1A 2PAKA 4X6QB 5FQ0B 3RI8A 4D69A 3FUQA 5BNOA 3VUOA 3BTXA 1LJ7A 1V6IA 4YVSB 3OEBA 4JHTA 2VO5A 4QM8A 1FNYA 2ZGOA 1CVNA 3HQRA 2AEZA 1GANA 5IK8A 2CNAA 4IEUA 3WHUA 4N53C 4XFBA 2EIBA 3DXUA 2BW8A 3GZEA 4SBVA 4CU9A 1NCRB 1H8TA 2JE8A 1LU2A 4XACA 5FZHA 5IK5A 1HV1A 5FMCA 2LRPA 1YQ2A 4ZHNA 5GLUA 2OS2A 4H7LA 2CDOA 1CAVA 1LEDA 2D93A 4UYBA 1AYN1 2BERA 3L2YA 4TLGA 3H3UA 2RS11 1WMDA 2ZHLA 4NN0A 5EP9A 4XVHA 2D44A 4CUCA 3GZTB 2WT1A 3W9AA 4AGGA 4I3GA 3FX3A 3POYA 4MUVA 2CDPA 3WP4A 2HEYF 1J58A 2MPFA 2PAEA 2WAOA 4N53A 5J36A 5JOWA 2XVLA 4UFKA 3ZFGB 1Z7S2 4XMIA 3R05A 1QJY3 2G9FA 5DXDA 3USUB 4B8EA 4D6QA 3MV01 4LE4A 4JC1A 2HYKA 5JSOA 1DIWA 1L7LA 4P9LA 4WVVA 4CCMA 1CAXB 2BNOA 1WBLA 2ARXA 3RVHA 3HAGA 1UKRA 4FBFA 1US3A 4GALA 3RJRA 5JXIA 5T54A 4GB31 1F15A 4LHLA 5DAVA 2D6OX 5DZEA 4BE3A 1DBNA 1DGRA 2HBUA 5EJ3A 4CDXB 1VMFA 1Y7BA 2C9AA 4XC9A 5FO8B 1HRI1 3DKWA 2VAUA 5KHJA 1SDDB 1ND3C 4NROA 2BFUL 4UF0B 4A7ZA 3I97A 3LDBA 1PK6B 1X7NA 2YROA 5DAXA 2GC0A 2WWSA 5DUVA 4QX5A 4B1LA 1HDKA 3LE0A 1AZDA 1HQLA 2KD7A 4AZZA 5T50A 5I91A 4AI1A 1L7QA 2RMU2 2C4XA 1LHUA 2JIGA 3A0NA 4DXTA 1JHJA 1FOD1 3KGZA 2HWC1 3AYEA 3ST7A 4PLNA 2Y8KA 5IK4A 1UY4A 3ETPA 4XTPA 3IDAA 4AG4A 4WZFA 2P2KA 5J37A 4DNYA 4DUVA 4INDA 5A7OA 1I6XA 2B5HA 4FO9A 1UU6A 2EAKA 3HBZA 4FPFA 5FWEA 3HQUA 3WQBA 2P3JA 3I2GA 2UWBA 1NCRC 1KJRA 2HEVF 2W1SA 1KS5A 5F5AA 3D5OA 3LSEA 1BBT2 1BVVA 2VQTA 3M2MA 5FP3A 2ZTNA 1XRUA 3AL5A 4QGLA 2HWE1 1MZ6A 1QU0A 2PQSA 4UW6A 5FXXA 4ARYA 4LJHA 2NYYA 1IOAA 5EFUA 3GF6A 2YFZA 1XNCA 3JZVA 3OUIA 5C9AB 3FHIB 4NHYA 1W9YA 3S7EA 3WLUA 3OSDA 3O14A 5DAWA 5C4WA 3WNKA 1V0AA 2R32A 5GJ6A 3T2OA 1JYIA 3NAPC 3RSJA 3X29B 1R083 4FVVA 5JR2A 4QXKA 1O3RA 3OJBA 3LCPA 4Q8KA 2WFPA 3I3EA 2ZAAA 4Q0VA 2XB6C 2ZGPA 4GKYA 1LHWA 1S0DA 1IS3A 4H3WA 3ZPOA 3C2UA 1AR93 2PLV2 2B8MA 3LGRA 1S0IA 2JWPA 2W9XA 1MZFA 5F9TA 3LEGA 2VW1A 3PNAA 5ERLA 1RVF3 2VOXA 3RYRA 4BPZA 1JYNA 3I2OA 3BTAA 4XBQA 2F4PA 2P6HA 4JGZB 4MV2A 2FDIA 1EV12 3NV3A 1KFUL 1N3PA 3V0BA 5C71A 5AFBA 3N9NA 3SLIA 1SDWA 3URFA 2J1TA 2Q1ZB 3LA7A 3KWVA 3KB5A 1RMU3 1PK6C 1RITA 4QPGC 4NHLA 1MEC2 5EHDA 3BODA 1DP0A 2VZPA 3M7AA 4BQ5A 3WW2A 1US2A 2Q8OA 2WS91 3OB8A 1ASJ3 2RDQA 4BK5A 4L2NA 5IW0A 4CYDA 3PU3A 5CADA 2YUEA 3V0AB 4HBNA 4CRQA 4EWAA 1ZBA2 4GWIA 1A3KA 1R1A2 1WKYA 5EWSA 5I0RA 1MS3A 4AW7A 3TNPB 5ABJC 4WM7A 2A6XA 1XNBA 2B9UA 2WZPP 5JSRA 2ETEA 1FT9A 1GICA 1VBD2 1GZWB 5JXGA 4LORA 1PIV2 3VD4A 3D8CA 4EZ4A 1VMHA 4KNCA 4KH9A 4CEWC 3WUDA 1C1FA 1RUF2 4HG6B 1PGL2 2VNRA 3SCFA 2VOWA 3WCRA 1LGNA 1W06A 2A75A 2E53A 1ULPA 4IV1C 1IPKA 4M00A 5LA2A 3T0BA 3VBFB 4QPGA 4NRQA 2XBO1 1JU3A 4OHXA 4A2UA 2GH2A 1UZYA 3QCWA 3KT7A 3N4MA 1RXGA 1JN2P 1VPHA 2ZGRA 4R52A 3MIHA 3ROUA 2X53S 4QX0A 2GH8A 4EN0A 1ZZ7A 5FTTC 4BZ4A 4ATFA 2P3IA 4QMAA 4PQQA 2VH9A 3AXDA 4XYXA 5FPVA 3RWNA 3TN93 5ABJA 1GKBA 1FX5A 1MQTB 4AI2A 4BYYA 2D6PA 4KU7A 1H9WA 4YM1A 3T2TA 1GP5A 4FTBA 1XSQA 4XABA 4Q4W2 5GZFA 2PHRA 2D3SA 4QGNA 2HWF2 2WSVA 1SFPA 3DECA 4MG2A 4M3CE 4IQPA 4EQVA 5SV5A 1FAYA 4CCNA 5AC91 3WNNA 4DXSA 3SH3A 3SEEA 4FP3A 4D8MA 1AR62 3W58A 4NHXA 2MNGA 1QJEA 5BXXA 1WLWA 1J3PA 3IT8A 3IAPA 4WM8A 3D0SA 5A7PA 5FLJA 4UI9L 3VBUC 2ZCWA 1WCSA 4JQTA 1UZ0A 1G9DA 1WCUA 1SCSA 1W6NB 4YWAA 1W0NA 1OH3A 4Q4X2 1ZRCA 1NLSA 5LZ6A 2E32A 1JYCA 1O4YA 5JPNB 3RG0A 4PIYA 4RGAA 5C8WA 1D4M1 1GU3A 1SQ4A 2ET7A 1YFWA 3H8UA 2VCMA 5FY4A 5FYMA 3SQOA 1EPZA 5A3PA 4A44A 1AR72 2WDBA 1COV1 3Q8FA 5FY0A 4EJRA 1GOHA 1LESA 1BYHA 1UYZA 2BNMA 2JX9A 4HKOA 2R062 5F39A 3GALA 4XCBA 5FUIA 5FBJA 4QT6A 3VHPA 4QKNA 3JBG3 4BQXA 4K40A 5I0DA 5L36A 1RUD2 2JDZA 2CL2A 2J7MA 1NXMA 5DDJ3 1ZRFA 2IXLA 2A6ZA 2YGLA 1JW6A 2EXIA 2W5FA 4LBNA 1Q3EA 4RHV3 2YB7A 5BNNC 1PO21 4U2AA 1FPN3 1WA6X 5JUVA 3SNMA 2QQMA 5A33A 5T5JA 4CDUC 1V9U3 4G4FA 3VBHC 3IM0A 1JOPA 4ORFA 4Q5OA 4Y5TA 2DCYA 4DINB 1UF2C 3CU7A 3DN7A 3OPZA 4JDMA 3RJ2X 5F2SA 2A71A 3JCIA 3WEZA 3BPSA 2AZ5A 3T30A 4S2DA 3LPFA 4BCUA 4E4HA 2YYOA 2ZPXA 2FDFA 4FQ4A 1PHMA 3NW4A 1MQTC 2G4IA 2BRTA 1FXZA 3GZUC 3IPVB 2ZX1A 5JCTA 1SBFA 3JD71 2CHHA 4MLOA 3AKPA 4BQWA 3FWEA 2RM22 4YZ3A 1M4WA 5BNNA 5IJRA 5BY5A 1STMA 3PUQA 2DTYA 3OG2A 5L19A 5KXDA 3VBHA 1RJ7A 1PVC1 4LO7A 3A22A 4N9IA 1YHFA 4P9XA 3O1MA 2DV9A 2VUJA 3ZXFA 1CX1A 1FMD1 3CJIB 4XHXA 3ZKYA 2BBAA 5A32A 1ZZBA 4CPBD 5GLWA 5ACA1 1N1YA 2E31A 5CKMA 1V6LA 4B3NA 4QXBA 1C5HA 4ES8A 3OYWB 3O0WA 5FO7B 1NA1C 2FMYA 5L7OB 4L99A 1ZBE3 1QDOA 2X5IA 4QQOA 1RUH1 5FY7A 2IWGB 2JE9A 3MIGA 4DRVA 1BMV1 1EUUA 1W8TA 3B5LB 2BBVA 4M3CB 3SISA 5K8SA 2DVGA 3FC0A 1KEXA 2YU1A 3W5NA 1NAEA 5KXBA 2BDRA 1DG6A 1LHNA 2DDUA 4IUGA 1FNZA 4QM9A 1G9FA 4RQPA 4AVBA 5JZGB 2VTXJ 1VBA1 3RDIA 1F5FA 1JZ3A 4IV3B 3W5MA 3AVSA 3WX5A 1L3JA 2Q1MA 5FZCA 1PM7A 1POV1 2Y6JA 2YC4A 4B4QA 3CZJA 4XJAA 3GBGA 3WOGA 4IEYA 1GOGA 4XCAA 4GJYA
chains in the Genus database with same CATH topology
1X33A 1XYNA 1NA1A 3CO2A 5D1IA 3ZFEA 1LULA 1PGW2 3FJSA 3BCWA 2R1BA 1GFF2 2BTVC 3ILFA 1CPMA 1RL3A 2UWCA 4FPKA 1QY4A 1NQJA 1LTEA 2XL7A 2BQPA 2R073 1HW5A 2WJSA 4HK9A 3WG1A 4EN7B 4R4XA 2Y0IA 1GV9A 3TNQA 1G9CA 3JB8A 3VZKA 1WLCA 5JOZA 3PMEA 2K9ZA 1DZRA 5GKAC 4D3WA 3B00A 2ES3A 4CDQA 4GH4B 3M4FA 2VOKA 5H9PA 3ZN6B 4F7ZA 4Q26A 2DCZA 2GMPA 4RFT0 4AQTA 2W0XA 2R16A 1SLIA 1W39A 2QE3A 2WZR2 3MW3A 3WINE 5KC5A 5JMCA 4LTAA 1YJLA 4QD2A 1VJ2A 3MDPA 2RS52 2SLIA 1N3OA 3FFQA 4B7EA 4FPGA 3MFAA 4IEZA 5FBZA 2E7AA 1RUC1 4X8NA 3BIWE 1QJY1 1Z0HA 4CP0A 4F8AA 4Z2WA 1VBB1 3CLPA 4M3CF 4XQ4A 4YVWA 4XQDA 4I2OA 5JZGC 4MGZE 1S2KA 4ASLA 2DF7A 1AYN2 1LODA 2VW0A 4IV3C 4LLFA 3TOJA 2RS12 4W6YA 1NXD1 1H30A 4ITCA 1G8WA 3ZXEA 2TEPA 1OFNA 2ZJCA 1J3RA 2P3KA 1RUE3 4Q4Y1 2UY9A 4U36A 1U12A 4BIOA 4E2SA 4J1XA 1AYM1 3VKFC 4J6GA 4JGYC 2R0HA 3MF9A 5AVPA 4XILA 1QH6A 2PA7A 4DOUA 4FAGA 3ZMNA 1G7YA 1OPMA 3UV9A 3ZSMA 1AF9A 2JECA 3VBRB 1AVBA 4DS0A 4PDWC 2CGPA 4XJZA 3WG3A 4GB32 2Y0OA 2VQAA 3NWKA 1XU2A 3FLRA 4AHZA 3WR0A 2CGOA 5LK7B 1BEV2 1DZTA 1HRI2 4GH4C 3AMQA 4KL1A 3U4XA 1PZ7A 3CF6E 2HKXA 4NOTA 2CWMA 1OMIA 5E16A 1CAUA 4FPJA 1ULFA 3QBQA 4FXKB 4LBQD 4J1WA 4XJUA 2DFCA 4JGYA 4MX3A 2HWC2 2O1QA 1XYPA 2EA7A 1HXS3 4IL7A 4LBLA 4Y20B 1DGWX 1UKGA 1DDLA 2VW2A 3I7DA 3E5UA 1DQ2A 4H14A 4QPIA 5EYYA 4C90A 1IS6A 3AXEA 4OI2A 1LGBA 1FV3A 4RS5A 2UYAA 3ES4A 3VBSC 1Y43B 2Z79A 3ELNA 4BH9A 1HQNA 5HXVA 4QGMA 2GNBA 4S2HA 3UL2A 4LBMA 3PLQA 1MS4A 1QMJA 1MS0A 1RVF1 2OYZA 2HWE2 2H6BA 1RUG3 4I01A 4Z1VA 1POV0 2D3RA 4MGIE 4XW3A 1RHI3 1VRH1 3HD8B 3RPQA 4H7MA 1ZZCA 5EV7A 3WG4A 1IGOA 2PFWA 3MZHA 4EN8B 4PQ9A 4Y1XA 3PJYA 1U5IA 5EXOA 3NVCA 2XLAA 4M0HA 3VBSA 2JG8B 3FLPA 1S2BA 4QQ2A 1UN1A 2PTMA 1GSLA 3D82A 3AZXA 2BFUS 3IWZA 3N7LA 1GBGA 4MVTA 1WW6A 1Y9QA 4QHBA 2I45A 5DZGA 4PF5A 1H1IA 1N1SA 2PHDA 1ZZ6A 4YW2A 2JD4A 5E88A 4M0NA 3I2DA 1IQAA 1ZM1A 1NCQC 2B39A 1CR7A 2ZKNA 4XJ8A 2WS92 3MW2A 4AEDC 1W6PA 1Q8SA 1Q8OA 2W68A 4Q0QA 4C1WA 3QOPA 5BNOB 1VB2A 1VAKA 4FPLA 4XQWA 4FSJA 2DFBA 4Q1PA 2WNUB 1V6NA 3RYPA 1KITA 3FUOA 2PHTA 2WFF1 2QZ2A 1SLBA 1PO13 4YGEA 2A3XA 3KZ4C 4XXAA 4Q0UA 1WBFA 4OI0A 3H3ZA 2WQ4A 3AZWA 4XJWA 1PMIA 3IKWA 5TSWA 5CFCC 4Y22A 1OLRA 3G6JB 1QJU2 2XVGA 2XBO2 1V6JA 3JQWA 2VMIA 2HWD1 1YFUA 4LBKA 1OQEA 4MH0E 4AEDA 4LT5A 3Q9OA 3BOWA 2C5DA 1LOEA 1H0BA 5CAZA 4RR3B 3ZFFA 4LBQA 1ZX5A 4AFBA 4JTOA 1C5IA 3H1MA 5F5QA 2Z42A 2CAUA 1VBC1 4OULA 3RYKA 2RS31 2XJTA 1C4RA 4A7KA 2A5ZA 5BYNA 3LAGA 4DQAA 3K48A 1W6MA 1Z7S3 1OPOA 5D8AB 4P9JA 5KBFA 4KG0A 4LLOA 3ZVXA 3VV1A 2FBEA 1ZVFA 2YY1A 2VGDA 1FPN1 1I9RA 3ZXAC 3HQXA 1V9U1 3LOBA 1OHFA 2PHWA 3OGJA 1S0FA 4FXGB 5DUUA 4Y1VA 1VAVA 4HMZA 5FPZA 1VBE1 2ZGKA 1TNRA 4UXAA 4AQ6A 4Y26A 3ETQA 3LA2A 1COV2 2H0VA 2R1DA 3DF0A 4BM8A 2JG9A 4HVQA 5A3LA 1SACA 2WNUC 1IS4A 4R9DA 2OZ6A 1NYWA 1NE6A 1TME1 2RMU3 2ZX0A 3NKTA 2DVBA 1QOTA 1MZEA 3AM2A 1RUOA 2X8KA 3H1WA 1Q56A 4XE9A 1WCDJ 1PO22 5JIUA 3OY8A 1F8VA 1HLCA 4GWMA 3DPRA 3VBOB 4HSJA 3H1YA 1I3HA 3MPPG 1Q8VA 4CDUB 1C8M1 1RTVA 1G86A 3VZNA 1WLTA 4R4ZA 1VIWB 2PHXA 2WLQA 4KU8A 1BBT3 5GZDA 1LR5A 4YZ5A 4LO4B 3SCGA 1R092 4CEYA 5CNAA 5LEJA 4DY5A 4MGYE 5K0UB 1H2NA 4AE2A 4EROA 3JD72 1C1LA 1B35C 2ZABA 4DXZA 3TBDA 2QJVA 1PVC2 1LOBA 3MYXA 1OQ1A 4GA9A 1UU5A 4K3UA 4LBOA 4URTA 1FMD2 1JXNA 3WQ7A 1XNDA 5DG1A 4UBHA 3AP6A 4XPVA 4BLJA 1UD1A 2EXJA 4O9GA 4BHPA 5CFDB 1SLLA 2PLV3 1FYUA 2X29A 2RHPA 3CNAA 3MEPA 4DB5A 2WL1A 4K20A 5C8CB 5DZFA 4E2QA 3AYCA 3WP6A 1EV13 3KCYA 1BMV2 3ZN4A 4B4RA 1O3TA 2JKBA 4XF1A 4MXWA 4C1XA 2GMEA 3E5QA 2A7AA 4AXOA 3U07A 1MACA 2RR11 5JLVA 1MEC3 1AHSA 2VULA 1VBA2 3EO6A 4DZGA 5AFEA 2ZS6B 4YVSC 1AX2A 1ZBA3 3UJQA 1R1A3 1QNWA 5BV6A 1D0GA 4AI0A 3B01A 5FDBA 1CONA 1VBD3 3PJQA 1WW5A 5GLVA 3RMXA 1PIV3 1X82A 4ATEA 3ZIXA 4CDUC 1ND3A 4I02A 3J8F1 5GZGA 4XF0A 1LHVA 1RUF3 2OPKA 1TMF2 4JCKA 1QOSA 4N43B 2UWAA 5LEKA 4Z8BA 1S0GA 4HVRA 2DUOA 4YW3A 3AMNA 5BNPB 2KM2A 1U5XA 3ZXGA 4S2FA 5FQ0A 1KDMA 1QOOA 5K0UC 3AFGA 4XOGA 3AJZA 3KCCA 1Q8QA 4V1PA 2BWAA 3CL1A 2WIIB 1QXJA 3ZYIB 1CN1A 4Q29A 2EALA 4XZPA 2H0BA 1F31A 2VVFA 4GMP3 3ZFGC 5J09A 1NCRA 2EF6A 4Q4W3 2OUJA 2HWF3 1RUE1 1OD5A 1QQP2 4QQPA 3O7OA 4CDXC 1LOGA 2ZGUA 1AR63 3MFCA 1RUC2 4F83A 5C8CC 1KFXL 4BLIA 4DFSA 4I0AA 3I54A 4FTEA 2Z5WA 1D4VB 1VBB2 3A0KA 5BUVA 3SH5A 4COWA 2RJKA 2NZ9A 3M3OA 3NAPA 1HRV1 3DV8A 4Q4X3 1HIXA 4SLIA 4E4SA 1XYOA 3USUA 4EWDA 1QJX1 1ZA4A 4WZCA 5KHKA 4UW5A 1UPIA 1YRZA 4L9BA 1CAXA 2FZ1A 3J9SA 3PTYA 1AR73 3V64A 3WXPA 2R063 4Q4Y2 5GALA 2Q0AA 1RUD3 4QPYA 1AYM2 2FMDA 3AKTA 2OA2A 2XKPA 1RUJ3 4GQ7A 1DGRN 2OUHA 4G9SB 3ZYPA 1O91A 1PK6A 4FP2A 1SLTA 2OW4A 1W6OA 4NHMA 2R0FA 2ILMA 5BNPC 3PVOA 5C9AC 3AKRA 4OHZA 1AR81 2UU8A 4Q0PA 5F1RA 1UL9A 3B9IA 3L2HA 4OHWA 3WW4A 2PHFA 1RUG1 4Y4YA 4CEWA 3GBFA 2VOVA 2GDFA 4LO6B 5FPXA 4XJ9A 3ZSKA 5CG9A 4IV1A 3GHMA 4EN9B 1N1VA 2RM23 5HCBA 5E1RA 4JGZC 2HJIA 5DG2A 3SCHA 5K7PA 4LR4A 1DZQA 2TUNA 4RL7A 2D6MA 4RGGA 5E89A 1YXWA 2A6WA 3AYAA 3WDXA 1C3HA 4R9AA 3KT4A 1J1TA 4BMBA 2IXCA 3GNEA 1C57A 2W52A 1SCRA 4RQPB 4WVMB 3FZ3A 4XIKA 3ZXJA 4N7IA 4A3XA 4NO4A 2HWB2 3E97A 1UIJA 1UW8A 1VRH2 2XL9A 1NY71 2C1FA 3APBA 4FOVA 3JUUA 2IXHA 4Q2FA 4COUA 4JGZA 1OQDA 3MIDA 3ZFEB 3VBUA 1G6NA 4Q4V1 1DQ1A 4CDWB 4LE3A 3VBFC 4LHNA 5KWRA 4AHYA 5KXCA 4IEQA 3L9JT 1PO11 5FCCA 1V6OA 1Q5OA 4YM2A 3KGLA 3HIFA 4D94A 5C33A 1N1TA 5BNQA 2YDEA 2XJRA 1GZWA 4R8HA 3AP7A 1IPJA 2PAMA 1WD3A 1AL22 2E63A 1C28A 4OLLA 2MEV1 3KCXA 1EAH1 2PYTA 1WMFA 4FPOB 2IFWA 4E4DX 4FOWA 2JE7A 2LUWA 1O3SA 1F2NA 3ZSEA 5SV8A 1AXZA 2B7YA 2NN8A 3ACLA 2WFF2 2NP0A 4BWOA 5I8TA 2Y38A 4META 4PBPA 2IXJA 1AX0A 1RGSA 3ZYJB 2R041 4KGGA 3TYJA 3VZJA 3N7KA 4TWTA 1DGWA 2RS53 4WVWA 1F9KA 1RUI1 2TBVA 4ZXKA 1MQTA 4IEPA 2TNFA 4YVWB 4YGBA 2ZHMA 2E7QA 2HWD2 3QACA 2BUKA 3VKOA 4FQZA 3THTA 3B3QE 2DU0A 3OTFA 2A70A 1CESA 1YFYA 4Y1UA 1MS9A 2WC2A 5FRAA 4EN6B 1RUNA 5I0SA 3QLQA 4MXVA 3U0ZA 2NQYA 1AYN3 5LRRA 2RS13 4AK3A 4Z92B 1S0EA 2A6VA 4R9BA 1EPWA 1IS5A 1W6NA 3IDBB 4PBOA 1VBC2 4HETA 2RS32 1H1AA 4PIZA 4UBGA 1G9BA 3AFKA 1LECA 4IEVA 4RA0A 4X6RB 2ZHNA 2Q5TA 1KXGA 1SMVA 2P37A 4AGRA 1YNAA 1UIKA 4FTSA 1OI6A 4JV4A 2RJLA 1OA3A 3SMHA 3VZMA 5GM0A 4NHKA 3UKTA 1V9U2 3GBWA 5JAXA 3ENRA 4MZUA 4GB33 3ZSJA 4OUSA 1CAUB 1VBE2 1BEV3 1MS1A 2B46X 1IZ3A 4N7UA 2W39A 2W08A 1YI9A 4AVVA 1TNFA 2ZMLA 3CJIC 3TAYA 4XF4A 1RC6A 3WHTA 5HBAA 1CX4A 4QPIB 1TME2 4W65A 1MR5A 2E9QA 2ZKLA 4LO5B 1RB8G 4RS5B 1QDCA 2HWC3 2WA3A 5L7OC 4I09A 3B9CA 3H50A 4COZA 5CU1A 1S0JA 1H4GA 2LM3A 1BK1A 3IPVA 1G9AA 4HPKB 5AVAA 1C8M2 4YYOA 4I3PA 2DVDA 3AB0A 1ENQA 2WQZC 1ZRDA 3OBRA 3VKNA 3P3NA 2JICA 2XJPA 1PNFA 2HWE3 3AP4A 3CJIA 4GIQA 1YJKA 3EJKA 3HN1A 2DTWA 3OCPA 1EV11 1LOFC 1ONAA 1FV2A 3WW1A 3JU9A 3I59B 3VHOA 3QH6A 1ZYBA 3VDDB 3FLTA 5L7OA 2B45X 4IESA 1YWKA 3WDTA 1J1LA 4I0BA 1MEC1 2GSYA 4XFCA 3D0JA 4M3CA 2GC3A 1T6GC 2LALA 1BCXA 3ILRA 1APNA 4YM0A 3TB0A 1ZBA1 4OFGA 5JZGA 3ZXDA 2DVAA 4IV3A 2AREA 1VBD1 1ND2B 1LOFA 4Q27A 2VNOA 5J48A 1RUF1 3NL1A 4HN1A 2G9GA 5JWPA 2EXKA 1AL0G 2VMGA 1CAWB 3G7DA 2RR12 3GZAA 4AVCA 3THPA 1FOD2 2D97A 4YLZA 2IXIA 4C0BA 2WS93 4COVA 3VL9A 4OHVA 1R081 1KJLA 4YW4A 4PDWA 1D2QA 2ZOEB 3KT1A 4FPYA 2WNEA 4Y22B 1OOPB 1AXYA 3CJXA 3ILNA 4HT1T 3LKJA 2A6YA 1AR91 1YIFA 4GH4A 3ZN6A 2UYBA 3J8F2 1QWRA 4K6BA 4XETA 3B02A 5IT6A 3W59A 3WVJA 2ZX2A 1QJU3 4PCRA 2XBO3 3SH4A 3ZFFB 3I8TA 1RMU1 4E27A 1HKDA 2CY6A 3LSDA 3SHRA 1ASJ1 2WT0A 1Q8PA 4C0HA 4FCAA 2AENA 1DLLA 3VKMA 3I4IA 2VNGA 2P34A 2WNVB 4AYUA 4DPNA 3VBRC 1GLHA 1AX1A 2D5HA 2R061 1KQRA 1K5MB 1JHNA 4XTMA 4RD7A 4F3JA 1DQ5A 5DUXA 4DRRA 1RUJ1 3OD4A 2QCSB 1SLAA 4QU2A 2O8OA 2VPVA 4IEXA 4FPEA 2BWCA 4HFSA 1HRV2 4TZDA 2XLGA 3AK0A 3WQ1A 2ZBJA 2JG9B 1A8DA 3ZYGA 4XFFA 1AXKA 1QJX2 3AJYA 3VHRA 1W6QA 5CIRA 2K2SA 3TN91 3PVEA 2BVBA 2N7GA 3WDUA 4FT8A 1QHDA 3AKSA 3VBRA 1COV3 4WVZA 2DURA 3R4SA