1V00A

Erythrina cristagalli lectin
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
239
structure length
239
Chain Sequence
b'VETISFSFSEFEPGNNDLTLQGAAIITQSGVLQLTKINQNGMPAWDSTGRTLYTKPVHIWDMTTGTVASFETRFSFSIEQPYTRPLPADGLVFFMGPTKSKPAQGYGYLGVFNNSKQDNSYQTLAVEFDTFSNPWDPPQVPHIGIDVNSIRSIKTQPFQLDNGQVANVVIKYDASSKILLAVLVYPSSGAIYTIAEIVDVKQVLPEWVDVGLSGATGAQRDAAETHDVYSWSFHASLPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LECTIN (ECL)
publication title Crystal Structures of Erythrina Cristagalli Lectin with Bound N-Linked Oligosaccharide and Lactose
pubmed doi rcsb
source organism Erythrina crista-galli
molecule tags Sugar binding protein
total genus 57
structure length 239
sequence length 239
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1v00A00
2OVUA 3CNAA 4LBQD 5DUXA 5GZDA 3WVJA 4HANA 5JDBA 3ZXKA 1WD3A 4DFSA 1BJQA 3V0AA 3SISA 1URXA 2WJSA 3WDVA 1DHKB 1QGLA 4Q1RA 4XIKA 1V6NA 1AJOA 4Y20A 4XYXA 5DZFA 1W6NA 1GICA 3UJQA 4DQAA 4AYUA 2D6MA 3USUA 4DPNA 1MACA 3ILFA 4FVVA 4W65A 3WUDA 1N3PA 5DXDA 5T5JA 2A3XA 5GLZA 1SBDA 2R49A 3SH4A 3TAYA 4ISRA 4YZ1A 2GNTA 4P9YA 3GNEA 4M00A 4BLIA 2A6VA 1IS4A 2WT1A 5DZEA 1G9CA 2PHTA 1IKPA 1N3OA 1LENA 5E89A 2Q5TA 4FPHA 2Z42A 1W6PB 5IK8A 1SBFA 1PZ9A 1X50A 4WV8A 2V73A 3WOGA 4LBNA 3N7MA 5KXBA 1DYPA 3WCRA 4F83A 1WW6A 4MYEA 5DUWA 2JKBA 3OY8A 3WUCA 5DUUA 4R9DA 3VV1A 4Y1UA 3AFKA 1IKQA 1DZQA 2B7YA 3AP7A 4ISQA 1LEDA 2VY0A 1N3QA 4YZ3A 3WG1A 3ZSJA 4CZSA 3AZZA 4Q27A 5GJ6A 4YW3A 4BOWA 4YGEA 2E51A 2GNBA 4YM2A 2VU9A 3MEPA 5HCAA 1Y7BA 1LEMA 2D3SA 1NLSA 2ZGSA 1G9FA 2ZKNA 1CIWA 1QDCA 2PHFA 3FLTA 2ZHLA 3M3QA 4LBMA 4XE9A 1DQ6A 3O0WA 1G9DA 1LGCA 3POSA 1YRZA 1N1TA 4Y1VA 1JBCA 4YW4A 3ZXEA 4UW5A 4Y22A 3AK0A 3IPVB 3SH5A 2SLIA 2A6ZA 2D6KA 5H9RA 4BMBA 3B00A 2AUYA 2ZGPA 3R4SA 2YMZA 4Q8LA 4Y1XA 1LOFA 2EIGA 1A3KA 3OYWB 4FPEA 4JRAA 1LECA 5GZCA 3R4UA 2A3YA 3ZVXA 1F9KA 4I30A 3U4XA 1SFYA 1DGLA 2G4IA 5FRAA 5JVVA 2ARXA 1G86A 1S0CA 1QDOA 3B9CA 3WCSA 5FREA 2ZMKA 1WUVA 1Q8OA 2P2KA 1LGNA 4WVVA 2GNDA 2DU0A 1AXZA 3DGTA 1G9BA 2VXRA 4AGVA 5T5OA 2A6YA 2R16A 2UWCA 2WSVA 1R1ZA 3BTAA 1AXYA 4FQZA 1SCSA 1HLCA 1Q8SA 2ENRA 2AR6A 3UL2A 4ATEA 1V6MA 3QLQA 1JHNA 4YZ5A 3WDWA 5JOXA 3HMYA 2A75A 1GZWA 3NV1A 1DQ0A 1MZ6A 1FX5A 1ULEA 2AH2A 4RA0A 4RL7A 1GSLA 2JE9A 3RRDA 2WKKA 3ZXLA 1KRIA 2FHRA 4LBQA 4U2AA 5H9SA 1CPMA 3A0NA 1N47A 3MW3A 1UMZA 1S0BA 3R05A 1C1LA 2CYFA 1WBFA 3ILRA 2ZACA 2WSUA 1SLLA 3AP9A 3JUUA 2ZHKA 2E6VA 4WVWA 4GKXA 1NXD1 2ZGNA 2WNEA 3N36A 3Q9OA 3M3OA 4ITCA 1MS5A 1UN1A 1S0GA 1FAYA 3WG2A 1AX0A 4M01A 4XJWA 3NV2A 4AVVA 4YM3A 1LHNA 3AZWA 3AZXA 4M3CF 2PHWA 2EXKA 4AVTA 4U36A 2VW1A 1CJPA 2A5ZA 2GMPA 5GLUA 3IN9A 1LODA 1KDKA 4YGCA 2DUQA 4K1YA 4Q8KA 1TEIA 1W0PA 1SLAA 1GV9A 1WLDA 4P14A 3HN1A 3AP6A 4TYSA 3NV3A 3WDTA 4GALA 2A3WA 1H30A 1BKZA 4C1WA 1Q8QA 3WG4A 5IK7A 2CWSA 2LALA 5JOWA 5IT6A 2C5DA 2JDZA 4PCRA 1V6LA 2JECA 1C4RA 3POWA 1JW6A 4KBBA 1AX2A 3AZYA 5HCFA 1N1SA 1YO8A 4YZ4A 4Z8BA 3RG0A 4XJ9A 4BM8A 1SACA 3POYA 4GWMA 4K1ZA 1CR7A 3V64A 4SLIA 4YG6A 4ATFA 4GWNA 3APBA 3PMEA 4FP2A 1FV3A 1FYUA 2E7TA 2WT0A 3V65A 2AYHA 3W59A 3AXEA 2ES3A 2A7AA 3ZYPA 4BMEA 4BQ1A 4NO4A 4PBOA 4NOTA 2NMNA 2P3KA 1MVQA 4XJZA 1C57A 2H0BA 1FATA 4M3CA 3WLUA 1PZ8A 3MPPG 1KDMA 4FPYA 3I4IA 3FLRA 2KM2A 3PJQA 3AYDA 1LGBA 2DVGA 3ZSKA 3W58A 4Q1PA 3WHTA 2ZGRA 4BLJA 1JUIA 2ZGOA 2CY6A 3ENRA 5IK5A 3V0BA 3FFZA 3O12A 3WHUA 2FMDA 2DVDA 1W6QA 3D6EA 2D3RA 1Q56A 3BODA 3INAA 4FOQA 4PQ9A 5EWSA 2GNMA 3WDUA 2W08A 4FP3A 4YG0A 2C9AA 1V6OA 2CTVA 2JE7A 2UURA 4XZPA 3V0AB 3AYAA 4YZ2A 3T1LA 2EXIA 4D69A 4XXAA 3AXDA 1GZ9A 4Y20B 1W6NB 3VKNA 2ZHNA 1WLWA 3USUB 1VIWB 1VAVA 3AJYA 1WD4A 3IMNA 3QCWA 1DIWA 1HDKA 3N7JA 1FNZA 3ZSMA 1JYIA 3HR9A 3N7LA 4K20A 4L8QA 4XBLA 4YLZA 4GXLA 2OUHA 4PF5A 3RQ0A 1WBLA 1A8DA 1JYCA 3UK9A 1QOOA 1QMJA 2ZGLA 1AZDA 4XHXA 2P3IA 1S0DA 3VKLA 1LHVA 3OBRA 3T2TA 3FUOA 1W6OA 1HQWA 1W6MA 4M3CE 1LTEA 2AENA 2EAKA 2OW4A 1ZM1A 2NM1A 3OJBA 3KM5A 5L73A 1LOCA 4R9CA 3LCPA 5JMCA 1LOEA 3OY8B 4FPGA 3WZ1A 1GYKA 1DQ5A 3GALA 1D0HA 2E7QA 2GMEA 2ZABA 3D4KA 1GBGA 2R1DA 1VAMA 4XDQA 2WT2A 1F31A 3AX4A 3RSJA 5DZGA 3AYEA 3IM0A 1ULFA 1BQPA 4IQPA 2DVAA 3N3HA 1EPWA 4H55A 4YM0A 1LHOA 1AJKA 2R0FA 3RS6A 1SLTA 1QKQA 3I8TA 5KXEA 1JN2P 3N35A 1YIFA 4YG3A 1FNYA 3NWKA 1YXWA 2W39A 2I2SA 1QNWA 2DURA 1LESA 5KXCA 4C1XA 1MS1A 5T54A 1CQ9A 1F5FA 4UW3A 3RMXA 1WW5A 1GNZA 5DUVA 2ZA9A 4Q26A 4Y22B 2ZMNA 1B09A 5GLTA 5GZEA 5DG2A 1LCLA 2GALA 4XJUA 3JU9A 1SLBA 2NYYA 4Y1ZA 3SH3A 1QOTA 1ENRA 1IS3A 1G8WA 1HKDA 4Y26A 1CN1A 4AGGA 2UWAA 1SBEA 2P3JA 1ENSA 3AP4A 4FPJA 4FOYA 1LJ7A 2GDFA 4YGDA 4YGBA 5JOZA 1QOSA 1Z78A 3SLIA 1APNA 2EALA 2ZGTA 1DBNA 1ULGA 1S0FA 1I3HA 5LK5A 5GLWA 2HYKA 1SCRA 3B69A 4FOVA 1OFSA 2RHPA 1ZA4A 2SBAA 3PVOA 4P9XA 3NV4A 1HQLA 1KQRA 1Q8VA 1UZYA 2D6OX 4XBNA 1MS3A 4XOGA 4FPKA 5T52A 1QU0A 2DVFA 2PHXA 1D2SA 1OKQA 1QF3A 3FLPA 5JLVA 1GZWB 2DVBA 5T5PA 4AGRA 1DYKA 3ZPYA 1W6PA 3B3QE 5E8AA 2VUAA 4LBQB 5GALA 2A6XA 3RMYA 2YZ4A 2R0HA 2ZBJA 4K21A 1WCSA 1WLCA 2YROA 3WNXA 4DRVA 2BQPA 1LU1A 1V6IA 1RIRA 2DYCA 4YM1A 1CONA 1WW4A 1O4YA 4GA9A 3WDXA 3C2UA 3ZYRA 5GZFA 2D6NA 2ZGMA 3FBYA 5F5QA 1LOBA 4XMIA 3SNMA 5CA6A 3N7KA 1JXNA 1LU2A 2DWRA 2R1BA 3ZSLA 2NP0A 1V6KA 4WZFA 3PVNA 1N1VA 1PZ7A 3OGGA 2ZGKA 1S0EA 1LOFC 4Q2FA 5IK4A 1JOJA 3VKMA 1VALA 1DQ1A 1BXHA 2VH9A 1ULCA 4CTEA 3BIWE 1LHWA 3IKWA 4GKYA 4R9BA 1G7YA 3ZXFA 1OQ1A 3VKOA 2TEPA 3LSEA 4LBJA 5BYNA 3IPVA 3VUOA 2JD4A 1H9WA 4FPCA 3A4UA 2ZHMA 4XILA 1Z0HA 3O0XA 1GKBA 1MS0A 3OYWA 1RINA 2OUJA 1AF9A 2A71A 3OBTA 1H9PA 3DUIA 4ASMB 3MW2A 2JJ6A 2GMMA 2P37A 1UL9A 2CWMA 5EYYA 1LHUA 2ERFA 1MR5A 1UAIA 1FV2A 2XG3A 4YW2A 2YY1A 1ULDA 1DQ2A 5EYXA 3M3EA 4FPOB 2DUPA 2P34A 1AXKA 1GNHA 1U0AA 2DTWA 3L2YA 1AVBA 5GZGA 5CB7A 1ENQA 3ILNA 1O4ZA 4M3CB 1MZ5A 3TB0A 2W68A 3M1HA 5T50A 2DUOA 4UW4A 4TZDA 2YXSA 2ZMLA 2E53A 1UZZA 3LSDA 3ZXJA 5CNAA 2D7FA 4AVSA 3AZVA 2VW2A 1YI7A 4CRQA 1CPNA 1SLIA 2YV8A 4HL0A 2ZAAA 3T1MA 1J1TA 1MS9A 2EF6A 4BPZA 5CBLA 4YFWA 4YW1A 3V0BB 4LBKA 1BZWA 1S0JA 4XBQA 4AWDA 1W6QB 5DG1A 5IUQA 2WQZC 1Q8PA 1IS6A 5GLVA 3PVEA 3AJZA 3O0VA 3AYCA 4XTMA 4Y24A 2D6PA 1KITA 2ARBA 5GM0A 3M2MA 2ZGUA 3WV6A 2A70A 1MS8A 1S1AA 5F9TA 5EXOA 5T5LA 2LTNA 3OPZA 1YYNA 3ASIA 1DQ4A 1MS4A 1WW7A 1KJLA 2WLQA 4LBLA 4XTPA 4DS0A 2ZGQA 3WDYA 2PHUA 3B01A 4YFZA 1BYHA 5HCBA 3UJOA 5JOYA 2UWBA 2CL2A 3BOPA 2DV9A 2ZZJA 4XIOA 2UU8A 4FOWA 1CESA 1LULA 2NN8A 3WG3A 2GN3A 4DRRA 2NMOA 4ZKTB 1LOGA 4OZXA 1N1YA 2W52A 1S0IA 1VLNA 4XMAA 3H0OA 1W6MB 1W6OB 4PBPA 1GZCA 1W0OA 3SITA 1IS5A 1CVNA 5KXDA 3KQRA 2A6WA 5H9QA 5E88A 1G9AA 1QNYA 4UW6A 2AGSA 2VW0A 1V6JA 1LOAA 2V5YA 1DLLA 2AREA 1AX1A 4FQ4A 1IOAA 2D6LX 5AVAA 4YW5A 1A78A 3O5SA 3A0KA 1UPSA 4LBOA 5H9PA 1C1FA 1ONAA 2PHRA 4XHBA 1UKGA 1V00A 2CNAA 3MW4A 1KJRA 4FPLA 3D5OA 2EXJA 4JCKA 1I1EA 3ATGA 2D3PA 4ZXKA 3AP5A 4XXPA 1GLHA 2DU1A 2NZ9A 4XJ8A 5SV8A 1DFQA 1GANA 4P9WA 2XB6C 5CAZA 2DTYA 1UX6A 5T55A 3FUQA 3M3CA 4XJAA 1MVEA 4FPFA 1SLCA 2D43A 1RITA 4R9AA 2GN7A 4Y1YA 3VKFC 2D44A 2PELA 4JC1A 2EXHA 1XQNA
chains in the Genus database with same CATH superfamily
3CMGA 3POBA 2OVUA 1UOJA 3CNAA 1QH6A 3SQOA 1ZBE1 4B4QA 1NQDA 4IEWA 1CAXB 4E4SA 4MXWB 3ZXKA 4BQ5A 3LDKA 4AE2A 2BUKA 1R1A2 4B29A 3RYKA 1VBE1 2ZOEB 3V0AA 1PNGA 3SISA 3TRSB 4TSVA 1MEC3 1CAUA 1UY2A 2VOTA 4CSWA 1QJU3 2ZXQA 1QGLA 4XIKA 1NCRA 3VHPA 2HEWF 4XYXA 5DZFA 2YC4A 4MHRA 3IIIA 4DPNA 3ILFA 3PNAA 4YVWC 4CP1A 1J1LA 4Y5SA 4YNIA 5LRSA 3N9LA 3WUDA 4CYDA 3RZMA 2QUOA 2Z69A 5T5JA 2A3XA 5FK8A 4LKDA 5GLZA 4AW7A 2R49A 1DGRA 5ACA1 4P00B 4UAPA 1NKGA 5AFEA 5BNOA 3E6CC 1HRV2 1LKNA 4P9YA 2ZZQA 2A6VA 5DZEA 4IE4A 4GJZA 2RS53 4KWLA 3U1XA 1D4M1 1AYM2 1LENA 4HN1A 2YGLA 3N9NA 1KD7A 3N9MA 1W6PB 5A3MA 1SBFA 1PZ9A 4XURA 3N9QA 2V73A 3MGUA 4AI8A 1DZTA 4FI9A 4JHZA 2J42A 4UYBA 1ALYA 4CXWA 2K46A 4MYEA 3PUAA 5DUWA 5FMOL 1IHMA 2JKBA 3DECA 5A80A 3D3AA 5SV5A 2QQLA 4IV3B 3L9JT 4Y1UA 1PVC3 3THDA 1ZRCA 4QT6A 1UMHA 2RMU1 1DZQA 4AFBA 3WW1A 4YZ3A 2TBVA 4MUVA 2IVJA 3FE5A 1RUI2 2JICA 4Q4X2 5A7NA 1RUJ3 4XUQA 4AFMA 5CFCC 4D3WA 4WM8C 2E51A 2VQAA 4NIGA 4YM2A 1HN1A 1RUE2 1EV13 2HWE3 3MEPA 5FMOS 2X29A 1BVP1 2D3SA 1G9FA 3M3QA 1CIWA 2PHFA 4LBMA 1W8TA 1YWKA 3F2ZA 4PDWB 4XE9A 1ZRRA 3VBFB 3I3QA 3LIHA 3POSA 3C7EA 1JBCA 1OMIA 3IPVB 1O5UA 1HJGA 2A6ZA 2VO5A 3SH5A 4AVAA 2AUYA 2ZGPA 1W04A 3MO4A 2B42B 3WINE 2P6HA 4PIYA 3DEMA 3GXUA 4O61A 1XNDA 1WGPA 1ZBE2 4FPEA 3RGBA 2O0OA 3RJ2X 1VMFA 1KS5A 2A3YA 1X9TA 2ZTNA 4XAAA 4L97A 3RVHA 4IL7A 3NAPB 1CZSA 3T09A 3KVAA 1VBE2 1VMHA 5ABJC 1NLQA 2GC0A 1QDOA 2J1TA 1H4HA 1Q43A 1OI6A 2A1XA 3B9CA 3IDBB 3R0RA 4INDA 5FZMA 3T3YA 5A6ZA 1HRV3 2R6QA 2YGMA 4A3ZA 2W9XA 4WVVA 2DCKA 2H6CA 4JHTA 2B5HA 4NPLA 5T5OA 3LEMA 4FQZA 2WSVA 3EJKA 4JGYB 4KU8A 4QQPA 1RUG3 3SKVA 5ACA2 4AL9A 2XJSA 5IVCA 2ENRA 3OF1A 4AI3A 1JI6A 4OULA 3ELNA 3C7FA 4IW3A 2VNRA 4ZS2A 1UF2C 4D7YA 5C4WB 1D4M2 4IV3C 1XU1A 2A75A 3NV1A 4IETA 4P02B 1XE0A 4JGZC 3U10A 1JYVA 3LFIA 4LR4A 4LBQA 3CIHA 2VMDA 1CPMA 4XF1A 3PU8A 4Z1VA 5A33B 3HAGA 1WMDA 5C6CA 3H42B 1S0BA 2ZEXA 1C1LA 2OPWA 3VD4A 1RUI3 1OSGA 3KCXA 4Q4X3 1ZRDA 4WVWA 4S2DA 5K8SA 1NXD1 4OUMA 1RUE3 2BNMA 3M3OA 3K3OA 3J7NA 3WG2A 3BCWA 1AX0A 5LY2A 4LO7A 4NUBA 3HIFA 4I3GA 4KG0A 4LITA 4M3CF 2OXBA 1W2OA 2CDPA 3MUZ1 4QKFA 2EXKA 4O65A 4U36A 1OH3A 2VW1A 3JD72 1ZNPA 4NAOA 3P6BA 4OFGA 5KHIA 4E2GA 4Q8KA 1KDKA 2DCYA 4V2WA 4ZHNA 3MLLA 3VGIA 1SLAA 2ARCA 2YC2A 3T08A 1GWKA 3OOXA 2HLEA 3AP6A 4N90A 4GZ9A 3NV3A 4TYSA 4GALA 4YVSB 1H30A 4BCUA 5DMYA 2PAMA 2QJVA 1J84A 1RUOA 4XVHA 3ZIXA 4A6SA 4YPJA 4FFGA 1YO8A 1FOD1 4GWIA 2R041 1GWLA 5D21A 2ZJCA 5FBJA 3RG0A 2JIJA 5HV4A 1M4WA 4JGYC 1CR7A 3KZ4C 1DU3D 3ZMNA 3V64A 2VZVA 5ACA3 1HJFA 2YU2A 3PJYA 5C4WC 1XYNA 4OUSA 4A41A 3WP3A 2Z2SB 4ATFA 3NNFA 1H2KA 4Q4Y1 1AYN2 2E7TA 1FV3A 1XNCA 4MX3A 2VULA 4UOJA 5FPUA 3AXEA 2A7AA 2ZX3A 5FO7B 3R4DB 4NOTA 1MVQA 2OQ6A 1C57A 2H0BA 1GOHA 1X9PA 2VE1A 4L2NA 3POIA 3WLUA 4DUWA 5A6XA 1NQJA 2C4XA 2RDQA 5ANNA 1QEXA 3K75B 2RR11 3HQUA 4DB5A 3PJQA 4L0PA 1LGBA 4OI2A 3ZFGA 4Q1PA 5A7WB 3WHTA 4XUOA 4DXTA 2ID4A 1JUIA 4LO4B 4OCTA 3KCCA 3WHUA 3TYJA 5IHRA 2ZS6B 2DVDA 5FLJA 3D6EA 1Q56A 2WNVA 1XOYA 3JD73 5A6QA 3I49A 2IXCA 3MIDA 2C9AA 1U5XA 2JE7A 1CJDA 2VOXA 3V0AB 4NRPA 2X10A 4D69A 2EXIA 1SEFA 1CAUB 1ZZ8A 5JUVA 5CG9A 4EWEA 1NCRB 2AZ5A 3P3PA 3UKNA 1EUUA 2XMLA 1BMV1 4LA2A 4NMIA 2ZHNA 2JE8A 5FLHA 1VAVA 1WD4A 2VZTA 1QQP1 1S55A 1BVVA 3QCWA 2JX9A 3H9AA 3N7JA 1FNZA 2W5FA 3ZSMA 2PQSA 1ODNA 3I2JA 2GC1A 5BNOB 4XBLA 4YLZA 1JZ6A 3BKZA 4XF0A 5LBEA 3RNSA 4LK7A 3UK9A 1QOOA 3ECQA 2J22A 2ZGLA 5DDJ1 3SEEA 1AYN3 4M4RA 1US2A 2PLV3 1W6MA 1HQWA 2VPVA 3H7JA 5J36A 2AENA 4YWAA 4NN0A 5JXJA 5A7QA 5D8AA 1FI2A 1JTZX 1LOEA 2G9FA 3WZ1A 1EAH1 5JMCA 1D0HA 4Q4Y2 1ND3C 3KWVA 5APAA 2ZABA 5JI7A 2VZSA 2VMEA 3ZX7A 2BYVE 4K3UA 3GBWA 3RSJA 3IM0A 1BQPA 4IQPA 4COWA 1EPWA 2XQRA 4H55A 1C5IA 2VL4A 1HV1A 2R0FA 4HVRA 5IAVA 4LLFA 3VBOA 1UCXA 1RTVA 2UYAA 5FPLA 1JN2P 3N35A 1GP6A 3OD4A 4QDQA 2RR12 3F95A 3O1RA 4UBGA 1ODMA 5A1FA 5A3LA 4BXFA 2Q1MA 5DUVA 1RUH1 4GULA 1UWWA 1NCRC 2YPJA 2I74A 2EICA 2K2SA 4W6YA 1QJEA 1UOGA 2XHKA 4NRMA 4QX0A 1LCLA 4RR3A 1X8MA 3WQ1A 2G19A 4QPWA 1SLBA 1QOTA 4KNCA 1IS3A 1G8WA 2ZCWA 3ROUA 1CN1A 4LORA 4E4ZA 1ENSA 5JPNB 4FOYA 2R30A 2UY9A 1QOSA 1OLRA 2P17A 2ARAA 4ZS3A 3CQOA 2EALA 2VMIA 1DBNA 1I3HA 5FZIA 1QQP2 1RMU1 3IB3A 3U14A 5EP9A 5LK5A 2XKOA 5LBCA 3H1MA 4NHKA 5ISLA 2HYKA 1SCRA 1UU4A 4FOVA 1OFSA 2JDUA 3VL9A 2SBAA 3CBNA 1L7RA 3JZVA 2ILMA 3NV4A 5F2SA 3HQRA 1Q8VA 4WZCA 2D6OX 4IEPA 4XQ4A 3A22A 4FPKA 3AKQA 2Y38A 3ZYBA 1OD5A 2PHXA 5JLVA 3W5MA 4FTEA 4OI0A 1OLMA 5DDJ2 4Q4Y3 3ZPYA 1KFXL 3B3QE 5E8AA 4YYOA 4LBQB 3RMYA 4URAA 2YZ4A 2HWF2 2ZBJA 4OHXA 3VBHA 4P9LA 1WLCA 2YROA 3SCFA 1J59A 1EAH2 4QX8A 4AEDA 4AK3A 5GZFA 2RR13 1Q5OA 2VZPA 3SNMA 1LOBA 4XMIA 2H6BA 2X05A 1LU2A 1QWRA 2R1BA 5FP3A 3VDCA 1O3SA 2V4VA 4QD2A 3JB4C 1S0EA 3JXSA 1YHFA 3I3EA 3VKMA 1VALA 1DQ1A 2K9ZA 4Q0PA 5IATA 4ES9A 1LRHA 1IPKA 3C7HA 3DKWA 3LKJA 3U0ZA 3D8CA 4R9BA 3ZYFA 2VMFA 1A6CA 4QMAA 3VKOA 3LSEA 1G6NA 1NZCA 4OLLA 1NZIA 4Q0QA 1PO11 3ZIWA 1UZ0A 4QB1A 4XILA 1Z0HA 4AF9A 3E97A 1GKBA 5FUIA 3OYWA 3JBG2 3KSCA 2RDNA 1AR61 5C7GA 3DUIA 1QQP3 4V2VA 3MW2A 3MFCA 2WO2A 1R64A 1UL9A 2ERFA 1UAIA 4MLOA 1FV2A 3HT1A 3IIAA 5E1RA 4YW2A 5FYTA 2GC2A 1S2KA 4HFSA 4AI1A 3WXPA 4DZGA 2DUPA 2Y6HA 1RUC1 3D0JA 5FPBA 2QQJA 3THCA 5IVFA 3ETQA 1X33A 4N8MA 5DDJ3 3L2YA 5GZGA 4CCEA 4Z92B 5I91A 3ILNA 2JG8A 2B45X 1UXZA 2HWF3 5DAQA 1SHWB 1MZ5A 3H50A 3TB0A 2HWB1 2W68A 4XF3A 2XVGA 4LHLA 2I07B 2E53A 1UZZA 4AVSA 2D7FA 3AKSA 2VW2A 3ZFGB 1CPNA 2YV8A 3LOBA 3MV01 5EPAA 1K42A 2QQMA 2Y6FA 3DYMA 2K0GA 1REDA 4BDVB 3H3UA 4QHBA 5DG1A 2ZX1A 1R092 2WNVB 2E33A 5IUQA 4CDQA 1Q8PA 1AUYA 3S30A 5KHKA 2X53S 5GLVA 4YARA 3AJZA 3O0VA 5JAXA 1YFXA 3AYCA 1W2TA 1IG3A 4RSUA 4Y24A 1NX9A 4BE3A 2ARBA 5GM0A 2VOVA 3M2MA 2PHLA 5F3GA 1KXGA 2DBIA 2XVLA 1U5ZA 2ZGUA 2A70A 2XONA 2FDKA 1MS8A 3J4UH 1S1AA 5EXOA 2XLAA 3MPBA 1J3PA 4Y5Z0 5T5LA 5F37A 4XDPA 2CU5A 3AB0A 1WW7A 3Q8BA 2WLQA 1KJLA 5K9YA 2ZGQA 5FOJB 2PHUA 3JBG3 1OFNA 2VOWA 5FZ4A 1F5JA 2JDYA 4F3JA 3TOJA 2CL2A 1VB4A 4I02A 2ZEZA 2ZZJA 4XIOA 5FCCA 4CCNA 1LR5A 5CISA 1NE6A 5FZBA 3WG3A 2GN3A 1PO12 4X8PA 3W9AA 4ZKTB 1LOGA 3CJIA 3M3IA 4HK9A 4OZXA 1OQDA 3VZLA 3PUIA 2BNNA 1W6MB 1AR62 2WA3A 4XF4A 1W0OA 2XQXA 2Q8CA 4IEYA 4A6OA 5KXDA 1H0BA 4UFLA 1QNYA 4UW6A 5D8AB 2FCUA 2VW0A 4CEYA 1LOAA 1TME2 1UD1A 1AR92 3NVCA 4J6GA 3BUCA 1OHFA 5C3RA 1RUC2 4FTBA 3VZKA 4FAHA 5T3NA 4KU7A 3ZFGC 3RYPA 3RZGA 1OF4A 4ZU4A 2C9KA 1Y9QA 4HK8A 1WMEA 5K0UA 4AR2A 1V00A 3MW4A 3D5OA 3DN7A 1I1EA 4JCKA 3VBOB 5FY1A 4PIZA 2HWB2 1ND2A 2V72A 2D3PA 3JQXA 4I01A 2PFWA 4XXPA 1GLHA 2DU1A 4JZRA 4XJ8A 2QBXA 5CKQA 1R093 5CAZA 3KT7A 1J83A 4OHVA 2DTYA 4Y4RA 5J7MA 2QQUA 3FMGA 2VQUA 4FPFA 3KQ4B 2D43A 5IVYA 1XNBA 2BU9A 4RYDA 2HYXA 4OQ8A 1GWMA 3S7IA 4RR3B 1X82A 5F32A 4CXYA 1W99A 5DUXA 3WVJA 3DPRC 2ZEWA 4O7XA 5JDBA 1PIV1 5KBFA 3H1WA 4EJRA 1UNBA 5FZKA 5FZ8A 1URXA 4NWWA 1WCUA 4K40A 1GQGA 4NHXA 4KWUA 1QXPA 5FK7A 3WDVA 1Y3TA 4Z2WA 1AJOA 2ADEA 1IGOA 3FL7A 3KF3A 1GICA 4BK4A 3JQWA 3ZFEC 3PURA 1O4TA 1PO13 2BFUL 3ITQA 3KV9A 4FVVA 1X36A 1NLRA 1QJU1 3UKVA 3VBSA 1N3PA 1AR63 1K5MC 3D82A 5FY8A 1MQTA 3LFMA 5FY7A 5C8WA 1QXRA 5AFBA 2FMYA 4YZ1A 5D8AC 1JH5A 3PTRB 3GNEA 5FZFA 4BLIA 3IDCB 1UU6A 2WT1A 3CDZB 4QKBA 2PHTA 1IKPA 1N3OA 1TME3 4RS5C 4KG8A 1AR93 1PK6A 1QJY2 2OKXA 1RUC3 4GIQA 3SCHA 5F6KA 2PHDA 4A7ZA 2BFUS 3VD5A 2A73B 3FC0A 2RS51 4PT6A 3VBHB 4AQTA 5C70A 5J96B 4LJHA 5F5CA 5J3UA 3VBOC 3BPZA 3NSTA 4G3YC 2RM21 2XUMA 5J37A 4C0BA 5FY0A 4AEDB 1Y9GA 2HWB3 2JENA 3K4ZA 2BOIA 3VV1A 1W8HA 1OKOA 3T30A 1IKQA 2D5HA 5A1LA 5KHGA 2WNUA 2VECA 4Y5TA 3WG1A 4BQXA 3ZSJA 4CZSA 3AZZA 4UBHA 5GJ6A 4BOWA 3MHZA 1PVC1 1TVGA 3C3VA 1W3XA 4RR3C 3HNMA 4FFIA 3OBZA 5DABA 5HCAA 1LEMA 5FYVA 5GLTA 2HBUA 3LDRA 1GUIA 4Y33A 1QDCA 1H8TC 2QZ3A 1G9DA 1POQA 1LGCA 1XNTA 1N1TA 1YNAA 1HB4A 4Y1VA 5B2GB 2HWE1 3DYPA 3AL5A 4Y22A 2CGOA 5FP4A 2SLIA 2RS31 4DUXA 5H9RA 4BMBA 2RG4A 3B00A 3E5UA 2XGXA 2YMZA 1WA6X 5FYSA 2EIGA 1A3KA 2GH8A 3OYWB 5FWJA 5GZCA 5FUPA 3RZKA 3LOIA 3T4HB 1PIV2 2RV9A 1F9KA 5JSRA 5DAPA 5TSWA 3K3NA 1DGLA 3ACLA 5FRAA 1XRUA 5JVVA 3ZSEA 1JZ3A 1G86A 4PLOA 1S0CA 4TTGA 2AEZA 3H3LA 4KH9A 2BEOA 2E9QA 4IEOA 3WCSA 4ZY9A 1Q8OA 2FCVA 2Y0OA 2GNDA 5LBBA 1RYYA 3QD6A 4JTOA 4Q4W1 3DGTA 4HT1T 1VBB3 3DXTA 4QXCA 4EN9B 4EWDA 4D94A 2WAOA 1QJY3 1G9BA 5FYBA 1RB8G 2IFRA 3SMHA 1HRV1 3VBHC 2JG8B 5LK7B 4IEQA 4S2GA 5C3QA 2BGPA 4RHV3 3QLQA 4YZ5A 4QQOA 4JV4A 4XAEA 4AEDC 1NA1C 2XWJB 5JOXA 3HMYA 1RUG1 1OD3A 5C71A 1ULEA 1MZ6A 1FX5A 1KEXA 1ZZBA 2AH2A 4RL7A 4UFJA 5FMBA 3RRDA 3TEYA 1KRIA 2FHRA 4U2AA 5H9SA 3A0NA 2G1MA 1QJFA 3MW3A 3NO8A 3I2HA 1UMZA 1YJKA 2JEMA 3NKGA 1TG7A 1RXGA 3I3DA 4MH0E 5L19A 1KFUL 3MIGA 1CAWA 1UKRA 2RM22 3QACA 3POGA 4GKXA 4CDQB 3VDAA 2PYTA 2IZWA 4W6XA 5LCWL 4Q0SA 3Q9OA 1NE4A 3QH7A 2IXHA 4UI9L 4XJWA 1WCQA 3HJRA 1WLTA 3WF1A 1DF0A 2C24A 4BXSV 5IVEA 1CJPA 2A5ZA 2WN2A 4CU6A 2FZ2A 2DFBA 1TEIA 1W0PA 4BYYA 4JQRA 5EJ3A 3FZ3A 1GV9A 1PIV3 4CPBD 5C5TA 3HQXA 1DZRA 2PXJA 4RGKA 4X8NA 5C8CA 3WDTA 4QX5A 4HONA 4ARYA 1Q8QA 2RS32 1NXMA 5IK7A 5IVJA 2LALA 3RZZA 2C5DA 3CJIB 2P4EA 1V6LA 3HNBM 2JECA 1C4RA 2YBKA 3K2OA 4KL1A 3AZYA 5HCFA 2VD7A 4OI1A 4HVQA 1NT0A 3NNGA 2VNGA 3KMHA 3B93A 4BM8A 4CEWA 1SACA 1Y9MA 1XYOA 4GWMA 2OQ7A 1JODA 5FZ9A 1E5RA 3E1F1 4FAGA 5JIAA 4CEYB 1I6XA 4CP9A 2QQIA 1SDWA 3W59A 5L7OA 3V65A 2QQNA 1XSQA 4N9IA 3ZYPA 4Q4W2 4BMEA 3P1IA 2WAAA 4NIHA 5FZCA 4BQ1A 1OA3A 4KWKA 1BBT2 2P3KA 3ZOIA 2MHFA 2XJTA 4Z2AA 3LIGA 5K0UB 4M3CA 2X5IC 2DBNA 5A32A 2ORZA 3C7GA 1D4VB 1ND2B 5E16A 3IMMA 4IV1A 1KDMA 4CDXC 4CDQC 4I2OA 2RM23 2ZX4A 2YUEA 3FLRA 2KM2A 1RUG2 5FZ7A 3AYDA 3ZYGA 1UY1A 2XOMA 2Y33A 5F8PA 4OQ9A 1OBNA 4BLJA 2CY6A 1W2NA 4PLNA 2VNVA 5DAWA 3ZN4A 1YI9A 3O12A 3HNYM 5LEKA 2HWC1 2XLGA 5FYMA 5BV6A 2GNMA 4FP3A 4YG0A 3K4DA 4ZPIA 4LEJA 3KVBA 1POV0 3RJRA 3HVDA 2ZPXA 4MGTA 3W5NA 5DAVA 4LUMA 4AVCA 3JD71 3G6JB 4MXVA 4F8AA 1UY0A 3ZXDA 4LK6A 4L92A 3CJIC 2RS33 1WLWA 1R081 3ZFFB 1GOGA 3WW4A 4DEQA 4EWAA 3IMNA 3VBSB 1ZA7A 2XWBB 3MFAA 3IAPA 5FXVA 1MQTB 4JKLA 2VZOA 4GXLA 5FP9A 3T4VA 4DUVA 4PF5A 3O1VA 1WBLA 3MZHA 3BYWA 1A8DA 5FZ0A 2WA4A 3A21A 3AKRA 4IDZA 4XFAA 4XW3A 1O91A 1PK6B 1YQ6A 3TWIA 1F4AA 1ZZ9A 3VKLA 1S0DA 4QGNA 1H4GA 4RQPA 4Q4W3 4A7YA 5HXMA 5K0UC 3OJBA 2P6CA 1BBT3 3KM5A 2BWCA 2Q30A 1AYN1 3LCPA 5FZOA 2PLV1 1YCIA 2VM9A 1W2AX 3GALA 4XFCA 2WO7A 3QBQA 3D4KA 1VAMA 2WT2A 4IESA 1JYWA 1SQ4A 1IZ3A 2WNUB 2GP3A 4META 2QE3A 3AYEA 1ULFA 1BK1A 1F4HA 1E57A 3J7LA 5DAXA 3RS6A 3MDPA 1SLTA 4OYUA 2WINB 4AAPA 3I8TA 4X6QB 1FNYA 2VUCA 2YPDA 1OUSA 1QNWA 2VCMA 4QAWA 5KXCA 1ZRFA 1MS1A 2VC9A 1RUD1 1UQXA 2WS91 4EROA 4OVEA 1WW5A 1GNZA 2ZA9A 3WX5A 4Y22B 1B35A 4AQSA 2VUJA 2WZR2 3PL0A 1PM4A 2GALA 2HWC2 3VZMA 3MICA 1JMUB 3I2FA 1RXFA 4JKMA 4PDWC 3VBFC 3BGAA 2FD8A 4Y26A 1JU4A 3O1OA 2BNOA 1REFA 1OA4A 4AGGA 1CWPA 1SBEA 1MQTC 2VBBA 3FHAA 3BTZA 4FPJA 2RJKA 2W92A 2GDFA 3HPNA 5F7UA 4LXLA 5A7SA 1Z78A 2BDRA 4QX1A 3SLIA 3ORJA 4HKOA 4E27A 2ZGTA 4DEVA 1R082 4W4ZA 3NAPC 2WUHA 3SCGA 1EYBA 4ASKA 5JIUA 5GLWA 3C8XA 4TLGA 5FY9A 4RGGA 3OCPA 1ZA4A 2IXJA 3ZFFA 1YFWA 2W0XA 2YU1A 1MS3A 1Y43B 4MVTA 4AQ6A 1HQNA 2R071 4HLTA 3FLPA 4TXWA 2DVBA 5T5PA 4AGRA 2R061 4CCOA 4SBVA 3U78A 5DQ0A 2VUAA 2WNUC 1UXXX 2YFUA 2A6XA 3GZAA 3IBMA 5GALA 2J1AA 4OI4A 4JAAA 3VBRA 2CGPA 4EN0A 1WCSA 2MPFA 1QHDA 2FBEA 4N53A 4QPIA 3WNXA 2BVBA 3EXUA 1LU1A 1V6IA 1ZRIA 1CAWB 2W1SA 3NJZA 1OLQA 1WW4A 2PLV2 4YM1A 5EIYB 1BCXA 4GA9A 3WDXA 5FP8A 4P5YA 4FSJA 3ZXAC 1U5IA 3FBYA 3KT1A 2I45A 2FDHA 1GZTA 1O59A 3S57A 1W9TA 2XH6A 5BPXA 2DWRA 2WWJA 2Q8EA 1ZBA2 3ZSLA 2E31A 4PJYA 4BK5A 2NP0A 4QU1A 2PA7A 4AVBA 3PVNA 4DY5A 1PZ7A 3OGGA 1WWYA 3KLSA 2WZR3 5IK4A 1J3RA 2HWC3 4LTAA 2VH9A 5FUNA 1CAVA 4RN5A 4LHKA 1GQPA 5JZGA 3BIWE 1RUD2 2WS92 3IKWA 4XEZA 4COZA 1G7YA 2Y6KA 3PLQA 4I0BA 5C8CB 4GMP0 4IEXA 1W8NA 2ZEYA 4K9SA 3J8F2 4LBJA 1Z7S3 1RC6A 2JD4A 3C7OA 4FPCA 3UV9A 2V5DA 1F35A 2ZHMA 3OSDA 3U07A 2IWGB 3O0XA 2PAEA 5IVVA 1K5JA 1MS0A 2JDNA 1AF9A 3B7MA 1R083 2A71A 3ETPA 2FDFA 3WNLA 2DCZA 4YVSC 4CEWB 2B39A 5A3WA 4QB2A 4BIOA 3PIGA 2JJ6A 2P37A 5EYYA 2XG3A 2VJXA 4A44A 4KWJA 5F3IA 1OLME 4CP9B 1RUF3 3NNJA 5FIXA 1CX1A 4FPOB 5L7OB 4HVOA 1AXKA 1YEWA 2IC1A 3I2KA 3K77A 2UYBA 1U0AA 2DTWA 4HG6B 1CIYA 1Q3EA 1UIJA 1ENQA 4FXKB 1OA2A 1OOPA 4M3CB 1I5PA 4WBBA 3ES4A 1H1MA 5A32B 2QNKA 4AI9A 4ASLA 5KWRA 2YB7A 4IV1B 1NG0A 4J1WA 3M1HA 5T50A 2R072 4N7UA 2BWAA 5F6LB 4TZDA 2YXSA 1ZZ6A 5C3OA 4O9GA 3GBGA 5CNAA 2R062 3AZVA 4CRQA 2HWF1 5F3EA 4OMCA 1YQ2A 4HL0A 3T1MA 1KGYA 4CUBA 2EF6A 4YFWA 1UW8A 4XUPA 4YW1A 4B7KA 1ZBA3 4XCBA 4XBQA 3OGSA 2WQZC 3MIFA 3PVEA 2KD7A 4P5HA 3M70A 1PNFA 3WNMA 4NR1A 2D6PA 5C8CC 1RUD3 2WS93 2WZEA 5FZGA 1NUKA 3J8F3 3WR0A 4V1PA 3OPWA 5FZAA 3ASIA 4LBLA 3WF0A 1BK0A 4XTPA 1S4CA 3KHCA 3AFGA 2TNFA 2Y6LA 1S2EA 3UJOA 4CEWC 1EUTA 2W91A 4EQVA 4XFHA 3VBUA 1LULA 4Q0UA 3JBG1 2W52A 5L7OC 1S0IA 2FDGA 4I3PA 5FYUA 1OUXA 1PMHX 3OUJA 2DDUA 4RQPB 5BNOC 2HKXA 5FWEA 3BTYA 1RJ7A 4GQ7A 1CVNA 4MGYE 4AFCA 3KQRA 4H14A 3EMRA 3FX3A 4JDOA 1OPMA 4NHMA 1OURA 4XFFA 5BXXA 3KF5A 1V6JA 2HEYF 5FZOB 3RFRA 4JVAA 2B46X 3KCYA 2OYZA 1XXNA 1YQCA 2AREA 1AX1A 2W47A 1IOAA 5FZLA 4CCKA 3BPSA 2D6LX 5AVAA 3SC7X 2WNOA 4E4DX 2R073 3A0KA 4LBOA 5H9PA 2FDIA 2R063 2Q1FA 1HB3A 5IVBA 4FPLA 2CNAA 4R52A 1GFF2 4BIFA 3GDBA 2BP6A 2IFWA 2DCJA 5GKAC 1E5HA 1CZVA 1QJX1 2NZ9A 3CEWA 1WA4A 1GANA 1E5IA 1V0AA 2JKXA 2KXLA 3RWKX 3VZJA 1UU5A 3ZDSA 3M8LA 1B35B 5JWPA 4R4XA 4LMFA 2GN7A 3DYOA 4Y1YA 3ABZA 1R091 3CJXA 3WT3A 2QQKA 2PELA 3WF3A 5GZDA 4HANA 4DFSA 1OH4A 3ALQA 2GH2A 4LNVA 3GHMA 2WYFA 2VVDA 2BGCA 3AC0A 5LY1A 3QOPA 4Y20A 4K8FA 1W6NA 2XJVA 3ZR6A 3UJQA 4DQAA 4L99A 5EFUA 3USUA 3VLBB 1IPJA 1MACA 2QCSB 1RJ8A 4W65A 4RQPC 4LO5B 3BALA 5DXDA 1GU3A 1SBDA 2G9ZA 2RDRA 4ISRA 4YRDA 3TAYA 2GNTA 1VBC2 1VAKA 2C6SA 1FPN3 1KS4A 3RZJA 3GZEA 5FZ6A 1G9CA 1VJ2A 2GC3A 2Q5TA 5E89A 1PX3A 4CA9A 5IK8A 1X50A 2J1VA 4A3XA 4ZXEA 4OMDA 3VB9A 3I2GA 2YYOA 3N7MA 4LBNA 1DYPA 3VBRB 2VOKA 1TME1 3CL1A 3BOWA 2JDHA 1AR91 4N53B 4QPIB 4QX3A 4DXZA 4D0QA 4J25A 2ATFA 1GNYA 5DUUA 1W0NA 3AFKA 2Y0IA 1W28A 4AHXA 4E2SA 3FWEA 2B7YA 3AP7A 1SDDB 3AMMA 4GD4A 1LEDA 5E6HA 4AI2A 3VZNA 1K12A 1HV0A 1N3QA 2VY0A 5FR3A 1I9RA 5JSOA 2XDVA 4Q27A 1YFUA 4GAZA 4YW3A 1XNKA 5KC6A 4A4AA 2VZ1A 2GNBA 4YSFA 2VU9A 4QPGA 1QJX2 2ZGSA 1CAVB 3GZTB 3FLTA 2ZHLA 5JZGB 1DQ6A 1HIXA 3B9IA 4Y3OA 1YRZA 3I7DA 1HRI3 4YW4A 2XJPA 5M0TA 4LQRA 2JIGA 1L3JA 4Q8LA 3WQ7A 3VD3A 5BUVA 5KR7A 4XUTA 1MZEA 3HEIA 4LO8A 3OEAA 4JRAA 5FYIA 1LECA 4UFHA 5L9VA 3R4UA 3BB6A 1EPZA 3ZVXA 3T0BA 3I59A 2G4IA 4HZFA 1JHJA 1W3VA 1O6UA 2ARXA 5FFOC 5B4XA 5F3CA 5KHHA 4YW7A 4P08A 5FREA 3HWJA 2ZX2A 5JSPA 1VBC3 2B9UA 1AHSA 2P2KA 1PGW1 1L7LA 3MBWA 4NHLA 5I0DA 2VXRA 1PM7A 5AVPA 5BY5A 3EHKA 1VMJA 2R16A 1VB2A 1AXYA 3BTAA 1VBA3 1HLCA 3KT4A 1OOPB 1Q8SA 1YLLA 2OPKA 5HBAA 4QPIC 5A1AA 3UL2A 4ATEA 2D93A 1V6MA 1VBB1 3TN91 1GP4A 4XZUG 4EE2A 1QJY1 3WDWA 4Q5OA 1GZWA 1F2NA 3ZXLA 3OGJA 4RHV1 1P8JA 4BQ3A 5C3PA 1XPWA 2BOJA 2CYFA 3R05A 5LEJA 1DLCA 1WBFA 3ILRA 2ZACA 1ASJ2 3AP9A 3JUUA 2ZHKA 1NY71 2E6VA 5IAXA 5F1RA 1FT9A 2RDSA 4WM8A 1QJX3 3THPA 2MEV2 2VCBA 2GAUA 4CDUA 4M01A 4AVVA 4YM3A 2YBSA 1LHNA 3AZWA 4AEJA 1A8MA 3RI8A 2WNVC 4AVTA 3ZYJB 2FCTA 2GMPA 5GLUA 4EV0A 5C9AA 2XUEA 3HD8B 4AEMA 5D1IA 4C90A 1EY2A 2HJIA 2D98A 2F6BA 4G4FA 2RE9A 1WLDA 2WDBA 4KGGA 1PO22 2WQ8A 4IGPA 5F5IA 3VBUB 5ABJA 1RHI3 4CCMA 4CCDA 2CWSA 3BVCA 1D0GA 2JDZA 1BEV2 4PCRA 4Q4V1 4KBBA 2AEYA 1AX2A 1J58A 4YZ4A 1AL21 5G04L 5CEHA 2VTFA 1W8WA 3RPQA 4XJ9A 4CCLA 3AMNA 3POYA 2DF7A 5FJHA 4BQ4A 4K1ZA 3HBKA 4SLIA 2PQQA 3OB8A 4UFKA 4E2QA 4UWDA 2AACA 4IE6A 3PMEA 4CU9A 3MV11 1PGW2 3OG2A 4NJ4A 3LB9A 5EV7A 3VD9A 2W95A 2VQ0A 3TBDA 1WCDJ 4JGZA 3AM2A 5CYYA 2MNGA 4UFIA 3NNMA 4DNYA 4XJZA 1W8OA 1RUNA 1FATA 4IUGA 3D0SA 5I8TA 5CU1A 1PZ8A 1D7PM 1UPIA 4MZUA 3MPPG 5F2WA 4BZ4A 1VBB2 4IE7A 3TN92 1W8FA 1ASJ3 2LS6A 2QVSB 4P9IA 2WN3A 2VVFA 2WIIB 4FPYA 2Z79A 1W9SA 3GYDA 4ZZ8A 4MG2A 2J1EA 2DVGA 1GOFA 4RHV2 3K51A 2LW8A 2MEV3 5LZ6A 2ZGOA 5EZWA 4RFT0 5A6YA 5IK5A 3FFZA 4IXLA 2VMCA 2D97A 1UYPA 5J98B 1NY72 2PN5A 3BODA 3INAA 2KA3A 2XJRA 5EWSA 3T2OA 5JI9A 2W08A 5FAXA 5IFPA 4IE5A 1V6OA 2CTVA 4XZPA 2UURA 5FMDA 3ES1A 2EA7A 3AYAA 4XETA 3HT2A 3T1LA 4BU2A 4YZ2A 1PHMA 3K46A 4XXAA 3UGFA 3VBUC 3AXDA 1PO23 2YFZA 2BERA 2VTXJ 4QQHA 1GZ9A 4QM8A 4Y20B 4CDWA 4AG4A 1W6NB 2R7EB 4Y4YA 3VKNA 3ZN5A 1XB9A 2P5BA 3USUB 1VIWB 1BEV3 1C8M1 3AJYA 2WL1A 3LEKA 1QH7A 4GJYA 4H7MA 4GB32 4CU8A 2P3YA 5LATA 1DIWA 2QKDA 1DG6A 3N9PA 1UZWA 3H8UA 3N7LA 3LPGA 4K20A 4L8QA 4G9SB 3SEPA 1A34A 2OUHA 4HKWA 3RQ0A 1X8EA 4LA3A 4K6BA 4EZ4A 3GZUC 4Q4V2 2XR4A 4JQTA 2JDMA 3KV4A 4BQ2A 1CZTA 1QMJA 2CHHA 2JB8A 2P3IA 4XHXA 1LHVA 3OBRA 1AL22 1W6OA 4M3CE 4ES8A 3U75A 2EAKA 2OW4A 3PDQA 2F4LA 1LOCA 2XKPA 5K4LA 4OUEA 3LGRA 1DQ5A 4Q29A 2E7QA 3TN93 2GMEA 5FYCA 2R1DA 4XDQA 5FYYA 5LB6A 1E5SA 1LB2A 5F5AA 1BBT1 3AX4A 2W3JA 2IXIA 3KS7A 4N43A 3ZPOA 3N3HA 4YM0A 1IQDC 1AJKA 1LHOA 4CPBA 4XUNA 3VZOA 3WNOA 2HWD1 5KXEA 1YIFA 1PVXA 1QXJA 5HI0A 1W9WA 4QPGB 2Y60A 2BRTA 2Y8KA 5L36A 1LESA 1WZXA 1V9U3 4R8HA 1CQ9A 4AAXA 1F5FA 1FMD2 4QKDA 4JDMA 3O1UA 4NWVA 3E6DA 4Q26A 4BJ0A 1ULPA 1B09A 1XJAA 2D5FA 2VZ3A 3VL8A 4QB6A 1AR72 4Z82A 2NYYA 3VDBA 3SH3A 2LUWA 4IE0A 4P9JA 1ENRA 2VZRA 1VRBA 1RVF2 1HKDA 2CAVA 4M4PA 1GQHA 4GB33 4B3NA 3I59B 3I3MA 2UWAA 2P3JA 3LA3A 1LAJA 3GCWA 3AP4A 4HN0A 1LJ7A 2QDNA 2EAAA 5G05L 2OZJA 2W1QA 4YGBA 1J3QA 1ZYBA 5FBZA 3USSA 4ONUA 4NIDA 1APNA 1C8M2 1O8SA 1ULGA 4Q4V3 3WNNA 2XJUA 3Q8EA 5L9BA 4BB3A 4H7LA 1AL23 4CP2A 1RL3A 4ET7A 2RHPA 4MGSA 3MYXA 5FV3A 3PVOA 4PLMA 3EQEA 1KQRA 1OC1A 3LWCA 2H0VA 3MUY1 4XBNA 5B4NA 5CKNA 3LA2A 4CCJA 1QU0A 3ZO0B 1D2SA 1OKQA 1QF3A 4L9BA 3ZKUA 1GZWB 4B1MA 1DYKA 3I97A 1ND3A 4AHYA 3N4MA 2JG8C 3S7EA 2JD9A 4IERA 5FMCA 1W03A 3ZMOA 4NPMA 4K21A 4QGMA 1ZX5A 2BQPA 2DYCA 1RIRA 3I54A 1O4YA 3J7HA 4MGZE 4QGLA 2JDAA 2Y26A 4WM8B 4NIIA 2Q8OA 3ZYRA 1TMF1 2ZGMA 1ZVFA 4NIAA 3WQ0A 1JXNA 4CDUB 1YIPA 2CSGA 4KGQA 3K48A 1FMD3 3M4FA 2L9LA 4KMQA 1V6KA 1UMIA 4WZFA 3E6BA 5CKMA 4DXRA 2HWD2 2ZGKA 3POJA 2IVIB 4Q2FA 1OT5A 3EO6A 3URFA 5C9AB 1HXS2 5J09A 2QZ2A 1AR73 3T0AA 1BXHA 4COVA 2LM3A 1ULCA 4FFHA 5FZ3A 4CTEA 4BQYA 4D6QA 1LHWA 5HV0A 1RVF3 1COV1 2WZR1 4WVMA 5ABJB 2Z4FA 5BYNA 1AR83 2IXKA 3VUOA 2OT7A 1W39A 4B4PA 1QIQA 2RVAA 3B5LB 2VNOA 3UGHA 1JZ7A 1RINA 2OUJA 1C8M3 1H9PA 4GWJA 1Z7S1 1RGSA 3BU7A 1GMMA 5I8YA 2WRAA 4X6RB 5JCTA 1QY4A 3OGRA 2GMMA 5FYHA 1LHUA 2B8MA 4XDOA 1MR5A 2WQ4A 5FYZA 4LE3A 5AC92 2YY1A 1ULDA 1DQ2A 1H1AA 2P34A 1PGSA 1F15A 1GNHA 4KI5M 1ENXA 4BQWA 2BJSA 4XCAA 3OGVA 1SG3A 1T2XA 1AVBA 1Y4WA 4JGZB 1RUF1 3BI3A 4CEYC 3ACHA 3POFA 2Q4SA 3AL6A 2IXLA 2VGDA 3UT0A 4MGQA 3CO2A 2ZMLA 3ZXJA 4MV2A 1SFNA 4CDUC 4A45A 3LZZA 1J1TA 1MS9A 3RDIA 3H8RA 1ND2C 4LBKA 5BNNA 4QWNA 1HW5A 5A3PA 1R1A3 1BZWA 4DINB 5IWFA 4C8DA 1W05A 4AWDA 4OHZA 5FTTC 3VHRA 4E8CA 5C9AC 3W21A 2HWD3 1DCSA 3POEA 3PVBB 5LA9A 4E9KA 3ZYHA 3TEZA 1HXS3 1TMF2 1TNFA 4LIUA 2CGNA 4EN8B 2WWSA 3OUHA 1ZBA1 4XTMA 3O14A 2CV6A 4CDWB 2B4KA 4E4HA 3RZHA 3K4AA 3NJYA 1DQ4A 1MS4A 2W94A 2ZKLA 1O3RA 3WDYA 3B01A 4YFZA 1BYHA 1VBD1 1AYM3 5LWBA 3J8F1 3GJBA 3NW4A 2O8QA 1COV2 2FDJA 3BOPA 4QX2A 2J7MA 4KQ7A 4QQLA 2O14A 5KHJA 3KGZA 2PTMA 4DRRA 1N1YA 3U11A 5AC93 3VBSC 2FQPA 2VCCA 5BNQA 4MGIE 4XMAA 1W6OB 1Z7S2 3UETA 3QH6A 2J1UA 4PHZA 3NRUA 1SFPA 5I93A 2E63A 1G9AA 2GP5A 3MF6A 4LO6B 3RZLA 1REEA 5JR2A 3ZM8A 3T2PA 1JYXA 1PK6C 3AMHA 1H8VA 4LOTA 4WVZA 4ZZ5A 4COUA 2VZUA 1XE8A 4YW5A 2NLRA 3O5SA 3GBFA 4RD7A 5L9RA 4Q0VA 4FT8A 4N43B 1T6BX 1ONAA 2RMU2 3FFQA 1RUF2 1XBFA 4QU2A 4XHBA 1WMXA 1UKGA 4GMP1 1POV3 4RFRB 1KJRA 5FKCA 2XJQA 1ZZCA 4B8EA 3CZJA 1O8PA 4QHZA 2V09A 4AHZA 1IPSA 5ANQA 5FZHA 3NMBA 3AP5A 3NQHA 4I09A 5LA1A 2G9GA 5SV8A 4P9WA 2XB6C 1UIKA 1TMF3 5T55A 4XJAA 3UNPA 1MVEA 5I8SA 1ZBE3 4EN6B 1SLCA 4XABA 3Q8CA 3PMSA 5FO9B 1RITA 5HCHA 2JDPA 1QJZA 3LA7A 1VBE3 4UT5A 4BA6A 4CDWC 3ACFA 1C3HA 1YC61 2VTXA 4JC1A 1YUDA 2EXHA 1XQNA 1H6YA 4LOSA 2RS11 4I0WB 4LBQD 4QDRA 5HXVA 1BLZA 4EYUA 4XFGA 1C28A 1PMJX 2N7GA 4MHUA 1WD3A 1BJQA 4QHOA 2WLPA 2XVKA 4AZZA 4FBFA 2YDEA 2BW8A 2WJSA 1COV3 1DHKB 2JWPA 2PAKA 2WFF1 3EBRA 1V6NA 3GJAA 4Q1RA 1L7QA 4D8MA 4IEUA 2ET7A 2WR9A 2ETEA 4XQWA 4AYUA 2D6MA 3CU7A 4TN7A 4MSVA 3WEZA 1JZ4A 4LKSA 1D4M3 3L2HA 1VBD2 3KGLA 1WMFA 4FO9A 4XC9A 1FXZA 5BNPA 2DCTA 1UZVA 1OQEA 3SH4A 4M00A 2PMWB 2WZ8A 3NNLA 1IS4A 2BBAA 2WO3A 4NRQA 2V4AA 1UOBA 1HX6A 4FPHA 2Z42A 3KD4A 4S2FA 1ND3B 2JB4A 4WV8A 5FQ0A 2VR4A 4MADA 1FPN1 5FY5A 4N43C 3WOGA 4QXKA 3ZR5A 5IYYA 5KXBA 3JCIA 3WCRA 4F83A 2RMU3 4LLOA 1U12A 2BVVA 2NQYA 2WFPA 1WW6A 3OY8A 3WUCA 3W20A 4R9DA 2QFEA 3AKTA 3LDBA 4OHYA 4ISQA 1OPOA 3BTXA 1CX4A 3O7OA 4DIQA 1MPXA 4XFIA 4YGEA 3UESA 1JOBA 1W8UA 4A2UA 2ADDA 3UGGA 1HB2A 1Y7BA 3PHMA 3G7DA 1NLSA 3OTFA 2ZKNA 3AMQA 4D7SA 5FPAA 3O0WA 2HBTA 3VD7A 3ZYIB 3DPRA 3DXUA 4WVMB 3ZXEA 4IEVA 4UW5A 3T2QA 3AK0A 1PX4A 5I0TA 2D6KA 2Y34A 4GH4A 3CLPA 4ORFA 2WYSA 1UO9A 3R4SA 4Y1XA 4DOUA 1LOFA 2Z5WA 3B02A 3LQCA 1H1IA 2RS12 1HRI1 5F39A 2ET1A 3ZFEA 2JG9A 1YFYA 4I30A 1FOD2 1SFYA 2R042 3U4XA 4JTNA 1VBD3 2VBPA 5FJKA 1H2LA 1K5MA 2WFF2 3DCQA 3AMPA 2ZMKA 3VDDA 1WUVA 1LGNA 1UY4A 1H2MA 5C3SA 2OX0A 2DU0A 4J1XA 1AXZA 4M0NA 4RS5A 5A7OA 3OBAA 4AGVA 1W9FA 4LE4A 1UYXA 2A6YA 2UWCA 5CFDA 1R1ZA 4AEKA 1VBC1 1SCSA 2GZWA 4UF0A 5FDBA 2QDRA 5FXWA 5FZ1A 3A7QA 3FBMA 3KV5A 3FJSA 4UFMA 2AR6A 3ZXGA 1JHNA 4QXHA 1YJLA 3S5AA 1VBA1 4RA0A 1DQ0A 1C8NA 4MO3M 1GSLA 1NCQA 2JE9A 2WKKA 4A7KA 3Q8AA 1FPN2 1X7NA 1YQ5A 4HPKA 3O1MA 1N47A 5FLIA 2OIIA 1K45A 1UOFA 5BNNB 4ARXA 4IV1C 1W06A 3WSOA 2CAUA 4GMP3 4W8JA 2YHJA 2WSUA 1SLLA 2BGOA 3NJXA 3SXWA 4HXCA 3ZN6A 5J48A 3LPFA 3HBZA 2ZGNA 2WNEA 2VAUA 3N36A 4ITCA 3VHNA 3J7MA 1MS5A 1UN1A 1S0GA 1FAYA 5CZKA 1K3IA 3RWNA 1W90A 5KC5A 1H8TA 1PGL1 3TEWA 1H6XA 2VQTA 3NJVA 3NV2A 5A7PA 3AZXA 1TE1B 3O1SA 2PHWA 1PMIA 4LPLA 1SZBA 1JYNA 3OD0A 3IN9A 4HKLA 3DV8A 1BMV2 1LODA 4HSLA 4YGCA 1UX7A 2DUQA 4K1YA 4PIXA 2RS13 1DGWX 3EYPA 4QDSA 3WD5A 4P14A 1OXCA 3HN1A 1FOD3 5I0UA 2R043 2B9VA 4C1WA 4IGQA 2A3WA 3ACGA 1BKZA 3MIHA 3WG4A 4OHWA 2WFF3 5IT6A 5JOWA 1NOVA 3POWA 1JW6A 1WKYA 4TLFA 3T0DA 2BBVA 2ORXA 1N1SA 1HRI2 2GSYA 3PIJA 5IJRA 4Z8BA 3ME2A 3SHRA 3RI9A 1RHI1 4YW6A 4NPRA 2F17A 4CE8A 4QPYA 1F8VA 3I2IA 4XF9A 4IGOA 4YG6A 1JZ8A 4C0HA 3GHNA 3FHIB 5IFTA 4GWNA 2UY8A 3APBA 3M7AA 1JOPA 4FP2A 1FYUA 2WT0A 3J9SA 2BV4A 2OZ6A 1XNAA 1OVPA 2AYHA 2ES3A 4XPVA 4JKKA 1NA1A 2VBDA 1DYOA 3DKQA 4WM7A 4AOCA 4JX0A 4NO4A 4PBOA 2NMNA 1SMVA 4HSJA 5FZEA 3VHOA 5BNNC 3OUIA 2EVXA 4UXAA 5A70A 4COYA 3I4IA 2WO1A 1VBA2 2YC0A 3IT8A 2C26A 5FKBA 3BIEA 2CDOA 3ZSKA 3W58A 4BISA 1DDLA 2ZGRA 4C91A 3ENRA 1ASJ1 3U37A 4AI0A 3WY6A 3V0BA 4FCAA 2FMDA 3LEGA 1RUH2 1W6QA 2XL7A 2D3RA 4PQ9A 4FOQA 3TNPB 2MEV1 4BH9A 3NKTA 3WDUA 1XSRA 2WC2A 3ACIA 4CXXA 4XQDA 1B35C 2R32A 2WWUA 1PGL2 2DFCA 4AFAA 3V56A 4NHYA 2QQWA 5EQUA 1GP5A 3WF4A 2JDKA 1MZFA 1DGRN 2RJLA 1PO21 1HDKA 2HH9A 1NYWA 4KBZA 1JYIA 1RMU2 5A3NA 3HR9A 5BNPB 3P3NA 4FTSA 3CKHA 5JXHA 2Q8DA 4BWOA 1BEV1 5J1XA 1IQAA 3WP5A 5DN2A 4AXOA 1SPPA 3TNQA 1JYCA 4PI2A 2WABA 3ZKYA 5I0RA 1AZDA 4YVWA 1ZZ7A 4HBNA 3T2TA 1EAH3 1O5LA 2J1RA 3FUOA 4QM9A 5FQ0B 1RHI2 3X29B 1LTEA 3ZFFC 5I0SA 1XU2A 1ZM1A 3PTYA 2NM1A 3P5BA 3I2DA 1GR3A 3LEIA 5L73A 4DXSA 4LKEA 4B7EA 4R9CA 5IW0A 3S5QA 2X5IA 3OY8B 4FPGA 1JZ2A 1GYKA 4L11A 1GBGA 1T6GC 3MIEA 4I0AA 3WP6A 4RGAA 1F31A 3VBRC 4CDXA 2VUDA 5DZGA 2VMHA 4LIVA 4N53C 2DVAA 3I3BA 3KV6A 2AC1A 4K8RB 1ULOA 3AVRA 4W50A 3O1PA 3KHBA 1BHGA 1QKQA 5JMOA 4YG3A 3NWKA 5A3UA 1RUH3 1YQ8A 3Q8FA 1YXWA 4LT5A 2W39A 1US3A 2I2SA 2QQVA 2DURA 3JB8A 4C1XA 5T54A 2OS2A 4QX7A 3DL3A 3DPRB 4UW3A 3IDEA 3RMXA 5LW9A 1VRH1 2E26A 2Y6JA 2ZMNA 3E5XA 3GCXA 5GZEA 4GH4B 5JPMB 5CFCA 5DG2A 5FXXA 3WP4A 1V9U1 4AHWA 4XJUA 3JU9A 1JZ5A 4Y1ZA 4JDNA 5JZGC 5C33A 3GF6A 3O1TA 2XL9A 4PI0A 1CAXA 2BZDA 1O7FA 2JG9B 3ZFEB 4MXWA 1W8ZA 3THTA 4DY3A 1ZREA 5BNPC 3PUSA 2VVEA 1RMU3 1ST8A 1K5MB 3TEXA 4YGDA 5JOZA 3DF0A 1H2NA 3VDDB 4H3WA 4GB31 5JXGA 4QKNA 3WNPA 2HEVF 1S0FA 2E7AA 4RS5B 3N9OA 4B4RA 3FHQA 1IG0A 3MF9A 3ZLIA 5CFDB 4CP0A 3B69A 4UF0B 1OVSA 5LA2A 5FZDA 1CD3G 4P9XA 3H8XA 1HQLA 5CG8A 3H1YA 1UZYA 4ZONA 4AFDA 2Q0AA 4XOGA 5T52A 2DVFA 2W87A 2XBO1 3ON7A 3ZDVA 2J1SA 4CUGA 3PU3A 1W6PA 3RYRA 1HB1A 1NCQB 2W1UA 1OOPC 4LHSA 4HPKB 1VE0A 5LRRA 3I2OA 3IWZA 2R0HA 4QQ2A 5FY4A 3E5QA 4MGKE 2EIDA 2F4PA 1TNRA 4DRVA 3H3ZA 3ST7A 5LA0A 3ZN6B 1CONA 5K7PA 4O9EA 2NPIA 3MLJA 5FPZA 4IV3A 3C2UA 1UYYA 2D6NA 5D2AA 1UYZA 4N7IA 5F5QA 5CA6A 3N7KA 1H8TB 5CVRA 5DPNA 4CUAA 1EP0A 1LNSA 2D40A 5JR7B 3WF2A 2BTVC 4GH4C 1DGWA 2QQOA 3UYJA 1VR3A 1O3QA 1N1VA 3WW3A 2W1WA 1LOFC 4DMIA 1JYTA 1JOJA 3GM8A 3HN3A 2EIEA 3EB7A 2KR2A 1FMD1 2JG9C 3BN6A 4IEZA 4PDWA 3VBFA 2IUWA 2ZAHA 4NVPA 1MEC1 5A3OA 1VPHA 3CHXA 4GKYA 4ZU5A 1VRH2 2Y64A 3ZXFA 1OQ1A 2TEPA 1M06G 1NAEA 1AR71 3IPVA 4D6SA 1O3TA 1H9WA 1XC6A 3LD8A 4HMZA 3VDDC 3A4UA 1V9U2 5EJZB 4JRLA 2QQPA 1RVF1 4R4ZA 3BU0A 4EZHA 4CUCA 1I5ZA 3A23A 3IAQA 3OBTA 5CFDC 4ASMB 1AR81 3NAPA 5LASA 2Y6GA 4D6RA 5FO8B 2CWMA 4LHNA 4NROA 5EJ1B 2LROA 3MLKA 5EYXA 4A42A 3M3EA 3CZUA 1DP0A 1V70A 4EN7B 2RJ2A 2GU9A 1W2UA 1NA1B 1NCQC 2FZ1A 4FFFA 4W6WA 4WM7B 5HPOA 4URTA 1STMA 4JGYA 5CB7A 2WBKA 1HN0A 1O4ZA 3AVSA 3B94A 4HOOA 4Z07A 1C5HA 3LF7A 4FXGB 5FOBB 3S0MA 5C4WA 3IZOA 2DUOA 2XBO2 4LUKA 4UW4A 3LSDA 3WW2A 5EHDA 1YI7A 1TZOA 1SLIA 2YG0A 2TUNA 2XLFA 2ZAAA 3PUQA 2Q1ZB 5A33A 4CU7A 1RUJ1 4BPZA 1XYPA 2X09A 4QXBA 1JUHA 5CBLA 3V0BB 3CF6E 2C0ZA 1S0JA 1EV11 4H2AA 3UKTA 1W6QB 5FPVA 5CIRA 1JU3A 4MOAA 3R6SA 3OPTA 1IS6A 5ERLA 3SKJE 1R1A1 2W2IA 3J26N 2WZPP 2BPA2 4OZOA 4D7TA 3KB5A 1KITA 2O1QA 2YBPA 1VRH3 3WV6A 3WQBA 1VP6A 1HXS1 5F9TA 2LTNA 1CGPA 3OPZA 1YYNA 4DS0A 1D2QA 2XXZA 3HOBA 5HCBA 5JOYA 2EIBA 1MEC2 2UWBA 2P1BA 3LE0A 3NL1A 1QJU2 2ZX0A 1JS9A 2DV9A 3MIBA 3H8OA 2UU8A 4YVSA 4FOWA 2O8OA 4DO0A 1CESA 2NN8A 4BHPA 1OF3A 4P9GA 1SPPB 2NMOA 5FPXA 1AYM1 1UY3A 4E8DA 3H7YA 3PUHA 5CADA 4YVWB 2VXJA 1VLNA 4LULA 3H0OA 4F7ZA 1XE7A 4NE9A 4PBPA 1GZCA 4WM7C 1AR82 2VMGA 3SITA 5C5UA 2XPJA 1IS5A 4NAMA 5FXZA 5AC91 2A6WA 3GGLA 4N9HA 5E88A 5H9QA 2RS52 5FP7A 2AGSA 4XACA 1AL0G 4B1LA 2V5YA 2X5IB 1DLLA 4FQ4A 4AQ2A 4S2HA 2VZQA 4M0HA 3VN4A 2X8KA 1A78A 2E32A 4CDXB 1UPSA 2XBO3 4CVUA 3LAGA 5JXIA 2VCAA 3MI8A 4HETA 1C1FA 4ZU7A 3IDAA 1S2BA 2C1FA 1ACCA 1U5YA 2PHRA 3WNKA 4PF1A 5A3TA 2LRPA 1RUI1 2XHNA 3OEBA 2EXJA 4Q4X1 4XFBA 3ATGA 4CCCA 4ZXKA 2OA2A 2VG9A 1RUE1 5LBFA 1PVC2 3FN9A 1W9YA 1DFQA 2QTWB 4LKFA 1POV1 4K7JA 1UX6A 2W46A 3FUQA 3M3CA 1WCKA 5A7WA 4PQQA 1RUJ2 4TWTA 3S6PA 4R9AA 3AKPA 3VKFC 4QPGC 1EV12 1TQ5A 2HWE2 5CFCB 2D44A 2JXAA 3U4SA
chains in the Genus database with same CATH topology
2OVUA 3CNAA 4B4QA 1QH6A 1ZBE1 4E4SA 1NQDA 4IEWA 1CAXB 4MXWB 3ZXKA 4B29A 4AE2A 2BUKA 1R1A2 3RYKA 1VBE1 2ZOEB 3V0AA 1PNGA 3SISA 3TRSB 4TSVA 1MEC3 1CAUA 1QJU3 1QGLA 4XIKA 1NCRA 3VHPA 2HEWF 4XYXA 5DZFA 4DPNA 3ILFA 3PNAA 4YVWC 4CP1A 1J1LA 4YNIA 5LRSA 4CYDA 3WUDA 2QUOA 2Z69A 5T5JA 2A3XA 5ACA1 4AW7A 5GLZA 2R49A 1DGRA 5BNOA 3E6CC 5AFEA 1HRV2 1LKNA 4P9YA 2ZZQA 2A6VA 5DZEA 4KWLA 2RS53 1D4M1 1AYM2 1LENA 4HN1A 2YGLA 1KD7A 1W6PB 5A3MA 1SBFA 1PZ9A 2V73A 3MGUA 4AI8A 1DZTA 1ALYA 4MYEA 5DUWA 5FMOL 1IHMA 2JKBA 5SV5A 4IV3B 3L9JT 4Y1UA 1PVC3 1ZRCA 4QT6A 2RMU1 1DZQA 4AFBA 3WW1A 4YZ3A 2TBVA 4MUVA 3FE5A 1RUI2 2JICA 4Q4X2 4AFMA 1RUJ3 5CFCC 4D3WA 4WM8C 2E51A 2VQAA 4YM2A 1RUE2 1EV13 2HWE3 3MEPA 5FMOS 2X29A 1BVP1 2D3SA 1G9FA 3M3QA 1CIWA 2PHFA 4LBMA 1YWKA 4PDWB 4XE9A 3VBFB 1ZRRA 3POSA 1JBCA 1OMIA 3IPVB 1O5UA 3SH5A 2A6ZA 4AVAA 2AUYA 2ZGPA 3WINE 2B42B 4PIYA 1XNDA 1WGPA 1ZBE2 4FPEA 2O0OA 3RJ2X 4E2QA 1KS5A 2A3YA 2ZTNA 4L97A 4IL7A 3NAPB 5ABJC 1VBE2 2GC0A 1QDOA 1H4HA 1Q43A 1OI6A 3B9CA 3R0RA 3IDBB 4INDA 1HRV3 2R6QA 2YGMA 4WVVA 2DCKA 2H6CA 2B5HA 5T5OA 4FQZA 2WSVA 3EJKA 4JGYB 4KU8A 4QQPA 1RUG3 5ACA2 2XJSA 2ENRA 3OF1A 4AI3A 4OULA 3ELNA 5C4WB 2VNRA 4D7YA 1UF2C 1D4M2 4IV3C 1XU1A 2A75A 3NV1A 4IETA 4JGZC 3U10A 4LR4A 4LBQA 4XF1A 1CPMA 4Z1VA 5A33B 3HAGA 1WMDA 1S0BA 1C1LA 1RUI3 1OSGA 3KCXA 4Q4X3 1ZRDA 4WVWA 4S2DA 5K8SA 1NXD1 4OUMA 1RUE3 2BNMA 3M3OA 3WG2A 3BCWA 1AX0A 4LO7A 3HIFA 4I3GA 4KG0A 4M3CF 2EXKA 4U36A 2VW1A 3JD72 1ZNPA 4OFGA 5KHIA 4E2GA 4Q8KA 1KDKA 2DCYA 3MLLA 3VGIA 1SLAA 3AP6A 4N90A 4TYSA 3NV3A 4YVSB 4GALA 4BCUA 1H30A 2PAMA 2QJVA 1RUOA 3ZIXA 1YO8A 1FOD1 2R041 2ZJCA 3RG0A 1M4WA 4JGYC 1CR7A 3KZ4C 1DU3D 3ZMNA 3V64A 5ACA3 3PJYA 5C4WC 1XYNA 4OUSA 3WP3A 2Z2SB 4ATFA 1H2KA 4Q4Y1 1AYN2 1FV3A 1XNCA 2E7TA 4MX3A 2VULA 3AXEA 2A7AA 2ZX3A 5FO7B 3R4DB 4NOTA 1MVQA 4L2NA 1C57A 2H0BA 3WLUA 1NQJA 2RR11 4DB5A 3PJQA 1LGBA 4OI2A 3ZFGA 4Q1PA 3WHTA 1JUIA 4LO4B 3KCCA 3WHUA 3TYJA 2ZS6B 2DVDA 5FLJA 3D6EA 1Q56A 2WNVA 3JD73 2IXCA 3MIDA 2C9AA 1U5XA 2JE7A 1CJDA 2VOXA 3V0AB 4D69A 2EXIA 1SEFA 1CAUB 1ZZ8A 5CG9A 4EWEA 1NCRB 2AZ5A 3P3PA 3UKNA 1BMV1 4LA2A 2ZHNA 5FLHA 1VAVA 1WD4A 1QQP1 1S55A 1BVVA 3QCWA 2JX9A 3H9AA 3N7JA 1FNZA 3ZSMA 2GC1A 5BNOB 4XBLA 4YLZA 4XF0A 3RNSA 3UK9A 1QOOA 3ECQA 2ZGLA 5DDJ1 1AYN3 2PLV3 1W6MA 1HQWA 2VPVA 3H7JA 5J36A 2AENA 4NN0A 5D8AA 1FI2A 1JTZX 1LOEA 2G9FA 3WZ1A 1EAH1 5JMCA 1D0HA 4Q4Y2 1ND3C 2ZABA 5JI7A 3ZX7A 2BYVE 4K3UA 3GBWA 3RSJA 3IM0A 1BQPA 4IQPA 4COWA 1EPWA 4H55A 3VL8A 1C5IA 4HVRA 1HV1A 2R0FA 4LLFA 3VBOA 1UCXA 1RTVA 2UYAA 1JN2P 3N35A 3OD4A 2RR12 4UBGA 5A3LA 2Q1MA 5DUVA 1RUH1 4GULA 1NCRC 2YPJA 2I74A 5GLTA 2K2SA 4W6YA 2XHKA 4RR3A 3WQ1A 1LCLA 1X8MA 1SLBA 1QOTA 4KNCA 1IS3A 1G8WA 2ZCWA 3ROUA 1CN1A 4E4ZA 1ENSA 5JPNB 4FOYA 2R30A 2UY9A 1QOSA 1OLRA 2P17A 2EALA 2VMIA 1DBNA 1I3HA 1QQP2 1RMU1 5LK5A 2XKOA 3H1MA 4NHKA 2HYKA 1SCRA 1UU4A 4FOVA 1OFSA 3VL9A 2SBAA 3JZVA 2ILMA 3NV4A 1Q8VA 4WZCA 2D6OX 4IEPA 4XQ4A 4FPKA 3AKQA 2Y38A 1OD5A 2PHXA 5JLVA 4FTEA 4OI0A 5DDJ2 4Q4Y3 3ZPYA 1KFXL 3B3QE 5E8AA 4YYOA 4LBQB 3RMYA 2YZ4A 2HWF2 2ZBJA 4OHXA 3VBHA 4P9LA 1WLCA 2YROA 3SCFA 1J59A 1EAH2 4AEDA 4AK3A 5GZFA 2RR13 1Q5OA 3SNMA 1LOBA 4XMIA 2H6BA 1LU2A 1QWRA 2R1BA 1O3SA 4QD2A 3JB4C 1S0EA 1YHFA 3VKMA 1VALA 1DQ1A 2K9ZA 4Q0PA 4ES9A 1LRHA 1IPKA 3DKWA 3LKJA 3U0ZA 3D8CA 4R9BA 1A6CA 4QMAA 3VKOA 3LSEA 1G6NA 1NZCA 4OLLA 4Q0QA 1PO11 3ZIWA 4XILA 1Z0HA 4AF9A 3E97A 1GKBA 3OYWA 3JBG2 3KSCA 1AR61 3DUIA 1QQP3 3MW2A 3MFCA 1UL9A 2ERFA 1UAIA 4MLOA 1FV2A 3HT1A 3IIAA 5E1RA 4YW2A 4AI1A 2GC2A 1S2KA 4HFSA 4DZGA 3WXPA 2DUPA 1RUC1 3D0JA 3ETQA 1X33A 5DDJ3 3L2YA 5GZGA 4Z92B 3ILNA 2JG8A 2B45X 2HWF3 1MZ5A 3H50A 3TB0A 2HWB1 2W68A 4XF3A 2XVGA 4LHLA 2I07B 2E53A 1UZZA 4AVSA 2D7FA 3AKSA 2VW2A 3ZFGB 1CPNA 2YV8A 3LOBA 2K0GA 1REDA 3H3UA 4QHBA 5DG1A 2ZX1A 1R092 2WNVB 5IUQA 4CDQA 1Q8PA 1AUYA 3S30A 5KHKA 2X53S 5GLVA 4YARA 3AJZA 3O0VA 5JAXA 1YFXA 3AYCA 4RSUA 4Y24A 4BE3A 2ARBA 5GM0A 2VOVA 3M2MA 2PHLA 1KXGA 2XVLA 2ZGUA 1U5ZA 2A70A 1MS8A 3J4UH 1S1AA 5EXOA 2XLAA 3MPBA 1J3PA 4Y5Z0 5T5LA 3AB0A 1WW7A 5K9YA 2WLQA 1KJLA 2ZGQA 5FOJB 2PHUA 3JBG3 1OFNA 2VOWA 1F5JA 4F3JA 2CL2A 1VB4A 4I02A 2ZZJA 4XIOA 5FCCA 1LR5A 1NE6A 3WG3A 2GN3A 1PO12 4X8PA 3W9AA 4ZKTB 1LOGA 3CJIA 3M3IA 4HK9A 4OZXA 1OQDA 3VZLA 2BNNA 1W6MB 1AR62 2WA3A 4XF4A 1W0OA 4IEYA 5KXDA 1H0BA 1QNYA 4UW6A 5D8AB 2VW0A 4CEYA 1LOAA 1TME2 1UD1A 1AR92 3NVCA 4J6GA 1OHFA 1RUC2 4FTBA 3VZKA 4FAHA 5T3NA 4KU7A 3ZFGC 3RYPA 4ZU4A 1Y9QA 4HK8A 1WMEA 5K0UA 1V00A 3MW4A 3D5OA 3DN7A 1I1EA 4JCKA 3VBOB 4PIZA 2HWB2 1ND2A 4I01A 2D3PA 3JQXA 2PFWA 4XXPA 1GLHA 2DU1A 4XJ8A 1R093 5CAZA 3KT7A 4OHVA 2DTYA 5J7MA 3FMGA 4FPFA 2D43A 1XNBA 3S7IA 4RR3B 1X82A 5DUXA 3WVJA 5JDBA 3DPRC 5KBFA 1PIV1 3H1WA 4EJRA 1URXA 4NWWA 4K40A 1GQGA 1QXPA 3WDVA 1Y3TA 4Z2WA 1AJOA 1IGOA 1GICA 3JQWA 3ZFEC 1O4TA 1PO13 2BFUL 4FVVA 1X36A 1NLRA 1QJU1 3UKVA 3VBSA 1N3PA 1AR63 1K5MC 3D82A 1MQTA 5C8WA 1QXRA 5AFBA 2FMYA 4YZ1A 5D8AC 1JH5A 3GNEA 4BLIA 3IDCB 1UU6A 2WT1A 2PHTA 1IKPA 1N3OA 1TME3 4RS5C 4KG8A 1AR93 1PK6A 1QJY2 1RUC3 4GIQA 3SCHA 5F6KA 2PHDA 4A7ZA 2BFUS 2A73B 3FC0A 2RS51 3VBHB 4AQTA 5J96B 5J3UA 3VBOC 3BPZA 3NSTA 4G3YC 2RM21 2XUMA 4C0BA 4AEDB 2HWB3 2JENA 3VV1A 1IKQA 2D5HA 5KHGA 2WNUA 2VECA 3WG1A 4CZSA 3ZSJA 3AZZA 4UBHA 5GJ6A 4BOWA 1PVC1 3C3VA 4RR3C 5HCAA 1LEMA 1QDCA 1H8TC 2QZ3A 1G9DA 1LGCA 1N1TA 1YNAA 4Y1VA 5B2GB 2HWE1 4Y22A 2CGOA 2SLIA 2RS31 5H9RA 4BMBA 3B00A 3E5UA 2XGXA 2YMZA 2EIGA 1A3KA 2GH8A 3OYWB 5GZCA 3LOIA 1PIV2 1F9KA 5JSRA 5TSWA 1DGLA 3ACLA 5FRAA 1XRUA 5JVVA 3ZSEA 1G86A 4PLOA 1S0CA 4KH9A 2BEOA 2E9QA 4IEOA 3WCSA 1Q8OA 2Y0OA 2GNDA 3QD6A 4JTOA 4Q4W1 4EN9B 3DGTA 4HT1T 1VBB3 4D94A 1G9BA 4EWDA 1RB8G 1QJY3 2IFRA 3SMHA 1HRV1 3VBHC 2JG8B 5LK7B 4IEQA 4S2GA 4RHV3 3QLQA 4YZ5A 4QQOA 4JV4A 4AEDC 1NA1C 2XWJB 5JOXA 3HMYA 1RUG1 1ULEA 1MZ6A 1FX5A 1ZZBA 2AH2A 4RL7A 3RRDA 1KRIA 2FHRA 4U2AA 5H9SA 3A0NA 3MW3A 3NO8A 1UMZA 1YJKA 2JEMA 3NKGA 4MH0E 5L19A 1KFUL 3MIGA 1CAWA 1UKRA 2RM22 3QACA 4CDQB 4GKXA 2PYTA 2IZWA 4W6XA 4Q0SA 3Q9OA 1NE4A 3QH7A 2IXHA 4XJWA 1WLTA 1DF0A 1CJPA 2A5ZA 2FZ2A 2DFBA 1TEIA 1W0PA 4BYYA 4JQRA 5EJ3A 3FZ3A 1GV9A 1PIV3 3HQXA 1DZRA 5C8CA 4X8NA 3WDTA 4QX5A 1Q8QA 2RS32 1NXMA 5IK7A 2LALA 3RZZA 2C5DA 3CJIB 1V6LA 2JECA 1C4RA 5HCFA 4KL1A 3AZYA 4OI1A 4HVQA 2VNGA 3KMHA 3B93A 4BM8A 4CEWA 1SACA 1XYOA 4GWMA 4FAGA 5JIAA 4CEYB 1I6XA 1SDWA 3W59A 5L7OA 3V65A 3ZYPA 4N9IA 4Q4W2 4BMEA 4BQ1A 1OA3A 4KWKA 1BBT2 2P3KA 5K0UB 2MHFA 2XJTA 4M3CA 2X5IC 5A32A 1D4VB 1ND2B 5E16A 4IV1A 1KDMA 4CDXC 4CDQC 4I2OA 2RM23 2ZX4A 2YUEA 3FLRA 2KM2A 1RUG2 3AYDA 3ZYGA 4BLJA 2CY6A 4PLNA 3ZN4A 1YI9A 3O12A 5LEKA 2HWC1 2XLGA 5BV6A 2GNMA 4FP3A 4YG0A 4LEJA 1POV0 3RJRA 2ZPXA 4AVCA 4LUMA 3JD71 3G6JB 4MXVA 4F8AA 3ZXDA 4L92A 3CJIC 2RS33 1WLWA 1R081 3WW4A 4EWAA 3IMNA 3VBSB 2XWBB 3MFAA 1MQTB 4GXLA 4PF5A 1WBLA 1A8DA 2WA4A 3AKRA 4XFAA 3TWIA 4XW3A 1O91A 1PK6B 1ZZ9A 3VKLA 1S0DA 4QGNA 1H4GA 4RQPA 4Q4W3 4A7YA 5K0UC 3OJBA 1BBT3 3KM5A 2BWCA 2Q30A 1AYN1 3LCPA 2PLV1 1YCIA 3GALA 4XFCA 3QBQA 3D4KA 1VAMA 2WT2A 4IESA 1SQ4A 1IZ3A 2WNUB 4META 2QE3A 3AYEA 1ULFA 1BK1A 1E57A 3RS6A 3MDPA 1SLTA 2WINB 3I8TA 4X6QB 1FNYA 1QNWA 5KXCA 1ZRFA 1MS1A 1RUD1 2WS91 4EROA 4OVEA 1WW5A 1GNZA 2ZA9A 3WX5A 4Y22B 1B35A 4AQSA 2VUJA 2WZR2 2GALA 2HWC2 3VZMA 3MICA 4PDWC 3VBFC 4Y26A 2BNOA 1REFA 1OA4A 4AGGA 1SBEA 1MQTC 4FPJA 2RJKA 2GDFA 1Z78A 3SLIA 4HKOA 4E27A 2ZGTA 1R082 3NAPC 3SCGA 1EYBA 5JIUA 5GLWA 4RGGA 3OCPA 1ZA4A 2IXJA 3ZFFA 2W0XA 1YFWA 1MS3A 1Y43B 4MVTA 1HQNA 2R071 4HLTA 3FLPA 2DVBA 5T5PA 4AGRA 2R061 4SBVA 2VUAA 2WNUC 3GZAA 5GALA 2A6XA 3IBMA 4OI4A 4JAAA 3VBRA 2CGPA 4EN0A 1WCSA 2MPFA 1QHDA 2FBEA 4N53A 4QPIA 3WNXA 2BVBA 3EXUA 1LU1A 1V6IA 4AQ6A 1CAWB 4YM1A 3NJZA 1OLQA 1WW4A 2PLV2 5I91A 4FSJA 1BCXA 4GA9A