5HBAA

Globular domain of zebrafish complement 1qa protein
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
133
structure length
133
Chain Sequence
EKPAFSVLRNETSQAQYKQPVTFNDKLSDANDDFQIKTGYFTCKVPGVYYFVFHASSEGRLCLRLKSTSAPPVSLSFCDFNSKSVSLVVSGGAVLTLLKGDKVWIEPFAGDGGVGQMPKRLYAVFNGFLIYRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Uncharacterized protein
publication title Crystal structure of zebrafish complement 1qA globular domain.
pubmed doi rcsb
source organism Danio rerio
total genus 25
structure length 133
sequence length 133
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5hbaA00
2X29A 1U5XA 1D4VB 1KXGA 2WNUB 2R6QA 5KWRA 4NN0A 1C28A 4D7YA 2HEWF 2WNUC 4QQ2A 4E4DX 4G4FA 5BNQA 3FC0A 3URFA 1S55A 1TNRA 4MXWB 1DU3D 1IQAA 4J6GA 4MXVA 1ALYA 3B94A 3LKJA 1PK6A 3AB0A 5TSWA 4F3JA 2QDNA 1OSGA 2JG9B 5L19A 2E7AA 4G3YC 1RJ7A 4KGQA 2JG9C 4EN0A 4OUSA 3L9JT 4QQPA 1GR3A 3QBQA 4N90A 4RSUA 1DG6A 4QQHA 1PK6B 2R32A 1A8MA 4KGGA 1PK6C 4HT1T 2WNVA 1RJ8A 1D0GA 3ALQA 4E4SA 1WCKA 2RJLA 2JG8A 3B93A 2TNFA 1O91A 4TSVA 3WD5A 2ZJCA 2RJKA 4QPYA 5HBAA 5L36A 2R30A 2Q8OA 2WNUA 4OULA 2QE3A 4KG8A 1JH5A 2WNVC 4GIQA 3QD6A 1U5ZA 1XU1A 1KD7A 2JG8C 4MXWA 2TUNA 4TWTA 3K48A 1OQEA 3B9IA 3IT8A 3MI8A 5KC6A 4DOUA 3V56A 1C3HA 4OUMA 4MSVA 2AZ5A 3TYJA 5CIRA 3ME2A 2JG9A 2O0OA 1OQDA 2KA3A 2OIIA 5KC5A 2WNVB 2HEVF 1U5YA 1XU2A 2Z5WA 2ZPXA 2HEYF 2RE9A 4QQOA 2JG8B 2Q1MA 3K51A 1JTZX 1I9RA 4DB5A 3TWIA 4QQLA 1D2QA 1TNFA
chains in the Genus database with same CATH superfamily
1JODA 1C1FA 5FUNA 1NLSA 1KGYA 1HRI3 1AVBA 3DL3A 4IV3C 1JOPA 1N3PA 5A33A 1GP4A 3RYKA 3VV1A 4DFSA 3M3QA 4NHYA 1QJY3 3HPNA 1FNZA 5A3UA 2RS52 1LR5A 5LW9A 5CEHA 2ZHMA 3OPZA 1S2BA 3D4KA 5BNQA 4RQPB 4BB3A 4EV0A 2VE1A 1SPPA 3MF6A 1NZCA 5LZ6A 5DAPA 3KV9A 4BH9A 1OA2A 1KFXL 2G19A 3CEWA 4EROA 4FFFA 4H3WA 1Z7S2 5FMOS 3ZPYA 5F5IA 2X05A 2GAUA 4CP0A 5BNPA 2CNAA 1X33A 1PIV3 1TEIA 4LMFA 3CNAA 4XMAA 3ZFFA 3KSCA 2E53A 3C8XA 2VZQA 3UT0A 1O6UA 5IFTA 2FD8A 2GZWA 3I2JA 1RHI3 4LKSA 5DN2A 2B7YA 3WNXA 3BTAA 1UZWA 3FJSA 2ZX4A 3T2TA 5A70A 5LBBA 1NX9A 1QXJA 4W8JA 4JAAA 2E26A 5A3NA 1OD5A 5FYTA 1CAWB 3J7NA 4XFIA 1H2LA 1R1A1 2BFUL 4YG3A 2Q8DA 2NP0A 5F7UA 2WN3A 2ZMNA 4XVHA 2ARCA 4CYDA 4P9XA 3B69A 4NROA 2HWB1 3QBQA 1W8UA 2AEYA 3AJYA 2RVAA 3UKVA 5FZ6A 1AR91 3T3YA 1FMD2 2YGMA 2QQLA 4OQ8A 5C7GA 4AI1A 3R4UA 3WNLA 1GU3A 3I59A 2PHFA 2XKOA 2L9LA 1V6KA 3SC7X 5APAA 3VBHC 2JG8A 1VBE1 4Y4YA 1HRV2 1XPWA 4KWLA 1W8OA 1YQCA 1ZA7A 3WD5A 3ZR5A 4Z1VA 2XVGA 1YFWA 2HWF3 3J26N 2VTFA 3WCRA 1W90A 1DQ1A 1AYN3 2C1FA 3POSA 4GB31 1OKQA 4B1MA 1W3XA 1Q8SA 3RRDA 5EYYA 1RVF1 1H6YA 4AI2A 3I2HA 4AQSA 1HQWA 1WCQA 1QDOA 1SEFA 2CAUA 3ZXEA 4AGRA 5DUVA 3U07A 4BPZA 2VTXA 3UGGA 4Y1XA 3KZ4C 5FY7A 5KHGA 1CVNA 2B4KA 1VBC3 2J1AA 1R1ZA 1VB4A 1N1SA 1S0BA 2LM3A 3M3EA 2WZPP 5LATA 4ZZ8A 3NRUA 1D4M3 5T3NA 3OEAA 2BTVC 4P00B 2JG8C 2G1MA 3KCYA 1C5HA 3CJXA 3MLJA 3RZMA 2C4XA 3LA7A 4AOCA 1BQPA 1RMU3 1N3OA 4Y5SA 1W05A 2OS2A 2OVUA 5A7OA 5B2GB 3PIJA 1TMF2 2A73B 3LEMA 4WVWA 4CP2A 1B09A 1S0GA 1BEV3 3NKTA 1QJU2 2DU0A 3HVDA 4KWUA 4EQVA 2H0VA 3J4UH 4ZONA 1OPMA 4R4ZA 3SH4A 1ENQA 1MS9A 1OQDA 1NE6A 2KA3A 4L0PA 2A3YA 2WNVB 3KF5A 3MIGA 5CVRA 5E6HA 4L11A 4ONUA 3NV4A 5DQ0A 3RI8A 5FMDA 4UFJA 1JOJA 1SLAA 2CHHA 2Q1MA 4B4RA 4QKNA 2CTVA 3T4VA 3WHTA 4D6QA 5IVCA 2XJQA 3ZSJA 4NOTA 4Q4W2 5FREA 5FZFA 1ND2B 4XFHA 3VD5A 1RUJ2 3R6SA 3QH6A 1QH6A 1JZ4A 4JDMA 4R9DA 4URTA 1QMJA 3DV8A 4AEMA 3TEZA 1NCQA 2JDKA 2RS53 4AVAA 5IVVA 3AM2A 1PO23 2A70A 1UIJA 2WC2A 4D7YA 1AJOA 2CWMA 2YY1A 3A7QA 3QACA 2YG0A 4YW2A 3MIDA 3NNJA 4OHWA 5FYHA 1VALA 4QKDA 3T2QA 2VVEA 4ATFA 3SCGA 1GZWB 3BTYA 4YSFA 1ASJ1 1Z7S3 3DCQA 4OZOA 1DQ2A 4J6GA 4MV2A 1QQP2 4BISA 2YB7A 1HN0A 1LEMA 1Q56A 3FMGA 2Y0OA 2F6BA 4BZ4A 5A33B 5C9AA 1HKDA 1GOHA 2Y0IA 1NKGA 1UIKA 4FQZA 4IE6A 1A8DA 3E6BA 3VBUB 1HB3A 1W03A 3WW1A 1DZQA 1ZZ9A 3THPA 1NCQC 2WQZC 1UMZA 1UYPA 2WT2A 1OHFA 4CA9A 5LA1A 2AH2A 2X53S 5FP8A 2J1TA 4BQWA 3W21A 1UKGA 1GP5A 1OUSA 3CJIA 4LBLA 4V1PA 4XEZA 5EIYB 2GC3A 4QQPA 1YCIA 3MW4A 4ES9A 2RV9A 4NVPA 1LHUA 2LRPA 5FCCA 3OBTA 3NJYA 4LQRA 5FYVA 5JI7A 4A6OA 4HT1T 3V0BA 3H8XA 4YZ5A 1JOBA 4CXYA 1NYWA 4XQWA 4NIIA 3BB6A 5JSRA 2IVIB 4FPCA 3VBHB 1WMDA 4R52A 1C8M2 2HYKA 1GZCA 2RJLA 3I97A 5CKQA 2RM22 3WQ1A 3UNPA 2P3YA 3NL1A 4RR3A 1GWLA 2JDZA 4TSVA 1MZ6A 5T55A 1W8FA 2PHUA 5FPZA 4IGQA 1REDA 1VP6A 4BQYA 5IVBA 4XJWA 5FYUA 4WM8A 3POFA 4J1XA 5L36A 2SLIA 1UPSA 4HSJA 1W9SA 2D3PA 4M3CA 5GM0A 5LBFA 3RJRA 1T6GC 3OGJA 2IXLA 3I59B 4LKDA 4C91A 2K0GA 5F39A 5JVVA 3O1PA 1O8PA 5I0SA 3GYDA 1U5ZA 1AXYA 2VOWA 1YJLA 2XLAA 2YFUA 4YZ2A 1V70A 5KHJA 5CU1A 2VZRA 2TUNA 1XB9A 3ZLIA 4XUPA 4P9IA 3T0AA 1CD3G 2HWD1 2W68A 5KXDA 3B9IA 3OBZA 3IAPA 3A21A 3VZOA 2IXCA 4AI3A 3ROUA 1DCSA 3PLQA 4LO6B 2OQ6A 4WM8C 4FXGB 3D3AA 4HANA 4FFGA 4MSVA 4AW7A 2QQVA 4DO0A 3PUHA 3K3OA 3TYJA 5IAXA 3ZXAC 3NKGA 2C6SA 2ORXA 3I2IA 1WMXA 1YNAA 3KMHA 4BK5A 1OQ1A 5FO8B 3SH3A 1UY4A 1OOPA 1DBNA 4XXAA 2VG9A 3K3NA 4GKYA 4YM1A 4AHWA 3V0AB 1VRH2 4PF1A 3RMXA 3ZVXA 1J58A 4P5YA 3IDBB 1WCSA 2XGXA 1VRBA 2EIEA 2FMDA 4GXLA 3TBDA 1GOGA 4OCTA 3TWIA 4OVEA 2VZVA 3C7GA 3CZJA 4Q4W3 1RUH1 5HCFA 4XIKA 1GSLA 5LY2A 1RUJ3 2X29A 1Y9QA 4OHYA 2QQMA 4JTNA 3MUY1 1F4HA 2NMNA 2UYAA 2R073 1OOPC 1UKRA 3AZVA 1RUG2 1DQ4A 4BQ5A 1GYKA 2HWC1 2NMOA 4FTBA 4P9YA 3WUDA 2R062 3I3QA 3NNGA 2VNVA 3URFA 2Z2SB 1PGL1 1TNRA 1H6XA 1QQP3 3RQ0A 5LCWL 2XQXA 5FYIA 2PN5A 1I1EA 3OD0A 2OXBA 3WNOA 3ATGA 1ALYA 4CCEA 4KWJA 2PHXA 3B94A 3BTZA 5C8CA 4FPJA 2D3SA 4BLIA 5J3UA 2VBBA 1LOEA 5BUVA 5GJ6A 5FXWA 1Q8OA 4LR4A 2VY0A 1PX3A 4MGIE 4WM7A 4CP9A 5FXXA 4LTAA 1FATA 3IDCB 2W39A 4N7IA 4GMP3 5JXGA 2P3IA 3AMQA 3WDXA 4K1ZA 1HB1A 2DWRA 1UX6A 4PI2A 4LBQB 4NPLA 2ETEA 4QX1A 1Y3TA 1CR7A 5FO9B 5HCAA 2QVSB 2YBSA 4MYEA 4Q8KA 5C8CC 4N43A 3ZYIB 4QPGC 3RFRA 1EUTA 3IIAA 2BRTA 4OHXA 2JKBA 4E4SA 1HV0A 4HXCA 1YO8A 4MADA 4WM7C 2FDIA 1HXS2 5BPXA 1TZOA 3WCSA 1RGSA 1RB8G 4NHMA 3R4DB 4QDQA 2UU8A 2AREA 3GBGA 3MIEA 1F5JA 3PVEA 4QMAA 4YVWB 4A3ZA 3ZYHA 4CE8A 2LALA 2BU9A 2WZR1 5K7PA 1RXGA 4FOYA 3BOWA 1OLME 4UYBA 4E2SA 1OLMA 4UFHA 4H2AA 4COVA 1W6NA 3LSDA 3AMNA 4RHV2 4BQ2A 4N43C 3HIFA 2FZ1A 4LKFA 3S5QA 3T08A 4TZDA 3JZVA 1LGNA 2QZ2A 2LUWA 3OY8A 1XU1A 2GH2A 3RZHA 4COWA 3T0BA 3VN4A 1OQEA 2B45X 5A7SA 1OC1A 1W9WA 1YC61 3VDDA 4B29A 5A1AA 2WR9A 2RR12 3OGGA 3HWJA 1US2A 1JU4A 1HLCA 1W04A 1DZTA 1G86A 2J1SA 2PELA 1QJX3 2C26A 5LA9A 3VBOC 1Y43B 4D6SA 4Z2AA 4QWNA 4UW6A 1VLNA 4D94A 1QIQA 3SHRA 1AR71 4XHXA 1NCRA 4COUA 2D6PA 3WF1A 1XXNA 1LOGA 1TVGA 2A3XA 5FYZA 4YM3A 1Y4WA 1I5PA 2R042 5F2WA 4WVMB 2DU1A 1JYWA 2Z69A 4LBJA 1E57A 3UETA 4B8EA 1JMUB 3VBRA 2GU9A 5H9QA 5FQ0B 4RGGA 3O1MA 1KITA 2ARXA 3W9AA 2BNNA 3VD9A 5E8AA 3BKZA 1ZRCA 3NQHA 2R7EB 3JU9A 2VQTA 3VZJA 3BALA 4EJRA 1QJY1 5GLVA 3MZHA 2GN7A 2FCVA 1NA1A 1OOPB 5FZOB 5T5JA 4Q4X1 3TB0A 2B39A 4I0AA 2PHDA 5A7WB 1YYNA 3FHIB 5KWRA 1RUG3 2PFWA 1BBT1 1VBA1 2R063 5B4XA 3BU7A 5D1IA 4AEDC 1SBDA 2GP5A 1YRZA 3RZGA 5F9TA 3VBRC 4XAAA 1XNDA 1RHI1 2ZHKA 1RUC3 3E5XA 2A6VA 3GBWA 5F3GA 4NWWA 2MEV2 2WWSA 4XE9A 1GP6A 2X5IC 4CDXA 4ATEA 3C7EA 3PJYA 4KG0A 4COYA 2WFF3 2DUOA 4DUXA 5AFEA 5IK5A 1A3KA 1LOFC 1F5FA 1XYOA 2YBPA 4BHPA 2X09A 4N9IA 4CUBA 5L19A 5AC91 2EVXA 2Z42A 2J7MA 2VW1A 3T4HB 5E16A 3OTFA 3SQOA 2F17A 4LK7A 5HCHA 1RL3A 2EICA 3K2OA 4N90A 4CUGA 1K5MA 1QJFA 2ZEWA 3AYCA 4LIVA 3LEKA 2C9KA 5C8CB 4HG6B 1ZBA2 1PHMA 2W91A 4QPGB 1CWPA 3LFIA 2UY9A 2QQOA 1ZM1A 5C6CA 1BMV1 4CDXC 4WM7B 3ACIA 3FN9A 1COV2 4NIGA 5FWEA 4GD4A 5A6QA 3PURA 3AZYA 4QPIC 4HN1A 1REEA 1AYN1 1S1AA 1IKPA 4QGMA 3SNMA 1J1LA 1LOBA 5FAXA 2V72A 3H3LA 2VGDA 5GLWA 2JDYA 3I4IA 1CAXA 1SMVA 1EV12 4N43B 1ZRIA 3ZKYA 3PUIA 1DGRN 2Q0AA 2JX9A 4A45A 5FJHA 3U4XA 4HMZA 1QY4A 4AHXA 1M4WA 2BV4A 1W39A 2OX0A 2FZ2A 5DG1A 1EP0A 4YGEA 1OD3A 2ZAAA 3UV9A 1UQXA 4CU7A 1HDKA 3IT8A 1W6PA 3MI8A 2RMU3 1K12A 1CJPA 3NJXA 4LORA 1XSRA 1YFUA 1NY71 2BVBA 2CWSA 3LA2A 4IV1C 3VBOB 1C3HA 1ZBE1 3KD4A 2JB8A 2WL1A 3AFKA 3ACGA 1H2NA 4BXSV 5JWPA 1ZVFA 2JE9A 1C1LA 1R64A 4R9AA 3SMHA 2YU1A 4DEVA 3ZPOA 3A4UA 3RVHA 5LBCA 4IEYA 4LBNA 5L73A 5A1FA 3ES1A 3POJA 4FAGA 2Q1FA 3WNMA 1TME3 1GKBA 4DNYA 1QXRA 2XLFA 1U5YA 4Q29A 1DGRA 5DDJ1 3GDBA 4BIFA 1YQ6A 1POV0 3R4SA 2PLV2 1KRIA 1DLCA 1ODMA 1I9RA 3N7JA 3OBAA 4XW3A 1IKQA 3AZWA 4INDA 5DUUA 4CCOA 1BXHA 1D2QA 2VBDA 3MGUA 5FOBB 5LY1A 3AFGA 1NE4A 2RS51 3O5SA 4NO4A 5CFDA 1JYXA 2Y6FA 3DPRC 4H55A 1T2XA 2Y6KA 4GJZA 3H1MA 3U1XA 1W0NA 4LT5A 1CIYA 4K8RB 4URAA 3RNSA 3KLSA 4AEDB 4N53C 3BIEA 1W6OA 4B4PA 3M1HA 1CAVB 4DUVA 1GNYA 2Y6JA 5HI0A 1RUI2 4I09A 5KHIA 1Z7S1 3VBRB 2GP3A 4AZZA 1AR63 4W4ZA 3ZYRA 1R082 4BIOA 3LSEA 1QEXA 3IMMA 4QHZA 2OZ6A 4YZ1A 3AXDA 3N35A 1LRHA 4UXAA 1CZTA 5A7QA 2ZMLA 4B4QA 3D5OA 2O8OA 5FZ0A 2CGPA 2X5IB 4XCBA 4IETA 4LLFA 4I2OA 2V09A 3AB0A 2V5YA 4NHKA 2FDJA 1H4HA 5FZ7A 1SDWA 4UW5A 3ACHA 2JD9A 1HB4A 3IKWA 4JQRA 4XABA 2GALA 3T0DA 1V6OA 2AUYA 5ACA3 1HRI2 5H9PA 2IXHA 1UMIA 4C1XA 2QKDA 5ISLA 1W9YA 2QUOA 1FMD1 2JWPA 4UW3A 1MS4A 3IWZA 3L9JT 4IDZA 3GZUC 3ZXKA 4C90A 1FI2A 2AC1A 1ZBA3 4QQHA 3TN93 4Y26A 3BIWE 4JHZA 2XLGA 3D8CA 3LB9A 4ASMB 3T1LA 4NE9A 2VQUA 5L9BA 5C3SA 3B7MA 4Y20A 4CDXB 2XQRA 3O12A 5J98B 1VE0A 5A3OA 1Q43A 1XNTA 2YC4A 1RJ8A 1COV3 1HRV1 4QPIB 3HQUA 2ZEZA 2PQQA 1PIV2 3K75B 2VR4A 5L7OC 2E6VA 1NXMA 2IVJA 1EPZA 1HQLA 3U37A 3UYJA 2LS6A 2H6BA 2VMFA 4AFCA 1L7LA 3ZFEC 1KQRA 1LODA 3K4AA 2R0FA 2XJTA 4AI9A 3OG2A 4NPRA 4HZFA 3E5UA 4QHOA 3ILFA 3OB8A 1EV13 5BV6A 2K9ZA 4LO8A 3SITA 4DXRA 4X8PA 2ET1A 3RJ2X 3IZOA 4OULA 4I0BA 3ZOIA 1QKQA 3N7KA 4DPNA 4NIHA 3RPQA 3KHBA 4GIQA 1POV1 3O14A 2A75A 2ZEXA 1C5IA 2G4IA 2JD4A 3AMMA 1FPN2 1SLIA 1ZA4A 5DZEA 1VB2A 3WOGA 1TMF1 1ULGA 2B42B 3JQXA 4IV1B 5KHHA 4DQAA 1QJU1 2AYHA 4L92A 4GA9A 3V56A 1XOYA 2IWGB 4KU7A 1W99A 2Q8EA 1UYZA 3ON7A 2HWF2 4CEYC 2P3KA 3DGTA 1WW4A 3MO4A 4RA0A 2JG9A 1T6BX 1WCUA 2O0OA 4CVUA 3DKWA 3ORJA 5KC5A 5L9VA 4Q4V2 1JBCA 4QXKA 4R9CA 1SLTA 2DFBA 3I54A 3M8LA 2PLV3 2ZXQA 2E32A 5FY5A 5C4WC 1VBC2 4Y5Z0 4Q4W1 5JOZA 5A6ZA 4COZA 1RUJ1 4L97A 4BQ4A 1D4M2 1VJ2A 2CSGA 4K9SA 2WBKA 4JV4A 1H1AA 3DPRB 3PU3A 3KGLA 1D4VB 2JDMA 5FK7A 1RMU2 4N53B 1ST8A 1UOJA 4Y22A 3ZKUA 4OQ9A 1FX5A 1QOTA 1AYM3 3AYDA 3C7FA 1W8WA 1ENRA 1RUI3 4QKFA 1NQJA 3M70A 2EIDA 4XBNA 1B35A 3NV1A 3JBG3 2XVLA 1H0BA 2UWCA 1S4CA 2B9UA 4XTMA 5E88A 2ARBA 2WKKA 4MXWB 3H3ZA 1OBNA 2DVFA 5DAQA 4K21A 4XPVA 3CU7A 4YPJA 4GWIA 4LK6A 3KS7A 2WA3A 4JVAA 1OI6A 2DV9A 2GC1A 3CO2A 1GMMA 1MQTC 4UW4A 1ZZ7A 4CDQA 2A6XA 1W6OB 2MHFA 3SH5A 3ZDVA 5IVFA 2W94A 4GMP1 1Q8VA 3HT1A 3WUCA 2ZGMA 2W46A 3AL6A 3SXWA 4WV8A 3IM0A 4Y3OA 1W2AX 3MV11 3ZXFA 5ANNA 4EN7B 4FPLA 1VBB1 4CU8A 3POIA 1PO22 4YFWA 5FLHA 3ZMOA 5DUWA 1ZRRA 2V4VA 1O3TA 5DG2A 2VBPA 2ZEYA 1C8M1 3ZO0B 3ZM8A 2BEOA 3WINE 2OPWA 1VPHA 2RM21 4XF1A 3WDUA 5L7OB 3K4DA 4CDUC 4CDQC 4YW4A 1O3QA 3EXUA 3E1F1 4XMIA 2NYYA 3CL1A 1IG0A 4JX0A 4LBOA 2OYZA 3HJRA 1PVC3 3USSA 1LJ7A 3ZFEB 4QPWA 4CUCA 1BLZA 2JE7A 3H9AA 1V6JA 1O91A 3ASIA 3MLLA 5I91A 4LEJA 1A34A 2WO2A 4AL9A 4O9EA 3AVRA 1ZYBA 2XUMA 5FKCA 1WLCA 1PO13 2PA7A 2EXIA 1A6CA 4FAHA 3L2YA 1GNHA 4XJZA 2I07B 1LU1A 1PMHX 4YW1A 4LXLA 1G9CA 5FYSA 1F35A 1CQ9A 3H0OA 4YZ3A 3KV5A 5BNPC 1WW7A 3FLRA 4CCKA 1CAUB 2PXJA 4R8HA 4YW5A 3ZFFC 2Q30A 4FTSA 2JICA 4Z07A 4NPMA 1FPN3 1MS3A 1FOD3 3N3HA 3POYA 3A0KA 2Y8KA 3U11A 5K0UA 2ILMA 4I02A 4PLMA 2WA4A 3RGBA 3T1MA 1V6NA 3RI9A 2IXJA 4XFFA 5FP4A 5A32B 5KC6A 1QGLA 5EZWA 3SEPA 2G9FA 4V2VA 4CEYB 1BYHA 3UJQA 2YROA 3VB9A 4XC9A 1H30A 1RUD3 5FPBA 1VRH1 2XONA 1OF4A 4AVSA 1A78A 1OT5A 2WRAA 4Q4V3 3TEWA 2RS32 3CQOA 1RXFA 1UOGA 2RS13 5C4WB 1RUF3 1IPKA 2DF7A 5FFOC 1AUYA 2F4PA 1R093 3WZ1A 1OXCA 5E89A 3M3CA 1SFYA 3BODA 4AFBA 1J59A 1J1TA 4I0WB 1H1IA 4LO5B 4GH4A 3VZNA 5JI9A 4LBKA 3KT1A 4XAEA 4WBBA 3LDRA 3PUSA 4RS5B 5EJ3A 1RUG1 2QZ3A 3I2GA 3WX5A 4EN6B 1URXA 2Y26A 4XZUG 5FZEA 1W3VA 3LFMA 4H7LA 2VMGA 2WFPA 4KWKA 4HL0A 3THCA 2E31A 1F15A 2VUDA 3FUOA 3ZN6B 1SBFA 2PAMA 3CLPA 2WQ4A 4YFZA 4FO9A 4E4ZA 3C7OA 3I49A 1S55A 5ANQA 1IG3A 1JZ8A 2W08A 2D93A 2ZGLA 3VZKA 4ET7A 5BNNB 5F6LB 4MXVA 1VIWB 2P6CA 1MQTB 2V5DA 1S0FA 3USUA 4XZPA 4GH4C 3RWNA 4RGKA 2ZGTA 3VBFB 5DUXA 3WF3A 3T2OA 1UCXA 2ADEA 3LOBA 4IV3B 2EIGA 3E6CC 1H8TA 3WNKA 4EN9B 3MEPA 1JN2P 2OW4A 4JHTA 3VGIA 5F8PA 4AQ6A 4P14A 4RGAA 1X36A 4JGZA 4YNIA 4JTOA 1JHNA 1AHSA 4Q2FA 3OYWA 4DXTA 4OHVA 3NNLA 5C5TA 3EO6A 2R072 4NAMA 2PYTA 3J9SA 1UD1A 3ABZA 3HD8B 3ZYBA 5JAXA 4FOQA 2K2SA 4CDUB 4CDQB 5DAWA 5LWBA 4IUGA 1REFA 3ZXJA 4R4XA 1ND3A 4BMEA 1YEWA 1HXS1 2OQ7A 3MBWA 3WNPA 2Y34A 5IATA 2VTXJ 2ZGUA 1F31A 4HPKA 5I8YA 4ARYA 4I3GA 4YVSA 3WF0A 3QLQA 1JYNA 4QM9A 5FUIA 3PVNA 4AE2A 3OSDA 1JI6A 1CX4A 1GBGA 4BQ3A 5HV0A 1SPPB 3AP9A 4RHV1 2YC2A 1V0AA 2R30A 3PJQA 4BYYA 4ZZ5A 4QX3A 2BUKA 5BNPB 2WNUA 4EYUA 1PMJX 4AAPA 3D82A 2ZX2A 1JH5A 4UBGA 4RD7A 3ZFFB 4PHZA 2W87A 4QX0A 1ND3C 1S0EA 1L7QA 2ZOEB 3AP6A 4SBVA 4PF5A 5C9AC 3KWVA 2QFEA 1RINA 2OT7A 1Y9GA 5FY4A 1KD7A 2RR11 3WLUA 3H8OA 4Y33A 5T50A 4XDQA 3VDCA 3NVCA 3P5BA 5FZHA 1MZEA 2YPDA 2QTWB 4BWOA 5HPOA 5IK7A 5FPAA 2JEMA 2Y6GA 3GF6A 3IAQA 4FOWA 4P9JA 1UYYA 3CJIC 4CEWA 2Y6LA 2WLPA 3I8TA 2XDVA 1BVVA 2R041 3ZSLA 1J83A 3I2KA 4KBZA 1LHOA 4RN5A 2RS33 2FDHA 3O0XA 2XJRA 4CTEA 1PZ7A 3O1TA 1NLQA 2R1DA 2JG8B 1ULOA 3F2ZA 4EWEA 1GUIA 3BU0A 2B5HA 3IDAA 1X9TA 2LTNA 1XE0A 4RR3C 1TNFA 2OPKA 4YM0A 2OKXA 2JECA 1WMFA 1SG3A 4Z82A 2D98A 2BDRA 1DYPA 2AEZA 5G04L 1GOFA 3BCWA 4C0BA 4OHZA 2D43A 3T09A 2HEWF 4ZU5A 1QJX2 5CFCA 2JXAA 3P3PA 3BN6A 4NRPA 4AI0A 2VNGA 2XJUA 3J7LA 4MUVA 2DCJA 2XBO3 3D0SA 1POQA 4Q8LA 5FV3A 2P17A 5GZGA 2GMMA 2MEV1 1LB2A 2BPA2 4AEKA 1AR92 5LASA 1JW6A 3J8F2 5H9SA 5HV4A 1IS3A 1ENSA 5JIUA 3LPFA 3AVSA 4FQ4A 4LO7A 5DAVA 2D6NA 3AP5A 3AKPA 4IEXA 1OLQA 4K20A 1SZBA 2R0HA 1HIXA 5JPMB 4IL7A 4NUBA 1AR83 2GNBA 1O5LA 4LA3A 4JCKA 4MX3A 2YV8A 5CFCC 3LGRA 2BBVA 5JZGA 4BMBA 1XQNA 1ZBA1 3PMSA 2WZEA 4OUSA 1OUXA 3ZXLA 4RSUA 1DG6A 1G6NA 3H42B 3ZSMA 4LIUA 1OH4A 4HBNA 1COV1 3ZSEA 3H7JA 5IYYA 5FZMA 1GNZA 2VCBA 5CKNA 3ZIWA 4LPLA 2YZ4A 4A7ZA 1SFNA 1D0GA 2ZGOA 2Y6HA 3K77A 4FSJA 2VZSA 1RUC2 3POEA 3EMRA 1NCQB 1J3QA 2Z4FA 1NZIA 4M0NA 4Q5OA 1WUVA 1YQ8A 2O14A 3AKTA 1AX1A 3HBZA 2XXZA 3I3BA 5LRRA 2WFF2 3ZXGA 5JZGC 2ZJCA 1EV11 1EAH1 4D6RA 5JXHA 3QCWA 3FHQA 2W52A 2CV6A 4Q1PA 3WQ7A 1W8HA 1YQ2A 1AL23 3WDVA 3OBRA 5IVEA 3RYRA 2TBVA 1HW5A 1J3PA 3FL7A 1AZDA 5B4NA 4XXPA 3MICA 5C9AB 2VO5A 3WHUA 4CRQA 2QQKA 4AQTA 3QD6A 4EZHA 2ZGKA 4CXXA 1TE1B 2GNMA 4IEQA 5FMBA 1WD4A 5BNOA 3FHAA 4MGTA 3G6JB 3KCCA 2IZWA 2VC9A 4FP3A 4JRAA 3ZYPA 4CDWA 3CJIB 3OGVA 4UI9L 5I0UA 1K3IA 1YWKA 3RWKX 3ZN4A 1DF0A 1MACA 2BFUS 3UGHA 1MR5A 2AZ5A 1Y7BA 1H4GA 4YM2A 3GZEA 5CIRA 1P8JA 3C2UA 4PJYA 2ZGNA 5FIXA 3GXUA 5LEJA 3ME2A 2V4AA 4PBPA 3V0BB 1G8WA 2PLV1 1MS1A 4YW6A 2DVBA 2XL7A 1XU2A 3PIGA 2OZJA 2VW0A 2B46X 1DLLA 3CKHA 3VBSA 5A3PA 2W95A 2G9GA 2VQ0A 2EIBA 3DYPA 4GWJA 3O0WA 4I30A 4RR3B 1LKNA 5BNOC 2ZS6B 5IVYA 3M3OA 2C5DA 1D2SA 5F5AA 4AFDA 1JYTA 3THTA 1NQDA 4ZXEA 3U10A 1W8NA 4WM8B 4FPEA 2RMU2 1LENA 4M3CB 3W20A 2YBKA 2DBNA 3M2MA 5JLVA 1F2NA 2O8QA 1R081 3PUAA 2CGOA 1APNA 1R1A3 2W1QA 3HN3A 2KM2A 4HKWA 5FZGA 1VAVA 4QQ2A 2W5FA 4LHNA 3AK0A 1AXKA 1O4TA 2XOMA 4PI0A 1MEC2 3VBSC 5BYNA 4XFCA 1TME2 2IFRA 2O1QA 3SLIA 5F3EA 1DZRA 1AR93 2ZKLA 3BVCA 1QHDA 2CAVA 3J8F3 4NAOA 5FYBA 2KD7A 3VHPA 1WBLA 1FYUA 3ZFGA 5FZ3A 1DGLA 1L3JA 2DCKA 2NN8A 3VDDC 4CSWA 1W06A 4N7UA 4PCRA 5TSWA 3S30A 3IB3A 1HRI1 4AGGA 1AXZA 1S0IA 2A1XA 2VMEA 5CFCB 4P02B 1UAIA 5FYYA 2VUAA 3LE0A 4E8DA 5FZCA 1AX0A 3AYAA 1LEDA 4FOVA 2E7QA 1NCRC 4NRQA 4GB33 4K8FA 4NRMA 5FZ8A 2Y60A 1GR3A 1RVF3 4D7TA 3ENRA 1LGCA 4FFHA 1E5HA 1S0JA 3K4ZA 1AR62 2JDPA 3ZFGC 1CZSA 1PIV1 2D6LX 3NAPA 1YFXA 4KBBA 5HCBA 3BGAA 3MV01 3WDTA 3UESA 4LHLA 4AEJA 3WEZA 5GKAC 4YRDA 5JZGB 3M7AA 3OUJA 4IEVA 4ZU7A 2W92A 3MPBA 1NA1C 5CB7A 5FWJA 2CU5A 4UF0A 4AVBA 4M3CF 1O4YA 2V73A 2XMLA 2QQNA 5I8TA 1OA3A 1YI7A 3A23A 4C1WA 2XUEA 1LTEA 3VL9A 5ACA2 3CHXA 4AG4A 1RTVA 4TLGA 1YLLA 3GZTB 2GMPA 4QB1A 5FXZA 4C8DA 5IK8A 5T5PA 1KS4A 4WZFA 3TN92 1L7RA 1XYPA 5FMOL 2I2SA 1FPN1 3G7DA 1WLDA 3N9NA 1QH7A 4M01A 3SISA 3IDEA 1DQ6A 3VD7A 4A7KA 3IIIA 2JDHA 4TWTA 4BCUA 4BM8A 4CP9B 4Q0SA 4TTGA 3FBYA 5IWFA 1KDKA 3WG3A 1NOVA 3ACLA 4XF4A 2AENA 2EXKA 2HWF1 3BOPA 5C3PA 4OUMA 4BA6A 3KT4A 5GZDA 1UZVA 3H3UA 1IGOA 4Q4V1 3CDZB 4AVCA 4Y1UA 1K5MC 3QH7A 1CZVA 3HMYA 2WAOA 1VBC1 2ATFA 1EPWA 1XBFA 2BERA 5CAZA 5F5CA 3PVOA 4W65A 2ZPXA 1D4M1 4EWAA 1ASJ3 4HVQA 5FY0A 2PHLA 3AYEA 1SHWB 5JR7B 1JTZX 4E2QA 5IVJA 3UKTA 1KDMA 1MZ5A 2WWJA 4OLLA 3S6PA 3VDBA 1RMU1 1JYVA 3U0ZA 3UKNA 2GSYA 1X82A 4QGLA 3T30A 4ARXA 1VR3A 3GHMA 1U5XA 2RG4A 1BEV1 1KXGA 1TQ5A 2D3RA 4OI4A 1PVXA 1W6NB 2HBUA 1C28A 1W8TA 3LZZA 1MS5A 3PDQA 2D6MA 3M4FA 1XJAA 2FBEA 4JGYA 3P6BA 4QGNA 2JKXA 2LROA 2DBIA 4E4DX 3BUCA 4OYUA 4G4FA 1MEC3 1QF3A 3OY8B 1X7NA 4WZCA 3VL8A 3ZMNA 1FV2A 2XVKA 4HK8A 3EYPA 4PQQA 3WDYA 4HOOA 4N9HA 1PMIA 1PM7A 3DUIA 4KQ7A 3VDDB 4OUEA 4FPHA 1UU5A 3WNNA 1DFQA 2RJ2A 2VOKA 1DP0A 1IOAA 1GQPA 4H7MA 4O9GA 2MPFA 4F3JA 3ZIXA 4AVVA 1DGWA 2E33A 2NPIA 1PO21 3NJZA 1W6MA 3GJBA 4P9LA 4PDWA 1XRUA 1NCRB 4FPYA 2E7AA 4JGYC 2JDUA 4TYSA 2WYFA 2PQSA 1RJ7A 4XJ9A 5GALA 3TEYA 4JKMA 1LESA 3RZKA 1AYM2 4CCDA 3MIFA 4IEWA 3IN9A 5FLIA 5CISA 3Q8AA 5D8AA 1KJRA 3ZFGB 4CCNA 1VMHA 5BXXA 4BE3A 4JRLA 4BQXA 1KEXA 4AK3A 3IPVA 2ZABA 3JBG2 4U36A 1A8MA 5GZCA 3OOXA 3W5NA 5T54A 3MW2A 5HXMA 2J1EA 3WVJA 4SLIA 4UAPA 3MW3A 3HNBM 1KS5A 1NA1B 1UX7A 1VBD2 4PDWC 4ZS2A 5CFDC 2JE8A 2HWD3 3NW4A 1ZX5A 2ZHNA 4IERA 4MHRA 4YGBA 3TOJA 3VHOA 5LBEA 3O1SA 3W5MA 2VCMA 1ZREA 5ABJA 1CIWA 5JXIA 1US3A 5KXEA 4UOJA 5JSOA 5D8AC 3POWA 4W6XA 3KGZA 1GFF2 2BVVA 1MS0A 4CCJA 4HLTA 4GZ9A 3AP7A 5A6XA 2XHKA 3INAA 1GWMA 4LOSA 4IXLA 3C7HA 1ZZBA 1CESA 3WF2A 4F83A 2EXHA 4RQPA 1FNYA 4NHLA 3RDIA 2VVDA 3T2PA 3NWKA 2BNMA 3PNAA 1D7PM 3SCFA 3K48A 2ZGPA 2VJXA 5H9RA 1HV1A 1RUE2 5ABJC 3M3IA 4B3NA 4GMP0 4XF9A 1PVC2 2UYBA 3FBMA 2XKPA 3PHMA 3S5AA 1K5MB 4JC1A 5BNNA 3S57A 4XUTA 3LWCA 2XWJB 2RS31 4NJ4A 2DFCA 4Q4X2 5F3IA 1PO12 3RS6A 1CAWA 2VD7A 5EQUA 2BWCA 4LJHA 4EWDA 2W1UA 1ZNPA 2HWC3 5GLUA 3I3MA 4Y24A 1WBFA 5I8SA 2WAAA 3WW4A 1FT9A 3GHNA 1SBEA 4BK4A 5FKBA 1WD3A 5FY1A 2ZA9A 1ZZ8A 3ZYGA 2HEYF 4Z8BA 3AP4A 2XG3A 1CPNA 4WVVA 4M4RA 4BQ1A 2P3JA 5FK8A 2R1BA 1FOD2 2A5ZA 2KXLA 4QQLA 1FAYA 2ZHLA 5BNNC 5IFPA 1UF2C 2GC2A 3MFAA 2EALA 3WSOA 3HEIA 1CAXB 2XB6C 1AF9A 5C8WA 1YXWA 2R6QA 4Y1VA 3PTRB 3Q8EA 2A6YA 5BY5A 5AC92 2JJ6A 2ZACA 4K7JA 3OD4A 4MGKE 4L8QA 4A4AA 4XDOA 1RUD2 1JUIA 5HXVA 4AXOA 1CJDA 3WG4A 1SLLA 2FCUA 3KCXA 1PZ8A 5E1RA 1IQAA 1N47A 2RS12 2VZOA 1RUF2 4E4HA 3GCXA 1OVSA 1W6PB 2ID4A 2ZGSA 2C0ZA 2XPJA 1R092 4XBQA 5FZBA 2VVFA 2FCTA 2GNDA 5FXVA 1PK6A 5FDBA 4KNCA 2WZ8A 1IS5A 4XURA 1GZTA 4GQ7A 2E51A 2D5HA 4WVZA 1K42A 2R071 1NAEA 4RYDA 2AR6A 1CN1A 2FDKA 4XTPA 2VW2A 2JG9C 1PZ9A 4D3WA 1XE7A 4IGOA 2DUQA 2CDPA 2HKXA 4KI5M 4GALA 4PT6A 1NT0A 1JS9A 4IE7A 1UN1A 1QQP1 2ORZA 4QT6A 3HN1A 3KVBA 5DPNA 5FP7A 3VD4A 2WO1A 2VL4A 3VD3A 2WNEA 1PK6C 4YGCA 2WNVA 5T52A 2BZDA 1H9PA 5EXOA 1I6XA 4ISQA 4PDWB 1I3HA 5CFDB 4J1WA 3TRSB 1NUKA 3EHKA 1VBD3 1JUHA 4MZUA 2TNFA 4G9SB 2VUJA 2IXKA 2UURA 2VXJA 5GLTA 4CXWA 1V9U2 2W9XA 2CYFA 1ND2A 1OH3A 1B35C 2WO3A 2QQJA 4XJ8A 2VNRA 3RG0A 3U4SA 1G9AA 3FWEA 1BZWA 4KG8A 1AR73 2WNVC 1LHNA 1KJLA 2WYSA 4HN0A 5KXBA 3O1RA 1U0AA 1C57A 1GZWA 2Y38A 3ACFA 2B9VA 2BBAA 1QNWA 2QNKA 5A3LA 1RUE3 3EB7A 1DGWX 2VUCA 2YPJA 4BJ0A 2YMZA 4E8CA 5FPUA 1YFYA 3TNQA 1V6MA 1ND2C 3JD72 3VBUA 3WQ0A 2VM9A 1VMJA 1UWWA 3SEEA 4MHUA 1OLRA 4Q4X3 4QHBA 1N1VA 4ZS3A 1KFUL 1O59A 4W6WA 1OFNA 2CDOA 1GQHA 4Y20B 1BBT3 5G05L 3N4MA 1VBA3 2WSUA 4XDPA 1V6IA 1W28A 1HX6A 4UT5A 1G9FA 3HOBA 1PGSA 2ADDA 2JENA 4IW3A 2PAKA 2BP6A 2MNGA 1W2TA 5ERLA 5EHDA 1BK0A 1M06G 2VNOA 3I2FA 2ZX1A 4QB2A 3Q8FA 2PHRA 4YW7A 3VBUC 4MH0E 3OGSA 3RZLA 3VBHA 4Q26A 1QJX1 1YJKA 2DVGA 3O1UA 4IE5A 5F3CA 1C4RA 3FUQA 4ZXKA 5AC93 1QJEA 3SKJE 5I0TA 3HAGA 3RSJA 5FMCA 5FZKA 3RYPA 2WABA 4META 1UOFA 2W1SA 4FI9A 3J8F1 1WLTA 1UL9A 2BOJA 4LO4B 2P2KA 2WNOA 3WW3A 3O1VA 2VMCA 4QXHA 1GANA 3HR9A 4LITA 4PIZA 4F7ZA 3F95A 1RC6A 2PMWB 4QDRA 1H9WA 4M0HA 3AKSA 1PM4A 2DURA 3S7EA 5I93A 5K0UC 2RDSA 3WV6A 3MHZA 4UBHA 3O7OA 1TG7A 4CU6A 2XJPA 2Z79A 3MFCA 2EF6A 3B01A 5JCTA 4HONA 5IHRA 3GNEA 2QQIA 3NNFA 1W0OA 2ZTNA 1EUUA 3UK9A 4CP1A 2JG9B 1OA4A 1XYNA 4G3YC 1JZ6A 3AXEA 2R061 3B02A 1RUNA 3V65A 4MGYE 2WINB 1EY2A 5JXJA 5GZFA 2P34A 4IESA 5CYYA 1W8ZA 5FBZA 4Q0QA 3HQRA 1PK6B 3C3VA 1ODNA 1SACA 2R32A 4QXBA 4DRVA 4LBMA 1RUC1 2FMYA 2SBAA 2XBO2 4J25A 1ONAA 3FZ3A 2YUEA 3VKLA 4AFAA 3V0AA 1VAMA 4B7KA 1JXNA 4YG0A 1K45A 2E63A 2WFF1 4Y22B 2VCAA 3WP3A 3ITQA 4RFT0 5J7MA 3OPWA 2QQWA 4AFMA 2BNOA 3H1WA 1V9U3 1AR82 1B35B 2DTYA 1W9TA 1ZBE3 2JIGA 5FO7B 4P9GA 4K3UA 5HBAA 1U5IA 1RITA 1CX1A 2VPVA 3CBNA 4QKBA 3I2OA 2VU9A 1ULDA 4TN7A 4AYUA 3GGLA 1LECA 3ZYFA 3AKRA 2EA7A 2B8MA 5GLZA 3S7IA 3MUZ1 2Y33A 3O1OA 3PMEA 1N3QA 2XR4A 3LDBA 1XNKA 2J1UA 1W2UA 2J1RA 2Q5TA 4MGQA 4UFIA 5DDJ3 4BU2A 5A6YA 2IFWA 3KT7A 1OPOA 3J7MA 2WS92 4XJUA 5LB6A 2HWE2 3FE5A 1UXZA 1H1MA 5CG9A 1H8TC 2YC0A 3FFZA 2VZUA 1DQ5A 1IQDC 2R49A 2WO7A 1UNBA 2WSVA 3JD73 3ZDSA 4O61A 1PGW2 4JGZC 2GH8A 4FPGA 4XJAA 5DAXA 2FDGA 3CZUA 4Y4RA 2J1VA 4ORFA 2A3WA 5GZEA 3A0NA 3WW2A 4DINB 3ZYJB 5IJRA 2VMHA 5LRSA 3EQEA 3CMGA 4XYXA 1AL22 4DRRA 3JB4C 4GJYA 5J09A 4A41A 4JQTA 4ASLA 5K8SA 2IXIA 4Q4Y2 4V2WA 4R9BA 4LKEA 1VAKA 2PTMA 2RE9A 4LBQA 1FV3A 3FLPA 3KHCA 1UZZA 3R05A 3K51A 5FYCA 2Q1ZB 4YVSC 2BJSA 2I74A 1XC6A 2RMU1 2C9AA 4CUAA 4OZXA 1OMIA 3SKVA 2ET7A 4AWDA 1EYBA 3PVBB 4XUOA 4Y5TA 3I2DA 5C3OA 4TXWA 1F9KA 2WWUA 4D8MA 2HBTA 2TEPA 1BCXA 2WN2A 2BOIA 4MG2A 1MEC1 1RIRA 2WNUC 3TNPB 1TME1 1BVP1 1GWKA 2D40A 1UY1A 3KM5A 2YGLA 5LK7B 3FC0A 5T5LA 4Z92B 1VBB2 1FMD3 2ZAHA 3AKQA 4YVWA 4ZHNA 5C33A 2QQPA 2WUHA 3ILRA 4AI8A 2P37A 4B7EA 4CPBA 4L2NA 5K0UB 2JDAA 4S2FA 5K9YA 5IK4A 1G7YA 4HK9A 1HRV3 4MLOA 3N7LA 4YARA 3UGFA 1ULEA 4QD2A 1UYXA 5FR3A 4LA2A 5F1RA 5CA6A 4CEWC 1MS8A 5FPXA 2BW8A 5EYXA 5J1XA 2H0BA 1WZXA 4W6YA 5DMYA 4IEUA 3AMPA 3RZZA 4M3CE 4A44A 3D0JA 4HVRA 1AR61 4YVWC 3WY6A 4PQ9A 4O7XA 4Q1RA 1R1A2 3ZN5A 3GM8A 2WIIB 5LA2A 5K4LA 2NZ9A 3AJZA 5A3WA 5LEKA 5CADA 1F4AA 4OMCA 1UXXX 2HWB2 4KL1A 4NIDA 2I45A 3KF3A 4GH4B 4AF9A 5EJ1B 1MVQA 3VUOA 5FRAA 1POV3 1Q8QA 3E97A 4ITCA 4P9WA 3U78A 4WVMA 4BXFA 2JIJA 2WQ8A 3BPZA 4XUNA 3WT3A 3GJAA 4Q0UA 3WF4A 5FQ0A 4UWDA 1TMF3 5ACA1 3B5LB 5CG8A 2HH9A 4MOAA 2HJIA 3KV4A 4RL7A 1QJU3 2HYXA 3H8UA 4FPKA 1VBE2 3LDKA 5A7PA 4LUMA 4X6QB 5FZ1A 5F6KA 4JKLA 1JYCA 4FPOB 2Q8OA 3ST7A 3VKMA 1O7FA 3NNMA 3TN91 4DY3A 2BQPA 5FZOA 3OEBA 1YHFA 4GB32 4KU8A 5A7WA 3USUB 3Q8BA 4QX2A 3LIHA 4GULA 1RVF2 4XACA 4QB6A 2QBXA 1QWRA 5FYMA 5JOXA 4JDNA 1OVPA 5JR2A 4YG6A 5FY9A 2WS93 1H8TB 2HWE3 4MO3M 4XILA 4HETA 3B3QE 2C24A 4QX5A 1UY2A 2D44A 2EAKA 3PL0A 4JGZB 3OYWB 3KQRA 4E2GA 1W2OA 3SCHA 1W0PA 2ZZJA 5JUVA 4CCCA 4QAWA 2VULA 3H1YA 4QX7A 3N9MA 2CGNA 3U75A 2Q8CA 5JDBA 1ZRDA 2OIIA 1SCRA 5JOYA 3VDAA 1ULPA 1ND3B 1WLWA 4Q4Y3 4FPFA 5JIAA 4A42A 2Z5WA 5FP9A 3WXPA 1SCSA 3DF0A 5F37A 3GALA 4HPKB 2J22A 3DECA 2EXJA 4YYOA 1PX4A 1OF3A 4PIYA 1ACCA 4YVSB 5DZGA 4QXCA 3AZZA 2VZTA 2D6KA 4QPGA 3NMBA 4AAXA 4IEPA 1Q5OA 1YIPA 4D0QA 1OKOA 2E7TA 4DUWA 4BLJA 1I5ZA 5F5QA 3MLKA 3JUUA 4Y1ZA 1WWYA 1UY3A 5CNAA 4PLNA 1DIWA 1UZ0A 2WNUB 5DXDA 5FPVA 2WDBA 3EJKA 3LPGA 1MVEA 2OUHA 4B1LA 5I0RA 1VBB3 4GWMA 5JPNB 1UPIA 3KVAA 3W58A 3WG1A 5KR7A 3VZMA 1DU3D 2NLRA 2DTWA 3HNMA 3IBMA 1SFPA 5FBJA 2W1WA 4YW3A 2ARAA 1C8M3 3I3DA 1ASJ2 1H2MA 1W6QA 3MIHA 3VHNA 2RM23 5FY8A 3WP5A 4JDOA 4E27A 4FT8A 4CDWC 1JU3A 4CEWB 2ENRA 1Z0HA 1WCDJ 1YI9A 1UMHA 1HQNA 4LUKA 2VXRA 2D5FA 4JZRA 1AYM1 4S2GA 3VKFC 4AGVA 1GZ9A 1D0HA 4AHYA 4E9KA 1RUI1 2QJVA 1U12A 1CPMA 1UU6A 5FPLA 3MIBA 1Y9MA 3JBG1 3VBOA 4Q0PA 1UW8A 3HNYM 3GCWA 3LOIA 4IE4A 4S2HA 4A6SA 3ZXDA 4XOGA 4AR2A 2PHWA 2X8KA 2HWB3 4GAZA 3ZSKA 2FHRA 3N9PA 4ZU4A 2NM1A 3LF7A 2VMIA 1VBD1 1PNFA 2AACA 2GMEA 1WA6X 3KV6A 3ALQA 1IPJA 1S2EA 2XJVA 3AZXA 3GBFA 5FZ4A 2ZGRA 2DDUA 2VZ1A 1GLHA 3JQWA 3LAGA 3JXSA 3WR0A 4LE4A 3B93A 5FOJB 4QDSA 2ZBJA 1DQ0A 2DUPA 4DXSA 1N1YA 1E5IA 1VBE3 3HT2A 1QXPA 3LQCA 3OF1A 2GNTA 1JZ3A 3AX4A 3EBRA 1LOCA 2N7GA 2VOXA 2WLQA 4NMIA 2RHPA 1YIFA 4I01A 4NR1A 5D2AA 4P5HA 4BOWA 3R0RA 2DYCA 3NO8A 5FZIA 1VRH3 2QE3A 3POBA 1BKZA 4AEDA 3X29B 4KMQA 1CAVA 2XJSA 1LHWA 1UZYA 5F2SA 4OI2A 3D6EA 4CCLA 1AJKA 4A3XA 2VZPA 5AFBA 3FFQA 1RUE1 5JMOA 5M0TA 5LA0A 4HVOA 1IPSA 4NHXA 1GV9A 1PVC1 3AL5A 2DVDA 4Y1YA 1OURA 2X5IA 4CZSA 3W59A 1STMA 2HWD2 4LHKA 1PO11 1SDDB 1PNGA 2X10A 5AVPA 1LAJA 1LOFA 3H8RA 5C70A 2IC1A 4XFAA 4XFBA 3P3NA 4IE0A 5CKMA 3MDPA 2CL2A 2VOTA 1QJZA 4N8MA 3S0MA 2BWAA 4F8AA 3NAPC 3LD8A 2XWBB 2P5BA 4I3PA 1FOD1 3N9OA 4YLZA 1HN1A 5KHKA 1Q8PA 2EAAA 4JKKA 4FCAA 1WMEA 1QOOA 4BDVB 5CBLA 3IMNA 2ZZQA 4QPIA 5IT6A 1W2NA 5AVAA 3V64A 1RUH2 1O4ZA 5L9RA 4HKOA 1RUD1 4L9BA 4EN8B 4P08A 3ZX7A 1Q3EA 4LULA 5J37A 4GWNA 2RS11 1RUF1 1ZZCA 3BPSA 3E6DA 4ZKTB 4K1YA 1ZRFA 1LU2A 1DHKB 3H50A 4QM8A 1R091 4MGSA 2KR2A 2HWC2 1Z78A 4XBLA 1IS6A 3OCPA 3WP6A 1CONA 5BNOB 1PGL2 3LIGA 1E5RA 4IEZA 5EJZB 4CDWB 3LKJA 4H14A 2A6WA 2F4LA 3VZLA 1H2KA 1HXS3 1NG0A 2DCTA 2VAUA 1JZ2A 1UY0A 4RFRB 2ZMKA 2QDNA 4DXZA 4C0HA 2FQPA 1S2KA 5SV8A 4IV1A 3NSTA 2RDQA 1CGPA 1WW6A 1NLRA 3DXUA 1GQGA 3LEIA 4KGQA 4A2UA 2PAEA 3MF9A 4XF0A 3WP4A 4XQDA 1EAH2 4EN0A 2YXSA 4IEOA 2H6CA 4RHV3 3VBSB 3ILNA 3FLTA 4TLFA 1NXD1 1WA4A 2P4EA 1W6QB 5FUPA 1BHGA 2A7AA 2NQYA 2VH9A 3OPTA 1AX2A 4IQPA 1IZ3A 2WJSA 3Q9OA 2DCYA 1X9PA 2VZ3A 3RZJA 2VCCA 1XE8A 2Y64A 2RR13 3P1IA 1K5JA 1V9U1 1E5SA 1HJGA 2BYVE 2YHJA 4DS0A 3QOPA 5FP3A 2XL9A 3WQBA 3POGA 4LNVA 4W50A 3JB8A 3DPRA 2YFZA 3DEMA 3TAYA 4YWAA 4N53A 3N9QA 4LBQD 3OUIA 5FJKA 3ES4A 3K46A 3BTXA 1O5UA 5SV5A 2R043 1JHJA 2W3JA 2WZR2 2G9ZA 3JCIA 4FVVA 2QCSB 4MGZE 2GC0A 4Q0VA 2DVAA 5IUQA 3I3EA 2A71A 3AC0A 1X8MA 4X6RB 4MXWA 2R16A 5DABA 5C3QA 4OMDA 4XIOA 2GDFA 3ETQA 3JD71 3MPPG 5A1LA 1UO9A 2ZKNA 5JMCA 2ZGQA 3CIHA 2QDRA 3UJOA 4DOUA 5J96B 1F8VA 4NIAA 4LOTA 2YU2A 3APBA 2FDFA 3A22A 1J84A 3O0VA 2LW8A 1WKYA 2VMDA 2JB4A 4AQ2A 3PU8A 1LHVA 5FTTC 1G9BA 4UFKA 4CCMA 4XF3A 3UL2A 2P1BA 1QOSA 4CPBD 4PIXA 5J48A 4FTEA 3NAPB 1S0CA 5DZFA 2UY8A 3ECQA 5EP9A 1XNBA 1WW5A 1FXZA 1XNCA 1AR72 2K46A 5KBFA 1LOAA 5FLJA 1QDCA 4KH9A 2XH6A 2DCZA 2ZX0A 4QQOA 5FZDA 3RMYA 2W47A 2MEV3 4HKLA 3DKQA 4L99A 3TEXA 4LE3A 4UF0B 2D7FA 4XCAA 1LGBA 4XFGA 5L7OA 3VKOA 1SLCA 5T5OA 1BK1A 1JYIA 1RUH3 3MYXA 2A6ZA 3AMHA 3KQ4B 2VECA 2UWBA 5EPAA 3BYWA 4NN0A 1MPXA 1QJY2 2P6HA 3OGRA 1DYOA 3PUQA 4YZ4A 3ZFEA 2Q4SA 3LEGA 1YUDA 3VLBB 4FBFA 5A80A 3PTYA 3OUHA 3Q8CA 3WDWA 4D7SA 4EZ4A 1G9DA 4HFSA 2ZCWA 2E9QA 3NJVA 1BBT2 1VBA2 1V00A 1HB2A 4RQPC 1LCLA 4DEQA 1SQ4A 3OJBA 3U14A 3CF6E 1VMFA 4Q27A 1ENXA 4HSLA 5A7NA 4UFMA 2YYOA 1IS4A 4DY5A 3L2HA 1CAUA 4Z2WA 4K40A 5FZLA 2VQAA 1RHI2 2BGOA 4M4PA 2IUWA 3N36A 1OSGA 3FX3A 5IAVA 3DN7A 2RDRA 3HQXA 4M00A 2J42A 3NV3A 1HJFA 3ETPA 4PBOA 4XETA 5KXCA 5C3RA 5A32A 2VOVA 1EAH3 1O3SA 3DYMA 2WT0A 1BJQA 3LA3A 4QU2A 4CEYA 5D21A 2XBO1 1QNYA 1LNSA 4XQ4A 5CZKA 3GZAA 4QU1A 4AVTA 1JZ5A 1O3RA 4KGGA 3KB5A 2ZX3A 4MVTA 1IHMA 2UWAA 3N7MA 3N9LA 5LK5A 4FXKB 5C4WA 1XSQA 2RDNA 5JSPA 3B00A 4FFIA 5EV7A 2W0XA 1WCKA 1ZZ6A 2ES3A 4OFGA 1AR81 3VKNA 1BMV2 1QU0A 4QX8A 1UU4A 4EE2A 5EWSA 3DXTA 5F32A 4GKXA 4JGYB 3NV2A 4O65A 4NWVA 3WG2A 3BI3A 4ZPIA 3ZR6A 3ELNA 1V6LA 1O8SA 2RJKA 1AYN2 3J7HA 4QPYA 4RS5A 4YGDA 3HBKA 1S0DA 1J3RA 3B9CA 1X50A 1SLBA 2WZR3 1X8EA 1AL0G 2WS91 1WGPA 2HWE1 3ZN6A 4D69A 4OI1A 4LHSA 3VHRA 3LCPA 3H7YA 4XUQA 2OA2A 4IGPA 4A7YA 5A3MA 5JOWA 2PHTA 2D6OX 4CU9A 1RUOA 1W6MB 3I7DA 1PGW1 2CY6A 4AHZA 5I0DA 4ZY9A 1UOBA 4XHBA 4OI0A 1MQTA 2W2IA 1RYYA 1H8VA 4S2DA 4U2AA 4DIQA 4K6BA 2HLEA 3VBFA 5EFUA 5IW0A 1ULCA 1YQ5A 4RS5C 4ASKA 2AGSA 5D8AB 1AL21 4DZGA 1DYKA 2WT1A 3E5QA 1BEV2 1NY72 4IV3A 1XNAA 2XHNA 3IPVB 2D97A 5J36A 1ZBE2 4UFLA 1DDLA 4Q4Y1 1LULA 1R083 5FZAA 2JDNA 4LLOA 5C71A 5A3TA 1JZ7A 2HEVF 1W9FA 3THDA 1OFSA 2ERFA 2OUJA 4DMIA 5FZ9A 4FP2A 2YDEA 1C8NA 4PLOA 2BGCA 4X8NA 3DYOA 5DDJ2 5C5UA 1MZFA 1N1TA 2GN3A 4DB5A 2QQUA 5ABJB 1GICA 4ISRA 3VBFC 4CDUA 4ES8A 2BGPA 1ULFA
chains in the Genus database with same CATH topology
1C1FA 1NLSA 1HRI3 1AVBA 3DL3A 4IV3C 1N3PA 5A33A 3RYKA 3VV1A 4DFSA 3M3QA 1QJY3 1FNZA 2RS52 1LR5A 2ZHMA 3OPZA 1S2BA 3D4KA 5BNQA 4RQPB 4EV0A 3MF6A 1NZCA 4BH9A 1OA2A 1KFXL 3CEWA 4EROA 4H3WA 1Z7S2 5FMOS 3ZPYA 5BNPA 4CP0A 2GAUA 2CNAA 1X33A 1PIV3 1TEIA 3CNAA 4XMAA 3ZFFA 3KSCA 2E53A 2GZWA 1RHI3 3WNXA 5BNNB 2B7YA 3BTAA 3FJSA 2ZX4A 3T2TA 1QXJA 4JAAA 1OD5A 1CAWB 4XFIA 1H2LA 1R1A1 2BFUL 4YG3A 2NP0A 2ZMNA 4CYDA 4P9XA 3B69A 2HWB1 3QBQA 3AJYA 3UKVA 1AR91 1FMD2 2YGMA 4AI1A 3R4UA 3I59A 2PHFA 2XKOA 1V6KA 3VBHC 2JG8A 1VBE1 4Y4YA 1HRV2 4KWLA 4Z1VA 3WD5A 2XVGA 1YFWA 2HWF3 3J26N 3WCRA 1DQ1A 1AYN3 2C1FA 3POSA 4GB31 1OKQA 3RRDA 1Q8SA 5EYYA 1RVF1 4AI2A 4AQSA 1HQWA 4AGRA 1QDOA 1SEFA 2CAUA 3ZXEA 5DUVA 3U07A 4BPZA 4Y1XA 3KZ4C 5KHGA 1CVNA 1VBC3 2LM3A 1R1ZA 1VB4A 1N1SA 1S0BA 3M3EA 2WZPP 1D4M3 5T3NA 2BTVC 2JG8C 3KCYA 1C5HA 3CJXA 3MLJA 3LA7A 1BQPA 1RMU3 1N3OA 2OVUA 5B2GB 1TMF2 2A73B 4WVWA 4CP2A 1B09A 1S0GA 1BEV3 3NKTA 1QJU2 2DU0A 2H0VA 3J4UH 1OPMA 4R4ZA 3SH4A 1ENQA 1MS9A 1OQDA 1NE6A 2KA3A 5CVRA 2A3YA 2WNVB 3MIGA 4L11A 4ONUA 3NV4A 3RI8A 1JOJA 1SLAA 2Q1MA 4B4RA 2CTVA 3WHTA 2XJQA 3ZSJA 4NOTA 4Q4W2 5FREA 1ND2B 4XFHA 1RUJ2 3R6SA 3QH6A 1QH6A 4JDMA 4R9DA 4URTA 1QMJA 3DV8A 4AEMA 1NCQA 2RS53 4AVAA 3AM2A 1PO23 2A70A 1UIJA 2WC2A 4D7YA 1AJOA 2CWMA 2YY1A 4YW2A 3QACA 3MIDA 4OHWA 4ATFA 1VALA 2VVEA 3SCGA 1GZWB 4YSFA 1ASJ1 1Z7S3 1DQ2A 4J6GA 4MV2A 1QQP2 1LEMA 1Q56A 3FMGA 2Y0OA 2F6BA 4BZ4A 5A33B 5C9AA 1HKDA 2Y0IA 1UIKA 4FQZA 3VBUB 1A8DA 3E6BA 3WW1A 1DZQA 1ZZ9A 3THPA 1NCQC 2WQZC 1UMZA 2WT2A 1OHFA 2AH2A 2X53S 1UKGA 3CJIA 4LBLA 4V1PA 4XEZA 2GC3A 4QQPA 1YCIA 3MW4A 4ES9A 4NVPA 1LHUA 5FCCA 3OBTA 5JI7A 4HT1T 3V0BA 4YZ5A 1NYWA 4XQWA 3BB6A 5JSRA 4FPCA 3VBHB 1WMDA 4R52A 1C8M2 2HYKA 1GZCA 2RJLA 3WQ1A 2RM22 3NL1A 4RR3A 2JDZA 4TSVA 1MZ6A 5T55A 2PHUA 5FPZA 1REDA 1VP6A 4XJWA 4WM8A 4J1XA 5L36A 2SLIA 1UPSA 4HSJA 2D3PA 4M3CA 5GM0A 3RJRA 1T6GC 3OGJA 2IXLA 3I59B 4C91A 2K0GA 5JVVA 5I0SA 3GYDA 1U5ZA 2XLAA 1AXYA 1YJLA 2VOWA 4YZ2A 5KHJA 1V70A 5CU1A 2TUNA 4P9IA 1CD3G 2HWD1 2W68A 5KXDA 3B9IA 3VZOA 2IXCA 4AI3A 3ROUA 3PLQA 4WM8C 4LO6B 4FXGB 4HANA 4MSVA 4AW7A 3TYJA 3ZXAC 3NKGA 1YNAA 3KMHA 1OQ1A 5FO8B 3SH3A 1OOPA 1DBNA 4XXAA 2VG9A 4GKYA 4AHWA 4YM1A 3V0AB 1VRH2 3RMXA 3ZVXA 1J58A 3IDBB 1WCSA 2XGXA 4GXLA 2FMDA 3TBDA 3TWIA 4OVEA 4Q4W3 1RUH1 5HCFA 4XIKA 1GSLA 1RUJ3 2X29A 1Y9QA 4OHYA 4JTNA 2NMNA 2UYAA 2R073 1OOPC 1UKRA 3AZVA 1RUG2 1DQ4A 4FTBA 1GYKA 2HWC1 2NMOA 4P9YA 3WUDA 2R062 3URFA 2Z2SB 1PGL1 1TNRA 1QQP3 3RQ0A 2PN5A 1I1EA 3OD0A 3ATGA 1ALYA 4KWJA 2PHXA 3B94A 5C8CA 4FPJA 2D3SA 4BLIA 5J3UA 1LOEA 5BUVA 5GJ6A 1Q8OA 4LR4A 2VY0A 4MGIE 4WM7A 4LTAA 1FATA 3IDCB 2W39A 4N7IA 4GMP3 2P3IA 3AMQA 3WDXA 4K1ZA 2DWRA 1UX6A 4LBQB 2ETEA 1Y3TA 1CR7A 5FO9B 5HCAA 2QVSB 4MYEA 4Q8KA 5C8CC 4N43A 3ZYIB 4QPGC 3IIAA 4OHXA 2JKBA 4E4SA 1HV0A 1YO8A 4WM7C 1HXS2 5BPXA 3WCSA 1RGSA 1RB8G 4NHMA 3R4DB 2UU8A 2AREA 3GBGA 3MIEA 1F5JA 3PVEA 4QMAA 4YVWB 2LALA 2WZR1 5K7PA 4FOYA 3BOWA 4E2SA 4COVA 1W6NA 3LSDA 3AMNA 4RHV2 4N43C 3HIFA 2FZ1A 4TZDA 3JZVA 1LGNA 2QZ2A 2LUWA 3OY8A 1XU1A 2GH2A 4COWA 3VN4A 1OQEA 2B45X 3VDDA 4B29A 3OGGA 2RR12 3HWJA 1HLCA 1DZTA 1G86A 2PELA 1QJX3 3VBOC 1Y43B 4UW6A 1VLNA 4D94A 3SHRA 1AR71 4XHXA 1NCRA 4COUA 2D6PA 1XXNA 1LOGA 2A3XA 4YM3A 2R042 4WVMB 2DU1A 2Z69A 4LBJA 1E57A 4B8EA 3VBRA 2GU9A 5H9QA 5FQ0B 4RGGA 1KITA 2ARXA 3W9AA 2BNNA 5E8AA 1ZRCA 3JU9A 3VZJA 3BALA 4EJRA 1QJY1 5GLVA 3MZHA 2GN7A 1NA1A 1OOPB 5T5JA 3TB0A 4Q4X1 2B39A 4I0AA 2PHDA 5KWRA 1YYNA 3FHIB 1RUG3 2PFWA 1BBT1 1VBA1 2R063 3BU7A 5D1IA 4AEDC 1SBDA 1YRZA 5F9TA 3VBRC 1XNDA 1RHI1 2ZHKA 1RUC3 3E5XA 2A6VA 3GBWA 4NWWA 2MEV2 2WWSA 4XE9A 2X5IC 4CDXA 4COYA 4ATEA 4KG0A 3PJYA 2WFF3 2DUOA 5AFEA 5IK5A 1A3KA 1LOFC 1F5FA 1XYOA 4BHPA 4N9IA 5L19A 5AC91 2EVXA 2Z42A 2VW1A 5E16A 3OTFA 1RL3A 4N90A 1K5MA 3AYCA 5C8CB 1ZBA2 1PHMA 4QPGB 2UY9A 1ZM1A 5C6CA 1BMV1 4CDXC 4WM7B 1COV2 3AZYA 4QPIC 4HN1A 1REEA 1AYN1 1S1AA 1IKPA 4QGMA 3SNMA 1J1LA 1LOBA 5FAXA 2VGDA 5GLWA 3I4IA 1CAXA 1SMVA 1EV12 4N43B 1DGRN 2Q0AA 2JX9A 3U4XA 4HMZA 1QY4A 4AHXA 1M4WA 1W39A 2FZ2A 5DG1A 1EP0A 4YGEA 2ZAAA 3UV9A 1HDKA 3IT8A 1W6PA 3MI8A 2RMU3 1CJPA 1YFUA 1NY71 2BVBA 2CWSA 3LA2A 4IV1C 3VBOB 1C3HA 1ZBE1 3KD4A 2WL1A 3AFKA 5JWPA 1H2NA 1ZVFA 2JE9A 1C1LA 4R9AA 3SMHA 3A4UA 4IEYA 4LBNA 5L73A 3ES1A 4FAGA 1TME3 1GKBA 4DNYA 1QXRA 2XLFA 1U5YA 4Q29A 1DGRA 5DDJ1 4BIFA 3R4SA 1POV0 1KRIA 2PLV2 1I9RA 3N7JA 4XW3A 1IKQA 3AZWA 4INDA 5DUUA 1BXHA 1D2QA 3MGUA 5FOBB 3AFGA 1NE4A 2RS51 3O5SA 4NO4A 5CFDA 3DPRC 4H55A 3H1MA 4LT5A 3RNSA 3KLSA 4AEDB 4N53C 1W6OA 4B4PA 3M1HA 1CAVB 5HI0A 1RUI2 4I09A 5KHIA 1Z7S1 3VBRB 1AR63 3ZYRA 1R082 4BIOA 3LSEA 2OZ6A 4YZ1A 3AXDA 3N35A 1LRHA 4UXAA 2ZMLA 4B4QA 3D5OA 2O8OA 2CGPA 2X5IB 4IETA 4LLFA 4I2OA 2V09A 3AB0A 2V5YA 4NHKA 1H4HA 1SDWA 4UW5A 3IKWA 4JQRA 2GALA 1V6OA 2AUYA 5ACA3 1HRI2 5H9PA 2IXHA 4C1XA 2QKDA 2QUOA 1FMD1 4UW3A 1MS4A 3IWZA 3L9JT 3GZUC 3ZXKA 4C90A 1FI2A 1ZBA3 4QQHA 3TN93 4Y26A 3BIWE 2XLGA 3D8CA 3LB9A 4ASMB 3T1LA 3B7MA 4Y20A 4CDXB 3O12A 5J98B 1Q43A 1RJ8A 1COV3 1HRV1 4QPIB 5L7OC 2PQQA 1PIV2 2E6VA 1NXMA 1EPZA 1HQLA 4AFCA 2H6BA 3ZFEC 1KQRA 1LODA 2R0FA 2XJTA 4NPRA 4HZFA 3E5UA 3ILFA 5BV6A 1EV13 2K9ZA 4LO8A 3SITA 4X8PA 2ET1A 3RJ2X 4OULA 4I0BA 1QKQA 3N7KA 4DPNA 3RPQA 4GIQA 1POV1 3O14A 2A75A 1C5IA 2G4IA 2JD4A 3AMMA 1FPN2 1SLIA 1ZA4A 5DZEA 1VB2A 3WOGA 1TMF1 1ULGA 2B42B 3JQXA 4IV1B 5KHHA 4DQAA 1QJU1 2AYHA 4L92A 4GA9A 3V56A 2IWGB 4KU7A 2HWF2 4CEYC 2P3KA 3DGTA 1WW4A 4RA0A 2JG9A 2O0OA 3DKWA 5KC5A 4Q4V2 1JBCA 4QXKA 4R9CA 1SLTA 2DFBA 3I54A 3M8LA 2PLV3 5C4WC 1VBC2 4Y5Z0 4Q4W1 5JOZA 4COZA 1RUJ1 4L97A 1D4M2 1VJ2A 4K9SA 4JV4A 1H1AA 3DPRB 3KGLA 1D4VB 1RMU2 4N53B 4Y22A 1FX5A 1QOTA 1AYM3 3AYDA 1ENRA 1RUI3 1NQJA 3M70A 4XBNA 1B35A 3NV1A 3JBG3 2XVLA 1H0BA 2UWCA 2B9UA 4XTMA 5E88A 2ARBA 2WKKA 4MXWB 3H3ZA 2DVFA 4K21A 4XPVA 3CU7A 3KS7A 2WA3A 4JVAA 1OI6A 2DV9A 2GC1A 3CO2A 1MQTC 4UW4A 1ZZ7A 4CDQA 2A6XA 1W6OB 2MHFA 3SH5A 4GMP1 1Q8VA 3HT1A 3WUCA 2ZGMA 3SXWA 4WV8A 3IM0A 3ZXFA 4EN7B 4FPLA 1VBB1 1PO22 4YFWA 5FLHA 3ZMOA 5DUWA 1ZRRA 1O3TA 5DG2A 3ZO0B 1C8M1 2BEOA 3WINE 4XF1A 2RM21 3WDUA 5L7OB 4CDUC 4CDQC 4YW4A 1O3QA 3EXUA 4XMIA 2NYYA 3CL1A 4LBOA 2OYZA 1PVC3 3USSA 1LJ7A 3ZFEB 2JE7A 3H9AA 1V6JA 1O91A 3ASIA 3MLLA 5I91A 4LEJA 4O9EA 1ZYBA 2XUMA 1WLCA 1PO13 2PA7A 2EXIA 1A6CA 4FAHA 3L2YA 1GNHA 4XJZA 2I07B 1LU1A 4YW1A 1G9CA 1CQ9A 3H0OA 4YZ3A 5BNPC 1WW7A 3FLRA 1CAUB 4R8HA 4YW5A 3ZFFC 2Q30A 4FTSA 2JICA 4Z07A 1FPN3 1MS3A 1FOD3 3N3HA 3POYA 3A0KA 3U11A 5K0UA 2ILMA 4I02A 4PLMA 2WA4A 3T1MA 1V6NA 3RI9A 2IXJA 4XFFA 5A32B 5KC6A 1QGLA 5EZWA 2G9FA 4CEYB 1BYHA 3UJQA 2YROA 1H30A 1RUD3 1VRH1 4AVSA 1A78A 4Q4V3 2RS32 5C4WB 2RS13 1RUF3 1IPKA 2DF7A 5FFOC 1AUYA 2F4PA 1R093 3WZ1A 5E89A 3M3CA 1SFYA 3BODA 4AFBA 1J59A 1J1TA 4I0WB 1H1IA 4LO5B 4GH4A 3VZNA 5JI9A 4LBKA 3KT1A 4WBBA 4RS5B 5EJ3A 4EN6B 1RUG1 2QZ3A 3WX5A 1URXA 2Y26A 4H7LA 2VMGA 2WFPA 4KWKA 4HL0A 3FUOA 3ZN6B 1SBFA 2PAMA 3CLPA 2WQ4A 4YFZA 4FO9A 4E4ZA 1S55A 2W08A 2D93A 2ZGLA 3VZKA 5F6LB 4MXVA 1VIWB 3USUA 1MQTB 1S0FA 4XZPA 4GH4C 3RWNA 2ZGTA 3VBFB 5DUXA 1UCXA 3LOBA 4IV3B 2EIGA 3E6CC 1H8TA 4EN9B 3MEPA 1JN2P 2OW4A 3VGIA 4AQ6A 4P14A 4RGAA 1X36A 4JGZA 4YNIA 4JTOA 1JHNA 1AHSA 4Q2FA 3OYWA 4OHVA 3EO6A 2R072 2PYTA 3J9SA 1UD1A 3HD8B 5JAXA 4FOQA 2K2SA 4CDUB 4CDQB 1REFA 3ZXJA 4R4XA 1ND3A 4BMEA 1HXS1 2ZGUA 1F31A 4HPKA 5I8YA 4I3GA 4YVSA 3QLQA 4QM9A 3PVNA 4AE2A 1GBGA 1CX4A 3AP9A 4RHV1 2R30A 3PJQA 4BYYA 2BUKA 5BNPB 2WNUA 3D82A 2ZX2A 1JH5A 4UBGA 4RD7A 3ZFFB 1ND3C 1S0EA 2ZOEB 3AP6A 4SBVA 4PF5A 5C9AC 3WLUA 2QFEA 1RINA 1KD7A 2RR11 5T50A 4XDQA 3NVCA 1MZEA 4BWOA 5IK7A 2JEMA 3GF6A 4FOWA 4P9JA 3CJIC 4CEWA 2WLPA 3I8TA 1BVVA 2R041 3ZSLA 1LHOA 2RS33 3O0XA 2XJRA 4CTEA 1PZ7A 2R1DA 2JG8B 4EWEA 2B5HA 2LTNA 4RR3C 1TNFA 2OPKA 4YM0A 2JECA 1WMFA 4Z82A 2D98A 1DYPA 4C0BA 3BCWA 4OHZA 2D43A 2HEWF 4ZU5A 1QJX2 5CFCA 2JXAA 3P3PA 4AI0A 2VNGA 2XJUA 4MUVA 2DCJA 2XBO3 3D0SA 4Q8LA 5GZGA 2P17A 2GMMA 2MEV1 1LB2A 2BPA2 4AEKA 1AR92 1JW6A 3J8F2 5H9SA 1IS3A 1ENSA 5JIUA 4FQ4A 4LO7A 2D6NA 3AP5A 3AKPA 4IEXA 1OLQA 4K20A 2R0HA 1HIXA 5JPMB 4IL7A 1AR83 2GNBA 1O5LA 4LA3A 4JCKA 4MX3A 2YV8A 5CFCC 3LGRA 2BBVA 5JZGA 4BMBA 1XQNA 1ZBA1 3PMSA 4OUSA 3ZXLA 4RSUA 1DG6A 1G6NA 3ZSMA 4HBNA 1COV1 3ZSEA 3H7JA 1GNZA 3ZIWA 2YZ4A 4A7ZA 1SFNA 1D0GA 2ZGOA 4FSJA 1RUC2 1NCQB 1J3QA 4M0NA 1WUVA 5LRRA 3AKTA 1AX1A 3HBZA 3ZXGA 5JZGC 2WFF2 2ZJCA 1EV11 1EAH1 3QCWA 2W52A 2CV6A 4Q1PA 3WQ7A 1AL23 3WDVA 3OBRA 3RYRA 2TBVA 1HW5A 1J3PA 1AZDA 4XXPA 3MICA 5C9AB 3WHUA 4CRQA 4AQTA 3QD6A 2ZGKA 1TE1B 2GNMA 4IEQA 1WD4A 5BNOA 3G6JB 3KCCA 2IZWA 4FP3A 4JRAA 3ZYPA 4CDWA 3CJIB 5I0UA 1YWKA 3ZN4A 1DF0A 1MACA 2BFUS 1MR5A 2AZ5A 1Y7BA 1H4GA 4YM2A 5CIRA 3C2UA 4PJYA 2ZGNA 5LEJA 3ME2A 4PBPA 3V0BB 1G8WA 2PLV1 1MS1A 2DVBA 2XL7A 1XU2A 2OZJA 2VW0A 2B46X 1DLLA 3VBSA 2G9GA 2VQ0A 4I30A 3O0WA 5BNOC 4RR3B 1LKNA 2ZS6B 3M3OA 2C5DA 1D2SA 4AFDA 3THTA 1NQDA 3U10A 4WM8B 4FPEA 2RMU2 1LENA 4M3CB 3M2MA 5JLVA 1F2NA 2O8QA 1R081 2CGOA 1APNA 1R1A3 2KM2A 4HKWA 1VAVA 4QQ2A 4LHNA 3AK0A 1AXKA 1O4TA 1MEC2 3VBSC 5BYNA 4XFCA 1TME2 2IFRA 2O1QA 3SLIA 1JYIA 1DZRA 1AR93 2ZKLA 3J8F3 1QHDA 2CAVA 3VHPA 1WBLA 1FYUA 3ZFGA 1DGLA 1L3JA 2DCKA 2NN8A 3VDDC 4PCRA 4N7UA 5TSWA 3S30A 1HRI1 4AGGA 1AXZA 1S0IA 5CFCB 1UAIA 2VUAA 1AX0A 3AYAA 1LEDA 4FOVA 2E7QA 1NCRC 4GB33 4K8FA 1GR3A 1RVF3 4D7TA 3ENRA 1LGCA 1S0JA 1AR62 3ZFGC 1PIV1 2D6LX 3NAPA 1YFXA 4KBBA 5HCBA 3WDTA 4LHLA 4AEJA 5GKAC 4YRDA 5JZGB 3M7AA 4IEVA 4ZU7A 3MPBA 1NA1C 5CB7A 4AVBA 4M3CF 1O4YA 2V73A 5I8TA 1OA3A 1YI7A 4C1WA 1LTEA 3VL9A 5ACA2 4AG4A 1RTVA 1YLLA 3GZTB 2GMPA 5IK8A 5T5PA 1KS4A 4WZFA 3TN92 1XYPA 5FMOL 2I2SA 1FPN1 3G7DA 1WLDA 4M01A 1QH7A 3SISA 3IDEA 1DQ6A 4A7KA 4BCUA 4TWTA 4BM8A 4Q0SA 3FBYA 1KDKA 3WG3A 1NOVA 3ACLA 4XF4A 2AENA 2EXKA 2HWF1 3BOPA 4OUMA 4BA6A 3KT4A 5GZDA 3H3UA 1IGOA 4Q4V1 4AVCA 4Y1UA 1K5MC 3QH7A 3HMYA 1VBC1 2ATFA 1EPWA 5CAZA 3PVOA 4W65A 2ZPXA 1D4M1 4EWAA 1ASJ3 4HVQA 2PHLA 3AYEA 5JR7B 4E2QA 1JTZX 3UKTA 1KDMA 1MZ5A 4OLLA 3S6PA 1RMU1 3U0ZA 3UKNA 2GSYA 1X82A 4QGLA 1VR3A 3GHMA 1U5XA 1BEV1 1KXGA 1TQ5A 2D3RA 4OI4A 1PVXA 1W6NB 1C28A 3LZZA 1MS5A 2D6MA 3M4FA 2FBEA 4QGNA 4JGYA 4E4DX 4G4FA 1MEC3 1QF3A 3OY8B 1X7NA 4WZCA 3VL8A 3ZMNA 1FV2A 2XVKA 4HK8A 3WDYA 4N9HA 1PMIA 1PM7A 3DUIA 4KQ7A 3VDDB 4FPHA 1UU5A 1DFQA 2VOKA 1IOAA 4H7MA 4O9GA 2MPFA 4F3JA 3ZIXA 4AVVA 1DGWA 2NPIA 1PO21 3NJZA 1W6MA 4PDWA 4P9LA 1XRUA 1NCRB 4FPYA 2E7AA 4JGYC 4TYSA 5GALA 4XJ9A 1RJ7A 1LESA 1AYM2 3MIFA 4IEWA 3IN9A 5FLIA 5JSOA 5D8AA 1KJRA 3ZFGB 5BXXA 4BE3A 4JRLA 4AK3A 3IPVA 2ZABA 3JBG2 4U36A 1A8MA 5GZCA 5T54A 3MW2A 3WVJA 4SLIA 3MW3A 1KS5A 1NA1B 1VBD2 4PDWC 5CFDC 2HWD3 3NW4A 1ZX5A 2ZHNA 4IERA 4YGBA 3TOJA 3VHOA 1ZREA 5ABJA 1CIWA 5KXEA 5D8AC 3POWA 4W6XA 3KGZA 1GFF2 2BVVA 1MS0A 4HLTA 3AP7A 2XHKA 3INAA 4IXLA 1ZZBA 1CESA 4F83A 2EXHA 4RQPA 1FNYA 4NHLA 3RDIA 2VVDA 3NWKA 2BNMA 3PNAA 3SCFA 3K48A 2ZGPA 5H9RA 1HV1A 1RUE2 5ABJC 3M3IA 4B3NA 4GMP0 4XF9A 1PVC2 2UYBA 3FBMA 2XKPA 3PHMA 1K5MB 4JC1A 5BNNA 3LWCA 2XWJB 2RS31 2DFCA 4Q4X2 1PO12 3RS6A 1CAWA 2BWCA 4EWDA 1ZNPA 2HWC3 5GLUA 4Y24A 1WBFA 5I8SA 3WW4A 1FT9A 3GHNA 1SBEA 4Z8BA 1WD3A 2ZA9A 1ZZ8A 3ZYGA 2HEYF 3AP4A 2XG3A 1CPNA 4WVVA 4BQ1A 2P3JA 2R1BA 1FOD2 2A5ZA 2KXLA 4QQLA 1FAYA 2ZHLA 5BNNC 1UF2C 2GC2A 3MFAA 2EALA 1CAXB 2XB6C 1AF9A 5C8WA 1YXWA 2R6QA 4Y1VA 2A6YA 5BY5A 5AC92 2JJ6A 2ZACA 4K7JA 3OD4A 4MGKE 4L8QA 1RUD2 1JUIA 5HXVA 4AXOA 1CJDA 3WG4A 1SLLA 3KCXA 1PZ8A 5E1RA 1IQAA 1N47A 2RS12 1RUF2 1W6PB 2ZGSA 2C0ZA 2XPJA 1R092 4XBQA 2VVFA 2GNDA 5FDBA 1PK6A 4KNCA 1IS5A 4GQ7A 2E51A 2D5HA 4WVZA 2R071 2AR6A 1CN1A 4XTPA 2VW2A 2JG9C 1PZ9A 4D3WA 1XE7A 2DUQA 2HKXA 4GALA 4QT6A 1UN1A 1QQP1 3HN1A 2WNEA 1PK6C 4YGCA 2WNVA 5T52A 1H9PA 5EXOA 1I6XA 4ISQA 4PDWB 1I3HA 5CFDB 4J1WA 3TRSB 3EHKA 1VBD3 1JUHA 4MZUA 2TNFA 4G9SB 2VUJA 2IXKA 2UURA 5GLTA 1V9U2 2CYFA 1ND2A 1B35C 4XJ8A 1G9AA 2VNRA 3RG0A 3FWEA 1BZWA 4KG8A 1AR73 2WNVC 1LHNA 1KJLA 5KXBA 4HN0A 1U0AA 1C57A 1GZWA 2Y38A 1QNWA 2QNKA 5A3LA 1RUE3 1DGWX 2YPJA 2YMZA 1YFYA 3TNQA 1V6MA 1ND2C 3JD72 3VBUA 3WQ0A 1OLRA 4Q4X3 4QHBA 1N1VA 1KFUL 4W6WA 1OFNA 4Y20B 1GQHA 3N4MA 1BBT3 1VBA3 2WSUA 1V6IA 1HX6A 1G9FA 1PGSA 2JENA 2PAKA 2MNGA 1M06G 2VNOA 2ZX1A 2PHRA 3VBUC 4MH0E 3VBHA 4Q26A 1QJX1 1YJKA 2DVGA 1C4RA 3FUQA 4ZXKA 5AC93 5I0TA 3HAGA 3RSJA 3RYPA 4META 4LO4B 3J8F1 1WLTA 1UL9A 2P2KA 3WW3A 4F7ZA 1GANA 3HR9A 4PIZA 1RC6A 1H9WA 4M0HA 3AKSA 2DURA 3S7EA 5I93A 5K0UC 3WV6A 4UBHA 3O7OA 2XJPA 2Z79A 3MFCA 2EF6A 3B01A 5JCTA 3GNEA 1W0OA 2ZTNA 3UK9A 4CP1A 2JG9B 1OA4A 1XYNA 4G3YC 3AXEA 2R061 3B02A 1RUNA 3V65A 4MGYE 2WINB 1EY2A 5GZFA 2P34A 4IESA 5FBZA 4Q0QA 1PK6B 3C3VA 2R32A 1SACA 4DRVA 4LBMA 1RUC1 2FMYA 2SBAA 2XBO2 1ONAA 3FZ3A 2YUEA 3VKLA 4AFAA 3V0AA 1VAMA 4B7KA 1JXNA 4YG0A 2E63A 2WFF1 4Y22B 3WP3A 4RFT0 5J7MA 4AFMA 2BNOA 3H1WA 1V9U3 1AR82 1B35B 2DTYA 5FO7B 1ZBE3 4P9GA 4K3UA 5HBAA 1U5IA 1RITA 2VPVA 2VU9A 1ULDA 4AYUA 1LECA 3AKRA 2EA7A 2B8MA 5GLZA 3S7IA 3PMEA 1N3QA 5DDJ3 1XNKA 1W2UA 2Q5TA 2IFWA 3KT7A 1OPOA 4XJUA 2WS92 2HWE2 3FE5A 1H1MA 5CG9A 1H8TC 2YC0A 3FFZA 1DQ5A 2R49A 2WSVA 3JD73 3ZDSA 1PGW2 4JGZC 2GH8A 4FPGA 4XJAA 4ORFA 2A3WA 5GZEA