5HBAA

Globular domain of zebrafish complement 1qa protein
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
133
structure length
133
Chain Sequence
EKPAFSVLRNETSQAQYKQPVTFNDKLSDANDDFQIKTGYFTCKVPGVYYFVFHASSEGRLCLRLKSTSAPPVSLSFCDFNSKSVSLVVSGGAVLTLLKGDKVWIEPFAGDGGVGQMPKRLYAVFNGFLIYRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of zebrafish complement 1qA globular domain.
pubmed doi rcsb
source organism Danio rerio
molecule tags Immune system
total genus 25
structure length 133
sequence length 133
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5hbaA00
3WD5A 2Z5WA 1RJ8A 1OQEA 1KD7A 2HEWF 1I9RA 3ALQA 4QQOA 1XU1A 2ZPXA 5HBAA 5KWRA 4OULA 2R6QA 5KC5A 4DB5A 3L9JT 2AZ5A 2JG8B 4NN0A 4EN0A 4OUMA 5KC6A 4KG8A 5L19A 1TNFA 4MXWA 1PK6C 1A8MA 3ME2A 2JG9A 1DG6A 4N90A 3K51A 4TWTA 1PK6A 1OQDA 4QQLA 1D2QA 2WNVA 2TUNA 4KGQA 4QQHA 4TSVA 3K48A 4MXWB 4MXVA 2JG9B 2HEVF 2JG9C 4E4SA 2HEYF 5CIRA 3TWIA 1PK6B 1C28A 4D7YA 2O0OA 2WNVC 5TSWA 4KGGA 2RJKA 4OUSA 2Q1MA 1DU3D 4QQPA 3B9IA 2R30A 2X29A 2KA3A 2ZJCA 5BNQA 1C3HA 2OIIA 4GIQA 1XU2A 2E7AA 2RJLA 3MI8A 4HT1T 2WNUA 2RE9A 1JH5A 1D0GA 4J6GA 4G3YC 3URFA 3V56A 1GR3A 3B94A 4MSVA 3QD6A 1U5XA 1IQAA 2WNVB 4DOUA 1KXGA 2R32A 4E4DX 1D4VB 2TNFA 1O91A 4QQ2A 3FC0A 2QDNA 4F3JA 3QBQA 5L36A 2WNUB 3TYJA 2WNUC 1TNRA 4QPYA 2Q8OA 1OSGA 3B93A 4RSUA 3LKJA 4G4FA 1WCKA 2JG8C 1S55A 1RJ7A 1ALYA 1JTZX 3AB0A 2QE3A 2JG8A 1U5ZA 1U5YA 3IT8A
chains in the Genus database with same CATH superfamily
4P9XA 1F2NA 4HVOA 4FOYA 1G7YA 1QJY3 5CKMA 3PUAA 5GZFA 2B8MA 3MF6A 2JE9A 1PZ9A 1W6NA 2TBVA 4Q4W3 3NJZA 4B4RA 5A1LA 3FBYA 5FY5A 3ZFEA 4CEYA 4E8CA 1W90A 1WA6X 3O12A 4C1WA 2HWD2 1W6QA 3WCSA 1GBGA 1IKPA 4Y5Z0 5DDJ2 5A7NA 1TVGA 5JZGB 3B5LB 1ZRFA 2P3YA 3VN4A 5JSPA 4TZDA 3ECQA 5CYYA 4P02B 4S2HA 1CX4A 3H50A 1QJX1 2CGNA 3N9PA 3OPWA 4BHPA 1QDCA 3I4IA 4BH9A 5HV0A 2IUWA 1DG6A 5C9AA 4JC1A 1UOBA 4PT6A 4AVVA 2Q1FA 2ZX0A 1E5RA 1UX6A 4XFIA 2OQ6A 2ADEA 3IN9A 3THTA 2Q5TA 4TLGA 5FO9B 4FOQA 4KNCA 3AM2A 4DRVA 2ZA9A 1LHVA 4GQ7A 4QQHA 2WQ4A 4UW3A 5FYTA 4RGKA 3U78A 1QJX3 1LB2A 2ZEXA 2HEVF 1PVC1 4HLTA 2YDEA 5A32B 1Z7S1 1W9FA 2GU9A 3KZ4C 1CAXB 4BQ5A 4XTPA 3SKVA 3MLLA 4WZFA 4XF1A 3DXUA 4TYSA 1NOVA 4CSWA 4FAGA 2PHFA 1AVBA 1DQ4A 2GSYA 5TSWA 3MYXA 3OGGA 5FYZA 2AEYA 1OKQA 1LOBA 3HNMA 1XE0A 3WF3A 1PVC3 1RUH3 5A80A 2DTWA 1Z7S3 2RG4A 3N9LA 4IEYA 2R30A 4CVUA 3FE5A 1RUE1 2YMZA 2RHPA 1C1LA 3J8F3 2GC3A 5B4NA 2LW8A 2X5IA 4L92A 2N7GA 3I3QA 2ZBJA 4MHUA 5JUVA 1H6XA 1E5HA 1QQP2 5L9RA 4P5HA 2I45A 4YW4A 3VBFB 3KS7A 3N3HA 2VCBA 4FPEA 5DPNA 1Y4WA 2AC1A 1JH5A 1UMIA 2VBBA 3GCXA 2C5DA 1BBT2 3QH7A 2CGPA 4QGNA 1OLMA 3VLBB 5C3SA 2DCTA 2JJ6A 3E5XA 4B8EA 1IPSA 3PJQA 2IVIB 5LRSA 1Y7BA 1DCSA 3S7IA 1K5MA 1KXGA 2R32A 5APAA 2FDFA 1XE7A 4AEDB 1H1IA 1FV2A 1LNSA 3GZUC 4A6OA 5IVFA 1WBFA 4UFIA 1HQWA 2I07B 4A7YA 1F15A 3HJRA 1QOOA 1UOGA 4RL7A 4UT5A 3BODA 5BNPA 3VBHC 4R9AA 4CPBD 2JIGA 4CDWA 4PQ9A 2WWSA 1AYM2 4YVWB 3SXWA 1WCKA 1GOGA 3P1IA 2EVXA 5C8CB 4OLLA 3K4DA 1VBB2 4B7KA 4Q4V1 1W2OA 2ZAHA 2GNDA 3EB7A 2RS12 5I0SA 3HVDA 5JPMB 1RHI2 1AR71 2W1WA 4IEVA 3WV6A 4CUAA 4LHKA 3CZUA 4Y5TA 5FY0A 3A7QA 3J7HA 3T0BA 4LBQD 4BISA 3U4XA 1U5YA 1Q8QA 2DTYA 2W1QA 2XVGA 4Z92B 4GWIA 1GANA 2JX9A 1H2LA 2PLV2 2WQZC 1SACA 3ZR5A 4EZ4A 3O1UA 1I9RA 1ULCA 2YC0A 2VXRA 3KSCA 3DPRB 4OHYA 3VBRA 4Q4V3 3WQ0A 3VZNA 2P3KA 1AR73 2EAAA 1LGBA 2XWBB 4YLZA 2VZUA 1UYYA 4MZUA 4BZ4A 4CCCA 1CPNA 5EQUA 2CNAA 2WLQA 3B00A 4Y3OA 4IE0A 1J1LA 1DF0A 4HKLA 2AGSA 4KG8A 3ILRA 4AQ2A 4MO3M 5CFCA 3I2KA 2SBAA 3L2HA 4IEOA 4UFJA 2GDFA 1UOFA 5FRAA 4BM8A 2R042 3WEZA 4JRLA 2ES3A 5I8TA 3H8RA 1H9PA 1GNZA 2NMOA 1NLSA 5F39A 2W47A 3MEPA 3MV11 1CR7A 2BWAA 3MUY1 4IQPA 1OUSA 4LLFA 4XZPA 3RYPA 4MG2A 3ATGA 3W59A 1BK1A 1YNAA 1H9WA 3D3AA 1W8ZA 4UF0A 2R1BA 4NO4A 4F83A 4E4SA 2NMNA 1AL21 1W0PA 2CAVA 2WABA 4LMFA 3OBTA 4MGSA 5AFBA 1UKGA 2XQRA 4Q4X2 5FFOC 1NY71 3OUJA 2B7YA 4EWEA 3ZYFA 3Q8FA 4NR1A 4Z2WA 1ZBA2 5FQ0B 4KH9A 3VBSB 3LPGA 2DCYA 5FYHA 1VLNA 2CGOA 2W5FA 1N3QA 4Y4RA 1LU1A 2XUMA 3SISA 4D3WA 1RYYA 1AX2A 1MACA 4ASKA 2IXLA 2IXJA 3LA7A 3WDXA 3IIAA 5A6QA 1AL23 2CHHA 5DUVA 4FSJA 4OHZA 3RZHA 4QKFA 2WR9A 2GP5A 1JZ2A 5BNQA 3GBGA 4NHYA 1LKNA 1XNKA 2Y34A 1Y3TA 1ZX5A 2VVDA 2R072 3HAGA 3KWVA 5JI7A 3GZTB 3SLIA 5LA1A 1OOPA 4BWOA 4EV0A 1XQNA 2X09A 3I3BA 1XNCA 2CTVA 2Y6HA 1A8DA 1WUVA 4NPLA 4LO8A 5F8PA 1DQ2A 3U75A 2YB7A 2QQPA 2WZR2 3Q8BA 4CU6A 2WS91 1C8NA 1ASJ2 1W8OA 2RS32 3B94A 2F6BA 4XJWA 2BWCA 3IAPA 1COV2 2BDRA 5FZHA 5C4WC 1WCSA 2XJPA 5KXCA 2YGLA 4RR3A 1IOAA 1HRV2 4XF9A 3S5QA 3VBHB 5A3MA 5CEHA 1WW4A 2P4EA 5SV8A 4YZ2A 2Q8OA 4OQ8A 2FZ2A 3BPSA 1IG0A 4P9YA 4XJ9A 3ZO0B 3ELNA 4K8FA 2RMU2 2WS93 4D7TA 4XIKA 2P34A 3E97A 5C3OA 4JAAA 2FCTA 3T3YA 5ABJC 5BV6A 3TEWA 2JG8C 3PVBB 1AJKA 3H3ZA 3N7LA 4AI9A 3AC0A 1RVF1 3WNKA 1UPIA 2D3PA 1VBC2 2QQVA 1VP6A 2W08A 3IPVB 3NKGA 3J4UH 3RZGA 1H8TB 1HW5A 3I2GA 1FI2A 4V2VA 1UOJA 2KD7A 4Y24A 1R082 3OTFA 4Z82A 4XABA 4D69A 4R8HA 5DZGA 4PHZA 3IT8A 5EV7A 5F1RA 4AI1A 3OCPA 2Z5WA 2FCVA 3DL3A 1JYTA 5DQ0A 3FUOA 5FMOS 5FZ3A 1SLCA 4R4ZA 1R1A1 1N1SA 4GD4A 2QZ3A 2WUHA 4MGIE 5CNAA 2VE1A 1O4YA 4PDWC 3RS6A 4QX2A 1JZ5A 1ONAA 3FZ3A 4BPZA 2PHXA 2R6QA 2YROA 2HWE3 1GNHA 1IS6A 4LUKA 2HWB1 4BIOA 3KVAA 5IJRA 4BE3A 1MQTC 3ACIA 5AVPA 5KC6A 3LSDA 2ARAA 1YC61 3WF4A 1JHNA 4JTNA 5AC91 4MV2A 2FBEA 5IVYA 1JYNA 1R1A3 1ZBE2 2FDHA 3KV9A 2D40A 3RG0A 2VVFA 3TB0A 2MNGA 4COUA 4Y20A 1I1EA 4JX0A 5ACA1 2HWB3 2IFWA 3I7DA 1YIFA 5FZIA 1V6NA 5LZ6A 1OQDA 1C5IA 3F2ZA 2DFBA 4AG4A 2GZWA 4LJHA 1WLWA 1S0EA 4H7MA 1X9TA 5AC93 4CDXC 4LKDA 3D82A 5D8AB 5KHJA 3S30A 5T3NA 5CISA 3AFKA 3N35A 4E2GA 1LHOA 3NAPB 3OSDA 1W39A 2X8KA 5ACA3 2A1XA 1RUD1 4GKXA 1Q56A 2V72A 3H8UA 3TEZA 2CL2A 1OURA 3HN1A 2ZGSA 2WQ8A 1LGCA 2C24A 3NNJA 1W2AX 1XNAA 4TTGA 3HT1A 4JCKA 1EUUA 3C2UA 4CEWB 4CEYB 3PUSA 1TMF1 2FCUA 1W8HA 1HRI1 1ZRDA 1FAYA 2JECA 3SCGA 3RI9A 1W2UA 1RUD3 2NM1A 4AXOA 5FO7B 3ZSKA 2Y0IA 4PQQA 1WMFA 5JXJA 3S57A 3VKOA 4I3GA 5A7QA 3GDBA 4FQ4A 3M8LA 4XQDA 4NHMA 3A4UA 2RJLA 3LA2A 4EQVA 5B2GB 3IM0A 3DYMA 1V00A 1UQXA 3M7AA 1W3VA 4W50A 1TMF3 5JOWA 3WG2A 1HRI3 5F2SA 1RC6A 1E57A 3CJIA 1UYPA 2WSVA 1LESA 1SCRA 3PLQA 4GH4B 3USUA 1BLZA 2GMEA 3TBDA 5LASA 2ZGUA 4QB6A 4A44A 1FPN3 3B3QE 4C1XA 2B39A 4O7XA 1QKQA 4AVAA 4CUGA 4CZSA 3E6BA 3TEYA 4U2AA 4S2FA 4MGQA 5FPXA 2BW8A 1BZWA 3WVJA 1LENA 3MF9A 1JZ6A 2WNUC 2WT0A 1ZZ6A 4LUMA 3H3LA 4Q26A 4WVWA 2XHNA 2ZGOA 5H9SA 2EICA 2CY6A 3LDKA 4YRDA 3VDDC 1NXD1 2WSUA 3WW3A 5ABJB 2IXHA 3PUHA 1ZBE1 3V64A 4E2SA 1UXZA 2PELA 5EJ3A 4C90A 5IATA 3U11A 2ZEZA 3OD0A 1J84A 3WHUA 5C3QA 2XR4A 4Q0UA 3AKQA 4D6RA 4XF0A 4OI4A 1LAJA 5JZGA 5CU1A 2ZZQA 3ZSLA 5JR2A 4FXGB 4QM9A 1S0IA 4EROA 3JQXA 4JKMA 5J09A 1NLRA 2GP3A 1VBD1 4BDVB 2E26A 1H2MA 2AACA 5GALA 3JQWA 3N36A 2V5YA 4ATFA 1MQTB 4CXXA 4A7KA 4JKKA 1RUJ2 2GH2A 5ERLA 1WCDJ 1YQ6A 3BB6A 5FIXA 3E6CC 1RUG1 2B46X 2BOJA 3EMRA 4LIUA 4AE2A 4Q27A 5LK7B 2WO1A 4OCTA 4Q0QA 1QGLA 1RUC3 3N7JA 2X05A 5A32A 1XSRA 5KXEA 4QX0A 2WL1A 4R9DA 1GFF2 3W21A 4TWTA 1MZ5A 3M3OA 4IEWA 2X10A 5BNOC 1CAXA 3I8TA 2AUYA 2OXBA 3K4AA 4XUOA 3LE0A 4BQ2A 1RUG3 2Z2SB 3WG3A 3R05A 4I0WB 1ULOA 4Y22A 3DGTA 3MIGA 5JPNB 2RR11 4HK8A 2DUPA 3PMSA 4Y26A 3J9SA 1VBA2 2WO2A 4K9SA 1MEC2 5GZDA 3BOPA 3POBA 3WCRA 1AR82 3AMNA 4K1YA 4YM3A 2Y6LA 1MR5A 1SDWA 1UZ0A 3AJZA 5C5UA 2XL7A 5JXIA 5LA9A 2BFUL 4AHXA 1EPZA 2ADDA 2D6MA 3TN92 1KEXA 5CAZA 2UY9A 4LKEA 3T09A 3PDQA 4O9GA 3VBFA 2HBUA 4GB33 2RR13 3IDEA 5FWEA 3WP6A 4OFGA 4QXBA 3H7YA 4JZRA 5FZBA 2DVFA 1GV9A 4V2WA 3I3DA 3MBWA 5CFCB 3ZYBA 3EXUA 2JE8A 4AEDA 4CA9A 1ENXA 2Q4SA 2QCSB 3WP4A 1QXPA 1LOEA 3ZFFC 1DZRA 2VUJA 1ZZ8A 3HOBA 5JOYA 5LEKA 1R1ZA 4CEWC 1TME1 3JD72 2WNEA 3BYWA 3LFIA 3V56A 4YZ4A 2BGOA 1JODA 1XNBA 3GALA 4XUQA 1JXNA 1SMVA 1WCUA 3I2HA 3OGJA 3CIHA 1CONA 4LK6A 4MSVA 4YVWA 4WM7C 3JBG3 4YW7A 3NL1A 1SLIA 3LQCA 2F4LA 2FQPA 4FVVA 4I01A 3FLPA 1D4VB 4OZOA 3GBFA 3SC7X 2R1DA 2GN3A 1MS9A 2A71A 3PU3A 5BNNA 4XYXA 4RFRB 5C8CA 2W94A 2WNUB 1SEFA 1UY0A 1TME3 2JWPA 1PX4A 1CIWA 1Z0HA 2R061 4FFFA 4B1LA 1U5IA 3UGHA 5ANQA 2VW0A 1DGWX 2R0FA 2NZ9A 3R4DB 2CSGA 4MHRA 2YXSA 4JRAA 1C8M1 3IKWA 1J1TA 2A5ZA 4DFSA 3MZHA 1PIV2 3CZJA 5FZ4A 5JAXA 1KRIA 5GLWA 1X8EA 1FXZA 3DPRA 4XFGA 5F6LB 5FYCA 2JENA 4F7ZA 1IPJA 5LBFA 1AXZA 2XJVA 1OPMA 5EYXA 1AUYA 5AFEA 3BTZA 1ZRRA 3CJXA 4FPOB 4DPNA 3KGZA 4AI3A 2ZTNA 2HYXA 2ZHNA 5CG8A 2IC1A 2UY8A 4ZKTB 4L8QA 1C8M3 3ACFA 3FUQA 1GZTA 3DYOA 1CAVB 2A75A 2VW1A 5IK4A 1UMHA 2QDRA 1PGL1 3X29B 1FV3A 2ZPXA 3AZZA 4NOTA 4XHBA 2QKDA 2WC2A 5LY2A 5HBAA 3WQBA 2W95A 3S7EA 2FDIA 5KC5A 3U4SA 3KD4A 4PI0A 4AGGA 1BMV1 2ZCWA 3IDAA 3WG1A 2W9XA 2WBKA 4NN0A 2EXHA 4QPGC 2XL9A 3P5BA 5HCHA 1LECA 1EY2A 1N1VA 1VAKA 1NZCA 2P2KA 1O59A 3N9OA 4NIGA 5CFCC 4RR3B 2QQWA 4BIFA 2ERFA 2VUDA 3J7MA 1I6XA 4A42A 1XJAA 4XTMA 1UU5A 1HJFA 4MGTA 3AKTA 2RM21 1JU3A 5FY4A 5BNOB 1HB1A 3MFAA 4W4ZA 4YW2A 4JDNA 4XOGA 4QQLA 1OPOA 2HWF3 5FQ0A 1RUF3 3FWEA 3VBSA 2VBDA 3ZMOA 4BQXA 1LCLA 4Q4Y1 4XJ8A 4KGQA 3UK9A 2VVEA 4MXVA 1AXYA 2WA3A 4KI5M 3VL8A 3IWZA 2EXJA 4DXZA 3OBZA 4MYEA 2RM23 3UJOA 3H7JA 2ZX1A 1YEWA 3GYDA 2D98A 2VCMA 1EYBA 2ID4A 1UZVA 4QGLA 4XJUA 2P17A 3P3PA 2HBTA 2JD9A 4XJAA 1YJKA 3BIWE 4D8MA 1ULDA 2TEPA 4PF5A 1QJY2 2FDJA 1LOFC 4IV3C 1LTEA 4Q4Y3 2O0OA 3ZDVA 2D43A 2QQIA 4FFIA 1DGRN 5IK7A 1SBFA 2V5DA 3H1YA 5K4LA 4AI0A 4CRQA 3C3VA 4XDPA 3CF6E 2JDKA 3LB9A 1CWPA 3HR9A 5B4XA 1OD3A 5FZGA 3HBZA 4O61A 3WNLA 4B4PA 2BTVC 3ZFFB 3DXTA 3LIGA 4LULA 4X8NA 5EP9A 1WW7A 3MI8A 3AMHA 1SFPA 2UYBA 2H0BA 3VBHA 5GLTA 4L99A 2OQ7A 1C57A 1RB8G 4O9EA 3B9CA 1PO11 4KL1A 3WNPA 4WM7B 1OH4A 4CP2A 3POWA 4R4XA 1V6OA 3TAYA 3ZYGA 2YBSA 1QJX2 1A78A 1SBEA 2HJIA 1LU2A 3IPVA 1H8TA 2DDUA 3QH6A 4X6RB 5DAVA 3C7HA 2CDPA 1K45A 3KQ4B 3M4FA 2VQTA 2ZS6B 1CAWB 1O8PA 1NXMA 2IXIA 4LITA 5FYUA 3D8CA 3MICA 4RN5A 5FP3A 2ZGNA 2RDNA 1PO13 1SLTA 1HQNA 3QACA 5F3GA 4IEXA 3JZVA 1B35B 1W9SA 2PHRA 4E4ZA 2A6WA 1AJOA 2VQUA 1VRH1 3W5MA 3CU7A 1PVC2 1CVNA 1QXRA 4P9GA 3RYRA 1Z7S2 2IXCA 1X7NA 2E9QA 1ULEA 3MO4A 3OEBA 4GWNA 4UFMA 1W28A 2CWMA 2XJUA 3VD7A 3CNAA 3O0VA 3ZM8A 1UXXX 1URXA 1X36A 1KD7A 2GH8A 4YNIA 1YQ8A 1O3QA 3M70A 2ZKNA 3VD4A 3LA3A 1W2TA 1LOAA 4AVTA 4L0PA 4YGDA 4AR2A 3RZKA 4CXYA 1HX6A 2B45X 2VOKA 4L2NA 1VRH3 5E88A 3OG2A 3AJYA 5FZOB 1H4HA 4UOJA 1OXCA 1UCXA 4QGMA 2BRTA 1KJLA 3WW4A 1RUE2 2YPDA 5LBCA 4ORFA 1YLLA 5FPLA 1KDMA 3FJSA 4MLOA 5FV3A 1W8WA 2VULA 3SCFA 4Q4W1 5D8AA 2OX0A 1PK6C 2DU1A 2Y6KA 3ACGA 5T54A 1WLCA 2VUAA 4W65A 4LBLA 4AVSA 3C8XA 1X82A 3FL7A 4BK4A 3VUOA 2EIBA 2XONA 2V09A 1DHKB 5FYMA 1LODA 5FUIA 5A7WB 2YBKA 4WV8A 4AF9A 1GMMA 1UF2C 3G7DA 1NT0A 2AH2A 4I3PA 4CCEA 2VJXA 3ZX7A 4BU2A 2I2SA 1W06A 3H0OA 4IEPA 4AQSA 1JZ8A 4CEWA 1QJEA 4JGZB 1DIWA 1W6OB 2XLGA 4NHXA 3VKFC 1JYWA 2FZ1A 1LEDA 1LRHA 1WZXA 4PBPA 2A3WA 4INDA 3CKHA 1S4CA 4MGKE 1NYWA 3BVCA 1CQ9A 3GBWA 3MIBA 3WY6A 3UKTA 1F8VA 1ZZ9A 2G9ZA 2O8QA 2WN2A 5FBZA 4OHXA 3SMHA 1Z78A 2H6BA 1BYHA 4META 4Y1YA 3RJ2X 4XAAA 3SEEA 2BBVA 1V6JA 4FO9A 2ZX4A 2DBNA 3ZXKA 2WAOA 5FPUA 2RJKA 4Q4V2 2BUKA 5A33B 4LBJA 5KHIA 4QPWA 2E31A 4IDZA 1AR72 5FXVA 1RUOA 3L2YA 4LBMA 4GH4A 5T50A 2BGPA 3WR0A 1NA1B 2PAMA 2OW4A 5C4WA 4NVPA 2XG3A 3H1MA 4BLJA 5IAVA 4HZFA 5A1FA 4JHZA 5F6KA 4SLIA 3GF6A 4OZXA 5KBFA 1RL3A 1RUH1 2CDOA 1H1MA 2PHLA 1NQDA 3O1OA 4HT1T 4GKYA 1GWMA 2WWJA 3VBUC 4JVAA 4YZ5A 1AYN3 1HB4A 5FWJA 3TRSB 3J8F1 5FMCA 3QCWA 4XE9A 4QHBA 3IZOA 1AR63 5ABJA 4B4QA 1V0AA 4ISQA 3ZFGC 1U12A 2BNNA 4E4DX 4Y22B 1C1FA 1I5ZA 2VNVA 3POSA 1XYNA 3LEGA 2DU0A 2MHFA 2W68A 2ZXQA 3QOPA 4BQWA 2Y26A 4OMDA 3RMXA 3BTYA 3LPFA 4AAPA 1PGW1 3VKMA 2VOTA 5FCCA 5IWFA 3VKNA 4DQAA 2E32A 1UW8A 3CMGA 4NE9A 3WDWA 1XSQA 4I2OA 2JICA 4LO7A 1J3PA 2RV9A 2QVSB 4BMBA 3T1MA 1JYIA 4RS5C 5FMDA 1EAH1 1B09A 3Q8CA 1RIRA 1FOD3 4Y33A 1V6LA 3ACLA 4P9LA 1JYVA 2VCCA 1AL22 3ENRA 3P3NA 5IVJA 5FR3A 5LY1A 3AB0A 1MQTA 4JHTA 4ZXKA 4EE2A 2ZX2A 3OYWA 1NY72 1UY1A 1YHFA 2YGMA 4JKLA 4XMAA 2UYAA 1Y9MA 2E6VA 4BOWA 4EJRA 3R6SA 4AHWA 1SLBA 3NNGA 3VD3A 2ZAAA 2OPKA 4QQOA 1EAH3 2NLRA 4J1WA 1VBE3 3U07A 2VGDA 1AX0A 1S0CA 4UAPA 1GKBA 4HXCA 4DB5A 1H6YA 2JE7A 1RXFA 1EUTA 1OLQA 1DZQA 5FZ0A 2AZ5A 2Y6FA 5FZDA 2E7TA 5E8AA 1FMD1 4IGQA 3USSA 3VBOB 5L19A 5A3UA 3R4UA 1T6BX 5BNNB 1W8FA 3PMEA 3WDVA 3ASIA 4GALA 3WXPA 3D0JA 5FYYA 4HBNA 1ACCA 2J1RA 3NVCA 1G9FA 2DVDA 4HETA 1DGWA 4LPLA 1GOHA 1FMD3 2WS92 5FPBA 2E53A 4WVVA 2TUNA 4QKDA 4TSVA 3LSEA 4LK7A 4DMIA 1RTVA 3DV8A 4YGEA 1LULA 4W6XA 1WLTA 4ZPIA 2RS51 3CO2A 3MIDA 1ENSA 2MPFA 2ZEWA 4CU9A 3OPZA 4XDQA 4JV4A 4QXCA 2D93A 2KXLA 2OUJA 3NRUA 5DDJ3 3WNNA 5F5CA 2Q8CA 1NCRC 5BYNA 2BEOA 3K3OA 1JOPA 1RVF2 5FXXA 5DAXA 4YSFA 2FDGA 2PQQA 2ZZJA 2HWE2 3N7KA 1BEV1 2RS53 3N4MA 2OA2A 3C7GA 1GWLA 1KQRA 2ZJCA 3RWKX 1UMZA 1N1TA 1JN2P 5JSRA 3FMGA 2BP6A 5BXXA 1HB3A 1X9PA 1R1A2 2AR6A 1R64A 4CP0A 3VBUB 1W0NA 2WNUA 5EFUA 2W46A 4YZ1A 1C5HA 2XPJA 3ZXLA 1HQLA 1GZ9A 5GM0A 3KT4A 3J26N 3UETA 4CCJA 1GR3A 1BEV3 1ULFA 2HWB2 2VZ1A 4LKSA 4QX5A 5FP8A 1MS3A 4UBGA 1GQHA 1XE8A 1POQA 4YFZA 3FHQA 4AEJA 4ZU5A 3W20A 1SFNA 3M3QA 1ENRA 1TE1B 1N3PA 4FPJA 5AC92 3PU8A 4QT6A 5FUNA 4DXTA 2W52A 3Q8EA 1L7LA 2ET1A 3GCWA 5EXOA 3MV01 4XZUG 4XQ4A 2EIDA 4K8RB 5BY5A 3RDIA 1K42A 1VIWB 5ACA2 5CFDC 1ZM1A 3V65A 4PIZA 5LW9A 5ISLA 1CAVA 3ST7A 4CP1A 1OKOA 2Z69A 1NE4A 4Y1VA 1G9BA 1W8NA 3VD9A 1WWYA 5A70A 4CE8A 2UURA 1ENQA 2QE3A 5H9QA 2Y8KA 4N9HA 5CA6A 2VZQA 1RUD2 2VW2A 4ZXEA 3ZFEC 4BMEA 5JOZA 5GJ6A 4D0QA 2YV8A 3POYA 2OS2A 3IB3A 3RZMA 1E5SA 4XF3A 2NQYA 2BGCA 4ONUA 3E5UA 5L73A 1DLLA 1TMF2 1DLCA 2G1MA 4IEQA 4XEZA 5A6YA 1HRI2 5F9TA 3J7NA 1ZA7A 4LBKA 2C26A 5BNOA 1OT5A 5I91A 2QZ2A 3K4ZA 1VMHA 2W39A 3JXSA 4UFHA 2DCKA 4FPGA 3KCCA 3VZLA 1W2NA 4YGBA 4COZA 2PHWA 3NSTA 5FLIA 4CDQC 1DGRA 1CX1A 2K0GA 2HWE1 3OOXA 3W58A 3KV6A 5JMOA 2VG9A 2RS13 3H9AA 2YG0A 3KCYA 4PCRA 2XJQA 4FP3A 4LT5A 3LOBA 3ZSEA 4FBFA 4KWUA 4FQZA 4XIOA 1APNA 5IUQA 4SBVA 1XOYA 4RYDA 1AX1A 3MPPG 4B1MA 5EYYA 4C0HA 2JG9C 3HBKA 4LOSA 4FPFA 4GMP1 1DQ1A 3S5AA 1W03A 2G9FA 4EN6B 4UWDA 3NAPA 3TWIA 3GJBA 1V9U1 3WF1A 4HVQA 2P6HA 3BCWA 1MS0A 1N3OA 3KF3A 2W92A 3ZFFA 2VZSA 4LEJA 2J1TA 2X5IC 4GWMA 4X8PA 4P9IA 3U14A 2R7EB 4AW7A 2PFWA 1IGOA 2R043 2WT2A 3POEA 4DY5A 3P6BA 4GMP3 4FTEA 1QIQA 4AVCA 4WM7A 4QX8A 1GP5A 2VO5A 5HCFA 1V9U3 5G04L 5LA2A 3PIGA 2B42B 1SFYA 4E9KA 1O6UA 3WQ1A 1VBD2 3OEAA 2L9LA 1D0GA 1YO8A 3KMHA 5A3OA 5SV5A 3SH5A 1CAWA 4ES8A 4Q0VA 3TNQA 3U0ZA 1LR5A 4Q4X3 3AKRA 2EXKA 4G9SB 4ITCA 4F8AA 3EQEA 5BNPC 4YG6A 2PMWB 2WKKA 1RUG2 4CDWC 1O91A 3GHMA 3V0BB 1B35A 3M3CA 4QXHA 5DAPA 4ZU7A 5LEJA 1ST8A 4L9BA 4N53C 1F5FA 2LUWA 4AZZA 3TYJA 2XJSA 4PIYA 4P08A 3ZN6B 1LHWA 3V0AB 1FPN1 3LOIA 4NRMA 1S1AA 3RMYA 3ZXGA 1JUHA 4IESA 3LGRA 2QQNA 5DUXA 2R16A 3DECA 3TOJA 5A1AA 4ZS3A 2RR12 1L7RA 4FAHA 1O7FA 5FZOA 4YPJA 3VBRC 5IVVA 3KB5A 2VMEA 4CDUC 4FCAA 5C4WB 2YU2A 2WZR3 2CV6A 1ASJ3 4LBNA 5FAXA 4NUBA 1COV3 1ZZBA 5FZAA 3POFA 3MW2A 5IYYA 1QHDA 3UV9A 1UU4A 2KR2A 4XFAA 1HRV3 3A22A 3NJYA 4K40A 4MUVA 2PTMA 4OULA 3D4KA 4UW6A 5A7WA 2JEMA 3JUUA 4UI9L 2JG8B 5K0UC 1GU3A 2WZEA 4FPKA 4K7JA 4XFBA 5T5JA 1SDDB 3UJQA 4OUMA 2BNMA 3T2PA 4CUBA 2P3IA 4DEVA 1NZIA 4CU7A 4Q8LA 3AMMA 2VD7A 4CDQB 5LRRA 5FK7A 4XXAA 4JGZA 1W6OA 4CCDA 5FBJA 3GGLA 3AXEA 5E16A 4EZHA 1W8TA 1GZWB 1WLDA 2BFUS 1TME2 4EN7B 3AMQA 4NJ4A 4V1PA 3ZYIB 2D6LX 3U37A 1RUI1 4KBZA 3WOGA 2WT1A 5A7PA 1PGSA 2JDAA 3MIFA 4FFHA 5CG9A 4P9JA 2VM9A 4PDWB 3I2JA 2J42A 1XB9A 1RUC1 4I09A 2XJTA 5A7SA 1NG0A 2JG9B 5G05L 3CL1A 5A33A 1Q8VA 4M4RA 1IHMA 1W9WA 3R0RA 3AP6A 4GMP0 2A6XA 1OHFA 2WFF1 4Q1PA 3OYWB 5A6ZA 2R062 4ASMB 1NKGA 1KS5A 3BALA 1RUI3 4JQRA 1NA1A 4NWWA 2Q8EA 3VDAA 1KS4A 2VNGA 1QXJA 1C8M2 4GULA 5FZ1A 1VJ2A 2PYTA 4DXRA 2D6KA 3DN7A 3K46A 2YFUA 2D44A 1GUIA 3KT7A 5FZMA 5LWBA 1UNBA 2W2IA 3KF5A 4W8JA 2Y38A 1OOPC 2DCJA 3MPBA 1ND3C 3RZJA 2WFF3 4YARA 3POGA 4RQPC 2J1SA 1JYXA 1VB2A 4KMQA 4PLOA 4HK9A 4CDXB 4ZZ5A 5FZFA 5IK8A 3ZLIA 4Z07A 4BXSV 4GB31 2VR4A 4MGYE 4E27A 2ET7A 1WA4A 1PGL2 2VMCA 2F17A 1IZ3A 2G19A 3GJAA 3ITQA 4PIXA 4ZY9A 2QQKA 1Q8OA 1BMV2 2JXAA 3LDBA 4QU1A 4QU2A 2WA4A 4URTA 3ZPOA 2A6VA 4DOUA 4DZGA 1V6KA 3I2FA 4XAEA 3UT0A 5FYBA 5FY8A 4XUPA 5JOXA 4OI2A 2XBO1 1CGPA 1A6CA 3ZIXA 2VMIA 2PHTA 3N9MA 4P00B 5EIYB 3KVBA 4AQ6A 1YRZA 2RM22 1TNRA 3O0XA 4JQTA 1OSGA 2WAAA 1GSLA 3JBG1 2BBAA 1PHMA 3VHRA 3KCXA 4NIIA 3WHTA 3WG4A 4IW3A 4S2GA 5FOJB 1BVVA 2QNKA 2FMDA 3LCPA 3SNMA 4Q4Y2 4WVMB 2VZRA 5J7MA 3RVHA 3H8OA 2OYZA 4AHZA 2PAKA 4LHLA 1GQGA 2XBO3 4AK3A 5I0RA 2O1QA 2VH9A 1HDKA 4J25A 4CDUB 4DINB 5F5AA 1S0DA 3MLJA 1OMIA 3MW3A 1D4M1 1TG7A 2Y6JA 4XCBA 4ZS2A 1YJLA 2B9UA 4GZ9A 1RJ8A 3VBOA 4CYDA 4QPIC 4DNYA 3INAA 4OHVA 2W3JA 4YM2A 3LZZA 1Q5OA 1NAEA 2ZACA 4NWVA 1EPWA 2J1VA 1LHNA 5JIAA 2XVKA 3UYJA 4I02A 5H9PA 4LBQB 4BB3A 3ZR6A 3VDDB 3HQRA 5K0UB 2VZ3A 4K20A 1D4M3 1UY4A 1DQ0A 1FYUA 4A2UA 2HH9A 4YVSC 1GWKA 2PQSA 3OD4A 5FZKA 4DEQA 4EN0A 3LIHA 4FXKB 4HOOA 5FP7A 4YGCA 4H14A 4XDOA 3VZJA 4MGZE 3T2OA 5FK8A 1OF4A 1PZ8A 1QNWA 3ZKUA 1T6GC 1UZWA 3VB9A 3SH4A 2WYSA 1O8SA 3HWJA 3A23A 4N90A 4R52A 1VPHA 4A4AA 4BQ3A 1YWKA 3KHCA 3ETQA 4HSLA 1FNYA 4H55A 3ZN5A 1PO12 1BKZA 3OGVA 4AVBA 5F2WA 3NKTA 1YXWA 2P37A 3WF2A 3NNLA 1QJZA 4XILA 4Y1XA 3RZLA 4HANA 4YW6A 2MEV1 3GZEA 4FPCA 4LO5B 1OA3A 2Y33A 4M0HA 5CIRA 4A45A 4ES9A 2QQMA 1O4TA 2G9GA 3VHOA 5C71A 2HWF1 1REDA 1RUF1 3O1RA 1UL9A 5EWSA 4BK5A 1OFNA 4QKNA 1E5IA 1CN1A 2AREA 4UW5A 1REFA 5C8WA 3AXDA 1CZSA 1T2XA 2WN3A 2WNVC 1RUNA 3VBUA 4NIHA 2MEV3 5FJKA 5T5OA 1GP6A 1GNYA 3NNMA 4PF1A 1VRH2 4UW4A 4YM0A 2V4AA 1VB4A 3W5NA 4RQPB 2C9KA 1OD5A 3OPTA 1WGPA 2CAUA 1WW5A 3FFQA 3MLKA 3VHNA 2OUHA 4NRQA 1ZZ7A 2ORZA 1XNTA 3CJIC 1Q8SA 3Q8AA 2GMPA 3MUZ1 1F31A 2Y64A 1XU2A 2WWUA 4ZONA 1WKYA 3PVEA 5LATA 3ACHA 3FLRA 2Y6GA 1CAUB 4IE5A 4W6YA 1GYKA 1MEC3 3C7OA 1SZBA 3AZYA 3QD6A 4IE7A 3FHAA 5IK5A 1WCQA 4OQ9A 3MIHA 4RS5A 4CUCA 5I0UA 1QWRA 2XKOA 4PBOA 4QQ2A 4YW5A 4Q4W2 3TN93 2GN7A 4D7SA 3BTAA 1O3RA 2YYOA 3HPNA 4RA0A 4AGRA 1X8MA 1UN1A 2XDVA 3MW4A 4IV1C 4J1XA 5GLUA 4CCLA 4RSUA 4COWA 5J1XA 3RWNA 2VOWA 4XACA 3SKJE 4ATEA 1ZA4A 4NHKA 5J96B 5JZGC 1PO21 3RFRA 3T4HB 3ZXEA 3WNMA 3B69A 1RXGA 2DCZA 3PL0A 1AR91 1XBFA 1KFUL 1VAVA 4H2AA 4JGYC 1HV1A 2PA7A 1IS3A 3AK0A 2XJRA 2ATFA 1EV11 4QPIB 5T5LA 5CADA 2YZ4A 3CBNA 4A3XA 5J36A 4HFSA 5FPVA 4Q5OA 3ILFA 1PO23 2G4IA 4DY3A 5KWRA 2LALA 4M4PA 4X6QB 2D6PA 1AR93 4YVSB 3RZZA 3O14A 2IXKA 3PUQA 3GZAA 4OUEA 1O3SA 1EV13 3RGBA 2ZHLA 4HKWA 4MVTA 2ARBA 3H42B 2WZPP 1W04A 4C8DA 3WUDA 4DUWA 3I49A 1PIV3 3ME2A 5F5QA 3VZMA 3O5SA 1RUH2 1CIYA 5M0TA 5GZGA 3I59B 4LIVA 2JDZA 4BJ0A 1D7PM 4LXLA 5EZWA 1NCQC 3K51A 3J8F2 4FFGA 1HXS3 3GM8A 2GNBA 2P1BA 2IVJA 4GA9A 1IPKA 3B02A 4LORA 5C6CA 1FOD2 1JUIA 5IFTA 3ZYPA 2XHKA 3ES1A 4QPGB 4RHV1 5A3LA 5F3EA 2J7MA 1PGW2 4AL9A 1TEIA 4NPRA 3VDBA 1RMU3 1ND2C 2FDKA 5F3CA 2VNOA 4QKBA 2HWC1 4Q0SA 5T5PA 3ZSMA 1Q43A 3FHIB 3AL6A 4AAXA 2ZABA 1EAH2 1UZYA 4LA2A 3ROUA 4Q29A 3HEIA 1QU0A 4AEDC 2DUOA 4XF4A 3A0NA 3IMNA 4RHV3 2BPA2 3WX5A 5JI9A 4ZU4A 4B29A 1R091 2VC9A 3WSOA 2XXZA 2OIIA 3KV5A 2HWC3 2D6NA 2P3JA 4YVWC 5LB6A 4KU8A 3V0BA 2VL4A 1DBNA 4XFFA 5H9RA 1A3KA 3HNBM 4I30A 1FT9A 1PX3A 2A70A 2IZWA 5CFDA 3ZN6A 5FUPA 1IKQA 2RDSA 3V0AA 2FHRA 4IV3B 1W05A 1FMD2 1BXHA 1R093 3BUCA 4ZHNA 3WDTA 2TNFA 5C7GA 1DFQA 2AEZA 2ZGLA 1MZEA 3LEMA 4ARXA 4XBQA 1AYN1 4MOAA 3KGLA 3DPRC 1S2BA 2A73B 2DBIA 4IV1B 2VTXJ 2VXJA 1AR61 3PURA 5EJ1B 5A3TA 1ZREA 4AFDA 1CD3G 3CQOA 1H0BA 3UGGA 1WD4A 4NAOA 4L11A 4XETA 3N9QA 1QJU1 1YFUA 4QHZA 1VE0A 4BQYA 1ODMA 3I2OA 2NP0A 4IEUA 3NV4A 1H2KA 5L7OC 3CEWA 4XHXA 4JGYB 4Z1VA 2RS52 4TLFA 2XGXA 2JG8A 5JWPA 3NQHA 1WW6A 4QMAA 1CZVA 3K3NA 3N7MA 4HN1A 4XQWA 4CDQA 4EWDA 1QJU3 4AFAA 1FOD1 4QAWA 1ZYBA 5K7PA 3C7FA 3ZKYA 1D2SA 4BLIA 2VBPA 1GP4A 4F3JA 1GZWA 4B3NA 2JDUA 4Q0PA 4AFCA 5DG2A 1BEV2 3L9JT 3RI8A 1C4RA 2A6YA 4JDOA 2VMHA 1MVQA 2Q30A 1SLAA 2QQOA 3D5OA 4PDWA 1G9DA 4RGAA 1G9AA 1XC6A 4AFMA 3B01A 1VBE1 5FLJA 5BUVA 2DURA 2RJ2A 2JG9A 3D6EA 3VBSC 3AP4A 5BPXA 5C3RA 5HV4A 2PHUA 3GNEA 3MDPA 1FNZA 1NCQB 1OH3A 3LAGA 5DUUA 1I3HA 2EXIA 4AQTA 3AP9A 5FO8B 5DG1A 3AP7A 2ZGPA 4LBOA 4NHLA 2B9VA 2XLFA 4N43C 4MXWB 3RRDA 4C0BA 4DIQA 3MHZA 5E1RA 2JDMA 1OLRA 3DYPA 1J3RA 2HEYF 3SHRA 2ETEA 1RINA 2XUEA 3BOWA 1QJFA 5DZEA 5FY9A 4OMCA 2RDRA 4WM8C 1ND2B 1UY3A 3RYKA 2OZ6A 3EHKA 3T08A 4CDXA 1MZ6A 1PK6B 5KXDA 2HLEA 1RUE3 1W6PB 3A21A 4IEZA 5JR7B 1QF3A 2WNOA 4KG0A 3JB8A 4GJZA 4P14A 4P9WA 3KLSA 4KGGA 4M01A 3PTYA 2ZHMA 2EIGA 3ZXJA 1STMA 3WNOA 2HWD1 3QLQA 4K3UA 1WD3A 4NAMA 5JXGA 3IBMA 4JTOA 1WMDA 2GALA 1VR3A 3FLTA 2P5BA 5DDJ1 1OVSA 4HONA 3WINE 2A7AA 1CZTA 2Z4FA 3M1HA 1C3HA 3IDCB 1QDOA 3FFZA 3NW4A 4TN7A 4CP9B 3PUIA 1H30A 4FT8A 4RFT0 4N53A 4PLNA 2OVUA 3WP5A 1MVEA 2WO7A 1GQPA 2UWAA 3GHNA 4CCOA 4R9BA 2HWD3 4AHYA 1H8TC 2YC4A 4M3CE 1SLLA 3ABZA 3K77A 3M3EA 5FY1A 5L9BA 2OKXA 3RJRA 2FD8A 4QX1A 2JDPA 3ZYHA 4B7EA 3UESA 4WVMA 3AP5A 2ZMLA 3MIEA 4HL0A 4YG0A 2VECA 3M3IA 3GXUA 4COVA 2VPVA 3S6PA 5HI0A 1KITA 3BU0A 4CDUA 1UU6A 3M2MA 2ZGTA 4MX3A 4CPBA 1XYOA 3OJBA 1K3IA 3NWKA 1YI9A 1SBDA 1ULPA 1JOBA 3B93A 4LR4A 4QXKA 1ZVFA 2XQXA 1F9KA 2OT7A 3D0SA 3OY8B 3NJXA 4OYUA 2C9AA 3UL2A 5F7UA 3U1XA 2DVAA 3THPA 4OHWA 3T2TA 4D6SA 1UY2A 5L7OB 2VOVA 3EO6A 2EAKA 1I5PA 1GICA 4IGPA 5EHDA 4DUVA 4LBQA 2ZGQA 1RJ7A 3VDDA 2BV4A 4FP2A 5K0UA 3ZFGB 1W0OA 2GC0A 1DQ6A 4QB2A 1JYCA 2VZOA 3WD5A 1Y9QA 3POJA 3BU7A 3ZXDA 1V9U2 5F32A 1BQPA 1H8VA 1QQP1 2SLIA 3BKZA 2ARCA 4IUGA 2J1EA 1SPPB 2ILMA 2BQPA 3HQUA 3BGAA 4XBLA 5EPAA 1BBT1 3I97A 5D8AC 3PVNA 1DP0A 5CKQA 3ZXAC 3O1SA 2EF6A 4H7LA 5JLVA 2CU5A 1SCSA 3HT2A 4NIDA 2VZPA 2Z42A 1YQCA 2EIEA 5FZ8A 1XNDA 4RS5B 4L97A 1CJPA 1O5UA 2LTNA 3NAPC 5FYIA 3I2DA 3VZOA 1XRUA 3Q9OA 2QJVA 4QDRA 1QQP3 4ET7A 2JD4A 3ORJA 2JB4A 3T0DA 3DCQA 2LM3A 5C5TA 4A7ZA 3AKPA 1Y43B 1YQ5A 2QUOA 1BBT3 1FX5A 1ODNA 2JKBA 4IL7A 3AZXA 4AEKA 4BXFA 2DFCA 3OF1A 4QX3A 1JHJA 1POV1 1YFWA 3LWCA 4CEYC 5D1IA 1AYM1 3WF0A 1W6MB 4IE4A 4IGOA 4K6BA 4N43B 3N9NA 3IMMA 1VBB1 3K48A 4XVHA 1KFXL 2D5HA 5GZEA 3ZPYA 2RS11 2D3SA 4XMIA 4YW3A 1ND3A 1RHI1 1DZTA 1W99A 3ZVXA 5C70A 5C9AC 4RQPA 2RVAA 4WM8B 1G6NA 1POV3 1FPN2 1AYM3 4AGVA 4I0AA 2PLV1 1C28A 4GH4C 1JS9A 1VBB3 4XXPA 1AXKA 1JOJA 1SG3A 5A6XA 2XVLA 2D3RA 3AYEA 4M3CB 2WJSA 3K2OA 4S2DA 3HD8B 3POIA 3H8XA 1RHI3 2JIJA 2NPIA 4HPKB 4EN9B 5LA0A 1CAUA 1BCXA 3LFMA 4DUXA 3THCA 3G6JB 2D6OX 1SHWB 2PLV3 4YWAA 4CCKA 2WZ8A 3EYPA 3TEXA 1LEMA 2R041 1LOCA 4UFLA 5DUWA 4EYUA 1YI7A 2JKXA 4LNVA 4OI0A 5FP9A 3ILNA 1AZDA 1MS5A 2NYYA 5IVBA 1NCRB 2V73A 3IDBB 3VZKA 1LJ7A 1QH7A 5CVRA 1W3XA 3U10A 3SITA 4LO4B 3NV3A 2E63A 3R4SA 1RVF3 3UNPA 3HN3A 5JCTA 2IWGB 1H2NA 4Q4X1 4LOTA 1FATA 4LA3A 4BYYA 1HLCA 1EP0A 4QPYA 3SH3A 1RUI2 5GLZA 1ZBA1 3OUHA 1HKDA 2C0ZA 2V4VA 4QPIA 2P6CA 2VQ0A 5FKCA 4LE3A 3ZDSA 5C33A 2E7QA 5FYVA 1K5MC 1RUC2 2PHDA 1U0AA 1DQ5A 1XXNA 2WYFA 4LQRA 5K8SA 4CXWA 4GJYA 5FOBB 4YVSA 2WFF2 2YPJA 1JBCA 2BOIA 2LRPA 1F4AA 1NX9A 4IETA 5JSOA 1O3TA 1ZBA3 3RPQA 1DYOA 1KDKA 1JZ7A 2R071 4XUTA 2ZMNA 2VUCA 5HXVA 1OLME 1HV0A 5LCWL 1S0BA 3T0AA 1L7QA 2QFEA 4BQ1A 1OVPA 3I59A 5CFDB 4YG3A 5FYSA 3E5QA 3RNSA 1LOGA 5DXDA 3APBA 4HG6B 3FX3A 3UKNA 1BK0A 2WZR1 5E89A 1ASJ1 2RS31 2XKPA 3A0KA 1UWWA 2J1AA 4N7IA 5HXMA 4K1ZA 1N1YA 4MH0E 1IQDC 1COV1 2H6CA 3WW2A 2R073 1AL0G 2VZVA 1MS1A 3H1WA 1BVP1 2OZJA 4GB32 1W9YA 1HRV1 2Z79A 1MZFA 2RDQA 4QM8A 4AI2A 1MS8A 3VGIA 1NUKA 4FPLA 4E2QA 1W6NB 3O1TA 4QWNA 4QPGA 3ZFEB 5FMOL 1K5JA 1POV0 2Q1ZB 1W6QB 2PXJA 2RMU1 1NE6A 2GMMA 1QEXA 2RS33 3AZWA 1D2QA 4URAA 3HQXA 1K12A 5FZ7A 2WNVA 3AZVA 5HCBA 1VBC1 2PAEA 1XPWA 1DYPA 2UWCA 1PM7A 3DKWA 1X33A 2AYHA 3OB8A 3PVOA 3AL5A 2XBO2 5I8SA 5C9AB 2J1UA 2PN5A 1R081 3WW1A 2O14A 4N8MA 3O1VA 3JBG2 3ON7A 2RMU3 3K75B 3IIIA 3KT1A 5IFPA 2ENRA 4N9IA 2C1FA 3DEMA 3S0MA 2GAUA 1UD1A 1X50A 4MADA 1OI6A 1VBC3 3WDYA 1CPMA 3NV1A 4OUSA 1VMFA 3KM5A 5D21A 5L9VA 1TQ5A 3AYDA 2VY0A 1R083 3BN6A 1UIJA 1PZ7A 2W1UA 1IS4A 1D4M2 3ZYJB 1LOFA 4N7UA 4IV3A 2KA3A 4NPMA 3O1PA 1QOTA 3MGUA 4AI8A 1A34A 4GXLA 5AVAA 4GWJA 4QB1A 2XB6C 4HSJA 2DVGA 1M4WA 4AWDA 1PMHX 3LD8A 4ASLA 2YFZA 2RE9A 2Y0OA 4IV1A 3URFA 5FJHA 5KR7A 4FTSA 3ZSJA 4Y5SA 1G86A 1LGNA 5JIUA 3BIEA 2QQUA 2VMFA 2GC2A 1IG3A 4KWKA 1F4HA 2H0VA 2X5IB 3SQOA 5I93A 2DWRA 4WVZA 4DO0A 3FC0A 1ZBE3 3CLPA 2QDNA 5HPOA 5F5IA 2F4PA 4XPVA 3QBQA 5L36A 1O4ZA 2E33A 2ZEYA 4JGYA 1QMJA 3ETPA 5FDBA 5J98B 5DAWA 1ZRCA 4A41A 3VL9A 1OQ1A 4G4FA 3ZXFA 2BU9A 2DV9A 1K5MB 1VAMA 2UWBA 2Y60A 3HNYM 3LDRA 4LLOA 1GOFA 2HKXA 3HIFA 3NJVA 2MEV2 2W91A 4O65A 2WLPA 2VZTA 4RR3C 4Z2AA 2VOXA 2C6SA 1VBD3 4UBHA 3NMBA 5E6HA 5GKAC 1JTZX 4BA6A 5A3PA 5BNPB 1QY4A 5I0DA 2OPWA 4CDWB 2HWF2 1RUF2 1JW6A 2UU8A 5DZFA 5EJZB 2X53S 1V6MA 2D97A 2XMLA 1YFYA 1ZRIA 4HN0A 1AHSA 2HEWF 2IFRA 3ALQA 3UGFA 5DMYA 1J59A 4N53B 5CZKA 4COYA 1XU1A 3E1F1 4FTBA 1HIXA 4IE6A 4NROA 3JB4C 5FZ6A 2XOMA 1NCQA 2ZGRA 2VCAA 3DF0A 4M3CF 5FTTC 5KHHA 3W9AA 3ZN4A 4PLMA 5J48A 5A7OA 4A3ZA 3NV2A 2CYFA 3ZOIA 1UYZA 4XW3A 1S0FA 2ZGMA 1TNFA 4EWAA 1MPXA 4KBBA 4MXWA 1J3QA 1REEA 2Q0AA 4FI9A 3VBRB 1G8WA 1ZZCA 5FP4A 1OBNA 5T52A 1HN0A 3EJKA 4CCMA 4E8DA 1YQ2A 1VALA 3EBRA 1ND2A 4LTAA 5FXWA 1RITA 5FY7A 1PK6A 3T4VA 1HJGA 1W6PA 2WFPA 5FKBA 1YYNA 2FMYA 3WT3A 2LS6A 5A3WA 3RSJA 2ORXA 1GLHA 1G9CA 2YC2A 1PNFA 5F37A 3PJYA 3PHMA 4Q2FA 2ZKLA 1WMXA 4M0NA 2YY1A 1YFXA 4LKFA 1KGYA 4RD7A 3WDUA 2DVBA 2B4KA 5FZ9A 4FOWA 5JDBA 4CP9A 1IS5A 1V6IA 1QNYA 4UXAA 1UYXA 3T30A 5A3NA 1BHGA 1J83A 2K9ZA 2BERA 3LF7A 5DN2A 1PO22 4LHNA 4YFWA 2Q1MA 5FPZA 5FZLA 3IAQA 4UF0B 3H3UA 4QQPA 4U36A 5IVEA 3MFCA 1AR92 1RUJ1 3WLUA 4Y1UA 2R49A 4KU7A 2X29A 1ZNPA 5HCAA 4FPHA 1EV12 1W9TA 2A3XA 2CWSA 2ZHKA 1UZZA 2QBXA 1N47A 2JDYA 2K2SA 2DUQA 1JI6A 4K21A 1DGLA 3FN9A 3NO8A 4GAZA 4UFKA 5T55A 4QDSA 4CTEA 3ZYRA 4J6GA 1B35C 3AVRA 4HVRA 2HYKA 5DABA 1O5LA 2VU9A 4DXSA 1RUJ3 1HXS2 2R063 3KHBA 4IXLA 5DAQA 3OUIA 5ANNA 1U5XA 3OY8A 3B7MA 3BTXA 2BVVA 2JDNA 2K46A 2XWJB 4IERA 4LE4A 4QHOA 1LHUA 1OOPB 3OBRA 3WP3A 1JZ4A 5L7OA 3LEKA 1ND3B 4NMIA 2BYVE 4DS0A 3C7EA 1OF3A 1VBA1 4AOCA 3ZMNA 1MEC1 2ZOEB 4BCUA 3ZFGA 1AR81 4D94A 3JCIA 1W8UA 1ULGA 1YUDA 3VKLA 1DYKA 4FPYA 2BNOA 4YW1A 5LBEA 2BJSA 4AEMA 1RMU2 4XCAA 2A3YA 1HB2A 2QQLA 3AVSA 4WZCA 4XUNA 3KV4A 4AYUA 1UO9A 1F35A 3TN91 1PMJX 2O8OA 3VDCA 2VNRA 1SPPA 1PM4A 1H4GA 2ARXA 3ZIWA 2I74A 4DRRA 1S55A 2VTFA 3O7OA 5FMBA 4CCNA 3VD5A 1WMEA 4P5YA 1VBA3 5F3IA 3WQ7A 5GLVA 3AKSA 2AENA 1L3JA 3I3EA 4RHV2 1AR83 5IW0A 2GNTA 4NRPA 1U5ZA 2ZMKA 3OBAA 2WIIB 1QOSA 4I0BA 5J3UA 3AX4A 2YU1A 2BZDA 5I0TA 1OQEA 2W87A 2VQAA 1J58A 1HN1A 2W0XA 2WRAA 2HWC2 3PNAA 1M06G 1GZCA 4HKOA 4M00A 3I3MA 4XFHA 3JD71 2XLAA 4EN8B 1UPSA 2VTXA 4YM1A 1S2EA 1SQ4A 2D5FA 3E6DA 4JGZC 2QQJA 3DUIA 3FBMA 2B5HA 2J22A 5IT6A 3LEIA 1W6MA 3OGRA 4N43A 3SEPA 1R092 3T2QA 4Q8KA 3F95A 3PTRB 3AMPA 4D6QA 4E4HA 1F5JA 3HMYA 1A8MA 3OGSA 2WO3A 3AYCA 5FZCA 5LBBA 3KQRA 5LK5A 4OVEA 2KM2A 3JD73 2WINB 5J37A 1P8JA 4WM8A 5KHGA 3J7LA 2R0HA 4XBNA 1Q3EA 2VMGA 3CDZB 2XH6A 1UKRA 4XC9A 2A6ZA 5FZEA 5D2AA 3SCHA 2JDHA 1PIV1 3I54A 1XYPA 5IAXA 4AFBA 3TNPB 1NA1C 4FOVA 3VV1A 4QX7A 4ZZ8A 4XJZA 2Q8DA 4M3CA 3O1MA 1UIKA 1OUXA 4KWJA 1AYN2 4HPKA 4C91A 2DYCA 1HXS1 4Y20B 1S0JA 2W1SA 1AR62 2ZGKA 4KWLA 2GNMA 4BQ4A 5CKNA 4PI2A 5JMCA 4Z8BA 1UX7A 2WDBA 2C4XA 4ISRA 1CESA 4Y1ZA 3WNXA 4D7YA 1QJU2 4XURA 3THDA 1Y9GA 4Q1RA 3O0WA 2E51A 4Y4YA 1DDLA 1AF9A 3JU9A 3T1LA 4CU8A 1DU3D 5IVCA 5FXZA 3AFGA 5CBLA 1YCIA 3B9IA 1OC1A 5IHRA 1RMU1 1VMJA 4RGGA 1PMIA 2QTWB 3WUCA 3PIJA 1NCRA 4LO6B 1US3A 4YZ3A 1VRBA 2EALA 4W6WA 4LHSA 4UYBA 4OI1A 1US2A 4HMZA 4WBBA 2VAUA 1QH6A 2BVBA 2E7AA 2LROA 2ZX3A 4GIQA 1D0HA 1OA4A 1UAIA 3I2IA 1H1AA 3BPZA 1NLQA 3VBFC 3DKQA 4JDMA 4G3YC 5JXHA 3AYAA 5FPAA 5FLHA 2GC1A 4QDQA 1JZ3A 2DF7A 5C3PA 3RQ0A 4KQ7A 1IQAA 1MS4A 1PNGA 1Q8PA 2WNVB 1OA2A 2VMDA 4NIAA 1RGSA 4XFCA 4A6SA 1VBE2 2JB8A 1JU4A 4H3WA 4PJYA 5K9YA 1V70A 1PVXA 5CB7A 1WBLA 5GZCA 1BJQA 4YYOA 3CJIB 4QD2A 3WZ1A 3LKJA 3USUB 1QJY1 3UKVA 5FREA 3BI3A 5KHKA 3NNFA 4ARYA 4TXWA 2D7FA 5C8CC 5I8YA 1OFSA 5JVVA 1S2KA 2YBPA 1JMUB 2NN8A 1NQJA 3VBOC 3VHPA 3ES4A 1YIPA 2YUEA 5BNNC 1S0GA 1CJDA 1KJRA 1ALYA 1TZOA 4R9CA 5KXBA 3CHXA 2EA7A 2YHJA
chains in the Genus database with same CATH topology
4P9XA 1F2NA 4HVOA 4FOYA 1G7YA 1QJY3 5GZFA 2B8MA 3MF6A 2JE9A 1PZ9A 1W6NA 2TBVA 4Q4W3 3NJZA 4B4RA 3FBYA 3ZFEA 4CEYA 3O12A 4C1WA 2HWD2 1W6QA 3WCSA 1GBGA 1IKPA 4Y5Z0 5DDJ2 5JZGB 3B5LB 1ZRFA 3VN4A 5JSPA 4TZDA 3ECQA 4S2HA 1CX4A 3H50A 1QJX1 2CGNA 4BHPA 4BH9A 1QDCA 3I4IA 1DG6A 5C9AA 4JC1A 4AVVA 2ZX0A 1UX6A 4XFIA 3IN9A 5FO9B 3THTA 2Q5TA 4FOQA 4KNCA 3AM2A 4DRVA 2ZA9A 1LHVA 4GQ7A 4QQHA 2WQ4A 4UW3A 1QJX3 1LB2A 2HEVF 1PVC1 4HLTA 2YDEA 5A32B 1Z7S1 2GU9A 3KZ4C 1CAXB 4XTPA 3MLLA 4WZFA 4XF1A 4TYSA 1NOVA 4FAGA 2PHFA 1AVBA 1DQ4A 2GSYA 5TSWA 3MYXA 3OGGA 1OKQA 1LOBA 1PVC3 1RUH3 2DTWA 1Z7S3 4IEYA 2R30A 3FE5A 1RUE1 2YMZA 2RHPA 1C1LA 3J8F3 2GC3A 4L92A 2X5IA 2N7GA 2ZBJA 1QQP2 4P5HA 2I45A 4YW4A 3VBFB 3KS7A 3N3HA 4FPEA 5K9YA 1JH5A 2C5DA 1BBT2 3QH7A 2CGPA 4QGNA 3VLBB 2DCTA 2JJ6A 3E5XA 4B8EA 3PJQA 5LRSA 1Y7BA 3S7IA 1K5MA 1KXGA 2R32A 1XE7A 4AEDB 1H1IA 1FV2A 3GZUC 1WBFA 1HQWA 2I07B 4A7YA 1QOOA 4RL7A 3BODA 5BNPA 3VBHC 4R9AA 4CDWA 4PQ9A 2WWSA 1AYM2 4YVWB 3SXWA 1WCKA 2EVXA 5C8CB 4OLLA 1VBB2 4B7KA 4Q4V1 2ZAHA 2GNDA 2RS12 5I0SA 5JPMB 1RHI2 1AR71 4IEVA 3WV6A 4LHKA 3U4XA 4LBQD 1U5YA 1Q8QA 2DTYA 2XVGA 4Z92B 1GANA 2JX9A 1H2LA 2PLV2 2WQZC 1SACA 1I9RA 1ULCA 2YC0A 2VXRA 3KSCA 3DPRB 4OHYA 3VBRA 4Q4V3 3WQ0A 3VZNA 2P3KA 1AR73 2EAAA 1LGBA 2XWBB 4YLZA 4MZUA 4BZ4A 1CPNA 2CNAA 2WLQA 3B00A 1J1LA 1DF0A 4HKLA 2AGSA 4KG8A 3ILRA 4AQ2A 5CFCA 4IEOA 2SBAA 3L2HA 4BM8A 2GDFA 5FRAA 2R042 4JRLA 2ES3A 5I8TA 1H9PA 1GNZA 2NMOA 1NLSA 3MEPA 1CR7A 2BWAA 4IQPA 4LLFA 4XZPA 3RYPA 3ATGA 3W59A 1BK1A 1YNAA 1H9WA 2R1BA 4NO4A 4F83A 4E4SA 2NMNA 1AL21 1W0PA 2CAVA 5AFBA 3OBTA 1UKGA 4Q4X2 5FFOC 1NY71 2B7YA 4EWEA 4NR1A 4Z2WA 1ZBA2 5FQ0B 4KH9A 3VBSB 4D94A 2DCYA 1VLNA 2CGOA 1N3QA 2XUMA 1LU1A 3SISA 4D3WA 1AX2A 1MACA 2IXLA 2IXJA 3LA7A 3WDXA 3IIAA 1AL23 4FSJA 5DUVA 4OHZA 5BNQA 3GBGA 1LKNA 1XNKA 1Y3TA 1ZX5A 2VVDA 2R072 3HAGA 3SLIA 5JI7A 3GZTB 1OOPA 4BWOA 4EV0A 1XQNA 1XNCA 2CTVA 1A8DA 1WUVA 4LO8A 1DQ2A 2QQPA 2WZR2 2WS91 1C8NA 1ASJ2 2RS32 3B94A 4XJWA 2F6BA 2BWCA 1COV2 5C4WC 1WCSA 2XJPA 5KXCA 2YGLA 4RR3A 1IOAA 1HRV2 4XF9A 3VBHB 5A3MA 1WW4A 5SV8A 4YZ2A 2Q8OA 2FZ2A 4P9YA 4XJ9A 3ZO0B 3ELNA 4K8FA 2RMU2 2WS93 4D7TA 4XIKA 2P34A 3E97A 4JAAA 5BV6A 5ABJC 2JG8C 3PVBB 1AJKA 3H3ZA 3N7LA 1RVF1 1UPIA 2D3PA 1VBC2 3NKGA 1VP6A 2W08A 3IPVB 3J4UH 1H8TB 1HW5A 1FI2A 4Y24A 1R082 3OTFA 4Z82A 4D69A 4R8HA 5DZGA 3IT8A 5EV7A 5F1RA 4AI1A 3OCPA 2Z5WA 3DL3A 3FUOA 5FMOS 1SLCA 4R4ZA 1R1A1 1N1SA 4MGIE 2QZ3A 5CNAA 3RS6A 1O4YA 4PDWC 1ONAA 3FZ3A 4BPZA 2PHXA 2R6QA 2YROA 2HWE3 1GNHA 1IS6A 4LUKA 2HWB1 4BIOA 4BE3A 1MQTC 5AVPA 5KC6A 3LSDA 1JHNA 4JTNA 5AC91 4MV2A 2FBEA 1R1A3 1ZBE2 2D40A 3RG0A 2VVFA 3TB0A 2MNGA 4COUA 4Y20A 1I1EA 5ACA1 2HWB3 2IFWA 3I7DA 1YIFA 1V6NA 1OQDA 1C5IA 2DFBA 4AG4A 2GZWA 1WLWA 1S0EA 4H7MA 5AC93 4CDXC 5KHJA 3D82A 5D8AB 3S30A 5T3NA 3AFKA 3N35A 4E2GA 1LHOA 3NAPB 1W39A 2X8KA 5ACA3 1RUD1 4GKXA 1Q56A 3H8UA 2CL2A 3HN1A 2ZGSA 1LGCA 3HT1A 4JCKA 3C2UA 4CEWB 4CEYB 1TMF1 1HRI1 1ZRDA 1FAYA 2JECA 3SCGA 3RI9A 1W2UA 1RUD3 2NM1A 4AXOA 5FO7B 3ZSKA 2Y0IA 1WMFA 3VKOA 4I3GA 4FQ4A 3M8LA 4XQDA 4NHMA 3A4UA 2RJLA 3LA2A 5B2GB 3IM0A 1V00A 3M7AA 1TMF3 3WG2A 1HRI3 1RC6A 1E57A 3CJIA 2WSVA 1LESA 1SCRA 3PLQA 4GH4B 3USUA 3TBDA 2GMEA 2ZGUA 4CZSA 1FPN3 3B3QE 4C1XA 2B39A 4AVAA 1QKQA 3E6BA 4U2AA 4S2FA 5FPXA 2BW8A 1BZWA 3WVJA 1LENA 3MF9A 2WNUC 2WT0A 1ZZ6A 4LUMA 4Q26A 4WVWA 2ZGOA 5H9SA 4YRDA 2CY6A 5ABJB 3VDDC 1NXD1 2WSUA 3WW3A 2IXHA 1ZBE1 3V64A 4E2SA 2PELA 5EJ3A 4C90A 3U11A 3OD0A 3WHUA 4Q0UA 3AKQA 4XF0A 4OI4A 5JZGA 5CU1A 2ZZQA 3ZSLA 4FXGB 4QM9A 1S0IA 4EROA 3JQXA 1NLRA 1VBD1 1H2MA 5GALA 3JQWA 3N36A 2V5YA 4ATFA 1MQTB 4A7KA 1RUJ2 2GH2A 1WCDJ 3BB6A 3E6CC 1RUG1 2B46X 4AE2A 4Q27A 5LK7B 4Q0QA 1QGLA 1RUC3 3N7JA 5A32A 5KXEA 2WL1A 4R9DA 1GFF2 4TWTA 1MZ5A 3M3OA 4IEWA 5BNOC 1CAXA 3I8TA 2AUYA 1RUG3 2Z2SB 3WG3A 3R05A 4I0WB 4Y22A 3DGTA 3MIGA 5JPNB 2RR11 4HK8A 2DUPA 3PMSA 4Y26A 3J9SA 1VBA2 4K9SA 1MEC2 5GZDA 3BOPA 3WCRA 1AR82 3AMNA 4K1YA 4YM3A 1MR5A 1SDWA 3AJZA 2XL7A 4AHXA 2BFUL 1EPZA 2D6MA 3TN92 5CAZA 2UY9A 3VBFA 4O9GA 3WP6A 4GB33 2RR13 3IDEA 4OFGA 3H7YA 2DVFA 1GV9A 5CFCB 4AEDA 3EXUA 1ENXA 2Q4SA 2QCSB 3WP4A 1QXPA 1LOEA 3ZFFC 1DZRA 2VUJA 1ZZ8A 5JOYA 5LEKA 1R1ZA 1TME1 3JD72 2WNEA 3V56A 4YZ4A 1XNBA 3GALA 1JXNA 1SMVA 3OGJA 4MSVA 4YVWA 1CONA 4WM7C 3JBG3 3NL1A 1SLIA 4FVVA 2FQPA 4DS0A 4I01A 5C8CA 3FLPA 1D4VB 3GBFA 2R1DA 2GN3A 1MS9A 2A71A 5BNNA 4XYXA 2WNUB 1SEFA 1TME3 1CIWA 1Z0HA 2R061 1U5IA 2VW0A 1DGWX 2R0FA 2NZ9A 3R4DB 2YXSA 4JRAA 1C8M1 3IKWA 1J1TA 2A5ZA 4DFSA 3MZHA 1PIV2 5JAXA 1KRIA 5GLWA 1X8EA 1FXZA 3DPRA 4XFGA 5F6LB 2JENA 4F7ZA 1IPJA 1AXZA 2XJVA 1OPMA 5EYXA 1AUYA 5AFEA 1ZRRA 3CJXA 4FPOB 4DPNA 3KGZA 4AI3A 2ZTNA 5CG8A 2ZHNA 2IC1A 2UY8A 4ZKTB 4L8QA 1C8M3 3FUQA 1CAVB 2A75A 2VW1A 5IK4A 2QDRA 1PGL1 3X29B 1FV3A 2ZPXA 3AZZA 4NOTA 4XHBA 2QKDA 2WC2A 5HBAA 3S7EA 5KC5A 3KD4A 4AGGA 1BMV1 2ZCWA 3WG1A 4NN0A 2EXHA 4QPGC 2XL9A 1LECA 1EY2A 1N1VA 1VAKA 1NZCA 2P2KA 4RR3B 4BIFA 2ERFA 1I6XA 4XTMA 1UU5A 3AKTA 2RM21 5BNOB 3MFAA 4YW2A 4JDNA 4XOGA 4QQLA 1OPOA 2HWF3 5FQ0A 1RUF3 3FWEA 3VBSA 3ZMOA 1LCLA 4Q4Y1 4XJ8A 4KGQA 3UK9A 2VVEA 4MXVA 1AXYA 2WA3A 3VL8A 3IWZA 2EXJA 4DXZA 4MYEA 2RM23 3UJOA 3H7JA 2ZX1A 3GYDA 4XJUA 2D98A 4QGLA 1EYBA 2P17A 3P3PA 4XJAA 1YJKA 3BIWE 1ULDA 2TEPA 4PF5A 1QJY2 1LOFC 4IV3C 1LTEA 4Q4Y3 2O0OA 2D43A 1DGRN 5IK7A 1SBFA 3H1YA 4AI0A 4CRQA 3C3VA 3CF6E 3LB9A 3HR9A 3HBZA 4B4PA 2BTVC 3ZFFB 4LULA 4X8NA 1WW7A 3MI8A 3AMHA 2UYBA 2H0BA 3VBHA 5GLTA 4L99A 1C57A 1RB8G 4O9EA 3B9CA 1PO11 4KL1A 4CP2A 4WM7B 3POWA 4R4XA 1V6OA 3TAYA 3ZYGA 1QJX2 1A78A 1SBEA 2HJIA 1LU2A 3IPVA 1H8TA 3QH6A 4X6RB 4F3JA 5J09A 3M4FA 2ZS6B 1CAWB 2IXIA 1NXMA 3D8CA 3MICA 2ZGNA 1PO13 1SLTA 1HQNA 3QACA 4IEXA 3JZVA 1B35B 2PHRA 4E4ZA 2A6WA 1AJOA 1VRH1 3CU7A 1PVC2 1CVNA 1QXRA 4P9GA 3RYRA 1Z7S2 2IXCA 1X7NA 2E9QA 1ULEA 4GWNA 2CWMA 2XJUA 3CNAA 3O0VA 1URXA 1X36A 1KD7A 2GH8A 4YNIA 1O3QA 3M70A 2ZKNA 3LA3A 1LOAA 4AVTA 4YGDA 1HX6A 2B45X 2VOKA 4L2NA 1VRH3 5E88A 3AJYA 1H4HA 1UCXA 4QGMA 3WW4A 1KJLA 1RUE2 4ORFA 1YLLA 1KDMA 3FJSA 4MLOA 2VULA 3SCFA 4Q4W1 5D8AA 1PK6C 2DU1A 5T54A 4AVSA 1WLCA 2VUAA 4W65A 4LBLA 3VUOA 1X82A 2V09A 1DHKB 1LODA 4WV8A 4AF9A 1UF2C 3G7DA 2AH2A 4I3PA 3ZX7A 2I2SA 4IEPA 3H0OA 4AQSA 4CEWA 4JGZB 1DIWA 1W6OB 2XLGA 3VKFC 2FZ1A 1LEDA 1LRHA 4PBPA 2A3WA 4INDA 4MGKE 1NYWA 1CQ9A 3GBWA 3MIBA 3WY6A 3UKTA 1F8VA 1ZZ9A 2O8QA 5FBZA 4OHXA 3SMHA 1Z78A 2H6BA 1BYHA 4META 4Y1YA 3RJ2X 2BBVA 1V6JA 4FO9A 2ZX4A 3ZXKA 2RJKA 4Q4V2 2BUKA 5A33B 4LBJA 5KHIA 1AR72 1RUOA 3L2YA 4LBMA 4GH4A 5T50A 3WR0A 1NA1B 2PAMA 2OW4A 5C4WA 4NVPA 2XG3A 3H1MA 4BLJA 4HZFA 5F6KA 4SLIA 3GF6A 4OZXA 5KBFA 1RL3A 1RUH1 1H1MA 2PHLA 1NQDA 4HT1T 4GKYA 3VBUC 4JVAA 4YZ5A 1AYN3 3TRSB 3J8F1 3QCWA 4XE9A 4QHBA 1AR63 5ABJA 4B4QA 4ISQA 3ZFGC 1U12A 2BNNA 4E4DX 4Y22B 1C1FA 1I5ZA 3POSA 1XYNA 2DU0A 2MHFA 2W68A 3QOPA 2Y26A 3RMXA 1PGW1 3VKMA 5FCCA 4DQAA 3VKNA 4I2OA 1UW8A 3WDWA 2JICA 4LO7A 1J3PA 2QVSB 4BMBA 3T1MA 1JYIA 4RS5C 1EAH1 1B09A 1RIRA 1FOD3 1V6LA 3ACLA 4P9LA 1AL22 3ENRA 3P3NA 3AB0A 1MQTA 4ZXKA 2ZX2A 3OYWA 1NY72 1YHFA 2YGMA 4XMAA 2UYAA 2E6VA 4BOWA 4EJRA 3R6SA 4AHWA 1SLBA 2ZAAA 2OPKA 4QQOA 1EAH3 2NLRA 4J1WA 1VBE3 3U07A 2VGDA 1AX0A 1S0CA 1GKBA 4DB5A 2JE7A 1OLQA 1DZQA 2AZ5A 2E7TA 5E8AA 1FMD1 3USSA 3VBOB 5L19A 3R4UA 5BNNB 3PMEA 3WDVA 3ASIA 4GALA 3WXPA 3D0JA 4HBNA 3NVCA 1G9FA 2DVDA 4HETA 1DGWA 1FMD3 2WS92 2E53A 4WVVA 2TUNA 4TSVA 3LSEA 4DMIA 1RTVA 3DV8A 4YGEA 1LULA 4W6XA 1WLTA 2RS51 3CO2A 3MIDA 1ENSA 2MPFA 3OPZA 4XDQA 4JV4A 5DDJ3 2D93A 2KXLA 2OUJA 1NCRC 5BYNA 2BEOA 1RVF2 4YSFA 2PQQA 2ZZJA 2HWE2 3N7KA 1BEV1 2RS53 3N4MA 2OA2A 1KQRA 2ZJCA 1UMZA 1N1TA 1JN2P 5JSRA 3FMGA 5BXXA 1R1A2 2AR6A 4CP0A 3VBUB 2WNUA 5EFUA 2XPJA 4YZ1A 1C5HA 3ZXLA 1HQLA 1GZ9A 5GM0A 3KT4A 3J26N 1GR3A 1BEV3 1ULFA 2HWB2 4QX5A 1MS3A 4UBGA 1GQHA 1XE8A 4YFZA 4AEJA 4ZU5A 1SFNA 3M3QA 1ENRA 1TE1B 1N3PA 4FPJA 5AC92 4QT6A 2W52A 5EXOA 2ET1A 4XQ4A 5BY5A 3RDIA 1VIWB 5ACA2 5CFDC 1ZM1A 3V65A 4PIZA 1CAVA 3ST7A 4CP1A 2Z69A 1NE4A 4Y1VA 1G9BA 2UURA 1ENQA 2QE3A 5H9QA 4N9HA 5CA6A 3ZFEC 1RUD2 2VW2A 4BMEA 5JOZA 5GJ6A 2YV8A 3POYA 4XF3A 2NQYA 2BGCA 4ONUA 3E5UA 5L73A 1DLLA 1TMF2 4IEQA 4XEZA 1HRI2 5F9TA 4LBKA 5BNOA 5I91A 2QZ2A 2W39A 2DCKA 4FPGA 3KCCA 3VZLA 4YGBA 4COZA 2PHWA 3NSTA 5FLIA 4CDQC 1DGRA 2K0GA 2HWE1 3W58A 2VG9A 2RS13 3H9AA 3KCYA 4PCRA 2XJQA 4FP3A 4LT5A 3LOBA 3ZSEA 4FBFA 4FQZA 4XIOA 1APNA 5IUQA 4SBVA 1AX1A 3MPPG 5EYYA 4C0HA 2JG9C 4FPFA 4GMP1 1DQ1A 4EN6B 2G9FA 3NAPA 3TWIA 1V9U1 4HVQA 3BCWA 1MS0A 1N3OA 3ZFFA 4LEJA 2X5IC 4GWMA 4X8PA 4P9IA 4AW7A 2PFWA 1IGOA 2R043 2WT2A 4DY5A 4GMP3 4FTEA 4AVCA 4WM7A 5HCFA 1V9U3 2B42B 1SFYA 4E9KA 3WQ1A 1VBD2 3KMHA 1D0GA 1YO8A 5SV5A 3SH5A 4ES8A 1CAWA 4Q0VA 3TNQA 3U0ZA 1LR5A 4Q4X3 3AKRA 2EXKA 4G9SB 4ITCA 4F8AA 3EQEA 5BNPC 4YG6A 2WKKA 1RUG2 4CDWC 1O91A 3GHMA 3V0BB 1B35A 3M3CA 4ZU7A 5LEJA 4L9BA 4N53C 1F5FA 2LUWA 3TYJA 2XJSA 4PIYA 3ZN6B 1LHWA 3V0AB 1FPN1 3LOIA 1S1AA 3RMYA 3ZXGA 1JUHA 4IESA 3LGRA 5DUXA 3TOJA 2R16A 2RR12 4FAHA 1O7FA 3VBRC 3KB5A 4CDUC 4FCAA 5C4WB 2WZR3 2CV6A 1ASJ3 4LBNA 5FAXA 1COV3 1ZZBA 3MW2A 1QHDA 3UV9A 1UU4A 4XFAA 1HRV3 4MUVA 4OULA 4K40A 4UW6A 2PTMA 3D4KA 2JEMA 3JUUA 2JG8B 5K0UC 4K7JA 4FPKA 4XFBA 5T5JA 3UJQA 4OUMA 2BNMA 2P3IA 4Q8LA 3AMMA 4CDQB 5LRRA 4XXAA 4JGZA 1W6OA 3AXEA 5E16A 1WLDA 1GZWB 2BFUS 1TME2 4EN7B 3AMQA 4V1PA 3ZYIB 2D6LX 1RUI1 3WOGA 2WT1A 1PGSA 3MIFA 5CG9A 4P9JA 4PDWB 1RUC1 4I09A 2XJTA 1NG0A 2JG9B 3CL1A 5A33A 1Q8VA 1IHMA 3R0RA 4GMP0 3AP6A 2A6XA 1OHFA 2WFF1 4Q1PA 3OYWB 2R062 4ASMB 1KS5A 3BALA 1RUI3 4JQRA 1NA1A 4NWWA 1KS4A 2VNGA 1QXJA 1C8M2 4GULA 1VJ2A 2PYTA 2D6KA 3DN7A 2D44A 3KT7A 2Y38A 1OOPC 2DCJA 3MPBA 1ND3C 2WFF3 4YARA 4RQPC 1VB2A 4PLOA 4HK9A 4CDXB 5IK8A 4Z07A 4GB31 4MGYE 4E27A 2ET7A 1WA4A 1PGL2 1IZ3A 4PIXA 1Q8OA 1BMV2 2JXAA 4QU2A 2WA4A 4URTA 2A6VA 4DOUA 4DZGA 1V6KA 5JOXA 4OI2A 2XBO1 1CGPA 1A6CA 3ZIXA 2VMIA 2PHTA 4AQ6A 1YRZA 2RM22 1TNRA 3O0XA 1OSGA 3JBG1 1GSLA 3VHRA 1PHMA 3KCXA 3WHTA 3WG4A 4S2GA 5FOJB 1BVVA 2QNKA 2FMDA 3LCPA 3SNMA 4Q4Y2 4WVMB 5J7MA 2OYZA 4AHZA 2PAKA 4LHLA 1GQGA 2XBO3 4AK3A 5I0RA 2O1QA 2VH9A 1HDKA 4CDUB 4DINB 1S0DA 3MLJA 1OMIA 3MW3A 1D4M1 1YJLA 2B9UA 1RJ8A 3VBOA 4CYDA 4QPIC 4DNYA 3INAA 4OHVA 4YM2A 3LZZA 1Q5OA 2ZACA 4NWVA 1EPWA 1LHNA 5JIAA 2XVKA 4I02A 5H9PA 4LBQB 3VDDB 5K0UB 4K20A 1D4M3 1DQ0A 1FYUA 4A2UA 4YVSC 3OD4A 4EN0A 4FXKB 4YGCA 4H14A 3VZJA 4MGZE 1PZ8A 1QNWA 1T6GC 3SH4A 3HWJA 4N90A 4R52A 1YWKA 3ETQA 4HSLA 1FNYA 4H55A 3ZN5A 1PO12 1BKZA 4AVBA 3NKTA 1YXWA 2P37A 1QJZA 4XILA 4Y1XA 4HANA 2MEV1 4FPCA 4LO5B 1OA3A 4M0HA 5CIRA 4ES9A 1O4TA 2G9GA 3VHOA 2HWF1 1REDA 1RUF1 1UL9A 5EWSA 1OFNA 4UW5A 1CN1A 2AREA 1REFA 5C8WA 3AXDA 2WNVC 1RUNA 3VBUA 2MEV3 5T5OA 1VRH2 4UW4A 4YM0A 1VB4A 4RQPB 1OD5A 1WGPA 2CAUA 1WW5A 3FFQA 3MLKA 3VHNA 2OUHA 1ZZ7A 3CJIC 1Q8SA 2GMPA 1F31A 1XU2A 3PVEA 3FLRA 1CAUB 4W6YA 1GYKA 1MEC3 3AZYA 3QD6A 5IK5A 3MIHA 4RS5A 5I0UA 1QWRA 2XKOA 4PBOA 4QQ2A 4YW5A 4Q4W2 3TN93 2GN7A 4D7SA 3BTAA 1O3RA 2YYOA 4RA0A 4AGRA 1X8MA 1UN1A 3MW4A 4IV1C 4J1XA 5GLUA 4RSUA 4COWA 3RWNA 2VOWA 4ATEA 1ZA4A 4NHKA 5J96B 5JZGC 1PO21 3ZXEA 3B69A 2DCZA 1AR91 1KFUL 1VAVA 4JGYC 1HV1A 2PA7A 1IS3A 3AK0A 2XJRA 2ATFA 1EV11 4QPIB 5T5LA 5CADA 2YZ4A 4A3XA 5J36A 4HFSA 3ILFA 1PO23 2G4IA 4DY3A 5KWRA 2LALA 4X6QB 2D6PA 1AR93 4YVSB 3RZZA 3O14A 2IXKA 3GZAA 1O3SA 1EV13 2ZHLA 4HKWA 4MVTA 2ARBA 2WZPP 3WUDA 1PIV3 3ME2A 5F5QA 3VZMA 3O5SA 1RUH2 5GZGA 3I59B 2JDZA 5EZWA 1NCQC 3K51A 3J8F2 1HXS3 2GNBA 4GA9A 1IPKA 3B02A 5C6CA 1FOD2 1JUIA 3ZYPA 2XHKA 3ES1A 4QPGB 4RHV1 5A3LA 1PGW2 1TEIA 4NPRA 1RMU3 1ND2C 2VNOA 2HWC1 4Q0SA 5T5PA 3ZSMA 1Q43A 3FHIB 2ZABA 1EAH2 1UZYA 4LA2A 3ROUA 4Q29A 1QU0A 4AEDC 2DUOA 4XF4A 3A0NA 3IMNA 4RHV3 2BPA2 3WX5A 5JI9A 4ZU4A 4B29A 1R091 2OIIA 2HWC3 2D6NA 2P3JA 4YVWC 3V0BA 4KU8A 1DBNA 4XFFA 5H9RA 1A3KA 4I30A 1FT9A 2A70A 2IZWA 5CFDA 3ZN6A 1IKQA 3V0AA 2FHRA 4IV3B 1FMD2 1BXHA 1R093 3WDTA 2TNFA 1DFQA 2ZGLA 1MZEA 4XBQA 1AYN1 3KGLA 3DPRC 1S2BA 2A73B 4IV1B 1AR61 1ZREA 4AFDA 1CD3G 1H0BA 1WD4A 4XETA 4L11A 1QJU1 1YFUA 2NP0A 4IEUA 3NV4A 1H2KA 5L7OC 3CEWA 4XHXA 4JGYB 4Z1VA 2RS52 4TLFA 2XGXA 2JG8A 5JWPA 1WW6A 4QMAA 3N7MA 4XQWA 4HN1A 4EWDA 4CDQA 1QJU3 4AFAA 1FOD1 5K7PA 1ZYBA 1D2SA 4BLIA 1GZWA 4B3NA 4Q0PA 4AFCA 5DG2A 1BEV2 3L9JT 3RI8A 1C4RA 2A6YA 4JDOA 2VMHA 1MVQA 2Q30A 1SLAA 3D5OA 4PDWA 1G9DA 4RGAA 1G9AA 4AFMA 3B01A 1VBE1 5FLJA 5BUVA 2DURA 2JG9A 3D6EA 3VBSC 3AP4A 5BPXA 2PHUA 3GNEA 3MDPA 1FNZA 1NCQB 3LAGA 5DUUA 1I3HA 2EXIA 4AQTA 3AP9A 5FO8B 5DG1A 3AP7A 2ZGPA 4LBOA 4NHLA 2XLFA 4N43C 4MXWB 3RRDA 4C0BA 5E1RA 1OLRA 1J3RA 2HEYF 3SHRA 2ETEA 1RINA 3BOWA 5DZEA 4WM8C 1ND2B 3RYKA 2OZ6A 3EHKA 4CDXA 1MZ6A 1PK6B 5KXDA 1RUE3 1W6PB 4IEZA 5JR7B 1QF3A 4KG0A 3JB8A 4P9WA 4P14A 3KLSA 4KGGA 4M01A 3PTYA 2ZHMA 2EIGA 3ZXJA 2HWD1 3QLQA 4K3UA 1WD3A 3IBMA 4JTOA 1WMDA 2GALA 1VR3A 3FLTA 5DDJ1 3WINE 2A7AA 3M1HA 1C3HA 3IDCB 1QDOA 3FFZA 3NW4A 1H30A 4FT8A 4RFT0 4N53A 4PLNA 2OVUA 3WP5A 1MVEA 2UWAA 3GHNA 4R9BA 2HWD3 4AHYA 1H8TC 4M3CE 1SLLA 3M3EA 3RJRA 4B7EA 4WVMA 3AP5A 2ZMLA 3MIEA 4HL0A 4YG0A 2VECA 3M3IA 4COVA 2VPVA 3S6PA 5HI0A 1KITA 4CDUA 1UU6A 3M2MA 2ZGTA 4MX3A 1XYOA