5HBAA

Globular domain of zebrafish complement 1qa protein
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
133
structure length
133
Chain Sequence
EKPAFSVLRNETSQAQYKQPVTFNDKLSDANDDFQIKTGYFTCKVPGVYYFVFHASSEGRLCLRLKSTSAPPVSLSFCDFNSKSVSLVVSGGAVLTLLKGDKVWIEPFAGDGGVGQMPKRLYAVFNGFLIYRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of zebrafish complement 1qA globular domain.
pubmed doi rcsb
source organism Danio rerio
molecule tags Immune system
total genus 25
structure length 133
sequence length 133
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5hbaA00
4KGQA 1PK6A 3L9JT 4DOUA 4GIQA 5BNQA 2QE3A 3WD5A 1IQAA 1D4VB 2Q8OA 1C28A 4QQ2A 3TYJA 2QDNA 4E4DX 4QQOA 1TNRA 2WNVB 1WCKA 3B93A 4F3JA 2TUNA 1I9RA 4QQHA 1PK6C 1U5ZA 2R32A 4EN0A 3AB0A 1OQDA 4MXVA 4MXWB 4RSUA 2TNFA 3IT8A 1ALYA 2WNVA 2HEYF 4QQLA 2HEWF 5KC5A 1RJ8A 2Z5WA 2JG8A 4TWTA 3V56A 1S55A 4G3YC 5TSWA 2AZ5A 4J6GA 4MXWA 4TSVA 4KG8A 4DB5A 1XU1A 2JG8B 1C3HA 2HEVF 1A8MA 1KD7A 1U5XA 2WNVC 5HBAA 4G4FA 3K51A 2X29A 2JG8C 1RJ7A 4OUMA 3ME2A 3LKJA 2WNUA 2E7AA 2RJLA 2OIIA 4NN0A 3TWIA 4OUSA 2ZJCA 3K48A 1KXGA 1XU2A 4QQPA 3QD6A 2R30A 4KGGA 2WNUB 1D0GA 5L19A 1U5YA 2R6QA 4D7YA 4QPYA 2RJKA 2JG9A 1JH5A 2WNUC 2RE9A 2KA3A 3ALQA 1DU3D 3FC0A 3B9IA 1TNFA 1DG6A 3QBQA 1PK6B 5KC6A 2O0OA 3MI8A 2JG9B 1D2QA 1JTZX 1OQEA 5KWRA 1OSGA 2Q1MA 4MSVA 5CIRA 4OULA 3B94A 3URFA 1O91A 2ZPXA 2JG9C 1GR3A 4E4SA 4HT1T 5L36A 4N90A
chains in the Genus database with same CATH superfamily
1UMHA 4R52A 1G6NA 4Q1PA 1ASJ1 3QCWA 4RS5B 1BK1A 3AMPA 3ZYIB 4TXWA 1O7FA 1OH4A 1EY2A 1N1YA 1ZZ8A 2P5BA 2ZX1A 1VJ2A 4QWNA 3CNAA 2FCUA 5HXMA 1W6OA 1CGPA 3FN9A 2ZGRA 4AVBA 4QXKA 1TNRA 5FPAA 4MV2A 2ADDA 1OPMA 1W06A 3ZPYA 3CHXA 5CKMA 5G04L 2RS52 5GLWA 1LOBA 3AZWA 4FQ4A 3ZX7A 4FTBA 3I59B 4LMFA 1TME2 1RUF2 1GMMA 4EN0A 3T2OA 1Q8VA 3C7OA 3RMXA 4QB6A 3MUZ1 2HWE2 2ZGUA 3WZ1A 3D0SA 5GM0A 1UIKA 5CFDB 4EQVA 2ZGOA 3AP4A 3ETQA 3R4UA 2VG9A 2W68A 3X29B 4B29A 4RHV3 1O3TA 1XNBA 2RMU3 2VTXJ 2EIGA 1VBA3 2Z5WA 5C8CB 3ACHA 3D8CA 3M8LA 4JGZB 3RZGA 1OT5A 1AXYA 2DCKA 5JMOA 1V9U2 3VBFA 1OLRA 4ZS3A 3UETA 5CB7A 3RYKA 3VB9A 2WNOA 3MEPA 3L2YA 5C6CA 1XNCA 2GN3A 3RI8A 1KFUL 1WA6X 1YCIA 2RDNA 2YU1A 1AX2A 5HPOA 5FIXA 1RHI3 2PHUA 3N7LA 3U0ZA 5IK4A 2FHRA 2HWD3 5BNOA 3VUOA 3T3YA 4NUBA 1AR83 2BRTA 4L8QA 3OJBA 1CAWB 1GYKA 2VNVA 1QEXA 3PVNA 1WZXA 4IERA 5FY7A 3ITQA 3LKJA 3T2PA 1SACA 5K0UA 1LOFA 1CD3G 4URTA 3IMMA 5G05L 2VZUA 1H1IA 2PLV1 4FVVA 4OUSA 5FZLA 4YGBA 5JIAA 4XMIA 4CDWB 4CEYB 4Z1VA 5CFDC 5IYYA 5LZ6A 5IJRA 1KDMA 3OD0A 4PI2A 3KHBA 1YQCA 1GZ9A 3O0VA 1LNSA 3OF1A 1FOD1 4XE9A 1DGRA 4Y20A 3WF3A 5C8CC 5IK8A 1KJRA 4JGZC 4TN7A 2DWRA 3I2IA 2W1QA 3ZFEB 4D6SA 2WA4A 2WNUC 3OG2A 4CCOA 2RS11 2HWC3 1S0DA 4RYDA 1JZ6A 3P3NA 1GZWB 2ARXA 2FZ2A 1W0OA 3F95A 1RUJ2 2HBTA 3WQ1A 2R0HA 1QXRA 4GB32 1LRHA 4OFGA 4CA9A 1WGPA 4Y1XA 1BMV2 3WX5A 1QJU2 3MLKA 2P17A 1J83A 3MF9A 1AR72 4AFBA 2VNRA 4S2DA 2R16A 3U75A 4B7EA 4JC1A 2WFF3 4DFSA 1UWWA 2JIJA 5IAXA 1R64A 3PJQA 2ZPXA 2R062 4XABA 4FSJA 2WT2A 1NXMA 3WOGA 5FZOA 2Q4SA 4CDWC 4CEYC 1ZBE3 4Q4X3 4CCJA 3E5QA 4PQQA 3DGTA 1GNZA 3HD8B 1JZ3A 4GKYA 2RS31 1T2XA 4LIUA 1XJAA 4DZGA 1H6XA 1TMF2 4LBQB 4LLFA 2PFWA 1AXZA 1QDOA 3NO8A 2Q8OA 3RGBA 4AEDB 3ZFEC 1UX6A 3U4SA 5ACA2 1HRI3 3ETPA 5IVFA 2XLGA 3NJZA 1F15A 4GMP1 1T6BX 1AR92 3MIEA 2XLAA 5FQ0B 1EPWA 5LBBA 3JU9A 3AZXA 1EPZA 2CWMA 4R8HA 4LULA 3RVHA 1VMHA 1UY0A 4XPVA 2Q8DA 1DGWA 2VMDA 4XVHA 4MGSA 3ZN5A 2A3XA 1FT9A 3I54A 5IK7A 3HVDA 2GH8A 2MEV3 5KHKA 1S0GA 1AJOA 4BK5A 2P3KA 4B8EA 3C7EA 3A22A 5FZKA 2YGMA 4XQDA 3H8OA 2DBNA 3J7MA 4J1WA 3M3EA 2FD8A 1WWYA 4XBNA 5ERLA 1X9PA 5FPBA 4KWUA 4EYUA 2BQPA 4AI1A 2NZ9A 1E57A 3R05A 5JSOA 1UCXA 1WLCA 2GMMA 2J1AA 3N9QA 4MO3M 1QIQA 1UYXA 2BJSA 1H30A 4P9XA 1VBD1 4AZZA 3KB5A 3T0DA 1OLQA 3NNJA 4HN0A 3WF4A 1WCDJ 2A75A 4M0HA 4CVUA 1F9KA 1S2KA 1SHWB 2A6ZA 4EV0A 4UFLA 1POV1 2RS53 2XL9A 4Y33A 4YG0A 3ZFGB 4NIHA 4IGQA 5DG2A 3M70A 3O1UA 3AZVA 2VJXA 3KGZA 1TME3 2K46A 3AP9A 5FK8A 5DUUA 4AEKA 4I2OA 3HAGA 3AYAA 2X5IB 5DQ0A 2RJLA 4BIFA 5CG9A 2JJ6A 4PLNA 4FI9A 1YIPA 1OLME 2HH9A 2AUYA 2ZGQA 4JKMA 4LHNA 3JBG3 1HB1A 1IPKA 2JIGA 4HMZA 4CCKA 1GOFA 5FP4A 4RR3B 3S6PA 2VZOA 2W1WA 3GM8A 1XYPA 1Q8PA 2R30A 5FBZA 3KCCA 3ZXDA 1R091 4WM8A 4WVMA 3RNSA 1UU6A 2B45X 1PGL1 2R1BA 1AHSA 4QX2A 2WC2A 3PU8A 3POBA 1V9U3 5BV6A 1YI9A 4QKFA 3TOJA 1J1LA 2I2SA 1QQP2 2QQMA 1DQ6A 3J7LA 3N3HA 3Q9OA 4IEWA 4CP9A 2D40A 2BGCA 1AF9A 3E6CC 1PVC1 1GBGA 1F8VA 2ZEWA 3C8XA 1OQ1A 1DG6A 3OGRA 2IXJA 3HJRA 1MS1A 5FREA 1VR3A 1XPWA 2OZJA 2WJSA 2AYHA 1IGOA 3ZFGC 5BY5A 4PIXA 1PO22 2VQUA 1NCQB 4GQ7A 2BV4A 3I2JA 4Y3OA 4XXAA 3VD5A 5EP9A 1CX1A 5CIRA 2X5IC 1XOYA 1OA3A 2JWPA 3O1VA 1H8TB 4XURA 2ZGKA 1OUXA 1CIWA 2WSVA 4NVPA 3PHMA 4CYDA 2ZX3A 1NE4A 1W6NA 4RR3C 4ZS2A 4A42A 3ZVXA 1LHNA 1SBDA 4CCLA 4EZ4A 1KGYA 1PO12 3LCPA 1QJZA 3B7MA 2D43A 4YLZA 1MQTB 3LWCA 1SCSA 1ODMA 2SLIA 1HXS2 1LCLA 4FFHA 1BVP1 2QE3A 3UGGA 1QJX1 4P02B 2QZ2A 5E16A 4ZXKA 5B2GB 5A80A 5IVBA 2AGSA 2VQAA 4GWIA 3VD9A 5CKQA 4E9KA 2WNVB 4ISRA 3AKTA 1LENA 4WM8C 3S5QA 3WG1A 4AF9A 4M3CB 5EYXA 2BNOA 3M3CA 4GB33 4QKDA 1JXNA 5FYUA 1ONAA 1C57A 1QJU3 5FPUA 2RM23 2BGPA 4QD2A 1AR73 2FDJA 2P2KA 5LA0A 5FP7A 4PLOA 4LUKA 2QQLA 4UFKA 3I3DA 4N43A 5FZBA 1NCQC 4AHXA 4AHYA 5A3TA 4IETA 1ENXA 4E8CA 2UYAA 1E5RA 2YXSA 2R063 3POFA 4P9YA 5I91A 3RG0A 1H8TC 5CFCC 1BHGA 1CX4A 1MZFA 3ZYPA 4GWNA 1Q8SA 5FYBA 2DFCA 1W2UA 1TVGA 2J7MA 3AVSA 4LBKA 1MQTC 4MGYE 1BXHA 3KSCA 3WDYA 1NQJA 1K5MB 2YYOA 2XWJB 3PNAA 4ATFA 1O4ZA 3VD3A 1CAVB 4ARXA 1SMVA 4W4ZA 4JVAA 1LECA 5FLIA 1XNKA 1L3JA 5LW9A 1YYNA 1RUG2 2ZTNA 2WNVC 4HVRA 1Y4WA 2C4XA 1LOAA 5BNPB 4BB3A 3DCQA 1I1EA 3N7JA 4ASKA 1O59A 1BLZA 1OVSA 5C3OA 5JLVA 1XE0A 3M4FA 1W8FA 3OY8A 4LXLA 3RFRA 1OFSA 4QX7A 4WM7C 4BQ2A 2W2IA 2A70A 4M00A 3GF6A 4HPKA 4BMEA 3NJVA 4PCRA 3DUIA 3RJ2X 3B01A 2DCTA 3ON7A 1Y9QA 3NQHA 5EZWA 3O1PA 1ZVFA 2FDHA 5H9SA 3LDKA 2PHLA 1XNDA 2VY0A 3P5BA 2ZACA 3AFKA 3LD8A 5T5PA 2XBO2 2A73B 2HWB2 2P3JA 2VBPA 1KS4A 3HT2A 3PL0A 4Z07A 1C5IA 5L7OA 5I0UA 1UD1A 3LE0A 2D98A 1QJY3 3AM2A 5D1IA 3V64A 4CEWA 5LBFA 2JDHA 3CZJA 3BPSA 4CE8A 4RHV1 2RMU1 3BTAA 2E6VA 1VBA1 2WWUA 3AFGA 3O0XA 4DIQA 3ROUA 1DQ0A 3PIGA 5T5OA 1PK6B 4XUNA 1N1SA 2CGPA 1VP6A 4NOTA 2WABA 5BNPC 2W94A 1W8WA 2WWSA 1R1ZA 2X09A 2ZGPA 3O7OA 4KI5M 4AI2A 3WINE 4XJZA 5FYZA 1FAYA 3RPQA 5A3UA 2WBKA 4RFRB 5JPNB 2YU2A 5A3LA 2XLFA 3T1MA 3BI3A 1O91A 1RHI1 3TRSB 1JMUB 2HWD1 2WQZC 3V0BB 2ZGMA 4OI4A 1CIYA 5LA9A 2A3WA 3W21A 2E32A 3O1RA 2VUJA 2BGOA 4B4QA 2I45A 1OKQA 3GBWA 5C70A 3U10A 1SDDB 4XHXA 1X8MA 4FFFA 1IHMA 2AC1A 4BH9A 1COV2 1QQP3 3NVCA 4EN6B 4UWDA 1UZWA 1F5FA 2VOVA 3DF0A 4QPIC 5E89A 3TYJA 4E4DX 1KRIA 2YPDA 4XJAA 1YUDA 1UYYA 2W08A 1WCKA 3GBGA 1O5UA 4I0WB 3RZZA 4ONUA 3CL1A 4IGPA 5F7UA 5J96B 3ZSKA 2FMDA 3H1MA 5F3GA 4CXYA 2R042 5I8YA 4XF9A 4AHZA 4F83A 4WZCA 1PK6C 1R082 3WHTA 2O14A 4AFDA 4P9JA 5F5CA 2GSYA 1R1A2 3D4KA 3INAA 1Q8QA 2HWC1 2Q8EA 1CJPA 3O1SA 1VRH1 3ENRA 3NAPC 3RZJA 2VOTA 4ATEA 2FDGA 1VALA 2JKXA 3HNMA 4OQ9A 3OGGA 1JW6A 4Q4V2 3HQXA 2XQXA 5T50A 4CUCA 4LOTA 3VL8A 4FPEA 1C4RA 4BA6A 2R1DA 2PHFA 1YXWA 1PMJX 1PO13 2F6BA 3POWA 4LPLA 3E1F1 2B39A 3SKVA 4KH9A 2IXLA 2WFF1 2Q8CA 4PDWB 2FZ1A 2L9LA 3WCSA 1AZDA 5FLHA 3S5AA 5DABA 1DIWA 1US3A 5IFTA 2WLPA 1ZBE1 4Q4X1 3O1MA 4M0NA 2BU9A 4Z8BA 1UPSA 4CDXA 3PVEA 1NOVA 3OPWA 1W28A 4DPNA 1OURA 1UNBA 4HBNA 1V6NA 2P4EA 1HRI1 2E7AA 5JOYA 1HV0A 1VAKA 4EWAA 2UWAA 3THCA 4UBGA 2BFUS 1JS9A 2VW2A 4XJ8A 3UGHA 4FPGA 4YG3A 5FKCA 4QPWA 3WNNA 3JUUA 5F5AA 4KGGA 3ZXGA 5F37A 1SLIA 1TEIA 3A4UA 3I3EA 5IVYA 2ZX4A 2WS92 4UW6A 1VBC2 5SV8A 2B8MA 4NHKA 1DQ2A 2Y33A 4ASMB 4CDUB 1QNWA 3HQUA 2XUEA 4KNCA 4OHXA 2MEV1 4HKOA 4WV8A 2ZS6B 1AYM2 3D3AA 4ASLA 2RHPA 2JDAA 3ZYBA 5K9YA 1G7YA 1JYXA 2XJQA 4IE6A 4PDWC 3UJQA 3I2GA 3I2OA 1E5HA 2VCMA 1UN1A 4YW3A 4XFCA 2D6NA 3RZKA 1RUG3 2EIBA 4XDQA 4UAPA 1D4M2 4V2VA 3N9LA 2G19A 1LR5A 4JTNA 1OD5A 1SFNA 4P9LA 4BLJA 1A6CA 3VBSB 4AQTA 4MUVA 4GH4C 4YGCA 1ZM1A 1GWMA 1GNHA 2VTFA 2WZR3 2Y0IA 4FO9A 4Y24A 5EWSA 4YW2A 3AZYA 4RS5A 3VDAA 3LOBA 3N9MA 4META 1JZ8A 2DVDA 2RS51 1MACA 1RUE2 1V6OA 2JG9C 2V4AA 3AP5A 1GR3A 3PTYA 4AE2A 4E4SA 1UZVA 1U12A 1TME1 4LBQD 2J1VA 2XBO3 3MICA 5F2WA 5JZGC 1H9WA 1W03A 4GXLA 4S2GA 1SEFA 1W6PB 2ZMLA 3PUAA 2D3PA 3RYPA 3U78A 5IVEA 4CDUC 5KR7A 5FMBA 2YMZA 3JBG1 2Z2SB 3VZOA 3HNBM 3LEMA 3B5LB 4L2NA 3LSDA 4QQOA 1RUC2 1OH3A 2JDKA 4UFHA 4CCNA 2B9UA 5I8TA 2ORZA 4W65A 1JZ7A 2VQTA 3C7FA 2YGLA 1O6UA 2AACA 3JCIA 2XKPA 1V9U1 4IQPA 4X6RB 4XIKA 3S0MA 1F35A 4LORA 1UAIA 3OCPA 4MH0E 4Y4YA 3VBSC 3LEGA 5CISA 1EYBA 4MXVA 1JYVA 3BB6A 2VH9A 4XF4A 3NNGA 2C9AA 2TNFA 3LDBA 2D3SA 1V70A 4FPFA 4D3WA 1EP0A 3JB8A 3ACFA 2VM9A 3BVCA 3PVBB 3H8UA 2WZEA 1PIV2 3CF6E 4QT6A 3W59A 1MVQA 4AVCA 1HQWA 1S55A 5JMCA 4Z2WA 1Z7S2 1LOEA 4IEPA 3T1LA 4MXWA 2NPIA 2FBEA 5A7OA 5A7PA 1W8OA 3WP6A 3JZVA 4E27A 3ZIWA 4SLIA 2OYZA 2QVSB 4FPCA 1CAWA 3TB0A 1HIXA 4AVAA 2JG8B 4OMCA 1PNFA 2Y0OA 4Q4W2 3ZMNA 4C90A 2FCTA 2Y6HA 4QGMA 3TN92 3AC0A 1R083 4XYXA 1W8UA 2OZ6A 1WD4A 3KQRA 5C3PA 1R1A3 1PGW2 3EBRA 4IV3B 4OI2A 5IFPA 1ND2A 4CTEA 3K77A 5GZFA 1CWPA 3LOIA 2PHDA 4Q4V3 1NA1B 4JCKA 3H1YA 5CAZA 3POYA 2XUMA 3NNMA 3RYRA 1VAMA 1IG3A 2EALA 4LJHA 1BMV1 3C7HA 5EJZB 4XHBA 2RM21 5HI0A 3WNOA 1AR71 5J7MA 3O0WA 2E26A 3VHNA 2R6QA 1SLBA 5FPXA 2WFPA 3IDEA 4C1XA 4CDQB 2NP0A 2F4PA 1O3RA 5BNNB 2AREA 4J25A 2CYFA 3MPPG 3THTA 5CU1A 4OMDA 3WUCA 3UKNA 3CJIC 1H0BA 3K75B 5EQUA 5FY0A 3ZKYA 4BIOA 2A71A 3VZKA 4R9CA 4L97A 3HN3A 2ZA9A 1UIJA 2JENA 2NMOA 4JDMA 4Q4Y1 4UI9L 5A6YA 2QUOA 4COYA 5KXDA 3BUCA 3CQOA 4Y5Z0 1DGWX 1H1AA 1C5HA 4K9SA 4H7MA 4IUGA 2K0GA 2O8QA 1FMD2 1US2A 1Q43A 4B4RA 2E33A 4CPBD 3GXUA 1RUI3 4N7UA 4A41A 2JX9A 2ZGNA 4IV3C 1B35B 4K21A 1YQ5A 4ORFA 2VMCA 3WG4A 1LOGA 5A70A 1NCRA 1NA1C 5FQ0A 3DECA 4AEDA 3ES1A 3KV5A 5A7WB 3W5MA 4KU7A 1OVPA 4KGQA 1YFUA 1VBC3 3ILNA 4HSLA 3ZKUA 4EJRA 4LO5B 3FUQA 5GKAC 4YSFA 4W50A 2GAUA 2YBKA 5BNQA 4LKDA 2W46A 4HONA 4B7KA 4YFZA 1IOAA 1WCUA 1W90A 2B42B 4CDQC 2CU5A 3H42B 3NW4A 4FOYA 1D4VB 3MW4A 3PVOA 4XDOA 4FOVA 4Q0QA 5KBFA 4XJWA 3VBRA 3BALA 3LEIA 2ZMNA 3PMSA 4K20A 3VN4A 1HLCA 2RDSA 4M4PA 5M0TA 3BTZA 1NLQA 4NHXA 3KWVA 4F3JA 4GULA 4Y1ZA 1XSRA 1OA2A 3IAPA 1D7PM 1YFYA 3H9AA 3M3IA 4XMAA 1KJLA 1QJY1 4F8AA 5FDBA 1L7LA 3MV01 1OQDA 3SISA 4ES8A 2E53A 3DEMA 4JTOA 3NJYA 2XVKA 5A32B 1RUE3 2JDPA 1G8WA 5AVPA 1B35C 2Y26A 1FYUA 2BVVA 4QM8A 3ZYFA 2HEWF 3SH4A 2ZAAA 3WW1A 4KBZA 2R073 5F3IA 3WLUA 3J7HA 2E63A 4TWTA 4IESA 5H9PA 4QB2A 3MIFA 2DFBA 3SCFA 3DPRA 2XKOA 4UF0A 2LRPA 2CHHA 2ORXA 4RFT0 2XVLA 4DB5A 1MS8A 2Y8KA 1GSLA 1REDA 3T4HB 3VGIA 4CU9A 1A8MA 4R9BA 2LW8A 5FWJA 1V6IA 2LTNA 4YVWB 2ZZQA 3TEWA 1SZBA 3UNPA 1SDWA 3WP5A 3I2HA 4INDA 3K51A 5D8AC 3OEAA 4OLLA 2VZRA 2J42A 3AP7A 3AMNA 1F2NA 1MS4A 1RVF2 5HV4A 3ILFA 1JUHA 2D6PA 1ULFA 5JVVA 4AW7A 5FZAA 5JR2A 1KITA 4NN0A 5KHIA 1MPXA 2JKBA 4GJYA 4NPRA 2VZ3A 5ABJA 4JX0A 4LHSA 4KMQA 3ZSLA 3MIGA 1C8M3 4HZFA 2YV8A 2QQOA 1PIV3 2WNUB 1BQPA 5F6KA 4ZZ8A 5F3CA 1VMJA 2PN5A 1CESA 3LSEA 1Z7S3 5FXVA 1JOBA 4U2AA 5C3RA 4QXHA 4BMBA 1UPIA 2CAVA 4Y22B 5DG1A 5JOWA 1L7QA 2DBIA 4RD7A 4XQ4A 3KT7A 4MYEA 1H4HA 3ZN4A 5FJHA 4QX1A 1VBE2 5FY5A 4DXRA 2A7AA 4P00B 5FZ7A 1PO11 4DS0A 4GA9A 3WG2A 4XZPA 3ABZA 1UY4A 1V6LA 2LM3A 4YVWC 3HR9A 4IL7A 5EYYA 3TN93 1PZ8A 3IM0A 3GCWA 1JZ4A 1ZZ9A 2HYKA 3E97A 1XC6A 3ST7A 1UOFA 4D0QA 1CAXB 1KDKA 2VE1A 4JKKA 4IV1A 4FOWA 2E51A 1S0JA 3B94A 4MG2A 1S0BA 5FZ8A 4YG6A 1V6MA 5DN2A 1S0IA 4JGYC 1EV12 3DV8A 5IAVA 4DXTA 1CPNA 2AEYA 2JD9A 1N1TA 1ZRRA 2OA2A 3ZXAC 3MIHA 3AYCA 2VMHA 5EHDA 1VBB2 1RUD3 4HETA 4YM0A 4AGRA 2W1SA 4I30A 4M3CA 2LALA 1N3QA 1CAUA 2W5FA 3M1HA 4DXSA 4UFIA 2O1QA 3HEIA 5HXVA 1K42A 3S30A 4D94A 5CG8A 1ZBA2 3WDXA 3ELNA 2YBPA 1X36A 5L9VA 4N7IA 1KFXL 1QHDA 1NE6A 2HWF1 3MDPA 1ST8A 2X53S 5IATA 1W6QB 1FMD3 2ARCA 4LKSA 4EN9B 1OOPB 4CU6A 1PNGA 4XOGA 4FBFA 2VO5A 5JAXA 1AR62 4GD4A 1YEWA 5F39A 2ZGSA 4PF5A 3H7JA 5C33A 2BERA 1RUG1 5H9RA 4NHMA 4CP0A 1VB4A 5C3SA 2JB4A 3A23A 4IEXA 1K5MA 4BK4A 5KXEA 2UWCA 2FDKA 3JD71 4QKNA 3V56A 3VV1A 2WZR1 1MEC2 1Y3TA 4QPGB 2DVGA 2AZ5A 3EO6A 2EICA 2B46X 1JYCA 2XL7A 1RITA 3UK9A 3UKTA 4D69A 5FCCA 1JYWA 1WD3A 4MGKE 1ND3C 5DAVA 4EZHA 3N35A 1N3PA 2B9VA 5LBEA 3N4MA 1C3HA 3VBHC 4P5YA 3T2TA 2W87A 4PBOA 2EF6A 2K9ZA 4XAEA 5KHJA 2B4KA 5FPVA 3BU0A 4KL1A 5CNAA 4JDOA 4LKEA 3ZXLA 3DYMA 4AR2A 5HBAA 1JN2P 3MFAA 4MHRA 2EXHA 1P8JA 1S0EA 1H9PA 1W9TA 3KCXA 3OYWB 4Q1RA 5DXDA 5FZ1A 5KXBA 3KGLA 1OOPC 1D2SA 3PUSA 5E88A 4YW4A 4YW7A 5GJ6A 2WIIB 3H8XA 1N3OA 4GWJA 4AVTA 1LHUA 3AL5A 4O9EA 1SLAA 3AMQA 3OBAA 5DAQA 5A7NA 5C9AB 5GLTA 4G9SB 5A3NA 3I8TA 3J8F2 4YNIA 5AFEA 4CU7A 1WLDA 3LA3A 1WKYA 1DLLA 2H6CA 3U11A 4QAWA 4Q8KA 3P1IA 1O4YA 4QPGC 5GALA 5CVRA 2BWCA 5FMOL 1JH5A 2H6BA 2IFRA 2Y6KA 3AZZA 3LA7A 4NIDA 2KA3A 3WXPA 4PHZA 1F5JA 2PMWB 4LBJA 1GV9A 5FP8A 1RMU2 4OI0A 4YM1A 5JOZA 2QQVA 1RUF3 3FC0A 2YBSA 1HJFA 1NX9A 2QQWA 2XG3A 3B9IA 4OHVA 2VUDA 4LHKA 3FUOA 2HWE3 4N53A 3SEEA 4MOAA 4NMIA 5JR7B 2XDVA 2DVFA 1RVF3 2PA7A 2W47A 2ZHKA 2XGXA 3K4AA 4FXKB 3RS6A 1A78A 3VKMA 5HCAA 1W9WA 2VU9A 5FTTC 2RR12 3IMNA 2DCZA 4YARA 5FZ0A 1UU5A 3AMHA 4HT1T 3LFMA 1R081 5C9AC 2ARAA 3ZXEA 5IWFA 4CUBA 4NHYA 1W8HA 5ANNA 2PXJA 2VCBA 1R1A1 3W20A 2QJVA 1AJKA 4YW6A 3GYDA 5C5UA 1QNYA 4Q4V1 2KD7A 1POQA 1Z0HA 5GLUA 1TE1B 5HCBA 5DDJ1 3GCXA 5FY1A 5I93A 2OUJA 3FHAA 2ET1A 4CUGA 1H2NA 4BYYA 1W0PA 4R4XA 3A0KA 2WINB 1PZ7A 1X7NA 3WNLA 1PMHX 5CFCB 5LEKA 4XFGA 3VBFB 4NHLA 3S7EA 3EXUA 5IT6A 4RSUA 5KXCA 4BZ4A 1FPN2 1YNAA 2OX0A 4RQPA 1EV13 4XBQA 3J26N 4PDWA 1GWKA 4FPJA 4QQLA 4A6OA 4K3UA 3OUIA 4XFFA 1F31A 4LNVA 1RJ8A 2ZBJA 1VBB3 4C8DA 1BEV2 1RUI1 3UV9A 4ISQA 2RVAA 4AFCA 1J58A 4JKLA 4FOQA 5J36A 4LIVA 1RUJ3 2D5FA 5JUVA 4KG8A 4L0PA 4XFIA 1K12A 1QGLA 4XXPA 4WM7B 3H1WA 3W5NA 1ZBA3 4QHZA 3H3LA 3SQOA 2GC3A 4GAZA 4XUQA 1VBC1 1APNA 2LROA 5F5QA 5DAXA 2WYFA 3A7QA 2OVUA 1AL21 3BCWA 5E8AA 3Q8EA 2ZHNA 4AWDA 3FJSA 4G4FA 5CBLA 3DXUA 1ZX5A 4LHLA 2XVGA 1AR63 5FV3A 1GANA 2VBBA 4DO0A 2WO7A 4CDUA 3VBFC 1UU4A 4R9DA 3K48A 4HVOA 2XMLA 1S0CA 4QQPA 4K1ZA 3TAYA 4AOCA 1TG7A 2C1FA 4ZU4A 1FOD2 4WVVA 3G6JB 3KQ4B 1TMF3 4FCAA 4MZUA 4FP2A 1LULA 1OBNA 2XWBB 3AYDA 2ZMKA 4OVEA 1SLLA 5FYSA 4ZU7A 3AVRA 1HDKA 5BNOC 3LPFA 3DXTA 2RS12 3K4ZA 1RXGA 1VLNA 2VPVA 2ZXQA 1W39A 2A6XA 1AR93 4OCTA 1Y9GA 1UY1A 4LT5A 3T0AA 5DAPA 1BZWA 2UU8A 3I3QA 2R071 1SCRA 4B1LA 2E31A 4OZXA 5FYTA 5FZOB 2ADEA 4KWKA 2Z4FA 4ZY9A 1VE0A 1LB2A 1YIFA 3FLRA 4UFJA 2ZEZA 1W3VA 5FP3A 4WVZA 3HBZA 1C8NA 3OB8A 3EB7A 1W9FA 1XQNA 4DRVA 2BZDA 1UOBA 3ZPOA 1DFQA 2CV6A 2VZSA 5CYYA 2VD7A 3VBOA 3LIHA 1NQDA 1AX0A 4M3CF 4V1PA 3PUQA 2RS32 2ZGLA 3IDCB 1QU0A 3FL7A 2B7YA 3J8F3 4FPOB 2WKKA 4QPIB 3USUA 4A4AA 1JYTA 4AXOA 1DGLA 2AEZA 3CKHA 2I74A 1HW5A 2WZ8A 4DY5A 2D7FA 1XYOA 1ZNPA 1PX3A 3ZSJA 3NNLA 1QJFA 5CADA 5FFOC 1IQAA 1C28A 1C8M1 2PAEA 2IC1A 3AKRA 4QQ2A 4XDPA 4E2GA 4I02A 2W91A 1RMU3 1S2BA 3NNFA 1WBFA 3THPA 3B93A 3ZSMA 4XBLA 3DYOA 2YUEA 2F17A 5ANQA 3NAPB 2WUHA 3RDIA 1Z7S1 2Y38A 1XBFA 3BODA 1ZA4A 3POGA 4QQHA 4AVVA 5ACA3 1UOJA 1DQ5A 3AB0A 1X33A 4YZ3A 5IUQA 3SH5A 3WNMA 2CDPA 4AHWA 1QDCA 5FXZA 1AR81 4LO7A 1WBLA 1SPPB 2GMPA 2AH2A 3TNQA 2JICA 3AK0A 2IFWA 1GQPA 4Q5OA 4HANA 5E6HA 1MVEA 3TN91 4IGOA 2BTVC 4O61A 4S2FA 5CEHA 1AL0G 1SQ4A 5FYVA 1A3KA 2JG8A 1VBD2 5TSWA 2JDYA 3VLBB 3I3MA 2BWAA 3NKGA 4UOJA 3AP6A 1NY71 3U1XA 1V00A 4YWAA 1GLHA 3PUIA 4NPLA 3HNYM 1D0HA 3FHQA 4YZ4A 4COWA 5D21A 2FDFA 1WW6A 3UT0A 2ZEXA 3CLPA 4UW3A 5J09A 4QX0A 1W6MA 4ZU5A 1PO23 1RUD1 3OGVA 5JXJA 3P6BA 4CCDA 1EAH2 3PTRB 4LQRA 4JQTA 1UZ0A 3QH6A 4WM8B 4WVMB 1JZ5A 2ERFA 1KEXA 1AUYA 3DYPA 2EXJA 4OUMA 2BOIA 1HN1A 2QKDA 5DUVA 5I8SA 4MGTA 1NG0A 4GWMA 4D7SA 5LA1A 4O7XA 4XF3A 2DDUA 2DUPA 1XSQA 1FPN3 3QACA 1R092 3SLIA 3VBUA 3EJKA 3IPVB 5BNNA 4RN5A 1LKNA 1HXS3 3POEA 5LK7B 1PGL2 2RJ2A 4IEQA 1FNZA 3IB3A 4BPZA 1FMD1 2YC2A 3NV2A 2HKXA 1QY4A 5FJKA 4LK7A 2ZHLA 3LEKA 1BEV3 1GZCA 4FPLA 2XJSA 3UJOA 4DRRA 3AKSA 4HOOA 1G9AA 4E4ZA 5H9QA 1ZRFA 2VOKA 5FZEA 3KV6A 1RGSA 2CTVA 1PVC2 3HT1A 4L99A 5E1RA 4ES9A 2ARBA 3MIBA 3FBYA 4FAHA 1RINA 1Y7BA 3N7KA 3MO4A 5FMDA 4GH4B 4YW1A 5GLZA 2Z42A 1DYOA 5FR3A 1T6GC 1W6NB 4YGEA 4BQ1A 2DU1A 3AJZA 4UFMA 2OXBA 1BCXA 4LKFA 2JG9B 3H7YA 4NPMA 1WCSA 2BOJA 1JTZX 2WAOA 1UL9A 1UXXX 1GOHA 2EXKA 4FPKA 2VC9A 3LIGA 3TEXA 2VBDA 3WF0A 3RZLA 5F3EA 1GQHA 4YVSB 4FTSA 1OSGA 2PHTA 5FZ3A 1OD3A 1QF3A 5JZGB 2VOWA 4YZ2A 5FXXA 4CCEA 3IZOA 1LEDA 3BGAA 4NRPA 2P34A 5F32A 3RMYA 2EAKA 2J1TA 2A1XA 2BBAA 4E4HA 2V5DA 4I3PA 1QJX2 3MIDA 4TYSA 2ZGTA 4MGQA 2NLRA 2RS13 3Q8BA 2EIDA 3ZR6A 1UY3A 3BTYA 3A21A 4X8PA 2WO3A 3MLJA 1WCQA 3F2ZA 1UXZA 4Q2FA 1W04A 2XR4A 1YWKA 1DP0A 4BE3A 4BQYA 1U0AA 4Z2AA 5C5TA 2D5HA 2IWGB 3WDTA 4XFBA 2V73A 3K3OA 4JZRA 1DYPA 4U36A 5DUXA 3AXDA 4DNYA 1M06G 3SMHA 4LLOA 5A32A 4AQ2A 1I9RA 3ZFFB 4IE0A 1U5ZA 3MYXA 3H50A 5T55A 5A7QA 1FX5A 3POIA 2XXZA 4NR1A 2VW0A 1IKQA 5FZDA 4DMIA 2Y6GA 4YVSC 2HWB3 1RUF1 3NV3A 4P5HA 2QTWB 1PZ9A 4BDVB 5T54A 4BWOA 4QX8A 2HWE1 2RS33 3U14A 2VR4A 2GNDA 2C9KA 3N7MA 5EV7A 1RVF1 2Y60A 2ILMA 5LB6A 3I59A 3VZNA 4G3YC 3WP4A 3KCYA 4YVWA 4Y5TA 3C7GA 4Q27A 2MNGA 3OTFA 5A3OA 1TZOA 4KBBA 3AKQA 4GMP3 2P1BA 3ZN6B 1I5PA 5CFDA 4QU1A 5ISLA 1QH7A 2H0BA 4QM9A 2JECA 4MVTA 2HEVF 4BQ3A 3GJAA 1UQXA 4MGIE 1LJ7A 3GHMA 2WSUA 3PURA 5C8CA 5LRSA 4JGZA 1GFF2 5L7OB 1UW8A 2OS2A 2PELA 2ZKLA 3HQRA 3ZFFC 5J48A 3ME2A 2WNUA 3BYWA 1URXA 5FZ6A 4AAPA 4FP3A 2VZTA 4LTAA 1CR7A 1YQ6A 4AG4A 5FZHA 1CZSA 3ACIA 5BXXA 3V65A 4AI9A 3PIJA 2GP5A 2Y6JA 4LE4A 3OGJA 1COV3 3CJIB 4YGDA 2GP3A 5F5IA 5GZCA 1XE8A 3PDQA 1QOOA 4PT6A 2CAUA 1O5LA 4QPYA 1HQNA 5LWBA 5DMYA 1VBA2 1EV11 4A44A 3MPBA 2R043 1BVVA 2D97A 4CDWA 3WW4A 3ALQA 1CAXA 1PM4A 1WMDA 2W3JA 4CEYA 2Y6LA 3SEPA 1VBB1 1DU3D 1YJKA 1J84A 3VZLA 2UWBA 3VDCA 1AX1A 4SBVA 3NL1A 1EAH3 3MF6A 4YFWA 5LY2A 3B00A 4RGGA 2E7TA 5JI7A 2PQSA 4AL9A 1RUJ1 1IQDC 4XCBA 4GB31 5L7OC 1H2LA 1OQEA 3ZFEA 5LBCA 2W39A 1RUOA 1LHOA 2OKXA 1QJU1 1ZBA1 2X8KA 4MSVA 4CEWC 5JOXA 1GZWA 3OSDA 4BXSV 4NRQA 2WA3A 4P9GA 5FYHA 2XJVA 4ZXEA 4RGAA 5A33B 5LA2A 4AYUA 2VTXA 2R061 3L9JT 1SLCA 1AR61 2NN8A 4M3CE 5JIUA 4OHYA 3GZAA 2C6SA 2V09A 4LBLA 2C0ZA 3PLQA 1CJDA 2DUOA 4YM3A 5FUIA 1ZZ7A 2AR6A 3ZLIA 3IBMA 2XB6C 2PHWA 4Z82A 2WDBA 3LPGA 1TMF1 2IZWA 1OXCA 1FNYA 2OW4A 3R6SA 4GJZA 4BCUA 2OUHA 2UURA 1DHKB 3H8RA 2HWC2 2FMYA 5J98B 2OPKA 1VRH2 2UYBA 1AR91 4OZOA 4R4ZA 1PHMA 4LBQA 3M7AA 5FKBA 4EWEA 1W0NA 4I3GA 3ZXFA 2D3RA 3QH7A 1IS4A 4QPGA 2WS93 1AYN2 1O3SA 3IT8A 1QH6A 4NROA 1ULEA 2GNBA 3IWZA 1SLTA 1YRZA 1AYM3 1RUH2 1W9SA 2YPJA 3NV1A 5JDBA 2W1UA 1J59A 2WFF2 1LGNA 2R49A 5DZGA 1M4WA 5EFUA 3WNPA 5KHGA 3OPZA 1OA4A 5BYNA 3OEBA 1GP6A 1IZ3A 1KQRA 1ZBE2 2YROA 4GKXA 1D4M3 1X82A 1HRV2 5D8AB 5IK5A 1H4GA 1XU1A 3IDAA 3LZZA 3OYWA 3RZHA 2WQ4A 3KV9A 1Q8OA 1G9DA 3AX4A 3BOWA 1DQ1A 1EUTA 4HL0A 1C1FA 4CCCA 3O1OA 1HRI2 1RL3A 5A6QA 2YC4A 5C4WB 5JSPA 3OD4A 5FZ4A 4UT5A 2OT7A 2WQ8A 2V4VA 2VMFA 4CZSA 2Q1ZB 1MS9A 2P6HA 1REFA 1B09A 1NYWA 3ZIXA 1VPHA 1SFPA 3H3UA 4IEVA 2VOXA 3ZXKA 3IAQA 4IXLA 3RJRA 4Y1VA 3SITA 1DZRA 3K46A 1I3HA 4O65A 2VVEA 2JDZA 4A7YA 3N9NA 4QDQA 2MEV2 1RIRA 3O12A 2DVAA 2WO2A 3ZFGA 2FCVA 4A45A 1JUIA 4PLMA 5ACA1 4C1WA 1JODA 1GU3A 1V6KA 4COZA 5L19A 1RUC3 1ZRIA 3SHRA 4HKWA 4CDXC 2A6VA 3GBFA 4XW3A 2XPJA 2X5IA 5FYYA 4TLFA 2UY8A 4AEMA 1XNTA 3JB4C 2WWJA 4UW4A 4CXXA 2DF7A 2OQ6A 2BVBA 4RR3A 1QQP1 1QWRA 1YLLA 2C5DA 2Z79A 4Q8LA 2QBXA 4Y4RA 3HOBA 3AXEA 4LA2A 5L9BA 3PU3A 4C91A 1RC6A 4XACA 3WCRA 4JGYB 5C8WA 1UMIA 2FQPA 2X05A 5C4WC 4A6SA 3I2FA 4BU2A 5T5LA 2YDEA 3AMMA 2D93A 4A7KA 2WT0A 2QQPA 1MS3A 2IXKA 3T2QA 5FZFA 5K8SA 2WLQA 4XAAA 4AAXA 3ES4A 1PO21 4AFMA 1NAEA 1OKOA 2WR9A 3R0RA 3SKJE 1IPJA 2Y64A 2J1EA 4HK8A 3FZ3A 3JBG2 3FLPA 5FP9A 3WNKA 3PJYA 1XRUA 2JDMA 1MR5A 3N36A 1GQGA 1NCQA 1S0FA 4MLOA 4Q4W3 5FAXA 1FPN1 4QHOA 4WBBA 5DZFA 4XFHA 1ZZ6A 3IDBB 1HXS1 4LEJA 4Q29A 1H8TA 1VMFA 5APAA 1PM7A 1PMIA 4RS5C 5FK7A 3OUHA 4CPBA 3LQCA 4I09A 5CFCA 1BEV1 4Y1YA 3ZO0B 4URAA 3VHOA 2Z69A 1J3RA 1BK0A 2VL4A 5SV5A 5EIYB 3WSOA 5A6XA 1MQTA 3DN7A 3JXSA 3ILRA 3LB9A 5A1FA 1W99A 3GJBA 3T4VA 2GNTA 1F4HA 4K6BA 3ASIA 4MXWB 4XUOA 3WW2A 5AC92 2UY9A 1Q56A 1HV1A 3DKQA 2WNVA 2HEYF 3O1TA 4X6QB 4Q0PA 5LCWL 4KWLA 4XC9A 5F2SA 2WYSA 1V6JA 4XTPA 4Y26A 4IEUA 1HJGA 1ND3B 2LUWA 2P3YA 5FO9B 4WM7A 4ZPIA 2ZEYA 4COVA 3VBHB 3GNEA 4GALA 4J6GA 4UBHA 3K4DA 2HJIA 3VKOA 1Q5OA 1QOSA 2BBVA 5A3WA 4I0AA 3SCHA 4NJ4A 4LBOA 1ND2B 1LHWA 4BQXA 4H2AA 3VZMA 3LFIA 2XJUA 3LDRA 4TTGA 2BW8A 3ECQA 4KU8A 4B1MA 1GKBA 3WHUA 5J37A 4WVWA 1O3QA 1K5JA 4P08A 5JWPA 4QB1A 1X9TA 5DPNA 4DEQA 1VRH3 2NM1A 5LK5A 4LO6B 4XILA 2BNMA 3OUJA 5A1AA 1GNYA 3TEYA 2W92A 4MGZE 2XQRA 3TWIA 1AYN3 1CAVA 1PGSA 2I07B 2IXCA 2VGDA 1LGBA 2RM22 3FFZA 1JHNA 1W2NA 1XU2A 4IE7A 3U4XA 5A3MA 1RUH3 4JHZA 1ULCA 4AK3A 5BNPA 4RL7A 1UKGA 2JE7A 3NWKA 1D0GA 3ZDVA 2JXAA 3I2KA 4HN1A 2Y34A 4D8MA 2MHFA 3CEWA 1NKGA 4S2HA 2XBO1 2HWB1 4LK6A 3ZOIA 2E9QA 4Q4Y2 4IDZA 2RJKA 3VHRA 1CZTA 1HRV3 5J1XA 1WMXA 3FBMA 1ND2C 4P9WA 1GOGA 3CMGA 1NCRB 1WUVA 3KT4A 2QFEA 3G7DA 4H7LA 3RZMA 4DEVA 3ZMOA 1O8PA 3V0AB 1LU2A 1YJLA 2C26A 4TLGA 4C0HA 2KXLA 1CN1A 3K2OA 2VXJA 4QX3A 3SCGA 1JU3A 1D2QA 1Y9MA 1K45A 2YHJA 3GHNA 1LODA 4QPIA 3S57A 4GZ9A 2G9FA 4AI8A 2G9ZA 1JZ2A 1IS5A 1I5ZA 3VDDB 3MV11 2BP6A 3FMGA 4QXBA 3URFA 3GALA 2XHKA 3VBRB 1DZTA 2RR11 2VW1A 1OF3A 1O8SA 4AFAA 3H0OA 5T3NA 3BIWE 3ZXJA 1PK6A 3C2UA 4DOUA 1X8EA 2H0VA 3MZHA 2W52A 3FX3A 2VVFA 2D6LX 3HWJA 3NAPA 4XJUA 1ZZCA 5FXWA 4A7ZA 3ACGA 5CZKA 3AYEA 4W6YA 4A2UA 2BPA2 3E6BA 1MZ6A 3S7IA 5A7SA 3K3NA 1IS6A 1COV1 3A0NA 3KM5A 4C0BA 5IVCA 3V0BA 1QJY2 1VRBA 3UGFA 2VMEA 3BTXA 2Q5TA 1SFYA 1NCRC 1SPPA 1YQ8A 3VKNA 4ZZ5A 4HG6B 4AEDC 3I4IA 1JYIA 1BBT2 4QDSA 3APBA 2IXHA 3CIHA 1W6OB 4MHUA 2DUQA 1UYPA 2R041 1UX7A 1ASJ2 2VCCA 3R4DB 4XZUG 3VDBA 5FOJB 3DPRB 4RA0A 4UF0B 2TBVA 2CWSA 2ZX0A 3LF7A 2A6WA 3VDDC 2KM2A 1ALYA 1W3XA 4CUAA 5KHHA 1EAH1 1HKDA 3VBRC 2IVJA 2IXIA 5KC5A 3B02A 4CP2A 4BOWA 1LGCA 1H6YA 2CSGA 4JAAA 4W6WA 3USSA 1VBE3 2GC1A 4PBPA 2GDFA 2ET7A 4YYOA 3NKTA 4AEJA 5CA6A 4JDNA 2R7EB 2A5ZA 3RI9A 5ABJB 5FY9A 2GNMA 1W8TA 2N7GA 3KVBA 5L73A 3TNPB 4M4RA 1U5IA 2XJTA 5L9RA 1CONA 1OPOA 2BNNA 3KT1A 2FDIA 1MS0A 4AGVA 2ZAHA 3VZJA 5JCTA 1DZQA 3IPVA 5JXGA 4R9AA 5FY4A 1UYZA 3E5XA 4ITCA 1W8ZA 4Y5SA 3T08A 5AC93 2CY6A 2ATFA 4CRQA 1G9FA 4OHWA 3DPRC 5I0DA 2ZJCA 5BNOB 4FPHA 4AI3A 1FATA 1RUNA 3DL3A 3WUDA 5HV0A 2G9GA 5IHRA 1DF0A 1ZA7A 3EMRA 2YY1A 1REEA 3DKWA 1NLRA 2CNAA 4BLIA 5IVVA 5K0UB 4WZFA 2WT1A 4QGNA 1HB3A 3IIIA 4GH4A 5C71A 1S4CA 1ZZBA 4OQ8A 1HB4A 2J1RA 1HQLA 3WV6A 4UYBA 4HVQA 2ETEA 1ZYBA 2WS91 1O4TA 3MHZA 3WEZA 5CKNA 2VXRA 4IEYA 2XOMA 1WW4A 1YQ2A 2JG9A 1Z78A 3MW3A 4IV1B 2RE9A 1AYM1 2GU9A 3HN1A 3Q8CA 3NRUA 4Y20B 4YVSA 1W2AX 1SBEA 4YW5A 5ABJC 2PLV2 4PIZA 5AVAA 3I97A 3WDVA 5JZGA 1LHVA 4UW5A 3QBQA 2ZHMA 1XB9A 1C1LA 2DCYA 2O0OA 3CU7A 1A8DA 2GN7A 3KV4A 4QMAA 5FMOS 5KC6A 4NIIA 3HIFA 1MS5A 1D4M1 3WQ7A 5DUWA 1CAUB 5KWRA 4ARYA 2Q1MA 3W58A 4IE4A 3GZEA 3D5OA 4HLTA 4ZKTB 1MEC3 1E5SA 1UF2C 3J7NA 3VKLA 2QZ3A 4F7ZA 5D2AA 2NYYA 3E6DA 4MX3A 1RUE1 4EN7B 1WLTA 5K0UC 1DBNA 1LOFC 3EHKA 4GIQA 4YPJA 1JHJA 3VBSA 2AENA 2WRAA 2JDUA 2W95A 1ACCA 2ZZJA 4HXCA 1W8NA 4I0BA 4Q4Y3 3WD5A 3HPNA 3ZFFA 3FHIB 3N9PA 2Y6FA 4HSJA 3MBWA 4BISA 4D6RA 2HWF2 3B69A 4IV1C 2DVBA 3KLSA 4W8JA 1N47A 2D6KA 5GZDA 5BUVA 3WP3A 1RUC1 1ULGA 2TUNA 3OPTA 5DZEA 1DLCA 3RQ0A 1W6PA 3KS7A 2VMIA 2PAKA 4PIYA 3VL9A 3IN9A 1NT0A 3M3OA 1YFWA 1PVXA 5FRAA 2J1UA 1OC1A 5K7PA 3WW3A 1Q3EA 2Q30A 3UL2A 4AGGA 5JXIA 2RV9A 4LBNA 2PHRA 3LGRA 3JD72 5K4LA 2DYCA 3WR0A 4CU8A 5FMCA 3WG3A 2Q0AA 2WZR2 4DUXA 2QQKA 3ZN6A 4E8DA 2P37A 2SBAA 2QNKA 4YM2A 4BJ0A 1H2MA 1OI6A 2QQNA 1VB2A 1YO8A 1PIV1 5A3PA 1OHFA 4JHTA 1RXFA 1NLSA 2EXIA 4A3XA 1JOJA 3WNXA 4K40A 1KS5A 1OFNA 1JYNA 2BUKA 4ZONA 5LATA 1ENQA 1U5XA 2VMGA 3WY6A 5EXOA 4OHZA 1GWLA 5B4NA 1I6XA 1K5MC 2XJPA 2BFUL 3ORJA 4KG0A 5I0RA 2WAAA 1BBT3 4Q4W1 1JU4A 3D82A 3R4SA 4B4PA 2RR13 5FPZA 3CJIA 5FY8A 1ASJ3 4E2QA 5B4XA 1NXD1 2BDRA 4XQWA 2DV9A 4FT8A 5F6LB 2P3IA 4LO4B 2B5HA 1OMIA 2VULA 1PGW1 1WMEA 3WQBA 1OLMA 2PQQA 1QXPA 1IKPA 4TZDA 4JRLA 1RTVA 5HCHA 1UKRA 4AVSA 1BKZA 3ZR5A 3N9OA 4N53B 4B3NA 3Q8AA 3ZSEA 2HBUA 1FV2A 4CSWA 4D7TA 3EQEA 1FXZA 2VQ0A 4IV3A 3OBZA 4QGLA 2A3YA 3J9SA 2XH6A 4DXZA 5JSRA 4NIAA 4Q0VA 1NA1A 4UXAA 1DCSA 1UO9A 4XF0A 3LAGA 1QKQA 5EJ1B 3IKWA 3O5SA 3TEZA 1IG0A 4K8FA 1ZRCA 3KHCA 1ENSA 1W2OA 5A33A 1JI6A 4XETA 1GP5A 4CDQA 4CP9B 5A6ZA 5AFBA 4YRDA 5F8PA 1HX6A 4NRMA 4OYUA 1CZVA 2JE9A 3NJXA 4IW3A 5LRRA 1WW5A 4OULA 1LOCA 3CBNA 1DYKA 2HLEA 4FQZA 1MZEA 1CQ9A 2YZ4A 3D0JA 4NAOA 4QKBA 3OBTA 4XFAA 1JBCA 2JEMA 2C24A 2YG0A 1AXKA 3L2HA 4AQ6A 4Y1UA 3RRDA 5GZGA 1LAJA 1W2TA 3EYPA 4N53C 4Z92B 2VNGA 1AYN1 2PTMA 4FAGA 3VD4A 4FPYA 2MPFA 1WW7A 4CXWA 1B35A 3WDUA 2CGNA 2QDNA 2VVDA 5DDJ2 3ZYGA 1RUH1 2F4LA 2G1MA 2HYXA 4XUPA 4D6QA 2PAMA 4L9BA 4RQPB 1ODNA 5EJ3A 2PLV3 5A7WA 1EUUA 1NZIA 4AI0A 3WT3A 3MLLA 5JXHA 4YZ5A 2VZQA 2YFUA 4KQ7A 4NO4A 1GZTA 5I0SA 1ZRDA 3NSTA 5LEJA 2ZX2A 1YHFA 2RDRA 1HRV1 1UOGA 3B9CA 4LOSA 4NWVA 4QXCA 3T09A 1J3QA 1FOD3 2ZCWA 3AKPA 3OOXA 4YZ1A 5HCFA 3LA2A 2V72A 4N9HA 1QMJA 1RB8G 5FUNA 2JD4A 1UMZA 2X10A 3THDA 1ZREA 3KF3A 5FZMA 5FLJA 1L7RA 1RUI2 1VAVA 1FV3A 5D8AA 3CJXA 4FXGB 4P14A 4V2WA 4QX5A 5FO8B 1ULDA 4N43B 3SH3A 2ID4A 2OPWA 2ZOEB 1XXNA 4KWJA 5GLVA 4HK9A 4DUWA 1VIWB 2GC2A 5DAWA 4QU2A 4K7JA 3BU7A 1NUKA 5C4WA 4TSVA 2CDOA 1DQ4A 2D6MA 3MFCA 3BKZA 2E7QA 2WZPP 1AL22 1ULOA 2HWF3 3P3PA 3NMBA 1G86A 4QHBA 3U37A 5F9TA 2R0FA 1GICA 1H8VA 4RQPC 1BYHA 2VNOA 4I01A 2VECA 4Q0UA 2GZWA 4DINB 2GC0A 3H3ZA 4LR4A 4M01A 2DURA 2X29A 1J3PA 3I3BA 3ZYJB 5T52A 4EROA 2WN2A 3SXWA 4BQ4A 2ENRA 4BQ5A 2OIIA 2QQJA 3JD73 3D6EA 3I49A 1KXGA 2DCJA 5FZIA 4L11A 1YC61 4P9IA 2GALA 3OY8B 4IEOA 4X8NA 1J1TA 2QQIA 4HPKB 3UYJA 3WDWA 1U5YA 5FO7B 1S1AA 2JE8A 4N43C 3CO2A 3O14A 4D7YA 5FYIA 2R072 4PQ9A 1MZ5A 4HKLA 1LESA 3SNMA 2LS6A 3MGUA 2NMNA 5FUPA 4JGYA 3VBOB 4PI0A 2P6CA 3WQ0A 2EIEA 1WA4A 1ULPA 4ET7A 4CEWB 1VBE1 3AJYA 3FWEA 3T0BA 3USUB 4NWWA 2RDQA 4XUTA 4COUA 1LTEA 2CL2A 2NQYA 3FE5A 4LBMA 2D44A 4PJYA 2WNEA 4QDRA 4IEZA 5FWEA 4Y22A 1QXJA 2BEOA 1GUIA 2YC0A 3AL6A 4H55A 2EA7A 3KVAA 1G9CA 3M2MA 1VBD3 2J1SA 3ATGA 1IPSA 3KD4A 4LUMA 5FOBB 2KR2A 5L36A 4XTMA 1YFXA 4N90A 3IIAA 4RHV2 2IVIB 2Q1FA 2RMU2 2WN3A 1HB2A 5BPXA 1POV3 3ZDSA 2BYVE 2QCSB 2JB8A 4N8MA 1JOPA 1C8M2 1CVNA 2D6OX 3VHPA 5AC91 4J1XA 4K1YA 4O9GA 4BHPA 5LASA 1YI7A 1OF4A 1UZYA 1XYNA 1X50A 4DY3A 3RWNA 3GDBA 2VZPA 5FZGA 2VAUA 4ZHNA 1DDLA 4LE3A 4XCAA 3VBOC 2K2SA 4RGKA 3BIEA 3PMEA 5EPAA 4DUVA 1XE7A 1RHI2 2QQUA 4FFGA 1LEMA 2VUCA 2G4IA 2VZ1A 2HWD2 2TEPA 3BN6A 1QOTA 1AR82 1IS3A 2ES3A 1TQ5A 2OQ7A 2XHNA 4LO8A 2R32A 1R093 4XF1A 4XIOA 4CP1A 1S2EA 1Y43B 3RSJA 1H2KA 1E5IA 1ND3A 3I7DA 3QOPA 1RYYA 3VBHA 4FTEA 1NZCA 2VZVA 3KMHA 1FI2A 1LU1A 1WMFA 3BPZA 3ZYHA 3NV4A 2A6YA 2PYTA 4LA3A 4BM8A 1W6MB 1UZZA 3Q8FA 1PVC3 4H14A 1SBFA 1NY72 1QJEA 1W6QA 4Q26A 2W0XA 4EN8B 1OOPA 2WO1A 3SC7X 2O8OA 4HFSA 2IUWA 3FLTA 3JQXA 2ZABA 4A3ZA 3CDZB 4L92A 1MEC1 3ACLA 5DDJ3 3W9AA 1RUD2 4AQSA 4Q0SA 3VBUB 2ZKNA 1W05A 3E5UA 1KD7A 3KF5A 3QLQA 3JQWA 2XONA 1F4AA 5C3QA 3POSA 3ZYRA 4BQWA 3J4UH 4H3WA 2YFZA 3VD7A 2JG8C 1RJ7A 3MUY1 3RWKX 1UY2A 2RG4A 3B3QE 3FFQA 4JQRA 4OI1A 5FBJA 3T30A 1GP4A 1G9BA 4NE9A 4K8RB 2VCAA 5FZ9A 4N9IA 5FPLA 1HN0A 4CDXB 1QJX3 5J3UA 1AVBA 4OUEA 1K3IA 1BJQA 3HBKA 3QD6A 2QDRA 5LY1A 2JDNA 2EAAA 3BOPA 3KZ4C 5IW0A 2GMEA 3UESA 3WF2A 3GZTB 1CPMA 1OUSA 3OGSA 4GMP0 4LITA 4Q4X2 5FZCA 3WVJA 5C7GA 5FYMA 3POJA 3OBRA 1W9YA 4PF1A 3UKVA 4EE2A 4XEZA 3MW2A 4XJ9A 5GZEA 3J8F1 4JV4A 1H1MA 3VKFC 2CGOA 4JRAA 2GH2A 2YB7A 4W6XA 3V0AA 4EWDA 2WL1A 4NIGA 3GGLA 3TBDA 1N1VA 2J22A 2EVXA 2W9XA 1AL23 1XNAA 2DU0A 5FYCA 1DGRN 1WLWA 3CZUA 3ZM8A 5C9AA 2XJRA 5I0TA 3VBUC 5F1RA 3M3QA 1TNFA 3VDDA 5BNNC 3I2DA 5IVJA 4NAMA 1RMU1 1PX4A 3MI8A 3U07A 3WF1A 4IE5A 4E2SA 2PHXA 2V5YA 4BXFA 4FFIA 1ENRA 2VUAA 4MADA 3HMYA 5JPMB 3C3VA 3PUHA 1SG3A 5T5JA 5A1LA 2DTWA 1V0AA 2DTYA 3GZUC 5JI9A 1A34A 4DQAA 1BBT1 4CCMA 1STMA 1POV0
chains in the Genus database with same CATH topology
4R52A 1G6NA 4Q1PA 1ASJ1 3QCWA 4RS5B 1BK1A 3AMPA 3ZYIB 1O7FA 1EY2A 1N1YA 1ZZ8A 2ZX1A 1VJ2A 3CNAA 1W6OA 1CGPA 2ZGRA 4AVBA 4QXKA 1TNRA 4MV2A 1OPMA 3ZPYA 2RS52 5GLWA 1LOBA 3AZWA 4FQ4A 3ZX7A 4FTBA 3I59B 1TME2 1RUF2 4EN0A 1Q8VA 3RMXA 2HWE2 2ZGUA 3WZ1A 3D0SA 5GM0A 1UIKA 5CFDB 2ZGOA 3AP4A 3ETQA 3R4UA 2VG9A 2W68A 3X29B 4B29A 4RHV3 1O3TA 1XNBA 2RMU3 2EIGA 1VBA3 2Z5WA 5C8CB 3D8CA 3M8LA 4JGZB 1AXYA 2DCKA 1V9U2 3VBFA 1OLRA 5CB7A 3RYKA 3MEPA 3L2YA 5C6CA 1XNCA 2GN3A 3RI8A 1KFUL 1YCIA 1AX2A 1RHI3 2PHUA 3N7LA 3U0ZA 5IK4A 2FHRA 2HWD3 5BNOA 3VUOA 1AR83 4L8QA 3OJBA 1CAWB 1GYKA 3PVNA 4IERA 3LKJA 1SACA 5K0UA 1LOFA 1CD3G 4URTA 1H1IA 2PLV1 4FVVA 4OUSA 4YGBA 5JIAA 4XMIA 4CDWB 4CEYB 4Z1VA 5CFDC 1KDMA 3OD0A 1GZ9A 3O0VA 3OF1A 4Y20A 1FOD1 4XE9A 1DGRA 5C8CC 5IK8A 1KJRA 4JGZC 2DWRA 3ZFEB 2WA4A 2WNUC 2RS11 2HWC3 1S0DA 3P3NA 1GZWB 2ARXA 2FZ2A 1W0OA 1RUJ2 3WQ1A 2R0HA 1QXRA 4GB32 1LRHA 4OFGA 1WGPA 4Y1XA 1BMV2 3WX5A 1QJU2 3MLKA 2P17A 3MF9A 1AR72 4AFBA 2VNRA 4S2DA 2R16A 4B7EA 4JC1A 2WFF3 4DFSA 3PJQA 2ZPXA 2R062 4FSJA 2WT2A 1NXMA 3WOGA 2Q4SA 4CDWC 4CEYC 1ZBE3 4Q4X3 3E5QA 3DGTA 1GNZA 3HD8B 4GKYA 2RS31 4DZGA 1TMF2 4LBQB 4LLFA 2PFWA 1AXZA 1QDOA 3NO8A 2Q8OA 4AEDB 3ZFEC 1UX6A 1HRI3 2XLGA 3NJZA 4GMP1 1AR92 3MIEA 2XLAA 5FQ0B 1EPWA 3JU9A 3AZXA 1EPZA 2CWMA 4R8HA 4LULA 4XPVA 1DGWA 3ZN5A 2A3XA 1FT9A 3I54A 5IK7A 2GH8A 2MEV3 5KHKA 1S0GA 1AJOA 2P3KA 4B8EA 2YGMA 4XQDA 4J1WA 3M3EA 4XBNA 2BQPA 4AI1A 2NZ9A 1E57A 3R05A 5JSOA 1UCXA 1WLCA 2GMMA 1H30A 4P9XA 1VBD1 3KB5A 1OLQA 4HN0A 1WCDJ 2A75A 4M0HA 1F9KA 1S2KA 2A6ZA 4EV0A 1POV1 2RS53 2XL9A 4YG0A 3ZFGB 5DG2A 3M70A 3AZVA 3KGZA 4I2OA 1TME3 3AP9A 4AEKA 5DUUA 3HAGA 3AYAA 2X5IB 4BIFA 2RJLA 5CG9A 2JJ6A 4PLNA 1YIPA 2ZGQA 2AUYA 4LHNA 3JBG3 5ACA2 1IPKA 4HMZA 4RR3B 3S6PA 1XYPA 1Q8PA 2R30A 5FBZA 3KCCA 3ZXDA 1R091 4WM8A 4WVMA 3RNSA 1UU6A 2B45X 1PGL1 2R1BA 1AHSA 2WC2A 1V9U3 5BV6A 1YI9A 3TOJA 1J1LA 2I2SA 1QQP2 1DQ6A 3N3HA 3Q9OA 4IEWA 2D40A 2BGCA 1AF9A 3E6CC 1PVC1 1GBGA 1F8VA 1OQ1A 1DG6A 2IXJA 1MS1A 5FREA 1VR3A 2OZJA 2WJSA 2AYHA 1IGOA 3ZFGC 5BY5A 4PIXA 1PO22 1NCQB 4GQ7A 4XXAA 5CIRA 2X5IC 1OA3A 1H8TB 2ZGKA 1CIWA 2WSVA 4NVPA 3PHMA 4CYDA 2ZX3A 1NE4A 1W6NA 4RR3C 3ZVXA 1LHNA 1SBDA 1PO12 3LCPA 1QJZA 3B7MA 2D43A 4YLZA 1MQTB 3LWCA 1SCSA 2SLIA 1HXS2 1LCLA 1BVP1 2QE3A 1QJX1 2QZ2A 5E16A 4ZXKA 5B2GB 2AGSA 2VQAA 4E9KA 2WNVB 4ISRA 3AKTA 1LENA 3WG1A 4AF9A 4M3CB 5EYXA 2BNOA 3M3CA 4GB33 1JXNA 1ONAA 1C57A 1QJU3 2RM23 4QD2A 1AR73 2P2KA 4PLOA 4LUKA 4AHYA 4N43A 4AHXA 1NCQC 4IETA 1ENXA 2UYAA 2YXSA 2R063 4P9YA 5I91A 3RG0A 1H8TC 5CFCC 1CX4A 1MZFA 3ZYPA 4GWNA 1Q8SA 2DFCA 1W2UA 3WDYA 4LBKA 1MQTC 4MGYE 1BXHA 3KSCA 1NQJA 1K5MB 2YYOA 2XWJB 3PNAA 4ATFA 1O4ZA 1CAVB 1SMVA 4JVAA 1LECA 1XNKA 1L3JA 1YYNA 1RUG2 2ZTNA 2WNVC 4HVRA 1LOAA 5BNPB 1I1EA 3N7JA 5JLVA 3M4FA 3OY8A 1OFSA 4WM7C 2A70A 4M00A 3GF6A 4HPKA 4BMEA 3RJ2X 4PCRA 3DUIA 3B01A 2DCTA 1Y9QA 5EZWA 1ZVFA 5H9SA 2PHLA 1XNDA 2VY0A 2ZACA 3AFKA 5T5PA 2XBO2 2A73B 2HWB2 2P3JA 3HT2A 1KS4A 4Z07A 1C5IA 5L7OA 5I0UA 1UD1A 2D98A 1QJY3 3AM2A 5D1IA 3V64A 4CEWA 4RHV1 2RMU1 3BTAA 2E6VA 1VBA1 3O0XA 3AFGA 3ROUA 1DQ0A 5T5OA 1PK6B 1N1SA 2CGPA 1VP6A 4NOTA 5BNPC 2WWSA 2ZGPA 3O7OA 1R1ZA 4AI2A 3WINE 4XJZA 5JPNB 1FAYA 3RPQA 5A3LA 2XLFA 3T1MA 1O91A 1RHI1 3TRSB 2HWD1 2WQZC 3V0BB 2ZGMA 4OI4A 2A3WA 2VUJA 4B4QA 2I45A 1OKQA 3GBWA 3U10A 4XHXA 1X8MA 1IHMA 4BH9A 1COV2 1QQP3 3NVCA 4EN6B 1F5FA 2VOVA 3DF0A 4QPIC 5E89A 3TYJA 4E4DX 1KRIA 4XJAA 1YUDA 2W08A 3GBGA 1WCKA 4I0WB 1O5UA 3RZZA 4ONUA 3CL1A 5J96B 3ZSKA 2FMDA 3H1MA 2R042 5I8YA 4XF9A 4AHZA 4F83A 4WZCA 1PK6C 1R082 3WHTA 4AFDA 4P9JA 2GSYA 1R1A2 3D4KA 3INAA 1Q8QA 2HWC1 1CJPA 1VRH1 3ENRA 3NAPC 4ATEA 1VALA 3OGGA 1JW6A 4Q4V2 3HQXA 5T50A 3VL8A 4FPEA 1C4RA 4BA6A 2R1DA 2PHFA 1YXWA 1PO13 3POWA 2F6BA 2B39A 4KH9A 2IXLA 2WFF1 4PDWB 2FZ1A 3WCSA 1AZDA 5FLHA 1DIWA 2WLPA 1ZBE1 4Q4X1 1POV0 4M0NA 4Z8BA 1UPSA 4CDXA 3PVEA 1NOVA 4DPNA 4HBNA 1V6NA 1HRI1 2E7AA 5JOYA 1HV0A 1VAKA 4EWAA 2UWAA 4UBGA 2BFUS 2VW2A 4XJ8A 4FPGA 4YG3A 3ZXGA 3JUUA 4KGGA 1SLIA 1TEIA 3A4UA 2ZX4A 2WS92 4UW6A 1VBC2 5SV8A 2B8MA 4NHKA 1DQ2A 4ASMB 4CDUB 1QNWA 4KNCA 4OHXA 2MEV1 4HKOA 4WV8A 2ZS6B 1AYM2 4ASLA 2RHPA 5K9YA 1G7YA 2XJQA 4PDWC 3UJQA 1UN1A 4YW3A 4XFCA 2D6NA 1RUG3 4XDQA 1D4M2 1LR5A 4JTNA 1OD5A 1SFNA 4P9LA 4BLJA 1A6CA 3VBSB 4AQTA 4MUVA 4GH4C 4YGCA 1ZM1A 2WZR3 1GNHA 4FO9A 4Y24A 2Y0IA 5EWSA 4YW2A 3LOBA 3AZYA 4RS5A 4META 2DVDA 2RS51 1MACA 1RUE2 1V6OA 2JG9C 3AP5A 3PTYA 1GR3A 4AE2A 4E4SA 1U12A 1TME1 4LBQD 2XBO3 3MICA 5JZGC 1H9WA 4GXLA 4S2GA 1SEFA 1W6PB 2ZMLA 3RYPA 2D3PA 4CDUC 2YMZA 3JBG1 2Z2SB 3VZOA 3B5LB 4L2NA 3LSDA 4QQOA 1RUC2 2B9UA 5I8TA 4W65A 2YGLA 3JCIA 2XKPA 1V9U1 4IQPA 4X6RB 4XIKA 3S0MA 1UAIA 3OCPA 4MH0E 4Y4YA 3VBSC 1EYBA 4MXVA 3BB6A 2VH9A 4XF4A 2C9AA 2TNFA 2D3SA 1V70A 4FPFA 4D3WA 1EP0A 3JB8A 3PVBB 3H8UA 3W59A 1PIV2 3CF6E 4QT6A 1MVQA 4AVCA 1HQWA 1S55A 5JMCA 4Z2WA 1Z7S2 1LOEA 4IEPA 3T1LA 4MXWA 2NPIA 2FBEA 3WP6A 3JZVA 4E27A 3ZIWA 4SLIA 2OYZA 2QVSB 4FPCA 1CAWA 3TB0A 1HIXA 4AVAA 2JG8B 1PNFA 2Y0OA 4Q4W2 3ZMNA 4C90A 4QGMA 3TN92 1R083 4XYXA 2OZ6A 1WD4A 3KQRA 1R1A3 1PGW2 3EBRA 4IV3B 4OI2A 1ND2A 4CTEA 5GZFA 3LOIA 2PHDA 4Q4V3 1NA1B 4JCKA 3H1YA 5CAZA 3POYA 2XUMA 3RYRA 1VAMA 1BMV1 2EALA 4XHBA 2RM21 5HI0A 1AR71 5J7MA 3O0WA 3VHNA 2R6QA 1SLBA 5FPXA 2WFPA 3IDEA 4C1XA 4CDQB 2NP0A 2F4PA 1O3RA 5BNNB 2AREA 3THTA 2CYFA 3MPPG 3WUCA 5CU1A 3UKNA 3CJIC 1H0BA 4BIOA 2A71A 3VZKA 4R9CA 4L97A 4Q4Y1 2ZA9A 1UIJA 2JENA 2NMOA 4JDMA 2QUOA 4COYA 5KXDA 4Y5Z0 1DGWX 1H1AA 1C5HA 4K9SA 4H7MA 2K0GA 2O8QA 1FMD2 1Q43A 4B4RA 1RUI3 4N7UA 2JX9A 2ZGNA 4IV3C 1B35B 4K21A 4ORFA 3WG4A 1LOGA 1NCRA 1NA1C 4AEDA 3ES1A 4KU7A 4KGQA 1YFUA 1VBC3 3ILNA 4HSLA 4EJRA 4LO5B 3FUQA 5GKAC 4YSFA 2GAUA 5BNQA 5FQ0A 4B7KA 4YFZA 1IOAA 2B42B 4CDQC 4FOYA 3NW4A 1D4VB 3MW4A 3PVOA 4FOVA 4Q0QA 5KBFA 4XJWA 3VBRA 3BALA 3PMSA 2ZMNA 4K20A 3VN4A 1HLCA 4F3JA 4GULA 4Y1ZA 1OA2A 1YFYA 3H9AA 3M3IA 4XMAA 1KJLA 1QJY1 4F8AA 5FDBA 1OQDA 3SISA 4ES8A 2E53A 4JTOA 2XVKA 5A32B 1RUE3 1G8WA 5AVPA 1B35C 2Y26A 1FYUA 2BVVA 4QM8A 2HEWF 3SH4A 2ZAAA 3WW1A 2R073 3WLUA 2E63A 4TWTA 4IESA 5H9PA 3MIFA 2DFBA 3SCFA 3DPRA 2XKOA 4RFT0 2XVLA 4DB5A 1MS8A 1GSLA 1REDA 3VGIA 1A8MA 4R9BA 1V6IA 2LTNA 4YVWB 2ZZQA 1SDWA 3WP5A 4INDA 3K51A 5D8AC 4OLLA 3AP7A 3AMNA 1F2NA 1MS4A 1RVF2 3ILFA 1JUHA 2D6PA 1ULFA 5JVVA 4AW7A 1KITA 4NN0A 5KHIA 2JKBA 4NPRA 5ABJA 3ZSLA 3MIGA 1C8M3 4HZFA 2YV8A 1PIV3 2WNUB 1BQPA 5F6KA 2PN5A 1CESA 3LSEA 1Z7S3 4U2AA 4BMBA 1UPIA 2CAVA 4Y22B 5DG1A 5JOWA 4RD7A 4XQ4A 3KT7A 4MYEA 1H4HA 3ZN4A 1VBE2 2A7AA 1PO11 4DS0A 4GA9A 3WG2A 4XZPA 1V6LA 2LM3A 4YVWC 3HR9A 4IL7A 5EYYA 3TN93 1PZ8A 3IM0A 1ZZ9A 2HYKA 3E97A 3ST7A 1KDKA 1CAXB 4IV1A 4FOWA 2E51A 1S0JA 3B94A 1S0BA 4YG6A 1V6MA 1S0IA 4JGYC 1EV12 3DV8A 1CPNA 1N1TA 1ZRRA 2OA2A 3ZXAC 3MIHA 3AYCA 2VMHA 1VBB2 1RUD3 4HETA 4YM0A 4AGRA 4I30A 4M3CA 2LALA 1N3QA 1CAUA 3M1HA 2O1QA 5HXVA 3S30A 4D94A 5CG8A 1ZBA2 3WDXA 3ELNA 1X36A 4N7IA 1KFXL 1QHDA 1NE6A 2HWF1 3MDPA 2X53S 1W6QB 1FMD3 4EN9B 1OOPB 1PNGA 4XOGA 4FBFA 5JAXA 1AR62 2ZGSA 4PF5A 3H7JA 5C33A 1RUG1 5H9RA 4NHMA 4CP0A 1VB4A 4IEXA 1K5MA 5KXEA 2UWCA 3JD71 3V56A 3VV1A 2WZR1 1MEC2 1Y3TA 4QPGB 2DVGA 2AZ5A 3EO6A 2B46X 1JYCA 2XL7A 1RITA 3UK9A 3UKTA 4D69A 5FCCA 1WD3A 4MGKE 1ND3C 3N35A 1N3PA 3N4MA 1C3HA 3VBHC 3T2TA 4PBOA 2EF6A 2K9ZA 5KHJA 4KL1A 5CNAA 4JDOA 5HBAA 3ZXLA 1JN2P 3MFAA 2EXHA 1S0EA 3KCXA 1H9PA 4Q1RA 3OYWB 5KXBA 5DXDA 3KGLA 1OOPC 1D2SA 5E88A 4YW4A 5GJ6A 2WIIB 1N3OA 4AVTA 1LHUA 4O9EA 1SLAA 3AMQA 5C9AB 5GLTA 4G9SB 3I8TA 3J8F2 4YNIA 5AFEA 1WLDA 3LA3A 1DLLA 2H6CA 3U11A 4Q8KA 1O4YA 4QPGC 5GALA 5CVRA 2BWCA 5FMOL 1JH5A 2H6BA 2IFRA 3AZZA 3LA7A 2KA3A 3WXPA 1F5JA 4LBJA 4OI0A 1GV9A 1RMU2 4YM1A 5JOZA 1RUF3 3FC0A 2XG3A 3B9IA 4OHVA 4LHKA 3FUOA 2HWE3 4N53A 5JR7B 2DVFA 1RVF3 2PA7A 2ZHKA 2XGXA 4FXKB 3RS6A 3VKMA 1A78A 5HCAA 2VU9A 5FTTC 2RR12 3IMNA 2DCZA 4YARA 1UU5A 3AMHA 4HT1T 1R081 5C9AC 3ZXEA 1R1A1 2QJVA 1AJKA 3GYDA 1QNYA 4Q4V1 1Z0HA 5GLUA 1TE1B 5HCBA 5DDJ1 5I93A 2OUJA 2ET1A 1H2NA 4BYYA 1W0PA 4R4XA 3A0KA 2WINB 1PZ7A 1X7NA 5CFCB 5LEKA 4XFGA 3VBFB 4NHLA 3S7EA 3EXUA 5IT6A 4RSUA 5KXCA 4BZ4A 1FPN2 1YNAA 4RQPA 4XBQA 1EV13 3J26N 4PDWA 4FPJA 4QQLA 4K3UA 4XFFA 1F31A 4LNVA 1RJ8A 2ZBJA 1VBB3 1BEV2 1RUI1 3UV9A 4ISQA 4AFCA 1J58A 4FOQA 5J36A 1RUJ3 2D5FA 4KG8A 4XFIA 1QGLA 4XXPA 4WM7B 3H1WA 1ZBA3 2GC3A 5F5QA 1VBC1 1APNA 2OVUA 1AL21 3BCWA 5E8AA 2ZHNA 4AWDA 3FJSA 4G4FA 5CBLA 1ZX5A 4LHLA 2XVGA 1AR63 1GANA 4CDUA 3VBFC 1UU4A 4R9DA 3K48A 4HVOA 1S0CA 4QQPA 4K1ZA 3TAYA 2C1FA 4ZU4A 1FOD2 4WVVA 3G6JB 4FCAA 1TMF3 4MZUA 4FP2A 1LULA 2XWBB 4ZU7A 3AYDA 2ZMKA 4OVEA 1SLLA 1HDKA 5BNOC 2RS12 1VLNA 2VPVA 1W39A 2A6XA 1AR93 4LT5A 1BZWA 2UU8A 2R071 1SCRA 4OZXA 4KWKA 1LB2A 1YIFA 3FLRA 4WVZA 3HBZA 1C8NA 1XQNA 4DRVA 1DFQA 2CV6A 3VBOA 1NQDA 1AX0A 4M3CF 4V1PA 2RS32 2ZGLA 3IDCB 1QU0A 3J8F3 2B7YA 4QPIB 4FPOB 2WKKA 3USUA 4AXOA 1DGLA 2I74A 1HW5A 4DY5A 2D7FA 1XYOA 1ZNPA 3ZSJA 5CADA 5FFOC 1IQAA 1C28A 1C8M1 2PAEA 2IC1A 3AKRA 4QQ2A 4E2GA 4I02A 1RMU3 1S2BA 1WBFA 3THPA 3B93A 3ZSMA 4XBLA 2YUEA 3NAPB 3RDIA 1Z7S1 2Y38A 3BODA 1ZA4A 4QQHA 4AVVA 5ACA3 1DQ5A 3AB0A 1X33A 4YZ3A 5IUQA 3SH5A 4AHWA 1QDCA 1AR81 4LO7A 1WBLA 2GMPA 3TNQA 2AH2A 2JICA 3AK0A 2IFWA 4HANA 1MVEA 3TN91 2BTVC 4S2FA 1AL0G 1SQ4A 1A3KA 2JG8A 1VBD2 5TSWA 3VLBB 2BWAA 3NKGA 3AP6A 1NY71 1V00A 1GLHA 1D0HA 4YZ4A 4COWA 1WW6A 5J09A 3CLPA 4UW3A 1W6MA 4ZU5A 1PO23 1RUD1 1EAH2 4WVMB 3QH6A 4WM8B 2ERFA 1AUYA 2EXJA 4OUMA 5DUVA 2QKDA 5I8SA 1NG0A 4GWMA 4D7SA 4XF3A 3SLIA 2DUPA 3QACA 1FPN3 3VBUA 1R092 3EJKA 3IPVB 5BNNA 1LKNA 1HXS3 5LK7B 1PGL2 4IEQA 1FNZA 4BPZA 1FMD1 3NV2A 2HKXA 1QY4A 4DRRA 2ZHLA 1BEV3 1GZCA 4FPLA 2XJSA 3UJOA 1G9AA 3AKSA 4E4ZA 5H9QA 1ZRFA 2VOKA 1RGSA 2CTVA 1PVC2 3HT1A 4L99A 5E1RA 4ES9A 2ARBA 3MIBA 3FBYA 4FAHA 1RINA 1Y7BA 3N7KA 4GH4B 4YW1A 5GLZA 2Z42A 1T6GC 1W6NB 4YGEA 4BQ1A 2DU1A 3AJZA 1BCXA 2JG9B 3H7YA 1WCSA 4WM8C 1JTZX 1UL9A 2EXKA 4FPKA 1GQHA 4YVSB 4FTSA 1OSGA 2PHTA 1QF3A 5JZGB 2VOWA 4YZ2A 1LEDA 2P34A 3RMYA 2EAKA 4I3PA 1QJX2 3MIDA 4TYSA 2ZGTA 2NLRA 2RS13 4X8PA 3MLJA 4Q2FA 1YWKA 4BE3A 1U0AA 2D5HA 2IWGB 3WDTA 4XFBA 2V73A 1DYPA 4U36A 5DUXA 3AXDA 4DNYA 1M06G 3SMHA 4LLOA 5A32A 4AQ2A 1I9RA 3ZFFB 1U5ZA 3MYXA 3H50A 5T55A 1FX5A 4NR1A 2VW0A 1IKQA 4DMIA 4YVSC 2HWB3 1RUF1 3NV3A 4P5HA 1PZ9A 5T54A 4BWOA 2HWE1 2RS33 2GNDA 3N7MA 5EV7A 1RVF1 2ILMA 3I59A 3VZNA 4G3YC 3WP4A 3KCYA 4YVWA 4Q27A 2MNGA 3OTFA 4KBBA 3AKQA 4GMP3 3ZN6B 5CFDA 1QH7A 2H0BA 4QM9A 2JECA 4MVTA 2HEVF 4MGIE 1LJ7A 3GHMA 2WSUA 5C8CA 5LRSA 4JGZA 1GFF2 5L7OB 1UW8A 2PELA 2ZKLA 5J48A 3ZFFC 3ME2A 2WNUA 1URXA 4FP3A 4LTAA 1CR7A 4AG4A 5BXXA 3V65A 4LE4A 3OGJA 1COV3 3CJIB 4YGDA 5GZCA 1XE8A 1QOOA 2CAUA 1O5LA 4QPYA 1HQNA 1VBA2 1EV11 3MPBA 2R043 1BVVA 2D97A 4CDWA 3WW4A 3ALQA 1CAXA 1WMDA 4CEYA 1VBB1 1DU3D 1YJKA 3VZLA 2UWBA 1AX1A 4SBVA 3NL1A 1EAH3 3MF6A 4YFWA 3B00A 4RGGA 2E7TA 5JI7A 1RUJ1 4GB31 5L7OC 1H2LA 1OQEA 3ZFEA 2W39A 1RUOA 1LHOA 1QJU1 1ZBA1 2X8KA 4MSVA 4CEWC 5JOXA 1GZWA 2WA3A 4P9GA 2XJVA 5A33B 4RGAA 4AYUA 3L9JT 2R061 1SLCA 1AR61 2NN8A 4M3CE 5JIUA 4OHYA 3GZAA 2V09A 4LBLA 2C0ZA 3PLQA 1CJDA 2DUOA 4YM3A 1ZZ7A 2AR6A 3IBMA 2XB6C 2PHWA 4Z82A 1TMF1 2IZWA 1FNYA 2OW4A 3R6SA 4BCUA 2OUHA 2UURA 1DHKB 2HWC2 2FMYA 5J98B 2OPKA 1VRH2 2UYBA 1AR91 4R4ZA 1PHMA 4LBQA 3M7AA 4EWEA 4I3GA 3ZXFA 2D3RA 3QH7A 1IS4A 4QPGA 2WS93 1AYN2 1O3SA 3IT8A 1QH6A 1ULEA 2GNBA 3IWZA 1SLTA 1YRZA 1AYM3 1RUH2 2YPJA 3NV1A 5JDBA 1J59A 2WFF2 1LGNA 2R49A 5DZGA 1M4WA 5EFUA 5KHGA 3OPZA 1OA4A 5BYNA 1IZ3A 1KQRA 1ZBE2 2YROA 4GKXA 1D4M3 1X82A 1HRV2 5D8AB 5IK5A 1H4GA 1XU1A 3LZZA 3OYWA 2WQ4A 1Q8OA 1G9DA 3AX4A 3BOWA 1DQ1A 4HL0A 1C1FA 1HRI2 1RL3A 5C4WB 5JSPA 3OD4A 4CZSA 2Q1ZB 1MS9A 1REFA 1B09A 1NYWA 3ZIXA 3H3UA 4IEVA 3ZXKA 2VOXA 4IXLA 3RJRA 4Y1VA 3SITA 1DZRA 1I3HA 2VVEA 2JDZA 4A7YA 2MEV2 1RIRA 3O12A 2DVAA 3ZFGA 5ACA1 1JUIA 4PLMA 4C1WA 4COZA 1V6KA 5L19A 1RUC3 4CDXC 3SHRA 4HKWA 2A6VA 3GBFA 4XW3A 2XPJA 2X5IA 4TLFA 2UY8A 4AEMA 3JB4C 4UW4A 2DF7A 4RR3A 2BVBA 1QQP1 1QWRA 1YLLA 2C5DA 2Z79A 4Q8LA 3AXEA 4LA2A 4C91A 1RC6A 3WCRA 4JGYB 5C8WA 5C4WC 2FQPA 5T5LA 2YDEA 3AMMA 2D93A 4A7KA 2WT0A 2QQPA 1MS3A 2IXKA 5K8SA 2WLQA 4AFMA 3ES4A 1PO21 3R0RA 1IPJA 4HK8A 3FZ3A 3JBG2 3FLPA 3PJYA 1XRUA 1MR5A 3N36A 1GQGA 1NCQA 1S0FA 4MLOA 4Q4W3 5FAXA 1FPN1 4WBBA 5DZFA 4XFHA 1ZZ6A 3IDBB 1HXS1 4LEJA 4Q29A 1H8TA 1PM7A 1PMIA 4RS5C 4I09A 5CFCA 1BEV1 4Y1YA 3ZO0B 3VHOA 2Z69A 1J3RA 5SV5A 1MQTA 3DN7A 3ILRA 3LB9A 2GNTA 4K6BA 3ASIA 4MXWB 3WW2A 5AC92 2UY9A 1Q56A 1HV1A 2WNVA 2HEYF 4X6QB 4Q0PA 4KWLA 4Y26A 1V6JA 4XTPA 4IEUA 1ND3B 2LUWA 5FO9B 4WM7A 4COVA 3VBHB 3GNEA 4GALA 4J6GA 4UBHA 2HJIA 3VKOA 1Q5OA 1QOSA 2BBVA 4I0AA 3SCHA 4LBOA 1ND2B 1LHWA 3VZMA 2XJUA 2BW8A 3ECQA 4KU8A 1GKBA 3WHUA 5J37A 4WVWA 1O3QA 5JWPA 1VRH3 2NM1A 5LK5A 4LO6B 4XILA 2BNMA 4MGZE 3TWIA 1AYN3 1CAVA 1PGSA 2I07B 2IXCA 2VGDA 1LGBA 2RM22 3FFZA 1JHNA 1XU2A 3U4XA 5A3MA 1RUH3 1ULCA 4AK3A 5BNPA 4RL7A 1UKGA 2JE7A 3NWKA 1D0GA 2JXAA 4HN1A 2MHFA 3CEWA 4S2HA 2XBO1 2HWB1 2E9QA 4Q4Y2 3VHRA 2RJKA 1HRV3 3FBMA 1ND2C 4P9WA 1NCRB 1WUVA 3KT4A 2QFEA 3G7DA 4H7LA 3ZMOA 3V0AB 1LU2A 1YJLA 4C0HA 2KXLA 1CN1A 3SCGA 1D2QA