4CDWC

Crystal structure of human enterovirus 71 in complex with the uncoating inhibitor gpp4
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
242
structure length
242
Chain Sequence
b'GFPTELKPGTNQFLTTDDGVSAPILPNFHPTPCIHIPGEVRNLLELCQVETILEVNNVPTNATSLMERLRFPVSAQAGKGELCAVFRADPGRNGPWQSTLLGQLCGYYTQWSGSLEVTFMFTGSFMATGKMLIAYTPPGGPLPKDRATAMLGTHVIWDFGLQSSVTLVIPWISNTHYRAHARDGVFDYYTTGLVSIWYQTNYVVPIGAPNTAYIIALAAAQKNFTMKLCKDASDILQTGTIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP1
publication title More-Powerful Virus Inhibitors from Structure-Based Analysis of Hev71 Capsid-Binding Molecules
pubmed doi rcsb
source organism Enterovirus a71
molecule tags Virus
total genus 41
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2013-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4cdwC00
1D4M2 1VB4A 1NCQA 3TN93 1VBD1 2WZR3 1VRH3 1NCQC 5L7OC 1NY71 1DDLA 1ZBE3 4Q4V2 3VBHB 1RUI3 1TME3 4Q4Y2 1RUD1 4RQPC 1PO12 4RS5B 3VBOB 2HWC1 1QJU3 2MEV3 4CDXC 2HWB3 1AR83 1ZBA3 2ZAHA 5BNPB 1E57A 2R043 5C4WB 2FZ1A 2HWE2 3JD72 4CDUC 1MQTB 2WS93 1QQP3 1RUG2 5A33A 3VDDA 1FOD2 4Q4Y1 2RS13 1QJX3 5GKAC 1VBB1 2FZ2A 2RR12 4YVWC 1RUF3 1RUJ3 1X33A 1Z7S2 5C9AA 4WM7B 4AEDB 4GMP0 2ZTNA 3VBSC 2RS52 1BBT1 5C8CC 2XBO2 2BFUL 1QJY2 3VBHA 4EJRA 1W39A 1RVF2 3ZFFB 1FOD1 1FMD2 2WFF2 4RFT0 3VBHC 1NA1B 1PIV2 1PVC2 1RUC2 2RR11 5ACA3 4RS5A 3VBOA 1TMF2 1NCRC 3ZFGB 4GMP3 2R063 2BUKA 5BNPA 2BBVA 2RM21 2RS51 2ZZQA 5C4WA 1VBE3 1RHI3 1FPN2 2TBVA 1AL23 1MQTA 2R072 2GH8A 1QJY1 5C4WC 1RVF1 1MQTC 4JGYC 1FMD1 1PIV1 1PVC1 1V9U2 1VBD3 3VBUB 2GSYA 3NAPC 4GH4C 4WM7A 4AEDA 5BNNC 5DDJ2 1ASJ2 1RUD3 4Q4W1 1RMU1 2R071 2HWC3 3ZFFA 1NA1A 5L7OB 3ZFFC 3ZFGA 4GB31 1C8M2 3JBG2 2VQ0A 4RQPB 1RUE2 4Y4YA 1R1A2 4WM8C 1HRV2 1AR91 1R092 5BNOC 1VBC3 1VBB3 5J96B 4IV1C 1H8TC 4CDXB 1AR62 1EV11 1HXS2 5ABJA 4QPGB 5AC92 4CDUB 3VBUA 5ABJC 1BBT3 1COV2 3J8F1 1C8M1 1B35C 4YVWB 1HRV1 2HWF1 2RMU2 2RR13 1ND3C 1AR61 1RUH1 4PDWC 1PO22 3VBSB 5C8CB 1R082 4N43C 5FOJB 5L7OA 1ND2C 1PGL2 2RM23 4RHV2 4Q4X1 4RQPA 1PGW1 1RVF3 1FMD3 1NCRB 2WLPA 4JGZB 4CDQA 1PIV3 1PVC3 4CDXA 1CJDA 4CDQC 1D4M1 4QPGA 1R081 4CDUA 1C8NA 4QPGC 1HRI2 4Q4W3 1BMV2 1RMU3 4JGYB 2R073 4Q4V1 4YVWA 1AYM2 3S6PA 4QPIC 3NAPB 3FBMA 4GH4B 1AYN2 1HX6A 1PO11 4FTEA 1F8VA 5BNNB 3VBSA 4GB33 5C8CA 1GFF2 2IZWA 2HWE1 1AR93 3JD71 5D8AB 2PLV2 1RUG1 4N53C 1EV13 5FMOS 1NCRA 4JGZA 4YVSC 4JGZC 1Z7S1 4WM8B 3J8F3 1C8M3 5BNOB 4IV1B 3TN92 1H8TB 2WZR2 4NWVA 1HRV3 1VRH2 2HWF3 2XBO1 4JGYA 1ZBE2 1EAH3 1RUH3 1RUI2 1WCDJ 5ABJB 2WFF1 1M06G 1F2NA 2HWD2 1RUC1 2X5IC 3NAPA 4GH4A 1TMF1 5BNNA 1B35B 1SMVA 1QJU2 4Q4X3 2MEV2 1VB2A 1AR82 1ZBA2 4Y5Z0 3TN91 3CJIC 1ND3B 2R042 3JB8A 4PDWB 5D8AA 1FPN1 4CDWC 3ZFEC 2WS92 1QQP2 5D8AC 3HAGA 4N43B 1ND2B 1D4M3 5CFCC 2HWD1 1QJX2 2RS12 1V9U1 1R083 3JB4C 1RUF2 3VBRC 1K5MC 1RUJ2 1A6CA 1RB8G 4WM8A 3VBFC 4SBVA 4Q4V3 5BNOA 5DDJ1 4IV1A 1H8TA 1ASJ1 4Q4Y3 1VBA2 4CDQB 1PO13 5A32B 5K0UC 2WS91 4FSJA 1OPOA 4CEYC 2BPA2 2RS11 1QJX1 1POV1 5ACA2 5LK7B 1RUF1 1B35A 2HWE3 3JD73 4IV3B 4CEWC 1VAKA 3JBG1 4QPIB 1RUG3 1RUE1 2R062 1R1A1 1FOD3 1ND3A 4PDWA 1R091 1VBA1 3DPRC 1NG0A 1VBE2 1BEV2 1RHI2 1AL22 2Y26A 5CFDC 4N43A 1Z7S3 1ND2A 1HXS1 5AC91 5J98B 3ZXAC 1VBD2 4N53B 2RS53 1COV1 2XBO3 1QJY3 4YVSB 2WFF3 1RUD2 1VBE1 2RMU1 1BEV1 1RUC3 5A32A 1TMF3 2HWC2 1PO21 5JZGA 1PGL1 1AR72 4IV3A 4RHV1 1FPN3 5JZGC 4QPIA 1MEC2 1NOVA 2X5IB 4IV3C 2HWD3 1VBC2 1V9U3 1VBB2 1QJZA 1POV0 3CJIB 1X36A 2RS32 5DDJ3 4CDWB 1OOPA 3ZFEB 4N53A 1AR71 1ASJ3 1HRI1 1BMV1 1BBT2 2DF7A 1OOPC 5CFCB 1MEC1 1AYM1 4YVSA 3VBRB 1K5MB 1AUYA 1VBC1 2BFUS 1AYN1 1POV3 3VBFB 3VDDC 1CD3G 2RS31 3JBG3 1AL0G 1RUE3 4FTBA 5K0UB 1R1A3 5C9AC 4FTSA 5FMOL 2RM22 1R093 1VBA3 4LLFA 4RR3B 4CEYB 2PLV1 1HQNA 1AR63 2X5IA 1TME2 1HXS3 2WWSA 4CEWB 5AC93 1COV3 3CJIA 4RS5C 2HWB2 3DPRB 3VBOC 4CDWA 2WZR1 3ZFEA 5CFDB 3LOBA 1VRH1 4Q4W2 2RMU3 1BEV3 1RMU2 1ZBE1 5BNPC 5CFCA 1RUI1 1PO23 1TME1 3VBRA 1K5MA 3M8LA 3VBFA 1IHMA 4RHV3 1QJU1 2QQPA 2MEV1 4GB32 2HWB1 1AR81 2XPJA 1ZBA1 5K0UA 2R041 4WM7C 4AEDC 1AR92 4RR3A 4CEYA 1QQP1 1EV12 4RR3C 1NCQB 4CEWA 5JZGB 1RUJ1 1AR73 1HRI3 1NA1C 4NWWA 3J8F2 3DPRA 1MEC3 1AYM3 3ZFGC 5CFDA 2HWF2 1AYN3 4Z92B 1EAH2 1RUH2 2RS33 5ACA1 1OOPB 3IDEA 4GMP1 1NY72 1OHFA 2PLV3 4Q4X2 3VBUC 2R061 5A33B 1PGW2 3VDDB 1RHI1 1AL21 1EAH1 4BCUA 5C9AB
chains in the Genus database with same CATH superfamily
4XUPA 1OVSA 4X6RB 3HD8B 4A4AA 1QHDA 1TNRA 1X7NA 1NCQC 2J42A 2RVAA 4Q29A 5DXDA 4EROA 4HSJA 1GZWB 4GWIA 4HPKB 3H3LA 5JIAA 1MPXA 4AQ2A 5J37A 1CAXB 2XUMA 2DDUA 2OW4A 2W08A 4CXXA 5KC5A 2JICA 5F5AA 1YYNA 1PO12 4RS5B 2VCAA 3KD4A 3T2QA 3E6BA 3LEIA 3WP6A 3ACIA 2AUYA 2VBBA 4BISA 4FPJA 4BQWA 3AYEA 2HWB3 3KVBA 1V6LA 1URXA 1DGRN 3T09A 3WV6A 3MFCA 3RYKA 3BOPA 1Q5OA 1SLLA 2JEMA 2ZAHA 4W4ZA 5ANQA 5T50A 3H8OA 1RINA 4XHXA 4CDUC 1Q8SA 1MQTB 5LBFA 3RJRA 4E4ZA 1J3RA 3RVHA 3NJXA 2VOXA 3POIA 5ISLA 2OZ6A 2B9VA 1OPMA 4XJUA 1FI2A 3AB0A 4QHZA 2WR9A 4XW3A 1US2A 1HB2A 3NMBA 2W1WA 1NX9A 2VZRA 3WP4A 2Q8CA 4IEXA 2DBNA 4WM7B 5L9VA 1DBNA 2CGNA 1W8UA 4K3UA 1MZFA 2Q8EA 3POJA 4JHTA 5FZMA 4NIAA 5EV7A 4BYYA 3MGUA 3P1IA 4D6RA 4XE9A 1LHVA 1GZWA 2XBO2 4HPKA 4URTA 2BFUL 1QJY2 2EXHA 1ZREA 3KCXA 3DL3A 1VIWB 2D6MA 3IDAA 4MGYE 1CAXA 1OQ1A 2BRTA 1PIV2 1D0GA 1Y3TA 4QQPA 2RR11 3AZXA 1SLCA 2DWRA 1MZ5A 4O65A 4RS5A 5GZDA 3RZKA 4QX8A 2ZS6B 4OCTA 4NAMA 5A80A 1HN0A 1R64A 3RPQA 1UL9A 1X8MA 4CTEA 2R063 1N1TA 1UZWA 3HN3A 1W8NA 2BBVA 2NQYA 2RM21 2RS51 2ZZQA 4ZPIA 3UKTA 3TEWA 5IWFA 5F9TA 1MQTA 2GH8A 3ZOIA 4CUCA 3W20A 3AVSA 2ZX4A 3I8TA 2PA7A 4HVOA 1FMD1 2E7AA 3ACLA 3L2HA 1OH3A 2JD4A 4AW7A 4JQRA 5FIXA 5FQ0B 3ORJA 4AFAA 3ROUA 1WBFA 2PTMA 4WM7A 2VW2A 1FXZA 4PLMA 3QACA 5FZHA 5BNNC 5DDJ2 4MGZE 4ZZ5A 4CP2A 2WN2A 3T4VA 1KS4A 5CA6A 1RMU1 4H7MA 5KXDA 4D8MA 3V0BB 3HQUA 4R9DA 3VZOA 2JDYA 3R4UA 3KLSA 5CIRA 3C7OA 2HWC3 4OHXA 5I0RA 4L9BA 5LWBA 1RYYA 2G19A 1OFNA 3UJQA 3HT2A 5FYCA 5T5JA 4GJYA 3IIAA 1VR3A 3M1HA 4NR1A 2QQMA 2VQ0A 1UKGA 4GQ7A 1W6OB 2D6OX 4P08A 1XE0A 4I0WB 4RQPB 3VHPA 4WM8C 1HRV2 1W2UA 4EYUA 1R092 1SFPA 3WF0A 1VBB3 4Z07A 4KGQA 5GLVA 4AF9A 5C8WA 1QOOA 1Y43B 2AC1A 4Q26A 4XCBA 5HV0A 2JXAA 2Q0AA 4IGQA 4UFKA 4DRVA 1KXGA 4X8PA 3LIGA 4F7ZA 5ABJA 4SLIA 1QKQA 5DZGA 2VMHA 3POWA 1OA2A 2J1RA 2VECA 4ZXEA 2EIEA 4H7LA 4LO4B 4KWUA 5FQ0A 2XKOA 3E1F1 4YW7A 5K7PA 1CQ9A 3ETPA 1HJGA 4ZU4A 1B35C 2Q5TA 2P3JA 3OBAA 3URFA 3NV1A 2NPIA 4IERA 4QQ2A 3TB0A 4BIOA 2QDRA 2BOIA 3ZXGA 1JYTA 1I5PA 3WQBA 3V0BA 1WMDA 3FLTA 5DAQA 5FWJA 4XQ4A 4OMCA 1CAWB 1RUH1 4Q0VA 1JBCA 3EQEA 1Q8QA 4NIDA 1YQ6A 5I91A 3VD9A 2E63A 5FOJB 2PHDA 1WW5A 3N9PA 4IE0A 2GMEA 2Q30A 4FOVA 3VV1A 3ZYJB 5IHRA 1WA6X 2XH6A 1LOCA 1PGL2 1PZ9A 1VRBA 2QVSB 1Q56A 1W04A 2W5FA 4YW6A 4C1WA 1XBFA 2HEWF 1XQNA 5A3MA 1LGNA 1YCIA 1Q8VA 1V00A 4RQPA 1W6OA 1JTZX 1NCRB 1IPJA 3TNPB 1POQA 1I6XA 2JD9A 1PVC3 1S1AA 1TQ5A 1C28A 5LRSA 1CJDA 5BV6A 1OVPA 1QMJA 3J7HA 4BMEA 1QOSA 2VR4A 1Y4WA 4LK6A 1R081 5EHDA 3ZYGA 3CJXA 1HRI2 2XLFA 1B09A 4OLLA 1BMV2 2X29A 4C0BA 5C3SA 5FLIA 2DFCA 2D40A 2XKPA 4FFHA 2GU9A 1F15A 2C0ZA 3S6PA 5JSOA 1QNYA 3NAPB 3FBMA 3USUB 4N9IA 1PO11 4BQ3A 4XQDA 3U4SA 4DUWA 4FTEA 1F8VA 2XLAA 2ZEXA 1CAWA 1L7QA 4BQ2A 2A3YA 2YFUA 1HW5A 2WT0A 3ZXJA 1QDCA 1OI6A 2YROA 3QBQA 5FZLA 1GFF2 1LHWA 1SLAA 2E26A 2FBEA 1H1AA 2PFWA 3ECQA 5FMBA 3RDIA 4Q1RA 2VUDA 5D8AB 3H1MA 2IVJA 4YGDA 3LA7A 4DO0A 3GCWA 4LE3A 4N53C 1XE8A 5EXOA 1E5IA 1Q8OA 3K4AA 4FPLA 3HJRA 3AMNA 3QLQA 4YGBA 1NCRA 2Y6HA 3WNLA 3GHNA 2RDNA 4YVSC 1YQCA 4RA0A 1UD1A 3PL0A 2VMDA 2WKKA 2CDOA 1T2XA 1G8WA 4Y5TA 5F2WA 1EY2A 4K9SA 2PHUA 2DURA 3KWVA 4G4FA 4QKFA 4YFWA 5J1XA 3ZSJA 3AL6A 2HWF3 4NPRA 2XBO1 4P00B 5EJ3A 2ZKLA 3AYCA 2QKDA 3I54A 1WCDJ 1GWLA 4KI5M 2QQJA 1M06G 2Y64A 1GNHA 2D43A 2V09A 2X5IC 3NAPA 5ANNA 3USUA 4CCEA 4QHBA 2A3WA 3B93A 1SMVA 2VH9A 1XNTA 5JUVA 4DMIA 1VB2A 3GDBA 2D7FA 2Z2SB 1LTEA 1QDOA 2JG8C 3WCSA 2BGPA 1CPNA 1LKNA 1ND3B 3FBYA 1Z0HA 2YV8A 3OBRA 4PDWB 5D8AA 5FXWA 1CVNA 2VBPA 4B1MA 1LJ7A 2ES3A 2WS92 2Y6GA 1UU5A 2XVLA 4RD7A 2J1SA 4HL0A 5FXXA 3THDA 2GC3A 2WC2A 2J1VA 5EIYB 3VKMA 2GH2A 2VQTA 2RS12 1QJX2 3E6DA 1UZYA 4ASMB 3JB4C 3AJZA 1RUF2 1RIRA 4UF0B 1MS8A 1RUJ2 1S2KA 4K20A 4TYSA 1NLSA 2PHLA 3D82A 5FBZA 3VKOA 1GP4A 3B9CA 3H8XA 5HCBA 1UU6A 4SBVA 3U75A 2WDBA 4JVAA 5DDJ1 1W8HA 4AAPA 1W6MB 5JAXA 1VBA2 2CV6A 4XZUG 4CDQB 3POYA 4OUSA 4LBKA 3U1XA 4NPMA 4AVVA 2ERFA 2A3XA 1UYPA 2QCSB 5TSWA 4FSJA 5BYNA 2GN7A 4CEYC 3O0WA 5DZEA 5A1AA 4NHYA 1AX0A 2VMCA 3M2MA 1LEMA 3JD73 2OQ7A 4IV3B 2W1UA 2Q8OA 1C1FA 3SKVA 4QPIB 1U5ZA 2V73A 3FE5A 5JMCA 2XJQA 1O5UA 4BU2A 1FOD3 1ND3A 1Y9QA 4PDWA 1R091 3CO2A 4QQHA 1RHI2 1RGSA 2CWSA 5DG2A 3VKNA 2A7AA 3K48A 4BJ0A 1Z7S3 4V2VA 2WNUB 1ZM1A 2W95A 1PZ7A 1WD3A 4UF0A 5CYYA 4ZU5A 5FYHA 5FZAA 3ZXAC 1S0EA 5IFTA 2DCJA 2O1QA 2OZJA 3OPWA 3PJYA 5GLUA 3IBMA 4WZCA 2JX9A 2BTVC 1W6MA 5FYTA 1YEWA 3LF7A 4JTOA 3C2UA 1RUD2 4M3CF 4AQTA 1JZ6A 2LS6A 2W1SA 4TLFA 3AP4A 1HN1A 1PK6B 4Y26A 4XBQA 2ZGMA 1STMA 5F7UA 2VZSA 4QU1A 3JZVA 5A7OA 4IGPA 3KVAA 5KHHA 2DV9A 1LOBA 3BB6A 5GZEA 4OHWA 1JZ8A 1LR5A 1PGL1 2DYCA 1SG3A 4IV3A 4QPIA 1REFA 3DKWA 4IDZA 4MUVA 1GBGA 3TEYA 1NAEA 3DYOA 1S0BA 1UZ0A 2BQPA 3JQXA 2HWD3 3N7KA 4YW5A 1GLHA 2DCKA 2H0BA 2R1BA 1ULDA 3RZGA 1YFUA 3LE0A 4C0HA 1OT5A 2VZTA 2ZHLA 2IFRA 2WNUA 2RS32 1GNZA 4P9YA 4M0NA 4JC1A 1IZ3A 1H1IA 4YW4A 3WF4A 4AQSA 1OOPA 3VDBA 4LBQD 4NRQA 1AR71 1W9SA 1LOFA 4RGGA 1HRI1 1DHKB 1BMV1 3MV11 3FZ3A 1BBT2 3MEPA 5J48A 1G9CA 4YGCA 1MEC1 1PX3A 3NL1A 3MUZ1 4J1XA 3WDTA 2GNTA 1K5MB 4LNVA 1LULA 2D98A 1DZQA 4UW4A 1QU0A 5GZFA 1POV3 3WP3A 1JYXA 1PK6A 1CD3G 5LATA 2VJXA 2ZGPA 3IDBB 4XURA 3GF6A 3JBG3 4LO7A 3F2ZA 4DXSA 1OF3A 1OQEA 4AOCA 2HYKA 3PTYA 1OKOA 5FMOL 2B39A 3GZTB 4LLFA 4RR3B 3UKVA 1J59A 1HQNA 3QD6A 4FAHA 1GUIA 1AR63 1KS5A 3M70A 1ULFA 4KU7A 1GWMA 4PQQA 1DYPA 4G3YC 3K77A 3GXUA 3IIIA 1HXS3 3FLPA 3P3NA 1MACA 4BXFA 1PNFA 2WWSA 4E4SA 2WA4A 2YMZA 2QQIA 3SEPA 4YGEA 3WF3A 4NHLA 2LALA 4LEJA 1COV3 2P3YA 3IN9A 3LFMA 3I3EA 2R1DA 3KCCA 4QDQA 1S0DA 3DPRB 1C57A 4RS5C 4BLJA 4OHYA 3OUIA 4AHWA 3DXTA 1JW6A 3BALA 2EIBA 3LOBA 1ZZ8A 4Q4W2 2RMU3 3N3HA 4HVRA 1LB2A 3OBTA 4AHYA 3RZHA 4XF9A 3WG4A 4AI3A 1TME1 2IXIA 1K5MA 1BKZA 1IS3A 2A6ZA 3C8XA 1IHMA 1V6OA 4AEKA 4CCOA 3VN4A 3B02A 1W6PB 2ZKNA 3LDRA 4E8DA 4ZU7A 4PI0A 5GALA 2ZHMA 4INDA 1H0BA 3I59B 1T6GC 2XPJA 2DU1A 3VD4A 2JKXA 1F9KA 1S2BA 4WM7C 1CJPA 1AR92 1ENQA 2Y34A 4JHZA 4OYUA 1D0HA 4RR3A 3ENRA 1CIYA 2KM2A 4CUAA 1EV12 3PIJA 4LPLA 3AMHA 4QXHA 1YJKA 1VAMA 3PLQA 2WINB 2DVAA 1IKQA 3NJZA 3ZFEC 1RUJ1 3JU9A 2RE9A 1IOAA 1UO9A 1F5JA 5L36A 4LJHA 4IETA 4HFSA 4RFRB 3J8F2 3DPRA 3ON7A 5CKQA 5HCAA 2FQPA 4EN9B 2ZX1A 1F35A 3PNAA 1XYPA 3LQCA 3OD0A 2QTWB 4B1LA 4XJ9A 2W91A 2Y0IA 1AYN3 1W03A 3DYMA 2WIIB 3WSOA 2GMPA 2G4IA 2CNAA 3WINE 3NSTA 4XF4A 2W46A 3TRSB 2FDHA 1US3A 1D4VB 4EN8B 4OMDA 3DECA 3SEEA 2VQUA 3T2TA 1W6PA 1IS6A 3HEIA 1NXMA 2PLV3 1ZVFA 3KMHA 1PX4A 1PZ8A 4O9GA 4Q4X2 2VNOA 3I59A 4IESA 4OI0A 5KHJA 3AVRA 1RHI1 2QQNA 4M3CB 3LEKA 5CB7A 2RJLA 3V64A 4PLOA 1H30A 1JN2P 1AJOA 4WZFA 5C9AB 2VW0A 1YFWA 3KQ4B 3MBWA 4ASLA 1D4M2 1VB4A 5KXEA 2E32A 1CGPA 2ID4A 5FZ8A 2D44A 2WZR3 3WT3A 4AGVA 2X09A 5FP4A 1VRH3 1IKPA 1UY2A 2YBKA 1NY71 4HKWA 4K21A 1DDLA 2QUOA 1ZBE3 1NZCA 2ARBA 4Q4V2 3VBHB 5A7WA 1T6BX 4IUGA 4QQOA 1UPSA 5L19A 5JXJA 1RUD1 1TZOA 1O3TA 4CYDA 3EHKA 1REEA 4RQPC 1H2LA 5FK7A 3VBOB 1IS4A 2QNKA 4L2NA 3E6CC 2XGXA 4WV8A 1RJ8A 2K2SA 2WO1A 5B4XA 2XG3A 1O4YA 4I0BA 3RSJA 2FCVA 4CCLA 1RJ7A 2HEVF 3TEXA 2ZGNA 3PUHA 4P5HA 5C4WB 3TYJA 5KC6A 2QQOA 1GOFA 4QDRA 1U12A 2Q8DA 3ZYIB 4WVVA 1UWWA 4P9IA 3RMYA 5T52A 2CHHA 3LFIA 3OG2A 3WUCA 4HOOA 2P3IA 2NYYA 4FPFA 3CBNA 5FWEA 1U0AA 2EAAA 2XUEA 3B94A 3PHMA 2RR12 4M3CA 3A0NA 5GJ6A 3UL2A 3ZN4A 1J1TA 1QEXA 2VU9A 1ULEA 2ZJCA 5C9AA 1KQRA 2KR2A 4Q8KA 3ZKUA 2YPDA 2CWMA 2ZX0A 5DAVA 4GMP0 2A6VA 2Q1ZB 4MX3A 1HQWA 5LA9A 4CCNA 5K4LA 2RS52 4LUKA 1UN1A 1BBT1 1WD4A 3HN1A 1O4TA 4OUMA 1ALYA 4EJRA 3VBHA 3LA3A 3NKTA 3NW4A 3B01A 4LK7A 4NROA 3ZFFB 2A75A 3O14A 1FOD1 1FMD2 1A78A 5IVFA 3CIHA 3W5NA 4B7KA 1DG6A 3VBOA 3O7OA 5FYZA 1J3PA 1TMF2 1NCRC 2IXHA 2VVEA 3ZFGB 3ZMNA 2ET7A 3ELNA 4AVAA 3RZLA 3SQOA 5IVYA 2DVFA 5LY2A 5FP3A 2B5HA 1MR5A 2HEYF 1ZX5A 4XJAA 2WYFA 3B69A 1ZRDA 2DUQA 3ACGA 4GKXA 5C4WA 1JZ2A 1NZIA 2TBVA 3FC0A 2BZDA 3FFZA 1CZSA 3O0VA 1UOGA 2TNFA 1OXCA 4A6OA 1RVF1 3ES1A 4XC9A 5FZOB 5KHIA 2BBAA 3H3ZA 2FCUA 3MV01 3ZSLA 4DRRA 5BUVA 3W5MA 1O3SA 1VBD3 4FQ4A 1WLWA 3WDXA 1V6NA 3I2HA 3J7LA 1YO8A 3NAPC 4PIYA 4AEJA 3S30A 1W8ZA 2P6CA 2PXJA 3O1OA 2IC1A 4JKKA 3K4DA 3VB9A 4COVA 1ASJ2 3FHAA 4Q4W1 5EWSA 5IK8A 1XJAA 5FXZA 1ULPA 2XR4A 2R071 4JDOA 5I93A 2HBUA 1YC61 3ZFFA 4OFGA 5F5CA 2I45A 2WQ4A 1TVGA 4A3XA 3VZMA 2QZ3A 3KHBA 5DUXA 2VTXJ 3THTA 2XB6C 3CU7A 1DGLA 1LHOA 1OH4A 1L7LA 3FJSA 3ZFGA 4LO8A 5A70A 2Y6KA 3AXEA 4JAAA 4MHUA 5FAXA 1TG7A 1RUE2 1UU4A 1R1A2 4XIOA 5BXXA 1SQ4A 5FKBA 4D6SA 1AR91 4FPHA 5LA0A 1VBC3 4GALA 4S2FA 4WVMB 2WZPP 4CDXB 2VZQA 5B4NA 1EV11 1YFYA 4GWJA 4QT6A 1BJQA 4ZS2A 5G04L 3RRDA 5FZOA 3UT0A 1GKBA 3OCPA 4QPGB 5AC92 1IS5A 5JOWA 3BUCA 1GP6A 2XHNA 5FJHA 3MLJA 1UY4A 5FY1A 4FPKA 1E5RA 3MYXA 4H2AA 4QB6A 4XABA 3J8F1 1C8M1 3VDCA 4BDVB 4DUXA 2VNVA 3H7JA 2C24A 4MADA 3SC7X 2OXBA 4I30A 4Y1UA 5H9PA 1JU4A 2WSUA 1VMJA 3AP6A 3X29B 1CN1A 4XF0A 4XF1A 3ZXDA 2VW1A 1ND3C 1AR61 1UZZA 3PUQA 3AKRA 4PDWC 2B42B 2IUWA 1H6XA 5JSRA 4O9EA 4Y1VA 2I2SA 2P34A 2HBTA 3ILFA 2W94A 5C8CB 1R082 4DUVA 4HVQA 4E2QA 5JI7A 2JDAA 3KT4A 4XMIA 3RJ2X 4NN0A 4OZOA 3WW4A 2WUHA 4AVTA 1BXHA 1EPZA 1JOJA 4Q4X1 4XUOA 5GLTA 4J1WA 1NYWA 5FREA 2ZMLA 2DTYA 5A6YA 2GAUA 4JGZB 1W3XA 5F39A 1PIV3 2ZX2A 1DGWX 1BVVA 4WVMA 5FPUA 4CDXA 4TN7A 1XU1A 4CDQC 4LITA 4M3CE 4UFLA 3MHZA 1ZRCA 3VZLA 1D4M1 3I3DA 4QPGA 5I0TA 3PVEA 2OVUA 4AK3A 3ZXFA 2W68A 1JYIA 4ASKA 1GOHA 1LGBA 5LA1A 4JGYB 2BNOA 2VVFA 2W0XA 4Q4V1 3T1MA 3BPZA 3P5BA 4OI2A 4NO4A 1FV3A 3B00A 4BM8A 2CDPA 3MO4A 4QPIC 5BNQA 3C7FA 1WUVA 2YXSA 3WHUA 5FXVA 2F4PA 2G1MA 2YBPA 5CISA 2P2KA 3N4MA 4YYOA 4FP2A 1MS3A 2YC0A 1QWRA 1EUTA 4GB33 1GR3A 4QXCA 5C8CA 1W0PA 1JS9A 2R7EB 4TSVA 1H2MA 2JIJA 1C3HA 2IZWA 3IZOA 4EWDA 2WNUC 5FRAA 5F5IA 2VC9A 3NWKA 1N3PA 2KD7A 1KGYA 5IAVA 3U07A 2UU8A 1LOFC 2DVBA 3HQRA 3K4ZA 4V1PA 3VDAA 2YGMA 1WW7A 1ENRA 3UETA 4JGZA 3WDUA 2A70A 5E88A 4EZ4A 5DAPA 1DF0A 1C5IA 4GIQA 4U36A 5FPBA 5T5LA 2E33A 2VQAA 5L9RA 3WR0A 1PK6C 4CPBD 4IV1B 3J4UH 1H8TB 2F4LA 1DCSA 1HRV3 3W9AA 3MW2A 1N3QA 3KF3A 2YG0A 4JGYA 4UXAA 3LGRA 2FMYA 1EAH3 3FHIB 2C6SA 2C9AA 2R6QA 4AI9A 4S2HA 5ABJB 1HIXA 2UY8A 5HCFA 1F2NA 2BWCA 3MW3A 2RG4A 4CP0A 3O1RA 1U5YA 2ARCA 2VZ1A 5FMDA 5LEKA 2ARXA 3ZSEA 1TMF1 2JKBA 4XILA 3WP5A 3WXPA 5JIUA 1OBNA 2H6CA 2DCZA 5AFEA 4XXAA 1Q8PA 3RYPA 1FYUA 2ZCWA 4JTNA 1X8EA 4LR4A 1QJFA 5FP7A 5GM0A 4LIUA 5F6KA 2VUJA 2ZOEB 2VZPA 3MIBA 2B9UA 3BGAA 3H8UA 4XDOA 3I3BA 5A7PA 4I2OA 5T55A 4RL7A 4EQVA 3H50A 1XE7A 2D5FA 3AZWA 4IE4A 2IWGB 4KG0A 4QX0A 5FZ3A 4XCAA 1K5MC 5A1LA 4GAZA 1A6CA 2EXIA 5IK5A 4YZ1A 1JHNA 1DYOA 2DUPA 1REDA 3ES4A 4MGQA 4HKLA 2AR6A 4IV1A 1H8TA 1ASJ1 4Q4Y3 1ZRFA 2WAAA 5IVEA 3FFQA 4BQYA 3LDKA 3QCWA 3HNMA 1HV1A 1OA4A 2VXRA 4IW3A 4NAOA 4RYDA 5A32B 5F37A 1OPOA 2MPFA 1RUOA 1CONA 5F3CA 2BPA2 3S57A 1WCQA 1VPHA 1WMXA 3NV3A 1LU2A 3SH4A 1CZVA 5DPNA 3AYAA 2YZ4A 2HWE3 1UKRA 3Q8AA 1RUG3 1IG0A 1BHGA 1RUE1 2R062 4E2SA 1F4AA 1R1A1 3EB7A 4XMAA 3H8RA 3DPRC 3Q8EA 1DQ4A 4YZ5A 5M0TA 3I97A 1ODMA 3ZPYA 1UYZA 2ZMNA 3ZDSA 5I0UA 3OOXA 1ACCA 1OFSA 4KBZA 4KU8A 2XHKA 5AC91 1W8TA 3Q8FA 2TUNA 5LRRA 4DY3A 1YIFA 3OF1A 3GALA 1E5SA 1BLZA 3AK0A 3N7JA 5CKNA 1LU1A 3ZYBA 2NM1A 3E5UA 5FFOC 1UY1A 2WFF3 2Z4FA 4Z2WA 2C1FA 2QZ2A 4N8MA 4OVEA 1CESA 1BEV1 1RUC3 1V6KA 5A32A 1EPWA 2XWBB 3U11A 5I0DA 5LCWL 1ZRRA 4URAA 2HWC2 1OMIA 2VBDA 4XAAA 4LORA 4Q1PA 2VAUA 4RN5A 1K12A 5JZGA 1AR72 3WUDA 3WNNA 4JCKA 4C8DA 3OD4A 1YHFA 1FPN3 1PMHX 4XJ8A 1MEC2 1DIWA 2WNVB 4UFJA 3AFKA 4CRQA 4MGSA 3CF6E 4R9BA 3ZVXA 3DCQA 1W2NA 3TWIA 1V9U3 1VBB2 4MVTA 2R0FA 2ETEA 1WKYA 2A73B 5FP8A 1TE1B 3ZXEA 4TTGA 4XF3A 5FPAA 2JDPA 5LK5A 2ZEYA 1Q43A 2XVKA 2EALA 1YRZA 3CJIB 3NNJA 3SITA 3H0OA 2W3JA 4LKSA 4QMAA 3INAA 3LPFA 3TEZA 4W8JA 1SCSA 1GNYA 1PNGA 1SBEA 4YARA 5A1FA 5DMYA 4YZ3A 2VCMA 4QHOA 3BYWA 5C7GA 1H9PA 1L7RA 1OKQA 5EYYA 2VOVA 3T2PA 3O0XA 1V70A 1VBC1 2BFUS 2EVXA 2YDEA 3HWJA 3PVOA 4K7JA 4UT5A 4XFHA 5FYSA 1L3JA 3A22A 1YQ5A 2AEZA 3CLPA 2YBSA 3KV4A 3N9MA 5CZKA 3DF0A 2E7TA 2XOMA 3JXSA 2V5DA 4Q0PA 5K0UB 5C9AC 1YI7A 4R9CA 2JDHA 3KS7A 1VBA3 4DXRA 4O7XA 1DFQA 2OUJA 3FL7A 2Y8KA 2QDNA 1QGLA 1A3KA 4LHSA 2HH9A 2WNVA 5FPZA 1TME2 2VGDA 2AENA 4QKNA 3WG3A 3OY8B 4B8EA 4CEWB 3POGA 2EIDA 3MIGA 4E27A 1A34A 5DZFA 4NIHA 1WMEA 1JMUB 4IGOA 2LM3A 3SKJE 1JHJA 1XNCA 3PVBB 4HN1A 3WD5A 4QB2A 3CJIA 2QJVA 3VBOC 4QX7A 2WT1A 3ZMOA 4LT5A 1XRUA 4P14A 4FOWA 3B9IA 2VOTA 1F31A 5LY1A 2YU1A 4U2AA 5E16A 1LODA 5A7QA 2BVVA 2HLEA 4JDNA 4L99A 3ZIXA 1PO23 3MZHA 2JDKA 3WF1A 1SFYA 4R9AA 5JR2A 1OD5A 2E31A 1ENXA 1KDKA 5FY9A 2Z42A 2RJ2A 5CBLA 1LAJA 3LD8A 3GZEA 2R49A 4RHV3 1CPMA 3J26N 2E53A 4IEWA 2HWB1 1HLCA 5KXCA 2CAUA 5K0UA 2X10A 2JE8A 2MNGA 2BOJA 3ZYRA 3KT1A 5JXGA 4J6GA 3OGVA 3GGLA 3VKLA 3VGIA 2JWPA 2NZ9A 2Y38A 1OQDA 1O7FA 4MXWB 4EE2A 5JXIA 1MS9A 2VVDA 4CSWA 2QFEA 4IL7A 2YHJA 1NCQB 3ZXLA 3OY8A 4CEWA 3T30A 1KJLA 3RI9A 3AKTA 2DVDA 1XB9A 2WZ8A 3R05A 4LKFA 1NT0A 2D97A 2QQWA 2BGCA 1SACA 4YNIA 3WQ0A 4HSLA 3BIEA 5JVVA 3I7DA 5FLJA 1AYM3 3ZFGC 5HBAA 1JOPA 2WNOA 3D3AA 3ZXKA 4Q5OA 4BE3A 3RI8A 2HWF2 1RTVA 3AMPA 1HQLA 1WCKA 3CNAA 4FPGA 4Z92B 2J7MA 2LW8A 4L92A 2FHRA 4XHBA 2K46A 2RS33 1VAVA 3WQ1A 4YRDA 1XU2A 3O1UA 1OOPB 4OHVA 4BB3A 5FYBA 5A3WA 1NY72 4A44A 4JKMA 2AGSA 5FY8A 3RYRA 2AEYA 1W2AX 2R061 1NE6A 4UFIA 5BPXA 4CUGA 5LBBA 1HB1A 2IVIB 4LBOA 2CTVA 2F6BA 1GQPA 3CMGA 4MGKE 3IDCB 1K5JA 1W8WA 4ES8A 4LKEA 1EAH1 4KWJA 3LEMA 4MXWA 4X8NA 5FY7A 4PF1A 4QPWA 4BCUA 3AXDA 5EQUA 4E4HA 2XVGA 1NCQA 5FZBA 4ARYA 5GZGA 4MXVA 4XFCA 3TN93 1KRIA 1DQ1A 3RG0A 2OPWA 1SFNA 2OS2A 2WSVA 4XFBA 4AYUA 4CUBA 2D6NA 4P9WA 3MLLA 3PURA 5A6XA 4AVBA 5HV4A 1RUI3 4LTAA 4DB5A 1W6NB 4W6XA 2A1XA 4QD2A 2B7YA 4BQXA 4F3JA 2B8MA 3PUSA 5FOBB 3AKQA 1HJFA 3ACHA 3N35A 5CEHA 2HWC1 3S5AA 5EPAA 3H3UA 5K9YA 1QJU3 4B3NA 2MEV3 1NQDA 4CDXC 4DXTA 1AR83 1ZBA3 4HK8A 5BNPB 1E57A 2R043 3UV9A 1JUHA 2FZ1A 3JD72 5H9RA 4QDSA 3CZUA 1QQP3 3C7HA 4YG0A 4AZZA 1FOD2 4Q4Y1 4XTMA 3RZZA 5LZ6A 2FZ2A 1VBB1 2W52A 5FTTC 3D4KA 4CVUA 3EBRA 3LSDA 4R8HA 2XJTA 3J9SA 4EWEA 1Z7S2 2ADEA 3MIFA 3NO8A 5CG9A 1AXKA 1YQ8A 1UX7A 1H4GA 1GQGA 5FZFA 2JDMA 2A6XA 5FMCA 5T54A 4PI2A 4AFCA 4XJZA 1W9WA 2GP5A 4HK9A 1J84A 2VTFA 5C8CC 3SCGA 5JMOA 1I3HA 3FLRA 5LBCA 2D3PA 3BU7A 4PJYA 1RVF2 1W6NA 5JI9A 4LQRA 1VMHA 3FWEA 1OLMA 5C70A 4RFT0 1NA1B 3AFGA 3GBGA 5FPLA 5ACA3 1SEFA 5FLHA 4NVPA 5T3NA 4Z1VA 4GMP3 3NNFA 2EXJA 2XLGA 1YUDA 3MF6A 2A6WA 3S0MA 4X6QB 4XTPA 2N7GA 4LIVA 3BI3A 2VD7A 5BNPA 1CX1A 2WA3A 1VBE3 2ZGUA 3LA2A 3V65A 2WABA 1AL23 2OQ6A 2R072 4I3PA 1OF4A 3UGFA 1VLNA 3PMSA 4N90A 4NHXA 1MQTC 3N9QA 4JGYC 3ZSMA 1BYHA 2KA3A 4O61A 4KBBA 1CZTA 1PVC1 2RDSA 4M4PA 3AM2A 3VBUB 2GSYA 2Q1FA 4YM3A 1DLCA 4OI1A 3T3YA 4W6WA 2XJSA 3ITQA 4ORFA 2DVGA 4BK4A 5I8YA 5JCTA 4ITCA 3A4UA 1MS5A 1KD7A 5EP9A 5DAWA 3DEMA 4Q0UA 3IB3A 4PQ9A 2ARAA 3AP7A 3AX4A 2ENRA 1LESA 1FT9A 4YW2A 2VZOA 3TOJA 5B2GB 3I2IA 5J7MA 4UBHA 3OGRA 1UXZA 2VZ3A 3MICA 2ZBJA 1NA1A 1GV9A 5L7OB 4Y1ZA 3SLIA 4QX1A 1QY4A 5FCCA 3DXUA 1GP5A 2BJSA 4F8AA 2Y0OA 2JDUA 2ZGRA 1C8M2 1S0FA 1OUXA 3I2GA 1UPIA 2UWAA 3JBG2 2J1UA 3ILNA 4NRPA 4XXPA 4ZS3A 5A7WB 2P1BA 4Y4YA 4FAGA 1KJRA 1ZRIA 3SH3A 3TNQA 4A2UA 4R52A 4E4DX 3V0AB 3Q8CA 3GBFA 4CCDA 2VULA 5J96B 4IV1C 3H1WA 4XOGA 3U4XA 1H8TC 4FPYA 5FZEA 1AR62 4CU8A 1QXPA 2E6VA 4LOSA 1HXS2 1WW4A 1V0AA 3BN6A 4LO5B 2R32A 2CSGA 3WOGA 2P5BA 4FPEA 3VBUA 5ABJC 5FZCA 1ENSA 2WRAA 1COV2 2R16A 3HNYM 3HBZA 2XDVA 4YVWB 5KR7A 5C3PA 1WCSA 3BTAA 4XEZA 1W2OA 5H9SA 5G05L 4P02B 4XYXA 3RQ0A 2HWF1 2RMU2 2VOWA 4W50A 2RR13 3ACFA 1G6NA 2BERA 4AFMA 3H42B 1H6YA 4ZHNA 3VBSB 2CU5A 1SHWB 3MIEA 5F8PA 4LUMA 2HYXA 4QKBA 5SV8A 1I9RA 5L7OA 4OULA 1SZBA 4XAEA 2B46X 1PVXA 2RM23 3VKFC 4DOUA 1RL3A 2JG9B 4AHXA 1QOTA 3GYDA 2ZABA 5CVRA 4PBOA 3E5QA 1D2SA 4YG3A 1CAVA 2FDFA 4W65A 5JOZA 2NMNA 3APBA 4PF5A 2P6HA 4E8CA 1FMD3 2WLPA 5E8AA 3DKQA 3V0AA 2VO5A 2JE9A 2R0HA 1WMFA 5D2AA 1G7YA 3O1TA 4HG6B 3VHOA 3I49A 2VNGA 4MO3M 3G6JB 4PT6A 2LROA 4KQ7A 3PDQA 2SBAA 4JX0A 4D7YA 5GZCA 4YW3A 2DTWA 5A3PA 3FUQA 3KF5A 1JZ4A 3UGGA 4DQAA 3POEA 1RMU3 1ULOA 3PMEA 2WZEA 5FPVA 4YVWA 2GC2A 2D5HA 3V56A 5A3OA 1GZCA 1MZ6A 1OC1A 4GH4B 1AYN2 1HX6A 1UNBA 2VUCA 3LCPA 1OLME 4F83A 1JYVA 5JPNB 2SLIA 3VBSA 4CE8A 4AG4A 1LECA 2EIGA 3ATGA 1OD3A 4CXWA 5F3GA 4CU6A 3WVJA 3JD71 3TBDA 2JG9A 4LE4A 1W28A 3USSA 5DG1A 1Y9GA 2PLV2 5FZ1A 4AFDA 1LENA 5FZIA 1QH6A 5KHKA 1FX5A 3LB9A 5FMOS 4XDQA 4LLOA 3NVCA 3SISA 2A5ZA 2W87A 4H14A 3T1LA 3AKSA 1NE4A 1IGOA 1Z7S1 2NN8A 4FCAA 2WO7A 4R4XA 5C5TA 1O5LA 3KZ4C 3PU3A 3HIFA 4AXOA 5BNOB 4B4PA 5APAA 1YQ2A 2OX0A 5FZ7A 2WZR2 4BPZA 1H2NA 1VRH2 2MHFA 4JZRA 1OSGA 3ME2A 3WX5A 3M7AA 1ZBE2 1H1MA 3T0DA 2YU2A 4XUNA 1OUSA 1RUH3 2YUEA 4A3ZA 4COZA 3GNEA 1WWYA 3FX3A 4M01A 3WNXA 4LBMA 1NUKA 3W58A 4GH4A 1UQXA 3WF2A 3EMRA 2JG8A 1W0NA 1K3IA 3ILRA 3VZJA 1JZ5A 3TN91 4Y5Z0 3WG2A 4CP9B 3CJIC 4GZ9A 3JB8A 1W90A 5IYYA 2OT7A 2KXLA 1QF3A 2J1TA 3J7MA 1GANA 1CAUB 5D8AC 4N43B 3R4SA 2FDIA 1ND2B 1G9DA 2ZHKA 3CL1A 3O1PA 2HWD1 4CP1A 2GZWA 1R083 3KQRA 1XSQA 3LPGA 4QGMA 5E1RA 4L97A 1RB8G 3OB8A 3BTYA 4QAWA 1D2QA 2JDZA 5BNOA 3I2KA 2YPJA 3LWCA 4M4RA 5DN2A 1P8JA 1ST8A 5F3EA 1G9AA 3L2YA 1O8PA 3OJBA 1PO13 2W2IA 3KM5A 2JJ6A 5K0UC 4XBNA 5J09A 4META 5AVAA 1S55A 2Z5WA 4LXLA 3W21A 3NNLA 4JV4A 4Q0SA 4WVZA 1NLQA 4KH9A 1POV1 5C71A 5LK7B 2UY9A 3MW4A 2ILMA 4CEWC 3DUIA 1X50A 1ODNA 4FXGB 1VAKA 3JBG1 1KEXA 1MVEA 5LASA 5LA2A 1W9YA 1BQPA 2X53S 5E89A 4CP9A 5C6CA 1H9WA 1ZNPA 1BEV2 1VE0A 4FFGA 4LMFA 2Y26A 5HXMA 4M0HA 4ARXA 1CAUA 1KITA 3L9JT 4AWDA 4N43A 1S0CA 4FVVA 1ND2A 4FPOB 4IEPA 1HXS1 3CZJA 4YPJA 3ZM8A 4AR2A 3CEWA 1QXJA 5J98B 5JOYA 1ZZCA 1VBD2 4HONA 3ZLIA 1UX6A 3O12A 1COV1 2XBO3 2YC4A 3K46A 1QJY3 1NQJA 1WGPA 3ABZA 2O0OA 3IAQA 4Y24A 3VHNA 1Y7BA 4XVHA 2BWAA 1JZ3A 1VBE1 2RMU1 4IEYA 2Z79A 3K51A 4A7KA 1UY0A 4EN0A 4UI9L 1O91A 3CDZB 4QM8A 3R4DB 1UF2C 2CYFA 4QKDA 4ATFA 2QBXA 4ET7A 1UMHA 4XFGA 2Y60A 5FZ0A 3LSEA 4AEMA 1ZZBA 3K3OA 2DBIA 3ZN6B 2ZACA 2WFPA 4AI2A 5EJZB 1NOVA 4IV3C 3ALQA 5AFBA 5FZDA 4NOTA 1LEDA 1VJ2A 3OGJA 1UAIA 4L8QA 4LBJA 1VBC2 2K9ZA 3JQWA 4BMBA 3RGBA 4DINB 1KFXL 4IE6A 1QJZA 4XPVA 3MFAA 3D8CA 2YB7A 4TLGA 4AGRA 2JB8A 4ZKTB 1BK0A 1X36A 4WVWA 1QJEA 5DDJ3 4CDWB 1LHNA 5C3QA 1ZA7A 2C4XA 1CR7A 4GWMA 3WW3A 4CCCA 5JSPA 2NLRA 3KV9A 5FYIA 3O1SA 5F1RA 5HPOA 1HKDA 1OOPC 4QQLA 3AJYA 1UIJA 5CFCB 2OKXA 3LEGA 3RMXA 3QOPA 1O59A 3SCHA 3VBRB 3WNMA 1SDWA 1AXZA 1V6MA 4Y3OA 2EICA 1R1ZA 1AYN1 2D3RA 3U78A 3VBFB 3GCXA 2XQRA 2ZGKA 5FJKA 2PQQA 3DGTA 3ZX7A 4MHRA 5HI0A 1C4RA 1DZRA 4R4ZA 4CZSA 2ORZA 5IK7A 4FFIA 4JDMA 4YFZA 1DQ6A 1TNFA 3HNBM 1R093 3ZN6A 2D6KA 4QGLA 2PLV1 3B3QE 2XWJB 4B4QA 2PN5A 5IVJA 1DZTA 3IT8A 3F95A 4GKYA 3KHCA 3M3CA 4Y4RA 4CU9A 1XNBA 1Y9MA 2Y33A 2ET1A 4UYBA 2VZVA 4P5YA 2F17A 2XL7A 1BVP1 2HWB2 3KSCA 4PCRA 4CDWA 4AI0A 3UJOA 2VL4A 2WZR1 2XJPA 5CFDB 1VRH1 2WLQA 3KB5A 5A3TA 3ASIA 3WCRA 3LDBA 1ZBE1 2W47A 5BNPC 5CFCA 4MSVA 5IATA 2FDKA 4UW3A 4GJZA 3VL9A 3VBRA 5FY5A 3NV4A 3FHQA 1IQDC 1DYKA 1FATA 2PHWA 4ES9A 3VBFA 3SCFA 1H2KA 2A71A 2RHPA 4GWNA 2BDRA 1GICA 4GB32 4JQTA 4ONUA 4DXZA 4OQ9A 2WQZC 4PLNA 3UKNA 3AZYA 4XUTA 5EFUA 4CU7A 3O1MA 4IE5A 3GJBA 1MS1A 4RR3C 5F2SA 4DIQA 2D3SA 2XJUA 3M4FA 3AZZA 2GNBA 2PHTA 2V72A 5JZGB 1W9FA 2P4EA 4M00A 1AR73 4N7IA 4MH0E 1HRI3 1NA1C 2X8KA 5IJRA 1PM4A 4GD4A 4C1XA 1MEC3 1RITA 1W2TA 4LBQB 1WLCA 2VTXA 5CFDA 5I0SA 3R0RA 1F5FA 4XUQA 5FK8A 2ZX3A 2JB4A 1JYCA 2Q1MA 5DAXA 1EAH2 2TEPA 5IVVA 5FUIA 1X9PA 2W1QA 3MI8A 3WW2A 2Y6LA 2VMFA 3OUHA 3QH7A 4E2GA 1SPPB 4NUBA 3JUUA 3NNMA 4UAPA 3VHRA 5HCHA 3ZR5A 4LOTA 1OHFA 4Y5SA 4EWAA 3VBUC 2WAOA 4K6BA 1UW8A 5A33B 1PM7A 1PGW2 5SV5A 3AYDA 3POFA 4FOQA 4L0PA 1V6JA 2O8QA 3VDDB 3HQXA 5FV3A 2B4KA 2JDNA 4IXLA 2DUOA 3I4IA 4YW1A 3UGHA 2DU0A 4GULA 2D6PA 2YYOA 4AI8A 3HT1A 2WL1A 4AVSA 2FD8A 4B4RA 5JOXA 5JR7B 3IMNA 5EYXA 3LOIA 3OGGA 1VBD1 4LA3A 4NPLA 1SCRA 4BH9A 5BY5A 3PVNA 4NIGA 3T0AA 4IEOA 4OZXA 5IT6A 5L7OC 2OUHA 4HKOA 3ZYPA 4XETA 1VP6A 2LTNA 1DU3D 1XNKA 4D7TA 4GXLA 4XZPA 5FZ6A 4FT8A 4LBQA 5FZ9A 2GC1A 1TME3 2YC2A 3IMMA 4Q4Y2 3CQOA 1J3QA 2ZXQA 4ISRA 1X82A 2GNMA 1W3VA 2ZAAA 1G9FA 1X9TA 3GHMA 3IWZA 1DLLA 2UURA 4KWLA 2VZUA 1DGRA 1SLIA 3AMQA 2AYHA 2QE3A 4IQPA 4OUEA 1GU3A 1SPPA 1UOFA 1JH5A 3FN9A 3I2JA 2HWE2 1E5HA 1LOGA 3O1VA 3OPZA 1F4HA 3PUAA 1LRHA 1JOBA 2WS93 1RUG2 5A33A 3WDYA 3VDDA 1JZ7A 1UY3A 3W59A 3PJQA 2RS13 1QJX3 3C3VA 3OBZA 5GKAC 4YM0A 4YVWC 4B7EA 5C3OA 4HN0A 5FR3A 1RUF3 2BV4A 2UYBA 1RUJ3 3RNSA 2UYAA 1X33A 4Q2FA 4QM9A 1RXGA 4BK5A 2AACA 1OLQA 4AEDB 2ZZJA 4HBNA 3VUOA 5DQ0A 3PTRB 2ZHNA 2ZTNA 3VBSC 4XJWA 3KCYA 3AP5A 3D0SA 1YJLA 2VE1A 5IFPA 2QQUA 4P9XA 1W39A 2JG9C 3FMGA 3UNPA 4D3WA 2I07B 2BW8A 2WFF2 3GZAA 3VBHC 3WHTA 4COWA 3OSDA 2RDRA 1O4ZA 1IG3A 1PVC2 1RUC2 3S5QA 3N9NA 1ZZ7A 5L9BA 3VD7A 2I74A 2OYZA 4QGNA 3IAPA 2PELA 2QQVA 2WQ8A 5J36A 5I8SA 1BZWA 1Z78A 5FBJA 4BWOA 2V5YA 3I2DA 2VPVA 1VMFA 2BUKA 4NJ4A 4KGGA 2AREA 3EYPA 3BKZA 2X05A 1RHI3 1FPN2 4I3GA 1W9TA 3OEAA 1QJY1 2DFBA 1W6QB 2XQXA 3CKHA 5C4WC 1LOAA 1S4CA 1JUIA 3T0BA 3SNMA 1C1LA 4Y22B 5FKCA 1PIV1 1XSRA 2CY6A 4ATEA 1V9U2 4QXKA 4CCKA 5A6ZA 4K1ZA 1XOYA 1YFXA 2Y6FA 3MIDA 5DABA 4FQZA 5IK4A 1QNWA 1XYOA 4YSFA 4JRAA 1N1VA 4GH4C 3I3QA 3T2OA 4AEDA 1DQ5A 1JXNA 2PAEA 2R30A 3A7QA 3M3QA 3G7DA 2OA2A 4KL1A 3AKPA 1RUD3 3K2OA 1IPKA 3KGLA 4HANA 4I09A 5F6LB 3S7IA 1RC6A 2VNRA 1DP0A 4LBLA 2ZGSA 4A6SA 5LEJA 1AJKA 4RGAA 3HVDA 5FPXA 1HV0A 1JI6A 1S2EA 3ZSKA 5CKMA 5JWPA 4I01A 4QU2A 2VMIA 3ZFFC 2A6YA 4LULA 3E5XA 5KWRA 2C26A 4YZ4A 5CAZA 1SDDB 4GB31 4DNYA 3SH5A 4GA9A 3RWNA 4AE2A 1HDKA 1AHSA 2PMWB 3ZDVA 4IEZA 5BNOC 4IEUA 5A3UA 1N3OA 2FCTA 1W6QA 4YM2A 1D7PM 5C33A 4Y22A 4D94A 4XBLA 1KFUL 1UOBA 4XIKA 4CDUB 4FBFA 2YFZA 4TZDA 2WT2A 4BXSV 1UMIA 1BBT3 3A0KA 2WO3A 3LZZA 3OPTA 4TWTA 1YXWA 4P9JA 1G86A 1W99A 1J83A 2AH2A 2RJKA 4QX3A 4XQWA 3RFRA 5JPMB 1UXXX 5F32A 1HRV1 1OA3A 1O6UA 4AHZA 4DEQA 5JXHA 3H7YA 4XFIA 4G9SB 1GYKA 5KHGA 3O5SA 5FDBA 2PHFA 1PO22 1U5IA 3C7EA 1AXYA 2P3KA 1AZDA 5A3LA 1CX4A 1QXRA 2H6BA 2NMOA 2AZ5A 4N43C 1FV2A 1W8FA 1ND2C 2JIGA 4PHZA 3C7GA 5DUUA 3PU8A 3TAYA 1WBLA 3THCA 1I5ZA 3MDPA 4RHV2 2C9KA 2H0VA 3SHRA 3KV6A 2IXCA 4EZHA 3N36A 3K75B 2PYTA 1PGW1 1RVF3 3BIWE 4ZXKA 3WZ1A 4UW6A 4AGGA 2BNNA 4Q0QA 4CDQA 2ADDA 1ULCA 5FZKA 3ZN5A 3M3IA 4QWNA 2D93A 1N1SA 5FUPA 5IUQA 4YZ2A 2PQSA 5LW9A 1YWKA 2D6LX 4FP3A 4ISQA 1U5XA 3D5OA 3OEBA 1XNAA 4CDUA 1C8NA 4H55A 2NP0A 1ZA4A 1GMMA 3HPNA 4QPGC 2DCYA 1ZZ6A 1C5HA 2PHRA 2VXJA 1TEIA 4Q4W3 4AL9A 4S2DA 5FYYA 2R073 1IPSA 2CGPA 4YWAA 3POSA 2VCCA 3AC0A 4YG6A 1AYM2 4HLTA 4MGTA 4I02A 1K42A 4QB1A 2XONA 1DQ2A 3NRUA 1W0OA 2G9GA 3HOBA 3T4HB 2GP3A 5CG8A 4RSUA 3WY6A 3IM0A 2WBKA 3T08A 1HB4A 3CHXA 5BNNB 2VMEA 4MG2A 3EJKA 5DUWA 2PAKA 1RXFA 3A23A 3OUJA 5J3UA 1I1EA 4LBNA 2HWE1 1AR93 2J22A 3MPPG 2DCTA 2EF6A 2VM9A 1XXNA 4FPCA 5FZGA 2EAKA 3WNKA 4AFBA 1RUG1 5D1IA 4Z82A 4KNCA 1K45A 1EV13 2WJSA 3BTXA 3ST7A 4BLIA 2IXKA 1XYNA 4BZ4A 4Z8BA 2VUAA 4EV0A 3AZVA 5LB6A 1UCXA 1JODA 2BGOA 1ZZ9A 2WN3A 4J25A 4DFSA 4JGZC 2GDFA 2ATFA 2CGOA 4IE7A 3EXUA 2VY0A 2BEOA 4WM8B 1FAYA 1C8M3 3J8F3 1QH7A 2GNDA 3QH6A 4MOAA 1A8MA 4LHKA 5C3RA 2JE7A 3TN92 4CXYA 1S0IA 1W05A 2VCBA 3ZYFA 4NWVA 5FY4A 5IW0A 3R6SA 5D21A 4ZZ8A 1SBDA 2O14A 1RUI2 2OPKA 2WFF1 4D6QA 2HWD2 3UYJA 1RUC1 2WWJA 5LBEA 3ZYHA 2XMLA 5BNNA 1B35B 2WWUA 1YNAA 3Q8BA 3ZR6A 1CIWA 3KV5A 5L73A 1LHUA 1WLTA 1AX1A 1QJU2 2GC0A 4Q4X3 4A7ZA 2MEV2 4XDPA 3I3MA 5CNAA 4A41A 1IQAA 5JLVA 1AR82 1DQ0A 1SLTA 1N47A 1ZBA2 2K0GA 2VMGA 2BYVE 4Y33A 4OHZA 4CCMA 1GZTA 2R042 3WLUA 1YIPA 3MPBA 1GWKA 2ZEWA 1FPN1 2IXLA 4CDWC 5F5QA 4IEQA 2ZGLA 4BHPA 3LAGA 3LIHA 4DZGA 1UYYA 1QQP2 3HAGA 1LNSA 3VLBB 2OIIA 1PGSA 3NJVA 1D4M3 4C91A 5CFCC 1V9U1 2P17A 4UBGA 3VBRC 5A7NA 4COUA 4FXKB 4WM8A 4ZONA 3VBFC 4Q4V3 4RGKA 1V6IA 3M3OA 1CAVB 3KGZA 1SLBA 1A8DA 2IXJA 4NE9A 1MVQA 4KMQA 2VOKA 2P37A 5AVPA 4D69A 4K1YA 2WS91 4K8FA 3ZIWA 1GSLA 2ZMKA 3D6EA 4LO6B 1BCXA 2QQLA 3DN7A 4A42A 4A7YA 2PAMA 1UYXA 3H9AA 1M4WA 2RS11 1QJX1 2FDGA 2ORXA 5ACA2 1S0JA 4K40A 3WNPA 3WQ7A 1RUF1 4UW5A 5H9QA 1B35A 2ZGTA 5IAXA 3OYWB 4W6YA 3GJAA 3BTZA 3VD3A 3WNOA 1XNDA 1ULGA 2BU9A 1VBA1 1NG0A 1VBE2 3A21A 3I2FA 4UWDA 4FFFA 1UZVA 1AL22 2G9FA 2WO2A 5EZWA 3RZMA 2ZA9A 1O3RA 5CFDC 1WW6A 1ZYBA 1J58A 1CWPA 2GMMA 3NV2A 5KBFA 1PMJX 3THPA 5CADA 5FY0A 5FYUA 1WA4A 3ETQA 3N9OA 4D0QA 1AVBA 4YLZA 3JCIA 3UESA 5K8SA 3I2OA 2RDQA 4WBBA 3VZNA 4N53B 2E9QA 2RS53 4DPNA 2LRPA 4Y1YA 2ZGQA 2W39A 3P6BA 3RZJA 4P9LA 3D0JA 3M3EA 3GZUC 1PMIA 4UFMA 4YVSB 3RWKX 3WW1A 4BQ5A 1AF9A 4HETA 2EA7A 5GLWA 4OQ8A 2C5DA 4N9HA 2XL9A 3BVCA 4EN7B 3ZO0B 3J7NA 3BCWA 3U37A 1TMF3 1YI9A 2IFWA 2WNEA 2XJRA 2ZGOA 5DUVA 1J1LA 1PO21 4NIIA 3NJYA 5FO9B 4NHKA 5E6HA 3PUIA 1XC6A 5A7SA 2HKXA 1GZ9A 3VZKA 2E51A 2E7QA 3OGSA 5GLZA 4RHV1 3OYWA 5JZGC 3WDVA 3POBA 2X5IB 5FZ4A 1AX2A 1PHMA 2Y6JA 3ZKYA 4MV2A 1FNYA 3H1YA 4Y20B 2BNMA 5KXBA 1MS4A 1OLRA 2QQKA 4TXWA 5IVCA 4BA6A 4NMIA 1POV0 2JG8B 4DY5A 3OTFA 5EJ1B 5IVBA 1S0GA 4NRMA 3VD5A 5ERLA 3ZFEB 4N53A 1ASJ3 2Q4SA 3WEZA 4FO9A 2FDJA 4EN6B 3FUOA 2DF7A 3BODA 3HMYA 2W9XA 3PIGA 4Q8LA 4CPBA 3MF9A 1AYM1 4YVSA 2JECA 1LCLA 4HZFA 3LKJA 3E97A 1AUYA 2LUWA 1O8SA 4XACA 2G9ZA 5FUNA 3VDDC 3AL5A 2W92A 2XXZA 4PBPA 5T5PA 4Y1XA 1Q3EA 2RS31 1AL0G 1YLLA 4V2WA 1RUE3 2V4AA 4FTBA 1R1A3 2ZEZA 4QPYA 4CA9A 4FTSA 3AMMA 1H8VA 3BU0A 3EO6A 2RM22 2UWBA 4P9GA 1HB3A 2GN3A 4CEYB 4XFAA 2B45X 3B5LB 4BIFA 2X5IA 4N7UA 4QX5A 1WCUA 3NNGA 3S7EA 1DGWA 1W06A 2XJVA 4Y20A 3IPVB 5AC93 2WNVC 1QIQA 4MLOA 2GALA 5FO8B 1GQHA 3MLKA 4BOWA 3NQHA 4FI9A 4Z2AA 3DV8A 4S2GA 3N7MA 1UOJA 3RS6A 4QXBA 3ZFEA 4LHNA 1NXD1 2FMDA 2YY1A 5A3NA 1O3QA 1BEV3 4PIZA 1RMU2 4MGIE 1GOGA 3HR9A 1FNZA 2Z69A 4HXCA 3UK9A 3NKGA 3KT7A 1RUI1 4JRLA 5FP9A 3WDWA 2V4VA 4AVCA 4Q27A 1LOEA 3GBWA 3Q9OA 4HMZA 3N7LA 4KG8A 3AP9A 3BPSA 3M8LA 2CL2A 2UWCA 5F3IA 2J1AA 4AI1A 1JYWA 3SXWA 1MS0A 1QJU1 3DYPA 4UFHA 1ONAA 4ZY9A 2MEV1 2QQPA 1SBFA 3MIHA 1AR81 1EUUA 5FYMA 3U10A 1ZBA1 1XPWA 2BP6A 2VG9A 1EYBA 1WZXA 2R041 2HJIA 4AEDC 4DEVA 4CEYA 4JKLA 4B29A 2EXKA 1QQP1 1G9BA 3U0ZA 1EP0A 3GM8A 4FOYA 3VL8A 1NLRA 4OI4A 4MYEA 5FYVA 4C90A 5A6QA 3IPVA 1MZEA 1WLDA 2RV9A 4NHMA 2CAVA 4UOJA 4LHLA 2WYSA 3U14A 5I8TA 4NWWA 4YM1A 2JENA 3N9LA 4I0AA 3BOWA 4COYA 4E9KA 1APNA 5HXVA 4L11A 3ZPOA 4A45A 4HT1T 4PIXA 4KWKA 1JYNA 5FO7B 4D7SA 2BVBA 4AQ6A 1BK1A 2YGLA 2PHXA 4LKDA 1RUH2 3K3NA 2J1EA 1LGCA 1VALA 2ZPXA 4CCJA 1H4HA 4DS0A 5ACA1 2L9LA 4XFFA 3IDEA 4BQ4A 4H3WA 4LA2A 1N1YA 4GMP1 4MZUA 1RUNA 3B7MA 3SMHA 4QX2A 3HBKA 4AAXA 1W8OA 1NKGA 5T5OA 1AL21 1KDMA 1JU3A 1UIKA 5CU1A 3WG1A 1UMZA 3MUY1 2O8OA 3P3PA 4IEVA 4K8RB 5C5UA 1OURA 3IKWA 5JDBA 4BQ1A
chains in the Genus database with same CATH topology
4X6RB 3HD8B 1QHDA 1TNRA 1X7NA 1NCQC 4Q29A 4EROA 4HSJA 1GZWB 4HPKB 5JIAA 4AQ2A 5J37A 1CAXB 2XUMA 2OW4A 2W08A 5KC5A 2JICA 1YYNA 1PO12 4RS5B 3KD4A 3E6BA 3WP6A 2AUYA 4FPJA 3AYEA 2HWB3 1V6LA 1URXA 1DGRN 3WV6A 3MFCA 3RYKA 3BOPA 1Q5OA 1SLLA 2JEMA 2ZAHA 5T50A 1RINA 4XHXA 4CDUC 1Q8SA 1MQTB 3RJRA 4E4ZA 1J3RA 2VOXA 2OZ6A 1OPMA 4XJUA 1FI2A 3AB0A 4XW3A 3WP4A 4IEXA 4WM7B 1DBNA 2CGNA 4K3UA 1MZFA 4BYYA 5EV7A 3MGUA 4XE9A 1LHVA 1GZWA 2XBO2 4HPKA 4URTA 2BFUL 1QJY2 2EXHA 1ZREA 3KCXA 3DL3A 1VIWB 2D6MA 4MGYE 1CAXA 1OQ1A 4QQPA 1PIV2 1D0GA 1Y3TA 2RR11 3AZXA 1SLCA 2DWRA 1MZ5A 4RS5A 5GZDA 2ZS6B 3RPQA 1UL9A 1X8MA 4CTEA 2R063 1N1TA 2BBVA 2NQYA 2RM21 2RS51 2ZZQA 3UKTA 5F9TA 1MQTA 2GH8A 2ZX4A 3I8TA 2PA7A 4HVOA 1FMD1 2E7AA 3ACLA 3L2HA 2JD4A 4AW7A 4JQRA 5FQ0B 4AFAA 3ROUA 1WBFA 2PTMA 4WM7A 2VW2A 1FXZA 4PLMA 3QACA 5BNNC 5DDJ2 4MGZE 4CP2A 1KS4A 5CA6A 1RMU1 4H7MA 5KXDA 3V0BB 4R9DA 3VZOA 3R4UA 3KLSA 5CIRA 4OHXA 2HWC3 5I0RA 4L9BA 1OFNA 3UJQA 3HT2A 5T5JA 3IIAA 1VR3A 3M1HA 4NR1A 2VQ0A 1UKGA 4GQ7A 1W6OB 2D6OX 4RQPB 4I0WB 3VHPA 4WM8C 1HRV2 1W2UA 1R092 1VBB3 4Z07A 4KGQA 5GLVA 4AF9A 5C8WA 1QOOA 1Y43B 4Q26A 2JXAA 2Q0AA 4DRVA 1KXGA 4X8PA 4F7ZA 5ABJA 4SLIA 1QKQA 5DZGA 2VMHA 3POWA 1OA2A 2VECA 5FQ0A 4H7LA 4LO4B 2XKOA 5K7PA 1CQ9A 4ZU4A 1B35C 2Q5TA 2P3JA 3URFA 3NV1A 2NPIA 4IERA 4QQ2A 3TB0A 4BIOA 2QDRA 3ZXGA 3V0BA 1WMDA 3FLTA 4XQ4A 1CAWB 1RUH1 4Q0VA 1JBCA 3EQEA 1Q8QA 5I91A 2E63A 5FOJB 2PHDA 1WW5A 3VV1A 2GMEA 2Q30A 4FOVA 3ZYJB 2XH6A 1LOCA 1PGL2 1PZ9A 2QVSB 1Q56A 4C1WA 1XQNA 2HEWF 5A3MA 1LGNA 1YCIA 1Q8VA 1V00A 4RQPA 1W6OA 1JTZX 1NCRB 1IPJA 3TNPB 1I6XA 1PVC3 1S1AA 1TQ5A 1C28A 5LRSA 1CJDA 5BV6A 1QMJA 4BMEA 1QOSA 1R081 3ZYGA 3CJXA 1HRI2 2XLFA 1B09A 4OLLA 1BMV2 2X29A 4C0BA 5FLIA 2DFCA 2D40A 2XKPA 2GU9A 2C0ZA 3S6PA 5JSOA 1QNYA 3NAPB 3FBMA 3USUB 4N9IA 1PO11 4XQDA 4FTEA 1F8VA 2XLAA 1CAWA 2A3YA 1HW5A 2WT0A 3ZXJA 1QDCA 1OI6A 2YROA 3QBQA 1GFF2 1LHWA 1SLAA 2FBEA 2PFWA 1H1AA 3ECQA 3RDIA 4Q1RA 5D8AB 3H1MA 4YGDA 3LA7A 4N53C 4LE3A 5EXOA 1XE8A 1Q8OA 4FPLA 3AMNA 3QLQA 4YGBA 1NCRA 3GHNA 4YVSC 4RA0A 1UD1A 2WKKA 1G8WA 1EY2A 4K9SA 2PHUA 2DURA 4G4FA 4YFWA 3ZSJA 2HWF3 4NPRA 2XBO1 5EJ3A 2ZKLA 3AYCA 2QKDA 3I54A 1WCDJ 1M06G 1GNHA 2D43A 2V09A 2X5IC 3NAPA 3USUA 4QHBA 2A3WA 3B93A 1SMVA 2VH9A 4DMIA 1VB2A 2D7FA 2Z2SB 1LTEA 1QDOA 2JG8C 3WCSA 4AFCA 1CPNA 1LKNA 1ND3B 3FBYA 1Z0HA 2YV8A 3OBRA 4PDWB 5D8AA 1CVNA 1LJ7A 2ES3A 2WS92 2XVLA 1UU5A 4RD7A 3ZFEC 4HL0A 2GC3A 2WC2A 3VKMA 2GH2A 2RS12 1QJX2 3E6DA 1UZYA 4ASMB 3JB4C 3AJZA 1RUF2 1RIRA 1MS8A 1RUJ2 1S2KA 4K20A 4TYSA 1NLSA 2PHLA 3D82A 5FBZA 3VKOA 3B9CA 5HCBA 1UU6A 4SBVA 4JVAA 5DDJ1 1W6MB 5JAXA 1VBA2 2CV6A 4CDQB 3POYA 4OUSA 4LBKA 4AVVA 2ERFA 2A3XA 2QCSB 5TSWA 4FSJA 5BYNA 2GN7A 4CEYC 3O0WA 5DZEA 1AX0A 3M2MA 1LEMA 3JD73 4IV3B 2Q8OA 1C1FA 4QPIB 1U5ZA 2V73A 3FE5A 5JMCA 2XJQA 1O5UA 1FOD3 1ND3A 1Y9QA 4PDWA 1R091 3CO2A 4QQHA 1RHI2 1RGSA 2CWSA 5DG2A 3VKNA 2A7AA 3K48A 1Z7S3 2WNUB 1ZM1A 1PZ7A 1WD3A 3ZXAC 4ZU5A 1S0EA 2DCJA 2O1QA 2OZJA 3PJYA 5GLUA 3IBMA 4WZCA 2JX9A 2BTVC 1W6MA 4JTOA 3C2UA 1RUD2 4M3CF 4AQTA 4TLFA 3AP4A 1PK6B 4Y26A 4XBQA 2ZGMA 3JZVA 5KHHA 2DV9A 1LOBA 3BB6A 5GZEA 4OHWA 1LR5A 1PGL1 2DYCA 4IV3A 4QPIA 1REFA 3DKWA 4MUVA 1GBGA 1S0BA 2BQPA 3JQXA 2HWD3 3N7KA 4YW5A 1GLHA 2DCKA 2R1BA 2H0BA 1ULDA 1YFUA 4C0HA 2ZHLA 2IFRA 2WNUA 2RS32 1GNZA 4P9YA 4M0NA 4JC1A 1IZ3A 1H1IA 4YW4A 4AQSA 1OOPA 4LBQD 1AR71 1LOFA 4RGGA 1HRI1 1DHKB 1BMV1 3FZ3A 1BBT2 3MEPA 5J48A 1G9CA 4YGCA 1MEC1 3NL1A 4J1XA 3WDTA 1K5MB 2GNTA 4LNVA 1LULA 2D98A 1DZQA 4UW4A 1QU0A 5GZFA 1POV3 3WP3A 1PK6A 1CD3G 2ZGPA 3IDBB 3GF6A 3JBG3 4LO7A 1OQEA 2HYKA 3PTYA 5FMOL 2B39A 3GZTB 4LLFA 4RR3B 3UKVA 1J59A 1HQNA 3QD6A 4FAHA 4KU7A 1AR63 1KS5A 3M70A 1ULFA 1DYPA 4G3YC 3P3NA 1HXS3 3FLPA 1MACA 1PNFA 2WWSA 4E4SA 2WA4A 2YMZA 4YGEA 4NHLA 2LALA 4LEJA 1COV3 3IN9A 4X6QB 4BLJA 2R1DA 3KCCA 4RS5C 1S0DA 3DPRB 1C57A 4OHYA 4AHWA 1JW6A 3BALA 3LOBA 1ZZ8A 4Q4W2 2RMU3 3N3HA 4HVRA 1LB2A 3OBTA 4AHYA 4XF9A 3WG4A 4AI3A 1TME1 2IXIA 1K5MA 1BKZA 1IS3A 2A6ZA 1IHMA 1V6OA 4AEKA 3VN4A 3B02A 1W6PB 2ZKNA 4ZU7A 5GALA 2ZHMA 4INDA 1H0BA 3I59B 1T6GC 2XPJA 2DU1A 1F9KA 1S2BA 4WM7C 1CJPA 1AR92 1ENQA 1D0HA 4RR3A 3ENRA 2KM2A 1EV12 3AMHA 1YJKA 1VAMA 3PLQA 2WINB 2DVAA 1IKQA 3NJZA 1RUJ1 3JU9A 2RE9A 1IOAA 1F5JA 5L36A 4IETA 4HFSA 3J8F2 3DPRA 5HCAA 2FQPA 4EN9B 2ZX1A 3PNAA 1XYPA 3OD0A 4XJ9A 2Y0IA 1AYN3 2WIIB 2GMPA 2G4IA 2CNAA 3WINE 3NSTA 4XF4A 3TRSB 4EN8B 1D4VB 3T2TA 1W6PA 1IS6A 1NXMA 2PLV3 1ZVFA 3KMHA 4O9GA 1PZ8A 4Q4X2 2VNOA 3I59A 4IESA 4OI0A 5KHJA 1RHI1 4M3CB 5CB7A 2RJLA 3V64A 4PLOA 1H30A 1JN2P 1AJOA 4WZFA 5C9AB 2VW0A 1YFWA 4ASLA 1D4M2 1VB4A 1CGPA 2D44A 2WZR3 3WT3A 4AGVA 1VRH3 1IKPA 4K21A 1NY71 4HKWA 1DDLA 2QUOA 1ZBE3 1NZCA 2ARBA 4Q4V2 3VBHB 4QQOA 1UPSA 5L19A 1RUD1 1O3TA 4CYDA 3EHKA 1REEA 4RQPC 1H2LA 3VBOB 1IS4A 2QNKA 4L2NA 3E6CC 2XGXA 4WV8A 1RJ8A 2K2SA 2XG3A 1O4YA 4I0BA 3RSJA 1RJ7A 2HEVF 2ZGNA 5C4WB 4P5HA 3TYJA 5KC6A 1U12A 3ZYIB 4WVVA 4P9IA 3RMYA 5T52A 3WUCA 2P3IA 2NYYA 4FPFA 1U0AA 2EAAA 3B94A 3PHMA 4M3CA 2RR12 5GJ6A 3A0NA 3UL2A 3ZN4A 1J1TA 2VU9A 1ULEA 2ZJCA 5C9AA 1KQRA 4Q8KA 2CWMA 2ZX0A 4GMP0 2A6VA 2Q1ZB 4MX3A 1HQWA 2RS52 4LUKA 1UN1A 1BBT1 1WD4A 3HN1A 1O4TA 4OUMA 1ALYA 4EJRA 3VBHA 3LA3A 3NKTA 3NW4A 3B01A 3ZFFB 2A75A 3O14A 1FOD1 1FMD2 1A78A 4B7KA 1DG6A 3VBOA 3O7OA 1J3PA 1TMF2 1NCRC 2IXHA 2VVEA 3ZFGB 3ZMNA 2ET7A 3ELNA 4AVAA 2DVFA 2B5HA 1MR5A 2HEYF 1ZX5A 4XJAA 3B69A 1ZRDA 2DUQA 5C4WA 4GKXA 2TBVA 3FC0A 3FFZA 3O0VA 2TNFA 1RVF1 3ES1A 5KHIA 3H3ZA 3ZSLA 4DRRA 1O3SA 5BUVA 1VBD3 4FQ4A 1WLWA 3WDXA 1V6NA 4AEJA 4PIYA 1YO8A 3NAPC 3S30A 2IC1A 4COVA 1ASJ2 5IK8A 4Q4W1 5EWSA 2R071 4JDOA 5I93A 3ZFFA 4OFGA 2I45A 2WQ4A 4A3XA 3VZMA 2QZ3A 5DUXA 3THTA 2XB6C 3CU7A 1DGLA 1LHOA 3ZFGA 3FJSA 4LO8A 3AXEA 4JAAA 5FAXA 1RUE2 1UU4A 1R1A2 4XIOA 5BXXA 1SQ4A 1AR91 4FPHA 1VBC3 4GALA 4S2FA 4WVMB 2WZPP 4CDXB 1EV11 1YFYA 4QT6A 1BJQA 3RRDA 1GKBA 3OCPA 4QPGB 5AC92 1IS5A 5JOWA 3MLJA 4FPKA 3MYXA 3J8F1 1C8M1 3H7JA 4I30A 4Y1UA 5H9PA 2WSUA 3AP6A 3X29B 1CN1A 4XF0A 4XF1A 3ZXDA 2VW1A 1ND3C 1AR61 1UZZA 3AKRA 4PDWC 2B42B 5JSRA 4O9EA 4Y1VA 2I2SA 2P34A 3ILFA 5C8CB 1R082 4HVQA 4E2QA 5JI7A 4XMIA 3KT4A 3RJ2X 3WW4A 4NN0A 4AVTA 1BXHA 1EPZA 1JOJA 4Q4X1 5GLTA 4J1WA 1NYWA 5FREA 2ZMLA 2DTYA 2GAUA 4JGZB 1PIV3 2ZX2A 1DGWX 1BVVA 4WVMA 4CDXA 1XU1A 4CDQC 1ZRCA 4M3CE 3VZLA 1D4M1 4QPGA 5I0TA 3PVEA 2OVUA 4AK3A 3ZXFA 2W68A 1JYIA 1LGBA 4JGYB 2BNOA 2VVFA 2W0XA 4Q4V1 3T1MA 3BPZA 4OI2A 4BM8A 4NO4A 1FV3A 3B00A 4QPIC 5BNQA 1WUVA 2YXSA 3WHUA 3N4MA 2F4PA 2P2KA 4YYOA 4FP2A 1MS3A 2YC0A 1QWRA 4GB33 1GR3A 5C8CA 1W0PA 4TSVA 1H2MA 1C3HA 2IZWA 4EWDA 2WNUC 5FRAA 3U07A 3NWKA 1N3PA 2UU8A 1LOFC 2DVBA 4V1PA 2YGMA 1WW7A 1ENRA 4JGZA 3WDUA 2A70A 5E88A 1DF0A 1C5IA 4GIQA 4U36A 5T5LA 2VQAA 3WR0A 1PK6C 4IV1B 3J4UH 1H8TB 1HRV3 3W9AA 3MW2A 1N3QA 4UXAA 4JGYA 3LGRA 2FMYA 1EAH3 3FHIB 2C9AA 2R6QA 4S2HA 5ABJB 1HIXA 2UY8A 5HCFA 1F2NA 2BWCA 3MW3A 4CP0A 1U5YA 5LEKA 2ARXA 3ZSEA 1TMF1 2JKBA 4XILA 3WP5A 3WXPA 5JIUA 2H6CA 2DCZA 5AFEA 4XXAA 1Q8PA 1FYUA 2ZCWA 4JTNA 1X8EA 4LR4A 5GM0A 5F6KA 2VUJA 2ZOEB 3MIBA 2B9UA 3H8UA 4I2OA 5T55A 4RL7A 3H50A 1XE7A 2D5FA 3AZWA 2IWGB 4KG0A 1K5MC 1A6CA 2EXIA 5IK5A 4YZ1A 1JHNA 2DUPA 1REDA 3ES4A 4HKLA 2AR6A 4IV1A 1H8TA 1ASJ1 4Q4Y3 1ZRFA 3FFQA 3QCWA 5A32B 1HV1A 1OA4A 2VXRA 1OPOA 2MPFA 1RUOA 1CONA 2BPA2 3NV3A 1LU2A 3SH4A 3AYAA 2YZ4A 2HWE3 1UKRA 1RUG3 1RUE1 2R062 4E2SA 1R1A1 4XMAA 3DPRC 4YZ5A 1DQ4A 3ZPYA 2ZMNA 3ZDSA 5I0UA 1OFSA 4KU8A 2XHKA 5AC91 5LRRA 2TUNA 4DY3A 1YIFA 3OF1A 3GALA 3AK0A 3N7JA 1LU1A 2NM1A 3E5UA 5FFOC 2WFF3 4Z2WA 2C1FA 2QZ2A 4OVEA 1CESA 1BEV1 1RUC3 1V6KA 5A32A 1EPWA 2XWBB 3U11A 1ZRRA 2HWC2 1OMIA 4Q1PA 5JZGA 1AR72 3WUDA 4JCKA 3OD4A 1YHFA 1FPN3 4XJ8A 1MEC2 1DIWA 2WNVB 4CRQA 3AFKA 3CF6E 4R9BA 3ZVXA 3TWIA 1V9U3 1VBB2 4MVTA 2R0FA 2ETEA 3ZXEA 2A73B 1TE1B 4XF3A 5LK5A 1Q43A 2XVKA 2EALA 1YRZA 3CJIB 3H0OA 4QMAA 3INAA 1SCSA 4YARA 1PNGA 1SBEA 4YZ3A 1H9PA 1OKQA 5EYYA 2VOVA 3O0XA 1V70A 1VBC1 2BFUS 2EVXA 2YDEA 3HWJA 3PVOA 4K7JA 4XFHA 1L3JA 3CLPA 3DF0A 2E7TA 4Q0PA 5K0UB 5C9AC 1YI7A 4R9CA 3KS7A 1VBA3 1DFQA 2OUJA 2QDNA 1QGLA 1A3KA 2WNVA 5FPZA 1TME2 2VGDA 2AENA 4B8EA 3WG3A 3OY8B 4CEWB 4E27A 3MIGA 5DZFA 1WMEA 2LM3A 1XNCA 3PVBB 4HN1A 3WD5A 3CJIA 2QJVA 3VBOC 3ZMOA 2WT1A 4LT5A 1XRUA 4P14A 4FOWA 3B9IA 1F31A 4U2AA 5E16A 1LODA 2BVVA 4JDNA 4L99A 3MZHA 3ZIXA 1PO23 1SFYA 4R9AA 1OD5A 1ENXA 1KDKA 2Z42A 5CBLA 2R49A 4RHV3 1CPMA 3J26N 2E53A 4IEWA 2HWB1 1HLCA 5KXCA 2CAUA 5K0UA 2MNGA 3ZYRA 3KT1A 4J6GA 3VKLA 3VGIA 2NZ9A 2Y38A 1OQDA 1O7FA 4MXWB 1MS9A 2VVDA 2QFEA 4IL7A 2YHJA 1NCQB 3ZXLA 3OY8A 4CEWA 1KJLA 3RI9A 3AKTA 2DVDA 3R05A 2D97A 2BGCA 1SACA 4YNIA 3WQ0A 4HSLA 5JVVA 3I7DA 5FLJA 1AYM3 3ZFGC 5HBAA 3ZXKA 4BE3A 3RI8A 2HWF2 1RTVA 3AMPA 1HQLA 1WCKA 3CNAA 4FPGA 4Z92B 4L92A 2FHRA 4XHBA 2RS33 1VAVA 3WQ1A 4YRDA 1XU2A 1OOPB 4OHVA 1NY72 2AGSA 3RYRA 2R061 1NE6A 5BPXA 4LBOA 2CTVA 2F6BA 4MGKE 3IDCB 4ES8A 1EAH1 4KWJA 4MXWA 4X8NA 4BCUA 3AXDA 2XVGA 1NCQA 5GZGA 4MXVA 4XFCA 3TN93 1KRIA 1DQ1A 3RG0A 1SFNA 2WSVA 4XFBA 4AYUA 2D6NA 4P9WA 3MLLA 4AVBA 1RUI3 4LTAA 4DB5A 1W6NB 4W6XA 4QD2A 2B7YA 4F3JA 2B8MA 5FOBB 3AKQA 3N35A 2HWC1 3H3UA 5K9YA 1QJU3 4B3NA 2MEV3 1NQDA 4CDXC 1AR83 1ZBA3 4HK8A 5BNPB 1E57A 2R043 3UV9A 1JUHA 2FZ1A 3JD72 5H9RA 1QQP3 4YG0A 1FOD2 4Q4Y1 4XTMA 3RZZA 2FZ2A 1VBB1 2W52A 5FTTC 3D4KA 3EBRA 3LSDA 4R8HA 2XJTA 3J9SA 4EWEA 1Z7S2 3MIFA 3NO8A 5CG9A 1AXKA 1H4GA 1GQGA 2A6XA 5T54A 4XJZA 4HK9A 5C8CC 3SCGA 1I3HA 3FLRA 2D3PA 3BU7A 4PJYA 1RVF2 1W6NA 5JI9A 3FWEA 4RFT0 1NA1B 3AFGA 3GBGA 5ACA3 1SEFA 5FLHA 4NVPA 5T3NA 4Z1VA 4GMP3 2EXJA 2XLGA 1YUDA 3MF6A 2A6WA 3S0MA 4XTPA 2N7GA 5BNPA 2WA3A 1VBE3 2ZGUA 3LA2A 3V65A 1AL23 2R072 4I3PA 1VLNA 3PMSA 4N90A 1MQTC 3ZSMA 4JGYC 1BYHA 2KA3A 4KBBA 1PVC1 3VBUB 3AM2A 2GSYA 4YM3A 4OI1A 4W6WA 2XJSA 4ORFA 2DVGA 5I8YA 5JCTA 4ITCA 3A4UA 1MS5A 1KD7A 4Q0UA 4PQ9A 3AP7A 3AX4A 2ENRA 1LESA 1FT9A 4YW2A 3TOJA 5B2GB 5J7MA 4UBHA 3MICA 2ZBJA 1NA1A 1GV9A 5L7OB 4Y1ZA 3SLIA 1QY4A 5FCCA 4F8AA 2Y0OA 2ZGRA 5DXDA 1C8M2 1S0FA 3RYPA 3JBG2 1UPIA 2UWAA 4XXPA 3ILNA 4FAGA 4Y4YA 1KJRA 3TNQA 3SH3A 4A2UA 4R52A 4E4DX 3V0AB 3GBFA 2VULA 5J96B 4IV1C 3H1WA 4XOGA 3U4XA 1H8TC 4FPYA 1AR62 1QXPA 2E6VA 1HXS2 1WW4A 4LO5B 2R32A 3WOGA 4FPEA 3VBUA 5ABJC 1ENSA 1COV2 2R16A 3HBZA 4YVWB 1WCSA 3BTAA 4XEZA 5H9SA 3RQ0A 4XYXA 2HWF1 2RMU2 2VOWA 2RR13 1G6NA 4AFMA 3VBSB 3MIEA 4LUMA 5SV8A 1I9RA 5L7OA 4OULA 2B46X 1PVXA 2RM23 3VKFC 4DOUA 1RL3A 2JG9B 4AHXA 1QOTA 3GYDA 2ZABA 5CVRA 4PBOA