4CDWC

Crystal structure of human enterovirus 71 in complex with the uncoating inhibitor gpp4
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
242
structure length
242
Chain Sequence
GFPTELKPGTNQFLTTDDGVSAPILPNFHPTPCIHIPGEVRNLLELCQVETILEVNNVPTNATSLMERLRFPVSAQAGKGELCAVFRADPGRNGPWQSTLLGQLCGYYTQWSGSLEVTFMFTGSFMATGKMLIAYTPPGGPLPKDRATAMLGTHVIWDFGLQSSVTLVIPWISNTHYRAHARDGVFDYYTTGLVSIWYQTNYVVPIGAPNTAYIIALAAAQKNFTMKLCKDASDILQTGTIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords VP1
publication title More-Powerful Virus Inhibitors from Structure-Based Analysis of Hev71 Capsid-Binding Molecules
pubmed doi rcsb
source organism Enterovirus a71
total genus 41
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2013-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4cdwC00
2BUKA 1ZBE1 3HAGA 3M8LA 1QQP2 5K0UB 2HWE1 3ZXAC 2ZTNA 1QJY2 1RUD2 2PLV2 3VBSC 5C4WC 3ZFEB 1AUYA 1C8M3 2RS33 1RHI2 4Q4V1 4CDXB 1HRV2 1POV1 1SMVA 2HWF1 1AR73 1AYN3 4Q4X1 1COV1 1Z7S3 1MQTC 1R082 1ASJ1 1PGW1 1OOPB 4CDUB 4Q4Y1 4RR3A 5D8AA 1QJX2 4QPIB 1PO22 2HWC3 1V9U3 5GKAC 2RS51 1VRH2 5BNPA 1NOVA 4EJRA 4CDWA 4FTBA 2R042 4JGYC 1QJU1 5ABJB 5C9AB 5JZGB 2BPA2 1PIV2 2RR13 1QJZA 2XBO1 1BEV1 4N53B 5CFDA 1FPN2 3VBRB 1EV12 4GMP3 4RQPB 1NCRB 2VQ0A 1D4M3 1VB4A 2HWD2 1TMF1 2HWB2 1AL23 1RUI3 3TN93 2TBVA 1NA1A 1VBB3 1ZBA3 1RVF3 4YVWC 1MEC3 4YVSC 2X5IA 3IDEA 4CEYA 2WS93 3CJIA 4N43C 4WM7B 1RUH1 5BNNC 2RS11 1VBE1 5K0UC 2Y26A 1K5MB 1HRI1 2RMU1 5A32A 4FTEA 1EAH1 3VDDA 1VBA2 1RUE1 4GH4B 1NCQB 1VBC1 2DF7A 3ZFEC 1ZBE3 2R072 3ZFGA 5J96B 4CDXC 3FBMA 1A6CA 1HX6A 2MEV1 1BBT1 4GB32 3NAPA 2WLPA 1PGL2 2WZR3 3ZFFA 4Q4V3 5C8CB 5A33B 4CDWB 1POV3 1OOPC 1RHI1 1PVC3 5AC92 4QPIC 4WM8B 4BCUA 4Q4X3 1AR92 1COV3 1TME3 4SBVA 1VBD1 1F8VA 1R081 1M06G 1RUC3 1HXS2 1R1A1 1FOD1 4Y5Z0 1FMD2 1RUG2 5ABJC 5C9AC 3J8F3 5JZGC 4FTSA 1PO21 1BMV1 2RS53 1W39A 4JGZA 4N53C 5DDJ1 1HQNA 3JD73 4AEDB 5CFCA 3VBRC 1QJU3 4RQPC 1NCRC 1RUJ1 5FMOS 1ND2A 2XBO3 1BEV3 1PIV1 1AYM1 1C8M2 2RS32 1RUF3 1FPN1 5A32B 3VDDB 4QPGB 4WM7C 3LOBA 1AR72 1AYN2 4RS5B 1PO13 4PDWB 3VBUB 3VBFC 4CEWA 1Z7S2 1K5MC 1NY72 1R091 1H8TB 1RUH3 1ND3B 4GH4C 1NCQC 2RS13 1VBE3 2HWC2 4CDQA 1V9U2 2ZZQA 1HRI3 2RMU3 4IV1B 1EAH3 1RUE3 5BNOB 1VBA1 2RR12 5C8CC 3VBSA 5C4WA 2R071 2MEV3 5L7OB 2R061 1BBT3 2WFF1 4RHV1 4WM8C 1CD3G 3DPRB 4GB31 1D4M2 2XPJA 3VBOB 1AL22 1RUI2 3TN92 4IV3C 1B35B 1VBB2 1MQTA 1ZBA2 3JBG1 1RVF2 1MEC2 5ACA1 2WS92 3VBHB 1VBD3 4Q4W3 4NWVA 1RMU3 4AEDC 1R1A3 1FOD3 1HXS1 1FMD1 4JGYA 1RUG1 5DDJ3 1ZBE2 4CEWB 1AR83 4GMP0 1RUJ3 4QPGC 2FZ2A 4RS5C 1AYM3 4PDWC 3VBUC 4CDQB 2RM21 2WZR2 1AR61 1C8M1 4Q4V2 2HWE3 1PVC2 1H8TC 4RR3B 1QQP1 1ND3C 5D8AB 4YVSA 4YVWA 1QJY1 1RUD1 4Q4X2 2PLV1 4N43A 1AYN1 1C8NA 1COV2 1TME2 5BNNA 5C4WB 3JB4C 5BNPB 1PGW2 1NG0A 1Z7S1 1R093 1RUC2 4IV1C 4CDUC 5K0UA 1HRV1 4NWWA 2HWF3 3J8F2 5BNOC 1GFF2 2RS52 3ZFEA 1ASJ3 5L7OC 5CFDB 3JD72 4CDXA 3DPRC 4Q4Y3 1QJU2 3VBOC 1QJX1 2XBO2 1BEV2 1CJDA 1POV0 2R063 1B35C 1NA1B 2WFF3 1VRH1 4RHV3 1RUF2 1VB2A 2BBVA 1OPOA 1OOPA 2X5IB 2R041 4CEYB 3CJIB 4QPIA 3VBHC 1AL21 1PO12 3JBG3 5ACA3 2GH8A 1EV11 1RUH2 5ABJA 2WS91 1TMF3 4Y4YA 5C9AA 5JZGA 2RS12 1VBE2 2QQPA 2HWD1 2HWB1 3ZFGB 4N53A 1HRI2 2RMU2 1EAH2 3NAPB 3VBRA 2GSYA 4RQPA 1RUE2 1NCRA 4N43B 1X36A 3ZFFB 2MEV2 1BBT2 4RR3C 5D8AC 2RM23 1VBC3 4WM7A 1AR63 4Z92B 5BNPC 2WZR1 4CDWC 3VBFA 2FZ1A 1QQP3 1PVC1 1K5MA 1QJY3 1RUD3 2PLV3 1IHMA 4GH4A 1PGL1 1NCQA 1VBD2 4JGZB 4Q4W2 1TME1 5CFDC 1RMU2 1RHI3 1R1A2 1FOD2 5CFCB 1HRV3 1RUC1 5AC91 2WWSA 1ND2B 1BMV2 3J8F1 5DDJ2 1AR91 1NA1C 1R083 5C8CA 5A33A 2X5IC 3JD71 1AR82 1F2NA 4CEYC 1RUJ2 3CJIC 1QJX3 4WM8A 1PO23 1AYM2 4FSJA 1VRH3 1DDLA 4IV3A 2R043 1RUF1 2HWE2 4LLFA 3VDDC 1PIV3 1E57A 3ZFGC 1PO11 2RS31 1R092 1FPN3 4AEDA 3NAPC 1EV13 2ZAHA 2HWF2 3ZFFC 2HWD3 2HWB3 1AR71 3VBSB 5FOJB 1ASJ2 3VBFB 3JB8A 4Q4Y2 2IZWA 1NY71 4QPGA 1VAKA 4RS5A 2HWC1 4PDWA 3VBUA 1V9U1 4RFT0 2R062 2WFF2 4RHV2 3S6PA 1MQTB 1RB8G 1H8TA 1ND3A 1VBA3 4JGZC 2RR11 2R073 3JBG2 5CFCC 5ACA2 4GB33 4IV1A 4JGYB 4CDUA 1ND2C 4GMP1 1TMF2 5BNOA 1D4M1 1OHFA 2BFUL 4Q4W1 1RUI1 1AL0G 3TN91 1RMU1 4IV3B 5AC93 5L7OA 1VBB1 1WCDJ 1ZBA1 1RVF1 3DPRA 5FMOL 1MEC1 5LK7B 1AR93 3VBOA 1X33A 4CEWC 2BFUS 1B35A 1HXS3 5J98B 1FMD3 1AR81 1RUG3 4YVSB 4YVWB 2RM22 1VBC2 4CDQC 1AR62 3VBHA 5BNNB
chains in the Genus database with same CATH superfamily
3KGZA 4R9BA 3B00A 3WEZA 3HAGA 3N9NA 1WCSA 5K0UB 3FE5A 3K48A 3RGBA 4AFAA 1QJY2 1XOYA 3KV9A 3LA2A 4MZUA 4XHBA 1VJ2A 5CAZA 2KD7A 1DQ6A 3TYJA 5C4WC 3QD6A 5JMOA 5JR7B 2WQZC 1LOAA 4GALA 3WZ1A 4DXZA 3AMHA 5GLWA 4DXTA 2A6WA 2XHNA 1PK6A 2PQQA 5FPXA 1E5SA 3PUQA 3MF6A 1AYN3 3NJXA 1OA3A 5LBEA 4IEZA 1A3KA 3SKVA 2J42A 3JCIA 1COV1 4AI2A 4F83A 5CKMA 1MQTC 3G6JB 1ZA7A 4OVEA 5A1FA 1SLIA 1WZXA 2QFEA 1J1LA 1OOPB 3FJSA 4TLGA 4Q4Y1 4RR3A 1LHUA 5D8AA 1DF0A 2GC2A 4E2SA 1QXPA 5J1XA 2A6XA 4YG6A 3T1MA 4AI0A 2W9XA 2Q1FA 1NOVA 2P6HA 2XJQA 3H1YA 1YYNA 4UFMA 3MZHA 1GWLA 4OZOA 4QB1A 3VLBB 4W8JA 3D0JA 5FFOC 3SEPA 3WG2A 2BPA2 4YGCA 2XWJB 3M3QA 2A6ZA 3S0MA 3NJVA 1Q56A 1ZZ9A 2WFPA 4YW4A 1AX1A 4LBKA 4AG4A 4P5HA 1J58A 1FPN2 1US3A 3I2IA 3ZOIA 3LOIA 4KL1A 1V6KA 3G7DA 3VBRB 4GMP3 4XCBA 4RQPB 1JZ6A 5A6ZA 4BOWA 1NCRB 2B39A 4Q2FA 2DYCA 2E32A 3OPZA 1VB4A 1WLWA 4Q5OA 5FZ7A 4BJ0A 2GP3A 1VP6A 4DEVA 3MHZA 1JZ2A 4ZU5A 2NMNA 1IKPA 4E2GA 1IPKA 3MLLA 2ILMA 1ZBA3 2OZJA 3KB5A 1UZWA 3N7MA 1SHWB 2VXJA 4Z1VA 1QOTA 2X5IA 4FFFA 1DCSA 2I07B 3CJIA 3KQ4B 5FO9B 3IAQA 3POEA 5FOBB 2TUNA 5FP4A 4JAAA 4FPJA 4QX7A 2JWPA 4NOTA 2LRPA 2VULA 2RMU1 5CBLA 2D6LX 2VJXA 3P3NA 1ULGA 1WMDA 1T6BX 1UYZA 1XYPA 1GQGA 1NCQB 3ZFEC 4Y5TA 3OYWA 1N1SA 3PHMA 5DG2A 3RZKA 1XXNA 2PQSA 2PYTA 2VNGA 4COVA 1ZREA 2OA2A 1BBT1 2ZMKA 4LHLA 4I3PA 1NT0A 1QJEA 3H3UA 2E7TA 3QCWA 1W3XA 4JKKA 4LBMA 2QBXA 2GC0A 4N8MA 4DRVA 4AE2A 4F3JA 1OLRA 2KXLA 3DECA 4CDWB 1KXGA 1RHI1 1TNRA 2J1RA 4EWDA 5IVJA 2AEYA 1N3PA 3HNBM 5FPVA 1LB2A 1GOGA 1WLCA 3CNAA 1H6XA 1Y7BA 2ATFA 3CU7A 3SMHA 4SBVA 2JDAA 1VBD1 5FPBA 1T6GC 2WO3A 5B4XA 4OI2A 4YZ5A 3E5UA 4YM1A 3I4IA 4UFJA 1G8WA 4XBNA 3I3BA 1HXS2 1R1A1 3DCQA 4Y5Z0 3MO4A 4Y20A 2BOIA 5ABJC 5C9AC 1W0OA 5IFTA 3J8F3 4MXVA 2JEMA 3O1MA 4EWAA 2RJKA 1BMV1 2D97A 2D6PA 2ARAA 3HJRA 5DDJ1 2QQKA 1XJAA 3JD73 1AX0A 2ZGSA 4O7XA 2IXHA 3WLUA 1RUJ1 2HEWF 3AL5A 2Q30A 3BOPA 1ND2A 3KCXA 1JOBA 3AFGA 3P3PA 1XNAA 4FPKA 5LBFA 4AYUA 3ZYPA 3KSCA 1SLAA 3AVRA 4NN0A 5FXZA 1O6UA 1U5XA 1QU0A 3MPPG 5A7PA 5A32B 5F1RA 4CCNA 5H9RA 3ORJA 4WM7C 1DQ5A 3GBGA 4EQVA 4X8NA 1NZIA 3QLQA 2ZX1A 4HLTA 2XKOA 2IUWA 4PDWB 4I02A 4O61A 5DZFA 3VBUB 4CA9A 1AJOA 5FUNA 1NUKA 4YGEA 1BVVA 5FREA 4ZZ8A 2K0GA 2XGXA 4Y1XA 5A7OA 2PHTA 4PBOA 2D5FA 2AENA 3F95A 3ITQA 4LBQD 4KWJA 4BB3A 2ZGLA 4FFHA 5LW9A 3J9SA 4A2UA 1SBEA 3D3AA 1LOGA 3H1MA 1SDDB 4LJHA 4PF5A 3RQ0A 4ES8A 1JS9A 3C7OA 4XZUG 1S0GA 4LKSA 4NIGA 1OXCA 5LBCA 3BIWE 3NNGA 5BY5A 4AWDA 1XU2A 3ZIXA 4KQ7A 4XPVA 5FJHA 3LQCA 2GNBA 4QU1A 2HBUA 3OGVA 2VC9A 3M2MA 3K51A 4IQPA 2O8OA 2ZMNA 1O3TA 1VBA1 4YZ2A 5D2AA 3IB3A 4MGIE 5C8CC 2ADEA 3VBSA 2R071 3KHCA 4LT5A 3MIGA 3HR9A 1YCIA 1O5UA 4NROA 3ACGA 3MV01 5FP7A 4FCAA 3TB0A 1JZ5A 3T0AA 2BU9A 3NWKA 4WVMB 1P8JA 3OPWA 3USUB 3ZPOA 3RJRA 2RDSA 3D8CA 1AL22 1UN1A 4XBQA 5EP9A 1EP0A 2E7AA 2OX0A 1YXWA 1PM4A 4XJ9A 2WO7A 5A3NA 1A8DA 2O8QA 3AMQA 3WX5A 1XNBA 3IBMA 1VBB2 4DMIA 3KT4A 3BU7A 4ITCA 2CU5A 3AKQA 4E2QA 4CPBD 3VBHB 2GN7A 4YM2A 1DZRA 5SV8A 2E9QA 2J7MA 3B7MA 1HB1A 2XR4A 3VZOA 2DU1A 4AGGA 2R0FA 3R4SA 4JGYA 2PHFA 1W8TA 4Y3OA 3LA3A 3MLKA 2JIGA 4WZCA 5CISA 2JD9A 1LECA 2AGSA 5DPNA 1BCXA 4LO5B 5ERLA 2JDYA 4KI5M 4UYBA 3ZYHA 3FUOA 2D6OX 1JYTA 1VAVA 2MNGA 4Y22A 5FPAA 4YPJA 2FZ2A 5FLJA 3VKLA 2VCMA 1WBLA 4ATFA 1OI6A 2PHXA 1AYM3 2Z79A 4WZFA 4MHRA 4YM0A 3DYPA 1OQDA 1AR61 4K40A 4UAPA 3U4SA 4CZSA 4GD4A 3ETPA 1C8M1 2BOJA 5FMDA 2ZGQA 3NJYA 4DO0A 1XE0A 1FNZA 1UY0A 2NQYA 4LIUA 1LOFA 1ND3C 2BBAA 3DKQA 3PU3A 4YNIA 4YVWA 1RUD1 4Q4X2 4R8HA 5F3IA 1GZWA 2PLV1 1EPZA 2YBSA 3FHQA 5BNNA 3GYDA 1RUC2 4IV1C 4PQ9A 3THPA 5K0UA 5DAQA 4C91A 1HRV1 1WCUA 2EA7A 4NWWA 1U5IA 3QH7A 4FPLA 3PURA 1O4ZA 1WW7A 3UGHA 4MXWB 2N7GA 3E1F1 4FPCA 2Q8CA 1S2BA 4AAPA 1F5JA 1W8NA 4JV4A 4IL7A 5CFDB 3I8TA 3WW4A 5F32A 1ZRDA 5KXBA 4Q4Y3 2GH2A 3LIHA 4RGKA 2CAUA 3OGRA 1S0JA 2DURA 3BVCA 4Z8BA 2BV4A 2YHJA 4J6GA 3BTZA 1CIYA 1G86A 1POV0 1W6PB 2R063 4RHV3 2D5HA 2VOXA 1GOFA 1SFNA 4GJZA 4QQ2A 2YU2A 3I54A 2FHRA 1LEDA 3GDBA 5FY4A 1J3PA 1OOPA 3HNMA 4RGGA 4FO9A 2ID4A 5JAXA 3FMGA 4IE7A 2YYOA 3DEMA 3V0AB 2YC4A 3H1WA 2VU9A 3JBG3 1LEMA 4HVOA 5I93A 3ILRA 1ULCA 2GH8A 2PHRA 3LF7A 4KU7A 4CCMA 4GWNA 3O0VA 1EV11 5CVRA 3RSJA 3B9CA 5I0TA 1VBE2 4WVVA 4A7KA 1N1YA 4LULA 4Z2WA 2W92A 3E5XA 3AMNA 4KWKA 3A23A 3GF6A 4MADA 2W5FA 3AM2A 4AQ6A 4D7SA 2XUEA 4AQSA 4G9SB 1EAH2 5DQ0A 2EAKA 3VBRA 2UWAA 4RQPA 3K3OA 1NCRA 4IEVA 4N43B 4BH9A 3OY8B 1X9TA 2VNRA 5AVPA 3OD0A 2W1UA 5JI9A 1W2NA 2VNOA 5IATA 2ORXA 2CHHA 5F2SA 4LBNA 1ULPA 3IDBB 3POYA 3LEGA 3ZYIB 2VZ3A 4CCJA 1QH6A 5DG1A 2G9GA 1C1FA 3WQ0A 1WMEA 4V1PA 5EHDA 2V4AA 4HONA 4V2VA 5A6YA 4PIXA 4CDWC 3VBFA 5CG9A 2FZ1A 2K9ZA 2VTXA 1QQP3 5SV5A 4XAAA 2ZOEB 1HJGA 4QD2A 4TZDA 3HVDA 2OQ7A 2EVXA 1NCQA 2TNFA 4HMZA 3ZXEA 4Q4W2 3S30A 1FAYA 4ORFA 1TME1 3LDBA 4L9BA 5EXOA 3SQOA 1RHI3 3N35A 3UJOA 2BVVA 1Y3TA 3ACIA 3AZZA 4COUA 3CZJA 2Y34A 3L9JT 2YDEA 1IKQA 3C7FA 3FZ3A 1DZTA 2VZ1A 3WP6A 5AC91 3O5SA 2WWSA 1DGWA 3SH5A 5GZCA 1PGSA 4IEQA 1JI6A 1KDKA 2BWAA 2XH6A 4CCKA 3O14A 3GZTB 4PIZA 1AR91 2DVDA 1MS0A 1NA1C 1QGLA 2QQOA 4K21A 5FZLA 3BKZA 3TEWA 3WNMA 1F2NA 4CEYC 3NVCA 3KCYA 3WV6A 2FDFA 3T2PA 3WQ1A 2ADDA 4LUKA 4LK7A 5HCHA 4L97A 3W58A 5FY0A 1VRH3 3VKFC 5LY1A 5JCTA 3IMNA 3EXUA 1GWMA 4Q8LA 5A1LA 1WUVA 1RUF1 1V6JA 5GJ6A 4BK4A 4FQZA 4OMCA 4Q29A 1AXZA 4XDOA 1CAXB 3SXWA 1E57A 3ZFGC 3AKPA 3VKMA 3O1SA 3PTRB 1PO11 1TVGA 4Y1VA 4AEKA 3WNLA 1DGRA 4URTA 1MZ5A 5I0UA 1YIPA 1WW6A 3RDIA 4ZZ5A 2ZAHA 4UI9L 5JXGA 3WVJA 4EN7B 3ZFFC 2HWB3 4XQWA 2ES3A 1QXJA 4UWDA 3AC0A 5FOJB 1PMHX 1S0CA 1SBFA 4C0HA 3B5LB 1ENQA 5EJ3A 3K4ZA 4ZONA 2ZGNA 2VMDA 1OH4A 2DCZA 4GA9A 1Q43A 4PDWA 3VBUA 3ES1A 2E6VA 2WFF2 3GBWA 4FAHA 4KWUA 1MQTB 3PU8A 1LRHA 2YFZA 4LLOA 1YQ8A 2MHFA 2VZOA 1I3HA 3ECQA 3D82A 3WNNA 2VH9A 4H2AA 3ZDVA 1VBA3 3RZZA 1G9DA 4AHYA 2DTYA 4KU8A 5C3QA 2VMEA 1UWWA 2R073 1ZZBA 2GP5A 5HXMA 3BI3A 5CFCC 1NQDA 4Q26A 2LM3A 4BLJA 3J7LA 1QNYA 2ZEWA 1SZBA 4GMP1 5EPAA 1J59A 1GMMA 4GQ7A 3M3IA 2BFUL 2B9UA 2HJIA 1O4YA 2WNVA 4QM9A 4XUQA 1AL0G 4EN0A 4XDPA 1W06A 4G3YC 1G9FA 4IV3B 5CNAA 4CP1A 1D4VB 4ATEA 5FYZA 1ZBA1 5HCFA 3WNKA 1YRZA 4C0BA 5ANNA 2Y6GA 3UYJA 1W8WA 3NNMA 3KT1A 4WVMA 5FZ8A 3USUA 1IPJA 1X33A 5F5CA 3T30A 3W20A 1AJKA 1GZ9A 1YFYA 2XB6C 1H30A 2JIJA 1XQNA 1JZ8A 2BERA 2WA4A 5FJKA 2VMHA 2IFWA 1G9BA 1AR81 4HN0A 4YSFA 2P4EA 4ZU4A 3AYAA 1H4HA 2CWMA 5FY7A 4NRQA 2V4VA 2RM22 1VBC2 5T55A 3NKTA 1UOFA 2VZTA 3I3DA 3VBHA 2BWCA 1QF3A 1UL9A 2BUKA 4TN7A 4UFHA 5FMBA 2FMDA 3J4UH 3N9LA 2CNAA 1HB4A 1NE6A 3ZXAC 4A6OA 4ASMB 4DIQA 2ZGTA 4URAA 4PI2A 3WW1A 3ZFEB 1C8M3 2RS33 4DXSA 2AC1A 3M70A 4ZXKA 4CXWA 4GIQA 2OVUA 1ZZ8A 3I2JA 3V0BB 2VBDA 2GMMA 2YU1A 4LMFA 1YHFA 3K4DA 2HWF1 2OS2A 2C5DA 1AR73 4XJUA 2ZEXA 1NLSA 2NP0A 3M1HA 2W08A 1IZ3A 1DYOA 4FOYA 1NKGA 5FZ6A 2RDQA 3N3HA 3ABZA 1QJX2 4Q0VA 5FZAA 3KM5A 5LASA 4Y1YA 1VRBA 3AXEA 4XACA 2HWC3 3ASIA 4NHLA 4CXXA 3NSTA 3R05A 5F5QA 1KDMA 2VOTA 2XWBB 3KF3A 2OIIA 2EICA 1CAVB 2R042 5BPXA 3OUIA 5FUPA 4ZPIA 5BXXA 4LQRA 5EJ1B 3V56A 2FDGA 4XF0A 1W2TA 5C9AB 5ABJB 1XRUA 5FXXA 4AQTA 1REFA 4MXWA 2IVJA 3H3LA 4OI4A 1C57A 3VKNA 4IESA 5CFDA 4PLNA 4B4RA 2HKXA 1CJPA 1QWRA 3FHIB 2GDFA 1XE7A 2ZEYA 4FPYA 5EFUA 4YW2A 4PBPA 2GC3A 3HN3A 4LE3A 1D4M3 4AVTA 3AX4A 2G9FA 1TMF1 2HWD2 1RUI3 4AEJA 2XXZA 3TN93 4META 2QZ2A 2TBVA 2XL7A 3C2UA 4ASLA 1QY4A 1HQWA 1GR3A 2AEZA 4P9LA 1IQDC 1MEC3 4KMQA 1JMUB 4YVSC 2Q8EA 3ZDSA 3ZYFA 3IDEA 3BN6A 5T52A 1F4AA 4N43C 2YG0A 4RFRB 4WM7B 3ZXLA 3MIFA 2QZ3A 2ENRA 2JKBA 4FP2A 4GWJA 1JOPA 2JG8C 3V0AA 3MLJA 4I01A 2X53S 3NKGA 4IETA 4LHKA 4OHWA 2VZQA 5LEKA 2JECA 2Y26A 3LEMA 2GNTA 2XVKA 4MUVA 4AR2A 3MW2A 3DF0A 3VDDA 2DF7A 3O1TA 5F6LB 1ZBE3 2WRAA 1HDKA 3VV1A 2OXBA 3BPSA 5J96B 4CDXC 5LRRA 2JDNA 2J1EA 1GP6A 2XONA 3FBMA 4AI1A 4E4HA 1H0BA 1HX6A 3H3ZA 4IGOA 1AXKA 1MVEA 1W9YA 4GB32 2XDVA 4L99A 3A0KA 1HV0A 2OQ6A 5FPZA 2QE3A 2WLPA 3AZYA 1Q3EA 2WQ8A 3MFCA 3ZM8A 2W1WA 4KG8A 1AX2A 4Z07A 3OY8A 5E16A 4AL9A 4E4SA 2JDKA 4Q4V3 5C8CB 2AZ5A 3FLTA 4JQTA 1POV3 4NHXA 4QDSA 4YLZA 5L9RA 3B93A 5LY2A 2JG9C 3JZVA 4OHYA 4K1ZA 1SFYA 4IERA 2WA3A 3MFAA 1J3QA 2NM1A 5H9PA 1QH7A 1TME3 5FR3A 1K42A 1KFUL 1D2SA 1F8VA 1BXHA 3WNPA 2ZA9A 1M06G 4R9DA 1JU3A 3PJYA 4QAWA 5K4LA 1FMD2 2HLEA 4XETA 3POIA 5JZGC 1FI2A 1QNWA 1LOCA 4AFBA 1NXMA 4FTSA 1IS6A 1WWYA 1ENXA 2VBPA 1OA4A 2RS53 1W39A 1UD1A 4W6XA 2E7QA 2Y33A 4HPKA 2K2SA 4LR4A 4TWTA 2V72A 4QU2A 3ZYJB 2YC0A 1UMHA 3K2OA 5GLVA 5IAVA 4CCCA 1D2QA 1QJU3 3OD4A 3R0RA 2E26A 4CP2A 5FLIA 5FMOS 1RJ7A 3ZLIA 3ZYBA 2XBO3 4DZGA 1BEV3 2V09A 4P9WA 1AYM1 5C70A 2QCSB 3OEAA 1WMXA 3GHMA 4XF9A 2P5BA 4CCLA 1RUF3 1XNDA 1BK1A 3VZNA 1LGNA 1MS1A 1FPN1 4SLIA 4YG3A 4UBHA 4EZ4A 1CWPA 1GLHA 2A1XA 4HG6B 5HCBA 5HXVA 5A80A 2WKKA 3WCRA 3LOBA 2FDKA 1JW6A 1SLBA 1W0NA 2J1TA 5EIYB 2VUAA 1PO13 2B46X 5DXDA 2Y6HA 4QHZA 4CEWA 1Z7S2 3PVOA 1ZVFA 3AJYA 3AL6A 2WJSA 1UQXA 2FDHA 1DYPA 3OUHA 4LBQB 2PXJA 5FMCA 2LALA 1RUH3 3UKTA 1ND3B 3AP9A 2OW4A 1UX6A 1W9WA 2RS13 1YWKA 1CAXA 4JQRA 1ZM1A 4CDQA 1V9U2 2O1QA 4ET7A 5LZ6A 2VQUA 4WVWA 1HRI3 3W5MA 4IV1B 4X6RB 3BUCA 1AF9A 1RC6A 2B45X 1RUE3 1XC6A 3CBNA 3SH3A 4YZ1A 4Y1ZA 4ZKTB 2CTVA 5JXJA 1ACCA 2RR12 5ANQA 1LODA 4LO4B 1IG3A 3OTFA 4MLOA 5C4WA 4OMDA 2F4PA 3AKTA 2DU0A 4XFGA 2MEV3 3GGLA 1RINA 2R061 2Z69A 4RHV1 3PUSA 4N7IA 3MPBA 3OEBA 2WABA 3RVHA 4NJ4A 2HYKA 1EUUA 1JYXA 1DQ4A 3AP4A 4XABA 4CUAA 2XPJA 2JX9A 4JDNA 1DLLA 5C5TA 2HH9A 1K45A 1GUIA 5KHHA 1B09A 3HT2A 1CR7A 2YBPA 4IV3C 4RSUA 4FBFA 1MQTA 3I7DA 3JBG1 3WDYA 3CZUA 1RVF2 2UY8A 3GZEA 5E8AA 4KBZA 4AI8A 3EHKA 2H6BA 3MF9A 4QXCA 2WS92 2XJSA 3A7QA 3AZXA 5FRAA 4DOUA 4XC9A 1W6OB 3VD9A 1G6NA 1V6NA 4YRDA 5I0DA 1H6YA 1FOD3 5JXHA 5EJZB 4QX5A 1CAUB 3OBTA 1HXS1 2I45A 5FP8A 1OPMA 3VHRA 1W8FA 1YEWA 3J26N 5KXCA 1IQAA 2PN5A 1DIWA 2W68A 5FTTC 3AP6A 3IPVB 3SNMA 1BJQA 2D6MA 1A34A 3LCPA 4IEPA 1SEFA 4JC1A 1AR83 1DBNA 2ZZJA 4JCKA 4K6BA 4QPGC 1XB9A 1O3QA 3ZR6A 1ZRRA 2BRTA 3PL0A 4RS5C 4D6SA 1CPMA 2W39A 2WUHA 2WZR2 5JI7A 2B4KA 3WQ7A 3EO6A 4BMEA 4LIVA 1TNFA 3FN9A 1IS5A 2WC2A 2VW2A 5FBZA 3RZLA 1PVC2 4BE3A 1H8TC 3ZPYA 4J1WA 1UIKA 1QQP1 4QGNA 4COWA 2RG4A 2WYFA 4JRAA 3NV4A 3VD5A 4BQ1A 3P5BA 1C8NA 1COV2 2NZ9A 4QKFA 2XJVA 4P9IA 3LSDA 5J36A 1R093 1UMIA 1W6NA 1QDCA 2WN3A 2HWF3 1FYUA 4B3NA 4QB6A 1S4CA 1UZ0A 1GKBA 2EF6A 2V73A 2XVGA 3KWVA 3AFKA 4LOTA 5IWFA 3ZFEA 5LWBA 5IW0A 4XIOA 3LPFA 3IZOA 3ZVXA 4WV8A 3DPRC 4LKDA 4INDA 5H9SA 4LBJA 3V0BA 3VZJA 3HQXA 1NQJA 3VBOC 3MV11 4CU9A 1CJDA 2A3XA 1S2EA 1HIXA 1OQEA 4NMIA 2WN2A 3ZXDA 2BTVC 3KQRA 1NA1B 1VRH1 1JYWA 1VB2A 2UWBA 1OPOA 3EMRA 2D98A 2WWJA 4LKEA 1W99A 4QQPA 2WLQA 4NUBA 2VZUA 4CEYB 3OBZA 1ONAA 1KFXL 5CEHA 4UXAA 2JDZA 1BQPA 3LDKA 3INAA 3C7GA 2VMIA 4I0WB 4XMIA 3U1XA 1LHNA 4HVQA 1AL21 4B7KA 2BJSA 2VMGA 4Q0PA 3RFRA 3PNAA 5ACA3 4WVZA 4AFCA 1CAVA 1V6LA 1D0GA 5EYYA 3R4DB 2C1FA 4DRRA 4Y4YA 1TMF3 1S0IA 3B9IA 4AAXA 5ABJA 2BNNA 5C9AA 1CAWB 3WOGA 1V70A 2HWB1 4BQWA 5LCWL 3ZFGB 4CU7A 1OBNA 3I2FA 3AB0A 2RMU2 3KLSA 1MZFA 4XJAA 3PVEA 2A73B 4JHZA 2EIGA 1X36A 3ZFFB 1DGWX 1NXD1 2ET7A 3GJBA 3KS7A 4Z2AA 5FKCA 1J83A 5FQ0B 3D6EA 3PDQA 1BBT2 1QIQA 3H7JA 1SCRA 2ZBJA 3ZXKA 4IEYA 1J84A 2VO5A 4NRPA 1HQLA 1MS5A 3I2DA 4W4ZA 4WM7A 1O8PA 2JD4A 4BQ5A 2RE9A 2PAMA 1NZCA 5BNPC 1Q5OA 3LFIA 3V64A 3AMMA 3DUIA 1O3RA 2WO2A 2WIIB 5FZCA 3Q8EA 1W6QB 3BGAA 3SC7X 1REEA 2GAUA 3WSOA 1I5PA 4J25A 3DXUA 1QJY3 1XE8A 1OURA 4GXLA 4JDOA 3ZXGA 5GZDA 1MR5A 1IHMA 3KV4A 2RDRA 2VNVA 4DB5A 2P3YA 4RGAA 2GU9A 2J22A 1VBD2 1PGL1 4GWIA 1X9PA 3ZSKA 4A3ZA 4Y5SA 3S5AA 1RMU2 1OMIA 5BYNA 2Y0OA 1R1A2 1SFPA 2BNOA 3MIDA 3ZN4A 1APNA 4Q0UA 1RUC1 2VVFA 5E88A 5CFCB 3PJQA 1GZCA 5CKNA 2AYHA 1WGPA 1YQ5A 2DBIA 4YZ3A 5EV7A 4EN9B 1BMV2 3URFA 4CCOA 4H7MA 2A6VA 1J1TA 1DGLA 3HWJA 3J7MA 3ALQA 3KVBA 3N9QA 4O65A 5DDJ2 1NLRA 5FWJA 2D6KA 2R32A 5C8CA 1JYVA 4AHXA 3LEKA 3OOXA 4CYDA 1XYOA 4PCRA 1JZ3A 3I59B 1RUJ2 4OULA 4XEZA 4HOOA 4JKLA 4LO7A 5FZ4A 5FZEA 4A3XA 5BNQA 1O8SA 1U0AA 1TZOA 2VAUA 2VPVA 4FSJA 3U37A 2WZEA 4MGYE 4NR1A 1LU1A 3LPGA 1DDLA 5K7PA 2YY1A 4D94A 4A45A 4LPLA 2HWE2 4RN5A 2A70A 3HMYA 2Q1ZB 5IAXA 4LOSA 4RA0A 3U10A 2JE7A 4LXLA 3RZMA 1POQA 4PLMA 5IJRA 4OI1A 1CN1A 1Q8OA 1I5ZA 1BKZA 2AR6A 4P9XA 2JB8A 1Q8VA 1W28A 4TTGA 2RS31 4XFCA 3OCPA 1FPN3 3WINE 3NAPC 4QKNA 4S2GA 3USSA 3O12A 4H55A 4HK8A 2VOWA 1ULFA 1V6OA 2VQAA 4XUNA 1AR71 3FBYA 4AVBA 3W9AA 1ASJ2 1RJ8A 4CTEA 1GOHA 1RGSA 5IVYA 4BWOA 3FLPA 1NY71 3RWKX 1UX7A 3OG2A 5LRSA 4QXHA 3TEYA 5FZOB 4A7YA 1OVPA 1WD4A 2HWC1 1JODA 3I2KA 4B1MA 2CDPA 2FCVA 4XFFA 3IM0A 1W2AX 4BM8A 3TNPB 3ZN6B 4LBQA 2VR4A 2B42B 4FAGA 4EZHA 2Z5WA 1ND3A 5DUVA 3T2TA 3H7YA 3WF1A 1LGBA 4JGZC 1OF4A 1FV2A 3M4FA 3UESA 2CWSA 4HT1T 4L11A 4OZXA 5T54A 2ZXQA 1LHWA 3VZMA 3ILNA 4U2AA 2FMYA 2X10A 1H2MA 3VDBA 1S2KA 5IK5A 4IV1A 3VKOA 3CHXA 3APBA 1REDA 2G1MA 2XVLA 4A44A 3WXPA 4AVSA 3N7LA 1WMFA 4OLLA 1D4M1 1X82A 4YW7A 4JZRA 4P9GA 4Q4W1 1WBFA 3VL9A 1RUI1 2VG9A 3ZSLA 2Y38A 3TN91 4JHTA 4GWMA 2ZPXA 1CONA 1BVP1 5F37A 1HN0A 2P3IA 3JUUA 4IEXA 4IW3A 5FMOL 5A3UA 1MEC1 5LK7B 1WCKA 4Q1PA 1YO8A 3MGUA 1W04A 2ZGUA 2YGLA 3CEWA 4IEUA 3S5QA 2YXSA 1CVNA 5K9YA 3AP5A 2DCKA 1HXS3 5J98B 2KA3A 5C3PA 4DFSA 1E5RA 2E53A 5I0SA 4YVSB 2YB7A 3H9AA 4CPBA 4L0PA 1CESA 3TOJA 4IGPA 1AR62 5IK7A 2W0XA 2JG8B 2Y6FA 3ES4A 5FXVA 1BYHA 4BQ2A 3P1IA 1ZBE1 5T3NA 2ZHLA 1SG3A 2AUYA 3CF6E 4B1LA 5I8TA 5J37A 3M8LA 2Y64A 5FZ3A 2VD7A 1CAUA 1YC61 3HBKA 3T2OA 1RUD2 2ZGOA 3B94A 4UW4A 2PLV2 2JKXA 5FYIA 4AOCA 2VL4A 2X05A 1JZ4A 4X6QB 3T08A 3IPVA 4YFZA 5JXIA 3FHAA 3R6SA 4H3WA 3ATGA 2PHUA 5A3TA 4Q4V1 1G9CA 4CDXB 1HRV2 1POV1 1SMVA 5T5PA 1BK0A 5JPNB 2W1SA 3WHTA 3WF4A 2WNOA 3MYXA 4RD7A 4AVVA 5F7UA 5DN2A 3BPZA 5G05L 4CUBA 4M0HA 3SHRA 3LB9A 1R082 1PGW1 2ZACA 4CDUB 2C4XA 2PA7A 1DYKA 1W6MB 2JG9B 3GHNA 4IEOA 1PO22 5FZFA 5CZKA 2R0HA 2RS51 2WAAA 3I2GA 1GU3A 1W8ZA 3I2HA 1NLQA 1OKOA 3ZN5A 4CDWA 1G7YA 5HCAA 1SQ4A 5KHGA 1DQ2A 5FZDA 4FTBA 3B01A 5JIAA 3TNQA 1QJU1 1CPNA 3ON7A 4Q27A 1HB2A 2JB4A 5JZGB 2IVIB 3KD4A 1PIV2 4CSWA 1VMHA 2XBO1 2WNUC 1BEV1 5C5UA 2BNMA 2PAEA 4YGBA 5E1RA 2CSGA 3CMGA 2IXCA 1W9FA 3NV1A 3K3NA 5GALA 4AVCA 1C1LA 1EV12 1H9PA 4K20A 5CYYA 5FP9A 1UY1A 1UZVA 5JOWA 2VQ0A 1AL23 5FZKA 5KXEA 4Y1UA 5FYCA 2DCYA 3C7EA 5T5OA 2W52A 4KH9A 4S2FA 5LBBA 1NA1A 1VBB3 4DS0A 2YV8A 3VN4A 4UFKA 4D3WA 1C5HA 3WR0A 4KWLA 3DKWA 4NVPA 2PMWB 2WINB 5LATA 4CEYA 3L2HA 4AQ2A 2QQVA 1F35A 1RUH1 1WLDA 5BV6A 1U12A 2RS11 2BEOA 3WDVA 1X8EA 1Q8QA 1QJFA 3ZYRA 2ZJCA 2VM9A 4XE9A 2O0OA 2GALA 1UO9A 1ULDA 4BA6A 1HRI1 2R7EB 2VECA 1NX9A 4CUGA 1FATA 5A32A 1JYIA 2WDBA 1RUE1 2UYAA 5LA1A 4LO8A 1VBC1 2QDNA 1CAWA 2O14A 2VBBA 3WUDA 3QBQA 3ZFGA 1URXA 4DINB 2FBEA 5F5IA 4BIOA 1QOSA 2XJTA 2VVEA 3WT3A 3O1PA 2MEV1 4G4FA 4QXBA 4RYDA 3WY6A 5A7NA 5LEJA 2WL1A 1UU5A 1H1IA 5A6XA 2CYFA 5T5LA 3QOPA 2ZCWA 5FYUA 3ZFFA 4NIHA 3N7KA 1H1AA 4ONUA 3HT1A 2PAKA 5FQ0A 3GXUA 4K3UA 5AC92 4I0AA 3TAYA 3GCXA 5T50A 4E4ZA 1WA6X 4QPIC 4XZPA 4COYA 4BK5A 4Q4X3 1YUDA 3THTA 4R9AA 1AR92 5FK7A 3NV3A 4ES9A 5APAA 3E6BA 3EBRA 1FT9A 2YUEA 4GULA 1Y9GA 5KHKA 3D5OA 3N36A 4NPMA 4QT6A 3ZXJA 1UYXA 4NRMA 1RUC3 4HKOA 1W6QA 1MZEA 4UOJA 1FOD1 4BISA 3AKRA 5C6CA 1RUG2 1Z78A 1K5JA 2LUWA 3ZMOA 5F3EA 3U4XA 4C1XA 1HV1A 1E5IA 5A70A 3NO8A 1FXZA 3LDRA 4N53C 1RIRA 1PX3A 1S0EA 2ZGKA 4B4PA 1HQNA 1KD7A 1N47A 2XHKA 1XNKA 4GJYA 5EWSA 3WP5A 3WF3A 4XVHA 5C3RA 5CFCA 5JWPA 4B8EA 4R9CA 5IVBA 2HEYF 2OYZA 4M3CF 1OF3A 4PJYA 4KGQA 3WW3A 5GZFA 2QQUA 4HKLA 5JOZA 5D1IA 2CAVA 2BVBA 2K46A 4D8MA 5FDBA 4L2NA 4E8DA 3DYMA 2GC1A 4QPGB 2C9AA 2ZMLA 5FYYA 3SCHA 3RYRA 1AYN2 4RS5B 1NYWA 2NYYA 4JVAA 3OYWB 2D6NA 2A75A 3M3OA 1DFQA 1DP0A 1KEXA 3HQUA 4W65A 2Q8OA 3SH4A 1K5MC 1OC1A 1L7RA 2EIEA 3WP3A 1R091 3W5NA 1H8TB 4GH4C 5JSRA 2X8KA 3WG4A 2VZVA 1CZVA 1VBE3 3RZGA 3UK9A 1VMFA 5K8SA 4FPOB 1XYNA 1W2OA 2JE8A 1S1AA 4IXLA 2ZZQA 4DXRA 5FYVA 1A78A 1EAH3 1DLCA 4R52A 4XFAA 5F6KA 1LKNA 3OUJA 3O1UA 4PT6A 4KG0A 4DUWA 4BQXA 1DGRN 2NLRA 4AF9A 1X50A 1N1VA 5FZ9A 4AW7A 1ZRCA 2XJRA 2JDHA 1UXZA 1GBGA 1KJLA 3B3QE 3ILFA 1YNAA 4XHXA 3I2OA 4M00A 2XJUA 4XDQA 4KNCA 1CD3G 4WM8C 2UWCA 3DPRB 1TQ5A 4Y20B 4GB31 5FIXA 5KHIA 1JYCA 1KS5A 5JVVA 1EY2A 4X8PA 5DABA 5FZOA 4A6SA 3IAPA 2DVFA 3VBOB 5C7GA 5IVEA 3B02A 3WF2A 3X29B 2XKPA 1OD3A 3O1RA 5FZIA 1ALYA 2BQPA 2VOKA 5GLZA 4U36A 2WT0A 1ZBA2 3AKSA 3BCWA 4O9GA 4C1WA 5ACA1 3OB8A 5CB7A 3EJKA 5F2WA 4EROA 5BUVA 4UF0B 4Q4W3 3WQBA 4NWVA 4BDVB 1PZ9A 2ARCA 4ARXA 4AEDC 1O7FA 1W6PA 2XMLA 2PHDA 4CVUA 5C71A 1FMD1 1LHOA 4DUVA 1RTVA 1S0BA 3RZHA 1GANA 1KITA 4IGQA 2XOMA 2QQWA 1OD5A 5FZGA 4W50A 2ZABA 5DAXA 3FUQA 4ZS3A 5FLHA 3VZKA 4HZFA 1U5ZA 2WAOA 4GKXA 3O1VA 4M01A 2VUCA 2P37A 2WSVA 4QB2A 2RDNA 3VDCA 5AFEA 1G9AA 2BGPA 4YW1A 4PI0A 2CL2A 3VHNA 4HVRA 2DUPA 2B7YA 4D7TA 1GP4A 1GICA 3A21A 4HK9A 4IE6A 3H8UA 2RJLA 2VW1A 2G9ZA 3DL3A 1Y43B 4XJ8A 3ZKUA 1MACA 5FO8B 3HNYM 4YVSA 4YG0A 3ZSJA 3Q8AA 3N4MA 1QJY1 3JQXA 3ELNA 4N43A 2JG8A 1S55A 3JB4C 5CU1A 5FY1A 3RPQA 5BNPB 2WNEA 1WA4A 3PMSA 3UGGA 1Z7S1 4MX3A 1LTEA 2DVAA 5FYHA 4CDUC 4QHOA 3RYKA 2W47A 3J8F2 1MS4A 5BNOC 4DNYA 1I9RA 1PNGA 1XNCA 4MO3M 1EUTA 1UPIA 1DU3D 4IE5A 3U78A 2CY6A 5L7OC 4K8RB 1CQ9A 2IXLA 4ZU7A 3JD72 4UFLA 3UKNA 4CDXA 4PQQA 2RHPA 2SLIA 5KC5A 3LIGA 2VW0A 2JDMA 3KF5A 5KWRA 2YROA 5E89A 4F7ZA 3HOBA 2DUOA 4JDMA 5M0TA 4A7ZA 4CP9B 2H0BA 1GNYA 4XFBA 4I2OA 2OPKA 2WFF3 1B35C 1H2NA 2GZWA 5DAPA 5FYBA 4FFIA 5DUXA 2Q1MA 1IS4A 3AZWA 2W91A 4MGZE 1W6MA 3NNJA 2JG9A 3I3QA 4AGRA 1MS3A 1A8MA 2UYBA 1OKQA 3V65A 1BZWA 3KV5A 5CADA 4BIFA 4QKBA 1EYBA 4OHXA 1HJFA 1RUOA 4QDRA 4FPEA 2P3KA 2WT1A 1XBFA 2VZSA 3F2ZA 4WBBA 3ZSMA 4B7EA 5A1AA 2WS91 4IE4A 3ACFA 4KBBA 5JZGA 4PF1A 3FWEA 1YJKA 2Z4FA 2QQLA 4EV0A 5HBAA 2WZ8A 3MEPA 4LHSA 1LULA 2EIBA 1UY3A 3N9OA 3BU0A 2J1VA 2QQIA 1BLZA 4E8CA 1PK6C 5A3LA 1NAEA 4BQ4A 1WCQA 3AYDA 3NAPB 3VHOA 2GSYA 2J1UA 4KGGA 2Z42A 5FO7B 1OUSA 3U07A 4XURA 2CV6A 4W6YA 2LTNA 2HEVF 4MGKE 4EN6B 5A3PA 2JXAA 1VIWB 4MH0E 2VUJA 2GN3A 2QJVA 4RR3C 5D8AC 3VL8A 4HXCA 1VMJA 3ZO0B 4HKWA 3PTYA 5C33A 2RM23 1VBC3 3UJQA 4Z92B 4Y24A 3OPTA 2OUJA 4BZ4A 2WZR1 2X09A 3MUY1 2P1BA 3UNPA 3MIEA 4M3CB 3WCSA 4P00B 1Y4WA 4AEMA 3HN1A 2EXJA 2B8MA 1PVC1 2D7FA 2ZX0A 5T5JA 3SCGA 2YBKA 3RI8A 3BODA 3T1LA 3H8XA 3CIHA 3FFZA 1DQ0A 2YFUA 3SITA 4JGZB 3DGTA 4IUGA 2EXKA 1YI9A 1H1MA 5IT6A 3T4VA 4LUMA 3PUAA 5F5AA 5AVAA 1ZA4A 2L9LA 2AH2A 1L7QA 4XXPA 1ZRIA 4P08A 3HPNA 2ET1A 1LR5A 3UV9A 2VGDA 4YW5A 1I6XA 1DHKB 3FFQA 3A22A 4K1YA 4MGSA 2ZKLA 4YW6A 4CP0A 1QDOA 1GWKA 4DY5A 3SCFA 3O0XA 5FKBA 3S57A 1UKRA 2YPJA 4FOQA 4XW3A 2X5IC 1ODNA 3C3VA 3CJIC 5JR2A 1W0PA 2G4IA 1QJX3 2Y6KA 3MBWA 3O1OA 1AYM2 2EXIA 3VDAA 4LTAA 2H0VA 1QEXA 4TLFA 2HYXA 5JMCA 2PHLA 3OBAA 3Q9OA 3CL1A 4IV3A 4QGMA 2R043 1KRIA 1YQ6A 3KMHA 2XG3A 4LLFA 4N7UA 1JXNA 1YI7A 4LA2A 4FVVA 2OKXA 1K3IA 1H2LA 1LGCA 1ODMA 2GNMA 1QKQA 5FK8A 4UW5A 3B69A 4I09A 5B2GB 1YIFA 4TXWA 4BXSV 2CGNA 4NIDA 2P17A 5KXDA 2I74A 2QQMA 2XQRA 3POWA 1OFNA 2HWD3 2XLAA 2F6BA 1LAJA 2VZRA 3NW4A 5F3CA 1US2A 4N9IA 1F31A 1YFXA 3GM8A 3TEXA 3VBFB 4ZHNA 1LESA 2BDRA 5F39A 3I3MA 1UIJA 2IXIA 4Q4Y2 2TEPA 1XSQA 4QPGA 3U75A 2DDUA 2LS6A 5JOXA 4O9EA 4AI9A 4RS5A 5JSPA 1ENRA 1TEIA 4BXFA 4MYEA 4R4XA 5IVVA 1W8OA 1ZX5A 2R062 2UU8A 1W8UA 2W2IA 4RFT0 4RHV2 3S6PA 4BLIA 5B4NA 4GKYA 5FZ1A 2UURA 1ZZ6A 5FAXA 1H8TA 4XJZA 4QXKA 5GLUA 3Q8CA 1IOAA 3RMYA 3I97A 4DUXA 2BZDA 4NHYA 1OVSA 2JJ6A 2RV9A 2UY9A 1F4HA 3GZAA 3JBG2 3LZZA 5FCCA 5FY5A 5C8WA 1O59A 2A3YA 3PLQA 3KT7A 3NL1A 1QOOA 1D7PM 4GB33 4C8DA 2R49A 1ND2C 3KCCA 2R16A 4JKMA 4RL7A 5DUUA 1W9TA 4QWNA 3OSDA 1IGOA 1UMZA 2FQPA 3WDTA 4LBOA 1OHFA 3UETA 1QXRA 2WNUB 1UYPA 5JDBA 1RL3A 1RMU1 3SISA 1N3QA 1UOJA 1UZZA 2VXRA 1MPXA 1VBB1 4FXGB 3UGFA 3VD4A 3DPRA 1T2XA 2DV9A 4I30A 4K7JA 1GV9A 3NNFA 3VBOA 1JHJA 3RG0A 4FPFA 2BFUS 1WD3A 3P6BA 4MSVA 4HFSA 2ORZA 4BU2A 3WD5A 4XMAA 4DY3A 3KHBA 4QDQA 1ZZCA 1FMD3 2D3PA 3BOWA 1OSGA 3HIFA 2EALA 3IT8A 2EXHA 5FYMA 4BPZA 4P9JA 5FYSA 3VB9A 1XPWA 2VVDA 5FPLA 3WUCA 3NV2A 4UF0A 1SLLA 1OA2A 2R1DA 5KC6A 5A7QA 4AFDA 4BQYA 1SCSA 1V00A 2OUHA 1JBCA 1QQP2 2HWE1 4E27A 1H9WA 2ZTNA 5JUVA 2F17A 4S2DA 1CZTA 4QPYA 3VBSC 1UU4A 3LA7A 1AUYA 3RI9A 1PMJX 1X8MA 3AP7A 4FT8A 1RHI2 5A3OA 1RITA 5IVFA 4B29A 3GNEA 2HBTA 2BP6A 3LFMA 3ST7A 2YMZA 5C3SA 1L7LA 2A7AA 2RJ2A 3D4KA 2VCCA 4HSLA 1L3JA 4P14A 4Q4X1 1V6IA 2BW8A 2P34A 4NAOA 2C26A 1ZZ7A 2ZS6B 1Z7S3 1JZ7A 2WR9A 1ASJ1 2AREA 5FY8A 5DAVA 2BGCA 3ENRA 1O91A 5F3GA 4QPIB 2Q8DA 4MVTA 4COZA 3THDA 2I2SA 2DTWA 1V9U3 2WNVB 4JTNA 4GZ9A 5GKAC 1AVBA 4OI0A 1VRH2 5BNPA 3JU9A 4DPNA 4EJRA 2VZPA 5FWEA 5L9BA 2VOVA 1QMJA 3AMPA 3VHPA 4D0QA 1MVQA 4JGYC 1ZYBA 2C9KA 1KS4A 1H8VA 4AVAA 3M7AA 3Q8BA 1JYNA 3ZIWA 2P2KA 1LHVA 1XSRA 2RR13 1CGPA 1QJZA 3MI8A 3TBDA 3K75B 1MS9A 5EYXA 4N53B 2ARXA 2FCUA 4OUSA 4NO4A 2V5DA 3M3EA 4EWEA 1SPPB 3S7EA 2ZX4A 3MIBA 2JENA 4CP9A 1UYYA 2HWB2 4QKDA 4YYOA 1OFSA 3A0NA 2E33A 2VY0A 4L92A 4XQDA 2E31A 2X29A 1W8HA 1RVF3 1LOFC 1F15A 4YVWC 3ZSEA 4P02B 5J48A 2WYSA 3POJA 4LBLA 2W87A 2WS93 4LE4A 4LHNA 1LU2A 4HANA 5BNNC 5FXWA 2WSUA 1PHMA 1OQ1A 1PM7A 1VBE1 3IIIA 4BYYA 2R1BA 1LNSA 2QTWB 3O0WA 3BALA 4AI3A 5K0UC 1K5MB 3FL7A 4YWAA 3LD8A 4FTEA 2ZGMA 1EAH1 2EIDA 1VBA2 4GH4B 2CGPA 5FV3A 5A7SA 3OJBA 3PIJA 5GZGA 1SBDA 3LSEA 1ZNPA 2R072 5G04L 2D44A 3R4UA 4Q8KA 1OLMA 2G19A 2IC1A 1JH5A 3J7HA 4FI9A 5A7WB 1OUXA 1A6CA 5JPMB 2D93A 5DUWA 4CCDA 3NAPA 5IYYA 2ZAAA 4LA3A 2PFWA 1KGYA 1PGL2 2NMOA 3CLPA 4YW3A 2P3JA 5JIUA 2WZR3 4F8AA 2W3JA 2GMEA 4XUPA 4PHZA 1LOEA 5A33B 2FDIA 1V6MA 2VUDA 4QX8A 1OOPC 5HI0A 1PVC3 4E9KA 5F8PA 1OT5A 2KR2A 2R6QA 1VAMA 2W1QA 4OCTA 4WM8B 3PVNA 1ZRFA 3HD8B 4BCUA 2WBKA 5ISLA 1E5HA 1Q8PA 1COV3 3T2QA 3HQRA 2B5HA 5I91A 1MZ6A 3WF0A 5FZMA 4BMBA 2Z2SB 1R081 4M3CA 3THCA 1SACA 3FX3A 4YFWA 3SEEA 2EAAA 3UL2A 5IHRA 5L9VA 4FOWA 3LEIA 3S7IA 4MV2A 3WW2A 1PO21 2A6YA 4JGZA 4HBNA 4MGTA 3D0SA 4Y4RA 1RXFA 3L2YA 4AEDB 1YLLA 2YC2A 4XQ4A 3VBRC 5L36A 2IXJA 4QHBA 4RQPC 1NCRC 1QHDA 1Z0HA 4XFIA 4XJWA 3VGIA 5AFBA 1GP5A 4XTMA 2GMPA 5FUIA 1PIV1 1HW5A 1FX5A 4CE8A 5CG8A 4LK6A 4PIYA 5A6QA 5HV0A 1W6OA 1C8M2 2RS32 4XIKA 1PMIA 3RNSA 3C7HA 4ISRA 2WT2A 2XUMA 4PLOA 1FV3A 2WQ4A 2JDPA 4ASKA 1O4TA 3LAGA 3FLRA 1RYYA 1SDWA 4QM8A 3VDDB 5HPOA 3LGRA 3O7OA 2IWGB 3QH6A 1AR72 4HN1A 3AK0A 4LKFA 4NHKA 3VZLA 3PVBB 4AK3A 1ULEA 4IE0A 4NPRA 1DQ1A 2Q4SA 4OUMA 5FZ0A 3VBFC 4M4RA 3BTYA 4IEWA 1VR3A 2A3WA 4L8QA 4XCAA 1NY72 3AYEA 5EZWA 4JX0A 2J1AA 4ISQA 4QPWA 1UF2C 1AXYA 1NCQC 4CCEA 4EN8B 5IUQA 2ARBA 2HWC2 5F9TA 1RUNA 1JOJA 1HN1A 1UY4A 3RS6A 3EB7A 4H7LA 2YGMA 2RMU3 5FBJA 1WW4A 2DWRA 3N7JA 5DZGA 5CKQA 5IK8A 3POSA 3U11A 5BNOB 3HBZA 3KV6A 4AFMA 3OGJA 3RMXA 2CDOA 1XU1A 4FPGA 3EQEA 2WFF1 1BBT3 5L7OB 4M0NA 1AZDA 4OQ9A 4LNVA 4FQ4A 4C90A 4AHZA 3ACLA 1D4M2 5FYTA 4HPKB 1RUI2 1JU4A 3TN92 5I0RA 3BIEA 5JLVA 2YPDA 3LWCA 1B35B 1MEC2 3POGA 1DG6A 4Z82A 4P9YA 2IFRA 3POFA 4XFHA 3RWNA 1LENA 3CDZB 5LB6A 5GLTA 1VBD3 3WDUA 4XTPA 1JUIA 4A41A 4AZZA 5KBFA 1H4GA 3NMBA 1RMU3 3MIHA 5FZHA 1R1ZA 3RYPA 1R1A3 3TWIA 3KGLA 3WNXA 1GZTA 1RUG1 3C8XA 3BTAA 4XXAA 5DDJ3 4ZXEA 3I3EA 1ZBE2 3LKJA 4QX0A 3DN7A 4CEWB 4BQ3A 2WNUA 4OUEA 2A71A 3ZX7A 1O3SA 4CXYA 1LJ7A 2J1SA 5LA2A 1UAIA 1PK6B 4GMP0 3TEZA 1XNTA 2H6CA 1RUJ3 4BHPA 3ZKYA 1F5FA 3OGSA 3RRDA 5FZBA 1HLCA 2XLGA 2BGOA 2W94A 4V2WA 3E6DA 4PDWC 3VBUC 2RM21 4CDQB 3J7NA 5J09A 1UOGA 2C6SA 1C5IA 3K77A 5I8SA 2XJPA 4Q4V2 1Q8SA 4AGVA 2HWE3 4XBLA 1UNBA 3W59A 5A3MA 2P6CA 2Q5TA 2VCAA 3NNLA 4RR3B 5D8AB 1PVXA 4D6QA 2VMCA 1Y9QA 4XF1A 1YQCA 4R4ZA 1C28A 1UOBA 3Q8FA 2VMFA 4MOAA 3KZ4C 4HSJA 4XOGA 4B4QA 1AYN1 1W05A 4JTOA 1TME2 5C4WB 4HL0A 3EYPA 1PGW2 1JHNA 1NG0A 1YJLA 4N9HA 3ZR5A 3IKWA 4OYUA 4XF4A 1W9SA 5IFPA 2QQNA 1I1EA 3T09A 3WDXA 2C24A 2WO1A 1GFF2 4MG2A 3DYOA 3GALA 1JN2P 2RS52 2WNVC 3N9PA 5C3OA 1ASJ3 3W21A 3IN9A 1WKYA 1QJU2 4N90A 3GBFA 5FPUA 1GYKA 4LITA 1QJX1 1HB3A 2XBO2 1AHSA 1BEV2 4YGDA 2LROA 3T3YA 5IK4A 5JSOA 3SKJE 3WNOA 3ZYGA 2E51A 1RUF2 4QX2A 2BBVA 5H9QA 2QNKA 2X5IB 2R041 1BHGA 3ACHA 3CJIB 3M3CA 3NJZA 4QQHA 4QPIA 1N1TA 5FP3A 3VBHC 2Y0IA 1N3OA 1R64A 1PO12 3ROUA 4DEQA 4FFGA 2FCTA 4XUOA 1C4RA 3FC0A 3NRUA 1C3HA 4NHMA 2R30A 3T0BA 5E6HA 3H8RA 4LO6B 2D43A 3I59A 1RUH2 1GQHA 5LK5A 2DCTA 4CRQA 5DAWA 2RS12 1JTZX 1CZSA 1STMA 4LEJA 2QQPA 4JRLA 2ETEA 2HWD1 5HV4A 4I3GA 4OHVA 4N53A 1UCXA 4QGLA 3WG3A 1OLME 4YZ4A 1TE1B 2JDUA 1HRI2 2AACA 2KM2A 1PNFA 2A5ZA 4J1XA 1W2UA 4UW6A 1OLQA 3PIGA 1SPPA 5J7MA 1SLTA 4XYXA 1RUE2 1J3RA 1K12A 2ZHKA 3OGGA 4GAZA 5GM0A 4FOVA 1LOBA 1YFUA 3K46A 3POBA 3IIAA 4MGQA 5L19A 2D3SA 1UY2A 3QACA 4CU6A 1GSLA 1WLTA 3AXDA 2GNDA 1H2KA 2MEV2 1W6NB 3MW3A 3NQHA 2FDJA 3BB6A 2JE9A 1HKDA 2PTMA 2ZGRA 3UKVA 3WDWA 1V0AA 1UU6A 1AR63 2W46A 3E6CC 4HETA 2Y60A 1VPHA 4NAMA 5GZEA 1VE0A 2OPWA 4AHWA 4M3CE 1DZQA 2SBAA 4D6RA 1K5MA 4Q1RA 1RUD3 3GCWA 2PLV3 2DVBA 1OH3A 4A42A 2PELA 3U0ZA 4D7YA 2ZX3A 4GH4A 2QQJA 3GZUC 4MHUA 1NE4A 1SLCA 3AVSA 1KQRA 4AXOA 2RVAA 5EQUA 3OBRA 2V5YA 5CFDC 4UBGA 3A4UA 1FOD2 3DXTA 4QQOA 5A7WA 4XUTA 1HRV3 3I49A 4H14A 2QUOA 2XQXA 4LORA 1CX4A 5CIRA 3ZN6A 5KR7A 5KHJA 1ND2B 4EE2A 1UPSA 3J8F1 2DFCA 3E5QA 1ENSA 1S0FA 4FPHA 3MICA 3PMEA 4EYUA 2Y6LA 1ST8A 4K8FA 3U14A 1R083 3H50A 3ZXFA 5A33A 3AJZA 2YZ4A 5FY9A 3JD71 3GJAA 1AR82 2VTFA 4OHZA 2OT7A 4WM8A 1PO23 1CIWA 3CJXA 2VTXJ 3HEIA 4UW3A 1UW8A 2QKDA 4M4PA 4P5YA 3WHUA 3CO2A 1UXXX 2E63A 5LA9A 3WG1A 2ERFA 2WWUA 5D21A 2DBNA 3MUZ1 3ETQA 3VDDC 4ZY9A 4CU8A 4XF3A 5TSWA 1RXGA 1W03A 1ULOA 3N9MA 3DV8A 2LW8A 4FP3A 1PIV3 4QQLA 4DQAA 4S2HA 5L73A 5I8YA 3IDCB 2QDRA 1CX1A 1IPSA 2D40A 3OF1A 3PUIA 4NIIA 1R092 4XILA 4AEDA 4OFGA 1EV13 3ME2A 2DVGA 2HWF2 2B9VA 3CQOA 1GQPA 1D0HA 2IXKA 2WZPP 3VBSB 3JQWA 3H42B 4Q0QA 1M4WA 2NN8A 3PUHA 5BNNB 3RZJA 3BYWA 2VE1A 3JB8A 1UKGA 2ZHNA 2IZWA 1W3VA 5J3UA 1U5YA 4UT5A 4I0BA 3WP4A 2FD8A 3CKHA 1VAKA 2PHWA 1MS8A 4ZS2A 3SLIA 3KVAA 1YQ2A 1GNZA 4QX3A 1VALA 1UZYA 3IMMA 4TYSA 1V9U1 4W6WA 3H0OA 3RJ2X 2CGOA 3ZMNA 1VLNA 2Q0AA 4IDZA 1Y9MA 2Y6JA 3TRSB 1TG7A 4TSVA 1RB8G 2C0ZA 2ZEZA 2ZX2A 5DZEA 1PZ8A 1JUHA 3IDAA 1PZ7A 5A3WA 4D69A 3VD3A 4YM3A 2RR11 4YARA 4NE9A 2Y8KA 2NPIA 1EPWA 1IG0A 1WW5A 3AZVA 1YFWA 5ACA2 3AYCA 4XAEA 5LA0A 2JICA 3E97A 4JGYB 4CDUA 4OQ8A 1PX4A 2BYVE 2DUQA 3MW4A 1TMF2 5IVCA 3VUOA 5BNOA 1W90A 2XLFA 1S0DA 1GNHA 1IS3A 4Y33A 4A4AA 4NPLA 4E4DX 4CUCA 3BTXA 3T0DA 2W95A 4Y26A 2DFBA 3LE0A 5AC93 5L7OA 4K9SA 1F9KA 4Y22B 1O5LA 1WCDJ 5CA6A 2VCBA 1RVF1 4UFIA 4FXKB 4NIAA 1KJRA 2ZHMA 2ZKNA 3VD7A 1AR93 2DCJA 2VQTA 4ARYA 5DMYA 4Q0SA 3H8OA 3UT0A 4CEWC 2D3RA 2F4LA 1B35A 2ZGPA 3K4AA 3T4HB 4QX1A 1LCLA 5JOYA 2QVSB 2XL9A 1RUG3 3IWZA 3JXSA 4YVWB 2MPFA 1FNYA 1GZWB 4CDQC 2OZ6A 1X7NA 3MDPA 4QMAA
chains in the Genus database with same CATH topology
3KGZA 4R9BA 3B00A 3HAGA 1WCSA 5K0UB 3FE5A 3K48A 4AFAA 1QJY2 3LA2A 4MZUA 4XHBA 1VJ2A 5CAZA 1DQ6A 3TYJA 5C4WC 3QD6A 5JR7B 2WQZC 1LOAA 4GALA 3WZ1A 4DXZA 3AMHA 5GLWA 2A6WA 1PK6A 2PQQA 5FPXA 3MF6A 1AYN3 1OA3A 4IEZA 1A3KA 4F83A 3JCIA 1COV1 4AI2A 1MQTC 3G6JB 4OVEA 1SLIA 2QFEA 1J1LA 1OOPB 3FJSA 4Q4Y1 4RR3A 1LHUA 5D8AA 1DF0A 2GC2A 4E2SA 1QXPA 2A6XA 4YG6A 3T1MA 4AI0A 1NOVA 2XJQA 3H1YA 1YYNA 3MZHA 3VLBB 3D0JA 5FFOC 3WG2A 2BPA2 4YGCA 2XWJB 3M3QA 2A6ZA 3S0MA 1Q56A 1ZZ9A 2WFPA 4YW4A 1AX1A 4LBKA 4AG4A 4P5HA 1J58A 1FPN2 3LOIA 4KL1A 1V6KA 3G7DA 3VBRB 4GMP3 4RQPB 4BOWA 1NCRB 2B39A 4Q2FA 2DYCA 3OPZA 1VB4A 1WLWA 1VP6A 4ZU5A 2NMNA 1IKPA 4E2GA 1IPKA 3MLLA 2ILMA 1ZBA3 2OZJA 3KB5A 3N7MA 4Z1VA 1QOTA 2X5IA 2I07B 3CJIA 5FO9B 5FOBB 2TUNA 4JAAA 4FPJA 4NOTA 2VULA 2RMU1 5CBLA 2D6LX 3P3NA 1ULGA 1WMDA 1XYPA 1GQGA 1NCQB 3ZFEC 3OYWA 1N1SA 3PHMA 5DG2A 1XXNA 2PYTA 2VNGA 4COVA 1ZREA 2OA2A 1BBT1 2ZMKA 4LHLA 4I3PA 3H3UA 2E7TA 3QCWA 4LBMA 2GC0A 4DRVA 4AE2A 4F3JA 1OLRA 2KXLA 4CDWB 1KXGA 1RHI1 1TNRA 4EWDA 1N3PA 1LB2A 1WLCA 3CNAA 1Y7BA 2ATFA 3CU7A 3SMHA 4SBVA 1VBD1 1T6GC 4OI2A 4YZ5A 3E5UA 4YM1A 3I4IA 1G8WA 4XBNA 1HXS2 1R1A1 4Y5Z0 4Y20A 5ABJC 5C9AC 1W0OA 3J8F3 4MXVA 2JEMA 4EWAA 2RJKA 1BMV1 2D97A 2D6PA 5DDJ1 3JD73 1AX0A 2ZGSA 2IXHA 3WLUA 1RUJ1 2HEWF 3BOPA 2Q30A 3P3PA 1ND2A 3KCXA 4FPKA 3AFGA 4AYUA 3ZYPA 3KSCA 1SLAA 4NN0A 1U5XA 1QU0A 3MPPG 5A32B 5F1RA 5H9RA 4WM7C 1DQ5A 3GBGA 4X8NA 3QLQA 2ZX1A 4HLTA 2XKOA 4PDWB 4I02A 5DZFA 3VBUB 1AJOA 4YGEA 1BVVA 5FREA 2K0GA 2XGXA 4Y1XA 2PHTA 4PBOA 2D5FA 2AENA 4LBQD 4KWJA 2ZGLA 3J9SA 4A2UA 1SBEA 3H1MA 1LOGA 3RQ0A 4PF5A 4ES8A 1S0GA 3BIWE 5BY5A 4AWDA 1XU2A 3ZIXA 4KQ7A 4XPVA 2GNBA 3M2MA 3K51A 4IQPA 2O8OA 2ZMNA 1O3TA 1VBA1 4YZ2A 4MGIE 5C8CC 3VBSA 2R071 4LT5A 3MIGA 3HR9A 1YCIA 1O5UA 4FCAA 3TB0A 3NWKA 4WVMB 3USUB 3RJRA 3D8CA 1AL22 1UN1A 4XBQA 1EP0A 2E7AA 1YXWA 4XJ9A 1A8DA 2O8QA 3AMQA 3WX5A 1XNBA 3IBMA 1VBB2 4DMIA 3KT4A 3BU7A 4ITCA 3AKQA 4E2QA 3VBHB 2GN7A 4YM2A 1DZRA 5SV8A 2E9QA 3B7MA 3VZOA 2DU1A 4AGGA 2R0FA 3R4SA 4JGYA 2PHFA 3LA3A 3MLKA 4WZCA 1LECA 2AGSA 1BCXA 4LO5B 3FUOA 2D6OX 1VAVA 2MNGA 4Y22A 2FZ2A 5FLJA 3VKLA 1WBLA 4ATFA 1OI6A 2PHXA 1AYM3 2Z79A 4WZFA 4YM0A 1OQDA 1AR61 4K40A 4CZSA 1C8M1 2ZGQA 1FNZA 2NQYA 1LOFA 1ND3C 4YVWA 4YNIA 1RUD1 4Q4X2 4R8HA 1GZWA 2PLV1 1EPZA 5BNNA 3GYDA 1RUC2 4IV1C 4PQ9A 3THPA 5K0UA 4C91A 1HRV1 2EA7A 4NWWA 1U5IA 3QH7A 4FPLA 1O4ZA 1WW7A 4MXWB 2N7GA 4FPCA 1S2BA 1F5JA 4JV4A 4IL7A 5CFDB 3I8TA 3WW4A 1ZRDA 5KXBA 4Q4Y3 2GH2A 2CAUA 1S0JA 2DURA 4Z8BA 2YHJA 4J6GA 1POV0 1G86A 1W6PB 2R063 4RHV3 2VOXA 2D5HA 1SFNA 4QQ2A 3I54A 2FHRA 1LEDA 1J3PA 1OOPA 4RGGA 4FO9A 5JAXA 3FMGA 2YYOA 3V0AB 3H1WA 2VU9A 3JBG3 1LEMA 4HVOA 5I93A 3ILRA 1ULCA 2GH8A 2PHRA 4KU7A 4GWNA 3O0VA 1EV11 5CVRA 3RSJA 3B9CA 5I0TA 1VBE2 4WVVA 4A7KA 1N1YA 4LULA 4Z2WA 3E5XA 3AMNA 4KWKA 3GF6A 3AM2A 4AQ6A 4D7SA 4AQSA 4G9SB 1EAH2 2EAKA 3VBRA 2UWAA 4RQPA 1NCRA 4IEVA 4N43B 4BH9A 3OY8B 2VNRA 5AVPA 3OD0A 5JI9A 2VNOA 4LBNA 3IDBB 3POYA 3ZYIB 1QH6A 5DG1A 2G9GA 1C1FA 3WQ0A 1WMEA 4V1PA 4PIXA 4CDWC 3VBFA 5CG9A 2K9ZA 2FZ1A 1QQP3 5SV5A 2ZOEB 4QD2A 4TZDA 2EVXA 1NCQA 2TNFA 4HMZA 3ZXEA 4Q4W2 3S30A 1FAYA 4ORFA 1TME1 5EXOA 4L9BA 1RHI3 3N35A 3UJOA 2BVVA 1Y3TA 3AZZA 4COUA 3L9JT 2YDEA 1IKQA 3FZ3A 3WP6A 1DZTA 5AC91 3O5SA 2WWSA 1DGWA 3SH5A 5GZCA 1PGSA 4IEQA 1KDKA 2BWAA 2XH6A 3O14A 3GZTB 4PIZA 1AR91 2DVDA 1MS0A 1NA1C 1QGLA 4K21A 1F2NA 4CEYC 3NVCA 3KCYA 3WV6A 3WQ1A 4LUKA 4L97A 3W58A 1VRH3 3VKFC 5JCTA 3IMNA 3EXUA 4Q8LA 1WUVA 1RUF1 1V6JA 5GJ6A 4FQZA 4Q29A 1AXZA 1CAXB 3SXWA 1E57A 3ZFGC 3AKPA 3VKMA 1PO11 4AEKA 4Y1VA 1DGRA 4URTA 1MZ5A 5I0UA 1YIPA 1WW6A 3RDIA 2ZAHA 3WVJA 4EN7B 3ZFFC 2HWB3 4XQWA 2ES3A 1QXJA 5FOJB 1S0CA 1SBFA 4C0HA 3B5LB 1ENQA 5EJ3A 2ZGNA 2DCZA 4GA9A 1Q43A 4PDWA 3VBUA 3ES1A 2E6VA 2WFF2 3GBWA 4FAHA 1MQTB 1LRHA 4LLOA 2MHFA 1I3HA 3ECQA 3D82A 2VH9A 1VBA3 3RZZA 1G9DA 4AHYA 2DTYA 4KU8A 2R073 1ZZBA 5CFCC 1NQDA 4Q26A 2LM3A 4BLJA 1QNYA 4GMP1 1J59A 4GQ7A 3M3IA 2BFUL 2WNVA 2B9UA 1O4YA 2HJIA 4QM9A 4EN0A 1AL0G 4G3YC 4IV3B 1G9FA 5CNAA 4CP1A 1D4VB 4ATEA 1ZBA1 5HCFA 1YRZA 4C0BA 3KT1A 4WVMA 3USUA 1IPJA 1X33A 1AJKA 1GZ9A 1YFYA 2XB6C 1H30A 1XQNA 1G9BA 2WA4A 2VMHA 2IFWA 1AR81 4HN0A 4YSFA 4ZU4A 3AYAA 1H4HA 2CWMA 2RM22 1VBC2 5T55A 3NKTA 3VBHA 2BWCA 1QF3A 1UL9A 2BUKA 2FMDA 3J4UH 2CNAA 1NE6A 3ZXAC 4ASMB 2ZGTA 3WW1A 3ZFEB 1C8M3 2RS33 3M70A 4ZXKA 4GIQA 2OVUA 1ZZ8A 3V0BB 2GMMA 1YHFA 2HWF1 2C5DA 1AR73 4XJUA 1NLSA 2NP0A 3M1HA 2W08A 1IZ3A 4FOYA 3N3HA 1QJX2 4Q0VA 3KM5A 4Y1YA 3AXEA 2HWC3 3ASIA 4NHLA 3NSTA 3R05A 5F5QA 1KDMA 2XWBB 2OIIA 2R042 1CAVB 5BPXA 5BXXA 3V56A 4XF0A 5ABJB 5C9AB 1XRUA 4AQTA 1REFA 4MXWA 4OI4A 1C57A 3VKNA 4IESA 5CFDA 4PLNA 4B4RA 2HKXA 1CJPA 1QWRA 3FHIB 2GDFA 1XE7A 5EFUA 4FPYA 4YW2A 4PBPA 2GC3A 4LE3A 1D4M3 4AVTA 3AX4A 2G9FA 1TMF1 2HWD2 1RUI3 4AEJA 3TN93 4META 2QZ2A 2TBVA 2XL7A 3C2UA 4ASLA 1QY4A 1HQWA 1GR3A 4P9LA 1MEC3 4YVSC 3ZDSA 3IDEA 3ZXLA 5T52A 4N43C 4WM7B 3MIFA 2QZ3A 2ENRA 2JKBA 4FP2A 2JG8C 3V0AA 3MLJA 4I01A 2X53S 3NKGA 4IETA 4LHKA 4OHWA 5LEKA 2JECA 2Y26A 2GNTA 2XVKA 4MUVA 3MW2A 3DF0A 3VDDA 2DF7A 5F6LB 1ZBE3 1HDKA 3VV1A 5J96B 4CDXC 5LRRA 3FBMA 4AI1A 1H0BA 1HX6A 3H3ZA 4L99A 1AXKA 1MVEA 4GB32 4OFGA 3A0KA 1HV0A 5FPZA 2QE3A 2WLPA 3AZYA 1Q3EA 3MFCA 4KG8A 1AX2A 4Z07A 3OY8A 5E16A 4E4SA 4Q4V3 5C8CB 2AZ5A 3FLTA 1POV3 4YLZA 3B93A 2JG9C 3JZVA 4OHYA 4K1ZA 1SFYA 4IERA 2WA3A 3MFAA 1J3QA 2NM1A 5H9PA 1QH7A 1TME3 1KFUL 1D2SA 1F8VA 1BXHA 2ZA9A 1M06G 4R9DA 3PJYA 1FMD2 4XETA 5JZGC 1FI2A 1QNWA 1LOCA 4AFBA 1NXMA 4FTSA 1IS6A 1ENXA 4W6XA 1OA4A 2RS53 1W39A 1UD1A 2E7QA 4HPKA 4LR4A 2K2SA 4TWTA 4QU2A 3ZYJB 2YC0A 5GLVA 1D2QA 1QJU3 3OD4A 3R0RA 4CP2A 5FLIA 5FMOS 1RJ7A 2XBO3 4DZGA 1BEV3 2V09A 4P9WA 1AYM1 2QCSB 4XF9A 3GHMA 1RUF3 1XNDA 1BK1A 3VZNA 1LGNA 1MS1A 1FPN1 4SLIA 4UBHA 1GLHA 5HXVA 3WCRA 5HCBA 3LOBA 2WKKA 1JW6A 1SLBA 2VUAA 1PO13 2B46X 5DXDA 4CEWA 1Z7S2 3PVOA 1ZVFA 3AJYA 2WJSA 1DYPA 4LBQB 2LALA 1RUH3 3UKTA 1ND3B 3AP9A 2OW4A 1UX6A 2RS13 1YWKA 1CAXA 4JQRA 1ZM1A 4CDQA 1V9U2 2O1QA 4WVWA 1HRI3 4IV1B 4X6RB 1AF9A 1RC6A 2B45X 1RUE3 3SH3A 4YZ1A 4Y1ZA 4ZKTB 2CTVA 2RR12 1LODA 4LO4B 3OTFA 4MLOA 5C4WA 2F4PA 3AKTA 2DU0A 4XFGA 2MEV3 4YG3A 1RINA 2R061 2Z69A 4RHV1 4N7IA 3MPBA 2HYKA 1DQ4A 3AP4A 2XPJA 2JX9A 4JDNA 1DLLA 5KHHA 1B09A 3HT2A 1CR7A 4IV3C 4RSUA 4FBFA 1MQTA 3I7DA 3JBG1 3WDYA 5E8AA 1RVF2 2UY8A 4AI8A 3EHKA 2H6BA 3MF9A 2WS92 2XJSA 3AZXA 5FRAA 4DOUA 1W6OB 1G6NA 1V6NA 4YRDA 1FOD3 4QX5A 1CAUB 3OBTA 1HXS1 2I45A 3VHRA 1OPMA 3J26N 5KXCA 1IQAA 2PN5A 1DIWA 2W68A 5FTTC 3AP6A 3IPVB 3SNMA 1BJQA 2D6MA 3LCPA 4IEPA 1SEFA 4JC1A 1AR83 1DBNA 2ZZJA 4JCKA 4K6BA 4QPGC 1O3QA 1ZRRA 4RS5C 1CPMA 2W39A 2WZR2 5JI7A 3WQ7A 3EO6A 4BMEA 1TNFA 1IS5A 2WC2A 2VW2A 5FBZA 1PVC2 4BE3A 1H8TC 3ZPYA 4J1WA 1UIKA 1QQP1 4QGNA 4COWA 4JRAA 3NV4A 4BQ1A 1C8NA 1COV2 2NZ9A 2XJVA 4P9IA 3LSDA 5J36A 1R093 1W6NA 1QDCA 2HWF3 1FYUA 4B3NA 2EF6A 1GKBA 2V73A 2XVGA 3AFKA 3ZFEA 4XIOA 3ZVXA 4WV8A 3DPRC 4INDA 5H9SA 4LBJA 3V0BA 3VZJA 3HQXA 1NQJA 3VBOC 1CJDA 2A3XA 1HIXA 1OQEA 3ZXDA 2BTVC 3KQRA 1NA1B 1VRH1 1VB2A 2UWBA 1OPOA 2D98A 4QQPA 4CEYB 2WLQA 1ONAA 1KFXL 4UXAA 2JDZA 1BQPA 3INAA 4I0WB 2VMIA 4XMIA 4HVQA 1LHNA 1AL21 4B7KA 2VMGA 4Q0PA 3PNAA 5ACA3 4WVZA 4AFCA 1CAVA 1V6LA 1D0GA 5EYYA 3R4DB 2C1FA 4DRRA 4Y4YA 1TMF3 1S0IA 3B9IA 5ABJA 5C9AA 2BNNA 1CAWB 3WOGA 1V70A 2HWB1 3ZFGB 3AB0A 2RMU2 3KLSA 1MZFA 4XJAA 3PVEA 2A73B 2EIGA 1X36A 3ZFFB 1DGWX 1NXD1 2ET7A 3KS7A 5FQ0B 3D6EA 1BBT2 3H7JA 3ZXKA 1SCRA 2ZBJA 4IEYA 1HQLA 1MS5A 3I2DA 4WM7A 2JD4A 2RE9A 2PAMA 1NZCA 5BNPC 1Q5OA 3V64A 3AMMA 3DUIA 1O3RA 2WIIB 1W6QB 1REEA 2GAUA 3ZXGA 1QJY3 1XE8A 4GXLA 4JDOA 5GZDA 1MR5A 1IHMA 4DB5A 4RGAA 2GU9A 1PGL1 1VBD2 3ZSKA 1RMU2 1OMIA 5BYNA 2Y0OA 1R1A2 2BNOA 3ZN4A 3MIDA 5CFCB 1APNA 4Q0UA 1RUC1 2VVFA 5E88A 3PJQA 1GZCA 2AYHA 1WGPA 4YZ3A 5EV7A 4EN9B 1BMV2 3URFA 4H7MA 2A6VA 1J1TA 1DGLA 3HWJA 5DDJ2 3ALQA 1NLRA 2D6KA 2R32A 5C8CA 4AHXA 4CYDA 1XYOA 4PCRA 3I59B 1RUJ2 4OULA 4XEZA 4LO7A 4A3XA 5BNQA 1U0AA 4FSJA 2VPVA 4MGYE 4NR1A 1LU1A 1DDLA 5K7PA 2YY1A 4D94A 2HWE2 2A70A 3HMYA 2Q1ZB 4RA0A 3U10A 2JE7A 4PLMA 4OI1A 1CN1A 1Q8OA 1I5ZA 1BKZA 2AR6A 4P9XA 1Q8VA 2RS31 4XFCA 3OCPA 1FPN3 3WINE 3NAPC 4S2GA 3USSA 3O12A 4H55A 4HK8A 2VOWA 1ULFA 1V6OA 2VQAA 1AR71 3FBYA 4AVBA 3W9AA 1ASJ2 1RJ8A 4CTEA 1RGSA 4BWOA 3FLPA 1NY71 5LRSA 4A7YA 1WD4A 2HWC1 4XFFA 3IM0A 4BM8A 3TNPB 3ZN6B 4LBQA 2B42B 4FAGA 2Z5WA 1ND3A 5DUVA 3T2TA 3H7YA 1LGBA 4JGZC 1FV2A 3M4FA 2CWSA 4HT1T 4L11A 4OZXA 5T54A 1LHWA 3VZMA 3ILNA 4U2AA 2FMYA 5IK5A 1H2MA 1S2KA 4IV1A 3VKOA 3APBA 1REDA 2XVLA 3WXPA 4AVSA 3N7LA 1WMFA 4OLLA 1D4M1 1X82A 4P9GA 4Q4W1 1WBFA 3VL9A 1RUI1 2VG9A 3ZSLA 2Y38A 3TN91 4GWMA 2ZPXA 1CONA 1BVP1 3JUUA 2P3IA 4IEXA 5FMOL 5LK7B 1MEC1 1WCKA 4Q1PA 1YO8A 3MGUA 2ZGUA 2YGLA 3CEWA 4IEUA 2YXSA 1CVNA 5K9YA 3AP5A 2DCKA 1HXS3 5J98B 2KA3A 4DFSA 2E53A 5I0SA 4YVSB 3H9AA 1CESA 3TOJA 1AR62 5IK7A 2W0XA 2JG8B 3ES4A 1BYHA 1ZBE1 5T3NA 2ZHLA 2AUYA 3CF6E 5I8TA 5J37A 3M8LA 1CAUA 1RUD2 2ZGOA 3B94A 4UW4A 2PLV2 4X6QB 4YFZA 3IPVA 3R6SA 4H3WA 3ATGA 2PHUA 4Q4V1 1G9CA 4CDXB 1HRV2 1POV1 1SMVA 5T5PA 5JPNB 3WHTA 4AVVA 3MYXA 4RD7A 3BPZA 4M0HA 3SHRA 3LB9A 1R082 1PGW1 2ZACA 4CDUB 2PA7A 1DYKA 1W6MB 2JG9B 3GHNA 4IEOA 1PO22 2R0HA 2RS51 3ZN5A 4CDWA 1G7YA 5HCAA 1SQ4A 5KHGA 1DQ2A 4FTBA 3B01A 5JIAA 3TNQA 1QJU1 1CPNA 4Q27A 5JZGB 3KD4A 1PIV2 2XBO1 2WNUC 1BEV1 2BNMA 2PAEA 4YGBA 5E1RA 5GALA 2IXCA 3NV1A 4AVCA 1C1LA 1EV12 1H9PA 4K20A 5JOWA 2VQ0A 1AL23 5KXEA 4Y1UA 2DCYA 5T5OA 2W52A 4KH9A 4S2FA 1NA1A 1VBB3 4DS0A 2YV8A 3VN4A 4D3WA 1C5HA 3WR0A 4KWLA 3DKWA 4NVPA 2WINB 4CEYA 3L2HA 4AQ2A 1RUH1 1WLDA 5BV6A 1U12A 2RS11 2BEOA 3WDVA 1X8EA 1Q8QA 3ZYRA 2ZJCA 4XE9A 2O0OA 2GALA 1ULDA 4BA6A 1HRI1 2VECA 5A32A 1FATA 1JYIA 1RUE1 2UYAA 4LO8A 1VBC1 2QDNA 1CAWA 3WUDA 3QBQA 3ZFGA 1URXA 4DINB 2FBEA 4BIOA 1QOSA 2XJTA 2VVEA 3WT3A 2MEV1 4G4FA 3WY6A 5LEJA 2WL1A 1UU5A 1H1IA 2CYFA 5T5LA 3QOPA 2ZCWA 3ZFFA 3N7KA 1H1AA 4ONUA 3HT1A 2PAKA 5FQ0A 4K3UA 5AC92 4I0AA 3TAYA 5T50A 4E4ZA 4QPIC 4XZPA 4COYA 4Q4X3 1YUDA 3THTA 4R9AA 1AR92 3NV3A 4ES9A 3E6BA 3EBRA 1FT9A 2YUEA 4GULA 5KHKA 3D5OA 3N36A 4QT6A 3ZXJA 1RUC3 4HKOA 1W6QA 1MZEA 1FOD1 3AKRA 5C6CA 1RUG2 1Z78A 2LUWA 3ZMOA 3U4XA 4C1XA 1HV1A 3NO8A 1FXZA 4N53C 1RIRA 1S0EA 2ZGKA 4B4PA 1HQNA 1KD7A 1N47A 2XHKA 1XNKA 5EWSA 3WP5A 5CFCA 5JWPA 4B8EA 4R9CA 2HEYF 2OYZA 4M3CF 4PJYA 4KGQA 3WW3A 5GZFA 4HKLA 5JOZA 5D1IA 2CAVA 2BVBA 5FDBA 4L2NA 2GC1A 4QPGB 2C9AA 2ZMLA 3SCHA 3RYRA 1AYN2 4RS5B 1NYWA 2NYYA