4CDWC

Crystal structure of human enterovirus 71 in complex with the uncoating inhibitor gpp4
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
242
structure length
242
Chain Sequence
GFPTELKPGTNQFLTTDDGVSAPILPNFHPTPCIHIPGEVRNLLELCQVETILEVNNVPTNATSLMERLRFPVSAQAGKGELCAVFRADPGRNGPWQSTLLGQLCGYYTQWSGSLEVTFMFTGSFMATGKMLIAYTPPGGPLPKDRATAMLGTHVIWDFGLQSSVTLVIPWISNTHYRAHARDGVFDYYTTGLVSIWYQTNYVVPIGAPNTAYIIALAAAQKNFTMKLCKDASDILQTGTIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP1
publication title More-Powerful Virus Inhibitors from Structure-Based Analysis of Hev71 Capsid-Binding Molecules
pubmed doi rcsb
source organism Enterovirus a71
molecule tags Virus
total genus 41
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2013-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4cdwC00
2WZR1 1AYM3 3VBRC 3VBFB 4BCUA 4RR3B 1VBB2 1RHI2 3VBSA 1F8VA 4Q4Y1 2HWB2 2RR11 1VBE3 1RUJ3 4LLFA 1RVF1 3JD71 2FZ2A 4GMP1 3VBHA 1VRH2 1RUE2 4YVSB 2HWD2 4JGYB 2R042 1R083 2TBVA 1NCRA 3J8F1 1EV12 5BNPB 1AL22 1VB2A 4GH4C 3VBSC 1M06G 1PO21 4CEWC 3ZXAC 2HWF1 4CDWB 3VBUC 1RUF2 5J96B 5AC93 4FTSA 1HXS3 1MEC2 1MQTA 1TME1 1VBD3 3VBHC 1RUG1 5K0UA 1WCDJ 2WFF1 2HWC2 1AR63 3NAPA 1V9U3 1B35B 2X5IA 1PO13 1H8TC 1AYM1 1FOD2 1NCRC 1RMU3 1X33A 4Y5Z0 2GSYA 4Z92B 1BBT3 4QPIB 3CJIB 1VBA1 4YVWA 1NG0A 4WM7B 5JZGB 1PIV3 1ZBE2 2IZWA 2WWSA 1AR72 2BBVA 1AR82 4CEYB 1HRV2 1NY72 1BEV1 4CDQA 3VBOB 5ACA2 2HWE2 3NAPC 4SBVA 5CFCB 2X5IC 5C8CB 5ABJA 4WM8B 1R081 5FMOS 1PGW1 1IHMA 2RS32 4YVWC 2XBO3 1NCQA 2WZR3 5GKAC 1TMF3 1FMD3 2RMU1 1B35C 1HXS1 4NWWA 1AR91 2RR13 2FZ1A 1OOPB 2RM21 1RVF3 1C8NA 3VBRB 5DDJ2 1AR61 1ASJ2 1R1A1 1NOVA 1V9U1 3VDDA 5C9AC 1RUC2 5ABJC 1C8M1 1RMU1 4CEYC 1QJY3 5C4WA 1NCQC 1COV2 3J8F3 1QJU1 5A33B 3S6PA 2R063 3ZFFA 1PO23 2HWB1 4RQPA 1RUJ2 1OHFA 2RS52 1HRI1 4RHV3 1D4M3 5BNNA 5A32A 4GMP0 4CDUA 4GH4B 2WFF3 3VBSB 4CEWB 2R041 1K5MA 1VAKA 5C4WC 2RS13 3VBUB 1OOPC 2XBO1 2WS92 1TMF1 1FMD1 3ZFEA 3ZFFC 3VBHB 1RUF1 4RQPC 1RUD3 1VBA3 1R092 3ZFGA 5AC92 4IV1A 2XPJA 1VBD2 5BNNC 1NA1A 2R072 1H8TB 4CDUC 1NCRB 1BEV3 1QJX2 1K5MC 1PO12 4QPGA 1POV1 1EAH2 1QJY1 1BBT2 1ZBA1 1QQP1 1PIV2 4Q4X2 3ZFGC 2R061 4IV1C 1AR71 3NAPB 1GFF2 4RHV1 2WLPA 1D4M1 2RMU3 2X5IB 1HQNA 1VBC1 4RR3A 5BNOA 1AYN3 1PVC1 1AR93 2MEV3 4GB31 1BMV1 1E57A 4CDXA 4YVWB 4QPGC 2RM23 2RS11 1R1A3 1PGL1 1C8M3 1ND2A 2WZR2 4RS5A 2ZTNA 4AEDA 4Q4V2 4YVSA 1RUD1 3JB8A 2ZAHA 1RHI3 1QJU3 4JGYA 4Q4Y2 5BNOC 4Q4W1 2RR12 5C9AB 2HWB3 5ABJB 1MQTC 1HRI3 1RVF2 3JD72 4CDXC 5K0UC 1NCQB 4CDWA 1VRH3 1RUE3 1RUH1 5L7OA 2ZZQA 2HWD3 1OPOA 1ND2C 4RS5C 3JBG1 2R043 1HX6A 4AEDC 3J8F2 5CFDA 1ND3A 2Y26A 1AL23 1PO22 4IV3A 2BUKA 1FPN1 2HWF2 1RUF3 1AYN1 2MEV1 2PLV1 1MEC3 4N53A 4QPIA 4CDQC 5C4WB 1TME2 3DPRA 1RUG2 3TN91 5L7OC 2HWC3 1Z7S1 1RUI1 3ZFFB 4RQPB 5FOJB 1AYM2 1POV3 3VBOA 5CFDC 1X36A 5BNNB 5CFCA 1VBB1 4IV3C 4FTEA 1SMVA 1VBA2 1ZBA3 1R091 4CDUB 1RHI1 1QQP3 4N43A 1VBE2 1AR73 1K5MB 4N53C 2R071 3DPRC 1AR83 1VBC3 1BEV2 5ACA3 1PVC3 1VRH1 2HWE3 1RUE1 4GB33 3VDDC 1EAH1 2HWD1 3ZFGB 4IV1B 4JGZA 1POV0 3FBMA 1R082 1PGW2 1AUYA 3VBRA 1NA1B 4Q4X1 1EV11 1AL21 4N43C 2RMU2 2BFUL 4QPGB 1HXS2 1AR92 1MEC1 4FSJA 3JB4C 2VQ0A 4Q4W3 5D8AA 5J98B 1AR62 2HWC1 1RB8G 4JGZC 4RFT0 1ASJ3 1V9U2 1C8M2 1RUH3 1RMU2 1FOD1 5BNOB 3JBG3 1COV3 1MQTB 4Q4V1 3ZFEC 4PDWA 4GH4A 1QJU2 1ZBE1 4CDXB 5K0UB 4CEWA 3VBUA 1FPN3 2RS53 1HRI2 5D8AC 1AR81 1HRV1 3VBFA 1NA1C 1ND2B 1NY71 5ACA1 4RS5B 4EJRA 1F2NA 2HWE1 2PLV3 4AEDB 3M8LA 3TN93 1Z7S3 1RUI3 4NWVA 1H8TA 2RS31 2XBO2 4PDWC 4CDQB 1TMF2 2WS93 1FMD2 1DDLA 1VBB3 3IDEA 5LK7B 1R093 5L7OB 3VBFC 4RR3C 2R073 1A6CA 5BNPA 5CFDB 1ND3B 5DDJ1 1ASJ1 1QJX3 1RUC1 4IV3B 1EAH3 1QJY2 2BPA2 1COV1 4N53B 1ZBA2 1CJDA 3DPRB 1QQP2 4YVSC 4Q4X3 1EV13 2R062 2DF7A 4JGYC 1VBE1 1RUJ1 1B35A 2RS51 3VDDB 4RHV2 1D4M2 1VBC2 5BNPC 1PVC2 1CD3G 3CJIA 4GB32 4WM7A 4CDWC 1BMV2 5JZGA 2WFF2 2GH8A 5C9AA 4N43B 2RS12 1AL0G 1PGL2 4CEYA 2QQPA 1FOD3 1ND3C 2WS91 5A32B 1RUD2 4Q4V3 4FTBA 5AC91 5C8CA 1ZBE3 4JGZB 4WM8A 5FMOL 4Q4Y3 4Q4W2 1VBD1 3HAGA 4QPIC 1VB4A 1W39A 3CJIC 4WM7C 1HRV3 3JD73 5JZGC 4GMP3 1QJX1 3ZFEB 1PO11 1RUH2 1QJZA 2BFUS 3VBOC 1BBT1 3JBG2 1OOPA 5D8AB 5CFCC 1PIV1 2RS33 4Y4YA 5C8CC 4WM8C 1FPN2 2HWF3 3LOBA 1AYN2 2MEV2 2PLV2 1TME3 1RUG3 2RM22 4PDWB 5A33A 3TN92 5DDJ3 1Z7S2 1RUI2 1R1A2 1RUC3
chains in the Genus database with same CATH superfamily
4QHOA 2ZBJA 5FPLA 4BCUA 3WQBA 1Q8OA 2ZEZA 4QDSA 5FXVA 5G04L 1JZ2A 1UO9A 5IVYA 4FPJA 3DXTA 2E6VA 2W1WA 2EIDA 1RHI2 3JQWA 1L3JA 3OBZA 2IFRA 4XBNA 4B4QA 4CP1A 4OQ9A 2HWB2 2RR11 1CAUA 3AC0A 4MHRA 4AI8A 3HN3A 2PQSA 1RJ8A 2OZ6A 4AYUA 3H8RA 1RIRA 1DZTA 2K0GA 3ZKYA 1UMZA 3T08A 3ZN5A 4GMP1 2VUJA 4HSLA 1MS8A 3VBHA 1OT5A 1VRH2 5CKQA 3PTYA 3ILRA 4QB2A 1KITA 3V0BB 3WDYA 3N9MA 3UKNA 1FV2A 1SG3A 4QGLA 2R042 4M3CB 2VD7A 4QQLA 5FPXA 1R083 1JU4A 3J8F1 3MDPA 2ET1A 2PMWB 1O3SA 1XNCA 2YPDA 2I07B 3WDUA 3KQRA 4DXZA 4EWEA 1SEFA 4COYA 3USUB 3I3DA 5G05L 3AZVA 5AC93 1DBNA 1HXS3 1ULCA 1DGLA 4XCBA 2MNGA 2WQ4A 2VTFA 4W65A 1ALYA 4A7YA 1BXHA 1X7NA 1RL3A 1MQTA 2JDPA 2OVUA 4KGQA 4NAOA 3VBHC 4FP3A 3ACFA 1YIPA 2BV4A 4Q0SA 4KL1A 2J1UA 1J1LA 3SH5A 1H9PA 1EPWA 2VECA 5LBFA 5A7SA 1B35B 2X5IA 3BVCA 4FOVA 2EIGA 1PO13 2VMGA 1Q8QA 4HPKB 4R9BA 5A3WA 5T5LA 1AYM1 1FOD2 1RMU3 1VAVA 1XNTA 4M01A 2BVBA 1J3PA 1QH6A 2BNOA 5I0TA 4XIKA 5FBJA 1QJFA 5F5CA 1OC1A 3CJIB 4EV0A 4YVWA 1NG0A 3PU8A 3C7OA 4WM7B 4CP2A 4CA9A 5CKMA 1Y4WA 2ZX1A 1D4VB 2GMEA 2NM1A 2SBAA 3IPVA 3RZJA 4N7IA 1AR72 3HVDA 3JZVA 5FYYA 4XF1A 4CXXA 3E6CC 2YXSA 1S0BA 4XQDA 2OYZA 2X29A 4CEYB 5DZFA 3NL1A 4H2AA 5FZKA 1QOTA 2JWPA 4TLGA 4BE3A 3TEYA 2GP5A 2WO1A 1TVGA 1LR5A 4BB3A 5I8SA 1UYYA 1PZ9A 1W2OA 2X5IC 2E9QA 2DTWA 2DTYA 1STMA 2KD7A 1Y9QA 4CCEA 5ABJA 1I9RA 2JD9A 3K2OA 4ES9A 2YBKA 4YVWC 3LA7A 3RI9A 3LSEA 1JHNA 2ZEXA 1FMD3 4ES8A 2YFZA 1B35C 4Y20A 3I2KA 1X9PA 3Q8AA 4IGPA 4NWWA 1SDDB 1AR91 1AVBA 2YUEA 4UFMA 1BZWA 3FUOA 1O3TA 2VVEA 5FYIA 4CCDA 4KWLA 1OOPB 2OUHA 3HR9A 1S2KA 3MIFA 3VZOA 1RVF3 4A6SA 2ZGKA 1C8NA 4XYXA 2W39A 4CXWA 4MGYE 1LGNA 3VDDA 3LOIA 4XQ4A 1DYPA 5ABJC 1F9KA 1W8FA 2R1BA 3GJAA 4IERA 2NP0A 2R32A 4CEYC 2XH6A 4PI0A 1QJY3 1CAWA 4QQHA 2A6VA 1COV2 3LDBA 4D0QA 4ISQA 5DMYA 4XF0A 4MZUA 2RJKA 3QACA 4FFFA 2R063 4KG8A 2HWB1 5FKCA 1WCUA 4RHV3 5C3SA 1TNFA 2JDHA 3PLQA 5CVRA 4A44A 1VR3A 2BJSA 4P9LA 4LKDA 4A4AA 2WNUB 4A6OA 4GMP0 2D6NA 4EYUA 3LEKA 4EN0A 2XHKA 2VMCA 1I3HA 4YW6A 3E5QA 4D7TA 5T3NA 1IS5A 3OY8B 4CEWB 4I3GA 1YFWA 2R041 1W6PB 1N47A 1WLTA 2GC2A 3VBUB 2CU5A 2EXKA 3LPFA 4PLOA 1OOPC 2WAOA 4M4PA 2VW0A 3AKSA 4K6BA 3ZFEA 4AEMA 3NNMA 4AI0A 1RUD3 1O7FA 1AXZA 4I3PA 3HN1A 4HK8A 3EMRA 3ZFGA 3A23A 5CKNA 1MPXA 2E63A 1UPSA 2WZEA 1OLQA 1IQDC 2EF6A 3NVCA 5E8AA 3B7MA 1CPNA 1VBD2 5LK5A 3WG1A 1XOYA 5A6YA 2XLFA 1IQAA 4XXAA 5SV5A 1IG3A 1BEV3 1DZQA 3HNYM 1YFXA 4LKSA 2VCAA 1QJX2 3M70A 1HW5A 4PJYA 1POV1 4XFFA 3HBZA 1GZTA 2R0FA 2XJTA 1BBT2 5A7WA 3A22A 2WNUC 3KSCA 3HPNA 4CCNA 1ZBA1 2P3KA 4WVVA 4QPYA 4QB6A 3LGRA 1DQ4A 1YJLA 1PIV2 1NLRA 4QMAA 5IK8A 1CX1A 3ZFGC 2V72A 5DUVA 4B8EA 3AYEA 2NMNA 1LULA 1ZRDA 1AR71 2LALA 1HJGA 2VXJA 3NAPB 4BQ2A 3WG2A 4GAZA 4EN8B 1LOGA 3RG0A 4NIHA 3RGBA 2KA3A 4Y1VA 1VBC1 1J1TA 1GANA 1SLAA 4OI4A 4XAEA 5BNOA 3NV1A 4MVTA 3Q8FA 3VKFC 3ZO0B 3MLLA 2W0XA 1E57A 3PTRB 4XXPA 5E16A 2RM23 4QQ2A 4XPVA 2H0BA 3NV2A 4CP9A 1W6OA 1R1A3 1NZCA 4AVCA 1PGL1 2PHDA 5A1FA 4YSFA 4MO3M 1MS4A 1IS4A 2HYKA 2WZR2 4RS5A 4X6QB 3SXWA 2XJPA 2VQTA 1Q5OA 3BIWE 3SCHA 5F3IA 4YVSA 3JB8A 4HFSA 3NV4A 3OUJA 5HCHA 4KU7A 4C1WA 1BCXA 1WMEA 1MZ5A 2O8OA 5BNOC 4Q4W1 3PIJA 4JRAA 2XL7A 4NUBA 4LK6A 3AXEA 3OD0A 1HRI3 4XURA 5DN2A 3JD72 1DQ6A 5FLIA 1JXNA 2CSGA 2Y64A 4UBHA 4YARA 2JKBA 1GSLA 1RUE3 4G9SB 4B1MA 2P3JA 3I2IA 4NHYA 4QX7A 4LHNA 2XR4A 5GZDA 1OPOA 3KF3A 4RS5C 2P3YA 3JBG1 1W6QB 4S2DA 5BY5A 4DQAA 1SFNA 2ENRA 2GMPA 1JOBA 2FCVA 2JIGA 4B3NA 5C71A 3BKZA 1AL23 3THDA 4IV3A 1B09A 4X8NA 4XZPA 2HWF2 4AAXA 1UZVA 3OJBA 4CUCA 3B93A 4QT6A 2DDUA 3WXPA 2YPJA 2MEV1 3CEWA 1QU0A 2YY1A 4CDQC 3DPRA 3NJXA 5FK7A 4GA9A 4OLLA 3ZXEA 3RYKA 2OS2A 3H7JA 5FZ4A 1UY0A 4BMBA 3ZFFB 5L19A 1WA4A 3NKGA 2XKOA 1WD3A 2YGMA 3BN6A 3K46A 1EY2A 2O1QA 4NIIA 4FPHA 1KFUL 1ZYBA 3WF3A 4IV3C 1VBA2 4XBQA 3WOGA 3GBGA 4CDUB 5E6HA 1A8MA 4HETA 4RYDA 2JX9A 3EBRA 2EIEA 3IKWA 1S0IA 2V5DA 4Y3OA 1ZREA 3T1MA 2D98A 2VZPA 2FDGA 3QH7A 2AEYA 1POQA 2FDFA 3DPRC 2P1BA 3AXDA 4UBGA 1AX2A 4ASMB 3UV9A 2F4PA 2YB7A 4YPJA 1PNGA 2ZGPA 3AYCA 1ULDA 2VXRA 2W5FA 1W9TA 4DINB 4XFCA 1HLCA 3PNAA 5FZ1A 4YRDA 2OPWA 2HWD1 2VUCA 4JGZA 1POV0 2WC2A 1QDCA 3WV6A 4WV8A 1R082 1VJ2A 1N1SA 1EP0A 1W8ZA 2D6KA 1N1TA 3I49A 5F7UA 2JG8B 1UY1A 1NA1B 2HEYF 2J1EA 3VB9A 1I1EA 3POJA 2PA7A 1H2NA 5IYYA 5LA0A 4CCJA 2KM2A 3ILFA 3ZYRA 2R0HA 1FV3A 1HXS2 5DXDA 1MEC1 4ZS3A 4LE4A 1JZ3A 3RZKA 1RGSA 3FFQA 4HONA 4XHBA 2GP3A 2W3JA 1G7YA 2Y33A 3TAYA 5J98B 2I45A 1W6MA 3ES4A 3O0XA 4DB5A 1YIFA 3MEPA 4UW3A 4JGZC 2K46A 2Y60A 1OVSA 4RFT0 4TYSA 2B5HA 1C8M2 2QZ3A 1PNFA 1RUH3 2IVIB 1FX5A 1RMU2 3CBNA 4AEKA 2GU9A 1G9BA 2D44A 2ARXA 2JDYA 3TWIA 1GZ9A 1C1LA 3ZLIA 3MZHA 2RDNA 2Q0AA 1OA4A 1F4AA 3M4FA 1GMMA 3S30A 4LBQA 1PM4A 4MGTA 1URXA 3IIAA 5KHIA 2RS53 3J7LA 1AR81 1VMFA 2B46X 2RDQA 4NPRA 1XJAA 4XUQA 5E89A 3VBFA 1NA1C 1REFA 1NY71 2YYOA 1M4WA 5ACA1 3S57A 1IPJA 1GWLA 2E33A 3ZYPA 2PLV3 2XJUA 4AEDB 2C6SA 3IAPA 1SBFA 1ST8A 2R16A 1JYWA 1VMHA 3TN93 3GCXA 3KVAA 4AQTA 2Y8KA 1JYVA 2GNDA 3ECQA 1LECA 1H8TA 1SACA 1UMHA 2VNOA 3JXSA 3H8XA 1UWWA 4D6SA 1FMD2 4IEYA 4Y33A 4CU8A 1DDLA 1YXWA 2EA7A 3ZR5A 4Z8BA 5EJ1B 3BCWA 4OUSA 4Y1XA 1OLME 3VBFC 1H2MA 3FBYA 3AKTA 1ZZ8A 4RR3C 2ID4A 5DAVA 1LEDA 5BV6A 2D3RA 4NIGA 1W2AX 4BOWA 5K7PA 2R073 1A6CA 3GM8A 2G19A 4PHZA 1ND3B 2G9GA 3MIBA 4MLOA 5FWEA 4NRQA 4COZA 1AX0A 1ASJ1 3N36A 5I0UA 2JG9B 5FAXA 1GYKA 4R52A 2W46A 5DG1A 5FQ0A 5FZBA 5FPVA 5T5OA 3UJOA 1E5SA 1MVEA 4MG2A 2WZ8A 3IDAA 1QJY2 2GALA 2YU1A 2F6BA 3OGGA 3HD8B 3AVSA 3I2FA 3NWKA 4AF9A 2BQPA 5A3UA 4GKXA 4OI0A 2ZHKA 1UYXA 1QQP2 2UWBA 3D5OA 2C24A 3KWVA 2C26A 3AMQA 3MF6A 4IUGA 4Q4X3 3I54A 2R062 5EJZB 2DF7A 1I6XA 1WD4A 3INAA 4RHV2 4EN6B 4Q8KA 1FATA 2HJIA 5LB6A 1BK0A 4LULA 5EIYB 2YC0A 5KHKA 4OUMA 2MHFA 3PUAA 2DVBA 4M3CE 1K3IA 4GB32 3BALA 3KD4A 2PAKA 1IOAA 2X8KA 5H9RA 5CIRA 3I2JA 2V09A 1YCIA 1PM7A 5C9AA 5CNAA 4BU2A 3TEXA 1OH3A 4AHXA 3DEMA 2IVJA 3VL8A 4HT1T 3WW1A 5IVVA 1FOD3 1ND3C 4AHZA 3GYDA 2Y0OA 2W1SA 3RMYA 1RUD2 5AC91 2HLEA 2J1AA 3F95A 5HV0A 4WM8A 2ZMLA 3OPWA 4NHLA 4Q4Y3 4DY5A 5CG8A 3HAGA 4JDNA 4QPIC 1L7LA 1VB4A 4MXWB 1OBNA 2AACA 1SCRA 4ZKTB 2HBUA 2XVGA 1UZZA 3OF1A 4XDOA 4FBFA 4DFSA 4DEVA 4XHXA 3OPZA 2A5ZA 1LAJA 2CNAA 2Q30A 1PO11 2AYHA 3FUQA 5FP3A 4WZFA 1YC61 3VBOC 4DIQA 1XNBA 4YZ3A 5D8AB 4BQYA 5BNQA 2E7QA 5CFCC 2H0VA 2ADEA 2G1MA 4LOTA 4Y4YA 2PHLA 4Y1ZA 2XVKA 3NV3A 5IUQA 3WINE 3WY6A 4K8FA 5JSOA 5M0TA 4KWJA 4WM8C 5FYTA 1FPN2 3ASIA 3PU3A 5FY8A 4D8MA 1KD7A 5JXJA 1G9DA 3WQ7A 2VOTA 2YBPA 5H9PA 2VZSA 4TLFA 1UMIA 2VZUA 3KCCA 2AZ5A 1WMDA 3AYDA 4XMAA 3VD5A 2RM22 3RQ0A 1LGCA 1NE6A 5FZ3A 5CG9A 2B4KA 1Z7S2 4I09A 5T5JA 1RUI2 1RUOA 1R1A2 4LXLA 2VCMA 3IDBB 2FDKA 1LHUA 1Q3EA 4LNVA 4GJZA 3VBRC 1ENXA 3KHBA 4D94A 3ABZA 5JR7B 3C3VA 4GZ9A 2XOMA 1VBB2 3E1F1 1CPMA 3HQRA 3R0RA 4IEOA 4LT5A 3VBSA 1YRZA 5FDBA 4IEPA 1REDA 2WL1A 4L11A 2FHRA 2W92A 5DPNA 1FYUA 2XDVA 5FYCA 1RVF1 4AGGA 5IK7A 3M3IA 3VKOA 1GICA 4V2WA 4E8DA 3HT2A 5FZOA 1DLCA 1RUE2 1EUUA 1GNHA 3CJXA 5DUWA 4O65A 3L9JT 1O4TA 1V6MA 3KGZA 4H3WA 4K1YA 2BERA 1IKPA 5FO7B 1LOFA 1N3QA 3Q8BA 4JGYB 2CY6A 5IAXA 2JDZA 1MZFA 4NVPA 3OGVA 4DMIA 5KXEA 3JUUA 2TBVA 1NCRA 3LKJA 4QKNA 3T2OA 3VZJA 5BNPB 1AL22 4GH4C 3VBSC 2V73A 1C28A 1CJPA 3SLIA 2J1RA 4RGGA 3RZLA 3B5LB 2Q8OA 3T4HB 3ZXAC 5J09A 4CDWB 2XMLA 3A21A 2WYSA 1BK1A 4CCOA 4WBBA 1H1MA 4BXSV 2Y6HA 1V6NA 2XUMA 2ZJCA 4Q1RA 3J4UH 4XVHA 1TME1 2VZOA 1VBD3 4E4SA 1RUG1 1HV0A 5K0UA 1WCDJ 4HXCA 1W8OA 2ILMA 2XVLA 3ZIWA 4BK5A 5JSPA 4Y1UA 4CPBD 3TEZA 1AR63 5K8SA 3C7FA 1LOFC 3GALA 1UOGA 4LO4B 2ZGNA 1LOBA 1CAVB 2YG0A 1GNYA 5IW0A 1NCRC 1XNAA 2IXHA 1YUDA 4Z92B 3O5SA 2E26A 1BBT3 2MPFA 3MFCA 1W2UA 3AMPA 1W2TA 3LIGA 5CBLA 1H6YA 1PIV3 1ZBE2 1I5PA 1RC6A 5FY5A 4D7SA 2WRAA 3WG4A 3ZXGA 2EIBA 2P2KA 1UU5A 3WVJA 3SISA 1UX6A 3AZYA 3MIEA 1X9TA 1BEV1 2K9ZA 2P3IA 2ZGQA 1N1VA 5L9BA 3DKWA 3X29B 5JMOA 1Q8VA 2OIIA 1DCSA 5GZFA 3DXUA 2Y34A 3MUY1 3O14A 4KWUA 4AZZA 1JODA 4WVMA 4LUMA 2A3XA 2RJ2A 3V56A 5FMOS 1PGW1 5CEHA 1GUIA 2PTMA 4BQXA 1I5ZA 4Y5TA 2WN3A 3B01A 1NCQA 2WZR3 1QHDA 3G6JB 2B45X 3JCIA 4QX5A 2YHJA 4N7UA 4HG6B 4QX0A 1JUIA 2DCYA 2PELA 4A45A 5FPUA 2QVSB 4O61A 3BTYA 5CA6A 4RL7A 1UX7A 3VUOA 2FCTA 1OD5A 5CZKA 1PK6C 2IXCA 4IE7A 2RM21 4AHWA 1H1IA 3H0OA 3LDKA 2WWJA 5A6QA 5FV3A 1JYXA 5FJKA 5JUVA 3AMHA 4E2SA 1R1A1 1NOVA 1V9U1 2VL4A 1QKQA 1RUC2 1U5IA 2YBSA 3H9AA 3GNEA 3MW4A 2OZJA 4I0WB 1LHNA 5FO9B 1W6NA 4HZFA 1NCQC 2JENA 2GMMA 4GWJA 2W95A 5H9SA 2O0OA 2ZHMA 4NRMA 4OMCA 5LBCA 4YGEA 4COUA 5FY1A 1HB4A 3NNJA 4UWDA 5A33B 2P17A 4PBOA 3T09A 3GDBA 2W2IA 1O3QA 5HXVA 2RS52 4L0PA 1HRI1 4XJWA 4S2HA 2YMZA 2WZPP 3I2OA 3B94A 1Y43B 1CZTA 3MIHA 3ZSKA 1U5ZA 5BNNA 4XFHA 4NIDA 1JOPA 1QXRA 4BJ0A 1J3QA 5JXIA 3VKNA 3ZYIB 1UYZA 2R6QA 3FFZA 4FAHA 1W3VA 4FPOB 3RNSA 2PHTA 1Q8PA 2RS13 1CAUB 1GR3A 3CKHA 2XBO1 1TZOA 1G86A 2LTNA 3LQCA 3MV01 4QXHA 4XUNA 3ZMOA 1TMF1 5JLVA 4P5HA 3T0BA 3VBHB 2OPKA 4LO7A 1XU1A 1VBA3 2VMEA 5DG2A 1AZDA 1BQPA 3ALQA 4GJYA 4IV1A 4JHTA 5F2WA 5FYZA 4A3ZA 3HNBM 3WLUA 2BOIA 5BNNC 4IE0A 3RYRA 1F31A 5HXMA 2R072 4JDMA 3WG3A 1NQDA 5FZ6A 5A3NA 4K40A 3TB0A 3JQXA 3VKLA 2ZGMA 2X10A 1KS5A 3THCA 1J59A 5GM0A 5JR2A 5KC5A 1WKYA 1VALA 1AXYA 3P3PA 4GXLA 3J7NA 1G6NA 4FQ4A 4J25A 5KHGA 5C33A 4I01A 1KGYA 3OEBA 4YW3A 4C0HA 4N9IA 2QCSB 2GH2A 4YGBA 1UPIA 2CV6A 4Q4X2 4IV1C 5F5IA 1KFXL 2QQNA 3POYA 1GFF2 2WR9A 3RWNA 1TE1B 2GNBA 5JCTA 4OHYA 1D4M1 3WP3A 5GJ6A 2X5IB 3KV5A 5L9RA 2PFWA 4FPKA 3MIGA 1HKDA 5F9TA 3SCGA 4PI2A 3IWZA 1EYBA 4W6YA 2ZEYA 1BMV1 4QKDA 4YVWB 1LENA 5JWPA 4TWTA 3HQXA 3IPVB 1GQGA 3MUZ1 3HEIA 4B7EA 4IE4A 4MX3A 3ZSEA 1C8M3 1C4RA 2VNRA 3C7EA 3GJBA 1XYOA 4N90A 1UAIA 3BPZA 3PJQA 3PUSA 2PHWA 4P02B 4XILA 4AEJA 2BRTA 2ZEWA 1YFUA 2QQUA 4LO6B 3ZPOA 2QQKA 3CQOA 5SV8A 3AZXA 1US3A 2ZAHA 5C6CA 3AMMA 3LEMA 2RG4A 4Q4Y2 4BLJA 4OCTA 2B39A 3LFMA 5ABJB 5J37A 4GIQA 1MS9A 1MQTC 4AVAA 3V0AA 2B9UA 3VD9A 1P8JA 5J7MA 1YQ2A 4HVRA 2BGOA 2UYAA 4LTAA 2LRPA 5FZHA 3WNOA 5C5UA 1ZA7A 3USUA 1RUH1 3IT8A 2WT2A 1HQLA 4COWA 2ZZQA 5IVEA 3BB6A 3AX4A 5I91A 4XACA 3D4KA 1WW6A 2W68A 3BYWA 3FN9A 1JW6A 2C1FA 4QKFA 1GOFA 4OYUA 1S0JA 3IMMA 1QXPA 3KMHA 1PO22 3APBA 3MPPG 1YHFA 2BUKA 3BTAA 4P9WA 3ZMNA 4HPKA 1WW5A 1KDKA 2WNOA 4YWAA 2WDBA 1PX4A 3G7DA 1AYN1 4LHLA 3VN4A 2QTWB 4BM8A 2PLV1 4XF3A 1SBEA 3E97A 3AB0A 2P37A 4DRVA 2VAUA 2AC1A 4OFGA 3K48A 2VBPA 4IE5A 3TN91 3AP4A 3RI8A 4DNYA 4LE3A 3T2PA 2HWC3 4Y22A 1H6XA 2XWBB 2Y6FA 3FWEA 4J1WA 1TG7A 4ZY9A 1XE7A 5H9QA 4XEZA 4FOQA 5DAPA 4AQSA 5F37A 1C5IA 2BU9A 1SMVA 1W8HA 3UNPA 1RHI1 1QQP3 1RXFA 4QPWA 2VMHA 2JECA 4L97A 3LFIA 2R071 1CQ9A 3POEA 4FCAA 4KU8A 4LBKA 2G9ZA 2HWE3 1VRH1 1RJ7A 4QX2A 1UN1A 4GB33 4R9CA 3VDDC 1F5JA 5C70A 4MGSA 2A70A 1JZ6A 3ZFGB 4AI1A 4PT6A 5AFEA 3MW2A 3NMBA 3FX3A 4LO5B 4YW1A 3BUCA 3KM5A 3LDRA 1QXJA 4IEVA 2BP6A 4Q4X1 3GXUA 3LZZA 4B7KA 1H1AA 4XQWA 5HCAA 3WEZA 2VMDA 4XMIA 1SDWA 5ERLA 1V6JA 4JKLA 1S0DA 3M1HA 5JPMB 2RMU2 1OMIA 2W94A 1NLQA 2NQYA 3ES1A 5JOWA 4FSJA 3N7KA 3UGFA 3I8TA 5A7WB 1MACA 1Y9GA 2Q1ZB 4QU2A 3ACHA 3KVBA 3Q8CA 2CAVA 3AFGA 1AR62 1DQ5A 3GZAA 5LZ6A 5CYYA 2C0ZA 1UKRA 4M4RA 1U12A 4OMDA 4QM9A 2VTXA 5FK8A 3ETQA 3T3YA 2G9FA 4YG0A 4AQ2A 1A3KA 1FOD1 4GKYA 2Z2SB 4HL0A 1Q8SA 1MS0A 4QX8A 2VOWA 5BNOB 1G9CA 4BZ4A 3ZFEC 1QJEA 4OUEA 2P5BA 3VHRA 4PDWA 1QJU2 4CEWA 3WHUA 4ZU7A 4E4HA 1WZXA 2UWCA 1W6PA 3U4XA 2QQJA 4QHBA 2XQRA 3CL1A 3VBUA 4CP9B 3M3OA 2X05A 1V00A 3N4MA 1FPN3 5D1IA 4KQ7A 1ZZCA 1S55A 3AL6A 4AG4A 2DBIA 3IN9A 3MFAA 5JOXA 4RS5B 1F2NA 3HJRA 1CIYA 4IXLA 3UK9A 4GULA 1CESA 5IWFA 3VD4A 3BIEA 1UYPA 1ULFA 1Z7S3 1MVQA 1RUI3 2GC0A 2BWAA 3ZXJA 4NWVA 5EQUA 5JVVA 3QCWA 3WDVA 2QDRA 3O1PA 4PDWC 5HCBA 2PAEA 3OOXA 1SLCA 3PURA 4CDQB 2VNVA 2VZ1A 1RITA 2UURA 2WS93 5EFUA 3WF4A 4B1LA 1VBB3 3O1RA 3VD7A 3K4ZA 1R093 1ACCA 3A0KA 4O9EA 1UZWA 1NQJA 3R4SA 4UF0B 3T1LA 3D6EA 4YW5A 4AW7A 5A3PA 2DFBA 2FQPA 3CDZB 4MH0E 1YJKA 3ZVXA 1VRBA 1XSQA 1OQDA 1EUTA 4IV3B 4Y5SA 5DQ0A 4BQ3A 2XXZA 5B2GB 4PLMA 1V6OA 5FP7A 5KBFA 4S2GA 3H50A 4KBBA 1COV1 1J3RA 1O91A 3DPRB 4JDOA 2NYYA 4YVSC 1WCKA 1SLBA 4CSWA 1SLTA 4IEWA 3FC0A 1DGWA 3POBA 5K4LA 1QH7A 1JH5A 1GOHA 4QQPA 4XF9A 3FHQA 3KQ4B 1PVC2 4XJZA 4ZU5A 5A3OA 5C7GA 1IZ3A 3D0JA 1HB3A 1MS1A 3IBMA 4JQTA 1TNRA 4FPEA 4UT5A 4B4PA 5JZGA 4TTGA 4CXYA 1UXXX 1OKQA 2R30A 5I0RA 5JAXA 5LRSA 3N7LA 3UKTA 4LJHA 2RS12 1AF9A 5FZFA 5JSRA 2WN2A 3WNNA 3VDBA 1H8VA 2C5DA 2QQPA 4W6WA 3SNMA 2JE9A 1U0AA 4FPCA 2PHRA 5EV7A 5A32B 3FMGA 4FPLA 4Q4V3 5FFOC 4XAAA 4F7ZA 1S4CA 3ZYHA 5C8CA 2AR6A 1ZBE3 3H8UA 3P5BA 3POFA 4JGZB 1JZ5A 4PIYA 4ASKA 3QD6A 1VBD1 2X53S 2I74A 5IK4A 1NLSA 2PQQA 4IQPA 5JZGC 4Q29A 4YZ2A 4AI2A 4GMP3 2JDUA 2FDJA 1QJX1 1X50A 4QDRA 5LEJA 2DU1A 1F5FA 1NE4A 3H1WA 1QJZA 3MICA 4NE9A 3NW4A 2BFUS 2DCTA 1UD1A 1BBT1 4NR1A 3I3EA 3POGA 1ZZ7A 3LIHA 1LESA 1PIV1 4PIZA 3AP7A 3LE0A 3PMSA 4Z1VA 5C8CC 3RYPA 1W6MB 3V64A 1S0EA 2X09A 4AE2A 1W04A 5KXBA 3O1SA 4LKFA 4BISA 1NT0A 1GBGA 4FPYA 2BYVE 4P5YA 3LOBA 5HI0A 1CZSA 3PDQA 4K1ZA 4AL9A 4ZHNA 1W99A 3KV9A 5F5AA 1OH4A 5DZEA 1S2EA 2CGNA 3GCWA 2JDNA 3U75A 1LJ7A 3KF5A 4LA3A 1OPMA 3KV6A 3GBWA 4FAGA 4LBQB 3VLBB 4EZHA 1RUC3 2NZ9A 2VVFA 5K9YA 2HEWF 4YYOA 2WZR1 4QWNA 3JU9A 1AYM3 3VBFB 5J1XA 3NQHA 3AL5A 4MOAA 1OKOA 2Y38A 3DYPA 4RR3B 3ZM8A 3OTFA 3POIA 1FNZA 2ARCA 2R49A 1F8VA 2JEMA 3CLPA 4I2OA 5AVPA 1YNAA 2WABA 4Q0UA 5IATA 2OKXA 5D21A 3K51A 4LLFA 4D6QA 5FY9A 3JD71 1J84A 3E5UA 4JTOA 5FR3A 2ZXQA 3EXUA 5T55A 3OYWB 1AJOA 4J1XA 5HV4A 3ZXDA 4GALA 1U5XA 3AP6A 3ROUA 2VPVA 3OB8A 1ZNPA 3P6BA 1JZ4A 3B9CA 2CL2A 2VJXA 2JDAA 4GWIA 4HSJA 2ZPXA 4Q5OA 3ZXLA 3O1OA 4L9BA 5FKBA 2VUAA 4H7MA 2Z42A 1ULEA 2IFWA 3J9SA 3U07A 3ZN6A 4MSVA 1IG0A 1EV12 2D40A 5A1AA 2KXLA 1VB2A 3AMNA 3I59A 1GP6A 3WW2A 1WLCA 2VTXJ 3AP9A 1YQ6A 1S0CA 1YQ5A 3ETPA 3M3QA 1QIQA 2HWF1 3K75B 5FQ0B 3EHKA 1ENQA 1O59A 5EWSA 3NNLA 5J96B 4FTSA 3MW3A 1QGLA 3WP6A 1L7QA 1AJKA 3MLKA 3N9PA 3QLQA 3UYJA 2HWC2 1F35A 1S0FA 1LU1A 1KQRA 5FCCA 2QKDA 5FREA 2VO5A 4ZXKA 1GZWB 2CWMA 5FBZA 3W59A 1H8TC 4C0BA 4Y5Z0 1X33A 1XXNA 5EHDA 2BTVC 5CAZA 2CGOA 4MADA 5EJ3A 4QPIB 3OG2A 1VBA1 4WZCA 5I0SA 1C1FA 1CGPA 2Q1MA 2WWSA 2ZZJA 5FRAA 2BBVA 4N8MA 1LCLA 2EXIA 5T54A 1VPHA 2BNMA 2ZKLA 1HRV2 4KI5M 5FZ7A 4UW5A 2ES3A 2NPIA 1KEXA 3DN7A 3O0VA 3VBOB 3RMXA 2HWE2 4YW7A 3AZWA 1X8MA 4OHZA 1HN1A 4HMZA 4SBVA 4YM2A 5CFCB 1UCXA 2WINB 3VZLA 4W6XA 3UJQA 5A1LA 2AREA 3N35A 3RPQA 1D2QA 4WM8B 1R081 2XJSA 5DAXA 4XZUG 2QNKA 2GC3A 4A7ZA 2A6XA 4LITA 2RS32 4HLTA 4UFIA 4NN0A 2JG9A 5GKAC 4AAPA 2ZX3A 1W8UA 4NPLA 4CU7A 2XONA 1HXS1 5AVAA 2IUWA 5FOBB 1DGRN 3F2ZA 4UOJA 4ZONA 1JZ8A 4OQ8A 2PXJA 2WYFA 3E5XA 4XW3A 3U37A 3U11A 1O3RA 2FZ1A 3B69A 3NKTA 2B7YA 4YM3A 4FFHA 4BIOA 5F8PA 3CF6E 1WCSA 3VBRB 1HDKA 1SLIA 4FOWA 5DDJ2 2VBBA 4BH9A 4QXKA 4E27A 1V6KA 1UIKA 4JRLA 4YGDA 3VZMA 5C9AC 1C8M1 3BI3A 1OFNA 2A3WA 5I93A 1RMU1 4AFCA 2VY0A 5IK5A 5C4WA 4LA2A 4W50A 4A41A 2YU2A 5KR7A 2YDEA 4AWDA 2VNGA 1XYNA 1JYNA 4NROA 3SEPA 4E4ZA 1C57A 1DHKB 4CU9A 2E53A 3S7IA 4IGOA 1PO23 2Q4SA 4RQPA 1RUJ2 1OHFA 5IVJA 4ASLA 5FUNA 2XUEA 3VZKA 2A1XA 3M2MA 5FJHA 3EQEA 4FOYA 3WSOA 4QXCA 5FYBA 3S0MA 2DYCA 2XJVA 4H7LA 3ZDVA 1JUHA 2YC4A 5FLJA 2B42B 1GWMA 4LBOA 3O12A 3SKJE 4GH4B 2WFF3 2ZGOA 3SH3A 3VBSB 4YZ1A 1GWKA 3NO8A 3RSJA 1K5MA 1OUSA 1VAKA 4LKEA 4RFRB 4XTPA 5C4WC 2A6ZA 4JKKA 1CAXB 4ZZ8A 1OD3A 4FPGA 5JIAA 2VW2A 3K77A 5EPAA 2BPA2 2WS92 3EB7A 4UI9L 1FMD1 4BWOA 5A70A 5FZOB 1LTEA 4RQPC 1LB2A 1DIWA 1RINA 1R092 2TNFA 1N3PA 3BPSA 3I2GA 4K20A 4Z07A 1WBFA 2FD8A 2XPJA 4M3CF 4GWNA 3ZPYA 2A6YA 1BYHA 3IDCB 1N3OA 5JDBA 4LBNA 1MS3A 1JYIA 1D0HA 2QQVA 1IPSA 1RTVA 1NCRB 2ZMNA 4ONUA 2R7EB 5FZ0A 1Q56A 3MYXA 1K5MC 2E7TA 2CWSA 4UAPA 1NAEA 2W91A 4QPGA 3LA2A 1GV9A 1CX4A 1NXD1 1QJY1 3VDAA 2VE1A 1PX3A 4JVAA 1CWPA 2DCZA 4URAA 3CZJA 2UWAA 3HNMA 1QQP1 3BODA 1QY4A 4V2VA 1CN1A 2FCUA 2XB6C 2ZGSA 2R061 4JV4A 4NO4A 5F6LB 5GLWA 4RSUA 3ST7A 3TNQA 1OSGA 1GP5A 2ADDA 2VBDA 3NJYA 4MGIE 5GLTA 3WNXA 4RHV1 1SBDA 2CTVA 2WLPA 3U10A 2RMU3 1BKZA 1HQNA 5IAVA 2UY8A 2XWJB 2MEV3 4GB31 3WUDA 2WT1A 4CDXA 2Y6GA 4NAMA 4QPGC 4V1PA 1LKNA 4XJ8A 1PZ7A 1J83A 5T50A 4QU1A 5F2SA 1ND2A 2VZQA 1LHVA 3B00A 4MYEA 3WP5A 4IW3A 4YW4A 1T6BX 3T2QA 1GNZA 2JDMA 2QBXA 5CISA 4Q27A 4Q4V2 5D2AA 1RUD1 1PK6B 1XRUA 2C4XA 2D5HA 3ENRA 3MO4A 3OGSA 5FYUA 1V6LA 3ZYJB 2BBAA 1QJU3 4EN9B 2O14A 4JGYA 1W2NA 2W52A 4MUVA 2ZGUA 5FZLA 4XETA 5FYMA 2RR12 1Y3TA 2A71A 2DUPA 1GOGA 1NXMA 2TEPA 1JS9A 4XUPA 4BPZA 4CDXC 5K0UC 2YC2A 1NCQB 2IXLA 4R8HA 4CU6A 1MZEA 4R4ZA 4CDWA 2EVXA 2BW8A 2P4EA 5IFTA 1W8WA 3PUQA 4P08A 3NSTA 1N1YA 3FLRA 5L7OA 5F6KA 2HWD3 1H2KA 1FNYA 1ND2C 2IC1A 5LCWL 3S5AA 3OUIA 1HX6A 3NRUA 3J8F2 5CFDA 3DECA 4OI2A 2V4AA 2Y26A 2PAMA 2QE3A 4LLOA 1ENSA 5HBAA 4BYYA 1ZRRA 1LOEA 2QJVA 1FPN1 4JC1A 4IEQA 2W9XA 2AGSA 1VAMA 2VQUA 1RUF3 1YQCA 4G3YC 4XBLA 3GZUC 3RZZA 4AQ6A 2OA2A 4NHMA 4ARYA 5JMCA 4H55A 4XOGA 4ZU4A 2QFEA 1BLZA 1W6NB 2QDNA 1MEC3 4N53A 3WF1A 5CADA 4QM8A 3MIDA 5GLZA 1XC6A 1DZRA 3VKMA 5LBEA 3ACIA 3OBRA 2WLQA 4NOTA 3LB9A 4K8RB 5L7OC 3U0ZA 1Z7S1 4JTNA 4F3JA 1RUI1 3R05A 5FZDA 2FMYA 1R1ZA 2ET7A 4O9GA 2E31A 3O7OA 4DY3A 3ITQA 4IL7A 2CGPA 1AYM2 2J7MA 3EO6A 1YO8A 2VVDA 5CFDC 3KZ4C 2ARBA 5FZCA 4D7YA 2D97A 5L36A 3AKPA 5BNNB 4ATEA 1VBB1 5LBBA 1DU3D 3BTZA 4FTEA 1H9WA 4FVVA 1R091 4YLZA 1MZ6A 3W21A 4BQWA 4YM0A 2DUOA 5LRRA 4INDA 4N43A 5BPXA 3WDTA 3IZOA 1US2A 2Z4FA 4N53C 1XQNA 4OHWA 3ZSLA 4ZZ5A 1UU6A 4MHUA 1AR83 1IPKA 1WMXA 5ACA3 1PVC3 4LBJA 3WDXA 1RUE1 4CP0A 2XJRA 4U36A 5KHJA 3EYPA 1XB9A 4QD2A 3R4DB 4H14A 4IV1B 4NJ4A 3UETA 1W9WA 4RD7A 1PVXA 2OX0A 3FBMA 2DUQA 4P9YA 5FZAA 1PGSA 3PL0A 4XF4A 5FWJA 3C2UA 1AUYA 1S1AA 2VZTA 3LEIA 5FUPA 4RGAA 1AL21 3CNAA 4WVZA 5F5QA 1JOJA 4OHXA 2ZA9A 1Z78A 4N43C 1XE0A 2DURA 4E2GA 5I8YA 3SHRA 3CZUA 4LBQD 3PIGA 3TBDA 1ZM1A 4JZRA 2OT7A 1AR92 5GZEA 1SPPA 3RFRA 3KB5A 4DXTA 2DVFA 4ISRA 2PHXA 1Y7BA 4Y4RA 3KV4A 2YGLA 4L92A 1LODA 1UF2C 3ZX7A 2Q8EA 4KNCA 1ASJ3 1WUVA 1OLRA 1W90A 3GF6A 1W9YA 3OBTA 5A6ZA 4R4XA 5CU1A 3E6DA 4Q0VA 3T0DA 2WNVA 4FT8A 3NNGA 2Q5TA 3MI8A 2W08A 1MQTB 3EJKA 4Q4V1 1AHSA 2CDPA 3HOBA 4XABA 3VHNA 4AVVA 1OLMA 1S0GA 3M7AA 1ZBE1 1GKBA 1GQHA 3PVOA 4O7XA 5A7NA 1APNA 3D82A 4K9SA 2VMFA 1VLNA 3I4IA 4PF5A 3M3CA 5I0DA 4IEUA 4GQ7A 3OGJA 2VZVA 4XDPA 4EJRA 3WCSA 1OUXA 4AI3A 1LHOA 1PMIA 2OW4A 3FE5A 3NNFA 3BU7A 3K3OA 1CVNA 4EE2A 2RV9A 2NLRA 2E51A 1DFQA 4CE8A 2VH9A 3LF7A 2GDFA 2HBTA 4DEQA 2VULA 2WNVC 1WWYA 1CONA 3AK0A 3V0AB 4LR4A 3URFA 4YNIA 4HKLA 3SQOA 1IS3A 4RN5A 3FHAA 1JHJA 1TEIA 2RJLA 3V0BA 3IDEA 1VMJA 5LK7B 1K5JA 3ACLA 2QQIA 1DG6A 4QXBA 4M3CA 3USSA 2VZRA 1IGOA 2XKPA 4FFGA 3K4AA 3ZXFA 3ORJA 3U4SA 4C1XA 1GU3A 1K42A 3WNPA 2D3SA 2ZX0A 4P14A 3RZHA 3ATGA 5FP9A 1YI7A 1JZ7A 1RUC1 4XTMA 2C9AA 1ZVFA 1FAYA 1FXZA 5J48A 3WW4A 3WHTA 3J7MA 4RGKA 3R4UA 4Y20B 3ZYGA 1EAH3 5FXWA 3OUHA 4XUOA 4META 2WSVA 1ZBA2 4HKOA 3TEWA 5JPNB 1HJFA 2A7AA 2XG3A 5FYHA 1EV13 5FXZA 3MPBA 4TXWA 2OQ6A 1W05A 3AYAA 3W5MA 2EAKA 4Y22B 1B35A 4DS0A 2RS51 2V5YA 3VDDB 1LRHA 2D7FA 3I2HA 2JB8A 4FI9A 4M0NA 3RWKX 3S5QA 4DUWA 5AFBA 3W5NA 2ORXA 1VBC2 2BNNA 4PQQA 3I3MA 1CAWB 2Y6LA 4LQRA 3CJIA 4A42A 2BWCA 4OZOA 4WM7A 3I97A 3OD4A 2WKKA 2WFF2 3POSA 2GH8A 1O8PA 2ARAA 3B9IA 1PGL2 3A7QA 4CEYA 2O8QA 4KH9A 2JIJA 3WF2A 5C3RA 1DGWX 4QQOA 5ANQA 2ZHLA 1G9AA 3LA3A 3ZN4A 4BIFA 1V70A 3MF9A 2D6LX 2P34A 2W87A 4JCKA 5JOZA 4DO0A 5FPBA 1XNDA 2TUNA 2GC1A 5FMOL 5FZ9A 4Q4W2 5IHRA 2A75A 2P6HA 1DF0A 1W39A 3CJIC 2W1UA 2A73B 3ILNA 4WM7C 5DZGA 1HRV3 5GLUA 4D3WA 2IXIA 2XGXA 4K7JA 2Z79A 4QX1A 3GGLA 4MGKE 2XLAA 5FZEA 5FPZA 3ZFEB 2F17A 1QEXA 4XJUA 4D69A 4XFAA 2LUWA 5F3EA 1OFSA 1UOBA 3HBKA 1K12A 2RHPA 3JBG2 4HANA 2ERFA 1OOPA 2L9LA 4IEZA 5LY1A 4AGRA 3PUIA 2RS33 4UFHA 4CYDA 4EWAA 2B9VA 4BXFA 2Y6KA 2QQLA 1QWRA 1W0NA 3FJSA 4KGGA 3VDCA 3LAGA 2WAAA 2DU0A 3ZSJA 5FP8A 4W4ZA 2MEV2 2ETEA 3SH4A 3WDWA 2E32A 1TME3 2B8MA 2Y6JA 1O4ZA 3N3HA 1RUG3 4PDWB 2QQWA 1JI6A 1V0AA 1W8NA 5DDJ3 1O4YA 1XE8A 3UESA 5JI9A 3TRSB 4XJAA 3IIIA 2CAUA 2ORZA 2Y0IA 2WNUA 1U5YA 1GP4A 4PIXA 2DCKA 3MHZA 3CHXA 4XFIA 4DRRA 3N9QA 2J22A 3DL3A 1QDOA 3OY8A 2DVAA 4K3UA 4Q4Y1 2LM3A 3PUHA 4YZ5A 2VU9A 1D2SA 1VBE3 1NYWA 1RUJ3 1W6OB 3A0NA 1H0BA 1ONAA 4A2UA 2EAAA 3DCQA 2N7GA 2FDIA 2FZ2A 2PHUA 3KS7A 4LK7A 1Q43A 2JJ6A 2VCBA 3Q9OA 3RJ2X 2A3YA 1XU2A 3VL9A 4DUVA 4OULA 2J1VA 4YVSB 1PMJX 2HWD2 1UW8A 4XCAA 4NHXA 2LS6A 5F32A 1NZIA 4MXVA 2WA3A 2ZX4A 3IB3A 1LNSA 1G8WA 4ORFA 4QKBA 3ZKUA 2K2SA 1JBCA 1M06G 2ZGRA 4YFWA 5FZMA 1PO21 5KHHA 3RS6A 3WNKA 4CEWC 3TYJA 4I02A 4XUTA 1RUF2 3VBUC 4OHVA 3DUIA 2EXHA 4ET7A 1O6UA 3PJYA 1KXGA 1MEC2 1UU4A 4J6GA 1YWKA 3CMGA 1OA2A 2GN7A 5GZGA 2HH9A 2WFF1 1QNYA 3O1UA 4MGZE 3D3AA 3R6SA 1VIWB 3NAPA 3ZOIA 4YGCA 4W8JA 1SQ4A 1V9U3 3ZYBA 5FUIA 3ZXKA 2Q8CA 4JQRA 3T2TA 3PMEA 5C3PA 2Q8DA 1S2BA 2GSYA 2DVDA 1YYNA 2JXAA 5KC6A 1LGBA 2FDHA 4L8QA 2Z5WA 3N9OA 3ME2A 4B29A 2D3PA 4UW6A 2AEZA 5JZGB 1DQ0A 2JD4A 5A6XA 4FXKB 2AENA 3TOJA 2IZWA 4CCKA 1MR5A 3RDIA 3DV8A 4Q8LA 1UY3A 3UKVA 5EYXA 4U2AA 1AR82 2JKXA 4AFBA 1PZ8A 3BGAA 4UW4A 1NY72 3OPTA 2XQXA 4CDQA 5ACA2 1K45A 1ZRIA 3NAPC 3S7EA 4CPBA 5FY7A 5A3TA 4QGNA 3KT4A 4Y24A 4CZSA 3RZMA 2HKXA 4UF0A 5C8CB 4LIUA 1IKQA 4UFJA 4BA6A 3PVNA 4M0HA 2CDOA 1H30A 2WBKA 2YZ4A 4P00B 5JI7A 3W9AA 4DZGA 4EN7B 5ISLA 1KRIA 4Y1YA 1IHMA 2RE9A 1SHWB 4WVWA 2BGPA 2XBO3 4X6RB 5A7OA 1OQ1A 5TSWA 1TMF3 3B3QE 4ZPIA 2RMU1 5J36A 1LHWA 3WX5A 5JXHA 4ATFA 3N9LA 2D93A 3NJVA 3OSDA 1W6QA 4PLNA 4AVTA 2RR13 5ANNA 1WBLA 1T2XA 2XL9A 1Y9MA 2Q1FA 3RZGA 1UY4A 3WP4A 4NMIA 5F1RA 1UZYA 2H6CA 1AR61 5F3CA 2IXJA 2VR4A 1ASJ2 4AOCA 4M00A 5FZIA 2HEVF 3B02A 1OF4A 2XLGA 3K4DA 5GLVA 4BQ5A 4FFIA 2VZ3A 5LEKA 4FPFA 1GZCA 4NIAA 1YQ8A 4C90A 2RDSA 3MBWA 1GLHA 4YG6A 2QUOA 5HPOA 4QX3A 4E8CA 2SLIA 3OBAA 5F3GA 2QZ2A 2QQMA 5FMDA 3J8F3 1QJU1 4IDZA 2J1TA 3THTA 4AGVA 2ZABA 1RYYA 2VOXA 2XJQA 4HBNA 3S6PA 3ZFFA 1HB2A 2D6PA 4LPLA 4E2QA 5FLHA 5LA2A 1F4HA 5LW9A 4YM1A 1D4M3 1XYPA 3VV1A 5FXXA 1TQ5A 2PYTA 2ZAAA 2JB4A 5A32A 3OCPA 5CB7A 4QHZA 4CDUA 5KWRA 3PHMA 4COVA 3O1TA 1MS5A 2EXJA 1SFPA 5FTTC 3DGTA 3DF0A 4BQ4A 2WIIB 5C3OA 2BVVA 3LD8A 3LSDA 4LHSA 3U14A 1SCSA 4BMEA 5IT6A 4IGQA 2JE8A 3MV11 3FLTA 3FLPA 2ZMKA 2CHHA 2EICA 4LBLA 3ZFFC 4A3XA 4MV2A 1RUF1 4JAAA 5LY2A 5A3MA 2ZCWA 5A3LA 4CCCA 5AC92 3T30A 5JXGA 1A34A 2WT0A 3PVBB 1OI6A 1UOJA 3BTXA 1YEWA 1HB1A 1ULPA 1DYKA 3H3LA 2DCJA 1KS4A 2JG8A 2RVAA 1NA1A 3AZZA 3GHMA 1H8TB 4KWKA 5DABA 3RRDA 4Q2FA 5A7PA 1E5IA 3ZN6B 4CDUC 4XFGA 3I59B 4GD4A 5DUUA 4OZXA 3ZDSA 3POWA 3O1VA 1PO12 3CU7A 4PQ9A 2VCCA 1YFYA 2YFUA 3BOPA 1W8TA 1EAH2 4F83A 1FT9A 2JE7A 1AX1A 2DWRA 2E7AA 3SEEA 4Z82A 2IXKA 3T4VA 4PCRA 1QF3A 2WUHA 1UKGA 3WD5A 5FO8B 4DXSA 3ZSMA 4RA0A 4AFDA 1EPZA 3V65A 2P6CA 2JG8C 2AUYA 3LCPA 1AYN3 4RR3A 3SITA 4IESA 1PVC1 1AR93 3QBQA 1OURA 3RJRA 5IJRA 5E88A 1WMFA 2UYBA 1QOOA 1CZVA 4Q1PA 3J26N 3QOPA 4I0AA 2RS11 1E5HA 2Z69A 4XE9A 5DUXA 4KMQA 4NHKA 5KXCA 5BYNA 3LEGA 3Q8EA 3OYWA 1OQEA 1J58A 1PMHX 2ZTNA 3O0WA 4JHZA 4P9JA 4OI1A 4AEDA 1RHI3 3DYMA 5I8TA 1NUKA 2JICA 3FZ3A 1UL9A 4B4RA 2ZHNA 1UOFA 2HWB3 2VOKA 1KDMA 3HIFA 5C9AB 5L73A 1RVF2 1C3HA 3VHOA 3H8OA 3KHCA 1WW4A 3WCRA 5GALA 5A80A 1ULGA 4Q0QA 1VRH3 1WLWA 4ARXA 4AR2A 4UFLA 5LWBA 4TN7A 1WLDA 1H4HA 5C8WA 3T0AA 1JYTA 1E5RA 2ZOEB 2R043 1VP6A 2V4VA 3SCFA 5B4XA 1ENRA 2ZX2A 1WGPA 1ODMA 3DKQA 4HVQA 4AEDC 5L9VA 1ND3A 4YFZA 5IVFA 2YROA 3BOWA 4LO8A 5A7QA 1QMJA 1GZWA 3CIHA 4BLIA 4KG0A 4P9GA 1O8SA 4L99A 4IE6A 1ZA4A 4CUBA 2W1QA 2LW8A 4LEJA 4QPIA 5C4WB 1BVP1 4NRPA 1D7PM 1HN0A 1TME2 3H1YA 5FPAA 1RUG2 4K21A 1UIJA 4Q0PA 2VG9A 1A8DA 1HIXA 4BK4A 4P9XA 1XSRA 2GN3A 4URTA 2PHFA 2UY9A 3WT3A 5IVCA 4RQPB 1OVPA 5JOYA 1JN2P 1BJQA 2J1SA 2WA4A 1C5HA 2DBNA 4AVBA 3AKQA 1JU3A 1POV3 3ELNA 4LORA 3VBOA 4F8AA 5FOJB 2GNTA 1X36A 3VD3A 2BZDA 4KBZA 3ZIXA 2I2SA 2WQZC 5CFCA 2JG9C 3KCYA 4XIOA 1UZ0A 2WWUA 1ZBA3 1CR7A 1BHGA 5C5TA 3O1MA 4CCMA 2HYXA 1UNBA 1W9FA 4YG3A 1NX9A 4YW2A 3VHPA 3ZR6A 4LUKA 4I30A 1IS6A 1VBE2 1AR73 2D5FA 1K5MB 3KT1A 4G4FA 1ZZBA 3ON7A 4FO9A 4UXAA 3ACGA 3L2HA 4UYBA 3WUCA 1VBC3 1BEV2 2LROA 2WFPA 2WQ8A 4I0BA 2NN8A 4IETA 5FY0A 3D0SA 2FMDA 1LOCA 3UGHA 1AXKA 4UFKA 5E1RA 1OA3A 1EAH1 4FP2A 5T52A 1X8EA 4QB1A 3AVRA 3H3ZA 5BUVA 5JIUA 1G9FA 4FQZA 2VQAA 3H42B 2WO7A 4MXWA 4P9IA 4AVSA 1PGW2 3CO2A 5DAQA 3VBRA 3WW3A 1EV11 4E9KA 2GAUA 5EXOA 4BQ1A 2WO3A 3BU0A 5DAWA 2BFUL 4QPGB 3C7HA 4HKWA 1ULOA 3KLSA 5LA9A 4AFAA 1ZX5A 4XJ9A 1NKGA 2GNMA 2VUDA 3JB4C 2VQ0A 3P1IA 4Q4W3 1H4GA 3OGRA 3AFKA 3J7HA 2D6MA 5D8AA 2GZWA 3RVHA 3WNMA 4FXGB 4BDVB 4XC9A 4Z2WA 3N9NA 2HWC1 1RB8G 4C91A 3W58A 1V9U2 4LIVA 4AI9A 1YLLA 2KR2A 1T6GC 5LA1A 1DLLA 4PBPA 4ZS2A 3WR0A 3D8CA 4JX0A 3UGGA 1QOSA 3LPGA 4GWMA 3JBG3 1COV3 4SLIA 5FYVA 5IVBA 2VW1A 3W20A 2G4IA 3GHNA 1DQ2A 4GH4A 4CTEA 1KJRA 4CDXB 5K0UB 5EP9A 4L2NA 4A7KA 4HK9A 4ITCA 1ODNA 3KT7A 1CAXA 2CYFA 1JYCA 3SKVA 2ZACA 1HRI2 1LEMA 5D8AC 1XPWA 4Y26A 1HRV1 1RXGA 3VZNA 5APAA 3FL7A 1ND2B 2D6OX 2IWGB 3IM0A 4LHKA 2HWE1 2BEOA 4HOOA 4NPMA 4MGQA 3I3QA 3HT1A 2VGDA 3ZYFA 4TZDA 2UU8A 3GBFA 2DV9A 3GZEA 1SFYA 4LBMA 3THPA 3M8LA 2VC9A 3H1MA 2WJSA 1FI2A 3WF0A 1W0PA 4HN0A 3IMNA 4EQVA 4QAWA 2RS31 2XBO2 2OQ7A 5T5PA 4EWDA 3C7GA 4R9AA 1HQWA 1TMF2 4IEXA 3U1XA 1Z0HA 2R1DA 2F4LA 5L7OB 3SC7X 1REEA 1DP0A 4X8PA 4WVMB 2PN5A 4TSVA 2ATFA 1F15A 3AKRA 3C8XA 2EALA 1D0GA 2WSUA 5BNPA 4JKMA 4QGMA 5CFDB 1DYOA 3P3NA 5DDJ1 1UY2A 5FMCA 4EZ4A 2WO2A 1ZRFA 1DQ1A 1QJX3 3QH6A 5FIXA 1VE0A 1PHMA 1WA6X 1UQXA 2W47A 1UXZA 5C3QA 2BOJA 1R64A 1DGRA 3WQ0A 3AJYA 1OF3A 5EZWA 2C9KA 4N53B 3UL2A 5GZCA 3HWJA 2WNEA 5J3UA 1CJDA 2ZKNA 4CUGA 3L2YA 4PF1A 4YZ4A 4Q26A 3KGLA 5B4NA 2QQOA 1LOAA 4JGYC 3M3EA 1VBE1 1RUJ1 4N9HA 1QNWA 1CAVA 1ZZ6A 1ZZ9A 5FZGA 1D4M2 1BVVA 1JTZX 5FYSA 4AFMA 3VGIA 4E4DX 5BNPC 2ZS6B 3TNPB 4QDQA 4S2FA 1CD3G 2XHNA 3N7JA 4DOUA 1PK6A 3I7DA 1BMV2 4CDWC 1SLLA 1V6IA 2NMOA 2H6BA 2OUJA 1HV1A 3NJZA 4N43B 1RUNA 1AL0G 1W03A 2JDKA 5KXDA 4XDQA 1XBFA 1H2LA 2ZGTA 3AM2A 3WNLA 3OEAA 3H3UA 1KJLA 1W9SA 2OXBA 3A4UA 2WS91 3HQUA 3MGUA 2D43A 3WZ1A 3DYOA 4FTBA 2J42A 3K3NA 1WW7A 2VM9A 3I2DA 1A78A 4AXOA 1CIWA 5FZ8A 4LOSA 4DUXA 4Z2AA 1GQPA 4OVEA 1SZBA 5FP4A 3JD73 4C8DA 1YI9A 2RDRA 2ZGLA 5IFPA 1WCQA 4DPNA 3AJZA 3I3BA 1O5UA 3FHIB 2BDRA 4ZXEA 1W06A 1RUH2 1W3XA 4AHYA 3GZTB 2FBEA 1SPPB 3MLJA 1XNKA 4LMFA 4CCLA 4HN1A 3UT0A 4AK3A 4CVUA 3HMYA 1W28A 2DFCA 2BGCA 2A6WA 3SMHA 1W0OA 5BXXA 2HWF3 4XFBA 5HCFA 5FMBA 1X82A 3IAQA 5F39A 4D6RA 4CRQA 1AYN2 3WQ1A 5LATA 2PLV2 3N7MA 1L7RA 2WNVB 3H7YA 2VOVA 3KCXA 5FY4A 3U78A 4BHPA 2DVGA 2YV8A 1ZRCA 3PVEA 4R9DA 3LWCA 1O5LA 3E6BA 4HVOA 2VMIA 5A33A 3TN92 2AH2A 1LU2A 3AP5A 5LASA 4EROA 4CUAA 1OXCA 4DXRA 5EYYA 1JMUB
chains in the Genus database with same CATH topology
2ZBJA 4BCUA 1Q8OA 4FPJA 2E6VA 1RHI2 3JQWA 1L3JA 4XBNA 2IFRA 4B4QA 4CP1A 2HWB2 2RR11 1CAUA 4AI8A 1RJ8A 2OZ6A 4AYUA 1RIRA 1DZTA 2K0GA 1UMZA 3ZN5A 4GMP1 2VUJA 4HSLA 1MS8A 3VBHA 1VRH2 3PTYA 3ILRA 1KITA 3V0BB 3WDYA 3UKNA 1FV2A 4QGLA 2R042 4M3CB 4QQLA 5FPXA 1R083 3J8F1 3MDPA 2ET1A 1O3SA 1XNCA 2I07B 3WDUA 3KQRA 4DXZA 4EWEA 1SEFA 4COYA 3USUB 3AZVA 5AC93 1DBNA 1HXS3 1ULCA 1DGLA 2MNGA 2WQ4A 4W65A 1ALYA 4A7YA 1BXHA 1X7NA 1RL3A 1MQTA 2OVUA 4KGQA 3VBHC 4FP3A 1YIPA 4Q0SA 4KL1A 1J1LA 3SH5A 1H9PA 1EPWA 2VECA 5KHKA 1B35B 2X5IA 4FOVA 4HPKB 2EIGA 1PO13 2VMGA 1Q8QA 4R9BA 5T5LA 3UV9A 1AYM1 1FOD2 1RMU3 1VAVA 4M01A 2BVBA 1J3PA 1QH6A 2BNOA 5I0TA 4XIKA 3CJIB 4EV0A 4YVWA 1NG0A 4WM7B 4CP2A 3IPVA 2ZX1A 1D4VB 2GMEA 2NM1A 2SBAA 4N7IA 1AR72 3JZVA 3E6CC 4XF1A 2YXSA 1S0BA 4XQDA 2OYZA 2X29A 4CEYB 5DZFA 3NL1A 1QOTA 4BE3A 1LR5A 5I8SA 1PZ9A 2X5IC 2E9QA 2DTWA 2DTYA 1Y9QA 5ABJA 1I9RA 4ES9A 4YVWC 3LA7A 3RI9A 3LSEA 1JHNA 1FMD3 4ES8A 1B35C 4Y20A 4NWWA 1AR91 1AVBA 2YUEA 1BZWA 3FUOA 1O3TA 2VVEA 4KWLA 1OOPB 2OUHA 3HR9A 1S2KA 3MIFA 3VZOA 1RVF3 2ZGKA 1C8NA 4XYXA 2W39A 4MGYE 1LGNA 3VDDA 3LOIA 4XQ4A 1DYPA 5ABJC 1F9KA 2R1BA 4IERA 2NP0A 2R32A 4CEYC 2XH6A 1QJY3 1CAWA 4QQHA 2A6VA 1COV2 4ISQA 4XF0A 4MZUA 2RJKA 3QACA 2R063 4KG8A 2HWB1 4RHV3 1TNFA 3PLQA 5CVRA 1VR3A 4P9LA 2WNUB 4GMP0 2D6NA 4EN0A 2XHKA 1I3HA 3E5QA 4D7TA 5T3NA 1IS5A 3OY8B 4CEWB 4I3GA 1YFWA 2R041 1W6PB 1N47A 1WLTA 2GC2A 3VBUB 2EXKA 4PLOA 1OOPC 2VW0A 3AKSA 4K6BA 3ZFEA 4AEMA 4AI0A 1RUD3 1O7FA 1AXZA 4I3PA 3HN1A 4HK8A 3ZFGA 2E63A 1UPSA 3NVCA 1OLQA 2EF6A 5E8AA 3B7MA 1CPNA 1VBD2 5LK5A 3WG1A 2XLFA 1IQAA 4XXAA 5SV5A 1BEV3 1DZQA 1YFXA 1QJX2 3M70A 1HW5A 4PJYA 1POV1 4XFFA 3HBZA 2XJTA 2R0FA 1BBT2 2WNUC 3KSCA 1ZBA1 2P3KA 4WVVA 4QPYA 3LGRA 1DQ4A 1YJLA 1PIV2 1NLRA 4QMAA 5IK8A 3ZFGC 5DUVA 4B8EA 3AYEA 2NMNA 1LULA 1ZRDA 1AR71 2LALA 4EN8B 3NAPB 3WG2A 1LOGA 3RG0A 2KA3A 4Y1VA 1VBC1 1J1TA 1GANA 1SLAA 4OI4A 5BNOA 3NV1A 4MVTA 3VKFC 3ZO0B 3MLLA 2W0XA 1E57A 4XXPA 5E16A 2RM23 4QQ2A 4XPVA 2H0BA 3NV2A 1W6OA 1R1A3 1NZCA 4AVCA 1PGL1 2PHDA 4YSFA 1MS4A 1IS4A 2HYKA 2WZR2 4RS5A 4X6QB 3SXWA 2XJPA 1Q5OA 3BIWE 3SCHA 4YVSA 3JB8A 4HFSA 3NV4A 4KU7A 4C1WA 1BCXA 1WMEA 1MZ5A 2O8OA 5BNOC 4Q4W1 4JRAA 2XL7A 3AXEA 3OD0A 1HRI3 3JD72 1DQ6A 5FLIA 1JXNA 4UBHA 4YARA 2JKBA 1GSLA 1RUE3 4G9SB 2P3JA 4LHNA 5GZDA 1OPOA 4RS5C 3JBG1 1W6QB 4S2DA 5BY5A 4DQAA 1SFNA 2ENRA 2GMPA 4B3NA 1AL23 4IV3A 1B09A 4X8NA 4XZPA 2HWF2 3OJBA 3B93A 4QT6A 3WXPA 2YPJA 2MEV1 3CEWA 1QU0A 2YY1A 4CDQC 3DPRA 4GA9A 4OLLA 3ZXEA 3RYKA 3H7JA 4BMBA 3ZFFB 5L19A 1WA4A 3NKGA 2XKOA 1WD3A 2YGMA 1EY2A 2O1QA 4FPHA 1KFUL 1ZYBA 4IV3C 1VBA2 4XBQA 3WOGA 3GBGA 4CDUB 1A8MA 4HETA 2JX9A 3EBRA 3IKWA 1ZREA 1S0IA 1KRIA 3T1MA 2D98A 3QH7A 3DPRC 3AXDA 4UBGA 1AX2A 4ASMB 2F4PA 1PNGA 2ZGPA 3AYCA 1ULDA 2VXRA 4DINB 4XFCA 1HLCA 3PNAA 4YRDA 2HWD1 4JGZA 1POV0 2WC2A 1QDCA 3WV6A 4WV8A 1R082 1VJ2A 1N1SA 1EP0A 2D6KA 1N1TA 2JG8B 2HEYF 1NA1B 1I1EA 2PA7A 1H2NA 2KM2A 3ILFA 3ZYRA 2R0HA 1FV3A 1HXS2 5DXDA 1MEC1 4LE4A 1RGSA 3FFQA 4XHBA 1G7YA 3TAYA 5J98B 2I45A 1W6MA 3ES4A 3O0XA 4DB5A 1YIFA 3MEPA 4UW3A 4JGZC 4RFT0 4TYSA 2B5HA 1C8M2 2QZ3A 1PNFA 1RUH3 1FX5A 1RMU2 4AEKA 2GU9A 1G9BA 2D44A 2ARXA 3TWIA 1GZ9A 1C1LA 3MZHA 2Q0AA 1OA4A 3M4FA 3S30A 4LBQA 1URXA 3IIAA 5KHIA 2RS53 1AR81 2B46X 4NPRA 5E89A 3VBFA 1NA1C 1REFA 1NY71 2YYOA 1M4WA 5ACA1 1IPJA 3ZYPA 2PLV3 2XJUA 4AEDB 1SBFA 2R16A 3TN93 4AQTA 2GNDA 3ECQA 1LECA 1H8TA 1SACA 2VNOA 1FMD2 4IEYA 1DDLA 1YXWA 2EA7A 4Z8BA 3BCWA 4OUSA 4Y1XA 3VBFC 1H2MA 3FBYA 3AKTA 1ZZ8A 4RR3C 1LEDA 2D3RA 5K7PA 4BOWA 2R073 1A6CA 1ND3B 2G9GA 3MIBA 4MLOA 4COZA 1AX0A 1ASJ1 3N36A 5I0UA 2JG9B 5FAXA 1GYKA 4R52A 5DG1A 5FQ0A 5T5OA 3UJOA 1MVEA 1QJY2 2GALA 2F6BA 3OGGA 3HD8B 3NWKA 4AF9A 2BQPA 4GKXA 4OI0A 2ZHKA 1QQP2 2UWBA 3D5OA 3MF6A 3AMQA 4Q4X3 3I54A 2R062 2DF7A 1I6XA 1WD4A 3INAA 4RHV2 4EN6B 4Q8KA 1FATA 2HJIA 4LULA 2YC0A 4OUMA 2MHFA 2DVBA 4M3CE 4GB32 3BALA 3KD4A 2PAKA 1IOAA 2X8KA 5H9RA 5CIRA 2V09A 1YCIA 1PM7A 5C9AA 5CNAA 4AHXA 3VL8A 4HT1T 3WW1A 1FOD3 1ND3C 4AHZA 3GYDA 2Y0OA 3RMYA 1RUD2 5AC91 4WM8A 2ZMLA 4NHLA 4Q4Y3 4DY5A 5CG8A 3HAGA 4JDNA 4QPIC 1VB4A 4MXWB 1SCRA 4ZKTB 2XVGA 1UZZA 3OF1A 4FBFA 4DFSA 4XHXA 3OPZA 2A5ZA 2CNAA 2Q30A 1PO11 2AYHA 3FUQA 4WZFA 3VBOC 1XNBA 4YZ3A 5D8AB 5BNQA 2E7QA 5CFCC 2H0VA 4Y4YA 2PHLA 4Y1ZA 2XVKA 3NV3A 5IUQA 3WINE 3WY6A 4K8FA 5JSOA 4KWJA 4WM8C 1FPN2 3ASIA 1G9DA 1KD7A 3WQ7A 5H9PA 4TLFA 3KCCA 2AZ5A 1WMDA 3AYDA 4XMAA 2RM22 3RQ0A 1LGCA 1NE6A 5CG9A 4I09A 1Z7S2 5T5JA 1RUOA 1RUI2 1R1A2 3IDBB 1LHUA 1Q3EA 4LNVA 3VBRC 1ENXA 4D94A 5JR7B 3C3VA 1VBB2 1CPMA 3R0RA 4IEOA 4LT5A 3VBSA 1YRZA 5FDBA 4IEPA 1REDA 2WL1A 4L11A 2FHRA 1FYUA 1RVF1 4AGGA 5IK7A 3M3IA 3VKOA 1GICA 3HT2A 1RUE2 1GNHA 3CJXA 5DUWA 3L9JT 1O4TA 1V6MA 3KGZA 4H3WA 4K1YA 1IKPA 5FO7B 1LOFA 1N3QA 4JGYB 2CY6A 2JDZA 1MZFA 4NVPA 4DMIA 5KXEA 3JUUA 2TBVA 1NCRA 3LKJA 3VZJA 5BNPB 1AL22 4GH4C 3VBSC 2V73A 1C28A 1CJPA 3SLIA 4RGGA 3B5LB 2Q8OA 3ZXAC 5J09A 4CDWB 1BK1A 4WBBA 1H1MA 1V6NA 2XUMA 2ZJCA 4Q1RA 3J4UH 1TME1 1VBD3 4E4SA 1RUG1 1HV0A 5K0UA 1WCDJ 5JSPA 2ILMA 2XVLA 3ZIWA 4Y1UA 1AR63 5K8SA 1LOFC 3GALA 4LO4B 2ZGNA 1LOBA 1CAVB 1NCRC 2IXHA 1YUDA 4Z92B 3O5SA 1BBT3 2MPFA 3MFCA 1W2UA 3AMPA 5CBLA 1PIV3 1ZBE2 1RC6A 4D7SA 3WG4A 3ZXGA 2P2KA 1UU5A 3WVJA 3SISA 1UX6A 3AZYA 3MIEA 1BEV1 2K9ZA 2P3IA 2ZGQA 1N1VA 3DKWA 3X29B 1Q8VA 2OIIA 5GZFA 3O14A 4WVMA 4LUMA 2A3XA 3V56A 5FMOS 1PGW1 2PTMA 1I5ZA 3B01A 1NCQA 2WZR3 1QHDA 3G6JB 2B45X 3JCIA 4QX5A 2YHJA 4N7UA 1JUIA 2DCYA 2PELA 2QVSB 5CA6A 4RL7A 3VUOA 1OD5A 1PK6C 2IXCA 4AHWA 2RM21 1H1IA 3H0OA 3AMHA 4E2SA 1R1A1 1NOVA 1V9U1 4I0WB 1QKQA 1RUC2 1U5IA 3H9AA 3MW4A 3GNEA 2OZJA 1LHNA 5FO9B 1W6NA 4HZFA 1NCQC 2JENA 2GMMA 5H9SA 2O0OA 2ZHMA 4YGEA 4COUA 5A33B 2P17A 4PBOA 1O3QA 5HXVA 2RS52 1HRI1 4XJWA 4S2HA 2YMZA 2WZPP 3B94A 1Y43B 3MIHA 3ZSKA 1U5ZA 5BNNA 4XFHA 1QXRA 1J3QA 3VKNA 3ZYIB 2R6QA 3FFZA 4FAHA 4FPOB 3RNSA 2PHTA 1Q8PA 2RS13 1CAUB 1GR3A 2XBO1 1G86A 2LTNA 5JLVA 3ZMOA 1TMF1 4P5HA 3VBHB 2OPKA 4LO7A 1VBA3 1XU1A 5DG2A 1AZDA 1BQPA 3ALQA 4IV1A 3WLUA 5BNNC 3RYRA 1F31A 2R072 4JDMA 3WG3A 1NQDA 4K40A 3TB0A 3JQXA 3VKLA 2ZGMA 1J59A 1KS5A 5GM0A 5KC5A 1VALA 1AXYA 3P3PA 4GXLA 4FQ4A 1G6NA 5KHGA 5C33A 4I01A 4YW3A 4C0HA 4N9IA 2QCSB 2GH2A 4YGBA 1UPIA 2CV6A 4Q4X2 4IV1C 1KFXL 3POYA 1GFF2 3RWNA 1TE1B 2GNBA 5JCTA 4OHYA 1D4M1 3WP3A 5GJ6A 2X5IB 2PFWA 4FPKA 3MIGA 1HKDA 5F9TA 3SCGA 3IWZA 1EYBA 4W6YA 1BMV1 4YVWB 1LENA 5JWPA 4TWTA 3HQXA 3IPVB 1GQGA 4B7EA 4MX3A 3ZSEA 1C8M3 1C4RA 2VNRA 4N90A 1XYOA 4XILA 1UAIA 3BPZA 3PJQA 4AEJA 2PHWA 1YFUA 4LO6B 5SV8A 3AZXA 2ZAHA 5C6CA 3AMMA 4BLJA 4Q4Y2 2B39A 5ABJB 5J37A 4GIQA 1MS9A 1MQTC 4AVAA 3V0AA 2B9UA 5J7MA 4HVRA 2UYAA 4LTAA 3USUA 1RUH1 3IT8A 2WT2A 1HQLA 4COWA 2ZZQA 3BB6A 3AX4A 5I91A 3D4KA 1WW6A 2W68A 1JW6A 2C1FA 1S0JA 1QXPA 3KMHA 1PO22 3APBA 3MPPG 1YHFA 2BUKA 3BTAA 4P9WA 3ZMNA 4HPKA 1WW5A 1KDKA 4TZDA 3G7DA 1AYN1 4LHLA 3VN4A 4BM8A 2PLV1 4XF3A 1SBEA 3E97A 3AB0A 2P37A 4DRVA 4OFGA 3K48A 4DNYA 3TN91 3AP4A 3RI8A 4LE3A 2HWC3 4Y22A 2XWBB 3FWEA 4J1WA 1XE7A 5H9QA 4XEZA 4FOQA 4AQSA 1C5IA 1SMVA 1RHI1 1QQP3 2VMHA 2JECA 4L97A 2R071 1CQ9A 4FCAA 4KU8A 4LBKA 2HWE3 1VRH1 1RJ7A 1UN1A 4GB33 4R9CA 3VDDC 1F5JA 2A70A 3ZFGB 4AI1A 5AFEA 3MW2A 3FX3A 4LO5B 4YW1A 3KM5A 1QXJA 4IEVA 4Q4X1 3LZZA 4B7KA 1H1AA 4XQWA 5HCAA 4XMIA 1SDWA 1V6JA 1S0DA 3M1HA 5JPMB 2RMU2 1OMIA 2NQYA 3ES1A 5JOWA 4FSJA 3N7KA 3I8TA 1MACA 2Q1ZB 4QU2A 2CAVA 3AFGA 1AR62 1DQ5A 3GZAA 2C0ZA 1UKRA 4QM9A 1U12A 3ETQA 2G9FA 4YG0A 4AQ2A 1A3KA 1FOD1 4GKYA 2Z2SB 4HL0A 1Q8SA 1MS0A 5BNOB 2VOWA 1G9CA 4BZ4A 3ZFEC 3VHRA 4PDWA 1QJU2 4CEWA 3WHUA 4ZU7A 3U4XA 2UWCA 1W6PA 4QHBA 3N4MA 3CL1A 3VBUA 3M3OA 1V00A 1FPN3 5D1IA 4KQ7A 1ZZCA 1S55A 4AG4A 3MFAA 3IN9A 5JOXA 4RS5B 1F2NA 4IXLA 3UK9A 4GULA 1CESA 1ULFA 1Z7S3 1MVQA 1RUI3 2GC0A 2BWAA 3ZXJA 4NWVA 5JVVA 3QCWA 3WDVA 2QDRA 4PDWC 5HCBA 2PAEA 1SLCA 4CDQB 2WS93 1RITA 2UURA 5EFUA 1VBB3 1R093 3A0KA 4O9EA 1NQJA 3R4SA 3T1LA 3D6EA 4YW5A 4AW7A 2DFBA 2FQPA 4MH0E 1YJKA 3ZVXA 1OQDA 4IV3B 5B2GB 4PLMA 1V6OA 5KBFA 4S2GA 3H50A 4KBBA 1COV1 1J3RA 1O91A 3DPRB 4JDOA 2NYYA 4YVSC 1WCKA 1SLBA 1SLTA 4IEWA 3FC0A 1DGWA 1QH7A 1JH5A 4QQPA 4XF9A 4XJZA 4ZU5A 1PVC2 1IZ3A 3D0JA 1MS1A 3IBMA 1TNRA 4FPEA 4B4PA 5JZGA 1OKQA 2R30A 5I0RA 5JAXA 5LRSA 3N7LA 3UKTA 2RS12 1AF9A 5JSRA 1H8VA 2C5DA 2QQPA 4W6WA 3SNMA 2JE9A 1U0AA 4FPCA 2PHRA 5EV7A 5A32B 3FMGA 4FPLA 4Q4V3 5FFOC 4F7ZA 5C8CA 2AR6A 1ZBE3 3H8UA 4JGZB 4PIYA 3QD6A 1VBD1 2X53S 2I74A 5IK4A 1NLSA 2PQQA 4IQPA 5JZGC 4Q29A 4YZ2A 4AI2A 4GMP3 1QJX1 1X50A 5LEJA 2DU1A 1F5FA 1NE4A 3H1WA 1QJZA 3MICA 3NW4A 2BFUS 2DCTA 1UD1A 1BBT1 4NR1A 1ZZ7A 1LESA 1PIV1 4PIZA 3AP7A 3PMSA 4Z1VA 5C8CC 3RYPA 1W6MB 3V64A 1S0EA 4AE2A 5KXBA 4FPYA 1GBGA 3LOBA 2BYVE 5HI0A 4K1ZA 5DZEA 2CGNA 1LJ7A 4LA3A 1OPMA 3GBWA 4FAGA 4LBQB 3VLBB 1RUC3 2NZ9A 2VVFA 5K9YA 2HEWF 4YYOA 2WZR1 3JU9A 1AYM3 3VBFB 4RR3B 2Y38A 3OTFA 1FNZA 2R49A 1F8VA 2JEMA 3CLPA 4I2OA 5AVPA 1YNAA 4Q0UA 3K51A 4LLFA 3JD71 4JTOA 3E5UA 3EXUA 5T55A 3OYWB 1AJOA 4J1XA 3ZXDA 4GALA 1U5XA 3AP6A 3ROUA 2VPVA 1ZNPA 3B9CA 2CL2A 4HSJA 2ZPXA 4L9BA 2VUAA 4H7MA 2Z42A 1ULEA 2IFWA 3J9SA 3U07A 3ZN6A 4MSVA 4AFDA 1EV12 2D40A 2KXLA 1VB2A 3AMNA 3I59A 3WW2A 1WLCA 3AP9A 1S0CA 3M3QA 2HWF1 5FQ0B 3EHKA 1ENQA 5EWSA 5J96B 4FTSA 3MW3A 1QGLA 3WP6A 1AJKA 3MLKA 3QLQA 2HWC2 1S0FA 1LU1A 1KQRA 5FCCA 2QKDA 5FREA 4ZXKA 1GZWB 2CWMA 5FBZA 3W59A 1H8TC 4C0BA 4Y5Z0 1X33A 1XXNA 2BTVC 5CAZA 2CGOA 5EJ3A 4QPIB 1VBA1 4WZCA 5I0SA 1C1FA 1CGPA 2Q1MA 2WWSA 2ZZJA 5FRAA 2BBVA 1LCLA 2EXIA 5T54A 2BNMA 2ZKLA 1HRV2 4UW5A 2ES3A 2NPIA 3DN7A 3O0VA 3VBOB 3RMXA 2HWE2 3AZWA 1X8MA 4OHZA 4HMZA 4SBVA 4YM2A 5CFCB 1UCXA 2WINB 3VZLA 4W6XA 3UJQA 2AREA 3N35A 3RPQA 1D2QA 4WM8B 1R081 2XJSA 2QNKA 2GC3A 4A7ZA 2A6XA 2RS32 4HLTA 4NN0A 2JG9A 5GKAC 2ZX3A 1HXS1 5AVAA 5FOBB 1DGRN 3E5XA 1O3RA 4XW3A 3U11A 2FZ1A 3B69A 3NKTA 2B7YA 4YM3A 4BIOA 3CF6E 1WCSA 3VBRB 1HDKA 1SLIA 4FOWA 5DDJ2 4BH9A 4QXKA 4E27A 1V6KA 1UIKA 4JRLA 4YGDA 3VZMA 5C9AC 1C8M1 1OFNA 2A3WA 5I93A 1RMU1 4AFCA 2VY0A 5IK5A 5C4WA 4LA2A 2YDEA 4AWDA 2VNGA 1XYNA 4E4ZA 1C57A 1DHKB 2E53A 3S7IA 1PO23 2Q4SA 4RQPA 1RUJ2 1OHFA 4ASLA 3VZKA 3M2MA 3EQEA 4FOYA 3S0MA 2DYCA 2XJVA 4H7LA 1JUHA 5FLJA 2B42B 4LBOA 3O12A 4GH4B 2WFF3 2ZGOA 3SH3A 3VBSB 4YZ1A 3NO8A 3RSJA 1K5MA 1VAKA 5C4WC 4XTPA 2A6ZA 1CAXB 4FPGA 5JIAA 2VW2A 2WS92 1FMD1 4BWOA 1LTEA 4RQPC 1LB2A 1DIWA 1RINA 1R092 2TNFA 1N3PA 4K20A 4Z07A 1WBFA 2XPJA 4M3CF 4GWNA 3ZPYA 2A6YA 1BYHA 3IDCB 1N3OA 5JDBA 4LBNA 1MS3A