2A71A

Crystal structure of emp47p carbohydrate recognition domain (crd), orthorhombic crystal form
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
217
structure length
217
Chain Sequence
KLSSDYSLPDLINTRKVPNNWQTGEQASLEEGRIVLTSNQNSKGSLWLKQGFDLKDSFTMEWTFRSVGYSGQTDGGISFWFVQDSNIPRDKQLYNGPVNYDGLQLLVDNNGPLGPTLRGQLNDGQKPVDKTKIYDQSFASCLMGYQDSSVPSTIRVTYDLEDDNLLKVQVDNKVCFQTRKVRFPSGSYRIGVTAQNGAVNNNAESFEIFKMQFFNGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Emp47p
publication title Structures of the carbohydrate recognition domain of Ca2+-independent cargo receptors Emp46p and Emp47p.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 49
structure length 217
sequence length 217
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03388 Lectin_leg-like Legume-like lectin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2a71A00
1SCRA 2UU8A 4DPNA 3WG2A 1BZWA 5BYNA 1A3KA 2DU0A 1N1VA 2C9AA 3SLIA 3R4SA 2GNBA 4GALA 4HANA 5DZGA 1MS0A 1AX2A 4FOYA 1S0FA 1DHKB 2ZZJA 2A71A 4P9WA 2NYYA 1R1ZA 2UURA 2YMZA 3MW3A 3GALA 1UZZA 1GBGA 1AZDA 3WG1A 1QKQA 2ZGSA 1AXYA 2GNDA 4U2AA 1PZ8A 2EALA 3TAYA 1LHOA 3ZVXA 2R0HA 3IMNA 1G9AA 1RITA 5FRAA 3VKLA 2D6LX 2D6PA 2PHTA 3FBYA 3USUA 3VV1A 1LCLA 1TEIA 2VH9A 3GNEA 2EAKA 2NZ9A 2VXRA 4YFWA 4M3CB 4XE9A 2CWMA 2GALA 4FPOB 4Y1ZA 1W6OA 3NWKA 4FPLA 4Q2FA 1LOGA 1ULGA 3V65A 2SLIA 1WBLA 1S0EA 4Q8KA 4BLJA 2ZGPA 1CPMA 1SLLA 2E53A 1VIWB 1S0JA 3TB0A 1IS6A 5JOXA 4Y22B 1N3QA 1LTEA 2ZGTA 2D3PA 1HDKA 1SBEA 1FYUA 4I30A 4K1ZA 1CPNA 1LGCA 3SNMA 1DGLA 1MS5A 1UKGA 2PELA 5DG1A 1CVNA 2ZGRA 2W08A 3O0VA 2ZBJA 3MPPG 3JU9A 1S0IA 3R4UA 4W65A 3WUCA 3ZSJA 2WT2A 2DVBA 4AVTA 3RMXA 5DUWA 2JE7A 3QLQA 1JBCA 1O4ZA 1QF3A 2NMOA 1CIWA 1QOSA 3I8TA 3RMYA 1DBNA 3R05A 3ZYPA 1LHNA 3D6EA 4YGEA 3WHUA 1KDKA 2ZHKA 1AJOA 4ATFA 2NMNA 4XJZA 3POSA 3UK9A 5IUQA 1F9KA 1V6IA 1DQ2A 1V6NA 3AZYA 1H30A 4Z8BA 4RL7A 1SBFA 3OBTA 2ZHNA 1DQ6A 1W6PB 2V73A 1DLLA 3AP9A 4RA0A 4Q1RA 1GZCA 2DWRA 2A3WA 2DUPA 2PHXA 2VW2A 5DUXA 3M3CA 2GNMA 1AVBA 4YW5A 3WDXA 4KBBA 1JN2P 4CZSA 1QGLA 2GN7A 2EF6A 1N47A 4IQPA 1H9PA 4BQ1A 2V5YA 3BTAA 4FPKA 4FP2A 2DTYA 2GMPA 4PBOA 5GLUA 4C1WA 1Q8SA 2B7YA 1W6MA 1WW4A 4P9XA 1JYCA 1LOEA 4LBKA 4D69A 3VKNA 3HR9A 2ZGLA 1IOAA 3AJZA 3ILNA 4LBJA 1MS9A 1UZYA 3U4XA 3WDYA 2D43A 2AENA 1V6MA 1J1TA 2H0BA 2LTNA 1ONAA 3AYDA 4XIOA 3WDTA 4Y20A 5CAZA 5GLTA 3Q9OA 1LULA 5LK5A 2YROA 2E51A 1UPSA 1AJKA 1DZQA 4R9BA 1W6QB 1ENRA 3AJYA 4Y24A 2ENRA 2ZHMA 4LBOA 5E8AA 1V6LA 4M00A 3A0NA 1QDOA 1G9FA 1LHWA 2DUQA 3ILRA 4M3CF 3ZSMA 1A78A 1G8WA 3KM5A 3OY8B 5L73A 1AX0A 1S1AA 2D6OX 1MR5A 3M3QA 1CR7A 3OJBA 3HN1A 4U36A 2YXSA 3KQRA 3B69A 1X50A 3FLPA 1LENA 3FUQA 2GMEA 2AR6A 2I2SA 5DXDA 4YZ2A 2EXIA 1RIRA 5JLVA 3VUOA 3ENRA 1N3OA 1QNYA 2JE9A 3PVNA 1GZWA 5GALA 4FP3A 3DGTA 4GA9A 3LSDA 2EIGA 2ZKNA 3DUIA 1N1SA 3UL2A 4Q1PA 4R9DA 1SLBA 2DTWA 2E7TA 3H0OA 4FOVA 4FPYA 3ZXKA 4ZKTB 2D6MA 2A70A 3MW2A 3W58A 5HCAA 3B3QE 2NP0A 1HQWA 3WG4A 5DG2A 1F31A 2SBAA 1S0BA 4FPEA 5SV8A 4YGCA 1MZ5A 3AXDA 1GANA 1I3HA 2AH2A 2XB6C 3B9CA 1XQNA 1Q8PA 3LSEA 3N3HA 3N7LA 1WW6A 4YGBA 1LECA 4F83A 3V0AB 1VAVA 4XDQA 4YW4A 4YW3A 1KJRA 2VW1A 5GZCA 2CWSA 2DVDA 1JYIA 1YIFA 1WW7A 3RG0A 4BPZA 1G9CA 1ENSA 4TYSA 2DVFA 1FAYA 1Z78A 2YV8A 4PQ9A 4PCRA 5GLVA 1DIWA 3SH4A 3T2TA 1APNA 3APBA 3M3EA 3N35A 5HCBA 2AYHA 4XJ9A 4YZ4A 5H9SA 1VLNA 2Z42A 3N7MA 1EPWA 2CL2A 3JUUA 3OGGA 1BQPA 4FQ4A 1AXZA 1WLDA 4SLIA 2DVAA 2ZGMA 4XBLA 4WV8A 1DQ0A 3RS6A 4XTMA 2ZMLA 3SH3A 5IK7A 1LU2A 4DRRA 3RSJA 3AP6A 1WCSA 1OKQA 2A3XA 1JW6A 5H9PA 1BJQA 4Y26A 2CTVA 1GNZA 3SH5A 3ZPYA 4Q8LA 3N7KA 5T5JA 2YY1A 5GLWA 2WJSA 3RQ0A 3RRDA 4GKXA 3BODA 5H9RA 4M3CE 5AVAA 3W59A 5T54A 1JHNA 1ULEA 1MS8A 4P14A 1SLAA 3BIWE 4AVSA 1ENQA 1BKZA 1DYKA 2EXJA 4LBQB 3WCSA 5JOZA 2A6VA 1QU0A 2AUYA 2A6YA 4LBNA 1YO8A 1SCSA 3AYEA 1SLCA 1MVEA 2G4IA 4AYUA 4JC1A 1RINA 3USUB 1Q8OA 4M01A 4PF5A 3V0BA 3IKWA 1YI7A 2DURA 2P2KA 3AZVA 3B00A 4FPHA 5JOWA 5KXBA 4XXAA 2W68A 1CQ9A 1W6OB 2D6NA 3IPVA 4XOGA 1NLSA 2W52A 4FPCA 1W6NA 2D3SA 3AK0A 4YG6A 5GZFA 4UW4A 2UWBA 4Y1VA 1QMJA 2ZMKA 3FLTA 1C4RA 2KM2A 4GKYA 1G7YA 1GZ9A 3ZSLA 1FNZA 1KDMA 1LJ7A 2JDZA 3VKOA 4MYEA 5DZEA 1N1YA 1MS1A 3PJQA 5JVVA 1WD3A 3IN9A 2TEPA 1IKQA 1A8DA 4H55A 1LHVA 3POWA 1O4YA 2OVUA 1GYKA 2OUHA 4BMBA 4YM0A 1URXA 2BQPA 2YZ4A 3FUOA 4P9YA 4UW5A 4YM2A 4XTPA 4C1XA 1FATA 1KRIA 4UW3A 4YW1A 3AP5A 3LCPA 5IK8A 3WV6A 1AX1A 2A5ZA 5GLZA 2ERFA 1W0OA 1Q56A 2GDFA 1CJPA 1UMZA 3WLUA 3WNXA 1IS5A 1LOBA 1SFYA 3O0WA 3PMEA 4PBPA 4WVWA 4DFSA 1ULDA 1V6JA 2WNEA 4LBLA 2CYFA 3AYCA 4FPGA 2DU1A 2VUAA 1JOJA 3FFZA 3WUDA 2DUOA 2JECA 4WVVA 1G9DA 3I4IA 3ZXEA 1FX5A 2ZMNA 4CRQA 2RHPA 1DQ5A 3PVEA 2WT0A 3OYWB 2FHRA 3MW4A 2ARBA 3AFKA 1PZ7A 3AP4A 3O0XA 3POYA 5T5LA 2P3JA 1MS4A 4XJAA 2LALA 4XYXA 4K1YA 1B09A 1UAIA 1YYNA 4ASMB 4M3CA 4TZDA 5GM0A 4R9CA 4FPFA 5T52A 2ZA9A 2GNTA 4DQAA 3WOGA 2WT1A 3NV4A 3SISA 2R0FA 3ZXFA 4XMAA 2PHUA 2WQZC 2A6ZA 2R1BA 4XILA 1W6MB 2P3KA 1QNWA 3T1MA 3AP7A 4LBMA 2FMDA 4Y22A 4AGVA 1V6KA 1SLTA 1LOCA 1C57A 3M1HA 1H9WA 1Z0HA 2ES3A 5E88A 4ISRA 5IK4A 3B01A 1Y7BA 4Y20B 1HQLA 2P3IA 2ZGKA 5DUVA 1YXWA 3MEPA 4XBQA 4GXLA 2PHRA 4OZXA 3NV1A 4AWDA 1WW5A 4YZ5A 2XG3A 1LU1A 4YG0A 2EXKA 5GZGA 4XHBA 3SITA 2ZACA 1IS3A 1KQRA 2NM1A 5EXOA 1MS3A 1D0HA 2A75A 1S0CA 1UX6A 4Y1XA 2VW0A 1FV3A 3AZZA 3V64A 1F5FA 5FREA 5F5QA 3ILFA 2UWCA 4LBQA 1GKBA 1ULFA 1LGBA 1W0PA 1ZA4A 3WDWA 4FOWA 1Q8QA 1V00A 1W6PA 4K21A 1S0GA 1SBDA 4Y1YA 4FQZA 1LOFA 2ZABA 5GJ6A 3ZXJA 2ZGOA 3D4KA 4R9AA 5T50A 2VU9A 2C5DA 1Q8VA 2DV9A 3NV2A 4XJ8A 4AVVA 1AXKA 1GZWB 1YRZA 3HMYA 1V6OA 1GICA 4XMIA 5IT6A 1C1FA 1IS4A 2JD4A 3WDVA 2WLQA 5JDBA 2E7QA 5EYXA 3OPZA 1LEMA 1CESA 1N1TA 1HLCA 1LESA 2PHFA 2WSUA 2ZHLA 3L2YA 5DZFA 1JXNA 1OQ1A 1QOTA 3O12A 1LOFC 1FNYA 1GV9A 3M2MA 2A6WA 5CA6A 4FPJA 5CBLA 4ISQA 2P37A 2D44A 4CTEA 1GLHA 2JJ6A 4HL0A 4DRVA 1VALA 5CB7A 1DFQA 3AZWA 4XXPA 4DS0A 5F9TA 2PHWA 1LOAA 4UW6A 1D2SA 4NOTA 2DYCA 1GNHA 1U0AA 3INAA 1W6QA 1WUVA 4XBNA 5KXCA 4NO4A 1KITA 2W39A 4AGGA 2D3RA 1MVQA 1JUIA 3AX4A 3ZSKA 2A3YA 2AGSA 2Q5TA 4XJWA 2R49A 4YG3A 5H9QA 3OBRA 5GZDA 2ZGQA 3IM0A 3OY8A 4YW2A 4Q26A 4XIKA 4Y1UA 1BXHA 3CNAA 3WHTA 1G9BA 1CONA 1WBFA 1ZM1A 3T1LA 4XHXA 3OYWA 3WCRA 1AF9A 2OUJA 4BLIA 1DQ1A 1SLIA 4GWMA 1DQ4A 4ITCA 3NV3A 5T55A 1G86A 2WSVA 5EWSA 3UJOA 1ULCA 3WDUA 3WVJA 1LEDA 3ASIA 2A7AA 4BMEA 1N3PA 2D7FA 3AYAA 3C2UA 4YM3A 2EXHA 3WG3A 3ZYRA 4ATEA 1VAMA 3A4UA 1C1LA 1KJLA 1QDCA 2WKKA 1FV2A 1WLCA 2CY6A 4JCKA 2D6KA 2ZGNA 1MZ6A 5CNAA 3O5SA 4GWNA 3VKFC 5T5PA 2OW4A 4FOQA 3FLRA 4YM1A 2NN8A 4K20A 1HKDA 3A0KA 2CNAA 3M3OA 3ATGA 1WD4A 5GZEA 2GN3A 4WZFA 2GMMA 2AREA 4FVVA 5HCFA 1DYPA 4Q27A 3V0BB 1LGNA 2HYKA 4XJUA 3N36A 3VKMA 2ZAAA 5JOYA 4BOWA 1CN1A 3WZ1A 4YZ1A 3V0AA 2A6XA 3BOPA 2ARXA 2R16A 3D5OA 5T5OA 1UL9A 3IPVB 5DUUA 3ZXLA 4ZXKA 1I1EA 1IKPA 1W6NB 5IK5A 1GSLA 4YLZA 4XZPA 2R1DA 5E89A 5EYYA 2E6VA 1WLWA 1NXD1 4BM8A 4LBQD 4YZ3A 4YFZA 1PZ9A 1BYHA 1OFSA 2JKBA 1S0DA 2DVGA 4L8QA 4JRAA 5JMCA 3AXEA 1UN1A 2ZGUA 3N7JA 3PVOA 4AGRA 1MACA 3QCWA 3UJQA 5KXDA 3AZXA 1LHUA 4YGDA 2P34A 2UWAA 5KXEA 2VY0A 1SACA 1LODA 1QOOA
chains in the Genus database with same CATH superfamily
5EFUA 3E6CC 2G9GA 3HBKA 2UU8A 3SCFA 4DPNA 1LAJA 2GZWA 3LFIA 4KQ7A 5C33A 5BNNB 2R7EB 4QQHA 2DU0A 2K2SA 4I09A 5LEJA 1A34A 3H9AA 3GZAA 1FMD1 2GNBA 1UX7A 1PO12 5J96B 2WNUA 4CCJA 4YW6A 1S0FA 1DHKB 2A71A 3WW2A 3VZOA 2QQNA 5D8AA 3IBMA 1JTZX 1Z7S1 5FKBA 4OI1A 3RFRA 4KWUA 4QM8A 2YMZA 5FMOS 2UYAA 1QJY3 1UZZA 2XPJA 5A32B 2IWGB 5GKAC 2XDVA 2OQ6A 1AXYA 2EALA 2VNGA 1RUE3 4L97A 2ZPXA 5FRAA 2Z2SB 4A3XA 4IEXA 3FBYA 3USUA 1I5ZA 1LCLA 1QJY1 1R093 5LB6A 4E4SA 1UY4A 3IDCB 5JIUA 2XLAA 3GNEA 2EAKA 1AR93 2WR9A 1BBT2 1RUE1 4RFRB 1W8TA 1J59A 4Y1ZA 1W6OA 4Y5Z0 4FPLA 4XQ4A 4Q2FA 4COYA 3V65A 5A6QA 5HBAA 5FZ0A 1WBLA 3LAGA 4FFIA 3S6PA 2ZGPA 2E53A 1VIWB 1C5HA 1AR91 4E8DA 1N3QA 5JZGC 4P5YA 1OFNA 1H8TC 1SBEA 1OOPA 2WZR1 2XLGA 5F5IA 1CPNA 3OOXA 3WW1A 4CCOA 1LR5A 1UKGA 1XSQA 3BI3A 1JYTA 1SEFA 1TQ5A 3JU9A 1RB8G 2VMCA 3JBG2 4BISA 1OPMA 4P9JA 3ETPA 3OGSA 2JE7A 2AACA 1YJKA 1D0GA 1VBE2 1XNKA 1JBCA 1O4ZA 3K4AA 5D21A 1CJDA 3E5QA 3OCPA 3TEYA 3R05A 1VP6A 3JD73 1TNFA 4W4ZA 3JCIA 3ZX7A 3WNLA 1GP4A 2RJLA 4L9BA 4AOCA 1OVSA 3VD7A 1TVGA 1UMIA 3WQ0A 2NMNA 3U4SA 5F39A 4AVCA 3PUHA 5IUQA 2VO5A 2VQUA 4PLMA 1UOBA 5FY9A 4BZ4A 5F32A 1RXFA 1H30A 4Z8BA 5J3UA 3JD71 2RS32 3Q8FA 1JS9A 3OBTA 4BQWA 1DLLA 4PQQA 4KG0A 4FCAA 5JPMB 1IQDC 2DUPA 2VW2A 3FWEA 2GNMA 5DQ0A 4CEWB 2MEV3 4MXWA 4KBBA 1JN2P 4KWLA 1ZZBA 4QXHA 5JUVA 4BQ1A 2WO7A 3BTAA 4LO6B 1RMU3 2B7YA 2JDMA 3NQHA 5FPVA 1KGYA 3S7IA 2MEV1 1LOEA 3CIHA 3OSDA 2VMIA 4LBKA 4D69A 3I2IA 3ILNA 4LO5B 2WFPA 4KGGA 3ZOIA 1RMU1 3RVHA 2HWF2 5LW9A 3BCWA 1YQ2A 1H2NA 4BH9A 1DCSA 2YBKA 1J58A 3AYDA 3MIHA 1AL23 1NX9A 2PAEA 1HRI3 1RHI1 4ONUA 2QQLA 3WDTA 2XLFA 3OGVA 4BHPA 4NR1A 3DPRC 1B35C 1LULA 1YI9A 5FZHA 4C91A 1DZQA 1W3VA 4Y24A 1ASJ3 1CIYA 4N43C 4EN9B 3VZLA 1AL21 3ROUA 1HRI1 1V6LA 1GQGA 1Q3EA 3M7AA 4PDWC 1LHWA 2DUQA 3ILRA 1JYWA 2QVSB 3ZYBA 3WR0A 2HKXA 3LD8A 5DN2A 3V56A 1AX0A 2R6QA 2YPJA 4PIZA 2WA4A 4QT6A 1CR7A 3N9MA 4ZZ8A 1PHMA 2OXBA 4HMZA 3B69A 1X50A 4RGAA 5HV4A 1O91A 1W0NA 4NE9A 2E7AA 4NHXA 3GZEA 4ASLA 3MO4A 5TSWA 4Q0QA 5FYUA 3ZFEB 4EYUA 2IVJA 1YIPA 2VQAA 1QHDA 3I97A 2ZS6B 3PVNA 3M4FA 4M4RA 4PI0A 2QZ3A 3DGTA 4G3YC 4LO7A 5LK7B 2ZKNA 3DUIA 4XCAA 4IV3A 4CEYB 3ZYFA 4K7JA 1NQDA 1RUC3 1ENXA 2RJKA 2WNVA 3IT8A 2QQUA 3UL2A 4NHLA 4MGSA 3VBHC 3H0OA 2YBPA 4QPGB 5E6HA 5K9YA 3KV5A 3ZPOA 5M0TA 4OUSA 5HCAA 2BW8A 3W20A 4A42A 5J37A 5C3QA 4DOUA 2NP0A 4LT5A 1HQWA 3D3AA 5DG2A 5FQ0A 4GH4B 1RUC1 4CDWB 2XJTA 4CP1A 1VBD3 3B9CA 3MV01 4RGGA 3N7LA 5FYTA 4CSWA 1VAVA 3N9LA 4MGYE 4D7YA 5IAXA 4LMFA 3LDRA 5K0UC 1WMXA 1I5PA 3KB5A 5GZCA 2CWSA 3VBSB 2I45A 2YPDA 3AKPA 4QX3A 1VBD1 1BCXA 1PK6B 1OF3A 4R8HA 2XJPA 5B4NA 3RZJA 4PQ9A 2YV8A 1DIWA 1APNA 1EPZA 2QQMA 3MIBA 5HCBA 1ST8A 2AYHA 2XONA 5CIRA 4YZ4A 5H9SA 1AL0G 3TN92 1PM7A 1A8MA 4LHKA 3VN4A 1L7QA 4LPLA 3JUUA 4OCTA 4C90A 5FZKA 2RM22 4FQ4A 4R52A 2R062 4KWKA 3GF6A 1WLDA 1VPHA 1PGW2 4X8PA 4WV8A 3T2PA 3IB3A 3JZVA 4LLOA 1WCKA 2VZ1A 4DRRA 2CGPA 1UF2C 1YFWA 1GOGA 4UWDA 3BTZA 2R071 2TBVA 1WMEA 3HPNA 4W6YA 2WNUB 2A3XA 3J7HA 1JW6A 1BJQA 3SH5A 1BEV2 1QJEA 2JB4A 3ZM8A 3GBFA 5EIYB 1E5SA 3MDPA 3P6BA 5AVAA 4BDVB 5T54A 2XBO3 1JHNA 2XXZA 4UT5A 4P14A 3AL5A 5JI7A 3OTFA 3K4DA 3EQEA 5CVRA 5FP4A 4AVSA 1BKZA 1ENQA 1DYKA 1VBB2 3WCSA 1M06G 5EPAA 5JOZA 2AUYA 1OSGA 1SCSA 1YNAA 1HB2A 1MVEA 3USUB 1RINA 2YDEA 2K46A 3EB7A 4GWJA 2XBO1 3IKWA 3WD5A 4CUAA 5KXBA 4OLLA 2W68A 4Q4W1 1ZZ6A 1W6OB 4JKKA 3IPVA 4QXKA 4XOGA 2W52A 3JQXA 3AK0A 4AI2A 3QBQA 4WZCA 3IAPA 1LNSA 2BGCA 2ZMKA 3ME2A 1QIQA 1NCQA 3ZSLA 2VZOA 1W2OA 3C7OA 2JDZA 5FLIA 4MYEA 2RG4A 1MS1A 1OOPB 2P6CA 2VZPA 5G05L 5JVVA 2W94A 2TEPA 1A8DA 1RUJ3 2VC9A 1J84A 4R4XA 3RWNA 2CDOA 4AI0A 2OVUA 1GYKA 5D1IA 3FUOA 2YZ4A 4EROA 1AYN3 1HQNA 5I0UA 1XYPA 3EJKA 4HXCA 4BQ2A 4OHYA 1RUJ1 3BPZA 5FUIA 3VGIA 2WFF2 1Q56A 2GU9A 1UMZA 3SC7X 2OQ7A 3WLUA 1AYN1 2Q4SA 3PMEA 2QJVA 1BK1A 4PBPA 4NN0A 4QMAA 2BFUL 4X6RB 2WNEA 2FDFA 4HSLA 3VBUA 1JOJA 1HV0A 4XFAA 3FFZA 4E4HA 5IFTA 4B29A 4QX7A 5FY7A 3OEBA 4HKLA 4OQ9A 3PVEA 3NJXA 3PJYA 4LHLA 5CKMA 4C0HA 1CAWA 2WT0A 3OYWB 1YWKA 3SCHA 3AFKA 5T5LA 4XEZA 5ISLA 4XYXA 2LALA 2UYBA 1COV2 2BU9A 1B09A 5BNPA 1QJFA 4MXWB 3ORJA 2Q1ZB 1UKRA 4M3CA 5IVEA 1DGWA 4FPFA 4IESA 5FZBA 4ARXA 1XNTA 5T52A 2J22A 3E5XA 2VJXA 3E6DA 3WOGA 4LITA 2R0FA 3S30A 3ZXFA 4QB2A 1UYPA 3DPRB 2VE1A 2OPKA 3HNBM 5JDBA 3J9SA 1GFF2 4GJYA 4Q29A 3G7DA 4GB33 1V6KA 1WCQA 5CFDA 5CFCC 4HT1T 2RV9A 4CDUC 4AVBA 3CJIA 1RUD2 1QY4A 5G04L 2O8QA 4CCCA 2WWSA 3NJYA 4AEDB 5IK4A 4Q4V2 3B01A 4GB31 5JSRA 4AI9A 1I9RA 1R082 1WMDA 1H4GA 4XBQA 4GXLA 4RSUA 5FYMA 4OZXA 1C8M3 4RHV2 3NV1A 1Y3TA 4XUOA 3ZN5A 4AWDA 4UF0A 4YZ5A 4YG0A 5JXJA 1K42A 1VB2A 3IDAA 3SITA 1F8VA 1SZBA 3KT1A 5EXOA 4JGZA 1C8M1 3E6BA 3VBOC 2VNRA 1F5FA 3HT1A 3ILFA 3O1SA 3E97A 3ZFGA 3MZHA 1LGBA 1IQAA 4CP9B 4S2GA 4CUCA 1QXJA 2PLV3 5FO7B 2PN5A 1V00A 3VBHB 4Y1YA 1S0GA 4UI9L 1RUG2 1VRH2 3KV4A 2ZABA 4P9GA 5C71A 5GJ6A 2A1XA 5A1LA 1Y43B 4JDMA 1UNBA 2ZGOA 1XE8A 1DGRN 3WEZA 2BJSA 3GDBA 2DV9A 1Q8VA 2HWB2 5FK8A 2PLV1 2HWE2 1AXKA 1LB2A 2BGPA 4NPLA 4UOJA 5F6LB 4UFIA 3WT3A 2WDBA 4EWAA 2NLRA 4MX3A 3WDVA 3IAQA 4IV3B 5JR7B 3SEEA 3ZXDA 1AR63 2WNVB 2PHFA 3L2YA 4ZY9A 2VZTA 1FNYA 2XHNA 3E5UA 5CA6A 2HWC2 1VBC3 2D44A 3QH7A 1GLHA 5IJRA 4Z2AA 1PVC3 1AR61 1JU3A 3SHRA 4N9IA 4COZA 3AZWA 4CXWA 2XL9A 3BU7A 5JSPA 4JDOA 2DDUA 2PHWA 4KBZA 4JQRA 4RQPA 2BNMA 5A3TA 4RYDA 4UXAA 1O3QA 2VCBA 3NAPC 1PGL1 3FX3A 3CLPA 1VBC1 2CHHA 2TNFA 3CZJA 1RUF2 1W6QA 1PVC1 4AQSA 4NO4A 2D3RA 4ES8A 2D5FA 5LBCA 1T6BX 3D0SA 4J1WA 1OA4A 2R49A 4BIOA 3LDBA 4M4PA 1ZBA2 4XFFA 3IM0A 1XE7A 5FY8A 4NHMA 4Q26A 1TE1B 1R64A 3CNAA 4Y1UA 1G9BA 1WBFA 4NJ4A 4UFLA 1W8WA 3WCRA 1SLIA 2VCMA 4ITCA 1QH6A 1G86A 2LUWA 2FDGA 3WNKA 5FPLA 1H8VA 4M0NA 1N3PA 2D7FA 3AYAA 2R041 3LEKA 4GMP3 2EXHA 5KC5A 3THDA 4IV1A 4TXWA 4HETA 3LPGA 1W06A 3C7EA 1QDCA 4XACA 5T3NA 4AAXA 2BUKA 4HSJA 1W8ZA 3LEIA 4A6SA 1OF4A 2D6KA 2YGMA 5CNAA 3TEWA 4GMP1 5T5PA 2JIGA 4FOQA 4YM1A 1CD3G 1X82A 4CP0A 2CNAA 2FZ1A 3M3OA 3ZN4A 4AI1A 4DB5A 1UIJA 3ZIXA 1OUXA 1ZA7A 2GMMA 3GM8A 2JWPA 5BNNC 4Q27A 1JYXA 4MGZE 4QM9A 4PIYA 3ZO0B 1AYM2 1UO9A 1UOJA 2GC2A 5EJ3A 3RNSA 1ZRRA 3WY6A 3WZ1A 3H8UA 3DYMA 1FOD3 2A6XA 4L92A 4W50A 4D6SA 3D5OA 4Q4X3 2VULA 1NZIA 3IPVB 5EQUA 3ZXLA 1XBFA 2YFZA 4XZPA 1EUTA 1NKGA 3HQXA 5LY2A 1WLWA 1CAXA 1YFXA 2FDKA 2VOWA 1NAEA 1PZ9A 3PIGA 2VZUA 5K8SA 4QU2A 1FOD1 2HWD3 3ZDVA 2YYOA 4Q4X1 4L8QA 3KGLA 2ZCWA 4IE5A 2W1WA 3IIIA 3EHKA 2WS93 5C8WA 4DFSA 2IXLA 5KXDA 1LHUA 2P34A 3MFAA 3D4KA 3Q8CA 2HWD1 1SACA 3KZ4C 1QOOA 2WWJA 3EMRA 1HV1A 4XFIA 5L9RA 1O6UA 2CV6A 1SCRA 1H1AA 2ORXA 2XJQA 4LK7A 2RS13 1PMIA 5DDJ2 2WS91 5F3EA 4NIGA 2Q1MA 3ACIA 2OKXA 1O5UA 4HLTA 4WM7A 1A3KA 3USSA 5BYNA 2N7GA 4URTA 4F7ZA 4IEVA 1YHFA 3R4SA 2ZX2A 3AMHA 4QKDA 1AX2A 3I3DA 4XUTA 5F3CA 1K12A 2RS52 2RS11 3NO8A 3FHAA 4X8NA 3ZKUA 4YRDA 2NYYA 1KS4A 4Z92B 3MW3A 3VBUB 1O8PA 5FPXA 3I3MA 4BIFA 1GBGA 1H6YA 1NE6A 1OQEA 2B5HA 4QPWA 3WW3A 1AUYA 1R1A3 3PDQA 4N90A 5J36A 2QQIA 5BNQA 4U2AA 3BTYA 3ZVXA 3POIA 5JI9A 1R092 1CAWB 1RITA 3BGAA 3ZR5A 2PHTA 3MBWA 1MZEA 3VV1A 4JKLA 3IIAA 4MGKE 5FY0A 2O14A 5CFCB 5A6ZA 1R1A1 5A7OA 4NIDA 5BNPB 1Y9MA 1UZ0A 2VXRA 4WVMA 2OYZA 1WZXA 3ZSEA 4M3CB 5FPBA 2GALA 3NWKA 2V72A 1DYOA 2WAOA 3H8XA 2C4XA 4Q8KA 2W46A 4JQTA 1SLLA 5FMDA 1AHSA 1IS6A 4QDRA 1F35A 4ZXEA 4AI8A 3MF9A 5CFDB 3UGFA 2IUWA 4I30A 4K1ZA 1MS5A 3TBDA 3CJIB 2PELA 2C1FA 3CDZB 4TWTA 4OFGA 4QHOA 2ZGRA 2BVBA 2IFWA 2V5DA 4BQ4A 4W65A 1S2EA 3WUCA 5CISA 3VBOB 3ZSJA 2B39A 2WT2A 2DVBA 1HB3A 2GAUA 1ND3A 2ZX0A 4PHZA 5DUWA 3ZMNA 2NMOA 1QF3A 4AHXA 1JODA 4SBVA 1LKNA 1CIWA 2XOMA 4UF0B 3RMYA 1VBA3 2RR13 1S2BA 3RDIA 3WHUA 3N9NA 2ZEZA 1GWLA 2ZHKA 4JGZB 2P1BA 1W03A 2JKXA 4XJZA 1DLCA 2YGLA 3POSA 1YUDA 4AR2A 4LA2A 5BUVA 4Q4Y2 1VBA1 4QX1A 3ZFGB 1V6IA 4JGYC 3T30A 1V6NA 1F5JA 1AR73 1SBFA 2ZHNA 4KI5M 4CCDA 5F2WA 1F4HA 2V73A 2VMDA 3HNYM 1PO22 4Q1RA 1OMIA 2A3WA 1ODMA 3LIGA 5F5AA 1NOVA 3CQOA 4XUNA 3GZUC 3WDXA 4KL1A 3CBNA 5LA0A 1AR71 2Q8CA 2YC4A 4A7KA 3ZYGA 4IQPA 2Y8KA 1H9PA 2Q0AA 4CUBA 2BNNA 3OGJA 2WA3A 1OUSA 4LHNA 1X7NA 2DTYA 2W1SA 1YFUA 3B9IA 1AR83 4C1WA 4D6QA 5A1FA 1W6MA 3PLQA 5FXWA 1WW4A 3PNAA 1JYCA 5IWFA 4KG8A 3AVSA 3VKNA 1GZTA 3ZYJB 1I6XA 2PHDA 2ILMA 2YU2A 4LBJA 1H0BA 1KD7A 3ES4A 5FMBA 3SXWA 4J6GA 2AENA 1HW5A 2H0BA 2XQXA 1OHFA 3ZFEC 3A22A 1ONAA 3LFMA 3ZIWA 4LLFA 2QQJA 3M8LA 5FPAA 2VBDA 4LK6A 5BY5A 1ASJ2 1OI6A 1UPSA 3N9OA 2WAAA 3RGBA 1W6QB 1ENRA 1OKOA 4EZHA 5FR3A 1ULOA 3ABZA 3WNOA 5FZAA 1QJX2 4HVOA 4ZZ5A 2ZOEB 4LIUA 1GQPA 3ELNA 4JVAA 1NYWA 1G9FA 4DUVA 3QH6A 3PIJA 3LPFA 2B9UA 3KWVA 4OVEA 2B45X 5DABA 5FYZA 4MUVA 5K4LA 3BALA 4YVSA 5J7MA 3PTYA 3M3QA 2ZJCA 3UKTA 1UOGA 3WP3A 5FWJA 2YC0A 2J1AA 1Y9GA 5KWRA 3OJBA 5APAA 1EV12 5FZMA 2WC2A 4U36A 4YVWA 5A7WA 1PIV1 4QHZA 4V1PA 3VBSC 1UZWA 5L19A 2GMEA 1Z7S3 1PK6C 1ZX5A 2VAUA 5DXDA 1OURA 3MIEA 4NVPA 5CU1A 3DV8A 1W04A 5JLVA 4I01A 3VUOA 2WN2A 1RUC2 1SDDB 1U5XA 4FP3A 3WP5A 3LSDA 5ACA1 2JG8A 2VZVA 4FT8A 2YHJA 2WUHA 1RUH1 2FCTA 3B02A 1W99A 4OUEA 5FYYA 2E7TA 3ZXKA 4ZKTB 2HBUA 4FPYA 4LNVA 4YVWC 3VD9A 5CG9A 2A70A 3MW2A 1OH3A 1XNDA 4QGMA 3P3NA 4XQWA 5F37A 2Y26A 1NY72 3BIEA 4IETA 2JDAA 2SBAA 3P5BA 1WWYA 3MGUA 4CCLA 3S5QA 3LSEA 1GANA 2AH2A 2JB8A 2WNUC 1XQNA 2GC1A 1OD3A 2JG8C 2DCTA 2D5HA 5D8AC 1FPN2 3HNMA 5FP8A 2JDKA 2VECA 4QD2A 5FJKA 4A6OA 2Y64A 3B93A 4XDQA 4YW4A 1TMF2 4YW3A 1KJRA 2WZR3 4H7LA 5IAVA 5BNOA 1CAXB 3RG0A 4AEJA 4BPZA 3X29B 5CYYA 4TYSA 1FAYA 5A3WA 3SH4A 4N53A 4UAPA 1MQTA 5DAPA 2KXLA 4JHZA 5A3NA 3N35A 1W9SA 2BP6A 2JE8A 2C26A 3OUIA 3N7MA 1EPWA 1E5RA 3B5LB 4R4ZA 4QKFA 5F8PA 4E2GA 3A23A 5A3MA 2DVAA 4S2HA 1DQ0A 4XFBA 3RS6A 4XTMA 4NIHA 3VDAA 1D4M1 2J1SA 4M0HA 1L3JA 2JDUA 2XL7A 3AP6A 5FDBA 3KQ4B 4IE4A 1OKQA 1BLZA 4Q0PA 1OOPC 1GOHA 5I0DA 4Q8LA 3RYKA 3N7KA 3NNGA 4D7TA 2WJSA 3OBZA 3RQ0A 2V4AA 2YB7A 3LE0A 3W59A 3I49A 1VJ2A 3OPWA 3PMSA 2WYFA 2JXAA 1SLAA 3J8F3 4XFCA 1QU0A 4LBNA 1XYNA 2A6YA 1QQP3 2G4IA 2KR2A 2VZRA 4HG6B 4KGQA 4M01A 4CDXA 5KHHA 1JUHA 5C5TA 5JOWA 3AZVA 2VGDA 3B00A 5FUPA 3J8F1 1Q43A 1W2TA 4HBNA 4A4AA 4TLFA 5I0SA 4Q0UA 1PX3A 3I2OA 2O8OA 5C3RA 2D3SA 1QQP1 1S55A 1GWKA 4FFFA 5IVCA 1QMJA 1C4RA 1VE0A 3LA7A 2G9ZA 1G7YA 1RUI3 3LA2A 1GZ9A 4XUPA 5DAXA 1CAVA 1CX4A 1KDMA 1LJ7A 1VMFA 5EHDA 4YSFA 3BUCA 5DZEA 3PJQA 1RHI3 4AE2A 3IN9A 4V2VA 3U11A 2VOXA 4XUQA 1LHVA 1RUI1 4AQ2A 2Y6JA 4G4FA 1O4YA 2G19A 5LY1A 2B9VA 2OUHA 2Y6HA 4YM0A 4BMBA 4UW5A 2FZ2A 5C5UA 1ND3B 4QX2A 1O8SA 2HEVF 4JGYB 4YW1A 3POBA 3LCPA 5FP3A 2DBNA 2F4PA 2PQQA 2FDHA 3JB8A 3PL0A 2GDFA 4IGOA 1CJPA 4NRQA 4AFAA 1LOBA 4XZUG 4EN0A 1XOYA 3AYCA 5C4WA 4FPGA 1HRV2 3MI8A 3VHPA 4AEDC 1V70A 3T0BA 3I4IA 1T2XA 3U07A 4B8EA 1FX5A 5KHKA 3CEWA 2DF7A 1IPKA 1NT0A 1DQ5A 2VVEA 3ETQA 3KT7A 4GQ7A 1JMUB 4LKEA 3RZLA 1NQJA 2FHRA 3H7JA 3ITQA 3CJXA 3TEZA 1OLME 3AP4A 3O0XA 4O9EA 4OHXA 4AXOA 1MS4A 4QB1A 1HXS3 3GJAA 3I3QA 4K1YA 4YW7A 4A7YA 5C4WC 1XE0A 4TZDA 1NLQA 4R9CA 5ANQA 2BWAA 2GNTA 2ZA9A 4DQAA 2WT1A 3NV4A 2EICA 3BTXA 4XMAA 2LM3A 1T6GC 2R1BA 1IHMA 1HXS1 1W6MB 3KCCA 4OI4A 3RPQA 3CMGA 1S4CA 3GGLA 3AP7A 3NNMA 2B8MA 4LBMA 4W6WA 4DUXA 1JZ7A 1TME2 2GC3A 2FCUA 4FBFA 5ABJA 4V2WA 5AFBA 2W87A 4H3WA 2VVDA 2X5IA 5FBZA 3KHBA 1OVPA 4MVTA 3RZHA 3VZMA 2W1QA 1H9WA 1W2AX 3WF2A 1DP0A 4WM8A 1QJU3 1X9TA 4GMP0 4META 4I02A 4XFHA 1W8HA 5E88A 5A7NA 4ET7A 3O1UA 4QU1A 1Y7BA 4L0PA 4LA3A 4O7XA 2ZGKA 4FTEA 1C3HA 3MEPA 1UIKA 2PHRA 3IWZA 4IV3C 4K9SA 4KU7A 3KT4A 2D97A 2WNVC 2BV4A 1O5LA 1QJU1 1LU1A 2PFWA 3HT2A 2X5IC 2E33A 2ZACA 5EJZB 5F5CA 1PO13 2AZ5A 1GWMA 2IXJA 3DCQA 4OMDA 5FPUA 1UMHA 4C8DA 4Y1XA 2VW0A 5FXZA 2O1QA 1FXZA 2I74A 1NLRA 3AMNA 2WRAA 1H1MA 4BQYA 4LBQA 4QAWA 4YVSB 3FN9A 1W0PA 1PO11 3KCYA 1XSRA 1E57A 1W8OA 2R073 4EN7B 5A7WB 1SBDA 2VXJA 4YVWB 4EN8B 1REEA 4IEYA 3RI9A 2VTFA 1CAUA 2OZJA 2WWUA 5DAQA 1JYNA 4QXCA 5E1RA 4LEJA 4R9AA 2ADDA 2VU9A 2C5DA 4XJ8A 4AVVA 2W1UA 1BBT3 1YRZA 3FL7A 3HMYA 2Y6FA 1GICA 4XMIA 5E16A 2JG8B 5IT6A 3W5NA 1IS4A 2JD4A 1V9U2 5D8AB 2E7QA 3OF1A 5EYXA 5JXHA 2WSUA 1ZBE2 1LESA 3UNPA 1YJLA 4OQ8A 5DZFA 3HEIA 4AI3A 3U1XA 3O12A 4QQ2A 1BBT1 3M2MA 3NJZA 2A6WA 4OUMA 4FPJA 5CBLA 1IGOA 4Q4W3 3N9QA 4JTNA 2QQVA 4HL0A 4DRVA 3KCXA 5FY1A 3T4HB 3ZLIA 4XXPA 3S57A 1GQHA 3OGRA 1JOBA 3O1OA 5I8SA 4N7IA 1LOAA 3JBG3 3DF0A 4O9GA 1GNHA 3BOWA 1SHWB 2Y6GA 4G9SB 2VQTA 2WZEA 4UBHA 2LRPA 5IW0A 2D40A 3ZN6A 1H6XA 3AX4A 4XURA 4EWEA 3IDBB 1JI6A 1POV3 2DFCA 2AGSA 3JBG1 4I0AA 1US3A 4N53B 1MQTB 5FZCA 4URAA 3S0MA 2KD7A 5GZDA 4QGNA 2IVIB 4OZOA 3WP6A 1VBE1 5FWEA 5AC92 3AL6A 4RS5A 1UXZA 1CONA 3VB9A 1W8FA 1HB1A 4LOSA 5FZ9A 4XHXA 1POV1 2WABA 2LS6A 2K0GA 5FZ3A 2GC0A 1DQ4A 2RS33 3NV3A 4C1XA 5CG8A 1LEDA 3ZFFA 4BQ5A 1UYYA 4AQTA 5C8CA 3WG3A 1NCQC 4LKFA 5JXGA 2Q8DA 4AHYA 1U5YA 3A4UA 4EE2A 3TEXA 1FV2A 1ALYA 2RS31 1WLCA 4K40A 1MZ6A 3O1VA 3T3YA 2NQYA 1Y4WA 4FTBA 1ZZ7A 3QOPA 3DXUA 1OH4A 4P9IA 3Q8EA 4E2QA 1UXXX 2AREA 4FVVA 5CKNA 3OEAA 5HCFA 4BE3A 3LA3A 2XQRA 4CDXB 2HYKA 4CPBA 4LTAA 2HWF3 5FZFA 5JOYA 2BVVA 4BOWA 2J1RA 3V0AA 3TNPB 2ARXA 2R16A 2BFUS 1RVF2 4UBGA 5JWPA 1GSLA 4IDZA 3VBUC 1RC6A 4ZU5A 4X6QB 5EYYA 2HWF1 3LZZA 2A73B 2F4LA 1CAVB 1E5HA 3DYPA 3U37A 3WX5A 2JKBA 4HFSA 1D2QA 1UN1A 3O14A 3HWJA 4ARYA 2ZGUA 1MACA 5A80A 3T09A 2WYSA 3UJQA 5FZ1A 3DN7A 3AZXA 4PIXA 4GZ9A 2RE9A 5BNPC 1NE4A 5KXEA 2VY0A 2RS12 2D6OX 5ANNA 2QDRA 4RFT0 2J7MA 4E27A 1KEXA 3WG2A 4PJYA 1SFNA 4LXLA 4A41A 4B4RA 4NIAA 3FC0A 4DXSA 2E26A 4GALA 5DZGA 4AFCA 4EJRA 4FOYA 2ID4A 5CFDC 2VZ3A 2FDIA 2WN3A 2BBAA 5FCCA 3CJIC 2XJSA 1R1A2 5C4WB 2UURA 5FLHA 1D7PM 3GALA 3EYPA 4LJHA 4XFGA 2W3JA 3WF1A 5J09A 1XXNA 1PZ8A 2VUJA 3IMNA 3NRUA 3IMMA 1G9AA 3DL3A 4F3JA 3AMQA 3O1PA 2D6PA 5K7PA 4B3NA 2WO2A 1EAH2 1MEC2 1TEIA 2RMU2 4QX5A 3O1RA 2NZ9A 4YFWA 3K3OA 1XC6A 2CWMA 4FPOB 4BYYA 4JGZC 4MGTA 4XW3A 1ULGA 2SLIA 1XRUA 2P3YA 1S0EA 3ZFGC 1BMV2 5DAWA 1S0JA 2TUNA 2BZDA 3TB0A 5JOXA 3ZXAC 1HN1A 5ABJB 1QXPA 5FZOA 1FYUA 1OPOA 2X5IB 3HVDA 3RYPA 2VNOA 1DGLA 4HK9A 1PGSA 3SNMA 3UT0A 3TN93 4WM8B 1REFA 5FQ0B 4CCNA 1GNYA 2RM23 4NIIA 2R063 2W5FA 1BVVA 3H1WA 3HQUA 4AFBA 5I0RA 4PLNA 3TN91 2RR12 5I93A 2XJRA 1Q5OA 5C7GA 3RZMA 1UU5A 1DBNA 1W9FA 2EA7A 2WQ8A 2JX9A 2RM21 3C8XA 3FE5A 4O65A 2R061 3TWIA 3VL8A 2W95A 1PGW1 4YGEA 5FXXA 1PX4A 1BEV3 2VMHA 3L2HA 3UV9A 3B7MA 1AJOA 5BV6A 4ATFA 5KHJA 5FBJA 4CXYA 4IEWA 2ZZQA 3UK9A 2JDNA 3WP4A 5J1XA 1YQ6A 4RQPC 3AMMA 5FUNA 4AFMA 2R043 3AZYA 4D0QA 2DBIA 3FHQA 3C7GA 4RL7A 3KD4A 1VBB3 2FD8A 4GD4A 1BEV1 4YARA 1JYVA 2ZEYA 3I2DA 3SEPA 1EY2A 3H8RA 3AP9A 2DWRA 1CAUB 5L36A 3EBRA 2PQSA 3LDKA 5DUXA 3M3CA 1WGPA 1HJGA 2OZ6A 4ES9A 4IW3A 4Y4RA 3H7YA 2X09A 1VBB1 4CZSA 4D7SA 4D8MA 1QGLA 2GN7A 1AR82 2EF6A 3ECQA 1CGPA 1UW8A 2V5YA 4HPKA 4FP2A 5FK7A 4PBOA 1W3XA 5A3OA 1Q8SA 1SPPA 5I8TA 4IEPA 4P9XA 1PMHX 1RJ8A 2ZX1A 4OULA 2X10A 4A2UA 3FHIB 3DECA 5FFOC 3AJZA 5B4XA 1JZ2A 1MS9A 1UZYA 3OD0A 5HPOA 2YBSA 2D43A 4IV1C 3U4XA 1V6MA 3HJRA 4J25A 2CAUA 4XIOA 3ZR6A 3UKNA 4HOOA 2EAAA 3GJBA 4QPIA 5C3PA 5CAZA 3NKTA 5F3IA 5LZ6A 3Q9OA 5LK5A 5LCWL 1W39A 1VR3A 1O4TA 4R9BA 2CSGA 1WA6X 4K8FA 4BXSV 3KLSA 2ENRA 3ZN6B 2QUOA 2WFF3 3BVCA 4LBOA 1WCDJ 5C9AA 4M00A 1NCQB 4NMIA 3A0NA 1QDOA 4FAHA 4M3CF 5L9BA 3BPSA 5FZDA 3RWKX 2J42A 2XVKA 3KM5A 4RS5B 5FP7A 4N9HA 4UFMA 1FMD2 1TZOA 3TNQA 2WFF1 2EVXA 1MR5A 2JDHA 2JENA 2UY9A 4PT6A 3URFA 1BVP1 5FTTC 4H14A 4EV0A 5JAXA 1Z7S2 2VM9A 3HN1A 3ZFFB 5FPZA 4Y3OA 2YXSA 4OI0A 2GP5A 3KQRA 4C0BA 5C8CB 1YQCA 3I2HA 5FY5A 2I2SA 4L99A 1O3SA 3CO2A 3NJVA 2VMGA 1COV3 4IEUA 4YZ2A 4LOTA 1RIRA 3K3NA 5GALA 4JX0A 4GA9A 5LBFA 2EIGA 1QJY2 3PUQA 3T0AA 4CU6A 4R9DA 1COV1 4FFGA 1RYYA 3POJA 3MIFA 5F2SA 1RUE2 1UOFA 4LQRA 3U78A 3W58A 3H3UA 1GMMA 4Y5SA 4WM7C 3WG4A 4AFDA 1F31A 1RUD3 1S0BA 1TNRA 2BWCA 3JXSA 5I0TA 3T2QA 3AXDA 2RJ2A 3VLBB 2VTXA 1AR92 4DEQA 1Q8PA 4CA9A 3V0AB 3FJSA 4Q4V3 1LECA 2XWBB 2WZR2 1R083 4MADA 2AC1A 4I0WB 4NPMA 1RUD1 1UY3A 4RHV3 4B1LA 2VW1A 1CZVA 3DXTA 4PLOA 3UGGA 1JYIA 5AVPA 4BCUA 1G9CA 1ENSA 2DFBA 4Q4V1 1NA1A 1UPIA 1Z78A 2DVFA 2ADEA 4PCRA 5GLVA 4I0BA 1R081 1JZ8A 2MHFA 4P5HA 4XJ9A 2IZWA 4RHV1 3VDCA 1VLNA 1ZNPA 2QQKA 3PU8A 4XETA 3I7DA 2CL2A 1JZ6A 4A45A 4QPYA 4IGPA 1K3IA 3F95A 2ZGMA 2J1EA 4DY3A 2Q1FA 2VL4A 2AEYA 2ZMLA 1US2A 3M70A 3F2ZA 5IK7A 3OBAA 3RSJA 1RUG3 1VRH3 3C3VA 3H3LA 1UY1A 3MV11 3U75A 3ZXGA 4CEWA 2VG9A 4XABA 4BK5A 3JD72 4Z82A 2HWB3 5H9PA 5IFPA 2CTVA 2K9ZA 2Y60A 3VBFA 3CKHA 2HH9A 2PXJA 1RUG1 1VRH1 2YY1A 3J8F2 3PU3A 3BODA 1UWWA 4M3CE 2ZAHA 2W91A 1X8EA 2HWB1 4EQVA 4RR3A 3BN6A 5HI0A 1ND3C 2BDRA 2HWE1 2XKPA 4BK4A 1YO8A 2QFEA 3DKQA 3J7MA 1SLCA 3T08A 2ET1A 4AYUA 1J3RA 2DCJA 4PF5A 4A7ZA 1YI7A 2P2KA 1K5MA 2ZKLA 4PF1A 2MEV2 4DUWA 4XXAA 2QDNA 3J4UH 4QXBA 2IXKA 1HN0A 2D6NA 4GJZA 5I91A 4FPCA 1WKYA 4FO9A 4YG6A 1RUI2 2HWC1 4QQOA 5GZFA 1RMU2 4UW4A 2UWBA 1RUF3 4QWNA 3SQOA 4GKYA 2OA2A 3AKRA 2XMLA 2FMYA 3EXUA 1IPJA 1RHI2 3GZTB 2VVFA 4UFHA 3VKOA 3GHNA 5FZOB 3VBRA 1K5MC 1X9PA 4HKOA 1ZBA3 1RUF1 3S5AA 1IKQA 4H55A 5L7OA 1OLRA 4IXLA 2R30A 4MHUA 1AL22 1HRI2 2E63A 5FOBB 4FTSA 4GIQA 1URXA 4YM2A 4E9KA 4P9YA 4K3UA 4Q0VA 4XTPA 3UKVA 4D6RA 1KRIA 4UW3A 4RQPB 1ZBA1 1KS5A 5IK8A 1SFPA 1AX1A 2A5ZA 5J48A 5GLZA 2ERFA 4E4ZA 5AFEA 1XU1A 4LO8A 1SFYA 3O0WA 3J7LA 4WVWA 4XCBA 1ULDA 5F1RA 3VZJA 2VBBA 2CYFA 2RDSA 3H42B 1F4AA 5FV3A 1QEXA 2DU1A 3HN3A 3WQ1A 3WF3A 2DUOA 2JECA 1PIV3 1G9DA 3ZXEA 1YC61 3ZYIB 5LA1A 1VB4A 2RHPA 4IEOA 4OHVA 1UU4A 2ARBA 4XDOA 3POYA 2F17A 4MGQA 2P3JA 4XJAA 5ACA3 1AYM3 1OT5A 1UAIA 1YYNA 4ASMB 2JEMA 3H50A 4IV1B 1RUH3 5GM0A 2XJVA 1FT9A 3GBGA 1POV0 2IXIA 3POFA 1ZRCA 3AKTA 3C7FA 3MHZA 3SISA 4ZU7A 4HPKB 4NPRA 4GWIA 2PHUA 2WQZC 2CDPA 2R32A 4XAAA 4COUA 1SPPB 4XILA 1GUIA 1AYM1 4MHRA 4YVSC 5L9VA 5LEKA 1QNWA 4HK8A 4XPVA 2OT7A 5FLJA 4BA6A 1A6CA 4Y22A 2X05A 3THTA 1DU3D 3L9JT 2PTMA 1C57A 2UY8A 2BERA 3M1HA 5FMOL 2ES3A 2ATFA 1VBD2 4ISRA 3N4MA 1H2KA 1NUKA 4QPIB 5KBFA 3PVBB 1ZVFA 2C6SA 1YXWA 5A3LA 4Q0SA 2VNVA 5LASA 1RUOA 3NNLA 1PMJX 3P3PA 5DDJ3 3ZKYA 1GU3A 2KA3A 2VD7A 3ALQA 1WW5A 5FYIA 2XG3A 3KF5A 1L7RA 4CU9A 4XHBA 3O7OA 5GZGA 1S2KA 3G6JB 5A33A 1KQRA 3KVAA 1TG7A 5C9AB 5FO9B 2VMFA 4DY5A 2NM1A 1RXGA 1D0HA 2RS53 1S0CA 1SG3A 2WO1A 5DDJ1 2JD9A 1FV3A 3PHMA 4LIVA 5FREA 4KWJA 2R072 1K45A 2UWCA 3BYWA 4HVRA 4UFJA 1D4M3 2BGOA 2D98A 1XYOA 4FOWA 3I2KA 1Q8QA 5JZGA 2RS51 3MFCA 1W6PA 4K21A 1H8TA 1REDA 1LOFA 4I3GA 5EZWA 5A1AA 4BQXA 5BNOC 4CP2A 4TTGA 5LRSA 3BU0A 2VR4A 3LOIA 4WM7B 1NZCA 4AEKA 5T50A 1U5ZA 1JU4A 1H2LA 1MQTC 3GXUA 4N53C 5IVBA 1R091 4IGQA 4CU7A 1V6OA 4A3ZA 2IC1A 1C1FA 5B2GB 4LHSA 1VMHA 2BBVA 2ORZA 2XBO2 2ZHLA 1CESA 3OPZA 1HLCA 4Q5OA 4XDPA 5C3OA 1JXNA 1OQ1A 2Y33A 2BYVE 2Z5WA 3ACFA 1LOFC 4Q4W2 5HXVA 5JMOA 4OI2A 2VZQA 5HV0A 2E32A 3KGZA 3THCA 1CZSA 4IUGA 4CTEA 4Z2WA 2G1MA 1OLQA 2JJ6A 4QX0A 2ZEWA 5CB7A 3HOBA 5F9TA 4DS0A 3T2OA 1DG6A 2GP3A 2PHLA 1PVXA 2V09A 1D2SA 4UW6A 4WVMB 4N8MA 4AL9A 2DYCA 4XF9A 1ZYBA 1H1IA 3TYJA 4COWA 5C3SA 5FO8B 3R4DB 1WUVA 5KXCA 1KITA 3OB8A 1ZREA 1MVQA 1PNGA 3ZSKA 5F7UA 1GOFA 5A70A 1NA1B 2IFRA 4QQPA 3ON7A 1OXCA 1BK0A 3OBRA 4NAMA 5JXIA 2IXHA 4CDXC 2BPA2 4NHKA 2ZGQA 4JHTA 1RUJ2 3OY8A 1G6NA 4S2FA 4IERA 4XIKA 3RYRA 5JR2A 1XNBA 2ARAA 4LKDA 4Q4Y3 1DGWX 5KR7A 1Y9QA 3OYWA 5LRRA 4AQ6A 1AF9A 1AYN2 2OUJA 2RVAA 4GWMA 4JKMA 3WDUA 5T55A 4BB3A 2QQOA 3U14A 3WVJA 3WQBA 2A7AA 4BMEA 2JIJA 1PO23 3C2UA 3UETA 4YM3A 2Y38A 5CZKA 4ATEA 4Q4Y1 1KJLA 2VBPA 4I3PA 2WKKA 4E2SA 4AEDA 2CY6A 2JDPA 3GYDA 2ZGNA 3POEA 3DPRA 1B35A 3VBFB 4TLGA 4CYDA 1PO21 2Z69A 3VKFC 4GWNA 1ULPA 4MG2A 1W2NA 3GHMA 2BOJA 4BU2A 3FLRA 4N7UA 2JDYA 4K20A 1HKDA 2Q8EA 4N43A 3ATGA 1WD4A 5LATA 5GZEA 3CU7A 4RR3B 4WZFA 2WO3A 2B46X 5EJ1B 4PDWA 1OQDA 2PAMA 5LBBA 3AVRA 4IE7A 4MSVA 2V4VA 1LGNA 3D82A 1JH5A 2YU1A 1K5MB 1CN1A 2VOTA 4YZ1A 2E31A 1XJAA 4S2DA 1UYZA 3AMPA 1DGRA 5FYBA 5A3PA 1OBNA 3ACHA 3IZOA 5DUUA 2J1TA 5T5OA 5IATA 4ZXKA 1I1EA 1O3RA 4YLZA 1W28A 1IZ3A 2R1DA 5C70A 4XF4A 1WCUA 2E6VA 4BM8A 4NHYA 4LBQD 2W47A 4KH9A 4YZ3A 4YFZA 4WVZA 1BYHA 1QJX3 4GB32 2DVGA 1UZVA 3NVCA 3OG2A 3VBRB 5A6XA 3VD3A 1ASJ1 2B42B 3N7JA 4P9LA 4AGRA 1RGSA 3WNNA 5L7OB 4CP9A 1UU6A 2RDRA 4J1XA 4YGDA 2QQWA 2UWAA 3PURA 3VBHA 4Z1VA 1QJX1 1LODA 5FP9A 4DXZA 3J7NA 4NUBA 1X33A 1C8M2 1EV13 1BZWA 1GP5A 5LWBA 4QHBA 1N1VA 2C9AA 2OPWA 3KVBA 3PUAA 3SLIA 4CCMA 1YEWA 2VTXJ 5ABJC 1NCRA 4HANA 5FZ8A 1MS0A 4XF1A 3D0JA 3WNPA 2ZZJA 2VPVA 5CEHA 4K8RB 3K2OA 2VMEA 4P9WA 1EV11 4ORFA 1R1ZA 4WM8C 4CXXA 1XPWA 2FCVA 5K0UA 2RDQA 1AZDA 3WG1A 1QKQA 2ZGSA 3LEMA 2GNDA 3TAYA 1LHOA 2PLV2 2R0HA 2XKOA 1C28A 4W6XA 3VKLA 2D6LX 5I8YA 1ACCA 3CHXA 1NCRC 1O7FA 1W90A 1JZ3A 2VH9A 4BWOA 3GCXA 2W9XA 4HZFA 4NRMA 4FFHA 4DIQA 4XE9A 5JIAA 1FPN3 3DKWA 5ERLA 5FKCA 1LOGA 5FYCA 1NY71 1UCXA 5HCHA 1AR62 1TMF3 4LKSA 3OUHA 4BLJA 1CPMA 1JHJA 4ZHNA 4Y22B 1PNFA 2Y6KA 1LTEA 2ZGTA 1FI2A 3H1YA 1RJ7A 2D3PA 4ZPIA 1FPN1 1HDKA 1PGL2 2OIIA 3AM2A 1VBC2 1LGCA 5A6YA 2ZEXA 1PVC2 5DG1A 1TMF1 3KV9A 1CVNA 2W08A 1DZRA 2P5BA 3K46A 2ZBJA 3MPPG 3O0VA 1S0IA 3R4UA 5JPNB 2QE3A 3VHRA 4AAPA 1QXRA 4JRLA 1UD1A 5FZ6A 5FZIA 1UY0A 4AVTA 3RMXA 3VZNA 1MPXA 2HEYF 1U5IA 3FMGA 3I59A 3NSTA 2BTVC 4B7EA 3QLQA 4D3WA 1QOSA 3I8TA 3GBWA 1VBE3 3ZYPA 1LHNA 5A33B 5BNOB 2YG0A 3D6EA 1KDKA 1HIXA 3I2FA 3E1F1 1CWPA 4FAGA 5FYSA 2R042 4CPBD 1DF0A 3OUJA 1M4WA 3RJRA 1F9KA 3LEGA 1DQ2A 4LR4A 2WIIB 4GAZA 1EP0A 4BQ3A 5JZGB 1DQ6A 3HBZA 1W6PB 4NWVA 1H8TB 4RA0A 4QDSA 1GZCA 4UYBA 4TSVA 3UGHA 4IE6A 2PHXA 4AZZA 5FXVA 5LA2A 1AVBA 4YW5A 2VOVA 4NRPA 2WL1A 3SMHA 2WNOA 3OPTA 2VOKA 4AF9A 2QTWB 3OD4A 2F6BA 1N47A 4CVUA 4QGLA 2EIBA 2QQPA 4MOAA 4FPKA 4RS5C 1LRHA 2GMPA 1W8NA 5GLUA 5A3UA 3VZKA 1QH7A 5CKQA 2ET7A 3SKVA 2ZGLA 1IOAA 3I2GA 3ZFFC 4YPJA 5HXMA 3MLJA 2VZSA 3MIGA 5C8CC 2VUCA 2QBXA 5FZEA 3WDYA 3KHCA 4DNYA 1X8MA 3NNJA 1J1TA 2LTNA 1ND2A 1OC1A 1FOD2 5LA9A 3ACGA 4Q4X2 4Y20A 5GLTA 4Y5TA 2VCCA 1ODNA 2YROA 2E51A 3I54A 1AJKA 3TRSB 3AC0A 4XC9A 3FZ3A 5FZGA 1HX6A 3B94A 3AJYA 2PYTA 3WNMA 2QNKA 2HWD2 2ZHMA 3NW4A 2IXCA 5E8AA 5BPXA 2GSYA 5DAVA 3ZSMA 1A78A 2WS92 1ND2C 1G8WA 3R6SA 2BOIA 2HYXA 3OY8B 4HKWA 1HRV3 2B4KA 4O61A 5L73A 4DO0A 3K51A 3CL1A 3HQRA 1S1AA 1RL3A 1V0AA 4ZS2A 5IVYA 4OHWA 3S7EA 2LW8A 1SMVA 1C5IA 5CFCA 4CCKA 3W21A 3FLPA 5FZ7A 4CDUA 2OX0A 1HRV1 1LENA 3FUQA 3MICA 2AR6A 2XVGA 5KHGA 3DEMA 2XR4A 2WZPP 3VDDA 5JCTA 2EXIA 1ZZ9A 3ENRA 1N3OA 1QNYA 2JE9A 1X36A 1GZWA 3JQWA 3R0RA 3WW4A 1BHGA 1B35B 4A44A 1N1SA 4MV2A 2C0ZA 1IG0A 4Q1PA 4B4PA 1SLBA 2DTWA 4N43B 4FOVA 4E4DX 2D6MA 1TME3 1UY2A 1E5IA 1OA3A 2PA7A 3B3QE 1ZRDA 3WF0A 3Q8AA 4PDWB 4MO3M 4HVQA 3VL9A 4ZS3A 3RZZA 4K6BA 3VDDC 5SV8A 3VBOA 4FPEA 4YGCA 1MZ5A 2QZ2A 1I3HA 2XB6C 2P4EA 3AKQA 2GH8A 4LO4B 3N3HA 4YGBA 4F83A 5LBEA 1WW6A 2Q8OA 3AFGA 2PMWB 1TME1 2H6CA 4WBBA 4QX8A 3H8OA 2X29A 4KNCA 4OHZA 2HEWF 2CGOA 2DVDA 4YNIA 1YIFA 1WW7A 3NKGA 2JG9A 2XHKA 2Z79A 2CAVA 4COVA 1H4HA 2HJIA 3T2TA 3T0DA 1STMA 1W05A 3APBA 1MZFA 3M3EA 1OA2A 4MLOA 3MIDA 1HJFA 3AB0A 2Z42A 2Y0OA 4FSJA 1P8JA 3OGGA 2JICA 1BQPA 1AXZA 4SLIA 3K77A 3IDEA 4XBLA 3JB4C 4YYOA 3MYXA 1O3TA 3SH3A 4FXGB 3KS7A 3M3IA 1LU2A 2JG9C 4LUKA 4H7MA 4XAEA 1VBA2 1WCSA 3A7QA 1NCRB 2Q30A 2W92A 1QWRA 4Y26A 1GNZA 3ZPYA 2Y0IA 4JV4A 4IEQA 4PI2A 3NAPA 2BNOA 2QKDA 5GLWA 4RGKA 5T5JA 5KHIA 3RRDA 2L9LA 4GKXA 1V9U3 4NAOA 5H9RA 5K0UB 2ZX4A 5IYYA 1ZBE3 1J3PA 1MS8A 1ULEA 3BB6A 4BXFA 3ST7A 3BIWE 2GH2A 1AR72 1VMJA 2EXJA 3LGRA 4LBQB 4EN6B 2FQPA 2A6VA 4IE0A 4OMCA 3EO6A 3AYEA 4RD7A 4F8AA 4JC1A 4LORA 4LUMA 1Q8OA 3V0BA 3KV6A 1V9U1 3DYOA 5EP9A 3I3BA 1SQ4A 2DURA 1ZBE1 4FPHA 2DCYA 1H2MA 1JOPA 2H6BA 1J3QA 2VQ0A 1CQ9A 2WLPA 1VAKA 3PUSA 4AK3A 1NLSA 4P00B 4CDQA 1W6NA 3HAGA 2XUMA 2XH6A 4Y1VA 4MH0E 3FLTA 2KM2A 4MXVA 3J26N 4LE4A 1FNZA 4IEZA 4CE8A 1CX1A 3D8CA 2ZX3A 1N1YA 2QCSB 3LOBA 1WD3A 2RDNA 3FBMA 4TN7A 4IL7A 1W9YA 3PUIA 4CDQC 2I07B 5AC93 4CCEA 3POWA 5IVJA 2ARCA 4UFKA 2BQPA 2YFUA 4JDNA 3K4ZA 1FATA 3O1TA 1DZTA 1GR3A 2X8KA 4JAAA 3I59B 3GCWA 3AP5A 4DXTA 1KFXL 1YFYA 3LKJA 5BNNA 3WV6A 5AC91 1QJZA 4GULA 4H2AA 2D93A 3U10A 1W0OA 3NNFA 3LQCA 5SV5A 5FMCA 3WNXA 1IS5A 1ZZ8A 4D94A 4HONA 2FDJA 2XJUA 1V6JA 4LBLA 1XNAA 1PIV2 2VUAA 2E9QA 5J98B 4DMIA 1OD5A 1W2UA 4WVVA 3WUDA 5A32A 3KSCA 3TOJA 4QPIC 2ZMNA 3WF4A 3ZMOA 5JSOA 4CRQA 3LIHA 1YQ5A 3H3ZA 2W2IA 1EYBA 3MW4A 5ACA2 5FZ4A 2YUEA 1WLTA 1PZ7A 1IPSA 4NROA 1RUH2 2OS2A 4AG4A 5C9AC 2ETEA 1SDWA 1YQ8A 4B7KA 5F3GA 1RVF3 3CZUA 4OYUA 4MZUA 2A6ZA 2P3KA 2NPIA 3T1MA 2FMDA 4AGVA 1U12A 3I2JA 1RVF1 1SLTA 1LOCA 2J1UA 3KMHA 3N9PA 3RI8A 4DEVA 1CZTA 2Z4FA 2DCZA 1Z0HA 3ACLA 3W5MA 1ND2B 4QKBA 5IVVA 4MGIE 3SKJE 2ZXQA 4LULA 4Y20B 1PM4A 1HQLA 2P3IA 5DUVA 4W8JA 1XNCA 2W0XA 5FOJB 2ZTNA 3POGA 1W8UA 3T4VA 2H0VA 4XQDA 1UQXA 3NMBA 3MPBA 2EXKA 3Q8BA 2WBKA 4Z07A 1IS3A 4Y33A 2BRTA 1KFUL 1MS3A 4LE3A 1F15A 2A75A 2XWJB 1UX6A 1D4M2 4FXKB 3AZZA 4HN1A 3V64A 2J1VA 2VCAA 4XVHA 5F5QA 4DXRA 2HLEA 1GKBA 3MLKA 1ULFA 5CADA 1ZA4A 3WDWA 1RUNA 3MUZ1 3MF6A 1L7LA 1UYXA 3ZDSA 3K48A 4QB6A 1YCIA 1NXMA 3FFQA 2C24A 4FQZA 5FAXA 3WINE 4CDUB 4ZONA 5D2AA 4EZ4A 3ZXJA 1EAH3 1MEC3 2MNGA 4B4QA 2RMU3 3NL1A 5A7SA 4E8CA 1NA1C 1DDLA 3VDDB 2X53S 2VUDA 3I3EA 3NV2A 3SCGA 2CGNA 3RZKA 4I2OA 1JZ5A 1GZWB 1O59A 1ZRIA 3MLLA 2HWE3 2Y6LA 2WLQA 2WQ4A 3UYJA 3VD5A 4HN0A 1EAH1 1MEC1 1LEMA 3THPA 1N1TA 2RMU1 3VHNA 5A7QA 1OLMA 1QOTA 4AVAA 1JZ4A 1K5JA 3KF3A 2EIEA 1GV9A 3RJ2X 5DMYA 3LWCA 1QQP2 4EWDA 2Y34A 4ISQA 2P6HA 2P37A 5FY4A 4AHZA 4CEWC 5KC6A 1ZRFA 1VALA 1DFQA 2DCKA 2HWC3 1BMV1 1ZZCA 2EIDA 3ES1A 2XUEA 4QQLA 3BKZA 4JGYA 4AHWA 3VBFC 4NOTA 4DZGA 1U0AA 3ZYHA 3INAA 3QD6A 4JTOA 1W9TA 4BJ0A 1YLLA 4XBNA 3WXPA 2PAKA 1IG3A 2W39A 3K75B 3LF7A 4AGGA 1JUIA 2JG9B 3UESA 4RR3C 2A3YA 2P17A 2Q5TA 4XJWA 4CUGA 4YG3A 4INDA 5H9QA 1D4VB 4L11A 2RR11 1WA4A 4NWWA 5EV7A 4YW2A 4ASKA 4DINB 1BXHA 3WHTA 1ZM1A 1KXGA 1RTVA 5A7PA 3T1LA 1VRBA 5FYHA 2YC2A 5FIXA 4CU8A 4BLIA 1DQ1A 3UJOA 2WSVA 5EWSA 1WMFA 1J1LA 1ULCA 4KMQA 3ASIA 1POQA 3H1MA 4P08A 3HIFA 4XF0A 4P02B 3P1IA 1W9WA 3ZYRA 4AEMA 1VAMA 1C1LA 3ZFEA 5IVFA 3A21A 3VBRC 1XB9A 5C6CA 1GP6A 3VDBA 4JCKA 4RN5A 2LROA 2MPFA 4QDQA 3NAPB 3U0ZA 2XVLA 5L7OC 3O5SA 3VHOA 4CEYA 2OW4A 1F2NA 5BXXA 2HBTA 2NN8A 3AKSA 3CF6E 5FYVA 3A0KA 4QPGA 4L2NA 3W9AA 2GN3A 3C7HA 1AR81 4ZU4A 5F6KA 4B1MA 1DYPA 3V0BB 4XJUA 1XU2A 4GH4A 3N36A 5DPNA 1HXS2 3VKMA 2ZAAA 4CDWA 4XF3A 4KU8A 3HD8B 3QACA 3WSOA 3LB9A 3PTRB 3BOPA 4CEYC 2BEOA 4CDQB 1UL9A 5IK5A 1IKPA 1W6NB 2XGXA 3MUY1 1EUUA 4QPGC 5E89A 5IHRA 1NXD1 2WZ8A 3VBSA 2CU5A 1PK6A 5FZLA 1C8NA 1OFSA 4JZRA 3VD4A 1S0DA 4FI9A 4GH4C 4JRAA 5JMCA 3AXEA 2G9FA 4CDWC 2C9KA 2AEZA 4QKNA 4YWAA 3O1MA 2FBEA 3PVOA 2O0OA 2WINB 4AW7A 1NG0A 5FJHA 3QCWA 4Y4YA 3WQ7A 1QJU2 3RZGA 1HB4A 3HR9A 1FMD3 1J83A
chains in the Genus database with same CATH topology
5EFUA 3E6CC 2G9GA 2UU8A 3SCFA 4DPNA 2GZWA 4KQ7A 5C33A 5BNNB 4QQHA 2DU0A 2K2SA 4I09A 5LEJA 3H9AA 3GZAA 1FMD1 2GNBA 1PO12 5J96B 2WNUA 1S0FA 1DHKB 2A71A 3WW2A 3VZOA 5D8AA 3IBMA 1JTZX 1Z7S1 4OI1A 4QM8A 5FMOS 2YMZA 2UYAA 1QJY3 1UZZA 2XPJA 5A32B 2IWGB 5GKAC 1AXYA 2EALA 2VNGA 1RUE3 4L97A 2ZPXA 5FRAA 2Z2SB 4A3XA 4IEXA 3FBYA 3USUA 1I5ZA 1LCLA 1QJY1 1R093 4E4SA 3IDCB 5JIUA 2XLAA 3GNEA 2EAKA 1AR93 1BBT2 1RUE1 1J59A 4Y1ZA 1W6OA 4Y5Z0 4FPLA 4XQ4A 4Q2FA 4COYA 3V65A 5HBAA 3S6PA 1WBLA 3LAGA 2ZGPA 2E53A 1VIWB 1C5HA 1AR91 1N3QA 5JZGC 1OFNA 1H8TC 1SBEA 1OOPA 2WZR1 2XLGA 3WW1A 1CPNA 1LR5A 1UKGA 1SEFA 1TQ5A 3JU9A 1RB8G 3JBG2 1OPMA 4P9JA 2JE7A 1YJKA 1D0GA 1VBE2 1XNKA 1JBCA 1O4ZA 1CJDA 3E5QA 3OCPA 3R05A 1VP6A 3JD73 1TNFA 3ZX7A 3JCIA 2RJLA 4L9BA 3WQ0A 2NMNA 4AVCA 5IUQA 4PLMA 4BZ4A 1H30A 4Z8BA 5J3UA 3JD71 2RS32 3OBTA 1DLLA 4KG0A 4FCAA 5JPMB 2DUPA 2VW2A 3FWEA 2GNMA 4CEWB 2MEV3 4MXWA 4KBBA 1JN2P 4KWLA 1ZZBA 4BQ1A 3BTAA 4LO6B 1RMU3 2B7YA 3S7IA 2MEV1 1LOEA 4LBKA 4D69A 2VMIA 3ILNA 4LO5B 2WFPA 4KGGA 1RMU1 2HWF2 3BCWA 4BH9A 1H2NA 3AYDA 1J58A 3MIHA 4AEDA 1AL23 4ONUA 2PAEA 1HRI3 1RHI1 3WDTA 4BHPA 2XLFA 4NR1A 3DPRC 1B35C 1LULA 1YI9A 4C91A 1DZQA 4Y24A 1ASJ3 4N43C 4EN9B 3VZLA 1AL21 3ROUA 1HRI1 1V6LA 1GQGA 1Q3EA 3M7AA 4PDWC 1LHWA 2DUQA 3ILRA 2QVSB 3WR0A 2HKXA 3V56A 1AX0A 2R6QA 2YPJA 4PIZA 2WA4A 4QT6A 1CR7A 1PHMA 4HMZA 3B69A 1X50A 4RGAA 1O91A 2E7AA 4ASLA 5TSWA 4Q0QA 3ZFEB 1YIPA 2VQAA 1QHDA 2ZS6B 3PVNA 3M4FA 2QZ3A 3DGTA 4G3YC 4LO7A 5LK7B 2ZKNA 3DUIA 4CEYB 4IV3A 4K7JA 1NQDA 1RUC3 1ENXA 2RJKA 2WNVA 3IT8A 3UL2A 3VBHC 4NHLA 3H0OA 4QPGB 5K9YA 4OUSA 5HCAA 2BW8A 5J37A 2NP0A 4DOUA 4LT5A 1HQWA 5DG2A 5FQ0A 4GH4B 1RUC1 4CDWB 2XJTA 4CP1A 1VBD3 3B9CA 4RGGA 3N7LA 1VAVA 4D7YA 4MGYE 5K0UC 3KB5A 5GZCA 2CWSA 3VBSB 2I45A 3AKPA 1VBD1 1BCXA 1PK6B 4R8HA 2XJPA 4PQ9A 2YV8A 1DIWA 1APNA 1EPZA 3MIBA 5HCBA 5CIRA 2AYHA 4YZ4A 5H9SA 3TN92 1AL0G 1PM7A 1A8MA 4LHKA 3VN4A 3JUUA 4C90A 2RM22 4FQ4A 4R52A 2R062 4KWKA 3GF6A 1WLDA 4X8PA 1PGW2 4WV8A 3JZVA 4LLOA 1WCKA 4DRRA 2CGPA 1UF2C 1YFWA 2R071 2TBVA 1WMEA 4W6YA 2WNUB 2A3XA 1JW6A 1BJQA 3SH5A 1BEV2 3GBFA 3MDPA 5AVAA 5T54A 2XBO3 1JHNA 4P14A 5JI7A 3OTFA 3EQEA 5CVRA 4AVSA 1M06G 1BKZA 1ENQA 1DYKA 1VBB2 3WCSA 5JOZA 2AUYA 1OSGA 1SCSA 1YNAA 1MVEA 3USUB 1RINA 2YDEA 2XBO1 3IKWA 3WD5A 5KXBA 4OLLA 2W68A 4Q4W1 1ZZ6A 1W6OB 4QXKA 3IPVA 4XOGA 2W52A 3JQXA 3AK0A 4AI2A 3QBQA 4WZCA 3ME2A 2ZMKA 2BGCA 1NCQA 3ZSLA 2JDZA 5FLIA 4MYEA 1MS1A 1OOPB 5JVVA 2TEPA 1A8DA 1RUJ3 4R4XA 3RWNA 4AI0A 2OVUA 1GYKA 5D1IA 3FUOA 2YZ4A 4EROA 1AYN3 1HQNA 5I0UA 1XYPA 3EJKA 4OHYA 1RUJ1 3BPZA 3VGIA 2WFF2 1Q56A 2GU9A 1UMZA 3WLUA 1AYN1 2Q4SA 3PMEA 2QJVA 1BK1A 4PBPA 4NN0A 4QMAA 2BFUL 4X6RB 2WNEA 4HSLA 3VBUA 1JOJA 1HV0A 4XFAA 3FFZA 4B29A 4HKLA 3PVEA 3PJYA 4LHLA 4C0HA 1CAWA 2WT0A 3OYWB 1YWKA 3SCHA 3AFKA 5T5LA 4XEZA 4XYXA 2LALA 2UYBA 1COV2 1B09A 5BNPA 4MXWB 2Q1ZB 1UKRA 4M3CA 1DGWA 4FPFA 4IESA 5T52A 3E5XA 3WOGA 3E6DA 3ZXFA 2R0FA 3S30A 3DPRB 2OPKA 3J9SA 1GFF2 4Q29A 3G7DA 4GB33 1V6KA 5CFDA 5CFCC 4HT1T 4CDUC 4AVBA 3CJIA 1RUD2 1QY4A 2O8QA 2WWSA 4AEDB 5IK4A 4Q4V2 3B01A 4GB31 5JSRA 1I9RA 1R082 1WMDA 1H4GA 4XBQA 4GXLA 4RSUA 4OZXA 1C8M3 4RHV2 3NV1A 1Y3TA 3ZN5A 4AWDA 4YZ5A 4YG0A 1VB2A 3SITA 1F8VA 3KT1A 5EXOA 4JGZA 1C8M1 3E6BA 3VBOC 2VNRA 1F5FA 3HT1A 3ILFA 3E97A 3ZFGA 3MZHA 1LGBA 1IQAA 4S2GA 1QXJA 2PLV3 5FO7B 2PN5A 1V00A 3VBHB 4Y1YA 1S0GA 1RUG2 1VRH2 2ZABA 4P9GA 5GJ6A 1Y43B 4JDMA 2ZGOA 1XE8A 1DGRN 2DV9A 1Q8VA 2HWB2 2PLV1 2HWE2 1AXKA 1LB2A 5F6LB 3WT3A 4EWAA 2NLRA 4MX3A 3WDVA 4IV3B 5JR7B 3ZXDA 1AR63 2WNVB 2PHFA 3L2YA 1FNYA 3E5UA 5CA6A 2HWC2 1VBC3 2D44A 3QH7A 1GLHA 1PVC3 1AR61 3SHRA 4N9IA 4COZA 3AZWA 5JSPA 2XL9A 3BU7A 4JDOA 2PHWA 4JQRA 4RQPA 2BNMA 4UXAA 1PGL1 1O3QA 3NAPC 3FX3A 3CLPA 1VBC1 2TNFA 1RUF2 1W6QA 1PVC1 4AQSA 4NO4A 2D3RA 4ES8A 2D5FA 3D0SA 4J1WA 1OA4A 2R49A 4BIOA 4XFFA 1ZBA2 3IM0A 1XE7A 4NHMA 4Q26A 1TE1B 4Y1UA 3CNAA 1G9BA 1WBFA 3WCRA 1SLIA 4ITCA 1QH6A 1G86A 2LUWA 1H8VA 4M0NA 1N3PA 2D7FA 3AYAA 2R041 4GMP3 2EXHA 5KC5A 4IV1A 4HETA 1QDCA 5T3NA 2BUKA 4HSJA 2D6KA 2YGMA 5CNAA 4GMP1 5T5PA 4FOQA 4YM1A 1CD3G 1X82A 4CP0A 2CNAA 2FZ1A 3M3OA 3ZN4A 4AI1A 4DB5A 1UIJA 3ZIXA 2GMMA 5BNNC 4Q27A 4MGZE 4QM9A 4PIYA 3ZO0B 1AYM2 2GC2A 5EJ3A 3RNSA 1ZRRA 3WY6A 3WZ1A 3H8UA 1FOD3 2A6XA 4L92A 3D5OA 4Q4X3 2VULA 3IPVB 3ZXLA 4XZPA 3HQXA 1WLWA 1CAXA 1YFXA 2VOWA 1PZ9A 5K8SA 4QU2A 1FOD1 2HWD3 2YYOA 4Q4X1 4L8QA 3KGLA 2ZCWA 3EHKA 2WS93 5C8WA 4DFSA 2IXLA 5KXDA 1LHUA 2P34A 3MFAA 3D4KA 2HWD1 1SACA 3KZ4C 1QOOA 4XFIA 1HV1A 2CV6A 1SCRA 1H1AA 2XJQA 2RS13 1PMIA 5DDJ2 2WS91 2Q1MA 5BYNA 1O5UA 4HLTA 4WM7A 1A3KA 3USSA 2N7GA 4URTA 4F7ZA 4IEVA 1YHFA 3R4SA 2ZX2A 3AMHA 1AX2A 2RS52 2RS11 3NO8A 4X8NA 4YRDA 2NYYA 1KS4A 4Z92B 3MW3A 3VBUB 5FPXA 4BIFA 1GBGA 1NE6A 1OQEA 2B5HA 3WW3A 5J36A 1AUYA 1R1A3 4N90A 5BNQA 4U2AA 3ZVXA 5JI9A 1R092 1CAWB 1RITA 2PHTA 1MZEA 3VV1A 3IIAA 4MGKE 5CFCB 1R1A1 5BNPB 4WVMA 2VXRA 2OYZA 3ZSEA 4M3CB 2GALA 3NWKA 4Q8KA 1SLLA 1AHSA 1IS6A 4AI8A 3MF9A 5CFDB 4I30A 4K1ZA 1MS5A 3TBDA 3CJIB 2PELA 2C1FA 4TWTA 4OFGA 2ZGRA 2BVBA 2IFWA 4W65A 3WUCA 3VBOB 3ZSJA 2B39A 2WT2A 2DVBA 2GAUA 1ND3A 2ZX0A 5DUWA 3ZMNA 2NMOA 1QF3A 4AHXA 4SBVA 1LKNA 1CIWA 3RMYA 1VBA3 2RR13 1S2BA 3RDIA 3WHUA 2ZHKA 4JGZB 4XJZA 5BUVA 2YGLA 3POSA 1YUDA 4LA2A 4Q4Y2 1VBA1 3ZFGB 1V6IA 4JGYC 1V6NA 1F5JA 1AR73 1SBFA 2ZHNA 2V73A 1PO22 4Q1RA 1OMIA 2A3WA 1NOVA 3GZUC 3WDXA 4KL1A 1AR71 4A7KA 3ZYGA 4IQPA 1H9PA 2Q0AA 2BNNA 3OGJA 2WA3A 4LHNA 1X7NA 2DTYA 1YFUA 3B9IA 1AR83 4C1WA 1W6MA 3PLQA 1WW4A 3PNAA 1JYCA 4KG8A 3VKNA 3ZYJB 1I6XA 2PHDA 2ILMA 3SXWA 4LBJA 1H0BA 1KD7A 3ES4A 4J6GA 2AENA 1HW5A 2H0BA 1OHFA 3ZFEC 3ZIWA 1ONAA 4LLFA 3M8LA 5BY5A 1ASJ2 1OI6A 1UPSA 1W6QB 1ENRA 1QJX2 4HVOA 2ZOEB 3ELNA 4JVAA 1NYWA 1G9FA 3QH6A 2B9UA 4OVEA 2B45X 4MUVA 3BALA 4YVSA 5J7MA 3PTYA 3M3QA 2ZJCA 3UKTA 3WP3A 2YC0A 5KWRA 3OJBA 1EV12 2WC2A 4U36A 4YVWA 1PIV1 3VBSC 4V1PA 5L19A 2GMEA 1Z7S3 1PK6C 1ZX5A 5DXDA 4NVPA 3MIEA 5CU1A 3DV8A 5JLVA 4I01A 3VUOA 1RUC2 1U5XA 4FP3A 3WP5A 3LSDA 5ACA1 2JG8A 4FT8A 2YHJA 1RUH1 3B02A 2E7TA 3ZXKA 4ZKTB 4FPYA 4LNVA 4YVWC 5CG9A 2A70A 3MW2A 1XNDA 4QGMA 3P3NA 4XQWA 2Y26A 1NY72 4IETA 2SBAA 3MGUA 3LSEA 1GANA 2AH2A 2WNUC 1XQNA 2GC1A 2JG8C 2DCTA 2D5HA 5D8AC 1FPN2 2VECA 4QD2A 3B93A 4XDQA 4YW4A 1TMF2 4YW3A 1KJRA 2WZR3 4H7LA 5BNOA 1CAXB 3RG0A 4AEJA 4BPZA 3X29B 4TYSA 1FAYA 3SH4A 4N53A 1MQTA 2KXLA 3N35A 3N7MA 1EPWA 3B5LB 4R4ZA 4E2GA 5A3MA 2DVAA 4S2HA 1DQ0A 4XFBA 3RS6A 4XTMA 1D4M1 4M0HA 1L3JA 2XL7A 3AP6A 5FDBA 1OKQA 4Q0PA 1OOPC 4Q8LA 3RYKA 3N7KA 4D7TA 2WJSA 3RQ0A 3W59A 1VJ2A 3PMSA 2JXAA 1SLAA 3J8F3 4XFCA 1QU0A 4LBNA 1XYNA 2A6YA 1QQP3 2G4IA 4KGQA 4M01A 4CDXA 5KHHA 1JUHA 5JOWA 3AZVA 2VGDA 3B00A 3J8F1 1Q43A 4HBNA 4TLFA 5I0SA 4Q0UA 2O8OA 2D3SA 1QQP1 1S55A 1QMJA 1C4RA 3LA7A 3LA2A 1G7YA 1RUI3 1GZ9A 1CAVA 1CX4A 1KDMA 1LJ7A 4YSFA 5DZEA 3PJQA 1RHI3 4AE2A 3IN9A 3U11A 2VOXA 4AQ2A 1LHVA 1RUI1 4G4FA 1O4YA 2OUHA 4BMBA 4YM0A 4UW5A 2FZ2A 1ND3B 2HEVF 4JGYB 4YW1A 3LCPA 2F4PA 2PQQA 3JB8A 2GDFA 1CJPA 4AFAA 1LOBA 4EN0A 3AYCA 5C4WA 4FPGA 1HRV2 3MI8A 3VHPA 4AEDC 1V70A 3I4IA 3U07A 4B8EA 5KHKA 1FX5A 3CEWA 2DF7A 1IPKA 2VVEA 1DQ5A 3ETQA 3KT7A 4GQ7A 1NQJA 2FHRA 3H7JA 3CJXA 3AP4A 3O0XA 4O9EA 4OHXA 4AXOA 1MS4A 1HXS3 4K1YA 4A7YA 5C4WC 4TZDA 4R9CA 2BWAA 2GNTA 2ZA9A 4DQAA 2WT1A 3NV4A 4XMAA 2LM3A 1T6GC 2R1BA 1IHMA 1HXS1 1W6MB 3KCCA 4OI4A 3RPQA 3AP7A 4LBMA 2B8MA 4W6WA 1TME2 2GC3A 4FBFA 5ABJA 5AFBA 4H3WA 2VVDA 2X5IA 5FBZA 4MVTA 3VZMA 1H9WA 4WM8A 1QJU3 4META 4GMP0 4XFHA 4I02A 5E88A 1Y7BA 4LA3A 2ZGKA 4FTEA 1C3HA 3MEPA 1UIKA 2PHRA 3IWZA 4IV3C 4K9SA 4KU7A 3KT4A 2D97A 2WNVC 1O5LA 1QJU1 1LU1A 2PFWA 3HT2A 2X5IC 2ZACA 1PO13 2AZ5A 2IXJA 4Y1XA 2VW0A 2O1QA 1FXZA 2I74A 1NLRA 3AMNA 1H1MA 4LBQA 4YVSB 1W0PA 1PO11