2A71A

Crystal structure of emp47p carbohydrate recognition domain (crd), orthorhombic crystal form
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
217
structure length
217
Chain Sequence
b'KLSSDYSLPDLINTRKVPNNWQTGEQASLEEGRIVLTSNQNSKGSLWLKQGFDLKDSFTMEWTFRSVGYSGQTDGGISFWFVQDSNIPRDKQLYNGPVNYDGLQLLVDNNGPLGPTLRGQLNDGQKPVDKTKIYDQSFASCLMGYQDSSVPSTIRVTYDLEDDNLLKVQVDNKVCFQTRKVRFPSGSYRIGVTAQNGAVNNNAESFEIFKMQFFNGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Emp47p
publication title Structures of the carbohydrate recognition domain of Ca2+-independent cargo receptors Emp46p and Emp47p.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Sugar binding protein
total genus 49
structure length 217
sequence length 217
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03388 Lectin_leg-like Legume-like lectin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2a71A00
3AJZA 2RHPA 1LEMA 3WLUA 3ILNA 4ITCA 4FVVA 4YM1A 1Z78A 5CA6A 1N1VA 1S0FA 3R05A 5KXCA 4OZXA 2AYHA 1WLDA 1V6MA 2UWCA 3O5SA 4YM0A 2GN3A 4Q26A 3AYCA 2NMOA 2SLIA 5H9SA 4YZ2A 3D5OA 2VW0A 1AXYA 1AVBA 2CYFA 2OVUA 4LBNA 5DG2A 4U36A 2ZMLA 4WV8A 1A78A 2DUPA 2ARBA 4AVSA 1KDKA 3WDYA 2A3WA 5T5OA 3AXEA 3ATGA 2NN8A 4XDQA 4ISQA 4YZ3A 5IK7A 3OBRA 3ILFA 3MW3A 3NWKA 4XHXA 1G8WA 3W58A 1WW4A 3M3CA 1GICA 2ZGNA 1BQPA 1WLWA 3PJQA 2ZKNA 4XJUA 2V73A 2A70A 2UU8A 1KJLA 2EXJA 1IS5A 3HMYA 3FFZA 1ENRA 2VW1A 3POSA 3ZYPA 1I3HA 2EIGA 3IM0A 3AYAA 1LTEA 1QKQA 3VKNA 1Y7BA 1KQRA 1CONA 2AUYA 4L8QA 5GZDA 3IPVB 4DFSA 1FYUA 1JBCA 1G7YA 4XIKA 3ZSLA 1ULDA 2GMPA 1N3QA 3B9CA 4YW4A 5DUUA 4YW5A 5GZEA 3WV6A 1JYCA 1S0DA 5CAZA 2JKBA 3FLTA 2YZ4A 3RMYA 1AXKA 1FNZA 4ZXKA 3PVEA 1MACA 2D6LX 3BIWE 1QDCA 1SLCA 4XJ9A 3WG1A 2YV8A 3ZXJA 4BMEA 2P3IA 2WLQA 5GLTA 5JLVA 3T1LA 4ISRA 4GKYA 2D3PA 1VALA 3DGTA 3WHTA 4YGBA 2YXSA 1VIWB 2EALA 3OYWB 3IMNA 1FAYA 3POWA 3O0WA 2E51A 4XTPA 1MS4A 3OY8B 1SACA 2DYCA 4AVTA 3VKOA 4K1YA 2FMDA 1DZQA 2P34A 1WW7A 3ZSKA 4PBOA 1S0CA 1LGBA 5GJ6A 3ZSJA 1V6OA 2XB6C 3GALA 1UX6A 3VKFC 1PZ9A 4LBLA 4XXAA 3LSEA 2D44A 4TYSA 2PHTA 4XHBA 1GBGA 4Y20A 4FPGA 1DQ6A 4H55A 5IT6A 1SBDA 4PCRA 4Y1ZA 1LOEA 4FOWA 4K20A 2GDFA 1FNYA 1GYKA 3AXDA 1S1AA 1C4RA 2CWSA 4DRVA 2PHRA 1LESA 1WCSA 2WT2A 2DVDA 2R1DA 1RIRA 3PVOA 4DS0A 3CNAA 1V6IA 1W6NB 4M3CB 2GNDA 3O0VA 3R4UA 2JDZA 3B00A 5SV8A 4BMBA 3O12A 1PZ7A 4Y1UA 3MW2A 4LBMA 3FLRA 4Z8BA 2GNMA 2G4IA 1Q8OA 2NP0A 1UZZA 1QMJA 1SBEA 4AYUA 1G9BA 1IKPA 1V6JA 4AWDA 3V0AA 1WUVA 1LECA 3WDXA 4RA0A 2VY0A 1YO8A 3AFKA 1VAMA 2WT0A 3QCWA 4FPCA 4YGDA 3DUIA 1AJOA 1SLBA 1W6MA 2A3XA 2ZBJA 1GZWA 3IN9A 4Q1PA 3ZSMA 2AH2A 1DQ1A 1X50A 1YXWA 3PVNA 4FPEA 1B09A 1GZCA 2UWBA 3WG2A 5EWSA 3MEPA 2ZGLA 1DQ5A 1IS3A 4XZPA 2R0HA 2D7FA 2WT1A 3GNEA 4FPOB 5T5LA 2ZMNA 3USUA 2GALA 5CB7A 4R9DA 4FQ4A 4D69A 1S0GA 5DZGA 2ZGKA 1GKBA 2ZGRA 3AP6A 3HR9A 4Q2FA 1CN1A 1LOBA 5AVAA 3N36A 1AF9A 1DHKB 1W6PB 1QOOA 2ARXA 1GV9A 2ZHKA 1AXZA 1AJKA 1VLNA 4AGGA 1W6OA 1YYNA 1GZ9A 1RITA 2Q5TA 4BLIA 1H30A 4BPZA 2EF6A 2UWAA 3WDWA 4XBNA 1DFQA 3POYA 1LCLA 1V00A 4XJZA 3SITA 3RQ0A 1LU2A 2A6XA 3Q9OA 4M3CF 1W6QB 2WSUA 5JOWA 3SLIA 1N3OA 2D6OX 3AX4A 1UN1A 3O0XA 1LOFA 1DYPA 2A6VA 4YZ5A 4ATFA 4Q27A 2W52A 2ZZJA 1O4ZA 2E7QA 1AX2A 2I2SA 2PHXA 1LGCA 3ZPYA 2W08A 1CJPA 4NOTA 3WUDA 3D4KA 4UW3A 4KBBA 2JE7A 3M1HA 3UJOA 5HCBA 3WUCA 1V6LA 2EAKA 4MYEA 1LOAA 2ZHMA 4Y22B 3N7LA 1IOAA 1LJ7A 4YM3A 1D0HA 4P9XA 4JRAA 4LBQB 4YW1A 2PHUA 3RSJA 1NLSA 1CVNA 2YY1A 5GLZA 2PHFA 5DUXA 1JYIA 3A0NA 4FOVA 1S0BA 1SFYA 3APBA 2VU9A 2YMZA 4CRQA 4XTMA 4YZ4A 3M3OA 1F9KA 2OUJA 4CZSA 1FV2A 1WD3A 2W68A 2AGSA 3IPVA 2NMNA 2SBAA 4R9BA 4XJWA 3A0KA 2W39A 2C5DA 2A7AA 2JD4A 2R16A 4W65A 1ULCA 1QOTA 1MS8A 1V6NA 1D2SA 3AJYA 2D6MA 1QF3A 2PELA 4HANA 2DU0A 3ZXKA 3OJBA 1MVQA 1SBFA 2FHRA 1MZ6A 3INAA 3ZXFA 1KJRA 2A3YA 2A6WA 2DUQA 1OFSA 1LENA 1MZ5A 4Q1RA 1G9FA 1C57A 3LSDA 1MS9A 3AP5A 3WG4A 4FPFA 1WD4A 4FOQA 2JE9A 1UMZA 2ZACA 3D6EA 4YLZA 2JECA 1ZM1A 1F31A 3NV2A 2DV9A 4CTEA 3OYWA 5DZEA 4AGVA 5GZCA 1G86A 2JJ6A 1G9DA 2E6VA 4XYXA 3OY8A 5F5QA 4BLJA 1LHWA 1LOGA 2VH9A 2D3RA 1URXA 4ZKTB 1EPWA 5GZFA 2A5ZA 2WJSA 2WNEA 2ENRA 1WLCA 5IK8A 2D6NA 2AREA 2ZGMA 4FP2A 1YIFA 4M00A 1G9CA 1XQNA 5HCFA 3T1MA 4YGEA 3M3QA 1CR7A 2ZAAA 2DVBA 1UZYA 3BODA 4LBJA 1N1TA 1LU1A 3KM5A 3H0OA 3AK0A 5F9TA 2D3SA 3ZVXA 3WVJA 1CPMA 2ZA9A 4SLIA 1W6NA 3AYDA 3AZVA 4M3CA 1HQLA 3ZYRA 2ZGUA 2KM2A 3FLPA 3QLQA 2DUOA 1QU0A 3WCRA 3SH5A 1SLAA 4BM8A 1JUIA 4XILA 2ZGSA 1IKQA 2DVGA 5GM0A 5KXEA 4IQPA 3V0BB 1JXNA 1Q8VA 3A4UA 4UW4A 4XJ8A 1FATA 5T50A 3UJQA 3LCPA 1CQ9A 4ATEA 5LK5A 2ZGTA 2GNTA 3KQRA 5H9RA 2DVAA 1R1ZA 1CPNA 1QNWA 3VUOA 2GMMA 1AX0A 1FV3A 1LOCA 2EXKA 3AP7A 1HDKA 3I8TA 3N35A 4YGCA 4AVVA 1UAIA 5JOYA 2LTNA 2CL2A 3IKWA 5EYXA 3WHUA 2E53A 3WCSA 2P3KA 1KDMA 3RG0A 5IUQA 4HL0A 3HN1A 3SNMA 1QNYA 2A6YA 1UPSA 3WDTA 3PMEA 1Q8SA 3NV3A 4XXPA 1A8DA 1HKDA 4DQAA 2DTYA 1Q8QA 3M3EA 1BZWA 3V65A 2Z42A 3I4IA 4YG6A 1LOFC 1DYKA 2ZGQA 5DUVA 2NM1A 2DTWA 3RRDA 1MS5A 2WSVA 1WW5A 1GSLA 1W0PA 4P9YA 4LBKA 3WDVA 3VKMA 4AGRA 3W59A 1DBNA 3MW4A 3AZYA 3VV1A 4Q8KA 3L2YA 2ZHLA 2ERFA 5T55A 2NYYA 1GANA 3AYEA 1APNA 2GNBA 2EXHA 4JCKA 4FPYA 1DQ4A 1W6QA 2EXIA 4YW2A 3ZXLA 4P14A 4NO4A 5JOXA 4Y24A 4YG3A 4Y26A 1O4YA 5GLWA 1IS6A 5IK4A 1FX5A 2D6PA 2DWRA 3N7JA 3B01A 1BKZA 1S0IA 4GKXA 1NXD1 4UW6A 4XBLA 5JMCA 1ULFA 1N1SA 2D6KA 5JOZA 3R4SA 4WVWA 5JVVA 1ONAA 1JOJA 1V6KA 3NV1A 4UW5A 4C1WA 4M01A 5H9QA 3SH3A 1GNHA 1ENSA 2BQPA 3OBTA 2C9AA 4Y22A 1LGNA 2P37A 1SLTA 1N47A 4FPKA 1N1YA 4YFWA 3RMXA 1WBFA 2R49A 4LBQA 1OQ1A 1ZA4A 2DURA 1ULGA 4FQZA 4XOGA 5E8AA 4YW3A 1Q8PA 5H9PA 5FREA 1IS4A 4LBQD 2HYKA 4XBQA 4K21A 4ASMB 1MS1A 4GWNA 4PBPA 3OGGA 2A6ZA 1J1TA 5E89A 2AR6A 1BYHA 2R1BA 3SISA 4M3CE 1DQ0A 2CTVA 4YZ1A 1QDOA 1SLLA 1LHVA 1BJQA 3N3HA 1I1EA 5DUWA 3MPPG 1RINA 1SCRA 2H0BA 3ZXEA 1A3KA 5EYYA 5GLUA 5T52A 5T54A 4GWMA 5E88A 1W0OA 2B7YA 2E7TA 2A71A 2V5YA 3AP9A 3V64A 2VW2A 3OPZA 4GALA 4XMAA 3N7MA 4YFZA 2ZGPA 1AX1A 3NV4A 5FRAA 1MR5A 2NZ9A 3ILRA 4FPHA 1CESA 4R9AA 5GLVA 1OKQA 4P9WA 3ENRA 1GLHA 1MS3A 5T5JA 1LODA 2GN7A 4C1XA 1DQ2A 1YRZA 2DU1A 4Y1YA 1C1FA 4FPLA 1KITA 2WKKA 1AZDA 1H9PA 4Y20B 1LHNA 3UK9A 1KRIA 1F5FA 5HCAA 5CNAA 2ES3A 1S0JA 2CY6A 5GZGA 5DXDA 1QGLA 4GXLA 5DZFA 4YM2A 1UKGA 4U2AA 4XE9A 3BOPA 3UL2A 1UL9A 3JU9A 2UURA 3AZWA 3B69A 4PQ9A 5BYNA 3FUOA 3JUUA 5EXOA 1HLCA 1DGLA 2LALA 1LHOA 2VXRA 3FBYA 4R9CA 3M2MA 1C1LA 2P3JA 2DVFA 4GA9A 2A75A 3WZ1A 1PZ8A 5L73A 4Y1XA 1LULA 2OW4A 4F83A 1JHNA 5KXBA 2ZMKA 4FP3A 2PHWA 1TEIA 4I30A 1CIWA 1H9WA 1QOSA 5IK5A 1BXHA 3C2UA 3V0AB 2VUAA 3VKLA 4FPJA 4BOWA 4JC1A 5JDBA 3FUQA 1W6MB 5KXDA 1GZWB 3V0BA 5T5PA 1GNZA 3WG3A 3ASIA 1U0AA 1VAVA 3T2TA 3N7KA 3SH4A 2XG3A 4WZFA 5CBLA 2R0FA 3TAYA 1Z0HA 2AENA 3BTAA 4Q8LA 4WVVA 4XMIA 3RS6A 2GMEA 1SCSA 2TEPA 4LBOA 2ZABA 4TZDA 1G9AA 1SLIA 5GALA 3USUB 1DLLA 4PF5A 3WDUA 1JW6A 2CWMA 2OUHA 4K1ZA 3TB0A 3U4XA 4XJAA 1LHUA 1Q56A 1S0EA 2ZGOA 4Y1VA 5DG1A 1ENQA 1JN2P 2P2KA 2WQZC 3WOGA 3AZXA 2YROA 4YG0A 1WW6A 2D43A 4FOYA 4DRRA 3B3QE 1MVEA 1HQWA 2ZHNA 1LEDA 1DIWA 1MS0A 1WBLA 1YI7A 3AZZA 1W6PA 4XIOA 1W6OB 1ULEA 3WNXA 4BQ1A 1N3PA 4RL7A 2CNAA 3AP4A 4DPNA
chains in the Genus database with same CATH superfamily
1EV11 2CU5A 5IVVA 3WLUA 2LM3A 3PTYA 2WR9A 1Z78A 2X10A 5KXCA 1V6MA 1O5LA 5JCTA 5BNPC 4QX7A 4YM0A 2GN3A 3NMBA 3AYCA 4LTAA 4CEWB 2SLIA 3LIGA 5H9SA 3UYJA 1UZWA 2RS13 4YZ2A 1AXYA 1AVBA 2CYFA 2G1MA 2G9ZA 2P5BA 2XBO2 4KG8A 4NE9A 2Q1ZB 4IV3A 1A78A 4AVSA 5FYUA 2RM21 1LB2A 3WDYA 4N43C 3ATGA 1XE8A 2YBSA 4H2AA 1QJZA 2NN8A 2P3YA 2FDHA 4XDQA 4ISQA 5AFBA 5IK7A 3OBRA 1YFUA 3M3CA 5FP4A 1GICA 2HBTA 4HPKB 4B4RA 4OHYA 3PJQA 4JHTA 1QEXA 2ZKNA 2VJXA 3POSA 4DXSA 3ZYPA 2VW1A 3ZFEC 5CFDB 2CDPA 4P00B 1LRHA 1AR63 1XYNA 4ZS2A 4MHRA 1W2NA 5JAXA 2VULA 1KQRA 2W94A 3LA3A 3RPQA 5BNNA 2RG4A 5G05L 4QDQA 1G7YA 3VBSB 4EN8B 4XIKA 2J1AA 1ENXA 3GDBA 4C8DA 4CCNA 5AC91 2OZ6A 5CYYA 1RUD3 1GP6A 3AL6A 3B9CA 5ACA1 2XONA 3BUCA 2JKBA 4W4ZA 5C3PA 1FI2A 2YZ4A 3OD0A 4UFKA 4IUGA 4ZXKA 5CKNA 4ONUA 3K46A 1OH4A 1OLME 1QDCA 2H6BA 1CAUA 3MLJA 5FYMA 4EWDA 3FN9A 1O3QA 2YV8A 1JODA 3GCXA 4DZGA 5GLTA 3T1LA 3VZNA 1PO22 5F32A 3LQCA 3MV01 1UY2A 2VC9A 3HQXA 4WBBA 1UNBA 4D0QA 4JKLA 1MS4A 1VBA3 2VMHA 3OY8B 2W46A 5A7SA 4YPJA 5C4WB 2V09A 3GBGA 3VKOA 5IVEA 4OZOA 3ZSKA 2ZX2A 1GP5A 1LGBA 3DXTA 3ZSJA 1B35B 4OI2A 1JOBA 1AR81 1UX6A 4S2GA 4UFMA 4XXAA 5FZIA 2HWB2 3VKFC 1GQHA 3LSEA 5A7NA 3HD8B 4KL1A 4TYSA 4YVSC 2VVEA 1NKGA 3LGRA 2VUCA 2Y6GA 4BIFA 2VG9A 1DQ6A 4XUNA 4PCRA 2GDFA 1GYKA 1AR92 1NA1A 3WNNA 2VNVA 2YC4A 3KCYA 1WCSA 2WT2A 5ERLA 2R1DA 1IGOA 4QB6A 4QAWA 2JDYA 4GULA 3JD72 1F4HA 3Q8CA 5A7WA 3POGA 5F8PA 4Q4X1 2JDZA 1KGYA 1MZEA 2YBKA 1VE0A 4NVPA 3MW2A 3RVHA 3KMHA 1FPN3 2WN3A 3A23A 3MLKA 2JG9B 1W9SA 5FR3A 2LW8A 1VBE2 2MEV3 2JB8A 1REEA 4LA3A 3VDDA 3AC0A 4NR1A 1G9BA 4P5YA 3BALA 4QMAA 1EAH3 1STMA 3V0AA 1EYBA 2JIGA 3IDAA 4QM9A 5C3SA 1RHI1 3VN4A 3ZYIB 2VOWA 3B93A 1X36A 2DBIA 5LA9A 3ZN6B 3ZSMA 1AJOA 1SLBA 2ZBJA 1SZBA 3K4ZA 2AH2A 1X50A 1YXWA 3PVNA 1OVSA 4FPEA 3T0BA 5FJKA 1QJU2 2HEVF 4J6GA 3MEPA 2WUHA 2HWD3 2E31A 3GJAA 4BU2A 1IS3A 3ACHA 2D7FA 3GNEA 1UQXA 5LA2A 3THTA 4X6RB 3PMSA 3IIAA 1E5HA 4KQ7A 4FQ4A 4R4ZA 4NJ4A 5DZGA 5FPLA 3USSA 3HR9A 4GMP1 4NIAA 4LULA 4Q2FA 4ZS3A 3VBHB 3CU7A 3N36A 3ZKYA 1CX1A 1AF9A 2B42B 3C7HA 1DHKB 3SHRA 1GV9A 5FZAA 3R4DB 1VRH1 3EO6A 1AXZA 3NO8A 4LOSA 4AEKA 3RYKA 4ASLA 5KR7A 3VBRA 1RITA 1W9YA 4EWEA 4I3GA 4CP9B 5BXXA 2EF6A 4B4QA 1PGW1 1PIV2 5F3IA 2KXLA 2R32A 2XJQA 1TNFA 3KCXA 2C6SA 2WFF1 1V00A 4M4RA 5JZGC 1XYPA 2A6XA 4URTA 4NHLA 1W6QB 3WP4A 4LUMA 4QKDA 3SLIA 1YCIA 4NHKA 1UN1A 1BK0A 3HJRA 1WWYA 2RM23 4CEWA 1DGRN 1JUHA 1GNYA 4AHXA 2ZZJA 3ACGA 3GZUC 4XDOA 1O4ZA 4QPIC 4XUPA 1XNBA 4K7JA 5BNPB 3O1UA 3WW2A 3C7GA 1XE0A 3H50A 1VB4A 1E5RA 2ZJCA 4FXGB 4NHYA 1YIPA 1UU6A 1W3VA 4KBBA 4NOTA 1COV2 2QQJA 2JE7A 5FPZA 1H8TB 3NSTA 4MYEA 1LOAA 2Q1FA 1GWLA 1QJY1 4CDWC 1IOAA 4P9XA 3VL9A 4E4HA 4YW1A 4HPKA 4N43B 2VZVA 4P9IA 1GU3A 1AL23 1NLSA 3RGBA 1ZZCA 2XUMA 1CVNA 1J3QA 5I0SA 4E4ZA 4UBGA 4XQDA 4FOVA 5CFDA 1JOPA 1SFYA 2VU9A 4QHOA 3PHMA 4YZ4A 3HOBA 3K75B 1RUC1 3SCGA 1HRI3 4NIGA 1F9KA 2W68A 4MX3A 4QU2A 5E6HA 3ZFEB 3CHXA 3VBSA 1L7QA 2OQ7A 4R52A 1RYYA 4HZFA 2C5DA 4CDQC 2JD4A 2QDNA 4W65A 3AMNA 4CU6A 4R8HA 1KFXL 1D2SA 1YFYA 1ZBA3 2D6MA 4LNVA 5IAVA 5FZEA 3OJBA 3INAA 2VD7A 1LENA 3HVDA 2JX9A 4L92A 5JWPA 4W6XA 2PAKA 3GJBA 1MS9A 4FPFA 4FOQA 4YLZA 1UMZA 1D7PM 4LPLA 4PIXA 4Q0PA 2JE8A 2H0VA 3JBG3 2QZ2A 3OUHA 2XVLA 5DZEA 3LOIA 4AGVA 5JUVA 1NXMA 5C4WA 3OY8A 1O6UA 1LHWA 1LOGA 4Q4W2 1XSRA 2D3RA 2Q8DA 3OD4A 5CKMA 2BNOA 3FHAA 3LEIA 5GZFA 5DMYA 1B35A 4L9BA 4ES8A 2ENRA 4I3PA 4IDZA 3H1YA 2PTMA 1G9CA 5FY1A 2BBVA 2K46A 1E5IA 3ECQA 4QKBA 1CD3G 3ZR6A 2XHKA 1IQDC 3M3QA 4KNCA 4ZHNA 1W8NA 2DVBA 1UZYA 4YVSB 4OVEA 3Q8BA 1PNFA 1XNCA 2WABA 3BODA 3KM5A 3H8OA 2R042 5FZCA 2GP5A 5F9TA 2GH2A 1CWPA 3JXSA 4SLIA 1RXFA 4WVZA 5EFUA 5F5AA 3HAGA 4XAEA 2FCTA 5FJHA 3TN91 2R063 1SLAA 1NE6A 1K42A 4XILA 2ZGSA 5GM0A 4AQ2A 4D3WA 2WO1A 3ZMOA 1Q8VA 3DPRC 4UW4A 2JG9A 4XJ8A 3W5NA 3B5LB 1FATA 3J8F3 5A3WA 3UJQA 3OCPA 1W9TA 3WD5A 4ATEA 5LB6A 2D93A 2XXZA 4OI0A 4GJZA 5H9RA 4D94A 4YVWC 1JZ5A 2VCCA 4OQ8A 1CPNA 4IXLA 4XUQA 1AX0A 3ZIXA 3EYPA 1SQ4A 2C24A 3I3EA 3ZN6A 4AVVA 5A3UA 3KCCA 4HKOA 2I74A 5B2GB 4SBVA 4S2FA 2TUNA 3AKPA 5EYXA 2E53A 4XURA 5EHDA 3NJYA 3BVCA 1NE4A 3LKJA 1SDDB 4GWIA 2W91A 4HL0A 1QNYA 2A6YA 1OFNA 4XXPA 4BQ3A 1HKDA 2UY9A 4DQAA 2DTYA 1VRH3 3B7MA 4AEDA 1Q8QA 3LWCA 1S2EA 2Z42A 3I4IA 2WFPA 4OHXA 1YWKA 4XQWA 2XBO1 3VBHA 4AW7A 3RRDA 1Q5OA 2YC2A 1CAVB 1F4AA 1PVXA 2DTWA 5DUVA 1MS5A 4AAPA 3O1SA 2Q4SA 3P3PA 4FSJA 1Q3EA 4BISA 1IPSA 1C5HA 4LBKA 4P9YA 4J25A 1W2UA 3WDVA 4AGRA 1E57A 2XVGA 5JXHA 3MW4A 4Y5TA 4CP9A 2WRAA 4Q8KA 5T55A 2ERFA 2ZEXA 2QQLA 2NYYA 3AYEA 5A6QA 3MBWA 1R093 4PLMA 5LA1A 3D3AA 4AF9A 1W6QA 4YW2A 2IXHA 2B9UA 4IEQA 5KHHA 5DN2A 5BNNC 4Y26A 2HWF2 5IK4A 1FX5A 2D6PA 5JZGB 2CAVA 3ROUA 1RMU3 4BYYA 3B01A 2ET1A 3C3VA 1BKZA 1QJY3 1NXD1 4XBLA 5KHIA 5BNPA 3ZLIA 4YSFA 1O3SA 5L9RA 2QFEA 5DAPA 5BV6A 4WVWA 2WA3A 1V6KA 2WNUC 4QPIB 4M01A 2G9FA 3F2ZA 1H8TA 2QBXA 2PQSA 2BQPA 4YFWA 1K5MC 1LGNA 1O59A 1SLTA 3J7NA 4IV1C 4ZU4A 5HI0A 4YW7A 1ZA4A 4NWWA 4N43A 1RUC3 5H9PA 1UMIA 4AEJA 4URAA 1XNAA 5I0UA 2XGXA 4LBQD 4DUXA 1WA6X 4CDWB 4XBQA 5F3CA 4ASMB 1UD1A 3CLPA 3U78A 2BDRA 3OGGA 3C7FA 5EQUA 1PO21 1J1TA 3BTXA 4BWOA 4GB32 1BYHA 3MIFA 5CISA 1HW5A 1GOHA 3KVAA 2CTVA 4JX0A 4LKSA 3ZFEA 1NG0A 3S5AA 5C71A 3N3HA 3AKTA 4K6BA 5DUWA 2A1XA 3LE0A 3SMHA 5C6CA 3MPPG 1GQPA 1RINA 3BCWA 4E2GA 1ASJ2 1A3KA 4IE6A 4OUEA 3I3QA 4QXHA 2PLV1 5IW0A 2V5YA 2HWB1 2A71A 4CDQB 4EJRA 2VW2A 3ON7A 4A42A 4HN0A 1O7FA 5FYHA 4GALA 4GD4A 1HIXA 5FXWA 4O9GA 2FD8A 3LFIA 3LAGA 2PHLA 1VBC3 1AR91 3ENRA 3MUZ1 4KGGA 1UOJA 4HKLA 3MIHA 2EIDA 4FPLA 2PFWA 2WKKA 3JD71 1PO12 5FBZA 1H9PA 1ACCA 1AZDA 4OMDA 1BVVA 4Q0SA 4Y20B 3UK9A 4PHZA 3ZXGA 5CNAA 1S0JA 5DXDA 1QGLA 5LY1A 1D2QA 4YM2A 4P02B 2WC2A 1CZSA 1J3RA 1T6BX 4OULA 3ZX7A 1OUXA 3FUOA 4XF1A 1H4GA 4DXZA 4N9IA 3I2DA 3FBYA 4B29A 4LORA 2XVKA 2RE9A 4AVAA 1V70A 4YVSA 2WWSA 1PZ8A 1FMD2 4Y1XA 5L73A 3ZYFA 5HXVA 5FPVA 4B1MA 4OFGA 1Z7S3 4CCMA 5A1LA 1TEIA 4H14A 4A7YA 4ZY9A 3ZYBA 5IK5A 1QJU1 1H8VA 2R072 1WA4A 4AFDA 1JMUB 1OXCA 1ZBE2 1IPJA 3FUQA 5KXDA 1GZWB 1NLQA 2WAOA 1PVC3 1KXGA 4B8EA 2DCKA 5JXJA 3N7KA 4AFMA 2XG3A 2K9ZA 4S2DA 2UY8A 5IVJA 1Z0HA 2AENA 3BTAA 3DPRB 3FMGA 2RMU2 1AR73 3WNPA 5FZBA 3I2HA 1PNGA 3WDUA 4O61A 1JW6A 4K1ZA 5FZ1A 4YVWB 3U4XA 2BEOA 1LHUA 2ZGOA 2RVAA 1AUYA 4K9SA 5DDJ2 5DG1A 1ENQA 1JN2P 2P2KA 2WQZC 3VZLA 1NCRC 1XE7A 2C1FA 1IQAA 1PIV1 2IVIB 2XLAA 2D43A 1OKOA 2ZAHA 3HT1A 4DRRA 2EVXA 3B3QE 3LPGA 1MVEA 4M4PA 5EZWA 1LEDA 4AHWA 4CEWC 5J36A 4QHBA 4Q5OA 2J1RA 2P4EA 1W6OB 1ULPA 2J7MA 3I59B 1TZOA 2Z79A 4KGQA 4RL7A 1UYZA 4BQ2A 4DPNA 2RHPA 2JENA 5JXIA 3NNJA 4ITCA 4FVVA 5CZKA 5FP3A 4LJHA 2HWC1 3DEMA 1JS9A 5I8TA 1S0FA 4I02A 4QQPA 4XVHA 4OQ9A 3URFA 2UWCA 3O5SA 1W28A 1WMEA 1COV1 3IWZA 3HT2A 3U37A 2BFUS 4Q26A 1XU2A 3J7MA 3D5OA 1H1IA 4B4PA 3C7OA 3KZ4C 4XW3A 1YEWA 3MPBA 3WINE 4AVBA 4DIQA 2VMCA 3GYDA 3M70A 2W1WA 1W06A 2W1SA 1KDKA 3J9SA 2A3WA 2IXLA 2WO2A 5D2AA 3VBSC 1Q43A 5JZGA 1M06G 1RUF3 4XHXA 1OPOA 1YC61 3W58A 1D0GA 3BYWA 4KU7A 3OF1A 1WLWA 2YGMA 3LA2A 1PX4A 1S2BA 1PHMA 2AACA 4GWJA 1KJLA 2EXJA 3FFZA 3LZZA 1ENRA 2WN2A 4QPIA 1LAJA 5DPNA 1Y7BA 4LLOA 4Q0UA 3WF3A 5C8WA 1UXXX 3U75A 3IPVB 2WNUB 4NMIA 1QH7A 5CU1A 4DFSA 3FX3A 1BCXA 2ZKLA 3ZSLA 1K5MB 4YW4A 4CDWA 4IV1B 5DUUA 4BE3A 1VPHA 1JYCA 1S0DA 2VBDA 3P1IA 1POV3 5CAZA 3DCQA 4NRPA 1POQA 5FCCA 1Y9MA 4FFHA 5J98B 1FNZA 2PN5A 3PVEA 5TSWA 2PLV3 3BGAA 5IAXA 5EJ1B 1QJX3 1ZNPA 1ND3C 5HPOA 1QQP3 4Q4W1 4XJ9A 3WG1A 5KC5A 2BGPA 2WLQA 5FZ3A 2CAUA 4ISRA 2WS92 4IEXA 3GCWA 1WMXA 4CEYC 2D3PA 2VZ1A 3NKGA 3A7QA 4PJYA 2EICA 1UU4A 1VIWB 1HXS3 2DF7A 2EALA 2JXAA 2YXSA 5FYVA 3MGUA 5FMOS 3UGGA 4I2OA 3LDKA 1R083 1DZTA 2Y8KA 1SACA 5G04L 5A6ZA 4RHV3 3P5BA 1RVF2 4I0BA 2ZX0A 2P34A 4LHKA 1WW7A 4NHMA 4OUSA 4PBOA 3T0AA 5GJ6A 4LO4B 2JKXA 1UF2C 2XB6C 3U1XA 2ARCA 3K3NA 3CJXA 1PZ9A 4LBLA 3NL1A 2R041 4ARXA 2BV4A 4EYUA 1RUI3 2PHTA 2BU9A 1KS5A 5K8SA 2QQKA 4Y20A 1EUTA 5IT6A 4RFT0 1PGL2 2I07B 5FO9B 1RGSA 1LOEA 2W47A 1V9U2 3I3DA 4FOWA 4MZUA 4P9LA 4Y1ZA 2WINB 3QD6A 4O9EA 4DRVA 1TNRA 3U07A 1WCDJ 2CHHA 4E8DA 1VMJA 2DVDA 1RIRA 5LBBA 4DS0A 3CF6E 1W6NB 2WZR2 4OHWA 2W95A 4B1LA 1EPZA 1I5PA 4IETA 4TLFA 4IESA 1OH3A 1OLMA 3H3UA 1W8FA 3OUIA 4JAAA 3THCA 2Y6JA 1QJU3 1REFA 1ODNA 4JDMA 3FLRA 4FFGA 5KC6A 3TRSB 2XH6A 2MNGA 3FHQA 2FDJA 3UV9A 2G4IA 5BNQA 4NAOA 1SBEA 2GAUA 3MIDA 1IKPA 1V6JA 4UOJA 4EQVA 1WUVA 4PQQA 5A80A 3MO4A 1F8VA 2RS52 4IE5A 5BPXA 1Y3TA 2VMIA 3AFKA 1VAMA 3U14A 3QCWA 2ZX3A 2OZJA 3DUIA 3NW4A 1VP6A 4Q1PA 3OEBA 1GZWA 2QJVA 4D6RA 2GSYA 3AMQA 1B09A 3WG2A 2E26A 1FOD3 5FY5A 3KHCA 2XJUA 3DPRA 1MEC1 1ZRFA 1TMF3 4OHZA 3ZR5A 2ZMNA 2GALA 5CB7A 2VQTA 1QHDA 4YVWA 4UFIA 4D69A 3UNPA 3NAPC 4P08A 3SEEA 1L3JA 4NN0A 4XF4A 1ZA7A 4X8PA 2BNMA 1JTZX 1OURA 3J7HA 5FZHA 2ZXQA 1RL3A 1QOOA 3CIHA 4YNIA 1NCRB 4Q4Y3 5FPUA 1JZ8A 2ZHKA 1VLNA 2HWC3 3POIA 1W6OA 1YYNA 1BEV3 4BK5A 1GZ9A 2HWF1 2Q5TA 2X53S 3I59A 4MVTA 2UWAA 3WDWA 3AKRA 4XBNA 4QKFA 3VHRA 1DFQA 5FV3A 1LCLA 2D98A 1OA4A 2BGCA 4IE0A 1H8TC 4Z92B 3U11A 4C91A 2WSUA 1TME2 5JOWA 2BPA2 1T2XA 1VBD3 3AX4A 4I01A 3RJ2X 4JGYC 4M0HA 4KG0A 4UFJA 4AG4A 2QE3A 4Q27A 1VBB3 4MHUA 1AX2A 2I2SA 3LEGA 2R7EB 1RUG3 1CJPA 1ZREA 2ZPXA 4PLNA 4FFIA 3WUDA 3PUIA 4C90A 2VQAA 5CFCC 3I2OA 2VBPA 3ES1A 1H4HA 4PIZA 4XUOA 5F6KA 3VLBB 2PYTA 1HRV2 1LJ7A 2W5FA 4GB31 4BK4A 4EE2A 2J1EA 4JRAA 4LBQB 2HEYF 4AI1A 4UF0B 3R0RA 2YFZA 2YY1A 5GLZA 2PHFA 4YYOA 1JYIA 3A0NA 1S0BA 4E9KA 1ASJ1 4BCUA 3I3MA 4FCAA 2V72A 3IPVA 2WNUA 4NAMA 3VD7A 1C8NA 2RV9A 2RS33 2Y0OA 3A0KA 1RUOA 2IWGB 2ZCWA 4Q29A 4QX3A 1K5MA 4TLGA 2A7AA 4JDOA 5T3NA 2W2IA 4IV1A 1MS8A 4Q4W3 1TE1B 3AJYA 3LB9A 5FLIA 4XFFA 2IZWA 2DU0A 2C26A 2RDSA 5A7OA 2Y34A 3ZXFA 5FO8B 2ADEA 4V2VA 2F4PA 2JG8C 1HN1A 1MZ5A 1HN0A 1PO11 1OF3A 4AAXA 1G9FA 5FOBB 4NIHA 3OGJA 4UWDA 3AP5A 3AMPA 5APAA 1UOGA 1WD4A 2JE9A 4BDVB 3D6EA 1GZTA 1XNKA 1I9RA 1ZM1A 1ND3B 3NV2A 3H3ZA 2DV9A 4XETA 5K9YA 5GZCA 1G86A 1G9DA 4XYXA 5F5QA 4QB1A 4BLJA 2VH9A 4CEYB 3THPA 4CCKA 4ZKTB 2VXJA 3PJYA 3VBOC 4A44A 3I2GA 3BKZA 2D97A 1I5ZA 2WJSA 3AFGA 3HBKA 1RUH2 1RUE2 2AREA 1R1A2 2DDUA 2O0OA 2ZGMA 4M00A 4YARA 1XQNA 2VUDA 3OOXA 3T1MA 1H2KA 4WM7C 3WT3A 1CJDA 4YGEA 4JGZC 2BJSA 1AYM3 2OQ6A 4PLOA 1ZBE1 5A3MA 3H0OA 4D6SA 3AK0A 2D3SA 2YB7A 2V4AA 3ZVXA 3WVJA 1NOVA 2IVJA 5IATA 1W6NA 4IEZA 4E4SA 1K12A 3QLQA 2KM2A 4KWLA 1JZ2A 4CCLA 4Q4V3 1OSGA 2W1UA 5A7PA 4MGQA 3WCRA 2RMU1 3SH5A 4DEVA 5JSOA 3ZO0B 3G6JB 4HMZA 1W05A 1JUIA 4W6YA 4BM8A 2FZ1A 2DVGA 1OA3A 4CVUA 3KGZA 4FXKB 5KXEA 4IQPA 2ZX1A 1Y43B 3V0BB 3THDA 1SFNA 4JVAA 5DDJ1 5LK5A 4Z1VA 1OD5A 4MADA 4ZU7A 4AFBA 2DVAA 1OC1A 1QNWA 2OIIA 2GMMA 1FV3A 3VUOA 4FTBA 2EXKA 3AP7A 1MEC3 3JZVA 4YGCA 1RUJ3 1D4M2 3CBNA 4IEWA 1ST8A 4AQ6A 1HB4A 5JOYA 2VUJA 2LTNA 1AYN2 1FXZA 3IKWA 1UKRA 4K8RB 3WHUA 1DYOA 2OPKA 1EV13 2XL9A 3BPSA 4CSWA 1GOGA 5KHJA 1ND2C 2YBPA 1UPSA 4RR3C 3PMEA 1Q8SA 1C3HA 2WNOA 1A8DA 5L9BA 2OT7A 4JTOA 4MXWB 3U10A 1BZWA 5FDBA 1ZRIA 3NAPB 2VOVA 2ZGQA 2NM1A 4AXOA 3GM8A 4CDXC 3Q8AA 1GSLA 1NCRA 1DZRA 3VD3A 5FZ8A 3ABZA 2FDFA 4CDQA 1WCKA 1AL0G 1DBNA 1W2OA 3EQEA 3MI8A 3L2YA 5KWRA 1O3TA 4LKEA 1GANA 1W99A 2EXHA 2QKDA 4HVOA 4FPYA 5FLHA 2EXIA 2X5IB 1VR3A 3ZXLA 4COYA 4YG3A 1O4YA 2XLFA 5LASA 4XFBA 3RZLA 1IS6A 3N7JA 4AI9A 2RR12 2Q0AA 4UW6A 3JCIA 4DEQA 5F6LB 3KS7A 4JGYB 1N1SA 3FE5A 5JVVA 1GQGA 3W21A 1JOJA 1U12A 1UWWA 5H9QA 4XAAA 3LA7A 5AC93 3FFQA 1ENSA 3VZKA 4E27A 4HSLA 3N4MA 2P37A 5ACA3 1N1YA 2J1SA 1WMFA 1WBFA 2WYSA 4LBQA 1OQ1A 5E8AA 4UF0A 4XOGA 4D7YA 2YGLA 2XJSA 2XKOA 2WZ8A 5CFCB 1IS4A 3POJA 1OT5A 4AI0A 4EN6B 4XF0A 1NCQC 5FUNA 4K21A 2RS12 5L36A 2VZPA 4PBPA 5CKQA 2WS91 4F3JA 1GOFA 1JYWA 3NKTA 1SPPB 2VZQA 5FZ0A 4BB3A 1DQ0A 2QQNA 4D8MA 4YZ1A 4ES9A 4DINB 4IGQA 5F3EA 1XB9A 3TOJA 1I1EA 1RVF1 4CA9A 2DCYA 1W04A 2ZZQA 4B3NA 5FZKA 5GLUA 4DUVA 2B46X 5T52A 5T54A 4H7MA 4GWMA 5E88A 5J7MA 1RC6A 3BI3A 2E7TA 4INDA 1IG3A 3AP9A 2JDUA 3E5UA 1AHSA 1KS4A 3PU3A 3SKVA 3OPZA 1AR83 3EXUA 4IEUA 3UT0A 5FRAA 3PURA 1MR5A 4R9AA 1AR62 5F3GA 2Y33A 3HIFA 1PGL1 1V9U1 1MPXA 1XC6A 2JG8B 4P9WA 1GLHA 1OLRA 4A45A 5JI9A 1LODA 2GN7A 1ND3A 4C1XA 3K3OA 4Y1YA 2WZR1 1JYTA 4PT6A 3UETA 2YUEA 4CEYA 3BU0A 5HCAA 3I97A 4GXLA 4ZXEA 3ZYJB 4CDUC 1UKGA 3B02A 3UL2A 4Q4X3 5F37A 2EIBA 5A3PA 4JKKA 2VR4A 4OUMA 4BJ0A 5EXOA 4OMCA 3VBOB 1DGLA 2DFCA 2LALA 4AOCA 5FFOC 3TEZA 1LHOA 1EUUA 2I45A 3R6SA 2BZDA 1FT9A 4G4FA 2RS51 2DVFA 5I8SA 2A75A 2FCVA 4XDPA 4F83A 1SG3A 2RMU3 1JHNA 1RHI3 4WM7B 5L7OC 4AR2A 2PHWA 5C33A 4JGZB 3POEA 4TN7A 3DECA 5LATA 3ZKUA 5LWBA 3C2UA 2YU2A 1LR5A 5IFPA 1OA2A 3K4DA 2VUAA 3I54A 3VKLA 5DDJ3 5FWEA 3O1OA 4BOWA 2BFUL 4JTNA 5JDBA 3I49A 3PDQA 4AFCA 4F7ZA 1W03A 3V0BA 2BERA 5T5PA 4QQLA 1VAVA 3T2TA 2VVDA 3NJXA 3SH4A 4WZFA 3F95A 4I09A 2BW8A 3TAYA 4XFHA 4Q8LA 5F39A 5JIAA 5LRRA 2Q8CA 2BYVE 3DF0A 1UO9A 4GMP3 4A6OA 1SCSA 2TEPA 3WF0A 2ZABA 4TZDA 4QDSA 2JDHA 5KBFA 5LBEA 3S7EA 1X8MA 2CWMA 2OUHA 3OG2A 1S0EA 1BBT2 4I0AA 4P9JA 5A70A 3K77A 2BVBA 1HV1A 3HQUA 1GWMA 4XQ4A 5LY2A 1FPN2 3AZXA 3WW1A 2LROA 1W9WA 2VZ3A 2UYBA 3MF9A 3D0SA 1HQWA 3T09A 2ZHNA 3AZZA 1YI7A 5LEKA 2MEV2 5FXXA 4UYBA 1TME1 2VMDA 2WFF3 4QX2A 1W8WA 2HWE2 4BQ1A 2RDNA 3SQOA 3LDRA 3KV9A 1JU4A 4MXWA 1H1AA 4Z2AA 4TSVA 3AP4A 1WCQA 3AMHA 1ND2B 1L7LA 1LEMA 4RR3B 2BOJA 4YM1A 3GZAA 2NPIA 3NAPA 3PNAA 3WQ0A 2HLEA 1NT0A 3R05A 3RZJA 3KQ4B 4OZXA 2AYHA 1WLDA 4QB2A 3WNKA 1REDA 2YFUA 4COVA 2HWD2 2XQRA 3N9NA 3ME2A 2OPWA 2NMOA 1OUSA 4EROA 4CDXB 4LA2A 1GFF2 1HRV1 5FXZA 4LBNA 4JV4A 3ETPA 4QWNA 5DG2A 4U36A 2VCBA 1GR3A 1BK1A 5FZ7A 1O3RA 2PAEA 2X5IA 1UZVA 1UW8A 5T5OA 3AXEA 4N7UA 2TNFA 3AVSA 3LD8A 3LIHA 1OD3A 2Z4FA 2J1UA 2RJKA 2XQXA 3ILFA 3MW3A 1US3A 4IEYA 2ZEWA 4IGPA 5CG9A 2ZGNA 1BQPA 3GHNA 3I2FA 4JGYA 4XJUA 2N7GA 2V73A 3HPNA 1W3XA 2A70A 2UU8A 1F2NA 3H7JA 3HMYA 2JWPA 1UIJA 3EHKA 3MF6A 1I3HA 2EIGA 4QQHA 3AYAA 4QXCA 5I0TA 4AI2A 1LTEA 3ZOIA 2QQMA 4J1WA 5IVCA 1WCUA 1X9PA 1UYPA 4WZCA 3LOBA 1JBCA 2XJRA 3NRUA 1HV0A 5CFCA 3ZMNA 1UPIA 4L0PA 2GMPA 1N3QA 2XWJB 1UOBA 5FP8A 3WV6A 4NIIA 4LO7A 1UY1A 2ZX4A 5FBJA 2VOTA 3FLTA 4IEOA 3E1F1 4XEZA 3RMYA 1NCQB 1SPPA 1MACA 2D6LX 2HBUA 5FYBA 2CSGA 2VZTA 2CGPA 1GWKA 4RGAA 3ZYHA 2VL4A 5C8CC 3CZJA 2E7AA 1C8M2 3GHMA 4BMEA 2P3IA 1C28A 1OOPB 5JMOA 3VD9A 3KT4A 4PDWC 5JLVA 3IT8A 4GKYA 5I0DA 5FZOB 4PI2A 1VALA 1AL22 3E5XA 3OYWB 4CCCA 1RUH1 1RUE1 1R1A1 4C0BA 2Z5WA 2FBEA 2DYCA 4MV2A 4AVTA 2F4LA 2ETEA 4K1YA 2FMDA 1DZQA 1ZRCA 2BRTA 4JKMA 3RYRA 1HRI2 3PIJA 2JG8A 1V6OA 1ZYBA 2E32A 3S30A 2QUOA 4DNYA 2D44A 4FI9A 3CMGA 3T0DA 1VBE1 2X09A 4E2QA 1GBGA 1W8HA 2ZEYA 1TG7A 1ZBA2 2YPJA 3IAPA 4FPGA 4AVCA 4LUKA 4XCAA 4AK3A 2WWJA 4RSUA 5LA0A 3AXDA 3WY6A 2GP3A 1IPKA 1C4RA 1UY3A 1H6XA 2PHRA 1LESA 1TVGA 4GH4C 4K40A 3TN93 3OBAA 4GMP0 3RI9A 4CXWA 3PVOA 4M0NA 3CNAA 2VZOA 4GIQA 4QGLA 3VBOA 3TNQA 3LF7A 4CDUB 3L9JT 5LRSA 3SKJE 3VL8A 3O0VA 5FOJB 3PLQA 3R4UA 5C9AC 4MOAA 2ORZA 3JBG2 4BMBA 2Q8EA 3O12A 1PZ7A 1H2NA 2GU9A 4HOOA 4LBMA 4CE8A 4UAPA 1R64A 3AM2A 1D4M1 2EA7A 2GNMA 4WM7A 3MHZA 1DGWX 4ZZ5A 2ZOEB 4JGZA 2Y38A 1UOFA 1UZZA 1QMJA 1AYN1 3D0JA 3FBMA 2XJVA 4AYUA 2WO7A 4GJYA 4QX1A 4FAHA 1LECA 3N9QA 1US2A 4RA0A 2VY0A 1YO8A 3O1RA 2YG0A 3RZHA 4YGDA 3IN9A 5I8YA 2A3XA 3U4SA 1Y9QA 1DQ1A 2P17A 2J1VA 4JHZA 4CUGA 5JSPA 4XFIA 1OQEA 5E16A 2ZGLA 1DQ5A 4XZPA 3H9AA 1XRUA 2R0HA 2VVFA 4KI5M 5FYCA 2WT1A 1UY4A 4FPOB 5FYZA 3VZOA 3H8RA 1NUKA 3KV6A 2XBO3 3O1PA 4R9DA 3MV11 3KVBA 4AE2A 4NRMA 1S0GA 1X82A 2CDOA 3J4UH 2ZGRA 2R062 4QXBA 4LIVA 2TBVA 5DABA 1W2AX 1DDLA 5L9VA 3WNMA 1CAWB 5FXVA 4RD7A 2W0XA 1W6PB 3D8CA 3J8F2 5BUVA 1CAVA 2ARXA 2EIEA 2O14A 3BPZA 2WA4A 3DYPA 5D8AC 4AGGA 3NJZA 5C70A 2K2SA 2QNKA 1H30A 5J48A 2KR2A 2X8KA 5A6YA 2JDKA 2ARAA 1ND2A 2OXBA 3POYA 2RR11 4RR3A 1JI6A 4XJZA 1HRV3 4FO9A 3RQ0A 3SITA 1LU2A 4M3CF 3O1VA 4N90A 2QVSB 3HBZA 5IVYA 3O0XA 2GZWA 3FC0A 3ZXAC 3OGRA 3T4HB 4ATFA 2W52A 4CDXA 4DOUA 1X33A 2VM9A 3WW3A 4RQPC 4W8JA 4HETA 1NX9A 3N9OA 4FT8A 2QQUA 1VRH2 3LEMA 4UW3A 4MGIE 2VTXA 2RS11 2ZTNA 3M1HA 4MSVA 5HCBA 3VHOA 1VB2A 2EAKA 4QM8A 3WUCA 5EPAA 4YRDA 4YM3A 4QPWA 1D0HA 4GAZA 2IXJA 1PO23 3QH6A 4ZZ8A 2HYXA 3HWJA 1M4WA 4CXYA 4A7KA 2FDGA 1U5YA 5DUXA 2VAUA 1QH6A 4CRQA 4CUBA 3ORJA 1R092 4XTMA 3NVCA 1U5XA 3M3OA 5FZ4A 1ODMA 4WVMB 1XU1A 2OUJA 4MXVA 3A22A 2W3JA 1FV2A 4V2WA 4XFAA 4R9BA 4CZSA 1DGWA 2SBAA 4DB5A 2HWB3 4JRLA 4Q0QA 2W39A 1AR61 1NYWA 1RMU2 2Y0IA 1V6NA 3AKSA 1QJY2 4IL7A 1QF3A 2PELA 3MICA 1LKNA 4O65A 3VB9A 1DLCA 3ZXKA 3VGIA 3PUHA 1XSQA 1SBFA 2FHRA 1MZ6A 2W1QA 4NUBA 5A33B 1KJRA 1AR93 2DUQA 1NCQA 1Y9GA 1OFSA 3W5MA 3RZMA 3IAQA 1D4VB 4Q1RA 2FZ2A 1DU3D 2JDPA 5LCWL 3UGHA 4ORFA 3JD73 2PHDA 3WG4A 4LHSA 1OOPA 4HVRA 4NWVA 4EWAA 4F8AA 5A1AA 2GC1A 4LO8A 3WQ1A 2JECA 5FZOA 5C8CB 4CTEA 3OYWA 4CU8A 3SCFA 4LMFA 4PDWB 5ANNA 5FPBA 2CGOA 3V56A 4MGYE 2BTVC 4KMQA 1ZVFA 5FKBA 1VBE3 2WYFA 4RS5C 1EPWA 4A41A 2O8OA 1KEXA 1VMHA 1WLCA 4LO6B 4QX8A 2D6NA 4RYDA 4MUVA 4DMIA 3RZKA 4FP2A 1YIFA 4EZHA 1JYXA 1K3IA 1GP4A 5HCFA 4NRQA 3WX5A 3GXUA 1CR7A 4LT5A 1K5JA 1CAXB 1MQTC 3KWVA 4J1XA 1QXRA 2RDQA 3JB8A 3FWEA 4LBJA 4BXSV 1HX6A 1LU1A 2VE1A 3ZM8A 1OF4A 1JYVA 2JIJA 1SMVA 5C3QA 2Q1MA 3AYDA 1OBNA 3ZYRA 1VBC2 1RTVA 2ZGUA 3FLPA 2Q30A 2WLPA 4CDUA 5FPXA 4GH4B 1SEFA 1IKQA 3M4FA 5FPAA 1NY72 5D21A 5C9AB 3M7AA 5FYTA 3NJVA 3PVBB 4HLTA 1BBT1 5T50A 2Q8OA 3MIGA 2BOIA 5FZGA 2ZGTA 4JZRA 2JB4A 1R1ZA 3EMRA 4IGOA 2VQUA 1PIV3 1HDKA 2MEV1 3A21A 3N35A 4LO5B 5LBCA 1O4TA 2BVVA 1QXPA 1UAIA 3I2IA 4AQTA 2HWE1 3MFAA 4HVQA 5EIYB 2DCZA 4G9SB 4OHVA 2IUWA 4XZUG 3GBFA 4DUWA 3AB0A 2P3KA 3WCSA 1KDMA 3RG0A 1Z7S2 5A6XA 3IB3A 5IVBA 5IUQA 4N53C 3EB7A 5J3UA 3HN1A 2CV6A 1P8JA 1W2TA 1NQDA 1UYYA 5IWFA 4UFHA 3WDTA 2HWD1 4IW3A 4BA6A 3M3EA 3V65A 5K7PA 1COV3 2X5IC 4META 3GZTB 5KHKA 4YG6A 1DGRA 3I7DA 4UBHA 1LOFC 1S55A 2BGOA 1DYKA 1CAWA 1PVC2 2D5FA 2ZEZA 3T2QA 2WSVA 4HBNA 3J26N 4JQTA 1BLZA 3MYXA 4O7XA 1YLLA 1AR72 4KWKA 2QCSB 5FP7A 3AZYA 3VV1A 5K0UC 3Q8FA 4QGNA 4B7KA 3PTRB 1SHWB 1APNA 5D8AB 1OPMA 1POV0 2C9KA 4JCKA 1DQ4A 5JIUA 2BUKA 5F5IA 1ZZ7A 1RXGA 4P14A 2VO5A 4NO4A 4QGMA 2PAMA 1QWRA 1W90A 2KD7A 2DCJA 1S2KA 2WNVC 3POBA 4Y3OA 3VBUC 5C5TA 2HEWF 2DWRA 3ZFFC 2XOMA 3HN3A 5FZLA 5JMCA 4QKNA 2WQ4A 2D6KA 3I3BA 1GMMA 3R4SA 2C4XA 3G7DA 4CYDA 4UW5A 4RQPB 4COZA 2OS2A 1OLQA 4H3WA 5IFTA 4MG2A 2ADDA 1N47A 4FPKA 3ZN5A 2R49A 3VZJA 4FQZA 4YW3A 3VHNA 4LQRA 3ALQA 2Y60A 3QH7A 4LKDA 1C8M1 1MS1A 1XBFA 5FIXA 2A6ZA 4QD2A 4Y33A 1DF0A 5E89A 2P1BA 1AL21 4FBFA 2R1BA 3SISA 4WVMA 1ZZ8A 1O91A 1QDOA 2W9XA 4A3XA 4TXWA 4QU1A 4MLOA 3LDBA 4XF9A 4Z82A 4BHPA 1RUF2 4DXRA 1SCRA 1HRI1 2J42A 5F5CA 2H0BA 4K3UA 2AEZA 3ZXEA 4CP0A 5C3OA 2WWUA 5A33A 4QT6A 2B7YA 4Y5Z0 3I2JA 1XNTA 4FAGA 5EJZB 3Q8EA 3OGSA 4XMAA 3N7MA 2R043 5A3LA 1AX1A 2RJLA 3NV4A 5C3RA 1ZBA1 3BIEA 2NZ9A 4FPHA 3SEPA 2XMLA 3UESA 5FLJA 4C0HA 3S0MA 4HK8A 5GLVA 4AFAA 1OKQA 3OPWA 1MS3A 1FMD1 2RJ2A 3VD5A 1DQ2A 1YRZA 2DU1A 5C8CA 1C1FA 3GF6A 3WXPA 1KITA 5J96B 4PDWA 5FZFA 3HNBM 5L7OB 2WZPP 5FY7A 2R071 2ES3A 3JBG1 4XC9A 5GZGA 3EBRA 4XE9A 1YFWA 2PLV2 3IDBB 5FZMA 3KD4A 5JR7B 1QJX2 1W9FA 2BBAA 2UURA 4PQ9A 1KD7A 3LEKA 1QQP2 4RS5B 5FMBA 4XF3A 1HLCA 1NZCA 2VXRA 4R9CA 4TWTA 1ULOA 3OSDA 2P3JA 1NZIA 3ZPOA 1W39A 2BNNA 4GA9A 3CJIC 3WZ1A 1CAXA 1HXS2 4GQ7A 3K51A 1JZ3A 1U5IA 3BN6A 1LULA 2OW4A 1U5ZA 3DV8A 1OQDA 1UZ0A 1R082 3OEAA 2AZ5A 4RHV2 3MDPA 1W8OA 2LRPA 1OVPA 1MQTB 1BXHA 2R6QA 2OKXA 2VECA 1BBT3 3ZDSA 4GH4A 1HB3A 2QQOA 5B4XA 2VNRA 4TTGA 3RI8A 1RUI2 5FP9A 4V1PA 3WF1A 1VMFA 1W6MB 3H1MA 4BQYA 2ILMA 4IERA 5JSRA 5C9AA 1GNZA 2QZ3A 4DO0A 5FMCA 4JQRA 4W50A 2VTXJ 1U0AA 3TEWA 2R061 3ELNA 2HWE3 3K48A 3UKNA 3VZMA 2R0FA 1O8SA 4AQSA 5CBLA 3E6CC 4XMIA 3LPFA 2WDBA 1PMJX 3KSCA 4PIYA 1A34A 4N8MA 3UKTA 1SLIA 3J8F1 5GALA 3USUB 3ZN4A 4PF5A 3CZUA 4XJAA 1Q56A 2R30A 4KBZA 5E1RA 4Y1VA 5IJRA 4LEJA 3WW4A 2GC0A 1XNDA 2YROA 1WW6A 4FOYA 5K4LA 4FFFA 2HWF3 3WF4A 4CPBA 3N9MA 1HJFA 3DYOA 4A3ZA 5LEJA 4XACA 2IFRA 1UU5A 3ZXDA 4XIOA 3WNXA 1V0AA 2B8MA 4AEDB 2CNAA 5J09A 4N53B 4KU8A 3AJZA 3TYJA 5FKCA 1J83A 3ILNA 3IZOA 5B4NA 3QACA 3HQRA 4A6SA 5AFEA 1UY0A 5CA6A 2E33A 2VGDA 4XPVA 3WNLA 1N1VA 2V4VA 3KB5A 3KT1A 1SDWA 1MZFA 1FOD2 2D5HA 2XR4A 1NQJA 5A7QA 4NHXA 1TMF2 1GUIA 1ZRRA 4H7LA 2VW0A 2YU1A 2O1QA 2OVUA 3NNLA 3FHIB 5D8AA 2ZMLA 2VCAA 1PMHX 4WV8A 3ZFGC 2DUPA 2ARBA 2ATFA 4GB33 5JI7A 2YPDA 5K0UB 3ES4A 2XJPA 5JXGA 1PM7A 1WZXA 2FDIA 5DAQA 5FO7B 1R091 4YZ3A 3IIIA 3NWKA 1G8WA 3O1MA 1WW4A 1ASJ3 2HKXA 4Q4Y2 5HXMA 1PMIA 2HWC2 4IEVA 4HFSA 3VBUB 2WNVB 4EN9B 1BEV2 2VNGA 3W20A 3ST7A 1IS5A 2F17A 5FUIA 3ZFFB 3L2HA 4UI9L 1RMU1 3POFA 3S5QA 4YWAA 3IM0A 4RQPA 4CU7A 3BU7A 1C8M3 1QKQA 2C0ZA 3T4VA 3VKNA 1BMV2 2LS6A 1CONA 1WMDA 2AUYA 2VCMA 4L8QA 1O5UA 5GZDA 1FYUA 1OOPC 1VBD2 2VPVA 3RNSA 2JDMA 1ULDA 4HXCA 3IDCB 2JDAA 4YW5A 5GZEA 1PO13 1VBB2 4S2HA 4DY5A 3BTZA 2X05A 1RUG2 3ZDVA 3AMMA 3PIGA 1AXKA 3WF2A 3BIWE 2IFWA 5FK8A 1SLCA 3C7EA 5HCHA 3BTYA 2XJTA 3DL3A 3SCHA 2P6HA 2UYAA 2Y6KA 3ZXJA 2J22A 2QTWB 3OPTA 3QOPA 5FYSA 3VDBA 5FK7A 5L19A 2IXKA 4OLLA 5KHGA 3DGTA 3WHTA 4QHZA 3MZHA 3QBQA 2QQIA 4YGBA 3WR0A 4YW6A 5FY4A 3IMNA 1FAYA 1FMD3 3O0WA 2E51A 3POWA 4XTPA 4ZU5A 4D6QA 1RUD2 2VMFA 3ITQA 3O14A 4FTEA 1JZ7A 3WNOA 4A4AA 5A3OA 1S0CA 1RJ8A 5I91A 4JDNA 2R073 3IDEA 2JICA 3GALA 3K4AA 5JPMB 4COWA 2RS32 5LK7B 3VBFC 4QPGC 5BNOC 5JPNB 3WP6A 4L97A 1ZBE3 2PA7A 4XHBA 3T2OA 3NQHA 1IZ3A 1VBC1 4AI3A 3S6PA 5L7OA 4H55A 4AZZA 1SBDA 2FQPA 4K20A 3DN7A 1FNYA 3EJKA 1S1AA 2CWSA 1NY71 1VBA2 2NQYA 3RDIA 4LR4A 4WM8C 1J1LA 3IBMA 1V6IA 4RS5A 4M3CB 3WP5A 1ZZ6A 2GNDA 3ZYGA 3W9AA 2QQVA 2EAAA 2LUWA 3B00A 5SV8A 3E6DA 5C7GA 1J59A 1T6GC 4Y1UA 5ABJC 3U0ZA 4Z8BA 2DFBA 3ETQA 3BOWA 1F35A 2BWAA 1H2MA 5FYIA 2WL1A 1Q8OA 3CJIB 2NP0A 1MQTA 4AWDA 3MUY1 1G6NA 1NLRA 1HB2A 3WDXA 1J3PA 5DAVA 4MH0E 2Y26A 1Z7S1 4EV0A 2VOKA 2WT0A 4FPCA 4MO3M 1HJGA 3S57A 4NPLA 1JHJA 1PK6C 1ZX5A 1W6MA 2D40A 2VBBA 2WQ8A 4X8NA 1YQCA 2QDRA 1OHFA 4RGKA 5F1RA 1W8ZA 4HT1T 1AYM2 1GZCA 2UWBA 5EWSA 3CDZB 3LFMA 4LXLA 3NNFA 4E4DX 1PVC1 1KFUL 1X7NA 1Y4WA 5T5LA 4BIOA 2BP6A 4MGSA 3WQ7A 1QJEA 2OYZA 3USUA 4CPBD 3KHBA 1EAH2 4Q4V2 2ZGKA 1GKBA 4QDRA 1AR71 4CUAA 3AP6A 3ZIWA 4RN5A 5FTTC 1CN1A 1LOBA 2VZSA 5AVAA 5JR2A 3T08A 2DBNA 4ZPIA 1YHFA 5IYYA 2CGNA 1AJKA 3BB6A 4IV3C 5FY8A 2GC3A 3E97A 4BLIA 4OYUA 4BPZA 5FZDA 3FJSA 3JQWA 3KT7A 4N53A 5A3TA 2XKPA 1MEC2 5J1XA 3C8XA 2QQPA 1RUJ2 5A1FA 4KWUA 2PQQA 3Q9OA 1N3OA 2D6OX 4A7ZA 1RUNA 2AC1A 1LOFA 1DYPA 2A6VA 5FMOL 4Z07A 4YZ5A 1W8UA 1EV12 4CP2A 4CUCA 2E7QA 5I93A 1YQ8A 3OB8A 2PHXA 4AL9A 1LGCA 3TBDA 2W08A 3ZPYA 1CGPA 5K0UA 3JB4C 3D82A 1RJ7A 2JD9A 3D4KA 4HSJA 2FDKA 3UJOA 1JU3A 1V6LA 3PUQA 2Z2SB 5A32B 3ZFGB 4HK9A 1ZRDA 2ZHMA 4K8FA 4Y22B 4W6WA 2P6CA 3N7LA 3VDAA 2W92A 5CEHA 4E8CA 4OI4A 2PHUA 2WS93 2YYOA 3RSJA 4Y4YA 3VBUA 2VTFA 2WNVA 4BQXA 2RM22 2XLGA 5DAXA 3ZFFA 4CCJA 1RUF1 1HQNA 5FY9A 2VNOA 3ACLA 3J7LA 3APBA 5ANQA 2YMZA 1RVF3 4NIDA 2H6CA 3CEWA 3H42B 3TEYA 2VZRA 5F7UA 1WD3A 2IXCA 2AGSA 2VMGA 2NMNA 4RFRB 4XJWA 2E9QA 4Y5SA 4A2UA 2PMWB 1UYXA 4CU9A 4LKFA 5LBFA 2G9GA 4LE3A 4HKWA 4BH9A 3RZZA 4BXFA 2R16A 1ULCA 1QOTA 5EP9A 4L99A 1PM4A 4CCOA 4HANA 1MVQA 4LHNA 1V9U3 4P9GA 4UXAA 2A3YA 5DQ0A 2A6WA 5FZ6A 2WAAA 5I0RA 5AC92 1POV1 1C57A 5BY5A 2WZR3 1CIYA 3LSDA 2X29A 2Y6FA 3FZ3A 4ZONA 5ACA2 2ZACA 3OUJA 3VD4A 2B39A 5ISLA 1WGPA 5FAXA 1F31A 1QJX1 1QQP1 1YJKA 4IE7A 4PI0A 2XWBB 1NA1C 2JJ6A 2E6VA 4X6QB 4MGKE 4LLFA 1URXA 4QPYA 2YDEA 4E2SA 1HXS1 4Q0VA 2A5ZA 2WNEA 2RS53 3DKQA 1R081 5IK8A 2W87A 4RHV1 5GKAC 5HV4A 1UXZA 3SC7X 4NPMA 3VBFB 2ZAAA 3E5QA 3VDDC 4QPGB 4XUTA 5BNOB 3MIEA 4D7TA 2BWCA 1RUI1 4G3YC 1AR82 1N1TA 2A73B 3KF3A 5EJ3A 2IC1A 4ASKA 1IG0A 4HN1A 4DXTA 1F15A 3E6BA 1CPMA 2ZA9A 4Z2WA 2ORXA 3AZVA 4M3CA 1HQLA 1UMHA 5F2SA 2DUOA 1QU0A 2F6BA 3ZSEA 4XCBA 3T30A 1IHMA 2NLRA 4WM8B 5FQ0B 3SXWA 2Y6HA 4QQOA 1JXNA 2E63A 3A4UA 3RZGA 1YUDA 2V5DA 2OA2A 3B94A 3LCPA 1CQ9A 3CJIA 5ABJB 1W0NA 2GNTA 4AEMA 1DP0A 3KQRA 4Q4X2 5FUPA 1JH5A 3DKWA 3PUAA 1H6YA 1VRBA 5DAWA 3RFRA 1LOCA 1X8EA 4P5HA 3TNPB 3I8TA 2B9VA 2XHNA 3T3YA 4I0WB 2XPJA 4LIUA 3WEZA 3NNMA 2CL2A 1TME3 4QXKA 2VMEA 3CL1A 2ZS6B 3VDCA 1PK6B 3AKQA 1VAKA 4LK6A 1RHI2 2YC0A 3VBRC 4DY3A 1PGSA 1DCSA 1ZZ9A 2QQWA 3UKVA 1YI9A 3AL5A 2WZEA 2GC2A 3SNMA 1CX4A 1OI6A 3NV3A 1FOD1 5HV0A 1SFPA 4XFGA 3WP3A 5AVPA 5FYYA 1TMF1 4QX5A 2L9LA 1TQ5A 5CVRA 3M3IA 4PF1A 1J84A 1ALYA 3KGLA 4LITA 3RYPA 5FY0A 1A6CA 1WW5A 1YNAA 1W0PA 2XDVA 4FTSA 1XXNA 3VKMA 5F2WA 3CKHA 3W59A 4D7SA 2XUEA 4LE4A 2KA3A 1X9TA 2ZHLA 3OBZA 4COUA 5LZ6A 2GNBA 3NNGA 4Q4Y1 1H0BA 4IV3B 3MFCA 3H8XA 1BEV1 5M0TA 2WIIB 5JOXA 2VQ0A 4Y24A 1NAEA 5GLWA 5CG8A 4UT5A 1PGW2 1XJAA 3M8LA 1BMV1 4BZ4A 1S0IA 4GKXA 5CFDC 2DCTA 2WFF2 3T2PA 1VBD1 1LNSA 1ULFA 1JZ6A 3TEXA 5JOZA 1L7RA 2O8QA 2XL7A 1I6XA 4AHZA 4BQ4A 1ONAA 3O1TA 1QXJA 3NV1A 4EN0A 4C1WA 5A3NA 5IHRA 1VBB1 3SH3A 1XOYA 1GNHA 3ZFGA 4OCTA 5A32A 3OBTA 1OMIA 2C9AA 3DYMA 1QY4A 1XPWA 4Y22A 1RUG1 3RMXA 2JEMA 5BNNB 1C5IA 4ARYA 2DURA 4XABA 1ULGA 4XFCA 3O7OA 3K2OA 4QX0A 1Q8PA 3MLLA 1A8MA 5FREA 4N9HA 1BVP1 2B4KA 4KH9A 2HYKA 3B9IA 3HNMA 4IE4A 4EN7B 3GZEA 4GWNA 4LHLA 3N9LA 2YHJA 2AR6A 2VOXA 2FCUA 4L2NA 3WSOA 1ZZBA 4M3CE 3I2KA 4CXXA 1PX3A 1LHVA 1CAUB 1RUD1 1SLLA 5CIRA 1BJQA 1RUH3 1RUE3 1R1A3 3RWNA 3DXUA 1XYOA 5D1IA 5C4WC 3FL7A 3H3LA 5EYYA 1WLTA 5FWJA 1E5SA 5HBAA 3RWKX 1W0OA 1RUC2 2RS31 1YQ6A 3P6BA 4L11A 3V64A 1O8PA 3P3NA 3PUSA 4NROA 4KWJA 1B35C 4GZ9A 2FMYA 3ACIA 4YFZA 2ZGPA 5FMDA 5SV5A 3ILRA 5IVFA 1CESA 3ACFA 3HEIA 4MGTA 1RB8G 3WQBA 4NPRA 2IXIA 1YQ5A 3OGVA 5T5JA 1VBA1 3KV5A 3N9PA 4UFLA 2G19A 2OX0A 4MGZE 4EZ4A 4B7EA 1KRIA 2J1TA 1LHNA 4HONA 5J37A 1F5JA 1F5FA 1HB1A 2CY6A 5DZFA 3TWIA 4U2AA 1NA1B 3BOPA 4BQ5A 1UL9A 3JU9A 2K0GA 4CP1A 3AZWA 3B69A 5BYNA 3JUUA 1VJ2A 1JZ4A 1WKYA 5A7WB 1D4M3 2JG9C 3M2MA 1C1LA 4AHYA 2MPFA 1CZTA 3VHPA 3VBFA 5C5UA 1JYNA 1AYN3 1DG6A 4QPGA 5BNOA 4CCEA 2MHFA 5KXBA 4Y4RA 2Y64A 2ZMKA 2RDRA 4FP3A 4I30A 4BQWA 5CADA 2Z69A 1CIWA 4OI1A 3VDDB 1QIQA 1H9WA 2B45X 1QOSA 3CQOA 1AYM1 2VZUA 2JDNA 3V0AB 3X29B 3AVRA 3OTFA 1J58A 1FPN1 1CZVA 3IMMA 1EP0A 1H2LA 4FPJA 4WM8A 4JC1A 5FQ0A 4R4XA 3PU8A 1UIKA 3H1WA 3WG3A 1EAH1 2ID4A 3ASIA 3PL0A 4Q4V1 3UGFA 4ET7A 4AI8A 1W8TA 5ABJA 1YJLA 4LK7A 1K45A 2Y6LA 3H8UA 3RJRA 2ET7A 4WVVA 3RS6A 2WO3A 3S7IA 1YFXA 3KV4A 3TN92 1EY2A 5LW9A 2GMEA 2PXJA 4LBOA 4RGGA 4AEDC 4CCDA 1G9AA 2WBKA 4QQ2A 1DLLA 3H7YA 3GBWA 5FZ9A 3TB0A 3VBHC 2GH8A 3CO2A 2HJIA 2AEYA 3HNYM 1UX7A 3WOGA 4YG0A 1PK6A 1H1MA 1BHGA 2B5HA 1RUJ1 3MIBA 1DIWA 1MS0A 1WBLA 2HH9A 3JQXA 4IEPA 4N7IA 1S4CA 5EV7A 3KLSA 1W6PA 1YQ2A 2RR13 1ULEA 3KF5A 1UCXA 3VBRB 1N3PA 3GGLA 4HG6B 1QJFA 4LOTA
chains in the Genus database with same CATH topology
1EV11 3WLUA 2LM3A 3PTYA 1Z78A 5KXCA 1V6MA 1O5LA 5JCTA 5BNPC 4YM0A 2GN3A 3AYCA 4LTAA 4CEWB 2SLIA 5H9SA 4YZ2A 2RS13 1AXYA 1AVBA 2CYFA 2XBO2 4KG8A 2Q1ZB 4IV3A 1A78A 4AVSA 1LB2A 2RM21 3WDYA 4N43C 3ATGA 1XE8A 1QJZA 2NN8A 4XDQA 4ISQA 5IK7A 3OBRA 1YFUA 3M3CA 1GICA 4HPKB 4B4RA 4OHYA 3PJQA 2ZKNA 3POSA 3ZYPA 2VW1A 3ZFEC 5CFDB 1LRHA 1AR63 1XYNA 5JAXA 2VULA 1KQRA 3LA3A 3RPQA 5BNNA 4EN8B 1G7YA 3VBSB 4XIKA 1ENXA 5AC91 2OZ6A 1RUD3 3B9CA 5ACA1 2JKBA 1FI2A 2YZ4A 3OD0A 4ZXKA 4ONUA 1QDCA 2H6BA 1CAUA 3MLJA 4EWDA 1O3QA 2YV8A 4DZGA 5GLTA 3T1LA 3VZNA 1PO22 3HQXA 4WBBA 5C4WB 1MS4A 1VBA3 2VMHA 3OY8B 2V09A 3GBGA 3VKOA 3ZSKA 2ZX2A 1LGBA 3ZSJA 1B35B 4OI2A 1AR81 1UX6A 4S2GA 3VKFC 4XXAA 2HWB2 1GQHA 3LSEA 3HD8B 4KL1A 4TYSA 4YVSC 2VVEA 3LGRA 4BIFA 2VG9A 1DQ6A 4PCRA 2GDFA 1GYKA 1AR92 1NA1A 3KCYA 1WCSA 2WT2A 2R1DA 1IGOA 4GULA 3JD72 4Q4X1 2JDZA 1MZEA 4NVPA 3MW2A 3KMHA 1FPN3 3MLKA 2JG9B 1VBE2 2MEV3 4LA3A 1REEA 3VDDA 4NR1A 1G9BA 4QMAA 3BALA 1EAH3 3V0AA 1EYBA 4QM9A 1RHI1 3VN4A 3ZYIB 2VOWA 3B93A 1X36A 3ZN6B 3ZSMA 1AJOA 1SLBA 2ZBJA 2AH2A 1X50A 1YXWA 3PVNA 4FPEA 1QJU2 2HEVF 4J6GA 3MEPA 2HWD3 1IS3A 2D7FA 3GNEA 3THTA 4X6RB 3PMSA 3IIAA 4KQ7A 4FQ4A 4R4ZA 5DZGA 3USSA 3HR9A 4GMP1 4LULA 4Q2FA 3VBHB 3CU7A 3N36A 1AF9A 2B42B 1DHKB 3SHRA 1GV9A 3R4DB 1VRH1 3EO6A 1AXZA 3NO8A 4AEKA 3RYKA 4ASLA 3VBRA 1RITA 4EWEA 4I3GA 5BXXA 2EF6A 4B4QA 1PGW1 1PIV2 2KXLA 2R32A 2XJQA 1TNFA 3KCXA 2WFF1 1V00A 5JZGC 1XYPA 2A6XA 4URTA 4NHLA 1W6QB 3WP4A 4LUMA 3SLIA 1YCIA 4NHKA 1UN1A 2RM23 4CEWA 1DGRN 1JUHA 4AHXA 2ZZJA 3GZUC 1O4ZA 4QPIC 1XNBA 4K7JA 5BNPB 3WW2A 3H50A 1VB4A 2ZJCA 4FXGB 4NOTA 1YIPA 1UU6A 4KBBA 1COV2 2JE7A 5FPZA 1H8TB 3NSTA 4MYEA 1LOAA 1QJY1 4CDWC 1IOAA 4P9XA 3VL9A 4YW1A 4HPKA 4N43B 4P9IA 1AL23 1NLSA 1ZZCA 2XUMA 1CVNA 1J3QA 5I0SA 4E4ZA 4UBGA 4XQDA 4FOVA 5CFDA 1SFYA 2VU9A 3PHMA 4YZ4A 3SCGA 1RUC1 1HRI3 1F9KA 2W68A 4MX3A 4QU2A 3ZFEB 3VBSA 4R52A 4HZFA 2C5DA 4CDQC 2JD4A 2QDNA 4W65A 3AMNA 4R8HA 1KFXL 1D2SA 1YFYA 1ZBA3 2D6MA 4LNVA 3OJBA 3INAA 1LENA 2JX9A 4L92A 5JWPA 4W6XA 2PAKA 1MS9A 4FPFA 4FOQA 4YLZA 1UMZA 4Q0PA 4PIXA 2H0VA 3JBG3 2QZ2A 2XVLA 5DZEA 3LOIA 4AGVA 1NXMA 5C4WA 3OY8A 1LHWA 1LOGA 4Q4W2 2D3RA 3OD4A 2BNOA 5GZFA 1B35A 4L9BA 4ES8A 2ENRA 4I3PA 3H1YA 2PTMA 1G9CA 2BBVA 3ECQA 1CD3G 2XHKA 3M3QA 4KNCA 2DVBA 1UZYA 4YVSB 4OVEA 1PNFA 1XNCA 3BODA 3KM5A 2R042 5F9TA 2GH2A 4SLIA 4WVZA 5EFUA 3HAGA 3TN91 2R063 1SLAA 1NE6A 4XILA 2ZGSA 5GM0A 4AQ2A 4D3WA 3ZMOA 1Q8VA 3DPRC 4UW4A 2JG9A 4XJ8A 3B5LB 1FATA 3J8F3 3UJQA 3OCPA 4ATEA 3WD5A 4OI0A 2D93A 5H9RA 4D94A 4YVWC 1CPNA 4IXLA 1AX0A 3ZIXA 1SQ4A 4AVVA 3ZN6A 3KCCA 4HKOA 2I74A 5B2GB 4SBVA 4S2FA 2TUNA 3AKPA 5EYXA 2E53A 1NE4A 3LKJA 4HL0A 1QNYA 2A6YA 1OFNA 4XXPA 1HKDA 2UY9A 4DQAA 2DTYA 1VRH3 3B7MA 4AEDA 1Q8QA 3LWCA 2Z42A 3I4IA 2WFPA 4OHXA 1YWKA 4XQWA 2XBO1 3VBHA 4AW7A 3RRDA 1Q5OA 5DUVA 1CAVB 2DTWA 1PVXA 4FSJA 1MS5A 2Q4SA 3P3PA 1Q3EA 4P9YA 1C5HA 4LBKA 3WDVA 1W2UA 4AGRA 1E57A 2XVGA 3MW4A 4Q8KA 5T55A 2ERFA 2NYYA 3AYEA 1R093 4PLMA 4AF9A 1W6QA 4YW2A 2IXHA 2B9UA 4IEQA 5KHHA 5BNNC 4Y26A 2HWF2 5IK4A 1FX5A 2D6PA 5JZGB 2CAVA 3ROUA 1RMU3 4BYYA 3B01A 2ET1A 3C3VA 1BKZA 1QJY3 1NXD1 4XBLA 5KHIA 5BNPA 4YSFA 1O3SA 2QFEA 5BV6A 4WVWA 2WA3A 1V6KA 2WNUC 4QPIB 4M01A 2G9FA 1H8TA 2BQPA 4YFWA 1K5MC 1LGNA 1SLTA 4IV1C 4ZU4A 5HI0A 1ZA4A 4NWWA 4N43A 1RUC3 5H9PA 4AEJA 5I0UA 2XGXA 4LBQD 4CDWB 4XBQA 4ASMB 1UD1A 3CLPA 3OGGA 1PO21 1J1TA 4BWOA 4GB32 1BYHA 3MIFA 1HW5A 2CTVA 3ZFEA 1NG0A 3N3HA 3AKTA 4K6BA 5DUWA 5C6CA 3SMHA 3MPPG 1RINA 3BCWA 4E2GA 1ASJ2 1A3KA 2PLV1 2V5YA 2HWB1 2A71A 4CDQB 4EJRA 2VW2A 4HN0A 1O7FA 4GALA 1HIXA 4O9GA 3LAGA 2PHLA 1VBC3 1AR91 3ENRA 4KGGA 4HKLA 3MIHA 4FPLA 2PFWA 2WKKA 3JD71 1PO12 5FBZA 1AZDA 1H9PA 4Y20B 3UK9A 1BVVA 4Q0SA 3ZXGA 5CNAA 1S0JA 5DXDA 1QGLA 1D2QA 4YM2A 2WC2A 1J3RA 4OULA 3ZX7A 3FUOA 4XF1A 1H4GA 4DXZA 4N9IA 3I2DA 3FBYA 4B29A 2XVKA 2RE9A 4AVAA 1V70A 4YVSA 2WWSA 1PZ8A 1FMD2 4Y1XA 5L73A 5HXVA 4OFGA 1Z7S3 1TEIA 4H14A 4A7YA 5IK5A 1QJU1 1H8VA 2R072 1WA4A 4AFDA 1ZBE2 1IPJA 3FUQA 5KXDA 1GZWB 1PVC3 1KXGA 4B8EA 2DCKA 3N7KA 4AFMA 2XG3A 2K9ZA 4S2DA 2UY8A 1Z0HA 2AENA 3BTAA 3DPRB 3FMGA 2RMU2 1AR73 1PNGA 3WDUA 1JW6A 4K1ZA 4YVWB 3U4XA 2BEOA 1LHUA 2ZGOA 1AUYA 4K9SA 5DDJ2 5DG1A 1ENQA 1JN2P 2P2KA 2WQZC 3VZLA 2XLAA 1NCRC 1XE7A 1IQAA 1PIV1 2C1FA 3HT1A 2D43A 4DRRA 2ZAHA 2EVXA 3B3QE 1MVEA 5EZWA 1LEDA 4AHWA 4CEWC 5J36A 4QHBA 1W6OB 3I59B 2Z79A 4KGQA 4RL7A 4DPNA 2RHPA 2JENA 4ITCA 4FVVA 2HWC1 5I8TA 1S0FA 4I02A 4QQPA 3URFA 2UWCA 3O5SA 1WMEA 1COV1 3IWZA 3HT2A 2BFUS 4Q26A 1XU2A 3D5OA 1H1IA 4B4PA 3KZ4C 4XW3A 3MPBA 4AVBA 3WINE 3GYDA 3M70A 1KDKA 3J9SA 2A3WA 2IXLA 3VBSC 1Q43A 5JZGA 1M06G 1RUF3 4XHXA 1OPOA 3W58A 1D0GA 4KU7A 3OF1A 1WLWA 2YGMA 3LA2A 1S2BA 1PHMA 1KJLA 2EXJA 3FFZA 3LZZA 1ENRA 4QPIA 1Y7BA 4LLOA 4Q0UA 5C8WA 3IPVB 2WNUB 5CU1A 1QH7A 4DFSA 3FX3A 1BCXA 2ZKLA 3ZSLA 1K5MB 4YW4A 4CDWA 4IV1B 5DUUA 4BE3A 1JYCA 1S0DA 5CAZA 1POV3 5FCCA 5J98B 1FNZA 2PN5A 3PVEA 5TSWA 2PLV3 1QJX3 1ZNPA 1ND3C 1QQP3 4Q4W1 4XJ9A 3WG1A 5KC5A 2WLQA 2CAUA 4ISRA 2WS92 4IEXA 4CEYC 2D3PA 3NKGA 4PJYA 2YXSA 1UU4A 1VIWB 1HXS3 2DF7A 2EALA 2JXAA 4CDQA 4I2OA 3MGUA 5FMOS 1R083 1DZTA 1SACA 4RHV3 1RVF2 4I0BA 2ZX0A 2P34A 4LHKA 1WW7A 4NHMA 4OUSA 4PBOA 5GJ6A 4LO4B 1UF2C 2XB6C 3CJXA 1PZ9A 4LBLA 3NL1A 2R041 1RUI3 2PHTA 1KS5A 5K8SA 4Y20A 5IT6A 4RFT0 1PGL2 2I07B 5FO9B 1RGSA 1LOEA 4FOWA 1V9U2 4MZUA 4P9LA 4Y1ZA 2WINB 3QD6A 4O9EA 4DRVA 1TNRA 3U07A 1WCDJ 2DVDA 1RIRA 4DS0A 3CF6E 1W6NB 2WZR2 4OHWA 1EPZA 4TLFA 4IETA 4IESA 3H3UA 4JAAA 1QJU3 1REFA 4JDMA 3FLRA 5KC6A 3TRSB 2XH6A 2MNGA 3UV9A 2G4IA 5BNQA 1SBEA 2GAUA 3MIDA 1IKPA 1V6JA 1WUVA 1F8VA 2RS52 5BPXA 1Y3TA 2VMIA 3AFKA 1VAMA 3QCWA 2ZX3A 2OZJA 3DUIA 3NW4A 1VP6A 4Q1PA 1GZWA 2QJVA 2GSYA 3AMQA 1B09A 3WG2A 1FOD3 2XJUA 3DPRA 1MEC1 1ZRFA 1TMF3 4OHZA 2ZMNA 2GALA 5CB7A 1QHDA 4YVWA 4D69A 3NAPC 1L3JA 4NN0A 4XF4A 4X8PA 2BNMA 1JTZX 1RL3A 1QOOA 4YNIA 1NCRB 4Q4Y3 2ZHKA 1VLNA 2HWC3 1W6OA 1YYNA 1BEV3 1GZ9A 2HWF1 2Q5TA 2X53S 3I59A 4MVTA 2UWAA 3WDWA 3AKRA 4XBNA 3VHRA 1DFQA 1LCLA 2D98A 1OA4A 2BGCA 1H8TC 4Z92B 3U11A 4C91A 2WSUA 1TME2 5JOWA 2BPA2 1VBD3 3AX4A 4I01A 3RJ2X 4JGYC 4M0HA 4KG0A 4AG4A 2QE3A 4Q27A 1VBB3 1AX2A 2I2SA 1RUG3 1CJPA 1ZREA 2ZPXA 4PLNA 3WUDA 4C90A 2VQAA 5CFCC 3ES1A 4BHPA 1H4HA 4PIZA 5F6KA 3VLBB 2PYTA 1LJ7A 1HRV2 4GB31 4JRAA 4AI1A 4LBQB 2HEYF 3R0RA 2YY1A 5GLZA 2PHFA 4YYOA 1JYIA 3A0NA 1S0BA 4E9KA 1ASJ1 4BCUA 4FCAA 3IPVA 2WNUA 1C8NA 2RS33 2Y0OA 3A0KA 1RUOA 2IWGB 2ZCWA 4Q29A 1K5MA 2A7AA 4JDOA 5T3NA 4IV1A 1MS8A 4Q4W3 1TE1B 3AJYA 3LB9A 5FLIA 4XFFA 2IZWA 2DU0A 3ZXFA 5FO8B 2F4PA 2JG8C 1MZ5A 1PO11 5FOBB 1G9FA 3OGJA 3AP5A 3AMPA 1WD4A 2JE9A 3D6EA 1XNKA 1I9RA 1ZM1A 1ND3B 3NV2A 3H3ZA 2DV9A 4XETA 5K9YA 5GZCA 1G86A 1G9DA 4XYXA 5F5QA 4CEYB 4BLJA 2VH9A 3THPA 4ZKTB 3PJYA 3VBOC 2D97A 1I5ZA 2WJSA 3AFGA 1RUH2 1RUE2 2AREA 1R1A2 2O0OA 2ZGMA 4M00A 4YARA 1XQNA 3T1MA 3WT3A 1H2KA 4WM7C 1CJDA 4YGEA 4JGZC 1AYM3 4PLOA 1ZBE1 5A3MA 3H0OA 3AK0A 2D3SA 3ZVXA 3WVJA 1NOVA 1W6NA 4IEZA 4E4SA 3QLQA 2KM2A 4KWLA 4Q4V3 1OSGA 3WCRA 2RMU1 3SH5A 5JSOA 3ZO0B 3G6JB 4HMZA 4W6YA 1JUIA 4BM8A 2FZ1A 2DVGA 1OA3A 3KGZA 4FXKB 5KXEA 4IQPA 2ZX1A 1Y43B 3V0BB 1SFNA 4JVAA 5DDJ1 5LK5A 4Z1VA 1OD5A 4ZU7A 4AFBA 2DVAA 1QNWA 2OIIA 2GMMA 1FV3A 3VUOA 4FTBA 2EXKA 3AP7A 1MEC3 3JZVA 4YGCA 1RUJ3 1D4M2 4IEWA 4AQ6A 5JOYA 2VUJA 2LTNA 1AYN2 1FXZA 3IKWA 1UKRA 3WHUA 2OPKA 1EV13 2XL9A 5KHJA 1ND2C 1UPSA 4RR3C 3PMEA 1Q8SA 1C3HA 1A8DA 4JTOA 4MXWB 3U10A 1BZWA 5FDBA 3NAPB 2VOVA 2ZGQA 2NM1A 4AXOA 4CDXC 1GSLA 1NCRA 1DZRA 1WCKA 1AL0G 1DBNA 3EQEA 3MI8A 3L2YA 5KWRA 1O3TA 1GANA 2QKDA 2EXHA 4HVOA 4FPYA 5FLHA 2EXIA 2X5IB 1VR3A 3ZXLA 4COYA 4YG3A 1O4YA 2XLFA 4XFBA 1IS6A 3N7JA 2RR12 2Q0AA 4UW6A 3JCIA 5F6LB 3KS7A 4JGYB 1N1SA 3FE5A 5JVVA 1GQGA 1JOJA