2A71A

Crystal structure of emp47p carbohydrate recognition domain (crd), orthorhombic crystal form
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
217
structure length
217
Chain Sequence
KLSSDYSLPDLINTRKVPNNWQTGEQASLEEGRIVLTSNQNSKGSLWLKQGFDLKDSFTMEWTFRSVGYSGQTDGGISFWFVQDSNIPRDKQLYNGPVNYDGLQLLVDNNGPLGPTLRGQLNDGQKPVDKTKIYDQSFASCLMGYQDSSVPSTIRVTYDLEDDNLLKVQVDNKVCFQTRKVRFPSGSYRIGVTAQNGAVNNNAESFEIFKMQFFNGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Emp47p
publication title Structures of the carbohydrate recognition domain of Ca2+-independent cargo receptors Emp46p and Emp47p.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Sugar binding protein
total genus 49
structure length 217
sequence length 217
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03388 Lectin_leg-like Legume-like lectin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2a71A00
2HYKA 3OBTA 2FHRA 1ENQA 3OY8B 4OZXA 3USUB 2GMPA 3AYCA 1GZCA 3IPVA 5L73A 1IS3A 1QOTA 4Q1PA 1DHKB 1DFQA 5IK7A 1MS9A 4RL7A 1YYNA 3UJOA 3FUQA 2JJ6A 2ERFA 2ZZJA 2C9AA 3O5SA 4FPYA 3SNMA 1LU1A 1CR7A 4AVTA 3N7KA 1UN1A 2W68A 5DG1A 1DGLA 3FFZA 2R49A 2E6VA 1NXD1 1SLBA 3HMYA 3M3QA 1QNYA 1AZDA 1VAVA 3O12A 3B3QE 3AYDA 1F9KA 1JHNA 4GXLA 4GWMA 1G9FA 3M3EA 2CWSA 3AK0A 2H0BA 4XTPA 2NN8A 1CPNA 1CJPA 4AGVA 4P14A 4FPJA 3A0NA 4P9WA 4W65A 1A8DA 3VKFC 3WCSA 4M3CF 4FP3A 1LGCA 1N3QA 4JRAA 2ZHMA 2ZGOA 3WG2A 5GLVA 2WJSA 2E51A 3NWKA 5JLVA 3WDUA 4BMEA 1J1TA 3BOPA 5CAZA 4XXAA 4PCRA 4TZDA 4XJUA 5DZEA 1JYCA 1LHOA 1MS4A 5H9RA 1AX1A 2GNTA 4FPLA 1WBLA 2WSUA 3WCRA 1W6QB 2OW4A 2R1BA 4LBQA 1JUIA 2A75A 5IK8A 1FNYA 1O4YA 2D6OX 2ENRA 2P2KA 2VXRA 3AXEA 3R05A 4XDQA 4GKXA 1MZ5A 5GZCA 2ZGNA 3CNAA 1VALA 3H0OA 1N1SA 1GNZA 3GALA 4DRVA 2C5DA 5T5LA 3VKLA 2NMOA 5DXDA 1OQ1A 2R16A 2AH2A 1LOFA 5T5PA 3WV6A 1ULFA 3AYEA 2A6ZA 4YFZA 3DUIA 4AWDA 2WT1A 4XTMA 4AGGA 2ZA9A 1V6LA 2D6PA 3A4UA 3OGGA 4YZ2A 3AYAA 3AZXA 1UL9A 1MVQA 5IUQA 5CA6A 2R0HA 4YM0A 1MZ6A 2ZGQA 3RMYA 1ZM1A 3V0BB 4D69A 1APNA 4WZFA 4GALA 3APBA 4NOTA 2W08A 1WLDA 5T50A 5CB7A 1HLCA 1W6OA 2ZGTA 1DBNA 2A6XA 2B7YA 2NM1A 3WVJA 2RHPA 2DVBA 4HL0A 3PVEA 3WOGA 1W6PB 2ZAAA 1LESA 1LOEA 3O0WA 4NO4A 4BLJA 2D3PA 1DYKA 2ZGRA 4H55A 3LSDA 4FOYA 1IKQA 1UX6A 3RG0A 4LBKA 1GV9A 3BTAA 3ZYPA 2D43A 3WDVA 1W0OA 3ILRA 2R0FA 2GALA 4WVVA 1W6NA 3WG4A 5FRAA 1AX2A 1SLAA 3I8TA 2ZHLA 1QDCA 1SBDA 2GNBA 2EXHA 4XMAA 1SLIA 1R1ZA 3AP5A 3N35A 4XBQA 1I3HA 2DUOA 3IMNA 3T1LA 1WW6A 3PMEA 1RIRA 1LGNA 3M3CA 5JOZA 3AZVA 4YLZA 3RQ0A 3M1HA 1S0EA 3MW2A 3RS6A 1ENRA 1UMZA 3RMXA 2GNMA 3T1MA 4XMIA 1YXWA 4BOWA 4Y1YA 1GANA 2VW1A 3AZZA 2ZGUA 3OPZA 4XBLA 4AVSA 4Y20A 1AVBA 3B69A 2DVGA 4PBOA 1BYHA 3BIWE 3M2MA 3FLRA 1UAIA 3TAYA 5T5OA 1GSLA 1S0BA 3MW3A 1DQ0A 2FMDA 2ZHNA 3AJYA 5EXOA 1N1VA 1DQ4A 2DV9A 3B00A 4ISQA 3WUDA 4DRRA 4JCKA 3WG1A 5E8AA 1MS8A 4DPNA 4MYEA 4XIOA 3SLIA 1S0CA 5KXBA 5IK5A 1Q56A 5F9TA 1ONAA 1KJRA 3VKOA 1DQ6A 4M00A 1AJOA 3SITA 3OYWA 4Y1ZA 2UWCA 3RRDA 1W6MB 4XYXA 2PHUA 1AJKA 1KITA 1MACA 2GN3A 3M3OA 4LBNA 1YRZA 3SH4A 5KXCA 4F83A 1LOGA 1H9PA 2KM2A 2EXKA 3FBYA 3KQRA 3POWA 2DTWA 4ATEA 1BJQA 2BQPA 4LBLA 3AZYA 4FPEA 4ZKTB 4M3CB 4Q1RA 4P9XA 2AYHA 2P37A 4R9DA 1GNHA 5IT6A 2EXJA 1LOAA 1Q8VA 4YW4A 2CNAA 1AXKA 5GLZA 2WT2A 2E7TA 3ZVXA 4XE9A 2D7FA 1HDKA 5JDBA 1KDMA 1LEMA 2PHFA 1Q8SA 5JOXA 2GMEA 3BODA 1WUVA 1Z78A 2A6YA 3IM0A 3OY8A 3WLUA 1W0PA 3USUA 2YMZA 5CNAA 5GJ6A 3AP6A 2GMMA 2OVUA 4FQZA 1G9DA 2ZHKA 4XJAA 3N7JA 1DZQA 3V0AB 4K1YA 2PELA 2A7AA 1LHUA 1V6MA 2XB6C 2EALA 4Q2FA 2GNDA 2NZ9A 4L8QA 3N7LA 3ZSMA 4ATFA 1JYIA 5KXEA 2SLIA 1I1EA 1LULA 3JUUA 4YM3A 4DQAA 4GKYA 2P34A 3DGTA 3AZWA 5FREA 1WD3A 2PHRA 2ZGSA 1B09A 3FLPA 1CESA 3N3HA 3W58A 2A5ZA 4ISRA 4YFWA 2CY6A 2WNEA 1AF9A 1LHWA 1V6OA 3SISA 2V73A 1ULGA 5DUVA 1N3PA 3WZ1A 1X50A 2YXSA 2A3XA 5T55A 5KXDA 1D2SA 2UURA 3JU9A 4R9CA 5GLWA 1TEIA 2UWBA 4PQ9A 1W6QA 1SLTA 1FNZA 5T54A 5DUWA 3HN1A 1S0FA 5EWSA 3ZXKA 1ENSA 1KRIA 3WUCA 1FATA 1FV3A 2D6MA 1LTEA 1GLHA 2ZBJA 3SH3A 1F5FA 3POSA 1GKBA 4XBNA 4M3CE 4XZPA 4WVWA 3ZPYA 1MS0A 1CVNA 4YW1A 2CL2A 4K21A 3W59A 4BPZA 1LOCA 1KDKA 2CWMA 3WDYA 5H9PA 1V6KA 1SLCA 2P3KA 2WT0A 4I30A 4XIKA 2NYYA 3UK9A 3WHUA 4ZXKA 3POYA 1AX0A 1MS1A 1ULEA 1LCLA 1PZ8A 1LGBA 4AYUA 2DURA 4XHBA 2JECA 3V0BA 4YM2A 4XXPA 2P3JA 5T52A 4C1WA 2JD4A 1YIFA 3R4UA 4FPHA 1GYKA 2SBAA 3MEPA 4UW3A 4TYSA 1EPWA 1CIWA 2JDZA 2YZ4A 4LBQD 3GNEA 4R9AA 1W6PA 2ZKNA 2WSVA 4CTEA 4CRQA 2D6NA 2DWRA 1LODA 2A6VA 4C1XA 2DVDA 2D6LX 1LEDA 4Z8BA 1BQPA 4YG0A 4PBPA 3WDXA 3T2TA 1QOSA 3RSJA 1WD4A 1OFSA 1SACA 1WCSA 1SBEA 1LECA 3B01A 3O0XA 4Y1VA 1LOFC 4YM1A 2ARBA 4XJWA 3AP4A 2EAKA 4Y22B 2WKKA 4YZ1A 1XQNA 1Z0HA 3AXDA 1QOOA 1VIWB 1WLCA 3WG3A 2AR6A 4XJZA 1SLLA 4LBOA 1IS4A 4IQPA 4UW5A 3IPVB 1JOJA 3LSEA 1DQ2A 4AVVA 2VH9A 1V6NA 1F31A 1LENA 3PVOA 2ZGMA 2NMNA 5LK5A 3D6EA 4GWNA 5DUXA 3C2UA 5SV8A 3I4IA 1FX5A 1CPMA 1JXNA 1WLWA 1Q8OA 4U36A 3QCWA 3ILNA 4XHXA 3V64A 5GZEA 2OUJA 1SBFA 1FAYA 3ZSKA 2WQZC 1HQWA 1ZA4A 1DLLA 1UZYA 3U4XA 3MPPG 2WLQA 1HQLA 4Y26A 1KJLA 1URXA 2JKBA 1JW6A 4Y1XA 2TEPA 4Y1UA 1N47A 4YGEA 4YGCA 2AUYA 3ZXFA 1SCSA 3N36A 3ASIA 1Q8QA 1A78A 3L2YA 2ZGPA 1SCRA 1G7YA 5GZDA 4YZ5A 1S0DA 1WW5A 1JN2P 1VAMA 2R1DA 2GDFA 5DUUA 2OUHA 1MR5A 1UPSA 1YI7A 2ES3A 2P3IA 2VU9A 1MS5A 2AENA 4K20A 4SLIA 3ZYRA 1W6MA 5BYNA 3ZSLA 3PJQA 2CTVA 4YW2A 1IS5A 1AXZA 5GLUA 2DUQA 4UW4A 2Z42A 5T5JA 3UL2A 3R4SA 4LBQB 2G4IA 4LBMA 4DS0A 3B9CA 5HCBA 2ARXA 1PZ9A 4FPFA 1RITA 2GN7A 3ILFA 4K1ZA 2EIGA 4M3CA 5JVVA 4FPOB 3ENRA 3IKWA 4YZ4A 5GM0A 5EYYA 1N1YA 3LCPA 1U0AA 1DIWA 2YROA 3N7MA 1JBCA 5GZFA 2D3SA 1HKDA 5AVAA 4BLIA 2PHXA 4FPGA 2LALA 2ZACA 2DU0A 4FPCA 1BKZA 1S0IA 1BXHA 1QGLA 2LTNA 3OJBA 1UKGA 1DQ1A 1WBFA 3AFKA 1QU0A 1V00A 3O0VA 5EYXA 3VKMA 4BQ1A 3V0AA 3WDTA 1W6OB 2E53A 1QDOA 5E89A 3NV4A 4DFSA 1VLNA 1G9BA 1D0HA 2A71A 4HANA 2ZGLA 3TB0A 1FYUA 4Q8KA 5JOWA 1S0GA 2ZGKA 4U2AA 1S0JA 5HCAA 3D5OA 1CQ9A 3INAA 1H9WA 4GA9A 3VUOA 2E7QA 1C1LA 2A70A 1LU2A 1GZWB 1ULCA 4YGBA 4FPKA 2V5YA 3IN9A 1W6NB 3SH5A 5DZFA 4CZSA 5JMCA 1MS3A 5E88A 4YW5A 5GALA 1IOAA 3KM5A 4YG6A 1OKQA 2D3RA 3ZXLA 5IK4A 4Q8LA 4FOVA 3VV1A 4FOQA 1FV2A 4XILA 1N1TA 1LJ7A 3ZXJA 5H9SA 3V65A 2VUAA 4LBJA 1G9AA 1N3OA 2PHTA 2ZMNA 3NV1A 1AXYA 3NV2A 4FP2A 4PF5A 2W39A 1YO8A 2D44A 2AREA 4FQ4A 1SFYA 3AJZA 3FLTA 1LOBA 1Y7BA 1GBGA 5GLTA 3WHTA 1MVEA 2VW0A 4Y20B 2DVFA 1IS6A 2YV8A 3MW4A 3AX4A 4JC1A 1QMJA 3ATGA 4YG3A 2Q5TA 1RINA 1GZWA 4XJ8A 1PZ7A 4ASMB 2DTYA 2XG3A 4M01A 4Q26A 2A3YA 3QLQA 2VW2A 2EXIA 1WW4A 4XJ9A 3HR9A 1QKQA 5H9QA 2UWAA 2ZABA 3WDWA 3Q9OA 1C4RA 1CONA 2ZMLA 3ZXEA 2W52A 5GZGA 3A0KA 3AP9A 2JE7A 4YGDA 1WW7A 3WNXA 2EF6A 4FOWA 4FVVA 5CBLA 2NP0A 3OYWB 2UU8A 1DYPA 5HCFA 5JOYA 1ULDA 4Q27A 4YW3A 1LHNA 1G9CA 5DZGA 1G8WA 1A3KA 3AP7A 2I2SA 1QF3A 3VKNA 2AGSA 1UZZA 4RA0A 4XOGA 4WV8A 2VY0A 1CN1A 1V6IA 2DUPA 1G86A 1GICA 1KQRA 1LHVA 1DQ5A 1IKPA 1C1FA 3PVNA 4P9YA 1O4ZA 2DU1A 2PHWA 1Q8PA 3D4KA 3NV3A 4R9BA 1BZWA 4UW6A 4Y24A 3ZSJA 3OBRA 1H30A 2JE9A 4ITCA 2ZMKA 1V6JA 3UJQA 1NLSA 1C57A 1QNWA 4AGRA 2D6KA 2A6WA 2CYFA 4BMBA 2A3WA 4YZ3A 4BM8A 1S1AA 3FUOA 2DYCA 2DVAA 4KBBA 5DG2A 2YY1A 5F5QA 4Y22A 1GZ9A
chains in the Genus database with same CATH superfamily
2ZTNA 3WF2A 1GOGA 5ACA3 4KQ7A 2PHDA 5KWRA 2E26A 2XJUA 2GMPA 3DF0A 3S7EA 1W8ZA 5F2WA 1QJX1 3ZFGC 4LK6A 5LY2A 1F15A 5IK7A 4DXTA 1YYNA 3FUQA 2HWB3 5JXGA 2VZOA 1CGPA 4IDZA 5B2GB 3O5SA 1UYZA 3SNMA 5ABJA 5A3OA 4AVTA 1VBB1 2IFWA 4EQVA 2RS12 3RZMA 2BBAA 1F4AA 3N7KA 3ZMOA 3KT7A 2W68A 2P1BA 1TME2 1DGLA 2V5DA 3FL7A 2YG0A 3FFZA 3HMYA 4JDMA 4GJZA 5LZ6A 1AZDA 1JU4A 1CZTA 4AK3A 2VZVA 3ZXAC 4GWMA 2WQ8A 5IVFA 3VZKA 2CWSA 1DDLA 1V9U3 3AK0A 2NN8A 5BV6A 4OQ9A 4P02B 1CJPA 1RMU2 4AGVA 1HV0A 1RGSA 4FPJA 4W65A 5I0TA 3VKFC 5FBJA 4M3CF 4NR1A 1RVF2 1LGCA 1N3QA 4AQSA 3WG2A 3NJVA 4COWA 1R1A2 3WDUA 5T3NA 2OX0A 3BOPA 4UF0B 4M4PA 4E4DX 4H3WA 4PCRA 1AR91 5DZEA 4RS5B 1JYCA 1UO9A 4GD4A 3CIHA 1JHJA 2OW4A 1OD3A 3KVAA 4LBQA 4I2OA 1RUC1 2CDOA 1O4YA 1KXGA 1PO12 3IWZA 5GZCA 4SBVA 4MOAA 1VBD2 1RC6A 2IVJA 1GNZA 3B02A 3GALA 4DEVA 4DRVA 3O1VA 1FPN1 1OA3A 4RN5A 4PT6A 3VKLA 1B35A 5FZCA 3KSCA 1YFUA 2R16A 4META 1UOBA 2XKPA 3VL8A 4L99A 4CU9A 3AYEA 2ZA9A 3D3AA 1V6LA 2D6PA 4ZY9A 3RNSA 3DYMA 1MVQA 5KHJA 4GB32 5CA6A 1EUUA 1BBT1 2RDSA 4YM0A 4BQ4A 1J3QA 1H6XA 1Y43B 2YU2A 2ZGQA 4CCEA 4D69A 1APNA 3Q8BA 2W08A 3FHAA 4TWTA 4AE2A 3AL5A 1W06A 2GAUA 2RR11 4UI9L 3KF3A 1DBNA 3FBMA 1X8EA 1W0NA 2W3JA 4GMP1 2D5FA 1ULPA 2DVBA 2QJVA 3K4ZA 4JTNA 4B1MA 1ZZ7A 3PVEA 2XQXA 2RS32 3WOGA 1IG3A 4D7SA 3MO4A 1YJKA 4E8DA 1LOEA 4CP0A 4NO4A 2JWPA 3C7OA 2D3PA 3VDDB 3T3YA 3VZMA 3T2PA 5A32A 4H55A 4NAOA 2VMGA 5FFOC 1VBB2 3E5UA 4LBKA 2D43A 1JZ4A 2H6CA 3EB7A 3ILRA 3MIDA 4WM8C 4N9HA 4R8HA 2GALA 3WG4A 3HEIA 3LGRA 4DY5A 1AL0G 5J37A 2WNUB 1OQDA 4B4QA 1YC61 1R1ZA 1PGSA 1FT9A 5FOJB 4XBQA 2QTWB 4MGZE 3T1LA 2ILMA 3MZHA 2RV9A 4W4ZA 5HCHA 1OLQA 3KGZA 4N43C 3M3CA 5JOZA 1TZOA 2CHHA 4NVPA 1S0EA 3MW2A 2VUDA 2MHFA 4OHVA 3T1MA 3C3VA 1ASJ2 4XMIA 1YXWA 4BOWA 4FBFA 3IIIA 1RHI3 2W1QA 4GZ9A 3ZFEA 4BZ4A 2IWGB 2JDPA 3GCXA 4Q0UA 2HWD1 4TSVA 4IEQA 5FYMA 4Y4RA 2Q8EA 4FTEA 1RUC2 1T6BX 2B45X 4PBOA 1BYHA 2VXJA 2WWSA 4IGOA 2TNFA 4A2UA 5C7GA 2W94A 4QB6A 1UZVA 1CAXA 4BWOA 4HOOA 4E8CA 4XF0A 1S0BA 3SKVA 4HVOA 2YBSA 1N1VA 4UWDA 5A7WB 3ZX7A 4QPGB 3FHIB 3WG1A 2Q1MA 3MIGA 5E8AA 2VMDA 1POQA 1V0AA 3I7DA 4CDUC 5IK5A 2YPDA 3PUHA 5F9TA 5D8AC 2QQWA 1PM4A 3OYWA 4Y1ZA 3OEAA 1BBT2 3K3NA 1W6MB 3H7YA 2PHUA 2RMU3 1MACA 3MV11 2YHJA 5KXCA 3H8RA 4E4HA 4QPIB 1RB8G 4AF9A 2B4KA 3HT1A 1GP4A 2KM2A 2RR12 3EMRA 3HPNA 3ZN6A 1RUH3 3KQRA 3AM2A 2VL4A 4ATEA 1BJQA 2VO5A 4BQ5A 5L7OB 3T2OA 3AZYA 4FPEA 1D4M3 4Q1RA 4ZKTB 5DAXA 3KV4A 3A21A 1NCQB 2EXJA 3WW3A 1PK6A 4NJ4A 5GLZA 5LA9A 1BK1A 4DO0A 3BIEA 4JQTA 4IEPA 1ZZCA 2NLRA 2VMFA 4RR3B 3E5XA 1NG0A 5JOXA 3BODA 3ABZA 1HRV1 4JKLA 2VULA 1UCXA 2HWC1 3EBRA 3MLKA 1OOPC 1WUVA 1UU5A 1NT0A 5J36A 2YMZA 2VQ0A 3MLJA 4ZPIA 3ZYJB 4A45A 1BVP1 1GMMA 2VQTA 2XHKA 1VMFA 2PELA 4FXGB 1SMVA 1LHUA 1HRI2 4Q2FA 2BJSA 3WNLA 5LBCA 3BN6A 1JYIA 4N7UA 1O7FA 1O5UA 4QX8A 3UGHA 3DGTA 3AZWA 4NRMA 5FREA 2FZ2A 1H8TC 4I0WB 3FLPA 4EN0A 1RXGA 3KT4A 1O8PA 3LD8A 2PQSA 4NIIA 3LFMA 5FUNA 3W9AA 5M0TA 4MV2A 3W58A 1YUDA 3FE5A 3T2QA 1O3RA 3VZJA 2E31A 3B94A 4YFWA 3UV9A 2CY6A 5JIUA 5B4NA 1XU1A 3ES1A 1XE7A 3ZLIA 1LHWA 1V6OA 3DKWA 4E2QA 2V73A 1ULGA 5DUVA 1N3PA 1QXJA 1W28A 3N4MA 3GJAA 4YVSB 4HLTA 2YXSA 3LOIA 3NKTA 5T55A 1QH6A 3NVCA 3JU9A 4R9CA 4YYOA 1TEIA 1K12A 2RM23 4Z07A 5A7OA 3BPSA 1T6GC 1W6QA 4CDXB 1POV0 5T54A 2BVBA 3CJIA 5JSPA 2G9GA 5DUWA 1S0FA 4UFHA 2PMWB 1WMEA 5CYYA 1ENSA 5C9AC 4LO6B 5FYTA 2R063 5FXWA 5JI7A 5L9VA 1GKBA 2O0OA 4P9IA 5IHRA 1QJFA 3BU0A 1WLTA 1UZWA 1CVNA 4K7JA 3VHPA 1LNSA 4BPZA 1CX1A 4JKMA 1E5RA 1GOHA 4IV3B 1LOCA 1KDKA 1NQJA 4QDRA 3WDYA 3TEWA 1R091 1HXS3 1VPHA 1W2NA 2P3KA 2WT0A 3VBFC 5EHDA 1IQAA 2OXBA 4ZXKA 3POYA 1AX0A 4RQPC 2MPFA 4XHBA 1ZBA3 3E6BA 3V0BA 2OKXA 3JQXA 1HRV2 4ZU4A 4QGMA 2HWC2 4MGKE 4Q0QA 3AVSA 1YIFA 3R4UA 4FPHA 4HT1T 3WNMA 4CXXA 5A6XA 2DFBA 3DECA 4FSJA 4AHYA 4UW3A 4NPRA 2YZ4A 2J1VA 3KZ4C 1JOPA 1VB2A 4A41A 2FD8A 3NMBA 3GNEA 4R9AA 5EIYB 2ZKNA 2WNOA 3PVBB 4HKOA 1O3SA 3HIFA 4CTEA 2OQ7A 2YFUA 5FV3A 1EAH3 5IVVA 3ZDSA 4AVAA 4C1XA 4PDWB 4Z8BA 5CFDC 1BQPA 4MADA 5FJHA 4DEQA 4FTSA 4OUMA 2PXJA 4BCUA 2ZX4A 3OUHA 1WD4A 1JZ6A 2JDAA 1EP0A 2WS91 1PMIA 1JTZX 5C3PA 4D8MA 3ES4A 3K4AA 5BNPB 4LORA 2Z4FA 4KU8A 4B7EA 4EROA 2YB7A 2WKKA 1RUE3 1UY3A 1VIWB 1WLCA 3HQUA 4LITA 5FZGA 3KB5A 4LHLA 1IS4A 5AC93 3IDCB 4RFT0 4XF1A 4UW5A 1Q5OA 1W9FA 3LSEA 3U75A 1WGPA 3QOPA 4ORFA 1VB4A 4AVVA 4AZZA 1F31A 3JB8A 2ZGMA 4Q4X1 3ZXDA 3D6EA 1IPJA 1Q43A 2ET1A 1JXNA 4LOSA 2CGPA 1AHSA 4CCMA 1NE6A 4CEYB 2JKXA 3CU7A 2QZ2A 4XHXA 4AEJA 3I2KA 4QXKA 3IDBB 1W90A 2YBKA 1RL3A 3JBG3 4RFRB 1VBA1 3O7OA 3C7EA 1DLLA 1UZYA 4A3ZA 5FP3A 3MPPG 4Q0PA 1HQLA 5F2SA 5EJ3A 2JKBA 1UQXA 2W5FA 4IEZA 4M0HA 2EICA 1J58A 2TEPA 1C5IA 4Y1UA 1AL23 4YGCA 4YGEA 3SMHA 3ZXFA 3ACLA 5LY1A 3PMSA 1Q8QA 1SG3A 4JRLA 1SCRA 3MIBA 3POEA 4CP1A 3NAPC 1NA1A 1WW5A 3BTYA 1JN2P 2R1DA 1K5JA 1LRHA 2GDFA 2QQLA 1MR5A 4K20A 4QDSA 2P3IA 2GH2A 4XJ8A 1MS5A 5FPAA 3ZYIB 2VD7A 3GZTB 4KNCA 4FAGA 5BYNA 2WABA 3NNJA 2RS51 1OD5A 3MGUA 3AMHA 5C8WA 1RUG1 1W9YA 1OLRA 1K42A 1QQP3 1RITA 4DPNA 5JVVA 3OUIA 1E5SA 1OFNA 5HBAA 2EIDA 5I0RA 2AEZA 2R6QA 4WM8A 5E1RA 1JH5A 4Q4Y1 1DIWA 4XFIA 4CDWC 1CJDA 4LK7A 3N7MA 3OD4A 2J1UA 1JBCA 3E5QA 5GZFA 4AR2A 4I09A 3PIJA 2QQKA 1WWYA 4EJRA 3MFCA 2WNUC 1IQDC 2ZACA 3N9PA 2WS92 4RHV1 4QWNA 4XC9A 2VZUA 4N43A 2VGDA 1WMDA 4XUOA 2JDKA 3PL0A 1VBE1 2LTNA 4LE3A 3LF7A 3O0VA 4BQ1A 2EAAA 4XCAA 5FUIA 3NV4A 2JDMA 3H1MA 3CLPA 1O59A 3TB0A 5JMOA 4PHZA 4Y5Z0 1FYUA 1CAUB 1W99A 4NHLA 4QGNA 4W6YA 5DDJ3 2VJXA 3SQOA 3HOBA 2CGOA 4DOUA 5GKAC 5JOWA 2VM9A 1S0JA 1PO21 4R4XA 4YWAA 3JD71 4PIZA 1H9WA 2V72A 1AR81 4GA9A 3H8UA 2E7QA 2A70A 4LLFA 4MSVA 4YGBA 1GZWB 5CIRA 2J1RA 1ALYA 2V5YA 5C33A 4QKDA 1W6NB 4UFLA 3SH5A 5DZFA 4CZSA 1MS3A 4CDUA 2RVAA 1KEXA 1S55A 1OUXA 3R0RA 5KC5A 1IOAA 5A7NA 3UETA 1UKRA 4FOVA 3VV1A 4IETA 2GH8A 3RYPA 3WNOA 1H2KA 4MGIE 2ZMNA 3NV1A 3NV2A 2W39A 1YO8A 1WMFA 4QPIC 5CISA 4QQOA 3FJSA 3DKQA 4GH4B 4YVWB 1AR71 3FN9A 5F39A 5FQ0B 4D3WA 2RS52 5F6KA 3PURA 3MW4A 1UU6A 2YV8A 4EWEA 4WVMA 5JUVA 4LO4B 4YG3A 2Q5TA 1Q3EA 4NUBA 2XG3A 1OLME 1RUF3 3LKJA 2O8QA 4PIYA 3QACA 4D94A 1M4WA 2EXIA 3U10A 1XB9A 2XJPA 4GJYA 3GHNA 5C3SA 1KFUL 1VR3A 2HEWF 2ZABA 4AI0A 3Q9OA 2CV6A 4Q4Y2 3UGFA 1C4RA 1CONA 3D82A 2Q1FA 3ZXEA 1HJGA 1O4TA 1MQTC 3F95A 5FLIA 3WNXA 3FZ3A 4LIVA 3OGSA 1XOYA 3MI8A 5CBLA 1QJU3 4Y4YA 3JQWA 4BQWA 2UU8A 1FOD3 4AXOA 4W50A 1LHNA 3WSOA 1FI2A 2XLAA 3LE0A 1OT5A 5DZGA 1VBE2 3CF6E 2GC0A 5BNQA 2V4VA 2W9XA 1A3KA 3AP7A 5LRRA 3CKHA 1R081 4AEDB 2AGSA 3DPRB 3H50A 2OQ6A 3LPGA 4RA0A 3OB8A 1IGOA 1CN1A 1V6IA 4AQ6A 2DUPA 5C8CB 1K5MA 1LHVA 1H8TA 2DCKA 2WN3A 1C1FA 4P9YA 1A6CA 1O4ZA 2AC1A 2DU1A 3P5BA 3ZFFB 3OBRA 1H30A 3MF6A 4XACA 1R64A 5I0DA 1V6JA 4TN7A 1PO22 2Y0OA 1IPSA 1JUHA 3UJQA 2JX9A 1C57A 3JD72 1AR82 2PYTA 2A6WA 2CYFA 2QCSB 5BNNA 1VBC1 1D4VB 2XHNA 4MXWB 2DYCA 3NW4A 3NL1A 3WINE 5K9YA 1NE4A 5CKQA 4A44A 3V64A 5EJ1B 3FC0A 4P00B 4PLOA 3TEYA 1ENQA 1DG6A 1VE0A 5IWFA 5C5TA 4COYA 1GZCA 4QX3A 3AMNA 4YVSC 5L73A 1IS3A 1QOTA 2VQAA 3KCCA 3WP5A 1DHKB 3O1RA 2BOIA 1MS9A 4RL7A 5J09A 3VB9A 5C9AA 4S2FA 4XFAA 2ZZJA 4JGYB 4COUA 4KWLA 1CR7A 3RWNA 1WZXA 2A73B 1REDA 1UN1A 1TMF3 4QHBA 4R9DA 1WCUA 2E6VA 1SLBA 4LA2A 3M3QA 5FP9A 3NQHA 1VMHA 1AYN3 1RUJ1 3ZMNA 4DY3A 1G9FA 5CZKA 3SHRA 1ZRFA 2Y6KA 4YPJA 3HBZA 4IV3C 3VBFA 4P14A 3BVCA 4P9WA 1A8DA 4RQPA 3WCSA 5EPAA 2WRAA 4Q29A 4JRAA 1XNTA 3WF4A 3PU3A 2WJSA 1RUI1 1L3JA 5GLVA 5FBZA 4J1WA 3U11A 4QHOA 3VBSC 4AW7A 4BMEA 2ZCWA 4TZDA 2VMHA 3QH7A 4I3PA 4XDOA 2R041 1NYWA 5H9RA 2VBBA 4XDPA 4JTOA 1D4M2 5IK8A 5A6ZA 3S30A 1UY0A 2A75A 3DYOA 2P2KA 3R05A 4AFDA 4GKXA 5I8YA 2EA7A 5HXMA 2W1WA 2VOTA 3CNAA 3TN91 5C71A 5JZGB 5CFDA 1NQDA 3H7JA 5I8SA 2WYFA 4ZS3A 2WC2A 4BQ2A 2XLFA 2NMOA 1R082 2XJTA 2NQYA 3W5MA 2VUCA 4Z2AA 1S2EA 5L36A 1AR61 3K75B 2A6ZA 1KFXL 3DUIA 4AWDA 1XU2A 2JDNA 1Y3TA 4A4AA 1ND3A 3OOXA 3VBOB 3AYAA 3AZXA 4CUCA 5G05L 3AL6A 3O1MA 2R0HA 1HB1A 2RDNA 1BK0A 2Q0AA 4KWJA 5IJRA 3NJYA 5FWJA 5A3LA 3CBNA 4GALA 1VBC2 4CPBA 4IEYA 3THDA 1UMIA 4E4SA 4HMZA 4A42A 3VDCA 1W6OA 5FMOL 4AI2A 4URTA 2B7YA 2NM1A 2UY8A 3WVJA 3J8F1 4RSUA 4GULA 4B4PA 1TME1 1YFWA 5F3CA 4BLJA 5E6HA 1YJLA 2JDUA 2PQQA 5L9RA 4IEVA 2XJQA 4EYUA 4FOYA 1IKQA 1JZ3A 1JZ7A 4X8NA 3RZZA 2J1TA 4BIFA 4HN1A 5LB6A 3KGLA 3VD4A 1W0OA 2R0FA 3FFQA 3AKRA 1W05A 3KV6A 2WN2A 1RVF1 5EQUA 1SLAA 3NAPA 5FRAA 1WMXA 3TBDA 4FI9A 4BH9A 5FYUA 2GNBA 2EXHA 3OEBA 4XMAA 3NJZA 3OCPA 2WNVA 5J1XA 3WR0A 4Q4V3 3J7MA 4D7TA 4QAWA 3N35A 2RM22 2DUOA 1NUKA 4XAEA 4LT5A 3NRUA 1RIRA 1SPPB 4QD2A 1LGNA 1EYBA 3D0JA 1RUI2 1COV1 3AZVA 4YLZA 3RQ0A 4LIUA 4DB5A 1W2UA 1ENRA 3J7NA 3D0SA 1BEV3 2R042 2X8KA 1VBD1 2WQ4A 2ZPXA 2WFF1 2VW1A 1PHMA 2ZGUA 1NKGA 2XKOA 4Y20A 1C3HA 1F5JA 1H1MA 3P3NA 3B69A 4DINB 2JG9B 4CVUA 4CDWA 4KI5M 1W9TA 5C4WB 2XGXA 3KD4A 2R7EB 3BIWE 3I59A 1HXS2 2A1XA 3FLRA 3K3OA 3M2MA 3M8LA 1UAIA 5LASA 5CG8A 3TAYA 1FXZA 1IG0A 3HQXA 5T5OA 3ZN5A 1MZFA 4XURA 5EXOA 1TNFA 2DV9A 4D7YA 4C8DA 1CAWB 4NN0A 1HB3A 1VRH3 4JCKA 5C3OA 1UYYA 4QXHA 1AR62 5FMDA 2LRPA 3SLIA 2YUEA 3R4DB 1S0CA 3HBKA 3VBHA 5KXBA 4RD7A 1KJRA 1DQ6A 4MG2A 2UWCA 4NWVA 3ZPOA 2ZS6B 1OPMA 5FYVA 1KITA 2GN3A 3M3OA 1KGYA 4LKFA 3SH4A 2RS31 5A33A 1CD3G 1FMD3 4C90A 1LOGA 1H9PA 1H1AA 4P9JA 1W3XA 4B3NA 5BNOC 3UNPA 2O14A 1RUNA 3FBYA 2VZTA 1F8VA 2JG8C 3J8F2 1XC6A 1HX6A 4NRQA 3LOBA 1DGRN 4P9XA 1O91A 2AYHA 1GNHA 3KS7A 1LOAA 4YW4A 3I49A 3W5NA 2E7TA 3ZVXA 2ADEA 4XE9A 2D7FA 1HDKA 4XCBA 1LEMA 2OPKA 3P1IA 3K77A 4OI1A 4QQLA 2GMEA 3N9MA 2WZR2 5AC92 2H0VA 3BGAA 1Z78A 1W8NA 3OY8A 4WM7B 3USUA 5A3WA 2X05A 3AP6A 4FQZA 4JX0A 2ZHKA 3PLQA 3R6SA 2P3YA 4QPIA 4MHRA 4PJYA 1YQ8A 4XEZA 3LDBA 2TUNA 1ASJ1 1HJFA 4MHUA 2A7AA 3JBG2 1V6MA 2XB6C 4GH4C 1COV2 4QHZA 5FY0A 3WEZA 2GNDA 2NZ9A 5A6QA 3N7LA 4NIAA 3ZSMA 5KR7A 3LPFA 2SLIA 4YW6A 4Q4X3 4YM3A 2XOMA 5LK7B 4GKYA 2XDVA 2KXLA 3RVHA 2WFF2 3LEGA 5C3QA 1HQNA 4HPKB 3VDAA 5F6LB 2ZGSA 1B09A 1CESA 2VBDA 4UFIA 5JR7B 1UMHA 4A7ZA 4N9IA 3N3HA 2CGNA 3RI8A 3AVRA 3T30A 1MQTA 1OKOA 2WWJA 1J1LA 4XFHA 2VZRA 1K45A 4EWDA 3OPWA 2VPVA 3KV5A 1SDWA 1E57A 4UFMA 3SISA 3TYJA 3VD3A 3OD0A 3ZDVA 3WZ1A 3PIGA 4JGZC 2VNOA 4KMQA 3ITQA 1GWMA 3U0ZA 1D2SA 1QQP2 4S2HA 4BK4A 2UWBA 1FNZA 4B1LA 3HN1A 1KRIA 3UKTA 5A3MA 1FV3A 2D6MA 4Z1VA 1STMA 2P6HA 3GBGA 1PIV3 1RUG3 3GYDA 4XBNA 1YHFA 4M3CE 1XNCA 3URFA 4CEWB 4CU6A 3ME2A 2C4XA 4XFFA 4YW1A 1HW5A 3CZJA 4CXYA 4GWIA 3WP3A 2Q4SA 2ZKLA 4JHZA 3IAPA 4I30A 1YWKA 3WHUA 2NYYA 2B9VA 2FCUA 3DXUA 2RJKA 3G7DA 3G6JB 2ORXA 4KWKA 2P3JA 1NCRB 4C1WA 2JD4A 5FPBA 4XFGA 1GYKA 1UYXA 2SBAA 2X5IB 2FDKA 1YEWA 3MEPA 2J42A 4X6QB 3VZOA 4OUSA 5AFEA 1HRI1 4TYSA 1EPWA 1CIWA 2JDZA 4LBQD 5FZDA 4AAXA 4DNYA 5KBFA 1W6PA 2Z2SB 2ZEYA 2WSVA 3QBQA 4K9SA 4OCTA 1AYM2 3B9IA 5LA2A 5I91A 2D6NA 2DWRA 1LODA 1C28A 4FO9A 1W8FA 3OGJA 4GQ7A 2DCYA 4O9EA 4OI0A 3PDQA 3VBRB 4G4FA 5K0UB 2VTFA 4PBPA 4YG0A 1Z7S3 3GBFA 3T2TA 1OFSA 1GWKA 1SACA 1W2OA 1WCSA 2QFEA 4YARA 4K8RB 1QHDA 4S2GA 4YM1A 2UYBA 5F5AA 2MEV1 4LXLA 1DZTA 3VBSA 2EAKA 1X9PA 1CWPA 3MICA 1QXRA 3MBWA 1Z0HA 3AXDA 4E27A 1QOOA 1OURA 1ZZ8A 2AR6A 1SLLA 2HWF1 3POBA 2Y60A 4HG6B 5J96B 1JOJA 3CZUA 5FY7A 1DQ2A 4QT6A 2D5HA 4AI8A 5LK5A 2MNGA 3S5QA 4GWNA 2D98A 3I4IA 1FX5A 1CPMA 1QH7A 2ETEA 1WLWA 1RUF2 3IZOA 4HKLA 4UYBA 5FZKA 3VDBA 1NLRA 3ILNA 4E4ZA 4ZU7A 3ZSKA 5FZ1A 2IXKA 5LWBA 4OI2A 3U4XA 4IEWA 5EJZB 2PLV1 1URXA 2Q1ZB 2QQNA 2JEMA 1ND2C 1E5IA 3WNPA 2XL9A 1PVC2 4OFGA 3VBOC 1YCIA 2XUMA 4UXAA 3VBUA 4CCDA 3SCHA 1FOD2 1SHWB 2W1SA 1S0DA 2VVEA 5JI9A 1VAMA 5G04L 5KXEA 1UPSA 1YI7A 2VU9A 4TTGA 2ZZQA 3VGIA 2XBO3 3ZSLA 3OUJA 2CTVA 3A23A 4B7KA 2CAVA 1IZ3A 1AXZA 4CU8A 3E6CC 1CZVA 3KCXA 3IDEA 4QXCA 4TXWA 4BE3A 5AFBA 3LDRA 4LNVA 3R4SA 4LBQB 2GZWA 4DS0A 2YPJA 2ZEZA 4LO5B 3AKQA 5C5UA 1EY2A 2WO3A 2DCZA 4HXCA 2GN7A 1ZYBA 4K1ZA 4LKEA 4LR4A 4M3CA 4X8PA 4I0AA 2R071 5GM0A 1HN0A 2DCTA 1B35B 2RE9A 3LCPA 4LHNA 4KGQA 3C7HA 5JWPA 5FKBA 5BUVA 1U5XA 2V09A 4WZCA 4B4RA 4RGAA 3B5LB 4BLIA 4AVBA 2LALA 3DXTA 1MEC2 2WUHA 5FY4A 2DU0A 5A7PA 4AFAA 4E2SA 2IXJA 4CCLA 1OMIA 1REEA 2MEV2 1S0IA 1BXHA 2PN5A 4NROA 4WVZA 4CCOA 1UWWA 5A7SA 3AFKA 1QU0A 1LR5A 2BZDA 3V0AA 3WDTA 1QJY2 2E53A 1X36A 3TEXA 5E89A 4CCNA 4CP9A 1PX3A 2WAOA 4LULA 2HWF2 1D0HA 1H4GA 4Q4W1 1OHFA 1AYN2 1XNBA 2XWJB 2ZGLA 4NMIA 1WA6X 2G9FA 2E33A 2FDJA 2ZGKA 2HWE3 2EVXA 3J7LA 5A32B 3WQBA 3D5OA 5I93A 5C4WC 3INAA 2IVIB 3S0MA 4IERA 3VUOA 3OF1A 1C1LA 1CIYA 1RTVA 1OC1A 2J22A 3USSA 5LATA 3SEEA 3MYXA 4EZ4A 4OHXA 4XFCA 4P9GA 1JS9A 1EV13 4IEUA 2VR4A 2CAUA 2PLV2 3IMMA 4QQ2A 5E88A 5I0UA 5CFCC 5A3UA 1UOFA 2Y6GA 2D3RA 3KQ4B 3ZXLA 4EWAA 5IK4A 5IYYA 2KA3A 5CG9A 4FOQA 4IE7A 4XILA 3B7MA 2WL1A 4QMAA 1LJ7A 2PA7A 5DAWA 5DG2A 2GU9A 1C8M3 2WR9A 3MIFA 4LBJA 2N7GA 4OHWA 3VN4A 3ZFGA 1N3OA 4C91A 5BNOA 5DPNA 1OH4A 2E7AA 2AREA 2JG8A 1Y9MA 3FMGA 4LHSA 5FZ6A 1LOBA 3I3QA 2YFZA 5GLTA 3WHTA 3ZFEB 2VW0A 4XF9A 1TNRA 2VCMA 2FDGA 4UFKA 3ATGA 4ASMB 1OA2A 1GZWA 2QNKA 1PZ7A 1TQ5A 2DTYA 1XRUA 2JB4A 2YBPA 3HT2A 5FZOA 1SZBA 4O7XA 4Q26A 4UAPA 2A3YA 5ACA1 2VW2A 3OSDA 1WW4A 3AMPA 2R072 3HR9A 4P5YA 4XJ9A 4XQWA 3SC7X 3TWIA 3WF0A 4Y3OA 3C7FA 1DGRA 1WKYA 5IVYA 2ZMLA 3AB0A 5FPXA 4D6SA 3CDZB 1RUD3 2HWB1 3A0KA 5BXXA 3E6DA 1WW7A 4LMFA 1J83A 1XXNA 1ZBE3 2EF6A 4FOWA 4FVVA 1JYNA 2NP0A 3NNFA 3OYWB 1O8SA 4KG0A 3RZHA 5HCFA 1HN1A 3NSTA 2PFWA 4RS5C 4NAMA 1DYOA 4UT5A 3U1XA 1V9U1 1QF3A 1QXPA 2JIGA 3ZN6B 2BOJA 4QB2A 4KG8A 3I2HA 1G86A 1DQ5A 2RS13 3AKTA 3PVNA 2H6BA 4K8FA 4MO3M 4N53B 4Q4W2 1Q8PA 3D4KA 4UW6A 1BZWA 1PK6B 3FX3A 2JE9A 4ITCA 4WBBA 2IXCA 4N7IA 4Q4V2 3BKZA 4QGLA 1QNWA 4AGRA 2RDRA 4BMBA 2A3WA 1D7PM 2RDQA 1S1AA 3FUOA 3I2JA 1RMU3 2DVAA 3N9LA 2CDPA 2BYVE 4Y22A 1GZ9A 2HYKA 2ZEWA 4JGZA 3MPBA 3OBTA 2FHRA 1RVF3 4OZXA 1UIJA 3UESA 3V56A 5K7PA 3PUAA 2ZJCA 3AYCA 3I54A 1R1A3 4YNIA 3IPVA 4Q1PA 5ISLA 1DFQA 2WAAA 5FZ4A 3UJOA 5FPLA 4AG4A 4BDVB 3WY6A 5A1AA 5FMBA 3CMGA 1F4HA 2W0XA 4CUGA 1PMJX 3NJXA 3TNPB 1PO13 4JC1A 3BALA 1NXD1 5EV7A 4J25A 4GXLA 1VAVA 4INDA 4BB3A 3BTZA 3B3QE 1TE1B 3AYDA 1JHNA 1U5IA 3VDDC 4ASLA 1E5HA 3LQCA 4EN7B 1H1IA 4XTPA 2H0BA 1JZ2A 5FK7A 4LKDA 3WT3A 2VCCA 1JYWA 5FY1A 4DMIA 4FP3A 5ACA2 3I3MA 1I5ZA 5IW0A 2ZHMA 3ACGA 5FO7B 5FY9A 3S57A 2E51A 5JLVA 2BNOA 4GB33 1J1TA 1W8TA 4XXAA 3BOWA 4XJUA 4URAA 1DZRA 1CZSA 2HWB2 3J4UH 2BEOA 1WA4A 2OA2A 1XJAA 1MS4A 4W8JA 3C8XA 1AX1A 2C6SA 2ADDA 4IW3A 2GNTA 4KWUA 3WCRA 2VVDA 2WSUA 1W6QB 2PTMA 4FTBA 1W8WA 1FNYA 3CJIB 3AXEA 4OQ8A 1OXCA 2VVFA 4NHYA 1MZ5A 3QD6A 4XDQA 2ZGNA 4Q0SA 1QJX3 3H0OA 5L19A 4JVAA 3EYPA 2ZX1A 5IVCA 2W46A 1V9U2 4IV1B 2AH2A 3C7GA 3ETPA 4C0HA 1VBB3 1ULFA 4YFZA 1YLLA 4CYDA 4HK8A 4AGGA 1LKNA 3OGGA 2GC3A 4XABA 3CL1A 3RZJA 4P08A 3WNNA 4OMDA 4QPGC 2BTVC 5D8AA 3RMYA 1NZIA 3V0BB 4WZFA 1GUIA 5DN2A 1JI6A 4XW3A 3APBA 2KR2A 4NOTA 2JDHA 1WLDA 5K8SA 5T50A 2QDRA 3MUY1 5CB7A 2ZGTA 4QDQA 2Y8KA 2A6XA 2RHPA 3P3PA 2J7MA 2ZAAA 5ABJC 1LESA 3O0WA 1AR93 1DYKA 2ZGRA 3POIA 5L9BA 1PNFA 2OIIA 4XUQA 3RG0A 5L7OC 3POJA 3I3EA 5FP8A 4MGTA 1ND2A 3BTAA 4EN6B 1RUC3 2IC1A 1NCQC 1SFNA 3VBOA 4XFBA 1P8JA 4COVA 2BFUL 3BYWA 4R4ZA 2VNRA 1AX2A 5IVBA 1POV1 3I8TA 1DLCA 2HLEA 1FPN3 1QDCA 1SBDA 1OOPA 4RR3C 1SLIA 4DUVA 1CAVA 2CSGA 2F4PA 3THPA 4QKFA 4NIDA 1RUH1 1W9WA 1BVVA 1UZ0A 4O65A 2ATFA 1XNKA 4A7KA 1ENXA 2WDBA 2Y6FA 4FAHA 4NPMA 4UBGA 3S5AA 1D4M1 3ACIA 3I97A 5FMOS 4QXBA 3DL3A 3WQ0A 1BBT3 4XQ4A 3H3ZA 3RMXA 3RS6A 5A1FA 2GNMA 4H7LA 4IGQA 3WW4A 5FDBA 5IVJA 1YQ2A 1GANA 3AZZA 4OI4A 4RGKA 4XBLA 3VHRA 4AVSA 4CCJA 2RR13 4QM9A 4P5HA 5A3PA 3AC0A 4H2AA 2DVGA 4GMP3 3A7QA 1QWRA 4UBHA 1D0GA 4Z92B 3PJYA 5FZLA 5FAXA 1JZ5A 3U07A 4ZHNA 1GSLA 4FCAA 5A3TA 3MW3A 3H8OA 2FMDA 4DRRA 3B00A 1SFPA 5FYBA 4G9SB 4YW7A 1U5YA 5CKMA 4OHYA 4XUPA 1MS8A 2Z79A 1JYTA 2BNNA 5FZMA 1NA1B 4M00A 3SITA 3DV8A 3GF6A 1QJZA 1AJKA 3IT8A 4V2WA 3VD9A 4NRPA 4PI2A 1U5ZA 1RHI2 4ZXEA 1ZZBA 3AFGA 4QPWA 1XYNA 3THTA 3THCA 4AEMA 1H2LA 4F83A 3EHKA 5C3RA 2YGMA 3KV9A 5FZ8A 2F6BA 2O8OA 2PAEA 1Z7S2 4CDXC 2DTWA 4PF1A 5FPZA 5C4WA 2BQPA 4LBLA 2ZOEB 5IFTA 4BQXA 2ARAA 4ES8A 4WM8B 1UU4A 2CNAA 4HSJA 2ET7A 4NHMA 5FZFA 2HWD3 4YRDA 5FZAA 5CFCA 2PHFA 1Q8SA 2FDFA 2FMYA 2GP3A 2HBUA 2RM21 5FCCA 3UKNA 3TEZA 2VG9A 2A6YA 2W2IA 3WLUA 4N43B 5IAXA 2RMU2 5GJ6A 3RZKA 3PU8A 1G9DA 1YFXA 1QY4A 3IDAA 4XJAA 2DBIA 2R061 1DZQA 3N7JA 4IE0A 3KHCA 2HBTA 4LO7A 4XETA 2VBPA 1RUH2 5ABJB 2EIEA 5FZIA 2VE1A 1W39A 3VHNA 4L8QA 5F37A 4ES9A 1ST8A 3JUUA 2P34A 1HXS1 3MIEA 4NHXA 1GP5A 2D97A 4CUBA 1OUSA 1WD3A 2PHRA 1V70A 4MGQA 4PDWC 2C24A 4GMP0 2FDIA 1ZBA1 3VD7A 1ZZ6A 1US2A 4LTAA 2AEYA 2VOVA 5FYSA 2A5ZA 1NXMA 4CDUB 1BMV2 2WNEA 5FOBB 5BNPC 1AF9A 3L9JT 3I2DA 1PGL1 3FWEA 1UY2A 4L0PA 4UF0A 1J59A 4IXLA 5HI0A 3LEKA 2C1FA 4AFCA 4NIHA 1T2XA 5LW9A 2F4LA 4RS5A 1GQPA 1X50A 1EAH1 2A3XA 1HRV3 3OTFA 4IE4A 4QX7A 5KXDA 2HWC3 4XUTA 1UOGA 1SLTA 5FP4A 4LE4A 4MX3A 2WO2A 2QQMA 2WIIB 2YYOA 3ZXKA 1JMUB 5CKNA 3NNGA 2K46A 5ANNA 3LWCA 1BCXA 1LTEA 1GLHA 2K2SA 4HKWA 5FO9B 3GXUA 4N53C 1F5FA 1I6XA 3EO6A 4WVMB 4IUGA 1NOVA 4XZPA 4CEYC 4EV0A 3J26N 1CX4A 1MS0A 3OG2A 4BISA 4K21A 2LROA 5JSOA 2VZSA 2WZR1 4PIXA 5AC91 1SLCA 3ZN4A 2Z69A 3UK9A 4LEJA 4HVQA 4DXRA 3OPTA 1MS1A 4AYUA 4F3JA 1PZ8A 2ZX2A 3U4SA 3ETQA 2DURA 4ONUA 1NY72 2JECA 5DAPA 4FFIA 3UYJA 3BU7A 4CSWA 5ANQA 4CDQB 2DFCA 2Y64A 3L2HA 3TOJA 1XYOA 3JBG1 2HWE2 2X09A 4CP2A 2R062 5FLHA 5SV5A 3VDDA 4CRQA 3MUZ1 3N9QA 1H8VA 1K5MB 1H8TB 2DVDA 2VTXJ 1LEDA 3ZYBA 5JSRA 3WDXA 1QOSA 3HAGA 3RSJA 3WP4A 3PHMA 3B01A 3M7AA 3O0XA 3ZYGA 2YC0A 2FCVA 3PTYA 1LOFC 2K9ZA 1WCKA 2ARBA 3ZKUA 2WNUA 1ZBA2 5BNNB 1X9TA 3AP4A 3KCYA 1H6YA 4L2NA 2IUWA 2W47A 4YZ1A 3I2FA 3EXUA 2BGPA 4CPBD 3KWVA 2OT7A 2Q8DA 3WW2A 1JYVA 4LA3A 1QQP1 1R093 2GC1A 1YNAA 1PGL2 2XPJA 2VH9A 1V6NA 1GFF2 3WD5A 1JODA 1GOFA 1LENA 4F8AA 5C9AB 3C2UA 3LDKA 2QVSB 1ZRDA 1EAH2 2ARCA 5JIAA 1Q8OA 2XONA 4E2GA 2I45A 5GZEA 3RGBA 2OUJA 1SBFA 4CCCA 3ZIWA 2WQZC 3HNYM 4IV1C 1ODNA 4Y26A 1KJLA 1RUD2 1W03A 3VBFB 1N47A 2AUYA 5A7WA 5FIXA 4K3UA 4QKNA 4BU2A 4QPGA 2BVVA 4RQPB 5HXVA 4NWWA 1RUE2 3ASIA 4J1XA 1A78A 4ZONA 5AVPA 1G7YA 5GZDA 3H3UA 3M3IA 1RYYA 2XVGA 2WS93 2PAKA 2OUHA 5F8PA 2ES3A 3T09A 2AENA 3ZYRA 2R32A 4SLIA 5DDJ1 1W6MA 3PJQA 1UY4A 2JXAA 3O1TA 5E16A 2OZ6A 1F2NA 4YW2A 5GLUA 4CE8A 2XH6A 3NNMA 5I0SA 2Z42A 3UL2A 1AYM1 3JZVA 2G4IA 4LBMA 1UD1A 3B9CA 2Y26A 3HQRA 4ZZ5A 3H9AA 5JPNB 1UF2C 1PZ9A 2ARXA 3N9OA 4FPFA 4QKBA 4YVWC 5CFDB 5L7OA 2EIGA 4FPOB 3BB6A 3ENRA 4YZ4A 1ZREA 2XVLA 1NCQA 5EYYA 1N1YA 1PGW1 1A8MA 1K3IA 1AL22 5DQ0A 4DXZA 1OVPA 2YROA 4OULA 2TBVA 2D3SA 4RR3A 1ND3B 3TNQA 1ULOA 4ZZ8A 5AVAA 4KGGA 2BERA 4FPGA 3PUSA 1VBA3 1XYPA 4FPCA 3ROUA 2AACA 5A3NA 1QGLA 4COZA 4EN9B 1UKGA 1DQ1A 1WBFA 3VKMA 4MLOA 3GBWA 5A1LA 1UOJA 5EYXA 3O1UA 4XVHA 5DMYA 3BUCA 1W6OB 4ZU5A 1QDOA 2W91A 2LW8A 3AKPA 1G9BA 2A71A 1RUF1 2C0ZA 2ZX0A 4HANA 4X6RB 3BPZA 4JDNA 3VZLA 5ERLA 2BNMA 1S2KA 1S0GA 2D40A 5CVRA 3MFAA 4AEDC 1TVGA 4ARXA 5HCAA 3DPRC 2RS53 1I5PA 5C8CC 1CQ9A 3GZAA 1Y4WA 2HEVF 5A6YA 3KT1A 3ZFFC 2LS6A 1ULCA 2BV4A 5FYCA 4FPKA 4DIQA 1H2NA 1PVC1 1QJU1 3IN9A 3I3DA 1J84A 3KHBA 4JZRA 4BJ0A 1FOD1 2QE3A 4N90A 5JMCA 3NAPB 4YW5A 1W8HA 4FFHA 4DUWA 3JXSA 3IBMA 2WNVB 4W6XA 4Q4Y3 1NA1C 5CU1A 4IEOA 4Q8LA 5F32A 3GZEA 1FV2A 1YQ6A 2J1AA 2VCAA 2B8MA 4YVSA 4NE9A 3V65A 2VUAA 4IL7A 4PF5A 4QM8A 5DABA 4D6QA 4RHV3 1QJX2 2OS2A 2D44A 4FQ4A 4CDXA 2XL7A 3AJZA 5DDJ2 4JQRA 1Y7BA 1VBE3 4JGYC 1XE8A 4BQ3A 4Y20B 2DVFA 1IS6A 4Y5TA 3AX4A 4A6OA 4BYYA 1XPWA 1RINA 4CDWB 2KD7A 4OLLA 2OPWA 3I59B 3CQOA 1ZNPA 4AHZA 3QLQA 3NKGA 4IV3A 3RJ2X 5FY8A 4ASKA 4EE2A 1QKQA 2P17A 4IE5A 3K2OA 5H9QA 1OF4A 1MEC1 1PGW2 2VC9A 1PO23 3U14A 3WDWA 5FZ3A 4AL9A 2BP6A 2XR4A 3JD73 4FFFA 3WNKA 1AR83 2W52A 4H7MA 5FP7A 3VBHB 1DP0A 4KBZA 5FO8B 4TLGA 3SCFA 2JICA 3PTRB 1O3TA 4HSLA 3RWKX 1QJY1 1DYPA 1TMF1 1GQHA 1ULDA 2RJLA 4Q27A 4YW3A 3UKVA 1AR92 1G9CA 4LJHA 3GDBA 1AYN1 5IAVA 5A33B 4QQHA 3DCQA 5BPXA 4NHKA 2DCJA 2JIJA 3WXPA 3IAQA 3PUIA 4XOGA 3GJBA 2VY0A 5FYYA 3O1PA 1ZRRA 1GICA 1KQRA 5JZGC 1IKPA 4PDWA 2WBKA 1W8OA 4XF3A 2PHWA 3NV3A 4R9BA 3QH6A 5F5CA 1FPN2 5HV4A 4L11A 1KD7A 1AR73 2ZMKA 2WZEA 4S2DA 2NPIA 4IE6A 1NLSA 2BBVA 4UOJA 5BNPA 2D6KA 4BM8A 4YZ3A 3KF5A 4IEXA 2B39A 1LB2A 1HB4A 2YY1A 1QJU2 4XUNA 4CCKA 3CJXA 3K4DA 3OY8B 4D0QA 1POV3 3LFIA 2G1MA 5FYHA 3USUB 2X29A 4HZFA 5F3GA 4A7YA 2WWUA 4BHPA 4LUMA 1OI6A 2JJ6A 2ERFA 4AOCA 4CUAA 2O1QA 2C9AA 4FPYA 1LU1A 4H14A 5TSWA 4B8EA 5LEKA 4N53A 4OHZA 4CEYA 4OZOA 4R52A 5DG1A 4BXFA 2R49A 4DQAA 2QQIA 2VZQA 3AMQA 1QNYA 2G9ZA 3JCIA 3O12A 4XQDA 4ET7A 1F9KA 3T0DA 3LAGA 3M3EA 1DF0A 5KHHA 1OH3A 1R083 1YFYA 4LO8A 1CPNA 4K6BA 4AHXA 1OA4A 4DUXA 1QEXA 3A0NA 2PHLA 3GCWA 1MQTB 3UT0A 2QQVA 4JDOA 5JR2A 1XSQA 5JPMB 3MDPA 2ZGOA 2J1SA 4QB1A 5EZWA 2C9KA 3NWKA 2XVKA 1QJEA 5FXXA 3T4VA 4IESA 4CDQC 5CAZA 3LIHA 2Y6LA 1VBC3 1LHOA 3OBAA 1RJ7A 4K40A 4FPLA 1WBLA 3T08A 3ZR6A 2R1BA 1JUIA 1BLZA 4HBNA 1TMF2 2D6OX 2VQUA 2ENRA 2VXRA 3SKJE 4N8MA 1VALA 3WX5A 2VUJA 1IHMA 1N1SA 4PQQA 1K5MC 2C5DA 2HWD2 3BI3A 1W3VA 3POFA 5T5LA 3H1YA 2QQUA 5DXDA 2WA3A 2FDHA 2YDEA 2VZ3A 1OQ1A 2JG9C 3PUQA 5IATA 4Q4V1 1LOFA 5T5PA 3WV6A 2ZAHA 1SEFA 2WT1A 4XTMA 5JXIA 3FHQA 3A4UA 4YZ2A 1YI9A 3LA7A 1UL9A 4LKSA 2VAUA 5BNNC 5IUQA 1RUJ3 5C70A 2B42B 3M4FA 1MZ6A 2L9LA 3ON7A 1BEV1 2XLGA 1US3A 5FLJA 1GQGA 1ZM1A 3OGRA 4QU1A 3SCGA 3KMHA 3AKSA 1VMJA 3WF1A 4MVTA 1HLCA 1OPOA 1L7LA 1NZCA 4HL0A 1RUI3 2XWBB 4I01A 1W6PB 1QIQA 1CAUA 2R043 1PNGA 3HVDA 4IV1A 2BGCA 3RZLA 3LSDA 2HEYF 1VRBA 1UX6A 1VRH1 3ZIXA 4Q5OA 1GV9A 3KVBA 1GU3A 5JCTA 3K48A 3ZYPA 5A70A 3HWJA 3WDVA 3UGGA 3TN93 5IFPA 2QBXA 2VNVA 2P6CA 1W8UA 1W6NA 2Y38A 4WVVA 1CAXB 2ZHLA 3RYRA 2Y0IA 4F7ZA 3VBSB 1MZEA 3A22A 4FFGA 2P4EA 1XE0A 3VZNA 2FQPA 3ALQA 1FMD1 4HETA 3AP5A 5FR3A 1I3HA 1AR63 3IMNA 5KC6A 2BW8A 3T0AA 5APAA 1WW6A 3PMEA 4WM7C 3GGLA 3M1HA 4C0BA 3U78A 4NPLA 1C8NA 1UMZA 4Q0VA 4CA9A 4GH4A 4YVWA 2R30A 5LBBA 4Y1YA 5FQ0A 2HKXA 4QU2A 4XAAA 1REFA 4EN8B 3OPZA 5LCWL 3ACFA 4JHTA 1AVBA 1UXZA 2VMCA 4RGGA 5FPVA 3U37A 1NX9A 1ZRCA 4AEKA 3J8F3 3OBZA 2GSYA 2J1EA 5A80A 2ID4A 2G19A 3W21A 1L7RA 1TME3 4B29A 3IIAA 1DQ0A 2BFUS 2JE8A 2WZ8A 2ZHNA 3AJYA 3H42B 1DQ4A 1ND3C 1WCDJ 1X82A 3JB4C 4ISQA 3SXWA 1OBNA 3WUDA 4TLFA 1EPZA 3VBUB 4I0BA 2C26A 4MYEA 4XIOA 4DXSA 1F35A 1OVSA 2B5HA 1Q56A 2ZEXA 3TRSB 2BPA2 1ONAA 2WZR3 1HV1A 3D8CA 3ELNA 3RFRA 1AJOA 3HD8B 3J7HA 3Q8CA 3T4HB 3VKOA 2FZ1A 4AFMA 5JXJA 3RRDA 2WZPP 4PI0A 4HK9A 4XYXA 1BEV2 2XQRA 2YC2A 4ZS2A 4LBNA 4O9GA 3ACHA 1YRZA 4BIOA 2VZ1A 5F1RA 1X8MA 1UXXX 2EXKA 3F2ZA 4Z2WA 1UYPA 3J9SA 4AEDA 2F17A 3POWA 3DPRA 1YQCA 1PX4A 5C8CA 2HYXA 1COV3 2IXLA 2LUWA 3H1WA 1DU3D 4M3CB 2CU5A 1J3PA 4AHWA 2P37A 3ZFFA 4BQYA 1O3QA 1Y9QA 5IT6A 1Q8VA 4JV4A 3Q8EA 1EUTA 1VBD3 1AXKA 1H4HA 2WFF3 2VNGA 2WT2A 3LIGA 4XPVA 3I2OA 5FUPA 1KS4A 4L97A 1VRH2 4CEWC 2VOXA 5JDBA 1KDMA 4OVEA 4MXWA 2OZJA 2XJVA 1R092 1J3RA 2WNVC 2RG4A 5FMCA 5J48A 3IM0A 2VCBA 5D21A 1W0PA 5CNAA 3CO2A 1X7NA 2GMMA 2OVUA 3H8XA 1FMD2 3V0AB 1PIV1 3LZZA 4K1YA 1NCRC 2PAMA 4BXSV 3GHMA 2W92A 4CP9B 2X5IC 4CU7A 1SDDB 4JGYA 4AAPA 3ZYFA 2EALA 3DYPA 1VAKA 1W04A 2JENA 2FCTA 4ATFA 4HFSA 1I1EA 1LULA 1ZVFA 3O1OA 3VD5A 2RS33 3O14A 1PM7A 3E97A 2X10A 4LOTA 3RPQA 2QQPA 1DCSA 3VBRC 5K0UC 2BGOA 4MXVA 4YSFA 2BU9A 3EQEA 3W20A 1ODMA 3MV01 2HH9A 4ISRA 2EIBA 4V2VA 3VBHC 1KS5A 3VHOA 3OGVA 2BWAA 5FZ0A 3BTXA 2XMLA 1PMHX 3I3BA 4Y33A 3ZFGB 1RHI1 5GLWA 2UURA 5BNOB 2QDNA 1RJ8A 3S6PA 5KHIA 3ORJA 3BCWA 4PQ9A 4A6SA 5BY5A 1U12A 2JG8B 1Z7S1 3H3LA 4OUEA 4Q4X2 5EWSA 3ZR5A 5JZGA 1XNDA 3WUCA 1FATA 5FY5A 2ZBJA 1SQ4A 4JAAA 1DGWA 1AYM3 3SH3A 1ASJ3 3POSA 4IGPA 3O1SA 3HNBM 4MGSA 4WVWA 5FKCA 1W9SA 1XNAA 3ZPYA 5FZOB 4MH0E 3I2IA 1VBA2 2CL2A 2YC4A 3IB3A 3W59A 1RXFA 2CWMA 4AVCA 5H9PA 1V6KA 3ZXGA 4AQTA 5LA1A 2RJ2A 2IXIA 4XIKA 5FYIA 2JB8A 1ULEA 2YU1A 1LCLA 2E32A 1LGBA 2RMU1 2E9QA 2Y34A 4PLNA 5FK8A 5F7UA 4NIGA 3AMMA 4YM2A 2I07B 4XXPA 5D1IA 2P5BA 5T52A 1UNBA 2ORZA 2VTXA 5FXVA 1XSRA 4M4RA 4PLMA 5LBFA 2QQJA 2Q30A 4LQRA 5LA0A 1JZ8A 1PIV2 1RUG2 5FZ7A 3EJKA 4FT8A 4HVRA 2WYSA 2A6VA 2BRTA 2D6LX 3WP6A 4P9LA 2VOWA 2FBEA 3HJRA 5FTTC 3ZOIA 3I2GA 4OYUA 1ZZ9A 2E63A 1OF3A 3CHXA 1SBEA 1B35C 1LECA 5CEHA 3WQ1A 4Y1VA 1BMV1 5F5IA 4BA6A 1GP6A 5B4XA 2XBO1 3ZKYA 5CADA 5J3UA 4XJWA 3NNLA 1VJ2A 1UIKA 4CDQA 5IVEA 1PVC3 4Y22B 4RHV2 2XXZA 4JGZB 1XQNA 1GWLA 3RDIA 4FXKB 3WG3A 4XZUG 4GAZA 1UPIA 1SPPA 2VECA 4XJZA 4LBOA 2VMEA 4IQPA 3IPVB 3E1F1 2WA4A 3PVOA 4BK5A 2NMNA 4EZHA 5HV0A 2Y33A 4KH9A 1IPKA 1UY1A 5DUXA 5SV8A 3VL9A 1NAEA 3WF3A 4AI1A 2WO1A 2AZ5A 2BDRA 2IFRA 4L92A 4U36A 1X33A 3QCWA 5FXZA 3WQ7A 5FPUA 2JG9A 1YIPA 5LBEA 1FAYA 1GZTA 1HRI3 2BWCA 2IZWA 1HQWA 2QUOA 3M70A 3N9NA 5FZEA 1ZA4A 2VMIA 5K4LA 2WLQA 3RYKA 2WFPA 5J7MA 1M06G 1JW6A 5A7QA 4Y1XA 2D93A 3ST7A 4J6GA 3WW1A 1CAWA 1SCSA 3N36A 3KLSA 1AUYA 4RYDA 1NY71 2ZGPA 2ZXQA 3L2YA 2DF7A 3MHZA 4KU7A 4L9BA 4YZ5A 3LA2A 3S7IA 5DUUA 1MEC3 1HIXA 2LM3A 2GP5A 2B46X 4Z82A 3B93A 3RZGA 2MEV3 2HWE1 5JXHA 1IS5A 5FZHA 4DZGA 2DUQA 3MF9A 4UW4A 3RI9A 4G3YC 5T5JA 5KHKA 1QJY3 4QX5A 5FYZA 5I8TA 3K46A 1MPXA 1LAJA 3Q8FA 5HCBA 2HWF3 2W1UA 1AR72 3ECQA 4GIQA 3ILFA 5J98B 1NLQA 3ZFEC 3IKWA 5JAXA 1EV11 2WINB 1TG7A 2ZX3A 4LHKA 5C6CA 1YQ5A 1U0AA 3MLLA 1D2QA 5FWEA 1UX7A 1PVXA 1Y9GA 1C5HA 4HN0A 1C8M1 1HKDA 2JDYA 4UFJA 2PHXA 4HONA 3PNAA 4V1PA 3LB9A 1BKZA 5D8AB 2PLV3 3NO8A 4WM7A 2XBO2 3OJBA 1OQEA 2BUKA 4XF4A 1OSGA 1V00A 3GZUC 4QX2A 3X29B 4AI3A 1O5LA 2YGLA 5FJKA 4DFSA 1VLNA 2I74A 2QQOA 2XUEA 2X53S 1ZX5A 2WO7A 5LEJA 4QX1A 2Q8OA 3DEMA 2QKDA 1G6NA 4Q8KA 4JKKA 5HPOA 1OLMA 1W2AX 4U2AA 5EP9A 2VOKA 3ZO0B 1XBFA 1H2MA 3RJRA 2B9UA 4AI9A 3CEWA 4QX0A 4HPKA 4AQ2A 4M0NA 1RUD1 1ND2B 3T0BA 2WLPA 1LU2A 2Y6JA 2W95A 2QZ3A 4I3GA 1ZBE1 1PK6C 4I02A 2DDUA 1RUE1 5FZ9A 3MIHA 4O61A 3P6BA 2R073 4LLOA 4MUVA 3VBUC 1JYXA 1OOPB 5GALA 3KM5A 4YG6A 1OKQA 1CAVB 4MZUA 3ZYHA 1JU3A 2OYZA 4KL1A 1N1TA 3ZXJA 5H9SA 1G9AA 1O6UA 3HN3A 2PHTA 2GC2A 4FP2A 1I9RA 1AXYA 5DAQA 5LRSA 2RS11 3ZSEA 3HNMA 5DAVA 1SFYA 1L7QA 2HJIA 3FLTA 4AFBA 1VP6A 3VLBB 1GBGA 2JD9A 1MVEA 2W87A 1ZA7A 4QQPA 1BHGA 3POGA 1QMJA 1A34A 1WCQA 1AL21 1ZRIA 1RMU1 4A3XA 4LPLA 4CXWA 2Y6HA 4CEWA 1DGWX 1UW8A 4M01A 4Q4W3 4W6WA 5EFUA 1RUJ2 4Y5SA 5F3IA 1EV12 2UWAA 1R1A1 2V4AA 3LEIA 1H0BA 2Z5WA 3ZM8A 4QPYA 5GZGA 3AP9A 2IXHA 2JE7A 2XJSA 1C8M2 4YGDA 1ACCA 1NCRA 5KHGA 1GR3A 2X5IA 4ARYA 5JOYA 1PO11 4LUKA 1G8WA 4OMCA 4D6RA 3DN7A 1GNYA 5D2AA 1S2BA 2I2SA 3VKNA 1UZZA 3CJIC 4WV8A 4GWJA 5FZBA 1HB2A 2UY9A 2VZPA 3TN92 2Q8CA 4E9KA 3VBRA 5K0UA 3ZSJA 4Y24A 1RUOA 2XJRA 2UYAA 5F3EA 2DBNA 2K0GA 4GB31 3LEMA 4MGYE 5CFCB 1S4CA 1JOBA 3LA3A 3GM8A 3SEPA 3Q8AA 4KBBA 1ZBE2 1W2TA 3K51A 5F5QA
chains in the Genus database with same CATH topology
2ZTNA 5KWRA 5ACA3 4KQ7A 2PHDA 2XJUA 2GMPA 3DF0A 3S7EA 1QJX1 3ZFGC 5IK7A 1YYNA 3FUQA 2HWB3 1CGPA 5B2GB 3O5SA 3SNMA 5ABJA 4AVTA 1VBB1 2IFWA 2RS12 3N7KA 3ZMOA 3KT7A 2W68A 1TME2 1DGLA 3FFZA 3HMYA 4JDMA 1AZDA 4AK3A 3ZXAC 4GWMA 3VZKA 2CWSA 1DDLA 1V9U3 3AK0A 2NN8A 5BV6A 1CJPA 1RMU2 4AGVA 1HV0A 1RGSA 4FPJA 4W65A 5I0TA 3VKFC 4M3CF 4NR1A 1RVF2 1LGCA 1N3QA 4AQSA 3WG2A 4COWA 1R1A2 3WDUA 5T3NA 3BOPA 4E4DX 4H3WA 4PCRA 1AR91 5DZEA 4RS5B 1JYCA 2OW4A 4I2OA 4LBQA 1RUC1 3IWZA 1O4YA 1KXGA 1PO12 5GZCA 4SBVA 1VBD2 1RC6A 3B02A 1GNZA 3GALA 4DRVA 1FPN1 1OA3A 3VKLA 1B35A 3KSCA 1YFUA 2R16A 4META 2XKPA 3VL8A 4L99A 3AYEA 2ZA9A 1V6LA 2D6PA 3RNSA 1MVQA 5KHJA 4GB32 5CA6A 1BBT1 4YM0A 1J3QA 1Y43B 2ZGQA 4D69A 1APNA 2W08A 4TWTA 4AE2A 2GAUA 2RR11 1DBNA 3FBMA 1X8EA 4GMP1 2D5FA 2DVBA 2QJVA 4JTNA 1ZZ7A 3PVEA 2RS32 3WOGA 4D7SA 1YJKA 1LOEA 4CP0A 4NO4A 3VDDB 2D3PA 3VZMA 5A32A 4H55A 2VMGA 5FFOC 1VBB2 3E5UA 4LBKA 2D43A 2H6CA 3ILRA 3MIDA 4WM8C 4N9HA 4R8HA 2GALA 3WG4A 4DY5A 3LGRA 5J37A 1AL0G 2WNUB 1OQDA 4B4QA 1R1ZA 1PGSA 1FT9A 5FOJB 4XBQA 4MGZE 3T1LA 2ILMA 3MZHA 1OLQA 3KGZA 4N43C 3M3CA 5JOZA 4NVPA 1S0EA 3MW2A 2MHFA 4OHVA 3T1MA 3C3VA 1ASJ2 4XMIA 1YXWA 4BOWA 4FBFA 1RHI3 3ZFEA 4BZ4A 2IWGB 4Q0UA 2HWD1 4TSVA 4IEQA 4FTEA 1RUC2 2B45X 4PBOA 1BYHA 2WWSA 2TNFA 4A2UA 4BWOA 1CAXA 4XF0A 1S0BA 4HVOA 1N1VA 3ZX7A 4QPGB 3FHIB 3WG1A 2Q1MA 3MIGA 5E8AA 3I7DA 4CDUC 5IK5A 5F9TA 5D8AC 3OYWA 4Y1ZA 1BBT2 1W6MB 3H7YA 2PHUA 2RMU3 1MACA 2YHJA 5KXCA 4QPIB 1RB8G 4AF9A 3HT1A 2KM2A 2RR12 3ZN6A 1RUH3 3KQRA 3AM2A 4ATEA 1BJQA 5L7OB 3AZYA 4FPEA 1D4M3 4Q1RA 4ZKTB 1NCQB 2EXJA 3WW3A 1PK6A 5GLZA 1BK1A 4IEPA 1ZZCA 2NLRA 4RR3B 3E5XA 1NG0A 5JOXA 3BODA 1HRV1 2VULA 1UCXA 2HWC1 3EBRA 3MLKA 1OOPC 1WUVA 1UU5A 5J36A 2YMZA 2VQ0A 3MLJA 3ZYJB 1BVP1 2XHKA 2PELA 4FXGB 1SMVA 1LHUA 1HRI2 4Q2FA 1JYIA 4N7UA 1O7FA 1O5UA 3DGTA 3AZWA 5FREA 2FZ2A 1H8TC 4I0WB 3FLPA 4EN0A 3KT4A 3W9AA 4MV2A 3W58A 1YUDA 3FE5A 1O3RA 3B94A 4YFWA 3UV9A 2CY6A 5JIUA 1XU1A 3ES1A 1XE7A 1LHWA 1V6OA 3DKWA 4E2QA 2V73A 1ULGA 5DUVA 1N3PA 1QXJA 3N4MA 4YVSB 4HLTA 2YXSA 3LOIA 3NKTA 5T55A 1QH6A 3NVCA 3JU9A 4R9CA 4YYOA 1TEIA 2RM23 4Z07A 1T6GC 1W6QA 4CDXB 1POV0 5T54A 2BVBA 3CJIA 5JSPA 2G9GA 5DUWA 1S0FA 1WMEA 1ENSA 5C9AC 4LO6B 2R063 5JI7A 1GKBA 2O0OA 4P9IA 1WLTA 4K7JA 1CVNA 3VHPA 4BPZA 4IV3B 1LOCA 1KDKA 1NQJA 3WDYA 1R091 1HXS3 2P3KA 2WT0A 3VBFC 1IQAA 4ZXKA 3POYA 1AX0A 4RQPC 2MPFA 4XHBA 1ZBA3 3E6BA 3V0BA 3JQXA 1HRV2 4ZU4A 4QGMA 2HWC2 4MGKE 4Q0QA 4HT1T 1YIFA 3R4UA 4FPHA 4FSJA 2DFBA 4AHYA 4UW3A 4NPRA 2YZ4A 3KZ4C 1VB2A 3GNEA 4R9AA 2ZKNA 3PVBB 4HKOA 1O3SA 3HIFA 4CTEA 1EAH3 3ZDSA 4AVAA 4C1XA 4PDWB 4Z8BA 5CFDC 1BQPA 4FTSA 4OUMA 4BCUA 2ZX4A 1WD4A 1EP0A 2WS91 1PMIA 1JTZX 3ES4A 5BNPB 4KU8A 4B7EA 4EROA 2WKKA 1RUE3 1VIWB 1WLCA 3KB5A 4LHLA 1IS4A 5AC93 3IDCB 4RFT0 4XF1A 4UW5A 1Q5OA 3LSEA 1WGPA 3QOPA 4ORFA 1VB4A 4AVVA 1F31A 3JB8A 2ZGMA 4Q4X1 3ZXDA 3D6EA 1IPJA 1Q43A 2ET1A 1JXNA 2CGPA 1AHSA 1NE6A 4CEYB 3CU7A 4XHXA 2QZ2A 4AEJA 4QXKA 3IDBB 1RL3A 3JBG3 1VBA1 3O7OA 1DLLA 1UZYA 3MPPG 4Q0PA 1HQLA 5EJ3A 2JKBA 4IEZA 4M0HA 2TEPA 1J58A 4Y1UA 1C5IA 4YGEA 1AL23 4YGCA 3SMHA 3ZXFA 3ACLA 3PMSA 1Q8QA 4JRLA 1SCRA 3MIBA 4CP1A 3NAPC 1NA1A 1WW5A 1JN2P 2R1DA 2GDFA 1LRHA 4K20A 1MR5A 4XJ8A 2P3IA 2GH2A 1MS5A 3ZYIB 4FAGA 3GZTB 4KNCA 5BYNA 2RS51 1OD5A 3MGUA 3AMHA 5C8WA 1RUG1 1OLRA 1QQP3 1RITA 4DPNA 5JVVA 5HBAA 1OFNA 5I0RA 2R6QA 4WM8A 5E1RA 1JH5A 4Q4Y1 1DIWA 4XFIA 4CDWC 1CJDA 3N7MA 3OD4A 3E5QA 1JBCA 5GZFA 4I09A 4EJRA 3MFCA 2WNUC 2ZACA 4RHV1 2WS92 4N43A 2VGDA 1WMDA 1VBE1 2LTNA 4LE3A 3O0VA 4BQ1A 2EAAA 3NV4A 3H1MA 3CLPA 3TB0A 4Y5Z0 1FYUA 1CAUB 4NHLA 4W6YA 4QGNA 5DDJ3 5JOWA 2CGOA 4DOUA 5GKAC 1S0JA 1PO21 4R4XA 3JD71 4PIZA 1H9WA 4GA9A 1AR81 3H8UA 2E7QA 2A70A 4LLFA 4MSVA 4YGBA 1GZWB 5CIRA 1ALYA 2V5YA 5C33A 1W6NB 3SH5A 5DZFA 4CZSA 1MS3A 4CDUA 1S55A 3R0RA 1IOAA 1UKRA 4FOVA 3VV1A 4IETA 2GH8A 3RYPA 1H2KA 4MGIE 2ZMNA 3NV1A 3NV2A 2W39A 1YO8A 1WMFA 4QPIC 4QQOA 3FJSA 4GH4B 4YVWB 1AR71 5FQ0B 4D3WA 2RS52 5F6KA 3MW4A 1UU6A 2YV8A 4EWEA 4WVMA 4LO4B 4YG3A 2Q5TA 1Q3EA 2XG3A 1RUF3 3LKJA 4PIYA 2O8QA 4D94A 3QACA 1M4WA 2EXIA 3U10A 2XJPA 3GHNA 1KFUL 1VR3A 2HEWF 2ZABA 4AI0A 3Q9OA 2CV6A 4Q4Y2 1C4RA 1CONA 3D82A 3ZXEA 1O4TA 1MQTC 5FLIA 3WNXA 3FZ3A 5CBLA 3MI8A 1QJU3 4Y4YA 3JQWA 2UU8A 1FOD3 4AXOA 1LHNA 1FI2A 2XLAA 5DZGA 1VBE2 3CF6E 2GC0A 5BNQA 1A3KA 3AP7A 5LRRA 1R081 4AEDB 2AGSA 3DPRB 3H50A 4RA0A 1IGOA 1CN1A 1V6IA 4AQ6A 2DUPA 5C8CB 1K5MA 1LHVA 1H8TA 2DCKA 4P9YA 1C1FA 1A6CA 1O4ZA 2DU1A 3ZFFB 3OBRA 1H30A 3MF6A 1V6JA 1PO22 2Y0OA 1JUHA 3UJQA 2JX9A 1C57A 3JD72 1AR82 2PYTA 2A6WA 2CYFA 2QCSB 5BNNA 1VBC1 1D4VB 4MXWB 3WINE 2DYCA 3NW4A 3NL1A 1LB2A 5K9YA 1NE4A 3V64A 3FC0A 4PLOA 1ENQA 1DG6A 4COYA 1GZCA 4YVSC 3AMNA 5L73A 1IS3A 1QOTA 2VQAA 3KCCA 3WP5A 1DHKB 1MS9A 4RL7A 5J09A 5C9AA 4S2FA 4XFAA 2ZZJA 4JGYB 4COUA 4KWLA 1CR7A 3RWNA 2A73B 1REDA 1UN1A 1TMF3 4QHBA 4R9DA 2E6VA 1SLBA 4LA2A 3M3QA 1AYN3 1RUJ1 3ZMNA 4DY3A 1G9FA 3SHRA 1ZRFA 3HBZA 4IV3C 3VBFA 4P14A 4P9WA 1A8DA 4RQPA 3WCSA 4Q29A 4JRAA 5GLVA 2WJSA 1RUI1 1L3JA 5FBZA 4J1WA 3U11A 3VBSC 4AW7A 4BMEA 2ZCWA 4TZDA 2VMHA 3QH7A 4I3PA 2R041 1NYWA 5H9RA 4JTOA 1D4M2 5IK8A 3S30A 2A75A 2P2KA 3R05A 4AFDA 4GKXA 5I8YA 2EA7A 5JZGB 3CNAA 3TN91 5CFDA 1NQDA 3H7JA 5I8SA 2WC2A 2XLFA 2NMOA 1R082 2XJTA 2NQYA 5L36A 1AR61 2A6ZA 1KFXL 3DUIA 4AWDA 1XU2A 1Y3TA 1ND3A 3VBOB 3AYAA 3AZXA 2R0HA 2Q0AA 4KWJA 5A3LA 4GALA 1VBC2 4IEYA 4E4SA 4HMZA 1W6OA 5FMOL 4AI2A 4URTA 2B7YA 2NM1A 2UY8A 3WVJA 3J8F1 4RSUA 4GULA 4B4PA 1TME1 1YFWA 4BLJA 1YJLA 2PQQA 4IEVA 2XJQA 4FOYA 1IKQA 4X8NA 3RZZA 4BIFA 4HN1A 3KGLA 1W0OA 2R0FA 3FFQA 3AKRA 5FRAA 1RVF1 1SLAA 3NAPA 3TBDA 4BH9A 2GNBA 2EXHA 4XMAA 3NJZA 3OCPA 2WNVA 3WR0A 4Q4V3 4D7TA 3N35A 2RM22 2DUOA 4LT5A 1RIRA 4QD2A 1LGNA 1EYBA 3D0JA 1RUI2 1COV1 3AZVA 4YLZA 3RQ0A 4DB5A 1W2UA 1ENRA 3D0SA 1BEV3 2R042 2X8KA 1VBD1 2WQ4A 2ZPXA 2WFF1 2VW1A 1PHMA 2ZGUA 2XKOA 4Y20A 1C3HA 1F5JA 1H1MA 3P3NA 3B69A 4DINB 2JG9B 4CDWA 5C4WB 2XGXA 3KD4A 3BIWE 3M2MA 3I59A 1HXS2 5CG8A 3FLRA 3M8LA 1UAIA 3TAYA 1FXZA 3HQXA 5T5OA 3ZN5A 1MZFA 5EXOA 1TNFA 2DV9A 4D7YA 1CAWB 4NN0A 1VRH3 4JCKA 1AR62 3SLIA 2YUEA 3R4DB 1S0CA 5KXBA 3VBHA 4RD7A 1KJRA 1DQ6A 2UWCA 4NWVA 2ZS6B 1OPMA 1KITA 2GN3A 3M3OA 3SH4A 2RS31 5A33A 1CD3G 1FMD3 4C90A 1LOGA 1H9PA 1H1AA 4P9JA 4B3NA 5BNOC 1RUNA 1F8VA 3FBYA 2JG8C 3J8F2 1HX6A 3LOBA 1DGRN 4P9XA 1O91A 2AYHA 1GNHA 3KS7A 1LOAA 4YW4A 2E7TA 3ZVXA 4XE9A 2D7FA 1HDKA 1LEMA 2OPKA 4OI1A 4QQLA 2GMEA 2WZR2 5AC92 2H0VA 1Z78A 3OY8A 4WM7B 3USUA 3AP6A 4FQZA 2ZHKA 3PLQA 3R6SA 4QPIA 4XEZA 4PJYA 2TUNA 1ASJ1 2A7AA 3JBG2 1V6MA 2XB6C 4GH4C 1COV2 2GNDA 2NZ9A 3N7LA 3ZSMA 2SLIA 4Q4X3 4YM3A 5LK7B 4GKYA 2KXLA 2WFF2 1HQNA 4HPKB 5F6LB 2ZGSA 1B09A 1CESA 5JR7B 4A7ZA 4N9IA 3N3HA 2CGNA 3RI8A 1MQTA 1J1LA 4XFHA 4EWDA 2VPVA 1SDWA 1E57A 3SISA 3TYJA 3OD0A 3WZ1A 4JGZC 2VNOA 3U0ZA 1D2SA 1QQP2 4S2HA 2UWBA 1FNZA 3HN1A 1KRIA 3UKTA 5A3MA 1FV3A 2D6MA 4Z1VA 3GBGA 1PIV3 1RUG3 3GYDA 4XBNA 1YHFA 4M3CE 1XNCA 3URFA 4CEWB 3ME2A 4YW1A 4XFFA 1HW5A 3WP3A 2Q4SA 2ZKLA 4I30A 1YWKA 3WHUA 2NYYA 2RJKA 3G7DA 3G6JB 4KWKA 2P3JA 1NCRB 4C1WA 2JD4A 4XFGA 1GYKA 2SBAA 2X5IB 3MEPA 4X6QB 3VZOA 4OUSA 5AFEA 1HRI1 4TYSA 1EPWA 1CIWA 2JDZA 4LBQD 4DNYA 5KBFA 1W6PA 2Z2SB 3QBQA 2WSVA 4K9SA 1AYM2 3B9IA 5I91A 2D6NA 2DWRA 1LODA 1C28A 4FO9A 3OGJA 4GQ7A 4O9EA 2DCYA 4OI0A 3VBRB 4G4FA 5K0UB 4YG0A 4PBPA 1Z7S3 3GBFA 3T2TA 1OFSA 1SACA 1WCSA 2QFEA 4YARA 1QHDA 4S2GA 4YM1A 2UYBA 2MEV1 1DZTA 3VBSA 2EAKA 3MICA 1QXRA 1Z0HA 3AXDA 4E27A 1QOOA 1ZZ8A 2AR6A 1SLLA 2HWF1 5J96B 1JOJA 1DQ2A 4QT6A 2D5HA 4AI8A 5LK5A 2MNGA 4GWNA 2D98A 3I4IA 1FX5A 1CPMA 1QH7A 2ETEA 1WLWA 1RUF2 4HKLA 5ABJB 1NLRA 3ILNA 4E4ZA 4ZU7A 3ZSKA 2IXKA 4OI2A 3U4XA 4IEWA 2PLV1 1URXA 2Q1ZB 2JEMA 1ND2C 2XL9A 1PVC2