2ERFA

Crystal structure of the thrombospondin-1 n-terminal domain at 1.45a resolution
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
209
structure length
209
Chain Sequence
b'GGDNSVFDIFELTGAARKGSGRRLVKGPDPSSPAFRIEDANLIPPVPDDKFQDLVDAVRTEKGFLLLASLRQMKKTRGTLLALERKDHSGQVFSVVSNGKAGTLDLSLTVQGKQHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELDVPIQSVFTRDLASIARLRIAKGGVNDNFQGVLQNVRFVFGTTPEDILRNKGCS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thrombospondin-1
publication title The structures of the thrombospondin-1 N-terminal domain and its complex with a synthetic pentameric heparin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 58
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2005-10-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2erfA00
1S0FA 1S0EA 1CN1A 2E6VA 3GALA 2ARBA 4FPGA 2CYFA 1WLCA 1AXKA 2UWCA 4H55A 3V0AA 1WD3A 4XDQA 4FPFA 1JN2P 1ONAA 3WG2A 3D6EA 4PQ9A 4WV8A 3WUDA 3ZYRA 4XJ9A 4F83A 1BYHA 5HCAA 2ZGRA 1V6OA 3WG3A 1WBLA 3WLUA 4LBMA 1QMJA 1G8WA 2VXRA 4ITCA 1I3HA 3T1LA 5H9SA 1RITA 3WHTA 4Y1YA 1MZ5A 2PHUA 1LOFC 1WW7A 2ZGUA 5GALA 2SLIA 2NZ9A 1ENRA 2DV9A 3AJYA 2ZGOA 1LOFA 1IKQA 2XB6C 3C2UA 1MACA 4YW5A 2ZGLA 4P14A 3UL2A 2A7AA 4M01A 4W65A 3AZZA 4NO4A 1GZWA 4IQPA 1WW5A 2ZHLA 3B9CA 1SCSA 1ULCA 1KITA 5GZEA 1Y7BA 2R0HA 3OYWB 3O0WA 4XHBA 1C1FA 4XILA 2VW0A 3B3QE 4YG6A 1GANA 1DLLA 2JD4A 3QLQA 1BJQA 1YXWA 1OKQA 5E8AA 2B7YA 3WV6A 3GNEA 4XIKA 3SH5A 3UJOA 2GDFA 3PVEA 2ZMLA 4XZPA 1AX2A 1MS8A 3DUIA 3VKMA 1GNZA 3PMEA 1H30A 3OBTA 4Y1UA 5GLWA 3ZXKA 4YM0A 3VUOA 1Q8VA 2D44A 4U2AA 3SITA 4AGRA 4DFSA 3U4XA 3ZXJA 1NXD1 4Y24A 5DXDA 2GNTA 2ZMKA 1LODA 4BMEA 1LCLA 2ZGQA 4ISRA 3W58A 2VUAA 4Y22B 4FOQA 2E7TA 1LOBA 3RMYA 1OFSA 3OGGA 1W6QB 1V6LA 4XBQA 2A70A 3AYEA 1IS3A 1AX0A 2YXSA 4FPLA 5DUVA 2AUYA 3AJZA 5DUWA 4XE9A 2A5ZA 4FPCA 3T1MA 1N1SA 4YGDA 2NMOA 1KDMA 5IK4A 2DVAA 1VLNA 4XJWA 4GKXA 4BQ1A 4PBPA 2AENA 1FX5A 3HMYA 1C1LA 1LHWA 2YROA 5GJ6A 2CL2A 3IMNA 3ZYPA 1YO8A 3O0VA 1S0BA 2A6XA 1NLSA 4CTEA 3N36A 1WUVA 3NV4A 5EYYA 2DTWA 1LOGA 1N47A 3N3HA 4FVVA 1LJ7A 1G7YA 4YLZA 3H0OA 1LOAA 1JYCA 5GLZA 2JKBA 2EXKA 4FOVA 3W59A 3SNMA 1JHNA 1V6JA 1F5FA 2SBAA 2AH2A 2VW1A 3VKFC 2NP0A 3HR9A 3BTAA 1SFYA 2GMEA 2A71A 2OUJA 2ZA9A 4KBBA 1B09A 3WDVA 5GZCA 2ENRA 3A0KA 4BM8A 1ENQA 4NOTA 5KXBA 5IK7A 1AX1A 4ZXKA 2AR6A 2ZMNA 3NV1A 1H9PA 2VW2A 4FPHA 2P3KA 1O4YA 4JC1A 4SLIA 3TB0A 1LGNA 1BXHA 1JW6A 2R16A 5GZFA 2PHXA 1QOOA 3KQRA 3ILRA 4YW2A 3WDXA 2AREA 5FRAA 5CB7A 1N3PA 5DG1A 3RSJA 4CRQA 5KXEA 1SLAA 1WW6A 2DYCA 2G4IA 4TYSA 4Y1ZA 2WLQA 3WZ1A 1DQ1A 1WLWA 3RMXA 3IPVA 1MS4A 2D3SA 1G9BA 1W0PA 3ZSKA 2JDZA 1SLBA 3AXEA 2DVBA 4L8QA 4Q1RA 2CNAA 4Y1XA 4CZSA 3JUUA 3IN9A 3R4UA 4FOWA 3POWA 2UU8A 3VKLA 4GWNA 5JLVA 1SLLA 1W6NA 1W6MA 2PHFA 4LBQB 2GN7A 2YMZA 4M00A 3AX4A 1W0OA 4ISQA 1C57A 1Q8OA 1VAMA 5FREA 4JRAA 3VKNA 1J1TA 3BOPA 2FHRA 1UZZA 4FQ4A 5T54A 1LU2A 3OPZA 3AZVA 2ZHKA 2GNDA 5CAZA 2EALA 1JOJA 3LSEA 5HCBA 3RRDA 4K1YA 4XXAA 4YM1A 2ERFA 1DQ6A 1APNA 4UW4A 1N3QA 3PJQA 3T2TA 3POYA 1ZM1A 1G86A 3AP5A 1DZQA 1G9DA 1JYIA 4Z8BA 2I2SA 2E51A 3M3OA 2VY0A 1FNZA 1DFQA 2W08A 3R05A 4XMIA 1UX6A 4GA9A 4Q27A 1LGCA 3N35A 4YW4A 1CR7A 1U0AA 2DURA 2ZHNA 3AP9A 4YZ4A 5T50A 1ULGA 1IKPA 2A6ZA 1WD4A 2A3WA 1LOEA 4XJAA 5JOXA 1GZCA 1FV3A 1ULFA 1URXA 1Q8PA 1QKQA 2LALA 3KM5A 4XIOA 3WDWA 2PHTA 5T5PA 5JDBA 1KJRA 1MR5A 2P37A 2EXHA 3A0NA 1W6OB 1FYUA 2E53A 2BQPA 2WT0A 2EXJA 2D43A 3IKWA 1QF3A 1AF9A 2NYYA 4XJUA 4PCRA 1AXYA 4LBNA 1GV9A 1LGBA 2AYHA 5T5OA 3ZVXA 1LEMA 1GSLA 4M3CB 5T5JA 1AZDA 2PELA 4AVSA 4P9WA 1R1ZA 3I8TA 5E88A 3L2YA 1V6KA 5EXOA 3PVOA 2VU9A 3PVNA 3WUCA 4BLJA 1DQ4A 3IM0A 1XQNA 1DHKB 3AXDA 2A3XA 4YFZA 1N1YA 1ENSA 1HKDA 1G9FA 4DS0A 1CESA 3ENRA 1H9WA 4YW3A 3UJQA 2D3PA 2EF6A 2P2KA 4Y22A 1MS1A 2VH9A 4YM2A 3LCPA 3SH3A 2CTVA 2GMPA 2R1BA 1AJOA 1DQ5A 3AYCA 4Q2FA 5DUUA 2PHWA 1KJLA 3ZXFA 3MPPG 4OZXA 1MVEA 1A3KA 2DVFA 3ILNA 3TAYA 1LTEA 1G9AA 3FLRA 2XG3A 1CPNA 3VKOA 1AVBA 1HLCA 2YV8A 3WCSA 2DU1A 1LHNA 1N3OA 5CNAA 2P3JA 4XJZA 1WBFA 4XBLA 5T5LA 1YI7A 1GKBA 1BQPA 4YZ5A 3OJBA 1AJKA 4LBOA 4YG0A 1MS5A 3M1HA 5L73A 1D2SA 1DIWA 1PZ8A 2DUQA 2NMNA 2EIGA 3V0BB 1CJPA 1LENA 4C1WA 3SH4A 4LBKA 4U36A 1V6MA 4R9DA 2ES3A 3FLPA 3OY8B 3M2MA 5H9QA 1LECA 1N1VA 4UW3A 1LHUA 1S0IA 1FATA 2WT1A 2YY1A 3WG4A 3R4SA 4MYEA 1GZ9A 2GN3A 3ZSJA 4YM3A 4FOYA 3MW2A 2ZGKA 2CWMA 1UN1A 1CQ9A 2EAKA 1Z0HA 2RHPA 1QDCA 5DUXA 1RIRA 1JBCA 1W6PB 4RA0A 2A3YA 5F5QA 2D6MA 1Z78A 4LBLA 2ZAAA 2WSVA 1ZA4A 1SBDA 1QGLA 5JMCA 1S0GA 3HN1A 5JOWA 1QOTA 2CWSA 1S0JA 5SV8A 2HYKA 4YFWA 2GALA 5GLTA 4XTPA 2DUOA 5T55A 2UWAA 4I30A 4FPJA 1N1TA 2ZHMA 5GLVA 4ASMB 1JXNA 4BMBA 2EXIA 4XYXA 1QDOA 2D6NA 2LTNA 2Q5TA 3AP7A 4GKYA 3VV1A 2WT2A 3WDTA 3ZXLA 4BOWA 2FMDA 1GBGA 3IPVB 3MW3A 2ZZJA 2TEPA 4ATFA 2JE9A 4FP3A 3BODA 4YGCA 1GNHA 1DYKA 4P9YA 5H9RA 3USUB 3AP6A 2WKKA 3AK0A 4LBQA 5GZGA 4Q1PA 3ILFA 4Y20B 1GICA 3V65A 1SLIA 4PF5A 3AZYA 3CNAA 4GXLA 2C5DA 1ULDA 2V73A 3AZXA 3D4KA 4FQZA 3V0AB 2V5YA 3AFKA 5CA6A 4GALA 4K21A 3N7LA 1SACA 2P3IA 3WVJA 1UZYA 3WDYA 1MVQA 1CVNA 1QU0A 1KDKA 3POSA 5JOYA 5KXDA 4FP2A 5H9PA 1RINA 4HL0A 2WJSA 3N7MA 4XOGA 3ZSMA 1CPMA 2D3RA 5AVAA 2D7FA 3D5OA 5GM0A 1DGLA 4HANA 5IUQA 1Q8QA 2DVDA 3DGTA 1IS4A 2A6VA 4K20A 1ULEA 4WVVA 2OW4A 3I4IA 4P9XA 3FLTA 2UURA 4UW5A 3QCWA 1CONA 4FPKA 5F9TA 2R1DA 4FPOB 3ATGA 1GZWB 1MZ6A 3OYWA 2ZGSA 1IS6A 3WDUA 3FUOA 2CY6A 1DBNA 4R9CA 3B69A 5IK5A 1MS0A 3B01A 3V64A 1IOAA 4XHXA 4YZ2A 3BIWE 4RL7A 2GNMA 4AGVA 4AVVA 2GNBA 3N7JA 2JECA 1W6OA 2ZGTA 2WSUA 4YW1A 1TEIA 3RS6A 1FV2A 1HQWA 3ZSLA 2ZBJA 4BPZA 1HQLA 2DU0A 2H0BA 1S0CA 4JCKA 1QOSA 1UL9A 3LSDA 1SBFA 2DWRA 4WVWA 1LHOA 4D69A 4DRVA 5CBLA 5DG2A 5LK5A 3O0XA 2NM1A 1LULA 2OVUA 1WW4A 3NWKA 3RG0A 1LOCA 4R9AA 5DZEA 2W68A 5DZGA 5HCFA 4M3CA 2W52A 1O4ZA 1UPSA 1MS9A 4LBJA 4DQAA 5IK8A 2A75A 1DQ0A 3M3CA 1A8DA 4Q8LA 2D6PA 1JUIA 4LBQD 4DRRA 1IS5A 1F9KA 1HDKA 1SLTA 1W6QA 2DUPA 4AVTA 2ZABA 3JU9A 3WG1A 1G9CA 4M3CE 1AXZA 1UKGA 1S1AA 4K1ZA 5GZDA 1A78A 3FBYA 4UW6A 1EPWA 1V00A 3FFZA 1QNYA 3FUQA 2A6YA 3WHUA 1LESA 1VAVA 1YYNA 4YGBA 5BYNA 2PHRA 1GYKA 5KXCA 1V6IA 3INAA 4XJ8A 4YGEA 4C1XA 2E7QA 2P34A 1S0DA 1LEDA 3WNXA 1OQ1A 1SCRA 4Y26A 1VALA 1YIFA 4AGGA 2R0FA 3NV2A 2Z42A 2ZGNA 3AZWA 4AWDA 3SLIA 5IT6A 3B00A 4XTMA 4XMAA 2ZGPA 3Q9OA 5JOZA 1LHVA 1V6NA 3WCRA 3ZXEA 4FPYA 4M3CF 3V0BA 2D6OX 2DTYA 5JVVA 1QNWA 4YG3A 5EWSA 3OY8A 2YZ4A 1UMZA 2DVGA 1SBEA 2NN8A 4FPEA 5T52A 3O5SA 1MS3A 1UAIA 2A6WA 2UWBA 4Q26A 1F31A 3A4UA 1Q8SA 1C4RA 3WOGA 5GLUA 1WLDA 4YZ1A 1PZ9A 1DYPA 2ZGMA 3N7KA 5EYXA 3RQ0A 1W6PA 5E89A 1WCSA 1FNYA 3ASIA 3NV3A 4YZ3A 2R49A 4Q8KA 3M3QA 5DZFA 1Q56A 3OBRA 2ZACA 2D6KA 2OUHA 1BKZA 4ATEA 1DQ2A 1KQRA 3M3EA 2JE7A 1X50A 3MW4A 1SLCA 3SISA 1VIWB 4ZKTB 2AGSA 4GWMA 3O12A 2W39A 3AP4A 2KM2A 1D0HA 2WNEA 4XBNA 1FAYA 3AYDA 3AYAA 4R9BA 1W6NB 1CIWA 1YRZA 4DPNA 1W6MB 3UK9A 4BLIA 2D6LX 2WQZC 1GLHA 2ARXA 2C9AA 4PBOA 2GMMA 3APBA 4Y1VA 3USUA 4AYUA 2JJ6A 3ZPYA 1KRIA 4TZDA 1PZ7A 2ZKNA 1BZWA 4XXPA 4WZFA 4Y20A 1I1EA 1LU1A 3MEPA
chains in the Genus database with same CATH superfamily
4K40A 1S0FA 5FWEA 1UOGA 4A2UA 1IGOA 2J22A 4FPGA 1W28A 2YBKA 2WBKA 2CYFA 2UWCA 2BBVA 2RE9A 1WD3A 3ZN5A 1HJGA 4FPFA 3RYRA 1JN2P 4AVCA 2PQQA 3KZ4C 3NVCA 3BB6A 3MF6A 3THTA 2HWD3 4EZHA 2RMU3 5FY9A 4AI3A 2VMDA 2W5FA 4F83A 2XBO3 5J36A 4EJRA 1HRV3 2WRAA 1VBD2 4LIVA 3AKSA 4ITCA 1JTZX 4J1XA 4NRPA 5H9SA 2BDRA 2PHUA 3ZKYA 4COWA 1RUE2 2WLPA 2ZGUA 4GH4A 2DV9A 5FXZA 1LOFA 1IKQA 1VMFA 2BOJA 4DXTA 2ZGLA 3TRSB 4CUBA 2A7AA 1HXS2 1UX7A 4W65A 3OSDA 4CEYB 3B9CA 2X10A 5F6KA 4A6SA 1Y7BA 1VBB1 2ZOEB 3VBSA 4CEYC 1EV11 1P8JA 3JB4C 3PTRB 4MGYE 2J7MA 3B3QE 3KQ4B 4YG6A 2JD4A 1DLLA 1BJQA 4DEQA 1SQ4A 2I07B 1YI9A 1JI6A 3RJ2X 2E26A 2GC2A 1D0GA 1ZBE1 3E6CC 3T09A 1FI2A 3WW3A 3NQHA 4CU9A 2QE3A 2ZMLA 5ANQA 3VKMA 3DUIA 3I59B 3MDPA 3ZKUA 2PFWA 3GHMA 4YVWB 3E1F1 4META 4YM0A 1MEC2 1Q8VA 2D44A 3SITA 4URTA 4DFSA 3U4XA 3K46A 4OHWA 4YVWC 5FY7A 4LKDA 2GNTA 1GQGA 1STMA 2E7TA 3LEIA 3VHPA 4ES9A 1OFSA 5I8SA 1QHDA 4V1PA 4JGZA 4CP2A 2VMGA 3J8F3 1HN0A 4NIAA 3AVRA 5DUWA 1QJX3 3FX3A 2WNUB 4XE9A 1NYWA 4NPMA 3T2PA 2XVGA 3KS7A 5C7GA 2JB8A 2JDKA 3Q8AA 4UF0A 3SKJE 3H8OA 4YGDA 3AC0A 5LBFA 1FXZA 2JG8A 4QM9A 2DF7A 3IIIA 5L7OB 3LGRA 3WQ7A 3ZYFA 3USSA 3GXUA 3VDDA 4PBPA 3EQEA 3HMYA 1FX5A 1QJU1 3DYOA 4R4ZA 5FKBA 5FMOL 3HOBA 3A21A 3EO6A 1AR82 1E57A 4CDWB 4N53B 3PUIA 4IE6A 1QJY2 3WEZA 4CVUA 2NQYA 4E4HA 3OD0A 1JU3A 1N47A 4JDOA 1LOAA 5ACA2 3DKQA 4N53C 4P02B 2JKBA 2EXKA 2R063 4FOVA 1DDLA 3W59A 2SBAA 5IYYA 2ZX3A 1NUKA 3ZMOA 1YLLA 4Q4Y2 3I3DA 2OUJA 1MQTC 2BWCA 3A0KA 3K75B 4NOTA 1V0AA 1ALYA 1AX1A 3AL5A 3WNPA 2AR6A 4PHZA 3FC0A 4JRLA 1H9PA 3J7HA 5KC6A 5L9BA 2P3KA 1O4YA 2YC2A 1RUI2 3OPWA 1BXHA 3WX5A 3ZSEA 4FCAA 1OURA 2WS91 4I01A 4KWJA 5K8SA 3KQRA 5LEJA 4ZZ8A 1BEV2 2JX9A 1BVVA 2BERA 4QQ2A 4OI4A 4XC9A 4NAOA 2G4IA 1NCRC 2CGNA 3U07A 1AL21 1WLWA 3KWVA 3VBOA 1K45A 3BYWA 3IPVA 3I2GA 2BPA2 4KG0A 2Z79A 4Q4W1 3AKTA 3VL9A 4PF1A 2CNAA 5JWPA 1UQXA 5A6YA 2VOXA 4YVSC 5KR7A 3R4UA 5C8WA 1JODA 1W03A 4EN7B 3E6DA 4OQ8A 4KWUA 1SLLA 1W6NA 4C0HA 4LBQB 2GN7A 1OD3A 1F5JA 1W0OA 4AR2A 1XRUA 1Q8OA 4UFLA 5CADA 1RUH1 4JHZA 2XMLA 3POFA 1EAH1 1C5IA 5C5UA 2EA7A 4AEJA 2R6QA 1VBB3 1V9U2 4QGMA 5J37A 1EV13 3KV5A 2W3JA 2R042 4LA3A 3MZHA 4N9HA 4CSWA 2XKOA 3NJZA 3OGSA 5FZLA 4HLTA 1AYN3 3POYA 3W5MA 1ZM1A 3AP5A 1EUUA 1DZQA 1PO22 4Z2WA 1S2KA 3DL3A 2BEOA 3M3OA 5FZ0A 1FNZA 1CZSA 1DFQA 3R05A 4XMIA 2XLFA 5T3NA 2MEV1 1WGPA 3AP9A 2LS6A 2PMWB 1ZNPA 4YYOA 2OZJA 2MHFA 3PU8A 1LAJA 2QVSB 4FTSA 2CGOA 4ZZ5A 1JZ7A 2B8MA 1X33A 1AR91 5FY5A 4QU2A 4ZONA 1Q8PA 3NAPB 4J1WA 3I3EA 1B35A 1IG3A 1VBA1 4LNVA 1A34A 3UKVA 2FCUA 4DB5A 1PO12 3CDZB 4QB2A 2IXHA 4AF9A 5C5TA 3LEMA 3S5AA 2E9QA 3T0AA 3H3LA 2EXJA 3CZUA 4X8NA 1X7NA 2C24A 4IDZA 2NYYA 3QH6A 4OHZA 4XJUA 1GUIA 3M8LA 3OCPA 1GV9A 1LGBA 2AYHA 1UPIA 5T5OA 1RUOA 1LEMA 3FHQA 3KGZA 5EPAA 2YGLA 5T5JA 4CCEA 1AZDA 2WYFA 4D8MA 2AZ5A 1PK6C 5F1RA 3VGIA 5EXOA 3J4UH 3URFA 2VU9A 3TN93 1DQ4A 3KCXA 3UESA 5FJHA 2WAAA 5C3RA 2A3XA 4YFZA 1N1YA 3D8CA 2DDUA 5CISA 3ENRA 1HV1A 1NA1C 1YNAA 2YFZA 4YW3A 1HQNA 3UJQA 4CEWA 4Y22A 2Y60A 1ND2C 2XJUA 4AG4A 4UFMA 4K8FA 1XXNA 5FPZA 3U37A 3JBG1 4D94A 3TAYA 1LTEA 5LA1A 1DGRN 3UKTA 3J7MA 3ZFEB 3VKOA 1HLCA 2WR9A 3O1PA 4HOOA 2QDNA 3WCSA 2DU1A 1JYTA 4D7TA 2RDRA 2VUCA 4XJZA 5CNAA 1DYOA 4XBLA 1NG0A 3GZTB 4J25A 4BQ2A 1BQPA 5L19A 5KWRA 3MIFA 1H8TA 2RVAA 1AJKA 1RB8G 4LBOA 3BCWA 5AC93 4YG0A 4MLOA 3WXPA 4CU6A 3WQ1A 1AL23 1XJAA 3BN6A 4LOSA 4QDSA 4I3PA 2VQAA 5BNOB 1ND3B 2EIGA 4K9SA 3VD7A 2ET7A 2XJQA 4G3YC 3RZLA 1TNRA 1UZVA 4C1WA 1C8M3 4LBKA 2ES3A 3POGA 5A6ZA 4I0BA 2OYZA 5H9QA 2E31A 1N1VA 5DAQA 1FATA 3WG4A 4EWDA 4XDPA 2HEVF 5I0DA 1RUH3 3MIHA 4OZOA 2WZR1 5HXMA 1EAH3 4FOYA 3MW2A 2Z5WA 1RUJ1 3O7OA 3RNSA 4GB33 3NNJA 5CU1A 5F3CA 4EV0A 4PI2A 5FQ0A 1W6PB 3DYMA 2AEYA 2PQSA 3CF6E 1ODNA 4LBLA 1JUHA 4AEKA 1XBFA 4NUBA 5E16A 5FMOS 5JMCA 2VR4A 3KV9A 1WMEA 5FY4A 1O59A 2BGCA 4DEVA 5IATA 4K6BA 2D5FA 5JXIA 4A44A 3K77A 2VD7A 3ECQA 2RDQA 2ZZQA 4QKFA 4ASMB 4IV1A 4BIOA 2YPDA 4XDOA 1QDOA 2D6NA 4Z2AA 1AR71 1YEWA 2WT2A 1NY71 2FMDA 2VMFA 3MV11 4GZ9A 1PMHX 2MEV3 1UZ0A 2Y6HA 3GZUC 5DAVA 3MW3A 4XUOA 4ATFA 2GC1A 2W9XA 1CAUB 3ZFGA 1DYKA 2ID4A 2WKKA 5CFCA 3AK0A 1AR93 3OUJA 4IGOA 3JD72 1VBA3 1SLIA 3E97A 4BDVB 2XL7A 3CNAA 1QXRA 2TBVA 4DUWA 5D21A 4JQTA 1PGW1 1AUYA 3AZXA 3D4KA 3OD4A 1NCQA 4QAWA 5DN2A 3THPA 3PUQA 2TUNA 3VBHA 2RDNA 1OKOA 1VE0A 2X53S 1MZEA 4GALA 4I02A 5F32A 2Y26A 3WVJA 1UZYA 3CJXA 4JX0A 4N90A 1MVQA 2FDKA 1UU5A 3SMHA 5B4NA 3FHIB 3POSA 3KV6A 5IVBA 3AB0A 4QXCA 5FZCA 1CWPA 1PVC1 4LHLA 1CPMA 2D3RA 1UXZA 1UKRA 4BH9A 3ZMNA 4HN1A 5AVAA 3UNPA 5KHHA 3D5OA 1I6XA 1DGLA 2WQ8A 4EZ4A 2VAUA 4QX3A 3DGTA 3O1VA 1ZBA2 1IS4A 2A6VA 4W50A 4GIQA 4WBBA 3I4IA 4GH4B 4P9XA 1NAEA 1PVXA 2BGOA 2UURA 1DGWA 3BALA 3QCWA 1CONA 5FYCA 2WNVC 2Q4SA 3VD5A 2OS2A 3DKWA 5FZOA 4GH4C 2Y6JA 5FFOC 2HJIA 1W2NA 4LHKA 4B1MA 4H7MA 2CY6A 1DBNA 1VMHA 4HKWA 3VBSB 3BIWE 3I97A 1W2UA 2OQ6A 4AGVA 3H8UA 3N7JA 2Y6GA 5FO7B 4M4PA 4EWEA 4BPZA 2Q8OA 1HQLA 2H0BA 3NSTA 1F4AA 1PX4A 4DZGA 2DWRA 2VCAA 2Z69A 1LHOA 2DBNA 3O0XA 2QJVA 2NM1A 2IFRA 3WF2A 4QPIB 3RG0A 3AVSA 4R9AA 5DZEA 2W68A 1Y9GA 2YGMA 5DZGA 4EN0A 5HV4A 1SPPA 1UPSA 2VQ0A 5IK8A 2WUHA 3G6JB 1TME1 2BGPA 4LUMA 2GAUA 4FTBA 2XPJA 4X6QB 1JUIA 4A7ZA 4DRRA 2W47A 1IS5A 1F9KA 1SLTA 2K2SA 2QZ3A 3Q8EA 4QDQA 3J26N 2YDEA 4QPGA 1HW5A 5HI0A 5CKNA 3H1WA 4BQ3A 2XQXA 1V00A 4UF0B 3KCYA 4JGZC 1RUJ3 1HRI1 2E63A 5D1IA 5I0UA 2JG8B 4BWOA 4RS5A 3AKPA 4YGBA 3VHOA 3MIGA 3VDDB 3C3VA 2PHRA 2B45X 4XJ8A 2JG8C 4G4FA 2F17A 1V70A 2E7QA 2P34A 1S0DA 4CDUC 3OGRA 2J1UA 4Q4W2 3VDDC 5BY5A 2IUWA 4Y26A 5ISLA 3DPRC 2G19A 4AGGA 1RUC1 3B7MA 2ZGNA 4MX3A 1UU4A 1AR73 1R081 2PYTA 4XFAA 1RMU1 3U75A 3ZFFB 2X09A 4DY3A 5JUVA 4XTMA 2VZSA 3Q9OA 4XFFA 5LASA 1LHVA 4D7YA 4AI9A 5JOZA 4FPYA 3V0BA 2D6OX 2DTYA 3ETQA 5FP9A 4KWKA 3BKZA 1ULOA 5IFTA 1SFNA 3OY8A 4OMDA 4ORFA 3JZVA 1DU3D 4MH0E 3IB3A 4HETA 4N7UA 5DPNA 5K4LA 5DDJ2 4MXWA 1F31A 4WM7C 1FPN2 5EJ1B 3WOGA 2DCTA 1WLDA 4QQLA 2R072 3RQ0A 4EN9B 5C4WB 2C26A 4Q4X3 5B4XA 5JAXA 2IXKA 3OBRA 3POEA 4H14A 3IDAA 5BNNA 2D6KA 2OUHA 1BKZA 3O14A 4PIYA 2Y34A 1X50A 1SLCA 1VIWB 1YQ2A 5FYZA 5FZBA 4ZKTB 2AGSA 3VBOC 3H7YA 5FYVA 1OPMA 4HONA 1OLRA 2KM2A 4XFBA 1D0HA 3O1RA 4HVOA 1FAYA 4AEDB 4RN5A 3NW4A 1W6NB 3O1MA 4QQOA 3UK9A 5FZMA 4BLIA 1UD1A 2ARXA 3DEMA 3VBRC 5JIUA 3MFAA 2JWPA 4TZDA 1H0BA 3MO4A 4BE3A 4JKMA 4E8CA 1NQJA 1W9YA 4XXPA 5F37A 1PHMA 2W1SA 4DOUA 2RDSA 4QHZA 5FZHA 2BFUS 2XR4A 1CN1A 1DF0A 4RHV1 1WLCA 1REFA 4H55A 2JEMA 5C3QA 3RI8A 5FIXA 1GWMA 3MBWA 3RZGA 1XNKA 1UMHA 3MIEA 5C33A 3BU0A 2JE8A 2RG4A 3RZZA 4MV2A 3I3QA 5A7PA 3R4DB 4X6RB 5APAA 4WV8A 3I2OA 1NXMA 1VP6A 1R093 2XHKA 2RR12 1BYHA 4DINB 2VPVA 3GBFA 3WNLA 1V6OA 3MUY1 2VNOA 2GC0A 3H50A 1QMJA 1G8WA 2A1XA 2D98A 2E33A 3RGBA 1TME3 4QXKA 4HBNA 3BPSA 4LTAA 4A3XA 4KI5M 4DNYA 3GJAA 3T1LA 1RITA 3VBUC 3ZIXA 3ALQA 5GALA 4BIFA 1ENRA 4KG8A 2VOTA 2NLRA 5FYHA 1LRHA 2Q8DA 4P14A 5LRSA 1B35B 1IPSA 1GWKA 4Z92B 4NAMA 3JBG2 3GJBA 1JOPA 1GZWA 2P6HA 4IQPA 4NO4A 1WW5A 1ULCA 1BMV1 2VMHA 3O0WA 3QACA 1C1FA 4XILA 1ZRRA 1D4VB 2RMU1 4D6SA 1GANA 1GQPA 2Z4FA 5E8AA 2B7YA 3WV6A 2JDMA 2XBO1 4KU8A 1UZWA 2CV6A 3SH5A 4IE4A 3PVEA 5FP7A 5FZFA 3VZLA 1AX2A 4QX5A 5FUPA 1W3VA 1QJZA 4Z82A 2VOWA 4AVAA 1M4WA 1ZZ8A 3ZXGA 4HSJA 5GLWA 5A70A 1KFXL 3LB9A 3VUOA 4QD2A 1R083 4ZXEA 4F7ZA 2P3YA 2WWSA 1NXD1 3T2QA 3FHAA 4L92A 5BXXA 5DXDA 3HQRA 3J9SA 1LODA 3E6BA 1LCLA 2ZGQA 3EHKA 4CEWB 4Y22B 1LOBA 3I3BA 4GJYA 1IG0A 2JG9A 4IGQA 4DXZA 4XBQA 2A70A 1WCDJ 1IS3A 1AX0A 5DUVA 3KF3A 4FPLA 2AUYA 2XL9A 3ZLIA 4CEWC 2B39A 1PM4A 1AHSA 2A5ZA 4TN7A 3E5XA 1CD3G 4W6XA 3T1MA 4NHYA 4ONUA 1N1SA 1LNSA 2Y0OA 5FZKA 5A7QA 1JH5A 3K4AA 4LITA 4CU7A 5IK4A 1VLNA 4BQ1A 3MLJA 4GKXA 4LKEA 4XF0A 4AOCA 3H1YA 1YUDA 4B4RA 1RHI1 5FP3A 1C1LA 1LHWA 2QZ2A 2YROA 4EN6B 1H8TB 4I0WB 5ABJC 1S0BA 1YQCA 1UOBA 2QCSB 1RUD1 2ZPXA 4NROA 4QGNA 3A7QA 3ZYJB 4CTEA 5BNOA 3GZEA 3HJRA 1S4CA 3N36A 3BVCA 3NJXA 2JICA 1PNFA 1WUVA 5EYYA 2DTWA 3H8XA 4FVVA 4YLZA 2AACA 3GF6A 5GLZA 5LWBA 1IQDC 2ZTNA 3J8F1 1S2EA 1JS9A 1F5FA 4ZU7A 2VW1A 2NP0A 4MHUA 3VKFC 3SHRA 3HR9A 1SFYA 2QTWB 2FQPA 1GOFA 4KBBA 1B09A 2VMCA 5GZCA 2CDOA 3RZMA 2ZAHA 2V4AA 4BM8A 4Q29A 5FXXA 4LKFA 3T08A 4C90A 5FQ0B 3RI9A 5FPBA 1FMD2 2ZMNA 4F8AA 3TEZA 4DUXA 1PIV1 1RUF2 1Z7S2 1VBE2 2WO7A 1FOD1 4NMIA 5GZFA 2R16A 4AQ2A 5JXHA 1QQP2 4BB3A 2PHXA 3JXSA 1RUNA 4YW2A 3N9PA 1RYYA 2AREA 1N3PA 3RSJA 2VZRA 3MICA 4PIXA 3ZPOA 1WW6A 2DYCA 4TYSA 2WLQA 4IV1B 4Q4Y3 3WZ1A 1L7LA 4DXRA 3K4ZA 2D3SA 4RYDA 2A73B 2JDZA 4LIUA 1C8NA 4K3UA 4L8QA 4IV1C 5CIRA 3JUUA 4CZSA 3IN9A 1PMJX 4Z07A 3ZFGB 3EXUA 4MG2A 3OGVA 4GWNA 2VM9A 1DP0A 1W99A 3RZJA 2O8QA 5CFCB 1PX3A 1XYNA 1D4M1 2YMZA 4M00A 3ZFGC 3N9QA 1VRH2 2IXIA 4ISQA 4KH9A 4UOJA 1VAMA 5FY1A 2BZDA 1Q5OA 2VVDA 3RZKA 1UZZA 3HIFA 4LORA 1RTVA 2RS51 1LU2A 1XOYA 1XB9A 3LEKA 2LUWA 3ES4A 1NCQB 3MHZA 2VXJA 3VBHB 2UY9A 1WMFA 1JOJA 2ZJCA 4CXYA 2YBSA 5HCBA 4AHYA 4OULA 1NCQC 4K1YA 2GH2A 1J3PA 1QXPA 4YM1A 1DQ6A 3VBHC 5J98B 1N3QA 1SFPA 4PIZA 1G86A 2RM22 4B29A 2E51A 5CVRA 2ET1A 2DFBA 1UX6A 3BOWA 2EVXA 1XNAA 1H4HA 3G7DA 4LO5B 1RUG1 3PTYA 2ZHNA 5T50A 1ULGA 4CA9A 2HWF1 1CJDA 3C7HA 3BTYA 5BV6A 4TLFA 1OFNA 4K8RB 1JHJA 2RS31 1XYOA 3L9JT 1Y3TA 5FZOB 5BNPA 5I91A 3ACGA 2VECA 4LMFA 4DO0A 5JOXA 5FZGA 2WFF1 3WDWA 4O7XA 1XNTA 2HWB2 4AFBA 4JGYA 4GD4A 4IL7A 1KJRA 4TSVA 5T5PA 5C3OA 3K3NA 4UBHA 1GOHA 2F4PA 2JENA 3EBRA 2EXHA 3U11A 2HEYF 1I9RA 2ZS6B 3A0NA 1O3TA 1OVSA 5F5CA 1FYUA 4Y4RA 1AYN1 2BQPA 2VQUA 4PLMA 5F5AA 3IKWA 2KA3A 1CGPA 2WN3A 4P9LA 1QF3A 4QPIA 2VZTA 1H6XA 1O3SA 2DCKA 1RHI3 3JB8A 3ZVXA 5LBCA 1JZ6A 2CGPA 4J6GA 3I2KA 1GSLA 5CKQA 1RUD3 2PELA 4AVSA 1SPPB 4P9WA 4XAAA 1U5XA 3M4FA 4NN0A 4W6YA 3PVOA 3PVNA 2GP3A 4KL1A 1POV1 4NVPA 5FP4A 1AR61 3H9AA 4BLJA 1H2NA 5IVVA 1OOPB 1X36A 4DIQA 1G6NA 2WZ8A 3TEXA 1U5IA 1OSGA 5KC5A 3LE0A 4QPGB 3B93A 5FBJA 1G9FA 1XU2A 3EJKA 4DS0A 2ADDA 4URAA 2D3PA 2OPWA 5A3LA 4NHXA 2HWC1 4YM2A 5A33A 4Y33A 4JKLA 5A1LA 3SH3A 2CTVA 2J1EA 1AJOA 3FL7A 2WNUC 2R32A 3ZYGA 3DV8A 3I54A 5FUIA 3MPPG 4HN0A 1W8ZA 4JZRA 3ZXFA 4FSJA 1UIKA 4RS5B 5FYBA 4OI2A 2K46A 5L7OC 4QT6A 1VB2A 4JDNA 1PIV3 4Y4YA 1AVBA 2YG0A 1FOD3 3ZXAC 4RS5C 4I09A 1LHNA 1N3OA 2Q8EA 1O6UA 1WBFA 4OFGA 3WW2A 1RVF2 1XE7A 2RS12 3TN91 4CPBA 1YI7A 3S6PA 3H3ZA 5J1XA 4N43A 3TEWA 4EROA 3ZFFA 4CDWC 3VL8A 2BRTA 5FUNA 4H7LA 3K48A 4OHVA 4LLFA 1J3QA 3M1HA 3KVAA 5L73A 2V4VA 5I0TA 1D2SA 3WW1A 4QM8A 4A7YA 1PGSA 4LK7A 3V0BB 3CQOA 3KSCA 4L2NA 2JB4A 2W91A 3M2MA 3OY8B 2E32A 1LECA 1D4M3 1YJLA 4MYEA 4M0NA 2P4EA 3J7LA 3LA3A 4YM3A 5IFPA 1KFUL 4MXWB 1C5HA 2J1VA 1ST8A 2RS53 4ZU4A 1UN1A 1CAVA 1CQ9A 2EAKA 1Z0HA 4CCLA 5A3TA 1K42A 1JBCA 4HKOA 3O1OA 5C4WA 4RA0A 5F5QA 5AC91 2D6MA 3MPBA 2ZAAA 2WSVA 1ZA4A 2KD7A 1LR5A 1QOTA 1S0JA 2CWSA 2PAEA 4YFWA 2CAVA 2GALA 5BNNB 2HH9A 4HVRA 4XFIA 5FK7A 2UWAA 3POIA 3W20A 1BK1A 3R0RA 4FPJA 4QU1A 4E2QA 5GLVA 1C8M1 3QOPA 4QXBA 2PAMA 3N9NA 1F15A 4XYXA 2Q5TA 3AP7A 4AEDA 5BNNC 1ZZCA 3ZXLA 1R1A2 1GBGA 1RUG3 4Q4V1 1YQ8A 2BWAA 4ASLA 2HWF3 2JE9A 3C7OA 3B9IA 3KGLA 4FP3A 4P9YA 3GCXA 4HKLA 3UGHA 2RS33 4GB31 4AXOA 3AM2A 3DXUA 4QXHA 2WFF3 4KGQA 4XUTA 3ZOIA 2HWD2 3GM8A 1F4HA 3H42B 2VOKA 4JHTA 1W0NA 2QQLA 2H0VA 1HRV2 1OA2A 4FQZA 2W92A 4CPBD 1OLMA 3KD4A 1AYM1 3AFKA 5CA6A 1GU3A 4LK6A 3VZOA 1QEXA 1YWKA 2P3IA 3M3IA 1XC6A 4KQ7A 1CVNA 2TNFA 4E4DX 3IDEA 1ZREA 1LKNA 3MGUA 1L3JA 4HL0A 1BBT1 2WJSA 3OEAA 2FMYA 4HVQA 3C8XA 1COV2 2W2IA 2VTXA 4QQHA 1E5SA 1D2QA 5DQ0A 1ZRDA 3F2ZA 4HANA 4A41A 1POV3 4XF4A 2DVDA 1AR63 3E5QA 4K20A 4V2VA 3WF0A 4OYUA 2NPIA 3WNMA 3FLTA 3K2OA 5F2WA 2IXLA 3LZZA 1NZCA 2Y6LA 4NR1A 5F9TA 2Q8CA 4IEUA 3NAPC 2R1DA 4FPOB 1J1LA 1GZWB 3AMMA 2HWC3 1IS6A 4NPLA 3TNPB 4MXVA 3VDAA 1IOAA 3ZX7A 1ENXA 2VZPA 4BXFA 3LEGA 4LPLA 2GNBA 5J96B 2GZWA 3P1IA 2JECA 3DECA 3ZSLA 1TEIA 4PT6A 1FV2A 1W06A 3IT8A 4HZFA 5C70A 5LA0A 1S0CA 1W8HA 2W94A 5FLHA 2QQPA 4AHWA 4WVWA 4QGLA 4W6WA 2W1QA 4O61A 1LULA 1X8MA 1WW4A 4MGKE 1SDDB 1RL3A 3NWKA 4OUSA 3LDRA 1YFXA 4M3CA 2W52A 5FYIA 1O4ZA 1Y43B 3P5BA 4LBJA 4A3ZA 3M3CA 1QJX2 2E7AA 1K5MA 4EN8B 4LEJA 3R6SA 1J3RA 2D6PA 3L2HA 2HBUA 2ZXQA 4C0BA 4XPVA 4YWAA 1HDKA 4AVTA 4XUNA 4MGIE 5F7UA 2JG9B 2AEZA 1AXZA 1UKGA 3HT1A 1S1AA 2Y6FA 3LDBA 3THCA 4QPYA 1GR3A 4K7JA 2QNKA 1H1MA 1TMF1 1GQHA 3EMRA 3FUQA 2OPKA 4JTNA 2RV9A 3WHUA 1LESA 3ZFEC 5C9AA 1VAVA 5CG9A 1YYNA 1QWRA 1VPHA 5BYNA 2HWE1 3PL0A 1V6IA 4C1XA 2R062 2PA7A 1OQ1A 2JDYA 4BXSV 1SCRA 3IBMA 4PLOA 1PGL2 2I74A 2QQVA 4YARA 4FFHA 3I2FA 2Z42A 4X8PA 4LR4A 5BNOC 4MGZE 3UKNA 1ND3C 4JAAA 3M7AA 1W9TA 3SLIA 5IT6A 4XMAA 2CSGA 3WP5A 4AZZA 4HK8A 4NJ4A 4Q4V3 1OMIA 2AC1A 1I5PA 2BYVE 5EWSA 3RZHA 4CDXB 4OUMA 5IAXA 1SBEA 1ASJ1 5CEHA 5LY2A 5A7WA 2FDGA 5I8YA 1UAIA 2XJVA 2QQOA 3O1TA 5EFUA 1GOGA 4LO8A 2UWBA 2WQ4A 5E1RA 4Q26A 3U78A 4AHZA 2YU1A 3CJIA 5JZGA 3I49A 4FFIA 5HV0A 4CYDA 1CAXA 5GLUA 1DCSA 3BTXA 4MZUA 5LZ6A 1PZ9A 2VNRA 2ZGMA 1AYM3 3AMNA 3LOIA 1JOBA 4IEOA 4WVZA 5EJ3A 4ZU5A 1TZOA 1FNYA 3ASIA 3CEWA 3PUSA 3NV3A 3FE5A 3VZJA 1G9BA 3PUAA 2FCTA 4GWJA 1O8PA 1BBT3 4ET7A 3B5LB 1UMIA 4D6QA 3VZKA 4OI1A 4CCCA 5CFDA 3WF4A 3Q8CA 2BV4A 5DDJ3 5A3OA 4QMAA 2FD8A 5KHGA 4XFHA 3SEEA 2FDHA 1VBB2 1EV12 4DPNA 5JSOA 5LA9A 1GLHA 3LPFA 2C9AA 4PBOA 4CCKA 2W1UA 3ZPYA 4E4ZA 2JDNA 2VGDA 2VZQA 2ZKNA 4MHRA 5BUVA 4Y20A 1I1EA 1ZBE2 4ASKA 4RSUA 2ZX2A 2E6VA 1JMUB 2ARBA 3GALA 1YCIA 4Q4X1 1AXKA 1W39A 3VD3A 5FO9B 3AFGA 3V0AA 3HQUA 4OMCA 3WP3A 3U1XA 1ONAA 4XETA 5FMDA 3KV4A 3CU7A 1CAWA 4YNIA 1VBC1 3D6EA 4LO6B 5FAXA 1ZZ9A 3WUDA 3A23A 5FY8A 2R7EB 5HCAA 1Q3EA 5J09A 2PHDA 1WBLA 1O5UA 3U4SA 4OI0A 2VXRA 4EYUA 2D97A 1I3HA 3E5UA 2C4XA 2GC3A 1ULPA 4C91A 2RJLA 2OQ7A 1LOFC 4QHOA 4RFRB 1T2XA 2NZ9A 5BNPB 4UFHA 2J1TA 2VTXJ 3AJYA 4ARXA 3C2UA 2XB6C 3D0SA 2WL1A 2YPJA 4JGYB 2K0GA 5CKMA 4IEPA 4M01A 3UL2A 2FDIA 1QJU2 3VBSC 2ZHLA 2BUKA 3VHNA 1TMF3 2OX0A 1SCSA 4GJZA 4IW3A 4FAHA 5C71A 1JYNA 2RJ2A 4JGYC 2KR2A 4NHLA 1IPKA 2FZ1A 5ERLA 4XHBA 1RJ8A 3HEIA 1H6YA 1OH3A 3UGFA 3WINE 1R091 1OKQA 2QDRA 3MF9A 3VBFA 3VB9A 3NNGA 5LY1A 2HWE3 1UYZA 3I2IA 4MSVA 3GNEA 4XIKA 3ACFA 1QH6A 2PLV1 3UJOA 4DMIA 1YFUA 4QPIC 3OBAA 2P6CA 4XZPA 1MS8A 3W5NA 2WDBA 4NIDA 1OOPA 3OBTA 4D3WA 4IETA 3ZXKA 1E5RA 2YUEA 4U2AA 2YFUA 4AGRA 3AKQA 3ZXJA 3BIEA 2BJSA 2WC2A 2XH6A 3I2DA 3PHMA 5IVCA 2H6BA 3GHNA 2G9GA 4Q0SA 4XF1A 1O5LA 3H7JA 3MLLA 3C7EA 4W4ZA 4BMEA 4B3NA 4ISRA 2VUAA 3S5QA 4FOQA 4QB6A 3ZR6A 5A33B 4AFDA 3OGGA 1ASJ3 2VBBA 1VAKA 2WS92 2FDJA 1V6LA 1WMDA 3NRUA 1VBD1 1UYXA 3AYEA 4IEYA 5FLJA 3T3YA 3AJZA 2WINB 4BQ4A 4XVHA 4RGKA 1AL22 1RUE1 2PN5A 1X82A 4L11A 4TXWA 4E8DA 5D8AB 2NMOA 1KDMA 3BGAA 5K0UB 2DVAA 3DYPA 5L36A 1HXS1 4LHNA 4QKBA 2AENA 2ADEA 3T4VA 3B02A 3KHCA 5GJ6A 4N43B 2IVJA 1YO8A 3O0VA 4CCDA 2Q1ZB 3ZDVA 3ORJA 5DAWA 1YFYA 1RUH2 2ATFA 3ZFFC 1XNCA 1LOGA 3I7DA 4DY5A 1H2LA 4AW7A 1EAH2 3H0OA 4XQDA 4AFCA 4GB32 3ZR5A 2X29A 1QIQA 3SNMA 1JHNA 1YQ6A 5F39A 2YBPA 2VNVA 4XQWA 4UFIA 3HBKA 3KF5A 4FI9A 3BTAA 2N7GA 3N9LA 1MZFA 3LIGA 2B46X 1MEC1 4RFT0 3ELNA 5FXWA 3THDA 2JDAA 5IK7A 1CAVB 4AVBA 1JZ4A 3PURA 4ZXKA 1IHMA 4FAGA 4GWIA 1OLQA 3LDKA 2IC1A 1PNGA 4FPHA 4JC1A 4LA2A 2UY8A 4HT1T 4SLIA 4XUPA 1LGNA 3ETPA 3TB0A 4DUVA 1UU6A 2MEV2 5C4WC 3ILRA 1HJFA 2YU2A 4TWTA 3WDXA 1VBC3 3WY6A 3ACLA 3MV01 5DG1A 4CRQA 5KXEA 3M70A 1SLAA 4Y1ZA 4Y5SA 2Q0AA 5GKAC 1UIJA 1AR92 3OPTA 3ZSKA 1SLBA 2K9ZA 5FLIA 4JTOA 1UXXX 1R64A 1VBA2 1ZZ6A 4Q1RA 1TQ5A 3IDCB 4R8HA 4XUQA 3GBGA 5EP9A 3OTFA 4AEDC 4FOWA 5FZ1A 1FMD3 4RQPA 3RWNA 4AI2A 4XABA 5JLVA 4Q5OA 2PHFA 3WSOA 1AR81 1OA3A 2VZ1A 1FT9A 2W0XA 1QJY1 4OQ9A 2VO5A 2XDVA 5FREA 4JRAA 2R30A 3PMSA 5K7PA 2PTMA 2B42B 3BOPA 1UOFA 1UF2C 2X5IA 4FQ4A 1JU4A 5FPLA 5ACA1 1F35A 2XJRA 1W8FA 1GMMA 5JXJA 1UY0A 3T0DA 2GNDA 2VOVA 4IEVA 4M4RA 4XAEA 3NL1A 4Q4Y1 3LA7A 3RFRA 3ZYBA 1J83A 4UW4A 3Q8FA 3PIGA 4TLGA 2PLV3 4P00B 3OG2A 4IESA 3PVBB 1GP4A 2BNOA 2I2SA 1W8OA 2G9ZA 2KXLA 2VE1A 3H1MA 1H8VA 5LB6A 2W08A 4OCTA 3ES1A 4BQXA 4GA9A 1RUI1 4Q27A 4AAPA 2XHNA 3N35A 1CR7A 1U0AA 3OB8A 5I0RA 1BCXA 3NMBA 1BEV1 1IKPA 1DG6A 2A6ZA 2IFWA 3MYXA 1OHFA 4INDA 5J7MA 1JYXA 1LOEA 1UYPA 1VB4A 4XEZA 4XJAA 1M06G 4XACA 1B35C 1FV3A 2X05A 1ULFA 1NQDA 2LALA 3PIJA 4ZPIA 5I0SA 2JDPA 1VBD3 1JZ3A 2P37A 5FJKA 5SV5A 5JPNB 4KGGA 5FPVA 3CL1A 3ABZA 4HMZA 2E53A 4BU2A 1RUE3 2QUOA 5EQUA 2D43A 2QQMA 5A3UA 1SHWB 3ACIA 3NJYA 4BA6A 1AF9A 1HXS3 3LKJA 2MPFA 4PCRA 1AXYA 3LFIA 4JDMA 1Q43A 4LBNA 5FZDA 1OT5A 2ZEYA 3WW4A 1V9U1 1XU1A 4M3CB 4B8EA 2HWB3 2R041 4AHXA 5E88A 3TYJA 5JMOA 1K5MB 3WUCA 2GH8A 4OHYA 2WZR2 2EIDA 2QBXA 1PK6A 2YYOA 4O9GA 3ZIWA 1RUJ2 1DHKB 5FKCA 1MPXA 1ENSA 1REEA 3LD8A 1F8VA 1PO21 2Y38A 1H9WA 4CDQA 2Z2SB 2EF6A 2P2KA 1MS1A 3LCPA 2GMPA 1XSQA 2R1BA 1XE0A 1DQ5A 1MEC3 5DUUA 1ND2A 2PHWA 5M0TA 4OZXA 4E2SA 2VMEA 3WD5A 5C9AB 2DVFA 3TEYA 1UY4A 1Y9QA 2JXAA 4MUVA 3FLRA 2W95A 2XG3A 2YB7A 2OKXA 2G9FA 1AR72 1NY72 4BHPA 1QXJA 4OUEA 2P3JA 5I93A 1H8TC 2JIGA 5T5LA 4JVAA 4MO3M 4HG6B 1PO11 1YIPA 2PAKA 3OJBA 2IVIB 4LO4B 3S7IA 4YZ5A 3SCGA 1MS5A 2QQIA 1C28A 4OVEA 4OLLA 2WA4A 2XWBB 3ITQA 1DIWA 1PZ8A 3OOXA 1OF3A 2DUQA 2NMNA 2ZEZA 4CDXA 2YC0A 3SH4A 3X29B 1PGW2 3FLPA 1HN1A 2FDFA 3N9MA 1NLRA 1AR83 1LHUA 1XNDA 1HB3A 2WT1A 5A7WB 3R4SA 5FZ3A 3RWKX 2ZX4A 1QJY3 1RVF3 2GN3A 3DCQA 3CJIB 3HNMA 5JZGB 5ACA3 5HPOA 1CAXB 2CWMA 1PVC2 1W90A 1QDCA 5DUXA 1RIRA 1US3A 3WQ0A 4RGGA 2C0ZA 5JZGC 1Z78A 4P9GA 2Y8KA 4FTEA 1SBDA 1QGLA 5A6XA 5HBAA 1S0GA 2O8OA 2B4KA 3HN1A 5JOWA 2WWJA 4N9IA 5FYSA 4CE8A 4LT5A 3WNNA 1Y4WA 4HK9A 4B4QA 2XJPA 3BTZA 5GLTA 4XTPA 1QH7A 4I30A 5KBFA 2ZHMA 3TOJA 4QX0A 4UT5A 1JXNA 5A3PA 5CFDB 2EXIA 4GKYA 3WDTA 1RUI3 4IE5A 4FXGB 2JDUA 2BTVC 2LRPA 2WWUA 4E27A 2O0OA 2F6BA 2JDHA 4WM8A 1J84A 1BEV3 2CHHA 3QH7A 1POV0 5CFCC 2VNGA 1OQEA 1EUTA 1WCQA 2UYAA 3ON7A 2Y64A 1JYVA 5GZGA 4LJHA 2P17A 4L99A 4Y20B 1GICA 4ZS2A 5FZ8A 1JZ2A 2QQUA 4BQWA 5LATA 4O9EA 2VUDA 4EWAA 1VJ2A 2IXCA 4GXLA 1RXFA 2VMIA 4LXLA 4AI0A 1ZA7A 3KT1A 3V0AB 5FYUA 2Q30A 2V5YA 5LEKA 3PJYA 4ARYA 4HFSA 5D2AA 1CAWB 1TME2 4K21A 1SACA 3PLQA 3BU7A 3WDYA 4AAXA 1OUXA 3JCIA 3FN9A 3VD4A 5JOYA 5KXDA 4NIGA 4FP2A 3W9AA 1WCKA 4XOGA 1V9U3 3ZSMA 2VCMA 1CX4A 4YSFA 1OLME 1OXCA 1YQ5A 2R043 2D7FA 5GM0A 1H4GA 2OA2A 5IUQA 2B9VA 1Q8QA 4MVTA 5FZAA 5JSPA 5J48A 4L97A 4WVVA 1RJ7A 3NKTA 4E9KA 1HRI2 4UW5A 2VJXA 4PJYA 5C6CA 1QJEA 1PO23 4FPKA 5LK7B 2DCYA 3ATGA 1MZ6A 2WNVA 2ZGSA 4IUGA 2Y6KA 3RDIA 5IJRA 3FUOA 4IEWA 4TTGA 1XYPA 4YZ2A 2DFCA 2XGXA 4RL7A 2GNMA 4AVVA 3K3OA 2ZX0A 4BQYA 4LUKA 1RUC2 1W6OA 2WSUA 4YW1A 1COV3 2EIEA 3PUHA 4Q0UA 4AFMA 2ZBJA 4XCAA 3CMGA 4B7EA 2DU0A 3VBFB 5JSRA 1UL9A 1R082 1RMU2 1SBFA 5CBLA 1Y9MA 4D69A 4DRVA 3HBZA 3CHXA 3JD71 5DG2A 1CX1A 2BW8A 4S2HA 3T30A 3VBFC 4B7KA 3ROUA 1PO13 3D3AA 4CCMA 4Q0PA 5F3GA 1LOCA 3VLBB 5HCFA 1GZTA 5JPMB 1US2A 1OUSA 2BP6A 1WA6X 5DMYA 1A8DA 1OOPC 2OXBA 3OBZA 2BNNA 2FBEA 5F5IA 2Q1FA 1REDA 4QPGC 1WCUA 2DUPA 5FZ7A 2ZABA 3FJSA 2EAAA 3JU9A 4XFCA 4MADA 2WO2A 1G9CA 4FT8A 4M3CE 4O65A 3AKRA 4K1ZA 4AI8A 1HB2A 1AL0G 1NE6A 5GZDA 4UW6A 3BI3A 4BZ4A 1ZBA1 4RD7A 5D8AA 3FFZA 5K0UA 1J59A 1UWWA 4N8MA 1QNYA 3O1UA 5A3MA 2ORZA 1PMIA 2XJTA 3N9OA 4RR3A 3INAA 5FYYA 1XE8A 1OA4A 3LF7A 4UYBA 3WNXA 3D0JA 3F95A 4IEZA 4CDUA 1YIFA 5F3EA 3LQCA 2R0FA 3UGGA 3NV2A 4CCJA 1T6GC 3MLKA 3DPRA 3KT4A 3POBA 1T6BX 5A3WA 4NWWA 1IZ3A 4SBVA 4NRMA 1V6NA 3ZDSA 3ZXEA 4RHV2 4PDWA 5JVVA 1KD7A 1QNWA 1WMXA 2VCBA 4IERA 4YG3A 5C3SA 2YZ4A 4FPEA 2DVGA 5T52A 1I5ZA 4G9SB 5AFEA 1ZRCA 4UI9L 4LLOA 5G04L 1MS3A 1JZ8A 4Q0QA 3DXTA 2XONA 4LE3A 1MQTB 5FCCA 3SCHA 1O4TA 3WR0A 4HSLA 3A4UA 3PDQA 1W3XA 1C4RA 3V56A 4WM7A 1LB2A 2W1WA 1DYPA 4CP9A 5FK8A 5E89A 1WCSA 4E2GA 5LRRA 5KHJA 2XJSA 5JI7A 4NPRA 4Q8KA 2R49A 3BPZA 3M3QA 4COZA 1Q56A 3D82A 3HAGA 3SKVA 2ZACA 4YW6A 2ORXA 1UOJA 4XFGA 4BISA 1GP5A 3VN4A 5IHRA 1NCRB 3IMMA 5A32A 1DQ2A 1KQRA 2JE7A 3SISA 3MW4A 5LW9A 5E6HA 3O12A 3AP4A 4D6RA 2CU5A 1YHFA 2WNEA 4RQPB 4CUAA 1H2MA 3AYAA 2WZEA 4R9BA 4YVSB 1BMV2 1CIWA 4R52A 1C3HA 3S7EA 2RMU2 2OT7A 2WQZC 3NNLA 4FXKB 4RQPC 4AYUA 3USUA 3WNKA 1KRIA 2XBO2 4B4PA 4IGPA 3U10A 3VBRA 5IVFA 1NLQA 1ZRIA 1BZWA 2X5IB 4WZFA 1EY2A 1LU1A 3MEPA 3KLSA 1S0EA 1KS5A 3KHBA 2X5IC 1VR3A 1EPZA 1OF4A 5IWFA 4XDQA 2IWGB 2WZPP 1ZX5A 1OPOA 3Q8BA 1O91A 2H6CA 5L9RA 3WG2A 2LROA 4AE2A 1W2OA 2ARAA 3JD73 4LE4A 4PQ9A 4AK3A 5ANNA 5F8PA 2ETEA 1H1IA 4A45A 5JCTA 3ZYRA 5DDJ1 1TG7A 4CUGA 3WT3A 4XJ9A 3LOBA 1FPN1 1YJKA 2ZGRA 3SXWA 4IEQA 2C6SA 3WG3A 4IV3A 3WLUA 4LBMA 1WWYA 2R071 3RVHA 1ZBE3 3ACHA 3GBWA 4S2FA 5FY0A 5FZIA 4CP1A 3WHTA 3I2JA 4UAPA 4Y1YA 1MZ5A 4Z1VA 3AMHA 1WW7A 4I2OA 4NRQA 3CIHA 5JR2A 2SLIA 4GULA 4W8JA 5LBBA 3EB7A 3VBUA 2ZGOA 4MOAA 3PU3A 1MACA 4YW5A 2BOIA 3AZZA 1RHI2 3KVBA 2QQJA 5GZEA 1GNYA 1KITA 2V72A 1H1AA 1ZBA3 5EV7A 2R0HA 2HBTA 3OYWB 1RUD2 4JV4A 5IW0A 3C7GA 3VZMA 1W9SA 1EYBA 2VW0A 3IIAA 3ME2A 3QLQA 1YXWA 2IXJA 1KEXA 1U5ZA 2GDFA 3J8F2 5FR3A 1XSRA 2W87A 2WFPA 1GNZA 2ZCWA 4HPKA 3ZN6B 4E4SA 1UYYA 3AL6A 3PMEA 1H30A 2DCJA 2BU9A 1QJU3 2ZEXA 4JQRA 2RJKA 4Y1UA 1PK6B 4QX7A 4AQSA 4CP0A 2LM3A 3K4DA 2PXJA 3RYPA 2J1RA 2YC4A 1W9WA 1IPJA 1BLZA 1CZVA 5C3PA 4Y24A 2ZMKA 2JG9C 4CDQB 1PIV2 1DZTA 2RR11 3W58A 3RMYA 1FOD2 1NA1B 2WAOA 4UXAA 3H8RA 1W6QB 5FP8A 1ND2B 2YXSA 4CDQC 2JIJA 2VZOA 2XQRA 4WVMA 3P6BA 4FPCA 5FZ4A 5FMBA 2I45A 3I3MA 1EP0A 3POJA 2B9UA 4CCNA 4XJWA 3UV9A 1CZTA 1UY3A 3GZAA 3ZYPA 2V5DA 2CL2A 3IMNA 3UYJA 2XXZA 3J7NA 2FCVA 3KCCA 3LFMA 5FZEA 2A6XA 1D4M2 1SMVA 1NLSA 5ABJA 2WS93 4LOTA 3GYDA 5C8CA 3NV4A 2WN2A 4ZY9A 3N3HA 5BPXA 1LJ7A 1G7YA 4A7KA 1JYCA 4A42A 1UO9A 2RS52 4XURA 1RGSA 3WQBA 4S2GA 1SDWA 5EZWA 1RC6A 1V6JA 1XPWA 4I3GA 4Q4W3 3T4HB 1L7QA 4CDXC 5FPUA 5DAXA 5JR7B 2AH2A 3HT2A 5FYTA 2GMEA 4C8DA 2A71A 1ZYBA 2ZA9A 1HIXA 3WDVA 1F2NA 2ENRA 3ST7A 5KXBA 1ENQA 3SCFA 2VL4A 4ZHNA 2MNGA 2P1BA 1OD5A 3NV1A 2WO1A 2VW2A 4AQTA 3CZJA 2WYSA 2EIBA 1JW6A 1L7RA 1RUG2 2VCCA 5B2GB 1KXGA 3OGJA 1QOOA 1DGWX 5FZ6A 2HWF2 4P9IA 4QHBA 4KMQA 2WO3A 5FRAA 5CB7A 2BFUL 3W21A 4JKKA 2RS32 4LQRA 1DQ1A 1FPN3 1QY4A 3RMXA 3SQOA 3ZN4A 1MS4A 2WFF2 2VUJA 2Y33A 1W8WA 4QX2A 1TNFA 1W0PA 2VVFA 1NKGA 5LA2A 4D7SA 1WA4A 1SZBA 2DVBA 2R073 3AXEA 3TBDA 3N4MA 4Y1XA 4WM8B 3HD8B 4CCOA 2QQWA 2J42A 2UU8A 3POWA 3VKLA 4QQPA 4PLNA 4AEMA 1SEFA 1AYN2 1S2BA 1W6MA 4WM8C 3GDBA 3AX4A 4CUCA 4MGTA 3FWEA 1C57A 2ILMA 3VKNA 1SG3A 1J1TA 2XLAA 2FHRA 3HNBM 4XF3A 5T54A 4IXLA 1X8EA 3OPZA 3AZVA 2ZHKA 3LA2A 3OUIA 4P08A 3U14A 2EALA 2BNMA 5CAZA 2O14A 4N7IA 1HX6A 3LSEA 5FXVA 3RRDA 2VQTA 1S55A 1AR62 1HB1A 1CIYA 4XXAA 3S0MA 2ERFA 3SEPA 1NE4A 1APNA 1TVGA 3PJQA 3T2TA 1G9DA 1NT0A 1JYIA 4A4AA 2OIIA 5HXVA 5AVPA 4Z8BA 5JIAA 1ZZ7A 3NJVA 1FMD1 1NZIA 2VY0A 1WKYA 1RUF1 2HWC2 1O8SA 1Z7S1 1VBE1 3LPGA 1LGCA 1UNBA 1QQP1 4YW4A 4QPWA 4YZ4A 2DURA 5IAVA 1DGRA 2JD9A 3LAGA 1K12A 3NNMA 4NHMA 1WD4A 2A3WA 5A7SA 5BNPC 4XQ4A 4B1LA 4GMP0 2QQNA 1GZCA 2RR13 2WNVB 4QB1A 2ZEWA 1URXA 3KM5A 1QKQA 4XIOA 5FOJB 2PHTA 2Q1MA 5JDBA 1MR5A 4CEYA 2XOMA 3TN92 4GQ7A 4H3WA 2DBIA 1W6OB 2WT0A 2XKPA 2GP5A 1VRH1 2B5HA 1KS4A 3JBG3 3DF0A 2HEWF 4I0AA 5LCWL 3I59A 5A1AA 1R1ZA 3I8TA 4FFFA 1K3IA 3L2YA 1V6KA 4LO7A 3DN7A 4YVWA 4IE7A 3ZYIB 5A7OA 3IM0A 1XQNA 1W8UA 3AXDA 5G05L 3GGLA 3U0ZA 2HLEA 5FWJA 5BNQA 1HKDA 2RM21 1CESA 5J3UA 3WF1A 5AC92 1E5HA 2BBAA 2VH9A 2ZX1A 5F2SA 5FV3A 5FPXA 4GAZA 4Q2FA 3AYCA 3HVDA 3RJRA 1KJLA 3A22A 5F6LB 3ZYHA 1MVEA 1A3KA 2WNUA 2J1SA 3ILNA 4JGZB 1YFWA 1G9AA 5D8AC 1C8M2 5K0UC 3HN3A 2OZ6A 4RR3B 1CPNA 3WP6A 5KHIA 2WZR3 2YV8A 2C9KA 5L7OA 2HWB1 4Q4V2 4N43C 1WZXA 3FBMA 3VDCA 4RR3C 4CDUB 1GKBA 1HB4A 2GU9A 2O1QA 2W46A 1TE1B 4GMP1 3FMGA 2VZVA 2XVLA 3DPRB 3FFQA 3K51A 3S57A 4P5YA 4ES8A 4CDWA 3KB5A 3MFCA 2Y0IA 4N53A 3FZ3A 4PQQA 3TNQA 5K9YA 5JXGA 1DLCA 1U5YA 1ZVFA 2DCZA 3MUZ1 5DAPA 5A7NA 4XW3A 1W2TA 2F4LA 4PDWB 1CJPA 1LENA 3QBQA 4U36A 1V6MA 4R9DA 4XCBA 2VULA 1AYM2 4UW3A 4COVA 1S0IA 1MQTA 2JKXA 2L9LA 2YY1A 4HXCA 4PDWC 4S2DA 1GZ9A 3ZSJA 2C1FA 2ZGKA 4H2AA 1BBT2 3WF3A 2RHPA 4WM7B 5AFBA 2PHLA 4CP9B 1GFF2 2A3YA 4LKSA 1W2AX 3JQWA 4LULA 2D40A 2HYXA 2WNOA 4MGSA 3T0BA 5IVEA 2P5BA 2XWJB 1NCRA 4PI0A 1O3QA 5SV8A 2HYKA 2G1MA 1U12A 3OF1A 3MI8A 1XNBA 2DUOA 4FFGA 5A32B 2HKXA 4Y5TA 5T55A 1N1TA 4BMBA 3EYPA 4YVSA 4F3JA 3UETA 1RUF3 2LTNA 4BOWA 3VV1A 1Z7S3 1VBE3 4XZUG 5CG8A 3VBOB 1POQA 1QQP3 3IPVB 1PVC3 2ZZJA 2TEPA 1RVF1 2RS11 4YGCA 3BODA 4XF9A 1GNHA 1YC61 5FTTC 3RYKA 5H9RA 4QKDA 3USUB 1IQAA 3AP6A 1WLTA 2D5HA 4LBQA 3VBRB 4COUA 4Q1PA 3ILFA 4MGQA 2VC9A 2VG9A 4UFJA 4KWLA 4LHSA 3V65A 4PF5A 3IZOA 4NHKA 1A6CA 3AZYA 2UYBA 1NOVA 2C5DA 1ULDA 2V73A 1VRBA 5IVJA 2BVBA 3CBNA 3WP4A 5FPAA 2IZWA 3NKGA 1VRH3 2WABA 3N7LA 1JYWA 4CXXA 4KBZA 5FMCA 2XUMA 1QU0A 1KDKA 3SC7X 1J58A 5H9PA 1JZ5A 1QJFA 1RINA 4M0HA 4IEXA 3N7MA 3I2HA 4IV3B 5A1FA 3OEBA 4Y3OA 5L9VA 2ZKLA 5EHDA 1A8MA 1UY1A 1TMF2 3HQXA 1W04A 4IV3C 1ULEA 2OW4A 2XVKA 4YPJA 3TWIA 1KGYA 5F3IA 3VBUB 1ZRFA 4ZS3A 4L9BA 3KMHA 2RM23 4YW7A 5FDBA 2BVVA 2HWE2 1BHGA 3WDUA 3OYWA 4P9JA 1OBNA 3NAPA 4R9CA 1R1A1 3B69A 5IK5A 1MS0A 3B01A 2VBDA 3C7FA 4XHXA 3V64A 2WA3A 4RGAA 1UCXA 4QX1A 3BUCA 1GWLA 2ZGTA 4BJ0A 3RS6A 1HQWA 3P3NA 4JCKA 3VHRA 1QOSA 3LSDA 4NIIA 3CLPA 4CU8A 4IE0A 1OQDA 5LK5A 2X8KA 3VDBA 2HWD1 1HRI3 2GSYA 3ZN6A 5JI9A 4DXSA 2OVUA 4NWVA 1E5IA 2EICA 1UW8A 4HPKB 4QDRA 3WNOA 4GMP3 2FZ2A 4KNCA 3UT0A 1HRV1 1ASJ2 2VTFA 1K5MC 1MS9A 3GCWA 4DQAA 2A75A 1DQ0A 4Q8LA 5LBEA 2QKDA 5IVYA 4LBQD 3P3PA 1RUC3 1NA1A 1K5JA 1X9TA 1W6QA 5CZKA 3WG1A 1RMU3 4QKNA 4L0PA 4V2WA 1COV1 3ZM8A 3VD9A 1RXGA 1OVPA 4WVMB 1A78A 3FBYA 2WIIB 5A3NA 4OHXA 4QWNA 5DABA 3OUHA 3RPQA 1EPWA 5C9AC 3AMQA 3AMPA 1UY2A 4Y5Z0 5CYYA 4BQ5A 2A6YA 2CDPA 4AL9A 3O1SA 3IAPA 4A6OA 5EIYB 3ZFEA 2LW8A 1H2KA 4COYA 1GYKA 5KXCA 4WZCA 4YGEA 3B94A 3ZO0B 5FBZA 1LEDA 2QQKA 4EE2A 4NIHA 1VALA 5ABJB 3MIDA 1OH4A 3CO2A 5C8CB 1GP6A 3AZWA 4BK4A 5EJZB 3IDBB 4AWDA 1HV0A 5HCHA 3B00A 1D7PM 3JQXA 1OI6A 2ZGPA 5C8CC 1ND3A 3WCRA 2RS13 4M3CF 4Q4X2 4FO9A 5A6QA 4QX8A 4EQVA 1UMZA 2NN8A 1DZRA 1W8NA 2V09A 2VZ3A 3ZXDA 3QD6A 5FO8B 1W05A 3O5SA 1VBC2 3CJIC 1X9PA 1QJX1 3IWZA 3NO8A 1W9FA 1OC1A 2VZUA 2A6WA 2QFEA 4BK5A 2J1AA 3LIHA 4FBFA 4AI1A 1Q8SA 3T2OA 4YZ1A 4KU7A 3MIBA 1NX9A 4UFKA 1ACCA 3N7KA 5EYXA 1W6PA 5I8TA 3NNFA 4NE9A 3HNYM 4YRDA 4YZ3A 2XUEA 4RHV3 5DZFA 1W8TA 2ARCA 4BCUA 1BVP1 5FYMA 2CAUA 4ATEA 3S30A 3HPNA 5CFDC 5KHKA 1O3RA 3KT7A 3HWJA 3M3EA 4P5HA 4UWDA 1VMJA 5FOBB 4CXWA 4GWMA 4AQ6A 2W39A 2XLGA 3IAQA 4UBGA 4XBNA 2D93A 2R061 2VBPA 2VVEA 3AYDA 4BYYA 4Q0VA 1YRZA 3LWCA 1BK0A 3PNAA 1O7FA 1PM7A 1W6MB 5TSWA 1CAUA 2D6LX 4D0QA 4AFAA 3CKHA 1PGL1 3H3UA 1R092 2GMMA 3APBA 4Y1VA 5FZ9A 2YHJA 2JJ6A 5A80A 1PZ7A 4R4XA 1ZZBA 3VZNA 2PLV2 1R1A3 1ODMA
chains in the Genus database with same CATH topology
4K40A 1S0FA 4A2UA 1IGOA 4FPGA 2CYFA 2UWCA 2BBVA 2RE9A 1WD3A 3ZN5A 4FPFA 3RYRA 1JN2P 4AVCA 2PQQA 3KZ4C 3NVCA 3BB6A 3MF6A 3THTA 2HWD3 2RMU3 4AI3A 4F83A 2XBO3 5J36A 4EJRA 1HRV3 1VBD2 3AKSA 4ITCA 1JTZX 4J1XA 5H9SA 2PHUA 4COWA 1RUE2 2WLPA 2ZGUA 4GH4A 2DV9A 1LOFA 1IKQA 2ZGLA 3TRSB 2A7AA 1HXS2 4W65A 4CEYB 3B9CA 5F6KA 1Y7BA 1VBB1 2ZOEB 3VBSA 4CEYC 1EV11 4MGYE 3JB4C 3B3QE 4YG6A 2JD4A 1DLLA 1BJQA 1SQ4A 2I07B 1YI9A 3RJ2X 2GC2A 1D0GA 1ZBE1 3E6CC 3WW3A 1FI2A 2QE3A 2ZMLA 3VKMA 3DUIA 3I59B 3MDPA 2PFWA 3GHMA 4YVWB 4META 4YM0A 1MEC2 1Q8VA 2D44A 3SITA 4URTA 4DFSA 3U4XA 4OHWA 4YVWC 2GNTA 1GQGA 2E7TA 3VHPA 4ES9A 1OFSA 5I8SA 1QHDA 4V1PA 4JGZA 4CP2A 2VMGA 3J8F3 5DUWA 1QJX3 3FX3A 2WNUB 4XE9A 1NYWA 2XVGA 3KS7A 4YGDA 1FXZA 2JG8A 4QM9A 2DF7A 5L7OB 3LGRA 3WQ7A 3USSA 3VDDA 4PBPA 3EQEA 3HMYA 1FX5A 1QJU1 4R4ZA 5FMOL 3EO6A 1AR82 1E57A 4CDWB 4N53B 1QJY2 2NQYA 3OD0A 1N47A 4JDOA 1LOAA 5ACA2 4N53C 2JKBA 2EXKA 2R063 4FOVA 1DDLA 3W59A 2SBAA 2ZX3A 3ZMOA 1YLLA 4Q4Y2 2OUJA 1MQTC 2BWCA 3A0KA 4NOTA 1ALYA 1AX1A 2AR6A 3FC0A 4JRLA 1H9PA 5KC6A 2P3KA 1O4YA 1RUI2 1BXHA 3WX5A 3ZSEA 4FCAA 2WS91 4I01A 4KWJA 5LEJA 5K8SA 3KQRA 1BEV2 2JX9A 1BVVA 4QQ2A 4OI4A 2G4IA 1NCRC 2CGNA 3U07A 1AL21 1WLWA 3VBOA 2BPA2 3IPVA 4KG0A 2Z79A 4Q4W1 3AKTA 3VL9A 2CNAA 5JWPA 2VOXA 4YVSC 3R4UA 5C8WA 4EN7B 3E6DA 1SLLA 1W6NA 4C0HA 4LBQB 2GN7A 1F5JA 1W0OA 1XRUA 1Q8OA 5CADA 1RUH1 1EAH1 1C5IA 2EA7A 4AEJA 2R6QA 1VBB3 1V9U2 4QGMA 5J37A 1EV13 3MZHA 2R042 4LA3A 4N9HA 2XKOA 3NJZA 4HLTA 1AYN3 3POYA 1ZM1A 3AP5A 1DZQA 1PO22 4Z2WA 1S2KA 3DL3A 2BEOA 3M3OA 1FNZA 1DFQA 3R05A 4XMIA 2XLFA 5T3NA 2MEV1 1WGPA 3AP9A 1ZNPA 4YYOA 2OZJA 2MHFA 2QVSB 2CGOA 2B8MA 1X33A 1AR91 4QU2A 1Q8PA 3NAPB 4J1WA 1B35A 4LNVA 1VBA1 3UKVA 4DB5A 1PO12 4AF9A 2IXHA 2E9QA 2EXJA 4X8NA 1X7NA 2NYYA 3QH6A 4OHZA 4XJUA 3M8LA 3OCPA 1GV9A 1LGBA 2AYHA 1UPIA 5T5OA 1RUOA 1LEMA 3KGZA 2YGLA 5T5JA 1AZDA 2AZ5A 1PK6C 5F1RA 3VGIA 5EXOA 3J4UH 3URFA 2VU9A 3TN93 1DQ4A 3KCXA 2A3XA 4YFZA 1N1YA 3D8CA 3ENRA 1HV1A 1NA1C 1YNAA 4YW3A 3UJQA 1HQNA 4CEWA 4Y22A 1ND2C 2XJUA 4AG4A 4K8FA 1XXNA 5FPZA 3JBG1 4D94A 3TAYA 1LTEA 1DGRN 3UKTA 3ZFEB 3VKOA 1HLCA 3WCSA 2QDNA 2DU1A 4D7TA 5CNAA 4XJZA 4XBLA 1NG0A 3GZTB 1BQPA 5L19A 3MIFA 1H8TA 1RB8G 1AJKA 4LBOA 3BCWA 5AC93 4YG0A 4MLOA 3WXPA 3WQ1A 1AL23 4I3PA 2VQAA 5BNOB 1ND3B 2EIGA 4K9SA 2ET7A 2XJQA 4G3YC 1TNRA 4C1WA 1C8M3 4LBKA 2ES3A 4I0BA 2OYZA 5H9QA 1N1VA 1FATA 3WG4A 4EWDA 2HEVF 1RUH3 3MIHA 2WZR1 1EAH3 4FOYA 3MW2A 2Z5WA 1RUJ1 3O7OA 3RNSA 4GB33 5CU1A 4EV0A 5FQ0A 1W6PB 3CF6E 4LBLA 1JUHA 4AEKA 5E16A 5FMOS 5JMCA 1WMEA 2BGCA 4K6BA 2D5FA 3ECQA 2ZZQA 4ASMB 4BIOA 4IV1A 1QDOA 2D6NA 1AR71 2WT2A 1NY71 2FMDA 3GZUC 2MEV3 3MW3A 4ATFA 2GC1A 1CAUB 3ZFGA 1DYKA 2WKKA 5CFCA 3AK0A 1AR93 3JD72 1VBA3 1SLIA 3E97A 2XL7A 3CNAA 1QXRA 2TBVA 1PGW1 1AUYA 3AZXA 3D4KA 3OD4A 1NCQA 3THPA 2TUNA 3VBHA 2X53S 4GALA 1MZEA 4I02A 3WVJA 2Y26A 1UZYA 3CJXA 4N90A 1MVQA 1UU5A 3SMHA 3FHIB 3POSA 3AB0A 1PVC1 4LHLA 1CPMA 2D3RA 1UKRA 4BH9A 3ZMNA 4HN1A 5AVAA 5KHHA 3D5OA 1I6XA 1DGLA 3DGTA 1ZBA2 1IS4A 2A6VA 4WBBA 4GIQA 3I4IA 4GH4B 4P9XA 2UURA 1PVXA 1DGWA 3BALA 3QCWA 1CONA 2WNVC 2Q4SA 3DKWA 4GH4C 5FFOC 2HJIA 4LHKA 4H7MA 2CY6A 1DBNA 4HKWA 3VBSB 3BIWE 1W2UA 4AGVA 3H8UA 3N7JA 5FO7B 4EWEA 4BPZA 2Q8OA 1HQLA 2H0BA 3NSTA 4DZGA 2DWRA 2Z69A 1LHOA 3O0XA 2QJVA 2NM1A 2IFRA 4QPIB 3RG0A 4R9AA 5DZEA 2W68A 2YGMA 5DZGA 4EN0A 1UPSA 2VQ0A 5IK8A 3G6JB 1TME1 4LUMA 4FTBA 2GAUA 2XPJA 4X6QB 1JUIA 4A7ZA 4DRRA 1IS5A 1F9KA 1SLTA 2K2SA 2QZ3A 3J26N 2YDEA 4QPGA 1HW5A 5HI0A 3H1WA 1V00A 3KCYA 4JGZC 1RUJ3 1HRI1 2E63A 5D1IA 5I0UA 2JG8B 4BWOA 4RS5A 3AKPA 4YGBA 3VHOA 3MIGA 3VDDB 3C3VA 2PHRA 2B45X 4XJ8A 2JG8C 4G4FA 1V70A 2E7QA 2P34A 1S0DA 4CDUC 3VDDC 4Q4W2 5BY5A 4Y26A 3DPRC 4AGGA 1RUC1 3B7MA 2ZGNA 4MX3A 1UU4A 1AR73 1R081 2PYTA 4XFAA 1RMU1 3ZFFB 4DY3A 4XTMA 3Q9OA 4XFFA 4D7YA 1LHVA 5JOZA 4FPYA 3V0BA 2D6OX 2DTYA 3ETQA 4KWKA 1SFNA 3OY8A 4ORFA 3JZVA 1DU3D 4MH0E 4HETA 4N7UA 5DDJ2 4MXWA 1F31A 4WM7C 1FPN2 3WOGA 2DCTA 1WLDA 4QQLA 2R072 3RQ0A 4EN9B 5C4WB 4Q4X3 5JAXA 2IXKA 3OBRA 4H14A 5BNNA 2D6KA 2OUHA 1BKZA 3O14A 4PIYA 1X50A 1SLCA 1VIWB 4ZKTB 2AGSA 3VBOC 3H7YA 1OPMA 1OLRA 2KM2A 4XFBA 1D0HA 4HVOA 1FAYA 4AEDB 3NW4A 1W6NB 4QQOA 3UK9A 4BLIA 1UD1A 2ARXA 3VBRC 5JIUA 3MFAA 4TZDA 1H0BA 4BE3A 1NQJA 4XXPA 1PHMA 4DOUA 2BFUS 1CN1A 1DF0A 4RHV1 1WLCA 1REFA 4H55A 2JEMA 3RI8A 1XNKA 5C33A 3MIEA 3RZZA 4MV2A 3R4DB 4X6RB 4WV8A 1NXMA 1VP6A 1R093 2XHKA 2RR12 1BYHA 4DINB 2VPVA 3GBFA 1V6OA 2VNOA 2GC0A 3H50A 1QMJA 1G8WA 2D98A 4FTSA 1TME3 4QXKA 4HBNA 4LTAA 4A3XA 4DNYA 3T1LA 1RITA 3VBUC 3ZIXA 3ALQA 5GALA 4BIFA 1ENRA 4KG8A 2NLRA 1LRHA 4P14A 5LRSA 1B35B 4Z92B 3JBG2 4NO4A 1GZWA 4IQPA 1WW5A 1ULCA 1BMV1 2VMHA 3O0WA 3QACA 1C1FA 4XILA 1ZRRA 1D4VB 2RMU1 1GANA 5E8AA 2B7YA 3WV6A 2XBO1 4KU8A 2CV6A 3SH5A 3PVEA 3VZLA 1AX2A 4QX5A 1QJZA 4Z82A 2VOWA 4AVAA 1M4WA 1ZZ8A 3ZXGA 4HSJA 5GLWA 1KFXL 3LB9A 3VUOA 4QD2A 1R083 4F7ZA 2WWSA 1NXD1 5BXXA 4L92A 5DXDA 3J9SA 1LODA 3E6BA 1LCLA 2ZGQA 3EHKA 4CEWB 4Y22B 1LOBA 2JG9A 4DXZA 4XBQA 2A70A 1WCDJ 1IS3A 1AX0A 5DUVA 4FPLA 2AUYA 2XL9A 4CEWC 2B39A 1AHSA 2A5ZA 3E5XA 1CD3G 4W6XA 3T1MA 4ONUA 1N1SA 2Y0OA 1JH5A 5IK4A 1VLNA 4BQ1A 3MLJA 4GKXA 4XF0A 3H1YA 1YUDA 4B4RA 1RHI1 1C1LA 1LHWA 2QZ2A 2YROA 4EN6B 1H8TB 4I0WB 5ABJC 1S0BA 2ZPXA 2QCSB 4QGNA 1RUD1 3ZYJB 5BNOA 4CTEA 3N36A 2JICA 1PNFA 1WUVA 5EYYA 2DTWA 4FVVA 4YLZA 3GF6A 5GLZA 2ZTNA 3J8F1 1F5FA 4ZU7A 2VW1A 2NP0A 3VKFC 3SHRA 3HR9A 1SFYA 2FQPA 4KBBA 1B09A 5GZCA 2ZAHA 4BM8A 4Q29A 4C90A 5FQ0B 3RI9A 1FMD2 2ZMNA 4F8AA 1PIV1 1RUF2 1Z7S2 1VBE2 1FOD1 5GZFA 4AQ2A 2R16A 1QQP2 2PHXA 1RUNA 4YW2A 2AREA 1N3PA 3RSJA 4PIXA 3MICA 1WW6A 2DYCA 4TYSA 2WLQA 4IV1B 4Q4Y3 3WZ1A 2D3SA 2A73B 2JDZA 1C8NA 4K3UA 4L8QA 4IV1C 5CIRA 3JUUA 4CZSA 3IN9A 4Z07A 3ZFGB 3EXUA 4GWNA 2O8QA 5CFCB 1XYNA 1D4M1 2YMZA 4M00A 3ZFGC 1VRH2 2IXIA 4ISQA 4KH9A 1VAMA 1Q5OA 2VVDA 1UZZA 3HIFA 1RTVA 2RS51 1LU2A 2LUWA 3ES4A 1NCQB 3VBHB 2UY9A 1WMFA 1JOJA 2ZJCA 5HCBA 4AHYA 1NCQC 4K1YA 2GH2A 1J3PA 1QXPA 4YM1A 1DQ6A 3VBHC 5J98B 1N3QA 4PIZA 1G86A 2RM22 4B29A 2E51A 5CVRA 2ET1A 2DFBA 1UX6A 3BOWA 2EVXA 3G7DA 1H4HA 4LO5B 1RUG1 3PTYA 2ZHNA 5T50A 1ULGA 2HWF1 1CJDA 5BV6A 4TLFA 1OFNA 2RS31 1XYOA 3L9JT 1Y3TA 5BNPA 5JOXA 5I91A 2VECA 2WFF1 3WDWA 2HWB2 4AFBA 4JGYA 5T5PA 4IL7A 1KJRA 4TSVA 4UBHA 2F4PA 2JENA 3EBRA 2EXHA 3U11A 2HEYF 1I9RA 2ZS6B 3A0NA 1O3TA 1FYUA 1AYN1 2BQPA 4PLMA 3IKWA 2KA3A 1CGPA 4P9LA 1QF3A 4QPIA 1O3SA 2DCKA 1RHI3 3JB8A 3ZVXA 2CGPA 4J6GA 1GSLA 1RUD3 2PELA 4AVSA 4P9WA 1U5XA 3M4FA 4NN0A 4W6YA 3PVOA 3PVNA 4KL1A 1POV1 4NVPA 4BLJA 1AR61 3H9AA 1H2NA 1OOPB 1X36A 1G6NA 1U5IA 1OSGA 5KC5A 4QPGB 3B93A 1G9FA 1XU2A 3EJKA 4DS0A 2D3PA 5A3LA 2HWC1 4YM2A 5A33A 3SH3A 2CTVA 1AJOA 2WNUC 2R32A 3ZYGA 3DV8A 3I54A 3ZXFA 3MPPG 4HN0A 4FSJA 1UIKA 4RS5B 4OI2A 5L7OC 4QT6A 1VB2A 4JDNA 1PIV3 4Y4YA 1AVBA 1FOD3 3ZXAC 4RS5C 4I09A 1LHNA 1N3OA 1WBFA 4OFGA 3WW2A 1RVF2 1XE7A 2RS12 3TN91 1YI7A 3S6PA 3H3ZA 4N43A 4EROA 3ZFFA 4CDWC 3VL8A 4H7LA 3K48A 4OHVA 4LLFA 1J3QA 3M1HA 5L73A 5I0TA 1D2SA 3WW1A 4QM8A 4A7YA 1PGSA 3V0BB 3KSCA 4L2NA 3OY8B 3M2MA 1LECA 1D4M3 1YJLA 4MYEA 4M0NA 3LA3A 4YM3A 1KFUL 4MXWB 1C5HA 2RS53 4ZU4A 1UN1A 1CAVA 1CQ9A 2EAKA 1Z0HA 1JBCA 4HKOA 5C4WA 4RA0A 5F5QA 5AC91 2D6MA 3MPBA 2ZAAA 2WSVA 1ZA4A 1LR5A 1QOTA 1S0JA 2CWSA 2PAEA 4YFWA 2CAVA 2GALA 5BNNB 4HVRA 4XFIA 2UWAA 1BK1A 3R0RA 4FPJA 4E2QA 5GLVA 1C8M1 3QOPA 2PAMA 4XYXA 4AEDA 5BNNC 2Q5TA 3AP7A 1ZZCA 3ZXLA 1R1A2 1GBGA 1RUG3 4Q4V1 2BWAA 4ASLA 2HWF3 2JE9A 3KGLA 3B9IA 4FP3A 4P9YA 4HKLA 2RS33 4GB31 4AXOA 3AM2A 2WFF3 4KGQA 2HWD2 2VOKA 2H0VA 1HRV2 1OA2A 4FQZA 3KD4A 1AYM1 3AFKA 5CA6A 3VZOA 1YWKA 2P3IA 3M3IA 4KQ7A 1CVNA 2TNFA 4E4DX 3IDEA 1ZREA 1LKNA 3MGUA 1L3JA 4HL0A 1BBT1 2WJSA 2FMYA 4HVQA 1COV2 4QQHA 1D2QA 1ZRDA 4HANA 1POV3 4XF4A 2DVDA 1AR63 3E5QA