2ERFA

Crystal structure of the thrombospondin-1 n-terminal domain at 1.45a resolution
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
209
structure length
209
Chain Sequence
GGDNSVFDIFELTGAARKGSGRRLVKGPDPSSPAFRIEDANLIPPVPDDKFQDLVDAVRTEKGFLLLASLRQMKKTRGTLLALERKDHSGQVFSVVSNGKAGTLDLSLTVQGKQHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELDVPIQSVFTRDLASIARLRIAKGGVNDNFQGVLQNVRFVFGTTPEDILRNKGCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thrombospondin-1
publication title The structures of the thrombospondin-1 N-terminal domain and its complex with a synthetic pentameric heparin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 58
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2005-10-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2erfA00
3LSEA 4BQ1A 4Q1RA 4Q26A 1JOJA 2DTYA 1MS9A 2WNEA 2P2KA 1QMJA 4L8QA 2CTVA 3U4XA 4GWMA 1CVNA 4P9YA 1LEDA 3WDWA 1LCLA 1V6KA 1DHKB 2ZAAA 4FPLA 2ZGSA 2RHPA 3N7KA 3RSJA 1LOFC 3GNEA 1SBFA 4GA9A 3ZYRA 1H9PA 3NWKA 5AVAA 1WW6A 1V6IA 3DGTA 3HR9A 1JBCA 1SBEA 3PVOA 4HL0A 4XE9A 5F9TA 2NYYA 2I2SA 3B3QE 4YM2A 2DTWA 2P37A 2A70A 2UWAA 1ULEA 4YZ1A 1IS6A 1GANA 2EXHA 1HQLA 3B00A 3ILRA 1LU2A 4OZXA 1J1TA 5DZGA 1HDKA 3R4UA 1QGLA 1LULA 3ZXEA 5GZDA 3WOGA 4I30A 2R1DA 2SLIA 1WLDA 2YXSA 2AYHA 1SLTA 1JW6A 2AGSA 1JYCA 2YMZA 2ERFA 1DQ2A 1WW4A 3R4SA 3SISA 1GICA 1AF9A 2AUYA 4PQ9A 1HKDA 3N7JA 3T2TA 3IN9A 4K21A 3ZVXA 3N35A 1V6OA 2PHRA 1DBNA 1ENQA 4C1WA 5DUVA 2E6VA 2ZMLA 2D6OX 1D0HA 2EXIA 1MACA 1X50A 2DV9A 5E88A 3WDUA 1XQNA 2A6WA 2A6VA 1S0JA 1UX6A 2UWCA 2DVAA 2NZ9A 1N3PA 4ITCA 1UZYA 3NV4A 3RRDA 4ZKTB 2ENRA 4TYSA 1WLWA 1OQ1A 2VH9A 1SCSA 4MYEA 1G9BA 3RG0A 4Y1XA 4IQPA 1UKGA 3D4KA 2A71A 3RQ0A 3ZSJA 5IK8A 3ZXKA 5HCAA 1AX0A 1F31A 1NXD1 3AZWA 3QLQA 1LHNA 2ARBA 2ZMNA 3APBA 2GMEA 1BQPA 2DUOA 3AZXA 3B01A 1CESA 3VKMA 2NN8A 3AYCA 5EYXA 4YW4A 1JN2P 2WSVA 3AYAA 4XTMA 1AVBA 1W6OB 1AXKA 2GALA 5T52A 2WT0A 3T1LA 1OFSA 3W59A 4YW2A 1Q56A 1LGNA 2ZZJA 3USUB 4BM8A 1MS5A 3AZZA 4PBOA 1YIFA 5JVVA 5T5OA 3ZYPA 1KQRA 2A3XA 4YGBA 4ZXKA 1WD4A 1GBGA 3BODA 1QKQA 1BYHA 3GALA 4Q2FA 2NMNA 4YZ5A 1KRIA 2Q5TA 1AJOA 2W52A 1W6PB 3KM5A 4WVWA 5T55A 1MS4A 5CA6A 5JOZA 4XXPA 1IKPA 1WD3A 3FFZA 3SNMA 4FQ4A 1JUIA 4ISRA 4YGCA 1VAMA 3AZYA 2ZHLA 3AP5A 3V0AB 2XG3A 3V0BB 1N1YA 1ULDA 2E51A 3AZVA 5L73A 4M3CB 2GDFA 3WDYA 3M3OA 4BOWA 5JOYA 3ENRA 2P3JA 2A6XA 1SLAA 4GKYA 2JKBA 1SCRA 1U0AA 4CZSA 3AJZA 1VAVA 4UW5A 4FPEA 5T5PA 2A75A 5DZEA 1MS3A 2JE7A 1I1EA 1C1FA 1Z78A 2DURA 4ATFA 1W0OA 1V6NA 2ZHNA 1BZWA 2CYFA 1GYKA 5IT6A 1DQ6A 1YXWA 2E7TA 1N3OA 2BQPA 2OW4A 3OYWA 1Q8SA 3OBRA 1Q8OA 1AJKA 4LBQA 4AGRA 1CIWA 1H9WA 1D2SA 2WKKA 4ISQA 2ZGUA 1CQ9A 1FNYA 1JXNA 1W6MA 3WDXA 1GNHA 4Y20A 1AX2A 3WDVA 1LOEA 1SACA 1MZ6A 1IS4A 3V65A 3AYDA 1ONAA 3FUQA 2GNTA 3KQRA 5GLUA 1ENRA 3POWA 2YZ4A 4DFSA 1CR7A 5T50A 5H9SA 2D3PA 3TAYA 2DU1A 2YY1A 1KDMA 4FOWA 4GXLA 4YM3A 3ILNA 5E89A 1S0BA 4M3CF 4YZ3A 1N1TA 4CTEA 1GLHA 1N3QA 2ZGQA 3IPVB 4Z8BA 3WCSA 2NM1A 1URXA 2YV8A 4YG6A 1JYIA 3PJQA 2ZA9A 1QNYA 3B9CA 2B7YA 3AX4A 4R9AA 4XHBA 3WUDA 4XIOA 3D5OA 4YG3A 3LSDA 2FHRA 3NV3A 5DXDA 2V5YA 2WLQA 4FP3A 2ZACA 5GALA 1TEIA 5DG1A 5DUWA 1FV2A 1HLCA 1G9FA 3WVJA 2TEPA 5KXDA 4LBLA 4AGVA 2GMMA 1DGLA 5H9QA 4XTPA 3O5SA 2CY6A 1G9CA 1LODA 3ZSMA 3FLRA 5HCBA 3HN1A 1BKZA 2ZGOA 1LTEA 2EAKA 2DVBA 2OUJA 4XBNA 4XZPA 3I4IA 3V64A 1C4RA 4FPCA 1PZ7A 2JECA 1GV9A 1S0CA 2OUHA 5IK5A 2ZGMA 5T5LA 3H0OA 2PHUA 1W6QB 1LGBA 1DYPA 3AYEA 2ZBJA 4PF5A 1KJLA 1S1AA 2AR6A 4XJWA 1WCSA 2D3RA 1G7YA 2DYCA 4P9XA 1WW5A 1FNZA 4YW1A 3O12A 3OY8A 1LOGA 1PZ9A 3ZSKA 2JJ6A 3VKNA 1DIWA 2VXRA 1Q8VA 1Y7BA 3V0BA 1KDKA 4XJAA 1RINA 1DQ4A 4XOGA 4M3CA 4P14A 1SLLA 2VU9A 5DUXA 2H0BA 4AVSA 2DUPA 1CN1A 4YW3A 3M2MA 1C1LA 4Y22A 3O0VA 3HMYA 4LBNA 1S0EA 1QU0A 3ASIA 1YO8A 3PVEA 5IUQA 4F83A 1Q8QA 2WT2A 5E8AA 2ZGRA 3ZPYA 1DQ0A 1CONA 3WZ1A 4RA0A 1O4ZA 3B69A 4M00A 4XYXA 2A3YA 2R0HA 2ES3A 1N47A 4FOQA 4Y26A 3VV1A 2PELA 1WW7A 4XMIA 3VKOA 1LOBA 4DS0A 4GALA 2W68A 5JOWA 4R9CA 5JOXA 1UPSA 2E53A 3A0NA 2ZMKA 5CBLA 3MW4A 2HYKA 3MEPA 4DRRA 1A8DA 5JDBA 5CNAA 2AREA 2DU0A 4UW3A 4FPOB 1FAYA 2KM2A 3MPPG 2DVDA 3R05A 1CPMA 1GZWB 4AGGA 1CPNA 2ZHMA 4JC1A 1S0GA 1CJPA 3AJYA 4Y24A 1G9DA 1SBDA 1DZQA 4FPGA 3UJOA 2GNDA 2ZGTA 1QOOA 1IS3A 3L2YA 4YFZA 3WG1A 3ZXLA 1LECA 1QDCA 1R1ZA 4SLIA 1G9AA 3AXEA 1UN1A 4HANA 1VALA 5FREA 1G86A 1AXYA 4DPNA 2CWMA 3ILFA 2DWRA 3BIWE 3IPVA 4YLZA 1UZZA 4XJZA 1LOAA 4AVVA 3WG2A 4Y1VA 1ZM1A 1QDOA 1LOFA 1MS1A 2DVGA 4UW6A 2VW0A 3ATGA 1BXHA 1QOTA 1V6MA 2EXJA 4PBPA 3AFKA 5JMCA 2P3KA 5SV8A 3CNAA 2ZGNA 3WCRA 4RL7A 3T1MA 3POSA 2VY0A 4FPHA 5GZEA 3RMYA 1YRZA 1RIRA 5GLZA 2D7FA 4XJ9A 3WG4A 5CAZA 3OGGA 1APNA 1ULCA 2D44A 3N3HA 3NV2A 3BOPA 1UL9A 1YI7A 4FOVA 4LBKA 2YROA 3AP9A 3SITA 3WDTA 2VUAA 1BJQA 1F9KA 1S0IA 3M1HA 4D69A 1UMZA 3PVNA 3WG3A 4FPJA 2PHTA 2UURA 1V6LA 3A0KA 1LESA 1IKQA 2A6YA 1ZA4A 4FPYA 4GWNA 1LGCA 1GZCA 1I3HA 1V00A 1WBFA 1N1VA 3INAA 3M3CA 3NV1A 4K20A 2R16A 4XJ8A 1KJRA 1ULGA 1W6NB 1F5FA 1LU1A 5GJ6A 5BYNA 4H55A 2WSUA 4XXAA 2A5ZA 2C9AA 1FYUA 1YYNA 2R1BA 1G8WA 3M3EA 1H30A 3D6EA 4Q8LA 1WLCA 4Y1ZA 3UJQA 5KXEA 4TZDA 4YGEA 4XBQA 3AP4A 4W65A 4C1XA 1Q8PA 2CWSA 5T5JA 1RITA 3WV6A 1LHVA 3IKWA 3AP7A 4Y1UA 2ARXA 3AK0A 3OBTA 4JRAA 4R9DA 4XHXA 5GLTA 1MZ5A 5HCFA 1OKQA 2D6NA 2A6ZA 2JD4A 3OYWB 1GSLA 1UAIA 3UL2A 1W6OA 2PHWA 3ZXJA 3LCPA 1A3KA 2LALA 3SH5A 1DQ1A 2DUQA 2PHXA 4LBQB 3USUA 2GMPA 4YM0A 4YGDA 3O0WA 2SBAA 1S0FA 4XMAA 4DQAA 4UW4A 4FP2A 5GZCA 1DQ5A 3WNXA 1W6MB 2D43A 1FATA 4Y20B 4K1ZA 2VW1A 2CL2A 3RMXA 1KITA 1W6PA 3VKLA 4FVVA 3SH4A 3QCWA 3OJBA 4K1YA 2P3IA 1DLLA 4LBJA 4U2AA 5KXCA 3SLIA 2ZGPA 1DFQA 1V6JA 3FUOA 3O0XA 1DYKA 3C2UA 5DZFA 2ZHKA 3V0AA 1MVQA 2WQZC 2ZGKA 4FOYA 3I8TA 4YM1A 1GZWA 1NLSA 3BTAA 2D6MA 2D3SA 4PCRA 2OVUA 1FV3A 1AXZA 3SH3A 2NP0A 2JE9A 5FRAA 1Z0HA 4YG0A 1A78A 4XIKA 4NOTA 2LTNA 4GKXA 3FLPA 2A3WA 4M01A 3W58A 3N36A 2D6PA 4LBQD 5LK5A 3JUUA 2ZABA 1GKBA 2W08A 1MS0A 2CNAA 3Q9OA 2EALA 1AX1A 3PMEA 4XBLA 5EYYA 1FX5A 1N1SA 3AXDA 3WHUA 1VLNA 2PHFA 4ASMB 1ENSA 1WUVA 5H9PA 3ZSLA 5GLWA 1QOSA 2A7AA 2ZKNA 5EWSA 1B09A 5GLVA 3UK9A 2VW2A 2WJSA 3IMNA 4XILA 1LOCA 2WT1A 2UU8A 2GN3A 2C5DA 4WVVA 1S0DA 5KXBA 5DUUA 4YZ2A 4P9WA 4XDQA 3DUIA 4WV8A 3M3QA 3RS6A 4Q1PA 5T54A 4YZ4A 5GZGA 1SFYA 3FBYA 2GN7A 2E7QA 4AYUA 2DVFA 1LENA 4FPKA 1IOAA 4Q27A 4WZFA 3TB0A 4BLJA 5JLVA 2D6KA 2EXKA 2NMOA 3OY8B 1SLCA 4CRQA 1LEMA 2G4IA 4NO4A 1MR5A 5IK7A 3JU9A 1W0PA 5IK4A 4LBOA 4KBBA 5GZFA 3WUCA 4LBMA 4JCKA 3A4UA 4U36A 5EXOA 1MVEA 4AVTA 4R9BA 3VUOA 4AWDA 4Q8KA 5H9RA 2D6LX 5GM0A 3AP6A 1W6NA 2JDZA 1QNWA 2Z42A 4Y22B 1MS8A 1SLBA 1GZ9A 1VIWB 2AH2A 2EF6A 3N7LA 3OPZA 2UWBA 5CB7A 1ULFA 3MW2A 1AZDA 4YFWA 4YW5A 2AENA 3N7MA 2R0FA 4FPFA 3VKFC 2W39A 4BLIA 4BMEA 2ZGLA 3MW3A 5DG2A 3ZXFA 4ATEA 1EPWA 1C57A 1QF3A 2FMDA 5F5QA 4DRVA 1HQWA 1GNZA 3IM0A 2R49A 4FQZA 2P34A 3WLUA 1LHOA 2V73A 1SLIA 1WBLA 4Y1YA 3POYA 2GNMA 3FLTA 1IS5A 4M3CE 2GNBA 2EIGA 2XB6C 3WHTA 4BPZA 1LHWA 1O4YA 1PZ8A 1W6QA 1LJ7A 1LHUA 4XJUA 1JHNA 4BMBA
chains in the Genus database with same CATH superfamily
3I3DA 4JDOA 3LSEA 5A7OA 2W1UA 4Q26A 1W9TA 3OPTA 1MS9A 1VBE2 3R0RA 4CXWA 1W9WA 3VHNA 4QM8A 5F39A 4GWMA 2IFRA 4Q4X1 1L7QA 1RC6A 4CCJA 1HX6A 2VQ0A 4JGYC 4D8MA 2ZAAA 4MLOA 1NCQB 4ZPIA 3PTRB 1COV2 1DGWX 2RHPA 3N7KA 4GA9A 1AL23 2VMGA 1H9PA 1PNFA 3LEMA 3Q8CA 4UFLA 2NLRA 4HL0A 2FDKA 4FFIA 1XXNA 3PUAA 4R8HA 3N4MA 2QQUA 3LDRA 1ULEA 2WNUA 1J84A 2VCMA 4TXWA 1GANA 4QDSA 5DZGA 5CFDB 5BNPB 1NY71 2ZX0A 1LULA 5I0UA 4DMIA 5BY5A 5JZGA 4PF1A 2AGSA 1XOYA 4S2HA 1JYCA 2BNNA 3ZFEB 4BDVB 1KGYA 1FPN3 2AUYA 4PQ9A 3U78A 4CUCA 4LULA 3VZMA 2FCTA 4CXXA 1DBNA 2YGMA 2LRPA 5FYZA 3I3QA 4GD4A 2Y34A 2MHFA 2D6OX 2E31A 2WZR2 1X50A 3PIGA 4OHVA 5L9VA 1W9YA 1XQNA 1ZX5A 4I3GA 3S6PA 2NZ9A 3ZYGA 1UZYA 2JDAA 4A6SA 4PIXA 1OQ1A 1ND2A 1EV11 3ACGA 4AHWA 3WP4A 1XE0A 3KHBA 3AKQA 4JRLA 4Y1XA 5BV6A 1NCRC 2CDOA 5IVVA 1GUIA 3S57A 3J7NA 3RQ0A 4JVAA 3JD73 1F31A 3QLQA 3PUHA 2QDNA 3ZYBA 1OURA 4S2DA 4NROA 5EJ3A 2DUOA 2ZAHA 1AR93 3AYCA 3LKJA 4FFFA 2VG9A 5EYXA 2MPFA 4XTMA 1AVBA 1HRI2 1NKGA 4FO9A 4YW2A 3WD5A 4BIOA 4K8RB 4I0AA 3O1OA 2XMLA 2XKOA 4LLFA 4CCKA 4PDWA 3OUIA 2PTMA 3KVBA 4YGBA 5DDJ2 3T4HB 4OHWA 1TE1B 4B4PA 5J96B 1WD4A 4CU8A 5A6ZA 1QKQA 4R52A 2NMNA 5FZAA 5FO8B 4YZ5A 2ORXA 1KRIA 1AJOA 2W52A 1W6PB 3NMBA 4WVWA 2VNGA 3WNNA 2QCSB 1PGW2 3ZYJB 5CA6A 4N43C 4XXPA 1IKPA 4CEYA 4EE2A 3SNMA 4FQ4A 1W90A 1PO13 4ISRA 1OOPA 1VAMA 2HWC1 1ULOA 3AP5A 3NJXA 4L2NA 4B29A 2RG4A 3V0BB 1EYBA 1TMF3 3AZVA 4BB3A 1CZSA 5L73A 1UOFA 1RUJ2 2RE9A 5I0TA 2Y6LA 3M3OA 3WDYA 5JOYA 2D93A 1JU4A 2P3JA 3T2QA 3LFMA 3WNKA 1SG3A 5FDBA 1CX1A 1PGSA 4MUVA 5LW9A 2JE8A 4HG6B 4GIQA 2W3JA 5FMDA 1OC1A 2OS2A 5EJ1B 1RVF1 3VD7A 5FY1A 1I1EA 1RUF1 3IDAA 4J1XA 4NE9A 5FMBA 2J1RA 3SMHA 1ZRDA 4RS5B 2FCVA 3TRSB 1BZWA 2CYFA 3Q8EA 1DQ6A 3WY6A 1XPWA 2H0VA 2E7TA 2HEYF 2YC2A 2BQPA 4KGQA 5KHHA 4LOSA 5J98B 1OBNA 4IESA 1Q8OA 1JZ3A 1ZZCA 3VHRA 5CG8A 2BVVA 5I8YA 2WC2A 4LKEA 4LJHA 1CIWA 5CFDA 4CDXC 5EFUA 1D2SA 2WKKA 3RYRA 1YHFA 1BK0A 1GQPA 1JXNA 2X5IB 5BNOA 4E2GA 3VDAA 1NOVA 1AX2A 4XDPA 4UAPA 1IHMA 5ACA3 3T08A 3VBOC 2QZ3A 1IS4A 3ZFEA 1JZ2A 3AYDA 2XDVA 3MV11 2B5HA 4HN1A 3B7MA 2KD7A 3FUQA 2GNTA 5FPZA 1LAJA 3P1IA 2JDHA 2WAAA 2G1MA 5GLUA 3CJXA 3H3UA 4AW7A 1YJLA 1GP4A 1EY2A 2XLGA 4QPIC 5T50A 4D0QA 2D3PA 3TAYA 1YFWA 2HWD2 2FDJA 4FOWA 4NIIA 3OD4A 4YZ3A 1PVC2 1H4GA 3WW3A 2QQLA 1URXA 5FCCA 1W2AX 1JYIA 2WS92 2ZA9A 4A41A 2VAUA 1QJU2 4OCTA 4XIOA 1X8MA 2UY9A 1AR83 1H8TA 2FHRA 3NV3A 5LZ6A 2O8OA 5IVEA 4AQSA 1TEIA 5KHJA 3TEXA 1HLCA 1YQ6A 1G9FA 3KCCA 5FZ8A 3WVJA 4IUGA 1T2XA 4LPLA 1DGLA 4PJYA 5A80A 1XYNA 4XQWA 3BIEA 3HVDA 3VD5A 2RS53 1XRUA 1G9CA 3BUCA 2C0ZA 2RS13 4DXTA 5A6YA 1O7FA 3ZFFA 5LATA 2DVBA 1QJY2 3I4IA 1RUOA 4NHKA 2XUMA 1R1A2 2V4AA 3QOPA 2JECA 4OVEA 4WM7C 5DAVA 2JWPA 1GV9A 4BISA 5FY8A 3O14A 4Y4RA 5T5LA 1VPHA 3H0OA 1OF3A 2Y60A 1LGBA 3LDKA 4H14A 4HETA 4YW6A 3AYEA 4AVCA 4BQWA 1UY0A 1WA4A 4QHZA 2QQOA 1D7PM 4AEKA 2RMU1 1F4AA 4BZ4A 1FNZA 3TOJA 3ZYIB 1RJ8A 1LOGA 2K2SA 1F35A 3ZSKA 1ZBA2 2JJ6A 4Q0VA 1VBA3 1HRV1 3VKNA 4ZXEA 1DIWA 2VXRA 4I0BA 5FY7A 3NJZA 1Q8VA 3V0BA 3T0AA 1X33A 1PX3A 4XJAA 2Q8CA 1O5LA 4XOGA 1SLLA 4BHPA 2VU9A 5DUXA 2H0BA 4AVSA 2WNUC 2JDKA 1W05A 4Y22A 4G3YC 2YBSA 4A45A 3ASIA 4LQRA 3PVEA 1Q8QA 4MGZE 3C7EA 4KU8A 1BEV2 1R093 5J48A 4RA0A 3VV1A 1UU4A 2QQJA 3IZOA 2W87A 2J1AA 4OMDA 1DYOA 4RS5A 5AFBA 4NAOA 1LOBA 4GALA 2WNVA 3UV9A 1S55A 1ASJ1 2R063 3AVSA 2QFEA 3A0NA 5E6HA 5E16A 3MEPA 1WCUA 4XCBA 3H1MA 4DRRA 5C3PA 5CNAA 2BGPA 2AREA 3LEGA 2Z2SB 4CUGA 1O3RA 4Y5SA 4CYDA 1US3A 3MF6A 1FAYA 2Z5WA 3C7FA 4RHV2 3HIFA 3R05A 5FMOL 1NQJA 4Z82A 1WWYA 1EV13 4HLTA 1CPMA 1MEC3 3VBRA 1CPNA 2XHKA 2ZHMA 1JZ4A 1S0GA 3PMSA 3AJYA 3KGLA 4Y24A 4ZY9A 4MGYE 2YU2A 3MPBA 2B4KA 3VBFB 4DO0A 1ND2C 5FQ0A 1IQAA 3O1TA 1RUI2 5JR7B 1K5MA 4AF9A 1UN1A 4LKFA 4ZONA 5JXIA 2HWB1 4KWJA 4SBVA 1VALA 2WRAA 2HBTA 4RSUA 1RUD2 2VNVA 3GGLA 5FREA 4AQ2A 2XBO3 1BCXA 1B35C 1PM7A 1BMV2 2HH9A 3IDCB 2JG9A 1RXGA 2QQNA 3ILFA 2QDRA 2DWRA 2VMDA 3BIWE 4JQRA 4AFAA 2R073 2MNGA 4RR3A 4AVVA 2O14A 3WG2A 1ZM1A 1QDOA 1MS1A 3K46A 4MZUA 3WR0A 4CCLA 3GZEA 1J83A 1C28A 5LK7B 3WQ0A 2F6BA 4N53A 4QB1A 5CFCA 5JMCA 2P3KA 3EHKA 2FZ1A 4YVWB 4PDWC 4JDMA 4RL7A 2GC2A 3WCRA 2VOTA 5C9AA 2FMYA 4FPHA 4LA2A 4NIDA 4PLNA 1PGL2 4AOCA 3RMYA 2HWF1 3PUIA 5FWEA 4D6SA 2ID4A 1APNA 1W8FA 4XFCA 4HSJA 4P9IA 1OOPC 4LBKA 5FLIA 1QJX3 3WQ1A 3I2IA 1HN0A 3WDTA 2VUAA 2QQIA 5LY2A 4IL7A 2VMEA 2PLV1 5C7GA 1FOD1 1YEWA 4FPJA 4LO7A 1XNCA 3POIA 4QD2A 1LESA 1IKQA 3VLBB 1ZA4A 1RVF3 3A21A 4HVOA 1I3HA 2BDRA 3O1SA 3KV6A 3EYPA 5JIUA 1CAWB 1POV1 4N90A 4H55A 5CYYA 4LKDA 4EWAA 1CJDA 3OCPA 1G8WA 3M3EA 2YDEA 4Y1ZA 3THPA 4TZDA 2Y6JA 3MBWA 4IEZA 5FPXA 4YGEA 2ZEYA 4B7EA 4XBQA 5JI9A 2CWSA 2ZTNA 1H2NA 1ZBE1 4GULA 4Q0SA 5F8PA 3IKWA 4GJZA 2D5FA 2IWGB 4PLMA 2QBXA 3OBTA 2XJPA 5FMCA 3AFGA 1O8PA 3FHAA 4XHXA 3N9MA 3AVRA 1GSLA 1UAIA 5CFDC 1FMD3 4QPYA 2RR12 4K9SA 3ZXJA 3LCPA 1FI2A 1A3KA 5BNOC 1DQ1A 2MEV2 4LBQB 2GMPA 1ND3A 2BV4A 2BW8A 2GU9A 3GZUC 1KFXL 1RHI1 2WFF2 3POBA 5FYHA 4DQAA 3ZFEC 4META 1DQ5A 1W6MB 4GMP1 4NWVA 3J7MA 1FATA 1K42A 3LAGA 5J1XA 1BHGA 3KSCA 3WXPA 4KNCA 3QCWA 1DZRA 4OI2A 3KWVA 4QXHA 1DLLA 4U2AA 1I6XA 2XLAA 5KXCA 3VD4A 2RDRA 3KT1A 1RUC2 2R043 3J8F1 3BN6A 5LEKA 1MVQA 2WQZC 4FOYA 4YM1A 3A23A 4KQ7A 3MLKA 2TUNA 4OZOA 3K4DA 4Q4Y1 1OH3A 3LEIA 1UYZA 4PCRA 3TWIA 1FV3A 3ZIWA 1CAVB 3NO8A 1H8TC 3VBFA 1VBE3 4LO8A 4XIKA 2ATFA 1W39A 4NOTA 1HJGA 3E1F1 2A3WA 2VZTA 1SZBA 4QGNA 3WNOA 2VCCA 2BUKA 2VCAA 5G04L 5FKBA 3JUUA 1MQTB 3K3OA 4GB31 3K48A 3NNLA 2ZABA 3AKSA 1MS0A 1COV3 3I2JA 4LTAA 1O5UA 4N8MA 4B4QA 2BBAA 2RM21 1FX5A 3ZFFC 3RJ2X 1ENSA 1WUVA 5JAXA 2I45A 3ZSLA 1VBC2 2CAVA 5GLVA 3UK9A 2VW2A 1WMXA 3IMNA 1W8WA 1UYXA 3CJIB 4RGAA 5F6LB 3RVHA 2WT1A 2UU8A 4YVWA 1JOBA 5EQUA 5FYIA 1JI6A 4D6RA 5DUUA 4P9WA 2RDSA 1AYN1 3N9OA 5ANNA 4BQYA 3AKRA 3FBYA 5FZ3A 5C70A 3R6SA 3ZKYA 5A6XA 5FOBB 1IOAA 2Q0AA 4WZFA 4I3PA 4BLJA 5F3EA 3OTFA 2NMOA 3OY8B 4CEWB 2IC1A 3FJSA 4ZS2A 5IK7A 3KV4A 3JU9A 2JG8B 3WUCA 1VRH2 4LBMA 2WZR3 2E7AA 4Y5Z0 5FZMA 5F3GA 2VQTA 1MVEA 1POV0 4A6OA 4FBFA 4Q8KA 5H9RA 2D6LX 5GM0A 1G6NA 2DCTA 3JB4C 2JDZA 4Q4W2 3TYJA 3ZSEA 2K0GA 2ARCA 1SLBA 2XJSA 4MHRA 1W9FA 3OPZA 2ADDA 2BFUS 1AL21 2UWBA 3MW2A 1H2LA 4RS5C 5CB7A 3VD3A 3X29B 1IPKA 2W39A 1UY3A 2WNVC 2ZGLA 4K3UA 3MW3A 5APAA 4XFGA 1JOPA 2H6BA 3POGA 2FMDA 5F5QA 2FDFA 2VMHA 5IFTA 2R49A 4FQZA 1IPSA 3LPFA 1EUTA 2BGCA 1QWRA 1SLIA 1HRI3 3POYA 1VB4A 4MGIE 1VMJA 3VBRC 2GNBA 4Q4V2 4CDQB 4GMP0 5FZIA 1NZCA 2ZX1A 2D98A 4IETA 3NVCA 2HWB3 1PZ8A 1W6QA 1CD3G 4UF0B 4NN0A 1FPN1 3RJRA 3RNSA 1HW5A 4BMBA 2QQPA 3PL0A 1K5MC 1PO22 3MFAA 4Q1RA 3Q8AA 1JOJA 5CFCC 2DTYA 5KHKA 2WYSA 2HBUA 2PAMA 4KWKA 3TN92 3SKJE 2P2KA 4W6WA 2CTVA 1OHFA 4HVRA 1VBB2 1VB2A 5D1IA 1CVNA 2JG9C 1DGRN 1Y9QA 2R6QA 4LK7A 4FPLA 1ZREA 2ZGSA 4RR3C 3RSJA 2OX0A 2IZWA 1WW6A 3DGTA 4N7IA 1DG6A 1JBCA 1SBEA 2WFPA 1CAVA 3PVOA 4N53C 4XE9A 2QUOA 2NYYA 4YWAA 3TEZA 4YM2A 1GP5A 1U5YA 3I2KA 5C9AC 2A70A 2OA2A 4AFBA 4YZ1A 2ADEA 1IS6A 1LR5A 2EXHA 3AL5A 3B00A 3JD71 3DECA 4QB6A 3R4UA 1MQTA 3ZXEA 1RB8G 4HVQA 2R1DA 2SLIA 2YXSA 3FHQA 5FZ7A 1GU3A 2UYAA 3USSA 1W2OA 2ERFA 5IATA 3SISA 2G9GA 3AC0A 4PI0A 1AF9A 1XJAA 3I2OA 1RMU2 4D7SA 1REEA 3CJIA 2JENA 2VPVA 1AYM2 1NG0A 5K0UB 5FK8A 2WZEA 1NQDA 5DUVA 1Z7S2 4MHUA 2ZMLA 5K4LA 1QH6A 1C5IA 1KS4A 5FXZA 3WDUA 4EV0A 2A6WA 2VO5A 1JS9A 3LOBA 4DINB 1UX6A 1ZRRA 3CKHA 1PO11 4UFIA 4YARA 4LXLA 5FOJB 1AR62 2K9ZA 2ZX3A 3MIFA 4ZKTB 2WQ4A 2HKXA 4QAWA 4TYSA 4IE6A 1TMF1 3D0JA 1G9BA 1HXS2 5F2WA 1EAH2 3FFQA 1PVC3 4WVZA 3MUY1 5HCAA 2YB7A 1XU2A 3DXUA 3WQBA 2ARBA 1HV1A 3WF3A 2WS93 3B93A 3POJA 4XUTA 3AZXA 1QJU3 5IWFA 3B01A 4ZZ5A 4YW4A 1JN2P 1ND3C 3LPGA 3DXTA 4HKLA 1AXKA 2GALA 2VD7A 2WT0A 1OFSA 5AFEA 1Q56A 3RWKX 3LOIA 1XU1A 3USUB 5A3LA 2JDNA 1SFPA 5A7SA 3K75B 3SQOA 2C26A 2WN2A 3AZZA 4IV3B 4BIFA 5A1AA 2A3XA 3NKGA 3VDDB 3Q8FA 4Q4Y3 4ES9A 4COUA 2X29A 1M06G 2VOKA 4YPJA 4QHOA 5T55A 3LWCA 3C3VA 1MS4A 2GSYA 1UWWA 2IVJA 4JHZA 1UY2A 4CP1A 1WD3A 2O1QA 1JUIA 1R1A3 4E8CA 3AZYA 3B02A 2ZHLA 1UF2C 5ACA1 4LNVA 1N1YA 1RGSA 4IE0A 1GFF2 4UF0A 3VBFC 3ZYHA 4ASKA 4BOWA 1UU5A 4XZUG 2TNFA 1H6XA 1NE6A 2ZJCA 1NZIA 4LR4A 4OQ9A 4GKYA 2JKBA 1U0AA 1DU3D 3DPRB 5FBJA 4JDNA 1O91A 3AJZA 3OOXA 3AMQA 4CP9B 1ZBA3 3ECQA 2C24A 2BJSA 2JDPA 4FPEA 4UW5A 3AB0A 5T5PA 4YYOA 1MS3A 2JE7A 3E6DA 3HQXA 4XAEA 2DURA 2Q1FA 2ZZQA 4ATFA 1V6NA 2WWSA 4FCAA 1AR81 2VZRA 3DYPA 4AFCA 3HEIA 4URAA 1YXWA 3BU7A 3KHCA 4EWEA 4EZ4A 4HN0A 5FKCA 3OYWA 3D3AA 1Q8SA 3I2DA 5C8WA 2Q1ZB 2WQ8A 1TME3 5EPAA 4YVWC 4MO3M 1AJKA 1HV0A 3MLLA 4IV1B 4J25A 1H1IA 2BVBA 1JZ5A 3LD8A 4XUNA 1UCXA 2D97A 1OD5A 3SKVA 2J1TA 1HB3A 2RS51 3WSOA 5IVYA 4OHXA 2RS11 2JIGA 1W3XA 1X9PA 5JXJA 3WDXA 4OQ8A 4Y20A 1EUUA 3BOWA 4QT6A 3WDVA 3RYKA 3RZJA 3V65A 4GH4A 3NAPB 1Y9MA 3KQRA 4FAHA 1ENRA 5FYMA 3M70A 2EAAA 4DFSA 3G6JB 2WWJA 2X53S 2DU1A 2YY1A 4RHV3 1KDMA 2ZKLA 4LO6B 4RD7A 3U07A 4AQ6A 4C90A 3MV01 3BVCA 1S0BA 3GDBA 1N1TA 1OVSA 3HQUA 3IPVB 4CTEA 5JPNB 1J3RA 4CP2A 2CSGA 5FXWA 4ES8A 1Y4WA 1W9SA 3AX4A 1VBA1 2HLEA 4YG3A 1RUI3 1QXJA 3LSDA 3LZZA 2YC0A 1U5IA 2V5YA 4FSJA 2ZACA 4XACA 1SFNA 2D5HA 3KGZA 2IXIA 1RUD3 1RUG3 5DUWA 1FV2A 3I3EA 5F5AA 3CF6E 3DL3A 4AGVA 1UW8A 4BQ3A 3JXSA 3PLQA 2CY6A 2GZWA 2XR4A 3ZR5A 3HNYM 3OUHA 1R091 2WUHA 1IGOA 5CIRA 5DAQA 2VBPA 5IJRA 3VBUA 3WNLA 3HT2A 4XZPA 3OGJA 3ZMNA 4CPBA 4L11A 4FPCA 1CAUA 1XBFA 2RS33 2FQPA 1S0CA 2R061 2OUHA 2FDHA 2RMU2 1XNDA 2RJLA 2ZGMA 4XVHA 5JSRA 4IV3A 5L19A 3E97A 5BNNA 3H8UA 3LFIA 4E2QA 4UFJA 3UETA 3VDDA 1K5JA 4I02A 3VZNA 1F8VA 3IAQA 4BQ4A 2D3RA 4O9GA 1WW5A 1O59A 4CCMA 3RZKA 1MEC1 2PYTA 2E33A 1NLQA 5AC92 2F17A 3PJYA 3VDBA 1RUE3 5HV0A 3FHIB 4AXOA 1CGPA 3EMRA 1CZTA 2VOWA 2VQAA 2C6SA 3E6BA 4IW3A 3VBSB 2P17A 3EO6A 4YW3A 5LA9A 3VBHB 1V9U1 3O0VA 4JKMA 3FWEA 2PAEA 1J59A 2XBO1 3FBMA 4K7JA 1MQTC 5IUQA 5A1LA 1UZ0A 3AL6A 4CP9A 3U0ZA 3OEBA 4A4AA 3ZPYA 5JSOA 2R071 4GAZA 1O4ZA 4XYXA 3U4SA 4Y26A 2Y8KA 4XMIA 1WW7A 3PU8A 3VKOA 4HMZA 3PURA 1OMIA 2W68A 3AM2A 4DB5A 4NJ4A 4AI1A 3I2GA 3MW4A 3CJIC 1XYPA 2HWE2 2WABA 3I59A 2DFCA 2CV6A 2DU0A 2RR13 4QPGB 1GOGA 1GP6A 4QQHA 5FZDA 1UIKA 4UFHA 3ZFGA 3VHPA 4EN7B 2MEV3 4QU1A 2ZEWA 1NX9A 3OEAA 2WFF3 3MYXA 5IW0A 4Y5TA 1AR72 1OA4A 2IXJA 1CJPA 1S2KA 1G9DA 1W8OA 4FPGA 1QJX1 5K7PA 2GNDA 2ZGTA 4LHLA 3K51A 4YFZA 4Z1VA 1XSRA 4S2GA 3NAPA 4JZRA 3ZXLA 1QDCA 1J3QA 1R1ZA 2Q4SA 4NHLA 2Y6FA 4OI4A 3IMMA 5JMOA 1G9AA 4HANA 3RZZA 2XVGA 2O0OA 3RI9A 1RUC3 2P4EA 4NPMA 1QQP2 2X09A 5JSPA 4BQXA 1NCQA 1G86A 3MIGA 5CKQA 3U14A 5A32B 4DY5A 1S2BA 4BQ2A 3IWZA 3J9SA 4PHZA 4E4HA 2BBVA 4WVMB 3IPVA 3S5QA 5K9YA 4XJZA 2XL9A 4NIAA 3TNQA 5CEHA 2DVGA 2JEMA 4UW6A 2E32A 4KMQA 2VW0A 2DCKA 3BTYA 3C8XA 4ZU7A 2IFWA 2VCBA 3AFKA 1GWMA 3JB8A 3H42B 3CNAA 5BNPA 5C3RA 2PXJA 2OPWA 3RDIA 3POSA 2VY0A 5JXHA 1RUH2 5GZEA 1AHSA 5GLZA 2VQUA 1H1MA 1FMD1 5FLHA 1MZEA 5CAZA 5LY1A 2PLV2 3NV2A 4H3WA 1VBC3 1D4VB 2W95A 1UL9A 2YROA 1S4CA 5FR3A 2W9XA 4NIHA 3SITA 3LGRA 2VUCA 2W1SA 3GZTB 3I97A 4BA6A 4DXRA 4QX8A 1C8NA 1AL0G 3WP3A 2PHTA 1E5HA 3A0KA 4GWNA 4C91A 5FBZA 1GZCA 4EN0A 3M3CA 5D8AC 4K20A 4MADA 5A3TA 5IVBA 1OPMA 3NJVA 1KJRA 1OLRA 4JKLA 1F5FA 1LU1A 2R041 3CZJA 5BYNA 3OUJA 3IIIA 2WR9A 5LA1A 1O8SA 2A5ZA 1ZNPA 3LDBA 5FY4A 1H30A 2GAUA 1HB4A 1OQDA 3C7HA 4KWLA 1BBT3 4CU9A 1JTZX 4W65A 1OT5A 4C1XA 1Q8PA 5T5JA 1VBE1 1C8M3 2W91A 3PVBB 1VBD2 1JYXA 2XVLA 3T4VA 2ARXA 3M3IA 4AE2A 2GC0A 4O65A 4Q0QA 5F32A 3VBSA 4Q4W3 5GLTA 1MZ5A 3VBHA 1OKQA 1RHI2 2D6NA 2GP3A 4XFAA 4XURA 3OGVA 4YRDA 5T3NA 3RPQA 1COV1 2LALA 1W28A 1PIV3 2E9QA 4YGDA 1KXGA 2CHHA 4BJ0A 1DGWA 1UXXX 1GNYA 5GZCA 4FP2A 4UBHA 4NMIA 4QX1A 3WNXA 2IXLA 4GH4C 2D43A 4GJYA 4JKKA 3S30A 3WW4A 3LF7A 4IEQA 1YIPA 4ZZ8A 1OFNA 3ACIA 3ALQA 2VW1A 3RMXA 1W6PA 3T09A 2ZCWA 4P9LA 1O3SA 4XABA 3FC0A 3K77A 2HYXA 4QPGA 4LBJA 2J1EA 5C4WB 3SLIA 3O0XA 1DFQA 4TLGA 4XDOA 2XONA 1DYKA 5DZFA 3WT3A 1V70A 1OQEA 2W1WA 1VMFA 2HEWF 3LQCA 4QX3A 4DXSA 5FYVA 1SDDB 4FXKB 1NLSA 3JZVA 3SCGA 2BZDA 2D3SA 4LLOA 4UWDA 3SCHA 1AXZA 1PO23 2VZ1A 4NHMA 3SH3A 1Z0HA 4NVPA 3TN93 5CZKA 3W58A 5BUVA 4P5YA 1VBB3 2D6PA 2WZR1 4RFT0 5JZGC 2PHLA 3B94A 1GKBA 2W08A 1H6YA 3SEPA 5A32A 4AFMA 4OULA 4BK4A 1AX1A 4XBLA 3ZN6B 4WVMA 3VBUC 3GF6A 3E5QA 3AXDA 3WHUA 1W8TA 2PHFA 4ASMB 4ZU4A 4AG4A 3RZHA 1VP6A 4F7ZA 3PDQA 5LA0A 1EPZA 2ZKNA 3ELNA 1ULPA 3IIAA 4TLFA 1U5ZA 5EWSA 5IVFA 1ZRCA 2VECA 3TEYA 4AI0A 3JBG2 1LOCA 1QH7A 5FP3A 4IV3C 3DF0A 3OF1A 1KD7A 5BNNC 4XF1A 4FT8A 4WVVA 2B46X 2ILMA 2X5IA 2PMWB 4UBGA 3VDDC 3ZM8A 4AHXA 4WZCA 4A3ZA 4YZ2A 3DUIA 3NKTA 3UNPA 1RYYA 1HRI1 1SFYA 2EVXA 3H7YA 4XFFA 2WNOA 4TN7A 1UMIA 2E7QA 3BCWA 4FPKA 4JV4A 1POQA 5L7OB 4JGZB 2EXKA 5C8CB 2YBKA 1V9U3 1W99A 1OF4A 4UFMA 1MR5A 3KB5A 2F4LA 4LUMA 1ODMA 2QJVA 1I5PA 5IK4A 4LBOA 5GZFA 1Z7S3 2OKXA 3HNBM 3KS7A 5FIXA 4AVAA 3A4UA 4U36A 1UIJA 4AVTA 2O8QA 1SEFA 4NPRA 4DOUA 5F2SA 4DIQA 3AP6A 1O6UA 4QQPA 5J37A 3POFA 1W8UA 1W8NA 1GZ9A 3CDZB 2EF6A 5FPBA 1AZDA 4D69A 1HXS3 1TZOA 4BMEA 2QQMA 3ZXFA 4ATEA 1EPWA 2VZ3A 4G4FA 5HBAA 4CEYC 2RJ2A 3CBNA 3I2HA 4XETA 3ZFGC 4CDWB 3T2OA 5FP9A 1DP0A 5FYBA 3WLUA 3POEA 5FYYA 1WBLA 4Y1YA 5DPNA 1VMHA 1IS5A 1LNSA 5FV3A 4AEJA 2TBVA 4NHXA 3WHTA 4AI2A 5F3IA 3DV8A 2WDBA 4K8FA 1LJ7A 4AL9A 4GQ7A 4XJUA 4AI3A 2NQYA 2OPKA 5LBFA 2Y6HA 4LIUA 3AMMA 2WNEA 5D2AA 1RXFA 4DEVA 1NCQC 5LEJA 4KG8A 2VXJA 4URTA 2J1VA 5DN2A 4P9YA 3WDWA 5KHIA 3OBAA 1LCLA 1V6KA 5FUIA 1DHKB 2ARAA 1YQ5A 4LUKA 1HJFA 3MUZ1 5FWJA 3GNEA 5FPAA 4JGYB 4QXBA 3NWKA 4V2VA 1V6IA 3HR9A 2DFBA 3SHRA 5LA2A 5F9TA 3IB3A 5BNPC 2NPIA 2DTWA 3NJYA 2RVAA 1AR92 3E5UA 2UWAA 5CU1A 1PVC1 3LA7A 4NWWA 1HQLA 3ILRA 3VL8A 1LU2A 3WF2A 4CA9A 2XJUA 1QGLA 1JYNA 4HOOA 2WS91 1R082 1OD3A 1QJU1 3E5XA 3WOGA 3UGHA 1ZZ9A 3ME2A 4AK3A 1SLTA 1K12A 2QE3A 4HK8A 4MV2A 2WA3A 3TBDA 1O3QA 4QU2A 4W4ZA 1H8VA 2YMZA 4HFSA 3DEMA 3L9JT 1DQ2A 1WW4A 1PVXA 1GICA 2UYBA 3CZUA 3MIHA 1HKDA 3N7JA 4IEVA 5E1RA 3T2TA 3ZKUA 3N35A 1V6OA 2PHRA 3ZVXA 1OA3A 1ENQA 1E5IA 4OLLA 1W06A 4M4RA 4NRPA 2VTXA 1I5ZA 1W2UA 4M4PA 4Z2AA 3ZR6A 3BB6A 5E88A 1J58A 2A6VA 1S0JA 2VE1A 1QJY1 2Y38A 4CDUB 3GHMA 2H6CA 2DVAA 1N3PA 1R1A1 3JCIA 3NV4A 3RRDA 3OG2A 4KGGA 1WLWA 4JGZA 3WP6A 5L7OA 5IFPA 4DXZA 4A42A 5A6QA 2LW8A 1UKGA 4X8NA 2VM9A 1XNBA 4INDA 5FY5A 3VBSC 5IK8A 3ZXKA 2IXCA 1AX0A 3HAGA 2VTFA 3VBHC 4YNIA 2VNRA 2ZMNA 2WO1A 4X8PA 4COWA 3APBA 1NCRB 2BFUL 1ZBA1 2Y33A 4V2WA 1D4M2 3VKMA 2NN8A 2XJQA 2WSVA 3AYAA 3UT0A 1W6OB 3O1VA 1LGNA 2ZZJA 3D8CA 5FP8A 5CISA 4AEDB 5T5OA 5EJZB 1KQRA 2JDYA 3VZJA 3ZYPA 1TME1 4OYUA 4DY3A 5CADA 2VULA 2WLPA 3SEEA 4Q2FA 3BODA 3GALA 4AVBA 5IVCA 2LS6A 1UMHA 4N9IA 4MH0E 3KM5A 3RYPA 3VL9A 1OPOA 2ET1A 3IDEA 4EWDA 2GC1A 3V0AB 2W47A 2XG3A 2QTWB 3RZLA 2W94A 4TWTA 1YCIA 2VMFA 4M3CB 3P5BA 4YW7A 3THTA 3ZXDA 4JTOA 4EN8B 3ENRA 1CAWA 3HN3A 2A6XA 2BOIA 4RHV1 1T6GC 1SCRA 5C5UA 4M0HA 1EP0A 3ES4A 3ZLIA 4HONA 1VAVA 3MICA 3OD0A 4B3NA 5AC93 3AMPA 4DZGA 5K8SA 4I09A 5JCTA 1JUHA 5DZEA 3HWJA 5A33B 3THDA 1C1FA 1Z78A 5TSWA 1YNAA 1OXCA 3P6BA 1RUI1 5F5CA 5DQ0A 5FPUA 5BPXA 3OBRA 3RGBA 2RS12 1RUD1 1RUG1 5A7PA 1BMV1 5F3CA 5DAWA 3SC7X 5FZLA 2X5IC 4LBQA 1MZFA 4AGRA 3HJRA 3DKWA 2DBIA 4COZA 1FNYA 5F5IA 1W6MA 5DDJ3 2VVEA 4Q4X2 1JHJA 1GNHA 1JZ8A 2B9VA 3PHMA 2RDNA 1LOEA 1AUYA 1SACA 5EV7A 1MZ6A 5FJHA 1ONAA 4C0BA 5C71A 5KC6A 5J3UA 5BXXA 3N9NA 4NR1A 2HWE3 2BGOA 2RS31 3GCXA 1JODA 4QB2A 3POWA 5DAPA 1PGL1 4ONUA 3ZYFA 4D7YA 5H9SA 3PUSA 1IZ3A 4OMCA 5C33A 4YM3A 2W92A 4A44A 2BWAA 2DBNA 3ETPA 1SDWA 4M3CF 1RUJ3 1JZ7A 1AR73 4Z8BA 1GLHA 3VGIA 2ZGQA 1WCKA 4IEUA 1NY72 4RN5A 2B8MA 2IUWA 5A7WB 5HCHA 3B9CA 1QNYA 4XHBA 2B7YA 4OI1A 3WUDA 5FFOC 4CDUA 3BPSA 3D5OA 5FPVA 1RUE1 4ASLA 5DXDA 2PAKA 2B39A 1WA6X 1X7NA 4EQVA 3RZMA 1QQP3 2VZUA 3F2ZA 4ET7A 3BYWA 1UY1A 5DG1A 1IPJA 4PLOA 3KV9A 1YLLA 2TEPA 5KXDA 2Z79A 4XTPA 3O5SA 2EIBA 4P9GA 3R4DB 5LBCA 3IAPA 5EHDA 3ACLA 3ZSMA 3FLRA 2YPJA 5HCBA 3HN1A 4B7KA 2RDQA 4W8JA 4LHNA 3WINE 5G05L 2OUJA 4XBNA 4NIGA 3MIDA 1ST8A 2ZXQA 2VZVA 3CU7A 2BOJA 1DF0A 1RUH3 3U10A 4PT6A 2JICA 5IAVA 2PHUA 1CAXB 1EV12 3FX3A 4AEDA 3U1XA 3E6CC 2Q8EA 4QPWA 2RR11 4PF5A 5GKAC 1ZZBA 5FZGA 1S1AA 1ODNA 2MEV1 2WO2A 2ET7A 5JR2A 1G7YA 3T0DA 2VTXJ 3BPZA 2WFF1 3O12A 3OY8A 4YW1A 4CEWA 2HWD3 4LMFA 4AEMA 2W0XA 2JG8A 3JQWA 5J36A 2C4XA 4P5HA 2BWCA 1Y7BA 1UX7A 1U12A 4JTNA 3PTYA 4M3CA 1XC6A 1UO9A 1CN1A 2DUPA 4QM9A 4AHZA 1C1LA 1RUC1 2P3YA 3HT1A 4JQTA 3HMYA 1QU0A 1YO8A 5A3OA 3GYDA 4O61A 2WNUB 1UXZA 2J1UA 3W20A 2ZGRA 1DQ0A 3WZ1A 3OB8A 2B45X 3HQRA 2YHJA 2A3YA 4BQ1A 2ES3A 4FOQA 2XJRA 4EZHA 1VBD3 5ABJB 4CCNA 2HWC2 2VC9A 2WO3A 3S5AA 4R9CA 5JOXA 1UPSA 1L7RA 1VE0A 1YFUA 1QHDA 2WIIB 1NT0A 3B5LB 5JDBA 1QJY3 1Y3TA 2XQXA 3FZ3A 4IXLA 4UW3A 4YVSB 2JIJA 4COVA 1YUDA 1E5SA 4OHYA 4CDQA 2GH2A 2KM2A 3MPPG 3NQHA 3PIJA 2Q8OA 2D40A 4OUEA 3GXUA 1JH5A 1GZWB 4AGGA 2DCZA 1VBC1 4GWIA 4BH9A 5A3WA 2Y26A 4KI5M 5L36A 1RVF2 1DZQA 1SHWB 2E26A 5I8SA 1W8ZA 3UJOA 1QOOA 1RUF2 5FYUA 1IS3A 3L2YA 3QH7A 4JGZC 2XWJB 4MX3A 3WG1A 4AQTA 5FYCA 5L7OC 2UY8A 3GBFA 1LECA 3OGSA 4SLIA 1VAKA 2ZOEB 1XB9A 2OZ6A 2WAOA 3ST7A 3CMGA 1XNAA 1QXRA 1ND2B 2Z69A 4P02B 3WP5A 2A73B 1C3HA 4WM8B 1AXYA 4DPNA 2CWMA 3B9IA 1W04A 2PFWA 4RQPB 2WYFA 3TNPB 1YFYA 2PN5A 5BNQA 4Q29A 1UZZA 4XC9A 1LOAA 2OXBA 1B35B 4OUMA 5A7WA 4Y1VA 4Q0UA 2BTVC 1LOFA 3KV5A 3ATGA 2J42A 4PBPA 1GZTA 1XYOA 1BBT1 4G9SB 1V0AA 1VRH1 2JD9A 1BEV3 4QQLA 4QX2A 1WMDA 5SV8A 3VZLA 2BU9A 5FZEA 1C8M1 1GWKA 1YQ8A 3NL1A 3H8XA 1WCQA 1GWLA 2P6CA 2Y6KA 4Q4W1 5FO7B 1UKRA 1FXZA 2D7FA 4K40A 4PDWB 5JWPA 4CXYA 3WG4A 2FD8A 3VD9A 1ULCA 2JB4A 3N3HA 3RI8A 1PIV1 3ZN4A 1YI7A 4FOVA 1UZWA 3Q8BA 3VZKA 1IG0A 3AP9A 5FZBA 4XF4A 3JBG3 1GQHA 5K0UA 4KL1A 1BJQA 1F9KA 5I0DA 2Q8DA 1OOPB 2GH8A 3KCYA 3PVNA 1REFA 3WG3A 1V6LA 1OH4A 4FPYA 1CAXA 3N9QA 4E4DX 1LGCA 3QH6A 1WBFA 1V00A 4FXGB 5FZ4A 3INAA 4LEJA 5LASA 1HQNA 2R16A 4XJ8A 3K4AA 1W6NB 1ULGA 4Q4V1 4UOJA 5GJ6A 3NNFA 4F3JA 1QEXA 4CU7A 2AEYA 5FZKA 2OQ7A 1YYNA 1NA1B 2R1BA 4FTBA 3PNAA 5KXEA 1ZZ6A 5FUNA 1PO21 4B8EA 1YI9A 3AP4A 5L9BA 2WWUA 3LE0A 5FK7A 3MZHA 1RITA 2FCUA 5LBEA 3TN91 2XLFA 4HT1T 3AP7A 5FZ1A 4Y1UA 1UZVA 3NSTA 1VBB1 4XFBA 4MXVA 4NAMA 2DUQA 2PHXA 2QQWA 3USUA 4NUBA 3O0WA 5F37A 1WLTA 5FY0A 3FE5A 4XMAA 5FAXA 5FJKA 5BNOB 4KBZA 4PI2A 1HRV2 2G9FA 2XH6A 1K3IA 5ABJA 4K1ZA 3T2PA 3VKLA 4FVVA 3KF3A 2P3IA 1YC61 2ORZA 4YVSA 1GOFA 3PU3A 2ZGPA 4XFIA 1VJ2A 3C2UA 4XUPA 2YC4A 3CEWA 3H1YA 3I8TA 1GZWA 4EYUA 1PK6B 3BTAA 1L7LA 3M7AA 4CDUC 1ZA7A 4JAAA 2OVUA 4QXKA 1RMU1 3I3MA 2NP0A 1XE7A 4XFHA 3WW2A 2JE9A 1O4TA 5ANQA 1AYM1 4YG0A 2JDMA 4HK9A 3DPRA 3OBZA 5EZWA 3THCA 3O1MA 1Z7S1 3N36A 1ASJ2 2IXHA 2WINB 1H8TB 2YGLA 4LBQD 4LKSA 5LK5A 4E2SA 4AAXA 3T0BA 4QGLA 4Y4YA 5LRRA 5FTTC 4WM8A 5FZ6A 4J1WA 2CNAA 3Q9OA 2EALA 1AR61 4R4ZA 2VBDA 4RFRB 4RQPA 5EYYA 3ON7A 2AACA 2XVKA 1VLNA 4FFHA 1YJKA 2B42B 1WKYA 5JXGA 1B35A 5GLWA 1NUKA 1QOSA 3GZAA 1HXS1 1UD1A 2DF7A 4IV1A 3GBWA 1EAH1 4QKNA 4XILA 3CL1A 3ZFFB 4HPKB 4XPVA 3V56A 2QQKA 4R4XA 2L9LA 1M4WA 4AEDC 5AVPA 2GN3A 1US2A 2C5DA 5KXBA 2RV9A 1R083 3WQ7A 2FBEA 2VZPA 2F4PA 2HWB2 3M3QA 5FP7A 4Q1PA 1LB2A 3H8OA 5T54A 1J1LA 2FDIA 4YZ4A 3KZ4C 4X6RB 3FMGA 4AYUA 4CEWC 2DVFA 1LENA 3LEKA 3MFCA 5FY9A 5JLVA 3TB0A 2JG8C 1TG7A 2GP5A 2VZOA 3WW1A 1HB2A 3FL7A 2VNOA 3J26N 1SLCA 4CRQA 3ORJA 3I2FA 4NO4A 3GCWA 1W0PA 4H7MA 4KBBA 4JCKA 4DUXA 1A34A 2Y6GA 1ZZ7A 4IE7A 3H7JA 1UY4A 3VB9A 1GR3A 3AKPA 3ITQA 4Z2WA 5JI7A 5KR7A 1W6NA 1KFUL 2P6HA 1F2NA 1HB1A 2HWF2 2VR4A 2Q1MA 4Y22B 1UYPA 1F15A 1MS8A 2YYOA 4BCUA 3N7LA 4CP0A 1NA1A 3UYJA 4YW5A 3VKFC 2LM3A 3N7MA 2YFZA 4LIVA 5DG2A 1TQ5A 3RWNA 1GNZA 3IM0A 4HZFA 5KC5A 1H1AA 2WNVB 4B1MA 5B4NA 2VL4A 1FOD2 4OFGA 2E63A 1D4M3 2P34A 2PQQA 4CDQC 1LHOA 3ZDSA 4Z92B 4M3CE 3MIBA 2WA4A 2R32A 4QXCA 3D0SA 1GMMA 2EIGA 3I54A 4YSFA 2VMCA 2XB6C 4BPZA 4NRMA 1BK1A 5C6CA 4I2OA 2XJTA 3MIEA 4AI9A 1LHUA 3VBRB 1Q3EA 1JHNA 3ROUA 5DMYA 4OI0A 3J4UH 2LUWA 1JZ6A 3RZGA 4X6QB 4H7LA 1ZBE2 4LHSA 5FQ0B 3OGRA 1A8MA 1QMJA 4L8QA 4CCOA 2WZPP 3URFA 5A3UA 1K5MB 1Y9GA 4L99A 3U4XA 4QHBA 2FDGA 1LEDA 4O9EA 4JHTA 4BE3A 2ZX4A 2VZSA 1VRH3 2C9KA 5B4XA 4IERA 1OI6A 4QMAA 1DGRA 4IGQA 2JG9B 1LOFC 1PK6A 1SBFA 1WZXA 5FZOB 1Y43B 2K46A 3QD6A 2X05A 5AVAA 3ZYRA 1W0NA 4E9KA 4RR3B 2J7MA 5F7UA 2I2SA 3B3QE 4ZHNA 2P37A 4QX0A 3A7QA 3KMHA 1NE4A 2VZQA 1QY4A 3EXUA 4N53B 5CFCB 4D6QA 4OZXA 1W3VA 1J1TA 1HDKA 2BNOA 3C7OA 1QJFA 3EQEA 2YG0A 4MSVA 4IE4A 4XUOA 3U11A 5C9AB 5GZDA 4QQOA 4I30A 1WLDA 2AYHA 2XPJA 3J8F2 1JW6A 5FPLA 4F8AA 4HXCA 4TSVA 1C5HA 4Q4Y2 5K0UC 3R4SA 3UKVA 1W2NA 4CCEA 1TNRA 3IN9A 4K21A 4HPKA 4Q4V3 5SV5A 4QWNA 2LROA 4LITA 2XKPA 4C1WA 1WCDJ 3M4FA 1UYYA 4I01A 1ZRIA 1L3JA 2AEZA 2E6VA 5D21A 3KCXA 5FXVA 2EXIA 1D0HA 3BU0A 1MACA 3HOBA 1UU6A 2VGDA 2DV9A 4NRQA 4Q4X3 4XW3A 1NYWA 4GB32 2V4VA 2C1FA 1WMEA 2UWCA 4ITCA 1XNKA 4FI9A 3ZN5A 2ENRA 2RM22 4NPLA 3W21A 4Y33A 1OVPA 2VJXA 3ZX7A 2VH9A 1SCSA 4MYEA 1OUSA 4LO4B 3T3YA 3RG0A 5KWRA 2W5FA 4IQPA 2ETEA 3CQOA 2A71A 3D4KA 3ZSJA 4AR2A 4LORA 3AZWA 1NXD1 4XQDA 1LHNA 1BVP1 1NXMA 3CLPA 1IQDC 3TEWA 1REDA 3WNMA 2GMEA 5CKNA 1BQPA 1Q43A 3J7LA 5AC91 2XWBB 4EJRA 1CESA 5EIYB 3AKTA 1AYN2 4QGMA 1TME2 5T52A 3T1LA 5J7MA 1OA2A 3W59A 3I7DA 1JYVA 1ND3B 4XUQA 5ABJC 4BM8A 1MS5A 4PBOA 2QVSB 1YIFA 2Y64A 2BERA 5JVVA 1TNFA 5I8TA 4W6XA 3BTZA 1QIQA 2ZPXA 4QKDA 4ZXKA 3H50A 3W5NA 5I0SA 3UESA 3BALA 1GBGA 3UGGA 1BYHA 1QJZA 2WL1A 3CIHA 3NNGA 4YVSC 2Q5TA 3K4ZA 1Q5OA 1RMU3 3M8LA 4XCAA 2Q30A 5JOZA 1AYM3 3FFZA 5DDJ1 4CU6A 1U5XA 1CIYA 4YGCA 2JB8A 4BQ5A 3WNPA 3VZOA 5LBBA 4HKWA 3IDBB 1R64A 2E51A 1ULDA 2XXZA 3WF0A 3QACA 2WO7A 1PGW1 1AL22 2HWE1 2R7EB 3LB9A 3DPRC 2GDFA 3H9AA 4K6BA 4Q5OA 1KS5A 4M0NA 3ES1A 1AR63 1XE8A 1SLAA 2OQ6A 3KD4A 5IYYA 3A22A 3NRUA 4IGOA 3UKNA 1LKNA 3UKTA 5LB6A 3EB7A 4CPBD 4WM8C 4CZSA 4C8DA 1RUJ1 1AR71 1EAH3 4RQPC 2A75A 3CO2A 4L97A 3H3LA 3O1UA 1RUG2 5HI0A 2A1XA 1W0OA 4LOTA 3S7IA 4IE5A 2ZHNA 5FZOA 1GYKA 2OYZA 5IT6A 3H1WA 3DN7A 4IV1C 1YWKA 2V09A 1D2QA 3BTXA 1N3OA 2OW4A 1QQP1 4DNYA 1W03A 2EICA 2XGXA 1FPN2 3BI3A 1UNBA 4AZZA 3LA2A 1SPPB 5CG9A 3LA3A 3MI8A 1UOJA 4LO5B 2VBBA 1H9WA 3QBQA 4ISQA 2RS32 1CQ9A 2ZGUA 3NAPC 3H8RA 3MHZA 2HWC3 2V72A 4CVUA 5IAXA 5FMOS 2I74A 5M0TA 4LHKA 2JXAA 4XF3A 2W46A 1DCSA 2B9UA 5C4WA 1RUH1 1P8JA 2YZ4A 5KHGA 1CR7A 2OT7A 2VUDA 3HNMA 1ZVFA 1BLZA 3GM8A 1QXPA 3ILNA 4GXLA 5A3NA 5I93A 1WMFA 5E89A 5LWBA 1FT9A 4MOAA 3T30A 1RUE2 3JD72 1CWPA 1N3QA 5FZ0A 5ERLA 3WCSA 3ZXAC 2NM1A 2YV8A 4KU7A 4YG6A 5HXMA 1RUF3 3PJQA 4R9AA 2HWD1 4UI9L 4A7YA 4XAAA 3OSDA 1NA1C 2CGNA 2BPA2 4IEYA 2QZ2A 2WLQA 3K2OA 4FP3A 4RGGA 5C5TA 1CX4A 4A3XA 5GALA 2KR2A 3W9AA 3D82A 3NNMA 3IBMA 4B4RA 1PMHX 4LBLA 2GMMA 3ZN6A 5H9QA 4QQ2A 2JX9A 3G7DA 3KF5A 4XEZA 1XNTA 4HKOA 4W6YA 4H2AA 3VDCA 5F1RA 5B2GB 1LODA 3IT8A 4W50A 2P1BA 1BKZA 2ZGOA 2EIDA 2YPDA 1LTEA 2DDUA 2EAKA 3V64A 1C4RA 1PO12 3I3BA 1VBD1 1TVGA 1PZ7A 4I0WB 3L2HA 1IG3A 1BVVA 5IK5A 1TMF2 1W6QB 3EJKA 4HBNA 3U37A 1VR3A 1DYPA 4QKFA 4EROA 2ZBJA 1KJLA 3DKQA 2AR6A 4XJWA 1PNGA 1WCSA 2DYCA 4P9XA 5A70A 3O7OA 2YU1A 5C8CA 1H2MA 1PMIA 1A6CA 1XSQA 2VMIA 1PZ9A 3DYOA 4D3WA 1JYWA 5C3SA 4JX0A 2R30A 5C3OA 1OLMA 3MLJA 4LE4A 1PK6C 3MF9A 5HPOA 1DDLA 1VRBA 2VVFA 4MGKE 3NW4A 1KDKA 1RINA 1DQ4A 4P14A 4XF9A 1KEXA 3M2MA 4LBNA 1S0EA 5A3PA 2XL7A 4RGKA 4P00B 1UOBA 4GZ9A 4F83A 4QX7A 3W5MA 3ABZA 2WT2A 5E8AA 3KLSA 4EN9B 3JQXA 1CONA 2XJVA 3B69A 4M00A 2AC1A 2R0HA 1N47A 4UT5A 4S2FA 2PELA 5IHRA 2EIEA 3U75A 4QPGC 3ZOIA 4DS0A 3KQ4B 5JOWA 4CDWA 5ACA2 1BEV1 3PUQA 2E53A 2X8KA 2ZMKA 3N9LA 2HJIA 5CBLA 2BEOA 1ACCA 2HYKA 2XHNA 5LRSA 2BRTA 1A8DA 1RTVA 5HV4A 1NLRA 4DEQA 1SPPA 4AI8A 4FPOB 2DVDA 4IEWA 2BYVE 2RMU3 5I91A 4N43B 2W2IA 3EBRA 4PIYA 3F95A 4KWUA 4JC1A 4A2UA 1HIXA 1HRV3 1SBDA 4D94A 4J6GA 3JBG1 2OZJA 4AAPA 2JDUA 4NHYA 3RFRA 3ACHA 4OHZA 3CHXA 1AR82 4FTEA 3AXEA 2EA7A 2XUEA 3KT7A 5EP9A 4EN6B 1D0GA 3HPNA 2RJKA 2ZEXA 4KG0A 3AMHA 4C0HA 2V5DA 1X9TA 3WEZA 1BBT2 3GJBA 4N9HA 1YQCA 3MDPA 3LIGA 1JMUB 4JGYA 5JIAA 4BK5A 2YFUA 2G19A 4AFDA 4YLZA 1C8M2 4QX5A 2RS52 5FZHA 2QQVA 1T6BX 2HEVF 3GHNA 4UXAA 1SMVA 1F5JA 1BXHA 1QOTA 1V6MA 2EXJA 1YFXA 4LT5A 1ASJ3 2ZX2A 2QKDA 3DYMA 2ZGNA 5F6KA 1UOGA 2CU5A 1PIV2 1X82A 3T1MA 5A7QA 3HBKA 1ENXA 4CDXB 3ZIXA 1PMJX 1YRZA 1RIRA 2JKXA 2VVDA 1GQGA 5A7NA 4XJ9A 5LCWL 1S2EA 2CGOA 3OGGA 4OUSA 4Y3OA 4ZS3A 2D44A 3KT4A 4BYYA 1RUNA 3VHOA 2YUEA 3BOPA 4CUAA 3VBOB 2Z4FA 5FP4A 1VBA2 1S0IA 4XQ4A 3M1HA 1UMZA 4QPIB 4FFGA 2UURA 2PHDA 1W2TA 2A6YA 4E8DA 1WGPA 4PQQA 5ISLA 1NAEA 1ZZ8A 3NV1A 1ALYA 1N1VA 2I07B 4MGSA 2W1QA 2XOMA 4KH9A 5FZCA 4BXSV 3OPWA 4IEOA 2WSUA 4XXAA 5D8AB 1OUXA 2C9AA 1FYUA 4Q8LA 1CZVA 3D6EA 1R092 1WLCA 3UJQA 3S0MA 2XQRA 3GBGA 2YBPA 3WV6A 1LHVA 5A1FA 1NCRA 3DCQA 3AK0A 4JRAA 2R062 1HN1A 4R9DA 1PM4A 4L9BA 4MXWB 2HWF3 4XF0A 5HCFA 2A6ZA 2JD4A 3OYWB 2WZ8A 4L0PA 3UL2A 4E4SA 1W6OA 2PHWA 1OSGA 5FYSA 2Y0OA 3SH5A 1ZYBA 4YM0A 5FLJA 2SBAA 3P3NA 1STMA 1S0FA 3NNJA 4TTGA 5I0RA 4UW4A 1MEC2 2GC3A 3BGAA 4WM7B 2FZ2A 1AR91 4Y20B 2PLV3 5FO9B 1F4HA 5JUVA 4ORFA 5C4WC 5JPMB 1FOD3 2CL2A 1KITA 4V1PA 2IVIB 4BWOA 4GH4B 3SH4A 3OJBA 1DZTA 4K1YA 1ZRFA 1RL3A 3ZO0B 1R081 1V6JA 3FUOA 3HD8B 1V9U2 1POV3 1H0BA 3V0AA 2ZHKA 1K45A 5DABA 4N43A 2ZGKA 2XBO2 4BXFA 1SQ4A 1OLQA 2J1SA 3WF4A 4DUVA 2D6MA 4AHYA 2R072 4Z07A 2IXKA 3HBZA 5FUPA 5FRAA 1ZBE3 4IEPA 1A78A 4QDQA 2LTNA 3ACFA 4GKXA 4RYDA 3FLPA 2ZS6B 4M01A 5FZ9A 4A7KA 4IDZA 4A7ZA 5FXXA 4CSWA 2X10A 3I49A 4FTSA 1I9RA 5A33A 4LA3A 2VUJA 4L92A 4COYA 2WN3A 5JZGB 4ARXA 1J3PA 4GWJA 2VOVA 3GJAA 2OIIA 3PMEA 5HXVA 1N1SA 3AMNA 3ETQA 4IEXA 3J7HA 5FZFA 1H4HA 1RHI3 5H9PA 1LRHA 5CVRA 2A7AA 3O1RA 4GMP3 1B09A 4QDRA 3VBUB 3VN4A 5KBFA 2WJSA 4D7TA 1QJX2 4O7XA 5DAXA 4E4ZA 3WX5A 2AZ5A 4P9JA 4HSLA 5A3MA 4WBBA 1CAUB 2N7GA 3P3PA 4UYBA 1S0DA 1D4M1 4XDQA 5L9RA 3ZPOA 2CDPA 4WV8A 1GOHA 1PHMA 3J8F3 3RS6A 3SXWA 3ZDVA 4CDXA 5BNNB 5GZGA 5C8CC 3SCFA 4FAGA 1E57A 1JU3A 2GN7A 4B1LA 4PIZA 4Q27A 4CUBA 4E27A 5CKMA 1UPIA 1UQXA 2D6KA 3VBOA 1O3TA 2KA3A 5IVJA 2BNMA 3FN9A 4IGPA 2PQSA 1LEMA 2G4IA 1DLCA 4LE3A 3MGUA 2Y0IA 4QPIA 4MG2A 5EXOA 4R9BA 3ZXGA 4AWDA 3VUOA 3O1PA 4DUWA 4GB33 2CAUA 2PA7A 4MVTA 4QKBA 1X36A 2DCYA 2DCJA 3LIHA 4P08A 3K3NA 3S7EA 1QNWA 2Z42A 2RM23 5J09A 1FMD2 1VIWB 2AH2A 2P5BA 4MGQA 5D8AA 3UGFA 1RJ7A 2J22A 4BU2A 4LK6A 1ULFA 5C3QA 4BLIA 4YFWA 1X8EA 2AENA 4FPFA 2R0FA 3WF1A 3ZMOA 4CCCA 1PX4A 1W8HA 4CDWC 2ZEZA 2BP6A 3H3ZA 1C57A 1QF3A 3KVAA 4DRVA 4CCDA 1HQWA 2QNKA 4UFKA 3BKZA 4MGTA 3N9PA 2WBKA 1OLME 4MXWA 1MPXA 4CE8A 1AYN3 2V73A 1H2KA 1YQ2A 3I59B 5FYTA 2GNMA 1QJEA 3FLTA 3ZFGB 4CEYB 4ARYA 3C7GA 1JYTA 2R042 4N7UA 2KXLA 3MO4A 4Q0PA 2VOXA 1LHWA 1O4YA 1OKOA 2CGPA 4ZU5A 2G9ZA 4WM7A 1E5RA
chains in the Genus database with same CATH topology
4JDOA 3LSEA 4Q26A 3R0RA 1MS9A 1VBE2 3VHNA 4QM8A 4GWMA 2IFRA 4Q4X1 1RC6A 1HX6A 2VQ0A 4JGYC 2ZAAA 4MLOA 1NCQB 1COV2 1DGWX 2RHPA 3N7KA 4GA9A 1AL23 2VMGA 1H9PA 1PNFA 2NLRA 4HL0A 1XXNA 4R8HA 3N4MA 1ULEA 2WNUA 1GANA 5DZGA 5CFDB 5BNPB 1NY71 2ZX0A 1LULA 5I0UA 4DMIA 5BY5A 5JZGA 2AGSA 3ZFEB 4S2HA 1JYCA 2BNNA 1FPN3 2AUYA 4PQ9A 4LULA 3VZMA 1DBNA 2YGMA 2MHFA 2D6OX 2WZR2 1X50A 4OHVA 1XQNA 1ZX5A 4I3GA 3S6PA 2NZ9A 3ZYGA 1UZYA 4PIXA 1OQ1A 1ND2A 1EV11 4AHWA 3WP4A 5BV6A 3AKQA 4JRLA 4Y1XA 1NCRC 3RQ0A 4JVAA 3JD73 1F31A 3QLQA 2QDNA 4S2DA 5EJ3A 2DUOA 2ZAHA 1AR93 3AYCA 3LKJA 5EYXA 2VG9A 2MPFA 4XTMA 1AVBA 1HRI2 4FO9A 4YW2A 3WD5A 4BIOA 4I0AA 2XKOA 4LLFA 4PDWA 2PTMA 4B4PA 4YGBA 5DDJ2 5J96B 4OHWA 1TE1B 1WD4A 1QKQA 4R52A 2NMNA 5FO8B 4YZ5A 1KRIA 1AJOA 2W52A 1W6PB 4WVWA 2VNGA 2QCSB 1PGW2 3ZYJB 5CA6A 4N43C 4XXPA 1IKPA 4CEYA 3SNMA 4FQ4A 1PO13 4ISRA 1OOPA 1VAMA 2HWC1 3AP5A 4L2NA 4B29A 3V0BB 1EYBA 1TMF3 3AZVA 5L73A 1RUJ2 2RE9A 5I0TA 3WDYA 3M3OA 5JOYA 2D93A 2P3JA 5FDBA 1PGSA 4MUVA 4GIQA 1RVF1 1I1EA 1RUF1 4J1XA 3SMHA 1ZRDA 4RS5B 3TRSB 1BZWA 2CYFA 1DQ6A 3WY6A 2H0VA 2E7TA 2HEYF 2BQPA 4KGQA 5KHHA 5J98B 4IESA 1Q8OA 1ZZCA 3VHRA 5CG8A 2BVVA 5I8YA 2WC2A 1CIWA 5CFDA 4CDXC 5EFUA 1D2SA 2WKKA 3RYRA 1YHFA 1JXNA 2X5IB 5BNOA 4E2GA 1NOVA 1AX2A 1IHMA 5ACA3 3VBOC 2QZ3A 1IS4A 3ZFEA 3AYDA 4HN1A 2B5HA 5FPZA 3B7MA 3FUQA 2GNTA 5GLUA 3CJXA 3H3UA 4AW7A 1YJLA 1EY2A 2XLGA 4QPIC 5T50A 2D3PA 3TAYA 1YFWA 2HWD2 4FOWA 3OD4A 4YZ3A 1PVC2 1H4GA 3WW3A 1URXA 5FCCA 1JYIA 2WS92 2ZA9A 1QJU2 4XIOA 1X8MA 2UY9A 1AR83 1H8TA 2FHRA 3NV3A 2O8OA 4AQSA 1TEIA 5KHJA 1HLCA 1G9FA 3KCCA 3WVJA 1DGLA 4PJYA 1XYNA 4XQWA 2RS53 1XRUA 1G9CA 2C0ZA 2RS13 1O7FA 3ZFFA 2DVBA 1QJY2 3I4IA 4NHKA 2XUMA 1R1A2 3QOPA 4OVEA 2JECA 4WM7C 1GV9A 3O14A 5T5LA 3H0OA 1LGBA 4HETA 4H14A 3AYEA 4AVCA 1WA4A 4AEKA 2RMU1 4BZ4A 1FNZA 3TOJA 3ZYIB 1RJ8A 1LOGA 2K2SA 3ZSKA 1ZBA2 2JJ6A 4Q0VA 1VBA3 1HRV1 3VKNA 1DIWA 2VXRA 4I0BA 3NJZA 1Q8VA 3V0BA 1X33A 4XJAA 1O5LA 4XOGA 1SLLA 4BHPA 2VU9A 5DUXA 2H0BA 4AVSA 2WNUC 4Y22A 4G3YC 3ASIA 3PVEA 1Q8QA 4MGZE 4KU8A 1BEV2 1R093 5J48A 4RA0A 3VV1A 1UU4A 5AFBA 4RS5A 1LOBA 4GALA 2WNVA 3UV9A 1S55A 1ASJ1 2R063 2QFEA 3A0NA 5E16A 3MEPA 3H1MA 4DRRA 5CNAA 2AREA 2Z2SB 1O3RA 4CYDA 3MF6A 1FAYA 2Z5WA 4RHV2 3HIFA 3R05A 5FMOL 1NQJA 4Z82A 1EV13 4HLTA 1CPMA 1MEC3 3VBRA 1CPNA 2XHKA 2ZHMA 1S0GA 3PMSA 3AJYA 3KGLA 4Y24A 4MGYE 3MPBA 3VBFB 1ND2C 5FQ0A 1IQAA 1RUI2 5JR7B 1K5MA 4AF9A 1UN1A 2HWB1 4KWJA 4SBVA 1VALA 5FREA 4AQ2A 4RSUA 1RUD2 1BMV2 2XBO3 1BCXA 1B35C 1PM7A 3IDCB 2JG9A 3ILFA 2QDRA 2DWRA 3BIWE 4JQRA 4AFAA 2R073 2MNGA 4RR3A 4AVVA 3WG2A 1ZM1A 1QDOA 1MS1A 4MZUA 3WR0A 1C28A 5LK7B 3WQ0A 2F6BA 4N53A 5CFCA 5JMCA 2P3KA 3EHKA 2FZ1A 4YVWB 4PDWC 4JDMA 4RL7A 2GC2A 3WCRA 5C9AA 2FMYA 4FPHA 4LA2A 4PLNA 1PGL2 3RMYA 2HWF1 1APNA 4XFCA 4HSJA 4P9IA 1OOPC 4LBKA 5FLIA 1QJX3 3WQ1A 3WDTA 2VUAA 4IL7A 2PLV1 1FOD1 4FPJA 4LO7A 1XNCA 4QD2A 1LESA 1IKQA 3VLBB 1ZA4A 1RVF3 4HVOA 1I3HA 5JIUA 1CAWB 1POV1 4N90A 4H55A 4EWAA 1CJDA 3OCPA 1G8WA 3M3EA 2YDEA 4Y1ZA 3THPA 4TZDA 4IEZA 5FPXA 4YGEA 4B7EA 4XBQA 5JI9A 2CWSA 2ZTNA 1H2NA 1ZBE1 4GULA 4Q0SA 3IKWA 2D5FA 2IWGB 4PLMA 3OBTA 2XJPA 3AFGA 4XHXA 1GSLA 1UAIA 5CFDC 1FMD3 4QPYA 2RR12 4K9SA 3ZXJA 3LCPA 1FI2A 1A3KA 5BNOC 1DQ1A 2MEV2 4LBQB 2GMPA 1ND3A 2BW8A 2GU9A 3GZUC 1KFXL 1RHI1 2WFF2 4DQAA 3ZFEC 4META 1DQ5A 1W6MB 4GMP1 4NWVA 1FATA 3LAGA 3KSCA 3WXPA 4KNCA 3QCWA 1DZRA 4OI2A 1DLLA 4U2AA 1I6XA 2XLAA 5KXCA 3KT1A 1RUC2 2R043 3J8F1 5LEKA 1MVQA 2WQZC 4FOYA 4YM1A 4KQ7A 3MLKA 2TUNA 4Q4Y1 4PCRA 3TWIA 1FV3A 3ZIWA 1CAVB 3NO8A 1H8TC 3VBFA 1VBE3 4LO8A 4XIKA 2ATFA 1W39A 4NOTA 2A3WA 4QGNA 2BUKA 3JUUA 1MQTB 4GB31 3K48A 2ZABA 3AKSA 1MS0A 1COV3 4LTAA 1O5UA 4B4QA 2RM21 1FX5A 3ZFFC 3RJ2X 1ENSA 1WUVA 5JAXA 2I45A 3ZSLA 1VBC2 2CAVA 5GLVA 3UK9A 2VW2A 3IMNA 3CJIB 5F6LB 4RGAA 2WT1A 2UU8A 4YVWA 5DUUA 4P9WA 1AYN1 3AKRA 3FBYA 5FOBB 3R6SA 1IOAA 2Q0AA 4WZFA 4I3PA 4BLJA 3OTFA 2NMOA 3OY8B 4CEWB 2IC1A 3FJSA 5IK7A 3JU9A 2JG8B 3WUCA 1VRH2 4LBMA 2WZR3 2E7AA 4Y5Z0 4FBFA 1MVEA 1POV0 4Q8KA 5H9RA 2D6LX 5GM0A 1G6NA 2DCTA 3JB4C 2JDZA 4Q4W2 3TYJA 3ZSEA 2K0GA 1SLBA 2XJSA 3OPZA 2UWBA 2BFUS 1AL21 3MW2A 5CB7A 1H2LA 4RS5C 3X29B 1IPKA 2W39A 2WNVC 2ZGLA 4K3UA 3MW3A 4XFGA 2H6BA 2FMDA 5F5QA 2VMHA 2R49A 4FQZA 2BGCA 1QWRA 1SLIA 1HRI3 3POYA 1VB4A 4MGIE 3VBRC 2GNBA 4Q4V2 4CDQB 4GMP0 1NZCA 2ZX1A 2D98A 4IETA 3NVCA 2HWB3 1PZ8A 1W6QA 1CD3G 4NN0A 1FPN1 3RJRA 3RNSA 1HW5A 4BMBA 2QQPA 1K5MC 1PO22 3MFAA 4Q1RA 1JOJA 5CFCC 2DTYA 5KHKA 2PAMA 4KWKA 3TN92 2P2KA 4W6WA 2CTVA 1OHFA 4HVRA 1VBB2 1VB2A 5D1IA 1CVNA 2JG9C 1DGRN 1Y9QA 2R6QA 4FPLA 1ZREA 2ZGSA 4RR3C 3RSJA 2IZWA 1WW6A 3DGTA 4N7IA 1DG6A 1JBCA 1SBEA 2WFPA 1CAVA 3PVOA 4N53C 4XE9A 2QUOA 2NYYA 4YM2A 1U5YA 5C9AC 2A70A 2OA2A 4AFBA 4YZ1A 1IS6A 1LR5A 2EXHA 3JD71 3B00A 3R4UA 1MQTA 3ZXEA 1RB8G 4HVQA 2R1DA 2SLIA 2YXSA 3USSA 2UYAA 2ERFA 3SISA 2G9GA 1AF9A 1RMU2 4D7SA 1REEA 3CJIA 2JENA 2VPVA 1AYM2 1NG0A 5K0UB 1NQDA 5DUVA 1Z7S2 2ZMLA 1QH6A 1C5IA 1KS4A 3WDUA 4EV0A 2A6WA 3LOBA 4DINB 1UX6A 1ZRRA 1PO11 4YARA 5FOJB 1AR62 2K9ZA 2ZX3A 3MIFA 4ZKTB 2WQ4A 2HKXA 4TYSA 1TMF1 3D0JA 1G9BA 1HXS2 1EAH2 3FFQA 1PVC3 4WVZA 5HCAA 1XU2A 2ARBA 1HV1A 2WS93 3B93A 3AZXA 1QJU3 3B01A 4YW4A 1JN2P 1ND3C 4HKLA 1AXKA 2GALA 2WT0A 1OFSA 5AFEA 1Q56A 3LOIA 1XU1A 3USUB 5A3LA 3AZZA 4BIFA 4IV3B 2A3XA 3NKGA 3VDDB 4Q4Y3 4ES9A 4COUA 2X29A 1M06G 2VOKA 5T55A 3LWCA 3C3VA 1MS4A 2GSYA 4CP1A 1WD3A 2O1QA 1JUIA 1R1A3 3AZYA 3B02A 2ZHLA 1UF2C 5ACA1 4LNVA 1N1YA 1RGSA 1GFF2 3VBFC 4BOWA 1UU5A 2TNFA 1NE6A 2ZJCA 4LR4A 4GKYA 2JKBA 1U0AA 1DU3D 3DPRB 4JDNA 1O91A 3AJZA 3AMQA 1ZBA3 3ECQA 4UW5A 4FPEA 3AB0A 5T5PA 4YYOA 1MS3A 2JE7A 3E6DA 3HQXA 2DURA 4ATFA 2ZZQA 1V6NA 2WWSA 4FCAA 1AR81 4AFCA 1YXWA 3BU7A 4EWEA 4HN0A 3OYWA 3I2DA 1Q8SA 5C8WA 2Q1ZB 1TME3 4YVWC 1AJKA 1HV0A 3MLLA 4IV1B 1H1IA 2BVBA 1UCXA 2D97A 1OD5A 2RS51 4OHXA 2RS11 3WDXA 4Y20A 3BOWA 4QT6A 3WDVA 3RYKA 3V65A 4GH4A 3NAPB 3KQRA 4FAHA 1ENRA 3M70A 2EAAA 4DFSA 3G6JB 2X53S 2DU1A 2YY1A 4RHV3 1KDMA 2ZKLA 4LO6B 4RD7A 3U07A 4AQ6A 4C90A 1S0BA 1N1TA 4CTEA 3IPVB 5JPNB 1J3RA 4CP2A 4ES8A 3AX4A 1VBA1 4YG3A 1RUI3 1QXJA 3LSDA 3LZZA 2YC0A 1U5IA 2V5YA 4FSJA 2ZACA 1SFNA 2D5HA 3KGZA 2IXIA 1RUD3 1RUG3 5DUWA 1FV2A 3CF6E 3DL3A 4AGVA 1UW8A 3PLQA 2CY6A 2GZWA 1R091 5CIRA 1IGOA 3VBUA 3HT2A 4XZPA 3OGJA 3ZMNA 4L11A 4FPCA 1CAUA 2RS33 2FQPA 1S0CA 2R061 2OUHA 2RMU2 1XNDA 2RJLA 2ZGMA 5JSRA 4IV3A 5L19A 3E97A 5BNNA 3H8UA 4E2QA 3VDDA 4I02A 3VZNA 1F8VA 2D3RA 4O9GA 1WW5A 1MEC1 2PYTA 5AC92 3PJYA 1RUE3 3FHIB 4AXOA 1CGPA 2VOWA 2VQAA 3E6BA 3VBSB 2P17A 3EO6A 4YW3A 3VBHB 1V9U1 3O0VA 3FWEA 2PAEA 1J59A 2XBO1 3FBMA 4K7JA 1MQTC 5IUQA 3U0ZA 3ZPYA 5JSOA 2R071 1O4ZA 4XYXA 4Y26A 4XMIA 1WW7A 3VKOA 4HMZA 1OMIA 2W68A 3AM2A 4DB5A 4AI1A 3MW4A 3CJIC 1XYPA 2HWE2 3I59A 4QPGB 2DFCA 2CV6A 2DU0A 2RR13 3ZFGA 4QQHA 1UIKA 3VHPA 4EN7B 2MEV3 2WFF3 3MYXA 1AR72 1OA4A 2IXJA 1CJPA 1S2KA 1G9DA 4FPGA 1QJX1 5K7PA 2GNDA 2ZGTA 4LHLA 3K51A 4YFZA 4Z1VA 4S2GA 3NAPA 3ZXLA 1QDCA 1J3QA 1R1ZA 2Q4SA 4NHLA 4OI4A 1G9AA 4HANA 3RZZA 2XVGA 2O0OA 3RI9A 1RUC3 1QQP2 5JSPA 1NCQA 1G86A 3MIGA 5A32B 4DY5A 1S2BA 2BBVA 3IWZA 3J9SA 4WVMB 3IPVA 5K9YA 4XJZA 2XL9A 3TNQA 2DVGA 2JEMA 4UW6A 2VW0A 2DCKA 4ZU7A 2IFWA 3AFKA 3JB8A 3CNAA 5BNPA 3RDIA 3POSA 2VY0A 1RUH2 5GZEA 1AHSA 5GLZA 1H1MA 1FMD1 5FLHA 1MZEA 5CAZA 2PLV2 3NV2A 4H3WA 1VBC3 1D4VB 1UL9A 2YROA 3SITA 3LGRA 3GZTB 4BA6A 1C8NA 1AL0G 3WP3A 2PHTA 3A0KA 4GWNA 4C91A 5FBZA 1GZCA 4EN0A 3M3CA 5D8AC 4K20A 1OPMA 1KJRA 1OLRA 5BYNA 1F5FA 1LU1A 2R041 2A5ZA 1ZNPA 1H30A 2GAUA 1OQDA 4KWLA 1BBT3 1JTZX 4W65A 4C1XA 1Q8PA 5T5JA 1VBE1 1C8M3 3PVBB 1VBD2 2XVLA 2ARXA 3M3IA 4AE2A 2GC0A 4Q0QA 3VBSA 4Q4W3 5GLTA 1MZ5A 3VBHA 1OKQA 1RHI2 2D6NA 4XFAA 4YRDA 5T3NA 3RPQA 1COV1 2LALA 1PIV3 2E9QA 4YGDA 1KXGA 1DGWA 5GZCA 4FP2A 4UBHA 3WNXA 2IXLA