2ERFA

Crystal structure of the thrombospondin-1 n-terminal domain at 1.45a resolution
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
209
structure length
209
Chain Sequence
GGDNSVFDIFELTGAARKGSGRRLVKGPDPSSPAFRIEDANLIPPVPDDKFQDLVDAVRTEKGFLLLASLRQMKKTRGTLLALERKDHSGQVFSVVSNGKAGTLDLSLTVQGKQHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELDVPIQSVFTRDLASIARLRIAKGGVNDNFQGVLQNVRFVFGTTPEDILRNKGCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Thrombospondin-1
publication title The structures of the thrombospondin-1 N-terminal domain and its complex with a synthetic pentameric heparin.
pubmed doi rcsb
source organism Homo sapiens
total genus 58
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2005-10-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2erfA00
1CPNA 5GLUA 1U0AA 2R49A 1MS3A 4XBLA 5DUVA 5CB7A 1V6LA 2D6LX 1V00A 3AJYA 4YG6A 1V6JA 4Y24A 1AF9A 2A6YA 3A4UA 5H9SA 5T5LA 5GLZA 5T52A 3R4UA 1S0DA 3NV1A 1Z0HA 1ZM1A 3O5SA 3OYWA 2VW1A 1WD4A 5DZEA 5IUQA 4AVTA 1S1AA 3FUOA 5FREA 4Q8LA 2NP0A 2JKBA 3GNEA 4AGGA 1CONA 2OUJA 4WVVA 1WW6A 4XTPA 2DUQA 1WD3A 3N7MA 4HANA 1BXHA 1AX1A 2WT1A 3DGTA 4OZXA 3N3HA 1KDKA 2GNMA 2ZHKA 4M3CA 4PBOA 1QKQA 2SLIA 2AH2A 1MZ6A 1G86A 4RL7A 4LBQB 4LBMA 2GNTA 3POSA 3UK9A 1BJQA 3V0AB 1G9DA 3LSEA 4JC1A 2YROA 3M3QA 3SH5A 1AJKA 2D3RA 1HDKA 1SLLA 4FQ4A 2WT0A 4RA0A 3SITA 3BTAA 2DVDA 1SLCA 4R9CA 3M3EA 4Q8KA 5GZEA 2PHTA 4YM1A 2LTNA 1UN1A 2JE7A 4XYXA 4FP3A 2WLQA 1SBFA 3NV4A 3WDXA 1V6IA 4XHXA 1LOGA 3AP5A 2GN3A 3AZWA 3U4XA 4FPCA 4YZ2A 1AX2A 1JW6A 3BIWE 4YW1A 3FFZA 1LHNA 1UMZA 2ZGRA 1LENA 2AR6A 4GXLA 1D0HA 3I8TA 4Q26A 2JE9A 4WVWA 1Q8QA 4K20A 1DQ5A 1WLCA 3T2TA 4ZXKA 2JDZA 4M3CF 1MVQA 1ZA4A 3MW4A 2YY1A 5IK8A 1IOAA 1GBGA 2VXRA 1ENQA 4Y22B 3UL2A 1WW4A 4ASMB 1BYHA 2DVAA 4ITCA 1DYPA 5T50A 2AUYA 3BOPA 2CWMA 3AFKA 4XILA 4GALA 2E51A 1VAMA 3NV3A 3WHTA 4YGDA 1IS5A 2ZGOA 5CNAA 2AGSA 4Q1PA 4FPYA 4FOVA 2A6WA 2NM1A 2VW2A 5KXEA 3WCSA 3B00A 3V64A 5H9PA 2NYYA 4XMAA 2R0HA 4U2AA 4XBNA 4XIKA 3SISA 3ZSLA 5CBLA 2RHPA 3AK0A 1S0CA 1KRIA 1G9BA 4FPEA 2ZAAA 3VV1A 1LEMA 3ZYPA 1CESA 2DVGA 5GM0A 2EXHA 1N1SA 1B09A 1HQWA 3B9CA 1VIWB 3D4KA 4XHBA 4YGEA 1LOBA 3UJOA 1DQ4A 1LHVA 1VALA 1G9CA 1C1FA 2C5DA 1A3KA 3PMEA 4YM2A 5T5PA 5KXDA 1SLIA 4XXPA 4P9WA 1Q8PA 1GKBA 4AWDA 4Y20B 3LSDA 2EALA 1N47A 2CYFA 1SBEA 3FLPA 2A6ZA 5JVVA 3N36A 1ULFA 2GALA 4LBOA 4Y1YA 4DS0A 1GLHA 4UW6A 5JOXA 1CPMA 4YW5A 5JMCA 2WJSA 1Q56A 1I3HA 3PVNA 1LODA 2AENA 1QNYA 1OFSA 3Q9OA 2A71A 3R4SA 4PBPA 3AZXA 4WZFA 1DLLA 1QOTA 1A8DA 2P3KA 4BLIA 4XJ9A 2BQPA 2ZGTA 4FQZA 5T5JA 5T54A 4FOWA 1LOFA 1WW7A 4XJ8A 5EXOA 3M3OA 3WDYA 2VUAA 2D6PA 3ILRA 5IK7A 3IPVA 3D6EA 1W6NB 1Q8OA 2KM2A 3FLTA 5GLWA 2G4IA 1AXZA 3N7JA 4LBKA 1Z78A 2CL2A 3V0BA 4XBQA 1LHOA 1MS0A 3M2MA 5DG2A 3ATGA 1RIRA 2Q5TA 5BYNA 4DRRA 1FYUA 5FRAA 2A5ZA 3OY8A 5KXCA 1JBCA 4R9AA 2ZGKA 1IKQA 3MEPA 2H0BA 3AYEA 4AVSA 5JOWA 1GNZA 2A7AA 2GNBA 1BQPA 2ZMKA 2PHUA 3A0KA 3FLRA 3OY8B 3ZXFA 2JJ6A 4Y1VA 1I1EA 4BM8A 3HN1A 2B7YA 4LBJA 1MR5A 2FMDA 1LESA 2NMNA 2W52A 3A0NA 3D5OA 3N35A 4CZSA 4ISRA 1YXWA 4DQAA 3OBRA 1UAIA 1Q8VA 1JOJA 3OYWB 2CTVA 2AYHA 2P2KA 1H30A 4JRAA 4GA9A 4YM0A 2SBAA 5JOYA 2ZMNA 4YZ4A 5EYYA 4XTMA 3WG3A 1W6PA 2P3IA 5E88A 2DUOA 2ZHMA 1DBNA 2ZACA 2DU0A 1SACA 2ENRA 3HR9A 3WDWA 4FPOB 2WNEA 5IT6A 4KBBA 2D43A 3WUDA 1H9PA 1YO8A 1MS8A 2YV8A 1WBFA 4I30A 5HCBA 3ZSKA 2DYCA 1WLWA 3RG0A 1GZCA 2R16A 4M3CB 3WHUA 4YZ5A 3INAA 5CAZA 3POYA 4UW5A 4GWNA 4YGCA 2PHFA 2ZABA 1JN2P 2VY0A 2OVUA 4YGBA 2E7QA 2CY6A 3PVOA 4U36A 1WBLA 1TEIA 5GJ6A 1CVNA 3W58A 1DQ1A 3BODA 4CTEA 1OKQA 1SCSA 3OGGA 3POWA 4YZ1A 1DQ2A 2D6KA 3M3CA 2D3PA 4FPLA 2ZGPA 1LU1A 1AJOA 1LOFC 3T1MA 1NXD1 3SNMA 1W6MA 5L73A 1VAVA 2GNDA 4LBQD 3WNXA 1AVBA 1SLBA 4BMEA 5CA6A 1UZYA 4FPFA 4ATEA 1VLNA 1F5FA 1MS5A 2GMEA 4SLIA 2W08A 1PZ9A 2LALA 2D6MA 2ZBJA 5GZDA 2UWBA 4K21A 2EXIA 1G9FA 4AYUA 4BMBA 3AYCA 3SLIA 4DFSA 3C2UA 1G7YA 3L2YA 2TEPA 5T5OA 4P9XA 2ZGNA 1GZWA 3PVEA 3CNAA 4M00A 4PF5A 3OBTA 3USUA 1FATA 1LECA 2ZZJA 5F5QA 5AVAA 3JU9A 3LCPA 1W0PA 1WW5A 3O0XA 1DIWA 1Q8SA 2CNAA 1W6QA 5DZFA 1YRZA 4LBLA 3USUB 2PHWA 2FHRA 2D6NA 5DUXA 5JDBA 2DU1A 2E7TA 2V5YA 1QOOA 5EWSA 4TZDA 1A78A 4FOQA 1FAYA 1KJLA 3R05A 1C1LA 4GKYA 1PZ8A 2A6VA 1ENRA 1N1YA 4XJUA 3M1HA 1KQRA 4YLZA 1LJ7A 4IQPA 3WCRA 4W65A 2DTYA 4FPKA 2W39A 4BPZA 5H9RA 5KXBA 3V65A 3WG2A 4YG0A 5EYXA 3PJQA 1LGBA 1QMJA 4ATFA 3IKWA 1ULDA 1LEDA 2HYKA 3AP4A 1R1ZA 4XZPA 1X50A 1QGLA 2ZGQA 5JOZA 4K1ZA 4C1XA 3W59A 2NZ9A 3AXDA 1MACA 4NO4A 1YI7A 1NLSA 3AZVA 3ZPYA 2DTWA 2AREA 3O0WA 5JLVA 3AJZA 4Y1ZA 1WUVA 5GALA 1W6OA 2PHRA 3ZXEA 1DQ6A 3IPVB 3AP7A 5GZGA 1LU2A 2ZHNA 1F9KA 4FVVA 3KQRA 1CQ9A 3V0BB 1D2SA 1GNHA 3ILFA 3IN9A 3O0VA 5DUUA 4K1YA 4NOTA 2ARXA 5GLTA 1GSLA 2ZGMA 1GV9A 2WT2A 3ILNA 3ZSJA 1ONAA 1JYCA 2P37A 2JD4A 1JHNA 2OW4A 3MW3A 4PCRA 2Z42A 1S0IA 3T1LA 2DVFA 1GICA 1CR7A 2A3XA 4XJAA 4GWMA 4YM3A 2DVBA 1YIFA 2EIGA 4M3CE 1JXNA 2R0FA 2XB6C 1UPSA 4BOWA 1DQ0A 1SCRA 2GMMA 5DXDA 1AXYA 4Y26A 3RMYA 1ENSA 1QNWA 3WG1A 2R1DA 2E53A 2ZMLA 1BKZA 3AP9A 3APBA 2NMOA 2R1BA 1DGLA 1W6PB 1C57A 1WCSA 2A70A 2C9AA 3O12A 1FV2A 1IS3A 2I2SA 1N3PA 1C4RA 4CRQA 4M01A 3VKLA 1V6NA 5IK4A 1LGNA 3B3QE 3H0OA 1GYKA 2YMZA 1LULA 4R9DA 2D6OX 4XE9A 5GZCA 3MW2A 5H9QA 3IM0A 4XJZA 2PHXA 1DFQA 2WSUA 4AGRA 3ZYRA 2UWCA 3AYDA 3AX4A 2JECA 1AXKA 1JUIA 5DG1A 3NWKA 3OJBA 4LBQA 4ZKTB 1UKGA 3ASIA 2WSVA 4XJWA 3AXEA 1S0GA 4FPJA 1UX6A 2A6XA 2DWRA 3ZXKA 2E6VA 4P9YA 3VKNA 4D69A 1FNZA 1OQ1A 3I4IA 1W0OA 1YYNA 1G8WA 4R9BA 2D44A 4FPHA 4Z8BA 4WV8A 1BZWA 3ZXJA 3TAYA 1RITA 3MPPG 1H9WA 4UW3A 4AGVA 2ZGLA 4YW4A 2EF6A 1APNA 4BLJA 1LHUA 1W6MB 2YZ4A 1O4ZA 4LBNA 2ERFA 1LTEA 3WLUA 3WV6A 1N3OA 1S0BA 4YW2A 3FBYA 3RRDA 3VKOA 1RINA 2ARBA 3DUIA 4XOGA 1LHWA 1N3QA 5HCAA 2D7FA 2V73A 2ZA9A 3WDUA 1SLTA 1MVEA 4GKXA 4AVVA 3OPZA 3GALA 3FUQA 4L8QA 3WOGA 2GDFA 2VU9A 4UW4A 2UURA 2ZGSA 1URXA 1FV3A 3NV2A 3RMXA 3VKFC 3ENRA 4YFWA 1WLDA 1MS9A 1V6KA 3IMNA 3TB0A 2A3WA 2DUPA 1AZDA 1GZWB 4YFZA 1ULEA 4Y22A 4TYSA 1MZ5A 2VH9A 2WKKA 3RQ0A 3RS6A 4MYEA 4H55A 2A3YA 2OUHA 1W6QB 3AP6A 3N7KA 1CIWA 1HQLA 1UL9A 1ULGA 2P3JA 5HCFA 1SFYA 4F83A 1F31A 4JCKA 4XDQA 3QCWA 1CJPA 1S0EA 4DPNA 2UWAA 2EXJA 4HL0A 4C1WA 4ISQA 2A75A 2ZGUA 1QU0A 4XMIA 1FX5A 1AX0A 2W68A 5E8AA 3VKMA 1QOSA 3AYAA 5T55A 3WUCA 2DURA 1LOEA 3WZ1A 1O4YA 1SBDA 4YW3A 3WG4A 1V6OA 1J1TA 1DZQA 1MS1A 2EAKA 3RSJA 5E89A 3ZSMA 2P34A 5LK5A 4PQ9A 4Q1RA 4P14A 1SLAA 3UJQA 1FNYA 1LCLA 1KJRA 3AZZA 5F9TA 1LOAA 1XQNA 2EXKA 1QDOA 5DZGA 3B01A 4Y20A 3WVJA 1S0FA 1KITA 1IKPA 1IS6A 2DV9A 2WQZC 2ZKNA 3AZYA 4Q2FA 5IK5A 1JYIA 5GZFA 2D3SA 4YZ3A 3N7LA 4FPGA 5SV8A 3V0AA 1QF3A 5GLVA 3WDVA 4XXAA 4YG3A 2YXSA 1W6OB 1EPWA 1N1VA 1DYKA 1S0JA 1KDMA 3JUUA 1CN1A 2VW0A 1HLCA 4Q27A 1LGCA 1IS4A 1V6MA 3ZXLA 3ZVXA 1ULCA 3SH3A 2ES3A 1PZ7A 3HMYA 1QDCA 4DRVA 1W6NA 3KM5A 4Y1UA 3QLQA 1LOCA 2ZHLA 2NN8A 3SH4A 2XG3A 1GANA 1DHKB 4FOYA 2UU8A 1G9AA 4BQ1A 1UZZA 1MS4A 1N1TA 4XIOA 4Y1XA 4FP2A 3WDTA 2GMPA 2GN7A 1GZ9A 2PELA 5DUWA 1HKDA 3B69A 3VUOA 2CWSA 1Y7BA
chains in the Genus database with same CATH superfamily
5FPLA 2YU1A 4CCKA 3KT1A 2P5BA 4OHYA 3IIIA 2KXLA 3AJYA 2FBEA 4GMP3 3SCGA 4JKMA 3POIA 1D4VB 2UYBA 2A6YA 3VBFA 3O1VA 2DCTA 3H3LA 3NV1A 1Z0HA 2BU9A 3IDEA 3O5SA 1EAH2 1WD4A 2VW1A 4COUA 1O6UA 1SFPA 1W39A 2ZPXA 5FO7B 5FREA 4AVTA 4BISA 5CG9A 4LQRA 3TRSB 3CO2A 1COV3 2OUJA 3TNPB 4XZUG 4HANA 3ZFGA 3BU7A 5LY1A 1OC1A 4R8HA 1NZIA 2W92A 2WT1A 1IPJA 5FZ6A 3LOIA 3LGRA 3MIFA 1KDKA 3J7MA 4RYDA 2SLIA 2BPA2 1MZ6A 1GOFA 4BB3A 3NSTA 3N9PA 3OGRA 2IFWA 3IT8A 1REFA 5J96B 4DY3A 2GNTA 2D93A 3POSA 3DL3A 2I07B 5FFOC 3UK9A 2XONA 2FCTA 2G9GA 5LRSA 3IB3A 2GH8A 5FXVA 1F5JA 3NAPC 5FMOL 1RC6A 4Q4W1 3SH5A 2D3RA 4IE6A 1HDKA 2W3JA 1SLLA 2RMU2 2E63A 5FZMA 1ZBA1 1RYYA 2W1WA 4XF0A 1AYM3 1UYZA 2E9QA 2WNVB 5C7GA 3VZMA 4LEJA 1U5IA 2B45X 1RTVA 4FP3A 1MZEA 1SBFA 3NV4A 4IEPA 2W87A 3E5XA 5C5UA 3P3PA 3JQXA 1AL0G 4J6GA 4XHXA 2QDNA 3BUCA 1PVC3 5I8TA 1LOGA 1NCQC 5KHIA 1EYBA 3AZWA 2XQRA 3KF3A 4YZ2A 4XVHA 2HYXA 1LHNA 3MIBA 3MUY1 1UMZA 3TYJA 2AR6A 4GXLA 3AKTA 4YVWC 2W9XA 2BBAA 5FZHA 3ETQA 1NCRC 1ZZCA 3I8TA 1V9U1 2IZWA 4Q26A 1DQ5A 1WLCA 3S30A 2W47A 4M3CF 3VZNA 4XFGA 1UPIA 1TNFA 1ZA4A 3MW4A 3KHBA 2YY1A 1IOAA 1GBGA 3KMHA 4KGGA 3D3AA 4WM8B 1EAH3 4MVTA 3VBRA 4CP9A 1RUF3 3PJYA 4KMQA 4LE3A 2DVAA 2OT7A 4LULA 2Q8OA 4XFIA 3VDDC 2AUYA 1VBB1 3WHTA 4NIDA 4FPYA 2HBUA 3THTA 2W5FA 2I74A 2ZS6B 2E26A 3JBG3 4XMAA 2R0HA 2HH9A 4U2AA 4XBNA 4PI2A 4BIFA 3U78A 4K3UA 3S0MA 2ZAAA 1X82A 1XYOA 4M0NA 5CYYA 3NNMA 2Z4FA 1W8NA 1N1SA 4KNCA 1B09A 1O3QA 4IV1C 4XHBA 2VOTA 4QPIA 2RMU3 4R4XA 4IEQA 4YM2A 5KXDA 5T5PA 4AHYA 4QGMA 4XXPA 4CDQB 1UY1A 1O5UA 2VOVA 4MO3M 3TOJA 1S2BA 2ZOEB 2WS91 4Y20B 4BIOA 2EALA 3BI3A 2Y0IA 4LO4B 3FLPA 5JXGA 1ZA7A 2XLFA 3RWKX 3WNNA 3LB9A 1SQ4A 1NKGA 1GLHA 1LRHA 4D7YA 1JZ7A 2B46X 3PVNA 3B02A 3CDZB 4I3PA 3V0AB 4N9IA 1QNYA 1OFSA 2FQPA 4ZU7A 3LWCA 3O1MA 5CKMA 1A8DA 2BJSA 3POBA 2OYZA 2BQPA 5JSPA 5T5JA 5L7OA 2QCSB 3GCXA 4IE0A 5T54A 3LKJA 4FOWA 1VRH2 4N9HA 3A21A 2VG9A 3D8CA 4OUMA 5D8AC 3R4DB 3D6EA 1YQ8A 2RE9A 5A70A 1PHMA 1Q8OA 2KM2A 2MEV1 4LA2A 1W8UA 1Z78A 2CL2A 3V0BA 1W8OA 2ADDA 5FK8A 2RS32 2XJQA 4QKFA 3VBUC 4XUQA 5DG2A 1RIRA 2PYTA 5FYZA 1SEFA 3K3NA 3D82A 2VZRA 4DRRA 1W8FA 4NPRA 1FYUA 5FZFA 5K7PA 3WW2A 2A5ZA 4HOOA 2AZ5A 4M0HA 3MEPA 4XW3A 3AYEA 1A8MA 3RZZA 2R061 4A6OA 4AF9A 5I0UA 2DFCA 2Z5WA 2PHUA 5A1FA 5M0TA 4KG8A 1I1EA 4BM8A 3FL7A 2G9FA 3HN1A 4NHYA 1MR5A 3N35A 2QBXA 3AKSA 3VBFB 1YXWA 3VHOA 4JHZA 4P9GA 3I7DA 2BYVE 4BH9A 2CTVA 1H30A 3C7EA 1AR81 4GA9A 4YM0A 5A7SA 2ZMNA 4RHV1 4XTMA 4HPKA 1PO21 4E2SA 2ZHMA 1L7QA 4I0AA 4RSUA 1DBNA 3VDCA 2ZACA 1NG0A 4KU8A 4GWIA 4WVMA 2EIDA 2WNEA 5FXWA 3ZFGB 4KBBA 2D43A 2HWD1 2ILMA 3POJA 2RS12 5HCBA 1MS8A 1NY72 4X8PA 3UKVA 2CSGA 1E57A 1ZZ8A 2BVBA 2R16A 2B8MA 3ELNA 3INAA 4P5YA 4QKDA 3POYA 4AI0A 4YZ5A 5JZGA 4E9KA 1OSGA 2WFPA 1UYPA 1HRI2 1J1LA 1JN2P 3UGGA 2OVUA 4BK5A 4QDSA 2GH2A 3VBSA 2WN2A 4EWEA 4FO9A 4U36A 5FK7A 5LBEA 4AFMA 1WBLA 2VZUA 1C28A 1VRH3 3VHNA 2D5FA 5GJ6A 1CVNA 3W58A 3LDKA 4GMP1 1HJFA 4IGQA 3HT2A 5FOBB 4F7ZA 1ODMA 3OGGA 1S2EA 5T3NA 2CGNA 5G05L 1OBNA 4YZ1A 4CA9A 1O8SA 3GBWA 5I8SA 2RS33 3M3CA 4HT1T 4QMAA 1OD3A 1COV1 4QQ2A 2VVFA 4XABA 1YUDA 2ID4A 1O8PA 2BFUS 4EN7B 1F4AA 3WNXA 1OKOA 4LBQD 4XETA 5FMBA 1OF4A 1UZYA 3KB5A 2YU2A 4FPFA 1GOGA 1VLNA 3LOBA 1VMHA 1F5FA 1MS5A 4SLIA 5LBCA 3EMRA 4AFCA 3VD7A 1CJDA 4IE4A 1EUUA 1HN0A 5FPBA 5GZDA 4K21A 4BYYA 3ACGA 3VBRB 1XJAA 5CU1A 3ZN4A 4CP9B 3QH6A 4AYUA 4BMBA 4Q0SA 3GHNA 1DGRN 1G7YA 3NNLA 5T5OA 4WM7A 4PDWC 4M00A 4UXAA 3FHQA 4PT6A 4S2HA 1ZRFA 5AVAA 2ZZJA 5F5QA 2VXJA 3AM2A 3JU9A 5FZCA 1JHJA 3KVAA 1AYM1 1H2MA 5CZKA 2Q8EA 4NHMA 4QM8A 5FY4A 3T2PA 2PHWA 3KV9A 2FHRA 1AR92 1X8EA 1WCDJ 4BK4A 4BQ3A 1QJU2 4Y4YA 1CZTA 2RDRA 3IZOA 1HRI3 5FZ0A 1OLMA 1FAYA 5BNOA 1PVC1 3MICA 3OOXA 1OUXA 1ENRA 1ND2A 3M1HA 1TNRA 4NHKA 1VJ2A 2BWAA 3K48A 2JDNA 4QPIB 4MG2A 1VPHA 4N90A 2CAVA 4IQPA 5EQUA 4DZGA 3VBHA 4BPZA 3H8RA 3NNJA 4DB5A 3V65A 2WNUC 4YG0A 1EAH1 1R1A1 3PLQA 5FUNA 3RYKA 3ZMNA 1RUF1 2IXJA 4ATFA 1UYYA 5FZ8A 1LEDA 4LOSA 4XZPA 1F2NA 1HXS2 3K46A 1JOPA 5FZAA 4DEVA 5JOZA 1O5LA 2D5HA 1VB2A 1I9RA 2NZ9A 3HAGA 3W59A 5L7OB 2YC2A 3PUSA 1NLSA 4KWUA 3NNFA 2ET7A 3JBG1 2XMLA 2XUEA 3E5QA 4MHRA 4Y1ZA 3X29B 5GALA 3O1UA 3I3DA 3FHIB 1VBC3 1W6OA 2BDRA 2PHRA 3ZXEA 1ZRCA 2ZHNA 3MYXA 3PL0A 1DG6A 4HVOA 1MPXA 5A32A 3V0BB 3ILFA 3IN9A 1ZREA 1PMJX 4K1YA 4NIHA 4IV3C 1GSLA 5JI9A 1H2NA 4QAWA 1QXRA 4IEVA 4NE9A 3ILNA 2RMU1 5F39A 1E5HA 1K5MC 1JYCA 1UD1A 1US2A 3J8F2 3OPTA 2PHDA 2Z42A 1XPWA 5JSRA 4XJAA 1CR7A 5B2GB 2QQOA 4OVEA 4PJYA 4GWMA 1JYWA 1ZNPA 2JG8A 4XUPA 3KCYA 2WO7A 3WY6A 3I3QA 2XJSA 3HNYM 3HNMA 1H0BA 3DPRA 5IVYA 4BOWA 4MUVA 3NJVA 4Y26A 5FV3A 3WG1A 3MLJA 3I2OA 2R1DA 5F32A 3AP9A 4HK9A 2NMOA 2RR11 3GCWA 4HPKB 1UKRA 3EB7A 3RGBA 2A70A 2K46A 3O12A 1OPMA 4BQXA 1FV2A 4LO7A 1MQTC 4DXZA 4WVMB 2A1XA 2BP6A 4P02B 3B3QE 1GYKA 2YMZA 4R9DA 5C5TA 1XU2A 2J1AA 1V0AA 2PAEA 4XQDA 5JZGB 4XJZA 1UOGA 2J22A 1DGWX 2HEVF 2PHXA 5IVJA 5IVFA 5IATA 3HD8B 1HXS3 2F4PA 4LORA 4XF9A 4NR1A 5FBZA 1JUIA 1AR63 2Y34A 3LPGA 3A23A 4ZKTB 4QPGC 3ASIA 1H8TC 5A6QA 2ZX2A 4FPJA 5ABJA 1UX6A 1VBA2 3LDBA 2VQAA 2R32A 2Y60A 1W9SA 4I01A 3VKNA 1OQ1A 3DKWA 4LHNA 1QJEA 4CDXA 1G8WA 1GWKA 2D44A 5EJZB 4CXYA 3LPFA 5CFCC 3ZXJA 3NJZA 3EO6A 3LEIA 4NN0A 3CLPA 1H9WA 5I0RA 2Y26A 3QOPA 5BPXA 5IYYA 1L7RA 1YQ6A 4LT5A 1VBE2 5A6XA 1LHUA 3WV6A 1LTEA 3HIFA 1YFXA 5A3LA 4LJHA 3FBYA 3SXWA 3VKOA 1RINA 3DUIA 3OD0A 2F4LA 3N9LA 4A7YA 1N3QA 2HWC2 3IBMA 4E27A 1OQDA 5J36A 4BCUA 1W8HA 4AVVA 4LKFA 3GALA 4EWAA 2PLV2 3FUQA 3WOGA 4CCDA 3AMHA 2UURA 4ES9A 5KHKA 1FV3A 1AUYA 1H1IA 1MS9A 1VRH1 4Q0UA 4YFWA 1V6KA 4WBBA 5GKAC 4WM7B 5FBJA 4CDWA 1ZRDA 1RUC2 1ULEA 4D94A 4TYSA 4ORFA 4ZXEA 1MZ5A 1IQAA 4MYEA 3LEGA 4H55A 3UNPA 4ZS2A 2RS31 3N7KA 1ULGA 2C9KA 3DEMA 1XNTA 4HSLA 4XDQA 2OQ6A 5DABA 4LHLA 5FP3A 3I3BA 1O59A 1S0EA 2XLAA 2LM3A 3GJAA 4DPNA 5HV4A 5BNOB 2EXJA 2WINB 1ZBA2 2AEYA 4HL0A 4JX0A 1ULOA 2ETEA 4MSVA 1FX5A 1ALYA 3T4VA 3AMMA 1ND2B 4XAEA 3VL8A 5E8AA 4A4AA 4UFMA 4OI0A 3MF6A 3S57A 1LOEA 4LUMA 3WZ1A 3AMPA 4QHZA 3Q8BA 3WG4A 3ZKYA 1V6OA 2Z79A 1J1TA 4YARA 4QXHA 1VBA3 1YFUA 1OMIA 3SEEA 3VBHB 2JB4A 3JD73 4GMP0 5FLJA 4IDZA 5F9TA 4UFJA 1XQNA 5FZIA 1H1AA 2EXKA 1FOD2 1JODA 4MGIE 1TVGA 3B01A 1JYXA 5L9VA 3WP3A 2WIIB 3ZO0B 5C3SA 1VBE3 3RYRA 1W2OA 5JSOA 1X9PA 1V9U2 1NE4A 2WQZC 3AZYA 1CX4A 3VN4A 4AQ6A 4NUBA 2FDHA 1NY71 2VUDA 3N7LA 1HV1A 2BW8A 1XNBA 3JXSA 3LFMA 4IEXA 1FMD3 5SV8A 4JDOA 1ST8A 2HWC3 3WDVA 1JYVA 1W6OB 1W9FA 1S0JA 4FFFA 4QXCA 1HRI1 4OULA 1Q5OA 1CN1A 1VBB2 2JDMA 1QQP3 1YEWA 4QQLA 5A32B 3UGFA 2PLV3 4XUTA 1O7FA 1ULCA 3SMHA 4GQ7A 3WF1A 3OF1A 1REEA 3HMYA 1PZ7A 4MXVA 4D6SA 1NCQA 1UQXA 1W6NA 4JGZC 4B8EA 4XURA 5FY7A 1LOCA 4YW6A 1RUC3 3T3YA 3ZYJB 1U5XA 4FOYA 2B9VA 2UU8A 4F8AA 1H8VA 1MS4A 4YVWA 3DECA 4TLGA 2V09A 1VE0A 1FT9A 4ZS3A 4QPWA 2V5DA 2JG8B 3WDTA 1PIV1 1GZ9A 5FLIA 3BPZA 3DF0A 5DZFA 3DPRB 1Y7BA 4YGBA 4AHZA 1CPNA 1ZBA3 2PHLA 4NVPA 1D7PM 5CB7A 2PQSA 1F35A 3LEKA 1V00A 2WS92 2X8KA 4MZUA 2EAAA 1VAKA 4EWDA 5F7UA 5J48A 1B35C 2RDQA 5H9SA 3UYJA 3SCFA 1VBC1 1S0DA 1TMF2 1ZM1A 3I2JA 4HFSA 5IUQA 3HN3A 1Y3TA 2DCKA 4Q8LA 5LBFA 1OI6A 2ZAHA 2IXCA 1GP6A 3GNEA 3M70A 4LK7A 1SFNA 4P08A 4WVVA 3ZMOA 4AGGA 1PGL1 1FOD3 2DUQA 4XTPA 4UYBA 5I8YA 2JDPA 5LW9A 3M4FA 3JQWA 4Q5OA 1UY0A 3MZHA 3MFCA 2YFUA 2ZHKA 4M3CA 4PBOA 3OEAA 2VTFA 4Y5SA 2AH2A 2MEV2 4LKDA 4RL7A 4NRPA 5F8PA 5L9BA 4UBHA 1UWWA 1YC61 5C9AA 4HKWA 5IAVA 5HI0A 1G9DA 4AEDC 2WN3A 2WRAA 2ZKLA 4TSVA 1BCXA 5ABJB 2VVEA 4JC1A 4EE2A 3ZKUA 4CDXB 3M3QA 1I6XA 5KC6A 1AJKA 4XDPA 1VR3A 4HMZA 1RUI3 4ET7A 3SITA 2QNKA 3AVRA 1OOPC 1R093 4GJYA 3ROUA 1XBFA 3LEMA 4Q8KA 4NMIA 5CISA 1UMHA 3HBZA 4N8MA 3ZFEC 1UN1A 2K9ZA 5K0UC 2WLQA 3WDXA 3GZUC 5D8AA 1JZ4A 3PDQA 4QX0A 4BA6A 2GSYA 3E1F1 3H1MA 5FY8A 3J7LA 2V4VA 4RHV2 4AR2A 4BQ2A 1PO22 4HONA 4FPCA 2RJKA 3VBUA 2VUCA 1YI9A 5FYIA 1HXS1 2VNOA 3FFZA 2O14A 5A3UA 2VBPA 1LENA 4D6RA 3FMGA 1AR61 2P17A 4WVWA 1Q8QA 2RVAA 3J9SA 3WP4A 5AFBA 2VBBA 4ZXKA 4FFIA 4CDWB 2Y38A 2QQIA 2R072 3OB8A 1TMF3 4MGKE 5DN2A 4NAOA 3P6BA 3NW4A 4E8DA 1WMEA 5LA9A 2OZJA 1JTZX 3BOPA 2QTWB 2VNVA 3AFKA 2F6BA 4PQQA 2E33A 4GALA 2E51A 2VL4A 3ABZA 4TTGA 2VZOA 2RJ2A 4CP2A 1POV3 2AGSA 4FBFA 4FOVA 5A1AA 2A6WA 2VW2A 5KXEA 3WCSA 4O9EA 3B00A 5DQ0A 2X09A 3ZSLA 2MEV3 3SISA 3MF9A 3BB6A 1KRIA 5F3GA 3OBZA 4Q4X2 2DVGA 1COV2 5FZ1A 5FZEA 4CUBA 1ULPA 2D98A 4A44A 1LOBA 1DQ4A 2W94A 2GZWA 2TUNA 4HN0A 2ARAA 1NAEA 3CJIC 4TWTA 3S7IA 4JGYC 4P9WA 5K4LA 4IEYA 1Q8PA 1GKBA 4GZ9A 4EJRA 1N47A 2CYFA 3UGHA 3W5NA 4G3YC 4LBOA 2QKDA 5JMCA 3Q9OA 2LW8A 1AL22 2AENA 1UZVA 1K12A 4RHV3 3AZXA 2C0ZA 2LUWA 3KGLA 4UF0A 3WNMA 5BV6A 1NQDA 4XJ9A 5E16A 4FQZA 4XFBA 4PIZA 1OHFA 2YBSA 2X5IC 4N53C 4RS5C 4XF4A 4EN6B 3WDYA 2HWF1 3KHCA 3MUZ1 2O0OA 1AYM2 1W8TA 1G6NA 3CL1A 3ILRA 4Q4V2 3IPVA 5IK7A 1GUIA 1NCQB 1W6NB 1VMFA 1AXZA 2R073 3N7JA 4AI3A 3ALQA 1VBA1 1NQJA 1LHOA 3GZEA 3M2MA 4G9SB 1LB2A 3JD71 4LO8A 4YVWB 1PVC2 3FJSA 1XRUA 1HX6A 5BYNA 1RUD3 3KWVA 3BTZA 3VZOA 2HWE2 5FRAA 5LY2A 2WAOA 4W4ZA 5F1RA 1JBCA 1EV11 4JTNA 1H2KA 1VBE1 1HRV2 2P4EA 3B9IA 3R6SA 1GNZA 2A7AA 2DBIA 1BQPA 3OY8B 4MX3A 4BWOA 3FLRA 3MV01 4H7LA 4Y1VA 4PDWA 1GQGA 3D5OA 1LESA 3AKQA 1FMD1 1R1A2 2ZEXA 1DZRA 2HWC1 1WMDA 1RUF2 4Q0QA 3ZYFA 4D6QA 1UAIA 2BTVC 3HQRA 4Q4X3 5JXHA 3ZXDA 2X29A 3K2OA 2ZEZA 4QU2A 1QQP1 2BRTA 4LOTA 5JOYA 2PLV1 3WG3A 3SC7X 2P3IA 3NJYA 3HR9A 3VZLA 3JBG2 1Q3EA 1RUC1 3KV6A 4UFHA 1H9PA 3WUDA 4AHWA 4IV1B 3RG0A 4M3CB 4E4ZA 1ZBE2 2RM22 3DYMA 5CAZA 5FYHA 4UW5A 1VB4A 3RVHA 2RV9A 4Z2AA 4FFGA 5C9AB 5KHGA 1AL23 5LRRA 2EIBA 2ZABA 5LA1A 1ZZ7A 3PVOA 4JHTA 1W28A 1OA2A 1PK6C 2ZTNA 3GXUA 1H2LA 1KXGA 2WLPA 1E5RA 4OFGA 4IL7A 2WQ8A 4Q4V3 4CTEA 3PUIA 4LA3A 1JH5A 5F6KA 5FZGA 4QB6A 3UKNA 2ADEA 2D6KA 5FDBA 1ACCA 2MHFA 4KWLA 2ZGPA 1LU1A 1WMXA 5D8AB 5J7MA 2JICA 5JIAA 2BFUL 2VZ1A 3CIHA 2XDVA 4I09A 1FOD1 2HWE3 4R52A 2VQ0A 2RR12 3LFIA 1HRV3 1IG0A 1YIPA 5FTTC 3VBUB 3MLKA 1J3RA 2F17A 2YC4A 3PU3A 2OXBA 4BDVB 5CFDC 1K5MA 2GMEA 3PTRB 1UZWA 1R1A3 1X9TA 5JCTA 2LALA 4S2GA 2VMCA 4J1XA 2KA3A 2VCAA 2WNOA 3ZIXA 1QY4A 4CEYC 4M4PA 4CU7A 3WQ1A 2VM9A 3H3ZA 3DCQA 3JB4C 2TEPA 3LE0A 4O61A 1UXXX 5L9RA 2BNNA 2ZGNA 1GZWA 1RUI1 3CNAA 3PVEA 4PF5A 4ARYA 1R091 1IGOA 1OH4A 2VUJA 3A7QA 1W2NA 3USUB 1RJ7A 5I93A 2D6NA 3OSDA 4UBGA 5DUXA 5FP9A 1ZBE3 2RM23 1ZZBA 2JX9A 2JDUA 4TZDA 2OQ7A 1NT0A 5JAXA 1MQTA 1A78A 3B93A 3T09A 4GKYA 1C1LA 2N7GA 4NRQA 1W90A 3URFA 3PUQA 1ZX5A 2B39A 4URTA 4XJUA 2VZTA 1KQRA 3ZYHA 2VULA 4CU6A 1LJ7A 4R4ZA 3CJXA 3WCRA 4H2AA 3VLBB 4AI9A 2B9UA 3E6BA 3WP6A 4LIVA 5FKBA 4AI2A 1TMF1 3PJQA 3HEIA 4IEOA 3QD6A 4QPGA 3U11A 1H8TA 1ULDA 3ME2A 1PNFA 1PMHX 3NQHA 3C7GA 5C4WC 5KR7A 5FIXA 2JE8A 3AP4A 1R1ZA 1X50A 3VB9A 1POV1 1DP0A 1QGLA 2RR13 5A3WA 4UF0B 4FT8A 5CFCA 1MACA 5HXMA 5BXXA 4MHUA 3LZZA 3AZVA 2XJRA 2AREA 4HVRA 2J1RA 4W50A 1ODNA 4NPMA 2R042 1DQ6A 3IPVB 3AP7A 5FMDA 4O65A 3VDAA 1F9KA 4FVVA 3F95A 1O3RA 3KQRA 1CQ9A 2YC0A 1X8MA 3WQBA 2XBO2 3MV11 1CZSA 3ZLIA 2ARXA 2VCBA 5GLTA 4LKSA 3ZXAC 5HCHA 4B1LA 1JU4A 2PAMA 3J7NA 2VO5A 5FZKA 3U37A 4JKLA 3H1YA 2Z2SB 1XSQA 1BEV3 1GP4A 4AQSA 4D7TA 3OG2A 2Q8DA 4DXRA 2VE1A 2XHKA 3I97A 4CEWC 1JZ2A 4GULA 1CAVA 4PDWB 2R0FA 4YVSC 4AVAA 2Y8KA 1JZ6A 2JG9C 3S7EA 5F3CA 1QNWA 4FTBA 5FYSA 1DDLA 2ZMLA 5CG8A 2XVGA 2QQMA 1H4HA 1JZ5A 2R1BA 3AL5A 2VGDA 2VMEA 3QBQA 3F2ZA 5FKCA 3DYPA 1IS3A 4FCAA 1XYPA 1C4RA 3FC0A 4CRQA 1V6NA 1LGNA 2R071 5A33A 5LASA 2XWBB 3H0OA 1J3QA 3M8LA 3H9AA 4CXWA 2VQTA 4XE9A 2ZCWA 2HWB2 3ETPA 3OEBA 5GZCA 3OCPA 4AEKA 3IM0A 4H3WA 1RUD1 2WSUA 2TBVA 4AGRA 4QGLA 3ZYRA 2UWCA 3AYDA 3U75A 4LIUA 4N43C 2JECA 2GC1A 2AEZA 2WC2A 3ECQA 3RI8A 1HV0A 2LRPA 2YYOA 5DG1A 4Q0VA 4AEJA 5JPMB 4ONUA 4LBQA 5FUPA 1OVSA 1UKGA 2XJVA 5C8CC 3GYDA 1M06G 2A6XA 2R043 3RJ2X 5AVPA 2DWRA 4MGYE 4Q4X1 1PIV2 4R9BA 3THPA 4Z8BA 1AYN2 2XBO3 5DAXA 4QQHA 4QB1A 1MEC2 1VRBA 2G1MA 1XXNA 1RITA 3TAYA 4E4SA 4AGVA 2Z69A 3AKRA 5FMOS 5KWRA 4YW4A 2EF6A 2QQLA 4BLJA 2YZ4A 1O4ZA 3WLUA 1D2QA 4ZY9A 4AFAA 1WCKA 5FZ4A 2QQUA 2VOKA 4J1WA 2BNMA 1VBC2 4FFHA 1I5PA 2YB7A 2ZX0A 4QHOA 4XOGA 3BN6A 5HCAA 1K5MB 2ZA9A 5LZ6A 1MVEA 1AL21 1NXMA 1PGL2 5FZ7A 4NHLA 5J37A 1PX4A 2WO3A 4V2WA 4L8QA 4Z92B 2GDFA 2VU9A 4B29A 1SZBA 3ENRA 4FXKB 4OQ9A 3IMNA 5CADA 3H7YA 2A3WA 1GZWB 4Q4V1 3WNLA 2XHNA 3C3VA 4YFZA 4KG0A 4YSFA 4XFAA 4AAPA 4CCNA 4PHZA 4XFCA 5A6YA 2WKKA 3RQ0A 3H50A 2YBKA 4P9JA 2A3YA 2OUHA 3AP6A 2D97A 1CIWA 4UFLA 4K8FA 1SFYA 2HWB3 2Y33A 4LXLA 1B35A 4F83A 1F31A 5BNNC 2G19A 2VMDA 4PI0A 1MQTB 4RR3C 4LK6A 2UWAA 1U12A 2HWE1 4KBZA 4C1WA 2A75A 1HRV1 2W68A 2HLEA 5E1RA 5A6ZA 2ZEWA 4QX7A 2G9ZA 5T55A 2IUWA 1BVVA 2DURA 1OVPA 2Y0OA 3C7HA 3VD3A 3ZPOA 1O4YA 4DINB 4AVBA 2YBPA 1PGW2 1DZQA 1S55A 3ZSMA 5J3UA 2P34A 5LK5A 1JUHA 3WF4A 1GQPA 1PIV3 1RVF2 1SLAA 3UJQA 1XSRA 3ZFGC 1AYN3 5FZOA 1KJRA 3WEZA 5BNPC 3SKVA 2YPDA 1MEC3 4LR4A 4L99A 4QPGB 3RZJA 2P6CA 1QDOA 1H8TB 1ZYBA 4AEDA 4KWJA 2XVLA 3WVJA 1ZZ6A 1AR62 3AL6A 4NAMA 4GD4A 5IK5A 1IS6A 5A7NA 2B4KA 4Q2FA 4JZRA 3VD4A 2D3SA 5CFCB 4WZCA 4FPGA 1GQHA 1ZBE1 2RM21 3LIHA 4XXAA 1L7LA 1ASJ3 5FMCA 3MI8A 2ZEYA 1DYKA 4Q0PA 5FYMA 2K0GA 4PLNA 4L2NA 1W03A 3WT3A 3ZFEA 4B1MA 2YGLA 1S2KA 1HLCA 5K0UA 1RMU3 3OUHA 3I3EA 5KHHA 3LAGA 4XACA 1EPZA 3ZVXA 4Z2WA 1D0GA 1FPN2 5EJ3A 3EXUA 2B5HA 4EZHA 4UWDA 4Y1UA 1LAJA 1VP6A 4QXKA 4DO0A 3SH4A 3RNSA 1GANA 1XE0A 2VMFA 5HPOA 1O3TA 3ZYBA 1W3VA 3RZHA 2GMPA 1EUTA 2WZ8A 2PMWB 1CAVB 2PELA 4GAZA 2J1UA 1J59A 1CIYA 1NE6A 4C91A 2OZ6A 4LPLA 1BMV1 1YCIA 4OHXA 4XBLA 5DUVA 5IHRA 1V6LA 2NPIA 2D6LX 3BIEA 1DYOA 4IGPA 1NLQA 4HN1A 1PMIA 3KCCA 1AF9A 5T52A 5T5LA 5GLZA 3VD9A 3R4UA 2RDSA 3OYWA 2B42B 3C8XA 1X36A 4DIQA 1S1AA 3FUOA 5A33B 1BBT2 1RVF3 4LE4A 4MOAA 5C3RA 2NP0A 1QJZA 2JKBA 4CUGA 1C5HA 3N9OA 2VAUA 3ZSEA 1RUOA 1YQCA 5IAXA 2H6CA 1BXHA 1AX1A 2EICA 3KT7A 2HWF2 4QX5A 3D0JA 2VMGA 1BEV1 3N3HA 2GNMA 3FFQA 2JIGA 2Q8CA 1QKQA 3W9AA 2QE3A 4OHWA 4YNIA 1G86A 1POV0 2GC0A 2Q30A 1UU4A 4CUAA 1ZRIA 4LBQB 4OMDA 4DXTA 4JGYA 4LBMA 2DF7A 3JD72 4UT5A 3U1XA 2QQVA 5DDJ1 2IVJA 1QJFA 3LSEA 5A7WA 3T2QA 4COZA 4QPIC 1C8M2 3MLLA 3MGUA 4HZFA 4MGSA 5JIUA 3N4MA 2WAAA 4Q4Y3 4ZHNA 4IEUA 4META 1C5IA 2YROA 4CE8A 4LLFA 4BQYA 2K2SA 4FQ4A 1EV12 3EYPA 4SBVA 5EHDA 2WT0A 4RA0A 1FPN3 2JD9A 3I3MA 1KFUL 2ZX3A 4R9CA 4COVA 3M3EA 3WF2A 1PGSA 2PHTA 4YM1A 4E8CA 1QJX3 2P1BA 2LTNA 1FMD2 2X5IA 2XQXA 4N53A 4RS5A 4XYXA 5FLHA 5FY1A 1JYTA 2JDHA 4CCEA 3E6CC 5C33A 1QQP2 1RB8G 1Y4WA 2C6SA 2IC1A 2J42A 2GP3A 4CPBA 2GN3A 3U4XA 1RUNA 1DZTA 2C24A 1JW6A 1RXGA 1RUG2 3BIWE 3I2GA 5ISLA 4ZU4A 3RWNA 2JIJA 1D0HA 3T2OA 3VBOC 3U07A 5C3PA 4D0QA 5A3NA 3O1OA 4K20A 3USSA 2OA2A 1XE7A 4AXOA 5FQ0A 4GB32 1PNGA 1MVQA 5IWFA 5IK8A 2R041 2VXRA 4IEZA 4XFHA 3T0AA 4QKNA 2XLGA 3UL2A 2VC9A 4ASMB 4ZONA 1WGPA 1BYHA 2L9LA 1BBT3 4AFDA 4CDUC 1CGPA 2XBO1 1DYPA 3Q8EA 1QWRA 4XILA 4P5HA 1CZVA 1B35B 1VAMA 4YGDA 1W04A 3VHRA 5JXJA 2ZGOA 4Q1PA 3ZYGA 2TNFA 2HWF3 1Z7S2 2BVVA 3M7AA 5AC92 4BQ5A 3ACHA 3SKJE 2NYYA 2MNGA 3KV5A 2Q4SA 1UY3A 4K9SA 4S2DA 3U4SA 5F2WA 5C3OA 2NLRA 5CBLA 1S0CA 3P1IA 3S5AA 3VV1A 3FX3A 4O7XA 1LEMA 5FY0A 3ZYPA 3PUAA 5GM0A 2WWSA 1C8M3 2W1SA 3ZOIA 1HQWA 3IMMA 5IW0A 1VIWB 4PIXA 4YGEA 4MGTA 3T08A 2XOMA 3UJOA 2O8QA 5FZOB 3T30A 1LHVA 1G9CA 3GF6A 1EV13 5A1LA 4B3NA 2C5DA 1A3KA 3PMEA 3NAPA 4JKKA 4KI5M 2CAUA 1GMMA 3IDBB 3DYOA 4AEDB 2WYSA 3K4AA 4DXSA 3O1TA 3MO4A 5FO8B 5JZGC 1PK6A 3K51A 3WW1A 1W9YA 1QH7A 2RS52 1RJ8A 4MGQA 3VBSC 3K77A 4UW6A 5JOXA 2HWB1 2EA7A 1Q56A 3R4SA 1XOYA 1LODA 4BXSV 5IVCA 3AMQA 2A71A 4PBPA 5CKQA 2CU5A 1DLLA 2P3KA 2WZR3 3ZFEB 2ZGTA 1RUI2 1RUG3 4GH4C 4I02A 3UV9A 4AVCA 5K0UB 1W05A 4HK8A 4J25A 1R092 2CV6A 4XJ8A 1UX7A 1JMUB 4HXCA 4RGAA 2VUAA 2D6PA 5FPXA 3ZDVA 3VZKA 4A3XA 3FLTA 4GB33 4NWWA 4CCOA 2Y6GA 4LBKA 4C90A 1NCRA 1MS0A 1HB2A 4Y33A 1BK1A 3ATGA 5A7QA 2WR9A 3BOWA 1H1MA 1AYN1 2Q5TA 3ACIA 5CFDA 3H3UA 1MEC1 3RI9A 5F37A 3ON7A 1U5ZA 2XL9A 2BGOA 3FWEA 2Y6FA 3OY8A 4R9AA 5KXCA 3VDDA 1OF3A 2H0BA 1WKYA 2PFWA 1Z7S3 2PN5A 4CEYA 5AC93 1J58A 1T2XA 1HB3A 2GNBA 2ZMKA 5JOWA 3A0KA 3RZLA 3KQ4B 3ST7A 1GOHA 5FO9B 3VUOA 5HXVA 2B7YA 4LBJA 3ZN6A 2FMDA 2W52A 5FZ9A 2E31A 3FHAA 5JUVA 4CZSA 1ASJ1 3OBRA 1RUJ2 3NVCA 4DUVA 1JOJA 1NUKA 3OYWB 3ZN5A 2AYHA 4JRAA 4ASLA 2V4AA 4Y3OA 5A7PA 1RMU1 4IGOA 2FDJA 4Z82A 2IXKA 4W6WA 3O1SA 2GP5A 3DKQA 4IV1A 4CCCA 2DU0A 5L36A 2ENRA 5IT6A 5I0SA 4B7KA 4MV2A 3K4ZA 5BNQA 1YO8A 2VZQA 2YV8A 4I30A 1WBFA 4P00B 2DYCA 1WLWA 2YDEA 2RS53 5BNOC 4RFT0 3PHMA 4Z1VA 1ND2C 1NLRA 1UY2A 4CU9A 4JGYB 2OIIA 1TE1B 2PHFA 3CQOA 2VY0A 2YFZA 5JR2A 4A41A 5LA0A 5A7WB 2WUHA 4L92A 1OD5A 4AG4A 1NZCA 2XR4A 4XEZA 3TEZA 3AB0A 5FUIA 1TEIA 5FWJA 3S5QA 4DNYA 5A3TA 4A6SA 1DQ1A 4OYUA 5FYCA 2WBKA 4RQPC 1OKQA 4LLOA 1W8WA 1PGW1 2QQKA 2JEMA 1DQ2A 4FI9A 1UYXA 4HKLA 2D3PA 5JI7A 2X5IB 4N53B 1RVF1 1AJOA 3AC0A 4RS5B 1BK0A 1LOFC 2QDRA 3NJXA 3G6JB 1NXD1 4YWAA 1W6MA 2BOJA 1VAVA 5L73A 4YYOA 2VECA 2CDPA 2QUOA 4IETA 2GNDA 2X10A 3HJRA 1WZXA 5B4XA 3CMGA 5LATA 2Y6HA 2C1FA 3IAPA 2UY9A 5FR3A 4INDA 1UOJA 4P9IA 4BQWA 1IPSA 5JPNB 1UIJA 1OT5A 2W08A 2D6MA 2ZBJA 5FQ0B 1R64A 1Y43B 1RUJ3 2Q1MA 3GHMA 4QD2A 2GU9A 2EXIA 1RUD2 4LHKA 4Q4Y1 1G9FA 4CEWA 3J4UH 3AYCA 1GZTA 4Q29A 5FPUA 1WWYA 2WWJA 4P9XA 4YVSA 1US3A 1FPN1 3JZVA 3OBTA 2JG9A 2WA4A 1LECA 1I5ZA 4JDMA 4OHVA 3USUA 1SPPA 3O0XA 4CYDA 1DIWA 1Q8SA 2JWPA 1W6QA 2VCMA 1YRZA 1QJX1 1OPOA 3DPRC 3CU7A 3KV4A 4LBLA 5LK7B 5JDBA 3CZJA 4OCTA 2WA3A 2DU1A 1ZVFA 2E7TA 2HEYF 4XQWA 5EWSA 3THDA 3ITQA 1KJLA 4K7JA 1RGSA 4WVZA 4QHBA 4XDOA 3K4DA 3M3IA 1NX9A 4QWNA 3MBWA 4AOCA 5CVRA 4W65A 2DTYA 3NAPB 2W39A 4N43A 5H9RA 5KXBA 5DAWA 3WG2A 1RHI2 4NWVA 3EHKA 1PK6B 4I3GA 5L19A 3S6PA 5EYXA 3H42B 4XUNA 5EP9A 1LGBA 1BBT1 1QMJA 2C4XA 5FYYA 5C8CA 3AKPA 1FI2A 1OLRA 4H14A 3O14A 3BU0A 2ZGQA 3WQ0A 1YFYA 4K1ZA 1W9TA 4C1XA 3AXDA 4NO4A 5ABJC 2O1QA 3N9NA 1YI7A 4QB2A 5JLVA 3AJZA 4OHZA 1BLZA 4PF1A 2QJVA 3TN92 5G04L 1LU2A 3U14A 5KC5A 3WINE 1NYWA 2IWGB 1C8M1 1CD3G 1KS4A 1NCRB 3HPNA 3O0VA 4TN7A 5DUUA 2WDBA 4KL1A 2ZGMA 3O1RA 2CDOA 2CGPA 3IWZA 5CFDB 5FY9A 3ZSJA 3AMNA 2P37A 2JD4A 2OPWA 1JHNA 2OW4A 1OLQA 2DVFA 2WZEA 1NA1C 3HT1A 3VDDB 4CEYB 1GR3A 4K6BA 4QX2A 1YJLA 2XGXA 2FCUA 1XNDA 4YM3A 3SHRA 1TQ5A 1JS9A 2EIGA 1JXNA 4LHSA 3ZN6B 1YLLA 1GFF2 2XKOA 1UPSA 4XAAA 1OURA 1DQ0A 3KSCA 3H8UA 1AXYA 3RMYA 1ENSA 1KD7A 1STMA 2E53A 2WZR1 1BKZA 1RUG1 5IVVA 3APBA 4FAGA 1DGLA 3WF0A 5BNNA 1WCSA 2C9AA 3GZTB 4RR3A 2XJPA 1N3PA 2OS2A 4GB31 4L0PA 3VKLA 4OUSA 2BUKA 1RHI3 2X05A 1LULA 1WA6X 2PA7A 5FP7A 4I0BA 3RZMA 2WNUA 1UCXA 1DFQA 1YFWA 2YPJA 3ACLA 3HVDA 5FPZA 5FZBA 4OUEA 4GIQA 4D8MA 3AX4A 1ND3C 3IIAA 4GJZA 1Z7S1 5AC91 5BNPA 5ERLA 1K5JA 1NOVA 1TME2 4IERA 5C4WB 4UI9L 1J83A 2WSVA 3JCIA 3TN93 3DN7A 1S0GA 2QQWA 3DV8A 4XCAA 3ZM8A 5JXIA 2FZ2A 4KWKA 5C3QA 3ZXKA 4CUCA 2E6VA 1FNZA 2VJXA 3I4IA 1W0OA 3R0RA 5FYBA 4FPHA 4IEWA 1UF2C 4AQTA 1XNCA 2XJUA 2IXLA 3MPPG 4UW3A 4CXXA 1W2AX 4DOUA 1BMV2 5DAVA 4HG6B 1W6MB 4IV3A 3MPBA 3E5UA 1O3SA 2ERFA 2FDFA 3MIDA 4HBNA 3RRDA 5CKNA 2RS51 1LHWA 1UOFA 4UFIA 3ZFFC 5CEHA 5LEKA 4QX1A 4P9LA 2BEOA 1A34A 4X8NA 4N7IA 4EN0A 3H8OA 1POQA 3AVSA 2VOXA 4UW4A 1QXJA 2XXZA 2QZ3A 2ZGSA 4QDQA 4QKBA 4CEWB 2NQYA 1URXA 3NV2A 3TWIA 1RUE2 1BEV2 3VKFC 4AFBA 3TB0A 1REDA 2CHHA 2DUPA 4ZZ8A 3GBFA 4YVSB 1UU5A 1EY2A 2JG9B 2R30A 3FE5A 3L9JT 4Y22A 3I2FA 4AW7A 1R081 1SPPB 2VH9A 2YHJA 5DDJ2 1W6QB 3LA3A 1T6GC 4NPLA 2P3JA 1UL9A 4JV4A 3G7DA 1OUSA 5HBAA 4JCKA 3QCWA 3T0DA 5I0DA 1CX1A 1PVXA 2E7AA 2ZGUA 4ISQA 4QM9A 2VOWA 1AX0A 4CSWA 2ATFA 1QOSA 3AYAA 3WUCA 2ZX4A 1QIQA 5I0TA 1ZRRA 1E5IA 1TME3 4X6QB 1SBDA 3W20A 2VCCA 4XFFA 1V70A 1MS1A 2O8OA 4IUGA 4N43B 4E2GA 1RUJ1 4PLOA 3PIGA 1FNYA 4QGNA 2UY8A 2GAUA 3AZZA 1LOAA 2QQJA 3P5BA 5FXZA 1YWKA 5C8CB 1XE8A 1CAUA 1UIKA 1AR72 1KEXA 1KITA 1IKPA 4OZOA 5C9AC 2ZKNA 1JI6A 5GZFA 4YZ3A 4E4HA 5ACA2 3PURA 4LO6B 5J1XA 1QF3A 4YG3A 2EIEA 5F3IA 4RFRB 1EPWA 3WD5A 1N1VA 4LUKA 3JUUA 1KDMA 3ZR6A 2WNVC 2DCYA 5LBBA 2RG4A 2VTXA 4UOJA 1V6MA 3K3OA 1IPKA 2FZ1A 4MADA 1DLCA 4PLMA 5I91A 2J7MA 3SH3A 1H4GA 1RUE3 2ES3A 4DRVA 5LA2A 4AZZA 2JDYA 4BZ4A 4DMIA 3OD4A 3I2IA 3WR0A 1DHKB 3I2HA 3P3NA 1J84A 2RDNA 1G9AA 5LEJA 3WSOA 1N1TA 4Y1XA 5DDJ3 3VBOA 2BWCA 1XB9A 2BZDA 3UETA 4LITA 4FP2A 4GWJA 4AHXA 2GN7A 3ES1A 1K42A 1Y9QA 5DUWA 1YQ2A 2JDKA 1HN1A 1CAXA 2XUMA 3B69A 3K75B 4W6YA 4WM8C 5GLUA 3UESA 4KQ7A 4CDUA 4FTSA 3KLSA 1U0AA 3DXUA 2R49A 1MS3A 1HB4A 3C7OA 2XWJB 4XF1A 3POEA 2AACA 1ENXA 4XC9A 4YG6A 2BV4A 1HB1A 1V6JA 3BALA 4Y24A 1YJKA 1WCUA 3A4UA 5BNNB 2FDKA 4RR3B 1EP0A 3SCHA 1HW5A 4Y4RA 5DZEA 1UXZA 3CEWA 3HNBM 3PUHA 4BE3A 3QACA 1DGWA 1UU6A 4L11A 4MXWA 2VPVA 1CONA 4QU1A 1WW6A 4AL9A 2WFF2 1WD3A 3N7MA 4TXWA 2WNUB 5JWPA 1UY4A 4HLTA 5KHJA 3DGTA 3O1PA 5F3EA 3ZPYA 1AR73 4OZXA 3E6DA 1BVP1 2XVKA 1YQ5A 2Y64A 5EFUA 5BNPB 3J26N 4QXBA 1XNKA 3NO8A 3D0SA 5ACA3 3WNKA 1BJQA 3O7OA 4CDQC 2W1QA 1W2TA 3LQCA 4EN9B 4NJ4A 4RN5A 4QX8A 5EV7A 1GWMA 4X6RB 2DCJA 2WL1A 1KS5A 4L9BA 2FMYA 3B5LB 2QQNA 3AFGA 3OPWA 3BTAA 2BNOA 4JDNA 1WMFA 2DVDA 1SLCA 4W6XA 4BXFA 5GZEA 3KT4A 4IV3B 5E6HA 3N9MA 4GH4A 2E32A 1QEXA 2Y6LA 2JE7A 1SG3A 4JGZA 3BCWA 1RHI1 1ASJ2 5DMYA 1UO9A 1V6IA 3POGA 4EYUA 2YUEA 1SMVA 2W0XA 1RMU2 3AP5A 5B4NA 1AX2A 1Y9MA 4YW1A 1OLME 3U10A 5IVBA 2ZGRA 1GWLA 3BYWA 3OGJA 1FXZA 1H6YA 2PTMA 5BUVA 2JE9A 3E97A 1U5YA 3T2TA 4A7KA 5IFTA 2BBVA 2JDZA 3GBGA 4CU8A 3TN91 1MZFA 2Q0AA 1ENQA 3MDPA 4Y22B 1WW4A 4JRLA 1W3XA 2MPFA 4ITCA 5T50A 3RPQA 2CWMA 3PNAA 3NV3A 1IS5A 2WFF3 4MH0E 5CNAA 3VBFC 2A73B 2GC2A 2NM1A 3L2HA 3VL9A 2OX0A 3V64A 4COYA 1PM4A 5H9PA 2HKXA 1TG7A 2H6BA 2J1TA 4XIKA 2RS13 1ZZ9A 2RHPA 3AK0A 4AQ2A 4A42A 1VBD2 1G9BA 4FPEA 4JVAA 3H1WA 2YGMA 1W0NA 4N7UA 1CESA 1OA4A 3U0ZA 4NROA 3BTXA 2EXHA 4KGQA 1RXFA 1DCSA 3B9CA 2VMHA 4CP1A 3D4KA 3VZJA 1L3JA 5FXXA 1VALA 1C1FA 1XNAA 1H6XA 1SLIA 3H7JA 4AWDA 1CAUB 1QJY2 3LSDA 2LS6A 1SBEA 2QFEA 2A6ZA 4D3WA 3RJRA 5JVVA 4DUWA 1OOPA 5A3PA 3N36A 1ULFA 2GALA 3LA2A 3CF6E 4Y1YA 4C0BA 1SDDB 3KGZA 4DS0A 5C71A 5IFPA 1CPMA 4YW5A 4RQPA 2WJSA 5ANNA 1I3HA 2D40A 4Q4Y2 4XF3A 4FTEA 1LNSA 1K3IA 4WZFA 1QOTA 5FZLA 3B94A 2HBTA 2W46A 4OLLA 3WW4A 3GM8A 4BLIA 2VVDA 2XPJA 2PQQA 3IAQA 5AFEA 2WYFA 1LOFA 1SHWB 1WW7A 5EXOA 3M3OA 5FP8A 3KF5A 5FPVA 4DUXA 1PX3A 1TME1 1QJX2 2ORZA 2YG0A 4NIAA 5GLWA 1PM7A 2WQ4A 5F6LB 2G4IA 4A7ZA 4XBQA 4XPVA 1JOBA 2ORXA 4H7MA 1HQNA 4UAPA 4V2VA 3VBOB 5IVEA 1IHMA 3WW3A 4RGGA 4I2OA 5JR7B 2QQPA 4RD7A 2ZGKA 1IKQA 5DAQA 1CAXB 3ZDSA 3ZXGA 4AVSA 1M4WA 3VBRC 3ZXFA 4CDUB 4FAHA 4BJ0A 3CZUA 3KCXA 2JJ6A 3ES4A 1OXCA 4Y5Z0 4AEMA 2NMNA 3A0NA 1VBD3 3PIJA 4OI4A 1AR93 4JTOA 4F3JA 4ISRA 1PO12 2UYAA 3C7FA 4DQAA 3V56A 1QJU3 2VQUA 4NHXA 4QX3A 1TZOA 1Q8VA 4CCLA 5C70A 4LTAA 2P2KA 3JB8A 2SBAA 2VZ3A 4G4FA 2KD7A 4YZ4A 5EYYA 4NIGA 1W6PA 2ZJCA 3ZIWA 4LMFA 2DUOA 5E88A 4MXWB 5FZ3A 5D21A 3POFA 1JZ3A 1RUH2 3HQUA 1RUE1 4C0HA 1SACA 3CHXA 2BOIA 3WDWA 4FPOB 3GJBA 3WNOA 5FPAA 1QJY3 2FDGA 3CJIA 5FY5A 2WO1A 3ZSKA 5A3MA 4JAAA 1GZCA 3WHUA 4XQ4A 1CAWA 4NIIA 1F4HA 4OI1A 3CBNA 4EQVA 5BY5A 1XU1A 4GWNA 4YGCA 1HJGA 5FYUA 5F5CA 5A3OA 3I2KA 4OI2A 2E7QA 2CY6A 4IE7A 1D4M2 1BHGA 3MIHA 3VBSB 1JZ8A 1IZ3A 1HIXA 2ARCA 3BODA 1QH6A 4YRDA 1SCSA 4JQRA 3POWA 3KZ4C 2WO2A 4GH4B 4FPLA 5L7OC 4JGZB 2VZVA 5JMOA 2H0VA 5EPAA 2W2IA 3T1MA 3SNMA 2WZR2 4A3ZA 2FDIA 4MLOA 3MHZA 3I59A 1AVBA 1SLBA 4QDRA 4BMEA 1AR71 3J8F3 3NKGA 4EV0A 5CA6A 2DFBA 5A7OA 1KFXL 4ATEA 3HOBA 4OMCA 5FZDA 3IDCB 5C8WA 5ACA1 4QPYA 1JYNA 1WCQA 3TEYA 1PZ9A 2P3YA 1PO13 1NA1A 4RGKA 3WNPA 4EROA 4O9GA 2UWBA 1Q43A 3T4HB 3RYPA 2DBNA 3SLIA 3C2UA 3L2YA 4DFSA 4YW7A 1RUH3 1FATA 1QXPA 4ES8A 3VDBA 3LCPA 1W0PA 1WW5A 3EBRA 4V1PA 5F5AA 2FD8A 4AI8A 2CNAA 3KS7A 5FYVA 4Y5TA 2OKXA 3UKTA 5LB6A 3I54A 4DEQA 1O4TA 2V5YA 3TEXA 1QOOA 1UZ0A 4CVUA 3RZGA 3PMSA 5SV5A 4CPBD 3B7MA 4FOQA 4ZU5A 3SQOA 3R05A 2ZZQA 1PZ8A 1WLTA 4HETA 2A6VA 4Q4W2 3PU8A 1N1YA 1D4M3 2QVSB 2VNRA 4YLZA 2J1EA 2R7EB 2Q1FA 3VHPA 1QHDA 1W2UA 4E4DX 4FPKA 4I0WB 1K45A 1ND3A 4HKOA 4KH9A 1F8VA 3ACFA 2EVXA 4AAXA 1OOPB 4IESA 3IKWA 1OFNA 3TEWA 1DF0A 2HYKA 4FSJA 3LF7A 4RQPB 4B7EA 2IFRA 4FXGB 2W1UA 2WFF1 4BQ4A 3TNQA 5IJRA 3ZYIB 3WF3A 3HQXA 2ET1A 3NKTA 2HJIA 4BHPA 2DTWA 4TLFA 3O0WA 3LA7A 1R082 1WUVA 2RS11 5HV0A 5K8SA 4ZPIA 3T0BA 2BGPA 3GDBA 5GZGA 4NRMA 3ORJA 3MFAA 3PVBB 1D2SA 1GNHA 1GP5A 4UFKA 4NOTA 2X53S 1GV9A 3ZFFA 3W21A 2WT2A 1ONAA 2C26A 3OUJA 3OGSA 4JQTA 5K9YA 2VZSA 2ZX1A 1T6BX 3MW3A 2JB8A 4PCRA 1S0IA 3T1LA 4B4PA 1C3HA 1GICA 4L97A 2A3XA 3PTYA 4AK3A 5FOJB 3DXTA 4B4RA 1IG3A 2DVBA 1YIFA 5EJ1B 4M3CE 5A80A 1OH3A 2XB6C 2AC1A 3UT0A 1JU3A 2IVIB 2Y6KA 3Q8AA 1SCRA 4WM7C 2GMMA 2WABA 3I49A 3OBAA 3KVBA 5DXDA 3CKHA 4Q4W3 2IXHA 2VNGA 3WQ7A 4URAA 4A45A 1W6PB 2OPKA 1OA3A 1C57A 1X33A 3OUIA 5F5IA 3VD5A 5LWBA 2I2SA 1X7NA 2HEWF 3BVCA 4M01A 5IK4A 2DCZA 1UMIA 3LD8A 3GZAA 3CJIB 5D2AA 5F2SA 2WWUA 5EIYB 2KR2A 2D6OX 5FAXA 1AHSA 1CAWB 1GU3A 3MW2A 4HSJA 4KU7A 4S2FA 5H9QA 2VD7A 3EQEA 1CWPA 4PIYA 2W91A 3Q8FA 4QQPA 5D1IA 3VBHC 5CIRA 5C4WA 4B4QA 1AXKA 2ZXQA 3I2DA 5EZWA 3NWKA 1W99A 3OJBA 1V9U3 5J09A 1KGYA 3NL1A 2FCVA 4DY5A 1O91A 1R083 4XJWA 3AXEA 5FYTA 1VBD1 1S4CA 1AR91 1XYNA 1OQEA 1UW8A 3FZ3A 3Q8CA 3MIEA 4P9YA 4LO5B 4D69A 1LKNA 1QJU1 1UNBA 1YYNA 4E2QA 1YNAA 4EN8B 4WV8A 4YPJA 1BZWA 1VBB3 3MIGA 2ZGLA 3HBKA 4C8DA 4MGZE 1VMJA 2XL7A 1APNA 4M4RA 2JXAA 3THCA 1DGRA 2WNVA 1RL3A 2P6HA 2R062 2W95A 4LBNA 4EZ4A 3I59B 1QJY1 1N3OA 1W06A 1S0BA 1SDWA 4LNVA 4AI1A 2R6QA 4YW2A 3BPSA 1C8NA 4OQ8A 2ARBA 2Y6JA 1P8JA 4IW3A 2D7FA 4ARXA 1J3PA 1E5SA 2V73A 2VBDA 2LROA 3GGLA 3NMBA 3WDUA 1A6CA 2DDUA 1SLTA 1W8ZA 2XJTA 4GKXA 1NA1B 3FN9A 1AR82 3OPZA 5J98B 4QQOA 3QH7A 4BU2A 5DPNA 3ZX7A 3NNGA 3RMXA 5FJHA 2JG8C 1WLDA 2I45A 1YHFA 2JENA 5APAA 5FWEA 1IQDC 1AZDA 3A22A 2WS93 2HWD2 4WM8A 3SEPA 2JKXA 2GC3A 3WP5A 5FP4A 4W8JA 3RS6A 4QT6A 2VTXJ 1HQLA 5HCFA 2BERA 4XCBA 3LDRA 4ZZ5A 1UOBA 4ASKA 2VR4A 1CJPA 2CGOA 5FCCA 3WX5A 3ZR5A 3OTFA 1QU0A 4XMIA 3J8F1 4K40A 3VKMA 3EJKA 4XUOA 4IE5A 3W5MA 2IXIA 4YW3A 3HWJA 5FJKA 3RSJA 2EAKA 4COWA 3RZKA 5E89A 2WZPP 1PO11 2VMIA 4PQ9A 4Q1RA 4P14A 1ND3B 2J1SA 3LIGA 4LKEA 3NRUA 1LCLA 4CCJA 5C6CA 2Q1ZB 2XH6A 3OGVA 4CP0A 4A2UA 5DZGA 4CDQA 4Y20A 3TBDA 1RUH1 1S0FA 2J1VA 1WA4A 1F15A 2R063 3BKZA 2DV9A 5DAPA 5KBFA 1JYIA 4AE2A 4CCMA 2XKPA 4CDXC 5LCWL 1XC6A 3RDIA 5GLVA 3V0AA 1Y9GA 2PAKA 2YXSA 3FBMA 1LR5A 2V72A 2RJLA 4IXLA 2VW0A 5TSWA 3WXPA 1DU3D 3VGIA 1AR83 3H8XA 4Q27A 1LGCA 1IS4A 2BGCA 3BTYA 1PO23 3BGAA 1D4M1 3ZXLA 5ANQA 2PXJA 3ZFFB 4HVQA 3RFRA 1QDCA 2QZ2A 3KM5A 4Z07A 2VZPA 1GNYA 3QLQA 2ZHLA 2HWD3 2NN8A 2XG3A 3N9QA 3KD4A 4BQ1A 1UZZA 4XIOA 3J7HA 4D7SA 4K8RB 3IDAA 2JDAA 4CDWC 1W9WA 1HKDA 2CWSA
chains in the Genus database with same CATH topology
3KT1A 4OHYA 2KXLA 3AJYA 2FBEA 4GMP3 3SCGA 1D4VB 2UYBA 2A6YA 3VBFA 2DCTA 3NV1A 1Z0HA 3O5SA 3IDEA 1EAH2 1WD4A 2VW1A 4COUA 1W39A 5FO7B 2ZPXA 4AVTA 5FREA 5CG9A 3TRSB 3CO2A 1COV3 2OUJA 3TNPB 4HANA 3ZFGA 3BU7A 4R8HA 2WT1A 1IPJA 3LOIA 3LGRA 3MIFA 1KDKA 2SLIA 2BPA2 1MZ6A 5J96B 3NSTA 2IFWA 3IT8A 1REFA 4DY3A 2GNTA 2D93A 3POSA 3DL3A 2I07B 5FFOC 3UK9A 2G9GA 5LRSA 2GH8A 1F5JA 3NAPC 5FMOL 1RC6A 4Q4W1 3SH5A 2D3RA 1HDKA 1SLLA 2RMU2 2E63A 1ZBA1 4XF0A 1AYM3 2E9QA 2WNVB 3VZMA 4LEJA 1U5IA 2B45X 1RTVA 4FP3A 1MZEA 1SBFA 3NV4A 4IEPA 3E5XA 3P3PA 3JQXA 1AL0G 4J6GA 4XHXA 2QDNA 1PVC3 5I8TA 1LOGA 1NCQC 5KHIA 1EYBA 3AZWA 4YZ2A 1LHNA 3MIBA 1UMZA 3TYJA 2AR6A 4GXLA 3AKTA 4YVWC 3ETQA 1NCRC 1ZZCA 3I8TA 1V9U1 2IZWA 4Q26A 1DQ5A 1WLCA 3S30A 3VZNA 4M3CF 4XFGA 1UPIA 1TNFA 1ZA4A 3MW4A 2YY1A 1IOAA 1GBGA 3KMHA 4KGGA 4WM8B 1EAH3 4MVTA 3VBRA 1RUF3 3PJYA 4LE3A 2DVAA 3VDDC 4LULA 2Q8OA 4XFIA 2AUYA 1VBB1 3WHTA 4FPYA 3THTA 2I74A 2ZS6B 3JBG3 4XMAA 4BIFA 2R0HA 4U2AA 4XBNA 4K3UA 3S0MA 2ZAAA 1X82A 1XYOA 4M0NA 1N1SA 4KNCA 1B09A 1O3QA 4IV1C 4XHBA 4QPIA 2RMU3 4R4XA 4IEQA 4YM2A 5KXDA 5T5PA 4AHYA 4QGMA 4XXPA 4CDQB 1O5UA 2VOVA 3TOJA 1S2BA 2ZOEB 2WS91 4Y20B 4BIOA 2EALA 2Y0IA 4LO4B 3FLPA 2XLFA 3LB9A 1SQ4A 1GLHA 1LRHA 4D7YA 2B46X 3PVNA 3B02A 4I3PA 3V0AB 4N9IA 1QNYA 1OFSA 2FQPA 4ZU7A 3LWCA 1A8DA 2OYZA 5L7OA 5JSPA 2BQPA 5T5JA 2QCSB 5T54A 3LKJA 4FOWA 1VRH2 4N9HA 3D8CA 2VG9A 4OUMA 5D8AC 3R4DB 3D6EA 2RE9A 1PHMA 1Q8OA 2KM2A 2MEV1 4LA2A 1Z78A 2CL2A 3V0BA 2RS32 2XJQA 3VBUC 5DG2A 1RIRA 2PYTA 1SEFA 3D82A 4DRRA 4NPRA 1FYUA 5K7PA 3WW2A 2A5ZA 2AZ5A 4M0HA 3MEPA 4XW3A 3AYEA 1A8MA 3RZZA 2R061 4AF9A 5I0UA 2DFCA 2Z5WA 2PHUA 4KG8A 1I1EA 4BM8A 2G9FA 3HN1A 1MR5A 3N35A 3AKSA 3VBFB 1YXWA 3VHOA 4P9GA 3I7DA 2BYVE 4BH9A 2CTVA 1H30A 1AR81 4GA9A 4YM0A 2ZMNA 4RHV1 4XTMA 4HPKA 1PO21 4E2SA 2ZHMA 4I0AA 4RSUA 1DBNA 2ZACA 1NG0A 4KU8A 4WVMA 3ZFGB 2WNEA 4KBBA 2D43A 2HWD1 2ILMA 2RS12 5HCBA 1MS8A 1NY72 4X8PA 3UKVA 1E57A 1ZZ8A 2BVBA 2R16A 2B8MA 3ELNA 3INAA 4YZ5A 4AI0A 3POYA 5JZGA 4E9KA 1OSGA 2WFPA 1HRI2 1J1LA 1JN2P 2OVUA 2GH2A 3VBSA 4EWEA 4FO9A 4U36A 4AFMA 1WBLA 1C28A 1VRH3 2D5FA 5GJ6A 1CVNA 3W58A 4GMP1 3HT2A 5FOBB 4F7ZA 3OGGA 5T3NA 2CGNA 4YZ1A 3GBWA 5I8SA 2RS33 3M3CA 4HT1T 4QMAA 1COV1 4QQ2A 2VVFA 1YUDA 2BFUS 4EN7B 3WNXA 4LBQD 4XETA 1UZYA 3KB5A 4FPFA 1VLNA 3LOBA 1F5FA 1MS5A 4SLIA 4AFCA 1CJDA 5GZDA 4K21A 4BYYA 3VBRB 5CU1A 3ZN4A 3QH6A 4AYUA 4BMBA 4Q0SA 3GHNA 1DGRN 1G7YA 5T5OA 4WM7A 4PDWC 4M00A 4UXAA 4S2HA 1ZRFA 5AVAA 2ZZJA 5F5QA 3AM2A 3JU9A 1AYM1 1H2MA 4NHMA 4QM8A 2PHWA 2FHRA 1AR92 1X8EA 1WCDJ 1QJU2 4Y4YA 1HRI3 1FAYA 5BNOA 1PVC1 3MICA 1ENRA 1ND2A 3M1HA 1TNRA 4NHKA 1VJ2A 2BWAA 3K48A 4QPIB 4N90A 2CAVA 4IQPA 4DZGA 3VBHA 4BPZA 4DB5A 3V65A 2WNUC 4YG0A 1EAH1 1R1A1 3PLQA 3RYKA 3ZMNA 1RUF1 2IXJA 4ATFA 1LEDA 4XZPA 1F2NA 1HXS2 5JOZA 1O5LA 2D5HA 1VB2A 1I9RA 2NZ9A 3HAGA 3W59A 5L7OB 1NLSA 3X29B 3ZPYA 2ET7A 3JBG1 3E5QA 4Y1ZA 5GALA 3FHIB 1VBC3 1W6OA 2PHRA 3ZXEA 2ZHNA 3MYXA 1DG6A 4HVOA 5A32A 3V0BB 3ILFA 3IN9A 1ZREA 4K1YA 4IV3C 1GSLA 5JI9A 1H2NA 1QXRA 4IEVA 3ILNA 2RMU1 1K5MC 1JYCA 1UD1A 3J8F2 2PHDA 2Z42A 5JSRA 4XJAA 1CR7A 5B2GB 4OVEA 4PJYA 4GWMA 1ZNPA 2JG8A 3KCYA 3WY6A 2XJSA 1H0BA 3DPRA 4BOWA 4MUVA 4Y26A 3WG1A 3MLJA 2R1DA 3AP9A 4HK9A 2NMOA 2RR11 4HPKB 1UKRA 2A70A 3O12A 1OPMA 1FV2A 4LO7A 1MQTC 4DXZA 4WVMB 3B3QE 1GYKA 2YMZA 4R9DA 1XU2A 2PAEA 4XQDA 5JZGB 4XJZA 1DGWX 2HEVF 2PHXA 3HD8B 1HXS3 2F4PA 4XF9A 4NR1A 5FBZA 1JUIA 1AR63 4ZKTB 4QPGC 3ASIA 1H8TC 2ZX2A 4FPJA 5ABJA 1UX6A 1VBA2 2VQAA 2R32A 4I01A 3VKNA 4CDXA 1OQ1A 3DKWA 4LHNA 1G8WA 2D44A 5CFCC 3ZXJA 3NJZA 3EO6A 4NN0A 3CLPA 1H9WA 5I0RA 2Y26A 3QOPA 5BPXA 4LT5A 1VBE2 1LHUA 3WV6A 1LTEA 3HIFA 1YFXA 5A3LA 3FBYA 3SXWA 3VKOA 1RINA 3DUIA 3OD0A 4A7YA 1N3QA 2HWC2 3IBMA 4E27A 1OQDA 5J36A 4BCUA 4AVVA 3GALA 4EWAA 2PLV2 3FUQA 3WOGA 3AMHA 2UURA 4ES9A 5KHKA 1FV3A 1AUYA 1H1IA 1MS9A 1VRH1 4Q0UA 4YFWA 1V6KA 4WBBA 5GKAC 4WM7B 3VHNA 4CDWA 1ZRDA 1RUC2 1ULEA 4D94A 4TYSA 4ORFA 1MZ5A 1IQAA 4MYEA 4H55A 2RS31 3N7KA 1ULGA 4HSLA 4XDQA 4LHLA 2XLAA 1S0EA 4DPNA 2LM3A 5BNOB 2EXJA 2WINB 1ZBA2 4HL0A 2ETEA 4MSVA 1FX5A 1ALYA 3AMMA 1ND2B 3VL8A 5E8AA 4OI0A 3MF6A 1LOEA 4LUMA 3WZ1A 3AMPA 3WG4A 1V6OA 2Z79A 1J1TA 4YARA 1VBA3 1YFUA 1OMIA 3VBHB 3JD73 4GMP0 5FLJA 5F9TA 1XQNA 1H1AA 2EXKA 1FOD2 4MGIE 3B01A 3WP3A 2WIIB 3ZO0B 5JSOA 1VBE3 3RYRA 1V9U2 1NE4A 2WQZC 3AZYA 1CX4A 3VN4A 4AQ6A 1NY71 3N7LA 1HV1A 2BW8A 1XNBA 4IEXA 1FMD3 5SV8A 4JDOA 2HWC3 3WDVA 1W6OB 1S0JA 1HRI1 4OULA 1Q5OA 1CN1A 1VBB2 1QQP3 4QQLA 5A32B 2PLV3 1O7FA 1ULCA 3SMHA 4GQ7A 3OF1A 1REEA 3HMYA 1PZ7A 4MXVA 1NCQA 1W6NA 4JGZC 4B8EA 1LOCA 1RUC3 3ZYJB 1U5XA 4FOYA 2UU8A 4F8AA 1H8VA 1MS4A 4YVWA 2V09A 1FT9A 2JG8B 3WDTA 1PIV1 1GZ9A 5FLIA 3BPZA 3DF0A 5DZFA 3DPRB 1Y7BA 4YGBA 4AHZA 1CPNA 1ZBA3 2PHLA 4NVPA 5CB7A 4MZUA 1V00A 2WS92 2X8KA 4EWDA 2EAAA 1VAKA 5J48A 1B35C 5H9SA 3SCFA 1VBC1 1S0DA 1TMF2 1ZM1A 4HFSA 5IUQA 1Y3TA 2DCKA 4Q8LA 1OI6A 2ZAHA 2IXCA 3GNEA 3M70A 3ZMOA 4AGGA 1SFNA 1PGL1 4WVVA 1FOD3 2DUQA 4XTPA 5I8YA 3M4FA 3JQWA 3MZHA 3MFCA 2ZHKA 4M3CA 4PBOA 2AH2A 2MEV2 4RL7A 4UBHA 5C9AA 4HKWA 5HI0A 1G9DA 4AEDC 2ZKLA 5ABJB 4TSVA 1BCXA 2VVEA 4JC1A 4CDXB 3M3QA 1I6XA 5KC6A 1AJKA 1VR3A 4HMZA 1RUI3 3SITA 2QNKA 1OOPC 1R093 3ROUA 4Q8KA 3HBZA 3ZFEC 1UN1A 2K9ZA 5K0UC 2WLQA 3WDXA 3GZUC 5D8AA 4BA6A 2GSYA 3H1MA 4RHV2 1PO22 4FPCA 2RJKA 3VBUA 1YI9A 1HXS1 2VNOA 3FFZA 1LENA 3FMGA 1AR61 2P17A 4WVWA 1Q8QA 3J9SA 3WP4A 5AFBA 4ZXKA 4CDWB 2Y38A 2R072 1TMF3 4MGKE 3NW4A 1WMEA 2OZJA 1JTZX 3BOPA 3RPQA 3AFKA 2F6BA 4GALA 2E51A 4CP2A 1POV3 2AGSA 4FBFA 4FOVA 2A6WA 2VW2A 5KXEA 3WCSA 4O9EA 3B00A 3ZSLA 2MEV3 3SISA 3MF9A 3BB6A 1KRIA 4Q4X2 2DVGA 1COV2 2D98A 1LOBA 1DQ4A 2GZWA 2TUNA 4HN0A 4TWTA 3CJIC 3S7IA 4JGYC 4P9WA 4IEYA 1Q8PA 1GKBA 4EJRA 1N47A 2CYFA 4G3YC 4LBOA 2QKDA 5JMCA 3Q9OA 1AL22 2AENA 4RHV3 3AZXA 2C0ZA 2LUWA 3KGLA 5BV6A 1NQDA 4XJ9A 5E16A 4FQZA 4XFBA 4PIZA 1OHFA 2X5IC 4N53C 4RS5C 4XF4A 4EN6B 3WDYA 2HWF1 2O0OA 1AYM2 4Q4V2 1G6NA 3CL1A 3ILRA 5IK7A 3IPVA 1NCQB 1W6NB 1AXZA 2R073 3N7JA 4AI3A 3ALQA 1VBA1 1NQJA 1LHOA 3M2MA 4G9SB 1LB2A 3JD71 4LO8A 4YVWB 1PVC2 3FJSA 1XRUA 1HX6A 5BYNA 1RUD3 3VZOA 2HWE2 5FRAA 5F1RA 1JBCA 1EV11 4JTNA 1H2KA 1VBE1 1HRV2 3B9IA 3R6SA 1GNZA 2A7AA 1BQPA 3OY8B 4MX3A 4BWOA 3FLRA 4H7LA 4Y1VA 4PDWA 1GQGA 3D5OA 1LESA 3AKQA 1FMD1 1R1A2 1DZRA 2HWC1 1WMDA 1RUF2 4Q0QA 1UAIA 2BTVC 4Q4X3 3ZXDA 2X29A 4QU2A 1QQP1 5JOYA 2PLV1 3WG3A 2P3IA 3HR9A 3VZLA 3JBG2 1Q3EA 1RUC1 3WUDA 4AHWA 1H9PA 4IV1B 3RG0A 4M3CB 4E4ZA 1ZBE2 2RM22 5CAZA 4UW5A 1VB4A 5C9AB 5KHGA 1AL23 5LRRA 2ZABA 1ZZ7A 3PVOA 1OA2A 1PK6C 2ZTNA 1H2LA 1KXGA 2WLPA 4OFGA 4IL7A 4Q4V3 4CTEA 4LA3A 1JH5A 5F6KA 3UKNA 2D6KA 5FDBA 2MHFA 4KWLA 2ZGPA 1LU1A 5D8AB 5J7MA 2JICA 5JIAA 2BFUL 4I09A 1FOD1 2HWE3 4R52A 2VQ0A 2RR12 1HRV3 5FTTC 1YIPA 3VBUB 3MLKA 1J3RA 5CFDC 1K5MA 2GMEA 1R1A3 5JCTA 2LALA 4S2GA 4J1XA 2KA3A 3ZIXA 1QY4A 4CEYC 3WQ1A 3H3ZA 3JB4C 2TEPA 2BNNA 2ZGNA 1GZWA 1RUI1 3CNAA 3PVEA 4PF5A 1R091 1IGOA 2VUJA 3USUB 1RJ7A 5I93A 2D6NA 4UBGA 5DUXA 1ZBE3 2RM23 1ZZBA 2JX9A 4TZDA 5JAXA 1MQTA 1A78A 3B93A 4GKYA 1C1LA 2N7GA 3URFA 1ZX5A 2B39A 4URTA 4XJUA 1KQRA 2VULA 1LJ7A 4R4ZA 3CJXA 3WCRA 3VLBB 2B9UA 3E6BA 3WP6A 4AI2A 1TMF1 3PJQA 4IEOA 3QD6A 4QPGA 3U11A 1H8TA 1ULDA 3ME2A 1PNFA 5C4WC 3AP4A 1R1ZA 1X50A 1POV1 1QGLA 2RR13 4FT8A 5CFCA 1MACA 5BXXA 3LZZA 3AZVA 2XJRA 2AREA 4HVRA 2R042 1DQ6A 3IPVB 3AP7A 1F9KA 4FVVA 1O3RA 3KQRA 1CQ9A 2YC0A 1X8MA 2XBO2 3ZXAC 2ARXA 5GLTA 2PAMA 3H1YA 2Z2SB 1BEV3 4AQSA 4D7TA 2XHKA 4CEWC 4GULA 1CAVA 4PDWB 2R0FA 4YVSC 4AVAA 2JG9C 3S7EA 1QNWA 4FTBA 1DDLA 2ZMLA 5CG8A 2XVGA 1H4HA 2R1BA 2VGDA 3QBQA 1IS3A 4FCAA 1XYPA 1C4RA 3FC0A 4CRQA 1V6NA 1LGNA 2R071 5A33A 2XWBB 3H0OA 1J3QA 3M8LA 3H9AA 4XE9A 2ZCWA 2HWB2 5GZCA 3OCPA 4AEKA 3IM0A 4H3WA 1RUD1 2WSUA 2TBVA 4AGRA 4QGLA 3ZYRA</