3U4SA

Histone lysine demethylase jmjd2a in complex with t11c peptide substrate crosslinked to n-oxalyl-d-cysteine
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
345
structure length
345
Chain Sequence
LNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Linking of 2-Oxoglutarate and Substrate Binding Sites Enables Potent and Highly Selective Inhibition of JmjC Histone Demethylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase substrate
molecule keywords Lysine-specific demethylase 4A
total genus 106
structure length 345
sequence length 345
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2011-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3u4sA01
3U78A 4URAA 2YBSA 4DIQA 3ZLIA 5E6HA 3PDQA 4GJYA 3NJYA 5FY9A 4UF0A 4D6QA 5F32A 2P5BA 2GP5A 2VD7A 5A7SA 4QX7A 4V2WA 3ZPOA 4CCLA 2XMLA 5FWEA 4IGPA 5FZOA 3LDBA 3PUAA 5IWFA 4GAZA 4CCNA 2Q8EA 5FJKA 4AI9A 5FZ4A 3AVRA 5FP4A 2XDVA 5FZGA 2YBPA 5FY7A 2Q8CA 5FZ6A 3N9MA 5FJHA 5FP3A 5FZHA 5FZ8A 5F3CA 4HONA 3PU3A 3KV5A 5FWJA 5FY4A 5FPBA 4Y33A 5LY2A 3K3OA 3K3NA 3KVBA 3KV9A 4DO0A 5FZLA 5FXXA 5FZ7A 2YPDA 2OQ7A 4BU2A 4XDOA 4QU1A 5F5CA 5F5IA 5FYVA 4QXHA 5FYCA 4D6SA 5FZIA 5A7PA 5FZAA 3U4SA 5F39A 5FYHA 5FP8A 4CCOA 3N9QA 2GP3A 5FXWA 4CCKA 4HOOA 3DXTA 4V2VA 2WWUA 3PURA 5A7NA 5IVCA 3KV6A 4TN7A 5F3EA 2OX0A 4QWNA 3K2OA 5K4LA 3N9OA 1VRBA 5FY5A 5A7QA 3KV4A 3PUSA 4LIVA 4GD4A 5FZFA 4EZ4A 4NUBA 5KR7A 2XXZA 5FXVA 5LY1A 4EZHA 5FP9A 4QXBA 5IVJA 5FZ1A 4C8DA 5FZEA 5FYMA 5CEHA 3PU8A 4IGQA 5A3WA 5F3IA 3N9PA 5FYUA 5FZ3A 5FY8A 5FPAA 3LD8A 5FZMA 5FY0A 4EYUA 2YU2A 2W2IA 3AL6A 5FZ0A 4CUGA 4CCMA 4XDPA 4BXFA 5IW0A 2OT7A 5FPVA 5IVEA 5FYSA 5FXZA 5FYIA 5ISLA 5A7OA 4BISA 5FBJA 3DXUA 5IVVA 4QX8A 4IGOA 5FZCA 5FYYA 5FZ9A 4QXCA 2YBKA 4LIUA 5A3PA 3AVSA 5A80A 2Q8DA 4UF0B 5A1FA 3N9NA 5IVBA 5FPLA 5FYZA 2XUEA 5FPUA 4CCJA 5F37A 5FZKA 4AAPA 2OS2A 4Y4RA 5FV3A 4ASKA 3UYJA 5A7WB 5IVFA 3PTRB 4LXLA 3PUQA 5A3NA 5FZDA 5F5AA 5FZBA 2PXJA 5FP7A 3AL5A 5F2SA 5LW9A 5FY1A 5FUNA 4Y3OA 4LITA 4E4HA 5F3GA 5A3TA 3N9LA 2WWJA 3RVHA 5LWBA 5FUPA 5F2WA 4GJZA 2OQ6A 5A1LA 5FYTA 5IVYA 3KVAA 3OPTA 5FZOB 3OPWA 4D6RA 4CSWA 5ANQA 2YU1A 5A7WA 5FYBA
chains in the Genus database with same CATH superfamily
1IS5A 2EAKA 5BNPB 1N3QA 3ZLIA 1S0IA 3S7EA 3T0AA 3FJSA 1T6BX 4YNIA 2UWBA 4FFGA 4LORA 4UAPA 1REFA 1W6OA 2RJ2A 1AL23 5A7SA 1AJKA 2D93A 1FPN2 1WLDA 3FWEA 2JE8A 4CCLA 2XMLA 3ZFEC 5LZ6A 4QMAA 4WVZA 4IXLA 2X8KA 1NCQB 3CBNA 4H2AA 2E26A 4O65A 5DPNA 2ZGMA 4Q4W2 1ND3B 1GICA 1O4YA 5FCCA 3WNXA 4J25A 3J26N 3ZKUA 1MACA 1GOGA 3V0AA 3D8CA 5H9SA 3EO6A 2ZCWA 5FOBB 2BNNA 2P17A 4AGVA 1NCRB 4KMQA 3SNMA 3BU7A 3FE5A 5AFEA 4FPJA 4DZGA 2DUQA 3TEWA 4CP9A 3RI9A 5DG2A 1GFF2 2R042 4M4PA 1VPHA 4INDA 1V6KA 2RG4A 5A70A 4OHZA 3RS6A 3IKWA 1W8TA 2W3JA 1VBB3 4CPBA 3ZFGA 3GBFA 5IVCA 1LEDA 4GH4C 1B35A 2QDNA 1YXWA 3BODA 4HN1A 1ND2A 2RS32 3K2OA 3ITQA 4QDRA 5FMOS 2C9AA 3HJRA 1V70A 2YGLA 5KR7A 2WS91 1U12A 1F2NA 1ENQA 3RG0A 3JU9A 4YLZA 4XVHA 4QGLA 5FYMA 1CPNA 2W9XA 2XVLA 1OOPA 4COZA 3VBSB 2VZUA 5FZ3A 5AC91 1UO9A 2UY9A 4A44A 2PAEA 4C0BA 1YQ5A 3ST7A 1QF3A 4P5YA 1MR5A 2BWCA 3S6PA 3POJA 3WNPA 2A71A 1S0CA 2VVEA 2RS13 1NAEA 3Q8BA 1MQTA 4ZZ8A 1R64A 1W05A 4TXWA 5LB6A 1HB1A 2BPA2 3MIEA 4LUKA 1SFYA 1BMV1 3OGVA 2BDRA 1GSLA 1HDKA 1Y9GA 4FTBA 1DQ0A 1ULEA 1YNAA 3ATGA 2BFUS 5FFOC 1CESA 2TNFA 2D6NA 2ZACA 1ZBE3 3POWA 3WDVA 3R4SA 5JAXA 3FBYA 4QKDA 2EALA 3WHTA 4UF0B 3ZDVA 1W8FA 3TN93 2VUAA 5FYZA 1OOPB 4EN7B 5HCFA 4LJHA 2ET1A 4IEQA 1YJKA 4AQ6A 3E6CC 4XDQA 3VBRC 2RR12 5ERLA 2A6XA 1MZFA 1OVPA 3ORJA 3QH7A 1KITA 3VGIA 1S0DA 3O1SA 5F2SA 1PX3A 3IDCB 5DAQA 4E4HA 2GALA 2VMDA 1OA2A 5GALA 1W6MA 3PLQA 4I30A 4JV4A 3M8LA 2YYOA 3JQWA 5IVYA 3KZ4C 1W2AX 2A73B 4CSWA 2BZDA 2DTYA 3J8F3 2PYTA 1PIV2 1W6OB 1W8ZA 4YFZA 4LNVA 4FPGA 5A7WA 3EYPA 3MO4A 4NPMA 1EV13 3RRDA 4LLOA 3J7HA 2R0HA 3CQOA 3FHAA 3H1MA 1G86A 2R063 4KU7A 3K75B 3MLJA 3ILFA 3OBTA 4XAEA 1JOJA 4YGBA 5CIRA 4IE0A 4YVWA 5LATA 4GAZA 1C57A 2EIDA 4HT1T 4XXPA 3POSA 2HH9A 1OC1A 4AOCA 4Q0UA 1W2TA 2P34A 4GIQA 2YPJA 3GNEA 2CTVA 3I59B 4Y24A 5F3CA 4N53A 1RUF3 2WYFA 2KXLA 3KV5A 1ZBA3 1JXNA 4LO7A 2YUEA 3NQHA 1IHMA 4PI0A 1OD3A 2BJSA 1BEV2 4CUAA 2IVIB 1GP6A 1MEC2 2GH8A 2IXIA 5CFCC 4BQ4A 4XTPA 1LODA 3ZR6A 3VDCA 1H8VA 4YSFA 3WF2A 1UYXA 1NLQA 5D1IA 1BK0A 4LBQD 2F4PA 4EWEA 1U5ZA 2V73A 1FYUA 5A7NA 4AFCA 2VQTA 5LA2A 3TEXA 3TN91 5F3EA 2OX0A 1H2NA 2JE7A 4UW4A 2X53S 3N36A 3OTFA 3RPQA 4XAAA 1SLAA 5E1RA 5KHHA 3HNBM 4XIKA 4XZUG 1F5JA 2D5FA 3ZMNA 1PIV3 2ZGQA 4QHBA 1W6QA 3GXUA 4XQ4A 1G6NA 2HWD2 2MEV2 3GALA 1O8PA 1Y9MA 1ULCA 5FZEA 2XKPA 5IT6A 2BWAA 2OUJA 4IGQA 1JUIA 3MDPA 2NQYA 3I3QA 3W9AA 2FMYA 3LKJA 3OJBA 1LGCA 3IPVB 1OXCA 1VBC3 2GMMA 2E7AA 1P8JA 1W9WA 3UT0A 4LT5A 3TWIA 1V6JA 1NQDA 2JD4A 4GWNA 2RR13 4CCMA 3ZDSA 1W8NA 4NHLA 2JDPA 5C3PA 4AVAA 4DY5A 4CUCA 5EJ1B 2FDJA 1C1LA 1EAH1 2EAAA 1RUF2 2CAUA 1I1EA 5IVVA 1FOD1 3PVOA 2JB8A 4RGGA 2D6KA 4QX5A 3RSJA 3WF1A 2XKOA 2A6ZA 1CPMA 3MPBA 5IK5A 2R16A 5FQ0B 4AGGA 1WUVA 5J37A 1UYYA 4Y1ZA 2GAUA 4RD7A 5LK5A 3SCFA 3I2JA 3FL7A 2XJRA 4QKBA 4EN8B 1SFPA 3JD73 4OI4A 1S0JA 3GZAA 1D4VB 4XABA 3ZFFB 2WN2A 5JXJA 1RB8G 3T2PA 3WNKA 3RZGA 1QKQA 5DUVA 5DZEA 2RDQA 3ZXKA 2PHXA 3AL5A 4BQYA 1F35A 5LWBA 5BNOB 2VC9A 4PIZA 2JKXA 1HRI2 2W91A 5EJ3A 2YROA 4NVPA 4AI2A 3PJQA 1AR91 1G9BA 3AP9A 1K5MC 4GMP1 4HMZA 4AEDA 3I3EA 4I0BA 4LPLA 1L7LA 4QDSA 3B00A 5HV4A 2WFF3 1H1AA 2VTFA 4LULA 2HWE3 2A1XA 1VBE1 1WA6X 3QACA 1F4HA 5DZGA 4G4FA 2B8MA 2ILMA 2VCMA 2VG9A 4FFFA 4OVEA 5JIUA 3BU0A 1N1VA 1JH5A 3GGLA 4NIGA 3NRUA 5I8TA 1DZTA 4ZHNA 3BIEA 5BUVA 2VOXA 1DG6A 3NKTA 1QHDA 4XC9A 4XIOA 3VBHC 4U36A 4YM3A 3OD0A 1URXA 1V6IA 4M0HA 2QQWA 5T55A 2A3YA 4IERA 3NAPB 2XQRA 3LDBA 5C71A 4AVSA 5HPOA 5KWRA 3A21A 2RS11 1QJU1 4KI5M 1VAVA 3AJYA 4NMIA 3QH6A 1QDCA 1LTEA 1Z7S2 2PMWB 4XPVA 2ZX3A 3ZVXA 1BLZA 3OBZA 2JDZA 4DINB 4I02A 2ZZJA 3A22A 4GALA 3RFRA 3ZYHA 4QX1A 1ASJ1 4MGSA 2VTXA 4CZSA 2EXJA 3KVBA 1G9DA 2FDHA 2V72A 2MHFA 3SC7X 4LBQA 5BNNA 3Q8CA 4QU1A 3AYAA 3DV8A 1UKRA 2D3RA 4Y1VA 1AZDA 1EAH3 1S1AA 5BNOC 3POIA 4FPEA 3ES4A 4RS5C 3J4UH 4DXSA 4AVVA 3N9QA 1G8WA 2QFEA 2VGDA 3NW4A 4I0AA 1TZOA 1XYOA 4XOGA 4AHXA 3R4DB 2Y0IA 4YVSB 3GM8A 2QZ3A 4GH4B 3PURA 3S0MA 1D4M1 1PNFA 2ADEA 4QDQA 1DZRA 1W0OA 2VAUA 3JXSA 5B2GB 1OBNA 3C7OA 3IN9A 1JU4A 2TEPA 1OD5A 3KGZA 3KGLA 2ZEXA 2WWSA 3B3QE 3IPVA 1YJLA 3WSOA 1HRV2 3POBA 4QXBA 4XW3A 4CP9B 1ULDA 3WOGA 4N43A 4NHXA 5L9BA 1I5ZA 4RHV2 2Q8OA 1VMHA 4OQ9A 5BNPA 2QQUA 3AKPA 3FMGA 4N7IA 1Q8VA 4UI9L 5GZFA 5FO8B 4HANA 4QKNA 4BB3A 4BQWA 5LA9A 5IFPA 3ELNA 1K5JA 4PI2A 4OHWA 2DVDA 2VCAA 2XJTA 1RUI1 1TNRA 3V0AB 2WFF1 1AX0A 2JIJA 3LB9A 3N7LA 4JC1A 2OA2A 2TBVA 4A7ZA 3TBDA 1SLBA 3N3HA 4ZU7A 3Q8AA 5FXZA 4PDWA 3THCA 2RS51 3CKHA 2G4IA 4XFBA 2WC2A 4YWAA 4M3CF 5A7OA 1UZVA 4QX8A 1KEXA 4Y20A 1IPSA 2VBPA 2WZR1 2IVJA 2ZXQA 1Q5OA 4ASLA 1AL21 2VW1A 4RR3B 3VN4A 1POQA 3EB7A 1CGPA 3TEYA 4IE7A 1Q56A 1C28A 3ZSJA 3VKLA 1NUKA 2IXKA 3J8F1 3O0XA 2VM9A 3UYJA 4RSUA 3IDEA 3RZZA 4MHRA 3VBRB 1ACCA 3PUQA 2VZPA 2HWB2 5LCWL 4XF9A 3RGBA 4LITA 2YHJA 4GWMA 3DEMA 2RE9A 2VMCA 1UN1A 3WP5A 1YEWA 4MGQA 2DCKA 4QAWA 4S2HA 1LJ7A 3TOJA 5KBFA 1H1MA 2WT0A 5ACA3 2DBIA 1UOFA 1AVBA 4KQ7A 3AXDA 1GYKA 1HRV3 4OFGA 1XNTA 5JXIA 2WZR2 2PHWA 2J1TA 1UIJA 3ILNA 1O6UA 4B8EA 1SFNA 4QU2A 3AKRA 3CHXA 1NYWA 1FT9A 3JCIA 1LU1A 3LPGA 3OPZA 2J1RA 2BYVE 2VW0A 1KQRA 1TVGA 2HWC3 1ND3C 4HN0A 4QX7A 5E89A 4BHPA 2K2SA 5C8WA 3MGUA 1VLNA 3PNAA 3WCSA 3D6EA 3WY6A 1JYWA 4NWVA 3O1UA 1V9U2 3B69A 3TRSB 3ZYFA 4BYYA 2OPWA 1FI2A 1NCRC 1VBA3 3LIGA 1GOFA 3N35A 4RQPB 3ALQA 4UBGA 4YPJA 3EBRA 5FZ6A 3VZOA 1XNBA 4OI2A 3WQ7A 5F6LB 2JDNA 4Z1VA 3WR0A 3PVBB 5FPBA 2ZKLA 1OUXA 3CL1A 5K8SA 3K4DA 1APNA 3CZJA 1ZRRA 2WKKA 4Q8LA 3K77A 3AZYA 3MW2A 1JU3A 4FPCA 4Q4Y2 3UGGA 4XDOA 4NO4A 4P9GA 2CU5A 3AMNA 1XXNA 1WCUA 4BU2A 3T09A 3T4VA 5JPNB 3VZLA 1UXZA 1CQ9A 2VZOA 3ZN6A 3U1XA 5E88A 2QQKA 3SKVA 1AXYA 3RZMA 3ETQA 5FLIA 2DVAA 1QWRA 2W47A 4NPLA 3AFGA 1GNZA 4NWWA 3DXTA 1Q8QA 1XSRA 5FXWA 3RZKA 1RUG1 4HPKB 1WMEA 2OKXA 5JLVA 1G7YA 4QWNA 3PIJA 4JX0A 3GF6A 2R49A 3HOBA 5ABJA 1LULA 4P5HA 1DFQA 4XFGA 1UPIA 4FBFA 4X6QB 1YLLA 3VDBA 1LESA 2ZS6B 2Y6LA 5FP9A 3MHZA 5FZ1A 3RMXA 5DDJ1 1CAWB 5I0RA 2WS93 3WNNA 1NXD1 3WINE 5A3LA 3N9PA 3WG3A 1SCSA 3H3UA 5D2AA 4RL7A 5JSPA 2DCTA 5LEJA 5T5JA 3OUJA 4XACA 4WVMB 4EYUA 2DU0A 3JB4C 3K4ZA 4ISRA 3ZIXA 3ME2A 2WABA 2IFRA 2OT7A 3CDZB 4OULA 1YI9A 1H2MA 5GZCA 3VUOA 4YGDA 3RYPA 1CIWA 5C8CC 4H7MA 4EN0A 2PAMA 5FBJA 5BNOA 5F5QA 2Y34A 4TSVA 1Y9QA 1DQ4A 4R8HA 2P4EA 4FXGB 5FZCA 3RDIA 2IXHA 5CFDC 1ONAA 2AREA 3NJZA 2N7GA 1HJFA 4OUEA 2C9KA 3DPRB 5D8AB 3KD4A 1UYPA 1NY71 2AR6A 2EA7A 4XZPA 3ZOIA 3O1MA 1YFXA 4H7LA 1HRI1 1TNFA 5AVAA 4BMEA 2QQLA 4LKSA 3MW4A 4FTEA 1IS6A 3JD72 1D2QA 4DFSA 4MVTA 5LW9A 1IKPA 1C8NA 5A3TA 3ZXAC 5HXMA 1RHI3 2GH2A 4B29A 1LOAA 3VD9A 1AR73 1H4GA 4M00A 3KQRA 4XF4A 3CLPA 3SEEA 3MV11 1JZ3A 5EXOA 1PM4A 1MS9A 1ASJ3 1R082 2UWAA 3GZUC 5H9RA 5DMYA 3PUIA 1QJX3 3I3DA 2DTWA 2LS6A 4AVTA 1A8MA 1GZTA 2DCJA 1CX1A 4DIQA 2VZRA 1GKBA 5F6KA 3PDQA 3SLIA 1GMMA 3UESA 1SLCA 3UETA 4TLGA 5KC5A 5F32A 2WLQA 3ZXDA 1JOBA 3B9CA 1W0PA 3ZM8A 3BPZA 3Q8EA 3POYA 4XJZA 1HLCA 4YM1A 1OURA 2ZMKA 2BVBA 3VD3A 5JSOA 3ILRA 2QZ2A 2Q8EA 2HWD3 4XUNA 5FZ4A 2CNAA 3ON7A 2BVVA 4KGGA 4X6RB 1J84A 2DVGA 2DURA 5T5OA 1NZCA 1NCQA 1COV3 1WW4A 1SQ4A 3WNOA 4Q4X2 1AYN3 5JSRA 2AACA 2OXBA 3N9MA 3WW4A 4WV8A 5CZKA 3VD4A 1A34A 1A8DA 2JD9A 3H50A 2VE1A 4IE5A 4KH9A 3CIHA 3K3NA 1O5LA 2JG8B 4HSLA 1UZ0A 2JG9A 3DYMA 4Q4X3 5FMCA 3IM0A 1UMHA 3C3VA 3QCWA 5FXXA 2YPDA 1PZ7A 5C3OA 4PBPA 1POV3 1QMJA 1C5HA 4AFAA 2ZAHA 2ZBJA 4WM8C 1UCXA 3SEPA 2ZEYA 4N53B 4OHYA 3KS7A 3VBFB 5C9AB 1JBCA 4XMAA 1PO22 4YVSC 5JVVA 3EJKA 4WM7A 1R1A1 3M3QA 1GOHA 2GMPA 1DGWA 2JDYA 4AVBA 2X5IA 4QQOA 2CY6A 5E16A 2Y0OA 1YQCA 4QD2A 3WDXA 4AFBA 1RHI1 1ZRFA 4IEWA 1H1IA 4N9IA 4UFMA 3ROUA 1UYZA 1W9YA 3K4AA 4HKLA 1PZ8A 4KGQA 4AHWA 5FYUA 4IEXA 4Q0SA 2HLEA 2R062 3B9IA 4W8JA 2QE3A 3ZKYA 4MOAA 2EICA 3ACIA 1ZBA1 3MF6A 3C7FA 5FY0A 4XHXA 4GWIA 3WDYA 4XEZA 1EPZA 3OEAA 4BJ0A 3ZXFA 1SBDA 2NZ9A 4HG6B 4L2NA 2XQXA 2ES3A 1JYCA 1JUHA 1W6MB 1G9CA 1R1A2 4BWOA 4NHYA 2UY8A 4BLJA 4QQLA 3WG4A 1DYOA 2VZTA 1GV9A 3VBHB 5JXHA 1WGPA 4D8MA 5DG1A 3VZKA 5GZEA 4ZZ5A 2VNRA 5A1FA 3N9NA 5IVBA 5BNNB 3SQOA 3M3CA 3PMEA 5BY5A 1Y43B 2AEYA 1H9PA 4XJAA 4MGZE 2B46X 4I3GA 5B4NA 2J22A 4EJRA 3TNPB 4NRMA 5GZDA 3T0BA 3RNSA 2VQ0A 2BBAA 2WSVA 2XWBB 2JECA 3ASIA 4PHZA 4Q4V3 2Z2SB 4Y3OA 1W2NA 3LEKA 3ZFGC 1R092 1SCRA 3H1YA 4GJZA 5DAVA 1D0GA 2VUCA 3N7MA 2J1UA 1CJDA 3T3YA 4BPZA 2D97A 4Q4X1 4QXKA 1W8HA 1GWLA 1OSGA 5I8YA 1CWPA 3I2GA 2F17A 4IW3A 3BN6A 1RUG3 5DAPA 1YQ8A 2R7EB 3SCHA 5DQ0A 4A7KA 3O5SA 3OYWB 2OW4A 2HYKA 4DPNA 1VAKA 2W46A 3L2YA 5DDJ2 2WZEA 3WQ1A 3A0KA 1JZ5A 2CDPA 3T2TA 3VLBB 5FY9A 3USUA 4W4ZA 2P5BA 4PLOA 1HQLA 1PNGA 3FLRA 4OMDA 1ND2B 2WNVB 3MEPA 2FDIA 2Q30A 4CU7A 4YZ2A 1D0HA 3OY8B 4JKKA 4RQPC 1EV11 1J1LA 1PVC2 1VMJA 3DL3A 2YBPA 3RJRA 4F7ZA 1ZBE2 3LA2A 1GU3A 3NV1A 2BNMA 2K0GA 2RJKA 4QQHA 2QQOA 1HN1A 1LOBA 1WBLA 2ZX0A 4ZU5A 2OYZA 1XOYA 5C70A 4CP1A 1QIQA 1LOEA 1QJU3 5H9QA 4N90A 1XU1A 4Y33A 3WNMA 4GKYA 2RMU2 3AZXA 3AMMA 4DO0A 3S57A 2WDBA 4G3YC 1BBT2 2P3KA 4QGNA 4RGKA 1UQXA 4AFMA 4Q4W3 4IEOA 4IDZA 4G9SB 2RS53 4QXHA 3VBOA 4AI3A 1H4HA 1IG3A 1WMFA 3NL1A 5FZAA 5T3NA 1VBE2 3AFKA 4Q4Y3 4COYA 2D98A 3IAPA 4LHKA 1BVVA 5AFBA 1ND3A 1UU4A 1W8WA 4CP0A 3WNLA 2W1SA 1CONA 4LQRA 5JZGB 2F4LA 1DHKB 2FQPA 1BEV3 1VALA 2DFBA 3LFMA 2GC3A 4GB31 4RFT0 4LO8A 5IVJA 1NCQC 4C8DA 4TTGA 1OLME 2G1MA 5HBAA 5IAXA 5ACA2 1HB3A 3NV4A 5A3WA 4CDQB 2XOMA 1RINA 1RL3A 5C3SA 4I2OA 5JI7A 4NHMA 3ZSMA 2BU9A 1X8MA 2EXHA 4FP2A 1HKDA 1FPN1 1ODMA 4HLTA 4XILA 3MBWA 1YIPA 4O9GA 1X7NA 2EF6A 5FYIA 5ISLA 3I7DA 2WZR3 1PHMA 3ETPA 1F31A 4LBKA 1DGRA 2JX9A 4AQ2A 5HI0A 4LO6B 5JDBA 5FYYA 1GANA 2XBO1 2YY1A 1GZ9A 1MZ6A 4JQTA 3WW1A 1U5IA 3POEA 3VZMA 5JCTA 3AMHA 3DKQA 3S7IA 5IFTA 4HL0A 4IEPA 2JG9B 1YC61 4FOWA 4JRAA 3BGAA 5FZKA 3HR9A 2OS2A 1CX4A 4MUVA 4YZ1A 1X9TA 4XUQA 4RR3A 2VMFA 5FP7A 1OOPC 4PT6A 4QB2A 3A23A 4NAMA 3BTXA 4AEKA 2YMZA 2D44A 1LCLA 2RDRA 4K3UA 4E2QA 4CU6A 4UFKA 4E2SA 4LMFA 1O3SA 3GCXA 4IV3A 3OPTA 2G19A 2AGSA 2VXJA 1RUD2 2DV9A 4WZCA 3OGRA 1S0EA 5K0UC 1MQTC 1LEMA 2BQPA 3D5OA 1QQP1 1CAXB 4FOVA 4ZS2A 5EWSA 2Q5TA 1IS3A 2VNOA 1N1YA 3JD71 2DWRA 5CB7A 3NKGA 4D3WA 2DVFA 3ZYIB 4S2DA 2OVUA 2YBSA 1BBT1 3RI8A 5ACA1 4C90A 1PK6C 1XNAA 3ZSEA 1UWWA 4AGRA 2ERFA 1YO8A 3DCQA 1WBFA 4ATEA 1WMDA 2JDUA 1JYNA 1LOGA 1CR7A 1Z7S1 4I09A 4L0PA 3NO8A 1WCDJ 4RHV3 1MS5A 4K8FA 1GNYA 4JTOA 2RM22 4Q1PA 4MX3A 1HQWA 2WQ8A 3IMNA 2CDOA 1NA1B 2Z69A 3CU7A 4EN9B 1NKGA 2ZPXA 1C4RA 2ZOEB 1DU3D 4B1LA 5C7GA 5J98B 4BIFA 5F9TA 4ZY9A 3USUB 2JG8C 3RYRA 1G9AA 5J7MA 3FZ3A 1AR63 4JDNA 4Y5SA 1OQDA 2ZAAA 1LOFC 4Z2WA 5GLVA 4UBHA 5FYCA 3POFA 2NMNA 3ZO0B 3VDDB 1UOJA 2WR9A 1ENSA 2LM3A 2ZGLA 1C3HA 3H9AA 4ZU4A 3T1LA 1HXS1 4YW1A 1AUYA 1YWKA 2WJSA 2RMU3 2D43A 2XVGA 2WZPP 4CCKA 5BV6A 4MGTA 1OVSA 4N43C 2Y6FA 4F8AA 5JR2A 1MQTB 1QDOA 3NAPA 4JKLA 1AR62 3LDRA 1VRBA 5A7QA 3KCXA 3SH5A 1MVQA 2MPFA 2XG3A 3PVNA 2Y26A 1TMF3 1UY4A 2WFF2 1CZVA 2ETEA 2BUKA 1WW6A 4XFHA 2WO2A 3PU8A 4CU9A 1V6OA 3N4MA 1SLLA 2W94A 3NSTA 5HXVA 4NIAA 3SMHA 4MADA 2XL9A 5EQUA 5FY8A 2RM23 3LD8A 2DYCA 3ACLA 1CJPA 2VH9A 1OI6A 3BOPA 1OF4A 1H2LA 4Y1XA 1BCXA 1QJX1 2XB6C 5L7OB 2PLV3 3M1HA 3WW3A 1B35B 3FFZA 4L11A 4JGZA 4BQ1A 5KHKA 4PF1A 5T5LA 1JHNA 3VBOC 2XHNA 3C7EA 1JTZX 2GDFA 3SH3A 1DQ2A 4IEUA 1KDKA 1KS5A 3W5MA 2NM1A 2WQZC 3E1F1 5A33A 3R6SA 4LIUA 3AVSA 1HRI3 4EN6B 1W6PB 2PHUA 4JGYA 2Q4SA 3BTYA 3POGA 4CCJA 5J1XA 1EP0A 1JZ8A 3VKFC 2QUOA 1CAXA 3HQUA 2AZ5A 3IDAA 2QJVA 3B93A 4IV3B 1YHFA 1VBC2 3FUOA 4ONUA 3TYJA 1QXRA 1NX9A 1OLMA 4WM7B 4BK4A 2DCZA 2E63A 4QX2A 4XMIA 2O0OA 1S55A 2VUJA 2VMEA 2WIIB 4QPGC 3WP6A 5EYYA 4XBLA 4MGIE 5FKCA 4DMIA 2HWB1 1S2KA 1RIRA 2RMU1 1VRH3 3IMMA 3L9JT 4URTA 4XJ9A 4ET7A 3W5NA 1K5MB 1SACA 4B4QA 2KR2A 1X8EA 3JB8A 4LHNA 2BGPA 3T0DA 1FXZA 1H6YA 2HWF1 5APAA 4Q5OA 2GN7A 1MVEA 1XQNA 4FI9A 1SDWA 4XQDA 1ZZ6A 3W21A 4JTNA 1AXZA 1W90A 2QQPA 3IAQA 2VZQA 4Y4YA 1HJGA 2JWPA 3X29B 3BI3A 5HCAA 4PDWC 5J48A 1KRIA 4M3CA 4OI1A 4QHOA 3BTZA 2LUWA 5DZFA 2X05A 1UX7A 3ZXLA 4K6BA 4OZOA 1Y7BA 4RYDA 3ZFFC 2GU9A 5FMOL 3OUHA 3VB9A 4ZONA 4GWJA 4R9CA 4CXXA 4NE9A 3ZN5A 4YZ5A 2JICA 3GJAA 1ZRDA 1X50A 4WVVA 4BCUA 1AR71 3WXPA 1WWYA 1MS1A 2WA3A 1F4AA 3JBG2 2XJPA 5LBBA 3OCPA 3M3OA 4L99A 1RXGA 3MUZ1 4CA9A 3H8XA 2ENRA 3NNLA 2ORXA 3I8TA 5F39A 4ES8A 3I59A 2VU9A 5KHJA 2R073 4NPRA 3BPSA 4QPGB 2JENA 2PELA 3OF1A 1SBEA 5LEKA 3RZLA 1REEA 4Z2AA 4CDWA 3NMBA 5M0TA 4DXRA 4PJYA 1C8M2 1A6CA 1ZZ9A 1J1TA 3I2KA 5SV5A 2ARAA 5CG9A 1YYNA 5JOYA 1LHUA 2CSGA 3G6JB 2QQIA 4YG0A 3ZYBA 4EWDA 1I9RA 1EYBA 4LBQB 1OLQA 5CEHA 4HXCA 4UW3A 3KSCA 4KG8A 4CDXA 2W1QA 4FPFA 5FPAA 3LEMA 4OYUA 4JDMA 5A33B 1MS8A 3KF3A 3AL6A 1DGLA 4TYSA 4UWDA 4LUMA 3E97A 5K7PA 1HXS2 1EV12 5FPZA 1U5YA 1YFWA 4H14A 4XFIA 1ZBE1 3A0NA 3MF9A 4R4XA 3FLPA 2R061 3WQBA 3TN92 2HWC1 4YGEA 4A45A 4QHZA 3O1OA 4IGOA 5KC6A 2D3PA 4EE2A 3U14A 4RS5B 4BQXA 4QXCA 2W0XA 5JMCA 1K42A 1PVC3 5A80A 1O5UA 4TLFA 5A1AA 1ZVFA 4AZZA 4BH9A 2XLAA 1UL9A 1CAWA 3B01A 2FCVA 3OBAA 2JDAA 5I0SA 5IHRA 1QH7A 1O8SA 1R093 2WAAA 3LSDA 4DUXA 3LGRA 4O7XA 1ZZ7A 2YFUA 1OPMA 4LBNA 2F6BA 4Q4V2 5F5AA 2EIGA 4XF1A 4AEDB 1S2EA 1UY2A 2Q0AA 1X36A 4CP2A 1BKZA 4Q0QA 4XF0A 5FUPA 2OZJA 5LBCA 2E53A 4BQ5A 1ALYA 1VMFA 3R0RA 4YRDA 2FZ1A 1RJ7A 5EV7A 5IYYA 4NN0A 4YFWA 2X10A 2OIIA 3KMHA 5CAZA 4WVMA 2P6HA 5FDBA 5JXGA 4AK3A 2J1AA 1K12A 1RYYA 3O0VA 2VZVA 2Z5WA 4KWUA 1LOFA 3BB6A 5FYBA 4AVCA 3KCCA 4YM0A 2PLV2 3LOIA 5FBZA 2WNVC 1PVC1 4R9BA 4GJYA 3WVJA 1X82A 4QT6A 2E33A 1RUD1 2QQMA 2ZJCA 4R52A 2VY0A 2C24A 5K9YA 2E7TA 4RR3C 1BJQA 3IIAA 5FZOA 1GQHA 1IOAA 1RUE1 2BRTA 1NG0A 2VNVA 3LSEA 3NAPC 4OZXA 3SCGA 3E5QA 4MG2A 5F1RA 3BKZA 3N7KA 1RVF1 3MPPG 3W20A 3P1IA 4ASMB 5FZHA 4ZXKA 4WM8A 2YG0A 3J7MA 1WMXA 1VBD3 2DBNA 2NLRA 2HJIA 1CD3G 2VXRA 5FLJA 1XNDA 3UKVA 1STMA 1J83A 3FHIB 1N3OA 2FCTA 3KQ4B 3NNMA 5EP9A 4IEZA 2X5IC 4JGZC 2DU1A 2UYAA 1KD7A 3ZYGA 1BMV2 1E5SA 2ZGOA 4FAGA 5AC93 1NLRA 3LFIA 3WW2A 2D3SA 4PF5A 5KXDA 1A78A 5H9PA 5A6YA 2WN3A 5FY5A 2YDEA 3DN7A 4R9DA 3PUSA 4LIVA 1HV1A 4N8MA 1CAUB 3GHMA 1ZBA2 2NN8A 5FXVA 1MS3A 4FCAA 4EZHA 2DUPA 4BDVB 2R30A 1V9U3 5IK8A 3OSDA 1U5XA 2A5ZA 2Z4FA 4LOTA 2JG8A 1PMHX 1V6NA 1FPN3 1W6QB 2KD7A 2ZX4A 3Q9OA 1YFYA 1US3A 4QM8A 3CNAA 3OGJA 4IV1B 5GLTA 2YC4A 2ZGTA 1VBC1 4BZ4A 3HAGA 1QNWA 5BYNA 5FYSA 5T50A 4M3CB 1J59A 2QKDA 1I3HA 1PK6B 1FV3A 2AH2A 1FAYA 3A4UA 5FUIA 5LA1A 4FPOB 1B09A 3DUIA 3RJ2X 2HWF3 4XFFA 2D6PA 2V5YA 4AR2A 4K20A 3LEGA 4CDWC 1ASJ2 1R083 1GWKA 1ZM1A 2PLV1 1WCKA 2E6VA 5FMDA 2DDUA 1J3RA 2HWB3 1O7FA 5GJ6A 3O7OA 4P9JA 1ZZ8A 4YW7A 5F37A 5CFDB 1F8VA 1UX6A 4FSJA 1NA1C 1CAUA 1DZQA 2ARCA 4GMP3 2PA7A 3MFAA 2B4KA 5FZDA 5FZBA 5L9RA 5CBLA 4XE9A 1ZNPA 1OH4A 4MV2A 1JZ7A 1PO11 3H8UA 4XXAA 4DNYA 3BVCA 2P37A 2WWJA 3KM5A 3J7NA 4GH4A 3OB8A 4Z07A 3GZTB 5T52A 3NV3A 2VTXJ 1OMIA 2QCSB 3IWZA 3JUUA 2BOJA 4D6RA 1DCSA 4OI0A 2WRAA 3KT4A 2Z79A 2A7AA 2VUDA 2VZ3A 2YU1A 1AR72 5G05L 1IPKA 4D94A 3OG2A 4QM9A 4URAA 2BOIA 1GBGA 2R6QA 3D3AA 1SDDB 2XPJA 4N43B 4AXOA 5E8AA 1EUUA 3OEBA 4UF0A 1WW7A 3VV1A 4AAXA 1DYPA 2W95A 2IXJA 4HVOA 2ZHNA 3T4HB 1DBNA 3AKTA 3RWKX 4NIIA 3WD5A 1NQJA 4B7EA 2FDKA 1SPPB 2EIBA 3AX4A 3JQXA 4JQRA 4AI9A 2PHTA 2YGMA 3LIHA 4A3ZA 1YQ6A 1MPXA 1FATA 2V4VA 3RZJA 1LB2A 1Y4WA 2P3JA 4IESA 4A6OA 3AZZA 1AF9A 5A3UA 3UJOA 4BQ3A 2Q1MA 5FP3A 4LBJA 3UL2A 2VOVA 1LHNA 1W99A 4HONA 4P9LA 3I3MA 2XJVA 3AXEA 2HWD1 1OA4A 4CDUA 3VDDC 1UU6A 1TME1 2RS33 4N9HA 1CN1A 3HBKA 4FXKB 3VBUC 2OQ7A 1LHWA 4B7KA 4ES9A 1ULFA 2BV4A 1LHOA 2Y38A 2R0FA 2QDRA 4FT8A 4I01A 4Z82A 5GLUA 4CEWB 3ACHA 3D4KA 3M2MA 2ZMLA 1RUH2 1D4M3 3D82A 3AC0A 3IZOA 1BBT3 1KXGA 3VHRA 1PGL1 4HETA 2R043 4MGYE 2VZSA 1TMF2 2RDNA 4XURA 4H55A 4OMCA 3PHMA 1I5PA 1LRHA 3KV6A 1OQ1A 2VOTA 1QJFA 4DEQA 3VL8A 3LA3A 1AHSA 1Z7S3 2ZX1A 5K4LA 4IL7A 1H9WA 4QX3A 2XLGA 3KV4A 2J1VA 3IB3A 4GD4A 3WCRA 2QTWB 1W04A 3ZN6B 4W6WA 4DRRA 2GC0A 1JOPA 3PJYA 3AYCA 1NE6A 1AXKA 3DKWA 1OLRA 1IGOA 1K3IA 1QOTA 1WD4A 3LCPA 2JE9A 2H6CA 5L7OC 2AC1A 4CDUB 5I91A 1H8TB 3HD8B 4LBOA 4DQAA 3ABZA 4MGKE 5CU1A 3VBHA 4YVWC 2HEVF 2ATFA 2CYFA 2W2IA 4FP3A 1XC6A 3ZYJB 1RUE2 3J9SA 1WZXA 3M70A 4RQPA 5JIAA 1PVXA 2D6LX 1HB4A 3J7LA 2RDSA 3H1WA 1UZZA 1REDA 3LDKA 4YW4A 1DQ1A 1O91A 4CCEA 2YBKA 5A3PA 3LEIA 3AM2A 1BEV1 4FPYA 4LKFA 3U11A 1Q43A 2VW2A 5HCHA 3I97A 3IIIA 3WT3A 3CJXA 1DIWA 1N1TA 1VBA1 2FMDA 3MIBA 4A2UA 3KF5A 5HCBA 4CDXC 4XJWA 4AEDC 1D2SA 4YW6A 4GA9A 4C1XA 5L9VA 4Q1RA 2WNEA 1KFXL 2MNGA 4YW2A 4Q4W1 4A41A 1AR81 3DF0A 4UW5A 4GB33 2DUOA 4S2GA 3GDBA 1VBD1 3GBWA 5EHDA 4UFHA 5ANQA 3VKMA 4COWA 4IUGA 3WUDA 2A70A 1MZ5A 1DLCA 4D7YA 1RVF3 2WNUB 3HT2A 1HRV1 2P3IA 2PFWA 1JS9A 1L3JA 4CVUA 3HQXA 1AYM3 1K5MA 2W87A 1W28A 2WNUA 3AP7A 5AC92 1W3VA 1PMIA 2A6WA 2ZTNA 4RFRB 4W50A 4BQ2A 2IWGB 2XR4A 5FRAA 1AR93 4Y1YA 3UGFA 2VD7A 3HNYM 1T6GC 5FKBA 3ZPOA 4FOQA 4XCAA 3T08A 3HQRA 3O14A 5FJKA 3MIFA 2J42A 4KBBA 3O0WA 3VL9A 2HWF2 5FZGA 5GZGA 3EXUA 2ZABA 1RJ8A 4PIYA 1TG7A 4V1PA 1E5HA 2XLFA 3VZNA 1RUNA 4FPKA 4TZDA 1RUJ2 1VBD2 4AEMA 2B9UA 3PU3A 4BLIA 5IJRA 2ZEZA 5LY2A 3U10A 5JUVA 4H3WA 2VPVA 5J3UA 4RHV1 3KV9A 3AZWA 1UZYA 4B1MA 2PQSA 4B4RA 4UFIA 1PZ9A 1QJY1 2EXIA 1UD1A 1QH6A 1SEFA 4FO9A 4I3PA 3JZVA 3F95A 5F5IA 4D6SA 5A7PA 4CXWA 1UAIA 2AUYA 3KWVA 4WM8B 1XSQA 1MS0A 3BCWA 4XUTA 1VJ2A 2VOKA 5DUXA 1MEC3 4R9AA 2RS52 2AYHA 2XL7A 2WWUA 3ZXJA 2GNTA 1QQP3 2LRPA 3I3BA 4DUWA 1FNYA 2W52A 3BALA 1US2A 5KHGA 4SBVA 3G7DA 4BOWA 2FD8A 3N9OA 2O8QA 5DDJ3 3NNJA 3UGHA 4AI1A 4NUBA 1H8TA 1MS4A 2VZ1A 3AP5A 4YG3A 3T2QA 4YM2A 5A6ZA 3MUY1 3IDBB 5LY1A 1SHWB 2GMEA 1UZWA 3ENRA 1O59A 2GNDA 5HV0A 2ZGSA 1RTVA 5I93A 3VHOA 1ZZCA 1SLIA 4ZKTB 1RMU1 2Y6HA 1JYTA 1SBFA 3OGSA 2OZ6A 5LK7B 1H2KA 2B39A 2XWJB 2Z42A 1NOVA 1AX2A 4META 5I8SA 4BXFA 5FPVA 1AL0G 4HZFA 4Y26A 3S5QA 1W06A 3ZYPA 1AR82 5BNPC 1V9U1 2RV9A 2WFPA 3KCYA 4GMP0 4JGYC 4PCRA 5G04L 4LEJA 1QJU2 1W3XA 2PHDA 1HX6A 4AI0A 2VULA 4ORFA 2G9GA 4XBNA 4CU8A 5FAXA 4FTSA 4YGCA 3AMQA 2JJ6A 2RR11 2JEMA 2VMGA 4XJUA 2YC2A 3U37A 1RHI2 5JR7B 1R091 3BTAA 5BNNC 2IXLA 1YIFA 1OKQA 1H0BA 1YI7A 1QJY2 3UKTA 1HXS3 5BNQA 4RS5A 4Q8KA 2IXCA 2ZMNA 2D40A 3O1PA 1RUH1 4AW7A 2PXJA 2VBDA 5IUQA 5C5TA 1LU2A 4XF3A 5DAWA 3K48A 4QPIB 4IETA 2B9VA 3F2ZA 4OCTA 1JHJA 3ZFGB 4AG4A 4CXYA 3I49A 5A6QA 1M06G 1SPPA 1IQAA 1RUG2 3UV9A 1AYM1 1PGW1 3UJQA 2OUHA 2P6CA 1RUJ1 4A3XA 1NE4A 4LK6A 3VDDA 1FV2A 3CZUA 1OFNA 2VR4A 5C6CA 1MEC1 4K8RB 2RM21 1EUTA 4WVWA 1ODNA 2XGXA 3C7GA 1QJZA 1WKYA 4P00B 1OHFA 5IAVA 3VD5A 3NJYA 3ZXGA 4A4AA 1NCRA 3P3PA 5KXEA 1C5IA 1QGLA 4J6GA 1UOGA 4C91A 1TME3 2RS31 4NIHA 3H42B 1X9PA 3MLKA 5FR3A 2O8OA 4Q2FA 5LRSA 1NA1A 1DQ5A 3AKSA 2IZWA 1C1FA 1OH3A 2I07B 1PO21 1UY1A 1GUIA 2XHKA 1U0AA 1S2BA 5L19A 5I0DA 3TB0A 2XDVA 5LA0A 1H30A 2E31A 3E5UA 1DQ6A 2R041 2MEV3 5FZ8A 3VDAA 1RMU3 3Q8FA 3ECQA 3LOBA 5CFDA 1RUJ3 2VMIA 4KBZA 1LKNA 4PLNA 5JI9A 3THPA 1S0FA 1XPWA 1Z78A 4DY3A 1J3PA 5F5CA 5FYVA 3R05A 4CEWC 3W59A 1BZWA 1E57A 4BMBA 1DGWX 4NJ4A 1OF3A 2HBTA 2VO5A 4R4ZA 4UFLA 3V64A 2JDKA 3M4FA 1BYHA 1PK6A 2ORZA 2YXSA 4L97A 1UPSA 2WO1A 2ZKNA 4LK7A 4CDWB 2VMHA 3VD7A 4QPGA 4K7JA 1DDLA 3MW3A 4XTMA 5JPMB 4FOYA 4M0NA 3BUCA 2YV8A 5ANNA 4XQWA 3SITA 1VRH2 5FZFA 3VBSC 3VBRA 1QJX2 1UKGA 2WT1A 4ARXA 1I6XA 3WP3A 1BK1A 3CEWA 4JHZA 4XCBA 5DABA 3ZYRA 1WLTA 3NNFA 3W58A 4KWLA 2R072 5EYXA 4WBBA 4CDUC 1CAVA 4CDQC 2HWC2 3L2HA 4QB6A 3WV6A 4AQTA 4DOUA 2YU2A 2C5DA 2RJLA 5FZ0A 5L73A 4AL9A 4CUGA 2XVKA 4CTEA 5FO9B 2XUMA 1MZEA 2ARXA 4JVAA 1IS4A 1OA3A 3AB0A 2C26A 3LWCA 1QNYA 2E7QA 2XJQA 2BERA 1AYN2 1IQDC 3I2HA 2VJXA 5FIXA 3LQCA 3THDA 3VBOB 3ZN4A 1KJLA 2BTVC 2HEYF 1DP0A 2W1UA 3NVCA 3OBRA 4AHYA 3LE0A 5C8CA 4IEVA 1VBB1 2ZGPA 3TAYA 2JG9C 3ACFA 4AYUA 2AENA 4AF9A 4Y4RA 2R071 4OLLA 3WDUA 4ASKA 4OQ8A 1AR92 1CVNA 2V09A 4UOJA 2D6MA 4CCCA 4KWJA 4QB1A 4F3JA 2VECA 2Y33A 3BOWA 3VHPA 2ZHMA 4N53C 3N9LA 1FOD3 4AWDA 1UOBA 4ZS3A 1ZRIA 4YVSA 5A1LA 3WQ0A 2IC1A 4Y5Z0 4RGAA 5CNAA 3KVAA 3CJIC 2WNVA 2ZHLA 4CEYA 2CWSA 3T30A 2WA4A 4Y22B 2IFWA 1F15A 4MO3M 5LBFA 4YARA 5J96B 2WBKA 1QY4A 2YC0A 4MXWB 2JIGA 3ES1A 1YFUA 4MZUA 2Y64A 4LA3A 1AR83 4D6QA 4PQ9A 3V56A 3OYWA 3B7MA 1GP4A 2PAKA 4Q29A 1XNKA 3HBZA 4HFSA 1JZ2A 1IG0A 1PIV1 2GZWA 2CL2A 2VNGA 1KDMA 1V0AA 1NZIA 2KM2A 4QQ2A 3MICA 1XE0A 3EQEA 4COUA 4M3CE 4KNCA 3WZ1A 1D7PM 1W8UA 3ZR5A 4JDOA 2CGOA 1ZYBA 2HWE1 1JMUB 2Q8CA 1DF0A 1H8TC 4MLOA 3CF6E 4O61A 4HSJA 5CKNA 3FX3A 3AK0A 3DPRC 4QGMA 5D8AC 1QXJA 2C1FA 1FMD1 4FVVA 4KG0A 3HEIA 3K3OA 4J1WA 3QBQA 1XBFA 1JYIA 2NP0A 4CE8A 2W92A 4WM7C 1VR3A 1TMF1 4HVRA 1VBA2 3OOXA 5SV8A 4B4PA 5C3RA 4RA0A 1EY2A 2HYXA 2ZA9A 4GXLA 5L36A 3WDTA 1O3QA 2JDHA 4LHLA 3U4SA 4I0WB 3HN1A 1UW8A 2XH6A 5KHIA 2FDGA 4KU8A 2WS92 1UY0A 4MSVA 1LHVA 3U75A 1W6NA 2BFUL 4IE6A 1EPWA 1Z0HA 2EVXA 2C0ZA 2VBBA 3D0JA 2FZ2A 3MIGA 2PN5A 2LTNA 3LA7A 1KFUL 2PQQA 4OUMA 4E4SA 4EZ4A 4AHZA 3PTYA 4A6SA 4NR1A 4NIDA 2UWCA 3ZFFA 4DXTA 1UY3A 1RUD3 1VBB2 1QXPA 3WDWA 2WNOA 1FMD3 2PHFA 1RUH3 2J1SA 1Q8OA 4ZPIA 2C6SA 1VP6A 1LECA 4LR4A 4A7YA 2R1DA 4HK9A 4UFJA 1S0GA 4YZ4A 1PM7A 1PMJX 4BIOA 5IW0A 3FHQA 4JKMA 1JZ4A 5C5UA 4XUPA 2HWE2 1AYM2 2H0VA 1PGW2 2B5HA 5A3MA 1GNHA 3DGTA 2CWMA 4K21A 3SISA 3VBFA 1L7QA 5C9AA 5CKQA 4Q4V1 4IEYA 1GZWA 4P08A 4CDXB 5FPLA 3DECA 2J1EA 2A3XA 4CRQA 1E5IA 1DLLA 4AAPA 4EROA 1ZRCA 2BP6A 3FBMA 4J1XA 3I2OA 1H6XA 3WF4A 4W6XA 2QQVA 5IVFA 3FFQA 1W2OA 4O9EA 3AJZA 4K1ZA 1W2UA 5A32B 3P3NA 3GJBA 3R4UA 4QPIC 5DN2A 5F3GA 5FUNA 4NHKA 3RVHA 5FOJB 5I0TA 1AJOA 4E9KA 2PHRA 3FN9A 2A75A 4LTAA 4PLMA 4NOTA 3E6BA 1O4ZA 4M01A 1PO12 3WG2A 2XBO2 1JW6A 4QPWA 1K45A 3WEZA 4QQPA 3BIWE 3I2FA 1GLHA 1WW5A 3U78A 5C4WC 1UMIA 1VB2A 5CVRA 3THTA 3E5XA 4U2AA 3RWNA 3WG1A 5T5PA 1JYXA 5GKAC 5EIYB 3UK9A 1GZWB 3M3IA 2KA3A 3PUHA 5EPAA 2B45X 3VZJA 2JKBA 1HV0A 2ET7A 4LO4B 3HWJA 3H7YA 3APBA 2RVAA 1SG3A 2V4AA 3ZMOA 4DUVA 5JZGA 1BQPA 3WP4A 3BYWA 2A6YA 2GC1A 3AVRA 4PDWB 2RHPA 5FP4A 4DS0A 1R1ZA 1V00A 4FPLA 3O1VA 4Q0PA 2WUHA 2GN3A 1ULPA 4MH0E 5EJZB 5EZWA 3SXWA 4E27A 3VBUA 3MZHA 4XYXA 3HT1A 3MFCA 3GYDA 3AP4A 1R081 3I2DA 4Q27A 4UW6A 4HKOA 2H6BA 5FJHA 2J7MA 3URFA 4E4ZA 3UNPA 1XJAA 2UYBA 1A3KA 3ZSLA 3NV2A 1FNZA 1M4WA 3IBMA 3ZSKA 4C1WA 4CDQA 2P1BA 5GLWA 2Y6KA 1XYNA 1BVP1 4D0QA 4JGYB 5FZ7A 3RZHA 2B42B 2DCYA 4K40A 2I45A 4PIXA 4AFDA 2BEOA 3DYPA 2D5HA 4AI8A 4C0HA 1CZSA 2K9ZA 4CCOA 4UYBA 4YG6A 1TME2 2GP3A 5IK4A 3H8RA 2ZGKA 4HOOA 2VQAA 4P02B 3OY8A 2WL1A 2R1BA 2O1QA 3H3LA 4JGZB 4TN7A 1RUC3 5GLZA 5L7OA 4BXSV 4AEJA 1LR5A 1W0NA 1HW5A 4WZFA 3WHUA 1UNBA 4PQQA 3HMYA 5D21A 4HVQA 3U4XA 3ZFEB 5K0UB 2W5FA 3O1RA 1TEIA 4P9IA 3D0SA 2Q1FA 1DGRN 1UMZA 1V6LA 3NJXA 1O3TA 1XRUA 1VBE3 3DPRA 5D8AA 5FLHA 3NJVA 3C2UA 2BNOA 3MIHA 1EAH2 4GQ7A 1Q8PA 1N1SA 2I74A 1RC6A 1VRH1 3RMYA 4B3NA 3B5LB 2ZEWA 1W39A 5LASA 1VE0A 2ADDA 5JMOA 3CJIA 1JZ6A 3MIDA 3QD6A 4L9BA 2DF7A 3S5AA 5CG8A 4OHVA 1IKQA 2K46A 5KXBA 4XJ8A 4IQPA 3KB5A 3B02A 4HKWA 1OUSA 1C8M1 1XNCA 2EIEA 2SLIA 4QKFA 5FZ9A 1VAMA 1RUC1 3AYDA 3VBSA 3KLSA 1SMVA 2XUEA 2GC2A 3U07A 1R1A3 1SZBA 2ZGRA 4MXWA 3E6DA 5LBEA 3ZFEA 1FOD2 5A3NA 4Y22A 1S4CA 2XJUA 3GBGA 4CEYB 1W9TA 4M4RA 2LROA 2WAOA 1NT0A 4FFHA 3PL0A 4P14A 4UT5A 1W9FA 1ULOA 5A6XA 1JN2P 1LGBA 2LW8A 2L9LA 1LENA 1PGSA 3CJIB 3MI8A 4GKXA 3GCWA 4JAAA 4NRPA 5FYTA 3NWKA 3OPWA 1QJEA 1Q8SA 2Y60A 4LBMA 4P9YA 5J09A 2SBAA 4ZXEA 3V65A 4W6YA 4EWAA 2ZGUA 3KT1A 4CCDA 4N7UA 4HBNA 2RS12 1ZX5A 1WCQA 2W39A 2CAVA 3KT7A 3MYXA 2O14A 3MV01 1ZA4A 5K0UA 2ZZQA 1GWMA 4FFIA 2A3WA 4KWKA 1PO23 3PVEA 2EXKA 2GP5A 4LBLA 4D69A 3U0ZA 4V2WA 2OPKA 4OHXA 1ZA7A 2QQJA 5JOZA 2PTMA 4JHTA 4QX0A 1YRZA 1N47A 2AEZA 2UURA 1JODA 4FQZA 3VHNA 4LE3A 3A7QA 2MEV1 2G9FA 4X8NA 4Q0VA 2HEWF 4BE3A 5F7UA 4NROA 4CUBA 3INAA 1FX5A 2YB7A 4E8CA 3OD4A 2C4XA 2X29A 3EHKA 1XE8A 2CV6A 2WT2A 5FWJA 5FY4A 1QQP2 1GR3A 1OKOA 4E4DX 1CAVB 2TUNA 4E8DA 2VCCA 3N7JA 5CISA 2DFCA 3P6BA 1NXMA 3UKNA 5C8CB 4Z92B 2V5DA 4W65A 3LZZA 4CPBD 4NRQA 1UU5A 1ZZBA 2P2KA 5FZIA 1G9FA 3HIFA 3I4IA 4Y20B 5FTTC 5FP8A 2X5IB 1XB9A 4BM8A 1J58A 3VBUB 3V0BA 2D7FA 1CIYA 1YQ2A 3M3EA 2HBUA 3PIGA 4DRVA 4JCKA 5DXDA 4XFAA 4SLIA 4IV3C 3O12A 4Q4Y1 2I2SA 4D7TA 1JI6A 1RXFA 1L7RA 2UU8A 3H0OA 1RVF2 3VKOA 1W9SA 1GQPA 1RMU2 2XXZA 1KS4A 1OFSA 3LF7A 1V6MA 2VL4A 5T54A 3C8XA 5KXCA 3WX5A 5FK8A 1WCSA 5LRRA 4P9XA 2FBEA 3ACGA 5F3IA 4YW5A 4LOSA 5CA6A 2YFZA 1TE1B 1RUF1 5FK7A 4AE2A 3NNGA 1WLWA 3KHBA 4RN5A 4MHUA 4AQSA 4E2GA 1QEXA 1S0BA 1UXXX 3ZPYA 3SH4A 4IV1C 3OUIA 2DVBA 1RUOA 3HPNA 2XJSA 2P3YA 1OPOA 4TWTA 3AMPA 3GHNA 4Q26A 2XBO3 1PO13 1J3QA 2WQ4A 1NLSA 3I2IA 4YVWB 3LPFA 5A32A 1IPJA 3FUQA 3IT8A 1AR61 5DUUA 4FAHA 2CGPA 1COV2 5JOXA 4GB32 4K9SA 2Q8DA 3HN3A 2ID4A 2WO7A 4XBQA 4XHBA 2WINB 4Z8BA 2GNMA 2NYYA 3ZX7A 3JBG1 5DUWA 1W03A 5FPUA 4IE4A 1QOOA 1W6PA 3DYOA 1W8OA 2FCUA 4YW3A 5FV3A 5A7WB 5IATA 3PTRB 2GNBA 2CGNA 1LOCA 4GULA 1SLTA 4PBOA 3AKQA 4XETA 2HKXA 4FPHA 2VQUA 2PHLA 1W6NB 2QNKA 1QJY3 5F2WA 1PGL2 4ARYA 4QPYA 4S2FA 1GQGA 5FZOB 3J8F2 2ZGNA 1KGYA 5I0UA 1QU0A 1VIWB 3WF0A 3PMSA 3VBFC 5C9AC 1LNSA 1RGSA 5EFUA 5C4WB 2VCBA 5CFCA 2E9QA 1UF2C 5BXXA 1RUE3 1JYVA 3MLLA 2ARBA 3M7AA 1XE7A 4LE4A 4OUSA 5E6HA 3WLUA 1OT5A 5JWPA 2W68A 2VOWA 2H0BA 1F9KA 4HK8A 4YZ3A 3AP6A 3TEZA 2BBVA 1B35C 5ABJB 1O3RA 2BGOA 1ND2C 1FMD2 5FWEA 4IGPA 3PUAA 4Y1UA 4JZRA 5F8PA 5IWFA 4HPKA 3ZIWA 4CCNA 4YYOA 2XONA 1KJRA 1WLCA 4MYEA 4QPIA 3RYKA 1IZ3A 2IUWA 2Y8KA 4MXVA 5FY7A 2YZ4A 2FDFA 2WYSA 1POV0 4CYDA 3T2OA 4CEWA 4LKDA 4NAOA 1HN0A 1Y3TA 1C8M3 3QOPA 5FPXA 1UIKA 2NPIA 2X09A 5AVPA 5FZLA 4ATFA 1WD3A 1D4M2 2VVDA 3FC0A 5C4WA 5CFCB 1GP5A 3H3ZA 4LO5B 2WLPA 2ZHKA 4Y5TA 3K51A 3H7JA 3EMRA 4LLFA 5FYHA 5FREA 1Q3EA 3WF3A 2B7YA 1AL22 1RITA 2WNUC 5IK7A 2NMOA 3LAGA 5CKMA 2A6VA 4ITCA 3RQ0A 5A3OA 4V2VA 3SHRA 4A42A 5C33A 1LAJA 5C3QA 1ZREA 5JZGC 3JBG3 4P9WA 5CYYA 4GZ9A 5FO7B 1HB2A 5J36A 1XYPA 1RUC2 3VKNA 2CHHA 1HIXA 2Y6GA 2Y6JA 3HVDA 3K46A 2Q1ZB 4DEVA 1RUI2 4K1YA 3P5BA 1LGNA 2GSYA 5B4XA 2WSUA 1BHGA 1WA4A 2WO3A 3OGGA 4BK5A 2WZ8A 2E51A 3AZVA 5ABJC 5FQ0A 4F83A 5FZMA 1VB4A 2JB4A 1AYN1 3FLTA 1GZCA 2D6OX 1ENRA 3T1MA 2QBXA 1XU2A 3CMGA 2JDMA 1ST8A 1DYKA 1YCIA 4XDPA 4LKEA 5IVEA 3KHCA 3GZEA 2E32A 1AX1A 2W08A 1BXHA 4BISA 3DXUA 4XUOA 1T2XA 1OQEA 1N3PA 1X33A 1YUDA 2QQNA 3AYEA 4ISQA 4LHSA 4UXAA 4DB5A 5GM0A 3C7HA 3B94A 1O4TA 5CADA 4EQVA 5BPXA 4BA6A 3HNMA 1HQNA 4L8QA 4DXZA 2G9ZA 3TNQA 2BW8A 2BGCA 2LALA 3H8OA 3I54A 1PX4A 2QVSB 4EV0A 3CO2A 4LXLA 3S30A 4FQ4A 3SKJE 4JRLA 4CEYC 3QLQA 4COVA 1CZTA 1POV1 2JXAA 5FY1A 3ZXEA 3WUCA 5JOWA 2W1WA 1NY72 2FHRA 4LA2A 4KL1A 2OQ6A 4L92A 5DAXA 4XFCA 3USSA 5TSWA 3V0BB 5FMBA 2VVFA 4IV1A 1QOSA 4X8PA 3O1TA 1RUI3 1F5FA 1ULGA 1COV1 1ENXA 1TQ5A 2R32A 1E5RA 4D7SA 2ZX2A
chains in the Genus database with same CATH topology
3U78A 4URAA 2YBSA 4DIQA 3ZLIA 5E6HA 3PDQA 4GJYA 3NJYA 5FY9A 4UF0A 4D6QA 5F32A 2P5BA 2GP5A 2VD7A 5A7SA 4QX7A 4V2WA 3ZPOA 4CCLA 2XMLA 5FWEA 4IGPA 5FZOA 3LDBA 3PUAA 5IWFA 4GAZA 4CCNA 2Q8EA 5FJKA 4AI9A 5FZ4A 3AVRA 5FP4A 2XDVA 5FZGA 2YBPA 5FY7A 2Q8CA 5FZ6A 3N9MA 5FJHA 5FP3A 5FZHA 5FZ8A 5F3CA 4HONA 3PU3A 3KV5A 5FWJA 5FY4A 5FPBA 4Y33A 5LY2A 3K3OA 3K3NA 3KVBA 3KV9A 4DO0A 5FZLA 5FXXA 5FZ7A 2YPDA 2OQ7A 4BU2A 4XDOA 4QU1A 5F5CA 5F5IA 5FYVA 4QXHA 5FYCA 4D6SA 5FZIA 5A7PA 5FZAA 3U4SA 5F39A 5FYHA 5FP8A 4CCOA 3N9QA 2GP3A 5FXWA 4CCKA 4HOOA 3DXTA 4V2VA 2WWUA 3PURA 5A7NA 5IVCA 3KV6A 4TN7A 5F3EA 2OX0A 4QWNA 3K2OA 5K4LA 3N9OA 1VRBA 5FY5A 5A7QA 3KV4A 3PUSA 4LIVA 4GD4A 5FZFA 4EZ4A 4NUBA 5KR7A 2XXZA 5FXVA 5LY1A 4EZHA 5FP9A 4QXBA 5IVJA 5FZ1A 4C8DA 5FZEA 5FYMA 5CEHA 3PU8A 4IGQA 5A3WA 5F3IA 3N9PA 5FYUA 5FZ3A 5FY8A 5FPAA 3LD8A 5FZMA 5FY0A 4EYUA 2YU2A 2W2IA 3AL6A 5FZ0A 4CUGA 4CCMA 4XDPA 4BXFA 5IW0A 2OT7A 5FPVA 5IVEA 5FYSA 5FXZA 5FYIA 5ISLA 5A7OA 4BISA 5FBJA 3DXUA 5IVVA 4QX8A 4IGOA 5FZCA 5FYYA 5FZ9A 4QXCA 2YBKA 4LIUA 5A3PA 3AVSA 5A80A 2Q8DA 4UF0B 5A1FA 3N9NA 5IVBA 5FPLA 5FYZA 2XUEA 5FPUA 4CCJA 5F37A 5FZKA 4AAPA 2OS2A 4Y4RA 5FV3A 4ASKA 3UYJA 5A7WB 5IVFA 3PTRB 4LXLA 3PUQA 5A3NA 5FZDA 5F5AA 5FZBA 2PXJA 5FP7A 3AL5A 5F2SA 5LW9A 5FY1A 5FUNA 4Y3OA 4LITA 4E4HA 5F3GA 5A3TA 3N9LA 2WWJA 3RVHA 5LWBA 5FUPA 5F2WA 4GJZA 2OQ6A 5A1LA 5FYTA 5IVYA 3KVAA 3OPTA 5FZOB 3OPWA 4D6RA 4CSWA 5ANQA 2YU1A 5A7WA 5FYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U78 A;  4URA A;  2YBS A;  4DIQ A;  3ZLI A;  5E6H A;  3PDQ A;  4GJY A;  3NJY A;  5FY9 A;  4UF0 A;  4D6Q A;  5F32 A;  2P5B A;  2GP5 A;  2VD7 A;  5A7S A;  4QX7 A;  4V2W A;  3ZPO A;  4CCL A;  2XML A;  5FWE A;  4IGP A;  5FZO A;  3LDB A;  3PUA A;  5IWF A;  4GAZ A;  4CCN A;  2Q8E A;  5FJK A;  4AI9 A;  5FZ4 A;  3AVR A;  5FP4 A;  2XDV A;  5FZG A;  2YBP A;  5FY7 A;  2Q8C A;  5FZ6 A;  3N9M A;  5FJH A;  5FP3 A;  5FZH A;  5FZ8 A;  5F3C A;  4HON A;  3PU3 A;  3KV5 A;  5FWJ A;  5FY4 A;  5FPB A;  4Y33 A;  5LY2 A;  3K3O A;  3K3N A;  3KVB A;  3KV9 A;  4DO0 A;  5FZL A;  5FXX A;  5FZ7 A;  2YPD A;  2OQ7 A;  4BU2 A;  4XDO A;  4QU1 A;  5F5C A;  5F5I A;  5FYV A;  4QXH A;  5FYC A;  4D6S A;  5FZI A;  5A7P A;  5FZA A;  3U4S A;  5F39 A;  5FYH A;  5FP8 A;  4CCO A;  3N9Q A;  2GP3 A;  5FXW A;  4CCK A;  4HOO A;  3DXT A;  4V2V A;  2WWU A;  3PUR A;  5A7N A;  5IVC A;  3KV6 A;  4TN7 A;  5F3E A;  2OX0 A;  4QWN A;  3K2O A;  5K4L A;  3N9O A;  1VRB A;  5FY5 A;  5A7Q A;  3KV4 A;  3PUS A;  4LIV A;  4GD4 A;  5FZF A;  4EZ4 A;  4NUB A;  5KR7 A;  2XXZ A;  5FXV A;  5LY1 A;  4EZH A;  5FP9 A;  4QXB A;  5IVJ A;  5FZ1 A;  4C8D A;  5FZE A;  5FYM A;  5CEH A;  3PU8 A;  4IGQ A;  5A3W A;  5F3I A;  3N9P A;  5FYU A;  5FZ3 A;  5FY8 A;  5FPA A;  3LD8 A;  5FZM A;  5FY0 A;  4EYU A;  2YU2 A;  2W2I A;  3AL6 A;  5FZ0 A;  4CUG A;  4CCM A;  4XDP A;  4BXF A;  5IW0 A;  2OT7 A;  5FPV A;  5IVE A;  5FYS A;  5FXZ A;  5FYI A;  5ISL A;  5A7O A;  4BIS A;  5FBJ A;  3DXU A;  5IVV A;  4QX8 A;  4IGO A;  5FZC A;  5FYY A;  5FZ9 A;  4QXC A;  2YBK A;  4LIU A;  5A3P A;  3AVS A;  5A80 A;  2Q8D A;  4UF0 B;  5A1F A;  3N9N A;  5IVB A;  5FPL A;  5FYZ A;  2XUE A;  5FPU A;  4CCJ A;  5F37 A;  5FZK A;  4AAP A;  2OS2 A;  4Y4R A;  5FV3 A;  4ASK A;  3UYJ A;  5A7W B;  5IVF A;  3PTR B;  4LXL A;  3PUQ A;  5A3N A;  5FZD A;  5F5A A;  5FZB A;  2PXJ A;  5FP7 A;  3AL5 A;  5F2S A;  5LW9 A;  5FY1 A;  5FUN A;  4Y3O A;  4LIT A;  4E4H A;  5F3G A;  5A3T A;  3N9L A;  2WWJ A;  3RVH A;  5LWB A;  5FUP A;  5F2W A;  4GJZ A;  2OQ6 A;  5A1L A;  5FYT A;  5IVY A;  3KVA A;  3OPT A;  5FZO B;  3OPW A;  4D6R A;  4CSW A;  5ANQ A;  2YU1 A;  5A7W A;  5FYB A; 
#chains in the Genus database with same CATH topology
 1IS5 A;  2EAK A;  5BNP B;  1N3Q A;  3ZLI A;  1S0I A;  3S7E A;  3T0A A;  3FJS A;  1T6B X;  4YNI A;  2UWB A;  4FFG A;  4LOR A;  4UAP A;  1REF A;  1W6O A;  2RJ2 A;  1AL2 3;  5A7S A;  1AJK A;  2D93 A;  1FPN 2;  1WLD A;  3FWE A;  2JE8 A;  4CCL A;  2XML A;  3ZFE C;  5LZ6 A;  4QMA A;  4WVZ A;  4IXL A;  2X8K A;  1NCQ B;  3CBN A;  4H2A A;  2E26 A;  4O65 A;  5DPN A;  2ZGM A;  4Q4W 2;  1ND3 B;  1GIC A;  1O4Y A;  5FCC A;  3WNX A;  4J25 A;  3J26 N;  3ZKU A;  1MAC A;  1GOG A;  3V0A A;  3D8C A;  5H9S A;  3EO6 A;  2ZCW A;  5FOB B;  2BNN A;  2P17 A;  4AGV A;  1NCR B;  4KMQ A;  3SNM A;  3BU7 A;  3FE5 A;  5AFE A;  4FPJ A;  4DZG A;  2DUQ A;  3TEW A;  4CP9 A;  3RI9 A;  5DG2 A;  1GFF 2;  2R04 2;  4M4P A;  1VPH A;  4IND A;  1V6K A;  2RG4 A;  5A70 A;  4OHZ A;  3RS6 A;  3IKW A;  1W8T A;  2W3J A;  1VBB 3;  4CPB A;  3ZFG A;  3GBF A;  5IVC A;  1LED A;  4GH4 C;  1B35 A;  2QDN A;  1YXW A;  3BOD A;  4HN1 A;  1ND2 A;  2RS3 2;  3K2O A;  3ITQ A;  4QDR A;  5FMO S;  2C9A A;  3HJR A;  1V70 A;  2YGL A;  5KR7 A;  2WS9 1;  1U12 A;  1F2N A;  1ENQ A;  3RG0 A;  3JU9 A;  4YLZ A;  4XVH A;  4QGL A;  5FYM A;  1CPN A;  2W9X A;  2XVL A;  1OOP A;  4COZ A;  3VBS B;  2VZU A;  5FZ3 A;  5AC9 1;  1UO9 A;  2UY9 A;  4A44 A;  2PAE A;  4C0B A;  1YQ5 A;  3ST7 A;  1QF3 A;  4P5Y A;  1MR5 A;  2BWC A;  3S6P A;  3POJ A;  3WNP A;  2A71 A;  1S0C A;  2VVE A;  2RS1 3;  1NAE A;  3Q8B A;  1MQT A;  4ZZ8 A;  1R64 A;  1W05 A;  4TXW A;  5LB6 A;  1HB1 A;  2BPA 2;  3MIE A;  4LUK A;  1SFY A;  1BMV 1;  3OGV A;  2BDR A;  1GSL A;  1HDK A;  1Y9G A;  4FTB A;  1DQ0 A;  1ULE A;  1YNA A;  3ATG A;  2BFU S;  5FFO C;  1CES A;  2TNF A;  2D6N A;  2ZAC A;  1ZBE 3;  3POW A;  3WDV A;  3R4S A;  5JAX A;  3FBY A;  4QKD A;  2EAL A;  3WHT A;  4UF0 B;  3ZDV A;  1W8F A;  3TN9 3;  2VUA A;  5FYZ A;  1OOP B;  4EN7 B;  5HCF A;  4LJH A;  2ET1 A;  4IEQ A;  1YJK A;  4AQ6 A;  3E6C C;  4XDQ A;  3VBR C;  2RR1 2;  5ERL A;  2A6X A;  1MZF A;  1OVP A;  3ORJ A;  3QH7 A;  1KIT A;  3VGI A;  1S0D A;  3O1S A;  5F2S A;  1PX3 A;  3IDC B;  5DAQ A;  4E4H A;  2GAL A;  2VMD A;  1OA2 A;  5GAL A;  1W6M A;  3PLQ A;  4I30 A;  4JV4 A;  3M8L A;  2YYO A;  3JQW A;  5IVY A;  3KZ4 C;  1W2A X;  2A73 B;  4CSW A;  2BZD A;  2DTY A;  3J8F 3;  2PYT A;  1PIV 2;  1W6O B;  1W8Z A;  4YFZ A;  4LNV A;  4FPG A;  5A7W A;  3EYP A;  3MO4 A;  4NPM A;  1EV1 3;  3RRD A;  4LLO A;  3J7H A;  2R0H A;  3CQO A;  3FHA A;  3H1M A;  1G86 A;  2R06 3;  4KU7 A;  3K75 B;  3MLJ A;  3ILF A;  3OBT A;  4XAE A;  1JOJ A;  4YGB A;  5CIR A;  4IE0 A;  4YVW A;  5LAT A;  4GAZ A;  1C57 A;  2EID A;  4HT1 T;  4XXP A;  3POS A;  2HH9 A;  1OC1 A;  4AOC A;  4Q0U A;  1W2T A;  2P34 A;  4GIQ A;  2YPJ A;  3GNE A;  2CTV A;  3I59 B;  4Y24 A;  5F3C A;  4N53 A;  1RUF 3;  2WYF A;  2KXL A;  3KV5 A;  1ZBA 3;  1JXN A;  4LO7 A;  2YUE A;  3NQH A;  1IHM A;  4PI0 A;  1OD3 A;  2BJS A;  1BEV 2;  4CUA A;  2IVI B;  1GP6 A;  1MEC 2;  2GH8 A;  2IXI A;  5CFC C;  4BQ4 A;  4XTP A;  1LOD A;  3ZR6 A;  3VDC A;  1H8V A;  4YSF A;  3WF2 A;  1UYX A;  1NLQ A;  5D1I A;  1BK0 A;  4LBQ D;  2F4P A;  4EWE A;  1U5Z A;  2V73 A;  1FYU A;  5A7N A;  4AFC A;  2VQT A;  5LA2 A;  3TEX A;  3TN9 1;  5F3E A;  2OX0 A;  1H2N A;  2JE7 A;  4UW4 A;  2X53 S;  3N36 A;  3OTF A;  3RPQ A;  4XAA A;  1SLA A;  5E1R A;  5KHH A;  3HNB M;  4XIK A;  4XZU G;  1F5J A;  2D5F A;  3ZMN A;  1PIV 3;  2ZGQ A;  4QHB A;  1W6Q A;  3GXU A;  4XQ4 A;  1G6N A;  2HWD 2;  2MEV 2;  3GAL A;  1O8P A;  1Y9M A;  1ULC A;  5FZE A;  2XKP A;  5IT6 A;  2BWA A;  2OUJ A;  4IGQ A;  1JUI A;  3MDP A;  2NQY A;  3I3Q A;  3W9A A;  2FMY A;  3LKJ A;  3OJB A;  1LGC A;  3IPV B;  1OXC A;  1VBC 3;  2GMM A;  2E7A A;  1P8J A;  1W9W A;  3UT0 A;  4LT5 A;  3TWI A;  1V6J A;  1NQD A;  2JD4 A;  4GWN A;  2RR1 3;  4CCM A;  3ZDS A;  1W8N A;  4NHL A;  2JDP A;  5C3P A;  4AVA A;  4DY5 A;  4CUC A;  5EJ1 B;  2FDJ A;  1C1L A;  1EAH 1;  2EAA A;  1RUF 2;  2CAU A;  1I1E A;  5IVV A;  1FOD 1;  3PVO A;  2JB8 A;  4RGG A;  2D6K A;  4QX5 A;  3RSJ A;  3WF1 A;  2XKO A;  2A6Z A;  1CPM A;  3MPB A;  5IK5 A;  2R16 A;  5FQ0 B;  4AGG A;  1WUV A;  5J37 A;  1UYY A;  4Y1Z A;  2GAU A;  4RD7 A;  5LK5 A;  3SCF A;  3I2J A;  3FL7 A;  2XJR A;  4QKB A;  4EN8 B;  1SFP A;  3JD7 3;  4OI4 A;  1S0J A;  3GZA A;  1D4V B;  4XAB A;  3ZFF B;  2WN2 A;  5JXJ A;  1RB8 G;  3T2P A;  3WNK A;  3RZG A;  1QKQ A;  5DUV A;  5DZE A;  2RDQ A;  3ZXK A;  2PHX A;  3AL5 A;  4BQY A;  1F35 A;  5LWB A;  5BNO B;  2VC9 A;  4PIZ A;  2JKX A;  1HRI 2;  2W91 A;  5EJ3 A;  2YRO A;  4NVP A;  4AI2 A;  3PJQ A;  1AR9 1;  1G9B A;  3AP9 A;  1K5M C;  4GMP 1;  4HMZ A;  4AED A;  3I3E A;  4I0B A;  4LPL A;  1L7L A;  4QDS A;  3B00 A;  5HV4 A;  2WFF 3;  1H1A A;  2VTF A;  4LUL A;  2HWE 3;  2A1X A;  1VBE 1;  1WA6 X;  3QAC A;  1F4H A;  5DZG A;  4G4F A;  2B8M A;  2ILM A;  2VCM A;  2VG9 A;  4FFF A;  4OVE A;  5JIU A;  3BU0 A;  1N1V A;  1JH5 A;  3GGL A;  4NIG A;  3NRU A;  5I8T A;  1DZT A;  4ZHN A;  3BIE A;  5BUV A;  2VOX A;  1DG6 A;  3NKT A;  1QHD A;  4XC9 A;  4XIO A;  3VBH C;  4U36 A;  4YM3 A;  3OD0 A;  1URX A;  1V6I A;  4M0H A;  2QQW A;  5T55 A;  2A3Y A;  4IER A;  3NAP B;  2XQR A;  3LDB A;  5C71 A;  4AVS A;  5HPO A;  5KWR A;  3A21 A;  2RS1 1;  1QJU 1;  4KI5 M;  1VAV A;  3AJY A;  4NMI A;  3QH6 A;  1QDC A;  1LTE A;  1Z7S 2;  2PMW B;  4XPV A;  2ZX3 A;  3ZVX A;  1BLZ A;  3OBZ A;  2JDZ A;  4DIN B;  4I02 A;  2ZZJ A;  3A22 A;  4GAL A;  3RFR A;  3ZYH A;  4QX1 A;  1ASJ 1;  4MGS A;  2VTX A;  4CZS A;  2EXJ A;  3KVB A;  1G9D A;  2FDH A;  2V72 A;  2MHF A;  3SC7 X;  4LBQ A;  5BNN A;  3Q8C A;  4QU1 A;  3AYA A;  3DV8 A;  1UKR A;  2D3R A;  4Y1V A;  1AZD A;  1EAH 3;  1S1A A;  5BNO C;  3POI A;  4FPE A;  3ES4 A;  4RS5 C;  3J4U H;  4DXS A;  4AVV A;  3N9Q A;  1G8W A;  2QFE A;  2VGD A;  3NW4 A;  4I0A A;  1TZO A;  1XYO A;  4XOG A;  4AHX A;  3R4D B;  2Y0I A;  4YVS B;  3GM8 A;  2QZ3 A;  4GH4 B;  3PUR A;  3S0M A;  1D4M 1;  1PNF A;  2ADE A;  4QDQ A;  1DZR A;  1W0O A;  2VAU A;  3JXS A;  5B2G B;  1OBN A;  3C7O A;  3IN9 A;  1JU4 A;  2TEP A;  1OD5 A;  3KGZ A;  3KGL A;  2ZEX A;  2WWS A;  3B3Q E;  3IPV A;  1YJL A;  3WSO A;  1HRV 2;  3POB A;  4QXB A;  4XW3 A;  4CP9 B;  1ULD A;  3WOG A;  4N43 A;  4NHX A;  5L9B A;  1I5Z A;  4RHV 2;  2Q8O A;  1VMH A;  4OQ9 A;  5BNP A;  2QQU A;  3AKP A;  3FMG A;  4N7I A;  1Q8V A;  4UI9 L;  5GZF A;  5FO8 B;  4HAN A;  4QKN A;  4BB3 A;  4BQW A;  5LA9 A;  5IFP A;  3ELN A;  1K5J A;  4PI2 A;  4OHW A;  2DVD A;  2VCA A;  2XJT A;  1RUI 1;  1TNR A;  3V0A B;  2WFF 1;  1AX0 A;  2JIJ A;  3LB9 A;  3N7L A;  4JC1 A;  2OA2 A;  2TBV A;  4A7Z A;  3TBD A;  1SLB A;  3N3H A;  4ZU7 A;  3Q8A A;  5FXZ A;  4PDW A;  3THC A;  2RS5 1;  3CKH A;  2G4I A;  4XFB A;  2WC2 A;  4YWA A;  4M3C F;  5A7O A;  1UZV A;  4QX8 A;  1KEX A;  4Y20 A;  1IPS A;  2VBP A;  2WZR 1;  2IVJ A;  2ZXQ A;  1Q5O A;  4ASL A;  1AL2 1;  2VW1 A;  4RR3 B;  3VN4 A;  1POQ A;  3EB7 A;  1CGP A;  3TEY A;  4IE7 A;  1Q56 A;  1C28 A;  3ZSJ A;  3VKL A;  1NUK A;  2IXK A;  3J8F 1;  3O0X A;  2VM9 A;  3UYJ A;  4RSU A;  3IDE A;  3RZZ A;  4MHR A;  3VBR B;  1ACC A;  3PUQ A;  2VZP A;  2HWB 2;  5LCW L;  4XF9 A;  3RGB A;  4LIT A;  2YHJ A;  4GWM A;  3DEM A;  2RE9 A;  2VMC A;  1UN1 A;  3WP5 A;  1YEW A;  4MGQ A;  2DCK A;  4QAW A;  4S2H A;  1LJ7 A;  3TOJ A;  5KBF A;  1H1M A;  2WT0 A;  5ACA 3;  2DBI A;  1UOF A;  1AVB A;  4KQ7 A;  3AXD A;  1GYK A;  1HRV 3;  4OFG A;  1XNT A;  5JXI A;  2WZR 2;  2PHW A;  2J1T A;  1UIJ A;  3ILN A;  1O6U A;  4B8E A;  1SFN A;  4QU2 A;  3AKR A;  3CHX A;  1NYW A;  1FT9 A;  3JCI A;  1LU1 A;  3LPG A;  3OPZ A;  2J1R A;  2BYV E;  2VW0 A;  1KQR A;  1TVG A;  2HWC 3;  1ND3 C;  4HN0 A;  4QX7 A;  5E89 A;  4BHP A;  2K2S A;  5C8W A;  3MGU A;  1VLN A;  3PNA A;  3WCS A;  3D6E A;  3WY6 A;  1JYW A;  4NWV A;  3O1U A;  1V9U 2;  3B69 A;  3TRS B;  3ZYF A;  4BYY A;  2OPW A;  1FI2 A;  1NCR C;  1VBA 3;  3LIG A;  1GOF A;  3N35 A;  4RQP B;  3ALQ A;  4UBG A;  4YPJ A;  3EBR A;  5FZ6 A;  3VZO A;  1XNB A;  4OI2 A;  3WQ7 A;  5F6L B;  2JDN A;  4Z1V A;  3WR0 A;  3PVB B;  5FPB A;  2ZKL A;  1OUX A;  3CL1 A;  5K8S A;  3K4D A;  1APN A;  3CZJ A;  1ZRR A;  2WKK A;  4Q8L A;  3K77 A;  3AZY A;  3MW2 A;  1JU3 A;  4FPC A;  4Q4Y 2;  3UGG A;  4XDO A;  4NO4 A;  4P9G A;  2CU5 A;  3AMN A;  1XXN A;  1WCU A;  4BU2 A;  3T09 A;  3T4V A;  5JPN B;  3VZL A;  1UXZ A;  1CQ9 A;  2VZO A;  3ZN6 A;  3U1X A;  5E88 A;  2QQK A;  3SKV A;  1AXY A;  3RZM A;  3ETQ A;  5FLI A;  2DVA A;  1QWR A;  2W47 A;  4NPL A;  3AFG A;  1GNZ A;  4NWW A;  3DXT A;  1Q8Q A;  1XSR A;  5FXW A;  3RZK A;  1RUG 1;  4HPK B;  1WME A;  2OKX A;  5JLV A;  1G7Y A;  4QWN A;  3PIJ A;  4JX0 A;  3GF6 A;  2R49 A;  3HOB A;  5ABJ A;  1LUL A;  4P5H A;  1DFQ A;  4XFG A;  1UPI A;  4FBF A;  4X6Q B;  1YLL A;  3VDB A;  1LES A;  2ZS6 B;  2Y6L A;  5FP9 A;  3MHZ A;  5FZ1 A;  3RMX A;  5DDJ 1;  1CAW B;  5I0R A;  2WS9 3;  3WNN A;  1NXD 1;  3WIN E;  5A3L A;  3N9P A;  3WG3 A;  1SCS A;  3H3U A;  5D2A A;  4RL7 A;  5JSP A;  2DCT A;  5LEJ A;  5T5J A;  3OUJ A;  4XAC A;  4WVM B;  4EYU A;  2DU0 A;  3JB4 C;  3K4Z A;  4ISR A;  3ZIX A;  3ME2 A;  2WAB A;  2IFR A;  2OT7 A;  3CDZ B;  4OUL A;  1YI9 A;  1H2M A;  5GZC A;  3VUO A;  4YGD A;  3RYP A;  1CIW A;  5C8C C;  4H7M A;  4EN0 A;  2PAM A;  5FBJ A;  5BNO A;  5F5Q A;  2Y34 A;  4TSV A;  1Y9Q A;  1DQ4 A;  4R8H A;  2P4E A;  4FXG B;  5FZC A;  3RDI A;  2IXH A;  5CFD C;  1ONA A;  2ARE A;  3NJZ A;  2N7G A;  1HJF A;  4OUE A;  2C9K A;  3DPR B;  5D8A B;  3KD4 A;  1UYP A;  1NY7 1;  2AR6 A;  2EA7 A;  4XZP A;  3ZOI A;  3O1M A;  1YFX A;  4H7L A;  1HRI 1;  1TNF A;  5AVA A;  4BME A;  2QQL A;  4LKS A;  3MW4 A;  4FTE A;  1IS6 A;  3JD7 2;  1D2Q A;  4DFS A;  4MVT A;  5LW9 A;  1IKP A;  1C8N A;  5A3T A;  3ZXA C;  5HXM A;  1RHI 3;  2GH2 A;  4B29 A;  1LOA A;  3VD9 A;  1AR7 3;  1H4G A;  4M00 A;  3KQR A;  4XF4 A;  3CLP A;  3SEE A;  3MV1 1;  1JZ3 A;  5EXO A;  1PM4 A;  1MS9 A;  1ASJ 3;  1R08 2;  2UWA A;  3GZU C;  5H9R A;  5DMY A;  3PUI A;  1QJX 3;  3I3D A;  2DTW A;  2LS6 A;  4AVT A;  1A8M A;  1GZT A;  2DCJ A;  1CX1 A;  4DIQ A;  2VZR A;  1GKB A;  5F6K A;  3PDQ A;  3SLI A;  1GMM A;  3UES A;  1SLC A;  3UET A;  4TLG A;  5KC5 A;  5F32 A;  2WLQ A;  3ZXD A;  1JOB A;  3B9C A;  1W0P A;  3ZM8 A;  3BPZ A;  3Q8E A;  3POY A;  4XJZ A;  1HLC A;  4YM1 A;  1OUR A;  2ZMK A;  2BVB A;  3VD3 A;  5JSO A;  3ILR A;  2QZ2 A;  2Q8E A;  2HWD 3;  4XUN A;  5FZ4 A;  2CNA A;  3ON7 A;  2BVV A;  4KGG A;  4X6R B;  1J84 A;  2DVG A;  2DUR A;  5T5O A;  1NZC A;  1NCQ A;  1COV 3;  1WW4 A;  1SQ4 A;  3WNO A;  4Q4X 2;  1AYN 3;  5JSR A;  2AAC A;  2OXB A;  3N9M A;  3WW4 A;  4WV8 A;  5CZK A;  3VD4 A;  1A34 A;  1A8D A;  2JD9 A;  3H50 A;  2VE1 A;  4IE5 A;  4KH9 A;  3CIH A;  3K3N A;  1O5L A;  2JG8 B;  4HSL A;  1UZ0 A;  2JG9 A;  3DYM A;  4Q4X 3;  5FMC A;  3IM0 A;  1UMH A;  3C3V A;  3QCW A;  5FXX A;  2YPD A;  1PZ7 A;  5C3O A;  4PBP A;  1POV 3;  1QMJ A;  1C5H A;  4AFA A;  2ZAH A;  2ZBJ A;  4WM8 C;  1UCX A;  3SEP A;  2ZEY A;  4N53 B;  4OHY A;  3KS7 A;  3VBF B;  5C9A B;  1JBC A;  4XMA A;  1PO2 2;  4YVS C;  5JVV A;  3EJK A;  4WM7 A;  1R1A 1;  3M3Q A;  1GOH A;  2GMP A;  1DGW A;  2JDY A;  4AVB A;  2X5I A;  4QQO A;  2CY6 A;  5E16 A;  2Y0O A;  1YQC A;  4QD2 A;  3WDX A;  4AFB A;  1RHI 1;  1ZRF A;  4IEW A;  1H1I A;  4N9I A;  4UFM A;  3ROU A;  1UYZ A;  1W9Y A;  3K4A A;  4HKL A;  1PZ8 A;  4KGQ A;  4AHW A;  5FYU A;  4IEX A;  4Q0S A;  2HLE A;  2R06 2;  3B9I A;  4W8J A;  2QE3 A;  3ZKY A;  4MOA A;  2EIC A;  3ACI A;  1ZBA 1;  3MF6 A;  3C7F A;  5FY0 A;  4XHX A;  4GWI A;  3WDY A;  4XEZ A;  1EPZ A;  3OEA A;  4BJ0 A;  3ZXF A;  1SBD A;  2NZ9 A;  4HG6 B;  4L2N A;  2XQX A;  2ES3 A;  1JYC A;  1JUH A;  1W6M B;  1G9C A;  1R1A 2;  4BWO A;  4NHY A;  2UY8 A;  4BLJ A;  4QQL A;  3WG4 A;  1DYO A;  2VZT A;  1GV9 A;  3VBH B;  5JXH A;  1WGP A;  4D8M A;  5DG1 A;  3VZK A;  5GZE A;  4ZZ5 A;  2VNR A;  5A1F A;  3N9N A;  5IVB A;  5BNN B;  3SQO A;  3M3C A;  3PME A;  5BY5 A;  1Y43 B;  2AEY A;  1H9P A;  4XJA A;  4MGZ E;  2B46 X;  4I3G A;  5B4N A;  2J22 A;  4EJR A;  3TNP B;  4NRM A;  5GZD A;  3T0B A;  3RNS A;  2VQ0 A;  2BBA A;  2WSV A;  2XWB B;  2JEC A;  3ASI A;  4PHZ A;  4Q4V 3;  2Z2S B;  4Y3O A;  1W2N A;  3LEK A;  3ZFG C;  1R09 2;  1SCR A;  3H1Y A;  4GJZ A;  5DAV A;  1D0G A;  2VUC A;  3N7M A;  2J1U A;  1CJD A;  3T3Y A;  4BPZ A;  2D97 A;  4Q4X 1;  4QXK A;  1W8H A;  1GWL A;  1OSG A;  5I8Y A;  1CWP A;  3I2G A;  2F17 A;  4IW3 A;  3BN6 A;  1RUG 3;  5DAP A;  1YQ8 A;  2R7E B;  3SCH A;  5DQ0 A;  4A7K A;  3O5S A;  3OYW B;  2OW4 A;  2HYK A;  4DPN A;  1VAK A;  2W46 A;  3L2Y A;  5DDJ 2;  2WZE A;  3WQ1 A;  3A0K A;  1JZ5 A;  2CDP A;  3T2T A;  3VLB B;  5FY9 A;  3USU A;  4W4Z A;  2P5B A;  4PLO A;  1HQL A;  1PNG A;  3FLR A;  4OMD A;  1ND2 B;  2WNV B;  3MEP A;  2FDI A;  2Q30 A;  4CU7 A;  4YZ2 A;  1D0H A;  3OY8 B;  4JKK A;  4RQP C;  1EV1 1;  1J1L A;  1PVC 2;  1VMJ A;  3DL3 A;  2YBP A;  3RJR A;  4F7Z A;  1ZBE 2;  3LA2 A;  1GU3 A;  3NV1 A;  2BNM A;  2K0G A;  2RJK A;  4QQH A;  2QQO A;  1HN1 A;  1LOB A;  1WBL A;  2ZX0 A;  4ZU5 A;  2OYZ A;  1XOY A;  5C70 A;  4CP1 A;  1QIQ A;  1LOE A;  1QJU 3;  5H9Q A;  4N90 A;  1XU1 A;  4Y33 A;  3WNM A;  4GKY A;  2RMU 2;  3AZX A;  3AMM A;  4DO0 A;  3S57 A;  2WDB A;  4G3Y C;  1BBT 2;  2P3K A;  4QGN A;  4RGK A;  1UQX A;  4AFM A;  4Q4W 3;  4IEO A;  4IDZ A;  4G9S B;  2RS5 3;  4QXH A;  3VBO A;  4AI3 A;  1H4H A;  1IG3 A;  1WMF A;  3NL1 A;  5FZA A;  5T3N A;  1VBE 2;  3AFK A;  4Q4Y 3;  4COY A;  2D98 A;  3IAP A;  4LHK A;  1BVV A;  5AFB A;  1ND3 A;  1UU4 A;  1W8W A;  4CP0 A;  3WNL A;  2W1S A;  1CON A;  4LQR A;  5JZG B;  2F4L A;  1DHK B;  2FQP A;  1BEV 3;  1VAL A;  2DFB A;  3LFM A;  2GC3 A;  4GB3 1;  4RFT 0;  4LO8 A;  5IVJ A;  1NCQ C;  4C8D A;  4TTG A;  1OLM E;  2G1M A;  5HBA A;  5IAX A;  5ACA 2;  1HB3 A;  3NV4 A;  5A3W A;  4CDQ B;  2XOM A;  1RIN A;  1RL3 A;  5C3S A;  4I2O A;  5JI7 A;  4NHM A;  3ZSM A;  2BU9 A;  1X8M A;  2EXH A;  4FP2 A;  1HKD A;  1FPN 1;  1ODM A;  4HLT A;  4XIL A;  3MBW A;  1YIP A;  4O9G A;  1X7N A;  2EF6 A;  5FYI A;  5ISL A;  3I7D A;  2WZR 3;  1PHM A;  3ETP A;  1F31 A;  4LBK A;  1DGR A;  2JX9 A;  4AQ2 A;  5HI0 A;  4LO6 B;  5JDB A;  5FYY A;  1GAN A;  2XBO 1;  2YY1 A;  1GZ9 A;  1MZ6 A;  4JQT A;  3WW1 A;  1U5I A;  3POE A;  3VZM A;  5JCT A;  3AMH A;  3DKQ A;  3S7I A;  5IFT A;  4HL0 A;  4IEP A;  2JG9 B;  1YC6 1;  4FOW A;  4JRA A;  3BGA A;  5FZK A;  3HR9 A;  2OS2 A;  1CX4 A;  4MUV A;  4YZ1 A;  1X9T A;  4XUQ A;  4RR3 A;  2VMF A;  5FP7 A;  1OOP C;  4PT6 A;  4QB2 A;  3A23 A;  4NAM A;  3BTX A;  4AEK A;  2YMZ A;  2D44 A;  1LCL A;  2RDR A;  4K3U A;  4E2Q A;  4CU6 A;  4UFK A;  4E2S A;  4LMF A;  1O3S A;  3GCX A;  4IV3 A;  3OPT A;  2G19 A;  2AGS A;  2VXJ A;  1RUD 2;  2DV9 A;  4WZC A;  3OGR A;  1S0E A;  5K0U C;  1MQT C;  1LEM A;  2BQP A;  3D5O A;  1QQP 1;  1CAX B;  4FOV A;  4ZS2 A;  5EWS A;  2Q5T A;  1IS3 A;  2VNO A;  1N1Y A;  3JD7 1;  2DWR A;  5CB7 A;  3NKG A;  4D3W A;  2DVF A;  3ZYI B;  4S2D A;  2OVU A;  2YBS A;  1BBT 1;  3RI8 A;  5ACA 1;  4C90 A;  1PK6 C;  1XNA A;  3ZSE A;  1UWW A;  4AGR A;  2ERF A;  1YO8 A;  3DCQ A;  1WBF A;  4ATE A;  1WMD A;  2JDU A;  1JYN A;  1LOG A;  1CR7 A;  1Z7S 1;  4I09 A;  4L0P A;  3NO8 A;  1WCD J;  4RHV 3;  1MS5 A;  4K8F A;  1GNY A;  4JTO A;  2RM2 2;  4Q1P A;  4MX3 A;  1HQW A;  2WQ8 A;  3IMN A;  2CDO A;  1NA1 B;  2Z69 A;  3CU7 A;  4EN9 B;  1NKG A;  2ZPX A;  1C4R A;  2ZOE B;  1DU3 D;  4B1L A;  5C7G A;  5J98 B;  4BIF A;  5F9T A;  4ZY9 A;  3USU B;  2JG8 C;  3RYR A;  1G9A A;  5J7M A;  3FZ3 A;  1AR6 3;  4JDN A;  4Y5S A;  1OQD A;  2ZAA A;  1LOF C;  4Z2W A;  5GLV A;  4UBH A;  5FYC A;  3POF A;  2NMN A;  3ZO0 B;  3VDD B;  1UOJ A;  2WR9 A;  1ENS A;  2LM3 A;  2ZGL A;  1C3H A;  3H9A A;  4ZU4 A;  3T1L A;  1HXS 1;  4YW1 A;  1AUY A;  1YWK A;  2WJS A;  2RMU 3;  2D43 A;  2XVG A;  2WZP P;  4CCK A;  5BV6 A;  4MGT A;  1OVS A;  4N43 C;  2Y6F A;  4F8A A;  5JR2 A;  1MQT B;  1QDO A;  3NAP A;  4JKL A;  1AR6 2;  3LDR A;  1VRB A;  5A7Q A;  3KCX A;  3SH5 A;  1MVQ A;  2MPF A;  2XG3 A;  3PVN A;  2Y26 A;  1TMF 3;  1UY4 A;  2WFF 2;  1CZV A;  2ETE A;  2BUK A;  1WW6 A;  4XFH A;  2WO2 A;  3PU8 A;  4CU9 A;  1V6O A;  3N4M A;  1SLL A;  2W94 A;  3NST A;  5HXV A;  4NIA A;  3SMH A;  4MAD A;  2XL9 A;  5EQU A;  5FY8 A;  2RM2 3;  3LD8 A;  2DYC A;  3ACL A;  1CJP A;  2VH9 A;  1OI6 A;  3BOP A;  1OF4 A;  1H2L A;  4Y1X A;  1BCX A;  1QJX 1;  2XB6 C;  5L7O B;  2PLV 3;  3M1H A;  3WW3 A;  1B35 B;  3FFZ A;  4L11 A;  4JGZ A;  4BQ1 A;  5KHK A;  4PF1 A;  5T5L A;  1JHN A;  3VBO C;  2XHN A;  3C7E A;  1JTZ X;  2GDF A;  3SH3 A;  1DQ2 A;  4IEU A;  1KDK A;  1KS5 A;  3W5M A;  2NM1 A;  2WQZ C;  3E1F 1;  5A33 A;  3R6S A;  4LIU A;  3AVS A;  1HRI 3;  4EN6 B;  1W6P B;  2PHU A;  4JGY A;  2Q4S A;  3BTY A;  3POG A;  4CCJ A;  5J1X A;  1EP0 A;  1JZ8 A;  3VKF C;  2QUO A;  1CAX A;  3HQU A;  2AZ5 A;  3IDA A;  2QJV A;  3B93 A;  4IV3 B;  1YHF A;  1VBC 2;  3FUO A;  4ONU A;  3TYJ A;  1QXR A;  1NX9 A;  1OLM A;  4WM7 B;  4BK4 A;  2DCZ A;  2E63 A;  4QX2 A;  4XMI A;  2O0O A;  1S55 A;  2VUJ A;  2VME A;  2WII B;  4QPG C;  3WP6 A;  5EYY A;  4XBL A;  4MGI E;  5FKC A;  4DMI A;  2HWB 1;  1S2K A;  1RIR A;  2RMU 1;  1VRH 3;  3IMM A;  3L9J T;  4URT A;  4XJ9 A;  4ET7 A;  3W5N A;  1K5M B;  1SAC A;  4B4Q A;  2KR2 A;  1X8E A;  3JB8 A;  4LHN A;  2BGP A;  3T0D A;  1FXZ A;  1H6Y A;  2HWF 1;  5APA A;  4Q5O A;  2GN7 A;  1MVE A;  1XQN A;  4FI9 A;  1SDW A;  4XQD A;  1ZZ6 A;  3W21 A;  4JTN A;  1AXZ A;  1W90 A;  2QQP A;  3IAQ A;  2VZQ A;  4Y4Y A;  1HJG A;  2JWP A;  3X29 B;  3BI3 A;  5HCA A;  4PDW C;  5J48 A;  1KRI A;  4M3C A;  4OI1 A;  4QHO A;  3BTZ A;  2LUW A;  5DZF A;  2X05 A;  1UX7 A;  3ZXL A;  4K6B A;  4OZO A;  1Y7B A;  4RYD A;  3ZFF C;  2GU9 A;  5FMO L;  3OUH A;  3VB9 A;  4ZON A;  4GWJ A;  4R9C A;  4CXX A;  4NE9 A;  3ZN5 A;  4YZ5 A;  2JIC A;  3GJA A;  1ZRD A;  1X50 A;  4WVV A;  4BCU A;  1AR7 1;  3WXP A;  1WWY A;  1MS1 A;  2WA3 A;  1F4A A;  3JBG 2;  2XJP A;  5LBB A;  3OCP A;  3M3O A;  4L99 A;  1RXG A;  3MUZ 1;  4CA9 A;  3H8X A;  2ENR A;  3NNL A;  2ORX A;  3I8T A;  5F39 A;  4ES8 A;  3I59 A;  2VU9 A;  5KHJ A;  2R07 3;  4NPR A;  3BPS A;  4QPG B;  2JEN A;  2PEL A;  3OF1 A;  1SBE A;  5LEK A;  3RZL A;  1REE A;  4Z2A A;  4CDW A;  3NMB A;  5M0T A;  4DXR A;  4PJY A;  1C8M 2;  1A6C A;  1ZZ9 A;  1J1T A;  3I2K A;  5SV5 A;  2ARA A;  5CG9 A;  1YYN A;  5JOY A;  1LHU A;  2CSG A;  3G6J B;  2QQI A;  4YG0 A;  3ZYB A;  4EWD A;  1I9R A;  1EYB A;  4LBQ B;  1OLQ A;  5CEH A;  4HXC A;  4UW3 A;  3KSC A;  4KG8 A;  4CDX A;  2W1Q A;  4FPF A;  5FPA A;  3LEM A;  4OYU A;  4JDM A;  5A33 B;  1MS8 A;  3KF3 A;  3AL6 A;  1DGL A;  4TYS A;  4UWD A;  4LUM A;  3E97 A;  5K7P A;  1HXS 2;  1EV1 2;  5FPZ A;  1U5Y A;  1YFW A;  4H14 A;  4XFI A;  1ZBE 1;  3A0N A;  3MF9 A;  4R4X A;  3FLP A;  2R06 1;  3WQB A;  3TN9 2;  2HWC 1;  4YGE A;  4A45 A;  4QHZ A;  3O1O A;  4IGO A;  5KC6 A;  2D3P A;  4EE2 A;  3U14 A;  4RS5 B;  4BQX A;  4QXC A;  2W0X A;  5JMC A;  1K42 A;  1PVC 3;  5A80 A;  1O5U A;  4TLF A;  5A1A A;  1ZVF A;  4AZZ A;  4BH9 A;  2XLA A;  1UL9 A;  1CAW A;  3B01 A;  2FCV A;  3OBA A;  2JDA A;  5I0S A;  5IHR A;  1QH7 A;  1O8S A;  1R09 3;  2WAA A;  3LSD A;  4DUX A;  3LGR A;  4O7X A;  1ZZ7 A;  2YFU A;  1OPM A;  4LBN A;  2F6B A;  4Q4V 2;  5F5A A;  2EIG A;  4XF1 A;  4AED B;  1S2E A;  1UY2 A;  2Q0A A;  1X36 A;  4CP2 A;  1BKZ A;  4Q0Q A;  4XF0 A;  5FUP A;  2OZJ A;  5LBC A;  2E53 A;  4BQ5 A;  1ALY A;  1VMF A;  3R0R A;  4YRD A;  2FZ1 A;  1RJ7 A;  5EV7 A;  5IYY A;  4NN0 A;  4YFW A;  2X10 A;  2OII A;  3KMH A;  5CAZ A;  4WVM A;  2P6H A;  5FDB A;  5JXG A;  4AK3 A;  2J1A A;  1K12 A;  1RYY A;  3O0V A;  2VZV A;  2Z5W A;  4KWU A;  1LOF A;  3BB6 A;  5FYB A;  4AVC A;  3KCC A;  4YM0 A;  2PLV 2;  3LOI A;  5FBZ A;  2WNV C;  1PVC 1;  4R9B A;  4GJY A;  3WVJ A;  1X82 A;  4QT6 A;  2E33 A;  1RUD 1;  2QQM A;  2ZJC A;  4R52 A;  2VY0 A;  2C24 A;  5K9Y A;  2E7T A;  4RR3 C;  1BJQ A;  3IIA A;  5FZO A;  1GQH A;  1IOA A;  1RUE 1;  2BRT A;  1NG0 A;  2VNV A;  3LSE A;  3NAP C;  4OZX A;  3SCG A;  3E5Q A;  4MG2 A;  5F1R A;  3BKZ A;  3N7K A;  1RVF 1;  3MPP G;  3W20 A;  3P1I A;  4ASM B;  5FZH A;  4ZXK A;  4WM8 A;  2YG0 A;  3J7M A;  1WMX A;  1VBD 3;  2DBN A;  2NLR A;  2HJI A;  1CD3 G;  2VXR A;  5FLJ A;  1XND A;  3UKV A;  1STM A;  1J83 A;  3FHI B;  1N3O A;  2FCT A;  3KQ4 B;  3NNM A;  5EP9 A;  4IEZ A;  2X5I C;  4JGZ C;  2DU1 A;  2UYA A;  1KD7 A;  3ZYG A;  1BMV 2;  1E5S A;  2ZGO A;  4FAG A;  5AC9 3;  1NLR A;  3LFI A;  3WW2 A;  2D3S A;  4PF5 A;  5KXD A;  1A78 A;  5H9P A;  5A6Y A;  2WN3 A;  5FY5 A;  2YDE A;  3DN7 A;  4R9D A;  3PUS A;  4LIV A;  1HV1 A;  4N8M A;  1CAU B;  3GHM A;  1ZBA 2;  2NN8 A;  5FXV A;  1MS3 A;  4FCA A;  4EZH A;  2DUP A;  4BDV B;  2R30 A;  1V9U 3;  5IK8 A;  3OSD A;  1U5X A;  2A5Z A;  2Z4F A;  4LOT A;  2JG8 A;  1PMH X;  1V6N A;  1FPN 3;  1W6Q B;  2KD7 A;  2ZX4 A;  3Q9O A;  1YFY A;  1US3 A;  4QM8 A;  3CNA A;  3OGJ A;  4IV1 B;  5GLT A;  2YC4 A;  2ZGT A;  1VBC 1;  4BZ4 A;  3HAG A;  1QNW A;  5BYN A;  5FYS A;  5T50 A;  4M3C B;  1J59 A;  2QKD A;  1I3H A;  1PK6 B;  1FV3 A;  2AH2 A;  1FAY A;  3A4U A;  5FUI A;  5LA1 A;  4FPO B;  1B09 A;  3DUI A;  3RJ2 X;  2HWF 3;  4XFF A;  2D6P A;  2V5Y A;  4AR2 A;  4K20 A;  3LEG A;  4CDW C;  1ASJ 2;  1R08 3;  1GWK A;  1ZM1 A;  2PLV 1;  1WCK A;  2E6V A;  5FMD A;  2DDU A;  1J3R A;  2HWB 3;  1O7F A;  5GJ6 A;  3O7O A;  4P9J A;  1ZZ8 A;  4YW7 A;  5F37 A;  5CFD B;  1F8V A;  1UX6 A;  4FSJ A;  1NA1 C;  1CAU A;  1DZQ A;  2ARC A;  4GMP 3;  2PA7 A;  3MFA A;  2B4K A;  5FZD A;  5FZB A;  5L9R A;  5CBL A;  4XE9 A;  1ZNP A;  1OH4 A;  4MV2 A;  1JZ7 A;  1PO1 1;  3H8U A;  4XXA A;  4DNY A;  3BVC A;  2P37 A;  2WWJ A;  3KM5 A;  3J7N A;  4GH4 A;  3OB8 A;  4Z07 A;  3GZT B;  5T52 A;  3NV3 A;  2VTX J;  1OMI A;  2QCS B;  3IWZ A;  3JUU A;  2BOJ A;  4D6R A;  1DCS A;  4OI0 A;  2WRA A;  3KT4 A;  2Z79 A;  2A7A A;  2VUD A;  2VZ3 A;  2YU1 A;  1AR7 2;  5G05 L;  1IPK A;  4D94 A;  3OG2 A;  4QM9 A;  4URA A;  2BOI A;  1GBG A;  2R6Q A;  3D3A A;  1SDD B;  2XPJ A;  4N43 B;  4AXO A;  5E8A A;  1EUU A;  3OEB A;  4UF0 A;  1WW7 A;  3VV1 A;  4AAX A;  1DYP A;  2W95 A;  2IXJ A;  4HVO A;  2ZHN A;  3T4H B;  1DBN A;  3AKT A;  3RWK X;  4NII A;  3WD5 A;  1NQJ A;  4B7E A;  2FDK A;  1SPP B;  2EIB A;  3AX4 A;  3JQX A;  4JQR A;  4AI9 A;  2PHT A;  2YGM A;  3LIH A;  4A3Z A;  1YQ6 A;  1MPX A;  1FAT A;  2V4V A;  3RZJ A;  1LB2 A;  1Y4W A;  2P3J A;  4IES A;  4A6O A;  3AZZ A;  1AF9 A;  5A3U A;  3UJO A;  4BQ3 A;  2Q1M A;  5FP3 A;  4LBJ A;  3UL2 A;  2VOV A;  1LHN A;  1W99 A;  4HON A;  4P9L A;  3I3M A;  2XJV A;  3AXE A;  2HWD 1;  1OA4 A;  4CDU A;  3VDD C;  1UU6 A;  1TME 1;  2RS3 3;  4N9H A;  1CN1 A;  3HBK A;  4FXK B;  3VBU C;  2OQ7 A;  1LHW A;  4B7K A;  4ES9 A;  1ULF A;  2BV4 A;  1LHO A;  2Y38 A;  2R0F A;  2QDR A;  4FT8 A;  4I01 A;  4Z82 A;  5GLU A;  4CEW B;  3ACH A;  3D4K A;  3M2M A;  2ZML A;  1RUH 2;  1D4M 3;  3D82 A;  3AC0 A;  3IZO A;  1BBT 3;  1KXG A;  3VHR A;  1PGL 1;  4HET A;  2R04 3;  4MGY E;  2VZS A;  1TMF 2;  2RDN A;  4XUR A;  4H55 A;  4OMC A;  3PHM A;  1I5P A;  1LRH A;  3KV6 A;  1OQ1 A;  2VOT A;  1QJF A;  4DEQ A;  3VL8 A;  3LA3 A;  1AHS A;  1Z7S 3;  2ZX1 A;  5K4L A;  4IL7 A;  1H9W A;  4QX3 A;  2XLG A;  3KV4 A;  2J1V A;  3IB3 A;  4GD4 A;  3WCR A;  2QTW B;  1W04 A;  3ZN6 B;  4W6W A;  4DRR A;  2GC0 A;  1JOP A;  3PJY A;  3AYC A;  1NE6 A;  1AXK A;  3DKW A;  1OLR A;  1IGO A;  1K3I A;  1QOT A;  1WD4 A;  3LCP A;  2JE9 A;  2H6C A;  5L7O C;  2AC1 A;  4CDU B;  5I91 A;  1H8T B;  3HD8 B;  4LBO A;  4DQA A;  3ABZ A;  4MGK E;  5CU1 A;  3VBH A;  4YVW C;  2HEV F;  2ATF A;  2CYF A;  2W2I A;  4FP3 A;  1XC6 A;  3ZYJ B;  1RUE 2;  3J9S A;  1WZX A;  3M70 A;  4RQP A;  5JIA A;  1PVX A;  2D6L X;  1HB4 A;  3J7L A;  2RDS A;  3H1W A;  1UZZ A;  1RED A;  3LDK A;  4YW4 A;  1DQ1 A;  1O91 A;  4CCE A;  2YBK A;  5A3P A;  3LEI A;  3AM2 A;  1BEV 1;  4FPY A;  4LKF A;  3U11 A;  1Q43 A;  2VW2 A;  5HCH A;  3I97 A;  3III A;  3WT3 A;  3CJX A;  1DIW A;  1N1T A;  1VBA 1;  2FMD A;  3MIB A;  4A2U A;  3KF5 A;  5HCB A;  4CDX C;  4XJW A;  4AED C;  1D2S A;  4YW6 A;  4GA9 A;  4C1X A;  5L9V A;  4Q1R A;  2WNE A;  1KFX L;  2MNG A;  4YW2 A;  4Q4W 1;  4A41 A;  1AR8 1;  3DF0 A;  4UW5 A;  4GB3 3;  2DUO A;  4S2G A;  3GDB A;  1VBD 1;  3GBW A;  5EHD A;  4UFH A;  5ANQ A;  3VKM A;  4COW A;  4IUG A;  3WUD A;  2A70 A;  1MZ5 A;  1DLC A;  4D7Y A;  1RVF 3;  2WNU B;  3HT2 A;  1HRV 1;  2P3I A;  2PFW A;  1JS9 A;  1L3J A;  4CVU A;  3HQX A;  1AYM 3;  1K5M A;  2W87 A;  1W28 A;  2WNU A;  3AP7 A;  5AC9 2;  1W3V A;  1PMI A;  2A6W A;  2ZTN A;  4RFR B;  4W50 A;  4BQ2 A;  2IWG B;  2XR4 A;  5FRA A;  1AR9 3;  4Y1Y A;  3UGF A;  2VD7 A;  3HNY M;  1T6G C;  5FKB A;  3ZPO A;  4FOQ A;  4XCA A;  3T08 A;  3HQR A;  3O14 A;  5FJK A;  3MIF A;  2J42 A;  4KBB A;  3O0W A;  3VL9 A;  2HWF 2;  5FZG A;  5GZG A;  3EXU A;  2ZAB A;  1RJ8 A;  4PIY A;  1TG7 A;  4V1P A;  1E5H A;  2XLF A;  3VZN A;  1RUN A;  4FPK A;  4TZD A;  1RUJ 2;  1VBD 2;  4AEM A;  2B9U A;  3PU3 A;  4BLI A;  5IJR A;  2ZEZ A;  5LY2 A;  3U10 A;  5JUV A;  4H3W A;  2VPV A;  5J3U A;  4RHV 1;  3KV9 A;  3AZW A;  1UZY A;  4B1M A;  2PQS A;  4B4R A;  4UFI A;  1PZ9 A;  1QJY 1;  2EXI A;  1UD1 A;  1QH6 A;  1SEF A;  4FO9 A;  4I3P A;  3JZV A;  3F95 A;  5F5I A;  4D6S A;  5A7P A;  4CXW A;  1UAI A;  2AUY A;  3KWV A;  4WM8 B;  1XSQ A;  1MS0 A;  3BCW A;  4XUT A;  1VJ2 A;  2VOK A;  5DUX A;  1MEC 3;  4R9A A;  2RS5 2;  2AYH A;  2XL7 A;  2WWU A;  3ZXJ A;  2GNT A;  1QQP 3;  2LRP A;  3I3B A;  4DUW A;  1FNY A;  2W52 A;  3BAL A;  1US2 A;  5KHG A;  4SBV A;  3G7D A;  4BOW A;  2FD8 A;  3N9O A;  2O8Q A;  5DDJ 3;  3NNJ A;  3UGH A;  4AI1 A;  4NUB A;  1H8T A;  1MS4 A;  2VZ1 A;  3AP5 A;  4YG3 A;  3T2Q A;  4YM2 A;  5A6Z A;  3MUY 1;  3IDB B;  5LY1 A;  1SHW B;  2GME A;  1UZW A;  3ENR A;  1O59 A;  2GND A;  5HV0 A;  2ZGS A;  1RTV A;  5I93 A;  3VHO A;  1ZZC A;  1SLI A;  4ZKT B;  1RMU 1;  2Y6H A;  1JYT A;  1SBF A;  3OGS A;  2OZ6 A;  5LK7 B;  1H2K A;  2B39 A;  2XWJ B;  2Z42 A;  1NOV A;  1AX2 A;  4MET A;  5I8S A;  4BXF A;  5FPV A;  1AL0 G;  4HZF A;  4Y26 A;  3S5Q A;  1W06 A;  3ZYP A;  1AR8 2;  5BNP C;  1V9U 1;  2RV9 A;  2WFP A;  3KCY A;  4GMP 0;  4JGY C;  4PCR A;  5G04 L;  4LEJ A;  1QJU 2;  1W3X A;  2PHD A;  1HX6 A;  4AI0 A;  2VUL A;  4ORF A;  2G9G A;  4XBN A;  4CU8 A;  5FAX A;  4FTS A;  4YGC A;  3AMQ A;  2JJ6 A;  2RR1 1;  2JEM A;  2VMG A;  4XJU A;  2YC2 A;  3U37 A;  1RHI 2;  5JR7 B;  1R09 1;  3BTA A;  5BNN C;  2IXL A;  1YIF A;  1OKQ A;  1H0B A;  1YI7 A;  1QJY 2;  3UKT A;  1HXS 3;  5BNQ A;  4RS5 A;  4Q8K A;  2IXC A;  2ZMN A;  2D40 A;  3O1P A;  1RUH 1;  4AW7 A;  2PXJ A;  2VBD A;  5IUQ A;  5C5T A;  1LU2 A;  4XF3 A;  5DAW A;  3K48 A;  4QPI B;  4IET A;  2B9V A;  3F2Z A;  4OCT A;  1JHJ A;  3ZFG B;  4AG4 A;  4CXY A;  3I49 A;  5A6Q A;  1M06 G;  1SPP A;  1IQA A;  1RUG 2;  3UV9 A;  1AYM 1;  1PGW 1;  3UJQ A;  2OUH A;  2P6C A;  1RUJ 1;  4A3X A;  1NE4 A;  4LK6 A;  3VDD A;  1FV2 A;  3CZU A;  1OFN A;  2VR4 A;  5C6C A;  1MEC 1;  4K8R B;  2RM2 1;  1EUT A;  4WVW A;  1ODN A;  2XGX A;  3C7G A;  1QJZ A;  1WKY A;  4P00 B;  1OHF A;  5IAV A;  3VD5 A;  3NJY A;  3ZXG A;  4A4A A;  1NCR A;  3P3P A;  5KXE A;  1C5I A;  1QGL A;  4J6G A;  1UOG A;  4C91 A;  1TME 3;  2RS3 1;  4NIH A;  3H42 B;  1X9P A;  3MLK A;  5FR3 A;  2O8O A;  4Q2F A;  5LRS A;  1NA1 A;  1DQ5 A;  3AKS A;  2IZW A;  1C1F A;  1OH3 A;  2I07 B;  1PO2 1;  1UY1 A;  1GUI A;  2XHK A;  1U0A A;  1S2B A;  5L19 A;  5I0D A;  3TB0 A;  2XDV A;  5LA0 A;  1H30 A;  2E31 A;  3E5U A;  1DQ6 A;  2R04 1;  2MEV 3;  5FZ8 A;  3VDA A;  1RMU 3;  3Q8F A;  3ECQ A;  3LOB A;  5CFD A;  1RUJ 3;  2VMI A;  4KBZ A;  1LKN A;  4PLN A;  5JI9 A;  3THP A;  1S0F A;  1XPW A;  1Z78 A;  4DY3 A;  1J3P A;  5F5C A;  5FYV A;  3R05 A;  4CEW C;  3W59 A;  1BZW A;  1E57 A;  4BMB A;  1DGW X;  4NJ4 A;  1OF3 A;  2HBT A;  2VO5 A;  4R4Z A;  4UFL A;  3V64 A;  2JDK A;  3M4F A;  1BYH A;  1PK6 A;  2ORZ A;  2YXS A;  4L97 A;  1UPS A;  2WO1 A;  2ZKN A;  4LK7 A;  4CDW B;  2VMH A;  3VD7 A;  4QPG A;  4K7J A;  1DDL A;  3MW3 A;  4XTM A;  5JPM B;  4FOY A;  4M0N A;  3BUC A;  2YV8 A;  5ANN A;  4XQW A;  3SIT A;  1VRH 2;  5FZF A;  3VBS C;  3VBR A;  1QJX 2;  1UKG A;  2WT1 A;  4ARX A;  1I6X A;  3WP3 A;  1BK1 A;  3CEW A;  4JHZ A;  4XCB A;  5DAB A;  3ZYR A;  1WLT A;  3NNF A;  3W58 A;  4KWL A;  2R07 2;  5EYX A;  4WBB A;  4CDU C;  1CAV A;  4CDQ C;  2HWC 2;  3L2H A;  4QB6 A;  3WV6 A;  4AQT A;  4DOU A;  2YU2 A;  2C5D A;  2RJL A;  5FZ0 A;  5L73 A;  4AL9 A;  4CUG A;  2XVK A;  4CTE A;  5FO9 B;  2XUM A;  1MZE A;  2ARX A;  4JVA A;  1IS4 A;  1OA3 A;  3AB0 A;  2C26 A;  3LWC A;  1QNY A;  2E7Q A;  2XJQ A;  2BER A;  1AYN 2;  1IQD C;  3I2H A;  2VJX A;  5FIX A;  3LQC A;  3THD A;  3VBO B;  3ZN4 A;  1KJL A;  2BTV C;  2HEY F;  1DP0 A;  2W1U A;  3NVC A;  3OBR A;  4AHY A;  3LE0 A;  5C8C A;  4IEV A;  1VBB 1;  2ZGP A;  3TAY A;  2JG9 C;  3ACF A;  4AYU A;  2AEN A;  4AF9 A;  4Y4R A;  2R07 1;  4OLL A;  3WDU A;  4ASK A;  4OQ8 A;  1AR9 2;  1CVN A;  2V09 A;  4UOJ A;  2D6M A;  4CCC A;  4KWJ A;  4QB1 A;  4F3J A;  2VEC A;  2Y33 A;  3BOW A;  3VHP A;  2ZHM A;  4N53 C;  3N9L A;  1FOD 3;  4AWD A;  1UOB A;  4ZS3 A;  1ZRI A;  4YVS A;  5A1L A;  3WQ0 A;  2IC1 A;  4Y5Z 0;  4RGA A;  5CNA A;  3KVA A;  3CJI C;  2WNV A;  2ZHL A;  4CEY A;  2CWS A;  3T30 A;  2WA4 A;  4Y22 B;  2IFW A;  1F15 A;  4MO3 M;  5LBF A;  4YAR A;  5J96 B;  2WBK A;  1QY4 A;  2YC0 A;  4MXW B;  2JIG A;  3ES1 A;  1YFU A;  4MZU A;  2Y64 A;  4LA3 A;  1AR8 3;  4D6Q A;  4PQ9 A;  3V56 A;  3OYW A;  3B7M A;  1GP4 A;  2PAK A;  4Q29 A;  1XNK A;  3HBZ A;  4HFS A;  1JZ2 A;  1IG0 A;  1PIV 1;  2GZW A;  2CL2 A;  2VNG A;  1KDM A;  1V0A A;  1NZI A;  2KM2 A;  4QQ2 A;  3MIC A;  1XE0 A;  3EQE A;  4COU A;  4M3C E;  4KNC A;  3WZ1 A;  1D7P M;  1W8U A;  3ZR5 A;  4JDO A;  2CGO A;  1ZYB A;  2HWE 1;  1JMU B;  2Q8C A;  1DF0 A;  1H8T C;  4MLO A;  3CF6 E;  4O61 A;  4HSJ A;  5CKN A;  3FX3 A;  3AK0 A;  3DPR C;  4QGM A;  5D8A C;  1QXJ A;  2C1F A;  1FMD 1;  4FVV A;  4KG0 A;  3HEI A;  3K3O A;  4J1W A;  3QBQ A;  1XBF A;  1JYI A;  2NP0 A;  4CE8 A;  2W92 A;  4WM7 C;  1VR3 A;  1TMF 1;  4HVR A;  1VBA 2;  3OOX A;  5SV8 A;  4B4P A;  5C3R A;  4RA0 A;  1EY2 A;  2HYX A;  2ZA9 A;  4GXL A;  5L36 A;  3WDT A;  1O3Q A;  2JDH A;  4LHL A;  3U4S A;  4I0W B;  3HN1 A;  1UW8 A;  2XH6 A;  5KHI A;  2FDG A;  4KU8 A;  2WS9 2;  1UY0 A;  4MSV A;  1LHV A;  3U75 A;  1W6N A;  2BFU L;  4IE6 A;  1EPW A;  1Z0H A;  2EVX A;  2C0Z A;  2VBB A;  3D0J A;  2FZ2 A;  3MIG A;  2PN5 A;  2LTN A;  3LA7 A;  1KFU L;  2PQQ A;  4OUM A;  4E4S A;  4EZ4 A;  4AHZ A;  3PTY A;  4A6S A;  4NR1 A;  4NID A;  2UWC A;  3ZFF A;  4DXT A;  1UY3 A;  1RUD 3;  1VBB 2;  1QXP A;  3WDW A;  2WNO A;  1FMD 3;  2PHF A;  1RUH 3;  2J1S A;  1Q8O A;  4ZPI A;  2C6S A;  1VP6 A;  1LEC A;  4LR4 A;  4A7Y A;  2R1D A;  4HK9 A;  4UFJ A;  1S0G A;  4YZ4 A;  1PM7 A;  1PMJ X;  4BIO A;  5IW0 A;  3FHQ A;  4JKM A;  1JZ4 A;  5C5U A;  4XUP A;  2HWE 2;  1AYM 2;  2H0V A;  1PGW 2;  2B5H A;  5A3M A;  1GNH A;  3DGT A;  2CWM A;  4K21 A;  3SIS A;  3VBF A;  1L7Q A;  5C9A A;  5CKQ A;  4Q4V 1;  4IEY A;  1GZW A;  4P08 A;  4CDX B;  5FPL A;  3DEC A;  2J1E A;  2A3X A;  4CRQ A;  1E5I A;  1DLL A;  4AAP A;  4ERO A;  1ZRC A;  2BP6 A;  3FBM A;  4J1X A;  3I2O A;  1H6X A;  3WF4 A;  4W6X A;  2QQV A;  5IVF A;  3FFQ A;  1W2O A;  4O9E A;  3AJZ A;  4K1Z A;  1W2U A;  5A32 B;  3P3N A;  3GJB A;  3R4U A;  4QPI C;  5DN2 A;  5F3G A;  5FUN A;  4NHK A;  3RVH A;  5FOJ B;  5I0T A;  1AJO A;  4E9K A;  2PHR A;  3FN9 A;  2A75 A;  4LTA A;  4PLM A;  4NOT A;  3E6B A;  1O4Z A;  4M01 A;  1PO1 2;  3WG2 A;  2XBO 2;  1JW6 A;  4QPW A;  1K45 A;  3WEZ A;  4QQP A;  3BIW E;  3I2F A;  1GLH A;  1WW5 A;  3U78 A;  5C4W C;  1UMI A;  1VB2 A;  5CVR A;  3THT A;  3E5X A;  4U2A A;  3RWN A;  3WG1 A;  5T5P A;  1JYX A;  5GKA C;  5EIY B;  3UK9 A;  1GZW B;  3M3I A;  2KA3 A;  3PUH A;  5EPA A;  2B45 X;  3VZJ A;  2JKB A;  1HV0 A;  2ET7 A;  4LO4 B;  3HWJ A;  3H7Y A;  3APB A;  2RVA A;  1SG3 A;  2V4A A;  3ZMO A;  4DUV A;  5JZG A;  1BQP A;  3WP4 A;  3BYW A;  2A6Y A;  2GC1 A;  3AVR A;  4PDW B;  2RHP A;  5FP4 A;  4DS0 A;  1R1Z A;  1V00 A;  4FPL A;  3O1V A;  4Q0P A;  2WUH A;  2GN3 A;  1ULP A;  4MH0 E;  5EJZ B;  5EZW A;  3SXW A;  4E27 A;  3VBU A;  3MZH A;  4XYX A;  3HT1 A;  3MFC A;  3GYD A;  3AP4 A;  1R08 1;  3I2D A;  4Q27 A;  4UW6 A;  4HKO A;  2H6B A;  5FJH A;  2J7M A;  3URF A;  4E4Z A;  3UNP A;  1XJA A;  2UYB A;  1A3K A;  3ZSL A;  3NV2 A;  1FNZ A;  1M4W A;  3IBM A;  3ZSK A;  4C1W A;  4CDQ A;  2P1B A;  5GLW A;  2Y6K A;  1XYN A;  1BVP 1;  4D0Q A;  4JGY B;  5FZ7 A;  3RZH A;  2B42 B;  2DCY A;  4K40 A;  2I45 A;  4PIX A;  4AFD A;  2BEO A;  3DYP A;  2D5H A;  4AI8 A;  4C0H A;  1CZS A;  2K9Z A;  4CCO A;  4UYB A;  4YG6 A;  1TME 2;  2GP3 A;  5IK4 A;  3H8R A;  2ZGK A;  4HOO A;  2VQA A;  4P02 B;  3OY8 A;  2WL1 A;  2R1B A;  2O1Q A;  3H3L A;  4JGZ B;  4TN7 A;  1RUC 3;  5GLZ A;  5L7O A;  4BXS V;  4AEJ A;  1LR5 A;  1W0N A;  1HW5 A;  4WZF A;  3WHU A;  1UNB A;  4PQQ A;  3HMY A;  5D21 A;  4HVQ A;  3U4X A;  3ZFE B;  5K0U B;  2W5F A;  3O1R A;  1TEI A;  4P9I A;  3D0S A;  2Q1F A;  1DGR N;  1UMZ A;  1V6L A;  3NJX A;  1O3T A;  1XRU A;  1VBE 3;  3DPR A;  5D8A A;  5FLH A;  3NJV A;  3C2U A;  2BNO A;  3MIH A;  1EAH 2;  4GQ7 A;  1Q8P A;  1N1S A;  2I74 A;  1RC6 A;  1VRH 1;  3RMY A;  4B3N A;  3B5L B;  2ZEW A;  1W39 A;  5LAS A;  1VE0 A;  2ADD A;  5JMO A;  3CJI A;  1JZ6 A;  3MID A;  3QD6 A;  4L9B A;  2DF7 A;  3S5A A;  5CG8 A;  4OHV A;  1IKQ A;  2K46 A;  5KXB A;  4XJ8 A;  4IQP A;  3KB5 A;  3B02 A;  4HKW A;  1OUS A;  1C8M 1;  1XNC A;  2EIE A;  2SLI A;  4QKF A;  5FZ9 A;  1VAM A;  1RUC 1;  3AYD A;  3VBS A;  3KLS A;  1SMV A;  2XUE A;  2GC2 A;  3U07 A;  1R1A 3;  1SZB A;  2ZGR A;  4MXW A;  3E6D A;  5LBE A;  3ZFE A;  1FOD 2;  5A3N A;  4Y22 A;  1S4C A;  2XJU A;  3GBG A;  4CEY B;  1W9T A;  4M4R A;  2LRO A;  2WAO A;  1NT0 A;  4FFH A;  3PL0 A;  4P14 A;  4UT5 A;  1W9F A;  1ULO A;  5A6X A;  1JN2 P;  1LGB A;  2LW8 A;  2L9L A;  1LEN A;  1PGS A;  3CJI B;  3MI8 A;  4GKX A;  3GCW A;  4JAA A;  4NRP A;  5FYT A;  3NWK A;  3OPW A;  1QJE A;  1Q8S A;  2Y60 A;  4LBM A;  4P9Y A;  5J09 A;  2SBA A;  4ZXE A;  3V65 A;  4W6Y A;  4EWA A;  2ZGU A;  3KT1 A;  4CCD A;  4N7U A;  4HBN A;  2RS1 2;  1ZX5 A;  1WCQ A;  2W39 A;  2CAV A;  3KT7 A;  3MYX A;  2O14 A;  3MV0 1;  1ZA4 A;  5K0U A;  2ZZQ A;  1GWM A;  4FFI A;  2A3W A;  4KWK A;  1PO2 3;  3PVE A;  2EXK A;  2GP5 A;  4LBL A;  4D69 A;  3U0Z A;  4V2W A;  2OPK A;  4OHX A;  1ZA7 A;  2QQJ A;  5JOZ A;  2PTM A;  4JHT A;  4QX0 A;  1YRZ A;  1N47 A;  2AEZ A;  2UUR A;  1JOD A;  4FQZ A;  3VHN A;  4LE3 A;  3A7Q A;  2MEV 1;  2G9F A;  4X8N A;  4Q0V A;  2HEW F;  4BE3 A;  5F7U A;  4NRO A;  4CUB A;  3INA A;  1FX5 A;  2YB7 A;  4E8C A;  3OD4 A;  2C4X A;  2X29 A;  3EHK A;  1XE8 A;  2CV6 A;  2WT2 A;  5FWJ A;  5FY4 A;  1QQP 2;  1GR3 A;  1OKO A;  4E4D X;  1CAV B;  2TUN A;  4E8D A;  2VCC A;  3N7J A;  5CIS A;  2DFC A;  3P6B A;  1NXM A;  3UKN A;  5C8C B;  4Z92 B;  2V5D A;  4W65 A;  3LZZ A;  4CPB D;  4NRQ A;  1UU5 A;  1ZZB A;  2P2K A;  5FZI A;  1G9F A;  3HIF A;  3I4I A;  4Y20 B;  5FTT C;  5FP8 A;  2X5I B;  1XB9 A;  4BM8 A;  1J58 A;  3VBU B;  3V0B A;  2D7F A;  1CIY A;  1YQ2 A;  3M3E A;  2HBU A;  3PIG A;  4DRV A;  4JCK A;  5DXD A;  4XFA A;  4SLI A;  4IV3 C;  3O12 A;  4Q4Y 1;  2I2S A;  4D7T A;  1JI6 A;  1RXF A;  1L7R A;  2UU8 A;  3H0O A;  1RVF 2;  3VKO A;  1W9S A;  1GQP A;  1RMU 2;  2XXZ A;  1KS4 A;  1OFS A;  3LF7 A;  1V6M A;  2VL4 A;  5T54 A;  3C8X A;  5KXC A;  3WX5 A;  5FK8 A;  1WCS A;  5LRR A;  4P9X A;  2FBE A;  3ACG A;  5F3I A;  4YW5 A;  4LOS A;  5CA6 A;  2YFZ A;  1TE1 B;  1RUF 1;  5FK7 A;  4AE2 A;  3NNG A;  1WLW A;  3KHB A;  4RN5 A;  4MHU A;  4AQS A;  4E2G A;  1QEX A;  1S0B A;  1UXX X;  3ZPY A;  3SH4 A;  4IV1 C;  3OUI A;  2DVB A;  1RUO A;  3HPN A;  2XJS A;  2P3Y A;  1OPO A;  4TWT A;  3AMP A;  3GHN A;  4Q26 A;  2XBO 3;  1PO1 3;  1J3Q A;  2WQ4 A;  1NLS A;  3I2I A;  4YVW B;  3LPF A;  5A32 A;  1IPJ A;  3FUQ A;  3IT8 A;  1AR6 1;  5DUU A;  4FAH A;  2CGP A;  1COV 2;  5JOX A;  4GB3 2;  4K9S A;  2Q8D A;  3HN3 A;  2ID4 A;  2WO7 A;  4XBQ A;  4XHB A;  2WIN B;  4Z8B A;  2GNM A;  2NYY A;  3ZX7 A;  3JBG 1;  5DUW A;  1W03 A;  5FPU A;  4IE4 A;  1QOO A;  1W6P A;  3DYO A;  1W8O A;  2FCU A;  4YW3 A;  5FV3 A;  5A7W B;  5IAT A;  3PTR B;  2GNB A;  2CGN A;  1LOC A;  4GUL A;  1SLT A;  4PBO A;  3AKQ A;  4XET A;  2HKX A;  4FPH A;  2VQU A;  2PHL A;  1W6N B;  2QNK A;  1QJY 3;  5F2W A;  1PGL 2;  4ARY A;  4QPY A;  4S2F A;  1GQG A;  5FZO B;  3J8F 2;  2ZGN A;  1KGY A;  5I0U A;  1QU0 A;  1VIW B;  3WF0 A;  3PMS A;  3VBF C;  5C9A C;  1LNS A;  1RGS A;  5EFU A;  5C4W B;  2VCB A;  5CFC A;  2E9Q A;  1UF2 C;  5BXX A;  1RUE 3;  1JYV A;  3MLL A;  2ARB A;  3M7A A;  1XE7 A;  4LE4 A;  4OUS A;  5E6H A;  3WLU A;  1OT5 A;  5JWP A;  2W68 A;  2VOW A;  2H0B A;  1F9K A;  4HK8 A;  4YZ3 A;  3AP6 A;  3TEZ A;  2BBV A;  1B35 C;  5ABJ B;  1O3R A;  2BGO A;  1ND2 C;  1FMD 2;  5FWE A;  4IGP A;  3PUA A;  4Y1U A;  4JZR A;  5F8P A;  5IWF A;  4HPK A;  3ZIW A;  4CCN A;  4YYO A;  2XON A;  1KJR A;  1WLC A;  4MYE A;  4QPI A;  3RYK A;  1IZ3 A;  2IUW A;  2Y8K A;  4MXV A;  5FY7 A;  2YZ4 A;  2FDF A;  2WYS A;  1POV 0;  4CYD A;  3T2O A;  4CEW A;  4LKD A;  4NAO A;  1HN0 A;  1Y3T A;  1C8M 3;  3QOP A;  5FPX A;  1UIK A;  2NPI A;  2X09 A;  5AVP A;  5FZL A;  4ATF A;  1WD3 A;  1D4M 2;  2VVD A;  3FC0 A;  5C4W A;  5CFC B;  1GP5 A;  3H3Z A;  4LO5 B;  2WLP A;  2ZHK A;  4Y5T A;  3K51 A;  3H7J A;  3EMR A;  4LLF A;  5FYH A;  5FRE A;  1Q3E A;  3WF3 A;  2B7Y A;  1AL2 2;  1RIT A;  2WNU C;  5IK7 A;  2NMO A;  3LAG A;  5CKM A;  2A6V A;  4ITC A;  3RQ0 A;  5A3O A;  4V2V A;  3SHR A;  4A42 A;  5C33 A;  1LAJ A;  5C3Q A;  1ZRE A;  5JZG C;  3JBG 3;  4P9W A;  5CYY A;  4GZ9 A;  5FO7 B;  1HB2 A;  5J36 A;  1XYP A;  1RUC 2;  3VKN A;  2CHH A;  1HIX A;  2Y6G A;  2Y6J A;  3HVD A;  3K46 A;  2Q1Z B;  4DEV A;  1RUI 2;  4K1Y A;  3P5B A;  1LGN A;  2GSY A;  5B4X A;  2WSU A;  1BHG A;  1WA4 A;  2WO3 A;  3OGG A;  4BK5 A;  2WZ8 A;  2E51 A;  3AZV A;  5ABJ C;  5FQ0 A;  4F83 A;  5FZM A;  1VB4 A;  2JB4 A;  1AYN 1;  3FLT A;  1GZC A;  2D6O X;  1ENR A;  3T1M A;  2QBX A;  1XU2 A;  3CMG A;  2JDM A;  1ST8 A;  1DYK A;  1YCI A;  4XDP A;  4LKE A;  5IVE A;  3KHC A;  3GZE A;  2E32 A;  1AX1 A;  2W08 A;  1BXH A;  4BIS A;  3DXU A;  4XUO A;  1T2X A;  1OQE A;  1N3P A;  1X33 A;  1YUD A;  2QQN A;  3AYE A;  4ISQ A;  4LHS A;  4UXA A;  4DB5 A;  5GM0 A;  3C7H A;  3B94 A;  1O4T A;  5CAD A;  4EQV A;  5BPX A;  4BA6 A;  3HNM A;  1HQN A;  4L8Q A;  4DXZ A;  2G9Z A;  3TNQ A;  2BW8 A;  2BGC A;  2LAL A;  3H8O A;  3I54 A;  1PX4 A;  2QVS B;  4EV0 A;  3CO2 A;  4LXL A;  3S30 A;  4FQ4 A;  3SKJ E;  4JRL A;  4CEY C;  3QLQ A;  4COV A;  1CZT A;  1POV 1;  2JXA A;  5FY1 A;  3ZXE A;  3WUC A;  5JOW A;  2W1W A;  1NY7 2;  2FHR A;  4LA2 A;  4KL1 A;  2OQ6 A;  4L92 A;  5DAX A;  4XFC A;  3USS A;  5TSW A;  3V0B B;  5FMB A;  2VVF A;  4IV1 A;  1QOS A;  4X8P A;  3O1T A;  1RUI 3;  1F5F A;  1ULG A;  1COV 1;  1ENX A;  1TQ5 A;  2R32 A;  1E5R A;  4D7S A;  2ZX2 A; 
#chains in the Genus database with same CATH homology
 3U78 A;  4URA A;  2YBS A;  4DIQ A;  3ZLI A;  5E6H A;  3PDQ A;  4GJY A;  3NJY A;  5FY9 A;  4UF0 A;  4D6Q A;  5F32 A;  2P5B A;  2GP5 A;  2VD7 A;  5A7S A;  4QX7 A;  4V2W A;  3ZPO A;  4CCL A;  2XML A;  5FWE A;  4IGP A;  5FZO A;  3LDB A;  3PUA A;  5IWF A;  4GAZ A;  4CCN A;  2Q8E A;  5FJK A;  4AI9 A;  5FZ4 A;  3AVR A;  5FP4 A;  2XDV A;  5FZG A;  2YBP A;  5FY7 A;  2Q8C A;  5FZ6 A;  3N9M A;  5FJH A;  5FP3 A;  5FZH A;  5FZ8 A;  5F3C A;  4HON A;  3PU3 A;  3KV5 A;  5FWJ A;  5FY4 A;  5FPB A;  4Y33 A;  5LY2 A;  3K3O A;  3K3N A;  3KVB A;  3KV9 A;  4DO0 A;  5FZL A;  5FXX A;  5FZ7 A;  2YPD A;  2OQ7 A;  4BU2 A;  4XDO A;  4QU1 A;  5F5C A;  5F5I A;  5FYV A;  4QXH A;  5FYC A;  4D6S A;  5FZI A;  5A7P A;  5FZA A;  3U4S A;  5F39 A;  5FYH A;  5FP8 A;  4CCO A;  3N9Q A;  2GP3 A;  5FXW A;  4CCK A;  4HOO A;  3DXT A;  4V2V A;  2WWU A;  3PUR A;  5A7N A;  5IVC A;  3KV6 A;  4TN7 A;  5F3E A;  2OX0 A;  4QWN A;  3K2O A;  5K4L A;  3N9O A;  1VRB A;  5FY5 A;  5A7Q A;  3KV4 A;  3PUS A;  4LIV A;  4GD4 A;  5FZF A;  4EZ4 A;  4NUB A;  5KR7 A;  2XXZ A;  5FXV A;  5LY1 A;  4EZH A;  5FP9 A;  4QXB A;  5IVJ A;  5FZ1 A;  4C8D A;  5FZE A;  5FYM A;  5CEH A;  3PU8 A;  4IGQ A;  5A3W A;  5F3I A;  3N9P A;  5FYU A;  5FZ3 A;  5FY8 A;  5FPA A;  3LD8 A;  5FZM A;  5FY0 A;  4EYU A;  2YU2 A;  2W2I A;  3AL6 A;  5FZ0 A;  4CUG A;  4CCM A;  4XDP A;  4BXF A;  5IW0 A;  2OT7 A;  5FPV A;  5IVE A;  5FYS A;  5FXZ A;  5FYI A;  5ISL A;  5A7O A;  4BIS A;  5FBJ A;  3DXU A;  5IVV A;  4QX8 A;  4IGO A;  5FZC A;  5FYY A;  5FZ9 A;  4QXC A;  2YBK A;  4LIU A;  5A3P A;  3AVS A;  5A80 A;  2Q8D A;  4UF0 B;  5A1F A;  3N9N A;  5IVB A;  5FPL A;  5FYZ A;  2XUE A;  5FPU A;  4CCJ A;  5F37 A;  5FZK A;  4AAP A;  2OS2 A;  4Y4R A;  5FV3 A;  4ASK A;  3UYJ A;  5A7W B;  5IVF A;  3PTR B;  4LXL A;  3PUQ A;  5A3N A;  5FZD A;  5F5A A;  5FZB A;  2PXJ A;  5FP7 A;  3AL5 A;  5F2S A;  5LW9 A;  5FY1 A;  5FUN A;  4Y3O A;  4LIT A;  4E4H A;  5F3G A;  5A3T A;  3N9L A;  2WWJ A;  3RVH A;  5LWB A;  5FUP A;  5F2W A;  4GJZ A;  2OQ6 A;  5A1L A;  5FYT A;  5IVY A;  3KVA A;  3OPT A;  5FZO B;  3OPW A;  4D6R A;  4CSW A;  5ANQ A;  2YU1 A;  5A7W A;  5FYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...