3U4SA

Histone lysine demethylase jmjd2a in complex with t11c peptide substrate crosslinked to n-oxalyl-d-cysteine
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
345
structure length
345
Chain Sequence
LNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysine-specific demethylase 4A
publication title Linking of 2-Oxoglutarate and Substrate Binding Sites Enables Potent and Highly Selective Inhibition of JmjC Histone Demethylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase substrate
total genus 106
structure length 345
sequence length 345
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2011-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3u4sA01
2Q8DA 5FXVA 4UF0B 3PUSA 5F39A 3AVSA 5FUPA 2GP3A 4QX7A 5CEHA 5FPLA 5FPVA 3K3NA 5FWJA 4GJYA 5FPUA 5IVJA 5FZFA 5E6HA 4CCMA 5A3PA 2YPDA 4BISA 5FP9A 3N9LA 5A3WA 2OQ6A 2WWUA 3OPTA 5FUNA 5ISLA 5F5AA 2OX0A 3KV6A 5FY4A 3AL5A 4GJZA 4URAA 5FZ7A 3LDBA 2OS2A 4QX8A 5A3NA 3K3OA 5IW0A 2VD7A 5FWEA 4IGOA 4GD4A 3ZLIA 4AI9A 5KR7A 3PU8A 5A7NA 3N9QA 5FZIA 2YBSA 5IWFA 3KVBA 5FY9A 3N9NA 2WWJA 3AVRA 4V2VA 5FY1A 5FYYA 5FY8A 4HONA 4D6RA 5F5CA 5FZCA 4CCJA 5A80A 5LW9A 4XDOA 5FYUA 4QXCA 3N9MA 3N9OA 5F2SA 4LIVA 5FZLA 5FYTA 5FP4A 5FPAA 4GAZA 5FYHA 3PURA 4E4HA 5FP8A 2Q8EA 4EZHA 5FZHA 3KV5A 5FZOA 5F3GA 2YU2A 3U4SA 4ASKA 5F3CA 5FYMA 5A3TA 5FZAA 2OT7A 3RVHA 2OQ7A 5FP7A 4EYUA 3DXUA 5FBJA 4Y4RA 5IVVA 2XMLA 5FZKA 5F5IA 5FYBA 5FY5A 5A7OA 3PTRB 3NJYA 5FJHA 4QWNA 5ANQA 3N9PA 3PUQA 4HOOA 5F37A 4LIUA 2XUEA 5FPBA 4D6QA 4V2WA 5IVFA 4TN7A 2PXJA 4IGQA 4D6SA 4CUGA 4CCNA 5FZ4A 5FZ0A 5FZEA 3KVAA 5LY2A 4CCLA 5F2WA 5FZGA 4QU1A 5LY1A 5F3IA 4LXLA 5FV3A 5FJKA 5FZ9A 5FZBA 4QXBA 5IVBA 5FZ6A 5FXZA 2GP5A 4IGPA 5A7PA 4DIQA 5FZ8A 5F3EA 4CCOA 4BXFA 5FZMA 4EZ4A 3PU3A 4XDPA 4Y33A 5FXXA 5FZOB 5LWBA 3UYJA 3DXTA 5FZDA 3AL6A 3K2OA 5FYSA 3ZPOA 2P5BA 5IVYA 5A1FA 4Y3OA 5IVCA 5A7WA 5FZ1A 4C8DA 4DO0A 5FYCA 5FP3A 5FYIA 5FYZA 3U78A 5FY0A 4QXHA 3LD8A 3PDQA 4NUBA 5FXWA 4CCKA 5A1LA 2XDVA 2Q8CA 4CSWA 5FYVA 5A7WB 2YBPA 4UF0A 5F32A 4BU2A 2W2IA 5A7SA 5IVEA 3OPWA 5K4LA 4AAPA 2YBKA 3KV9A 3PUAA 2YU1A 1VRBA 5A7QA 3KV4A 2XXZA 5FZ3A 4LITA 5FY7A
chains in the Genus database with same CATH superfamily
1RUH1 4S2DA 2DUOA 4KH9A 3PUSA 4UT5A 1RC6A 1W9SA 4LEJA 1IS4A 2GALA 4QHBA 3BU7A 5A32A 2FBEA 3OGVA 5F9TA 5C9AA 4CCMA 1DGLA 3VD4A 2WAOA 1XNDA 2HWC1 2FDJA 2E7QA 3MUY1 3O0XA 1HRV1 2OXBA 3FLTA 2E7AA 1OUSA 1UMHA 1OH3A 4Y20A 3QACA 3VHPA 1KXGA 1VAKA 1E5SA 5C9AB 5FZ7A 4YRDA 2RM23 1GNZA 4MGZE 3VHOA 5C6CA 2ZX2A 3ZFFA 1AR62 2B46X 3OY8A 1JZ8A 3PU8A 1ZRDA 4NHYA 3U10A 3WINE 3GNEA 3OCPA 2XG3A 3MIEA 1S0IA 3POYA 4CUBA 2WINB 4CZSA 1H9WA 4UW4A 3HQXA 1PZ8A 1T2XA 1NLQA 4OUSA 4Q0VA 3ZFFB 2GNBA 2ZGLA 4XOGA 3OY8B 1W6MA 2JG9A 3VBHC 4CEYC 4Y22A 2V4AA 4ISQA 3WW1A 4Q4Y1 1QJFA 3RMYA 4NRQA 1AVBA 2FDFA 5LATA 4CP9A 4JAAA 5L19A 4P9LA 5FYHA 3D0SA 3S5AA 1W6MB 2JG9B 5LRRA 4Y22B 1OLMA 1PZ7A 3U4SA 3M3OA 4QDQA 5DAQA 2F17A 2VMIA 5L9RA 1PNFA 4PIXA 4EYUA 4CP9B 1RUI3 3KT7A 3CJIA 1EAH2 2AH2A 4FPCA 5C4WC 3BODA 1N3QA 5FYBA 4QPIC 1Q5OA 1S0CA 2E7TA 2WS93 4M4RA 3VDCA 3C7FA 5F5QA 1X9TA 1EV12 2CY6A 3RQ0A 2XJVA 4DZGA 2IXKA 1W2TA 3CJIB 1HRI1 3POWA 4NHKA 1MEC1 1ENQA 3KQRA 4ZKTB 1I3HA 4YZ4A 4QM9A 1UKRA 3H8XA 3IBMA 5FRAA 1UYZA 3ZYPA 4RHV2 2JJ6A 4B29A 3WNKA 4JKKA 1SHWB 2WNOA 4RS5C 4YVWA 2BFUS 2JG8A 1RUNA 1XU2A 4I0WB 4L8QA 2L9LA 4YM1A 3U75A 4QDRA 1H2MA 4YFWA 3ZKUA 4FPFA 5C8CC 2IWGB 3U1XA 2I2SA 1GUIA 1BKZA 4A7KA 1MS3A 1PM4A 3HWJA 3DXTA 2JB4A 4KWUA 5FZDA 3AL6A 4YVWB 1JYXA 5GLTA 2JG8B 1RUE3 3AM2A 3BTYA 1K5MC 2HWE1 3MBWA 4ISRA 1SLBA 3LOIA 3THPA 3LIGA 1FXZA 1SMVA 1O5UA 3LD8A 1W6NA 4PBOA 4A3XA 3PTYA 3BGAA 5I8TA 4AEDB 3PMEA 4TLGA 1IS6A 3PJQA 2CU5A 1PGW2 4KG8A 5FK8A 3IDEA 1W6NB 1Y9MA 4M0HA 2W47A 4IEYA 3GHNA 4E2QA 4COUA 4WM8A 2C9AA 3IAPA 1W8UA 4KG0A 4ZS3A 4JKLA 2LUWA 1PIV1 4ONUA 4P00B 4GWIA 5FUPA 4I09A 4R4XA 2TEPA 4XBQA 5BNPA 4H7MA 5FPUA 1MR5A 4U36A 1JUHA 4DPNA 5FZFA 4WM8B 2YPDA 4IV3A 1V6JA 2W1UA 4Q8KA 4BWOA 2H0VA 2VZTA 1LCLA 2GC1A 5BNPB 1BEV1 2VE1A 2WNEA 2V5YA 5J98B 2VGDA 2P1BA 2W94A 2WAAA 4BQWA 4EN8B 1H1AA 2B9UA 2OS2A 2WRAA 3J7NA 3K51A 4CCEA 1Z7S2 2XJPA 2YC2A 3DKWA 3HQRA 4JDMA 5JCTA 4COWA 3ZLIA 1RUC2 3NAPA 3UJQA 4P9JA 2RS52 4M3CB 2VM9A 4LHKA 4M00A 3IT8A 1ZBA1 4FP3A 1RMU1 2PLV1 4GWJA 2DV9A 3BCWA 2PELA 3NAPB 1UY1A 1R1ZA 1CAUA 2OZJA 2HJIA 2HWB1 4RFT0 3PVEA 2W46A 3LCPA 1XPWA 2Y64A 3D8CA 1XYPA 2F4LA 1O8PA 1CAUB 2LS6A 2ZHKA 1UMIA 1F15A 5D8AA 4CDQA 5FAXA 4B7EA 1EPZA 1QJU1 2G19A 2EA7A 2W1WA 5A33A 3EHKA 2OQ7A 1DGRN 4RQPC 5CU1A 3AXDA 3T1LA 1AR63 3KCXA 3TYJA 3CDZB 3R4SA 4ZU7A 5D8AB 1AJKA 1E5HA 2D93A 1V6LA 2BOIA 4CEWC 1WBFA 3FJSA 4D8MA 1BCXA 5A33B 3BTXA 1WW5A 4QWNA 1DQ1A 4X6RB 1CAVA 2BNNA 1KEXA 3RDIA 3N9PA 3ZSMA 3N35A 4XUTA 4XE9A 4XVHA 4W8JA 1ZZCA 3IDBB 1NCRA 1Q8OA 3FHIB 4GXLA 4TYSA 4I0BA 4DXSA 3TEZA 2XLGA 3ENRA 3N7JA 4PHZA 1OQ1A 5FZ4A 5IFTA 5JXGA 4GMP0 1CAVB 3UETA 3M8LA 1KJLA 1PIV2 4X8PA 1NCRB 3HJRA 4QQHA 4K21A 4AK3A 3CZJA 5FXZA 5IYYA 3CQOA 4IGPA 2ZX1A 4AW7A 1LR5A 1NQDA 1SLIA 4C1XA 1SBEA 4AVVA 4OQ8A 3ZDVA 4XHXA 4XXAA 3ZFGA 2ADDA 4XDPA 1B35B 5FDBA 5FXXA 1CQ9A 2HWF1 3MFAA 2YPJA 1PMHX 3WG3A 4CP0A 1OKOA 2OA2A 3UK9A 5KHIA 3N4MA 1VE0A 4LJHA 5A7WA 1C8M1 2ZXQA 5FZ1A 3OGRA 5FKCA 2KXLA 5K0UC 5CG8A 2RMU2 3ZFGB 1VB4A 4K7JA 1PK6A 4W4ZA 1JOPA 4XACA 1JZ6A 2RE9A 1P8JA 2Q1ZB 2RDSA 1ZZ8A 5T5LA 2RJ2A 4AI3A 4JV4A 5A7WB 4AFCA 2SBAA 2EIDA 4RHV3 2KA3A 2NZ9A 1PK6B 3KB5A 5K4LA 5ABJB 3D82A 5A7QA 1R083 3GF6A 3MEPA 3ZXLA 3WF0A 2KR2A 2E33A 3VDDA 5G05L 4FAGA 5C9AC 1HXS1 1DZQA 2VBPA 1IKPA 2PQSA 2XKPA 1RJ7A 4AHXA 2FD8A 4FPHA 2DUQA 2D6NA 3QOPA 1O7FA 1TMF1 4XAAA 3UV9A 2FDIA 4OHYA 2BGOA 2DFCA 2PMWB 5FP9A 5A6QA 2WFF2 5A3WA 2WWUA 1O6UA 5ISLA 1QJZA 5FY4A 1VBB1 2BERA 3T0BA 2VZOA 3LPGA 4I0AA 4RR3A 4YW6A 3ZFFC 2J1UA 3L2HA 1E5IA 3K3OA 5FO7B 3LA2A 2VCBA 2AC1A 4C91A 2PA7A 3JUUA 1X8EA 5KR7A 4SBVA 5FLHA 5E89A 3OD0A 4AQ6A 4RR3B 2YBSA 1L3JA 2JG9C 2YFUA 2D98A 4A3ZA 4DEVA 2EAKA 4A41A 2JICA 1GP5A 3J8F2 4Q26A 4L92A 1SLLA 2VG9A 3PVOA 3UGGA 1W9FA 1F4AA 4HZFA 4A42A 5IK8A 5GZDA 2NMOA 5FZLA 3X29B 5JAXA 1J59A 5LBEA 2ZGTA 3OYWA 5FPAA 1UX6A 2CYFA 1DHKB 2IVIB 4GALA 3KGLA 2IFWA 3VZLA 2VMGA 4XCAA 4K6BA 2DBNA 2E63A 2YU2A 3AC0A 1JYCA 3CJIC 3GZAA 4FXKB 4GZ9A 4ITCA 4QKDA 5A3OA 3WQ1A 1RHI3 2ZEYA 1F5JA 2R1BA 3DXUA 3INAA 3OYWB 1H4GA 3ZXGA 3BOWA 1POQA 1C8M2 4R8HA 1RUC3 2G9GA 4N9IA 4XMIA 1YIPA 3CLPA 2RS53 3HN3A 1UY0A 2R062 3PVBB 4QT6A 1UCXA 1NT0A 1FV2A 2VBBA 4RYDA 3VD3A 4Z2AA 4ARXA 4IE0A 2OUJA 3RYRA 5LEKA 1LU2A 4XMAA 1HIXA 4IUGA 3H8OA 2QQUA 5FPBA 2RR11 4S2HA 4OHZA 1H30A 4TN7A 5APAA 3ZN5A 4BM8A 1AR82 4HG6B 5E1RA 4AQTA 2JIGA 5HPOA 3RSJA 1LOFA 5L9VA 1B09A 1OMIA 2VQTA 3NNFA 1JI6A 4RL7A 4WZCA 4YVWC 1GZTA 4QU1A 2VY0A 4AE2A 2JG8C 5IK7A 4XQWA 3TB0A 5F3IA 3A23A 5FJKA 2E51A 4O9EA 4CPBA 3PJYA 2R1DA 3USUB 2GDFA 3RYKA 1LOGA 4XC9A 4AEDC 3PU3A 1VRH3 5JMOA 2WQ4A 2R072 4DXTA 1FMD1 2VCMA 4M01A 4RA0A 4HFSA 1MACA 1H8TB 1BYHA 4IEOA 1X50A 5J3UA 3JU9A 4LLOA 3MIBA 5ACA2 1ND3A 3CBNA 1ZREA 3RWKX 3ZYHA 3PDQA 1RITA 1Y9QA 5FXWA 3WD5A 3AB0A 2BWCA 1G6NA 4F83A 3H3LA 2A75A 2AEZA 3HVDA 3Q8BA 4EN9B 1FPN2 1NY71 3FLRA 1ENXA 4WM8C 3M70A 3IM0A 1A3KA 3WQ0A 1TE1B 2WT0A 3LKJA 3RJ2X 5BNPC 3OBTA 5GALA 5FY7A 3WNNA 1OBNA 1GMMA 4XZPA 1JZ3A 4B1MA 3MIDA 1SBDA 2BVBA 4BCUA 4LBQD 1DZRA 2H6CA 2RDNA 4MXWA 3B9CA 5K8SA 2GNDA 1ALYA 1W0OA 3HMYA 3WP5A 2RMU3 1BLZA 1W39A 2XVGA 4MLOA 4S2FA 2RS31 2XHNA 2QNKA 3E6DA 2E31A 1XE0A 3NAPC 4XTMA 4MXWB 3O1SA 1AXZA 4PT6A 5JIAA 1QKQA 5FWEA 4UW5A 3ZIXA 4CE8A 3S6PA 3VL9A 3LA7A 3P1IA 1K12A 3I2OA 2QQOA 4IEPA 4XPVA 1WCUA 5EV7A 1U5ZA 3Q8FA 5SV8A 2AACA 3GYDA 4FFIA 3TEXA 1ZNPA 3UT0A 1VBC3 5F5CA 1QJY2 2D7FA 2VPVA 4Y1YA 3T3YA 3CZUA 2XWJB 4META 5D8AC 3UKVA 1DGWX 2WFF3 3ZFEA 4MGQA 2ARBA 4MZUA 4XYXA 4TLFA 2JKXA 4Q5OA 3KV5A 1QJX1 1RYYA 3I8TA 1YCIA 5FKBA 2CWMA 5JI9A 4INDA 4O61A 2CV6A 5IVVA 2VTFA 3FHQA 3ZVXA 5F5IA 4OI1A 4IEZA 2K2SA 2OPKA 5EJ3A 5ANNA 3KF5A 3BUCA 5BV6A 4N53A 4F7ZA 1YIFA 3ZXAC 1NCRC 5F1RA 3AMMA 1LHOA 1RUJ1 4HK8A 1FATA 1BZWA 3VZKA 4AI2A 3VV1A 1S0JA 4Y24A 4LMFA 1J1TA 1VIWB 4IEXA 1JU4A 4WM7B 5C5UA 1B35C 1YFYA 4N53B 3WF2A 4AWDA 4CUAA 4ASLA 1UZVA 1UL9A 4AYUA 3ACHA 1OH4A 5LY1A 4YW3A 4PLMA 2FZ2A 3VKNA 3BVCA 2D6LX 4NWWA 4Q4X1 2E32A 1H6XA 5FZ6A 3ZFGC 5JDBA 5FZ8A 2C4XA 5FZMA 1H2KA 1NKGA 4DY5A 1Y3TA 4Y33A 5C5TA 2LRPA 3UYJA 3QH6A 2WZR2 2ZGUA 1H2NA 1PK6C 1O91A 3KGZA 3LSDA 4LE3A 1JH5A 2VCAA 1GKBA 4ZXKA 5ABJC 3NL1A 4FQZA 1ULDA 2K0GA 2Y6JA 1V6OA 2C5DA 1O5LA 1ZZ7A 4TSVA 4E8CA 1KGYA 1YI7A 5I8SA 1MZ5A 2A6XA 4JHTA 3RRDA 1GP6A 4CCKA 5GZCA 3ILRA 1AR83 4URTA 2A6YA 4AVBA 3AMNA 5A70A 4XXPA 1TEIA 3OBRA 3I3EA 4K20A 2HWD3 4UF0A 1ASJ3 2WO7A 3E6BA 2V09A 4YGBA 4AQ2A 4XFIA 4GB31 4QAWA 2V73A 3IAQA 4IXLA 4TTGA 2XPJA 3SH3A 1W06A 5CG9A 4JDNA 1YQCA 2VZ1A 4IV1B 4QPGA 4LITA 1NA1A 1V0AA 2C0ZA 2MEV2 4NWVA 4UF0B 1OVPA 1POV0 3V56A 3ACIA 3EO6A 3O0VA 5I0SA 4QX7A 5F7UA 1QXRA 5FWJA 4COVA 3PNAA 2WQZC 4MGSA 3DN7A 5BPXA 3WVJA 5C3QA 4AR2A 1G8WA 2IXLA 4K9SA 1NA1B 4RR3C 5B4XA 3VZMA 1HQLA 4ASMB 3DYMA 5LA1A 1W8HA 4DS0A 1WW4A 1SFNA 1REFA 2ZACA 4UFLA 3ZYBA 1SLTA 1SFYA 2RM22 3O12A 4Z07A 5GM0A 4MYEA 4YG0A 1ZRIA 2X29A 4FSJA 4Q4V1 3DGTA 5FZIA 4LK6A 1R1A1 4HXCA 3OF1A 4C0BA 1SG3A 4XJAA 2J1SA 3NV2A 4OUEA 1K42A 2WO2A 3ASIA 4BLJA 3TEWA 5T3NA 1QQP1 4YSFA 5B4NA 4LE4A 1UIJA 2ARXA 3PMSA 4XFGA 2ZZJA 4YW5A 4C1WA 4FTBA 3E5QA 5FREA 5BNOA 1GLHA 4HPKA 2YDEA 3TN93 4YW4A 4E4HA 5H9PA 1Z78A 5AFEA 2FDKA 5J1XA 4BQ4A 4B4QA 2G1MA 3MPBA 4ASKA 3WXPA 4B8EA 4E2SA 2QQVA 5H9RA 1UO9A 1RUI2 4HPKB 5DDJ3 3RVHA 5BNOB 2GC3A 2JDYA 3DL3A 4AHWA 3K48A 3ZYIB 5FMOS 5KHKA 2Y6GA 2P4EA 2XQXA 2WS92 2AREA 2CDOA 3OUHA 2CHHA 3NNJA 3PTRB 4R9CA 1FV3A 4A2UA 1DP0A 2ZGNA 4K3UA 1PO23 2HBUA 1WLCA 4UFMA 3SXWA 4CCDA 1FOD3 4CU7A 3WV6A 3N7KA 4LKDA 4GKXA 5FR3A 3PUQA 3WNMA 1RL3A 4H2AA 4D6QA 4V2WA 4IGQA 5H9SA 1HB4A 1W0PA 3FFQA 5DZFA 1QIQA 1CN1A 1Q43A 4EN6B 3KVAA 4FPKA 3N36A 4KI5M 4FPJA 2Q30A 3CJXA 4HKOA 4XCBA 3AP4A 3BIWE 3AX4A 1H8TC 1WMDA 3ETQA 2QUOA 1EY2A 1RXFA 1UYXA 4OI2A 2PHDA 3O7OA 2VNVA 2A3XA 1O8SA 4FT8A 4XFCA 2WNUA 3VBRA 2P3IA 3H7JA 5I8YA 4JZRA 4AEKA 4BQYA 5FZOB 3WF3A 1J1LA 4QXKA 1AX2A 1UN1A 2WJSA 2NN8A 1RUE2 1AR61 1S4CA 2DCTA 4RD7A 3SHRA 3MIGA 4YFZA 2WNUB 4NHLA 1AUYA 3UESA 3LDKA 4AL9A 3PUHA 2QQPA 1YEWA 4ZXEA 3O0WA 2VQ0A 3P3NA 2ILMA 3UL2A 2E9QA 3O1UA 2PHTA 1URXA 1ENSA 1UMZA 4A6OA 3VZJA 1BXHA 1C5HA 3R4DB 1KD7A 3GZTB 1JBCA 1O4ZA 1W0NA 2B5HA 3EYPA 1YQ6A 2D5HA 5BY5A 4DINB 3N7LA 2Z2SB 1UY4A 4BE3A 1FNZA 4IQPA 4NIGA 3H7YA 4KWLA 1A34A 2CTVA 4NPMA 4TWTA 5IATA 2LTNA 1HB2A 2H6BA 3HD8B 3U4XA 3WQBA 2W95A 4RN5A 2EIGA 5IUQA 1W28A 2WZR3 3IDAA 1EAH1 4XQDA 3NV4A 3B7MA 1PHMA 1SBFA 1HJFA 2EXHA 3LEKA 3M3CA 4LO8A 2BJSA 1VMJA 1HLCA 1EV11 1W2UA 1YFWA 1F9KA 3B02A 3M1HA 4JGYA 4MH0E 3TBDA 4K1ZA 1O3QA 4PDWB 5FLJA 1AR93 1OOPA 2DU1A 2ARAA 2BRTA 4XF3A 2HKXA 3P5BA 2AYHA 3HT1A 4NPLA 1WMXA 2GC2A 3AZVA 2GMMA 1J83A 3DKQA 4JGYB 4QB2A 4RHV1 4LPLA 3BPZA 4QM8A 3EJKA 3ZYGA 4A7YA 1OOPB 4GH4A 2MEV3 2R32A 4YZ1A 1CZVA 4XTPA 4AFMA 1YHFA 1T6BX 3RZZA 1NAEA 4G9SB 1BK0A 4GH4B 5JXJA 3UNPA 5FP8A 1Q8SA 5EXOA 4L0PA 1Y4WA 3IWZA 4P02B 5A32B 4UBGA 4HK9A 1OLQA 2BTVC 5CIRA 5F3GA 3U11A 1OC1A 3WP4A 3FMGA 2TNFA 5FZAA 1NXMA 3T2QA 3O1VA 1M06G 1YQ2A 2HYKA 3ZN6A 4A7ZA 2VTXA 4WM7C 1YI9A 2VUJA 2A6VA 2HEWF 4N53C 1A8DA 3KS7A 4Y20B 1W3VA 2QQKA 2W0XA 4BQ1A 5FPZA 1CJPA 1XU1A 1PGW1 2OW4A 4HN1A 4NN0A 2IC1A 2LROA 5ANQA 1GZ9A 3ZN6B 3PHMA 2A1XA 3HNMA 2W1SA 3J26N 3VL8A 4MG2A 1W8ZA 5FUIA 2BW8A 4CP1A 4CUGA 5FZEA 1L7RA 1ND2C 3ETPA 1L7QA 3FN9A 1UZYA 3SCFA 4D7TA 2NP0A 2FMYA 5EIYB 5FZ9A 1AL22 3A4UA 5JXHA 3LA3A 1US3A 3VD5A 4CDXA 4CDUA 5I93A 2CGNA 2VW0A 2YHJA 4DIQA 3KM5A 4QB6A 3AP9A 3VDAA 2HLEA 1W8NA 2BBVA 2Y0OA 4AF9A 3CNAA 2YZ4A 1MS1A 2P6HA 1NX9A 5KXEA 1RHI1 2ZKLA 2D3RA 1QMJA 4CDUB 4CDXB 1Z7S1 3JD73 3IMMA 5A1FA 1JZ5A 1RUC1 2JXAA 3Q8CA 4UW6A 5SV5A 2RS51 4DO0A 2VOVA 1SLCA 3AMPA 3LE0A 4IV1C 4UXAA 5T5JA 2DU0A 3SMHA 1PGL1 3V0BA 4QXHA 1G7YA 5A1LA 4QDSA 3L9JT 4XBLA 1LAJA 4WZFA 2VZQA 1A8MA 4WVWA 1JMUB 3I7DA 4Q8LA 1W6QA 1S0GA 2Y6FA 1VBD2 2W9XA 2RS13 4FPYA 1GZWA 1WA4A 2W2IA 1C1FA 4P9GA 1NA1C 2F4PA 1R082 1YRZA 1WD3A 2R30A 4XJ9A 2R49A 5FK7A 5GZEA 1RJ8A 5KXBA 1W6QB 2P37A 3GBGA 4KL1A 4S2GA 5FPVA 4EQVA 4LK7A 3FWEA 5A3PA 4OFGA 1QWRA 5DAXA 1VRH1 3D6EA 2OQ6A 4QPWA 1COV2 1GWLA 1NOVA 5L9BA 1KDKA 3KV6A 2A3WA 1RXGA 4XF1A 4XQ4A 1FYUA 1UKGA 2C24A 3B3QE 1TQ5A 4G3YC 4Q27A 3GJAA 4E4ZA 3ZSEA 3ON7A 3OGSA 3ZPYA 5A3NA 3TEYA 1WUVA 3ZXJA 1W9YA 4IGOA 2I07B 2MNGA 5CNAA 1YLLA 2G9ZA 4BPZA 2J1EA 3NJVA 4IESA 1JOJA 1ZYBA 4V1PA 4XILA 1SQ4A 3PVNA 3KVBA 1N3OA 3AVRA 4LBQA 5FMCA 4FPGA 3ZIWA 1A6CA 1UOBA 2AENA 3BIEA 2VZVA 4FPEA 5BNOC 1G9AA 2HEVF 1PX3A 4Q0QA 3HIFA 1W2OA 4LO5B 4BMEA 1F4HA 4LBQB 4ZU5A 2JD4A 5FLIA 1LKNA 3CIHA 1K5JA 1LJ7A 1R093 5FMDA 1ULFA 3W9AA 3OD4A 1Y9GA 3S7EA 1ENRA 1RHI2 3C2UA 1HB1A 3LB9A 4IV3B 2RMU1 4AI8A 2Q5TA 2VL4A 2XB6C 2XBO3 3AZWA 1ZBE3 2DTWA 5FY5A 2VH9A 4AGGA 1V6NA 3HAGA 4P5YA 1PGL2 5KHJA 1ONAA 4P14A 3ZXDA 5F37A 4MXVA 2JDZA 4W50A 3JB8A 3I3MA 4FTEA 4QPYA 3MPPG 1VBC1 1CX4A 2IVJA 1XYNA 1PGSA 5DZEA 5A1AA 3H50A 1CIWA 4QHZA 2XLAA 4AI0A 4A45A 1U5XA 5EYYA 1JUIA 3BTZA 2WNUC 1YQ5A 3K4ZA 4LXLA 3OEAA 4FP2A 4CXXA 2WFF1 2VXRA 2VW1A 3ZX7A 2Z4FA 1C28A 1V9U3 3HR9A 5JI7A 3TRSB 2KM2A 1VRH2 3ZYFA 2X10A 4DXZA 3MYXA 3PIGA 4L97A 1UPSA 4CDQB 3CF6E 2W68A 3ME2A 4GIQA 1GQGA 1ULGA 3SCGA 1VPHA 2CWSA 2PQQA 5IVCA 1JHJA 3TNPB 1RUF2 1POV1 1D4M3 1WD4A 1XSRA 1F35A 3BOPA 3POFA 4KQ7A 5CVRA 4AVTA 1AR73 5FY0A 3ALQA 3GDBA 3J8F1 2X5IA 4N9HA 1EYBA 4UYBA 4A44A 2D3SA 1GOHA 5HI0A 5FQ0A 2YBKA 3PUAA 4WBBA 1AL23 5JSRA 4QKBA 2DWRA 2P6CA 1YC61 4LBKA 4LHNA 2X5IB 5F6KA 2Q8DA 5I0RA 4KBBA 1AL0G 5C3PA 1H1MA 4HT1T 2B7YA 4PDWC 5FQ0B 4KWJA 1BJQA 5KC5A 3GCXA 4Q1PA 4FAHA 3A7QA 1UZ0A 4YGCA 4YW2A 1ULCA 2PHRA 2R061 4JGYC 3F95A 4XEZA 2ZZQA 3RZJA 3MV11 1AYN2 4LO7A 1OOPC 3MW2A 2ORZA 2UYBA 2RJLA 3AYCA 5IFPA 1VP6A 4LBJA 3C7GA 4FFGA 5JOZA 5DXDA 1S2EA 1XJAA 1YFXA 2VD7A 3WDTA 4DUVA 2OVUA 3ECQA 1VBD3 1DU3D 2CDPA 3O5SA 1AR81 4BK4A 2EALA 2WDBA 4GH4C 2VU9A 2HWD1 3N9NA 1GOFA 3POBA 3ITQA 3I2HA 3GALA 5FIXA 4CCCA 3PLQA 1VBC2 3W5MA 5HXMA 5AVAA 4QQ2A 3WF4A 2D3PA 4O7XA 1IPSA 5AC92 3LIHA 2QDRA 3LEIA 4LORA 5K9YA 3VKFC 4AGVA 1MQTA 3IIIA 5CKNA 5LA0A 3AP5A 4NHXA 3VDDB 4CYDA 3IN9A 3SC7X 1Q8VA 2YFZA 1COV3 2R071 2TBVA 5FZHA 1RUH3 3B00A 4OI4A 5F3CA 5JMCA 2H0BA 1MQTB 1YO8A 5ACA1 5FP7A 5FMBA 5M0TA 1IKQA 2O8QA 2BU9A 4AQSA 1KS5A 2Z5WA 3B93A 5FZKA 1BMV1 1N1TA 3MLKA 1V70A 2D43A 2ZKNA 4LBLA 1YWKA 3IIAA 4EWAA 3WHTA 1DBNA 1FPN1 1KJRA 1OA2A 4NAOA 1STMA 1LEMA 3KCYA 4DEQA 2BV4A 1OF3A 1U12A 2RHPA 4HOOA 5DAWA 3VZOA 3LSEA 3DECA 1IOAA 4I02A 2R042 4IL7A 2WZEA 1W8OA 1TNFA 1JYNA 2XL9A 3LEMA 4CDUC 4CDXC 2GC0A 5F2WA 4QD2A 3ZDSA 1FT9A 2UU8A 5KC6A 2WKKA 5CZKA 1HKDA 3TN91 5IVBA 2W39A 1RVF2 1GP4A 2BZDA 2GP5A 4FO9A 5F3EA 2XJSA 3SLIA 1J3QA 3GZUC 3M3QA 1HW5A 5LWBA 3AKTA 3BKZA 3I49A 3VBFA 1NZIA 5EZWA 5T52A 4DXRA 4DUXA 2D40A 5BNQA 1ULEA 3LDRA 4WVVA 1PO13 2X05A 1SCSA 4BOWA 3DPRA 1WMFA 3VBFB 1MS4A 3SCHA 3NNMA 1ZVFA 4MGKE 3RS6A 1QJY1 1N3PA 3THDA 3WQ7A 4KGGA 1S2KA 2HWD2 1ASJ2 1QDCA 2ZBJA 4BYYA 2JDUA 3PUIA 2XGXA 4RFRB 2DVGA 1Y43B 3B5LB 4PI0A 2WSVA 4L2NA 4OZXA 3IB3A 3NV3A 1HRI3 2R6QA 1D4VB 3DEMA 2DVBA 2ERFA 5GLVA 1MEC3 1EUUA 1HV0A 5EFUA 4XDQA 4QX2A 3WG4A 4ES9A 4EJRA 5FXVA 1C4RA 2WNVA 1TVGA 1YJKA 3A0KA 3EMRA 2GP3A 4XF0A 4Y5TA 1Q8QA 1W6OA 1H6YA 3MFCA 3R6SA 4XIOA 4NVPA 4O9GA 1I1EA 4LR4A 2NMNA 1X33A 4BQ2A 2DDUA 1RUF3 3O14A 2WNVB 3WHUA 4D0QA 1XNAA 4QGLA 2EXKA 2BNMA 2WABA 1UX7A 1W6OB 3K75B 1BMV2 3WUCA 3NWKA 2ID4A 1GOGA 1AHSA 4UW3A 1FNYA 1DF0A 4FPLA 4JRAA 4DY3A 4KMQA 1ND3B 4UFIA 2A70A 2PTMA 5CADA 1PVC2 2QQMA 1UZWA 5GZFA 2PYTA 3Q8EA 1D7PM 3CU7A 4FXGB 1R64A 3S7IA 3VBOA 2I45A 1NQJA 3I2JA 1NZCA 2JIJA 4IV3C 5FZCA 1XC6A 2XLFA 3H1YA 3WLUA 1PX4A 2RDRA 4ARYA 1AX0A 1WW6A 5IAVA 3O1TA 4LKFA 1NCQA 5JXIA 5FYTA 3TN92 4XHBA 3O1OA 1CESA 4GWNA 3VBOB 5FP4A 2QKDA 2R0HA 1W99A 4DNYA 2E6VA 2WZR1 3K4AA 3ZO0B 3W20A 1AYN3 1XQNA 1OF4A 5C3OA 5CFCA 5A3TA 4MADA 5DDJ2 4L99A 1YXWA 3SITA 1LB2A 4LULA 2BPA2 4HL0A 4CU9A 4OLLA 2ATFA 2O14A 1ACCA 2ETEA 3S57A 4JTOA 3U07A 5FOBB 3FFZA 2VC9A 2ZX3A 5I0UA 1L7LA 1PO22 5CFCB 5EJ1B 1FOD2 1US2A 2J1AA 1BEV3 3RI9A 1SACA 2IZWA 3FHAA 4BIOA 5AC93 1WLWA 5CA6A 2Y38A 3ZYRA 1RB8G 2MEV1 1JYVA 4CDQC 5LB6A 2IXCA 5FZ0A 3U14A 4XFBA 4DRRA 2DURA 4Y26A 1YNAA 1ZBA3 3J9SA 1LEDA 3AMHA 4O65A 4XBNA 4YYOA 2PLV3 4I3GA 1J58A 1QNWA 3I4IA 4YVSA 5L7OA 2EVXA 5A7PA 1TME2 4UFHA 1LHNA 2C9KA 3ZFEB 4BLIA 2HWB3 2ZEWA 1G86A 2VZSA 3AYEA 2O1QA 2RM21 4Y1ZA 1DDLA 2BEOA 5HCHA 3NJZA 5DABA 2I74A 4YVSB 4CU6A 5L7OB 2RVAA 5IVYA 1OKQA 4AXOA 2IFRA 1UY2A 2BVVA 1UYYA 1QJU3 2QQNA 3WDUA 4B4PA 2X5IC 2NPIA 1OA4A 1RINA 2W52A 2XOMA 3W59A 5JOXA 1JXNA 2R043 5JWPA 2GSYA 1CR7A 4AAXA 3AZZA 1AXYA 2JDPA 3OBAA 5F32A 2VECA 4Y5SA 4OQ9A 4YGDA 3H3UA 3RNSA 4JRLA 5DPNA 3B01A 3KLSA 1I5ZA 4NHMA 1XBFA 3I59A 2R7EB 1ZM1A 1CWPA 1RVF3 5T50A 1AZDA 4I30A 3POIA 4E4DX 4AHZA 3G6JB 4JQTA 4N43A 3NKTA 3D4KA 5F39A 1PNGA 2VUDA 1W3XA 1J3PA 1RUI1 5J96B 1REEA 4GJYA 3I59B 5C33A 3AYAA 5E6HA 3QH7A 1OXCA 4BISA 3VBHA 4CEYA 2BQPA 2WS91 4N43B 5F5AA 4OVEA 2GAUA 4L11A 2ENRA 2ZEXA 3MF6A 4LA3A 3AL5A 4WVMA 5CAZA 2J42A 2A6ZA 5FFOC 1C1LA 2PN5A 4QX8A 1AR92 2VMHA 1G9DA 1UXXX 2Q4SA 4KGQA 3UGFA 4CEYB 4FCAA 2Y6LA 4QQLA 4GD4A 3I54A 4FPOB 5DG1A 5DUXA 3VDDC 3BU0A 3RZHA 1FI2A 1K3IA 2FZ1A 5BYNA 5KXCA 1UYPA 2DTYA 4WVMB 3IPVA 4HKWA 1O3SA 2FMDA 4H55A 4LQRA 5IK4A 2EXIA 1RUD2 4HONA 3T08A 1OLME 2J1RA 4QPIA 2P2KA 3CKHA 2ZMLA 2W92A 2VTXJ 4XDOA 4AHYA 4LNVA 3N9MA 3IPVB 3NSTA 4XFAA 5LBCA 5J09A 1SPPA 4QPGB 5FYCA 4GAZA 1SDDB 2AEYA 2Y26A 5DUVA 3WDVA 4QGNA 2QZ3A 2Q8EA 3ZSJA 1EUTA 1RUE1 1DG6A 4PIYA 1JYTA 3DUIA 1HXS3 4DQAA 1SPPB 2ZMKA 3WEZA 2WUHA 3H8UA 2B9VA 3ATGA 3LEGA 1T6GC 1TMF3 3O1MA 4BJ0A 3GBWA 4CA9A 4RGKA 3CEWA 4BHPA 4AGRA 2ZTNA 1PVC3 1HB3A 1N47A 1JN2P 1XE8A 3OGGA 4R52A 4PIZA 5C8CA 1LHVA 3IDCB 1GWMA 2D6OX 2PHXA 1F2NA 3HOBA 3I2DA 3OOXA 3W21A 1CAXA 2YC4A 4D69A 3NJXA 5E88A 4GWMA 4YG3A 4I2OA 2ZX0A 3WP3A 5T55A 4P9YA 1K5MA 5DUUA 4XJ8A 3RMXA 3WCRA 1QF3A 4CCNA 1S0EA 1SZBA 4HVOA 3VKOA 4EN0A 4QKNA 3NV1A 1WA6X 1XSQA 4P5HA 3WX5A 5FV3A 2TUNA 2ZGRA 2DFBA 3ABZA 4B1LA 1LGBA 3H1WA 2WBKA 5ERLA 4JHZA 4P08A 3BPSA 3VBFC 3WDXA 1JZ2A 2PAKA 1MZ6A 4J1WA 1R091 2D5FA 2CSGA 1W8TA 3UJOA 2D6KA 1OI6A 1JHNA 2GN3A 2UWBA 2GZWA 2LALA 1H4HA 3JD72 3BB6A 4QX1A 2EICA 3APBA 3ZPOA 2XBO1 3AK0A 3KCCA 4IEUA 4YM3A 5LCWL 4Y5Z0 3I3BA 4C8DA 1DIWA 4EE2A 2PAMA 1LOFC 3M7AA 3MDPA 4PBPA 4HLTA 3JCIA 4AFBA 3U78A 4IE7A 4FOQA 1GZCA 3A21A 3NQHA 1KS4A 2WFPA 2RS12 2YBPA 4BQ5A 1EPWA 3BALA 2PHWA 3POJA 4BQ3A 3VUOA 1LHUA 1C3HA 3EXUA 3GM8A 2WNVC 4IEWA 4RGGA 1LU1A 2ZEZA 4DFSA 4H7LA 2RR13 1TME3 2ARCA 3WP6A 2JE8A 1RUG2 4M3CE 4RGAA 3PIJA 3GCWA 2ZHNA 2RV9A 4BDVB 2DBIA 3T4HB 4F8AA 1VMFA 2J1TA 4F3JA 1ND3C 1OQDA 3H3ZA 3GXUA 1FX5A 3T09A 5CFDA 3VBRB 1QH6A 4XF9A 4YPJA 1VMHA 1PMIA 3M4FA 3ZOIA 3GHMA 1BVP1 1WW7A 4HBNA 1VBA2 1DGWA 3VB9A 3LDBA 1YJLA 4K8FA 5C8WA 4XUOA 5CFDB 1W03A 1AR71 4L9BA 4NE9A 5E16A 2VVEA 2P3KA 5A3MA 3O1PA 1IPJA 3E5UA 4CTEA 1XYOA 1CONA 5A7NA 2PFWA 3VBOC 1W90A 3P6BA 1F5FA 1UWWA 1DYOA 1KITA 2Y8KA 1IPKA 1OPMA 5T5OA 1AYM2 2UYAA 3FE5A 4QHOA 4MVTA 2YXSA 4XAEA 1AL21 3F2ZA 3OPZA 4AI1A 1VALA 4YZ5A 4PCRA 4M3CF 4D7SA 1MVEA 4RSUA 3S0MA 1AX1A 2XJTA 2J22A 2ZGKA 3WT3A 3ZKYA 1XNCA 4JC1A 5FPXA 3MZHA 2EXJA 5FTTC 1Y7BA 2FCTA 3MLJA 4EN7B 4E27A 3RZGA 2W91A 4ZZ8A 1R092 1TG7A 2CAUA 3AJZA 2VJXA 3I2IA 1DYPA 1XRUA 3C8XA 3OTFA 4Q1RA 3ZXEA 5JLVA 3EQEA 5FYMA 4ES8A 2R16A 3OBZA 3LAGA 1GNHA 4NAMA 2VQAA 3VGIA 3GBFA 1U0AA 1XB9A 4PI2A 3ZN4A 3O1RA 2XBO2 1QEXA 1U5IA 1ZBE2 3KWVA 4ZS2A 5JPMB 5BNNA 2VUAA 5A6ZA 4I3PA 3QCWA 1C8NA 1OUXA 2GNMA 5FJHA 1VBD1 1UIKA 1RUD3 4MHUA 1OQEA 4AVSA 1R081 5J7MA 2QTWB 3RFRA 3N7MA 1E5RA 3B94A 5BNNB 3CL1A 4LA2A 3ZFEC 1WGPA 2XJUA 5DQ0A 4YWAA 1DLLA 2ZGSA 4BZ4A 4YVSC 5L7OC 5HCAA 1LOEA 1MS0A 3J7MA 1Q3EA 5C3RA 4M4PA 2ZX4A 3FX3A 5FZBA 3FBYA 2CNAA 1V9U2 1COV1 4GKYA 1DZTA 3HEIA 4K40A 2Y6KA 2G9FA 3URFA 4FOVA 2XWBB 5DMYA 2WLQA 4LKSA 2VVFA 2VNRA 5LBBA 2PHUA 3FLPA 3K2OA 4PJYA 5FYSA 3SISA 4R4ZA 1QJX3 1D4M2 4GA9A 1XNBA 2VULA 4XZUG 4DOUA 1AR72 1W6PA 1XOYA 2DVDA 4IEQA 4B3NA 1W04A 2XDVA 1GYKA 5HCBA 2IXIA 4W6WA 3JXSA 4NJ4A 5A7SA 1WLDA 1W6PB 3OPWA 3VBSA 2FCVA 1RUJ3 2YG0A 2MPFA 4N43C 5L73A 3LWCA 1LULA 2EIEA 2NYYA 4EWEA 1O3TA 3DV8A 3ZMNA 4LBMA 4LO6B 3E6CC 2FDHA 3VBSB 2EF6A 5D21A 1CAWA 4XUNA 1KRIA 2GH8A 1OPOA 2ZS6B 1W2AX 3DYOA 3WG1A 3ST7A 3UKNA 3AMQA 3M3IA 1VBE2 3HNYM 4Q4X3 1NE6A 4OZOA 5K7PA 4AVAA 4JTNA 4KBZA 4MSVA 1SCRA 1CAWB 1QJEA 1OVSA 2JE7A 4P9WA 1CX1A 2UY9A 2P3JA 1PO11 2D6MA 4PLNA 2W3JA 1UAIA 1OSGA 3IKWA 4HETA 4UAPA 1AJOA 5DUWA 4QPGC 4XETA 2XONA 2D6PA 1WCDJ 2VNGA 3V0BB 2JX9A 4LUMA 1QU0A 2WA3A 4ORFA 1XNTA 1U5YA 3Q9OA 3ZMOA 4FQ4A 5FY1A 2E53A 1BBT3 3RJRA 4PLOA 1GZWB 1RUG3 2UWCA 4ZZ5A 4R9DA 4Z82A 1IG0A 5HCFA 1GWKA 1GQHA 4QXCA 3OEBA 1DQ6A 2K9ZA 4IDZA 4AEMA 4GB33 1ZA7A 3VHRA 3RZMA 3JBG2 4QX0A 4CVUA 5F8PA 1HN0A 2WA4A 1RUH2 1O59A 1VB2A 1A78A 3MLLA 3I2GA 5E8AA 2B8MA 1UZZA 2OUHA 1VBA3 3JZVA 3I3QA 1RUF1 2Z69A 2WSUA 1QHDA 1JW6A 3DF0A 1RTVA 3HPNA 3HBKA 4IE5A 2CAVA 3B69A 4Z8BA 2XUMA 2Q0AA 3ORJA 3AP7A 5IHRA 1DLCA 1LRHA 3IMNA 4E4SA 1W9WA 2HWC2 1PVXA 5DAPA 3KHBA 4EV0A 5A7OA 1HRV2 3MW4A 1O3RA 1OHFA 3NJYA 4YM2A 3D5OA 2YB7A 3RWNA 4IE6A 4AFAA 2VZUA 4C0HA 4AEDA 1WCKA 1AYM3 1GV9A 3NVCA 1WLTA 1S0BA 3DCQA 3MGUA 2YMZA 4A4AA 3SH5A 5I91A 3NO8A 3VD7A 2PXJA 3HT2A 1MZFA 5G04L 1DQ4A 1H2LA 4D6SA 1AXKA 3WDWA 5HBAA 3VD9A 1UF2C 2JDNA 3HNBM 4Q4V3 1X7NA 3KMHA 3KHCA 1R1A3 4NO4A 3CMGA 5JOWA 3JB4C 4Q0SA 4DB5A 2YYOA 3G7DA 1QQP3 2UURA 4HMZA 1X8MA 4IERA 4PF1A 2WIIB 1AYN1 4Q4Y2 3NKGA 4NRPA 3VBUA 3VKMA 3K4DA 3WSOA 4ATFA 4NIHA 1KFXL 1G9FA 5HV4A 4IEVA 1WBLA 3ILFA 5EQUA 1CZSA 4ZPIA 1NE4A 2ZGMA 3ZSKA 4NRMA 3SNMA 4Y3OA 2RJKA 2JD9A 1PO12 1NUKA 3FL7A 1GBGA 2O8OA 1J84A 4JGZA 3VBUB 5KBFA 2B39A 5L36A 2QQLA 2JKBA 5FYZA 5GKAC 4GMP3 1NLSA 4Q4W3 3FZ3A 4KNCA 4M3CA 1HQWA 4HN0A 1MPXA 2XR4A 2Q1MA 3ACFA 3H42B 4XJZA 5AC91 4FTSA 2G4IA 4JGZB 4A6SA 1V6KA 4CRQA 5JZGA 2VQUA 4PQ9A 2ZPXA 5EWSA 3WOGA 3VBRC 4K8RB 3MW3A 1HRI2 1JYWA 2YU1A 1MEC2 4R9BA 2WN2A 3T0AA 1HJGA 1W9TA 5FZ3A 2BOJA 1EP0A 1XE7A 3T2TA 2JE9A 1CD3G 3POEA 1UU6A 4XW3A 2WZPP 5JZGB 2Y0IA 5LA2A 1GANA 1ZZ6A 2BDRA 5CFDC 5FPLA 3NW4A 5C7GA 2QZ2A 4XF4A 2BFUL 4B4RA 4ZHNA 4LT5A 1F8VA 2C1FA 1QOTA 3JQXA 1SDWA 2JWPA 4TXWA 3N9LA 3WCSA 1PM7A 4NOTA 1LHWA 2DCYA 1NXD1 2CGOA 2OX0A 3HN1A 4J6GA 2ZGPA 3FBMA 1I5PA 1H1IA 1V6IA 5IT6A 1HDKA 1ULOA 3R0RA 4KU7A 2A71A 2WC2A 1WMEA 1CGPA 1JODA 1LODA 4LTAA 1KDMA 4OHWA 4TZDA 3D3AA 5A6YA 1VAMA 2R041 3R05A 2HWE2 2VZPA 3ACGA 2DCKA 4HVRA 2Q1FA 2WWJA 4V2VA 1RUOA 5FY8A 3J7LA 3OB8A 5KXDA 4MGIE 3THTA 2AR6A 1CZTA 4XJUA 1RVF1 3T30A 4XFHA 5FYUA 5BUVA 3WR0A 1QXJA 2XVLA 3RI8A 1ST8A 4LIVA 3RPQA 5LEJA 1X36A 2W87A 3QBQA 3POSA 1VBE3 2WL1A 5C71A 4IETA 3LZZA 5GZGA 1CVNA 1B35A 4IE4A 2OZ6A 2Z79A 1APNA 5BNNC 3K77A 3C3VA 1ODNA 4Y4RA 2YV8A 4G4FA 1EAH3 2D44A 5C70A 5C3SA 3ROUA 1LOAA 2WO3A 5DAVA 2VVDA 2CGPA 1PZ9A 3UKTA 1ASJ1 3LPFA 4CP2A 4MGYE 1YFUA 1BEV2 5LK7B 1C5IA 1EV13 1GR3A 4LUKA 4COZA 4LIUA 1KFUL 1TZOA 4QQOA 4UFKA 4YZ2A 1W8WA 4KWKA 2EIBA 5ABJA 3VLBB 1GQPA 4Q0UA 3RZLA 4HANA 4OMCA 1ZBA2 3RZKA 3JBG3 1RMU2 5FZGA 2PLV2 5JUVA 5LASA 4CDWA 1UD1A 3I3DA 4LBOA 1S55A 1D2QA 3RYPA 1CPMA 2P17A 1CIYA 2BWAA 5FCCA 4BA6A 1QY4A 4N8MA 3OUIA 2HWB2 4CCOA 4N7UA 4ATEA 2LM3A 1YYNA 1SFPA 4CDWB 3TNQA 2HWC3 2WWSA 1HRV3 4BK5A 3HQUA 2JDMA 3T2PA 1XNKA 2HEYF 4YLZA 2YROA 1QJU2 3LFMA 1PVC1 5CBLA 5FYIA 1V6MA 1OLRA 4QGMA 2XH6A 4HSLA 3KF3A 2BNOA 4JDOA 3VBSC 2O0OA 2X09A 1V00A 4UI9L 3FUOA 4NMIA 1VRBA 4AVCA 5CYYA 2E26A 2GNTA 3ZXFA 4LO4B 2FCUA 4ZU4A 1J3RA 2DCJA 2ZGQA 5J37A 3N3HA 3MIFA 4DMIA 3QD6A 4Q4Y3 3SH4A 1UU4A 1D2SA 1MS5A 2B4KA 2ET1A 2YGLA 3E1F1 3K3NA 5DDJ1 5FBZA 2DUPA 1C57A 1JS9A 1LGCA 1GFF2 3AKQA 3WNLA 2PHFA 3WZ1A 2WQ8A 4BQXA 1IGOA 2JENA 1LNSA 3WW2A 1PO21 4HVQA 2WYFA 1MZEA 1OA3A 1FOD1 4Q0PA 2GN7A 1IS3A 1H8VA 2QVSB 1DQ0A 3V64A 3AFGA 3HBZA 3ZYJB 1W8FA 2HWF2 3RGBA 5KWRA 2WT1A 4XIKA 5DZGA 1ZZBA 1JZ4A 1Z7S3 1DCSA 3DPRB 2ZAHA 1N1SA 4AI9A 4EROA 4UOJA 1ULPA 2QCSB 4LOTA 1BVVA 4P9IA 2A7AA 4BMBA 1BK1A 3WY6A 3LGRA 3MIHA 4W65A 3C7OA 4LKEA 4D6RA 2WZ8A 4FVVA 3AP6A 2C6SA 3USSA 5JZGC 5LW9A 4NPRA 1TME1 2Z42A 1DGRA 3N9OA 3KT4A 4PQQA 1WCQA 5I0TA 3USUA 2QDNA 4AZZA 3AFKA 2FDGA 4FI9A 4EZHA 1H9PA 1S2BA 5JOYA 1LTEA 1HXS2 3VHNA 3ES1A 1RIRA 4YW7A 4D7YA 2OT7A 1LECA 1IHMA 4HSJA 1TMF2 2VW2A 4J25A 2YY1A 3ZSLA 1H8TA 2VAUA 2XL7A 2ZGOA 3JQWA 4Q2FA 1OD5A 2Y6HA 2PHLA 5I0DA 1I6XA 3TAYA 4D94A 2HWE3 1OFSA 2ZHLA 2C26A 5CB7A 2MHFA 2AZ5A 1IZ3A 1VBB2 2IUWA 2YC0A 1H0BA 3MHZA 5DN2A 4NIIA 5FO8B 4OMDA 2BGPA 5CKMA 2P3YA 2XUEA 3W5NA 3H1MA 1LOCA 1IQDC 2ZABA 4Y1XA 2JDAA 4LHLA 4LHSA 5LY2A 2ADEA 1D0GA 4P9XA 3E97A 2VO5A 1JZ7A 2ZAAA 3AKSA 3FC0A 5LBFA 2RG4A 1VR3A 4BIFA 4JQRA 1PIV3 1WZXA 2Y33A 1Q8PA 4QX5A 4QXBA 1NCQB 3VBUC 4UBHA 4MHRA 3WF1A 4E9KA 4YARA 1SEFA 1IQAA 1QNYA 2B45X 3Q8AA 1JYIA 1QOOA 4JVAA 3SEPA 1AR91 4JGZC 4X6QB 2PAEA 3T1MA 3ZM8A 4FBFA 2QFEA 1BQPA 2ZOEB 3V0AA 4XABA 1PMJX 4C90A 1UOGA 2WLPA 3KQ4B 3MICA 3AYDA 2ET7A 1RUD1 3W58A 3LF7A 5JR7B 3OJBA 1VAVA 2ZJCA 2Q8CA 4AEJA 1QOSA 4YM0A 2ZMNA 5DG2A 3V0AB 4ZY9A 3SKVA 4BU2A 1OT5A 1RMU3 4LLFA 1ZA4A 4D3WA 4Z1VA 1SLAA 2QQWA 5EJZB 2HBTA 3H0OA 1S1AA 4FFFA 1N1YA 4NIDA 1VJ2A 3KV4A 4UFJA 3BN6A 2RR12 2XXZA 3K46A 1CPNA 1UQXA 4Q29A 4QB1A 5EHDA 5GLUA 1OFNA 3FUQA 2VMEA 2HYXA 2FHRA 5CEHA 1AF9A 4BB3A 5FO9B 2AGSA 2GH2A 2VZ3A 4MOAA 1LENA 1DYKA 3BYWA 3AXEA 3M3EA 3ZR6A 4Z2WA 4H3WA 3KD4A 5JPNB 3OPTA 2WYSA 4YG6A 5FUNA 3S5QA 3POGA 2GMEA 2X8KA 2W08A 2YGMA 5EYXA 5KHHA 5IK5A 1ODMA 4URAA 2WN3A 3D0JA 2GMPA 3B9IA 3PL0A 2R0FA 3OSDA 4EWDA 1FMD2 4SLIA 1LOBA 4KU8A 2J7MA 4FOYA 3CO2A 5CKQA 2ZCWA 3N9QA 4H14A 5HXVA 1JTZX 1K45A 2VMCA 1POV3 3A22A 3T4VA 5FY9A 3T0DA 4WM7A 5FYYA 1E57A 2JEMA 3MO4A 1CJDA 2DVAA 1NYWA 5A80A 5TSWA 2P34A 3J8F3 3MV01 5CISA 1NY72 3J4UH 1UOFA 1Q56A 4FFHA 2VNOA 2QBXA 4MUVA 3S30A 3JD71 4XUQA 4LOSA 1YUDA 2WT2A 2XKOA 4HKLA 3J7HA 1NG0A 2DYCA 2A5ZA 2WR9A 2OYZA 1ND2A 1G9CA 4GULA 1FAYA 2Y34A 4YW1A 2HWF3 3P3PA 4CUCA 3VBHB 2DVFA 5FBJA 1F31A 4FOWA 2VCCA 1ZRRA 3BI3A 1C8M3 4WV8A 1ND2B 2RS11 2R063 3QLQA 3VZNA 5C4WA 2RS32 1W2NA 5A3LA 1GNYA 1MQTC 2N7GA 2BP6A 4AOCA 3LOBA 5IVFA 1BBT1 5JVVA 1KQRA 4MX3A 3OUJA 3I97A 1RUG1 2ORXA 1WCSA 5C4WB 3TWIA 4CDWC 2AUYA 4CCLA 3U0ZA 4IV1A 4AFDA 4QPIB 4M0NA 3V65A 1GSLA 2B42B 1ZZ9A 3ZXKA 2NM1A 2YUEA 5LK5A 2DF7A 3BTAA 5LA9A 5IJRA 4XFFA 4COYA 2CL2A 3WW4A 3NRUA 3AZYA 5JSOA 3GGLA 2BUKA 5FOJB 4BXFA 2ES3A 2FQPA 2XHKA 4RS5A 3MF9A 1VBA1 2IXHA 3WW3A 3C7EA 1MS8A 4I01A 3DYPA 4N90A 4K1YA 2R073 1VBB3 2P5BA 5J36A 4Z92B 1HX6A 1QJX2 4PF5A 1ZX5A 4WVZA 1M4WA 2NQYA 5FP3A 4RS5B 3EBRA 5T54A 2A6WA 4DUWA 5ACA3 1GICA 2VMFA 2IXJA 5A6XA 1UU5A 1AYM1 2OPWA 4NUBA 5C8CB 1X82A 3ELNA 4CSWA 2SLIA 1GU3A 4JKMA 2OKXA 3H8RA 1CAXB 2BBAA 2JECA 4OULA 1DQ5A 5BXXA 5LZ6A 1FPN3 1S0FA 1YQ8A 2VMDA 2WO1A 1RUJ2 4W6XA 2D97A 3WNXA 5GLWA 3WUDA 1K5MB 2QQJA 2Y60A 3NMBA 2A73B 1G9BA 4YGEA 4QMAA 1MVQA 4OHXA 2KD7A 3NNLA 3WG2A 3M2MA 1JU3A 1UXZA 3U37A 2UWAA 2VOWA 2XJRA 3GJBA 4OCTA 1UNBA 3AVSA 4NROA 4ET7A 4QX3A 3EB7A 4OUMA 5IVJA 3DPRC 1ZBE1 3GZEA 3C7HA 3ILNA 3ES4A 5GJ6A 4Q4X2 3WNOA 3KZ4C 3AJYA 4QKFA 1ZRCA 1UW8A 3LFIA 4GJZA 1HQNA 3SKJE 2JDKA 2VR4A 1DFQA 3I2KA 5IW0A 5HV0A 4LBNA 1VLNA 4GMP1 3ACLA 4Q4W1 5T5PA 2JDHA 4DRVA 3AZXA 3VN4A 5IWFA 4J1XA 1W05A 4AG4A 1BBT2 3THCA 5D2AA 4E2GA 1QXPA 3I2FA 1UY3A 4X8NA 4CCJA 5B2GB 1QJY3 1V9U1 2V72A 1O4TA 1HN1A 4ZONA 1IS5A 1RGSA 2QQIA 4GB32 1WKYA 5F2SA 3MI8A 2X53S 2K46A 3E5XA 3NNGA 4XUPA 3LQCA 3PURA 1D0HA 4QU2A 3ZR5A 1ZRFA 2VUCA 5AFBA 2GU9A 5FZOA 3A0NA 5J48A 4MGTA 1S0DA 1I9RA 3RG0A 1D4M1 4R9AA 4E8DA 2LW8A 2V5DA 1JOBA 4BXSV 2W5FA 3AKPA 5H9QA 5IAXA 1FMD3 2QE3A 2BGCA 2XMLA 5JIUA 3IZOA 4IW3A 5GLZA 4Y1VA 4NIAA 4CPBD 5JSPA 4N7IA 2VOTA 4RQPA 5KHGA 4Y4YA 5EP9A 1WWYA 2A3YA 1O4YA 4BH9A 3KSCA 1NCQC 1OD3A 2OIIA 2QJVA 1HV1A 3WNPA 4CEWA 4NR1A 4JX0A 4CXYA 2NLRA 3VKLA 4CXWA 2VOKA 4RQPB 2J1VA 3OGJA 5LRSA 5F6LB 4Q4V2 1R1A2 3SQOA 5CFCC 4CEWB 3MUZ1 1QGLA 1N1VA 4GQ7A 3H9AA 4UWDA 4U2AA 3WDYA 4W6YA 1BHGA 2Q8OA 3UGHA 4B7KA 1VBE1 2VZRA 5D1IA 1QQP2 4XURA 2V4VA 1NLRA 3R4UA 3OG2A 4EZ4A 1Z0HA 2VBDA 1DQ2A 4OYUA 3VDBA 1IG3A 2HH9A 1REDA 1X9PA 2DCZA 4Y1UA 3T2OA 2RS33 1LGNA 2ZA9A 5EPAA 2W1QA 1QDOA 3KT1A 4PDWA 5FMOL 3TOJA 3CHXA 2BYVE 3AKRA 3SEEA 4Q4W2 2XQRA 5AVPA 2RDQA 4MV2A 1QH7A 5K0UA 5JR2A 1MS9A 2XJQA 2F6BA 4JCKA 5FYVA 4CU8A 1LESA 4MO3M 2ZHMA 4XJWA 1UPIA 4OI0A 5IVEA 4YNIA 4AAPA 1OURA 4YZ3A 3KV9A 1TNRA 2VXJA 1UOJA 5K0UB 2VOXA 3JBG1 2JB8A 2XVKA 2EAAA 4QQPA 1XXNA 3L2YA 5A3UA 2UY8A 4OHVA
chains in the Genus database with same CATH topology
2Q8DA 5FXVA 4UF0B 3PUSA 5F39A 3AVSA 5FUPA 2GP3A 4QX7A 5CEHA 5FPLA 5FPVA 3K3NA 5FWJA 4GJYA 5FPUA 5IVJA 5FZFA 5E6HA 4CCMA 5A3PA 2YPDA 4BISA 5FP9A 3N9LA 5A3WA 2OQ6A 2WWUA 3OPTA 5FUNA 5ISLA 5F5AA 2OX0A 3KV6A 5FY4A 3AL5A 4GJZA 4URAA 5FZ7A 3LDBA 2OS2A 4QX8A 5A3NA 3K3OA 5IW0A 2VD7A 5FWEA 4IGOA 4GD4A 3ZLIA 4AI9A 5KR7A 3PU8A 5A7NA 3N9QA 5FZIA 2YBSA 5IWFA 3KVBA 5FY9A 3N9NA 2WWJA 3AVRA 4V2VA 5FY1A 5FYYA 5FY8A 4HONA 4D6RA 5F5CA 5FZCA 4CCJA 5A80A 5LW9A 4XDOA 5FYUA 4QXCA 3N9MA 3N9OA 5F2SA 4LIVA 5FZLA 5FYTA 5FP4A 5FPAA 4GAZA 5FYHA 3PURA 4E4HA 5FP8A 2Q8EA 4EZHA 5FZHA 3KV5A 5FZOA 5F3GA 2YU2A 3U4SA 4ASKA 5F3CA 5FYMA 5A3TA 5FZAA 2OT7A 3RVHA 2OQ7A 5FP7A 4EYUA 3DXUA 5FBJA 4Y4RA 5IVVA 2XMLA 5FZKA 5F5IA 5FYBA 5FY5A 5A7OA 3PTRB 3NJYA 5FJHA 4QWNA 5ANQA 3N9PA 3PUQA 4HOOA 5F37A 4LIUA 2XUEA 5FPBA 4D6QA 4V2WA 5IVFA 4TN7A 2PXJA 4IGQA 4D6SA 4CUGA 4CCNA 5FZ4A 5FZ0A 5FZEA 3KVAA 5LY2A 4CCLA 5F2WA 5FZGA 4QU1A 5LY1A 5F3IA 4LXLA 5FV3A 5FJKA 5FZ9A 5FZBA 4QXBA 5IVBA 5FZ6A 5FXZA 2GP5A 4IGPA 5A7PA 4DIQA 5FZ8A 5F3EA 4CCOA 4BXFA 5FZMA 4EZ4A 3PU3A 4XDPA 4Y33A 5FXXA 5FZOB 5LWBA 3UYJA 3DXTA 5FZDA 3AL6A 3K2OA 5FYSA 3ZPOA 2P5BA 5IVYA 5A1FA 4Y3OA 5IVCA 5A7WA 5FZ1A 4C8DA 4DO0A 5FYCA 5FP3A 5FYIA 5FYZA 3U78A 5FY0A 4QXHA 3LD8A 3PDQA 4NUBA 5FXWA 4CCKA 5A1LA 2XDVA 2Q8CA 4CSWA 5FYVA 5A7WB 2YBPA 4UF0A 5F32A 4BU2A 2W2IA 5A7SA 5IVEA 3OPWA 5K4LA 4AAPA 2YBKA 3KV9A 3PUAA 2YU1A 1VRBA 5A7QA 3KV4A 2XXZA 5FZ3A 4LITA 5FY7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q8D A;  5FXV A;  4UF0 B;  3PUS A;  5F39 A;  3AVS A;  5FUP A;  2GP3 A;  4QX7 A;  5CEH A;  5FPL A;  5FPV A;  3K3N A;  5FWJ A;  4GJY A;  5FPU A;  5IVJ A;  5FZF A;  5E6H A;  4CCM A;  5A3P A;  2YPD A;  4BIS A;  5FP9 A;  3N9L A;  5A3W A;  2OQ6 A;  2WWU A;  3OPT A;  5FUN A;  5ISL A;  5F5A A;  2OX0 A;  3KV6 A;  5FY4 A;  3AL5 A;  4GJZ A;  4URA A;  5FZ7 A;  3LDB A;  2OS2 A;  4QX8 A;  5A3N A;  3K3O A;  5IW0 A;  2VD7 A;  5FWE A;  4IGO A;  4GD4 A;  3ZLI A;  4AI9 A;  5KR7 A;  3PU8 A;  5A7N A;  3N9Q A;  5FZI A;  2YBS A;  5IWF A;  3KVB A;  5FY9 A;  3N9N A;  2WWJ A;  3AVR A;  4V2V A;  5FY1 A;  5FYY A;  5FY8 A;  4HON A;  4D6R A;  5F5C A;  5FZC A;  4CCJ A;  5A80 A;  5LW9 A;  4XDO A;  5FYU A;  4QXC A;  3N9M A;  3N9O A;  5F2S A;  4LIV A;  5FZL A;  5FYT A;  5FP4 A;  5FPA A;  4GAZ A;  5FYH A;  3PUR A;  4E4H A;  5FP8 A;  2Q8E A;  4EZH A;  5FZH A;  3KV5 A;  5FZO A;  5F3G A;  2YU2 A;  3U4S A;  4ASK A;  5F3C A;  5FYM A;  5A3T A;  5FZA A;  2OT7 A;  3RVH A;  2OQ7 A;  5FP7 A;  4EYU A;  3DXU A;  5FBJ A;  4Y4R A;  5IVV A;  2XML A;  5FZK A;  5F5I A;  5FYB A;  5FY5 A;  5A7O A;  3PTR B;  3NJY A;  5FJH A;  4QWN A;  5ANQ A;  3N9P A;  3PUQ A;  4HOO A;  5F37 A;  4LIU A;  2XUE A;  5FPB A;  4D6Q A;  4V2W A;  5IVF A;  4TN7 A;  2PXJ A;  4IGQ A;  4D6S A;  4CUG A;  4CCN A;  5FZ4 A;  5FZ0 A;  5FZE A;  3KVA A;  5LY2 A;  4CCL A;  5F2W A;  5FZG A;  4QU1 A;  5LY1 A;  5F3I A;  4LXL A;  5FV3 A;  5FJK A;  5FZ9 A;  5FZB A;  4QXB A;  5IVB A;  5FZ6 A;  5FXZ A;  2GP5 A;  4IGP A;  5A7P A;  4DIQ A;  5FZ8 A;  5F3E A;  4CCO A;  4BXF A;  5FZM A;  4EZ4 A;  3PU3 A;  4XDP A;  4Y33 A;  5FXX A;  5FZO B;  5LWB A;  3UYJ A;  3DXT A;  5FZD A;  3AL6 A;  3K2O A;  5FYS A;  3ZPO A;  2P5B A;  5IVY A;  5A1F A;  4Y3O A;  5IVC A;  5A7W A;  5FZ1 A;  4C8D A;  4DO0 A;  5FYC A;  5FP3 A;  5FYI A;  5FYZ A;  3U78 A;  5FY0 A;  4QXH A;  3LD8 A;  3PDQ A;  4NUB A;  5FXW A;  4CCK A;  5A1L A;  2XDV A;  2Q8C A;  4CSW A;  5FYV A;  5A7W B;  2YBP A;  4UF0 A;  5F32 A;  4BU2 A;  2W2I A;  5A7S A;  5IVE A;  3OPW A;  5K4L A;  4AAP A;  2YBK A;  3KV9 A;  3PUA A;  2YU1 A;  1VRB A;  5A7Q A;  3KV4 A;  2XXZ A;  5FZ3 A;  4LIT A;  5FY7 A; 
#chains in the Genus database with same CATH topology
 1RUH 1;  4S2D A;  2DUO A;  4KH9 A;  3PUS A;  4UT5 A;  1RC6 A;  1W9S A;  4LEJ A;  1IS4 A;  2GAL A;  4QHB A;  3BU7 A;  5A32 A;  2FBE A;  3OGV A;  5F9T A;  5C9A A;  4CCM A;  1DGL A;  3VD4 A;  2WAO A;  1XND A;  2HWC 1;  2FDJ A;  2E7Q A;  3MUY 1;  3O0X A;  1HRV 1;  2OXB A;  3FLT A;  2E7A A;  1OUS A;  1UMH A;  1OH3 A;  4Y20 A;  3QAC A;  3VHP A;  1KXG A;  1VAK A;  1E5S A;  5C9A B;  5FZ7 A;  4YRD A;  2RM2 3;  1GNZ A;  4MGZ E;  3VHO A;  5C6C A;  2ZX2 A;  3ZFF A;  1AR6 2;  2B46 X;  3OY8 A;  1JZ8 A;  3PU8 A;  1ZRD A;  4NHY A;  3U10 A;  3WIN E;  3GNE A;  3OCP A;  2XG3 A;  3MIE A;  1S0I A;  3POY A;  4CUB A;  2WIN B;  4CZS A;  1H9W A;  4UW4 A;  3HQX A;  1PZ8 A;  1T2X A;  1NLQ A;  4OUS A;  4Q0V A;  3ZFF B;  2GNB A;  2ZGL A;  4XOG A;  3OY8 B;  1W6M A;  2JG9 A;  3VBH C;  4CEY C;  4Y22 A;  2V4A A;  4ISQ A;  3WW1 A;  4Q4Y 1;  1QJF A;  3RMY A;  4NRQ A;  1AVB A;  2FDF A;  5LAT A;  4CP9 A;  4JAA A;  5L19 A;  4P9L A;  5FYH A;  3D0S A;  3S5A A;  1W6M B;  2JG9 B;  5LRR A;  4Y22 B;  1OLM A;  1PZ7 A;  3U4S A;  3M3O A;  4QDQ A;  5DAQ A;  2F17 A;  2VMI A;  5L9R A;  1PNF A;  4PIX A;  4EYU A;  4CP9 B;  1RUI 3;  3KT7 A;  3CJI A;  1EAH 2;  2AH2 A;  4FPC A;  5C4W C;  3BOD A;  1N3Q A;  5FYB A;  4QPI C;  1Q5O A;  1S0C A;  2E7T A;  2WS9 3;  4M4R A;  3VDC A;  3C7F A;  5F5Q A;  1X9T A;  1EV1 2;  2CY6 A;  3RQ0 A;  2XJV A;  4DZG A;  2IXK A;  1W2T A;  3CJI B;  1HRI 1;  3POW A;  4NHK A;  1MEC 1;  1ENQ A;  3KQR A;  4ZKT B;  1I3H A;  4YZ4 A;  4QM9 A;  1UKR A;  3H8X A;  3IBM A;  5FRA A;  1UYZ A;  3ZYP A;  4RHV 2;  2JJ6 A;  4B29 A;  3WNK A;  4JKK A;  1SHW B;  2WNO A;  4RS5 C;  4YVW A;  2BFU S;  2JG8 A;  1RUN A;  1XU2 A;  4I0W B;  4L8Q A;  2L9L A;  4YM1 A;  3U75 A;  4QDR A;  1H2M A;  4YFW A;  3ZKU A;  4FPF A;  5C8C C;  2IWG B;  3U1X A;  2I2S A;  1GUI A;  1BKZ A;  4A7K A;  1MS3 A;  1PM4 A;  3HWJ A;  3DXT A;  2JB4 A;  4KWU A;  5FZD A;  3AL6 A;  4YVW B;  1JYX A;  5GLT A;  2JG8 B;  1RUE 3;  3AM2 A;  3BTY A;  1K5M C;  2HWE 1;  3MBW A;  4ISR A;  1SLB A;  3LOI A;  3THP A;  3LIG A;  1FXZ A;  1SMV A;  1O5U A;  3LD8 A;  1W6N A;  4PBO A;  4A3X A;  3PTY A;  3BGA A;  5I8T A;  4AED B;  3PME A;  4TLG A;  1IS6 A;  3PJQ A;  2CU5 A;  1PGW 2;  4KG8 A;  5FK8 A;  3IDE A;  1W6N B;  1Y9M A;  4M0H A;  2W47 A;  4IEY A;  3GHN A;  4E2Q A;  4COU A;  4WM8 A;  2C9A A;  3IAP A;  1W8U A;  4KG0 A;  4ZS3 A;  4JKL A;  2LUW A;  1PIV 1;  4ONU A;  4P00 B;  4GWI A;  5FUP A;  4I09 A;  4R4X A;  2TEP A;  4XBQ A;  5BNP A;  4H7M A;  5FPU A;  1MR5 A;  4U36 A;  1JUH A;  4DPN A;  5FZF A;  4WM8 B;  2YPD A;  4IV3 A;  1V6J A;  2W1U A;  4Q8K A;  4BWO A;  2H0V A;  2VZT A;  1LCL A;  2GC1 A;  5BNP B;  1BEV 1;  2VE1 A;  2WNE A;  2V5Y A;  5J98 B;  2VGD A;  2P1B A;  2W94 A;  2WAA A;  4BQW A;  4EN8 B;  1H1A A;  2B9U A;  2OS2 A;  2WRA A;  3J7N A;  3K51 A;  4CCE A;  1Z7S 2;  2XJP A;  2YC2 A;  3DKW A;  3HQR A;  4JDM A;  5JCT A;  4COW A;  3ZLI A;  1RUC 2;  3NAP A;  3UJQ A;  4P9J A;  2RS5 2;  4M3C B;  2VM9 A;  4LHK A;  4M00 A;  3IT8 A;  1ZBA 1;  4FP3 A;  1RMU 1;  2PLV 1;  4GWJ A;  2DV9 A;  3BCW A;  2PEL A;  3NAP B;  1UY1 A;  1R1Z A;  1CAU A;  2OZJ A;  2HJI A;  2HWB 1;  4RFT 0;  3PVE A;  2W46 A;  3LCP A;  1XPW A;  2Y64 A;  3D8C A;  1XYP A;  2F4L A;  1O8P A;  1CAU B;  2LS6 A;  2ZHK A;  1UMI A;  1F15 A;  5D8A A;  4CDQ A;  5FAX A;  4B7E A;  1EPZ A;  1QJU 1;  2G19 A;  2EA7 A;  2W1W A;  5A33 A;  3EHK A;  2OQ7 A;  1DGR N;  4RQP C;  5CU1 A;  3AXD A;  3T1L A;  1AR6 3;  3KCX A;  3TYJ A;  3CDZ B;  3R4S A;  4ZU7 A;  5D8A B;  1AJK A;  1E5H A;  2D93 A;  1V6L A;  2BOI A;  4CEW C;  1WBF A;  3FJS A;  4D8M A;  1BCX A;  5A33 B;  3BTX A;  1WW5 A;  4QWN A;  1DQ1 A;  4X6R B;  1CAV A;  2BNN A;  1KEX A;  3RDI A;  3N9P A;  3ZSM A;  3N35 A;  4XUT A;  4XE9 A;  4XVH A;  4W8J A;  1ZZC A;  3IDB B;  1NCR A;  1Q8O A;  3FHI B;  4GXL A;  4TYS A;  4I0B A;  4DXS A;  3TEZ A;  2XLG A;  3ENR A;  3N7J A;  4PHZ A;  1OQ1 A;  5FZ4 A;  5IFT A;  5JXG A;  4GMP 0;  1CAV B;  3UET A;  3M8L A;  1KJL A;  1PIV 2;  4X8P A;  1NCR B;  3HJR A;  4QQH A;  4K21 A;  4AK3 A;  3CZJ A;  5FXZ A;  5IYY A;  3CQO A;  4IGP A;  2ZX1 A;  4AW7 A;  1LR5 A;  1NQD A;  1SLI A;  4C1X A;  1SBE A;  4AVV A;  4OQ8 A;  3ZDV A;  4XHX A;  4XXA A;  3ZFG A;  2ADD A;  4XDP A;  1B35 B;  5FDB A;  5FXX A;  1CQ9 A;  2HWF 1;  3MFA A;  2YPJ A;  1PMH X;  3WG3 A;  4CP0 A;  1OKO A;  2OA2 A;  3UK9 A;  5KHI A;  3N4M A;  1VE0 A;  4LJH A;  5A7W A;  1C8M 1;  2ZXQ A;  5FZ1 A;  3OGR A;  5FKC A;  2KXL A;  5K0U C;  5CG8 A;  2RMU 2;  3ZFG B;  1VB4 A;  4K7J A;  1PK6 A;  4W4Z A;  1JOP A;  4XAC A;  1JZ6 A;  2RE9 A;  1P8J A;  2Q1Z B;  2RDS A;  1ZZ8 A;  5T5L A;  2RJ2 A;  4AI3 A;  4JV4 A;  5A7W B;  4AFC A;  2SBA A;  2EID A;  4RHV 3;  2KA3 A;  2NZ9 A;  1PK6 B;  3KB5 A;  5K4L A;  5ABJ B;  3D82 A;  5A7Q A;  1R08 3;  3GF6 A;  3MEP A;  3ZXL A;  3WF0 A;  2KR2 A;  2E33 A;  3VDD A;  5G05 L;  4FAG A;  5C9A C;  1HXS 1;  1DZQ A;  2VBP A;  1IKP A;  2PQS A;  2XKP A;  1RJ7 A;  4AHX A;  2FD8 A;  4FPH A;  2DUQ A;  2D6N A;  3QOP A;  1O7F A;  1TMF 1;  4XAA A;  3UV9 A;  2FDI A;  4OHY A;  2BGO A;  2DFC A;  2PMW B;  5FP9 A;  5A6Q A;  2WFF 2;  5A3W A;  2WWU A;  1O6U A;  5ISL A;  1QJZ A;  5FY4 A;  1VBB 1;  2BER A;  3T0B A;  2VZO A;  3LPG A;  4I0A A;  4RR3 A;  4YW6 A;  3ZFF C;  2J1U A;  3L2H A;  1E5I A;  3K3O A;  5FO7 B;  3LA2 A;  2VCB A;  2AC1 A;  4C91 A;  2PA7 A;  3JUU A;  1X8E A;  5KR7 A;  4SBV A;  5FLH A;  5E89 A;  3OD0 A;  4AQ6 A;  4RR3 B;  2YBS A;  1L3J A;  2JG9 C;  2YFU A;  2D98 A;  4A3Z A;  4DEV A;  2EAK A;  4A41 A;  2JIC A;  1GP5 A;  3J8F 2;  4Q26 A;  4L92 A;  1SLL A;  2VG9 A;  3PVO A;  3UGG A;  1W9F A;  1F4A A;  4HZF A;  4A42 A;  5IK8 A;  5GZD A;  2NMO A;  5FZL A;  3X29 B;  5JAX A;  1J59 A;  5LBE A;  2ZGT A;  3OYW A;  5FPA A;  1UX6 A;  2CYF A;  1DHK B;  2IVI B;  4GAL A;  3KGL A;  2IFW A;  3VZL A;  2VMG A;  4XCA A;  4K6B A;  2DBN A;  2E63 A;  2YU2 A;  3AC0 A;  1JYC A;  3CJI C;  3GZA A;  4FXK B;  4GZ9 A;  4ITC A;  4QKD A;  5A3O A;  3WQ1 A;  1RHI 3;  2ZEY A;  1F5J A;  2R1B A;  3DXU A;  3INA A;  3OYW B;  1H4G A;  3ZXG A;  3BOW A;  1POQ A;  1C8M 2;  4R8H A;  1RUC 3;  2G9G A;  4N9I A;  4XMI A;  1YIP A;  3CLP A;  2RS5 3;  3HN3 A;  1UY0 A;  2R06 2;  3PVB B;  4QT6 A;  1UCX A;  1NT0 A;  1FV2 A;  2VBB A;  4RYD A;  3VD3 A;  4Z2A A;  4ARX A;  4IE0 A;  2OUJ A;  3RYR A;  5LEK A;  1LU2 A;  4XMA A;  1HIX A;  4IUG A;  3H8O A;  2QQU A;  5FPB A;  2RR1 1;  4S2H A;  4OHZ A;  1H30 A;  4TN7 A;  5APA A;  3ZN5 A;  4BM8 A;  1AR8 2;  4HG6 B;  5E1R A;  4AQT A;  2JIG A;  5HPO A;  3RSJ A;  1LOF A;  5L9V A;  1B09 A;  1OMI A;  2VQT A;  3NNF A;  1JI6 A;  4RL7 A;  4WZC A;  4YVW C;  1GZT A;  4QU1 A;  2VY0 A;  4AE2 A;  2JG8 C;  5IK7 A;  4XQW A;  3TB0 A;  5F3I A;  3A23 A;  5FJK A;  2E51 A;  4O9E A;  4CPB A;  3PJY A;  2R1D A;  3USU B;  2GDF A;  3RYK A;  1LOG A;  4XC9 A;  4AED C;  3PU3 A;  1VRH 3;  5JMO A;  2WQ4 A;  2R07 2;  4DXT A;  1FMD 1;  2VCM A;  4M01 A;  4RA0 A;  4HFS A;  1MAC A;  1H8T B;  1BYH A;  4IEO A;  1X50 A;  5J3U A;  3JU9 A;  4LLO A;  3MIB A;  5ACA 2;  1ND3 A;  3CBN A;  1ZRE A;  3RWK X;  3ZYH A;  3PDQ A;  1RIT A;  1Y9Q A;  5FXW A;  3WD5 A;  3AB0 A;  2BWC A;  1G6N A;  4F83 A;  3H3L A;  2A75 A;  2AEZ A;  3HVD A;  3Q8B A;  4EN9 B;  1FPN 2;  1NY7 1;  3FLR A;  1ENX A;  4WM8 C;  3M70 A;  3IM0 A;  1A3K A;  3WQ0 A;  1TE1 B;  2WT0 A;  3LKJ A;  3RJ2 X;  5BNP C;  3OBT A;  5GAL A;  5FY7 A;  3WNN A;  1OBN A;  1GMM A;  4XZP A;  1JZ3 A;  4B1M A;  3MID A;  1SBD A;  2BVB A;  4BCU A;  4LBQ D;  1DZR A;  2H6C A;  2RDN A;  4MXW A;  3B9C A;  5K8S A;  2GND A;  1ALY A;  1W0O A;  3HMY A;  3WP5 A;  2RMU 3;  1BLZ A;  1W39 A;  2XVG A;  4MLO A;  4S2F A;  2RS3 1;  2XHN A;  2QNK A;  3E6D A;  2E31 A;  1XE0 A;  3NAP C;  4XTM A;  4MXW B;  3O1S A;  1AXZ A;  4PT6 A;  5JIA A;  1QKQ A;  5FWE A;  4UW5 A;  3ZIX A;  4CE8 A;  3S6P A;  3VL9 A;  3LA7 A;  3P1I A;  1K12 A;  3I2O A;  2QQO A;  4IEP A;  4XPV A;  1WCU A;  5EV7 A;  1U5Z A;  3Q8F A;  5SV8 A;  2AAC A;  3GYD A;  4FFI A;  3TEX A;  1ZNP A;  3UT0 A;  1VBC 3;  5F5C A;  1QJY 2;  2D7F A;  2VPV A;  4Y1Y A;  3T3Y A;  3CZU A;  2XWJ B;  4MET A;  5D8A C;  3UKV A;  1DGW X;  2WFF 3;  3ZFE A;  4MGQ A;  2ARB A;  4MZU A;  4XYX A;  4TLF A;  2JKX A;  4Q5O A;  3KV5 A;  1QJX 1;  1RYY A;  3I8T A;  1YCI A;  5FKB A;  2CWM A;  5JI9 A;  4IND A;  4O61 A;  2CV6 A;  5IVV A;  2VTF A;  3FHQ A;  3ZVX A;  5F5I A;  4OI1 A;  4IEZ A;  2K2S A;  2OPK A;  5EJ3 A;  5ANN A;  3KF5 A;  3BUC A;  5BV6 A;  4N53 A;  4F7Z A;  1YIF A;  3ZXA C;  1NCR C;  5F1R A;  3AMM A;  1LHO A;  1RUJ 1;  4HK8 A;  1FAT A;  1BZW A;  3VZK A;  4AI2 A;  3VV1 A;  1S0J A;  4Y24 A;  4LMF A;  1J1T A;  1VIW B;  4IEX A;  1JU4 A;  4WM7 B;  5C5U A;  1B35 C;  1YFY A;  4N53 B;  3WF2 A;  4AWD A;  4CUA A;  4ASL A;  1UZV A;  1UL9 A;  4AYU A;  3ACH A;  1OH4 A;  5LY1 A;  4YW3 A;  4PLM A;  2FZ2 A;  3VKN A;  3BVC A;  2D6L X;  4NWW A;  4Q4X 1;  2E32 A;  1H6X A;  5FZ6 A;  3ZFG C;  5JDB A;  5FZ8 A;  2C4X A;  5FZM A;  1H2K A;  1NKG A;  4DY5 A;  1Y3T A;  4Y33 A;  5C5T A;  2LRP A;  3UYJ A;  3QH6 A;  2WZR 2;  2ZGU A;  1H2N A;  1PK6 C;  1O91 A;  3KGZ A;  3LSD A;  4LE3 A;  1JH5 A;  2VCA A;  1GKB A;  4ZXK A;  5ABJ C;  3NL1 A;  4FQZ A;  1ULD A;  2K0G A;  2Y6J A;  1V6O A;  2C5D A;  1O5L A;  1ZZ7 A;  4TSV A;  4E8C A;  1KGY A;  1YI7 A;  5I8S A;  1MZ5 A;  2A6X A;  4JHT A;  3RRD A;  1GP6 A;  4CCK A;  5GZC A;  3ILR A;  1AR8 3;  4URT A;  2A6Y A;  4AVB A;  3AMN A;  5A70 A;  4XXP A;  1TEI A;  3OBR A;  3I3E A;  4K20 A;  2HWD 3;  4UF0 A;  1ASJ 3;  2WO7 A;  3E6B A;  2V09 A;  4YGB A;  4AQ2 A;  4XFI A;  4GB3 1;  4QAW A;  2V73 A;  3IAQ A;  4IXL A;  4TTG A;  2XPJ A;  3SH3 A;  1W06 A;  5CG9 A;  4JDN A;  1YQC A;  2VZ1 A;  4IV1 B;  4QPG A;  4LIT A;  1NA1 A;  1V0A A;  2C0Z A;  2MEV 2;  4NWV A;  4UF0 B;  1OVP A;  1POV 0;  3V56 A;  3ACI A;  3EO6 A;  3O0V A;  5I0S A;  4QX7 A;  5F7U A;  1QXR A;  5FWJ A;  4COV A;  3PNA A;  2WQZ C;  4MGS A;  3DN7 A;  5BPX A;  3WVJ A;  5C3Q A;  4AR2 A;  1G8W A;  2IXL A;  4K9S A;  1NA1 B;  4RR3 C;  5B4X A;  3VZM A;  1HQL A;  4ASM B;  3DYM A;  5LA1 A;  1W8H A;  4DS0 A;  1WW4 A;  1SFN A;  1REF A;  2ZAC A;  4UFL A;  3ZYB A;  1SLT A;  1SFY A;  2RM2 2;  3O12 A;  4Z07 A;  5GM0 A;  4MYE A;  4YG0 A;  1ZRI A;  2X29 A;  4FSJ A;  4Q4V 1;  3DGT A;  5FZI A;  4LK6 A;  1R1A 1;  4HXC A;  3OF1 A;  4C0B A;  1SG3 A;  4XJA A;  2J1S A;  3NV2 A;  4OUE A;  1K42 A;  2WO2 A;  3ASI A;  4BLJ A;  3TEW A;  5T3N A;  1QQP 1;  4YSF A;  5B4N A;  4LE4 A;  1UIJ A;  2ARX A;  3PMS A;  4XFG A;  2ZZJ A;  4YW5 A;  4C1W A;  4FTB A;  3E5Q A;  5FRE A;  5BNO A;  1GLH A;  4HPK A;  2YDE A;  3TN9 3;  4YW4 A;  4E4H A;  5H9P A;  1Z78 A;  5AFE A;  2FDK A;  5J1X A;  4BQ4 A;  4B4Q A;  2G1M A;  3MPB A;  4ASK A;  3WXP A;  4B8E A;  4E2S A;  2QQV A;  5H9R A;  1UO9 A;  1RUI 2;  4HPK B;  5DDJ 3;  3RVH A;  5BNO B;  2GC3 A;  2JDY A;  3DL3 A;  4AHW A;  3K48 A;  3ZYI B;  5FMO S;  5KHK A;  2Y6G A;  2P4E A;  2XQX A;  2WS9 2;  2ARE A;  2CDO A;  3OUH A;  2CHH A;  3NNJ A;  3PTR B;  4R9C A;  1FV3 A;  4A2U A;  1DP0 A;  2ZGN A;  4K3U A;  1PO2 3;  2HBU A;  1WLC A;  4UFM A;  3SXW A;  4CCD A;  1FOD 3;  4CU7 A;  3WV6 A;  3N7K A;  4LKD A;  4GKX A;  5FR3 A;  3PUQ A;  3WNM A;  1RL3 A;  4H2A A;  4D6Q A;  4V2W A;  4IGQ A;  5H9S A;  1HB4 A;  1W0P A;  3FFQ A;  5DZF A;  1QIQ A;  1CN1 A;  1Q43 A;  4EN6 B;  3KVA A;  4FPK A;  3N36 A;  4KI5 M;  4FPJ A;  2Q30 A;  3CJX A;  4HKO A;  4XCB A;  3AP4 A;  3BIW E;  3AX4 A;  1H8T C;  1WMD A;  3ETQ A;  2QUO A;  1EY2 A;  1RXF A;  1UYX A;  4OI2 A;  2PHD A;  3O7O A;  2VNV A;  2A3X A;  1O8S A;  4FT8 A;  4XFC A;  2WNU A;  3VBR A;  2P3I A;  3H7J A;  5I8Y A;  4JZR A;  4AEK A;  4BQY A;  5FZO B;  3WF3 A;  1J1L A;  4QXK A;  1AX2 A;  1UN1 A;  2WJS A;  2NN8 A;  1RUE 2;  1AR6 1;  1S4C A;  2DCT A;  4RD7 A;  3SHR A;  3MIG A;  4YFZ A;  2WNU B;  4NHL A;  1AUY A;  3UES A;  3LDK A;  4AL9 A;  3PUH A;  2QQP A;  1YEW A;  4ZXE A;  3O0W A;  2VQ0 A;  3P3N A;  2ILM A;  3UL2 A;  2E9Q A;  3O1U A;  2PHT A;  1URX A;  1ENS A;  1UMZ A;  4A6O A;  3VZJ A;  1BXH A;  1C5H A;  3R4D B;  1KD7 A;  3GZT B;  1JBC A;  1O4Z A;  1W0N A;  2B5H A;  3EYP A;  1YQ6 A;  2D5H A;  5BY5 A;  4DIN B;  3N7L A;  2Z2S B;  1UY4 A;  4BE3 A;  1FNZ A;  4IQP A;  4NIG A;  3H7Y A;  4KWL A;  1A34 A;  2CTV A;  4NPM A;  4TWT A;  5IAT A;  2LTN A;  1HB2 A;  2H6B A;  3HD8 B;  3U4X A;  3WQB A;  2W95 A;  4RN5 A;  2EIG A;  5IUQ A;  1W28 A;  2WZR 3;  3IDA A;  1EAH 1;  4XQD A;  3NV4 A;  3B7M A;  1PHM A;  1SBF A;  1HJF A;  2EXH A;  3LEK A;  3M3C A;  4LO8 A;  2BJS A;  1VMJ A;  1HLC A;  1EV1 1;  1W2U A;  1YFW A;  1F9K A;  3B02 A;  3M1H A;  4JGY A;  4MH0 E;  3TBD A;  4K1Z A;  1O3Q A;  4PDW B;  5FLJ A;  1AR9 3;  1OOP A;  2DU1 A;  2ARA A;  2BRT A;  4XF3 A;  2HKX A;  3P5B A;  2AYH A;  3HT1 A;  4NPL A;  1WMX A;  2GC2 A;  3AZV A;  2GMM A;  1J83 A;  3DKQ A;  4JGY B;  4QB2 A;  4RHV 1;  4LPL A;  3BPZ A;  4QM8 A;  3EJK A;  3ZYG A;  4A7Y A;  1OOP B;  4GH4 A;  2MEV 3;  2R32 A;  4YZ1 A;  1CZV A;  4XTP A;  4AFM A;  1YHF A;  1T6B X;  3RZZ A;  1NAE A;  4G9S B;  1BK0 A;  4GH4 B;  5JXJ A;  3UNP A;  5FP8 A;  1Q8S A;  5EXO A;  4L0P A;  1Y4W A;  3IWZ A;  4P02 B;  5A32 B;  4UBG A;  4HK9 A;  1OLQ A;  2BTV C;  5CIR A;  5F3G A;  3U11 A;  1OC1 A;  3WP4 A;  3FMG A;  2TNF A;  5FZA A;  1NXM A;  3T2Q A;  3O1V A;  1M06 G;  1YQ2 A;  2HYK A;  3ZN6 A;  4A7Z A;  2VTX A;  4WM7 C;  1YI9 A;  2VUJ A;  2A6V A;  2HEW F;  4N53 C;  1A8D A;  3KS7 A;  4Y20 B;  1W3V A;  2QQK A;  2W0X A;  4BQ1 A;  5FPZ A;  1CJP A;  1XU1 A;  1PGW 1;  2OW4 A;  4HN1 A;  4NN0 A;  2IC1 A;  2LRO A;  5ANQ A;  1GZ9 A;  3ZN6 B;  3PHM A;  2A1X A;  3HNM A;  2W1S A;  3J26 N;  3VL8 A;  4MG2 A;  1W8Z A;  5FUI A;  2BW8 A;  4CP1 A;  4CUG A;  5FZE A;  1L7R A;  1ND2 C;  3ETP A;  1L7Q A;  3FN9 A;  1UZY A;  3SCF A;  4D7T A;  2NP0 A;  2FMY A;  5EIY B;  5FZ9 A;  1AL2 2;  3A4U A;  5JXH A;  3LA3 A;  1US3 A;  3VD5 A;  4CDX A;  4CDU A;  5I93 A;  2CGN A;  2VW0 A;  2YHJ A;  4DIQ A;  3KM5 A;  4QB6 A;  3AP9 A;  3VDA A;  2HLE A;  1W8N A;  2BBV A;  2Y0O A;  4AF9 A;  3CNA A;  2YZ4 A;  1MS1 A;  2P6H A;  1NX9 A;  5KXE A;  1RHI 1;  2ZKL A;  2D3R A;  1QMJ A;  4CDU B;  4CDX B;  1Z7S 1;  3JD7 3;  3IMM A;  5A1F A;  1JZ5 A;  1RUC 1;  2JXA A;  3Q8C A;  4UW6 A;  5SV5 A;  2RS5 1;  4DO0 A;  2VOV A;  1SLC A;  3AMP A;  3LE0 A;  4IV1 C;  4UXA A;  5T5J A;  2DU0 A;  3SMH A;  1PGL 1;  3V0B A;  4QXH A;  1G7Y A;  5A1L A;  4QDS A;  3L9J T;  4XBL A;  1LAJ A;  4WZF A;  2VZQ A;  1A8M A;  4WVW A;  1JMU B;  3I7D A;  4Q8L A;  1W6Q A;  1S0G A;  2Y6F A;  1VBD 2;  2W9X A;  2RS1 3;  4FPY A;  1GZW A;  1WA4 A;  2W2I A;  1C1F A;  4P9G A;  1NA1 C;  2F4P A;  1R08 2;  1YRZ A;  1WD3 A;  2R30 A;  4XJ9 A;  2R49 A;  5FK7 A;  5GZE A;  1RJ8 A;  5KXB A;  1W6Q B;  2P37 A;  3GBG A;  4KL1 A;  4S2G A;  5FPV A;  4EQV A;  4LK7 A;  3FWE A;  5A3P A;  4OFG A;  1QWR A;  5DAX A;  1VRH 1;  3D6E A;  2OQ6 A;  4QPW A;  1COV 2;  1GWL A;  1NOV A;  5L9B A;  1KDK A;  3KV6 A;  2A3W A;  1RXG A;  4XF1 A;  4XQ4 A;  1FYU A;  1UKG A;  2C24 A;  3B3Q E;  1TQ5 A;  4G3Y C;  4Q27 A;  3GJA A;  4E4Z A;  3ZSE A;  3ON7 A;  3OGS A;  3ZPY A;  5A3N A;  3TEY A;  1WUV A;  3ZXJ A;  1W9Y A;  4IGO A;  2I07 B;  2MNG A;  5CNA A;  1YLL A;  2G9Z A;  4BPZ A;  2J1E A;  3NJV A;  4IES A;  1JOJ A;  1ZYB A;  4V1P A;  4XIL A;  1SQ4 A;  3PVN A;  3KVB A;  1N3O A;  3AVR A;  4LBQ A;  5FMC A;  4FPG A;  3ZIW A;  1A6C A;  1UOB A;  2AEN A;  3BIE A;  2VZV A;  4FPE A;  5BNO C;  1G9A A;  2HEV F;  1PX3 A;  4Q0Q A;  3HIF A;  1W2O A;  4LO5 B;  4BME A;  1F4H A;  4LBQ B;  4ZU5 A;  2JD4 A;  5FLI A;  1LKN A;  3CIH A;  1K5J A;  1LJ7 A;  1R09 3;  5FMD A;  1ULF A;  3W9A A;  3OD4 A;  1Y9G A;  3S7E A;  1ENR A;  1RHI 2;  3C2U A;  1HB1 A;  3LB9 A;  4IV3 B;  2RMU 1;  4AI8 A;  2Q5T A;  2VL4 A;  2XB6 C;  2XBO 3;  3AZW A;  1ZBE 3;  2DTW A;  5FY5 A;  2VH9 A;  4AGG A;  1V6N A;  3HAG A;  4P5Y A;  1PGL 2;  5KHJ A;  1ONA A;  4P14 A;  3ZXD A;  5F37 A;  4MXV A;  2JDZ A;  4W50 A;  3JB8 A;  3I3M A;  4FTE A;  4QPY A;  3MPP G;  1VBC 1;  1CX4 A;  2IVJ A;  1XYN A;  1PGS A;  5DZE A;  5A1A A;  3H50 A;  1CIW A;  4QHZ A;  2XLA A;  4AI0 A;  4A45 A;  1U5X A;  5EYY A;  1JUI A;  3BTZ A;  2WNU C;  1YQ5 A;  3K4Z A;  4LXL A;  3OEA A;  4FP2 A;  4CXX A;  2WFF 1;  2VXR A;  2VW1 A;  3ZX7 A;  2Z4F A;  1C28 A;  1V9U 3;  3HR9 A;  5JI7 A;  3TRS B;  2KM2 A;  1VRH 2;  3ZYF A;  2X10 A;  4DXZ A;  3MYX A;  3PIG A;  4L97 A;  1UPS A;  4CDQ B;  3CF6 E;  2W68 A;  3ME2 A;  4GIQ A;  1GQG A;  1ULG A;  3SCG A;  1VPH A;  2CWS A;  2PQQ A;  5IVC A;  1JHJ A;  3TNP B;  1RUF 2;  1POV 1;  1D4M 3;  1WD4 A;  1XSR A;  1F35 A;  3BOP A;  3POF A;  4KQ7 A;  5CVR A;  4AVT A;  1AR7 3;  5FY0 A;  3ALQ A;  3GDB A;  3J8F 1;  2X5I A;  4N9H A;  1EYB A;  4UYB A;  4A44 A;  2D3S A;  1GOH A;  5HI0 A;  5FQ0 A;  2YBK A;  3PUA A;  4WBB A;  1AL2 3;  5JSR A;  4QKB A;  2DWR A;  2P6C A;  1YC6 1;  4LBK A;  4LHN A;  2X5I B;  5F6K A;  2Q8D A;  5I0R A;  4KBB A;  1AL0 G;  5C3P A;  1H1M A;  4HT1 T;  2B7Y A;  4PDW C;  5FQ0 B;  4KWJ A;  1BJQ A;  5KC5 A;  3GCX A;  4Q1P A;  4FAH A;  3A7Q A;  1UZ0 A;  4YGC A;  4YW2 A;  1ULC A;  2PHR A;  2R06 1;  4JGY C;  3F95 A;  4XEZ A;  2ZZQ A;  3RZJ A;  3MV1 1;  1AYN 2;  4LO7 A;  1OOP C;  3MW2 A;  2ORZ A;  2UYB A;  2RJL A;  3AYC A;  5IFP A;  1VP6 A;  4LBJ A;  3C7G A;  4FFG A;  5JOZ A;  5DXD A;  1S2E A;  1XJA A;  1YFX A;  2VD7 A;  3WDT A;  4DUV A;  2OVU A;  3ECQ A;  1VBD 3;  1DU3 D;  2CDP A;  3O5S A;  1AR8 1;  4BK4 A;  2EAL A;  2WDB A;  4GH4 C;  2VU9 A;  2HWD 1;  3N9N A;  1GOF A;  3POB A;  3ITQ A;  3I2H A;  3GAL A;  5FIX A;  4CCC A;  3PLQ A;  1VBC 2;  3W5M A;  5HXM A;  5AVA A;  4QQ2 A;  3WF4 A;  2D3P A;  4O7X A;  1IPS A;  5AC9 2;  3LIH A;  2QDR A;  3LEI A;  4LOR A;  5K9Y A;  3VKF C;  4AGV A;  1MQT A;  3III A;  5CKN A;  5LA0 A;  3AP5 A;  4NHX A;  3VDD B;  4CYD A;  3IN9 A;  3SC7 X;  1Q8V A;  2YFZ A;  1COV 3;  2R07 1;  2TBV A;  5FZH A;  1RUH 3;  3B00 A;  4OI4 A;  5F3C A;  5JMC A;  2H0B A;  1MQT B;  1YO8 A;  5ACA 1;  5FP7 A;  5FMB A;  5M0T A;  1IKQ A;  2O8Q A;  2BU9 A;  4AQS A;  1KS5 A;  2Z5W A;  3B93 A;  5FZK A;  1BMV 1;  1N1T A;  3MLK A;  1V70 A;  2D43 A;  2ZKN A;  4LBL A;  1YWK A;  3IIA A;  4EWA A;  3WHT A;  1DBN A;  1FPN 1;  1KJR A;  1OA2 A;  4NAO A;  1STM A;  1LEM A;  3KCY A;  4DEQ A;  2BV4 A;  1OF3 A;  1U12 A;  2RHP A;  4HOO A;  5DAW A;  3VZO A;  3LSE A;  3DEC A;  1IOA A;  4I02 A;  2R04 2;  4IL7 A;  2WZE A;  1W8O A;  1TNF A;  1JYN A;  2XL9 A;  3LEM A;  4CDU C;  4CDX C;  2GC0 A;  5F2W A;  4QD2 A;  3ZDS A;  1FT9 A;  2UU8 A;  5KC6 A;  2WKK A;  5CZK A;  1HKD A;  3TN9 1;  5IVB A;  2W39 A;  1RVF 2;  1GP4 A;  2BZD A;  2GP5 A;  4FO9 A;  5F3E A;  2XJS A;  3SLI A;  1J3Q A;  3GZU C;  3M3Q A;  1HW5 A;  5LWB A;  3AKT A;  3BKZ A;  3I49 A;  3VBF A;  1NZI A;  5EZW A;  5T52 A;  4DXR A;  4DUX A;  2D40 A;  5BNQ A;  1ULE A;  3LDR A;  4WVV A;  1PO1 3;  2X05 A;  1SCS A;  4BOW A;  3DPR A;  1WMF A;  3VBF B;  1MS4 A;  3SCH A;  3NNM A;  1ZVF A;  4MGK E;  3RS6 A;  1QJY 1;  1N3P A;  3THD A;  3WQ7 A;  4KGG A;  1S2K A;  2HWD 2;  1ASJ 2;  1QDC A;  2ZBJ A;  4BYY A;  2JDU A;  3PUI A;  2XGX A;  4RFR B;  2DVG A;  1Y43 B;  3B5L B;  4PI0 A;  2WSV A;  4L2N A;  4OZX A;  3IB3 A;  3NV3 A;  1HRI 3;  2R6Q A;  1D4V B;  3DEM A;  2DVB A;  2ERF A;  5GLV A;  1MEC 3;  1EUU A;  1HV0 A;  5EFU A;  4XDQ A;  4QX2 A;  3WG4 A;  4ES9 A;  4EJR A;  5FXV A;  1C4R A;  2WNV A;  1TVG A;  1YJK A;  3A0K A;  3EMR A;  2GP3 A;  4XF0 A;  4Y5T A;  1Q8Q A;  1W6O A;  1H6Y A;  3MFC A;  3R6S A;  4XIO A;  4NVP A;  4O9G A;  1I1E A;  4LR4 A;  2NMN A;  1X33 A;  4BQ2 A;  2DDU A;  1RUF 3;  3O14 A;  2WNV B;  3WHU A;  4D0Q A;  1XNA A;  4QGL A;  2EXK A;  2BNM A;  2WAB A;  1UX7 A;  1W6O B;  3K75 B;  1BMV 2;  3WUC A;  3NWK A;  2ID4 A;  1GOG A;  1AHS A;  4UW3 A;  1FNY A;  1DF0 A;  4FPL A;  4JRA A;  4DY3 A;  4KMQ A;  1ND3 B;  4UFI A;  2A70 A;  2PTM A;  5CAD A;  1PVC 2;  2QQM A;  1UZW A;  5GZF A;  2PYT A;  3Q8E A;  1D7P M;  3CU7 A;  4FXG B;  1R64 A;  3S7I A;  3VBO A;  2I45 A;  1NQJ A;  3I2J A;  1NZC A;  2JIJ A;  4IV3 C;  5FZC A;  1XC6 A;  2XLF A;  3H1Y A;  3WLU A;  1PX4 A;  2RDR A;  4ARY A;  1AX0 A;  1WW6 A;  5IAV A;  3O1T A;  4LKF A;  1NCQ A;  5JXI A;  5FYT A;  3TN9 2;  4XHB A;  3O1O A;  1CES A;  4GWN A;  3VBO B;  5FP4 A;  2QKD A;  2R0H A;  1W99 A;  4DNY A;  2E6V A;  2WZR 1;  3K4A A;  3ZO0 B;  3W20 A;  1AYN 3;  1XQN A;  1OF4 A;  5C3O A;  5CFC A;  5A3T A;  4MAD A;  5DDJ 2;  4L99 A;  1YXW A;  3SIT A;  1LB2 A;  4LUL A;  2BPA 2;  4HL0 A;  4CU9 A;  4OLL A;  2ATF A;  2O14 A;  1ACC A;  2ETE A;  3S57 A;  4JTO A;  3U07 A;  5FOB B;  3FFZ A;  2VC9 A;  2ZX3 A;  5I0U A;  1L7L A;  1PO2 2;  5CFC B;  5EJ1 B;  1FOD 2;  1US2 A;  2J1A A;  1BEV 3;  3RI9 A;  1SAC A;  2IZW A;  3FHA A;  4BIO A;  5AC9 3;  1WLW A;  5CA6 A;  2Y38 A;  3ZYR A;  1RB8 G;  2MEV 1;  1JYV A;  4CDQ C;  5LB6 A;  2IXC A;  5FZ0 A;  3U14 A;  4XFB A;  4DRR A;  2DUR A;  4Y26 A;  1YNA A;  1ZBA 3;  3J9S A;  1LED A;  3AMH A;  4O65 A;  4XBN A;  4YYO A;  2PLV 3;  4I3G A;  1J58 A;  1QNW A;  3I4I A;  4YVS A;  5L7O A;  2EVX A;  5A7P A;  1TME 2;  4UFH A;  1LHN A;  2C9K A;  3ZFE B;  4BLI A;  2HWB 3;  2ZEW A;  1G86 A;  2VZS A;  3AYE A;  2O1Q A;  2RM2 1;  4Y1Z A;  1DDL A;  2BEO A;  5HCH A;  3NJZ A;  5DAB A;  2I74 A;  4YVS B;  4CU6 A;  5L7O B;  2RVA A;  5IVY A;  1OKQ A;  4AXO A;  2IFR A;  1UY2 A;  2BVV A;  1UYY A;  1QJU 3;  2QQN A;  3WDU A;  4B4P A;  2X5I C;  2NPI A;  1OA4 A;  1RIN A;  2W52 A;  2XOM A;  3W59 A;  5JOX A;  1JXN A;  2R04 3;  5JWP A;  2GSY A;  1CR7 A;  4AAX A;  3AZZ A;  1AXY A;  2JDP A;  3OBA A;  5F32 A;  2VEC A;  4Y5S A;  4OQ9 A;  4YGD A;  3H3U A;  3RNS A;  4JRL A;  5DPN A;  3B01 A;  3KLS A;  1I5Z A;  4NHM A;  1XBF A;  3I59 A;  2R7E B;  1ZM1 A;  1CWP A;  1RVF 3;  5T50 A;  1AZD A;  4I30 A;  3POI A;  4E4D X;  4AHZ A;  3G6J B;  4JQT A;  4N43 A;  3NKT A;  3D4K A;  5F39 A;  1PNG A;  2VUD A;  1W3X A;  1J3P A;  1RUI 1;  5J96 B;  1REE A;  4GJY A;  3I59 B;  5C33 A;  3AYA A;  5E6H A;  3QH7 A;  1OXC A;  4BIS A;  3VBH A;  4CEY A;  2BQP A;  2WS9 1;  4N43 B;  5F5A A;  4OVE A;  2GAU A;  4L11 A;  2ENR A;  2ZEX A;  3MF6 A;  4LA3 A;  3AL5 A;  4WVM A;  5CAZ A;  2J42 A;  2A6Z A;  5FFO C;  1C1L A;  2PN5 A;  4QX8 A;  1AR9 2;  2VMH A;  1G9D A;  1UXX X;  2Q4S A;  4KGQ A;  3UGF A;  4CEY B;  4FCA A;  2Y6L A;  4QQL A;  4GD4 A;  3I54 A;  4FPO B;  5DG1 A;  5DUX A;  3VDD C;  3BU0 A;  3RZH A;  1FI2 A;  1K3I A;  2FZ1 A;  5BYN A;  5KXC A;  1UYP A;  2DTY A;  4WVM B;  3IPV A;  4HKW A;  1O3S A;  2FMD A;  4H55 A;  4LQR A;  5IK4 A;  2EXI A;  1RUD 2;  4HON A;  3T08 A;  1OLM E;  2J1R A;  4QPI A;  2P2K A;  3CKH A;  2ZML A;  2W92 A;  2VTX J;  4XDO A;  4AHY A;  4LNV A;  3N9M A;  3IPV B;  3NST A;  4XFA A;  5LBC A;  5J09 A;  1SPP A;  4QPG B;  5FYC A;  4GAZ A;  1SDD B;  2AEY A;  2Y26 A;  5DUV A;  3WDV A;  4QGN A;  2QZ3 A;  2Q8E A;  3ZSJ A;  1EUT A;  1RUE 1;  1DG6 A;  4PIY A;  1JYT A;  3DUI A;  1HXS 3;  4DQA A;  1SPP B;  2ZMK A;  3WEZ A;  2WUH A;  3H8U A;  2B9V A;  3ATG A;  3LEG A;  1T6G C;  1TMF 3;  3O1M A;  4BJ0 A;  3GBW A;  4CA9 A;  4RGK A;  3CEW A;  4BHP A;  4AGR A;  2ZTN A;  1PVC 3;  1HB3 A;  1N47 A;  1JN2 P;  1XE8 A;  3OGG A;  4R52 A;  4PIZ A;  5C8C A;  1LHV A;  3IDC B;  1GWM A;  2D6O X;  2PHX A;  1F2N A;  3HOB A;  3I2D A;  3OOX A;  3W21 A;  1CAX A;  2YC4 A;  4D69 A;  3NJX A;  5E88 A;  4GWM A;  4YG3 A;  4I2O A;  2ZX0 A;  3WP3 A;  5T55 A;  4P9Y A;  1K5M A;  5DUU A;  4XJ8 A;  3RMX A;  3WCR A;  1QF3 A;  4CCN A;  1S0E A;  1SZB A;  4HVO A;  3VKO A;  4EN0 A;  4QKN A;  3NV1 A;  1WA6 X;  1XSQ A;  4P5H A;  3WX5 A;  5FV3 A;  2TUN A;  2ZGR A;  2DFB A;  3ABZ A;  4B1L A;  1LGB A;  3H1W A;  2WBK A;  5ERL A;  4JHZ A;  4P08 A;  3BPS A;  3VBF C;  3WDX A;  1JZ2 A;  2PAK A;  1MZ6 A;  4J1W A;  1R09 1;  2D5F A;  2CSG A;  1W8T A;  3UJO A;  2D6K A;  1OI6 A;  1JHN A;  2GN3 A;  2UWB A;  2GZW A;  2LAL A;  1H4H A;  3JD7 2;  3BB6 A;  4QX1 A;  2EIC A;  3APB A;  3ZPO A;  2XBO 1;  3AK0 A;  3KCC A;  4IEU A;  4YM3 A;  5LCW L;  4Y5Z 0;  3I3B A;  4C8D A;  1DIW A;  4EE2 A;  2PAM A;  1LOF C;  3M7A A;  3MDP A;  4PBP A;  4HLT A;  3JCI A;  4AFB A;  3U78 A;  4IE7 A;  4FOQ A;  1GZC A;  3A21 A;  3NQH A;  1KS4 A;  2WFP A;  2RS1 2;  2YBP A;  4BQ5 A;  1EPW A;  3BAL A;  2PHW A;  3POJ A;  4BQ3 A;  3VUO A;  1LHU A;  1C3H A;  3EXU A;  3GM8 A;  2WNV C;  4IEW A;  4RGG A;  1LU1 A;  2ZEZ A;  4DFS A;  4H7L A;  2RR1 3;  1TME 3;  2ARC A;  3WP6 A;  2JE8 A;  1RUG 2;  4M3C E;  4RGA A;  3PIJ A;  3GCW A;  2ZHN A;  2RV9 A;  4BDV B;  2DBI A;  3T4H B;  4F8A A;  1VMF A;  2J1T A;  4F3J A;  1ND3 C;  1OQD A;  3H3Z A;  3GXU A;  1FX5 A;  3T09 A;  5CFD A;  3VBR B;  1QH6 A;  4XF9 A;  4YPJ A;  1VMH A;  1PMI A;  3M4F A;  3ZOI A;  3GHM A;  1BVP 1;  1WW7 A;  4HBN A;  1VBA 2;  1DGW A;  3VB9 A;  3LDB A;  1YJL A;  4K8F A;  5C8W A;  4XUO A;  5CFD B;  1W03 A;  1AR7 1;  4L9B A;  4NE9 A;  5E16 A;  2VVE A;  2P3K A;  5A3M A;  3O1P A;  1IPJ A;  3E5U A;  4CTE A;  1XYO A;  1CON A;  5A7N A;  2PFW A;  3VBO C;  1W90 A;  3P6B A;  1F5F A;  1UWW A;  1DYO A;  1KIT A;  2Y8K A;  1IPK A;  1OPM A;  5T5O A;  1AYM 2;  2UYA A;  3FE5 A;  4QHO A;  4MVT A;  2YXS A;  4XAE A;  1AL2 1;  3F2Z A;  3OPZ A;  4AI1 A;  1VAL A;  4YZ5 A;  4PCR A;  4M3C F;  4D7S A;  1MVE A;  4RSU A;  3S0M A;  1AX1 A;  2XJT A;  2J22 A;  2ZGK A;  3WT3 A;  3ZKY A;  1XNC A;  4JC1 A;  5FPX A;  3MZH A;  2EXJ A;  5FTT C;  1Y7B A;  2FCT A;  3MLJ A;  4EN7 B;  4E27 A;  3RZG A;  2W91 A;  4ZZ8 A;  1R09 2;  1TG7 A;  2CAU A;  3AJZ A;  2VJX A;  3I2I A;  1DYP A;  1XRU A;  3C8X A;  3OTF A;  4Q1R A;  3ZXE A;  5JLV A;  3EQE A;  5FYM A;  4ES8 A;  2R16 A;  3OBZ A;  3LAG A;  1GNH A;  4NAM A;  2VQA A;  3VGI A;  3GBF A;  1U0A A;  1XB9 A;  4PI2 A;  3ZN4 A;  3O1R A;  2XBO 2;  1QEX A;  1U5I A;  1ZBE 2;  3KWV A;  4ZS2 A;  5JPM B;  5BNN A;  2VUA A;  5A6Z A;  4I3P A;  3QCW A;  1C8N A;  1OUX A;  2GNM A;  5FJH A;  1VBD 1;  1UIK A;  1RUD 3;  4MHU A;  1OQE A;  4AVS A;  1R08 1;  5J7M A;  2QTW B;  3RFR A;  3N7M A;  1E5R A;  3B94 A;  5BNN B;  3CL1 A;  4LA2 A;  3ZFE C;  1WGP A;  2XJU A;  5DQ0 A;  4YWA A;  1DLL A;  2ZGS A;  4BZ4 A;  4YVS C;  5L7O C;  5HCA A;  1LOE A;  1MS0 A;  3J7M A;  1Q3E A;  5C3R A;  4M4P A;  2ZX4 A;  3FX3 A;  5FZB A;  3FBY A;  2CNA A;  1V9U 2;  1COV 1;  4GKY A;  1DZT A;  3HEI A;  4K40 A;  2Y6K A;  2G9F A;  3URF A;  4FOV A;  2XWB B;  5DMY A;  2WLQ A;  4LKS A;  2VVF A;  2VNR A;  5LBB A;  2PHU A;  3FLP A;  3K2O A;  4PJY A;  5FYS A;  3SIS A;  4R4Z A;  1QJX 3;  1D4M 2;  4GA9 A;  1XNB A;  2VUL A;  4XZU G;  4DOU A;  1AR7 2;  1W6P A;  1XOY A;  2DVD A;  4IEQ A;  4B3N A;  1W04 A;  2XDV A;  1GYK A;  5HCB A;  2IXI A;  4W6W A;  3JXS A;  4NJ4 A;  5A7S A;  1WLD A;  1W6P B;  3OPW A;  3VBS A;  2FCV A;  1RUJ 3;  2YG0 A;  2MPF A;  4N43 C;  5L73 A;  3LWC A;  1LUL A;  2EIE A;  2NYY A;  4EWE A;  1O3T A;  3DV8 A;  3ZMN A;  4LBM A;  4LO6 B;  3E6C C;  2FDH A;  3VBS B;  2EF6 A;  5D21 A;  1CAW A;  4XUN A;  1KRI A;  2GH8 A;  1OPO A;  2ZS6 B;  1W2A X;  3DYO A;  3WG1 A;  3ST7 A;  3UKN A;  3AMQ A;  3M3I A;  1VBE 2;  3HNY M;  4Q4X 3;  1NE6 A;  4OZO A;  5K7P A;  4AVA A;  4JTN A;  4KBZ A;  4MSV A;  1SCR A;  1CAW B;  1QJE A;  1OVS A;  2JE7 A;  4P9W A;  1CX1 A;  2UY9 A;  2P3J A;  1PO1 1;  2D6M A;  4PLN A;  2W3J A;  1UAI A;  1OSG A;  3IKW A;  4HET A;  4UAP A;  1AJO A;  5DUW A;  4QPG C;  4XET A;  2XON A;  2D6P A;  1WCD J;  2VNG A;  3V0B B;  2JX9 A;  4LUM A;  1QU0 A;  2WA3 A;  4ORF A;  1XNT A;  1U5Y A;  3Q9O A;  3ZMO A;  4FQ4 A;  5FY1 A;  2E53 A;  1BBT 3;  3RJR A;  4PLO A;  1GZW B;  1RUG 3;  2UWC A;  4ZZ5 A;  4R9D A;  4Z82 A;  1IG0 A;  5HCF A;  1GWK A;  1GQH A;  4QXC A;  3OEB A;  1DQ6 A;  2K9Z A;  4IDZ A;  4AEM A;  4GB3 3;  1ZA7 A;  3VHR A;  3RZM A;  3JBG 2;  4QX0 A;  4CVU A;  5F8P A;  1HN0 A;  2WA4 A;  1RUH 2;  1O59 A;  1VB2 A;  1A78 A;  3MLL A;  3I2G A;  5E8A A;  2B8M A;  1UZZ A;  2OUH A;  1VBA 3;  3JZV A;  3I3Q A;  1RUF 1;  2Z69 A;  2WSU A;  1QHD A;  1JW6 A;  3DF0 A;  1RTV A;  3HPN A;  3HBK A;  4IE5 A;  2CAV A;  3B69 A;  4Z8B A;  2XUM A;  2Q0A A;  3ORJ A;  3AP7 A;  5IHR A;  1DLC A;  1LRH A;  3IMN A;  4E4S A;  1W9W A;  2HWC 2;  1PVX A;  5DAP A;  3KHB A;  4EV0 A;  5A7O A;  1HRV 2;  3MW4 A;  1O3R A;  1OHF A;  3NJY A;  4YM2 A;  3D5O A;  2YB7 A;  3RWN A;  4IE6 A;  4AFA A;  2VZU A;  4C0H A;  4AED A;  1WCK A;  1AYM 3;  1GV9 A;  3NVC A;  1WLT A;  1S0B A;  3DCQ A;  3MGU A;  2YMZ A;  4A4A A;  3SH5 A;  5I91 A;  3NO8 A;  3VD7 A;  2PXJ A;  3HT2 A;  1MZF A;  5G04 L;  1DQ4 A;  1H2L A;  4D6S A;  1AXK A;  3WDW A;  5HBA A;  3VD9 A;  1UF2 C;  2JDN A;  3HNB M;  4Q4V 3;  1X7N A;  3KMH A;  3KHC A;  1R1A 3;  4NO4 A;  3CMG A;  5JOW A;  3JB4 C;  4Q0S A;  4DB5 A;  2YYO A;  3G7D A;  1QQP 3;  2UUR A;  4HMZ A;  1X8M A;  4IER A;  4PF1 A;  2WII B;  1AYN 1;  4Q4Y 2;  3NKG A;  4NRP A;  3VBU A;  3VKM A;  3K4D A;  3WSO A;  4ATF A;  4NIH A;  1KFX L;  1G9F A;  5HV4 A;  4IEV A;  1WBL A;  3ILF A;  5EQU A;  1CZS A;  4ZPI A;  1NE4 A;  2ZGM A;  3ZSK A;  4NRM A;  3SNM A;  4Y3O A;  2RJK A;  2JD9 A;  1PO1 2;  1NUK A;  3FL7 A;  1GBG A;  2O8O A;  1J84 A;  4JGZ A;  3VBU B;  5KBF A;  2B39 A;  5L36 A;  2QQL A;  2JKB A;  5FYZ A;  5GKA C;  4GMP 3;  1NLS A;  4Q4W 3;  3FZ3 A;  4KNC A;  4M3C A;  1HQW A;  4HN0 A;  1MPX A;  2XR4 A;  2Q1M A;  3ACF A;  3H42 B;  4XJZ A;  5AC9 1;  4FTS A;  2G4I A;  4JGZ B;  4A6S A;  1V6K A;  4CRQ A;  5JZG A;  2VQU A;  4PQ9 A;  2ZPX A;  5EWS A;  3WOG A;  3VBR C;  4K8R B;  3MW3 A;  1HRI 2;  1JYW A;  2YU1 A;  1MEC 2;  4R9B A;  2WN2 A;  3T0A A;  1HJG A;  1W9T A;  5FZ3 A;  2BOJ A;  1EP0 A;  1XE7 A;  3T2T A;  2JE9 A;  1CD3 G;  3POE A;  1UU6 A;  4XW3 A;  2WZP P;  5JZG B;  2Y0I A;  5LA2 A;  1GAN A;  1ZZ6 A;  2BDR A;  5CFD C;  5FPL A;  3NW4 A;  5C7G A;  2QZ2 A;  4XF4 A;  2BFU L;  4B4R A;  4ZHN A;  4LT5 A;  1F8V A;  2C1F A;  1QOT A;  3JQX A;  1SDW A;  2JWP A;  4TXW A;  3N9L A;  3WCS A;  1PM7 A;  4NOT A;  1LHW A;  2DCY A;  1NXD 1;  2CGO A;  2OX0 A;  3HN1 A;  4J6G A;  2ZGP A;  3FBM A;  1I5P A;  1H1I A;  1V6I A;  5IT6 A;  1HDK A;  1ULO A;  3R0R A;  4KU7 A;  2A71 A;  2WC2 A;  1WME A;  1CGP A;  1JOD A;  1LOD A;  4LTA A;  1KDM A;  4OHW A;  4TZD A;  3D3A A;  5A6Y A;  1VAM A;  2R04 1;  3R05 A;  2HWE 2;  2VZP A;  3ACG A;  2DCK A;  4HVR A;  2Q1F A;  2WWJ A;  4V2V A;  1RUO A;  5FY8 A;  3J7L A;  3OB8 A;  5KXD A;  4MGI E;  3THT A;  2AR6 A;  1CZT A;  4XJU A;  1RVF 1;  3T30 A;  4XFH A;  5FYU A;  5BUV A;  3WR0 A;  1QXJ A;  2XVL A;  3RI8 A;  1ST8 A;  4LIV A;  3RPQ A;  5LEJ A;  1X36 A;  2W87 A;  3QBQ A;  3POS A;  1VBE 3;  2WL1 A;  5C71 A;  4IET A;  3LZZ A;  5GZG A;  1CVN A;  1B35 A;  4IE4 A;  2OZ6 A;  2Z79 A;  1APN A;  5BNN C;  3K77 A;  3C3V A;  1ODN A;  4Y4R A;  2YV8 A;  4G4F A;  1EAH 3;  2D44 A;  5C70 A;  5C3S A;  3ROU A;  1LOA A;  2WO3 A;  5DAV A;  2VVD A;  2CGP A;  1PZ9 A;  3UKT A;  1ASJ 1;  3LPF A;  4CP2 A;  4MGY E;  1YFU A;  1BEV 2;  5LK7 B;  1C5I A;  1EV1 3;  1GR3 A;  4LUK A;  4COZ A;  4LIU A;  1KFU L;  1TZO A;  4QQO A;  4UFK A;  4YZ2 A;  1W8W A;  4KWK A;  2EIB A;  5ABJ A;  3VLB B;  1GQP A;  4Q0U A;  3RZL A;  4HAN A;  4OMC A;  1ZBA 2;  3RZK A;  3JBG 3;  1RMU 2;  5FZG A;  2PLV 2;  5JUV A;  5LAS A;  4CDW A;  1UD1 A;  3I3D A;  4LBO A;  1S55 A;  1D2Q A;  3RYP A;  1CPM A;  2P17 A;  1CIY A;  2BWA A;  5FCC A;  4BA6 A;  1QY4 A;  4N8M A;  3OUI A;  2HWB 2;  4CCO A;  4N7U A;  4ATE A;  2LM3 A;  1YYN A;  1SFP A;  4CDW B;  3TNQ A;  2HWC 3;  2WWS A;  1HRV 3;  4BK5 A;  3HQU A;  2JDM A;  3T2P A;  1XNK A;  2HEY F;  4YLZ A;  2YRO A;  1QJU 2;  3LFM A;  1PVC 1;  5CBL A;  5FYI A;  1V6M A;  1OLR A;  4QGM A;  2XH6 A;  4HSL A;  3KF3 A;  2BNO A;  4JDO A;  3VBS C;  2O0O A;  2X09 A;  1V00 A;  4UI9 L;  3FUO A;  4NMI A;  1VRB A;  4AVC A;  5CYY A;  2E26 A;  2GNT A;  3ZXF A;  4LO4 B;  2FCU A;  4ZU4 A;  1J3R A;  2DCJ A;  2ZGQ A;  5J37 A;  3N3H A;  3MIF A;  4DMI A;  3QD6 A;  4Q4Y 3;  3SH4 A;  1UU4 A;  1D2S A;  1MS5 A;  2B4K A;  2ET1 A;  2YGL A;  3E1F 1;  3K3N A;  5DDJ 1;  5FBZ A;  2DUP A;  1C57 A;  1JS9 A;  1LGC A;  1GFF 2;  3AKQ A;  3WNL A;  2PHF A;  3WZ1 A;  2WQ8 A;  4BQX A;  1IGO A;  2JEN A;  1LNS A;  3WW2 A;  1PO2 1;  4HVQ A;  2WYF A;  1MZE A;  1OA3 A;  1FOD 1;  4Q0P A;  2GN7 A;  1IS3 A;  1H8V A;  2QVS B;  1DQ0 A;  3V64 A;  3AFG A;  3HBZ A;  3ZYJ B;  1W8F A;  2HWF 2;  3RGB A;  5KWR A;  2WT1 A;  4XIK A;  5DZG A;  1ZZB A;  1JZ4 A;  1Z7S 3;  1DCS A;  3DPR B;  2ZAH A;  1N1S A;  4AI9 A;  4ERO A;  4UOJ A;  1ULP A;  2QCS B;  4LOT A;  1BVV A;  4P9I A;  2A7A A;  4BMB A;  1BK1 A;  3WY6 A;  3LGR A;  3MIH A;  4W65 A;  3C7O A;  4LKE A;  4D6R A;  2WZ8 A;  4FVV A;  3AP6 A;  2C6S A;  3USS A;  5JZG C;  5LW9 A;  4NPR A;  1TME 1;  2Z42 A;  1DGR A;  3N9O A;  3KT4 A;  4PQQ A;  1WCQ A;  5I0T A;  3USU A;  2QDN A;  4AZZ A;  3AFK A;  2FDG A;  4FI9 A;  4EZH A;  1H9P A;  1S2B A;  5JOY A;  1LTE A;  1HXS 2;  3VHN A;  3ES1 A;  1RIR A;  4YW7 A;  4D7Y A;  2OT7 A;  1LEC A;  1IHM A;  4HSJ A;  1TMF 2;  2VW2 A;  4J25 A;  2YY1 A;  3ZSL A;  1H8T A;  2VAU A;  2XL7 A;  2ZGO A;  3JQW A;  4Q2F A;  1OD5 A;  2Y6H A;  2PHL A;  5I0D A;  1I6X A;  3TAY A;  4D94 A;  2HWE 3;  1OFS A;  2ZHL A;  2C26 A;  5CB7 A;  2MHF A;  2AZ5 A;  1IZ3 A;  1VBB 2;  2IUW A;  2YC0 A;  1H0B A;  3MHZ A;  5DN2 A;  4NII A;  5FO8 B;  4OMD A;  2BGP A;  5CKM A;  2P3Y A;  2XUE A;  3W5N A;  3H1M A;  1LOC A;  1IQD C;  2ZAB A;  4Y1X A;  2JDA A;  4LHL A;  4LHS A;  5LY2 A;  2ADE A;  1D0G A;  4P9X A;  3E97 A;  2VO5 A;  1JZ7 A;  2ZAA A;  3AKS A;  3FC0 A;  5LBF A;  2RG4 A;  1VR3 A;  4BIF A;  4JQR A;  1PIV 3;  1WZX A;  2Y33 A;  1Q8P A;  4QX5 A;  4QXB A;  1NCQ B;  3VBU C;  4UBH A;  4MHR A;  3WF1 A;  4E9K A;  4YAR A;  1SEF A;  1IQA A;  1QNY A;  2B45 X;  3Q8A A;  1JYI A;  1QOO A;  4JVA A;  3SEP A;  1AR9 1;  4JGZ C;  4X6Q B;  2PAE A;  3T1M A;  3ZM8 A;  4FBF A;  2QFE A;  1BQP A;  2ZOE B;  3V0A A;  4XAB A;  1PMJ X;  4C90 A;  1UOG A;  2WLP A;  3KQ4 B;  3MIC A;  3AYD A;  2ET7 A;  1RUD 1;  3W58 A;  3LF7 A;  5JR7 B;  3OJB A;  1VAV A;  2ZJC A;  2Q8C A;  4AEJ A;  1QOS A;  4YM0 A;  2ZMN A;  5DG2 A;  3V0A B;  4ZY9 A;  3SKV A;  4BU2 A;  1OT5 A;  1RMU 3;  4LLF A;  1ZA4 A;  4D3W A;  4Z1V A;  1SLA A;  2QQW A;  5EJZ B;  2HBT A;  3H0O A;  1S1A A;  4FFF A;  1N1Y A;  4NID A;  1VJ2 A;  3KV4 A;  4UFJ A;  3BN6 A;  2RR1 2;  2XXZ A;  3K46 A;  1CPN A;  1UQX A;  4Q29 A;  4QB1 A;  5EHD A;  5GLU A;  1OFN A;  3FUQ A;  2VME A;  2HYX A;  2FHR A;  5CEH A;  1AF9 A;  4BB3 A;  5FO9 B;  2AGS A;  2GH2 A;  2VZ3 A;  4MOA A;  1LEN A;  1DYK A;  3BYW A;  3AXE A;  3M3E A;  3ZR6 A;  4Z2W A;  4H3W A;  3KD4 A;  5JPN B;  3OPT A;  2WYS A;  4YG6 A;  5FUN A;  3S5Q A;  3POG A;  2GME A;  2X8K A;  2W08 A;  2YGM A;  5EYX A;  5KHH A;  5IK5 A;  1ODM A;  4URA A;  2WN3 A;  3D0J A;  2GMP A;  3B9I A;  3PL0 A;  2R0F A;  3OSD A;  4EWD A;  1FMD 2;  4SLI A;  1LOB A;  4KU8 A;  2J7M A;  4FOY A;  3CO2 A;  5CKQ A;  2ZCW A;  3N9Q A;  4H14 A;  5HXV A;  1JTZ X;  1K45 A;  2VMC A;  1POV 3;  3A22 A;  3T4V A;  5FY9 A;  3T0D A;  4WM7 A;  5FYY A;  1E57 A;  2JEM A;  3MO4 A;  1CJD A;  2DVA A;  1NYW A;  5A80 A;  5TSW A;  2P34 A;  3J8F 3;  3MV0 1;  5CIS A;  1NY7 2;  3J4U H;  1UOF A;  1Q56 A;  4FFH A;  2VNO A;  2QBX A;  4MUV A;  3S30 A;  3JD7 1;  4XUQ A;  4LOS A;  1YUD A;  2WT2 A;  2XKO A;  4HKL A;  3J7H A;  1NG0 A;  2DYC A;  2A5Z A;  2WR9 A;  2OYZ A;  1ND2 A;  1G9C A;  4GUL A;  1FAY A;  2Y34 A;  4YW1 A;  2HWF 3;  3P3P A;  4CUC A;  3VBH B;  2DVF A;  5FBJ A;  1F31 A;  4FOW A;  2VCC A;  1ZRR A;  3BI3 A;  1C8M 3;  4WV8 A;  1ND2 B;  2RS1 1;  2R06 3;  3QLQ A;  3VZN A;  5C4W A;  2RS3 2;  1W2N A;  5A3L A;  1GNY A;  1MQT C;  2N7G A;  2BP6 A;  4AOC A;  3LOB A;  5IVF A;  1BBT 1;  5JVV A;  1KQR A;  4MX3 A;  3OUJ A;  3I97 A;  1RUG 1;  2ORX A;  1WCS A;  5C4W B;  3TWI A;  4CDW C;  2AUY A;  4CCL A;  3U0Z A;  4IV1 A;  4AFD A;  4QPI B;  4M0N A;  3V65 A;  1GSL A;  2B42 B;  1ZZ9 A;  3ZXK A;  2NM1 A;  2YUE A;  5LK5 A;  2DF7 A;  3BTA A;  5LA9 A;  5IJR A;  4XFF A;  4COY A;  2CL2 A;  3WW4 A;  3NRU A;  3AZY A;  5JSO A;  3GGL A;  2BUK A;  5FOJ B;  4BXF A;  2ES3 A;  2FQP A;  2XHK A;  4RS5 A;  3MF9 A;  1VBA 1;  2IXH A;  3WW3 A;  3C7E A;  1MS8 A;  4I01 A;  3DYP A;  4N90 A;  4K1Y A;  2R07 3;  1VBB 3;  2P5B A;  5J36 A;  4Z92 B;  1HX6 A;  1QJX 2;  4PF5 A;  1ZX5 A;  4WVZ A;  1M4W A;  2NQY A;  5FP3 A;  4RS5 B;  3EBR A;  5T54 A;  2A6W A;  4DUW A;  5ACA 3;  1GIC A;  2VMF A;  2IXJ A;  5A6X A;  1UU5 A;  1AYM 1;  2OPW A;  4NUB A;  5C8C B;  1X82 A;  3ELN A;  4CSW A;  2SLI A;  1GU3 A;  4JKM A;  2OKX A;  3H8R A;  1CAX B;  2BBA A;  2JEC A;  4OUL A;  1DQ5 A;  5BXX A;  5LZ6 A;  1FPN 3;  1S0F A;  1YQ8 A;  2VMD A;  2WO1 A;  1RUJ 2;  4W6X A;  2D97 A;  3WNX A;  5GLW A;  3WUD A;  1K5M B;  2QQJ A;  2Y60 A;  3NMB A;  2A73 B;  1G9B A;  4YGE A;  4QMA A;  1MVQ A;  4OHX A;  2KD7 A;  3NNL A;  3WG2 A;  3M2M A;  1JU3 A;  1UXZ A;  3U37 A;  2UWA A;  2VOW A;  2XJR A;  3GJB A;  4OCT A;  1UNB A;  3AVS A;  4NRO A;  4ET7 A;  4QX3 A;  3EB7 A;  4OUM A;  5IVJ A;  3DPR C;  1ZBE 1;  3GZE A;  3C7H A;  3ILN A;  3ES4 A;  5GJ6 A;  4Q4X 2;  3WNO A;  3KZ4 C;  3AJY A;  4QKF A;  1ZRC A;  1UW8 A;  3LFI A;  4GJZ A;  1HQN A;  3SKJ E;  2JDK A;  2VR4 A;  1DFQ A;  3I2K A;  5IW0 A;  5HV0 A;  4LBN A;  1VLN A;  4GMP 1;  3ACL A;  4Q4W 1;  5T5P A;  2JDH A;  4DRV A;  3AZX A;  3VN4 A;  5IWF A;  4J1X A;  1W05 A;  4AG4 A;  1BBT 2;  3THC A;  5D2A A;  4E2G A;  1QXP A;  3I2F A;  1UY3 A;  4X8N A;  4CCJ A;  5B2G B;  1QJY 3;  1V9U 1;  2V72 A;  1O4T A;  1HN1 A;  4ZON A;  1IS5 A;  1RGS A;  2QQI A;  4GB3 2;  1WKY A;  5F2S A;  3MI8 A;  2X53 S;  2K46 A;  3E5X A;  3NNG A;  4XUP A;  3LQC A;  3PUR A;  1D0H A;  4QU2 A;  3ZR5 A;  1ZRF A;  2VUC A;  5AFB A;  2GU9 A;  5FZO A;  3A0N A;  5J48 A;  4MGT A;  1S0D A;  1I9R A;  3RG0 A;  1D4M 1;  4R9A A;  4E8D A;  2LW8 A;  2V5D A;  1JOB A;  4BXS V;  2W5F A;  3AKP A;  5H9Q A;  5IAX A;  1FMD 3;  2QE3 A;  2BGC A;  2XML A;  5JIU A;  3IZO A;  4IW3 A;  5GLZ A;  4Y1V A;  4NIA A;  4CPB D;  5JSP A;  4N7I A;  2VOT A;  4RQP A;  5KHG A;  4Y4Y A;  5EP9 A;  1WWY A;  2A3Y A;  1O4Y A;  4BH9 A;  3KSC A;  1NCQ C;  1OD3 A;  2OII A;  2QJV A;  1HV1 A;  3WNP A;  4CEW A;  4NR1 A;  4JX0 A;  4CXY A;  2NLR A;  3VKL A;  4CXW A;  2VOK A;  4RQP B;  2J1V A;  3OGJ A;  5LRS A;  5F6L B;  4Q4V 2;  1R1A 2;  3SQO A;  5CFC C;  4CEW B;  3MUZ 1;  1QGL A;  1N1V A;  4GQ7 A;  3H9A A;  4UWD A;  4U2A A;  3WDY A;  4W6Y A;  1BHG A;  2Q8O A;  3UGH A;  4B7K A;  1VBE 1;  2VZR A;  5D1I A;  1QQP 2;  4XUR A;  2V4V A;  1NLR A;  3R4U A;  3OG2 A;  4EZ4 A;  1Z0H A;  2VBD A;  1DQ2 A;  4OYU A;  3VDB A;  1IG3 A;  2HH9 A;  1RED A;  1X9P A;  2DCZ A;  4Y1U A;  3T2O A;  2RS3 3;  1LGN A;  2ZA9 A;  5EPA A;  2W1Q A;  1QDO A;  3KT1 A;  4PDW A;  5FMO L;  3TOJ A;  3CHX A;  2BYV E;  3AKR A;  3SEE A;  4Q4W 2;  2XQR A;  5AVP A;  2RDQ A;  4MV2 A;  1QH7 A;  5K0U A;  5JR2 A;  1MS9 A;  2XJQ A;  2F6B A;  4JCK A;  5FYV A;  4CU8 A;  1LES A;  4MO3 M;  2ZHM A;  4XJW A;  1UPI A;  4OI0 A;  5IVE A;  4YNI A;  4AAP A;  1OUR A;  4YZ3 A;  3KV9 A;  1TNR A;  2VXJ A;  1UOJ A;  5K0U B;  2VOX A;  3JBG 1;  2JB8 A;  2XVK A;  2EAA A;  4QQP A;  1XXN A;  3L2Y A;  5A3U A;  2UY8 A;  4OHV A; 
#chains in the Genus database with same CATH homology
 2Q8D A;  5FXV A;  4UF0 B;  3PUS A;  5F39 A;  3AVS A;  5FUP A;  2GP3 A;  4QX7 A;  5CEH A;  5FPL A;  5FPV A;  3K3N A;  5FWJ A;  4GJY A;  5FPU A;  5IVJ A;  5FZF A;  5E6H A;  4CCM A;  5A3P A;  2YPD A;  4BIS A;  5FP9 A;  3N9L A;  5A3W A;  2OQ6 A;  2WWU A;  3OPT A;  5FUN A;  5ISL A;  5F5A A;  2OX0 A;  3KV6 A;  5FY4 A;  3AL5 A;  4GJZ A;  4URA A;  5FZ7 A;  3LDB A;  2OS2 A;  4QX8 A;  5A3N A;  3K3O A;  5IW0 A;  2VD7 A;  5FWE A;  4IGO A;  4GD4 A;  3ZLI A;  4AI9 A;  5KR7 A;  3PU8 A;  5A7N A;  3N9Q A;  5FZI A;  2YBS A;  5IWF A;  3KVB A;  5FY9 A;  3N9N A;  2WWJ A;  3AVR A;  4V2V A;  5FY1 A;  5FYY A;  5FY8 A;  4HON A;  4D6R A;  5F5C A;  5FZC A;  4CCJ A;  5A80 A;  5LW9 A;  4XDO A;  5FYU A;  4QXC A;  3N9M A;  3N9O A;  5F2S A;  4LIV A;  5FZL A;  5FYT A;  5FP4 A;  5FPA A;  4GAZ A;  5FYH A;  3PUR A;  4E4H A;  5FP8 A;  2Q8E A;  4EZH A;  5FZH A;  3KV5 A;  5FZO A;  5F3G A;  2YU2 A;  3U4S A;  4ASK A;  5F3C A;  5FYM A;  5A3T A;  5FZA A;  2OT7 A;  3RVH A;  2OQ7 A;  5FP7 A;  4EYU A;  3DXU A;  5FBJ A;  4Y4R A;  5IVV A;  2XML A;  5FZK A;  5F5I A;  5FYB A;  5FY5 A;  5A7O A;  3PTR B;  3NJY A;  5FJH A;  4QWN A;  5ANQ A;  3N9P A;  3PUQ A;  4HOO A;  5F37 A;  4LIU A;  2XUE A;  5FPB A;  4D6Q A;  4V2W A;  5IVF A;  4TN7 A;  2PXJ A;  4IGQ A;  4D6S A;  4CUG A;  4CCN A;  5FZ4 A;  5FZ0 A;  5FZE A;  3KVA A;  5LY2 A;  4CCL A;  5F2W A;  5FZG A;  4QU1 A;  5LY1 A;  5F3I A;  4LXL A;  5FV3 A;  5FJK A;  5FZ9 A;  5FZB A;  4QXB A;  5IVB A;  5FZ6 A;  5FXZ A;  2GP5 A;  4IGP A;  5A7P A;  4DIQ A;  5FZ8 A;  5F3E A;  4CCO A;  4BXF A;  5FZM A;  4EZ4 A;  3PU3 A;  4XDP A;  4Y33 A;  5FXX A;  5FZO B;  5LWB A;  3UYJ A;  3DXT A;  5FZD A;  3AL6 A;  3K2O A;  5FYS A;  3ZPO A;  2P5B A;  5IVY A;  5A1F A;  4Y3O A;  5IVC A;  5A7W A;  5FZ1 A;  4C8D A;  4DO0 A;  5FYC A;  5FP3 A;  5FYI A;  5FYZ A;  3U78 A;  5FY0 A;  4QXH A;  3LD8 A;  3PDQ A;  4NUB A;  5FXW A;  4CCK A;  5A1L A;  2XDV A;  2Q8C A;  4CSW A;  5FYV A;  5A7W B;  2YBP A;  4UF0 A;  5F32 A;  4BU2 A;  2W2I A;  5A7S A;  5IVE A;  3OPW A;  5K4L A;  4AAP A;  2YBK A;  3KV9 A;  3PUA A;  2YU1 A;  1VRB A;  5A7Q A;  3KV4 A;  2XXZ A;  5FZ3 A;  4LIT A;  5FY7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...