3U4SA

Histone lysine demethylase jmjd2a in complex with t11c peptide substrate crosslinked to n-oxalyl-d-cysteine
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
345
structure length
345
Chain Sequence
b'LNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysine-specific demethylase 4A
publication title Linking of 2-Oxoglutarate and Substrate Binding Sites Enables Potent and Highly Selective Inhibition of JmjC Histone Demethylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase substrate
total genus 106
structure length 345
sequence length 345
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2011-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3u4sA01
3AVRA 5FP3A 5IVYA 3RVHA 3LD8A 2Q8CA 2XMLA 2YPDA 4AI9A 4Y3OA 2YU1A 5FP8A 3PTRB 4IGOA 2P5BA 3PUAA 3PUQA 5A3PA 5FZOB 4UF0B 5FYIA 4QX8A 5F2SA 4EZHA 4C8DA 5IWFA 3KVAA 4E4HA 4QX7A 3U78A 3DXUA 5LY1A 4GAZA 4QXBA 5F5CA 4V2VA 5FPLA 4BXFA 5F3GA 4QXCA 5FZ1A 5A7WB 4CCMA 5A80A 3KV6A 5A3NA 3N9NA 3PU3A 5A1FA 5IVCA 2OQ7A 4BU2A 3K3NA 5F5AA 5FXVA 5E6HA 3LDBA 4DIQA 5FWJA 3OPWA 3N9MA 4Y4RA 5F37A 5ANQA 5FYCA 5FXXA 5LY2A 4CCJA 2GP5A 4URAA 5FYZA 5F32A 5FZ7A 2Q8EA 4CUGA 5A7NA 4D6RA 2GP3A 5LW9A 5F2WA 5KR7A 4NUBA 5IW0A 5FZLA 4CCOA 4EZ4A 5IVVA 4DO0A 4BISA 3KV9A 5FY0A 3K2OA 2WWUA 5F5IA 5A7OA 4EYUA 5FZ3A 5F3EA 4TN7A 5FZGA 3K3OA 5A3WA 5CEHA 5FYVA 2VD7A 2WWJA 2XUEA 5FBJA 5FZDA 3N9LA 4GJYA 5FXZA 4XDOA 4QU1A 4D6SA 3PUSA 4LIVA 3OPTA 3KVBA 4QXHA 4GJZA 5FJKA 5FYBA 5FY1A 5FZKA 5FZEA 5FPAA 4QWNA 3AL5A 3N9QA 5FY5A 2XDVA 5ISLA 5FYMA 5FZBA 3PURA 2XXZA 5FZ9A 5FYYA 2OX0A 3ZLIA 2W2IA 4IGQA 2YU2A 5FXWA 4Y33A 5FZ0A 5FZAA 5IVFA 3AVSA 4LXLA 4CCLA 4GD4A 2Q8DA 5A7SA 4LIUA 4ASKA 4V2WA 3U4SA 5FP4A 5FV3A 5FP9A 4CCNA 3KV5A 5FYUA 3PU8A 3AL6A 4XDPA 5FZCA 2OT7A 5FP7A 5IVJA 5FZFA 2OS2A 2OQ6A 5A1LA 5FY8A 5F3CA 5LWBA 5A7QA 4HONA 5FY9A 5FZ4A 5F3IA 4LITA 5IVBA 5FYHA 5K4LA 3KV4A 5FWEA 5FZHA 5FUPA 5F39A 4IGPA 1VRBA 4HOOA 4AAPA 4CCKA 5A3TA 5FUNA 3NJYA 5A7PA 5FZ6A 5FZOA 4UF0A 2YBKA 5FYTA 3UYJA 5FZIA 5FY7A 5FZMA 5FZ8A 5FJHA 5FPUA 5FPVA 3ZPOA 4CSWA 3PDQA 4D6QA 5FYSA 5A7WA 3N9OA 5FY4A 5FPBA 2YBPA 5IVEA 3DXTA 2YBSA 3N9PA 2PXJA
chains in the Genus database with same CATH superfamily
3ZIWA 3PIJA 2ZHMA 3A4UA 3RVHA 1I9RA 4UYBA 4AGRA 3VBSC 2HWF3 4AI9A 1RUJ3 1XOYA 3POSA 4JAAA 4CDUA 2FMDA 1XNBA 2RS33 4GH4A 4OHWA 3O1OA 1HRI2 3W59A 5T5JA 1LECA 1WA4A 2VULA 3IZOA 4COWA 1PMHX 1OF4A 5BY5A 2OKXA 1H8TC 5FPLA 2QQMA 1OOPB 2BVVA 3HJRA 3PJYA 1YQCA 5CKMA 3THTA 1Q8PA 1ZYBA 4LBQD 5A80A 2VMGA 4B7KA 3GYDA 5IATA 2VOTA 5FXVA 2W1WA 2XJUA 3TAYA 1O6UA 1T6BX 3CMGA 4OHVA 3AJZA 4ZONA 3VD3A 3LOIA 1PVC3 3AMMA 4KU7A 1GKBA 2JKXA 2XUMA 2ZEYA 3G6JB 2A71A 4YSFA 1W2OA 2X5IC 3NJZA 3CDZB 3ACGA 4QKBA 1UX6A 4UFJA 3UETA 4LULA 4Q0VA 4XFBA 1VBC2 4BH9A 3OGVA 2VCMA 4MHRA 5APAA 3VBUA 5F6LB 5F7UA 3R4UA 2D5HA 3GCWA 4DRRA 4D7TA 1UIKA 3DKWA 3OGSA 1ZRDA 1GP4A 1Y9MA 1AR83 3O0XA 3IM0A 3FL7A 4H7MA 3WD5A 3VDCA 2DWRA 2JDKA 1W8FA 2AACA 1XNKA 1Y43B 2BVBA 1UXXX 3NWKA 3MV11 4BCUA 1G9FA 3PMEA 5FPZA 4MGZE 4XQWA 2AEYA 4E2GA 1EUUA 5T52A 1VALA 4RQPB 3MV01 3PVEA 4CDWC 1UOFA 1X9PA 5C33A 3QACA 3UNPA 4E2QA 1S0JA 3W58A 2JG8B 2WT2A 2IXHA 5HCHA 3MO4A 3FN9A 3B00A 4JGYA 2HJIA 1TG7A 5GLZA 1R1ZA 3WW3A 1TEIA 4PQ9A 4HKWA 4N90A 3ZFFC 4ZZ5A 4A7ZA 1FV3A 3I2KA 5IVJA 4YZ3A 4ET7A 5I0RA 5A1LA 3KCCA 1C8M1 1RUG2 2NLRA 3LOBA 4YM1A 3OY8B 4IE4A 1K42A 3A21A 2PLV2 4XUOA 3VZKA 1TMF3 4PDWB 1AYN3 4CRQA 3BODA 2EVXA 4NJ4A 4I0WB 4AFBA 1HB3A 4RA0A 4PHZA 5FZOA 4AL9A 1REFA 3SHRA 1AVBA 4FP2A 2XBO2 3J26N 1J1LA 4YYOA 2Y34A 4PI0A 1JYXA 4OHXA 2WKKA 3LWCA 2O14A 2V5DA 5HXVA 2EIDA 1D4M3 1DCSA 3HR9A 1O91A 3RNSA 3ZMNA 3WW4A 3ZVXA 5FZEA 2JE7A 5FP3A 3SISA 5JZGB 4CEYA 3WDVA 5IVYA 2Q8CA 3F2ZA 1DZQA 3WQ1A 1WWYA 5F1RA 1YCIA 5L7OB 1HV1A 1QJX3 3OBZA 4AF9A 4A44A 4Y1ZA 1AR92 2LW8A 2WZ8A 4RR3A 2YV8A 4QHBA 5CFCA 5EFUA 2P3JA 4XF1A 1W0PA 1JOJA 2JDAA 3PL0A 4KG0A 1BEV1 4GWIA 5EJ1B 1IKPA 4M4PA 1JZ3A 4QX7A 4QM9A 2UWAA 4P02B 3IKWA 2YC2A 2Z5WA 3DYPA 4TLFA 3U0ZA 2EAKA 2TEPA 2B46X 2V4VA 3OYWB 5CKQA 1ND2A 4AEDA 4CUAA 3VZMA 1D2QA 1ASJ2 3LSDA 4XAEA 1EPWA 1OVPA 2VOXA 4EQVA 3NMBA 5JOXA 2FDIA 1V9U1 2QZ3A 1MQTB 3VZNA 1OUSA 1RUC3 3ILRA 4Q0UA 2QCSB 2W94A 3JD73 2VL4A 2HWB3 2RM21 1MZEA 1BZWA 2WA3A 3U10A 3I59A 3K4ZA 2J22A 1O59A 3NNGA 4UW6A 2FBEA 1V70A 2Y64A 1W6PA 3KV9A 5CIRA 5GLUA 2Y33A 3ZR6A 1JI6A 1O5LA 1RVF1 3EO6A 1XSRA 3MFCA 1ZZ9A 2E63A 5BNPB 3I3DA 2GN3A 3UGHA 5D1IA 2RV9A 5FXZA 1O4ZA 2WFF2 3N9LA 4BQWA 4E8CA 4EN6B 1GWKA 4DEVA 1SG3A 4TZDA 3HEIA 4OMDA 4AR2A 1O5UA 5GALA 4Q4X3 1KGYA 1KFXL 1ND3A 4GMP3 5JUVA 5FY1A 2RS11 4IV3B 1BVP1 3M7AA 4DXSA 4GIQA 2EXJA 5C9AC 2RS51 5ISLA 4CP2A 4LK6A 3VBOA 4AYUA 2Y6HA 2NM1A 4JTOA 4GALA 4S2GA 3OBTA 3WNOA 5I0DA 3PURA 4YVWB 1UKGA 4LEJA 4A2UA 2ZGLA 1C5IA 2P17A 4CCEA 1W6NB 3ZXFA 3MUZ1 1W6QB 2EIGA 3KT4A 3NVCA 4HETA 3ASIA 4DY5A 2BGPA 2VMCA 3IN9A 3QOPA 1H9PA 4Y4YA 2BJSA 2BNNA 3ZXDA 2HEYF 2IXIA 4MG2A 3P3NA 3POIA 5IUQA 3VL9A 5LRSA 1FAYA 1PGL2 5FY8A 3M8LA 5L36A 3BYWA 4YZ4A 1LOAA 4NRQA 3RZKA 2WIIB 5IVBA 1WKYA 5FYHA 5LBEA 1UY4A 2PN5A 4NOTA 5C4WB 1BXHA 1F35A 1GLHA 1XQNA 1Z7S1 4PCRA 4CDUC 5EYXA 3KF3A 4IGPA 4N9HA 3LAGA 3WP6A 1GYKA 4NHYA 1PVC2 4G3YC 2OVUA 2BOIA 2HWE2 2JE8A 1O3SA 3VHPA 3W21A 2FDHA 1XBFA 2NYYA 3AB0A 3MW2A 3OBRA 1AR63 4ZPIA 5FCCA 5GZFA 4WVVA 1AR71 3MIFA 2ZGTA 1IPJA 3PDQA 1VBA2 4AEMA 3D3AA 2EIBA 3KF5A 3KWVA 4AVSA 3AJYA 1OF3A 1OQEA 4BE3A 5ACA2 1RUH3 2QDRA 4OYUA 4D7YA 3E5QA 1TME1 5K0UA 3P6BA 4FPYA 1U5XA 1AJOA 4RL7A 5A6XA 4XW3A 2YPDA 3LGRA 3PTRB 4FPKA 3WOGA 4KWLA 1ACCA 1AR82 4KBBA 5D2AA 3URFA 4Z2WA 5BNOC 4OLLA 2JB4A 1RGSA 4CP1A 1IS3A 4QX8A 4I0BA 3ZKYA 1LTEA 1HRV3 2ENRA 1UO9A 1NOVA 2O8QA 4IEXA 5L73A 4R9CA 4NHKA 3WNPA 3MIDA 2X8KA 5CBLA 3DXUA 1QQP2 1W8WA 4XF0A 3VBUC 1C5HA 1VRH3 1NE6A 2VBDA 3NV3A 2C26A 4PBPA 2YY1A 4LUKA 2FZ2A 1DLLA 2VXJA 4XUQA 3ETPA 2JD4A 5I8SA 3F95A 1K45A 3HQXA 3LDBA 2D3PA 4QPIA 2JDPA 4OZXA 5FYCA 2EA7A 2GH8A 1ZX5A 3KS7A 4FPEA 2ZJCA 5EYYA 1MZ6A 1LGNA 1CONA 1PM7A 3ECQA 2Y60A 4GMP0 2EXIA 4K3UA 5E16A 3VDAA 3WINE 1BMV1 5HCBA 1NXD1 1LHUA 2XLFA 1GZWA 1SPPA 5IW0A 4I3PA 3WF4A 2IZWA 2YPJA 4DO0A 1NAEA 3EXUA 1FOD3 2EF6A 1W8TA 2K9ZA 3MW4A 5J36A 1ZZCA 3O0VA 3BTYA 1APNA 2R073 4JGYC 5F3EA 3T0DA 4OZOA 1EV11 5FYVA 4ISQA 5FBJA 1G8WA 4CDXA 4BQ5A 1AZDA 3I3QA 1AL23 4GKYA 5DAPA 3ZPYA 1DGRA 2ZAHA 5T54A 4KH9A 4LIVA 1HXS2 1QJZA 2I45A 3OPTA 2HWD1 4PQQA 4QXHA 3BB6A 1ULEA 3ZYPA 2C24A 4A41A 4ZS3A 4XJ9A 4JKKA 1UIJA 1ZBE1 3BGAA 3VD4A 2ZKNA 2HYKA 1UYYA 1VMJA 4DS0A 3OUHA 4ES8A 2GC1A 4AG4A 1QWRA 1W8ZA 1I3HA 5DUXA 4HXCA 3PTYA 5KXCA 3S57A 1CR7A 2J1SA 2B45X 1J3PA 1WGPA 5IK7A 5DMYA 1AX0A 4UFMA 1SFYA 4PJYA 1OOPA 3OG2A 4OFGA 1BQPA 1OVSA 4CU6A 1RUF1 3P1IA 1RUE1 3WDYA 5EV7A 5BNNA 4AAXA 2HWC3 3TN91 4GWJA 5ERLA 3I2GA 3RZGA 1IHMA 2P3IA 4CCCA 4CEYC 1QOOA 1WCUA 4WM8A 2VY0A 4GB33 3OGGA 3VHRA 4C1XA 1HB2A 3SCHA 5C8CB 4AEJA 2JDZA 4HOOA 1PO12 2C5DA 4AAPA 1HLCA 2FQPA 4J25A 1ZRCA 3FFQA 5CFCC 3DF0A 2B9UA 2ET1A 5CADA 1JHJA 4OUMA 1CQ9A 4JQTA 1QJU1 2WS93 5FZ8A 3RYKA 5DN2A 1QHDA 3USSA 4DEQA 1VBD1 1RHI3 4AGGA 5FYSA 3CU7A 4DZGA 4Y26A 5FY4A 4YZ5A 1K5JA 4AQTA 1ZZBA 4AEDC 2ZGNA 4OCTA 2MEV1 1S0EA 1R091 4OHZA 1ULFA 3OCPA 2JDHA 4WM7A 1UCXA 2EALA 2I2SA 3W5MA 1X36A 1W6OA 4LKFA 3IDAA 5FBZA 1EUTA 5B4NA 2P5BA 1OXCA 2B9VA 3PUAA 2CL2A 4AVBA 2WNVB 4NPLA 5I8TA 4UF0B 1F31A 2TUNA 1A8MA 3EB7A 3C2UA 4Q5OA 1JOBA 5A3OA 2W0XA 3B69A 3T08A 2YMZA 1ST8A 3ZKUA 4NIDA 1GQGA 5F8PA 4P9LA 2R062 4J1WA 4RHV3 5IAXA 1X82A 4KG8A 1RUI3 2VUCA 1JYCA 2IVJA 4Q8KA 2WO3A 3N9NA 1EAH3 5DUUA 5A3LA 5AC93 3NAPB 2YZ4A 2ES3A 3JBG3 3MIBA 2Q1MA 1DYOA 4BU2A 5IFTA 5F5AA 3S5AA 2R32A 1NYWA 2DU1A 1YWKA 2P6CA 2UWCA 1ND3C 4OUSA 4LLOA 1SCRA 4UT5A 3HQUA 2CDPA 2GZWA 2DVGA 3RWNA 4CCJA 2JG9C 1UYZA 1GP6A 1O8PA 1LESA 1D4VB 2R7EB 2Q8EA 3VBOC 2OZ6A 4Q27A 4XZPA 1CAVB 4CE8A 2QUOA 2DVDA 4LKEA 4KWJA 2C0ZA 2WT1A 4XC9A 3LEIA 4DY3A 4FCAA 3LIHA 4MH0E 3WSOA 4NN0A 4RN5A 1F4HA 1YFUA 3TEXA 4D94A 1FMD3 1KS5A 1PO21 2FD8A 1HW5A 4IE0A 1ULOA 4GJYA 1NCRA 1VBE1 1N3QA 3HVDA 4XETA 4QT6A 2X05A 3ZXLA 4KGGA 1RMU1 5ABJB 2VQUA 1GV9A 1OD3A 2AREA 3UGGA 3FLPA 2BBAA 4KGQA 4DOUA 4WV8A 2K46A 1PMIA 2A6VA 3AL5A 2ZKLA 3N9QA 3RWKX 1QGLA 4NIGA 4Q4W1 4WVMB 5KC5A 2R30A 2DUQA 5KBFA 1UYPA 2XH6A 4UW5A 1OBNA 4CXYA 3KGLA 3U75A 1C1FA 1UL9A 4JHZA 2VNGA 4I02A 3AVSA 2H0VA 2E6VA 4OHYA 2D6PA 3LSEA 1UZWA 5FP4A 5FV3A 1JZ4A 1O3RA 1QJY3 5DAWA 5J3UA 4QQHA 4CUBA 1HRV2 3LFMA 2DUOA 1I5PA 1PNFA 1GZCA 1HRI3 2VBBA 4EWDA 5A7QA 4Q1RA 2WO2A 4LBKA 1VBB2 5FZ4A 3TBDA 1DQ1A 5K0UC 2XJPA 1MEC2 4DXRA 2BNOA 1W9YA 3OSDA 4D0QA 1UPIA 2JIJA 1LENA 5A3TA 2L9LA 5A6QA 5A1AA 4HT1T 2XKPA 3IDEA 5FZ6A 2WBKA 4QAWA 1OPMA 2VVEA 4FPHA 4HPKB 2XLAA 2WYSA 5K8SA 4NHXA 3ZSLA 1W8UA 5H9RA 4P5HA 4HLTA 2PHXA 4FPLA 4K8RB 4YM2A 4FTSA 1PIV2 5A7WA 3SNMA 1COV1 3T0AA 2A73B 1G9DA 2Q30A 1HIXA 2J1RA 5D8AB 1QDCA 1MR5A 4XVHA 2A5ZA 4JGZA 1CWPA 3AXEA 1H2NA 5KHGA 2E53A 4WVZA 4B3NA 3LD8A 3ELNA 1VBC3 2XWJB 3EYPA 5FFOC 2VGDA 1W0OA 2VMIA 3LFIA 4YFWA 2W1SA 2EXKA 1GBGA 5EXOA 3Q9OA 3LEGA 2QVSB 2H6BA 5E8AA 4EZHA 3K51A 1R082 3FC0A 3AP4A 4LBOA 3S7EA 1J1TA 1UYXA 4ZHNA 1O3TA 2G19A 3LA3A 4YVSB 3U78A 4XBNA 1CPNA 4XXAA 5L9BA 3WLUA 2Z2SB 2MPFA 1BK0A 1CAWB 2X10A 4UFKA 1GMMA 4FFGA 1CJPA 1W8NA 4CDXC 4Q4V1 3J8F3 5DUWA 4HVQA 3GM8A 1K5MA 1L3JA 4L8QA 1S0FA 4QU2A 4AZZA 4Y4RA 3VB9A 5EHDA 1JYTA 3SEEA 5C7GA 2WZR2 5TSWA 1AUYA 3PNAA 4ITCA 4Y1UA 2VBPA 4CZSA 3MLLA 2D6MA 2A70A 3ABZA 2DV9A 2ZX3A 3WCSA 3NRUA 1A78A 1RUG3 5FZ3A 3NQHA 2QDNA 4I0AA 4IEYA 4QKFA 4YW7A 5IK5A 2VUDA 1UU6A 2PLV3 1GSLA 2AZ5A 1OOPC 2HEVF 2IXJA 2RDQA 4W65A 3ZYIB 1GQPA 1YQ8A 2CDOA 2ZGSA 4D6SA 3AZXA 1UWWA 3UT0A 1NXMA 1AYM1 3I3BA 4N9IA 4CVUA 5BNNC 2UU8A 4PT6A 1W06A 2JDUA 4MYEA 3WG3A 5FYMA 1WMFA 2XBO3 4WM8C 3PVBB 1R1A1 2J1EA 3H7YA 1ENRA 5FZ9A 5IHRA 4RS5B 5DQ0A 2VQTA 1GANA 2YYOA 4HMZA 3KHBA 2NPIA 2BDRA 3UESA 2DTYA 2ZACA 4XAAA 5FP9A 3RI9A 1UN1A 5GZGA 5LBBA 1W6MB 2WLPA 3LDKA 1E5RA 1Q8SA 2JIGA 2OUHA 3I2OA 1AR93 5DDJ2 2F17A 2R49A 4HONA 3L2YA 2RR11 4WM7C 1K3IA 4HFSA 3POGA 4FPJA 3J7NA 1OA4A 1GNYA 2CU5A 1AXYA 1TNFA 3RYRA 3WF3A 3WP3A 2Q1ZB 3T2OA 1YO8A 4Z2AA 4QB6A 4RQPC 2KXLA 2E51A 2VOKA 1F5JA 2Q1FA 4MVTA 2DCTA 5JR7B 1ASJ3 1DZRA 2D6OX 1ENXA 2ERFA 1REEA 1YXWA 5FZMA 1F2NA 4EJRA 5FPUA 1Z78A 2TNFA 2UY9A 1JZ2A 4M00A 4P9JA 1JUIA 4R4ZA 1POV1 1S55A 4FFFA 2JKBA 2YBPA 5GLTA 1JHNA 3BVCA 4BZ4A 5IVEA 3NV1A 3AYAA 1W8OA 3KT1A 4BQ3A 3ILNA 3MYXA 5DAQA 4A6SA 2NMOA 4OI4A 1W2UA 2CTVA 1HB1A 1PHMA 1WD4A 3AM2A 3BCWA 3AP6A 1B35B 1T2XA 1U5ZA 5FP8A 1OURA 1WW4A 2ZAAA 3T2TA 2C9KA 1QKQA 1FPN2 4N43A 2WFF3 4C8DA 4XFGA 5FTTC 1LOCA 3KVAA 1DLCA 2FCVA 3IAPA 3H8OA 3AZVA 1RUD2 5LY1A 2FDGA 1LNSA 1NQDA 3VKLA 4HG6B 1F15A 5JDBA 2VR4A 3GZTB 1AF9A 1H8VA 3PU3A 4IW3A 2B4KA 4BPZA 3C3VA 5C71A 2RDNA 2Z4FA 3ZFEA 2WNOA 3AMPA 3K75B 2RMU1 2AENA 4ARXA 4GWMA 1QJY2 5FZ7A 3BPSA 3KM5A 1UZZA 2X29A 4IERA 4XQDA 1BBT1 4AK3A 4Q4Y2 3TOJA 1QNYA 2VTFA 1CD3G 1QXJA 4BB3A 5T50A 1UMZA 3ZIXA 3WV6A 4E27A 4R4XA 4LTAA 4BMEA 5G04L 4NWWA 2DUPA 1J84A 2YC0A 4EYUA 4QPYA 3K3OA 5GM0A 5CEHA 2G4IA 4K1ZA 4Q0SA 3ZFGA 2YDEA 4N53A 3HBZA 2VW2A 2PHDA 3NKGA 3P5BA 1SFPA 4WVWA 4QPGB 2B42B 2DYCA 1MACA 3B3QE 2BQPA 3J7LA 2AYHA 3AMQA 2R042 2XJTA 1VIWB 2W9XA 2XVGA 3QCWA 5FY5A 4DINB 4AHZA 2HWE3 5FZBA 1J3QA 1IS5A 1LRHA 1MQTC 5BNOA 1NCQA 5FQ0B 3E97A 4LT5A 3GXUA 4Z82A 1VBA3 1NA1A 4JTNA 4MHUA 2YU2A 1OHFA 3VD7A 3WP5A 2ZEZA 3S7IA 1LOGA 1PX3A 2QQVA 2QQUA 5ACA3 2AC1A 1DYKA 1IG0A 1H0BA 3OEAA 3RFRA 2Q4SA 3O0WA 5BNPC 3SC7X 4YFZA 1W90A 4IV1B 3CJIB 5A3MA 3LEMA 5FP7A 5LEJA 5FZFA 4CEWA 4IEZA 2XPJA 5JXGA 5J48A 5IT6A 2Q5TA 4HVOA 2ZTNA 1DBNA 4JC1A 1UZVA 4JGZC 4EWAA 3GDBA 2Z79A 4F83A 1PZ7A 5D21A 2XWBB 4DQAA 1DGLA 2KA3A 2NZ9A 1S4CA 3UV9A 1XJAA 1QQP3 4AI0A 4AQ2A 4S2HA 3J8F2 1X8MA 5FUPA 1BLZA 3PLQA 4YVWC 1PGW1 1VLNA 4UBGA 4X8PA 2HWF1 1RUJ1 5C5UA 4FP3A 5JI7A 1PX4A 2EIEA 2RS31 4H2AA 3GZAA 5A32A 1W9SA 2ARCA 2ZGPA 1GP5A 1SLLA 4YGEA 4DUWA 4HVRA 3M1HA 1KFUL 1Y4WA 3N9OA 4HSLA 4JRAA 1KITA 4M4RA 3ACHA 1UY3A 2WNUB 4ZU4A 3VBRA 4B4RA 3TEYA 2V73A 5DZEA 2C4XA 2D3SA 3N7KA 5FMDA 1K5MC 3FJSA 1LOFA 2PHFA 3IWZA 4EN0A 3CIHA 4B4PA 2ZHLA 3LB9A 2D6KA 2C1FA 2GDFA 3IDBB 2IXCA 4GKXA 4TXWA 5IAVA 4NVPA 4BQ4A 4UWDA 1ZBA2 4UOJA 3VBHA 2WC2A 1CPMA 1BHGA 1H1AA 2A1XA 1SLTA 2G9ZA 2R1BA 5KHKA 4IXLA 3WDWA 3LF7A 4GA9A 3N4MA 4TWTA 4DFSA 1HXS3 1OUXA 3E6CC 4IETA 4DXTA 2R1DA 3OUJA 5CKNA 3AZWA 3WR0A 5HI0A 4M0NA 4RFT0 4ATFA 3AKPA 3MZHA 1ZZ8A 1S2BA 4BM8A 3KT7A 4Z1VA 2XJRA 5JCTA 4Q0PA 5JOYA 5KWRA 2CSGA 3P3PA 1W28A 2ZABA 1KXGA 3KQRA 2JB8A 5JXIA 5FXXA 5GZCA 2Z69A 3LKJA 1E5SA 4TSVA 3ZSMA 4LBJA 3B01A 4WZCA 2PELA 4JQRA 5LBCA 2GP3A 4ISRA 4WBBA 1MZFA 3GGLA 5DAXA 4LR4A 4XCAA 4H14A 4BDVB 2Y0IA 2CWMA 2RS13 2WWSA 5BV6A 5C6CA 2ZGRA 4FVVA 4W6WA 3WNMA 1YFWA 3C7FA 4P9XA 3CJXA 3HAGA 4L2NA 4AW7A 5C8WA 1ZRFA 2EXHA 4CXXA 3VBSB 3KVBA 4GJZA 1PO13 1JN2P 1YJKA 1SMVA 2PHTA 1VE0A 3HT2A 4LBQA 1WMEA 3AP9A 3WW2A 1JZ7A 3I3MA 3RZHA 4UFIA 1QNWA 3ZDVA 4C0BA 5BXXA 2PMWB 2PHUA 2W5FA 1H8TB 4QDRA 1TMF1 3U4XA 1LCLA 3VN4A 1AYN1 1E57A 1WMDA 3E6BA 4LXLA 5CISA 5JR2A 2D7FA 2DU0A 1LULA 3GZEA 3H0OA 2B5HA 3BOWA 2PAMA 1QJFA 1G9AA 2NN8A 1E5IA 1P8JA 3SCGA 1V6LA 1C1LA 2GNTA 1FATA 1SDDB 2X5IB 3POEA 5A33A 1UF2C 3W20A 2JG9A 3VBFA 1D4M1 3ZMOA 2ZGQA 2AEZA 2JJ6A 2O0OA 4Y5Z0 2R063 1VRBA 5J09A 1PK6A 4CU9A 1YQ5A 4N43C 3O5SA 2H0BA 4YGBA 3VLBB 1QJX1 2WAAA 2YXSA 5F9TA 3RPQA 1RUNA 1X33A 2QQNA 2Y6GA 2IFWA 1LU1A 1JW6A 1WW7A 2QQLA 5JMCA 2UWBA 1Z0HA 1F4AA 1QXRA 3RYPA 4HK9A 5FMOL 3T1MA 3ZN6B 3RG0A 3WDUA 2BBVA 4MGIE 3V0AB 4ARYA 1VAKA 1Q3EA 1QOSA 3OGRA 3NJVA 3OOXA 3ZFEC 4CDWB 3T0BA 1DQ5A 1KD7A 3VKNA 5EZWA 1X9TA 5GLWA 2XKOA 3K48A 4UXAA 4LO6B 1XRUA 3QH7A 4JKLA 1FNYA 1WMXA 4LHLA 3FFZA 5KXBA 3BIEA 4HKLA 1RUC1 5DABA 3H9AA 3JD71 4XTMA 4B1MA 2IUWA 1X8EA 2HWB1 3USUB 5F3GA 5FZ1A 4COYA 2LS6A 3DPRB 2J1VA 3ZFGC 4FFIA 5A3NA 2MHFA 4N53C 5A1FA 4NHMA 3AXDA 4Y22B 1QIQA 3ENRA 4LO8A 5E6HA 1C8M2 2CV6A 1OC1A 3RJ2X 1LU2A 4XIKA 1UPSA 1NUKA 2W95A 3DL3A 4J1XA 4TYSA 4AHXA 1RJ7A 1V6KA 4Q4X1 5IFPA 3IPVA 1AL0G 1NCQC 4CCOA 2GC3A 4IEUA 5IVVA 1DZTA 2VNVA 1JH5A 1NA1C 3K2OA 1JYNA 3GBFA 3IT8A 1VBB3 2VD7A 2UYBA 4LO5B 3WF2A 1OMIA 3MW3A 1MEC3 1WCSA 5JSRA 1NQJA 2ZGKA 4XHXA 2FCUA 3VDDB 3WDTA 3AYCA 5J98B 1IKQA 3UJOA 4MGKE 1Q8QA 3CQOA 4Y20B 4CEWC 4PIZA 1QU0A 3ZSKA 4AVVA 4CP9B 4L92A 1IGOA 4FXGB 2DDUA 1VR3A 4AVTA 1QDOA 2WQZC 3EJKA 1GOHA 1JZ5A 4M3CE 5B4XA 2V09A 2ZBJA 4MGSA 2GNMA 4Q1PA 1PIV3 4X6QB 4XJAA 1LHNA 1YI9A 1UOGA 2GNBA 1BEV2 1UMHA 2BW8A 3H1MA 2ZCWA 4QB1A 2ZGUA 4ASKA 4V2WA 5JLVA 1N1TA 3ZYJB 1YLLA 2IXKA 1YIPA 2VZ1A 3HNBM 3VBRC 2JX9A 3V0BB 1AR61 5LWBA 1LOEA 1R083 5F3IA 3MF6A 1LOFC 1V9U2 2I74A 3JXSA 4HKOA 1US3A 2XJQA 3FZ3A 2ZMNA 5M0TA 4I2OA 4QXKA 1XE7A 1RUH1 3ZYBA 2RM22 1WCKA 1GQHA 3NJYA 3VBHC 5A7PA 2VTXJ 4CDQB 5JWPA 1NLRA 5CYYA 4MXWB 1RVF2 4W8JA 5JVVA 1MS9A 4AE2A 1NZCA 1X7NA 5HPOA 4W50A 4CSWA 1LJ7A 4META 2VVDA 1UY1A 3U37A 2WZR3 1ZA4A 1A3KA 3DYMA 1CZSA 1D0GA 5JOZA 4XJUA 5C9AB 3M70A 3JCIA 5LB6A 4Y5TA 2A3WA 2WSVA 1OLMA 1IS4A 1NKGA 1VRH1 2RS12 5EJZB 3TYJA 1O4TA 2BWAA 2RS52 2XMLA 2PAEA 3H3UA 3SITA 3N36A 4I09A 3WG2A 4UW3A 4FPOB 5BNQA 2RE9A 2DVBA 4KNCA 4LPLA 5FO7B 5FMOS 5AFEA 5C5TA 1DDLA 1SCSA 3DKQA 4MGTA 1XE0A 2QE3A 1ZRRA 2E31A 3N7JA 4AOCA 5FUIA 3I54A 2P4EA 5C3PA 1J59A 3MFAA 4QXBA 5F5CA 4V2VA 5FK7A 3AKSA 4HN1A 1XSQA 1C28A 3KHCA 2VCBA 1FOD1 1ODNA 4XUTA 2F6BA 3WCRA 3ZOIA 1ENSA 2ZPXA 2P34A 2R071 3THDA 5D8AC 1MPXA 5LY2A 1WD3A 1AL21 4CDUB 4XABA 1CESA 4JDMA 3ATGA 4GH4B 1LEDA 1GFF2 1KEXA 4H7LA 1N1YA 2WFPA 1Z7S2 3OJBA 5KR7A 4MO3M 4RQPA 4RYDA 1JYWA 2WA4A 2E9QA 2Y6FA 5FY0A 1VJ2A 5DDJ3 4ES9A 2JG8A 4W6YA 4XMIA 5I0TA 2B39A 2Y6KA 5FZGA 5JXJA 4YVSC 3POYA 2VOVA 3J7HA 2A7AA 1AR72 3JB8A 3KD4A 3O1UA 3D82A 3VKFC 2P2KA 2XHKA 2EICA 4JVAA 5FYBA 2MNGA 4BQYA 3WG1A 1TME2 4FT8A 2CGPA 5SV8A 2PHWA 3OY8A 1JMUB 4LE4A 3V64A 3VBFC 4BIFA 2DURA 2BGOA 4PDWA 5HCAA 1AHSA 2HWC1 4XHBA 2WAOA 1D0HA 3VBUB 4EN9B 1PK6C 1O4YA 2GNDA 1Q8OA 3NV4A 5FZ0A 3BIWE 4CYDA 4GB31 3TEWA 3GBWA 4ZKTB 2WO1A 2DVFA 5JSOA 3SKJE 3HQRA 4KWUA 2QBXA 5HCFA 4BYYA 2BPA2 5FYUA 4JZRA 4XXPA 4AI8A 4AQ6A 3GCXA 1LOBA 2CGOA 1OFSA 2WS91 3OPZA 1AX2A 4B4QA 1DG6A 4DUVA 1FPN3 3FLRA 3OBAA 3PIGA 5FWJA 5CAZA 1RHI1 4YGCA 2DCYA 5JZGA 2PQSA 4YLZA 4COUA 3AK0A 2HEWF 3LIGA 2DBNA 3R4DB 5K4LA 3GJAA 1RUD3 5L7OA 4LA3A 1BMV2 4IDZA 1W8HA 5DXDA 2VZSA 5FDBA 5A3UA 5EP9A 3RI8A 3I7DA 1COV3 2QQKA 4V1PA 4JGYB 3GZUC 1HB4A 4IEOA 2G9FA 3CEWA 4Q0QA 4DB5A 4XMAA 2AUYA 3NV2A 4BWOA 2DVAA 3G7DA 1YJLA 3NKTA 2BZDA 1YFYA 4KWKA 4YPJA 1EV12 1DYPA 2DTWA 2VCAA 3NNJA 3CBNA 2W68A 3MLKA 4QDQA 2P1BA 2YUEA 3OYWA 4Q4Y3 2RJ2A 3A23A 2PXJA 5ANNA 2HWD2 3DEMA 4RHV1 2OZJA 1XNCA 5FK8A 1RUI1 1Q8VA 5AC91 5LA1A 1WLDA 1EAH1 1ZBE2 3RGBA 1JOPA 3ACLA 1MQTA 3JBG1 4M0HA 1DHKB 3HBKA 3S6PA 3VV1A 5FZOB 5FYIA 2EAAA 5F2SA 2CWSA 3M2MA 1H6YA 1A6CA 5CB7A 3RDIA 1U5IA 1LEMA 4MX3A 3IDCB 5T5OA 2GH2A 1US2A 4XCBA 5BNPA 1WLTA 2R043 3NSTA 5K7PA 1JYIA 2WSUA 1HKDA 3T09A 1RUF2 2D6LX 2DF7A 4P00B 1H1IA 1RUE2 4QDSA 5FAXA 2FDFA 5FLHA 4CEYB 1UU5A 2JDNA 3T2QA 1M06G 1FMD1 3JB4C 3T4HB 3ZXAC 2ZX1A 1H2LA 3TN92 3ILFA 3VZLA 4IV3A 1OQDA 2HLEA 4QD2A 4A7KA 4Y1VA 1WUVA 2CHHA 4RR3B 4CPBD 5A7NA 5CFCB 2PFWA 4KBZA 4KI5M 4HANA 5BUVA 1B35C 2KM2A 4YVWA 4NUBA 2R0FA 1UD1A 4JDNA 1TVGA 1W6NA 3O1VA 1W6QA 3EQEA 2OW4A 5CZKA 1WBFA 2WN3A 1E5HA 5F5IA 1QJU2 3DV8A 2F4LA 5E88A 1RYYA 1W99A 1PZ8A 1VBD2 4AEDB 1ND2B 2ZHKA 4XJWA 5AVPA 3D0SA 5KHJA 3LE0A 4FTEA 1UKRA 5E89A 2Y26A 4QU1A 3LCPA 4AFDA 1U12A 3H42B 3PUSA 3WT3A 2YG0A 2MEV2 3IAQA 3ITQA 3S30A 1HV0A 4B29A 1R092 2ORXA 3ACIA 1WLCA 4XZUG 1W2AX 3HD8B 3WVJA 4Z07A 2PHRA 1OA3A 3D6EA 2XVLA 3I59B 1VB2A 3KGZA 3N3HA 2G1MA 1W3VA 4IEPA 3A0NA 4QQLA 1HRI1 2DFBA 3ZYGA 3VGIA 1UAIA 2KD7A 1W6PB 1IQDC 1KS4A 2W2IA 5C4WA 3FHQA 4XYXA 3VKMA 2CAVA 4QGLA 3WHTA 3E5XA 1G7YA 1LR5A 5A7SA 1SLAA 5KC6A 1GUIA 4Y1YA 3TNPB 3U4SA 2XB6C 4LKDA 2JEMA 3KV5A 2JXAA 3C7OA 1ND3B 1NLQA 2ILMA 4UBHA 2N7GA 5CG8A 1ZBA3 3V65A 4OUEA 1ZREA 4YWAA 4GXLA 3VBOB 1UNBA 3PMSA 1QMJA 1ZZ6A 2TBVA 2P3YA 3RJRA 1YQ2A 2QJVA 2Q0AA 3RSJA 1GOFA 2F4PA 3NO8A 3AKTA 4DMIA 5JIAA 4BK5A 2WQ4A 2VQ0A 4BA6A 4S2FA 1WA6X 3UYJA 5FYTA 1VBC1 2W3JA 4XJZA 3H3LA 1V6IA 3K46A 3C7HA 5FR3A 1TNRA 1GZ9A 4LKSA 1PO22 1OKOA 2HBTA 2D98A 2O1QA 1VBE2 4XBQA 1SDWA 3WNKA 3LA7A 4XPVA 1RMU2 1O3QA 4HL0A 1DQ0A 3N9PA 1W9WA 2GN7A 4XILA 3DECA 2E7QA 1BJQA 1J3RA 5I0UA 4XFAA 5IK8A 4CP9A 1UY0A 2E7AA 2YU1A 3ACFA 2VVFA 3ME2A 4Q4W2 1RC6A 4SBVA 4YGDA 3MUY1 4O9GA 3ES1A 4L99A 5I0SA 4CU7A 2LM3A 1XU1A 2QQWA 5IYYA 5L19A 2QFEA 1XC6A 2SBAA 2OIIA 4QQ2A 2JG8C 4UFLA 4W6XA 2RMU3 1JS9A 4CP0A 1DQ4A 2W1QA 4PBOA 2LUWA 3IMNA 4IEQA 4AI3A 3HT1A 1OI6A 2H6CA 1RUG1 1BK1A 5FRAA 1UW8A 2D97A 2VNOA 3WXPA 5K0UB 3V0BA 2ETEA 3LPGA 2JE9A 2PLV1 3WF0A 1SFNA 2RJKA 2R0HA 1XYNA 3UGFA 4QM8A 1NY71 3W9AA 4IE6A 1IG3A 1YHFA 4UAPA 3WQ7A 2XQRA 5CFDB 4QX5A 4D6RA 4PDWC 4A45A 2LTNA 1KJRA 3MPPG 4EZ4A 5KHHA 1QY4A 4BISA 2VZPA 3M3QA 3O12A 4DXZA 2XBO1 2VCCA 1GWLA 5A7OA 1LHOA 5T55A 3KZ4C 1UZ0A 1IPSA 1CVNA 2QQIA 1COV2 3NL1A 1PGSA 3OD4A 2JECA 3H3ZA 4QMAA 4QPIB 5SV5A 2NP0A 2W91A 4AHYA 5FJKA 2ZX4A 4G4FA 1UZYA 1RL3A 3TB0A 5LK5A 2OPKA 3SCFA 3VZOA 3ZDSA 2XDVA 5JZGC 1CAUB 3JU9A 3O1RA 1REDA 1AR91 1GZWB 1SPPB 3QH6A 4FPFA 3T4VA 1Y9QA 1F8VA 3I4IA 2Y0OA 3MF9A 2P6HA 4XIOA 5L7OC 2OXBA 2E26A 3Q8CA 2D6NA 4MGYE 1GWMA 1K12A 4P9YA 5C8CA 1ULDA 3FE5A 5FO9B 3E1F1 4Y33A 3K4DA 1OA2A 1OH4A 4LUMA 5FZAA 4YW6A 4C0HA 4XF9A 1PMJX 1POV0 4LIUA 4HSJA 4CDXB 3LEKA 3BU0A 4AVAA 4XFFA 2GC2A 2BP6A 1XNDA 3AL6A 3HPNA 4FAHA 1ASJ1 1ZM1A 1D7PM 4Q4V2 2CGNA 2V5YA 3AMHA 3RMYA 3L9JT 4QX3A 3KCXA 5L9VA 2ZS6B 4G9SB 2WYFA 3I49A 4E4SA 3AMNA 2WO7A 1XPWA 2JDYA 2ZZJA 3WF1A 4PLMA 4EV0A 4FSJA 1GOGA 4XOGA 1EYBA 2WNVA 5GKAC 1G9CA 1V6OA 2HH9A 4UF0A 4ZU5A 1XNAA 4C91A 4M01A 3PHMA 4BLJA 5KHIA 4NRPA 3I2FA 5FJHA 1MS4A 1CAXB 1C8M3 3HMYA 2A6YA 3INAA 2WFF1 4MLOA 5FLIA 2A75A 4AI1A 4O61A 2UURA 3C7EA 4YZ2A 3JUUA 3AYDA 4BOWA 5BNNB 3VD5A 5JXHA 4LO7A 2Y8KA 1IQAA 1JODA 4YARA 3NAPA 4L11A 5FREA 1AYM2 1JU4A 4U2AA 4ATEA 3ZN4A 4WM8B 3FUOA 3SXWA 4NAMA 1DGWX 2ZMKA 4YZ1A 4IV3C 1UU4A 2E33A 2E32A 2XOMA 1V6JA 1NG0A 3AZYA 1KJLA 1R1A2 1WBLA 3FMGA 4H3WA 5F5QA 5IJRA 3ZSEA 4NPMA 1CAVA 5JMOA 4OVEA 5H9PA 1URXA 4XFCA 1MS8A 2Y6JA 3GHNA 4AXOA 1S0GA 4E4HA 4FI9A 1A34A 3ETQA 3KLSA 1LGCA 2VNRA 2XGXA 1ZA7A 3GALA 3OF1A 4CCMA 4D3WA 1XXNA 2YHJA 4IQPA 4DNYA 1YYNA 4P14A 1PGL1 2Y38A 3BUCA 3M3IA 2DFCA 2YGMA 4WM7B 1VMFA 3JZVA 3UK9A 3K3NA 1O7FA 4LBNA 4YNIA 3B94A 3JQWA 5ABJA 3RZLA 5F37A 1M4WA 5LCWL 1W6OB 3D0JA 3DGTA 4QX1A 2RR12 4TTGA 3M3CA 1BEV3 4QKDA 1S2KA 2W52A 5FYZA 1YI7A 4URAA 1LAJA 1WW5A 5JPMB 1HJGA 1SZBA 4KMQA 4WVMA 3O1SA 1JBCA 4YW2A 1ULCA 3BI3A 5C4WC 1PVC1 1V0AA 2HWE1 4Z92B 3AKQA 5JOWA 2PYTA 4EROA 1W03A 2BYVE 2DCJA 5A3WA 1J83A 3WNNA 2DCKA 4O9EA 2BFUL 2WWJA 2XUEA 1VBA1 1V9U3 3CZUA 4JRLA 5JIUA 2P37A 1YUDA 1S0BA 3B9IA 4UFHA 4XDOA 2BV4A 1YIFA 4AFCA 5ACA1 3DPRC 2PQQA 2RHPA 2RM23 1CN1A 1L7LA 1UXZA 2VZOA 2FMYA 4GULA 3N35A 4A42A 1NY72 2D43A 2ZOEB 1RVF3 2AGSA 5GLVA 1AR81 3Q8EA 5DAVA 1S0IA 4HK8A 4XF3A 3BU7A 4P5YA 4LNVA 1N1VA 4NAOA 4BXSV 1CGPA 5DPNA 5LZ6A 4NPRA 1IPKA 1OLRA 4XDQA 4DPNA 1QQP1 4FOQA 2J1TA 1Q43A 4FOVA 2Q8DA 1JUHA 1NCRB 4HPKA 4S2DA 3RQ0A 4RD7A 2JD9A 4YM0A 2RS53 4YW4A 3T2PA 5J7MA 4LK7A 4HBNA 4NRMA 4XDPA 1SACA 2OQ6A 2ID4A 2QQJA 5F3CA 4OI1A 1WZXA 1HN0A 5FMBA 5DG2A 5D8AA 3VDDC 1FI2A 3FBYA 4UW4A 1VP6A 5JAXA 1U5YA 1UOBA 3WUDA 2CNAA 3WY6A 2K2SA 1YFXA 1SBFA 2RMU2 1ZVFA 5CVRA 3NW4A 2YC4A 3KV4A 5FWEA 1C4RA 4JKMA 2OUJA 3RZJA 1CZTA 1BBT2 2E7TA 2WABA 5F39A 4C1WA 1A8DA 3SH3A 5FUNA 2ZX2A 1L7QA 5FMCA 3UKNA 3H8RA 1CIYA 2ZHNA 3SLIA 1OLME 3EMRA 2VO5A 2HKXA 5H9SA 1MVQA 1RB8G 4K7JA 2AR6A 3W5NA 3POWA 4YVSA 3MIGA 4M3CB 4D6QA 1Y3TA 3BPZA 3HIFA 5EPAA 2D93A 5AVAA 5GZEA 2QQOA 4OI0A 4F3JA 1PM4A 3BTAA 1CAWA 1FNZA 3S0MA 1HXS1 4IUGA 2HBUA 2R6QA 1Z7S3 4E4DX 5LRRA 2J1UA 3AVRA 1C57A 3DYOA 3MICA 5GZDA 1UMIA 1C8NA 3I8TA 5C3QA 2W39A 2ARBA 4EWEA 4A3XA 3H1WA 1N3PA 2XL7A 2AH2A 2G9GA 2RDSA 5F6KA 4YG6A 1AR73 3MDPA 4U36A 5LA0A 1VB4A 4QQOA 1WW6A 4CDQC 3BKZA 3E5UA 1R64A 1S2EA 1VPHA 5C70A 1TME3 2RJLA 1PZ9A 5A7WB 1POQA 3K4AA 5E1RA 3CNAA 4Y24A 2VMHA 1GNHA 2VE1A 5IVCA 1IS6A 4JGZB 4LHSA 4P9GA 4QHZA 3H8UA 3B5LB 4H55A 3ROUA 4K21A 4R9DA 3OPWA 3N9MA 4ZU7A 2GP5A 1JZ6A 4CUGA 5L9RA 1HDKA 1XU2A 3UKVA 4X6RB 1PO11 2XQXA 1BCXA 2W87A 1CJDA 2NQYA 4K9SA 1T6GC 5F2WA 4BQ1A 1PGW2 1GU3A 5JPNB 1YRZA 3B02A 4FTBA 4RS5A 3FX3A 5C8CC 3RMXA 4OQ8A 2HWF2 3ZSJA 1RUJ2 2A6WA 4MADA 3ZFFB 2RS32 4FOYA 4XFIA 3H8XA 2GU9A 2VZRA 1ZNPA 4TLGA 4NWVA 2QTWB 4JHTA 4LMFA 4YM3A 1TZOA 1K5MB 1QH7A 1OD5A 1SLBA 1W6MA 2SLIA 2UYAA 2XVKA 4GQ7A 1F5FA 4KU8A 4BJ0A 1Q56A 1W04A 3VKOA 3I2HA 2XLGA 5FZKA 4R9BA 1CX4A 4R8HA 4DRVA 1J58A 1IZ3A 4QWNA 3UJQA 3POBA 2GSYA 1EPZA 2BFUS 3PVOA 5LEKA 3MI8A 1RXGA 4JV4A 3ZN5A 1NE4A 3GBGA 4GH4C 4MXVA 1EV13 4GMP1 3ZLIA 4R9AA 3DUIA 2B8MA 1QXPA 2PA7A 5FXWA 2WNVC 5LASA 1HQLA 3B9CA 5FOJB 4LJHA 1Y9GA 1GZTA 1FYUA 5DZGA 2HWD3 5LK7B 2R061 3QBQA 2ZGMA 2WJSA 2I07B 1ZBE3 2CAUA 4NMIA 4PLNA 3CLPA 5C3SA 2VTXA 1UOJA 1OQ1A 3FBMA 4ZY9A 1MZ5A 3NNFA 5FY9A 3NAPC 4Y1XA 2JICA 4CU8A 4OULA 1PVXA 1HX6A 4L97A 1EY2A 5CFDA 2OYZA 1B35A 3S5QA 3RZMA 3AP5A 3AFKA 3ES4A 4LOTA 1RUF3 3ZXJA 4QGNA 3RRDA 2YBKA 1RUE3 5FZIA 5HXMA 5C3OA 2P3KA 3SQOA 3J4UH 1XNTA 4RGAA 1GICA 4XACA 1UY2A 4FBFA 2BU9A 1H1MA 1N1SA 3TN93 3TWIA 3FHAA 4FPCA 4XE9A 1TQ5A 3A0KA 2V72A 5FPBA 3LZZA 3I2JA 2A6ZA 4FQ4A 4BLIA 2RG4A 3ZXGA 1HJFA 3K77A 4K20A 3SH4A 5ABJC 2VZQA 1DFQA 1NX9A 5FLJA 1H4GA 2W1UA 2VAUA 1LB2A 4IEWA 4Y3OA 3ZYFA 3I3EA 1CAUA 1QJU3 4IGOA 3O1TA 1IOAA 3PUQA 1W9TA 3M4FA 1RIRA 1DGWA 1LGBA 1VBD3 3HN1A 2B7YA 3FUQA 1JXNA 4OMCA 1HN1A 2ADEA 4XBLA 3BTZA 4IE7A 5LA9A 3OD0A 2BTVC 1TMF2 1AXZA 1G86A 3AFGA 1AYN2 5DG1A 4HZFA 1STMA 2MEV3 3GJBA 1OFNA 4GAZA 2LRPA 3VD9A 1R093 4Y5SA 2XJSA 5KXEA 4MSVA 2ZXQA 4NROA 1N3OA 3WUCA 4X8NA 1HRV1 2WZEA 1G9BA 5J37A 1SHWB 2GALA 2VG9A 2WQ8A 4XURA 3CL1A 4QPGA 1ZRIA 1SLIA 2ZGOA 3I2IA 2WZPP 4NO4A 4QX0A 4Z8BA 1VBB1 3HNYM 4XJ8A 1DQ6A 1QJEA 5AFBA 1MEC1 2BRTA 4XFHA 3ZX7A 4EE2A 5JSPA 1D4M2 4OQ9A 3CF6E 4CTEA 4N43B 4GZ9A 5FO8B 1W05A 2C6SA 5LW9A 4KL1A 3SMHA 3I2DA 1WLWA 5LATA 5FQ0A 3T1LA 4E2SA 4I01A 1RTVA 1GNZA 1QJX2 2BOJA 2Q8OA 1H30A 4MV2A 2WWUA 3KMHA 4KQ7A 3RZZA 3ZM8A 4I3GA 1CAXA 1DGRN 2O8OA 1PIV1 3FHIB 2FCTA 3L2HA 1MS3A 3ALQA 2C9AA 4IV1A 3CJIA 3ZFEB 4K40A 4PLOA 2VW0A 2YROA 3WX5A 4AFAA 4D8MA 4CUCA 3TEZA 5FPAA 4LE3A 5FKBA 1ENQA 1QOTA 2Z42A 1BYHA 3H50A 2WLQA 2XJVA 2XXZA 4WZFA 3APBA 2ZMLA 3HNMA 1PO23 4RR3C 5FYYA 2DBIA 4B8EA 1JU3A 1UX7A 1R081 2YB7A 5HV0A 4MUVA 1VBE3 3WEZA 3WNLA 4COVA 1GR3A 4BK4A 3D8CA 4ZZ8A 3QLQA 5IVFA 1RMU3 1RUC2 2ZEXA 3JD72 3WHUA 1ULGA 3ZFGB 1W39A 2ARXA 2HWB2 3JQXA 4N53B 3AKRA 2IXLA 4ZXKA 1RUOA 1NZIA 4NE9A 4QQPA 3J9SA 3KB5A 4ASLA 3GNEA 3PU8A 5FZCA 5J96B 2OT7A 1ND2C 2YFZA 3D5OA 3OGJA 4Q4W3 2JDMA 1RITA 3OTFA 3MEPA 4PIYA 2XHNA 1NT0A 2WNUA 1F9KA 2Y6LA 3KQ4B 5DZFA 1AXKA 2VUJA 2BERA 2LALA 3IIAA 2YGLA 2ZEWA 1XYPA 2GAUA 2WZR1 2BEOA 1DP0A 4LITA 4LORA 4XTPA 4L0PA 5BNOB 1NCQB 1EP0A 3C8XA 5FZHA 1SLCA 4Q4X2 3U11A 1BVVA 1NA1B 4JCKA 1OT5A 1H6XA 2VU9A 3AYEA 1S0DA 4RGGA 1YC61 4AVCA 4W4ZA 4EN7B 2VM9A 3VUOA 2VZ3A 4JX0A 3SKVA 1WCQA 4PIXA 1H2KA 3QD6A 1V6MA 4LA2A 4MOAA 4Q8LA 2ARAA 3THPA 3ZPOA 1FXZA 1SQ4A 1HQNA 3KSCA 3BN6A 4CEWB 3VHOA 4AWDA 3A7QA 3R4SA 3NNMA 4SLIA 5EJ3A 2WR9A 3ZXKA 1TE1B 2VJXA 4FFHA 4IL7A 4BQ2A 4BIOA 5GJ6A 1C3HA 1I6XA 4P9WA 1RJ8A 1SEFA 1ZZ7A 3T30A 1MS0A 2A6XA 2VZVA 3Q8AA 2XG3A 5C3RA 2VC9A 1ALYA 1ODMA 1OKQA 4Q26A 4LLFA 1LHWA 2BUKA 2QKDA 3CKHA 4MGQA 5T5PA 2BWCA 1CIWA 4XEZA 3TNQA 4QPWA 1OPOA 5A32B 5IWFA 4XUPA 1OSGA 2J7MA 5JI9A 4RS5C 1DQ2A 2FDKA 1V6NA 2PHLA 3LQCA 4BXFA 1NLSA 2JENA 3NJXA 3O14A 4XUNA 4N8MA 3VBRB 4INDA 2VPVA 3KV6A 1CZVA 4D7SA 5CA6A 1S1AA 3MIEA 5DDJ1 2FDJA 3H1YA 4FOWA 4ZS2A 3R0RA 1Q5OA 1RXFA 4AFMA 1AR62 1V00A 3GF6A 2WUHA 5ANQA 3VBSA 2D3RA 4K1YA 5CG9A 2W08A 4YG0A 2ET7A 4P08A 4Q29A 2RDRA 2VZTA 1QH6A 3EBRA 5F32A 4B1LA 5B2GB 4IE5A 3O1PA 2KR2A 3VBHB 2QQPA 5EIYB 1RUH2 4FAGA 4CXWA 3U07A 2VOWA 2GMEA 2ORZA 3T3YA 3ZXEA 4YRDA 4Q4V3 1H8TA 3OB8A 4GWNA 2VECA 4I30A 4BQXA 3VDBA 4PI2A 1D2SA 1HQWA 4M3CA 1UQXA 5A6ZA 2DCZA 4C90A 4UI9L 3LPFA 3BOPA 4YW5A 4NIAA 4L9BA 2WRAA 3Q8BA 4LBLA 2ATFA 4LOSA 3VZJA 4AHWA 1CX1A 2D40A 4AQSA 1VRH2 2WT0A 1H4HA 2GMMA 2J1AA 2X5IA 4YW3A 1KDKA 2VMEA 4HN0A 1XE8A 2D44A 1FPN1 3RS6A 2WN2A 1B09A 2OX0A 4ASMB 4LHKA 5CFDC 3SEPA 2W47A 4IGQA 2YFUA 1W0NA 5I93A 4ORFA 1AJKA 1WCDJ 1DU3D 4ONUA 1RUD1 4CCLA 1X50A 4AI2A 2XONA 2XR4A 1AYM3 1ONAA 2VUAA 1YEWA 5CU1A 3CO2A 3TRSB 3AX4A 4BMBA 2X09A 3WQ0A 3FWEA 4N7UA 2FZ1A 5T3NA 3DCQA 3SH5A 2ZX0A 4YG3A 3O7OA 1FOD2 2J42A 2OS2A 3WZ1A 4COZA 1R1A3 2VXRA 3ZN6A 3D4KA 1FX5A 3E6DA 2R072 3WG4A 3PUHA 4A4AA 4QPIC 1PNGA 3M3EA 3V0AA 1QJY1 4LBQB 1AL22 2ZA9A 3LA2A 4CDWA 4Q4Y1 1VAMA 3AZZA 5LBFA 3OEBA 4CCKA 4FQZA 1Y7BA 4A3ZA 4PF5A 1W2TA 5DUVA 2VH9A 1W9FA 5FY7A 5H9QA 5T5LA 3UKTA 3ZFFA 3HN3A 5FPVA 1MVEA 3USUA 2VZUA 2RR13 1I5ZA 2X53S 3Q8FA 2OPWA 3KCYA 3DPRA 2GMPA 1LHVA 2CY6A 2YBSA 3DXTA 4IESA 3R6SA 5A33B 4NHLA 5J1XA 3GHMA 2JG9B 2R041 4QPGC 4Y22A 2RVAA 2WDBA 3VBFB 1OH3A 3J7MA 4R52A 3MLJA 4FO9A 4LO4B 2NMNA 1I1EA 4QGMA 4XQ4A 4NIIA 1MS5A 4NR1A 3POJA 1PK6B 3BALA 3WP4A 2HWC2 2PTMA 4A7YA 5A3PA 4FPGA 4N7IA 4URTA 1KDMA 1POV3 2W46A 1LODA 1VMHA 2LROA 4GB32 4LQRA 3U14A 1AX1A 3POFA 3ZYHA 4E4ZA 3HWJA 4P9IA 3ST7A 4QXCA 4BHPA 5BYNA 1L7RA 2VQAA 3PJQA 2WL1A 1KQRA 3HOBA 1ULPA 3ON7A 1U0AA 2OQ7A 3WNXA 2BNMA 1FT9A 2R16A 2WS92 3EHKA 4IV1C 1QEXA 2D5FA 3CJIC 4RFRB 5EQUA 3DN7A 4ZXEA 3VDDA 4CCDA 4LHNA 4DIQA 1RHI2 4Y20A 1RINA 1JZ8A 5IK4A 3PUIA 4CA9A 3N7MA 5FPXA 2QNKA 3J8F1 5LA2A 1XB9A 1YNAA 4EN8B 3OUIA 5FZLA 3CHXA 2GC0A 3AC0A 5A70A 5I91A 1JYVA 1KRIA 4XF4A 1DF0A 2VMFA 4AGVA 4DUXA 1QF3A 5HV4A 2OA2A 4TN7A 1FV2A 3NNLA 2UY8A 3WQBA 5K9YA 4IEVA 1OLQA 4QHOA 5FIXA 3X29B 3BTXA 5KXDA 2QZ2A 1BBT3 2ZZQA 2BGCA 4O65A 3UL2A 4YW1A 1YQ6A 4AEKA 4O7XA 2WNUC 3ZO0B 3MBWA 2IC1A 4RHV2 2W92A 5HBAA 5I8YA 1RUI2 2FHRA 4QKNA 3WW1A 5AC92 3FLTA 1EAH2 1S0CA 3IPVB 1VAVA 4F7ZA 3C7GA 1ZBA1 3JBG2 2XL9A 4PF1A 3ORJA 4M3CF 2VW1A 3IMMA 1H9WA 3ZR5A 1XYOA 2A3YA 3I97A 5A6YA 4CDQA 3VHNA 4K8FA 3WDXA 3N7LA 4GD4A 4QX2A 4MXWA 4CPBA 3ZYRA 1N47A 4F8AA 4CCNA 4D69A 1LKNA 5CNAA 4J6GA 2V4AA 2HYXA 3PVNA 3V56A 2IFRA 3LDRA 3MPBA 1W2NA 2K0GA 3IB3A 5C9AA 4E8DA 1FMD2 3B93A 4B7EA 1BKZA 4Q2FA 2VMDA 3M3OA 2A3XA 4A6OA 3H7JA 3VL8A 1O8SA 1SBDA 2ADDA 2WINB 4E9KA 3IBMA 2WNEA 3A22A 4NIHA 1H2MA 5EWSA 1G6NA 4OI2A 3CZJA 3B7MA 4JDOA 5G05L 4RSUA 4FXKB 3R05A 1SBEA 5BPXA 2PAKA 3IIIA 5FOBB 3MIHA 5FKCA 2IVIB 3MGUA 1NCRC 1JTZX 1MS1A 4K6BA 4RGKA 1W3XA 3MHZA 3U1XA 4QB2A 2JWPA 2IWGB 4LBMA 4MZUA 2CYFA 1DIWA 3THCA 5FZDA 3O1MA 3AP7A
chains in the Genus database with same CATH topology
3AVRA 5FP3A 5IVYA 3RVHA 3LD8A 2Q8CA 2XMLA 2YPDA 4AI9A 4Y3OA 2YU1A 5FP8A 3PTRB 4IGOA 2P5BA 3PUAA 3PUQA 5A3PA 5FZOB 4UF0B 5FYIA 4QX8A 5F2SA 4EZHA 4C8DA 5IWFA 3KVAA 4E4HA 4QX7A 3U78A 3DXUA 5LY1A 4GAZA 4QXBA 5F5CA 4V2VA 5FPLA 4BXFA 5F3GA 4QXCA 5FZ1A 5A7WB 4CCMA 5A80A 3KV6A 5A3NA 3N9NA 3PU3A 5A1FA 5IVCA 2OQ7A 4BU2A 3K3NA 5F5AA 5FXVA 5E6HA 3LDBA 4DIQA 5FWJA 3OPWA 3N9MA 4Y4RA 5F37A 5ANQA 5FYCA 5FXXA 5LY2A 4CCJA 2GP5A 4URAA 5FYZA 5F32A 5FZ7A 2Q8EA 4CUGA 5A7NA 4D6RA 2GP3A 5LW9A 5F2WA 5KR7A 4NUBA 5IW0A 5FZLA 4CCOA 4EZ4A 5IVVA 4DO0A 4BISA 3KV9A 5FY0A 3K2OA 2WWUA 5F5IA 5A7OA 4EYUA 5FZ3A 5F3EA 4TN7A 5FZGA 3K3OA 5A3WA 5CEHA 5FYVA 2VD7A 2WWJA 2XUEA 5FBJA 5FZDA 3N9LA 4GJYA 5FXZA 4XDOA 4QU1A 4D6SA 3PUSA 4LIVA 3OPTA 3KVBA 4QXHA 4GJZA 5FJKA 5FYBA 5FY1A 5FZKA 5FZEA 5FPAA 4QWNA 3AL5A 3N9QA 5FY5A 2XDVA 5ISLA 5FYMA 5FZBA 3PURA 2XXZA 5FZ9A 5FYYA 2OX0A 3ZLIA 2W2IA 4IGQA 2YU2A 5FXWA 4Y33A 5FZ0A 5FZAA 5IVFA 3AVSA 4LXLA 4CCLA 4GD4A 2Q8DA 5A7SA 4LIUA 4ASKA 4V2WA 3U4SA 5FP4A 5FV3A 5FP9A 4CCNA 3KV5A 5FYUA 3PU8A 3AL6A 4XDPA 5FZCA 2OT7A 5FP7A 5IVJA 5FZFA 2OS2A 2OQ6A 5A1LA 5FY8A 5F3CA 5LWBA 5A7QA 4HONA 5FY9A 5FZ4A 5F3IA 4LITA 5IVBA 5FYHA 5K4LA 3KV4A 5FWEA 5FZHA 5FUPA 5F39A 4IGPA 1VRBA 4HOOA 4AAPA 4CCKA 5A3TA 5FUNA 3NJYA 5A7PA 5FZ6A 5FZOA 4UF0A 2YBKA 5FYTA 3UYJA 5FZIA 5FY7A 5FZMA 5FZ8A 5FJHA 5FPUA 5FPVA 3ZPOA 4CSWA 3PDQA 4D6QA 5FYSA 5A7WA 3N9OA 5FY4A 5FPBA 2YBPA 5IVEA 3DXTA 2YBSA 3N9PA 2PXJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AVR A;  5FP3 A;  5IVY A;  3RVH A;  3LD8 A;  2Q8C A;  2XML A;  2YPD A;  4AI9 A;  4Y3O A;  2YU1 A;  5FP8 A;  3PTR B;  4IGO A;  2P5B A;  3PUA A;  3PUQ A;  5A3P A;  5FZO B;  4UF0 B;  5FYI A;  4QX8 A;  5F2S A;  4EZH A;  4C8D A;  5IWF A;  3KVA A;  4E4H A;  4QX7 A;  3U78 A;  3DXU A;  5LY1 A;  4GAZ A;  4QXB A;  5F5C A;  4V2V A;  5FPL A;  4BXF A;  5F3G A;  4QXC A;  5FZ1 A;  5A7W B;  4CCM A;  5A80 A;  3KV6 A;  5A3N A;  3N9N A;  3PU3 A;  5A1F A;  5IVC A;  2OQ7 A;  4BU2 A;  3K3N A;  5F5A A;  5FXV A;  5E6H A;  3LDB A;  4DIQ A;  5FWJ A;  3OPW A;  3N9M A;  4Y4R A;  5F37 A;  5ANQ A;  5FYC A;  5FXX A;  5LY2 A;  4CCJ A;  2GP5 A;  4URA A;  5FYZ A;  5F32 A;  5FZ7 A;  2Q8E A;  4CUG A;  5A7N A;  4D6R A;  2GP3 A;  5LW9 A;  5F2W A;  5KR7 A;  4NUB A;  5IW0 A;  5FZL A;  4CCO A;  4EZ4 A;  5IVV A;  4DO0 A;  4BIS A;  3KV9 A;  5FY0 A;  3K2O A;  2WWU A;  5F5I A;  5A7O A;  4EYU A;  5FZ3 A;  5F3E A;  4TN7 A;  5FZG A;  3K3O A;  5A3W A;  5CEH A;  5FYV A;  2VD7 A;  2WWJ A;  2XUE A;  5FBJ A;  5FZD A;  3N9L A;  4GJY A;  5FXZ A;  4XDO A;  4QU1 A;  4D6S A;  3PUS A;  4LIV A;  3OPT A;  3KVB A;  4QXH A;  4GJZ A;  5FJK A;  5FYB A;  5FY1 A;  5FZK A;  5FZE A;  5FPA A;  4QWN A;  3AL5 A;  3N9Q A;  5FY5 A;  2XDV A;  5ISL A;  5FYM A;  5FZB A;  3PUR A;  2XXZ A;  5FZ9 A;  5FYY A;  2OX0 A;  3ZLI A;  2W2I A;  4IGQ A;  2YU2 A;  5FXW A;  4Y33 A;  5FZ0 A;  5FZA A;  5IVF A;  3AVS A;  4LXL A;  4CCL A;  4GD4 A;  2Q8D A;  5A7S A;  4LIU A;  4ASK A;  4V2W A;  3U4S A;  5FP4 A;  5FV3 A;  5FP9 A;  4CCN A;  3KV5 A;  5FYU A;  3PU8 A;  3AL6 A;  4XDP A;  5FZC A;  2OT7 A;  5FP7 A;  5IVJ A;  5FZF A;  2OS2 A;  2OQ6 A;  5A1L A;  5FY8 A;  5F3C A;  5LWB A;  5A7Q A;  4HON A;  5FY9 A;  5FZ4 A;  5F3I A;  4LIT A;  5IVB A;  5FYH A;  5K4L A;  3KV4 A;  5FWE A;  5FZH A;  5FUP A;  5F39 A;  4IGP A;  1VRB A;  4HOO A;  4AAP A;  4CCK A;  5A3T A;  5FUN A;  3NJY A;  5A7P A;  5FZ6 A;  5FZO A;  4UF0 A;  2YBK A;  5FYT A;  3UYJ A;  5FZI A;  5FY7 A;  5FZM A;  5FZ8 A;  5FJH A;  5FPU A;  5FPV A;  3ZPO A;  4CSW A;  3PDQ A;  4D6Q A;  5FYS A;  5A7W A;  3N9O A;  5FY4 A;  5FPB A;  2YBP A;  5IVE A;  3DXT A;  2YBS A;  3N9P A;  2PXJ A; 
#chains in the Genus database with same CATH topology
 3ZIW A;  3PIJ A;  2ZHM A;  3A4U A;  3RVH A;  1I9R A;  4UYB A;  4AGR A;  3VBS C;  2HWF 3;  4AI9 A;  1RUJ 3;  1XOY A;  3POS A;  4JAA A;  4CDU A;  2FMD A;  1XNB A;  2RS3 3;  4GH4 A;  4OHW A;  3O1O A;  1HRI 2;  3W59 A;  5T5J A;  1LEC A;  1WA4 A;  2VUL A;  3IZO A;  4COW A;  1PMH X;  1OF4 A;  5BY5 A;  2OKX A;  1H8T C;  5FPL A;  2QQM A;  1OOP B;  2BVV A;  3HJR A;  3PJY A;  1YQC A;  5CKM A;  3THT A;  1Q8P A;  1ZYB A;  4LBQ D;  5A80 A;  2VMG A;  4B7K A;  3GYD A;  5IAT A;  2VOT A;  5FXV A;  2W1W A;  2XJU A;  3TAY A;  1O6U A;  1T6B X;  3CMG A;  4OHV A;  3AJZ A;  4ZON A;  3VD3 A;  3LOI A;  1PVC 3;  3AMM A;  4KU7 A;  1GKB A;  2JKX A;  2XUM A;  2ZEY A;  3G6J B;  2A71 A;  4YSF A;  1W2O A;  2X5I C;  3NJZ A;  3CDZ B;  3ACG A;  4QKB A;  1UX6 A;  4UFJ A;  3UET A;  4LUL A;  4Q0V A;  4XFB A;  1VBC 2;  4BH9 A;  3OGV A;  2VCM A;  4MHR A;  5APA A;  3VBU A;  5F6L B;  5F7U A;  3R4U A;  2D5H A;  3GCW A;  4DRR A;  4D7T A;  1UIK A;  3DKW A;  3OGS A;  1ZRD A;  1GP4 A;  1Y9M A;  1AR8 3;  3O0X A;  3IM0 A;  3FL7 A;  4H7M A;  3WD5 A;  3VDC A;  2DWR A;  2JDK A;  1W8F A;  2AAC A;  1XNK A;  1Y43 B;  2BVB A;  1UXX X;  3NWK A;  3MV1 1;  4BCU A;  1G9F A;  3PME A;  5FPZ A;  4MGZ E;  4XQW A;  2AEY A;  4E2G A;  1EUU A;  5T52 A;  1VAL A;  4RQP B;  3MV0 1;  3PVE A;  4CDW C;  1UOF A;  1X9P A;  5C33 A;  3QAC A;  3UNP A;  4E2Q A;  1S0J A;  3W58 A;  2JG8 B;  2WT2 A;  2IXH A;  5HCH A;  3MO4 A;  3FN9 A;  3B00 A;  4JGY A;  2HJI A;  1TG7 A;  5GLZ A;  1R1Z A;  3WW3 A;  1TEI A;  4PQ9 A;  4HKW A;  4N90 A;  3ZFF C;  4ZZ5 A;  4A7Z A;  1FV3 A;  3I2K A;  5IVJ A;  4YZ3 A;  4ET7 A;  5I0R A;  5A1L A;  3KCC A;  1C8M 1;  1RUG 2;  2NLR A;  3LOB A;  4YM1 A;  3OY8 B;  4IE4 A;  1K42 A;  3A21 A;  2PLV 2;  4XUO A;  3VZK A;  1TMF 3;  4PDW B;  1AYN 3;  4CRQ A;  3BOD A;  2EVX A;  4NJ4 A;  4I0W B;  4AFB A;  1HB3 A;  4RA0 A;  4PHZ A;  5FZO A;  4AL9 A;  1REF A;  3SHR A;  1AVB A;  4FP2 A;  2XBO 2;  3J26 N;  1J1L A;  4YYO A;  2Y34 A;  4PI0 A;  1JYX A;  4OHX A;  2WKK A;  3LWC A;  2O14 A;  2V5D A;  5HXV A;  2EID A;  1D4M 3;  1DCS A;  3HR9 A;  1O91 A;  3RNS A;  3ZMN A;  3WW4 A;  3ZVX A;  5FZE A;  2JE7 A;  5FP3 A;  3SIS A;  5JZG B;  4CEY A;  3WDV A;  5IVY A;  2Q8C A;  3F2Z A;  1DZQ A;  3WQ1 A;  1WWY A;  5F1R A;  1YCI A;  5L7O B;  1HV1 A;  1QJX 3;  3OBZ A;  4AF9 A;  4A44 A;  4Y1Z A;  1AR9 2;  2LW8 A;  2WZ8 A;  4RR3 A;  2YV8 A;  4QHB A;  5CFC A;  5EFU A;  2P3J A;  4XF1 A;  1W0P A;  1JOJ A;  2JDA A;  3PL0 A;  4KG0 A;  1BEV 1;  4GWI A;  5EJ1 B;  1IKP A;  4M4P A;  1JZ3 A;  4QX7 A;  4QM9 A;  2UWA A;  4P02 B;  3IKW A;  2YC2 A;  2Z5W A;  3DYP A;  4TLF A;  3U0Z A;  2EAK A;  2TEP A;  2B46 X;  2V4V A;  3OYW B;  5CKQ A;  1ND2 A;  4AED A;  4CUA A;  3VZM A;  1D2Q A;  1ASJ 2;  3LSD A;  4XAE A;  1EPW A;  1OVP A;  2VOX A;  4EQV A;  3NMB A;  5JOX A;  2FDI A;  1V9U 1;  2QZ3 A;  1MQT B;  3VZN A;  1OUS A;  1RUC 3;  3ILR A;  4Q0U A;  2QCS B;  2W94 A;  3JD7 3;  2VL4 A;  2HWB 3;  2RM2 1;  1MZE A;  1BZW A;  2WA3 A;  3U10 A;  3I59 A;  3K4Z A;  2J22 A;  1O59 A;  3NNG A;  4UW6 A;  2FBE A;  1V70 A;  2Y64 A;  1W6P A;  3KV9 A;  5CIR A;  5GLU A;  2Y33 A;  3ZR6 A;  1JI6 A;  1O5L A;  1RVF 1;  3EO6 A;  1XSR A;  3MFC A;  1ZZ9 A;  2E63 A;  5BNP B;  3I3D A;  2GN3 A;  3UGH A;  5D1I A;  2RV9 A;  5FXZ A;  1O4Z A;  2WFF 2;  3N9L A;  4BQW A;  4E8C A;  4EN6 B;  1GWK A;  4DEV A;  1SG3 A;  4TZD A;  3HEI A;  4OMD A;  4AR2 A;  1O5U A;  5GAL A;  4Q4X 3;  1KGY A;  1KFX L;  1ND3 A;  4GMP 3;  5JUV A;  5FY1 A;  2RS1 1;  4IV3 B;  1BVP 1;  3M7A A;  4DXS A;  4GIQ A;  2EXJ A;  5C9A C;  2RS5 1;  5ISL A;  4CP2 A;  4LK6 A;  3VBO A;  4AYU A;  2Y6H A;  2NM1 A;  4JTO A;  4GAL A;  4S2G A;  3OBT A;  3WNO A;  5I0D A;  3PUR A;  4YVW B;  1UKG A;  4LEJ A;  4A2U A;  2ZGL A;  1C5I A;  2P17 A;  4CCE A;  1W6N B;  3ZXF A;  3MUZ 1;  1W6Q B;  2EIG A;  3KT4 A;  3NVC A;  4HET A;  3ASI A;  4DY5 A;  2BGP A;  2VMC A;  3IN9 A;  3QOP A;  1H9P A;  4Y4Y A;  2BJS A;  2BNN A;  3ZXD A;  2HEY F;  2IXI A;  4MG2 A;  3P3N A;  3POI A;  5IUQ A;  3VL9 A;  5LRS A;  1FAY A;  1PGL 2;  5FY8 A;  3M8L A;  5L36 A;  3BYW A;  4YZ4 A;  1LOA A;  4NRQ A;  3RZK A;  2WII B;  5IVB A;  1WKY A;  5FYH A;  5LBE A;  1UY4 A;  2PN5 A;  4NOT A;  5C4W B;  1BXH A;  1F35 A;  1GLH A;  1XQN A;  1Z7S 1;  4PCR A;  4CDU C;  5EYX A;  3KF3 A;  4IGP A;  4N9H A;  3LAG A;  3WP6 A;  1GYK A;  4NHY A;  1PVC 2;  4G3Y C;  2OVU A;  2BOI A;  2HWE 2;  2JE8 A;  1O3S A;  3VHP A;  3W21 A;  2FDH A;  1XBF A;  2NYY A;  3AB0 A;  3MW2 A;  3OBR A;  1AR6 3;  4ZPI A;  5FCC A;  5GZF A;  4WVV A;  1AR7 1;  3MIF A;  2ZGT A;  1IPJ A;  3PDQ A;  1VBA 2;  4AEM A;  3D3A A;  2EIB A;  3KF5 A;  3KWV A;  4AVS A;  3AJY A;  1OF3 A;  1OQE A;  4BE3 A;  5ACA 2;  1RUH 3;  2QDR A;  4OYU A;  4D7Y A;  3E5Q A;  1TME 1;  5K0U A;  3P6B A;  4FPY A;  1U5X A;  1AJO A;  4RL7 A;  5A6X A;  4XW3 A;  2YPD A;  3LGR A;  3PTR B;  4FPK A;  3WOG A;  4KWL A;  1ACC A;  1AR8 2;  4KBB A;  5D2A A;  3URF A;  4Z2W A;  5BNO C;  4OLL A;  2JB4 A;  1RGS A;  4CP1 A;  1IS3 A;  4QX8 A;  4I0B A;  3ZKY A;  1LTE A;  1HRV 3;  2ENR A;  1UO9 A;  1NOV A;  2O8Q A;  4IEX A;  5L73 A;  4R9C A;  4NHK A;  3WNP A;  3MID A;  2X8K A;  5CBL A;  3DXU A;  1QQP 2;  1W8W A;  4XF0 A;  3VBU C;  1C5H A;  1VRH 3;  1NE6 A;  2VBD A;  3NV3 A;  2C26 A;  4PBP A;  2YY1 A;  4LUK A;  2FZ2 A;  1DLL A;  2VXJ A;  4XUQ A;  3ETP A;  2JD4 A;  5I8S A;  3F95 A;  1K45 A;  3HQX A;  3LDB A;  2D3P A;  4QPI A;  2JDP A;  4OZX A;  5FYC A;  2EA7 A;  2GH8 A;  1ZX5 A;  3KS7 A;  4FPE A;  2ZJC A;  5EYY A;  1MZ6 A;  1LGN A;  1CON A;  1PM7 A;  3ECQ A;  2Y60 A;  4GMP 0;  2EXI A;  4K3U A;  5E16 A;  3VDA A;  3WIN E;  1BMV 1;  5HCB A;  1NXD 1;  1LHU A;  2XLF A;  1GZW A;  1SPP A;  5IW0 A;  4I3P A;  3WF4 A;  2IZW A;  2YPJ A;  4DO0 A;  1NAE A;  3EXU A;  1FOD 3;  2EF6 A;  1W8T A;  2K9Z A;  3MW4 A;  5J36 A;  1ZZC A;  3O0V A;  3BTY A;  1APN A;  2R07 3;  4JGY C;  5F3E A;  3T0D A;  4OZO A;  1EV1 1;  5FYV A;  4ISQ A;  5FBJ A;  1G8W A;  4CDX A;  4BQ5 A;  1AZD A;  3I3Q A;  1AL2 3;  4GKY A;  5DAP A;  3ZPY A;  1DGR A;  2ZAH A;  5T54 A;  4KH9 A;  4LIV A;  1HXS 2;  1QJZ A;  2I45 A;  3OPT A;  2HWD 1;  4PQQ A;  4QXH A;  3BB6 A;  1ULE A;  3ZYP A;  2C24 A;  4A41 A;  4ZS3 A;  4XJ9 A;  4JKK A;  1UIJ A;  1ZBE 1;  3BGA A;  3VD4 A;  2ZKN A;  2HYK A;  1UYY A;  1VMJ A;  4DS0 A;  3OUH A;  4ES8 A;  2GC1 A;  4AG4 A;  1QWR A;  1W8Z A;  1I3H A;  5DUX A;  4HXC A;  3PTY A;  5KXC A;  3S57 A;  1CR7 A;  2J1S A;  2B45 X;  1J3P A;  1WGP A;  5IK7 A;  5DMY A;  1AX0 A;  4UFM A;  1SFY A;  4PJY A;  1OOP A;  3OG2 A;  4OFG A;  1BQP A;  1OVS A;  4CU6 A;  1RUF 1;  3P1I A;  1RUE 1;  3WDY A;  5EV7 A;  5BNN A;  4AAX A;  2HWC 3;  3TN9 1;  4GWJ A;  5ERL A;  3I2G A;  3RZG A;  1IHM A;  2P3I A;  4CCC A;  4CEY C;  1QOO A;  1WCU A;  4WM8 A;  2VY0 A;  4GB3 3;  3OGG A;  3VHR A;  4C1X A;  1HB2 A;  3SCH A;  5C8C B;  4AEJ A;  2JDZ A;  4HOO A;  1PO1 2;  2C5D A;  4AAP A;  1HLC A;  2FQP A;  4J25 A;  1ZRC A;  3FFQ A;  5CFC C;  3DF0 A;  2B9U A;  2ET1 A;  5CAD A;  1JHJ A;  4OUM A;  1CQ9 A;  4JQT A;  1QJU 1;  2WS9 3;  5FZ8 A;  3RYK A;  5DN2 A;  1QHD A;  3USS A;  4DEQ A;  1VBD 1;  1RHI 3;  4AGG A;  5FYS A;  3CU7 A;  4DZG A;  4Y26 A;  5FY4 A;  4YZ5 A;  1K5J A;  4AQT A;  1ZZB A;  4AED C;  2ZGN A;  4OCT A;  2MEV 1;  1S0E A;  1R09 1;  4OHZ A;  1ULF A;  3OCP A;  2JDH A;  4WM7 A;  1UCX A;  2EAL A;  2I2S A;  3W5M A;  1X36 A;  1W6O A;  4LKF A;  3IDA A;  5FBZ A;  1EUT A;  5B4N A;  2P5B A;  1OXC A;  2B9V A;  3PUA A;  2CL2 A;  4AVB A;  2WNV B;  4NPL A;  5I8T A;  4UF0 B;  1F31 A;  2TUN A;  1A8M A;  3EB7 A;  3C2U A;  4Q5O A;  1JOB A;  5A3O A;  2W0X A;  3B69 A;  3T08 A;  2YMZ A;  1ST8 A;  3ZKU A;  4NID A;  1GQG A;  5F8P A;  4P9L A;  2R06 2;  4J1W A;  4RHV 3;  5IAX A;  1X82 A;  4KG8 A;  1RUI 3;  2VUC A;  1JYC A;  2IVJ A;  4Q8K A;  2WO3 A;  3N9N A;  1EAH 3;  5DUU A;  5A3L A;  5AC9 3;  3NAP B;  2YZ4 A;  2ES3 A;  3JBG 3;  3MIB A;  2Q1M A;  1DYO A;  4BU2 A;  5IFT A;  5F5A A;  3S5A A;  2R32 A;  1NYW A;  2DU1 A;  1YWK A;  2P6C A;  2UWC A;  1ND3 C;  4OUS A;  4LLO A;  1SCR A;  4UT5 A;  3HQU A;  2CDP A;  2GZW A;  2DVG A;  3RWN A;  4CCJ A;  2JG9 C;  1UYZ A;  1GP6 A;  1O8P A;  1LES A;  1D4V B;  2R7E B;  2Q8E A;  3VBO C;  2OZ6 A;  4Q27 A;  4XZP A;  1CAV B;  4CE8 A;  2QUO A;  2DVD A;  4LKE A;  4KWJ A;  2C0Z A;  2WT1 A;  4XC9 A;  3LEI A;  4DY3 A;  4FCA A;  3LIH A;  4MH0 E;  3WSO A;  4NN0 A;  4RN5 A;  1F4H A;  1YFU A;  3TEX A;  4D94 A;  1FMD 3;  1KS5 A;  1PO2 1;  2FD8 A;  1HW5 A;  4IE0 A;  1ULO A;  4GJY A;  1NCR A;  1VBE 1;  1N3Q A;  3HVD A;  4XET A;  4QT6 A;  2X05 A;  3ZXL A;  4KGG A;  1RMU 1;  5ABJ B;  2VQU A;  1GV9 A;  1OD3 A;  2ARE A;  3UGG A;  3FLP A;  2BBA A;  4KGQ A;  4DOU A;  4WV8 A;  2K46 A;  1PMI A;  2A6V A;  3AL5 A;  2ZKL A;  3N9Q A;  3RWK X;  1QGL A;  4NIG A;  4Q4W 1;  4WVM B;  5KC5 A;  2R30 A;  2DUQ A;  5KBF A;  1UYP A;  2XH6 A;  4UW5 A;  1OBN A;  4CXY A;  3KGL A;  3U75 A;  1C1F A;  1UL9 A;  4JHZ A;  2VNG A;  4I02 A;  3AVS A;  2H0V A;  2E6V A;  4OHY A;  2D6P A;  3LSE A;  1UZW A;  5FP4 A;  5FV3 A;  1JZ4 A;  1O3R A;  1QJY 3;  5DAW A;  5J3U A;  4QQH A;  4CUB A;  1HRV 2;  3LFM A;  2DUO A;  1I5P A;  1PNF A;  1GZC A;  1HRI 3;  2VBB A;  4EWD A;  5A7Q A;  4Q1R A;  2WO2 A;  4LBK A;  1VBB 2;  5FZ4 A;  3TBD A;  1DQ1 A;  5K0U C;  2XJP A;  1MEC 2;  4DXR A;  2BNO A;  1W9Y A;  3OSD A;  4D0Q A;  1UPI A;  2JIJ A;  1LEN A;  5A3T A;  2L9L A;  5A6Q A;  5A1A A;  4HT1 T;  2XKP A;  3IDE A;  5FZ6 A;  2WBK A;  4QAW A;  1OPM A;  2VVE A;  4FPH A;  4HPK B;  2XLA A;  2WYS A;  5K8S A;  4NHX A;  3ZSL A;  1W8U A;  5H9R A;  4P5H A;  4HLT A;  2PHX A;  4FPL A;  4K8R B;  4YM2 A;  4FTS A;  1PIV 2;  5A7W A;  3SNM A;  1COV 1;  3T0A A;  2A73 B;  1G9D A;  2Q30 A;  1HIX A;  2J1R A;  5D8A B;  1QDC A;  1MR5 A;  4XVH A;  2A5Z A;  4JGZ A;  1CWP A;  3AXE A;  1H2N A;  5KHG A;  2E53 A;  4WVZ A;  4B3N A;  3LD8 A;  3ELN A;  1VBC 3;  2XWJ B;  3EYP A;  5FFO C;  2VGD A;  1W0O A;  2VMI A;  3LFI A;  4YFW A;  2W1S A;  2EXK A;  1GBG A;  5EXO A;  3Q9O A;  3LEG A;  2QVS B;  2H6B A;  5E8A A;  4EZH A;  3K51 A;  1R08 2;  3FC0 A;  3AP4 A;  4LBO A;  3S7E A;  1J1T A;  1UYX A;  4ZHN A;  1O3T A;  2G19 A;  3LA3 A;  4YVS B;  3U78 A;  4XBN A;  1CPN A;  4XXA A;  5L9B A;  3WLU A;  2Z2S B;  2MPF A;  1BK0 A;  1CAW B;  2X10 A;  4UFK A;  1GMM A;  4FFG A;  1CJP A;  1W8N A;  4CDX C;  4Q4V 1;  3J8F 3;  5DUW A;  4HVQ A;  3GM8 A;  1K5M A;  1L3J A;  4L8Q A;  1S0F A;  4QU2 A;  4AZZ A;  4Y4R A;  3VB9 A;  5EHD A;  1JYT A;  3SEE A;  5C7G A;  2WZR 2;  5TSW A;  1AUY A;  3PNA A;  4ITC A;  4Y1U A;  2VBP A;  4CZS A;  3MLL A;  2D6M A;  2A70 A;  3ABZ A;  2DV9 A;  2ZX3 A;  3WCS A;  3NRU A;  1A78 A;  1RUG 3;  5FZ3 A;  3NQH A;  2QDN A;  4I0A A;  4IEY A;  4QKF A;  4YW7 A;  5IK5 A;  2VUD A;  1UU6 A;  2PLV 3;  1GSL A;  2AZ5 A;  1OOP C;  2HEV F;  2IXJ A;  2RDQ A;  4W65 A;  3ZYI B;  1GQP A;  1YQ8 A;  2CDO A;  2ZGS A;  4D6S A;  3AZX A;  1UWW A;  3UT0 A;  1NXM A;  1AYM 1;  3I3B A;  4N9I A;  4CVU A;  5BNN C;  2UU8 A;  4PT6 A;  1W06 A;  2JDU A;  4MYE A;  3WG3 A;  5FYM A;  1WMF A;  2XBO 3;  4WM8 C;  3PVB B;  1R1A 1;  2J1E A;  3H7Y A;  1ENR A;  5FZ9 A;  5IHR A;  4RS5 B;  5DQ0 A;  2VQT A;  1GAN A;  2YYO A;  4HMZ A;  3KHB A;  2NPI A;  2BDR A;  3UES A;  2DTY A;  2ZAC A;  4XAA A;  5FP9 A;  3RI9 A;  1UN1 A;  5GZG A;  5LBB A;  1W6M B;  2WLP A;  3LDK A;  1E5R A;  1Q8S A;  2JIG A;  2OUH A;  3I2O A;  1AR9 3;  5DDJ 2;  2F17 A;  2R49 A;  4HON A;  3L2Y A;  2RR1 1;  4WM7 C;  1K3I A;  4HFS A;  3POG A;  4FPJ A;  3J7N A;  1OA4 A;  1GNY A;  2CU5 A;  1AXY A;  1TNF A;  3RYR A;  3WF3 A;  3WP3 A;  2Q1Z B;  3T2O A;  1YO8 A;  4Z2A A;  4QB6 A;  4RQP C;  2KXL A;  2E51 A;  2VOK A;  1F5J A;  2Q1F A;  4MVT A;  2DCT A;  5JR7 B;  1ASJ 3;  1DZR A;  2D6O X;  1ENX A;  2ERF A;  1REE A;  1YXW A;  5FZM A;  1F2N A;  4EJR A;  5FPU A;  1Z78 A;  2TNF A;  2UY9 A;  1JZ2 A;  4M00 A;  4P9J A;  1JUI A;  4R4Z A;  1POV 1;  1S55 A;  4FFF A;  2JKB A;  2YBP A;  5GLT A;  1JHN A;  3BVC A;  4BZ4 A;  5IVE A;  3NV1 A;  3AYA A;  1W8O A;  3KT1 A;  4BQ3 A;  3ILN A;  3MYX A;  5DAQ A;  4A6S A;  2NMO A;  4OI4 A;  1W2U A;  2CTV A;  1HB1 A;  1PHM A;  1WD4 A;  3AM2 A;  3BCW A;  3AP6 A;  1B35 B;  1T2X A;  1U5Z A;  5FP8 A;  1OUR A;  1WW4 A;  2ZAA A;  3T2T A;  2C9K A;  1QKQ A;  1FPN 2;  4N43 A;  2WFF 3;  4C8D A;  4XFG A;  5FTT C;  1LOC A;  3KVA A;  1DLC A;  2FCV A;  3IAP A;  3H8O A;  3AZV A;  1RUD 2;  5LY1 A;  2FDG A;  1LNS A;  1NQD A;  3VKL A;  4HG6 B;  1F15 A;  5JDB A;  2VR4 A;  3GZT B;  1AF9 A;  1H8V A;  3PU3 A;  4IW3 A;  2B4K A;  4BPZ A;  3C3V A;  5C71 A;  2RDN A;  2Z4F A;  3ZFE A;  2WNO A;  3AMP A;  3K75 B;  2RMU 1;  2AEN A;  4ARX A;  4GWM A;  1QJY 2;  5FZ7 A;  3BPS A;  3KM5 A;  1UZZ A;  2X29 A;  4IER A;  4XQD A;  1BBT 1;  4AK3 A;  4Q4Y 2;  3TOJ A;  1QNY A;  2VTF A;  1CD3 G;  1QXJ A;  4BB3 A;  5T50 A;  1UMZ A;  3ZIX A;  3WV6 A;  4E27 A;  4R4X A;  4LTA A;  4BME A;  5G04 L;  4NWW A;  2DUP A;  1J84 A;  2YC0 A;  4EYU A;  4QPY A;  3K3O A;  5GM0 A;  5CEH A;  2G4I A;  4K1Z A;  4Q0S A;  3ZFG A;  2YDE A;  4N53 A;  3HBZ A;  2VW2 A;  2PHD A;  3NKG A;  3P5B A;  1SFP A;  4WVW A;  4QPG B;  2B42 B;  2DYC A;  1MAC A;  3B3Q E;  2BQP A;  3J7L A;  2AYH A;  3AMQ A;  2R04 2;  2XJT A;  1VIW B;  2W9X A;  2XVG A;  3QCW A;  5FY5 A;  4DIN B;  4AHZ A;  2HWE 3;  5FZB A;  1J3Q A;  1IS5 A;  1LRH A;  1MQT C;  5BNO A;  1NCQ A;  5FQ0 B;  3E97 A;  4LT5 A;  3GXU A;  4Z82 A;  1VBA 3;  1NA1 A;  4JTN A;  4MHU A;  2YU2 A;  1OHF A;  3VD7 A;  3WP5 A;  2ZEZ A;  3S7I A;  1LOG A;  1PX3 A;  2QQV A;  2QQU A;  5ACA 3;  2AC1 A;  1DYK A;  1IG0 A;  1H0B A;  3OEA A;  3RFR A;  2Q4S A;  3O0W A;  5BNP C;  3SC7 X;  4YFZ A;  1W90 A;  4IV1 B;  3CJI B;  5A3M A;  3LEM A;  5FP7 A;  5LEJ A;  5FZF A;  4CEW A;  4IEZ A;  2XPJ A;  5JXG A;  5J48 A;  5IT6 A;  2Q5T A;  4HVO A;  2ZTN A;  1DBN A;  4JC1 A;  1UZV A;  4JGZ C;  4EWA A;  3GDB A;  2Z79 A;  4F83 A;  1PZ7 A;  5D21 A;  2XWB B;  4DQA A;  1DGL A;  2KA3 A;  2NZ9 A;  1S4C A;  3UV9 A;  1XJA A;  1QQP 3;  4AI0 A;  4AQ2 A;  4S2H A;  3J8F 2;  1X8M A;  5FUP A;  1BLZ A;  3PLQ A;  4YVW C;  1PGW 1;  1VLN A;  4UBG A;  4X8P A;  2HWF 1;  1RUJ 1;  5C5U A;  4FP3 A;  5JI7 A;  1PX4 A;  2EIE A;  2RS3 1;  4H2A A;  3GZA A;  5A32 A;  1W9S A;  2ARC A;  2ZGP A;  1GP5 A;  1SLL A;  4YGE A;  4DUW A;  4HVR A;  3M1H A;  1KFU L;  1Y4W A;  3N9O A;  4HSL A;  4JRA A;  1KIT A;  4M4R A;  3ACH A;  1UY3 A;  2WNU B;  4ZU4 A;  3VBR A;  4B4R A;  3TEY A;  2V73 A;  5DZE A;  2C4X A;  2D3S A;  3N7K A;  5FMD A;  1K5M C;  3FJS A;  1LOF A;  2PHF A;  3IWZ A;  4EN0 A;  3CIH A;  4B4P A;  2ZHL A;  3LB9 A;  2D6K A;  2C1F A;  2GDF A;  3IDB B;  2IXC A;  4GKX A;  4TXW A;  5IAV A;  4NVP A;  4BQ4 A;  4UWD A;  1ZBA 2;  4UOJ A;  3VBH A;  2WC2 A;  1CPM A;  1BHG A;  1H1A A;  2A1X A;  1SLT A;  2G9Z A;  2R1B A;  5KHK A;  4IXL A;  3WDW A;  3LF7 A;  4GA9 A;  3N4M A;  4TWT A;  4DFS A;  1HXS 3;  1OUX A;  3E6C C;  4IET A;  4DXT A;  2R1D A;  3OUJ A;  5CKN A;  3AZW A;  3WR0 A;  5HI0 A;  4M0N A;  4RFT 0;  4ATF A;  3AKP A;  3MZH A;  1ZZ8 A;  1S2B A;  4BM8 A;  3KT7 A;  4Z1V A;  2XJR A;  5JCT A;  4Q0P A;  5JOY A;  5KWR A;  2CSG A;  3P3P A;  1W28 A;  2ZAB A;  1KXG A;  3KQR A;  2JB8 A;  5JXI A;  5FXX A;  5GZC A;  2Z69 A;  3LKJ A;  1E5S A;  4TSV A;  3ZSM A;  4LBJ A;  3B01 A;  4WZC A;  2PEL A;  4JQR A;  5LBC A;  2GP3 A;  4ISR A;  4WBB A;  1MZF A;  3GGL A;  5DAX A;  4LR4 A;  4XCA A;  4H14 A;  4BDV B;  2Y0I A;  2CWM A;  2RS1 3;  2WWS A;  5BV6 A;  5C6C A;  2ZGR A;  4FVV A;  4W6W A;  3WNM A;  1YFW A;  3C7F A;  4P9X A;  3CJX A;  3HAG A;  4L2N A;  4AW7 A;  5C8W A;  1ZRF A;  2EXH A;  4CXX A;  3VBS B;  3KVB A;  4GJZ A;  1PO1 3;  1JN2 P;  1YJK A;  1SMV A;  2PHT A;  1VE0 A;  3HT2 A;  4LBQ A;  1WME A;  3AP9 A;  3WW2 A;  1JZ7 A;  3I3M A;  3RZH A;  4UFI A;  1QNW A;  3ZDV A;  4C0B A;  5BXX A;  2PMW B;  2PHU A;  2W5F A;  1H8T B;  4QDR A;  1TMF 1;  3U4X A;  1LCL A;  3VN4 A;  1AYN 1;  1E57 A;  1WMD A;  3E6B A;  4LXL A;  5CIS A;  5JR2 A;  2D7F A;  2DU0 A;  1LUL A;  3GZE A;  3H0O A;  2B5H A;  3BOW A;  2PAM A;  1QJF A;  1G9A A;  2NN8 A;  1E5I A;  1P8J A;  3SCG A;  1V6L A;  1C1L A;  2GNT A;  1FAT A;  1SDD B;  2X5I B;  3POE A;  5A33 A;  1UF2 C;  3W20 A;  2JG9 A;  3VBF A;  1D4M 1;  3ZMO A;  2ZGQ A;  2AEZ A;  2JJ6 A;  2O0O A;  4Y5Z 0;  2R06 3;  1VRB A;  5J09 A;  1PK6 A;  4CU9 A;  1YQ5 A;  4N43 C;  3O5S A;  2H0B A;  4YGB A;  3VLB B;  1QJX 1;  2WAA A;  2YXS A;  5F9T A;  3RPQ A;  1RUN A;  1X33 A;  2QQN A;  2Y6G A;  2IFW A;  1LU1 A;  1JW6 A;  1WW7 A;  2QQL A;  5JMC A;  2UWB A;  1Z0H A;  1F4A A;  1QXR A;  3RYP A;  4HK9 A;  5FMO L;  3T1M A;  3ZN6 B;  3RG0 A;  3WDU A;  2BBV A;  4MGI E;  3V0A B;  4ARY A;  1VAK A;  1Q3E A;  1QOS A;  3OGR A;  3NJV A;  3OOX A;  3ZFE C;  4CDW B;  3T0B A;  1DQ5 A;  1KD7 A;  3VKN A;  5EZW A;  1X9T A;  5GLW A;  2XKO A;  3K48 A;  4UXA A;  4LO6 B;  1XRU A;  3QH7 A;  4JKL A;  1FNY A;  1WMX A;  4LHL A;  3FFZ A;  5KXB A;  3BIE A;  4HKL A;  1RUC 1;  5DAB A;  3H9A A;  3JD7 1;  4XTM A;  4B1M A;  2IUW A;  1X8E A;  2HWB 1;  3USU B;  5F3G A;  5FZ1 A;  4COY A;  2LS6 A;  3DPR B;  2J1V A;  3ZFG C;  4FFI A;  5A3N A;  2MHF A;  4N53 C;  5A1F A;  4NHM A;  3AXD A;  4Y22 B;  1QIQ A;  3ENR A;  4LO8 A;  5E6H A;  1C8M 2;  2CV6 A;  1OC1 A;  3RJ2 X;  1LU2 A;  4XIK A;  1UPS A;  1NUK A;  2W95 A;  3DL3 A;  4J1X A;  4TYS A;  4AHX A;  1RJ7 A;  1V6K A;  4Q4X 1;  5IFP A;  3IPV A;  1AL0 G;  1NCQ C;  4CCO A;  2GC3 A;  4IEU A;  5IVV A;  1DZT A;  2VNV A;  1JH5 A;  1NA1 C;  3K2O A;  1JYN A;  3GBF A;  3IT8 A;  1VBB 3;  2VD7 A;  2UYB A;  4LO5 B;  3WF2 A;  1OMI A;  3MW3 A;  1MEC 3;  1WCS A;  5JSR A;  1NQJ A;  2ZGK A;  4XHX A;  2FCU A;  3VDD B;  3WDT A;  3AYC A;  5J98 B;  1IKQ A;  3UJO A;  4MGK E;  1Q8Q A;  3CQO A;  4Y20 B;  4CEW C;  4PIZ A;  1QU0 A;  3ZSK A;  4AVV A;  4CP9 B;  4L92 A;  1IGO A;  4FXG B;  2DDU A;  1VR3 A;  4AVT A;  1QDO A;  2WQZ C;  3EJK A;  1GOH A;  1JZ5 A;  4M3C E;  5B4X A;  2V09 A;  2ZBJ A;  4MGS A;  2GNM A;  4Q1P A;  1PIV 3;  4X6Q B;  4XJA A;  1LHN A;  1YI9 A;  1UOG A;  2GNB A;  1BEV 2;  1UMH A;  2BW8 A;  3H1M A;  2ZCW A;  4QB1 A;  2ZGU A;  4ASK A;  4V2W A;  5JLV A;  1N1T A;  3ZYJ B;  1YLL A;  2IXK A;  1YIP A;  2VZ1 A;  3HNB M;  3VBR C;  2JX9 A;  3V0B B;  1AR6 1;  5LWB A;  1LOE A;  1R08 3;  5F3I A;  3MF6 A;  1LOF C;  1V9U 2;  2I74 A;  3JXS A;  4HKO A;  1US3 A;  2XJQ A;  3FZ3 A;  2ZMN A;  5M0T A;  4I2O A;  4QXK A;  1XE7 A;  1RUH 1;  3ZYB A;  2RM2 2;  1WCK A;  1GQH A;  3NJY A;  3VBH C;  5A7P A;  2VTX J;  4CDQ B;  5JWP A;  1NLR A;  5CYY A;  4MXW B;  1RVF 2;  4W8J A;  5JVV A;  1MS9 A;  4AE2 A;  1NZC A;  1X7N A;  5HPO A;  4W50 A;  4CSW A;  1LJ7 A;  4MET A;  2VVD A;  1UY1 A;  3U37 A;  2WZR 3;  1ZA4 A;  1A3K A;  3DYM A;  1CZS A;  1D0G A;  5JOZ A;  4XJU A;  5C9A B;  3M70 A;  3JCI A;  5LB6 A;  4Y5T A;  2A3W A;  2WSV A;  1OLM A;  1IS4 A;  1NKG A;  1VRH 1;  2RS1 2;  5EJZ B;  3TYJ A;  1O4T A;  2BWA A;  2RS5 2;  2XML A;  2PAE A;  3H3U A;  3SIT A;  3N36 A;  4I09 A;  3WG2 A;  4UW3 A;  4FPO B;  5BNQ A;  2RE9 A;  2DVB A;  4KNC A;  4LPL A;  5FO7 B;  5FMO S;  5AFE A;  5C5T A;  1DDL A;  1SCS A;  3DKQ A;  4MGT A;  1XE0 A;  2QE3 A;  1ZRR A;  2E31 A;  3N7J A;  4AOC A;  5FUI A;  3I54 A;  2P4E A;  5C3P A;  1J59 A;  3MFA A;  4QXB A;  5F5C A;  4V2V A;  5FK7 A;  3AKS A;  4HN1 A;  1XSQ A;  1C28 A;  3KHC A;  2VCB A;  1FOD 1;  1ODN A;  4XUT A;  2F6B A;  3WCR A;  3ZOI A;  1ENS A;  2ZPX A;  2P34 A;  2R07 1;  3THD A;  5D8A C;  1MPX A;  5LY2 A;  1WD3 A;  1AL2 1;  4CDU B;  4XAB A;  1CES A;  4JDM A;  3ATG A;  4GH4 B;  1LED A;  1GFF 2;  1KEX A;  4H7L A;  1N1Y A;  2WFP A;  1Z7S 2;  3OJB A;  5KR7 A;  4MO3 M;  4RQP A;  4RYD A;  1JYW A;  2WA4 A;  2E9Q A;  2Y6F A;  5FY0 A;  1VJ2 A;  5DDJ 3;  4ES9 A;  2JG8 A;  4W6Y A;  4XMI A;  5I0T A;  2B39 A;  2Y6K A;  5FZG A;  5JXJ A;  4YVS C;  3POY A;  2VOV A;  3J7H A;  2A7A A;  1AR7 2;  3JB8 A;  3KD4 A;  3O1U A;  3D82 A;  3VKF C;  2P2K A;  2XHK A;  2EIC A;  4JVA A;  5FYB A;  2MNG A;  4BQY A;  3WG1 A;  1TME 2;  4FT8 A;  2CGP A;  5SV8 A;  2PHW A;  3OY8 A;  1JMU B;  4LE4 A;  3V64 A;  3VBF C;  4BIF A;  2DUR A;  2BGO A;  4PDW A;  5HCA A;  1AHS A;  2HWC 1;  4XHB A;  2WAO A;  1D0H A;  3VBU B;  4EN9 B;  1PK6 C;  1O4Y A;  2GND A;  1Q8O A;  3NV4 A;  5FZ0 A;  3BIW E;  4CYD A;  4GB3 1;  3TEW A;  3GBW A;  4ZKT B;  2WO1 A;  2DVF A;  5JSO A;  3SKJ E;  3HQR A;  4KWU A;  2QBX A;  5HCF A;  4BYY A;  2BPA 2;  5FYU A;  4JZR A;  4XXP A;  4AI8 A;  4AQ6 A;  3GCX A;  1LOB A;  2CGO A;  1OFS A;  2WS9 1;  3OPZ A;  1AX2 A;  4B4Q A;  1DG6 A;  4DUV A;  1FPN 3;  3FLR A;  3OBA A;  3PIG A;  5FWJ A;  5CAZ A;  1RHI 1;  4YGC A;  2DCY A;  5JZG A;  2PQS A;  4YLZ A;  4COU A;  3AK0 A;  2HEW F;  3LIG A;  2DBN A;  3R4D B;  5K4L A;  3GJA A;  1RUD 3;  5L7O A;  4LA3 A;  1BMV 2;  4IDZ A;  1W8H A;  5DXD A;  2VZS A;  5FDB A;  5A3U A;  5EP9 A;  3RI8 A;  3I7D A;  1COV 3;  2QQK A;  4V1P A;  4JGY B;  3GZU C;  1HB4 A;  4IEO A;  2G9F A;  3CEW A;  4Q0Q A;  4DB5 A;  4XMA A;  2AUY A;  3NV2 A;  4BWO A;  2DVA A;  3G7D A;  1YJL A;  3NKT A;  2BZD A;  1YFY A;  4KWK A;  4YPJ A;  1EV1 2;  1DYP A;  2DTW A;  2VCA A;  3NNJ A;  3CBN A;  2W68 A;  3MLK A;  4QDQ A;  2P1B A;  2YUE A;  3OYW A;  4Q4Y 3;  2RJ2 A;  3A23 A;  2PXJ A;  5ANN A;  2HWD 2;  3DEM A;  4RHV 1;  2OZJ A;  1XNC A;  5FK8 A;  1RUI 1;  1Q8V A;  5AC9 1;  5LA1 A;  1WLD A;  1EAH 1;  1ZBE 2;  3RGB A;  1JOP A;  3ACL A;  1MQT A;  3JBG 1;  4M0H A;  1DHK B;  3HBK A;  3S6P A;  3VV1 A;  5FZO B;  5FYI A;  2EAA A;  5F2S A;  2CWS A;  3M2M A;  1H6Y A;  1A6C A;  5CB7 A;  3RDI A;  1U5I A;  1LEM A;  4MX3 A;  3IDC B;  5T5O A;  2GH2 A;  1US2 A;  4XCB A;  5BNP A;  1WLT A;  2R04 3;  3NST A;  5K7P A;  1JYI A;  2WSU A;  1HKD A;  3T09 A;  1RUF 2;  2D6L X;  2DF7 A;  4P00 B;  1H1I A;  1RUE 2;  4QDS A;  5FAX A;  2FDF A;  5FLH A;  4CEY B;  1UU5 A;  2JDN A;  3T2Q A;  1M06 G;  1FMD 1;  3JB4 C;  3T4H B;  3ZXA C;  2ZX1 A;  1H2L A;  3TN9 2;  3ILF A;  3VZL A;  4IV3 A;  1OQD A;  2HLE A;  4QD2 A;  4A7K A;  4Y1V A;  1WUV A;  2CHH A;  4RR3 B;  4CPB D;  5A7N A;  5CFC B;  2PFW A;  4KBZ A;  4KI5 M;  4HAN A;  5BUV A;  1B35 C;  2KM2 A;  4YVW A;  4NUB A;  2R0F A;  1UD1 A;  4JDN A;  1TVG A;  1W6N A;  3O1V A;  1W6Q A;  3EQE A;  2OW4 A;  5CZK A;  1WBF A;  2WN3 A;  1E5H A;  5F5I A;  1QJU 2;  3DV8 A;  2F4L A;  5E88 A;  1RYY A;  1W99 A;  1PZ8 A;  1VBD 2;  4AED B;  1ND2 B;  2ZHK A;  4XJW A;  5AVP A;  3D0S A;  5KHJ A;  3LE0 A;  4FTE A;  1UKR A;  5E89 A;  2Y26 A;  4QU1 A;  3LCP A;  4AFD A;  1U12 A;  3H42 B;  3PUS A;  3WT3 A;  2YG0 A;  2MEV 2;  3IAQ A;  3ITQ A;  3S30 A;  1HV0 A;  4B29 A;  1R09 2;  2ORX A;  3ACI A;  1WLC A;  4XZU G;  1W2A X;  3HD8 B;  3WVJ A;  4Z07 A;  2PHR A;  1OA3 A;  3D6E A;  2XVL A;  3I59 B;  1VB2 A;  3KGZ A;  3N3H A;  2G1M A;  1W3V A;  4IEP A;  3A0N A;  4QQL A;  1HRI 1;  2DFB A;  3ZYG A;  3VGI A;  1UAI A;  2KD7 A;  1W6P B;  1IQD C;  1KS4 A;  2W2I A;  5C4W A;  3FHQ A;  4XYX A;  3VKM A;  2CAV A;  4QGL A;  3WHT A;  3E5X A;  1G7Y A;  1LR5 A;  5A7S A;  1SLA A;  5KC6 A;  1GUI A;  4Y1Y A;  3TNP B;  3U4S A;  2XB6 C;  4LKD A;  2JEM A;  3KV5 A;  2JXA A;  3C7O A;  1ND3 B;  1NLQ A;  2ILM A;  4UBH A;  2N7G A;  5CG8 A;  1ZBA 3;  3V65 A;  4OUE A;  1ZRE A;  4YWA A;  4GXL A;  3VBO B;  1UNB A;  3PMS A;  1QMJ A;  1ZZ6 A;  2TBV A;  2P3Y A;  3RJR A;  1YQ2 A;  2QJV A;  2Q0A A;  3RSJ A;  1GOF A;  2F4P A;  3NO8 A;  3AKT A;  4DMI A;  5JIA A;  4BK5 A;  2WQ4 A;  2VQ0 A;  4BA6 A;  4S2F A;  1WA6 X;  3UYJ A;  5FYT A;  1VBC 1;  2W3J A;  4XJZ A;  3H3L A;  1V6I A;  3K46 A;  3C7H A;  5FR3 A;  1TNR A;  1GZ9 A;  4LKS A;  1PO2 2;  1OKO A;  2HBT A;  2D98 A;  2O1Q A;  1VBE 2;  4XBQ A;  1SDW A;  3WNK A;  3LA7 A;  4XPV A;  1RMU 2;  1O3Q A;  4HL0 A;  1DQ0 A;  3N9P A;  1W9W A;  2GN7 A;  4XIL A;  3DEC A;  2E7Q A;  1BJQ A;  1J3R A;  5I0U A;  4XFA A;  5IK8 A;  4CP9 A;  1UY0 A;  2E7A A;  2YU1 A;  3ACF A;  2VVF A;  3ME2 A;  4Q4W 2;  1RC6 A;  4SBV A;  4YGD A;  3MUY 1;  4O9G A;  3ES1 A;  4L99 A;  5I0S A;  4CU7 A;  2LM3 A;  1XU1 A;  2QQW A;  5IYY A;  5L19 A;  2QFE A;  1XC6 A;  2SBA A;  2OII A;  4QQ2 A;  2JG8 C;  4UFL A;  4W6X A;  2RMU 3;  1JS9 A;  4CP0 A;  1DQ4 A;  2W1Q A;  4PBO A;  2LUW A;  3IMN A;  4IEQ A;  4AI3 A;  3HT1 A;  1OI6 A;  2H6C A;  1RUG 1;  1BK1 A;  5FRA A;  1UW8 A;  2D97 A;  2VNO A;  3WXP A;  5K0U B;  3V0B A;  2ETE A;  3LPG A;  2JE9 A;  2PLV 1;  3WF0 A;  1SFN A;  2RJK A;  2R0H A;  1XYN A;  3UGF A;  4QM8 A;  1NY7 1;  3W9A A;  4IE6 A;  1IG3 A;  1YHF A;  4UAP A;  3WQ7 A;  2XQR A;  5CFD B;  4QX5 A;  4D6R A;  4PDW C;  4A45 A;  2LTN A;  1KJR A;  3MPP G;  4EZ4 A;  5KHH A;  1QY4 A;  4BIS A;  2VZP A;  3M3Q A;  3O12 A;  4DXZ A;  2XBO 1;  2VCC A;  1GWL A;  5A7O A;  1LHO A;  5T55 A;  3KZ4 C;  1UZ0 A;  1IPS A;  1CVN A;  2QQI A;  1COV 2;  3NL1 A;  1PGS A;  3OD4 A;  2JEC A;  3H3Z A;  4QMA A;  4QPI B;  5SV5 A;  2NP0 A;  2W91 A;  4AHY A;  5FJK A;  2ZX4 A;  4G4F A;  1UZY A;  1RL3 A;  3TB0 A;  5LK5 A;  2OPK A;  3SCF A;  3VZO A;  3ZDS A;  2XDV A;  5JZG C;  1CAU B;  3JU9 A;  3O1R A;  1RED A;  1AR9 1;  1GZW B;  1SPP B;  3QH6 A;  4FPF A;  3T4V A;  1Y9Q A;  1F8V A;  3I4I A;  2Y0O A;  3MF9 A;  2P6H A;  4XIO A;  5L7O C;  2OXB A;  2E26 A;  3Q8C A;  2D6N A;  4MGY E;  1GWM A;  1K12 A;  4P9Y A;  5C8C A;  1ULD A;  3FE5 A;  5FO9 B;  3E1F 1;  4Y33 A;  3K4D A;  1OA2 A;  1OH4 A;  4LUM A;  5FZA A;  4YW6 A;  4C0H A;  4XF9 A;  1PMJ X;  1POV 0;  4LIU A;  4HSJ A;  4CDX B;  3LEK A;  3BU0 A;  4AVA A;  4XFF A;  2GC2 A;  2BP6 A;  1XND A;  3AL6 A;  3HPN A;  4FAH A;  1ASJ 1;  1ZM1 A;  1D7P M;  4Q4V 2;  2CGN A;  2V5Y A;  3AMH A;  3RMY A;  3L9J T;  4QX3 A;  3KCX A;  5L9V A;  2ZS6 B;  4G9S B;  2WYF A;  3I49 A;  4E4S A;  3AMN A;  2WO7 A;  1XPW A;  2JDY A;  2ZZJ A;  3WF1 A;  4PLM A;  4EV0 A;  4FSJ A;  1GOG A;  4XOG A;  1EYB A;  2WNV A;  5GKA C;  1G9C A;  1V6O A;  2HH9 A;  4UF0 A;  4ZU5 A;  1XNA A;  4C91 A;  4M01 A;  3PHM A;  4BLJ A;  5KHI A;  4NRP A;  3I2F A;  5FJH A;  1MS4 A;  1CAX B;  1C8M 3;  3HMY A;  2A6Y A;  3INA A;  2WFF 1;  4MLO A;  5FLI A;  2A75 A;  4AI1 A;  4O61 A;  2UUR A;  3C7E A;  4YZ2 A;  3JUU A;  3AYD A;  4BOW A;  5BNN B;  3VD5 A;  5JXH A;  4LO7 A;  2Y8K A;  1IQA A;  1JOD A;  4YAR A;  3NAP A;  4L11 A;  5FRE A;  1AYM 2;  1JU4 A;  4U2A A;  4ATE A;  3ZN4 A;  4WM8 B;  3FUO A;  3SXW A;  4NAM A;  1DGW X;  2ZMK A;  4YZ1 A;  4IV3 C;  1UU4 A;  2E33 A;  2E32 A;  2XOM A;  1V6J A;  1NG0 A;  3AZY A;  1KJL A;  1R1A 2;  1WBL A;  3FMG A;  4H3W A;  5F5Q A;  5IJR A;  3ZSE A;  4NPM A;  1CAV A;  5JMO A;  4OVE A;  5H9P A;  1URX A;  4XFC A;  1MS8 A;  2Y6J A;  3GHN A;  4AXO A;  1S0G A;  4E4H A;  4FI9 A;  1A34 A;  3ETQ A;  3KLS A;  1LGC A;  2VNR A;  2XGX A;  1ZA7 A;  3GAL A;  3OF1 A;  4CCM A;  4D3W A;  1XXN A;  2YHJ A;  4IQP A;  4DNY A;  1YYN A;  4P14 A;  1PGL 1;  2Y38 A;  3BUC A;  3M3I A;  2DFC A;  2YGM A;  4WM7 B;  1VMF A;  3JZV A;  3UK9 A;  3K3N A;  1O7F A;  4LBN A;  4YNI A;  3B94 A;  3JQW A;  5ABJ A;  3RZL A;  5F37 A;  1M4W A;  5LCW L;  1W6O B;  3D0J A;  3DGT A;  4QX1 A;  2RR1 2;  4TTG A;  3M3C A;  1BEV 3;  4QKD A;  1S2K A;  2W52 A;  5FYZ A;  1YI7 A;  4URA A;  1LAJ A;  1WW5 A;  5JPM B;  1HJG A;  1SZB A;  4KMQ A;  4WVM A;  3O1S A;  1JBC A;  4YW2 A;  1ULC A;  3BI3 A;  5C4W C;  1PVC 1;  1V0A A;  2HWE 1;  4Z92 B;  3AKQ A;  5JOW A;  2PYT A;  4ERO A;  1W03 A;  2BYV E;  2DCJ A;  5A3W A;  1J83 A;  3WNN A;  2DCK A;  4O9E A;  2BFU L;  2WWJ A;  2XUE A;  1VBA 1;  1V9U 3;  3CZU A;  4JRL A;  5JIU A;  2P37 A;  1YUD A;  1S0B A;  3B9I A;  4UFH A;  4XDO A;  2BV4 A;  1YIF A;  4AFC A;  5ACA 1;  3DPR C;  2PQQ A;  2RHP A;  2RM2 3;  1CN1 A;  1L7L A;  1UXZ A;  2VZO A;  2FMY A;  4GUL A;  3N35 A;  4A42 A;  1NY7 2;  2D43 A;  2ZOE B;  1RVF 3;  2AGS A;  5GLV A;  1AR8 1;  3Q8E A;  5DAV A;  1S0I A;  4HK8 A;  4XF3 A;  3BU7 A;  4P5Y A;  4LNV A;  1N1V A;  4NAO A;  4BXS V;  1CGP A;  5DPN A;  5LZ6 A;  4NPR A;  1IPK A;  1OLR A;  4XDQ A;  4DPN A;  1QQP 1;  4FOQ A;  2J1T A;  1Q43 A;  4FOV A;  2Q8D A;  1JUH A;  1NCR B;  4HPK A;  4S2D A;  3RQ0 A;  4RD7 A;  2JD9 A;  4YM0 A;  2RS5 3;  4YW4 A;  3T2P A;  5J7M A;  4LK7 A;  4HBN A;  4NRM A;  4XDP A;  1SAC A;  2OQ6 A;  2ID4 A;  2QQJ A;  5F3C A;  4OI1 A;  1WZX A;  1HN0 A;  5FMB A;  5DG2 A;  5D8A A;  3VDD C;  1FI2 A;  3FBY A;  4UW4 A;  1VP6 A;  5JAX A;  1U5Y A;  1UOB A;  3WUD A;  2CNA A;  3WY6 A;  2K2S A;  1YFX A;  1SBF A;  2RMU 2;  1ZVF A;  5CVR A;  3NW4 A;  2YC4 A;  3KV4 A;  5FWE A;  1C4R A;  4JKM A;  2OUJ A;  3RZJ A;  1CZT A;  1BBT 2;  2E7T A;  2WAB A;  5F39 A;  4C1W A;  1A8D A;  3SH3 A;  5FUN A;  2ZX2 A;  1L7Q A;  5FMC A;  3UKN A;  3H8R A;  1CIY A;  2ZHN A;  3SLI A;  1OLM E;  3EMR A;  2VO5 A;  2HKX A;  5H9S A;  1MVQ A;  1RB8 G;  4K7J A;  2AR6 A;  3W5N A;  3POW A;  4YVS A;  3MIG A;  4M3C B;  4D6Q A;  1Y3T A;  3BPZ A;  3HIF A;  5EPA A;  2D93 A;  5AVA A;  5GZE A;  2QQO A;  4OI0 A;  4F3J A;  1PM4 A;  3BTA A;  1CAW A;  1FNZ A;  3S0M A;  1HXS 1;  4IUG A;  2HBU A;  2R6Q A;  1Z7S 3;  4E4D X;  5LRR A;  2J1U A;  3AVR A;  1C57 A;  3DYO A;  3MIC A;  5GZD A;  1UMI A;  1C8N A;  3I8T A;  5C3Q A;  2W39 A;  2ARB A;  4EWE A;  4A3X A;  3H1W A;  1N3P A;  2XL7 A;  2AH2 A;  2G9G A;  2RDS A;  5F6K A;  4YG6 A;  1AR7 3;  3MDP A;  4U36 A;  5LA0 A;  1VB4 A;  4QQO A;  1WW6 A;  4CDQ C;  3BKZ A;  3E5U A;  1R64 A;  1S2E A;  1VPH A;  5C70 A;  1TME 3;  2RJL A;  1PZ9 A;  5A7W B;  1POQ A;  3K4A A;  5E1R A;  3CNA A;  4Y24 A;  2VMH A;  1GNH A;  2VE1 A;  5IVC A;  1IS6 A;  4JGZ B;  4LHS A;  4P9G A;  4QHZ A;  3H8U A;  3B5L B;  4H55 A;  3ROU A;  4K21 A;  4R9D A;  3OPW A;  3N9M A;  4ZU7 A;  2GP5 A;  1JZ6 A;  4CUG A;  5L9R A;  1HDK A;  1XU2 A;  3UKV A;  4X6R B;  1PO1 1;  2XQX A;  1BCX A;  2W87 A;  1CJD A;  2NQY A;  4K9S A;  1T6G C;  5F2W A;  4BQ1 A;  1PGW 2;  1GU3 A;  5JPN B;  1YRZ A;  3B02 A;  4FTB A;  4RS5 A;  3FX3 A;  5C8C C;  3RMX A;  4OQ8 A;  2HWF 2;  3ZSJ A;  1RUJ 2;  2A6W A;  4MAD A;  3ZFF B;  2RS3 2;  4FOY A;  4XFI A;  3H8X A;  2GU9 A;  2VZR A;  1ZNP A;  4TLG A;  4NWV A;  2QTW B;  4JHT A;  4LMF A;  4YM3 A;  1TZO A;  1K5M B;  1QH7 A;  1OD5 A;  1SLB A;  1W6M A;  2SLI A;  2UYA A;  2XVK A;  4GQ7 A;  1F5F A;  4KU8 A;  4BJ0 A;  1Q56 A;  1W04 A;  3VKO A;  3I2H A;  2XLG A;  5FZK A;  4R9B A;  1CX4 A;  4R8H A;  4DRV A;  1J58 A;  1IZ3 A;  4QWN A;  3UJQ A;  3POB A;  2GSY A;  1EPZ A;  2BFU S;  3PVO A;  5LEK A;  3MI8 A;  1RXG A;  4JV4 A;  3ZN5 A;  1NE4 A;  3GBG A;  4GH4 C;  4MXV A;  1EV1 3;  4GMP 1;  3ZLI A;  4R9A A;  3DUI A;  2B8M A;  1QXP A;  2PA7 A;  5FXW A;  2WNV C;  5LAS A;  1HQL A;  3B9C A;  5FOJ B;  4LJH A;  1Y9G A;  1GZT A;  1FYU A;  5DZG A;  2HWD 3;  5LK7 B;  2R06 1;  3QBQ A;  2ZGM A;  2WJS A;  2I07 B;  1ZBE 3;  2CAU A;  4NMI A;  4PLN A;  3CLP A;  5C3S A;  2VTX A;  1UOJ A;  1OQ1 A;  3FBM A;  4ZY9 A;  1MZ5 A;  3NNF A;  5FY9 A;  3NAP C;  4Y1X A;  2JIC A;  4CU8 A;  4OUL A;  1PVX A;  1HX6 A;  4L97 A;  1EY2 A;  5CFD A;  2OYZ A;  1B35 A;  3S5Q A;  3RZM A;  3AP5 A;  3AFK A;  3ES4 A;  4LOT A;  1RUF 3;  3ZXJ A;  4QGN A;  3RRD A;  2YBK A;  1RUE 3;  5FZI A;  5HXM A;  5C3O A;  2P3K A;  3SQO A;  3J4U H;  1XNT A;  4RGA A;  1GIC A;  4XAC A;  1UY2 A;  4FBF A;  2BU9 A;  1H1M A;  1N1S A;  3TN9 3;  3TWI A;  3FHA A;  4FPC A;  4XE9 A;  1TQ5 A;  3A0K A;  2V72 A;  5FPB A;  3LZZ A;  3I2J A;  2A6Z A;  4FQ4 A;  4BLI A;  2RG4 A;  3ZXG A;  1HJF A;  3K77 A;  4K20 A;  3SH4 A;  5ABJ C;  2VZQ A;  1DFQ A;  1NX9 A;  5FLJ A;  1H4G A;  2W1U A;  2VAU A;  1LB2 A;  4IEW A;  4Y3O A;  3ZYF A;  3I3E A;  1CAU A;  1QJU 3;  4IGO A;  3O1T A;  1IOA A;  3PUQ A;  1W9T A;  3M4F A;  1RIR A;  1DGW A;  1LGB A;  1VBD 3;  3HN1 A;  2B7Y A;  3FUQ A;  1JXN A;  4OMC A;  1HN1 A;  2ADE A;  4XBL A;  3BTZ A;  4IE7 A;  5LA9 A;  3OD0 A;  2BTV C;  1TMF 2;  1AXZ A;  1G86 A;  3AFG A;  1AYN 2;  5DG1 A;  4HZF A;  1STM A;  2MEV 3;  3GJB A;  1OFN A;  4GAZ A;  2LRP A;  3VD9 A;  1R09 3;  4Y5S A;  2XJS A;  5KXE A;  4MSV A;  2ZXQ A;  4NRO A;  1N3O A;  3WUC A;  4X8N A;  1HRV 1;  2WZE A;  1G9B A;  5J37 A;  1SHW B;  2GAL A;  2VG9 A;  2WQ8 A;  4XUR A;  3CL1 A;  4QPG A;  1ZRI A;  1SLI A;  2ZGO A;  3I2I A;  2WZP P;  4NO4 A;  4QX0 A;  4Z8B A;  1VBB 1;  3HNY M;  4XJ8 A;  1DQ6 A;  1QJE A;  5AFB A;  1MEC 1;  2BRT A;  4XFH A;  3ZX7 A;  4EE2 A;  5JSP A;  1D4M 2;  4OQ9 A;  3CF6 E;  4CTE A;  4N43 B;  4GZ9 A;  5FO8 B;  1W05 A;  2C6S A;  5LW9 A;  4KL1 A;  3SMH A;  3I2D A;  1WLW A;  5LAT A;  5FQ0 A;  3T1L A;  4E2S A;  4I01 A;  1RTV A;  1GNZ A;  1QJX 2;  2BOJ A;  2Q8O A;  1H30 A;  4MV2 A;  2WWU A;  3KMH A;  4KQ7 A;  3RZZ A;  3ZM8 A;  4I3G A;  1CAX A;  1DGR N;  2O8O A;  1PIV 1;  3FHI B;  2FCT A;  3L2H A;  1MS3 A;  3ALQ A;  2C9A A;  4IV1 A;  3CJI A;  3ZFE B;  4K40 A;  4PLO A;  2VW0 A;  2YRO A;  3WX5 A;  4AFA A;  4D8M A;  4CUC A;  3TEZ A;  5FPA A;  4LE3 A;  5FKB A;  1ENQ A;  1QOT A;  2Z42 A;  1BYH A;  3H50 A;  2WLQ A;  2XJV A;  2XXZ A;  4WZF A;  3APB A;  2ZML A;  3HNM A;  1PO2 3;  4RR3 C;  5FYY A;  2DBI A;  4B8E A;  1JU3 A;  1UX7 A;  1R08 1;  2YB7 A;  5HV0 A;  4MUV A;  1VBE 3;  3WEZ A;  3WNL A;  4COV A;  1GR3 A;  4BK4 A;  3D8C A;  4ZZ8 A;  3QLQ A;  5IVF A;  1RMU 3;  1RUC 2;  2ZEX A;  3JD7 2;  3WHU A;  1ULG A;  3ZFG B;  1W39 A;  2ARX A;  2HWB 2;  3JQX A;  4N53 B;  3AKR A;  2IXL A;  4ZXK A;  1RUO A;  1NZI A;  4NE9 A;  4QQP A;  3J9S A;  3KB5 A;  4ASL A;  3GNE A;  3PU8 A;  5FZC A;  5J96 B;  2OT7 A;  1ND2 C;  2YFZ A;  3D5O A;  3OGJ A;  4Q4W 3;  2JDM A;  1RIT A;  3OTF A;  3MEP A;  4PIY A;  2XHN A;  1NT0 A;  2WNU A;  1F9K A;  2Y6L A;  3KQ4 B;  5DZF A;  1AXK A;  2VUJ A;  2BER A;  2LAL A;  3IIA A;  2YGL A;  2ZEW A;  1XYP A;  2GAU A;  2WZR 1;  2BEO A;  1DP0 A;  4LIT A;  4LOR A;  4XTP A;  4L0P A;  5BNO B;  1NCQ B;  1EP0 A;  3C8X A;  5FZH A;  1SLC A;  4Q4X 2;  3U11 A;  1BVV A;  1NA1 B;  4JCK A;  1OT5 A;  1H6X A;  2VU9 A;  3AYE A;  1S0D A;  4RGG A;  1YC6 1;  4AVC A;  4W4Z A;  4EN7 B;  2VM9 A;  3VUO A;  2VZ3 A;  4JX0 A;  3SKV A;  1WCQ A;  4PIX A;  1H2K A;  3QD6 A;  1V6M A;  4LA2 A;  4MOA A;  4Q8L A;  2ARA A;  3THP A;  3ZPO A;  1FXZ A;  1SQ4 A;  1HQN A;  3KSC A;  3BN6 A;  4CEW B;  3VHO A;  4AWD A;  3A7Q A;  3R4S A;  3NNM A;  4SLI A;  5EJ3 A;  2WR9 A;  3ZXK A;  1TE1 B;  2VJX A;  4FFH A;  4IL7 A;  4BQ2 A;  4BIO A;  5GJ6 A;  1C3H A;  1I6X A;  4P9W A;  1RJ8 A;  1SEF A;  1ZZ7 A;  3T30 A;  1MS0 A;  2A6X A;  2VZV A;  3Q8A A;  2XG3 A;  5C3R A;  2VC9 A;  1ALY A;  1ODM A;  1OKQ A;  4Q26 A;  4LLF A;  1LHW A;  2BUK A;  2QKD A;  3CKH A;  4MGQ A;  5T5P A;  2BWC A;  1CIW A;  4XEZ A;  3TNQ A;  4QPW A;  1OPO A;  5A32 B;  5IWF A;  4XUP A;  1OSG A;  2J7M A;  5JI9 A;  4RS5 C;  1DQ2 A;  2FDK A;  1V6N A;  2PHL A;  3LQC A;  4BXF A;  1NLS A;  2JEN A;  3NJX A;  3O14 A;  4XUN A;  4N8M A;  3VBR B;  4IND A;  2VPV A;  3KV6 A;  1CZV A;  4D7S A;  5CA6 A;  1S1A A;  3MIE A;  5DDJ 1;  2FDJ A;  3H1Y A;  4FOW A;  4ZS2 A;  3R0R A;  1Q5O A;  1RXF A;  4AFM A;  1AR6 2;  1V00 A;  3GF6 A;  2WUH A;  5ANQ A;  3VBS A;  2D3R A;  4K1Y A;  5CG9 A;  2W08 A;  4YG0 A;  2ET7 A;  4P08 A;  4Q29 A;  2RDR A;  2VZT A;  1QH6 A;  3EBR A;  5F32 A;  4B1L A;  5B2G B;  4IE5 A;  3O1P A;  2KR2 A;  3VBH B;  2QQP A;  5EIY B;  1RUH 2;  4FAG A;  4CXW A;  3U07 A;  2VOW A;  2GME A;  2ORZ A;  3T3Y A;  3ZXE A;  4YRD A;  4Q4V 3;  1H8T A;  3OB8 A;  4GWN A;  2VEC A;  4I30 A;  4BQX A;  3VDB A;  4PI2 A;  1D2S A;  1HQW A;  4M3C A;  1UQX A;  5A6Z A;  2DCZ A;  4C90 A;  4UI9 L;  3LPF A;  3BOP A;  4YW5 A;  4NIA A;  4L9B A;  2WRA A;  3Q8B A;  4LBL A;  2ATF A;  4LOS A;  3VZJ A;  4AHW A;  1CX1 A;  2D40 A;  4AQS A;  1VRH 2;  2WT0 A;  1H4H A;  2GMM A;  2J1A A;  2X5I A;  4YW3 A;  1KDK A;  2VME A;  4HN0 A;  1XE8 A;  2D44 A;  1FPN 1;  3RS6 A;  2WN2 A;  1B09 A;  2OX0 A;  4ASM B;  4LHK A;  5CFD C;  3SEP A;  2W47 A;  4IGQ A;  2YFU A;  1W0N A;  5I93 A;  4ORF A;  1AJK A;  1WCD J;  1DU3 D;  4ONU A;  1RUD 1;  4CCL A;  1X50 A;  4AI2 A;  2XON A;  2XR4 A;  1AYM 3;  1ONA A;  2VUA A;  1YEW A;  5CU1 A;  3CO2 A;  3TRS B;  3AX4 A;  4BMB A;  2X09 A;  3WQ0 A;  3FWE A;  4N7U A;  2FZ1 A;  5T3N A;  3DCQ A;  3SH5 A;  2ZX0 A;  4YG3 A;  3O7O A;  1FOD 2;  2J42 A;  2OS2 A;  3WZ1 A;  4COZ A;  1R1A 3;  2VXR A;  3ZN6 A;  3D4K A;  1FX5 A;  3E6D A;  2R07 2;  3WG4 A;  3PUH A;  4A4A A;  4QPI C;  1PNG A;  3M3E A;  3V0A A;  1QJY 1;  4LBQ B;  1AL2 2;  2ZA9 A;  3LA2 A;  4CDW A;  4Q4Y 1;  1VAM A;  3AZZ A;  5LBF A;  3OEB A;  4CCK A;  4FQZ A;  1Y7B A;  4A3Z A;  4PF5 A;  1W2T A;  5DUV A;  2VH9 A;  1W9F A;  5FY7 A;  5H9Q A;  5T5L A;  3UKT A;  3ZFF A;  3HN3 A;  5FPV A;  1MVE A;  3USU A;  2VZU A;  2RR1 3;  1I5Z A;  2X53 S;  3Q8F A;  2OPW A;  3KCY A;  3DPR A;  2GMP A;  1LHV A;  2CY6 A;  2YBS A;  3DXT A;  4IES A;  3R6S A;  5A33 B;  4NHL A;  5J1X A;  3GHM A;  2JG9 B;  2R04 1;  4QPG C;  4Y22 A;  2RVA A;  2WDB A;  3VBF B;  1OH3 A;  3J7M A;  4R52 A;  3MLJ A;  4FO9 A;  4LO4 B;  2NMN A;  1I1E A;  4QGM A;  4XQ4 A;  4NII A;  1MS5 A;  4NR1 A;  3POJ A;  1PK6 B;  3BAL A;  3WP4 A;  2HWC 2;  2PTM A;  4A7Y A;  5A3P A;  4FPG A;  4N7I A;  4URT A;  1KDM A;  1POV 3;  2W46 A;  1LOD A;  1VMH A;  2LRO A;  4GB3 2;  4LQR A;  3U14 A;  1AX1 A;  3POF A;  3ZYH A;  4E4Z A;  3HWJ A;  4P9I A;  3ST7 A;  4QXC A;  4BHP A;  5BYN A;  1L7R A;  2VQA A;  3PJQ A;  2WL1 A;  1KQR A;  3HOB A;  1ULP A;  3ON7 A;  1U0A A;  2OQ7 A;  3WNX A;  2BNM A;  1FT9 A;  2R16 A;  2WS9 2;  3EHK A;  4IV1 C;  1QEX A;  2D5F A;  3CJI C;  4RFR B;  5EQU A;  3DN7 A;  4ZXE A;  3VDD A;  4CCD A;  4LHN A;  4DIQ A;  1RHI 2;  4Y20 A;  1RIN A;  1JZ8 A;  5IK4 A;  3PUI A;  4CA9 A;  3N7M A;  5FPX A;  2QNK A;  3J8F 1;  5LA2 A;  1XB9 A;  1YNA A;  4EN8 B;  3OUI A;  5FZL A;  3CHX A;  2GC0 A;  3AC0 A;  5A70 A;  5I91 A;  1JYV A;  1KRI A;  4XF4 A;  1DF0 A;  2VMF A;  4AGV A;  4DUX A;  1QF3 A;  5HV4 A;  2OA2 A;  4TN7 A;  1FV2 A;  3NNL A;  2UY8 A;  3WQB A;  5K9Y A;  4IEV A;  1OLQ A;  4QHO A;  5FIX A;  3X29 B;  3BTX A;  5KXD A;  2QZ2 A;  1BBT 3;  2ZZQ A;  2BGC A;  4O65 A;  3UL2 A;  4YW1 A;  1YQ6 A;  4AEK A;  4O7X A;  2WNU C;  3ZO0 B;  3MBW A;  2IC1 A;  4RHV 2;  2W92 A;  5HBA A;  5I8Y A;  1RUI 2;  2FHR A;  4QKN A;  3WW1 A;  5AC9 2;  3FLT A;  1EAH 2;  1S0C A;  3IPV B;  1VAV A;  4F7Z A;  3C7G A;  1ZBA 1;  3JBG 2;  2XL9 A;  4PF1 A;  3ORJ A;  4M3C F;  2VW1 A;  3IMM A;  1H9W A;  3ZR5 A;  1XYO A;  2A3Y A;  3I97 A;  5A6Y A;  4CDQ A;  3VHN A;  4K8F A;  3WDX A;  3N7L A;  4GD4 A;  4QX2 A;  4MXW A;  4CPB A;  3ZYR A;  1N47 A;  4F8A A;  4CCN A;  4D69 A;  1LKN A;  5CNA A;  4J6G A;  2V4A A;  2HYX A;  3PVN A;  3V56 A;  2IFR A;  3LDR A;  3MPB A;  1W2N A;  2K0G A;  3IB3 A;  5C9A A;  4E8D A;  1FMD 2;  3B93 A;  4B7E A;  1BKZ A;  4Q2F A;  2VMD A;  3M3O A;  2A3X A;  4A6O A;  3H7J A;  3VL8 A;  1O8S A;  1SBD A;  2ADD A;  2WIN B;  4E9K A;  3IBM A;  2WNE A;  3A22 A;  4NIH A;  1H2M A;  5EWS A;  1G6N A;  4OI2 A;  3CZJ A;  3B7M A;  4JDO A;  5G05 L;  4RSU A;  4FXK B;  3R05 A;  1SBE A;  5BPX A;  2PAK A;  3III A;  5FOB B;  3MIH A;  5FKC A;  2IVI B;  3MGU A;  1NCR C;  1JTZ X;  1MS1 A;  4K6B A;  4RGK A;  1W3X A;  3MHZ A;  3U1X A;  4QB2 A;  2JWP A;  2IWG B;  4LBM A;  4MZU A;  2CYF A;  1DIW A;  3THC A;  5FZD A;  3O1M A;  3AP7 A; 
#chains in the Genus database with same CATH homology
 3AVR A;  5FP3 A;  5IVY A;  3RVH A;  3LD8 A;  2Q8C A;  2XML A;  2YPD A;  4AI9 A;  4Y3O A;  2YU1 A;  5FP8 A;  3PTR B;  4IGO A;  2P5B A;  3PUA A;  3PUQ A;  5A3P A;  5FZO B;  4UF0 B;  5FYI A;  4QX8 A;  5F2S A;  4EZH A;  4C8D A;  5IWF A;  3KVA A;  4E4H A;  4QX7 A;  3U78 A;  3DXU A;  5LY1 A;  4GAZ A;  4QXB A;  5F5C A;  4V2V A;  5FPL A;  4BXF A;  5F3G A;  4QXC A;  5FZ1 A;  5A7W B;  4CCM A;  5A80 A;  3KV6 A;  5A3N A;  3N9N A;  3PU3 A;  5A1F A;  5IVC A;  2OQ7 A;  4BU2 A;  3K3N A;  5F5A A;  5FXV A;  5E6H A;  3LDB A;  4DIQ A;  5FWJ A;  3OPW A;  3N9M A;  4Y4R A;  5F37 A;  5ANQ A;  5FYC A;  5FXX A;  5LY2 A;  4CCJ A;  2GP5 A;  4URA A;  5FYZ A;  5F32 A;  5FZ7 A;  2Q8E A;  4CUG A;  5A7N A;  4D6R A;  2GP3 A;  5LW9 A;  5F2W A;  5KR7 A;  4NUB A;  5IW0 A;  5FZL A;  4CCO A;  4EZ4 A;  5IVV A;  4DO0 A;  4BIS A;  3KV9 A;  5FY0 A;  3K2O A;  2WWU A;  5F5I A;  5A7O A;  4EYU A;  5FZ3 A;  5F3E A;  4TN7 A;  5FZG A;  3K3O A;  5A3W A;  5CEH A;  5FYV A;  2VD7 A;  2WWJ A;  2XUE A;  5FBJ A;  5FZD A;  3N9L A;  4GJY A;  5FXZ A;  4XDO A;  4QU1 A;  4D6S A;  3PUS A;  4LIV A;  3OPT A;  3KVB A;  4QXH A;  4GJZ A;  5FJK A;  5FYB A;  5FY1 A;  5FZK A;  5FZE A;  5FPA A;  4QWN A;  3AL5 A;  3N9Q A;  5FY5 A;  2XDV A;  5ISL A;  5FYM A;  5FZB A;  3PUR A;  2XXZ A;  5FZ9 A;  5FYY A;  2OX0 A;  3ZLI A;  2W2I A;  4IGQ A;  2YU2 A;  5FXW A;  4Y33 A;  5FZ0 A;  5FZA A;  5IVF A;  3AVS A;  4LXL A;  4CCL A;  4GD4 A;  2Q8D A;  5A7S A;  4LIU A;  4ASK A;  4V2W A;  3U4S A;  5FP4 A;  5FV3 A;  5FP9 A;  4CCN A;  3KV5 A;  5FYU A;  3PU8 A;  3AL6 A;  4XDP A;  5FZC A;  2OT7 A;  5FP7 A;  5IVJ A;  5FZF A;  2OS2 A;  2OQ6 A;  5A1L A;  5FY8 A;  5F3C A;  5LWB A;  5A7Q A;  4HON A;  5FY9 A;  5FZ4 A;  5F3I A;  4LIT A;  5IVB A;  5FYH A;  5K4L A;  3KV4 A;  5FWE A;  5FZH A;  5FUP A;  5F39 A;  4IGP A;  1VRB A;  4HOO A;  4AAP A;  4CCK A;  5A3T A;  5FUN A;  3NJY A;  5A7P A;  5FZ6 A;  5FZO A;  4UF0 A;  2YBK A;  5FYT A;  3UYJ A;  5FZI A;  5FY7 A;  5FZM A;  5FZ8 A;  5FJH A;  5FPU A;  5FPV A;  3ZPO A;  4CSW A;  3PDQ A;  4D6Q A;  5FYS A;  5A7W A;  3N9O A;  5FY4 A;  5FPB A;  2YBP A;  5IVE A;  3DXT A;  2YBS A;  3N9P A;  2PXJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...