3U4SA

Histone lysine demethylase jmjd2a in complex with t11c peptide substrate crosslinked to n-oxalyl-d-cysteine
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
345
structure length
345
Chain Sequence
LNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysine-specific demethylase 4A
publication title Linking of 2-Oxoglutarate and Substrate Binding Sites Enables Potent and Highly Selective Inhibition of JmjC Histone Demethylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase substrate
total genus 106
structure length 345
sequence length 345
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2011-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3u4sA01
3AVSA 3PTRB 5FPUA 3OPWA 5F5IA 3KVBA 5FZOB 5FYCA 5FXZA 3NJYA 3ZLIA 5FYTA 2PXJA 4CCNA 4QU1A 2OQ7A 4V2WA 5FZIA 3PU8A 5FPLA 2Q8CA 3LDBA 5A7WB 5IWFA 3KV5A 4IGPA 5FUNA 5FZ4A 2YU2A 5FZ3A 5A7OA 3DXUA 5A7SA 2OX0A 2OQ6A 4C8DA 4AAPA 5FZOA 5FZDA 5A7QA 4GD4A 4AI9A 4CCMA 5IW0A 3N9LA 4CCKA 5FUPA 3N9PA 5A3PA 2GP5A 5FP8A 5FYZA 5A80A 4D6RA 5A7WA 5FBJA 5FZHA 5FXWA 4QWNA 5FPAA 5FZFA 5IVBA 5FY1A 2YPDA 4UF0B 4EYUA 5FV3A 5FYYA 5FY5A 5FYBA 4CUGA 4GJYA 4URAA 3U4SA 5FPBA 3PUAA 5FZ6A 4ASKA 5FYSA 5FZ1A 5F2SA 5F3CA 4XDPA 3RVHA 5A3WA 5FZ8A 3DXTA 2YU1A 2WWJA 4D6SA 5K4LA 3N9NA 5LW9A 5IVJA 2Q8EA 3PUQA 4UF0A 4CCLA 2P5BA 3KV6A 4QXHA 3K3OA 5FZCA 4LXLA 4BXFA 3KV9A 2YBSA 5FXXA 3KV4A 5FJHA 5FXVA 4E4HA 5FZ0A 2GP3A 5FZEA 5FY9A 5A3NA 5LY1A 2YBKA 4XDOA 5KR7A 3K3NA 5F3GA 5F39A 2WWUA 5FYHA 5FZKA 3N9MA 5A7PA 5FYMA 5A1FA 4BU2A 3PU3A 2Q8DA 5F32A 2OS2A 5FY4A 2VD7A 2W2IA 5IVYA 4GAZA 5F5CA 5FP4A 5FZ7A 4QXBA 5A1LA 1VRBA 5ISLA 4LIUA 4LIVA 5LY2A 5FYVA 4Y3OA 4QX7A 3AL6A 5CEHA 5FZGA 5F2WA 3AL5A 4TN7A 3UYJA 4DIQA 3U78A 2XXZA 5FY8A 5FZ9A 5A7NA 4EZHA 4GJZA 5FP7A 4Y33A 5IVEA 5FZAA 5LWBA 2XDVA 3AVRA 5FJKA 5FP3A 5F3IA 4Y4RA 2XUEA 4HONA 4NUBA 2OT7A 4QXCA 5FY7A 5FZBA 5IVFA 5E6HA 5FY0A 4V2VA 4LITA 4IGQA 5FYUA 3ZPOA 4D6QA 3PDQA 4DO0A 5A3TA 4CCJA 5F37A 5F3EA 3LD8A 5IVVA 5FP9A 5FPVA 5IVCA 3OPTA 4BISA 3K2OA 5FZLA 4EZ4A 3PUSA 4IGOA 5FZMA 2YBPA 5ANQA 5FYIA 5FWJA 3PURA 5F5AA 2XMLA 4QX8A 3N9QA 4CSWA 3KVAA 4CCOA 4HOOA 5FWEA 3N9OA
chains in the Genus database with same CATH superfamily
1VBC2 3WT3A 3PVBB 4P00B 2ENRA 1SZBA 1E5RA 1NCQC 1UZZA 2IZWA 4UW6A 2A5ZA 5FXZA 3ZSMA 1ZBA3 4NROA 1Q43A 5BNNB 2Q8CA 3WF4A 1B35C 2QKDA 1PO13 3RI8A 5J37A 1WCKA 1PGW1 5ABJB 1R091 5IHRA 5FUNA 3QD6A 1XYPA 2WUHA 4MX3A 4R9CA 2J1SA 5CFDC 1O5UA 5FMDA 4CDXC 4CPBA 2LW8A 4X6QB 5JR7B 3TN92 3K4AA 5A80A 2ZHNA 1LOGA 3UGGA 4QX2A 3I2IA 4P9LA 4LBQD 1O3TA 4NVPA 4EYUA 1J3RA 5LRRA 3MW2A 3OB8A 1X9TA 4Y5TA 4AVVA 1I5PA 3OY8B 3LOBA 2I45A 5DQ0A 1WD4A 1EAH3 1QDCA 4LBNA 5FZ1A 5T50A 2Y64A 1O3RA 1RUH1 2P3JA 3RRDA 1FV3A 2ARAA 2W1QA 4ZU5A 4J25A 5IFPA 4AQ2A 1IQAA 2JJ6A 2ZX2A 1O5LA 3AP5A 1DGLA 1RVF2 2ZX1A 1EUTA 1UZWA 3DYMA 1WMDA 1YEWA 2IXHA 2PAMA 2VBBA 4XFFA 4CP0A 3PUHA 1OI6A 4G4FA 5C8CA 1RC6A 1SEFA 5FZ0A 5I8TA 5LK7B 4KGQA 5GZEA 3AM2A 3HBKA 2JICA 3T4VA 3UETA 1QJEA 3WHUA 1QJX3 1TG7A 3PIGA 3LDKA 3OEAA 2WWUA 1KQRA 4W8JA 4LJHA 1ULCA 2FMDA 2VY0A 3BN6A 3HD8B 1GMMA 2HWD1 1US3A 2RM21 3IDEA 1UY3A 3NSTA 4XIOA 4MGYE 3FLPA 5FMOS 3W21A 3ZXFA 1FOD2 4QB6A 1ULDA 1GZWB 5ACA3 5F5CA 1T6GC 4JC1A 4OULA 2E9QA 3BB6A 4BB3A 4UBGA 2B42B 5BYNA 3SCHA 1UWWA 5C4WB 2LRPA 4B7EA 1VAVA 3VB9A 3AKTA 3HVDA 3RFRA 2EA7A 2KXLA 4GXLA 1GBGA 5DDJ1 4YVWB 4YW6A 4XBQA 1XNKA 4GWJA 3BCWA 5ERLA 2DTYA 4GJZA 1S0CA 1K5MB 4FT8A 4NIIA 2K2SA 2A3WA 4ISQA 3RPQA 2FDGA 2VMFA 2ZACA 3POWA 5JSPA 1Y9MA 4MOAA 2R061 4OI1A 1JYXA 2ZX4A 3WOGA 1O4TA 1UKRA 1UOJA 5FLHA 2JB4A 2WNEA 1HQLA 1JU3A 4SBVA 3GZTB 3ZIXA 1ENSA 2J42A 3ZYRA 1ZYBA 2GC1A 1ZZ8A 1ALYA 5F3EA 5F37A 5A6ZA 1ZA4A 1LU2A 1COV2 1LRHA 4HK8A 5EQUA 2H6CA 5IAVA 3OPTA 2IXLA 4IETA 4A3XA 4ZKTB 5CFCA 4QGNA 1OQEA 3I2KA 4H7MA 5JI7A 3DCQA 3LEMA 5CVRA 2NMOA 5F5AA 4HK9A 2D5HA 5F6KA 3BKZA 3J7MA 2Y6GA 2H0VA 2DDUA 3ECQA 5F5IA 2W1UA 4BHPA 4BQ3A 3ACFA 2BEOA 4WZCA 2HWB1 4BZ4A 2D6KA 1S0FA 1CIWA 4Q0QA 5FPLA 3VBFB 1MR5A 1XNBA 3GBGA 3I59A 1H0BA 5KHHA 2A73B 2X10A 1Q3EA 4L11A 2V73A 2WN3A 2ZHLA 3THPA 3VKMA 3IMNA 1YFWA 1WKYA 1XNAA 2W08A 4AAPA 1QOOA 2VMGA 5I0TA 1OLRA 2DFBA 2RS32 4QD2A 3A23A 3GNEA 3UJQA 3ZSEA 5AFBA 4BWOA 5BUVA 3H50A 4QT6A 3WNKA 5H9RA 1NE6A 4LBMA 4XUPA 1HX6A 1MS1A 1W9FA 5CZKA 4QWNA 1DGWA 1WLWA 2YGMA 2X5IC 3ETQA 3POBA 3Q8BA 2BOIA 3AB0A 5AVPA 4CUBA 3I54A 4AEMA 4GJYA 3TYJA 2VU9A 2YC2A 2W9XA 2VMHA 1NCQA 1DLLA 1PM4A 2XL9A 3H0OA 1T6BX 1RGSA 4BA6A 4EQVA 4XF4A 2WZEA 3V0AB 1NE4A 3U37A 3WP6A 1B35A 3H42B 4W65A 2C1FA 1KDMA 1O8PA 2W52A 3ALQA 1O4YA 1SQ4A 3OOXA 4QXHA 3T0BA 5JPMB 2V4VA 1S2BA 1RUI2 2ZEWA 1VBE2 2JECA 3FN9A 1MS8A 3K46A 5C3QA 4E4HA 5BY5A 2VE1A 2DCTA 4Q8KA 2CWMA 2BNNA 4I01A 3ZYPA 2VH9A 1K42A 4HPKB 3KSCA 5I0RA 2WFF2 5EYYA 3T30A 1K5JA 5D8AB 4N90A 3HQXA 4UW5A 3VZKA 1NLRA 1AYM3 1QU0A 3TWIA 2NN8A 4B7KA 4YM3A 2JG9A 1NKGA 1RUF1 2RMU2 2ZHMA 4NHXA 1VBB3 4PLOA 2AENA 4I2OA 5FO8B 4IV3C 5F2WA 1PO12 2CGPA 3WF1A 5ABJC 3RYPA 2O8QA 3MW4A 1V00A 5FP7A 5CA6A 1UXZA 1U5IA 2VZ1A 1UW8A 2GMPA 2XDVA 3OTFA 3O1OA 2VZUA 4EV0A 1QGLA 1ND2C 2P2KA 1MACA 2W3JA 2VCAA 4WM8C 5K0UC 3AZZA 1NY72 3V0BA 1AR61 3PMSA 3O1VA 4QPIB 4LMFA 1ZRDA 4IEZA 3FFZA 4FP3A 1M4WA 4ZHNA 4YGDA 2MEV1 5C5UA 1H1AA 2PN5A 5JLVA 4RQPC 3KF3A 3NNJA 1YQ5A 5JI9A 1IZ3A 3A4UA 1R1A3 3O0XA 4WZFA 5FZMA 4XW3A 5ANNA 3VDBA 2VOXA 3OUHA 1OH4A 2XJRA 4DUXA 1BCXA 3JD72 1S0EA 3LSEA 5IUQA 1DYOA 2RS52 4HOOA 4CCOA 2XWJB 1D4M2 1H6YA 2HWC1 4FOYA 1MVEA 4XUQA 4BCUA 4XF1A 1O91A 1UAIA 1GV9A 1ZZ6A 3CNAA 3WW1A 2PXJA 1AX2A 5DUWA 3RWNA 1QJX2 3E5XA 2HWE1 3ZO0B 1W6NB 3FUOA 1U0AA 1G6NA 1GP4A 3HJRA 2OA2A 1FATA 1HRI1 3ZFGB 4CDQC 2Y60A 3KQ4B 1G8WA 3C7EA 1NZIA 1AR71 4FPOB 4WBBA 1UQXA 4GH4B 3ZSLA 3ZDSA 1LAJA 5G04L 2JE9A 4C8DA 2OQ6A 4CU8A 1RUJ3 3JBG1 2WT0A 3NV2A 2FHRA 1S2KA 3LFMA 4GD4A 1V9U1 2R071 5CKMA 5F6LB 4BQ1A 5BNOC 2FDIA 2WNVC 3MW3A 2Y6HA 4QHBA 3AK0A 3NMBA 5C4WC 2ZOEB 4XFAA 2DURA 4I3PA 3MIDA 4KGGA 5FBJA 4Y20B 5FY1A 3SH5A 3POSA 1OT5A 1XSQA 3IPVB 1U5XA 3H8XA 2TBVA 4YVWC 4YW4A 4URAA 4HKLA 5IT6A 1URXA 5JXGA 2WLQA 3BIEA 2N7GA 1AR83 2WA4A 3JQXA 3K4DA 5CG9A 1VAMA 5K4LA 5C70A 4B8EA 4K40A 4CU9A 1SLLA 1BBT3 4NIAA 2Y0OA 1Q8SA 3VKLA 1YQCA 4LK7A 1MVQA 2Y38A 5I0DA 1SLCA 2XWBB 1GQGA 1YI9A 1OSGA 2C9KA 1OC1A 1W9WA 3ME2A 5FMOL 2RDRA 1QNWA 2YBKA 1IGOA 1WA6X 2P6HA 2GC3A 1R093 1E5SA 1NYWA 1AL21 2VNGA 1G9FA 1RUD2 5A7PA 1RUG2 3VZMA 2QE3A 4JV4A 2YFUA 3CEWA 2VUAA 4UFIA 3GYDA 1AX1A 1SDWA 1RUNA 4AW7A 3P5BA 4COWA 5DUUA 1W6OB 1SLIA 1W6QB 3MI8A 4DZGA 2WABA 2VVFA 3HBZA 2CWSA 1ENXA 1LEMA 1TMF1 3WD5A 4OUMA 1SACA 2GH8A 3B9IA 3LPFA 4QX7A 2Y6KA 2XBO3 1HKDA 1X33A 1AR91 2HLEA 5T5OA 2G9GA 1TNFA 4PIYA 3AJYA 1F5JA 3NKTA 2VMDA 3KLSA 1RUH3 2X8KA 4PBOA 4CEWA 1DHKB 1SBFA 2Z4FA 4OFGA 2BTVC 3VHNA 4EE2A 3KHCA 3J7LA 1ND3B 1W2UA 4CP9A 3GCXA 4FFFA 1E5IA 2VQ0A 2P34A 1JOBA 2GNTA 2Y0IA 1BMV2 1TE1B 2WJSA 4MGKE 3LIGA 1RIRA 1ZZBA 2K0GA 2VCCA 1VMFA 4AFCA 4DXZA 2RDNA 5IVCA 4JQTA 4N53C 2J7MA 1AXZA 2UU8A 1HN1A 2D6NA 2R0HA 3K75B 3NRUA 4RHV1 1VBA2 2X09A 1OPOA 3PUSA 2HWD3 2E63A 3DECA 4QHOA 3D3AA 2RM23 3H7JA 4IV3A 5ANQA 2WT2A 3HN3A 1Y3TA 3WP3A 4BQ5A 3O1RA 4CSWA 1FV2A 4P9JA 5DZFA 2PLV1 4GIQA 5D21A 4FQZA 4L9BA 2YZ4A 2PHLA 4ZS2A 4DRRA 3KS7A 1W8UA 1ND2A 3H1MA 1GNHA 2W95A 5E1RA 5DDJ3 3VDCA 1JS9A 2PHWA 1QJY2 2P3YA 2VL4A 4WM8A 2X53S 5K0UA 3OJBA 2ZKNA 4E4DX 2WRAA 1HRV1 2PQSA 2VZPA 3I4IA 1C5IA 1AYM2 2YC4A 4JGZC 3U07A 3ZSJA 3POIA 1BK1A 1IQDC 4A7ZA 4RQPA 1VLNA 3VHOA 2R063 2O0OA 2VQUA 4AHXA 5BNPC 2GP5A 2VTFA 1HQNA 1W2NA 2JDHA 3GHNA 4LLFA 4E9KA 4CPBD 1CX1A 1JTZX 2C5DA 2VR4A 4UFJA 5FPAA 4UWDA 4RD7A 5FYYA 5CKNA 1VRH1 3VBOB 3AC0A 1TME2 3IDBB 2KR2A 3O1UA 2WSUA 3LEIA 4E2SA 3U0ZA 1CQ9A 1ZA7A 3A0NA 3BOPA 4NRMA 4S2HA 4YRDA 1UU6A 4Q0PA 3RNSA 2BUKA 3VHPA 3EB7A 2IXIA 2ID4A 5J36A 5DXDA 1KJLA 3IIIA 1GOHA 2RVAA 3AYAA 3KV6A 4CDQA 4KQ7A 4CEYC 2I2SA 4QPIC 4MHUA 3SCGA 4A4AA 2XR4A 2HWB3 3BI3A 4Q8LA 4HSLA 1OA4A 1GZWA 4ARXA 1WCSA 5BNOA 1XOYA 3FE5A 1YO8A 2WNVA 3I2HA 2WYSA 4H2AA 1GP5A 4UW4A 4DXTA 1GQPA 1NX9A 5A6YA 5FYHA 1W9SA 4E27A 4Y22B 4C1XA 1GZCA 5FKBA 3WG3A 4XETA 2CDPA 3PIJA 4Z2WA 4YVWA 2A6YA 2UY8A 2W2IA 1G86A 4FPCA 4H7LA 1KEXA 5FP4A 1F8VA 1K3IA 1QQP2 2ZX3A 5E88A 4KH9A 3AZWA 1APNA 2AR6A 5EIYB 1NZCA 4KI5M 4LHKA 5FZGA 3VD5A 4AI3A 3TEWA 1AYN2 2PHUA 4HXCA 3ZFGC 3NV4A 1ODNA 4JGYA 3U78A 5DZGA 4MSVA 1NUKA 1R081 5F8PA 5LWBA 1GNZA 5FQ0B 1GWMA 1ZNPA 1RHI1 2J1EA 1V70A 3ZFEB 2RDQA 2WN2A 3NV1A 4XTPA 5T5LA 2XUEA 3VBSB 1OURA 1PIV1 2ZGPA 3AZXA 4HT1T 1YIFA 3SISA 2P37A 5FYUA 3T1MA 1CX4A 2GNMA 5FPZA 3RZHA 4RR3B 1D2SA 2DU1A 2YDEA 5IVVA 2XVLA 2OXBA 1IS6A 4JDMA 2A70A 1UY0A 4M3CE 1H6XA 2ARBA 4NWWA 3TNQA 3MPBA 1BBT2 2ATFA 1GWLA 4PT6A 3WVJA 5JZGC 1WCUA 1GZ9A 1VBD1 2GAUA 1V6IA 2R0FA 1MEC2 3HT2A 4HLTA 4XTMA 4BPZA 2VMEA 3JB8A 3VHRA 5KHGA 2Q4SA 2XQXA 3N9OA 3HN1A 1RUF3 3S57A 4XC9A 5LA0A 2JIGA 3ZFFC 1IS3A 2RJLA 4G9SB 3T1LA 1PVC2 1SLAA 4AG4A 2E53A 2KA3A 2ZGKA 3J26N 4QU1A 3KGZA 4AEKA 4CRQA 5J96B 3LDBA 3MIHA 2BPA2 1VB4A 4PF5A 4AGRA 3N35A 1FAYA 3LPGA 2AH2A 3NJXA 4W6XA 5IWFA 1LCLA 4OZXA 3WQ7A 5IK4A 4HKOA 2PHXA 4FPHA 3OUIA 4UFMA 3E6DA 3TOJA 4MXWB 1AZDA 4ISRA 3SMHA 2WNUC 4I09A 4AI9A 4N53A 3UKTA 5K9YA 2W91A 1AR63 3RYRA 1HV1A 2XBO2 2VMCA 1HXS1 5FRAA 4WVMB 1FNZA 5FV3A 2MEV3 3PHMA 1PO21 1VMJA 4ET7A 5DMYA 2D3PA 4U36A 3U4SA 4BMEA 5LA1A 3KT4A 4AHZA 3K48A 2X29A 4WVWA 1DG6A 1X8EA 3RVHA 3H8RA 4LKEA 4QDSA 2VXRA 5B4XA 4OLLA 1FYUA 1JMUB 4MXVA 3DF0A 4AI0A 4FTBA 1Y9QA 2HWC3 2BGOA 1RMU1 2QZ3A 2JDYA 1YFUA 5FOBB 1V6LA 3QH7A 4QQLA 1GWKA 2HWE3 4JGZA 5CB7A 4Q4V2 4NMIA 4OHYA 1DZTA 4IE5A 2FD8A 5H9QA 3VBUC 1HRI3 5KR7A 1CAUB 3T2PA 4AVAA 5CU1A 5BNPA 1AR73 4XZUG 4UAPA 1LOFC 4KBZA 1YXWA 1ONAA 3JBG3 3GZAA 3OYWB 2OPKA 2QUOA 3VDDB 1CN1A 1WMEA 1V9U3 2BERA 2R073 3TRSB 5FY4A 1OXCA 3TBDA 3M2MA 4XFIA 5GLWA 5CAZA 4FPFA 4QPGA 4B4QA 4HVOA 3P3PA 2MNGA 1IPSA 3I8TA 5LY2A 1VB2A 1LKNA 4M0NA 4Q4W1 1UN1A 3VBRB 2J1AA 4HKWA 3PVOA 4TN7A 1EV12 5JOYA 2BWCA 1DYKA 4JKKA 2CL2A 4CEYA 2ZMLA 2XVGA 3F95A 3ZN4A 1C3HA 3VKFC 2XOMA 2Y8KA 3WF0A 4DOUA 2IXCA 2WO1A 4XVHA 1MS3A 4YM1A 1CAWB 4RS5C 3AVRA 3KT1A 1C1LA 4P9GA 3AJZA 3RZJA 1FPN1 3I2DA 3HQRA 4GA9A 1RXFA 2WZR2 2WIIB 2WS91 1MQTB 3USUB 4LHNA 2J1TA 1BEV2 3VBOC 1XSRA 2JDPA 2FZ1A 3MBWA 4OYUA 4Q4Y2 4HANA 4QX3A 4IW3A 4FPLA 3IZOA 1UXXX 4Q0VA 5LCWL 4AOCA 1AL23 1LENA 5EJ1B 4D69A 4N8MA 4FAHA 1H8VA 5IK5A 4M3CA 4AAXA 4YYOA 5T52A 2XJSA 4QX8A 3ZFGA 4LORA 3VD3A 2HWF1 4FPYA 3E5QA 3AVSA 5A3OA 1UZ0A 3T3YA 2Q1MA 1TMF3 3ZXLA 3GCWA 4AE2A 2JD9A 3T08A 1BVVA 2BBAA 2GH2A 3CHXA 4NR1A 4ZZ5A 1JZ2A 3NJYA 3A7QA 4LBQB 5LATA 1JYVA 1AR93 4CDUC 4JZRA 1OPMA 2XL7A 3CDZB 4QB2A 2BBVA 1BQPA 4MVTA 1W05A 2W1WA 3NNLA 2WBKA 4XDQA 1GKBA 2WO2A 2XUMA 2NPIA 3T0DA 1L7RA 4FVVA 4NHYA 1MS5A 1QXRA 2GALA 2JWPA 3B7MA 5A7QA 4DXRA 5A70A 5DG1A 1YQ8A 3AP6A 2CU5A 3S7EA 1GUIA 3DYPA 4AFDA 4PLNA 1YJKA 3DL3A 4CP1A 5C5TA 1MS4A 4MV2A 5JZGA 1QJU1 1ZBE1 4QKFA 5T5JA 1H2KA 1JZ3A 2UWAA 4PI2A 2D93A 4W6YA 1RB8G 5IATA 3JQWA 2CAUA 1FMD1 1SG3A 4HMZA 3POEA 4KU8A 4RGAA 1JYWA 4RHV3 1A6CA 1N3OA 3Q8CA 5FO7B 3WCRA 4IEXA 4H14A 4N43A 3SH4A 3ZFFA 4UI9L 1RUE1 4OMDA 5AFEA 3G7DA 1J1LA 4AEDC 4DEQA 1ZRCA 2XPJA 1POV1 2RDSA 4O61A 2GC2A 4GB33 1A8MA 4JX0A 3VBSC 2PLV3 2P5BA 4QXKA 5AVAA 4FO9A 3ACLA 2UYAA 4KWJA 4BLIA 4BXFA 2JKBA 1Q8VA 2WNUA 2FCUA 3R4DB 4R8HA 2X05A 1JH5A 3O1MA 1R64A 1UL9A 4NPRA 3C3VA 4XAEA 3HNYM 4A7KA 2DVAA 5F3GA 2RE9A 3C7HA 1UX6A 3LAGA 4MO3M 4AXOA 1HRV3 3RGBA 2A3XA 2BRTA 1Z7S1 2VCMA 4FAGA 3PU3A 1V6NA 5CKQA 2ERFA 3D0SA 4FOQA 4KG8A 2H6BA 4PDWC 1ZREA 5IVYA 4UYBA 4NE9A 1N1SA 3J9SA 5D2AA 3UKNA 1QHDA 1VRH3 1O3QA 3ZN6A 4E8CA 1LODA 4UFLA 4XBLA 2VULA 1PZ9A 3ACGA 4RA0A 2Q1ZB 4Q1PA 2RR12 4BH9A 4META 3OGGA 1H8TC 5CNAA 4A3ZA 2P6CA 4JKMA 3M3OA 4U2AA 2ZXQA 3VBUA 4ZONA 2D3RA 2VBPA 3ZR5A 1LOFA 4XJ9A 3B69A 1NA1B 1HB2A 1TZOA 5FZBA 2MEV2 3NQHA 2ZMNA 2PHRA 1QOSA 2VTXJ 2R16A 4QU2A 1M06G 2EIEA 4XJWA 4Q1RA 4HN0A 4YM0A 3H9AA 5FZLA 2VW1A 2XQRA 3WNPA 4EWEA 2QQOA 5FYIA 2YPJA 3VD9A 1S4CA 4GMP3 3MIFA 4YFWA 2QQNA 3KVAA 1PZ8A 4UOJA 2JIJA 4AQTA 2VOKA 2DUOA 3IKWA 2HWE2 3WF2A 2R042 1BXHA 1HW5A 2JDKA 5L9RA 4IE4A 3D4KA 4RS5A 4XUTA 2B45X 4PJYA 2VECA 4YM2A 5AC91 1L7LA 4H55A 3BODA 2BFUS 1DLCA 2DBIA 4YW1A 3WEZA 3MLLA 5HCBA 1R083 5JAXA 3JBG2 3U4XA 5C3SA 5G05L 4TLGA 3WR0A 3ZXEA 4LKSA 3VDDC 4FP2A 4DNYA 4DS0A 1DBNA 3WX5A 1IKQA 5E16A 4YW3A 3FC0A 1RHI3 5FZOA 1XNTA 1D4VB 1R1ZA 1CJDA 1ASJ2 4O7XA 1C8M2 3ORJA 3R4UA 4UW3A 3M3QA 1PIV3 4CCKA 5FUPA 1JODA 1UY4A 1RJ8A 3N9PA 2V5DA 4Q4X1 3VBRC 3WP5A 3WP4A 4K8RB 1UO9A 3RS6A 5L7OC 3LE0A 3PUAA 4IEOA 2Q1FA 1PK6A 2PAKA 2YHJA 3HIFA 3ZYJB 4MUVA 1ULEA 3WNMA 4IEPA 4I30A 5BPXA 1I6XA 1VBD3 2JG8B 3WHTA 4AHWA 2ADDA 3AKSA 4CDUA 4LE4A 1Y9GA 3WW4A 5LW9A 2LUWA 2Q8EA 3RG0A 3SKVA 1W6MA 1V6OA 2ZZQA 3VKOA 4M0HA 4EN7B 4TZDA 4FQ4A 2F4LA 3THCA 3ZXDA 1N1VA 1NCRB 1TVGA 2DCZA 4YZ1A 3N7JA 5HV0A 3KCCA 4IV1A 1HDKA 4YARA 1JI6A 3VBHB 5FZEA 3QBQA 5FY9A 5A3NA 1W39A 3WQ1A 3TEYA 4XILA 5BV6A 1RUC2 1X50A 1AL0G 1UY1A 5KBFA 1GFF2 2D6PA 1RINA 4QKBA 3A22A 3UV9A 1IPJA 1SPPB 3IBMA 3U1XA 3N3HA 2BVBA 1OQDA 3H3ZA 3O14A 4BU2A 3S30A 4I0AA 4DRVA 5C9AB 2Y6FA 3ILNA 4FTEA 1S0JA 5A32B 4C0BA 2DYCA 4NRPA 5CYYA 2VPVA 2GN3A 3J8F1 3AYDA 1HXS3 1VRBA 1HJFA 2XONA 3GF6A 2CY6A 4FPKA 4LIVA 1PMHX 1WBLA 2ET1A 3NKGA 4AEDA 4B3NA 3PJQA 4GALA 1PO23 1W8NA 3JB4C 4QB1A 2UWBA 2VZOA 2PMWB 4IEQA 3THTA 4MGIE 5CFDA 5LB6A 2WWSA 3HMYA 2NMNA 1OVSA 2B5HA 3PVNA 4AGGA 4CDXA 3IDAA 3SITA 3Q9OA 5EJ3A 2BJSA 5FJKA 2XH6A 1GYKA 5KXBA 1QXPA 1RMU3 1VBC1 3AFKA 3MV11 3AMPA 3IIAA 4HBNA 4K9SA 1JW6A 4HONA 1VJ2A 3NJVA 2R1DA 5FK7A 2BQPA 5FY7A 1W8FA 5JMCA 3L2YA 3DPRB 4QQHA 2B9UA 4P9IA 3WDUA 3NAPB 3B00A 4COVA 3VUOA 2XVKA 4KWLA 3BGAA 3PDQA 4DEVA 4FCAA 2BNOA 3CQOA 1ZBA2 3LD8A 4IXLA 1PZ7A 4PDWA 5LA2A 5HCHA 5FPVA 4E4ZA 4EROA 2D7FA 4YGEA 3V65A 2QQMA 1DQ0A 3LA2A 5BNNC 3MICA 1SBDA 2RJ2A 4JQRA 4OUSA 4OHZA 1JZ4A 4GB32 4XJAA 5EPAA 4AHYA 1KDKA 1GOGA 3TN91 3H3UA 5I8SA 4XQDA 2HEVF 2WZPP 3AP7A 1W04A 1H8TA 1AXYA 4JKLA 4RFT0 5C6CA 4Q4W3 4FFHA 4A41A 1H4HA 1VALA 3MHZA 4M00A 1J3PA 2WQ8A 3AP4A 4CCNA 2OQ7A 3OGSA 3PU8A 1KD7A 4YG0A 1O3SA 5KHKA 4FXGB 4P14A 3OG2A 5EXOA 2CV6A 3B94A 3IT8A 4L92A 4YVSB 5A7WB 4BE3A 4WVMA 5DG2A 5FZ3A 1NT0A 2YU2A 3AMMA 1EAH2 3OGRA 1CAXA 1O59A 3ZYGA 4Z1VA 1XE7A 4R9DA 2GZWA 1WZXA 4Z2AA 4P9XA 1NLQA 5L9VA 1RVF1 2VNOA 3DGTA 3D6EA 2Q30A 4QPYA 1LHOA 5GLTA 3E1F1 2WS93 4LBOA 1W06A 4D6RA 2CDOA 2HBTA 1L3JA 4DB5A 4TLFA 1DU3D 5JOWA 1ZZCA 5A33B 3W5NA 1Q8PA 2F17A 2W1SA 3H8OA 1XNCA 3URFA 1LB2A 2MPFA 4BOWA 5HPOA 1S0GA 1LHNA 2G1MA 3OEBA 4S2FA 5F3CA 4COZA 3ZYFA 1JOPA 1KITA 4A45A 3L2HA 2VNRA 1FOD1 1RITA 2JDAA 2HWF3 5HI0A 3I49A 1W6PB 4ZZ8A 1YWKA 4UF0A 1CPMA 1EYBA 1Q8QA 2AEZA 3CJIB 3ZYBA 2V72A 4QKDA 5ACA2 2D5FA 3GZUC 4PQ9A 4EN0A 5DAPA 2AC1A 1C4RA 5FJHA 5GALA 4KWUA 2IVIB 5FCCA 2LS6A 3W5MA 3ZXAC 4QHZA 2A7AA 2VQAA 4CU7A 4Z07A 5F39A 3VBRA 3WY6A 4NOTA 1AXKA 4ITCA 3TNPB 1GICA 3U14A 1REEA 3P6BA 2ZABA 2ZGSA 4JDOA 2VJXA 4GWMA 5L7OA 1F35A 2OZJA 4ZXEA 2ORXA 5E8AA 1J84A 1K5MC 4I0WB 4PIZA 1OOPB 3UT0A 1UNBA 1ZBE3 2YXSA 2E31A 4NAMA 3C7FA 4Y3OA 3AL6A 1WBFA 5EWSA 3BU0A 1FMD3 3NVCA 1COV1 4ASLA 3EYPA 3BUCA 5DZEA 2JB8A 2XHKA 4KU7A 1DFQA 3CZJA 3E6BA 3ROUA 1RUE3 2VW0A 2GSYA 2QDRA 4QQ2A 5A7NA 2E26A 1Z78A 2CSGA 3WQBA 4L97A 1EY2A 3VZNA 3A0KA 1POV3 4P08A 3B01A 5HXVA 4FOVA 2X5IA 5A3UA 4K8FA 2E7AA 3JU9A 2JKXA 4YZ2A 4BQ2A 4QQPA 4CDWB 2W47A 2BW8A 2QJVA 4DO0A 1YJLA 3HEIA 1OBNA 3S5QA 1XQNA 1UZYA 3DEMA 4YGCA 3VBFC 4HZFA 4DUVA 4PF1A 4XCAA 3WW2A 4XABA 2RS31 3WDVA 1STMA 3OSDA 1NOVA 2VOTA 3U11A 3GBWA 3WV6A 1OKOA 4XF0A 3C7GA 5HCFA 5FWEA 2VM9A 1DQ6A 1KS5A 2D6OX 3CZUA 4IEWA 4NJ4A 4YZ3A 3CMGA 4A7YA 4BMBA 1NCRC 3M8LA 4D94A 4YFZA 3T0AA 5FYTA 3I2OA 2HKXA 4R4XA 4NPMA 1PGL2 2ZHKA 2DTWA 3Q8EA 1CD3G 3FBMA 2QFEA 1TEIA 3OGJA 5BNQA 5C71A 3OF1A 3KV5A 5A7OA 3ZXGA 2ZZJA 1W90A 5C9AC 3NL1A 4ZU4A 5JMOA 1W8HA 1CIYA 4XCBA 1PNFA 3MZHA 3ZPYA 1S0DA 3AYEA 5BNNA 2O1QA 2FDKA 2IFWA 5L36A 5IK7A 1RUI1 3M3IA 1VBE1 4N9HA 2VQTA 5FYZA 4QX0A 4LT5A 4A6SA 4EWDA 1H9PA 1CZSA 3H8UA 5ABJA 1LR5A 3HPNA 1IHMA 2VZTA 4CUGA 3O1SA 4O65A 3EJKA 4MZUA 2A6WA 2DWRA 3WDTA 4J6GA 2G19A 2W0XA 5FYSA 2EXIA 4O9GA 2VZVA 3USSA 5C8CB 3KM5A 3S7IA 2PFWA 1A3KA 4LR4A 2GC0A 1OD5A 1ZRIA 4XUOA 3POGA 1IS4A 2ZGMA 3PUQA 4LA3A 5D8AC 2RMU1 2J1VA 2GNDA 3DPRC 3VZJA 1JYTA 2E6VA 3AKQA 1X9PA 3OY8A 4V1PA 3DV8A 5GZCA 5AC93 1GSLA 5IJRA 5FXVA 1VBB2 4CP2A 5JIUA 2D3SA 2PTMA 1Q5OA 5FUIA 4E8DA 4QAWA 2VUCA 2WA3A 4GMP0 4AVCA 3FL7A 1LHVA 2J22A 2A6ZA 1LOCA 1QWRA 4NIGA 4FTSA 3I2JA 3LEKA 3R4SA 4N9IA 4DY5A 2ZEZA 1WMXA 3ASIA 2DVGA 2OS2A 3CU7A 1XC6A 4JTOA 1NY71 2Q5TA 3MPPG 4Q4X3 4KWKA 3FLRA 3Q8FA 2WFPA 1I9RA 1O4ZA 2NQYA 5CG8A 3GJAA 2FBEA 5JDBA 3C8XA 1DZRA 4QKNA 4DIQA 2IXJA 5J98B 3KWVA 2VO5A 4XQWA 1UPSA 1H1MA 2QBXA 5TSWA 2C26A 3QOPA 4KBBA 4NHLA 2ZAHA 3JD71 1D7PM 1H4GA 2G9FA 1LU1A 1R1A2 2RS51 3ETPA 2OPWA 3OBRA 4Q29A 3AFGA 2R6QA 1D4M1 5C4WA 3VL8A 5CFCB 2A75A 2ZEYA 4NPLA 2W46A 2XJQA 4Q2FA 4AI1A 3BOWA 1S0BA 2FZ2A 2VUDA 1QJX1 1XU2A 4OCTA 4V2VA 5FY0A 3ZPOA 3VKNA 2AYHA 4ONUA 1Y43B 3WLUA 3DUIA 1K5MA 4GKYA 2JXAA 5FP9A 1MZEA 3SC7X 4AI2A 2WYFA 1GQHA 4LULA 2ARCA 4TYSA 4AQSA 5JCTA 1GU3A 1SCRA 4ATEA 5APAA 3I59B 3KT7A 4ZXKA 3RZKA 3N9QA 3SEPA 3K51A 4GH4C 4QQOA 1RUJ2 3OUJA 4Q5OA 3J8F3 3ZXJA 4TSVA 4Y5SA 1SFYA 3FZ3A 4R4ZA 4PQQA 4D8MA 4LNVA 5J1XA 2MHFA 3GBFA 2ILMA 1QIQA 4COUA 3INAA 1QKQA 3ZKUA 3FHAA 4YG6A 4M3CF 3LWCA 2ZPXA 3GDBA 3M3CA 5GLZA 2CAVA 5JWPA 5LEJA 4XZPA 1AR82 3HT1A 1VIWB 3H1WA 1OLQA 2C24A 5FZDA 3EO6A 1NQJA 1VBC3 1WW4A 3U10A 3RZLA 4GULA 4JAAA 1C5HA 1NCQB 3RSJA 2IUWA 1YCIA 3VBFA 4OI0A 1OFSA 4HFSA 4LE3A 4LKFA 4NN0A 1KGYA 1CAVB 4NRQA 4WVVA 2B7YA 1B35B 4CCDA 1AJKA 2YPDA 2PAEA 4XFGA 3HR9A 5J48A 1I3HA 1XE0A 4O9EA 4DFSA 4CU6A 2QQWA 2OKXA 1NCRA 1RUD1 1C57A 1RUG1 4MYEA 4NHMA 4TXWA 4FPEA 3L9JT 1PGW2 3WF3A 1R092 4BQ4A 2WWJA 2Q0AA 4I02A 4XAAA 3SLIA 4CE8A 4D6SA 5I0UA 3QACA 1DQ4A 3I3MA 1S0IA 4LO4B 3TN93 2Z42A 3FHQA 1FXZA 1YC61 4Q27A 4Z8BA 4B4PA 1LESA 4NIDA 2QQJA 4YNIA 1AX0A 1WD3A 1HJGA 2G4IA 1PNGA 4LBKA 2OUHA 4QM9A 5KHJA 1LJ7A 3PNAA 4Z92B 2IWGB 4XEZA 2JG9B 4XF9A 3V0AA 5HCAA 2RHPA 4ORFA 1OVPA 3MLKA 1BHGA 2CGOA 5KXEA 4K7JA 3OBZA 4JTNA 3ES1A 1SMVA 1W8TA 3SQOA 4FFGA 1RUH2 1RVF3 1ZZ9A 2VD7A 2YROA 1BMV1 4XHXA 1ND3C 4QXBA 2Y6JA 5A6QA 1SCSA 4HPKA 5LEKA 3WCSA 3HWJA 2XJVA 2QQKA 1JUHA 2XHNA 3DKQA 1LHUA 4XACA 4QMAA 3V0BB 5D8AA 4C1WA 2V09A 5JOXA 4LO8A 4L8QA 1VBA1 4DUWA 2Z69A 3AYCA 4MHRA 4CCLA 1W2OA 4DQAA 1UKGA 2W5FA 1N3PA 5IVEA 2XLGA 3PJYA 1FOD3 3OGVA 3ZMOA 2HWD2 2DF7A 2RM22 1REFA 4K1YA 3ZIWA 5JR2A 1ZRFA 2LM3A 5JUVA 2NM1A 4XMIA 3ZKYA 5LRSA 2XLAA 5EYXA 3OD4A 2AGSA 3CJXA 5J3UA 5A3TA 4CCJA 1QJY1 2Z5WA 3WSOA 1D2QA 3MUY1 1F4HA 2PQQA 5DDJ2 4Y26A 3IM0A 3I3QA 4RSUA 2VBDA 4ZPIA 2YMZA 3PLQA 1OHFA 4QPIA 1KFUL 5FZFA 4A44A 2E7TA 4WM7B 3DN7A 5FPUA 1XB9A 3AXDA 2R062 4JRLA 3P3NA 1BK0A 2GMEA 1WLDA 3MO4A 1COV3 1TME1 4AVTA 1W0OA 3T2TA 3ST7A 3LEGA 4XFBA 2WQZC 3EQEA 4SLIA 2DCKA 3O12A 3NO8A 1XXNA 1LEDA 1XJAA 4D0QA 3UGHA 4LPLA 2WAAA 2B46X 1HLCA 1QOTA 4IL7A 4DPNA 1S2EA 3M70A 1OUXA 2QQUA 2ZGQA 3VV1A 4E2GA 2J1UA 4D7SA 1W6NA 1UMZA 1POQA 5FP8A 1UOFA 5IVBA 3BTAA 5SV8A 2ZCWA 1HN0A 1SHWB 4JDNA 4GH4A 4HETA 2ZBJA 2HWB2 1W3VA 1POV0 3FUQA 4LKDA 3KGLA 2RS11 2ZGLA 2OZ6A 2VVDA 4BM8A 3BTXA 4INDA 1XYNA 2YU1A 2RS33 4CUAA 5CBLA 3RYKA 5CFCC 4RN5A 1JXNA 2EICA 1CJPA 4Y20A 1UYPA 2D40A 3TAYA 3CKHA 2HH9A 5DAVA 1QQP1 3IPVA 1ENRA 1RTVA 1G9BA 3GM8A 4Y1ZA 3EHKA 3JCIA 3NNFA 1VR3A 5LK5A 4D3WA 4F83A 5E89A 4OMCA 1AYN1 4XURA 1U5YA 4AQ6A 1W28A 5FO9B 4TTGA 5LY1A 4XDOA 3K3NA 4K6BA 4XXPA 5CISA 1C28A 2ZGUA 1OA2A 2IVJA 3UKVA 3O7OA 5HV4A 1DZQA 5FYMA 1OMIA 2I07B 1SDDB 2IC1A 2VUJA 2L9LA 2PHDA 3UESA 3J8F2 1PMJX 2WQ4A 4JRAA 4CEWB 2QQLA 3S6PA 3FWEA 1RUI3 1VBE3 5FZ7A 3KF5A 4B1MA 3ZFEC 3ZX7A 5F1RA 2QQPA 2FCTA 2HYXA 3X29B 2Q8OA 2K46A 1FNYA 2BNMA 1WW6A 2DCJA 1PX4A 3FJSA 2ET7A 5EZWA 2V4AA 2XG3A 3NJZA 3UYJA 1W9YA 2W94A 2C9AA 2E51A 2NZ9A 4XF3A 5JOZA 1VMHA 1BBT1 4RR3C 2HEYF 1W6OA 2R7EB 1W6QA 5K7PA 3BTYA 3DKWA 1UPIA 5GZFA 1KS4A 1MEC1 1NG0A 5GZGA 5FP3A 2EALA 2EXKA 2DVDA 2RMU3 2WAOA 3I2GA 5FMBA 5FLIA 4QGLA 1QNYA 3VZLA 1I5ZA 4IV3B 4NUBA 1LNSA 2OT7A 2P3KA 4P9WA 3B3QE 5B2GB 5CIRA 1PVC1 2YY1A 1RUF2 3LZZA 4BQXA 5IVFA 2DBNA 3GXUA 1AJOA 3SKJE 3BIWE 3ON7A 1S55A 4YLZA 3PUIA 2SLIA 1ND3A 2ZGRA 4DY3A 1OLMA 1XE8A 4RL7A 4AF9A 3PMEA 5GKAC 3SXWA 1HB3A 3C7OA 1ND2B 4LOTA 1LOEA 4KNCA 3ACHA 1LHWA 1W0NA 2JDMA 4YW5A 4AFMA 2XMLA 3AP9A 4WM8B 1UYXA 5K0UB 5KHIA 5IYYA 3Q8AA 4YPJA 2XBO1 2SBAA 4HVQA 2BOJA 2AREA 1AR62 2AEYA 3NW4A 4JHZA 4LHSA 1SFNA 4NHKA 4ASMB 4RQPB 4ZY9A 3VGIA 5A1AA 2JG9C 4ES8A 4V2WA 3MLJA 1UIJA 3N4MA 4J1WA 2CYFA 1NXD1 2WR9A 4X6RB 4QGMA 2QDNA 4OUEA 4Y1UA 2JE7A 4HG6B 3JD73 3VD7A 2JENA 5A7SA 2FCVA 2EXHA 2RS53 4QM8A 3AKRA 1H1IA 1D4M3 1F9KA 1JUIA 4A2UA 2HJIA 3APBA 1GNYA 3BU7A 4UXAA 3ZN5A 2VOVA 3KZ4C 5T54A 1YFXA 2HWC2 4IESA 2YFZA 4A6OA 4AYUA 2EIDA 1OQ1A 3JXSA 4EN8B 1W8WA 4Y5Z0 4Q4V1 5FIXA 5F5QA 4XFHA 4R9AA 4CDQB 4DINB 1XPWA 5J09A 1QJFA 3M1HA 2GMMA 4HL0A 1BZWA 2OVUA 3D8CA 4ZU7A 3KQRA 1YNAA 4FPJA 1JYIA 1LGBA 2XKPA 1HRI2 4FFIA 4FXKB 1AR72 5FZ8A 3OBTA 1F5FA 5BNOB 5HXMA 3T4HB 2JDZA 1H2LA 2WNVB 4HN1A 3PL0A 2A1XA 4BQYA 4YSFA 5F7UA 2A71A 4FI9A 1V9U2 2R072 5LASA 3PTYA 3V64A 3VBOA 3SNMA 1LOBA 1UX7A 4LLOA 4LK6A 3MFAA 1UD1A 1N47A 2LALA 3H7YA 5EP9A 4MGQA 3I2FA 1EV11 3FBYA 2BGCA 1LGCA 3KCYA 1PX3A 5B4NA 3VZOA 2EVXA 2YC0A 3I3BA 2VOWA 4XPVA 4EN6B 1X8MA 1H30A 3H3LA 2HYKA 4IQPA 4JGYB 3UNPA 1CESA 1OA3A 3KMHA 4WM7C 2WLPA 2WZR1 4I0BA 1KRIA 2BP6A 3LDRA 4GAZA 4XJ8A 3RI9A 2F6BA 4UFHA 1VPHA 1RL3A 2E33A 4IE7A 1I1EA 2GNBA 1BEV1 2VZQA 4MGSA 1LULA 4L0PA 5ISLA 3V56A 4Q4Y1 3FHIB 2CNAA 5A3LA 1MQTC 4Y22A 2B4KA 2WDBA 3UL2A 4EWAA 1YHFA 3K4ZA 3HNMA 1RUD3 4QDQA 1RUG3 5FDBA 1JZ8A 3WNLA 4YZ5A 1MS0A 1AL22 1ZZ7A 2VNVA 5FLJA 1ZRRA 1AHSA 4YGBA 1F2NA 2EIGA 1A34A 2PA7A 2QQVA 4P5YA 4C0HA 1JHNA 1Q8OA 5LBBA 4QX1A 1J59A 2ADEA 5L19A 5C8WA 1TMF2 3ELNA 3THDA 3LGRA 4LBLA 2WO3A 1EPWA 5FQ0A 4N7UA 1WWYA 5M0TA 1TQ5A 4IDZA 1AR92 4HVRA 2YV8A 1YRZA 3CO2A 3ZFEA 3AMHA 1ST8A 4JHTA 5EV7A 4EZ4A 5JXHA 3VBSA 4NIHA 2ZJCA 4ATFA 4MGZE 2ARXA 4QPWA 1GR3A 3M7AA 1W8ZA 2BVVA 4OI2A 3ZYHA 4LQRA 2FDFA 3P1IA 3POJA 3PTRB 4RGGA 4RR3A 5DUXA 4BQWA 4FBFA 5J7MA 3S0MA 3HAGA 4N53B 2YG0A 3WUDA 3F2ZA 5C3RA 4S2GA 1VBA3 2D97A 1CAVA 4XBNA 3IWZA 4RHV2 5FZ4A 1UYZA 3VLBB 4W6WA 3NV3A 3UJOA 1SLBA 1FT9A 4CEWC 2LTNA 4ZS3A 5KC5A 2C6SA 1G9DA 2E7QA 5D1IA 1KXGA 3AXEA 5EHDA 3R6SA 2UURA 4JCKA 1U5ZA 1ZVFA 2PHTA 2PLV2 1W99A 1XU1A 2XB6C 3MF9A 5FZHA 5FXWA 1V6JA 5FKCA 1LECA 3AMNA 5FBZA 1HB4A 1QJY3 3PVEA 5FY5A 3LOIA 1X82A 1C8NA 3ABZA 3VD4A 4MXWA 1QJZA 1UMHA 4GQ7A 1S1AA 4ASKA 5F2SA 1BYHA 4JGZB 1GLHA 2QZ2A 3DXTA 2BGPA 3I3DA 2JDUA 1HRV2 4OZOA 4Z82A 3WNOA 5BNPB 4FOWA 3HNBM 2VXJA 1UU5A 2ZTNA 4NO4A 3ACIA 2RV9A 2DU0A 3K3OA 1X7NA 5T55A 1C1FA 4LXLA 2XKOA 3KV9A 4CTEA 1FPN3 5FXXA 1TME3 5GM0A 3ITQA 1OH3A 4UT5A 1VRH2 1B09A 1QH6A 4QPGB 5LZ6A 2RR11 2DUQA 1F4AA 2ZS6B 1D0GA 2W87A 1HV0A 4GKXA 2D6MA 1UYYA 4URTA 3RQ0A 4TWTA 4CEYB 2WKKA 1XBFA 4BLJA 3I3EA 4IUGA 4FSJA 1LTEA 2OIIA 4MG2A 4HSJA 5FTTC 2Y26A 1DDLA 4YWAA 5A1LA 1CAUA 4LIUA 1H2MA 2JD4A 5GLVA 1NA1C 1WW7A 2D43A 2PYTA 4XUNA 3WQ0A 4IE6A 1WW5A 3OYWA 2WSVA 3HQUA 1UOGA 1CZVA 1PVXA 3N7MA 4QX5A 3VDDA 2RS13 3SEEA 2Y33A 2XXZA 1YUDA 3ATGA 5DUVA 4C90A 1ZM1A 3ILRA 3BALA 3MEPA 3OPZA 5FZAA 1Y7BA 2VTXA 1MPXA 1JZ5A 4H3WA 4B1LA 2P3IA 2ZGOA 1SLTA 5LBFA 4DXSA 2VZ3A 1QQP3 1A78A 3LA7A 4XIKA 1G9CA 1GP6A 2TEPA 2XLFA 2R041 4M3CB 3OCPA 2P4EA 2ZMKA 1D0HA 1AYN3 1JBCA 1P8JA 2GDFA 1YYNA 2VC9A 4WM7A 4Q26A 4Y1VA 5F9TA 3LF7A 1CAWA 2QCSB 1QJU3 3B02A 3BPZA 2BZDA 2VVEA 1R082 1UY2A 1F15A 1DIWA 1JN2P 1K45A 3AX4A 3PURA 1MQTA 1QH7A 2ZKLA 4YG3A 3USUA 3WDYA 1G9AA 1ASJ1 1C8M1 3NWKA 1TNRA 3G6JB 1RHI2 1ULGA 2JE8A 3BYWA 3FLTA 4IE0A 5I0SA 3LA3A 4K1ZA 1PIV2 4XYXA 3ZLIA 2R30A 2ZEXA 1SBEA 4Y24A 3WNNA 3WDWA 4W4ZA 1HQWA 2ORZA 3W59A 3T2QA 5JZGB 1DCSA 3WDXA 1DGWX 4IEUA 4N7IA 3TEZA 2KM2A 1MEC3 4JGYC 1NQDA 3FX3A 2EAKA 1Q56A 1OFNA 4I3GA 3RJRA 1VBD2 3LFIA 1DP0A 4N43B 4UBHA 4LBQA 1PHMA 2JG8C 3VL9A 3ZFFB 1Z7S3 2OYZA 4BXSV 3WG4A 5I8YA 4KG0A 1PVC3 3VDAA 1JU4A 4BDVB 5L73A 5JXIA 5JPNB 2ZGTA 2BFUL 2NP0A 5FAXA 1AUYA 4OQ9A 1RUC1 3CLPA 3MIGA 5FPBA 2DFCA 1N1YA 3N7KA 2W92A 2R49A 3VBHC 2R32A 2WNUB 2K9ZA 2WT1A 4Q0SA 3E6CC 1CPNA 2FQPA 3NNMA 4X8NA 1LGNA 4C91A 5IVJA 1DQ1A 1JOJA 3WXPA 1GANA 2OUJA 2HEWF 5EFUA 4LOSA 3WG2A 1ODMA 5FMCA 1HXS2 4ES9A 3B93A 4IERA 1PO22 4IEVA 3DYOA 1XNDA 2YGLA 2YUEA 1RJ7A 4CXYA 1ULPA 3IDCB 3N9MA 4Y4YA 3ZR6A 4R9BA 3ZN6B 4RFRB 3CIHA 5A1FA 1J58A 2Q8DA 1UMIA 3W58A 4XMAA 1JZ7A 2B8MA 1FI2A 2BV4A 2WL1A 1IPKA 4P5HA 4AVBA 2WFF1 4OHXA 3UK9A 1RMU2 3GALA 3N7LA 4R52A 4Q4V3 1UIKA 1W8OA 3VBUB 1MS9A 1J83A 1SFPA 1ZBA1 2TNFA 3AL5A 4KL1A 1V0AA 4GZ9A 2XJUA 1RXGA 2VZSA 3M4FA 3NAPC 3VN4A 4BJ0A 4M4PA 3ZSKA 5HBAA 1DYPA 2UY9A 3AZYA 5FY8A 4AL9A 1PO11 2DVBA 5T3NA 2C0ZA 3T09A 4GB31 4EZHA 1W2TA 4Y33A 3MF6A 5H9SA 4AFBA 2RG4A 1PGSA 4BIFA 5LA9A 2A6VA 1L7QA 4AGVA 5KXDA 4LA2A 2AZ5A 4WV8A 1IG0A 3ZVXA 3GJBA 3D5OA 1Y4WA 2WINB 1T2XA 4YW2A 1BLZA 1G7YA 5DN2A 2O8OA 1W9TA 4LO6B 5H9PA 1IG3A 3RZMA 5DABA 4LITA 1EV13 4IGQA 2C4XA 4Q4W2 3WG1A 3SCFA 1PM7A 4XFCA 2QTWB 4EJRA 5JIAA 4XJUA 4CCEA 3RWKX 4L2NA 5SV5A 4CXXA 2FDJA 1O7FA 4RS5B 3RDIA 1W3XA 4K20A 1EAH1 1DQ5A 3EXUA 4D7TA 1CVNA 1MZ6A 4IGOA 1NA1A 2YBPA 2B39A 4YVSC 4XOGA 4PHZA 4AWDA 2CGNA 5A6XA 1KJRA 3IAQA 4AR2A 4MADA 2P17A 2WZR3 5JXJA 4XE9A 4LUMA 1CR7A 1O6UA 3ZM8A 4AK3A 1FPN2 3OPWA 1BEV3 1VE0A 5T5PA 5FZOB 2WS92 4Q4Y3 2WNOA 4GWNA 5C7GA 1VP6A 4YW7A 4QPGC 5FZIA 4OI4A 3KCXA 4MGTA 3WW3A 3I7DA 1X36A 1F31A 1REDA 3AZVA 1XYOA 4Q0UA 2IFRA 2GN7A 3RMXA 2YB7A 1YQ6A 2OX0A 3OD0A 1J3QA 2PELA 1WA4A 1PK6B 4CYDA 2XJTA 2F4PA 5FREA 2W68A 3RZGA 3JZVA 2HWF2 3CBNA 3IB3A 3N9LA 3I97A 3RZZA 5ACA1 4CDUB 1DF0A 4UFKA 5JSOA 4YZ4A 1JYNA 2VCBA 1W6MB 3CJIC 2RS12 5FR3A 1FX5A 4GWIA 5FYBA 5LBCA 2KD7A 5CADA 3ES4A 4GMP1 2D6LX 4XDPA 1IS5A 1DGRN 3MYXA 4IV1B 2Z2SB 3AKPA 4OVEA 3MGUA 1CZTA 1CWPA 3N9NA 4KMQA 3UGFA 4CXWA 3LCPA 2TUNA 2LROA 2ZGNA 1QDOA 2XJPA 4RYDA 1WCDJ 2AUYA 3QCWA 4PBPA 4XXAA 4AVSA 2YBSA 1OOPC 2WO7A 1QJU2 1ZBE2 2UWCA 2GP3A 4IEYA 4F8AA 2JG8A 3KHBA 4NAOA 2D98A 2QQIA 3W9AA 2QVSB 4AEDB 1FMD2 3N36A 5DAXA 4L99A 2UYBA 1YLLA 1AF9A 1NAEA 2DCYA 1RUE2 3A21A 3ZOIA 2BYVE 2BWAA 5KWRA 1N3QA 2VAUA 3R0RA 5F32A 1WCQA 4OQ8A 5C3PA 5DPNA 5CFDB 3O0WA 3MV01 4CDXB 3S5AA 2I74A 3NNGA 3VBHA 3WUCA 3ILFA 4CVUA 1YIPA 4Y1XA 3ZDVA 4J1XA 2NYYA 4D7YA 4LO7A 5LBEA 1UU4A 1SPPA 4CDWC 1O8SA 5C9AA 4LEJA 2G9ZA 1BJQA 2PHFA 4AZZA 4E2QA 5A32A 3KB5A 5BXXA 3WZ1A 1BVP1 5FZ9A 4RGKA 1YFYA 3U75A 1OKQA 4PCRA 3E97A 4PDWB 4BK5A 2WZ8A 4CUCA 4K3UA 3HOBA 1Z7S2 4N43C 1YI7A 3POFA 3FMGA 1EPZA 3J7HA 4JVAA 1JYCA 4M4RA 4Y4RA 5F3IA 4A42A 5K8SA 4PLMA 3W20A 1HIXA 5FPXA 4LO5B 2DV9A 1LOAA 1DQ2A 4QXCA 5DAQA 4B4RA 1QMJA 1U12A 1XRUA 3MUZ1 1UZVA 3BPSA 5E6HA 3TB0A 5KXCA 4S2DA 1PGL1 1NXMA 4D6QA 4P9YA 5EJZB 1H8TB 3OBAA 2RR13 2FDHA 1OF4A 4BISA 1QEXA 3K2OA 2JEMA 4AEJA 2A6XA 1IOAA 2ETEA 5C3OA 3RMYA 3B9CA 1J1TA 3O5SA 4QDRA 3H1YA 3DPRA 4ARYA 2VMIA 3NAPA 4M01A 2H0BA 1V6MA 2R1BA 3J4UH 1GZTA 3LQCA 5L9BA 1CAXB 2ZA9A 3ENRA 1CONA 1NLSA 1PMIA 2Y34A 1W2AX 3KVBA 5FYCA 4B29A 4G3YC 5IAXA 1WLTA 3GHMA 3LSDA 4CZSA 3QH6A 3WNXA 3MIBA 2J1RA 5FK8A 4IGPA 4NWVA 3DXUA 3CF6E 1JHJA 2VZRA 2P1BA 1OLME 1RYYA 5C8CC 1OUSA 2ZX0A 1GOFA 4CCMA 2R043 5IW0A 1CGPA 4P02B 1AYM1 3CL1A 5A3PA 2Z79A 5A7WA 2BDRA 4YVSA 5JVVA 1VBB1 2NLRA 2ES3A 2GU9A 1WGPA 1W0PA 1Z0HA 2VW2A 4UF0B 2ZAAA 2EIBA 5AC92 5FOJB 5IFTA 2A3YA 3ZYIB 4LTAA 5FZ6A 3IN9A 4W50A 3O1PA 5DAWA 5GZDA 3D82A 2HBUA 4LBJA 5JSRA 4Y1YA 5A3WA 4F3JA 3GGLA 2YYOA 3MIEA 4K21A 3TEXA 1WLCA 1N1TA 1OD3A 4X8PA 3EMRA 3LB9A 1ASJ3 2Y6LA 1ACCA 1C8M3 2OW4A 5GLUA 4FPGA 5A33A 2QNKA 2BU9A 2RJKA 4BIOA 4COYA 4XQ4A 2WC2A 4E4SA 3KD4A 1MZFA 3RJ2X 5FZCA 4CA9A 3SH3A 5L7OB 2V5YA 4Q4X2 1KFXL 1RUOA 1WUVA 5FFOC 1IKPA 3KV4A 3K77A 3ZXKA 5C33A 4LUKA 4BK4A 3WINE 2JX9A 3FFQA 3D0JA 4OHWA 3AMQA 1ULFA 2CTVA 1W6PA 5FZKA 5IK8A 2JDNA 1EUUA 1R1A1 3CJIA 2DVFA 4BYYA 5I91A 4PIXA 1EP0A 2EXJA 2XGXA 4XJZA 1H9WA 3M3EA 1QY4A 3SHRA 4CCCA 2VGDA 5FYVA 4XHBA 3O0VA 1UF2C 5CEHA 4LHLA 2X5IB 3C2UA 3E5UA 1VAKA 1RUC3 3BTZA 1ZX5A 2W39A 4OHVA 1W03A 1H2NA 4MH0E 1JZ6A 1UOBA 1V6KA 2DUPA 3B5LB 1OOPA 3LIHA 1PK6C 2D44A 4DMIA 3QLQA 1RUJ1 1WMFA 4F7ZA 4PI0A 3BVCA 4AI8A 3IMMA 5GJ6A 3MFCA 1MZ5A 2CHHA 2O14A 2IXKA 3LKJA 1YQ2A 5FWJA 1A8DA 2EAAA 3MDPA 5I93A 1K12A 2VG9A 3J7NA 3IAPA 4AFAA 1BKZA 2B9VA 1QXJA 2EF6A 3EBRA 3GZEA 4EN9B 2AACA 4MLOA 3T2OA 5KC6A 4CP9B 4IV1C 1AVBA 1US2A 3ZMNA 5A3MA 1ULOA 1AR81 1ENQA 3POYA 3O1TA 3JUUA 1HB1A 1E57A 2FMYA 1DGRA 3R05A 4CDWA 1UCXA 2WFF3 1E5HA 1QF3A 2E32A 4WVZA 1OF3A
chains in the Genus database with same CATH topology
3AVSA 3PTRB 5FPUA 3OPWA 5F5IA 3KVBA 5FZOB 5FYCA 5FXZA 3NJYA 3ZLIA 5FYTA 2PXJA 4CCNA 4QU1A 2OQ7A 4V2WA 5FZIA 3PU8A 5FPLA 2Q8CA 3LDBA 5A7WB 5IWFA 3KV5A 4IGPA 5FUNA 5FZ4A 2YU2A 5FZ3A 5A7OA 3DXUA 5A7SA 2OX0A 2OQ6A 4C8DA 4AAPA 5FZOA 5FZDA 5A7QA 4GD4A 4AI9A 4CCMA 5IW0A 3N9LA 4CCKA 5FUPA 3N9PA 5A3PA 2GP5A 5FP8A 5FYZA 5A80A 4D6RA 5A7WA 5FBJA 5FZHA 5FXWA 4QWNA 5FPAA 5FZFA 5IVBA 5FY1A 2YPDA 4UF0B 4EYUA 5FV3A 5FYYA 5FY5A 5FYBA 4CUGA 4GJYA 4URAA 3U4SA 5FPBA 3PUAA 5FZ6A 4ASKA 5FYSA 5FZ1A 5F2SA 5F3CA 4XDPA 3RVHA 5A3WA 5FZ8A 3DXTA 2YU1A 2WWJA 4D6SA 5K4LA 3N9NA 5LW9A 5IVJA 2Q8EA 3PUQA 4UF0A 4CCLA 2P5BA 3KV6A 4QXHA 3K3OA 5FZCA 4LXLA 4BXFA 3KV9A 2YBSA 5FXXA 3KV4A 5FJHA 5FXVA 4E4HA 5FZ0A 2GP3A 5FZEA 5FY9A 5A3NA 5LY1A 2YBKA 4XDOA 5KR7A 3K3NA 5F3GA 5F39A 2WWUA 5FYHA 5FZKA 3N9MA 5A7PA 5FYMA 5A1FA 4BU2A 3PU3A 2Q8DA 5F32A 2OS2A 5FY4A 2VD7A 2W2IA 5IVYA 4GAZA 5F5CA 5FP4A 5FZ7A 4QXBA 5A1LA 1VRBA 5ISLA 4LIUA 4LIVA 5LY2A 5FYVA 4Y3OA 4QX7A 3AL6A 5CEHA 5FZGA 5F2WA 3AL5A 4TN7A 3UYJA 4DIQA 3U78A 2XXZA 5FY8A 5FZ9A 5A7NA 4EZHA 4GJZA 5FP7A 4Y33A 5IVEA 5FZAA 5LWBA 2XDVA 3AVRA 5FJKA 5FP3A 5F3IA 4Y4RA 2XUEA 4HONA 4NUBA 2OT7A 4QXCA 5FY7A 5FZBA 5IVFA 5E6HA 5FY0A 4V2VA 4LITA 4IGQA 5FYUA 3ZPOA 4D6QA 3PDQA 4DO0A 5A3TA 4CCJA 5F37A 5F3EA 3LD8A 5IVVA 5FP9A 5FPVA 5IVCA 3OPTA 4BISA 3K2OA 5FZLA 4EZ4A 3PUSA 4IGOA 5FZMA 2YBPA 5ANQA 5FYIA 5FWJA 3PURA 5F5AA 2XMLA 4QX8A 3N9QA 4CSWA 3KVAA 4CCOA 4HOOA 5FWEA 3N9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AVS A;  3PTR B;  5FPU A;  3OPW A;  5F5I A;  3KVB A;  5FZO B;  5FYC A;  5FXZ A;  3NJY A;  3ZLI A;  5FYT A;  2PXJ A;  4CCN A;  4QU1 A;  2OQ7 A;  4V2W A;  5FZI A;  3PU8 A;  5FPL A;  2Q8C A;  3LDB A;  5A7W B;  5IWF A;  3KV5 A;  4IGP A;  5FUN A;  5FZ4 A;  2YU2 A;  5FZ3 A;  5A7O A;  3DXU A;  5A7S A;  2OX0 A;  2OQ6 A;  4C8D A;  4AAP A;  5FZO A;  5FZD A;  5A7Q A;  4GD4 A;  4AI9 A;  4CCM A;  5IW0 A;  3N9L A;  4CCK A;  5FUP A;  3N9P A;  5A3P A;  2GP5 A;  5FP8 A;  5FYZ A;  5A80 A;  4D6R A;  5A7W A;  5FBJ A;  5FZH A;  5FXW A;  4QWN A;  5FPA A;  5FZF A;  5IVB A;  5FY1 A;  2YPD A;  4UF0 B;  4EYU A;  5FV3 A;  5FYY A;  5FY5 A;  5FYB A;  4CUG A;  4GJY A;  4URA A;  3U4S A;  5FPB A;  3PUA A;  5FZ6 A;  4ASK A;  5FYS A;  5FZ1 A;  5F2S A;  5F3C A;  4XDP A;  3RVH A;  5A3W A;  5FZ8 A;  3DXT A;  2YU1 A;  2WWJ A;  4D6S A;  5K4L A;  3N9N A;  5LW9 A;  5IVJ A;  2Q8E A;  3PUQ A;  4UF0 A;  4CCL A;  2P5B A;  3KV6 A;  4QXH A;  3K3O A;  5FZC A;  4LXL A;  4BXF A;  3KV9 A;  2YBS A;  5FXX A;  3KV4 A;  5FJH A;  5FXV A;  4E4H A;  5FZ0 A;  2GP3 A;  5FZE A;  5FY9 A;  5A3N A;  5LY1 A;  2YBK A;  4XDO A;  5KR7 A;  3K3N A;  5F3G A;  5F39 A;  2WWU A;  5FYH A;  5FZK A;  3N9M A;  5A7P A;  5FYM A;  5A1F A;  4BU2 A;  3PU3 A;  2Q8D A;  5F32 A;  2OS2 A;  5FY4 A;  2VD7 A;  2W2I A;  5IVY A;  4GAZ A;  5F5C A;  5FP4 A;  5FZ7 A;  4QXB A;  5A1L A;  1VRB A;  5ISL A;  4LIU A;  4LIV A;  5LY2 A;  5FYV A;  4Y3O A;  4QX7 A;  3AL6 A;  5CEH A;  5FZG A;  5F2W A;  3AL5 A;  4TN7 A;  3UYJ A;  4DIQ A;  3U78 A;  2XXZ A;  5FY8 A;  5FZ9 A;  5A7N A;  4EZH A;  4GJZ A;  5FP7 A;  4Y33 A;  5IVE A;  5FZA A;  5LWB A;  2XDV A;  3AVR A;  5FJK A;  5FP3 A;  5F3I A;  4Y4R A;  2XUE A;  4HON A;  4NUB A;  2OT7 A;  4QXC A;  5FY7 A;  5FZB A;  5IVF A;  5E6H A;  5FY0 A;  4V2V A;  4LIT A;  4IGQ A;  5FYU A;  3ZPO A;  4D6Q A;  3PDQ A;  4DO0 A;  5A3T A;  4CCJ A;  5F37 A;  5F3E A;  3LD8 A;  5IVV A;  5FP9 A;  5FPV A;  5IVC A;  3OPT A;  4BIS A;  3K2O A;  5FZL A;  4EZ4 A;  3PUS A;  4IGO A;  5FZM A;  2YBP A;  5ANQ A;  5FYI A;  5FWJ A;  3PUR A;  5F5A A;  2XML A;  4QX8 A;  3N9Q A;  4CSW A;  3KVA A;  4CCO A;  4HOO A;  5FWE A;  3N9O A; 
#chains in the Genus database with same CATH topology
 1VBC 2;  3WT3 A;  3PVB B;  4P00 B;  2ENR A;  1SZB A;  1E5R A;  1NCQ C;  1UZZ A;  2IZW A;  4UW6 A;  2A5Z A;  5FXZ A;  3ZSM A;  1ZBA 3;  4NRO A;  1Q43 A;  5BNN B;  2Q8C A;  3WF4 A;  1B35 C;  2QKD A;  1PO1 3;  3RI8 A;  5J37 A;  1WCK A;  1PGW 1;  5ABJ B;  1R09 1;  5IHR A;  5FUN A;  3QD6 A;  1XYP A;  2WUH A;  4MX3 A;  4R9C A;  2J1S A;  5CFD C;  1O5U A;  5FMD A;  4CDX C;  4CPB A;  2LW8 A;  4X6Q B;  5JR7 B;  3TN9 2;  3K4A A;  5A80 A;  2ZHN A;  1LOG A;  3UGG A;  4QX2 A;  3I2I A;  4P9L A;  4LBQ D;  1O3T A;  4NVP A;  4EYU A;  1J3R A;  5LRR A;  3MW2 A;  3OB8 A;  1X9T A;  4Y5T A;  4AVV A;  1I5P A;  3OY8 B;  3LOB A;  2I45 A;  5DQ0 A;  1WD4 A;  1EAH 3;  1QDC A;  4LBN A;  5FZ1 A;  5T50 A;  2Y64 A;  1O3R A;  1RUH 1;  2P3J A;  3RRD A;  1FV3 A;  2ARA A;  2W1Q A;  4ZU5 A;  4J25 A;  5IFP A;  4AQ2 A;  1IQA A;  2JJ6 A;  2ZX2 A;  1O5L A;  3AP5 A;  1DGL A;  1RVF 2;  2ZX1 A;  1EUT A;  1UZW A;  3DYM A;  1WMD A;  1YEW A;  2IXH A;  2PAM A;  2VBB A;  4XFF A;  4CP0 A;  3PUH A;  1OI6 A;  4G4F A;  5C8C A;  1RC6 A;  1SEF A;  5FZ0 A;  5I8T A;  5LK7 B;  4KGQ A;  5GZE A;  3AM2 A;  3HBK A;  2JIC A;  3T4V A;  3UET A;  1QJE A;  3WHU A;  1QJX 3;  1TG7 A;  3PIG A;  3LDK A;  3OEA A;  2WWU A;  1KQR A;  4W8J A;  4LJH A;  1ULC A;  2FMD A;  2VY0 A;  3BN6 A;  3HD8 B;  1GMM A;  2HWD 1;  1US3 A;  2RM2 1;  3IDE A;  1UY3 A;  3NST A;  4XIO A;  4MGY E;  3FLP A;  5FMO S;  3W21 A;  3ZXF A;  1FOD 2;  4QB6 A;  1ULD A;  1GZW B;  5ACA 3;  5F5C A;  1T6G C;  4JC1 A;  4OUL A;  2E9Q A;  3BB6 A;  4BB3 A;  4UBG A;  2B42 B;  5BYN A;  3SCH A;  1UWW A;  5C4W B;  2LRP A;  4B7E A;  1VAV A;  3VB9 A;  3AKT A;  3HVD A;  3RFR A;  2EA7 A;  2KXL A;  4GXL A;  1GBG A;  5DDJ 1;  4YVW B;  4YW6 A;  4XBQ A;  1XNK A;  4GWJ A;  3BCW A;  5ERL A;  2DTY A;  4GJZ A;  1S0C A;  1K5M B;  4FT8 A;  4NII A;  2K2S A;  2A3W A;  4ISQ A;  3RPQ A;  2FDG A;  2VMF A;  2ZAC A;  3POW A;  5JSP A;  1Y9M A;  4MOA A;  2R06 1;  4OI1 A;  1JYX A;  2ZX4 A;  3WOG A;  1O4T A;  1UKR A;  1UOJ A;  5FLH A;  2JB4 A;  2WNE A;  1HQL A;  1JU3 A;  4SBV A;  3GZT B;  3ZIX A;  1ENS A;  2J42 A;  3ZYR A;  1ZYB A;  2GC1 A;  1ZZ8 A;  1ALY A;  5F3E A;  5F37 A;  5A6Z A;  1ZA4 A;  1LU2 A;  1COV 2;  1LRH A;  4HK8 A;  5EQU A;  2H6C A;  5IAV A;  3OPT A;  2IXL A;  4IET A;  4A3X A;  4ZKT B;  5CFC A;  4QGN A;  1OQE A;  3I2K A;  4H7M A;  5JI7 A;  3DCQ A;  3LEM A;  5CVR A;  2NMO A;  5F5A A;  4HK9 A;  2D5H A;  5F6K A;  3BKZ A;  3J7M A;  2Y6G A;  2H0V A;  2DDU A;  3ECQ A;  5F5I A;  2W1U A;  4BHP A;  4BQ3 A;  3ACF A;  2BEO A;  4WZC A;  2HWB 1;  4BZ4 A;  2D6K A;  1S0F A;  1CIW A;  4Q0Q A;  5FPL A;  3VBF B;  1MR5 A;  1XNB A;  3GBG A;  3I59 A;  1H0B A;  5KHH A;  2A73 B;  2X10 A;  1Q3E A;  4L11 A;  2V73 A;  2WN3 A;  2ZHL A;  3THP A;  3VKM A;  3IMN A;  1YFW A;  1WKY A;  1XNA A;  2W08 A;  4AAP A;  1QOO A;  2VMG A;  5I0T A;  1OLR A;  2DFB A;  2RS3 2;  4QD2 A;  3A23 A;  3GNE A;  3UJQ A;  3ZSE A;  5AFB A;  4BWO A;  5BUV A;  3H50 A;  4QT6 A;  3WNK A;  5H9R A;  1NE6 A;  4LBM A;  4XUP A;  1HX6 A;  1MS1 A;  1W9F A;  5CZK A;  4QWN A;  1DGW A;  1WLW A;  2YGM A;  2X5I C;  3ETQ A;  3POB A;  3Q8B A;  2BOI A;  3AB0 A;  5AVP A;  4CUB A;  3I54 A;  4AEM A;  4GJY A;  3TYJ A;  2VU9 A;  2YC2 A;  2W9X A;  2VMH A;  1NCQ A;  1DLL A;  1PM4 A;  2XL9 A;  3H0O A;  1T6B X;  1RGS A;  4BA6 A;  4EQV A;  4XF4 A;  2WZE A;  3V0A B;  1NE4 A;  3U37 A;  3WP6 A;  1B35 A;  3H42 B;  4W65 A;  2C1F A;  1KDM A;  1O8P A;  2W52 A;  3ALQ A;  1O4Y A;  1SQ4 A;  3OOX A;  4QXH A;  3T0B A;  5JPM B;  2V4V A;  1S2B A;  1RUI 2;  2ZEW A;  1VBE 2;  2JEC A;  3FN9 A;  1MS8 A;  3K46 A;  5C3Q A;  4E4H A;  5BY5 A;  2VE1 A;  2DCT A;  4Q8K A;  2CWM A;  2BNN A;  4I01 A;  3ZYP A;  2VH9 A;  1K42 A;  4HPK B;  3KSC A;  5I0R A;  2WFF 2;  5EYY A;  3T30 A;  1K5J A;  5D8A B;  4N90 A;  3HQX A;  4UW5 A;  3VZK A;  1NLR A;  1AYM 3;  1QU0 A;  3TWI A;  2NN8 A;  4B7K A;  4YM3 A;  2JG9 A;  1NKG A;  1RUF 1;  2RMU 2;  2ZHM A;  4NHX A;  1VBB 3;  4PLO A;  2AEN A;  4I2O A;  5FO8 B;  4IV3 C;  5F2W A;  1PO1 2;  2CGP A;  3WF1 A;  5ABJ C;  3RYP A;  2O8Q A;  3MW4 A;  1V00 A;  5FP7 A;  5CA6 A;  1UXZ A;  1U5I A;  2VZ1 A;  1UW8 A;  2GMP A;  2XDV A;  3OTF A;  3O1O A;  2VZU A;  4EV0 A;  1QGL A;  1ND2 C;  2P2K A;  1MAC A;  2W3J A;  2VCA A;  4WM8 C;  5K0U C;  3AZZ A;  1NY7 2;  3V0B A;  1AR6 1;  3PMS A;  3O1V A;  4QPI B;  4LMF A;  1ZRD A;  4IEZ A;  3FFZ A;  4FP3 A;  1M4W A;  4ZHN A;  4YGD A;  2MEV 1;  5C5U A;  1H1A A;  2PN5 A;  5JLV A;  4RQP C;  3KF3 A;  3NNJ A;  1YQ5 A;  5JI9 A;  1IZ3 A;  3A4U A;  1R1A 3;  3O0X A;  4WZF A;  5FZM A;  4XW3 A;  5ANN A;  3VDB A;  2VOX A;  3OUH A;  1OH4 A;  2XJR A;  4DUX A;  1BCX A;  3JD7 2;  1S0E A;  3LSE A;  5IUQ A;  1DYO A;  2RS5 2;  4HOO A;  4CCO A;  2XWJ B;  1D4M 2;  1H6Y A;  2HWC 1;  4FOY A;  1MVE A;  4XUQ A;  4BCU A;  4XF1 A;  1O91 A;  1UAI A;  1GV9 A;  1ZZ6 A;  3CNA A;  3WW1 A;  2PXJ A;  1AX2 A;  5DUW A;  3RWN A;  1QJX 2;  3E5X A;  2HWE 1;  3ZO0 B;  1W6N B;  3FUO A;  1U0A A;  1G6N A;  1GP4 A;  3HJR A;  2OA2 A;  1FAT A;  1HRI 1;  3ZFG B;  4CDQ C;  2Y60 A;  3KQ4 B;  1G8W A;  3C7E A;  1NZI A;  1AR7 1;  4FPO B;  4WBB A;  1UQX A;  4GH4 B;  3ZSL A;  3ZDS A;  1LAJ A;  5G04 L;  2JE9 A;  4C8D A;  2OQ6 A;  4CU8 A;  1RUJ 3;  3JBG 1;  2WT0 A;  3NV2 A;  2FHR A;  1S2K A;  3LFM A;  4GD4 A;  1V9U 1;  2R07 1;  5CKM A;  5F6L B;  4BQ1 A;  5BNO C;  2FDI A;  2WNV C;  3MW3 A;  2Y6H A;  4QHB A;  3AK0 A;  3NMB A;  5C4W C;  2ZOE B;  4XFA A;  2DUR A;  4I3P A;  3MID A;  4KGG A;  5FBJ A;  4Y20 B;  5FY1 A;  3SH5 A;  3POS A;  1OT5 A;  1XSQ A;  3IPV B;  1U5X A;  3H8X A;  2TBV A;  4YVW C;  4YW4 A;  4URA A;  4HKL A;  5IT6 A;  1URX A;  5JXG A;  2WLQ A;  3BIE A;  2N7G A;  1AR8 3;  2WA4 A;  3JQX A;  3K4D A;  5CG9 A;  1VAM A;  5K4L A;  5C70 A;  4B8E A;  4K40 A;  4CU9 A;  1SLL A;  1BBT 3;  4NIA A;  2Y0O A;  1Q8S A;  3VKL A;  1YQC A;  4LK7 A;  1MVQ A;  2Y38 A;  5I0D A;  1SLC A;  2XWB B;  1GQG A;  1YI9 A;  1OSG A;  2C9K A;  1OC1 A;  1W9W A;  3ME2 A;  5FMO L;  2RDR A;  1QNW A;  2YBK A;  1IGO A;  1WA6 X;  2P6H A;  2GC3 A;  1R09 3;  1E5S A;  1NYW A;  1AL2 1;  2VNG A;  1G9F A;  1RUD 2;  5A7P A;  1RUG 2;  3VZM A;  2QE3 A;  4JV4 A;  2YFU A;  3CEW A;  2VUA A;  4UFI A;  3GYD A;  1AX1 A;  1SDW A;  1RUN A;  4AW7 A;  3P5B A;  4COW A;  5DUU A;  1W6O B;  1SLI A;  1W6Q B;  3MI8 A;  4DZG A;  2WAB A;  2VVF A;  3HBZ A;  2CWS A;  1ENX A;  1LEM A;  1TMF 1;  3WD5 A;  4OUM A;  1SAC A;  2GH8 A;  3B9I A;  3LPF A;  4QX7 A;  2Y6K A;  2XBO 3;  1HKD A;  1X33 A;  1AR9 1;  2HLE A;  5T5O A;  2G9G A;  1TNF A;  4PIY A;  3AJY A;  1F5J A;  3NKT A;  2VMD A;  3KLS A;  1RUH 3;  2X8K A;  4PBO A;  4CEW A;  1DHK B;  1SBF A;  2Z4F A;  4OFG A;  2BTV C;  3VHN A;  4EE2 A;  3KHC A;  3J7L A;  1ND3 B;  1W2U A;  4CP9 A;  3GCX A;  4FFF A;  1E5I A;  2VQ0 A;  2P34 A;  1JOB A;  2GNT A;  2Y0I A;  1BMV 2;  1TE1 B;  2WJS A;  4MGK E;  3LIG A;  1RIR A;  1ZZB A;  2K0G A;  2VCC A;  1VMF A;  4AFC A;  4DXZ A;  2RDN A;  5IVC A;  4JQT A;  4N53 C;  2J7M A;  1AXZ A;  2UU8 A;  1HN1 A;  2D6N A;  2R0H A;  3K75 B;  3NRU A;  4RHV 1;  1VBA 2;  2X09 A;  1OPO A;  3PUS A;  2HWD 3;  2E63 A;  3DEC A;  4QHO A;  3D3A A;  2RM2 3;  3H7J A;  4IV3 A;  5ANQ A;  2WT2 A;  3HN3 A;  1Y3T A;  3WP3 A;  4BQ5 A;  3O1R A;  4CSW A;  1FV2 A;  4P9J A;  5DZF A;  2PLV 1;  4GIQ A;  5D21 A;  4FQZ A;  4L9B A;  2YZ4 A;  2PHL A;  4ZS2 A;  4DRR A;  3KS7 A;  1W8U A;  1ND2 A;  3H1M A;  1GNH A;  2W95 A;  5E1R A;  5DDJ 3;  3VDC A;  1JS9 A;  2PHW A;  1QJY 2;  2P3Y A;  2VL4 A;  4WM8 A;  2X53 S;  5K0U A;  3OJB A;  2ZKN A;  4E4D X;  2WRA A;  1HRV 1;  2PQS A;  2VZP A;  3I4I A;  1C5I A;  1AYM 2;  2YC4 A;  4JGZ C;  3U07 A;  3ZSJ A;  3POI A;  1BK1 A;  1IQD C;  4A7Z A;  4RQP A;  1VLN A;  3VHO A;  2R06 3;  2O0O A;  2VQU A;  4AHX A;  5BNP C;  2GP5 A;  2VTF A;  1HQN A;  1W2N A;  2JDH A;  3GHN A;  4LLF A;  4E9K A;  4CPB D;  1CX1 A;  1JTZ X;  2C5D A;  2VR4 A;  4UFJ A;  5FPA A;  4UWD A;  4RD7 A;  5FYY A;  5CKN A;  1VRH 1;  3VBO B;  3AC0 A;  1TME 2;  3IDB B;  2KR2 A;  3O1U A;  2WSU A;  3LEI A;  4E2S A;  3U0Z A;  1CQ9 A;  1ZA7 A;  3A0N A;  3BOP A;  4NRM A;  4S2H A;  4YRD A;  1UU6 A;  4Q0P A;  3RNS A;  2BUK A;  3VHP A;  3EB7 A;  2IXI A;  2ID4 A;  5J36 A;  5DXD A;  1KJL A;  3III A;  1GOH A;  2RVA A;  3AYA A;  3KV6 A;  4CDQ A;  4KQ7 A;  4CEY C;  2I2S A;  4QPI C;  4MHU A;  3SCG A;  4A4A A;  2XR4 A;  2HWB 3;  3BI3 A;  4Q8L A;  4HSL A;  1OA4 A;  1GZW A;  4ARX A;  1WCS A;  5BNO A;  1XOY A;  3FE5 A;  1YO8 A;  2WNV A;  3I2H A;  2WYS A;  4H2A A;  1GP5 A;  4UW4 A;  4DXT A;  1GQP A;  1NX9 A;  5A6Y A;  5FYH A;  1W9S A;  4E27 A;  4Y22 B;  4C1X A;  1GZC A;  5FKB A;  3WG3 A;  4XET A;  2CDP A;  3PIJ A;  4Z2W A;  4YVW A;  2A6Y A;  2UY8 A;  2W2I A;  1G86 A;  4FPC A;  4H7L A;  1KEX A;  5FP4 A;  1F8V A;  1K3I A;  1QQP 2;  2ZX3 A;  5E88 A;  4KH9 A;  3AZW A;  1APN A;  2AR6 A;  5EIY B;  1NZC A;  4KI5 M;  4LHK A;  5FZG A;  3VD5 A;  4AI3 A;  3TEW A;  1AYN 2;  2PHU A;  4HXC A;  3ZFG C;  3NV4 A;  1ODN A;  4JGY A;  3U78 A;  5DZG A;  4MSV A;  1NUK A;  1R08 1;  5F8P A;  5LWB A;  1GNZ A;  5FQ0 B;  1GWM A;  1ZNP A;  1RHI 1;  2J1E A;  1V70 A;  3ZFE B;  2RDQ A;  2WN2 A;  3NV1 A;  4XTP A;  5T5L A;  2XUE A;  3VBS B;  1OUR A;  1PIV 1;  2ZGP A;  3AZX A;  4HT1 T;  1YIF A;  3SIS A;  2P37 A;  5FYU A;  3T1M A;  1CX4 A;  2GNM A;  5FPZ A;  3RZH A;  4RR3 B;  1D2S A;  2DU1 A;  2YDE A;  5IVV A;  2XVL A;  2OXB A;  1IS6 A;  4JDM A;  2A70 A;  1UY0 A;  4M3C E;  1H6X A;  2ARB A;  4NWW A;  3TNQ A;  3MPB A;  1BBT 2;  2ATF A;  1GWL A;  4PT6 A;  3WVJ A;  5JZG C;  1WCU A;  1GZ9 A;  1VBD 1;  2GAU A;  1V6I A;  2R0F A;  1MEC 2;  3HT2 A;  4HLT A;  4XTM A;  4BPZ A;  2VME A;  3JB8 A;  3VHR A;  5KHG A;  2Q4S A;  2XQX A;  3N9O A;  3HN1 A;  1RUF 3;  3S57 A;  4XC9 A;  5LA0 A;  2JIG A;  3ZFF C;  1IS3 A;  2RJL A;  4G9S B;  3T1L A;  1PVC 2;  1SLA A;  4AG4 A;  2E53 A;  2KA3 A;  2ZGK A;  3J26 N;  4QU1 A;  3KGZ A;  4AEK A;  4CRQ A;  5J96 B;  3LDB A;  3MIH A;  2BPA 2;  1VB4 A;  4PF5 A;  4AGR A;  3N35 A;  1FAY A;  3LPG A;  2AH2 A;  3NJX A;  4W6X A;  5IWF A;  1LCL A;  4OZX A;  3WQ7 A;  5IK4 A;  4HKO A;  2PHX A;  4FPH A;  3OUI A;  4UFM A;  3E6D A;  3TOJ A;  4MXW B;  1AZD A;  4ISR A;  3SMH A;  2WNU C;  4I09 A;  4AI9 A;  4N53 A;  3UKT A;  5K9Y A;  2W91 A;  1AR6 3;  3RYR A;  1HV1 A;  2XBO 2;  2VMC A;  1HXS 1;  5FRA A;  4WVM B;  1FNZ A;  5FV3 A;  2MEV 3;  3PHM A;  1PO2 1;  1VMJ A;  4ET7 A;  5DMY A;  2D3P A;  4U36 A;  3U4S A;  4BME A;  5LA1 A;  3KT4 A;  4AHZ A;  3K48 A;  2X29 A;  4WVW A;  1DG6 A;  1X8E A;  3RVH A;  3H8R A;  4LKE A;  4QDS A;  2VXR A;  5B4X A;  4OLL A;  1FYU A;  1JMU B;  4MXV A;  3DF0 A;  4AI0 A;  4FTB A;  1Y9Q A;  2HWC 3;  2BGO A;  1RMU 1;  2QZ3 A;  2JDY A;  1YFU A;  5FOB B;  1V6L A;  3QH7 A;  4QQL A;  1GWK A;  2HWE 3;  4JGZ A;  5CB7 A;  4Q4V 2;  4NMI A;  4OHY A;  1DZT A;  4IE5 A;  2FD8 A;  5H9Q A;  3VBU C;  1HRI 3;  5KR7 A;  1CAU B;  3T2P A;  4AVA A;  5CU1 A;  5BNP A;  1AR7 3;  4XZU G;  4UAP A;  1LOF C;  4KBZ A;  1YXW A;  1ONA A;  3JBG 3;  3GZA A;  3OYW B;  2OPK A;  2QUO A;  3VDD B;  1CN1 A;  1WME A;  1V9U 3;  2BER A;  2R07 3;  3TRS B;  5FY4 A;  1OXC A;  3TBD A;  3M2M A;  4XFI A;  5GLW A;  5CAZ A;  4FPF A;  4QPG A;  4B4Q A;  4HVO A;  3P3P A;  2MNG A;  1IPS A;  3I8T A;  5LY2 A;  1VB2 A;  1LKN A;  4M0N A;  4Q4W 1;  1UN1 A;  3VBR B;  2J1A A;  4HKW A;  3PVO A;  4TN7 A;  1EV1 2;  5JOY A;  2BWC A;  1DYK A;  4JKK A;  2CL2 A;  4CEY A;  2ZML A;  2XVG A;  3F95 A;  3ZN4 A;  1C3H A;  3VKF C;  2XOM A;  2Y8K A;  3WF0 A;  4DOU A;  2IXC A;  2WO1 A;  4XVH A;  1MS3 A;  4YM1 A;  1CAW B;  4RS5 C;  3AVR A;  3KT1 A;  1C1L A;  4P9G A;  3AJZ A;  3RZJ A;  1FPN 1;  3I2D A;  3HQR A;  4GA9 A;  1RXF A;  2WZR 2;  2WII B;  2WS9 1;  1MQT B;  3USU B;  4LHN A;  2J1T A;  1BEV 2;  3VBO C;  1XSR A;  2JDP A;  2FZ1 A;  3MBW A;  4OYU A;  4Q4Y 2;  4HAN A;  4QX3 A;  4IW3 A;  4FPL A;  3IZO A;  1UXX X;  4Q0V A;  5LCW L;  4AOC A;  1AL2 3;  1LEN A;  5EJ1 B;  4D69 A;  4N8M A;  4FAH A;  1H8V A;  5IK5 A;  4M3C A;  4AAX A;  4YYO A;  5T52 A;  2XJS A;  4QX8 A;  3ZFG A;  4LOR A;  3VD3 A;  2HWF 1;  4FPY A;  3E5Q A;  3AVS A;  5A3O A;  1UZ0 A;  3T3Y A;  2Q1M A;  1TMF 3;  3ZXL A;  3GCW A;  4AE2 A;  2JD9 A;  3T08 A;  1BVV A;  2BBA A;  2GH2 A;  3CHX A;  4NR1 A;  4ZZ5 A;  1JZ2 A;  3NJY A;  3A7Q A;  4LBQ B;  5LAT A;  1JYV A;  1AR9 3;  4CDU C;  4JZR A;  1OPM A;  2XL7 A;  3CDZ B;  4QB2 A;  2BBV A;  1BQP A;  4MVT A;  1W05 A;  2W1W A;  3NNL A;  2WBK A;  4XDQ A;  1GKB A;  2WO2 A;  2XUM A;  2NPI A;  3T0D A;  1L7R A;  4FVV A;  4NHY A;  1MS5 A;  1QXR A;  2GAL A;  2JWP A;  3B7M A;  5A7Q A;  4DXR A;  5A70 A;  5DG1 A;  1YQ8 A;  3AP6 A;  2CU5 A;  3S7E A;  1GUI A;  3DYP A;  4AFD A;  4PLN A;  1YJK A;  3DL3 A;  4CP1 A;  5C5T A;  1MS4 A;  4MV2 A;  5JZG A;  1QJU 1;  1ZBE 1;  4QKF A;  5T5J A;  1H2K A;  1JZ3 A;  2UWA A;  4PI2 A;  2D93 A;  4W6Y A;  1RB8 G;  5IAT A;  3JQW A;  2CAU A;  1FMD 1;  1SG3 A;  4HMZ A;  3POE A;  4KU8 A;  4RGA A;  1JYW A;  4RHV 3;  1A6C A;  1N3O A;  3Q8C A;  5FO7 B;  3WCR A;  4IEX A;  4H14 A;  4N43 A;  3SH4 A;  3ZFF A;  4UI9 L;  1RUE 1;  4OMD A;  5AFE A;  3G7D A;  1J1L A;  4AED C;  4DEQ A;  1ZRC A;  2XPJ A;  1POV 1;  2RDS A;  4O61 A;  2GC2 A;  4GB3 3;  1A8M A;  4JX0 A;  3VBS C;  2PLV 3;  2P5B A;  4QXK A;  5AVA A;  4FO9 A;  3ACL A;  2UYA A;  4KWJ A;  4BLI A;  4BXF A;  2JKB A;  1Q8V A;  2WNU A;  2FCU A;  3R4D B;  4R8H A;  2X05 A;  1JH5 A;  3O1M A;  1R64 A;  1UL9 A;  4NPR A;  3C3V A;  4XAE A;  3HNY M;  4A7K A;  2DVA A;  5F3G A;  2RE9 A;  3C7H A;  1UX6 A;  3LAG A;  4MO3 M;  4AXO A;  1HRV 3;  3RGB A;  2A3X A;  2BRT A;  1Z7S 1;  2VCM A;  4FAG A;  3PU3 A;  1V6N A;  5CKQ A;  2ERF A;  3D0S A;  4FOQ A;  4KG8 A;  2H6B A;  4PDW C;  1ZRE A;  5IVY A;  4UYB A;  4NE9 A;  1N1S A;  3J9S A;  5D2A A;  3UKN A;  1QHD A;  1VRH 3;  1O3Q A;  3ZN6 A;  4E8C A;  1LOD A;  4UFL A;  4XBL A;  2VUL A;  1PZ9 A;  3ACG A;  4RA0 A;  2Q1Z B;  4Q1P A;  2RR1 2;  4BH9 A;  4MET A;  3OGG A;  1H8T C;  5CNA A;  4A3Z A;  2P6C A;  4JKM A;  3M3O A;  4U2A A;  2ZXQ A;  3VBU A;  4ZON A;  2D3R A;  2VBP A;  3ZR5 A;  1LOF A;  4XJ9 A;  3B69 A;  1NA1 B;  1HB2 A;  1TZO A;  5FZB A;  2MEV 2;  3NQH A;  2ZMN A;  2PHR A;  1QOS A;  2VTX J;  2R16 A;  4QU2 A;  1M06 G;  2EIE A;  4XJW A;  4Q1R A;  4HN0 A;  4YM0 A;  3H9A A;  5FZL A;  2VW1 A;  2XQR A;  3WNP A;  4EWE A;  2QQO A;  5FYI A;  2YPJ A;  3VD9 A;  1S4C A;  4GMP 3;  3MIF A;  4YFW A;  2QQN A;  3KVA A;  1PZ8 A;  4UOJ A;  2JIJ A;  4AQT A;  2VOK A;  2DUO A;  3IKW A;  2HWE 2;  3WF2 A;  2R04 2;  1BXH A;  1HW5 A;  2JDK A;  5L9R A;  4IE4 A;  3D4K A;  4RS5 A;  4XUT A;  2B45 X;  4PJY A;  2VEC A;  4YM2 A;  5AC9 1;  1L7L A;  4H55 A;  3BOD A;  2BFU S;  1DLC A;  2DBI A;  4YW1 A;  3WEZ A;  3MLL A;  5HCB A;  1R08 3;  5JAX A;  3JBG 2;  3U4X A;  5C3S A;  5G05 L;  4TLG A;  3WR0 A;  3ZXE A;  4LKS A;  3VDD C;  4FP2 A;  4DNY A;  4DS0 A;  1DBN A;  3WX5 A;  1IKQ A;  5E16 A;  4YW3 A;  3FC0 A;  1RHI 3;  5FZO A;  1XNT A;  1D4V B;  1R1Z A;  1CJD A;  1ASJ 2;  4O7X A;  1C8M 2;  3ORJ A;  3R4U A;  4UW3 A;  3M3Q A;  1PIV 3;  4CCK A;  5FUP A;  1JOD A;  1UY4 A;  1RJ8 A;  3N9P A;  2V5D A;  4Q4X 1;  3VBR C;  3WP5 A;  3WP4 A;  4K8R B;  1UO9 A;  3RS6 A;  5L7O C;  3LE0 A;  3PUA A;  4IEO A;  2Q1F A;  1PK6 A;  2PAK A;  2YHJ A;  3HIF A;  3ZYJ B;  4MUV A;  1ULE A;  3WNM A;  4IEP A;  4I30 A;  5BPX A;  1I6X A;  1VBD 3;  2JG8 B;  3WHT A;  4AHW A;  2ADD A;  3AKS A;  4CDU A;  4LE4 A;  1Y9G A;  3WW4 A;  5LW9 A;  2LUW A;  2Q8E A;  3RG0 A;  3SKV A;  1W6M A;  1V6O A;  2ZZQ A;  3VKO A;  4M0H A;  4EN7 B;  4TZD A;  4FQ4 A;  2F4L A;  3THC A;  3ZXD A;  1N1V A;  1NCR B;  1TVG A;  2DCZ A;  4YZ1 A;  3N7J A;  5HV0 A;  3KCC A;  4IV1 A;  1HDK A;  4YAR A;  1JI6 A;  3VBH B;  5FZE A;  3QBQ A;  5FY9 A;  5A3N A;  1W39 A;  3WQ1 A;  3TEY A;  4XIL A;  5BV6 A;  1RUC 2;  1X50 A;  1AL0 G;  1UY1 A;  5KBF A;  1GFF 2;  2D6P A;  1RIN A;  4QKB A;  3A22 A;  3UV9 A;  1IPJ A;  1SPP B;  3IBM A;  3U1X A;  3N3H A;  2BVB A;  1OQD A;  3H3Z A;  3O14 A;  4BU2 A;  3S30 A;  4I0A A;  4DRV A;  5C9A B;  2Y6F A;  3ILN A;  4FTE A;  1S0J A;  5A32 B;  4C0B A;  2DYC A;  4NRP A;  5CYY A;  2VPV A;  2GN3 A;  3J8F 1;  3AYD A;  1HXS 3;  1VRB A;  1HJF A;  2XON A;  3GF6 A;  2CY6 A;  4FPK A;  4LIV A;  1PMH X;  1WBL A;  2ET1 A;  3NKG A;  4AED A;  4B3N A;  3PJQ A;  4GAL A;  1PO2 3;  1W8N A;  3JB4 C;  4QB1 A;  2UWB A;  2VZO A;  2PMW B;  4IEQ A;  3THT A;  4MGI E;  5CFD A;  5LB6 A;  2WWS A;  3HMY A;  2NMN A;  1OVS A;  2B5H A;  3PVN A;  4AGG A;  4CDX A;  3IDA A;  3SIT A;  3Q9O A;  5EJ3 A;  2BJS A;  5FJK A;  2XH6 A;  1GYK A;  5KXB A;  1QXP A;  1RMU 3;  1VBC 1;  3AFK A;  3MV1 1;  3AMP A;  3IIA A;  4HBN A;  4K9S A;  1JW6 A;  4HON A;  1VJ2 A;  3NJV A;  2R1D A;  5FK7 A;  2BQP A;  5FY7 A;  1W8F A;  5JMC A;  3L2Y A;  3DPR B;  4QQH A;  2B9U A;  4P9I A;  3WDU A;  3NAP B;  3B00 A;  4COV A;  3VUO A;  2XVK A;  4KWL A;  3BGA A;  3PDQ A;  4DEV A;  4FCA A;  2BNO A;  3CQO A;  1ZBA 2;  3LD8 A;  4IXL A;  1PZ7 A;  4PDW A;  5LA2 A;  5HCH A;  5FPV A;  4E4Z A;  4ERO A;  2D7F A;  4YGE A;  3V65 A;  2QQM A;  1DQ0 A;  3LA2 A;  5BNN C;  3MIC A;  1SBD A;  2RJ2 A;  4JQR A;  4OUS A;  4OHZ A;  1JZ4 A;  4GB3 2;  4XJA A;  5EPA A;  4AHY A;  1KDK A;  1GOG A;  3TN9 1;  3H3U A;  5I8S A;  4XQD A;  2HEV F;  2WZP P;  3AP7 A;  1W04 A;  1H8T A;  1AXY A;  4JKL A;  4RFT 0;  5C6C A;  4Q4W 3;  4FFH A;  4A41 A;  1H4H A;  1VAL A;  3MHZ A;  4M00 A;  1J3P A;  2WQ8 A;  3AP4 A;  4CCN A;  2OQ7 A;  3OGS A;  3PU8 A;  1KD7 A;  4YG0 A;  1O3S A;  5KHK A;  4FXG B;  4P14 A;  3OG2 A;  5EXO A;  2CV6 A;  3B94 A;  3IT8 A;  4L92 A;  4YVS B;  5A7W B;  4BE3 A;  4WVM A;  5DG2 A;  5FZ3 A;  1NT0 A;  2YU2 A;  3AMM A;  1EAH 2;  3OGR A;  1CAX A;  1O59 A;  3ZYG A;  4Z1V A;  1XE7 A;  4R9D A;  2GZW A;  1WZX A;  4Z2A A;  4P9X A;  1NLQ A;  5L9V A;  1RVF 1;  2VNO A;  3DGT A;  3D6E A;  2Q30 A;  4QPY A;  1LHO A;  5GLT A;  3E1F 1;  2WS9 3;  4LBO A;  1W06 A;  4D6R A;  2CDO A;  2HBT A;  1L3J A;  4DB5 A;  4TLF A;  1DU3 D;  5JOW A;  1ZZC A;  5A33 B;  3W5N A;  1Q8P A;  2F17 A;  2W1S A;  3H8O A;  1XNC A;  3URF A;  1LB2 A;  2MPF A;  4BOW A;  5HPO A;  1S0G A;  1LHN A;  2G1M A;  3OEB A;  4S2F A;  5F3C A;  4COZ A;  3ZYF A;  1JOP A;  1KIT A;  4A45 A;  3L2H A;  2VNR A;  1FOD 1;  1RIT A;  2JDA A;  2HWF 3;  5HI0 A;  3I49 A;  1W6P B;  4ZZ8 A;  1YWK A;  4UF0 A;  1CPM A;  1EYB A;  1Q8Q A;  2AEZ A;  3CJI B;  3ZYB A;  2V72 A;  4QKD A;  5ACA 2;  2D5F A;  3GZU C;  4PQ9 A;  4EN0 A;  5DAP A;  2AC1 A;  1C4R A;  5FJH A;  5GAL A;  4KWU A;  2IVI B;  5FCC A;  2LS6 A;  3W5M A;  3ZXA C;  4QHZ A;  2A7A A;  2VQA A;  4CU7 A;  4Z07 A;  5F39 A;  3VBR A;  3WY6 A;  4NOT A;  1AXK A;  4ITC A;  3TNP B;  1GIC A;  3U14 A;  1REE A;  3P6B A;  2ZAB A;  2ZGS A;  4JDO A;  2VJX A;  4GWM A;  5L7O A;  1F35 A;  2OZJ A;  4ZXE A;  2ORX A;  5E8A A;  1J84 A;  1K5M C;  4I0W B;  4PIZ A;  1OOP B;  3UT0 A;  1UNB A;  1ZBE 3;  2YXS A;  2E31 A;  4NAM A;  3C7F A;  4Y3O A;  3AL6 A;  1WBF A;  5EWS A;  3BU0 A;  1FMD 3;  3NVC A;  1COV 1;  4ASL A;  3EYP A;  3BUC A;  5DZE A;  2JB8 A;  2XHK A;  4KU7 A;  1DFQ A;  3CZJ A;  3E6B A;  3ROU A;  1RUE 3;  2VW0 A;  2GSY A;  2QDR A;  4QQ2 A;  5A7N A;  2E26 A;  1Z78 A;  2CSG A;  3WQB A;  4L97 A;  1EY2 A;  3VZN A;  3A0K A;  1POV 3;  4P08 A;  3B01 A;  5HXV A;  4FOV A;  2X5I A;  5A3U A;  4K8F A;  2E7A A;  3JU9 A;  2JKX A;  4YZ2 A;  4BQ2 A;  4QQP A;  4CDW B;  2W47 A;  2BW8 A;  2QJV A;  4DO0 A;  1YJL A;  3HEI A;  1OBN A;  3S5Q A;  1XQN A;  1UZY A;  3DEM A;  4YGC A;  3VBF C;  4HZF A;  4DUV A;  4PF1 A;  4XCA A;  3WW2 A;  4XAB A;  2RS3 1;  3WDV A;  1STM A;  3OSD A;  1NOV A;  2VOT A;  3U11 A;  3GBW A;  3WV6 A;  1OKO A;  4XF0 A;  3C7G A;  5HCF A;  5FWE A;  2VM9 A;  1DQ6 A;  1KS5 A;  2D6O X;  3CZU A;  4IEW A;  4NJ4 A;  4YZ3 A;  3CMG A;  4A7Y A;  4BMB A;  1NCR C;  3M8L A;  4D94 A;  4YFZ A;  3T0A A;  5FYT A;  3I2O A;  2HKX A;  4R4X A;  4NPM A;  1PGL 2;  2ZHK A;  2DTW A;  3Q8E A;  1CD3 G;  3FBM A;  2QFE A;  1TEI A;  3OGJ A;  5BNQ A;  5C71 A;  3OF1 A;  3KV5 A;  5A7O A;  3ZXG A;  2ZZJ A;  1W90 A;  5C9A C;  3NL1 A;  4ZU4 A;  5JMO A;  1W8H A;  1CIY A;  4XCB A;  1PNF A;  3MZH A;  3ZPY A;  1S0D A;  3AYE A;  5BNN A;  2O1Q A;  2FDK A;  2IFW A;  5L36 A;  5IK7 A;  1RUI 1;  3M3I A;  1VBE 1;  4N9H A;  2VQT A;  5FYZ A;  4QX0 A;  4LT5 A;  4A6S A;  4EWD A;  1H9P A;  1CZS A;  3H8U A;  5ABJ A;  1LR5 A;  3HPN A;  1IHM A;  2VZT A;  4CUG A;  3O1S A;  4O65 A;  3EJK A;  4MZU A;  2A6W A;  2DWR A;  3WDT A;  4J6G A;  2G19 A;  2W0X A;  5FYS A;  2EXI A;  4O9G A;  2VZV A;  3USS A;  5C8C B;  3KM5 A;  3S7I A;  2PFW A;  1A3K A;  4LR4 A;  2GC0 A;  1OD5 A;  1ZRI A;  4XUO A;  3POG A;  1IS4 A;  2ZGM A;  3PUQ A;  4LA3 A;  5D8A C;  2RMU 1;  2J1V A;  2GND A;  3DPR C;  3VZJ A;  1JYT A;  2E6V A;  3AKQ A;  1X9P A;  3OY8 A;  4V1P A;  3DV8 A;  5GZC A;  5AC9 3;  1GSL A;  5IJR A;  5FXV A;  1VBB 2;  4CP2 A;  5JIU A;  2D3S A;  2PTM A;  1Q5O A;  5FUI A;  4E8D A;  4QAW A;  2VUC A;  2WA3 A;  4GMP 0;  4AVC A;  3FL7 A;  1LHV A;  2J22 A;  2A6Z A;  1LOC A;  1QWR A;  4NIG A;  4FTS A;  3I2J A;  3LEK A;  3R4S A;  4N9I A;  4DY5 A;  2ZEZ A;  1WMX A;  3ASI A;  2DVG A;  2OS2 A;  3CU7 A;  1XC6 A;  4JTO A;  1NY7 1;  2Q5T A;  3MPP G;  4Q4X 3;  4KWK A;  3FLR A;  3Q8F A;  2WFP A;  1I9R A;  1O4Z A;  2NQY A;  5CG8 A;  3GJA A;  2FBE A;  5JDB A;  3C8X A;  1DZR A;  4QKN A;  4DIQ A;  2IXJ A;  5J98 B;  3KWV A;  2VO5 A;  4XQW A;  1UPS A;  1H1M A;  2QBX A;  5TSW A;  2C26 A;  3QOP A;  4KBB A;  4NHL A;  2ZAH A;  3JD7 1;  1D7P M;  1H4G A;  2G9F A;  1LU1 A;  1R1A 2;  2RS5 1;  3ETP A;  2OPW A;  3OBR A;  4Q29 A;  3AFG A;  2R6Q A;  1D4M 1;  5C4W A;  3VL8 A;  5CFC B;  2A75 A;  2ZEY A;  4NPL A;  2W46 A;  2XJQ A;  4Q2F A;  4AI1 A;  3BOW A;  1S0B A;  2FZ2 A;  2VUD A;  1QJX 1;  1XU2 A;  4OCT A;  4V2V A;  5FY0 A;  3ZPO A;  3VKN A;  2AYH A;  4ONU A;  1Y43 B;  3WLU A;  3DUI A;  1K5M A;  4GKY A;  2JXA A;  5FP9 A;  1MZE A;  3SC7 X;  4AI2 A;  2WYF A;  1GQH A;  4LUL A;  2ARC A;  4TYS A;  4AQS A;  5JCT A;  1GU3 A;  1SCR A;  4ATE A;  5APA A;  3I59 B;  3KT7 A;  4ZXK A;  3RZK A;  3N9Q A;  3SEP A;  3K51 A;  4GH4 C;  4QQO A;  1RUJ 2;  3OUJ A;  4Q5O A;  3J8F 3;  3ZXJ A;  4TSV A;  4Y5S A;  1SFY A;  3FZ3 A;  4R4Z A;  4PQQ A;  4D8M A;  4LNV A;  5J1X A;  2MHF A;  3GBF A;  2ILM A;  1QIQ A;  4COU A;  3INA A;  1QKQ A;  3ZKU A;  3FHA A;  4YG6 A;  4M3C F;  3LWC A;  2ZPX A;  3GDB A;  3M3C A;  5GLZ A;  2CAV A;  5JWP A;  5LEJ A;  4XZP A;  1AR8 2;  3HT1 A;  1VIW B;  3H1W A;  1OLQ A;  2C24 A;  5FZD A;  3EO6 A;  1NQJ A;  1VBC 3;  1WW4 A;  3U10 A;  3RZL A;  4GUL A;  4JAA A;  1C5H A;  1NCQ B;  3RSJ A;  2IUW A;  1YCI A;  3VBF A;  4OI0 A;  1OFS A;  4HFS A;  4LE3 A;  4LKF A;  4NN0 A;  1KGY A;  1CAV B;  4NRQ A;  4WVV A;  2B7Y A;  1B35 B;  4CCD A;  1AJK A;  2YPD A;  2PAE A;  4XFG A;  3HR9 A;  5J48 A;  1I3H A;  1XE0 A;  4O9E A;  4DFS A;  4CU6 A;  2QQW A;  2OKX A;  1NCR A;  1RUD 1;  1C57 A;  1RUG 1;  4MYE A;  4NHM A;  4TXW A;  4FPE A;  3L9J T;  1PGW 2;  3WF3 A;  1R09 2;  4BQ4 A;  2WWJ A;  2Q0A A;  4I02 A;  4XAA A;  3SLI A;  4CE8 A;  4D6S A;  5I0U A;  3QAC A;  1DQ4 A;  3I3M A;  1S0I A;  4LO4 B;  3TN9 3;  2Z42 A;  3FHQ A;  1FXZ A;  1YC6 1;  4Q27 A;  4Z8B A;  4B4P A;  1LES A;  4NID A;  2QQJ A;  4YNI A;  1AX0 A;  1WD3 A;  1HJG A;  2G4I A;  1PNG A;  4LBK A;  2OUH A;  4QM9 A;  5KHJ A;  1LJ7 A;  3PNA A;  4Z92 B;  2IWG B;  4XEZ A;  2JG9 B;  4XF9 A;  3V0A A;  5HCA A;  2RHP A;  4ORF A;  1OVP A;  3MLK A;  1BHG A;  2CGO A;  5KXE A;  4K7J A;  3OBZ A;  4JTN A;  3ES1 A;  1SMV A;  1W8T A;  3SQO A;  4FFG A;  1RUH 2;  1RVF 3;  1ZZ9 A;  2VD7 A;  2YRO A;  1BMV 1;  4XHX A;  1ND3 C;  4QXB A;  2Y6J A;  5A6Q A;  1SCS A;  4HPK A;  5LEK A;  3WCS A;  3HWJ A;  2XJV A;  2QQK A;  1JUH A;  2XHN A;  3DKQ A;  1LHU A;  4XAC A;  4QMA A;  3V0B B;  5D8A A;  4C1W A;  2V09 A;  5JOX A;  4LO8 A;  4L8Q A;  1VBA 1;  4DUW A;  2Z69 A;  3AYC A;  4MHR A;  4CCL A;  1W2O A;  4DQA A;  1UKG A;  2W5F A;  1N3P A;  5IVE A;  2XLG A;  3PJY A;  1FOD 3;  3OGV A;  3ZMO A;  2HWD 2;  2DF7 A;  2RM2 2;  1REF A;  4K1Y A;  3ZIW A;  5JR2 A;  1ZRF A;  2LM3 A;  5JUV A;  2NM1 A;  4XMI A;  3ZKY A;  5LRS A;  2XLA A;  5EYX A;  3OD4 A;  2AGS A;  3CJX A;  5J3U A;  5A3T A;  4CCJ A;  1QJY 1;  2Z5W A;  3WSO A;  1D2Q A;  3MUY 1;  1F4H A;  2PQQ A;  5DDJ 2;  4Y26 A;  3IM0 A;  3I3Q A;  4RSU A;  2VBD A;  4ZPI A;  2YMZ A;  3PLQ A;  1OHF A;  4QPI A;  1KFU L;  5FZF A;  4A44 A;  2E7T A;  4WM7 B;  3DN7 A;  5FPU A;  1XB9 A;  3AXD A;  2R06 2;  4JRL A;  3P3N A;  1BK0 A;  2GME A;  1WLD A;  3MO4 A;  1COV 3;  1TME 1;  4AVT A;  1W0O A;  3T2T A;  3ST7 A;  3LEG A;  4XFB A;  2WQZ C;  3EQE A;  4SLI A;  2DCK A;  3O12 A;  3NO8 A;  1XXN A;  1LED A;  1XJA A;  4D0Q A;  3UGH A;  4LPL A;  2WAA A;  2B46 X;  1HLC A;  1QOT A;  4IL7 A;  4DPN A;  1S2E A;  3M70 A;  1OUX A;  2QQU A;  2ZGQ A;  3VV1 A;  4E2G A;  2J1U A;  4D7S A;  1W6N A;  1UMZ A;  1POQ A;  5FP8 A;  1UOF A;  5IVB A;  3BTA A;  5SV8 A;  2ZCW A;  1HN0 A;  1SHW B;  4JDN A;  4GH4 A;  4HET A;  2ZBJ A;  2HWB 2;  1W3V A;  1POV 0;  3FUQ A;  4LKD A;  3KGL A;  2RS1 1;  2ZGL A;  2OZ6 A;  2VVD A;  4BM8 A;  3BTX A;  4IND A;  1XYN A;  2YU1 A;  2RS3 3;  4CUA A;  5CBL A;  3RYK A;  5CFC C;  4RN5 A;  1JXN A;  2EIC A;  1CJP A;  4Y20 A;  1UYP A;  2D40 A;  3TAY A;  3CKH A;  2HH9 A;  5DAV A;  1QQP 1;  3IPV A;  1ENR A;  1RTV A;  1G9B A;  3GM8 A;  4Y1Z A;  3EHK A;  3JCI A;  3NNF A;  1VR3 A;  5LK5 A;  4D3W A;  4F83 A;  5E89 A;  4OMC A;  1AYN 1;  4XUR A;  1U5Y A;  4AQ6 A;  1W28 A;  5FO9 B;  4TTG A;  5LY1 A;  4XDO A;  3K3N A;  4K6B A;  4XXP A;  5CIS A;  1C28 A;  2ZGU A;  1OA2 A;  2IVJ A;  3UKV A;  3O7O A;  5HV4 A;  1DZQ A;  5FYM A;  1OMI A;  2I07 B;  1SDD B;  2IC1 A;  2VUJ A;  2L9L A;  2PHD A;  3UES A;  3J8F 2;  1PMJ X;  2WQ4 A;  4JRA A;  4CEW B;  2QQL A;  3S6P A;  3FWE A;  1RUI 3;  1VBE 3;  5FZ7 A;  3KF5 A;  4B1M A;  3ZFE C;  3ZX7 A;  5F1R A;  2QQP A;  2FCT A;  2HYX A;  3X29 B;  2Q8O A;  2K46 A;  1FNY A;  2BNM A;  1WW6 A;  2DCJ A;  1PX4 A;  3FJS A;  2ET7 A;  5EZW A;  2V4A A;  2XG3 A;  3NJZ A;  3UYJ A;  1W9Y A;  2W94 A;  2C9A A;  2E51 A;  2NZ9 A;  4XF3 A;  5JOZ A;  1VMH A;  1BBT 1;  4RR3 C;  2HEY F;  1W6O A;  2R7E B;  1W6Q A;  5K7P A;  3BTY A;  3DKW A;  1UPI A;  5GZF A;  1KS4 A;  1MEC 1;  1NG0 A;  5GZG A;  5FP3 A;  2EAL A;  2EXK A;  2DVD A;  2RMU 3;  2WAO A;  3I2G A;  5FMB A;  5FLI A;  4QGL A;  1QNY A;  3VZL A;  1I5Z A;  4IV3 B;  4NUB A;  1LNS A;  2OT7 A;  2P3K A;  4P9W A;  3B3Q E;  5B2G B;  5CIR A;  1PVC 1;  2YY1 A;  1RUF 2;  3LZZ A;  4BQX A;  5IVF A;  2DBN A;  3GXU A;  1AJO A;  3SKJ E;  3BIW E;  3ON7 A;  1S55 A;  4YLZ A;  3PUI A;  2SLI A;  1ND3 A;  2ZGR A;  4DY3 A;  1OLM A;  1XE8 A;  4RL7 A;  4AF9 A;  3PME A;  5GKA C;  3SXW A;  1HB3 A;  3C7O A;  1ND2 B;  4LOT A;  1LOE A;  4KNC A;  3ACH A;  1LHW A;  1W0N A;  2JDM A;  4YW5 A;  4AFM A;  2XML A;  3AP9 A;  4WM8 B;  1UYX A;  5K0U B;  5KHI A;  5IYY A;  3Q8A A;  4YPJ A;  2XBO 1;  2SBA A;  4HVQ A;  2BOJ A;  2ARE A;  1AR6 2;  2AEY A;  3NW4 A;  4JHZ A;  4LHS A;  1SFN A;  4NHK A;  4ASM B;  4RQP B;  4ZY9 A;  3VGI A;  5A1A A;  2JG9 C;  4ES8 A;  4V2W A;  3MLJ A;  1UIJ A;  3N4M A;  4J1W A;  2CYF A;  1NXD 1;  2WR9 A;  4X6R B;  4QGM A;  2QDN A;  4OUE A;  4Y1U A;  2JE7 A;  4HG6 B;  3JD7 3;  3VD7 A;  2JEN A;  5A7S A;  2FCV A;  2EXH A;  2RS5 3;  4QM8 A;  3AKR A;  1H1I A;  1D4M 3;  1F9K A;  1JUI A;  4A2U A;  2HJI A;  3APB A;  1GNY A;  3BU7 A;  4UXA A;  3ZN5 A;  2VOV A;  3KZ4 C;  5T54 A;  1YFX A;  2HWC 2;  4IES A;  2YFZ A;  4A6O A;  4AYU A;  2EID A;  1OQ1 A;  3JXS A;  4EN8 B;  1W8W A;  4Y5Z 0;  4Q4V 1;  5FIX A;  5F5Q A;  4XFH A;  4R9A A;  4CDQ B;  4DIN B;  1XPW A;  5J09 A;  1QJF A;  3M1H A;  2GMM A;  4HL0 A;  1BZW A;  2OVU A;  3D8C A;  4ZU7 A;  3KQR A;  1YNA A;  4FPJ A;  1JYI A;  1LGB A;  2XKP A;  1HRI 2;  4FFI A;  4FXK B;  1AR7 2;  5FZ8 A;  3OBT A;  1F5F A;  5BNO B;  5HXM A;  3T4H B;  2JDZ A;  1H2L A;  2WNV B;  4HN1 A;  3PL0 A;  2A1X A;  4BQY A;  4YSF A;  5F7U A;  2A71 A;  4FI9 A;  1V9U 2;  2R07 2;  5LAS A;  3PTY A;  3V64 A;  3VBO A;  3SNM A;  1LOB A;  1UX7 A;  4LLO A;  4LK6 A;  3MFA A;  1UD1 A;  1N47 A;  2LAL A;  3H7Y A;  5EP9 A;  4MGQ A;  3I2F A;  1EV1 1;  3FBY A;  2BGC A;  1LGC A;  3KCY A;  1PX3 A;  5B4N A;  3VZO A;  2EVX A;  2YC0 A;  3I3B A;  2VOW A;  4XPV A;  4EN6 B;  1X8M A;  1H30 A;  3H3L A;  2HYK A;  4IQP A;  4JGY B;  3UNP A;  1CES A;  1OA3 A;  3KMH A;  4WM7 C;  2WLP A;  2WZR 1;  4I0B A;  1KRI A;  2BP6 A;  3LDR A;  4GAZ A;  4XJ8 A;  3RI9 A;  2F6B A;  4UFH A;  1VPH A;  1RL3 A;  2E33 A;  4IE7 A;  1I1E A;  2GNB A;  1BEV 1;  2VZQ A;  4MGS A;  1LUL A;  4L0P A;  5ISL A;  3V56 A;  4Q4Y 1;  3FHI B;  2CNA A;  5A3L A;  1MQT C;  4Y22 A;  2B4K A;  2WDB A;  3UL2 A;  4EWA A;  1YHF A;  3K4Z A;  3HNM A;  1RUD 3;  4QDQ A;  1RUG 3;  5FDB A;  1JZ8 A;  3WNL A;  4YZ5 A;  1MS0 A;  1AL2 2;  1ZZ7 A;  2VNV A;  5FLJ A;  1ZRR A;  1AHS A;  4YGB A;  1F2N A;  2EIG A;  1A34 A;  2PA7 A;  2QQV A;  4P5Y A;  4C0H A;  1JHN A;  1Q8O A;  5LBB A;  4QX1 A;  1J59 A;  2ADE A;  5L19 A;  5C8W A;  1TMF 2;  3ELN A;  3THD A;  3LGR A;  4LBL A;  2WO3 A;  1EPW A;  5FQ0 A;  4N7U A;  1WWY A;  5M0T A;  1TQ5 A;  4IDZ A;  1AR9 2;  4HVR A;  2YV8 A;  1YRZ A;  3CO2 A;  3ZFE A;  3AMH A;  1ST8 A;  4JHT A;  5EV7 A;  4EZ4 A;  5JXH A;  3VBS A;  4NIH A;  2ZJC A;  4ATF A;  4MGZ E;  2ARX A;  4QPW A;  1GR3 A;  3M7A A;  1W8Z A;  2BVV A;  4OI2 A;  3ZYH A;  4LQR A;  2FDF A;  3P1I A;  3POJ A;  3PTR B;  4RGG A;  4RR3 A;  5DUX A;  4BQW A;  4FBF A;  5J7M A;  3S0M A;  3HAG A;  4N53 B;  2YG0 A;  3WUD A;  3F2Z A;  5C3R A;  4S2G A;  1VBA 3;  2D97 A;  1CAV A;  4XBN A;  3IWZ A;  4RHV 2;  5FZ4 A;  1UYZ A;  3VLB B;  4W6W A;  3NV3 A;  3UJO A;  1SLB A;  1FT9 A;  4CEW C;  2LTN A;  4ZS3 A;  5KC5 A;  2C6S A;  1G9D A;  2E7Q A;  5D1I A;  1KXG A;  3AXE A;  5EHD A;  3R6S A;  2UUR A;  4JCK A;  1U5Z A;  1ZVF A;  2PHT A;  2PLV 2;  1W99 A;  1XU1 A;  2XB6 C;  3MF9 A;  5FZH A;  5FXW A;  1V6J A;  5FKC A;  1LEC A;  3AMN A;  5FBZ A;  1HB4 A;  1QJY 3;  3PVE A;  5FY5 A;  3LOI A;  1X82 A;  1C8N A;  3ABZ A;  3VD4 A;  4MXW A;  1QJZ A;  1UMH A;  4GQ7 A;  1S1A A;  4ASK A;  5F2S A;  1BYH A;  4JGZ B;  1GLH A;  2QZ2 A;  3DXT A;  2BGP A;  3I3D A;  2JDU A;  1HRV 2;  4OZO A;  4Z82 A;  3WNO A;  5BNP B;  4FOW A;  3HNB M;  2VXJ A;  1UU5 A;  2ZTN A;  4NO4 A;  3ACI A;  2RV9 A;  2DU0 A;  3K3O A;  1X7N A;  5T55 A;  1C1F A;  4LXL A;  2XKO A;  3KV9 A;  4CTE A;  1FPN 3;  5FXX A;  1TME 3;  5GM0 A;  3ITQ A;  1OH3 A;  4UT5 A;  1VRH 2;  1B09 A;  1QH6 A;  4QPG B;  5LZ6 A;  2RR1 1;  2DUQ A;  1F4A A;  2ZS6 B;  1D0G A;  2W87 A;  1HV0 A;  4GKX A;  2D6M A;  1UYY A;  4URT A;  3RQ0 A;  4TWT A;  4CEY B;  2WKK A;  1XBF A;  4BLJ A;  3I3E A;  4IUG A;  4FSJ A;  1LTE A;  2OII A;  4MG2 A;  4HSJ A;  5FTT C;  2Y26 A;  1DDL A;  4YWA A;  5A1L A;  1CAU A;  4LIU A;  1H2M A;  2JD4 A;  5GLV A;  1NA1 C;  1WW7 A;  2D43 A;  2PYT A;  4XUN A;  3WQ0 A;  4IE6 A;  1WW5 A;  3OYW A;  2WSV A;  3HQU A;  1UOG A;  1CZV A;  1PVX A;  3N7M A;  4QX5 A;  3VDD A;  2RS1 3;  3SEE A;  2Y33 A;  2XXZ A;  1YUD A;  3ATG A;  5DUV A;  4C90 A;  1ZM1 A;  3ILR A;  3BAL A;  3MEP A;  3OPZ A;  5FZA A;  1Y7B A;  2VTX A;  1MPX A;  1JZ5 A;  4H3W A;  4B1L A;  2P3I A;  2ZGO A;  1SLT A;  5LBF A;  4DXS A;  2VZ3 A;  1QQP 3;  1A78 A;  3LA7 A;  4XIK A;  1G9C A;  1GP6 A;  2TEP A;  2XLF A;  2R04 1;  4M3C B;  3OCP A;  2P4E A;  2ZMK A;  1D0H A;  1AYN 3;  1JBC A;  1P8J A;  2GDF A;  1YYN A;  2VC9 A;  4WM7 A;  4Q26 A;  4Y1V A;  5F9T A;  3LF7 A;  1CAW A;  2QCS B;  1QJU 3;  3B02 A;  3BPZ A;  2BZD A;  2VVE A;  1R08 2;  1UY2 A;  1F15 A;  1DIW A;  1JN2 P;  1K45 A;  3AX4 A;  3PUR A;  1MQT A;  1QH7 A;  2ZKL A;  4YG3 A;  3USU A;  3WDY A;  1G9A A;  1ASJ 1;  1C8M 1;  3NWK A;  1TNR A;  3G6J B;  1RHI 2;  1ULG A;  2JE8 A;  3BYW A;  3FLT A;  4IE0 A;  5I0S A;  3LA3 A;  4K1Z A;  1PIV 2;  4XYX A;  3ZLI A;  2R30 A;  2ZEX A;  1SBE A;  4Y24 A;  3WNN A;  3WDW A;  4W4Z A;  1HQW A;  2ORZ A;  3W59 A;  3T2Q A;  5JZG B;  1DCS A;  3WDX A;  1DGW X;  4IEU A;  4N7I A;  3TEZ A;  2KM2 A;  1MEC 3;  4JGY C;  1NQD A;  3FX3 A;  2EAK A;  1Q56 A;  1OFN A;  4I3G A;  3RJR A;  1VBD 2;  3LFI A;  1DP0 A;  4N43 B;  4UBH A;  4LBQ A;  1PHM A;  2JG8 C;  3VL9 A;  3ZFF B;  1Z7S 3;  2OYZ A;  4BXS V;  3WG4 A;  5I8Y A;  4KG0 A;  1PVC 3;  3VDA A;  1JU4 A;  4BDV B;  5L73 A;  5JXI A;  5JPN B;  2ZGT A;  2BFU L;  2NP0 A;  5FAX A;  1AUY A;  4OQ9 A;  1RUC 1;  3CLP A;  3MIG A;  5FPB A;  2DFC A;  1N1Y A;  3N7K A;  2W92 A;  2R49 A;  3VBH C;  2R32 A;  2WNU B;  2K9Z A;  2WT1 A;  4Q0S A;  3E6C C;  1CPN A;  2FQP A;  3NNM A;  4X8N A;  1LGN A;  4C91 A;  5IVJ A;  1DQ1 A;  1JOJ A;  3WXP A;  1GAN A;  2OUJ A;  2HEW F;  5EFU A;  4LOS A;  3WG2 A;  1ODM A;  5FMC A;  1HXS 2;  4ES9 A;  3B93 A;  4IER A;  1PO2 2;  4IEV A;  3DYO A;  1XND A;  2YGL A;  2YUE A;  1RJ7 A;  4CXY A;  1ULP A;  3IDC B;  3N9M A;  4Y4Y A;  3ZR6 A;  4R9B A;  3ZN6 B;  4RFR B;  3CIH A;  5A1F A;  1J58 A;  2Q8D A;  1UMI A;  3W58 A;  4XMA A;  1JZ7 A;  2B8M A;  1FI2 A;  2BV4 A;  2WL1 A;  1IPK A;  4P5H A;  4AVB A;  2WFF 1;  4OHX A;  3UK9 A;  1RMU 2;  3GAL A;  3N7L A;  4R52 A;  4Q4V 3;  1UIK A;  1W8O A;  3VBU B;  1MS9 A;  1J83 A;  1SFP A;  1ZBA 1;  2TNF A;  3AL5 A;  4KL1 A;  1V0A A;  4GZ9 A;  2XJU A;  1RXG A;  2VZS A;  3M4F A;  3NAP C;  3VN4 A;  4BJ0 A;  4M4P A;  3ZSK A;  5HBA A;  1DYP A;  2UY9 A;  3AZY A;  5FY8 A;  4AL9 A;  1PO1 1;  2DVB A;  5T3N A;  2C0Z A;  3T09 A;  4GB3 1;  4EZH A;  1W2T A;  4Y33 A;  3MF6 A;  5H9S A;  4AFB A;  2RG4 A;  1PGS A;  4BIF A;  5LA9 A;  2A6V A;  1L7Q A;  4AGV A;  5KXD A;  4LA2 A;  2AZ5 A;  4WV8 A;  1IG0 A;  3ZVX A;  3GJB A;  3D5O A;  1Y4W A;  2WIN B;  1T2X A;  4YW2 A;  1BLZ A;  1G7Y A;  5DN2 A;  2O8O A;  1W9T A;  4LO6 B;  5H9P A;  1IG3 A;  3RZM A;  5DAB A;  4LIT A;  1EV1 3;  4IGQ A;  2C4X A;  4Q4W 2;  3WG1 A;  3SCF A;  1PM7 A;  4XFC A;  2QTW B;  4EJR A;  5JIA A;  4XJU A;  4CCE A;  3RWK X;  4L2N A;  5SV5 A;  4CXX A;  2FDJ A;  1O7F A;  4RS5 B;  3RDI A;  1W3X A;  4K20 A;  1EAH 1;  1DQ5 A;  3EXU A;  4D7T A;  1CVN A;  1MZ6 A;  4IGO A;  1NA1 A;  2YBP A;  2B39 A;  4YVS C;  4XOG A;  4PHZ A;  4AWD A;  2CGN A;  5A6X A;  1KJR A;  3IAQ A;  4AR2 A;  4MAD A;  2P17 A;  2WZR 3;  5JXJ A;  4XE9 A;  4LUM A;  1CR7 A;  1O6U A;  3ZM8 A;  4AK3 A;  1FPN 2;  3OPW A;  1BEV 3;  1VE0 A;  5T5P A;  5FZO B;  2WS9 2;  4Q4Y 3;  2WNO A;  4GWN A;  5C7G A;  1VP6 A;  4YW7 A;  4QPG C;  5FZI A;  4OI4 A;  3KCX A;  4MGT A;  3WW3 A;  3I7D A;  1X36 A;  1F31 A;  1RED A;  3AZV A;  1XYO A;  4Q0U A;  2IFR A;  2GN7 A;  3RMX A;  2YB7 A;  1YQ6 A;  2OX0 A;  3OD0 A;  1J3Q A;  2PEL A;  1WA4 A;  1PK6 B;  4CYD A;  2XJT A;  2F4P A;  5FRE A;  2W68 A;  3RZG A;  3JZV A;  2HWF 2;  3CBN A;  3IB3 A;  3N9L A;  3I97 A;  3RZZ A;  5ACA 1;  4CDU B;  1DF0 A;  4UFK A;  5JSO A;  4YZ4 A;  1JYN A;  2VCB A;  1W6M B;  3CJI C;  2RS1 2;  5FR3 A;  1FX5 A;  4GWI A;  5FYB A;  5LBC A;  2KD7 A;  5CAD A;  3ES4 A;  4GMP 1;  2D6L X;  4XDP A;  1IS5 A;  1DGR N;  3MYX A;  4IV1 B;  2Z2S B;  3AKP A;  4OVE A;  3MGU A;  1CZT A;  1CWP A;  3N9N A;  4KMQ A;  3UGF A;  4CXW A;  3LCP A;  2TUN A;  2LRO A;  2ZGN A;  1QDO A;  2XJP A;  4RYD A;  1WCD J;  2AUY A;  3QCW A;  4PBP A;  4XXA A;  4AVS A;  2YBS A;  1OOP C;  2WO7 A;  1QJU 2;  1ZBE 2;  2UWC A;  2GP3 A;  4IEY A;  4F8A A;  2JG8 A;  3KHB A;  4NAO A;  2D98 A;  2QQI A;  3W9A A;  2QVS B;  4AED B;  1FMD 2;  3N36 A;  5DAX A;  4L99 A;  2UYB A;  1YLL A;  1AF9 A;  1NAE A;  2DCY A;  1RUE 2;  3A21 A;  3ZOI A;  2BYV E;  2BWA A;  5KWR A;  1N3Q A;  2VAU A;  3R0R A;  5F32 A;  1WCQ A;  4OQ8 A;  5C3P A;  5DPN A;  5CFD B;  3O0W A;  3MV0 1;  4CDX B;  3S5A A;  2I74 A;  3NNG A;  3VBH A;  3WUC A;  3ILF A;  4CVU A;  1YIP A;  4Y1X A;  3ZDV A;  4J1X A;  2NYY A;  4D7Y A;  4LO7 A;  5LBE A;  1UU4 A;  1SPP A;  4CDW C;  1O8S A;  5C9A A;  4LEJ A;  2G9Z A;  1BJQ A;  2PHF A;  4AZZ A;  4E2Q A;  5A32 A;  3KB5 A;  5BXX A;  3WZ1 A;  1BVP 1;  5FZ9 A;  4RGK A;  1YFY A;  3U75 A;  1OKQ A;  4PCR A;  3E97 A;  4PDW B;  4BK5 A;  2WZ8 A;  4CUC A;  4K3U A;  3HOB A;  1Z7S 2;  4N43 C;  1YI7 A;  3POF A;  3FMG A;  1EPZ A;  3J7H A;  4JVA A;  1JYC A;  4M4R A;  4Y4R A;  5F3I A;  4A42 A;  5K8S A;  4PLM A;  3W20 A;  1HIX A;  5FPX A;  4LO5 B;  2DV9 A;  1LOA A;  1DQ2 A;  4QXC A;  5DAQ A;  4B4R A;  1QMJ A;  1U12 A;  1XRU A;  3MUZ 1;  1UZV A;  3BPS A;  5E6H A;  3TB0 A;  5KXC A;  4S2D A;  1PGL 1;  1NXM A;  4D6Q A;  4P9Y A;  5EJZ B;  1H8T B;  3OBA A;  2RR1 3;  2FDH A;  1OF4 A;  4BIS A;  1QEX A;  3K2O A;  2JEM A;  4AEJ A;  2A6X A;  1IOA A;  2ETE A;  5C3O A;  3RMY A;  3B9C A;  1J1T A;  3O5S A;  4QDR A;  3H1Y A;  3DPR A;  4ARY A;  2VMI A;  3NAP A;  4M01 A;  2H0B A;  1V6M A;  2R1B A;  3J4U H;  1GZT A;  3LQC A;  5L9B A;  1CAX B;  2ZA9 A;  3ENR A;  1CON A;  1NLS A;  1PMI A;  2Y34 A;  1W2A X;  3KVB A;  5FYC A;  4B29 A;  4G3Y C;  5IAX A;  1WLT A;  3GHM A;  3LSD A;  4CZS A;  3QH6 A;  3WNX A;  3MIB A;  2J1R A;  5FK8 A;  4IGP A;  4NWV A;  3DXU A;  3CF6 E;  1JHJ A;  2VZR A;  2P1B A;  1OLM E;  1RYY A;  5C8C C;  1OUS A;  2ZX0 A;  1GOF A;  4CCM A;  2R04 3;  5IW0 A;  1CGP A;  4P02 B;  1AYM 1;  3CL1 A;  5A3P A;  2Z79 A;  5A7W A;  2BDR A;  4YVS A;  5JVV A;  1VBB 1;  2NLR A;  2ES3 A;  2GU9 A;  1WGP A;  1W0P A;  1Z0H A;  2VW2 A;  4UF0 B;  2ZAA A;  2EIB A;  5AC9 2;  5FOJ B;  5IFT A;  2A3Y A;  3ZYI B;  4LTA A;  5FZ6 A;  3IN9 A;  4W50 A;  3O1P A;  5DAW A;  5GZD A;  3D82 A;  2HBU A;  4LBJ A;  5JSR A;  4Y1Y A;  5A3W A;  4F3J A;  3GGL A;  2YYO A;  3MIE A;  4K21 A;  3TEX A;  1WLC A;  1N1T A;  1OD3 A;  4X8P A;  3EMR A;  3LB9 A;  1ASJ 3;  2Y6L A;  1ACC A;  1C8M 3;  2OW4 A;  5GLU A;  4FPG A;  5A33 A;  2QNK A;  2BU9 A;  2RJK A;  4BIO A;  4COY A;  4XQ4 A;  2WC2 A;  4E4S A;  3KD4 A;  1MZF A;  3RJ2 X;  5FZC A;  4CA9 A;  3SH3 A;  5L7O B;  2V5Y A;  4Q4X 2;  1KFX L;  1RUO A;  1WUV A;  5FFO C;  1IKP A;  3KV4 A;  3K77 A;  3ZXK A;  5C33 A;  4LUK A;  4BK4 A;  3WIN E;  2JX9 A;  3FFQ A;  3D0J A;  4OHW A;  3AMQ A;  1ULF A;  2CTV A;  1W6P A;  5FZK A;  5IK8 A;  2JDN A;  1EUU A;  1R1A 1;  3CJI A;  2DVF A;  4BYY A;  5I91 A;  4PIX A;  1EP0 A;  2EXJ A;  2XGX A;  4XJZ A;  1H9W A;  3M3E A;  1QY4 A;  3SHR A;  4CCC A;  2VGD A;  5FYV A;  4XHB A;  3O0V A;  1UF2 C;  5CEH A;  4LHL A;  2X5I B;  3C2U A;  3E5U A;  1VAK A;  1RUC 3;  3BTZ A;  1ZX5 A;  2W39 A;  4OHV A;  1W03 A;  1H2N A;  4MH0 E;  1JZ6 A;  1UOB A;  1V6K A;  2DUP A;  3B5L B;  1OOP A;  3LIH A;  1PK6 C;  2D44 A;  4DMI A;  3QLQ A;  1RUJ 1;  1WMF A;  4F7Z A;  4PI0 A;  3BVC A;  4AI8 A;  3IMM A;  5GJ6 A;  3MFC A;  1MZ5 A;  2CHH A;  2O14 A;  2IXK A;  3LKJ A;  1YQ2 A;  5FWJ A;  1A8D A;  2EAA A;  3MDP A;  5I93 A;  1K12 A;  2VG9 A;  3J7N A;  3IAP A;  4AFA A;  1BKZ A;  2B9V A;  1QXJ A;  2EF6 A;  3EBR A;  3GZE A;  4EN9 B;  2AAC A;  4MLO A;  3T2O A;  5KC6 A;  4CP9 B;  4IV1 C;  1AVB A;  1US2 A;  3ZMN A;  5A3M A;  1ULO A;  1AR8 1;  1ENQ A;  3POY A;  3O1T A;  3JUU A;  1HB1 A;  1E57 A;  2FMY A;  1DGR A;  3R05 A;  4CDW A;  1UCX A;  2WFF 3;  1E5H A;  1QF3 A;  2E32 A;  4WVZ A;  1OF3 A; 
#chains in the Genus database with same CATH homology
 3AVS A;  3PTR B;  5FPU A;  3OPW A;  5F5I A;  3KVB A;  5FZO B;  5FYC A;  5FXZ A;  3NJY A;  3ZLI A;  5FYT A;  2PXJ A;  4CCN A;  4QU1 A;  2OQ7 A;  4V2W A;  5FZI A;  3PU8 A;  5FPL A;  2Q8C A;  3LDB A;  5A7W B;  5IWF A;  3KV5 A;  4IGP A;  5FUN A;  5FZ4 A;  2YU2 A;  5FZ3 A;  5A7O A;  3DXU A;  5A7S A;  2OX0 A;  2OQ6 A;  4C8D A;  4AAP A;  5FZO A;  5FZD A;  5A7Q A;  4GD4 A;  4AI9 A;  4CCM A;  5IW0 A;  3N9L A;  4CCK A;  5FUP A;  3N9P A;  5A3P A;  2GP5 A;  5FP8 A;  5FYZ A;  5A80 A;  4D6R A;  5A7W A;  5FBJ A;  5FZH A;  5FXW A;  4QWN A;  5FPA A;  5FZF A;  5IVB A;  5FY1 A;  2YPD A;  4UF0 B;  4EYU A;  5FV3 A;  5FYY A;  5FY5 A;  5FYB A;  4CUG A;  4GJY A;  4URA A;  3U4S A;  5FPB A;  3PUA A;  5FZ6 A;  4ASK A;  5FYS A;  5FZ1 A;  5F2S A;  5F3C A;  4XDP A;  3RVH A;  5A3W A;  5FZ8 A;  3DXT A;  2YU1 A;  2WWJ A;  4D6S A;  5K4L A;  3N9N A;  5LW9 A;  5IVJ A;  2Q8E A;  3PUQ A;  4UF0 A;  4CCL A;  2P5B A;  3KV6 A;  4QXH A;  3K3O A;  5FZC A;  4LXL A;  4BXF A;  3KV9 A;  2YBS A;  5FXX A;  3KV4 A;  5FJH A;  5FXV A;  4E4H A;  5FZ0 A;  2GP3 A;  5FZE A;  5FY9 A;  5A3N A;  5LY1 A;  2YBK A;  4XDO A;  5KR7 A;  3K3N A;  5F3G A;  5F39 A;  2WWU A;  5FYH A;  5FZK A;  3N9M A;  5A7P A;  5FYM A;  5A1F A;  4BU2 A;  3PU3 A;  2Q8D A;  5F32 A;  2OS2 A;  5FY4 A;  2VD7 A;  2W2I A;  5IVY A;  4GAZ A;  5F5C A;  5FP4 A;  5FZ7 A;  4QXB A;  5A1L A;  1VRB A;  5ISL A;  4LIU A;  4LIV A;  5LY2 A;  5FYV A;  4Y3O A;  4QX7 A;  3AL6 A;  5CEH A;  5FZG A;  5F2W A;  3AL5 A;  4TN7 A;  3UYJ A;  4DIQ A;  3U78 A;  2XXZ A;  5FY8 A;  5FZ9 A;  5A7N A;  4EZH A;  4GJZ A;  5FP7 A;  4Y33 A;  5IVE A;  5FZA A;  5LWB A;  2XDV A;  3AVR A;  5FJK A;  5FP3 A;  5F3I A;  4Y4R A;  2XUE A;  4HON A;  4NUB A;  2OT7 A;  4QXC A;  5FY7 A;  5FZB A;  5IVF A;  5E6H A;  5FY0 A;  4V2V A;  4LIT A;  4IGQ A;  5FYU A;  3ZPO A;  4D6Q A;  3PDQ A;  4DO0 A;  5A3T A;  4CCJ A;  5F37 A;  5F3E A;  3LD8 A;  5IVV A;  5FP9 A;  5FPV A;  5IVC A;  3OPT A;  4BIS A;  3K2O A;  5FZL A;  4EZ4 A;  3PUS A;  4IGO A;  5FZM A;  2YBP A;  5ANQ A;  5FYI A;  5FWJ A;  3PUR A;  5F5A A;  2XML A;  4QX8 A;  3N9Q A;  4CSW A;  3KVA A;  4CCO A;  4HOO A;  5FWE A;  3N9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...