4MUVA

M. loti cyclic-nucleotide binding domain mutant displaying inverted ligand selectivity, cyclic-gmp bound
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
142
structure length
142
Chain Sequence
b'GSQEVRRGDFVRNWQLVAAVPLFQKLGPAVLVEIVRALRARTVPAGAVICRIGEPGDRMFFVVEGSVSVASPNPSELGPGAFFGEMALISGEPRSATVSAATTVSLLSLHSADFQMLCSSSPEIAEIFRKTALERRGADASA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cyclic nucleotide-gated potassium channel mll3241
publication title Determinants of ligand selectivity in a cyclic nucleotide-regulated potassium channel.
pubmed doi rcsb
source organism Mesorhizobium loti
molecule tags Nucleotide binding protein
total genus 43
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4muvA00
2QCSB 2Q1ZB 4R8HA 1TQ5A 1ZZ7A 3MZHA 4J1WA 1UW8A 4I01A 4B29A 3E6BA 1X8MA 3DN7A 2QJVA 4BIFA 3I54A 3SCGA 4YRDA 5FLHA 2XL7A 1XE7A 3H1WA 4IEWA 1LB2A 4LULA 1CAXB 5KHKA 3CL1A 4HN0A 2PFWA 2D40A 5I8YA 2Q0AA 2OZ6A 1XRUA 3R6SA 2ET7A 5BPXA 4Q0UA 3G7DA 4IEXA 4BYYA 2PA7A 2ZCWA 3RPQA 4AVCA 2D5HA 3C3VA 3RYKA 3E97A 4XFBA 2IXJA 3UKTA 4LA2A 1UD1A 4HSJA 1J3QA 4BHPA 2B5HA 2HKXA 2E9QA 3E5XA 2GC2A 4MH0E 2H6BA 3IDCB 1J1LA 3ST7A 3BU7A 3MPBA 4K8FA 2BNOA 1UIKA 1EP0A 4IEVA 2IXHA 4L11A 2VECA 3SHRA 2EA7A 2QVSB 4WZCA 4KU7A 1YUDA 5BXXA 2XLFA 1YHFA 4I02A 4R52A 2IXKA 4HZFA 2BEOA 5FPXA 4YNIA 5JAXA 4RD7A 1QY4A 2XHKA 4KWJA 5CVRA 3ETQA 3KGZA 3B02A 4OFGA 4XF9A 4F8AA 1Q43A 3H50A 4JTOA 1O7FA 3ACLA 1RUNA 5JSPA 1DZRA 3KSCA 1CAWA 1DGRA 1IPJA 2CV6A 3H8UA 4MUVA 1EY2A 3IDBB 4N9IA 5JSRA 2ETEA 1O3TA 4D7SA 4IEUA 1ZRCA 1Q5OA 3HQXA 2H6CA 3GYDA 2O1QA 1YLLA 5C6CA 4QGNA 2D93A 3EQEA 3FFQA 1UIJA 2WC2A 4O9GA 4P9GA 2FMYA 4ZU4A 3SCFA 1IPKA 2GH2A 2K0GA 4MV2A 2UYBA 3E5UA 4YARA 2PYTA 1SEFA 4X6RB 2Z69A 3I59A 3E6CC 3NJZA 1H1MA 3O14A 4XFFA 3M70A 4YSFA 4HSLA 3CEWA 5JR7B 1RL3A 1UPIA 2UYAA 1FI2A 2HJIA 4ZU5A 4N9HA 4I0BA 3DV8A 3FJSA 4IEZA 4IEQA 5FLIA 2EVXA 3HIFA 1WLTA 5FQ0A 1LR5A 2EAAA 4J1XA 1EPZA 4UBGA 2OYZA 4EWAA 1VJ2A 4XF3A 3BCWA 3EJKA 2K9ZA 2OPKA 1WA4A 1O5UA 4Q0VA 5LEJA 1CX4A 1O4TA 3LA2A 3BB6A 2DCTA 4QGMA 4XFGA 1GQHA 4LUMA 4I3PA 5LEKA 4UXAA 4HMZA 3H9AA 1QXJA 1YFWA 4IEOA 4JV4A 3RNSA 4Q0SA 1JUHA 2ZKLA 3L2HA 1ZZCA 4IEPA 4BH9A 2UY8A 1FT9A 2WFPA 3CJXA 4I2OA 3D0SA 1YWKA 4PJYA 1RUOA 3CF6E 4WVZA 3CO2A 4GULA 4Z82A 3RYPA 3H7YA 2CAVA 4XF0A 1SQ4A 2BNMA 5HI0A 3RYRA 3U0ZA 5BUVA 4Q0PA 2H0VA 4JTNA 4XFHA 1QWRA 3FE5A 1O5LA 4AQ6A 1ZZBA 1CAUB 5C8WA 3OGJA 4KU8A 4E2GA 2V09A 1VR3A 1XE8A 1X82A 1LRHA 1Y9QA 3OF1A 3DL3A 5LRSA 1Y3TA 2BNNA 1CAUA 3QACA 4MX3A 2PTMA 1YFYA 1O3RA 2OZJA 1CAWB 3OTFA 4Z07A 4LTAA 3SXWA 1Q3EA 2PQQA 1U12A 3PNAA 3SCHA 4KWLA 2Q4SA 2FQPA 4XFIA 5F1RA 2B9UA 1ZX5A 2CGPA 3H1MA 4HLTA 1NZCA 1YFUA 5KHHA 1H1IA 4EV0A 1ZZ8A 1V70A 3MYXA 4QGLA 1ZRDA 3I59B 4HVQA 3KCCA 4FAGA 4ONUA 3DKWA 2IXCA 4HN1A 5E16A 4Q0QA 2GU9A 3S7EA 1RC6A 5EZWA 2BGCA 2CAUA 1ZREA 1EYBA 1X8EA 3IIAA 3NVCA 3KMHA 1J59A 1CGPA 3FZ3A 3NKTA 1I6XA 3WW4A 4D7TA 3OCPA 3BPZA 4WBBA 4O9EA 5FQ0B 2XGXA 5BY5A 5CU1A 2Y0OA 1J3RA 2OA2A 3ES4A 3PVBB 5I8SA 3EHKA 4FT8A 1DZTA 2XKOA 3WW3A 4AVAA 2F4PA 4Q29A 1CAVA 1QXRA 3LZZA 4JVAA 1NE4A 4XETA 3I7DA 4UBHA 4YYOA 4MGZE 2VPVA 4KL1A 1I5ZA 2PHLA 3ES1A 3LAGA 4CYDA 1G6NA 3BALA 4H7LA 4AVBA 1O3SA 3ROUA 5I8TA 3NSTA 4L2NA 5I0SA 3D0JA 4IETA 1ZZ9A 2XLGA 2PAEA 5J7MA 1PMIA 3VHRA 4F7ZA 3FWEA 3H1YA 4QM9A 5T3NA 1HW5A 4MGIE 4IERA 2UY9A 4LEJA 4MGKE 4PIYA 1SFNA 4HVRA 2MNGA 2PHDA 5I0UA 4E2QA 1J58A 3TNPB 3H3UA 5JCTA 4LUKA 4AQ2A 4LA3A 3MDPA 5E1RA 2QNKA 1L3JA 3HT1A 3H3ZA 2PAMA 3JZVA 4MGYE 3S7IA 3ZDSA 1GQGA 4ORFA 3SMHA 5KHJA 2XLAA 3QOPA 1NXMA 2MHFA 3PLQA 3LWCA 3USSA 1O3QA 5EFUA 3EBRA 1CAXA 4EWDA 4PIXA 5I0TA 1DGWA 4IEYA 1OI6A 4QMAA 3GBFA 4XFAA 3LA7A 3LOIA 4QXKA 2QDRA 3WW2A 4A2UA 5FPZA 2B8MA 2IXLA 3IWZA 5KHIA 1X7NA 2GZWA 3NW4A 3ELNA 5LRRA 3E5QA 1ZRFA 2O8QA 3CLPA 3RDIA 4FBFA 2N7GA 1PM7A 1YFXA 1OD5A 2ET1A 1NYWA 2GC1A 5KBFA 3KGLA 2Z2SB 3FHIB 3E6DA 1OFNA 5AVPA 4AXOA 4IESA 1WGPA 2C0ZA 1OMIA 2Q30A 4EWEA 2PAKA 4QX5A 3U11A 3NL1A 5CADA 1CAVB 4I0AA 1LKNA 3WW1A 5I93A 2ATFA 3HT2A 3FX3A 5J48A 5I0RA 5FLJA 5J3UA 5K8SA 4XFCA 2GAUA 2XKPA 4DINB 5D1IA 2VQAA 4OLLA 2P17A 4X6QB 4LLOA 5FDBA 4HBNA 4QM8A 3TNQA 4I09A 3EO6A 4HVOA 1FXZA 4TLFA 2I45A 3M3IA 4EROA 5KHGA 2IXIA 4MZUA 4NVPA 3RZZA 3IBMA 2IC1A 3UKVA 4XEZA 1J3PA 4FAHA 1ZRRA 2XL9A 2D5FA 2GC0A 5I91A 1UCXA 1RGSA 3UKNA 3LA3A 4XF1A 1RTVA 4XF4A 1ZZ6A 4E2SA 1ZVFA 1VP6A 4ZU7A 1ZNPA 5JSOA 3H7JA 4META 3S0MA 3U10A 3N4MA 2BYVE 3D82A 3OD0A 4PIZA 5BV6A 2MPFA 5FCCA 2KXLA 4KWKA 1NE6A 2GC3A
chains in the Genus database with same CATH superfamily
1SPPB 3BYWA 3FLRA 4GA9A 4AVVA 4JKMA 1TQ5A 4D6RA 4L8QA 4MXVA 4BK4A 4RQPA 4CCEA 4J1WA 4P14A 4Q5OA 1UW8A 4I01A 4B29A 1W39A 3SKVA 2DCZA 1X8MA 4A44A 5ABJA 3NAPA 3B00A 2ORXA 3ZFEA 1AL23 3GHMA 1NY71 5FZMA 5LATA 1UKRA 1REDA 3SCGA 5DMYA 4YRDA 1AHSA 4IV3C 5JVVA 4Q4X1 4OHZA 2XL7A 1BVP1 1RUC1 1RUH3 2WQZC 3U1XA 1OQ1A 3UGGA 1CAXB 4Q1RA 1W8FA 1F8VA 4RHV3 2R071 3CL1A 4Q4W1 3BTXA 1Q8QA 1RUD1 2W95A 2RDNA 2X53S 2OZ6A 4D69A 3VBFB 1XRUA 3LOBA 3CIHA 1QQP3 2C9AA 4P9JA 4GKYA 3H3LA 2CU5A 3AKPA 1G7YA 1GNHA 4E4ZA 1O8SA 5FZ0A 5F37A 2OX0A 4L9BA 5C71A 3C3VA 5FZFA 3RYKA 4AQSA 5LW9A 4GH4A 1PO21 3OYWB 5FYTA 3LE0A 3UKTA 4LA2A 5A1LA 3NRUA 1J3QA 3VGIA 2WO2A 3JUUA 2EXJA 2BV4A 3E5XA 2WAAA 1TMF3 2WFF3 5EQUA 4V2WA 4C1XA 4MH0E 1GV9A 3IDCB 1EUTA 1J1LA 1SLAA 3N9PA 4J25A 1C3HA 3ZYHA 3MPBA 4CCKA 4URTA 1UIKA 1IQDC 2RDQA 1UYYA 3UGFA 2IXHA 4AFAA 5CAZA 2Q8CA 2NPIA 2GH8A 4WVMA 2QVSB 1JW6A 5FYYA 2JDMA 2XVGA 3MLKA 3BTAA 2R32A 2XLFA 1UY2A 3R05A 2BQPA 4GWNA 4LOTA 4R52A 2FDGA 1OLME 3VDAA 3JB8A 1JU3A 2BEOA 5FPVA 5FZ7A 2VZQA 1GLHA 1QY4A 2XHKA 2FBEA 2Y0IA 5A7OA 1G9DA 2ZX2A 4LITA 4FSJA 3EXUA 1W9FA 2J22A 3B02A 4OFGA 1AX0A 1EUUA 2ADDA 2ZEZA 2RMU1 4WM7A 1TNFA 1WMEA 2RS12 4KGQA 5FY9A 1RUNA 1XU2A 3P1IA 4FQZA 5F5AA 3N7JA 3KSCA 5DABA 5CKMA 3A0KA 1EY2A 1V9U3 2JD4A 1AR72 3IDBB 4BK5A 2VNRA 4D7SA 1GWLA 2XHNA 1KEXA 5IVJA 3HQXA 4TLGA 1PVC1 1YLLA 1IS4A 4AI8A 5CG9A 3WDVA 4XQ4A 4DXZA 4IV3B 2ES3A 2WZEA 1S0EA 4O9GA 4Y1XA 2UWAA 4YZ3A 4P9GA 3ZMNA 4LBJA 4D3WA 1HJGA 1IPKA 2VZTA 3H42B 5DXDA 4GALA 2PHRA 3BU0A 2IFWA 1JOJA 2UYBA 4AHZA 4YARA 3D5OA 4XURA 3KB5A 1JUIA 2Z69A 5DAPA 1EAH1 2WZR1 5ACA2 3RWNA 4EJRA 1H1MA 3O12A 4IV1B 5FYZA 4HANA 4XFFA 1AR83 3M70A 3AKQA 3ITQA 3KLSA 1L7LA 3ZFFA 4HSLA 3O0VA 3ZSEA 4XBNA 1HB3A 3AL6A 4A7YA 4E9KA 4TXWA 2YGLA 1UPIA 4XC9A 4Y5Z0 4LKSA 5DAQA 1DFQA 1SBFA 1Q8SA 1YO8A 2VE1A 5E6HA 2J7MA 1CN1A 1OUXA 5FPUA 3VDBA 4JQTA 3GF6A 3IPVA 5CKQA 2VAUA 3M1HA 3ASIA 5FO8B 2VCCA 3OBZA 1QJX2 4PF1A 3WUDA 1J84A 4ES9A 3ENRA 4BLIA 5EHDA 3OB8A 3GJBA 5C9AA 4FTEA 2WDBA 1IS3A 2ZX4A 4UBGA 4UW5A 3T2OA 1YXWA 1WUVA 1N1TA 5GZDA 1VJ2A 4NIAA 3EJKA 1XU1A 3N36A 2K9ZA 3AZXA 3U75A 1WA4A 1WLCA 1ZM1A 2GALA 2WINB 1YEWA 3PUSA 4NR1A 2E32A 2A71A 2WNUC 2XH6A 3HBKA 3K4ZA 4LPLA 4QU2A 4TN7A 4QGMA 2ZHLA 1QF3A 1R082 4KBZA 1TME3 3LPFA 4QDQA 1W3VA 1GQHA 2J1VA 3TN93 4BZ4A 5F39A 3PU3A 3J8F2 4HMZA 4W6XA 4D6QA 1NQJA 2JE8A 1YFWA 4JV4A 2D7FA 1L7RA 1JYNA 2QFEA 5FP3A 3BIWE 3WEZA 4CUCA 3L2YA 2ADEA 4HXCA 1MZ6A 2A6XA 4GH4B 4LT5A 5F6KA 1KDKA 2HWB1 2B39A 4HT1T 5BYNA 4P9XA 4Q4X3 5D2AA 1LULA 2P6CA 1RUC3 5D21A 4GULA 2ID4A 4QU1A 4QHOA 2R073 4XOGA 3RYPA 4OHYA 3H7YA 1A78A 1SBEA 3ACIA 4LMFA 4Q4W3 4OZXA 1GKBA 4LJHA 1DP0A 3AFGA 2NLRA 3H8RA 1OOPA 3TEYA 3AKSA 3FUOA 3CHXA 5BUVA 5DDJ2 3TYJA 4ES8A 4JTNA 4P9LA 1QJU3 1QWRA 2VOWA 1W28A 3L9JT 1O5LA 1CR7A 1PO23 5H9RA 1WD3A 4KU8A 2GMEA 1QMJA 1X82A 1V0AA 4BQ4A 4ZXEA 2NN8A 2V4VA 5FZ6A 2HLEA 4XUTA 4CDQC 1POQA 3KM5A 2D6PA 4XMIA 3WF3A 1URXA 2PTMA 3DKQA 3WNLA 2B9VA 1S0GA 4FO9A 2WQ4A 1JXNA 3OTFA 4LTAA 3VKOA 5A33A 1RUF1 4XACA 3N9OA 3PNAA 3SCHA 3WOGA 3VBUC 3W5MA 1UY3A 2ZABA 4EN7B 5M0TA 3TEZA 1ZX5A 3T0AA 1QJEA 4LKEA 1RUE3 1ZA7A 3H1MA 3LSDA 3OEBA 4EZ4A 5KR7A 2D3PA 3O1OA 3HQUA 4QXCA 1ALYA 1XC6A 2YBSA 3MO4A 4CP1A 4BE3A 4U2AA 3LGRA 3AP5A 5C33A 4ZONA 3OY8B 4YVSC 1FPN2 2C5DA 3BN6A 1XPWA 3ORJA 4CDWC 5FK7A 2W68A 3AX4A 1ODNA 3KCCA 2XJTA 4N8MA 3ZIXA 1QNWA 5FY0A 5FY7A 4W6YA 5GLZA 4HN1A 2Y6FA 3VDCA 4XXAA 3ZFFB 1PVC3 4MGTA 2X29A 5D8AA 3NV2A 1FNYA 2YFUA 3CU7A 2GDFA 3ZO0B 1F15A 4A4AA 2R042 3NJXA 4OCTA 2RS11 1XXNA 5FXVA 3INAA 4YM2A 1J59A 2PHUA 4NROA 4HK9A 3H0OA 2Y6KA 3AC0A 3IPVB 5IFPA 3PTRB 2BOJA 2OT7A 2UWCA 3HNMA 5FWJA 1AR71 3KV9A 2ZEXA 5AVAA 1WW6A 5L9BA 3WHTA 2WZR3 5C9AB 3J7LA 1W8HA 3PVBB 2WYFA 1SDWA 3B93A 1OA3A 4QD2A 1W8ZA 3ZSJA 3CJIA 2F4PA 1MZ5A 4E4HA 4Q29A 2WS92 4AFBA 3N35A 4JVAA 5IT6A 3KQ4B 4UBHA 1XSRA 1AL22 4K8RB 3RZGA 1DQ0A 1CWPA 1O91A 4TWTA 4C1WA 1SLLA 1I5ZA 1Z0HA 2X5IC 2HWF2 5A32B 4BM8A 5ACA1 4JGZA 2D6KA 3HAGA 3PL0A 1KITA 3LAGA 4XMAA 1VBC1 3RQ0A 5HV0A 4QPWA 3POYA 4FPEA 3NMBA 4N43A 3WQBA 3TEWA 4YW1A 1JZ6A 5EJ3A 3FLPA 1UZWA 1PO12 4DB5A 4FPGA 4NHMA 3HN3A 3U07A 2E31A 3T09A 4MLOA 4XCAA 3AKRA 4XAAA 4CP0A 1F9KA 4G3YC 4YW5A 1OPOA 1N3PA 1WMXA 1T6GC 2WZ8A 2HEVF 1QJX1 1TG7A 4DY5A 1PMIA 4F7ZA 3FWEA 4S2GA 4XILA 3VBOB 1V6OA 5C4WA 3ABZA 3WHUA 4BDVB 4CPBD 4ZKTB 5JXIA 1N1SA 1OFSA 4PDWA 4YVSB 4NIHA 3AYCA 4DO0A 2RS32 3K51A 3GZTB 2RR12 2YGMA 4QKNA 1CVNA 5T5OA 2YHJA 1YI9A 3POFA 2B7YA 2YFZA 4P00B 1W9YA 2WNOA 1U5XA 4LQRA 3N9NA 4YW7A 2VVEA 1QOSA 3Q8CA 5I0UA 4LBMA 2CY6A 5FREA 1WA6X 1H0BA 3QH7A 1UXXX 1W0PA 1JODA 3ZYJB 2E7TA 4LUKA 4W4ZA 4BQ3A 2JEMA 2QNKA 3HT1A 4D6SA 1R081 2HWB3 5A3LA 1ENRA 2OVUA 3J8F1 5L7OA 4XHBA 5FP4A 5HCBA 2X09A 1XB9A 4YW3A 3I4IA 2DVDA 1OUSA 4UW6A 2MHFA 4NRQA 4LHNA 5JXJA 3KHCA 4XIOA 3T2TA 3RZKA 3USSA 4CXXA 3LFIA 2W94A 5E8AA 3UETA 4HG6B 5FPAA 4EWDA 1JMUB 2QTWB 3DPRA 5I0TA 3B9CA 3OUHA 4FCAA 4E27A 1UMHA 1V9U2 4W8JA 4ASMB 1D7PM 2W08A 2WIIB 1AYM2 4RN5A 1QNYA 4XUQA 1W2NA 1GP6A 3WW2A 4RR3A 5FPZA 2VMDA 2JDYA 3B69A 4RFRB 1DLCA 2P6HA 3WF0A 1PX3A 1GZCA 1HV0A 2VBDA 5DDJ1 1X7NA 4MO3M 1G9AA 3NW4A 4HKWA 1QDCA 3PIGA 1LEMA 2HWD2 3DYPA 3ACHA 4LBOA 4AQTA 3PVOA 3RDIA 3O1PA 5JPNB 3HJRA 2NM1A 1UU4A 5D8AB 1H8TA 1HN0A 2X8KA 2QE3A 1QDOA 1NYWA 2GC1A 1KQRA 3NKGA 2BRTA 2VL4A 5KBFA 3FHIB 1UZVA 4QQOA 3I2IA 3VBSB 4BMEA 3WDWA 4K3UA 3SEEA 4CP2A 5A3MA 5LA2A 1G9CA 1PK6A 2C0ZA 4QX2A 1RXFA 2WWUA 3ZSLA 3KVBA 2W2IA 4NPRA 4Q27A 3FC0A 4TSVA 3LSEA 2PAKA 5H9SA 4QPYA 3MPPG 4XABA 3VD7A 2A73B 4LO8A 4R4XA 4RS5C 2JG8C 1MS4A 3NL1A 1H2LA 1K12A 2HBUA 4AI1A 5FIXA 3I2HA 4I0WB 1W6NB 1UF2C 2JB4A 5I93A 3MBWA 1FNZA 1VMFA 5T54A 3WNPA 2RS13 5FXZA 2PLV1 4ISRA 1RXGA 1MZEA 5I0RA 5J48A 4OQ8A 5DUWA 4YZ4A 2WT1A 1FPN1 1PZ9A 1ND3A 2XPJA 1DQ5A 1C5HA 1HQLA 2WNVA 4JGZB 4YWAA 5FYUA 2DUOA 2DU1A 1SLCA 4DOUA 1AR73 1E5IA 4CDUB 5JZGC 4HBNA 2WAOA 3IN9A 1ULEA 1VB4A 2W46A 3AKTA 4QAWA 1JYXA 4KG0A 3M3IA 4RGGA 2R041 2IXIA 2PELA 1QH6A 4Y4RA 2IC1A 1XNAA 4IGQA 5ANQA 4FOVA 4O65A 4FAHA 4S2DA 3MGUA 2GC0A 4Q26A 5I91A 3CZUA 3NV3A 3N9MA 2LROA 2XWBB 1SLIA 3ZSKA 1F4AA 1RTVA 4DFSA 5FZKA 1AX2A 4XBQA 2PHXA 5C4WB 5ACA3 5CFDB 1OC1A 4AW7A 2QQMA 2EAKA 1VP6A 2F4LA 3OUJA 4QQPA 5FJKA 3H7JA 4META 4BISA 5K7PA 2RM22 2R1DA 3N4MA 1R1A3 3D82A 4JRAA 1G9FA 4PIZA 4LO7A 5BV6A 4B7EA 1BEV2 1CPMA 4LO5B 5FCCA 4A7KA 2KXLA 4KWKA 3O1MA 2F6BA 1V6JA 1AL21 2Q8OA 2E7QA 4BJ0A 1TEIA 2Q1ZB 4NIDA 1QJU2 1O6UA 1ZZ7A 3SC7X 2KD7A 3AYDA 2XG3A 2QZ3A 5FYCA 1QJX3 1WCKA 2G19A 2DUQA 1S2EA 4XJ8A 5L7OB 5A7SA 1BCXA 1SPPA 2VZOA 3DUIA 2YY1A 1YQ8A 4BIFA 4CCNA 3BTYA 3AXEA 1W9SA 5C8CC 5F3CA 3ATGA 3LDKA 2NMOA 1PO11 2R0HA 5A6XA 4OI2A 3PUIA 3V56A 1XE7A 3H1WA 3AZZA 1MVQA 3BKZA 4E4SA 4Y22A 5KHKA 2JG8B 5JOWA 2JJ6A 3U78A 1OLRA 2QQPA 4YGEA 4RFT0 3PUHA 2AACA 1ASJ2 2VNGA 3WF1A 4BYYA 4Q0UA 4LLFA 2YPJA 2A75A 5DQ0A 4RR3B 1KXGA 1R083 1H2NA 2VMCA 4P02B 1S2BA 2Z79A 2RS31 2IWGB 3E97A 2RR11 2XUEA 3J8F3 2TEPA 5J1XA 1RUE2 1W6MA 3ZKUA 1LHWA 3NJVA 1RUG2 1TZOA 4YZ5A 4WVVA 2LTNA 3AFKA 2BVVA 2E9QA 4CPBA 5IATA 1IKPA 1WLDA 1S0CA 3ST7A 2JWPA 3ZYRA 2BNOA 3MV11 4XVHA 2RHPA 5JXHA 1PM4A 3VDDC 2EA7A 1C1FA 3CDZB 3OGSA 1MS8A 1SFPA 1X50A 4WZCA 3WQ7A 4KU7A 2D6NA 3JD72 3PUAA 5BXXA 2FDFA 3OJBA 5FZIA 1MQTB 1H2KA 3GBWA 1YHFA 3W21A 5J36A 4I02A 5B4XA 2VZVA 2D6MA 2IXKA 2KR2A 4N7UA 4SBVA 2W52A 5JAXA 4YNIA 2YC0A 1W8OA 2G1MA 3W5NA 5CG8A 3O7OA 4KWJA 4Y33A 5DDJ3 5CVRA 1PK6B 3ETQA 3IZOA 3VBRC 1LGNA 1V9U1 4QDSA 1A8MA 4YM1A 1AYM1 2ZZJA 5APAA 3H50A 4JTOA 1O7FA 2JD9A 3AP6A 2XQRA 4AEDC 2D3RA 2I2SA 3APBA 1LHUA 2E51A 3B3QE 3I2GA 4AF9A 2X10A 1LHVA 1DGRA 5SV8A 5FXWA 1UOJA 2OQ6A 4AWDA 2B46X 4AL9A 1O3TA 2VOTA 1ZRCA 5CA6A 3MFAA 5FP7A 1Q5OA 2EXKA 4G9SB 3MFCA 3S30A 1JZ4A 3VZOA 4AGVA 5C8CB 1ND3B 2Q8DA 1MPXA 5CKNA 2A5ZA 5C6CA 2YMZA 2D93A 4L0PA 4FI9A 3FFQA 3POIA 3C7GA 2AC1A 2HWD1 5K0UC 4YVWC 3I3DA 4ZHNA 2RVAA 2BFUL 1JZ3A 4ARYA 2VTXA 4LBQD 3K46A 4DMIA 1WW4A 2GH2A 2ZGNA 3E5UA 4IV3A 4WZFA 3I59A 3VHOA 3NQHA 2GNMA 3MIHA 1JZ2A 5A3WA 1FOD2 1GOHA 3OG2A 4YSFA 4Z2WA 4UF0A 4YZ1A 1FPN3 3HOBA 2RS52 1VPHA 1XE0A 2ENRA 5HCAA 4ZU5A 5LBEA 4L99A 4IUGA 1WW7A 2B4KA 3JBG2 1N1VA 5FAXA 1S0DA 4O61A 1MS1A 1WLTA 4MGQA 3U37A 2R043 3AP7A 3VDDB 2BBAA 2FD8A 3P3NA 4J1XA 4Y24A 1EPZA 4CRQA 4QB6A 3TAYA 5FPBA 2OYZA 3PMSA 2V72A 4XW3A 4EWAA 5A70A 2FMDA 2ARAA 4R9DA 4RGKA 4LKFA 4XHXA 5IAVA 4EQVA 1YQ6A 5IK4A 1POV0 1W2AX 5FYMA 2VMFA 2VOXA 1O5UA 2ZGOA 3CMGA 5TSWA 4K7JA 3WDYA 5A1FA 4AVTA 1WCQA 2J1RA 5BNPB 4BA6A 2O14A 2DCTA 2WS93 4Y22B 4BLJA 3K77A 3HR9A 1KJRA 2VZRA 3LEKA 2W87A 3NNLA 4UWDA 4LUMA 1AF9A 5DG1A 4CDXC 3JB4C 4YFZA 1Q8VA 3H9AA 3Q8BA 1QXJA 2SBAA 4C0BA 1NX9A 4NAMA 4N53C 2JDAA 2HWF3 3THTA 4DRVA 3ZYPA 1QIQA 3B94A 5JOXA 1BXHA 4IEPA 5L73A 2UY8A 5C3RA 3LEMA 2JDNA 1W6MB 3LKJA 3CJXA 4YG6A 3BPSA 4NAOA 1BEV1 2JE7A 4Y1UA 3D0SA 4PLOA 4YVWB 1UY4A 1PO13 1YWKA 3ALQA 2ZX1A 5IVVA 5G04L 1RUOA 4ZZ8A 3ZXJA 5JLVA 1QJU1 3WVJA 4H3WA 2DVFA 2BNMA 1J83A 1NLSA 2ZGMA 3I2DA 4CCOA 4IE6A 3VUOA 3P6BA 2R0FA 4G4FA 2A6WA 4HL0A 3NJYA 4UFHA 1V6KA 1CPNA 2RS33 2RR13 1LODA 3IB3A 1CQ9A 1HLCA 4QHBA 2E63A 4K6BA 3H8XA 3ZXKA 1VR3A 2VQ0A 2V5DA 4UOJA 4DPNA 3LIGA 5FYIA 4JQRA 4ZPIA 1ASJ1 1XNKA 5LBFA 2HEWF 3DL3A 5A6YA 1NG0A 5LRSA 2DFCA 4DEVA 2HEYF 4QPGC 3WLUA 4AEKA 1PIV2 5FTTC 4CP9B 3H8OA 1E57A 2VUDA 1YFYA 5F5CA 4JDOA 3KCYA 4KQ7A 1RUE1 4UFIA 5FR3A 3SXWA 4FTBA 1DIWA 2PQQA 2VZPA 1UZYA 1IGOA 2DDUA 2WUHA 2VGDA 4KWLA 5FKCA 3VZLA 2Q4SA 2XUMA 1GNYA 1HB1A 4BMBA 1BJQA 5A3UA 2GN3A 2FQPA 3LEGA 4XFIA 2FHRA 4PQ9A 1OSGA 1B35C 4XDQA 5E88A 5LZ6A 4HLTA 1D0GA 1YFUA 5FUIA 5KHHA 5C5UA 2BGOA 4OHWA 2O0OA 5IAXA 1AYM3 2QQKA 5ABJC 4ASKA 4CDXB 4CXWA 2YXSA 3JD71 1WD4A 4XJ9A 3I3MA 1V70A 1YIPA 3MYXA 2ZMNA 4XUNA 3VD3A 4MG2A 1ZRDA 2WA3A 3I59B 2WNUA 4N53B 1DQ4A 4Y20B 2W39A 1BVVA 4W50A 4NE9A 4M3CA 4ONUA 1C8M2 2EIDA 2IXCA 3S5QA 2C26A 4Y26A 4BQ5A 3CBNA 3ZX7A 4AHYA 4UF0B 1H6XA 5IVFA 1RC6A 1AZDA 2BGCA 1HQWA 2VCBA 3OY8A 5LK5A 3RI8A 1K5MC 2Z42A 1UKGA 1EYBA 4CTEA 2Y6GA 5JPMB 2WSVA 2AREA 1E5SA 2HWD3 2ZEWA 3IIAA 3KMHA 1GNZA 3NNJA 4GXLA 1Z7S2 2MEV3 3I2JA 1CGPA 1I6XA 4MXWA 1R1A2 4AEMA 3QH6A 3BPZA 5GZGA 2A7AA 2H0BA 4UFLA 3TEXA 2GSYA 4RL7A 5CU1A 3THCA 1J3RA 4BXFA 3MW3A 2E26A 2W91A 1SHWB 1HRV2 2P3KA 4FT8A 4PHZA 5E89A 3A0NA 4HKLA 4JKLA 1FV2A 1CAVA 3LZZA 3POBA 2VUCA 3TBDA 3OPZA 4ZZ5A 2GP3A 3SH5A 4ATFA 4C91A 4DUVA 3UL2A 4M01A 1RJ8A 4P9IA 1RVF2 2W9XA 4FFIA 4JGYC 1PGSA 1MS3A 1R1ZA 2NMNA 2ZS6B 2OUHA 5DUXA 3WUCA 3ZXEA 5AFBA 1FOD1 5CYYA 3VBHC 2JDPA 2YG0A 1RJ7A 1G6NA 2ZHNA 5JOZA 3UESA 3BALA 4Z92B 2RS51 2WNEA 5DAWA 2P3JA 4AVBA 3MLLA 2ORZA 1GU3A 1S4CA 3ROUA 2BFUS 5A32A 2JENA 3OBAA 4CDQA 2XJRA 3ZXAC 1XOYA 5I8TA 3MIGA 1UY0A 2QQIA 1MEC2 3JBG1 1W6QA 1R092 4OVEA 5FO9B 1XNCA 1DZQA 2P5BA 5IJRA 1G86A 3HN1A 3K75B 1C5IA 3ME2A 4MADA 1DQ2A 1OT5A 5J7MA 1JYCA 2CGNA 1MS5A 3J4UH 1CONA 3KT7A 4GQ7A 4EYUA 4QM9A 1K42A 1I3HA 5JXGA 1O59A 1NKGA 1QJZA 1VBA3 3K2OA 2UY9A 3I3QA 3M3EA 5T5LA 5CEHA 2A3YA 4MGKE 3WX5A 2G4IA 4HK8A 4HVRA 2JG9C 1JU4A 3MUY1 3VBOA 2XJPA 2RM23 1J58A 4KBBA 1OH4A 4YVSA 4LA3A 5FPLA 4UFJA 1BEV3 2EXHA 5H9QA 3HBZA 3RJ2X 3S7IA 3AYEA 4NWVA 3T30A 4KNCA 1JH5A 1NXMA 1AXYA 2BERA 4HFSA 3VKNA 5B2GB 3T0BA 2GMPA 1O3QA 3FBYA 3B01A 4LK7A 4PIXA 3MUZ1 2EXIA 3KWVA 3WDXA 1V6MA 4AFMA 4AE2A 3D4KA 3M8LA 2G9FA 1W6PB 3ZM8A 1ULCA 1KRIA 1WWYA 3DF0A 3VV1A 3LOIA 3GCXA 1PX4A 2CSGA 1SBDA 3C8XA 2WKKA 4Q2FA 2YZ4A 4GKXA 3M3OA 4FPKA 2ZGKA 4O7XA 2B8MA 2IXLA 1HRI3 4MSVA 2DCJA 1ASJ3 4Y1YA 5GZFA 3O1TA 1YI7A 1NA1C 5KHIA 4IGPA 5A1AA 5SV5A 3NNMA 4LIVA 2WNUB 3HVDA 2JKXA 4D8MA 4QX8A 2X5IA 1LNSA 1SG3A 4DEQA 1ZRFA 2F17A 3POWA 3KQRA 1RUG3 4M3CB 2VG9A 1NLQA 3SH4A 4FBFA 5FY8A 5FZCA 3VKFC 2YUEA 2RDSA 1OD5A 1UPSA 4BCUA 4DY3A 1NXD1 4OMDA 4D94A 3I3EA 5JMCA 2WN2A 5IVEA 1QEXA 1GP4A 3ZN6B 1PIV1 3VKMA 3KGLA 1DG6A 4MXWB 4Q4Y2 1AXZA 2BOIA 2ZKNA 1OFNA 1COV2 5CFCC 4AXOA 4C90A 3U4XA 3X29B 4IESA 3JD73 1HV1A 1N3OA 4LE4A 1H1AA 1WCDJ 2Q30A 3F2ZA 4EWEA 2CHHA 3T0DA 1WZXA 2CNAA 2JG9B 3ECQA 1ENQA 2DURA 3AVSA 2W0XA 3CKHA 4QX5A 5T55A 5FZDA 1IZ3A 4OULA 3VBSA 1OURA 1LOGA 1CAVB 3JXSA 5FZ3A 1LKNA 4AK3A 3T3YA 3KZ4C 1KS4A 4NJ4A 5KC6A 3NV1A 1Y4WA 2SLIA 2Y60A 5J3UA 1GZWB 4CSWA 1GSLA 1JOBA 5D1IA 2QDNA 4EE2A 2ZGPA 2VR4A 2D3SA 4LBQB 4NUBA 4SLIA 1C8M1 1CZVA 1W6NA 4GB32 2WO1A 4ZS3A 1IPSA 3RWKX 2R6QA 4QM8A 3I97A 3J9SA 5AC92 2D98A 3LF7A 4TLFA 3KVAA 3I2FA 1S0JA 1ULGA 2TNFA 1ENXA 4ATEA 1LU2A 2WN3A 5FZ4A 4CDQB 1E5HA 3IBMA 3UKVA 1Z7S1 2AZ5A 2R30A 2Y8KA 3ZFGC 1R1A1 1J3PA 1W6QB 2ILMA 4XIKA 1SLTA 4CDUA 3IT8A 3V0AB 2D5FA 2GMMA 3AK0A 3WG4A 1U5IA 5F32A 2P3IA 1UYPA 1NA1B 4ASLA 3VBUB 2YB7A 1ZVFA 4XZPA 1ZNPA 3I2OA 1CZSA 1FOD3 3WQ1A 4NHXA 4NWWA 3OD0A 2MPFA 4CU8A 4YFWA 1DBNA 2RS53 1HB4A 3NO8A 5HPOA 1S2KA 1PHMA 3MIDA 4RA0A 2GC3A 1UYXA 1ODMA 2AGSA 3Q8EA 4H55A 5CFDA 1GANA 4CEYC 3MLJA 4R8HA 4OUMA 1RVF1 5HV4A 2ZMKA 3C7EA 3JBG3 4M4PA 4XDOA 4CDWB 4CEWC 1Y43B 1ZA4A 1YIFA 2CL2A 2VUAA 4WM8C 3E6BA 5EJ1B 3PTYA 4DZGA 5HBAA 3BOPA 5EP9A 3LCPA 4A6SA 2XWJB 5CFCB 3RZLA 2XJVA 1F35A 2WR9A 1H6YA 2LM3A 2W47A 5A7WA 1I9RA 4DQAA 2ZBJA 4H14A 1DCSA 1R64A 3TOJA 1LB2A 4LULA 4DNYA 4TYSA 1MEC1 1R091 1TVGA 2PFWA 2D40A 1N3QA 4L97A 4YGDA 4EZHA 1POV1 2J1TA 2D97A 2DWRA 4YGCA 4FP3A 3VZNA 3R6SA 1BYHA 1XSQA 5JR2A 5BPXA 1UXZA 1W6OA 2BP6A 1ACCA 2PA7A 2ZCWA 3G7DA 4IEXA 3CZJA 4P9WA 1F31A 3RPQA 3WF2A 4AVCA 2JG8A 3USUB 3PJQA 1RUJ2 2ARCA 5IVBA 4UFMA 2HYXA 3CJIC 1MACA 4QDRA 1NCQC 2EF6A 4MYEA 4BHPA 4DXRA 2B5HA 2WT2A 4MHRA 5B4NA 5EPAA 2ZXQA 4QX0A 4FXKB 1PZ7A 3VL9A 1OHFA 3U14A 2X5IB 4YG3A 1AVBA 2FDJA 3BU7A 4K8FA 5IHRA 1UOGA 1EP0A 4IEVA 4BQXA 3AMQA 2VECA 3VZMA 4COVA 2WT0A 4Q4V3 3ZYIB 4ET7A 5JZGA 5KXEA 2VTFA 3Q8AA 5G05L 4OUSA 4BQWA 2VC9A 2K46A 4JHZA 1YUDA 4TZDA 2Y6LA 1C8NA 3BIEA 3R4DB 2XR4A 2XVKA 2J1UA 3IDAA 4INDA 5FY1A 2MEV2 4WVWA 1XNTA 4RD7A 4UI9L 2P2KA 2QQOA 2XONA 5FYBA 4A7ZA 1T2XA 3KGZA 4FTSA 5IVYA 4ITCA 5FWEA 3MV01 4XQDA 5DUUA 1MQTA 4QPIC 1ULDA 3I3BA 1TNRA 1IG3A 4DUXA 1G9BA 1UU6A 2VNVA 5J09A 1DZRA 4PDWC 4PCRA 5A7PA 2ZMLA 4IE7A 1LOFA 1CAWA 1MVEA 2BWCA 2CV6A 4MUVA 5JDBA 4NMIA 4N9IA 3C7OA 2ETEA 2JDHA 3OBTA 4OI0A 4K40A 2C6SA 1PIV3 3WNNA 3FLTA 2Q1FA 3GYDA 3GXUA 5FYVA 2EIBA 4F83A 2W3JA 3AP4A 3EQEA 2WL1A 3VHPA 2WC2A 2I74A 2FMYA 4ZU4A 2J1EA 5FZHA 4B3NA 4JZRA 3WXPA 1A3KA 2K0GA 4FFHA 4MV2A 4OMCA 5FZAA 5C8CA 3DCQA 3THDA 2V73A 5EXOA 1XNDA 4YZ2A 4FPLA 2VW1A 5DUVA 2Z5WA 4Q4Y1 5JIUA 1BZWA 3O14A 2VCAA 1COV1 2O8OA 1XBFA 4JCKA 3DPRC 2YV8A 2WA4A 3DXUA 1OQEA 5A3PA 4QQ2A 2YC4A 1QJFA 1UMIA 1VBB3 1NCQB 5JR7B 1ND2C 1RL3A 5IFTA 5GM0A 4L92A 2UYAA 5IK8A 4OI1A 3WCRA 2LALA 1C8M3 3ILRA 3MIEA 4N9HA 3DV8A 5LBBA 3RGBA 3WP6A 4IEQA 4PT6A 1VBA2 5FLIA 2EVXA 4LBKA 1VBE2 2C9KA 3A22A 5GKAC 4DIQA 1W2UA 3JU9A 1UO9A 5FYHA 2EAAA 1RUI2 1Z7S3 4NHLA 4RGAA 2Q8EA 5KWRA 3KCXA 1DYPA 1PZ8A 3RSJA 1V6LA 2WS91 3WCSA 4XF3A 1CZTA 4YPJA 1CD3G 1UQXA 1UX7A 2AH2A 3IMNA 4LHKA 4QX3A 4QKFA 5ERLA 3VDDA 4CXYA 5DPNA 5AC91 4DRRA 2ZHKA 2YDEA 1HRV3 3IAQA 2EIGA 3MEPA 5A7WB 4LIUA 1O4TA 5DAXA 1FATA 5A80A 2HWF1 3LA2A 3BB6A 4KMQA 4NPLA 2NZ9A 5L9RA 4CA9A 3ON7A 2HWE2 4XFGA 4I3PA 2BU9A 5IWFA 3O0WA 5F2SA 2XDVA 3VBRA 1GMMA 1RUD2 1RVF3 3LPGA 4IEOA 1W6OB 3W58A 3LEIA 3C7HA 5BNPA 2WLQA 4PI2A 3M3QA 4Q0SA 1Y9MA 1JUHA 4RS5B 2HYKA 2ZKLA 3NNGA 5LY1A 4AEDA 4XZUG 3L2HA 1VMHA 1ZZCA 2QBXA 2C1FA 1C4RA 4BH9A 1FT9A 1RITA 2YU2A 4UYBA 3PHMA 1LTEA 1W90A 5J96B 1HRI2 3RZHA 2D6OX 2VO5A 2E53A 1LHOA 2VVDA 3URFA 1HN1A 4BB3A 2CDPA 3AMMA 3CF6E 1QOOA 2DFBA 3MICA 4QX7A 4AVSA 4WVZA 4BOWA 4C0HA 3CO2A 2CWSA 1F5FA 1MEC3 3ACGA 1R093 4NIIA 1XNBA 3POGA 5FY4A 1KD7A 1SQ4A 1B09A 2WNVC 1POV3 2ZAHA 5K0UA 4A3ZA 4AAXA 1ULPA 3KV4A 3GZEA 4YVWA 5HI0A 2Y6JA 5JZGB 1OF3A 4GMP1 1Y7BA 3AYAA 3KF5A 4Q0PA 5LCWL 3S57A 4XFHA 3BI3A 2VU9A 4WV8A 4FQ4A 1PGW2 5LB6A 1ND2B 1N1YA 3BTZA 4AQ6A 2VZUA 1ZZBA 2GNTA 3VN4A 4P5YA 1CAUB 1VBD2 3OGJA 4NOTA 3VL8A 1QKQA 1REEA 1FV3A 1XE8A 1VALA 4CVUA 5BNNC 5IK7A 3J26N 5C70A 2IUWA 4UW3A 4YW2A 3M2MA 3OF1A 3RS6A 3HMYA 4OI4A 1F2NA 4MOAA 2DF7A 4GIQA 3EMRA 2CTVA 2RMU2 4YW4A 1ST8A 2BNNA 3QACA 3POSA 3U4SA 3BVCA 5LWBA 1RUJ1 5CZKA 1WMDA 2OZJA 1CAWB 4FPOB 5BNOC 1X9PA 5C3OA 2C4XA 1U12A 4IL7A 3KHBA 5DAVA 3V0BB 4CP9A 2ARXA 2PXJA 3RJRA 2PN5A 2E33A 1CJPA 4TTGA 1SDDB 4Z1VA 1UY1A 4CUAA 2B9UA 3OPTA 4BQ2A 2A70A 4GZ9A 2CGPA 1NZCA 3O1UA 2VBBA 4NN0A 1LOAA 3IDEA 4AR2A 4EV0A 1NCRC 1W03A 1S55A 2CDOA 1PVXA 4LE3A 1RHI2 2FZ1A 4XTMA 4QGLA 3RMXA 2WZPP 4HVQA 2E6VA 5LY2A 2MEV1 4BWOA 1EAH2 2P3YA 2RJKA 2XB6C 3EYPA 5FZBA 2GP5A 4CDXA 4LO6B 2HBTA 4Q0QA 2OS2A 5FBZA 3DECA 2GU9A 2HWC2 2XBO2 2YROA 3QCWA 1OVSA 2NYYA 3S7EA 1G8WA 2YU1A 3G6JB 5FP9A 4ZS2A 3ZPOA 4E8DA 4N53A 1X8EA 1QOTA 4FPHA 3SEPA 3UNPA 2VUJA 1HB2A 2R16A 3NVCA 4LNVA 4Y20A 3FZ3A 4D7TA 1W06A 1W99A 2ZZQA 3BODA 1QH7A 3OCPA 4YM0A 4E4DX 2JX9A 4QT6A 1D2SA 4O9EA 1GZTA 3IAPA 3VBFC 3GZUC 2Y0OA 3ZXGA 5F6LB 3ES4A 4ZXKA 3DXTA 4CCMA 5I8SA 4Q4Y3 4Q8KA 1COV3 4YW6A 1CJDA 2R063 4AVAA 4NHYA 1CIYA 1XJAA 4CE8A 1JBCA 2ZACA 1QXRA 3K4DA 3GJAA 4PQQA 5GLTA 4AHWA 2VTXJ 1W8NA 3PJYA 1LCLA 1WBFA 4NHKA 1AXKA 2VPVA 5CB7A 1DHKB 4FPFA 3WY6A 2BDRA 2JXAA 2ZGQA 1ZRIA 3RRDA 3HEIA 3O5SA 2ZPXA 3D3AA 1HXS3 1N47A 1L7QA 1GOGA 3VBRB 3D8CA 1NUKA 2PHTA 2JDUA 5C3QA 4H7LA 3E1F1 3BUCA 1O3SA 3ZYGA 1W0NA 4QPGA 3NSTA 4AEDB 4GB33 3K3OA 5CNAA 3D0JA 3ZSMA 3AB0A 3OGVA 1GFF2 4HONA 5AC93 4A42A 1VBA1 4PBOA 4CZSA 2W92A 4QHZA 4GAZA 3T08A 1ZBE2 3ZR6A 4GWJA 4PLMA 1NZIA 2PAEA 1FMD2 2FCUA 3UT0A 3VHRA 1BK0A 4HPKB 3H1YA 1F5JA 1RUI1 1VRH3 3VZJA 2FDHA 1NCRB 2RM21 4LKDA 4AI3A 3OOXA 3ACFA 4CCDA 4IERA 5K0UB 5FUNA 1B35A 1KGYA 2VQUA 1FYUA 4Q4V2 2WWJA 4PIYA 4XTPA 4Y1VA 2QQJA 2MNGA 2PHDA 2W1WA 2JIGA 1LOBA 2P4EA 2A6ZA 2ZHMA 3DYOA 3KF3A 1UAIA 4AQ2A 1IKQA 3MDPA 3UJQA 5GJ6A 5J98B 2XMLA 4YGBA 3H3ZA 1SACA 2PAMA 2HWE1 3JZVA 4COUA 3A7QA 4N90A 5IVCA 3MIFA 4M0HA 1GQGA 4ORFA 3WINE 3ZDSA 2VW2A 2FCVA 4E8CA 5KHJA 1K5MA 4OYUA 3THPA 1TE1B 4HKOA 1V6NA 5DZFA 3PLQA 2DVGA 3LWCA 1K5JA 4KWUA 5CBLA 1QGLA 2W1QA 4GMP3 3N9LA 3PU8A 4IV1C 1JS9A 2YPDA 3OPWA 1HRI1 2QZ2A 3C7FA 1M06G 1OI6A 2QQLA 4QMAA 3GBFA 4XFAA 1IS6A 1KFUL 3LA7A 3R0RA 4S2HA 4LHSA 4XPVA 2QDRA 1RUF2 3A4UA 3O1SA 2JE9A 1FAYA 2QQNA 4F3JA 4DXSA 5C7GA 1RUG1 2CGOA 2UURA 3K4AA 1WW5A 2WO7A 2DBIA 2LRPA 2DYCA 1W6PA 1OVPA 4OZOA 4LO4B 3IWZA 3W59A 1IQAA 3WNKA 4COZA 3A21A 1DF0A 1PGW1 1RUJ3 1UMZA 4JGYA 4RQPC 1STMA 3ELNA 5K9YA 2WRAA 5LRRA 3E5QA 2Q1MA 3J7HA 1VBD1 3B7MA 2O8QA 3QD6A 4ARXA 1BMV2 3NAPC 4H7MA 3ZFEC 3GZAA 4NPMA 4QKDA 3VBHA 2W5FA 4JX0A 1VBB2 1OKOA 4QWNA 2JECA 4COYA 3PUQA 3WR0A 4GD4A 1CIWA 2Z2SB 3E6DA 3V64A 1GWMA 1WCSA 5T50A 3UV9A 4BIOA 3BOWA 1LENA 2Q5TA 5GZEA 4CU9A 1WGPA 3ZXLA 1JTZX 2AENA 2TUNA 4A45A 3O1VA 1OMIA 3ZLIA 1AJKA 4Y5TA 1ENSA 1YQCA 1UU5A 2JKBA 3WG3A 3ZXDA 3POEA 3GHNA 1H9WA 4DXTA 4IQPA 3ZN6A 5T5JA 3T4VA 1A8DA 3CQOA 4OHVA 3AM2A 3ZDVA 5CADA 5A7NA 5AFEA 2B45X 4GH4C 4I0AA 3O0XA 1UN1A 4Y5SA 1VMJA 3WW1A 1GWKA 3S5AA 3MI8A 1VAVA 2ATFA 2JG9A 1QJY2 2VD7A 3FX3A 3HT2A 5F8PA 5FLJA 2VBPA 4FPCA 1RHI1 4XFCA 3ZKYA 2QQVA 1SMVA 2GAUA 2VZSA 3WP3A 2P37A 3R4SA 2VQAA 3C2UA 1IS5A 1JZ5A 4KGGA 5FDBA 5EYXA 5LASA 3TNQA 5FOBB 1VBC2 3VZKA 2HWC1 2XBO1 1SCRA 3FMGA 5ISLA 1FXZA 1WKYA 2C24A 2YYOA 3ZN4A 2I45A 1GZWA 1IG0A 1W8TA 2Y38A 3ILFA 4MZUA 4CCJA 4NVPA 4QPGB 3RZZA 4J6GA 2VZ3A 5LA1A 1PGL2 1U5ZA 4LBQA 5JIAA 4XEZA 3WDTA 4Y4YA 4QQLA 1WMFA 2LS6A 1AYN2 3VD9A 1ZBA3 3UKNA 3LA3A 3WDUA 2XJQA 3PDQA 4WM7C 4XF4A 3VKLA 3OEAA 3SNMA 2ZJCA 4E2SA 5FYSA 3UK9A 1JHNA 4ZU7A 5JSOA 3U10A 2BYVE 4GMP0 4LOSA 4RQPB 1XYPA 1B35B 5HCFA 3T4HB 3V0AA 2LW8A 4BU2A 3PURA 4BQYA 4EN8B 5T5PA 4LBNA 2QUOA 2VMHA 5ABJB 3NAPB 1NE6A 3ZFEB 1NA1A 2QCSB 1RMU2 3VBUA 3ZYFA 2VNOA 1GQPA 3MZHA 3ZPYA 2I07B 3CNAA 3M7AA 4LK6A 2Y34A 1VBE3 2R49A 1UOFA 3WG2A 1C57A 4R9CA 3DN7A 2WO3A 3RZJA 1RUI3 4Q8LA 3ZIWA 2QJVA 4P9YA 1SFYA 1DYOA 4FVVA 4XJZA 1K5MB 2VXRA 3I54A 4CDWA 1LOCA 5FLHA 1H4HA 4IEWA 2A3WA 5FY5A 5IYYA 4HN0A 5FO7B 1O8PA 5CFCA 4IXLA 1AR62 4QKBA 4V2VA 5FZ1A 3GALA 1H30A 3ZFFC 2Q0AA 2FCTA 5I8YA 1ZBE1 3F95A 3KT1A 2G9ZA 2ET7A 1QXPA 1FMD1 1DLLA 3W20A 3ZN5A 2VVFA 4B4PA 1VE0A 1YNAA 1BBT2 2OW4A 5HCHA 2Y26A 2BTVC 2D5HA 2HWE3 4A6OA 4JHTA 1I5PA 5FZOA 1OPMA 4LHLA 1LOEA 1D4M2 3FHAA 4AFCA 4Z8BA 4XFBA 3GCWA 4YG0A 1RUD3 2IXJA 1JI6A 1GBGA 1U5YA 4W65A 1UD1A 4HSJA 4Q4V1 4QQHA 1LJ7A 2HKXA 5F3EA 4WVMB 1BQPA 3WQ0A 2RG4A 4IE5A 1LESA 2GC2A 1DDLA 4R9AA 4JGYB 5C9AC 1W0OA 2H6BA 3USUA 5I0DA 5FUPA 5JUVA 2XJUA 3SHRA 4L11A 2GN7A 3VBHB 3Q9OA 3HNYM 3JCIA 3MF9A 1UZZA 4NO4A 3M4FA 4WM7B 3GBGA 1OF4A 5FZ9A 4K21A 4HZFA 2DTWA 3ZOIA 2VMIA 3GNEA 3ZFGA 4H2AA 5FPXA 4AHXA 5ANNA 3N7KA 3PVNA 1RIRA 4YLZA 4B4QA 5F3GA 1LAJA 4KH9A 2VMEA 3M3CA 4XF9A 1Q43A 4F8AA 3ACLA 1DGWX 1VBD3 3UJOA 5JSPA 2R062 2QQUA 2ZEYA 1JYIA 3HNBM 2EALA 1IPJA 3H8UA 4IE0A 5F3IA 5C3SA 5GZCA 1QHDA 2ZGTA 3SQOA 5JSRA 2RMU3 3P3PA 4IEUA 4XJWA 1S1AA 2VQTA 4CEYA 3VBOC 1I1EA 1MZFA 2H6CA 2O1QA 2PLV2 3I8TA 4PF5A 5EWSA 5FZEA 3GDBA 1RINA 5FJHA 4QGNA 3WG1A 4CEWA 2ZTNA 4WM8A 1UIJA 2Y6HA 1OOPC 2BPA2 1C28A 1W8UA 5DZEA 1HXS2 3UYJA 1BMV1 1VIWB 3WNOA 3LB9A 1GP5A 1UYZA 3OD4A 3SCFA 3LFMA 4JDNA 1VBB1 2RE9A 1XQNA 4U36A 4M00A 3I49A 3AL5A 1RB8G 2PYTA 4AI2A 1SEFA 4X6RB 2K2SA 4C8DA 4XJAA 1EV12 3E6CC 1W05A 3J7MA 1BLZA 1VLNA 3N7MA 3NJZA 3DEMA 4P5HA 5FMOL 5GALA 2E7AA 5A3TA 4JC1A 1C1LA 1HIXA 1UOBA 1ONAA 4FOWA 4DUWA 3AP9A 3CEWA 3N3HA 4CUBA 1RHI3 3IMMA 4S2FA 4FP2A 5F2WA 1AR92 1FI2A 1H2MA 1VRH2 2HJIA 5LBCA 1HJFA 1EAH3 4Y1ZA 5FXXA 4JDMA 4I0BA 3FJSA 4IEZA 1OD3A 2D6LX 2IFRA 2HWC3 2XBO3 1VAMA 2XQXA 3AXDA 3IIIA 3HIFA 5F5QA 2KM2A 2YBPA 3TWIA 1NCQA 3J7NA 4P08A 5FQ0A 3O1RA 1PNGA 1NAEA 4EN0A 2VY0A 1LR5A 4UAPA 1QJY1 5JI7A 1HRV1 4B1LA 4X8PA 1VB2A 2BWAA 5DG2A 3W9AA 1K3IA 1GR3A 2Y64A 1Q56A 4FXGB 2EIEA 1MS9A 2DBNA 3BCWA 1RUH2 3IKWA 2EICA 2OPKA 1HKDA 4RHV2 4MVTA 4Q0VA 4OQ9A 4YM3A 2WYSA 5LEJA 1CX4A 1OKQA 1LHNA 1HX6A 1APNA 1WCUA 3A23A 2CYFA 1QQP2 4QXBA 4CUGA 1PGL1 3QBQA 2ZOEB 4ZY9A 5A7QA 3B5LB 1OXCA 4NIGA 4AGRA 1AL0G 3WF4A 1W8WA 5KXCA 3D6EA 3N9QA 3PMEA 5F7UA 5LEKA 4UXAA 2BBVA 1AYN1 4KI5M 3QLQA 5D8AC 3SH3A 1S0IA 2AEZA 4QPIA 1US3A 4LR4A 3RNSA 5KXBA 1TMF2 2AUYA 2WFF2 3HPNA 5J37A 5FZOB 3UGHA 3RMYA 3VBSC 2V4AA 5F5IA 5JI9A 2WFPA 4M3CE 4XAEA 2Y33A 4XUPA 2L9LA 5FP8A 4I2OA 1OOPB 3SITA 5LK7B 1UWWA 2GNDA 2PHWA 4ISQA 4PJYA 2DCKA 4FOYA 4K20A 1RMU1 2JDKA 4RS5A 5FMDA 3HD8B 4DS0A 2NQYA 4Z82A 3WT3A 1GOFA 5L9VA 5CISA 1A34A 4CU6A 2CAVA 4XF0A 2A6YA 5FZLA 1ZBE3 3AZVA 3RYRA 1FMD3 4CCLA 4LBLA 3U0ZA 2TBVA 2H0VA 2FDKA 5FK8A 1UX6A 2YC2A 4QB1A 3FE5A 5A3OA 3RG0A 1JYVA 1SZBA 5FKBA 5FV3A 5JWPA 2OUJA 2B42B 4JGZC 5HXVA 2WWSA 3ZFGB 5C8WA 4B1MA 2DUPA 4E2GA 2V09A 4QXHA 4BQ1A 4CDUC 1AR61 2OKXA 4HOOA 4N43C 2DVAA 3OGRA 1LRHA 1Y9QA 4QX1A 4R4ZA 1RYYA 1W2OA 1ND2A 4UW4A 5A33B 4LORA 3GM8A 1Y3TA 4N7IA 2QKDA 1BBT1 2DV9A 1CAUA 2XOMA 2AR6A 4MX3A 3WZ1A 1YJKA 4Y3OA 3NV4A 1O3RA 1D4M1 2WSUA 4D7YA 1J1TA 3GGLA 4Z07A 4AI9A 1O4ZA 2BW8A 1H9PA 1YRZA 2XXZA 2BZDA 3PIJA 1JN2P 4CEYB 4D0QA 5C4WC 5CFDC 5FZGA 3WD5A 5C5TA 1Y9GA 1IOAA 4CEWB 5F1RA 4WM8B 1M4WA 3TN91 5F9TA 4PBPA 4CCCA 2ZA9A 5CIRA 3IM0A 1REFA 3LIHA 1OBNA 5FMCA 1H1IA 2AEYA 2CWMA 1YC61 1YQ2A 1RUF3 1K45A 1AR82 2R1BA 3V0BA 1WLWA 1ZZ8A 2DTYA 5LA9A 3OGGA 4IW3A 5A6ZA 5GLWA 1DGRN 1US2A 5EYYA 4FAGA 2Z4FA 1Q8PA 3DKWA 5E16A 3AMPA 3WNMA 3MW4A 5L7OC 2PHFA 1ZBA2 3FN9A 5EZWA 2IVJA 3WP5A 2CAUA 1HQNA 1OA4A 3RFRA 4AAPA 1ZREA 2WABA 4B4RA 1QU0A 5L36A 4W6WA 3OUIA 3NKTA 2R061 3WW4A 3ZMOA 3CJIB 4UT5A 4WBBA 5FMBA 2DCYA 5FQ0B 5IUQA 5GLVA 2NP0A 4JKKA 2XGXA 5BY5A 2V5YA 2VOKA 2OA2A 1WBLA 3DYMA 2A3XA 3EHKA 2PQSA 4RR3C 1DZTA 2XKOA 4OHXA 3WW3A 1D2QA 1ULOA 1LEDA 1HXS1 2A6VA 3AJZA 1GZ9A 2VULA 1TME1 1NE4A 3LD8A 3I7DA 1TME2 1T6BX 4XETA 4YYOA 3RI9A 3AZYA 4MGZE 1F4HA 2J1SA 4JAAA 2VZ1A 3TN92 4KL1A 1OA2A 4N43B 1OLMA 3ZYBA 2ZGLA 1E5RA 4PI0A 3HWJA 3K3NA 5L19A 2PHLA 2ERFA 4AI0A 1EV11 2GNBA 3ES1A 4GB31 3MW2A 4XUOA 1H4GA 3POJA 1GUIA 1JHJA 2VOVA 4XJUA 3PVEA 3FUQA 4FFGA 4CYDA 3HQRA 1QJY3 4RYDA 1AJOA 1NY72 5BNNA 5JMOA 1H8TC 4QPIB 1X9TA 2OXBA 2VJXA 3FFZA 1MQTC 4XBLA 1AR91 1O4YA 2QQWA 1VRH1 2VMGA 4Q4X2 3TRSB 4BXSV 1RUC2 4L2NA 1YCIA 4Q1PA 5DZGA 2W1SA 1YQ5A 5FRAA 5I0SA 1V00A 4PDWB 2R072 4PLNA 1VAKA 4IETA 4Q4W2 1VBC3 2WQ8A 1ZZ9A 1PK6C 1KS5A 5BNOA 2XLGA 1SLBA 1LOFC 1AX1A 3P5BA 5FMOS 3R4UA 2WBKA 5BNQA 3RZMA 5FZ8A 4AEJA 3I2KA 5FBJA 1CX1A 5T3NA 1HW5A 3NWKA 4MGIE 1AYN3 1DYKA 1KFXL 2ZX0A 4RSUA 1PO22 1RUH1 1D0HA 3JQWA 4LEJA 1W9WA 1OQDA 3KD4A 1SFNA 4RHV1 3TB0A 3OBRA 2VM9A 4HPKA 3WSOA 2JICA 5H9PA 3ZXFA 1NCRA 2OQ7A 4GJZA 3AVRA 3MF6A 4LXLA 4XQWA 4E2QA 2W1UA 3TNPB 3ZR5A 1ND3C 3H3UA 4KG8A 3KS7A 4COWA 2DVBA 5E1RA 5JCTA 5FOJB 4AGGA 1QQP1 1NT0A 3AZWA 2AYHA 1L3JA 5EJZB 5EV7A 2XVLA 4K9SA 3DPRB 4MGYE 1RMU3 3B9IA 1JOPA 3KV6A 1FX5A 2P1BA 3SMHA 1W2TA 2XLAA 4URAA 3QOPA 3MIBA 1TMF1 2WFF1 3FL7A 3VD5A 2FDIA 4AOCA 4CU7A 2FZ2A 4XDPA 5EFUA 3EBRA 1CAXA 3VD4A 1GYKA 5JOYA 1DGWA 1KDMA 2A1XA 4IEYA 3SLIA 1A6CA 1AUYA 3BGAA 5FFOC 3VBFA 3SKJE 3MHZA 3LQCA 4QXKA 1BHGA 4FPYA 4R9BA 4A2UA 1XYNA 2RV9A 3VHNA 1AR63 3ETPA 2OPWA 3DGTA 4MHUA 1V6IA 3OYWA 4EN9B 4FPJA 2WJSA 2BJSA 4NRPA 2RDRA 2KA3A 1DQ6A 1DQ1A 1BBT3 1Q8OA 2RJ2A 3V65A 4B8EA 5HXMA 4IGOA 1NLRA 1H8TB 1PVC2 2GZWA 4XE9A 4M3CF 1D4M3 5LA0A 5DN2A 5K4LA 2ZGSA 5KC5A 1NOVA 2DU0A 1BKZA 1H8VA 1S0BA 2YBKA 3AJYA 4EN6B 2D44A 1LECA 2VXJA 3CLPA 4GWMA 3WP4A 2VW0A 2N7GA 4GJYA 4JRLA 1PM7A 1YFXA 3NNFA 3VB9A 2BVBA 2OIIA 2ET1A 4XYXA 3T1MA 3SISA 2J42A 2R7EB 3S6PA 4BPZA 1ZYBA 5BNPC 2WZR2 1UZ0A 5EIYB 5A3NA 3RVHA 1JYWA 5KXDA 3KV5A 1PNFA 1X36A 3K48A 4IDZA 5AVPA 2PMWB 3Q8FA 3VLBB 3EB7A 2JDZA 5IW0A 3AMNA 2JIJA 4X8NA 4AZZA 4XCBA 1U0AA 2LUWA 1CESA 4I3GA 3U11A 2ARBA 1Z78A 4NRMA 2VH9A 2P34A 5GLUA 1XYOA 1DU3D 2HH9A 2WNVB 4HETA 4GWIA 3T1LA 1JZ7A 1S0FA 2UWBA 1BK1A 2JB8A 3WNXA 4FFFA 1AR81 4AG4A 3T2QA 3N7LA 1EPWA 1LU1A 5K8SA 2ZAAA 2XKPA 4DINB 2IZWA 1YJLA 4QB2A 2BGPA 2BUKA 3JQXA 4OLLA 4V1PA 1LGCA 2P17A 5T52A 4X6QB 4LLOA 5A6QA 1JYTA 3OSDA 1LGBA 3LDBA 5BNNB 1MR5A 1W9TA 1UL9A 1ZBA1 2PLV3 3EO6A 4HVOA 1VRBA 4I09A 4IE4A 4B7KA 4AFDA 4EROA 4FOQA 1W04A 4K1YA 1OH3A 1GICA 1YYNA 5KHGA 2J1AA 4XXPA 1JZ8A 2D43A 5IK5A 1MS0A 2IVIB 3KT4A 1KJLA 4AYUA 4Z2AA 4I30A 3FHQA 2RJLA 3WV6A 4IV1A 1ZRRA 5BNOB 2XL9A 3AMHA 1HDKA 2X05A 3FBMA 1UCXA 4M0NA 1RGSA 4A3XA 3ZVXA 2ZX3A 4OUEA 2ZGRA 4XF1A 3LDRA 3T2PA 1EV13 4MGSA 1P8JA 1ZZ6A 2G9GA 2UU8A 1NQDA 1DGLA 1PMJX 1OLQA 1D4VB 4A41A 5C3PA 3S0MA 2WLPA 4UFKA 1W3XA 1IHMA 1PMHX 2VCMA 1VBE1 1X33A 2ZGUA 3ILNA 2XJSA 2HWB2 1Q3EA 1AR93 4K1ZA 4M4RA 1SCSA 1ULFA 1UNBA
chains in the Genus database with same CATH topology
4AVVA 3FLRA 4GA9A 1TQ5A 4L8QA 4MXVA 4RQPA 4J1WA 4P14A 1UW8A 4I01A 4B29A 1W39A 2DCZA 1X8MA 5ABJA 3NAPA 3B00A 3ZFEA 1AL23 3GHMA 1NY71 1UKRA 1REDA 3SCGA 4YRDA 1AHSA 4IV3C 5JVVA 4Q4X1 4OHZA 2XL7A 1BVP1 1RUC1 1RUH3 2WQZC 1OQ1A 1CAXB 4Q1RA 1F8VA 4RHV3 2R071 3CL1A 4Q4W1 1Q8QA 1RUD1 2X53S 4D69A 2OZ6A 3VBFB 1XRUA 3LOBA 1QQP3 2C9AA 4P9JA 4GKYA 3AKPA 1G7YA 1GNHA 4E4ZA 4L9BA 3C3VA 3RYKA 4AQSA 4GH4A 1PO21 3OYWB 3UKTA 4LA2A 1J3QA 3VGIA 3JUUA 2EXJA 3E5XA 1TMF3 2WFF3 4C1XA 4MH0E 1GV9A 3IDCB 1J1LA 1SLAA 1C3HA 3MPBA 4URTA 1UIKA 5CAZA 4AFAA 2IXHA 2NPIA 2GH8A 4WVMA 2QVSB 1JW6A 2XVGA 3MLKA 3BTAA 2R32A 2XLFA 3R05A 2BQPA 4GWNA 4R52A 3JB8A 2BEOA 1GLHA 1QY4A 2XHKA 2FBEA 2Y0IA 1G9DA 2ZX2A 4FSJA 3EXUA 3B02A 4OFGA 1AX0A 2RMU1 4WM7A 1TNFA 1WMEA 2RS12 4KGQA 1RUNA 1XU2A 4FQZA 3N7JA 3KSCA 3A0KA 1EY2A 1V9U3 2JD4A 1AR72 3IDBB 2VNRA 4D7SA 3HQXA 1PVC1 1YLLA 1IS4A 4AI8A 5CG9A 3WDVA 4XQ4A 4DXZA 4IV3B 2ES3A 1S0EA 4O9GA 4Y1XA 2UWAA 4YZ3A 4P9GA 3ZMNA 4LBJA 4D3WA 1IPKA 5DXDA 4GALA 2PHRA 2IFWA 1JOJA 2UYBA 4AHZA 4YARA 3D5OA 3KB5A 1JUIA 2Z69A 1EAH1 2WZR1 5ACA2 3RWNA 4EJRA 1H1MA 3O12A 4IV1B 4HANA 4XFFA 1AR83 3M70A 3AKQA 3KLSA 3ZFFA 4HSLA 3O0VA 3ZSEA 4XBNA 4A7YA 4E9KA 2YGLA 1UPIA 4Y5Z0 1DFQA 1SBFA 1Q8SA 1YO8A 1CN1A 3GF6A 3IPVA 5FO8B 3M1HA 3ASIA 1QJX2 3WUDA 4ES9A 3ENRA 4BLIA 5C9AA 4FTEA 4UBGA 1IS3A 2ZX4A 4UW5A 1YXWA 1WUVA 1N1TA 5GZDA 1VJ2A 3EJKA 1XU1A 3N36A 2K9ZA 3AZXA 1WA4A 1WLCA 1ZM1A 2GALA 2WINB 4NR1A 2A71A 2WNUC 2XH6A 4QU2A 4QGMA 2ZHLA 1QF3A 1R082 1TME3 1GQHA 3TN93 4BZ4A 3J8F2 4HMZA 4W6XA 1NQJA 1YFWA 4JV4A 2D7FA 2QFEA 3BIWE 3L2YA 1MZ6A 2A6XA 4GH4B 4LT5A 5F6KA 1KDKA 2HWB1 2B39A 4HT1T 5BYNA 4P9XA 4Q4X3 1LULA 1RUC3 4GULA 3RYPA 2R073 4XOGA 4OHYA 3H7YA 1A78A 1SBEA 4Q4W3 4OZXA 1GKBA 3AFGA 2NLRA 1OOPA 3AKSA 3FUOA 5BUVA 5DDJ2 3TYJA 4ES8A 4JTNA 4P9LA 1QJU3 1QWRA 2VOWA 3L9JT 1O5LA 1CR7A 1PO23 5H9RA 1WD3A 4KU8A 2GMEA 1QMJA 1X82A 2NN8A 4CDQC 3KM5A 4XMIA 2D6PA 1URXA 2PTMA 1S0GA 4FO9A 2WQ4A 1JXNA 3OTFA 4LTAA 3VKOA 5A33A 1RUF1 3PNAA 3SCHA 3WOGA 3VBUC 2ZABA 4EN7B 1ZX5A 1RUE3 3H1MA 3LSDA 2D3PA 1ALYA 4CP1A 4BE3A 4U2AA 3LGRA 3AP5A 5C33A 3OY8B 4YVSC 1FPN2 2C5DA 4CDWC 2W68A 3AX4A 3KCCA 2XJTA 3ZIXA 1QNWA 4W6YA 5GLZA 4HN1A 4XXAA 3ZFFB 1PVC3 2X29A 5D8AA 3NV2A 1FNYA 3CU7A 3ZO0B 2GDFA 2R042 2RS11 1XXNA 3INAA 4YM2A 1J59A 2PHUA 4HK9A 3H0OA 3IPVB 2UWCA 1AR71 5AVAA 1WW6A 3WHTA 2WZR3 5C9AB 3PVBB 1SDWA 3B93A 1OA3A 4QD2A 3ZSJA 3CJIA 2F4PA 1MZ5A 4Q29A 2WS92 4AFBA 3N35A 4JVAA 5IT6A 4UBHA 1AL22 1DQ0A 1O91A 4TWTA 4C1WA 1SLLA 1I5ZA 1Z0HA 2X5IC 2HWF2 5A32B 4BM8A 5ACA1 4JGZA 2D6KA 3HAGA 1KITA 3LAGA 4XMAA 1VBC1 3RQ0A 3POYA 4FPEA 4N43A 4YW1A 5EJ3A 3FLPA 1PO12 4DB5A 4FPGA 4NHMA 3U07A 4MLOA 3AKRA 4CP0A 1F9KA 4G3YC 4YW5A 1OPOA 1N3PA 1T6GC 2HEVF 1QJX1 4DY5A 1PMIA 4F7ZA 3FWEA 4S2GA 4XILA 3VBOB 1V6OA 5C4WA 4ZKTB 3WHUA 1N1SA 1OFSA 4PDWA 4YVSB 3AYCA 2RS32 3K51A 3GZTB 2RR12 2YGMA 1CVNA 5T5OA 2YHJA 1YI9A 2B7YA 1U5XA 2VVEA 1QOSA 5I0UA 4LBMA 2CY6A 5FREA 1H0BA 3QH7A 1W0PA 3ZYJB 2E7TA 4LUKA 2JEMA 2QNKA 3HT1A 1R081 2HWB3 5A3LA 1ENRA 2OVUA 3J8F1 5L7OA 4XHBA 5HCBA 4YW3A 3I4IA 2DVDA 4UW6A 2MHFA 4LHNA 4XIOA 3T2TA 3USSA 5E8AA 4EWDA 3DPRA 5I0TA 3B9CA 4FCAA 4E27A 1V9U2 4ASMB 2W08A 2WIIB 1AYM2 1QNYA 3WW2A 4RR3A 5FPZA 3B69A 1GZCA 1HV0A 5DDJ1 1X7NA 1G9AA 3NW4A 4HKWA 1QDCA 1LEMA 2HWD2 4LBOA 4AQTA 3PVOA 3RDIA 5JPNB 5D8AB 2NM1A 1UU4A 1H8TA 2X8KA 2QE3A 1QDOA 1NYWA 2GC1A 1KQRA 3NKGA 5KBFA 3FHIB 4QQOA 3VBSB 3WDWA 4K3UA 4CP2A 5A3MA 1G9CA 1PK6A 2C0ZA 3ZSLA 4NPRA 4Q27A 3FC0A 4TSVA 3LSEA 2PAKA 5H9SA 4QPYA 3MPPG 2A73B 4LO8A 4R4XA 4RS5C 2JG8C 1MS4A 3NL1A 1H2LA 4AI1A 4I0WB 1W6NB 1UF2C 5I93A 1FNZA 5T54A 2RS13 2PLV1 4ISRA 5J48A 1MZEA 5I0RA 5DUWA 4YZ4A 2WT1A 1FPN1 1PZ9A 1ND3A 2XPJA 1DQ5A 1C5HA 1HQLA 2WNVA 4JGZB 2DUOA 2DU1A 1SLCA 4DOUA 1AR73 4CDUB 5JZGC 4HBNA 3IN9A 1ULEA 1VB4A 3AKTA 4KG0A 3M3IA 4RGGA 2R041 2IXIA 2PELA 1QH6A 2IC1A 4FOVA 4FAHA 4S2DA 3MGUA 2GC0A 4Q26A 5I91A 3NV3A 2XWBB 3ZSKA 1SLIA 1RTVA 4DFSA 1AX2A 4XBQA 2PHXA 5C4WB 5ACA3 5CFDB 4AW7A 2EAKA 1VP6A 4QQPA 5K7PA 3H7JA 4META 2RM22 2R1DA 3N4MA 1R1A3 3D82A 4JRAA 1G9FA 4PIZA 4LO7A 5BV6A 4B7EA 1BEV2 1CPMA 4LO5B 5FCCA 4A7KA 2KXLA 4KWKA 2F6BA 1V6JA 1AL21 2Q8OA 2E7QA 1TEIA 2Q1ZB 1QJU2 1ZZ7A 3AYDA 2XG3A 2QZ3A 1QJX3 1WCKA 2DUQA 4XJ8A 5L7OB 1BCXA 3DUIA 4BIFA 2YY1A 3AXEA 5C8CC 3ATGA 2NMOA 1PO11 2R0HA 4OI2A 3V56A 1XE7A 3H1WA 3AZZA 1MVQA 4E4SA 4Y22A 5KHKA 2JG8B 5JOWA 2JJ6A 1OLRA 2QQPA 4YGEA 4RFT0 1ASJ2 2VNGA 4BYYA 4Q0UA 4LLFA 2YPJA 2A75A 4RR3B 1KXGA 1R083 1H2NA 1S2BA 2Z79A 2RS31 2IWGB 3E97A 2RR11 3J8F3 2TEPA 1RUE2 1W6MA 1LHWA 1RUG2 4YZ5A 4WVVA 2LTNA 3AFKA 2BVVA 2E9QA 1IKPA 1WLDA 1S0CA 3ST7A 3ZYRA 2BNOA 2RHPA 3VDDC 2EA7A 1C1FA 1MS8A 1X50A 4WZCA 3WQ7A 4KU7A 2D6NA 3JD72 5BXXA 3OJBA 1MQTB 1H2KA 3GBWA 1YHFA 5J36A 4I02A 2D6MA 2IXKA 4N7UA 4SBVA 5CG8A 2W52A 5JAXA 4YNIA 2YC0A 3O7OA 4KWJA 5DDJ3 5CVRA 1PK6B 3ETQA 3VBRC 1LGNA 1V9U1 1A8MA 4YM1A 1AYM1 2ZZJA 3H50A 4JTOA 1O7FA 3AP6A 4AEDC 2D3RA 2I2SA 3APBA 1LHUA 2E51A 3B3QE 4AF9A 1LHVA 1DGRA 5SV8A 4AWDA 2B46X 1O3TA 1ZRCA 5CA6A 3MFAA 1Q5OA 2EXKA 4G9SB 3MFCA 3S30A 3VZOA 4AGVA 5C8CB 1ND3B 2A5ZA 5C6CA 2YMZA 2D93A 3FFQA 2HWD1 5K0UC 4YVWC 2BFUL 4LBQD 4DMIA 1WW4A 2GH2A 2ZGNA 3E5UA 4IV3A 4WZFA 3I59A 3VHOA 2GNMA 3MIHA 1FOD2 4YSFA 4Z2WA 4YZ1A 1FPN3 2RS52 2ENRA 5HCAA 4ZU5A 4L99A 1WW7A 3JBG2 1N1VA 5FAXA 1S0DA 1MS1A 1WLTA 2R043 3AP7A 3VDDB 3P3NA 4J1XA 4Y24A 1EPZA 4CRQA 3TAYA 2OYZA 3PMSA 4XW3A 4EWAA 2FMDA 4R9DA 4XHXA 5IK4A 1POV0 2ZGOA 2VOXA 1O5UA 5TSWA 4K7JA 3WDYA 4AVTA 5BNPB 4BA6A 2WS93 2DCTA 4Y22B 4BLJA 3HR9A 1KJRA 4LUMA 1AF9A 5DG1A 4CDXC 3JB4C 4YFZA 1Q8VA 3H9AA 1QXJA 2SBAA 4C0BA 4N53C 2HWF3 3THTA 4DRVA 3ZYPA 3B94A 5JOXA 1BXHA 4IEPA 5L73A 2UY8A 1W6MB 3LKJA 3CJXA 4YG6A 1BEV1 2JE7A 4Y1UA 3D0SA 4PLOA 4YVWB 1PO13 1YWKA 3ALQA 2ZX1A 1RUOA 3ZXJA 5JLVA 1QJU1 3WVJA 4H3WA 2DVFA 2BNMA 1NLSA 2ZGMA 3I2DA 3VUOA 2R0FA 4G4FA 2A6WA 4HL0A 1V6KA 1CPNA 2RS33 2RR13 1LODA 1CQ9A 1HLCA 4QHBA 2E63A 4K6BA 3ZXKA 1VR3A 2VQ0A 4DPNA 4JQRA 1ASJ1 1XNKA 2HEWF 3DL3A 1NG0A 5LRSA 2DFCA 2HEYF 4QPGC 3WLUA 4AEKA 1PIV2 5FTTC 1E57A 1YFYA 4JDOA 3KCYA 4KQ7A 1RUE1 3SXWA 4FTBA 1DIWA 2PQQA 1UZYA 1IGOA 4BMEA 2VGDA 4KWLA 3VZLA 2Q4SA 2XUMA 4BMBA 1BJQA 2GN3A 2FQPA 4XFIA 2FHRA 4PQ9A 1OSGA 1B35C 4XDQA 5E88A 4HLTA 1D0GA 1YFUA 5KHHA 4OHWA 2O0OA 1AYM3 5ABJC 4CDXB 2YXSA 3JD71 1WD4A 4XJ9A 1V70A 1YIPA 3MYXA 2ZMNA 1ZRDA 2WA3A 3I59B 2WNUA 4N53B 1DQ4A 4Y20B 2W39A 1BVVA 4M3CA 4ONUA 1C8M2 2IXCA 4Y26A 3ZX7A 4AHYA 1RC6A 1AZDA 2BGCA 1HQWA 5LK5A 3OY8A 3RI8A 1K5MC 2Z42A 1UKGA 1EYBA 4CTEA 5JPMB 2WSVA 2AREA 2HWD3 3IIAA 3KMHA 4GXLA 1GNZA 1Z7S2 2MEV3 1CGPA 1I6XA 4MXWA 1R1A2 4AEMA 3QH6A 3BPZA 5GZGA 2A7AA 2H0BA 2GSYA 4RL7A 5CU1A 1J3RA 3MW3A 1HRV2 2P3KA 4FT8A 5E89A 3A0NA 4HKLA 1FV2A 1CAVA 3LZZA 3TBDA 3OPZA 3SH5A 4ATFA 4C91A 3UL2A 4M01A 1RJ8A 4P9IA 1RVF2 4JGYC 1PGSA 1MS3A 1R1ZA 2NMNA 2ZS6B 2OUHA 5DUXA 3WUCA 3ZXEA 5AFBA 1FOD1 3VBHC 1RJ7A 1G6NA 2ZHNA 5JOZA 4Z92B 3BALA 2RS51 2WNEA 2P3JA 4AVBA 3MLLA 3ROUA 2BFUS 5A32A 2JENA 5I8TA 4CDQA 2XJRA 3ZXAC 3MIGA 1MEC2 3JBG1 1W6QA 1R092 4OVEA 5FO9B 1XNCA 1DZQA 1G86A 3HN1A 3ME2A 1C5IA 1DQ2A 5J7MA 1JYCA 2CGNA 1MS5A 3J4UH 1CONA 3KT7A 4GQ7A 4QM9A 1I3HA 1VBA3 1QJZA 2UY9A 3M3EA 5T5LA 2A3YA 4MGKE 3WX5A 2G4IA 4HK8A 4HVRA 2JG9C 3VBOA 2XJPA 2RM23 1J58A 4KBBA 4YVSA 4LA3A 1BEV3 2EXHA 5H9QA 3HBZA 3RJ2X 3S7IA 3AYEA 4NWVA 4KNCA 1JH5A 1NXMA 1AXYA 3VKNA 4HFSA 5B2GB 2GMPA 1O3QA 3FBYA 3B01A 4PIXA 2EXIA 3WDXA 1V6MA 4AFMA 4AE2A 3D4KA 3M8LA 2G9FA 1W6PB 1ULCA 1KRIA 3VV1A 3DF0A 3LOIA 1SBDA 2WKKA 4Q2FA 2YZ4A 4GKXA 3M3OA 4FPKA 2ZGKA 2B8MA 2IXLA 1HRI3 4MSVA 2DCJA 1ASJ3 4Y1YA 5GZFA 1YI7A 1NA1C 5KHIA 5SV5A 2WNUB 2X5IA 1ZRFA 3POWA 4M3CB 3KQRA 1RUG3 2VG9A 3SH4A 4FBFA 3VKFC 2YUEA 1OD5A 1UPSA 4BCUA 4DY3A 1NXD1 4D94A 5JMCA 3ZN6B 1PIV1 3VKMA 3KGLA 1DG6A 4MXWB 4Q4Y2 1AXZA 2ZKNA 1OFNA 1COV2 5CFCC 4AXOA 4C90A 3U4XA 3X29B 4IESA 3JD73 1HV1A 1N3OA 4LE4A 1H1AA 1WCDJ 2Q30A 4EWEA 2CNAA 2JG9B 3ECQA 1ENQA 2DURA 4QX5A 2W0XA 5T55A 3VBSA 1IZ3A 4OULA 1LOGA 1CAVB 1LKNA 4AK3A 3KZ4C 1KS4A 5KC6A 3NV1A 2SLIA 5J3UA 1GZWB 1GSLA 5D1IA 2QDNA 2ZGPA 2D3SA 4LBQB 4SLIA 1C8M1 1W6NA 4GB32 2R6QA 4QM8A 5AC92 3J9SA 2D98A 4TLFA 2TNFA 1S0JA 1ULGA 1ENXA 4ATEA 1LU2A 4CDQB 3IBMA 3UKVA 1Z7S1 2AZ5A 2R30A 3ZFGC 4CDUA 1R1A1 1J3PA 1W6QB 2ILMA 4XIKA 1SLTA 3V0AB 3IT8A 2D5FA 2GMMA 3AK0A 3WG4A 1U5IA 2P3IA 1NA1B 4ASLA 3VBUB 1ZVFA 4XZPA 1ZNPA 3WQ1A 1FOD3 4NWWA 3OD0A 2MPFA 4YFWA 1DBNA 2RS53 3NO8A 1S2KA 1PHMA 3MIDA 4RA0A 2GC3A 2AGSA 4H55A 5CFDA 1GANA 4CEYC 3MLJA 4R8HA 4OUMA 1RVF1 2ZMKA 3JBG3 4CDWB 4CEWC 1Y43B 1ZA4A 1YIFA 2CL2A 2VUAA 4WM8C 3E6BA 3PTYA 4DZGA 5HBAA 3BOPA 3LCPA 2XWJB 5CFCB 2XJVA 2LM3A 4DQAA 1I9RA 2ZBJA 4H14A 3TOJA 1LB2A 4LULA 4DNYA 4TYSA 1MEC1 1R091 2PFWA 2D40A 1N3QA 4L97A 4YGDA 1POV1 2D97A 2DWRA 4YGCA 4FP3A 3VZNA 3R6SA 1BYHA 5BPXA 1W6OA 3G7DA 4IEXA 2PA7A 2ZCWA 4P9WA 1F31A 3RPQA 4AVCA 2JG8A 3USUB 3PJQA 1RUJ2 3CJIC 1MACA 1NCQC 2EF6A 4MYEA 4BHPA 2B5HA 2WT2A 4FXKB 1PZ7A 3VL9A 1OHFA 2X5IB 4YG3A 1AVBA 3BU7A 4K8FA 1EP0A 4IEVA 3AMQA 2VECA 3VZMA 4COVA 2WT0A 4Q4V3 3ZYIB 5JZGA 5KXEA 4OUSA 1YUDA 4TZDA 1C8NA 3R4DB 2XVKA 4INDA 2MEV2 4WVWA 4RD7A 2P2KA 4A7ZA 3KGZA 4FTSA 4ITCA 5DUUA 4XQDA 1MQTA 4QPIC 1ULDA 1TNRA 1G9BA 1UU6A 5J09A 1DZRA 4PDWC 4PCRA 2ZMLA 1LOFA 1CAWA 1MVEA 2BWCA 2CV6A 4MUVA 5JDBA 4N9IA 2ETEA 3OBTA 4OI0A 4K40A 1PIV3 3FLTA 3GYDA 4F83A 3AP4A 3EQEA 2WL1A 3VHPA 2WC2A 2I74A 2FMYA 4ZU4A 4B3NA 3WXPA 1A3KA 2K0GA 4MV2A 5C8CA 2V73A 5EXOA 1XNDA 4YZ2A 4FPLA 2VW1A 5DUVA 2Z5WA 4Q4Y1 5JIUA 1BZWA 3O14A 1COV1 2O8OA 4JCKA 3DPRC 2YV8A 2WA4A 1OQEA 4QQ2A 1VBB3 1NCQB 5JR7B 1ND2C 1RL3A 5GM0A 4L92A 2UYAA 5IK8A 4OI1A 3WCRA 2LALA 1C8M3 3ILRA 3MIEA 4N9HA 3DV8A 3WP6A 4IEQA 1VBA2 5FLIA 2EVXA 4LBKA 1VBE2 5GKAC 1W2UA 3JU9A 2EAAA 1RUI2 1Z7S3 4NHLA 4RGAA 5KWRA 3KCXA 1DYPA 1PZ8A 3RSJA 1V6LA 2WS91 3WCSA 4XF3A 1CD3G 2AH2A 3IMNA 4LHKA 3VDDA 5AC91 4DRRA 2ZHKA 2YDEA 1HRV3 3MEPA 2EIGA 1O4TA 1FATA 2HWF1 3LA2A 3BB6A 2NZ9A 4XFGA 2HWE2 4I3PA 3O0WA 3VBRA 1RUD2 1RVF3 4IEOA 1W6OB 3W58A 5BNPA 2WLQA 3M3QA 4Q0SA 1JUHA 4RS5B 2HYKA 2ZKLA 4AEDA 3L2HA 1ZZCA 4BH9A 2C1FA 1C4RA 1FT9A 1RITA 3PHMA 1LTEA 5J96B 1HRI2 2D6OX 2E53A 1LHOA 2VVDA 3URFA 3AMMA 3MICA 3CF6E 1QOOA 2DFBA 4AVSA 4BOWA 4WVZA 4C0HA 3CO2A