4MUVA

M. loti cyclic-nucleotide binding domain mutant displaying inverted ligand selectivity, cyclic-gmp bound
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
142
structure length
142
Chain Sequence
GSQEVRRGDFVRNWQLVAAVPLFQKLGPAVLVEIVRALRARTVPAGAVICRIGEPGDRMFFVVEGSVSVASPNPSELGPGAFFGEMALISGEPRSATVSAATTVSLLSLHSADFQMLCSSSPEIAEIFRKTALERRGADASA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Determinants of ligand selectivity in a cyclic nucleotide-regulated potassium channel.
pubmed doi rcsb
source organism Mesorhizobium loti
molecule tags Nucleotide binding protein
molecule keywords Cyclic nucleotide-gated potassium channel mll3241
total genus 43
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4muvA00
3E5QA 3TNQA 1FT9A 1LKNA 1L3JA 5JCTA 2D40A 4IEPA 1WGPA 1J3RA 3MZHA 1LR5A 1QY4A 3FHIB 2OZ6A 4BIFA 2OA2A 5FQ0B 4WBBA 3CEWA 1O5LA 2XGXA 3WW2A 1PM7A 1GQGA 3UKNA 4A2UA 1X7NA 4HVRA 4I0BA 4QGMA 1ZRCA 2GU9A 4AQ6A 4F7ZA 3FX3A 4IEYA 4Q29A 1J3PA 2XKOA 5FLHA 3RYPA 1CAXB 2QCSB 2VPVA 4FBFA 2B9UA 3RYRA 1LRHA 5AVPA 1ZRRA 3LA3A 2Q0AA 1PMIA 4KU8A 1NE6A 1DGRA 1OMIA 4UXAA 4GULA 1I6XA 3ELNA 3RYKA 2XLAA 4IEQA 4LEJA 1CAVB 3H8UA 5JAXA 4HSLA 3EHKA 4XEZA 2GAUA 1UIKA 3H7YA 1UIJA 5HI0A 2XLFA 2Z2SB 2Z69A 2ZCWA 1G6NA 1QWRA 2PAMA 5J3UA 2UY8A 5I0RA 5JR7B 5KHKA 3KSCA 5LRSA 1EP0A 1O7FA 4QGNA 4UBHA 5KHHA 4O9EA 3VHRA 1CAXA 1ZZ8A 4LA3A 2PHDA 4LTAA 3H3UA 2GH2A 1IPKA 4LUKA 3L2HA 1HW5A 3BB6A 4R8HA 2MNGA 2H0VA 2PQQA 2N7GA 4AVCA 1RTVA 5KHIA 1NZCA 4I3PA 4N9IA 3EO6A 5JSOA 1UPIA 4HZFA 5KHJA 4XFBA 1XE7A 4EROA 5FDBA 4EV0A 5BUVA 4ORFA 3E6CC 1NXMA 2MHFA 2V09A 3B02A 3USSA 4PIYA 2QVSB 3LA2A 5I0TA 4E2QA 5F1RA 1WA4A 1ZZBA 3OF1A 4MH0E 1CGPA 5LRRA 4IESA 2GC1A 2D93A 3ZDSA 1Q43A 4MGKE 4LA2A 4YARA 2VQAA 3IBMA 4JTOA 3NVCA 4R52A 2ET1A 3U0ZA 1J3QA 3NJZA 4I09A 4XF4A 3I59A 4QM8A 2Q4SA 4IETA 3DL3A 2O1QA 4XF3A 4ZU7A 1DZTA 4HVOA 2PHLA 4YYOA 2XL9A 5BPXA 1YWKA 1NYWA 3E5UA 4MV2A 4XFGA 1EPZA 3FFQA 4BH9A 1O3TA 4YNIA 4X6RB 1J58A 2IXJA 2PYTA 4QXKA 3S7IA 3RDIA 2MPFA 5I93A 2Y0OA 2EA7A 3U10A 1LB2A 4ZU5A 2PAKA 3ES1A 5I8SA 1ZNPA 1NE4A 4KWKA 1ZZ6A 4FAHA 3M70A 1YFYA 4LLOA 2KXLA 3IWZA 4DINB 1EYBA 1SFNA 2OPKA 4PIZA 1SEFA 3H1WA 1ZZ7A 3RNSA 4XFIA 2IXCA 1CAWB 4AVAA 4XETA 1ZRDA 4QX5A 4MZUA 2K9ZA 2UY9A 1ZREA 2O8QA 5BV6A 3PNAA 3D0SA 3D82A 2FQPA 4XF1A 4FT8A 2GC0A 2D5FA 2BNNA 1IPJA 3EJKA 3MPBA 1GQHA 3LA7A 4OLLA 2Q1ZB 4EWAA 2BYVE 4JVAA 3I7DA 3GYDA 5FCCA 5FLIA 3H7JA 1DGWA 3G7DA 4ONUA 3BPZA 3CL1A 2E9QA 1J1LA 3FZ3A 3FJSA 1U12A 1Y9QA 3KGLA 4HN0A 4I01A 3OTFA 3BCWA 4Q0PA 5C6CA 4QMAA 4IEZA 4FAGA 4EWEA 1I5ZA 2BGCA 5E1RA 5T3NA 4Z82A 4P9GA 2UYBA 1RUOA 3I59B 4NVPA 4L2NA 4HSJA 4F8AA 3RZZA 1H1MA 3IDCB 1OD5A 2H6CA 3SMHA 3DKWA 2ETEA 3IIAA 4EWDA 2XKPA 4MX3A 4HMZA 3WW1A 3FE5A 5I0UA 2H6BA 2ZKLA 1FI2A 3PLQA 3FWEA 4KWJA 2ET7A 3E6DA 3NW4A 3HT1A 5I91A 2PAEA 1UD1A 3PVBB 3HQXA 3M3IA 3D0JA 1ZZ9A 2GC3A 3E6BA 3QOPA 4YRDA 5LEKA 1YUDA 3H50A 1CAVA 2K0GA 3OGJA 1QXJA 3SCFA 3N4MA 3SXWA 3S0MA 3RPQA 3CO2A 3SHRA 4BYYA 3DV8A 2BNOA 1CAUB 5LEJA 4X6QB 3HT2A 4QM9A 1ZZCA 1Q5OA 1YFXA 2QJVA 3LAGA 2I45A 1XE8A 2PA7A 4IEVA 1RL3A 4HVQA 3OD0A 1OI6A 1CAUA 2B8MA 1RC6A 3KGZA 4OFGA 4LULA 4D7TA 3U11A 4KWLA 1Q3EA 5CVRA 2XL7A 1O4TA 1RGSA 3QACA 5I8YA 3NL1A 2GC2A 3LWCA 4Q0QA 3H3ZA 4IEOA 2FMYA 2IC1A 4L11A 2CGPA 4RD7A 4I2OA 3H1MA 3H1YA 3R6SA 2B5HA 1QXRA 1XRUA 3TNPB 4MGYE 1X8MA 1O5UA 1X82A 4YSFA 4K8FA 2CV6A 4E2GA 4KU7A 3ROUA 1J59A 3ACLA 1TQ5A 2D5HA 3E97A 5EZWA 5FQ0A 3WW4A 4QGLA 4MUVA 4D7SA 3ST7A 3OCPA 3KCCA 1OFNA 4J1WA 4XF0A 2EVXA 2PTMA 5JSRA 3SCGA 2HKXA 2IXHA 4Q0VA 2XHKA 4XFFA 4IEWA 5KHGA 4XFCA 1UCXA 3JZVA 5FLJA 4LUMA 1YLLA 5CADA 2ATFA 2WFPA 5I8TA 4META 1V70A 1DZRA 1SQ4A 3GBFA 3MYXA 5KBFA 4HBNA 2CAVA 1Y3TA 4AVBA 4J1XA 3CF6E 3LZZA 3NSTA 4XFHA 2BNMA 4IEUA 1X8EA 4Z07A 1YFWA 1VJ2A 2VECA 5FPZA 4IERA 1H1IA 3IDBB 2IXIA 5E16A 2OYZA 2GZWA 3I54A 2UYAA 4CYDA 1ZRFA 5I0SA 5K8SA 4ZU4A 2QDRA 3O14A 3CLPA 3WW3A 1ZVFA 3EQEA 5FPXA 3MDPA 4UBGA 1CAWA 1VP6A 5J7MA 3E5XA 3BALA 4I0AA 4E2SA 4Q0SA 5J48A 5D1IA 1O3QA 5BY5A 2C0ZA 4JTNA 5BXXA 4Q0UA 1ZX5A 4WZCA 1O3RA 2OZJA 4TLFA 1YFUA 2HJIA 4IEXA 2CAUA 4XFAA 2EAAA 3KMHA 3EBRA 2P17A 5JSPA 2DCTA 4H7LA 1CX4A 3DN7A 4KL1A 4AXOA 1RUNA 5CU1A 1FXZA 2QNKA 4AQ2A 5C8WA 4N9HA 3BU7A 2IXKA 3C3VA 3UKVA 1VR3A 4MGIE 4PJYA 4HLTA 3ES4A 5EFUA 2PFWA 2WC2A 4I02A 3SCHA 2IXLA 4MGZE 3NKTA 4WVZA 3H9AA 4PIXA 3S7EA 1WLTA 3CJXA 4HN1A 1UW8A 4O9GA 3ETQA 2XLGA 4JV4A 4BHPA 3HIFA 1YHFA 2BEOA 1O3SA 4XF9A 3LOIA 2F4PA 1EY2A 4B29A 2Q30A 3UKTA 1JUHA
chains in the Genus database with same CATH superfamily
5KC6A 3CJIA 3E5QA 3SNMA 1WBLA 5C8CA 1LKNA 4EN6B 2YU2A 1VBC3 1L3JA 2YUEA 2WZR2 4IEPA 2W47A 4FPKA 1CVNA 4JDMA 3WEZA 3FFZA 1H8TC 1AR81 2WO3A 5IVEA 2WZEA 1HRI2 4HPKB 5C5UA 1FPN3 1YEWA 2GH8A 2R49A 2QQPA 1NQJA 3GJAA 3VDBA 2HWE3 3N35A 1O5LA 2XGXA 2VMHA 4HVRA 5FYHA 5E6HA 3I2OA 1ZRCA 2GU9A 4DXRA 4CDXB 2ARCA 3FX3A 1YRZA 4IEYA 1FOD1 1O6UA 2RMU3 4FFIA 2DFBA 5FMDA 4AVSA 1BMV2 4LE3A 5FLHA 4CEWB 4DNYA 3POIA 1CAXB 2QCSB 3UGGA 1RUH3 1RUD2 2VE1A 1FMD3 3CMGA 3OGSA 2BFUS 1CN1A 1JTZX 4P00B 5D2AA 3D8CA 3WNKA 1JYCA 1NE6A 1DGRA 3H8XA 5LBEA 4HL0A 4AZZA 3J7HA 5LATA 3ELNA 3KD4A 4UFKA 4YGDA 3VBFC 3AMPA 1F35A 1CAVB 4IV1A 1UY3A 3ZFFA 2WINB 4HSLA 3PU8A 3H0OA 2E7AA 1Y4WA 2GAUA 2FDIA 4DB5A 5FUPA 1XXNA 3H7YA 3JBG2 5LB6A 4C90A 1W99A 2XLFA 5BNNC 2QZ3A 1BYHA 1OA2A 4FTBA 3M3EA 1DQ6A 1HDKA 4WM7C 1JXNA 4FSJA 4XIOA 5JOZA 4QHOA 3VBFA 1PHMA 5C4WB 2RM23 5JR7B 4W50A 1R092 2XQRA 3APBA 5FYTA 1MS4A 3KSCA 3M4FA 1EP0A 2C5DA 2ENRA 2JD9A 3JB4C 4QGNA 4Y20B 2JX9A 2W87A 2R6QA 1ALYA 2YHJA 3M1HA 4LA3A 4XVHA 2GH2A 5T54A 1IPKA 2XG3A 3L2HA 5HV4A 4R8HA 3OG2A 2PQQA 4K20A 4MADA 1HRV3 5FUIA 3DF0A 4QQLA 5FY1A 1AR83 1EPWA 3TB0A 4XHBA 4AAXA 2W94A 1NZCA 5JCTA 1NQDA 1D4M2 5A6ZA 4I3PA 1SHWB 5F9TA 1UPIA 4A4AA 5IVBA 3C8XA 2D3SA 1KGYA 1LHNA 1DGWX 1ND2B 1SBEA 2WZR3 1B09A 1QEXA 3NV3A 4LJHA 4MOAA 2VTXJ 5KHJA 3I3EA 1PK6C 3MIFA 4E4ZA 3A21A 4XMIA 3K4ZA 4AOCA 1A6CA 1MEC3 2MHFA 5KXCA 4D0QA 3GGLA 2FD8A 5FWJA 1D0GA 3B01A 1TZOA 3VBRC 1MS3A 2OT7A 1ZBA3 5FREA 4FPCA 4OQ9A 4EN0A 5I0TA 2W1UA 5F1RA 4NHMA 5F3CA 1XYOA 4DZGA 3OF1A 1N1VA 4MH0E 2GMMA 4AVTA 4WM7A 4IESA 5CB7A 1QH6A 1W8WA 5L7OA 1F9KA 1IOAA 3IZOA 4FI9A 1S2KA 1XPWA 3PL0A 1GLHA 4XUQA 4JTOA 5KR7A 2R041 3OYWB 2VZRA 4LQRA 4UW5A 4AGGA 1X9TA 2VVDA 1CZTA 4I09A 1QOTA 4RFRB 3I2GA 3AZWA 4QM8A 5FTTC 4ATFA 2JEMA 2CY6A 4IQPA 2O1QA 2W92A 1S0JA 2HWD1 5FBJA 3AKTA 3ZOIA 1XNKA 1MACA 2PHLA 4HK9A 4HETA 3V0BA 1GOHA 4LBKA 2XL9A 1R081 3VBSB 3LSDA 1QJX1 5IVFA 2E53A 1NYWA 4OI1A 1HN1A 3AZYA 4QD2A 1HJGA 1MZEA 3VL8A 5I0DA 2R0HA 4Y4RA 3WF3A 3MF9A 3HN3A 2WO7A 1D2QA 2A6YA 3T4VA 2QQIA 2IXJA 1RUD1 4QKNA 4AGVA 2LALA 4QXKA 1QMJA 3POFA 4LIUA 2MPFA 1O8PA 5F5QA 1P8JA 1R093 4OUMA 1REFA 4RGGA 1VRH1 2EA7A 1LB2A 1OQDA 5FKCA 2FZ2A 2V73A 1XE0A 3ES1A 1UPSA 2JDAA 1V6OA 4HK8A 1BK1A 1UYXA 2VTFA 1HJFA 5F37A 3ZPYA 2W39A 3M2MA 1HRV2 1MR5A 1VPHA 2JDYA 2RHPA 3IM0A 4LLOA 5FUNA 5GKAC 3I2IA 5BNQA 4GJZA 1W06A 2QQJA 2R7EB 2OPKA 3POJA 3G6JB 4WM7B 2PHXA 3GBWA 1H2NA 3R05A 4KBBA 1SEFA 3EXUA 1QKQA 2HWB2 1ZZ7A 1H4HA 1H2MA 3AFKA 2IXCA 2OS2A 1VBD2 2ZGNA 4OVEA 2E32A 1PO22 2K9ZA 4XABA 1O59A 4CEYC 2E6VA 3TEYA 3NWKA 2FCVA 4V2VA 2D6PA 1ND2A 3RG0A 1BBT1 4AG4A 3CBNA 1AR71 3LDKA 5JR2A 1GQPA 4HKLA 4KNCA 4JRAA 2BNNA 3N7LA 3JCIA 1AUYA 4R9DA 4CPBD 4OLLA 4U36A 3WUDA 3U4XA 5IWFA 3IDEA 1OQEA 5C70A 1JYIA 1V6NA 3UL2A 3PVEA 5GJ6A 3H7JA 2CSGA 4YLZA 1AJKA 4CEWC 3ACIA 1UF2C 2RR12 3G7DA 1Z0HA 1PO12 5BNPA 2DUPA 3CL1A 4TZDA 2E9QA 3C2UA 3GM8A 4AW7A 1Y43B 3FZ3A 1UZWA 5ABJC 4P5HA 3FJSA 3ABZA 2ZA9A 1RUJ2 3KGLA 4CCOA 4AGRA 2W3JA 4E8DA 4M00A 1DZQA 5LCWL 3BCWA 4Q0PA 3O5SA 2WRAA 4OULA 2XWJB 5FP9A 4TWTA 1K5MA 3D6EA 4LHSA 4EWEA 4CDWC 2HWD3 3IAPA 3WQ0A 3V0BB 1RJ8A 2HWE2 2PXJA 3NO8A 4EE2A 2A6WA 1W2NA 2HLEA 1C8M3 2D97A 2ZZJA 1QNYA 1UZYA 3I59B 3J9SA 4PF1A 4HSJA 5A3MA 4YGEA 2B4KA 2NMOA 5FZOA 1NY71 5KXDA 2BOIA 1PIV1 4EWDA 2XKPA 1XNAA 1O4ZA 4Y4YA 2VQUA 4JX0A 1QHDA 1A78A 3WW1A 2QKDA 5A7NA 4P9LA 5CAZA 1QJU2 5ISLA 5FPAA 1RINA 2ZKLA 1DBNA 2HYXA 1NLQA 2WFF2 2JDUA 1V6JA 4Y20A 3WNLA 3WSOA 5JPNB 3E6DA 4CCMA 3IMNA 1BBT3 3OUIA 1AXKA 1OF4A 4LPLA 5GLVA 5CIRA 2A70A 2VJXA 3RWNA 5I91A 4IGOA 2FCTA 2FBEA 3MHZA 3PVBB 3M3IA 3D0JA 4AF9A 4RA0A 4LITA 4ARYA 2E51A 2VOTA 2RM22 3CJIB 4N53B 1W6OA 3IB3A 4Q8KA 1EAH2 5LEKA 1YUDA 3H50A 1CAVA 4IV1B 3VBHA 5DN2A 5DUUA 4BXSV 3C7EA 2BPA2 5JXIA 3SXWA 3LKJA 2ZEYA 5A7WA 3K77A 2R043 3J8F1 3TRSB 3SHRA 2A73B 3ZN6A 2ZGTA 2HWF3 4BYYA 2PN5A 3BTYA 1CAUB 1GP6A 1PO13 2JG9C 4NWVA 4OHXA 4RS5A 3RMYA 5FYSA 3ZXFA 2I2SA 1LOEA 1NUKA 4EQVA 4QM9A 2RDNA 3VZLA 2WYSA 4NPRA 1ZZCA 2P2KA 3GNEA 2QFEA 1YFXA 3M7AA 3LAGA 2LTNA 1AYN3 3ZYRA 2XJSA 1TNFA 3I4IA 4IEVA 1RL3A 5G05L 3RWKX 2RS51 2VXJA 1W2UA 4H3WA 4J25A 5BNPC 1AR62 3OD0A 1PIV3 1OI6A 4LBQB 2XJRA 3AKSA 3QH6A 2B8MA 2WZ8A 3RJ2X 3KGZA 4E4HA 3HBKA 3IT8A 2ZX2A 4JZRA 4CUBA 1RUC3 4KWLA 1Q3EA 1W6NA 2JG9B 4PDWC 5CVRA 2XL7A 1O4TA 4AR2A 4IV3C 3NL1A 4FQ4A 2GC2A 3LWCA 3WNMA 5IATA 2A7AA 2RJ2A 3H3ZA 4WVVA 3E1F1 3SQOA 5K7PA 4YW6A 3ENRA 3MIHA 3OPTA 4AEMA 3B5LB 1R1A1 1AR61 5DMYA 2VGDA 5FKBA 4DEVA 2XBO3 4QXHA 3TN91 2R1DA 5CG9A 2VZVA 3H1YA 3R6SA 4HONA 2RMU1 1QXRA 3PUHA 1XRUA 4JAAA 3PIJA 3NRUA 4YSFA 1O5UA 1HN0A 1FPN2 3ILFA 4P9YA 1VB4A 1VBE1 1WW4A 5EYXA 4K1YA 4DUVA 2DTYA 3O0WA 4HT1T 4NJ4A 2LROA 4Z2AA 1HXS2 3MLLA 4IDZA 1TQ5A 5FQ0A 5FZCA 2B46X 2VMFA 1G9FA 1QU0A 4DOUA 5JZGB 2PHTA 2O8OA 4R9BA 3NNJA 5A7WB 3MF6A 3SKJE 3WG1A 1LENA 2LM3A 4CP2A 4D6RA 4UFHA 1COV3 3KCYA 2QTWB 1XNDA 2JENA 2YC2A 2LUWA 4XF0A 4YM2A 3WP5A 5JSRA 1AR73 2QUOA 1HQLA 1ULEA 2X53S 2IXHA 2JICA 4Q0VA 2CL2A 1WW6A 5JXJA 1EAH3 3OBZA 1BBT2 1DQ0A 3VKOA 4COUA 1V0AA 2ZAAA 5KHGA 4ASMB 3THDA 1OPMA 1UCXA 2XJUA 1R64A 1HLCA 5CADA 1CD3G 1UX7A 2A5ZA 1SCSA 1A3KA 1YNAA 5FOJB 2YYOA 1VB2A 1WZXA 3DGTA 5IFPA 3TEZA 3B7MA 5GM0A 2D3PA 3ZN4A 2CTVA 3FN9A 3T0AA 1LOAA 1NA1C 1TMF2 3LZZA 2TEPA 1FYUA 4CPBA 5FZ7A 3O1MA 3AP6A 4Z07A 4AI0A 2ZEXA 3FC0A 5FZ0A 4AFCA 1YQ2A 1VJ2A 2B9VA 1AR63 2YFUA 5DUVA 4YVSC 5FPZA 3ZN5A 5C4WC 3AYEA 1XJAA 4CCCA 5ACA2 1CPMA 2VZSA 1ULFA 2Z79A 2Y33A 1ULOA 4QHBA 4WM8A 5E16A 4XAAA 1LOCA 2XVGA 3MGUA 3GCXA 4OYUA 1NCQA 4YZ4A 3I54A 3SH3A 5LW9A 1DQ5A 3IMMA 1NA1A 1ZM1A 4CYDA 1RXGA 4CE8A 1ZRFA 3UJOA 4XBLA 4BA6A 5I0SA 2J42A 1RHI1 3AM2A 4GB31 4CA9A 2RV9A 5GZEA 1LGCA 2QDRA 3N9PA 5A33B 2GSYA 3O14A 1VRBA 2BBVA 2YDEA 3C7GA 5EYYA 4YPJA 1BZWA 1UXZA 2AH2A 2ZGKA 2GP3A 1ZVFA 2ZX0A 2ILMA 3AFGA 4N43A 2Q8CA 3MW2A 2FDHA 1KDKA 3BYWA 1OVPA 4K40A 5A7PA 1G9BA 5A6QA 1PGL1 3MDPA 3NV4A 2YFZA 4YVWA 1KRIA 4UBGA 4GKXA 3AB0A 2VW0A 3LQCA 3DXUA 3MW4A 4XHXA 4B4RA 1BCXA 4S2HA 1G7YA 4I0AA 1H2LA 3TEWA 5EV7A 4P9WA 2YPDA 2YZ4A 4W6XA 4Q4V3 1N3PA 1WCSA 4LBNA 4Q5OA 2VCBA 1K3IA 4M3CE 4LKDA 1YQCA 1H30A 2RS52 4GH4A 2WSVA 2C0ZA 4QX7A 1V6KA 3CZUA 3T0BA 3UGHA 1ZX5A 4WZCA 2ZGSA 5A7QA 1O3RA 4AEKA 4C0BA 2OZJA 1IHMA 1XC6A 3LD8A 4JDNA 3U78A 1XYPA 3WHTA 1UU5A 5IJRA 1RUF2 1QJEA 2EAAA 4MXWA 3RGBA 1W04A 1S0EA 3JD71 4JHZA 1LAJA 3VKFC 5BNNA 4CXYA 4EYUA 1CX4A 3VZKA 4OI0A 1UL9A 3I97A 2D43A 3HVDA 3AZVA 1NOVA 2QNKA 2EAKA 4MO3M 1TMF3 4K3UA 5C8WA 1XQNA 3C3VA 4UFIA 3TYJA 1OLME 2ZX4A 3CZJA 3FL7A 3WCSA 1WD4A 1H6XA 1C57A 1ZRIA 4GJYA 2D6NA 4HLTA 3O1RA 5HCAA 2WC2A 4NROA 1STMA 1V9U1 2UWAA 3ZKUA 5IAVA 5L7OC 1RUE1 5FYZA 1H8TA 3VD3A 5EWSA 2GNBA 1NKGA 3NKTA 5K4LA 4Q4X3 1YYNA 4QQHA 4G9SB 3I3QA 2BDRA 5C4WA 3VBUA 3B3QE 2VOXA 1IPSA 3ZN6B 5FYMA 4IE4A 2ZGOA 1Q56A 5AC91 5A3UA 5F32A 3HIFA 4BHPA 1CJDA 1YHFA 1FOD3 5FIXA 1Y7BA 1C3HA 2WZPP 1NCRB 2JDHA 1V9U2 3DYMA 3DPRB 4XF9A 3WQBA 2F4PA 4CDQB 4AHZA 2MEV2 4B29A 3VD7A 4AI9A 1VBD1 1C28A 1UMZA 1RUJ3 1MS1A 4Q4Y1 1GZCA 5LASA 4CEYA 5H9SA 5JLVA 1QY4A 4MXVA 2JD4A 1ND2C 3FHIB 4BIFA 3W59A 4Q8LA 3DCQA 1CIYA 2JJ6A 2OA2A 5BNOB 4WBBA 3WW2A 4BZ4A 3UKNA 2CYFA 3W20A 1YCIA 2OQ7A 4F7ZA 3OPZA 1T2XA 1J3PA 4BWOA 5BYNA 1UZZA 3T30A 2CHHA 1J83A 3RYPA 5FYCA 2VPVA 3AXDA 2GDFA 2B9UA 2XH6A 4IW3A 4XQWA 2GNMA 1SLLA 3WP3A 4BPZA 1LRHA 3OUJA 4EN9B 4YG6A 5AVPA 1DG6A 1ZRRA 4XJ8A 3LA3A 4QKFA 2BGPA 5HXVA 2Q0AA 5KXEA 1WLCA 3RZMA 1PMIA 2PLV2 2R073 1OH4A 5AVAA 2WO2A 5FJKA 1FV3A 4YW5A 5FYBA 2VCAA 1UAIA 2WQ8A 1VIWB 4IEQA 1DLCA 3H8UA 4LEJA 2XWBB 4ES9A 5JAXA 4NE9A 2XR4A 1G9CA 5DAPA 3AC0A 4QWNA 3N7JA 3EHKA 5DDJ2 1JZ7A 2WT0A 1UIJA 4JQRA 4JGZC 5FBZA 3R4SA 3VBOC 5HI0A 2P3YA 2Z2SB 2I74A 5E89A 2AEYA 4CEWA 1BK0A 1UNBA 2HBTA 2BGOA 4BLJA 3QBQA 3ZXDA 3S30A 4ARXA 1RB8G 1OBNA 5J3UA 3JBG3 2B42B 2UY8A 2VUAA 5I0RA 4XUOA 2C26A 5DABA 1D2SA 1RYYA 3PJYA 1SLIA 2YU1A 4GWMA 3NAPC 1DIWA 2GNDA 1GZWB 3ZXAC 1O7FA 5KHHA 4O9EA 1JU3A 5TSWA 5CISA 5G04L 3H3UA 5J48A 3OBTA 1UOBA 3BB6A 2DYCA 2KM2A 1OSGA 2MNGA 3KWVA 2R042 1WMEA 4PLMA 4A3ZA 4QPGB 2N7GA 1RTVA 5KHIA 3A0KA 5FO9B 3EO6A 1ENXA 3WDWA 1W6QA 1YQ6A 4AEDB 2IFWA 1QJY1 3RFRA 2VO5A 5F39A 4UW3A 1AYN2 4TTGA 1XE7A 1ND3B 1Z7S2 5B4XA 4EROA 4QDSA 5FDBA 2EIEA 4EV0A 5BUVA 4LIVA 1Q8VA 2EALA 3LCPA 3WLUA 1NXMA 1W05A 1UU4A 4OHYA 5GZCA 2BQPA 4XUTA 1RMU1 3R4DB 1ACCA 1JN2P 3B02A 2JECA 1JZ5A 3DPRA 5J37A 5FZ4A 1ENQA 1OURA 1WA4A 1W0NA 2J1AA 2D93A 3BTAA 3GBGA 4FPEA 3LSEA 4MGQA 3THCA 1N3OA 1WBFA 2PHFA 2W2IA 2VZOA 4MGKE 1RUD3 5FXXA 1FAYA 1PX4A 4LA2A 4NPMA 4Q4W3 2VQAA 5J98B 3ZFGC 1EUTA 3T08A 2HH9A 3ZSLA 5JVVA 2ZKNA 4W4ZA 3O1PA 4Q1RA 3U0ZA 1J3QA 5D21A 3BKZA 3SH5A 4BQ2A 2VNGA 2WAOA 4NOTA 4LK7A 3KB5A 3ZFEA 2BZDA 2BUKA 1ZA7A 3ZXKA 1PIV2 3DL3A 4LK6A 1LU1A 3M3QA 2BRTA 4NIIA 4ZU7A 1E57A 4MSVA 4YYOA 5DDJ3 1JHJA 3KHCA 5FXZA 4QPYA 2WNVC 5C7GA 1QDOA 4AHWA 3NJVA 1KD7A 3E5UA 3TOJA 1LOGA 4MV2A 1KFXL 3N3HA 2X10A 4XFGA 1RVF1 4BH9A 4EJRA 3ACHA 4YNIA 4HFSA 4QPWA 2PYTA 3ALQA 2CGOA 2K2SA 3S7IA 1GYKA 2NM1A 4MYEA 3FUQA 2EXIA 3H8OA 4Q4X1 1C5HA 1LTEA 2A75A 2D44A 5JXGA 5GLWA 2Y6FA 3I2DA 5I8SA 5LBFA 2CNAA 2G9GA 3ME2A 3ZIWA 4Y26A 1ZZ6A 3SITA 4YZ5A 3K51A 1YFYA 4QT6A 1JBCA 2D6KA 3GALA 3JD72 2RR11 4RYDA 3WX5A 3NAPA 1IQDC 2KXLA 5SV5A 3ZR5A 4DINB 1EYBA 2IFRA 4U2AA 1W90A 3PMSA 2BU9A 3VBSC 2Y6JA 4P9IA 3PUSA 2JG8A 3AZXA 4XFIA 3RNSA 1CAWB 1US2A 2OQ6A 3C7HA 1RJ7A 4D8MA 1CR7A 1ZRDA 1QJFA 4E2SA 1UZVA 2XONA 3SC7X 4BJ0A 1GP5A 3CKHA 4MZUA 4DXSA 3T0DA 2UY9A 1Q8OA 1ZREA 3BTZA 4EZHA 1CZSA 2ARAA 4IV3B 3PNAA 4FO9A 2HWC2 4LBLA 1YJLA 1QF3A 2W1WA 2AUYA 1L7RA 1PK6A 4GH4B 4C91A 3HNBM 2GC0A 5EIYB 1HV0A 1IPJA 4M01A 3AYAA 3LA7A 1JZ3A 1F4AA 1GV9A 2BYVE 4TSVA 2WA3A 1F31A 1S2EA 2W08A 4ISQA 4KI5M 5FCCA 5FLIA 1QIQA 3BU0A 4E4SA 2YBSA 4BQYA 4D69A 1WKYA 5JMCA 4OMDA 3BPZA 3PIGA 2ORZA 1U5ZA 5FY8A 1XSRA 1TME2 2GP5A 3W21A 1XNTA 4I01A 4YVSA 3MI8A 5FK7A 4BCUA 3MLJA 4YG3A 1FPN1 1VBE2 4QMAA 3ZO0B 4KWUA 2ZGQA 4FQZA 1I5ZA 1S0GA 5E1RA 4XUPA 1PNFA 4Z82A 1RIRA 3UESA 4A41A 1JZ8A 1RUOA 5FZFA 4A3XA 5LY2A 2QQUA 4ISRA 3ZFEB 1OFSA 2WWJA 5FZEA 2HEWF 2WS93 3WOGA 1FNZA 3IDCB 4A6OA 2H6CA 4RGAA 3IAQA 4BLIA 2ETEA 3LDBA 1KS5A 3NNFA 3IIAA 2DFCA 4RHV2 2IVJA 4RR3A 4URAA 4XJAA 5H9RA 4Q26A 4MGTA 1S0FA 2YC0A 4QKDA 1E5RA 3CHXA 5F3EA 3PLQA 4H55A 4BQ1A 3KV9A 4QHZA 1MQTC 2ZEZA 1JZ6A 2HEVF 4KWJA 2LS6A 3JQXA 1GZWA 2ET7A 4N7IA 1YIFA 3NW4A 1QH7A 1W8UA 5FP3A 5JZGC 2EIGA 3C7OA 3HT1A 1QNWA 5FMCA 2B39A 1IS3A 5IVCA 2ZHLA 1UD1A 4FPHA 4BQ3A 4AFMA 4W6WA 4LHNA 1WD3A 4R9CA 1ZZ9A 1PM4A 4L92A 1W6QB 2JB8A 4BIOA 1H9WA 2JKXA 4XUNA 3QOPA 4CUAA 3H42B 2RS33 3KM5A 4LBQA 4G4FA 4YVWC 4A42A 3ZLIA 1GUIA 2K0GA 1LHVA 4CDQA 1RUC1 1JUIA 1QXJA 2WAAA 2E63A 3UT0A 2AGSA 3WDUA 3K46A 1U5IA 3RPQA 3O1OA 4EN7B 2ZTNA 3GXUA 5A80A 3SEEA 5A1FA 2OPWA 3DV8A 2AENA 4NRQA 1MS5A 1PMJX 1MEC2 1W39A 4NIDA 1SLAA 1OKQA 1XU1A 1KQRA 1Z7S1 3VV1A 4UT5A 2JE9A 1D4VB 2QJVA 5F3GA 3IDAA 1ULPA 2BFUL 5FPUA 4DY3A 3D5OA 3AP5A 5IK8A 1JW6A 2PMWB 2XXZA 2ZGRA 1CAUA 4RS5B 3VKMA 4QX1A 4EZ4A 2G9ZA 5FZDA 4DY5A 2Y0IA 3R4UA 1ASJ2 2V5YA 4LULA 3FLPA 5FZ8A 1AYM2 3VD4A 4OZXA 1SBDA 4YW2A 1RGSA 3QACA 1NY72 5I8YA 4QXBA 3M3OA 1VAVA 4QX8A 2VMGA 3CDZB 5C3QA 4CXWA 4QAWA 2C24A 4XCAA 4YG0A 5C8CB 2IC1A 2DTWA 2VNRA 4L11A 3RS6A 3VBOB 4BE3A 3UJQA 3KT7A 4NRMA 1AL21 1UX6A 1QQP3 2AREA 4QPGA 4OHZA 3H1MA 4YW7A 3WY6A 2B5HA 2ZOEB 1VBC2 4YM3A 3B9IA 1K5MB 3HNMA 2X8KA 1FMD2 3K3NA 4K8FA 2BV4A 4XC9A 3T09A 2XBO2 2VOKA 1JOPA 4DXZA 3VD5A 2DBIA 1MVQA 1CJPA 4AYUA 5FRAA 4QGLA 2BWCA 2W1SA 4MUVA 4W6YA 3ZSEA 1N1YA 2RMU2 1NLSA 1HXS3 1VMHA 4QQOA 4S2GA 5EPAA 3ZFEC 4EN8B 3VUOA 3LOBA 3NNMA 1LGBA 3PUAA 1B35A 1GKBA 2W68A 5ANNA 2Y60A 4J1WA 4ZZ8A 1H4GA 1AYM1 1REEA 3AVRA 4UWDA 2E7TA 1SZBA 4IGPA 3AYCA 1JODA 1FX5A 5A70A 2XHKA 5LK7B 2HWC1 4XFFA 5APAA 3VZOA 1OLRA 3POEA 1W8ZA 1SDDB 2DURA 2VW1A 4XFCA 5HPOA 2GMPA 4XACA 3FBMA 3AL5A 5A3TA 2VZ3A 5F5AA 1YLLA 1DQ4A 5GLTA 2F17A 2E31A 2ATFA 2WFPA 4FPFA 1VBB1 4IE7A 4Y22A 4AHYA 4CDUA 5I8TA 1HQNA 1KXGA 4META 3WUCA 4QU2A 1FMD1 3K75B 1DZRA 1RHI3 4GB33 5B2GB 4BK5A 3N9MA 2I07B 3KV6A 4HBNA 2Y6GA 2QQVA 1JYTA 2CAVA 4IE5A 2ZHKA 4CP1A 2P3KA 2WNOA 3EYPA 4MVTA 4AVBA 1NCRC 3CF6E 4UW6A 4CDXA 3HNYM 3NSTA 4CXXA 4XFHA 1W9YA 1JH5A 3KVBA 3W5MA 1VE0A 2IZWA 4Y1UA 3I49A 1C8NA 3CU7A 4IERA 3J7NA 1N1SA 2R0FA 2VC9A 4BXFA 1CZVA 1YQ8A 2A3XA 2ARXA 2R1BA 3Q9OA 4O61A 5CFDA 4ATEA 4QXCA 2OYZA 1EV12 3BOWA 2NLRA 5L9BA 2GZWA 3T4HB 5T50A 2WJSA 3O12A 4YVWB 1Q8QA 4LO7A 3SISA 2WS91 1D4M3 3PHMA 1KJLA 1SDWA 5K8SA 4INDA 4QPIA 4IUGA 1E5HA 5IW0A 2ZHNA 5L19A 5IK5A 4XPVA 2JG8B 1W8NA 1Q8PA 1BMV1 1K5JA 3PJQA 3OBAA 4PQQA 1SLBA 4N7UA 5F2SA 3X29B 2C1FA 4IE6A 4QQ2A 4YVSB 3VZNA 1OLQA 3WT3A 4BB3A 2AR6A 4W8JA 1VP6A 2ZX1A 4Q4W1 2P34A 4PI0A 2R062 5CKNA 4X8PA 4JGYA 4JGYB 5FZMA 3BUCA 1APNA 1UN1A 4COZA 4M4PA 3UNPA 1UQXA 2JDMA 4Q0SA 4K21A 3AP9A 4O7XA 5FY9A 1UMHA 3WG4A 3WNOA 1X9PA 2D6MA 4AI8A 1BVVA 1F5JA 2PHWA 1C4RA 4XMAA 4KGQA 1BEV2 2A1XA 3PVOA 3MEPA 1GANA 5HCHA 2WWUA 1UOJA 1JHNA 1PGSA 1QJU3 2YPJA 4NIHA 5EJ1B 4DEQA 1JZ2A 1HV1A 2ZGMA 3ON7A 4LO6B 1IQAA 1GP4A 2VW2A 4JGYC 4ZS2A 2QQMA 3RMXA 3B9CA 2CGNA 5JOWA 1AR93 1WCQA 2HJIA 2RG4A 1IS4A 2W46A 1V00A 2CAUA 2PQSA 4XFAA 5FY7A 1W2OA 4DRVA 3KCXA 5F6KA 5FWEA 2DCTA 4H7LA 2PHRA 3ZYPA 4OZOA 4P9JA 5HCBA 3VBUC 2AYHA 1A8DA 5CFCA 4AEDA 5CU1A 1FXZA 3DKQA 1AR82 3AMNA 1DDLA 3GCWA 2W9XA 2JDNA 4N9HA 1YQ5A 3BOPA 1QOOA 4JKKA 2XDVA 1GNYA 4N90A 4GWNA 1U5XA 4KGGA 2Y38A 1D4M1 2WA4A 2UWBA 2DF7A 4MGIE 3O0XA 1QJY2 4PJYA 1D0HA 3ES4A 3V65A 2AEZA 4COYA 3VDAA 2W5FA 2RS11 5JZGA 5F6LB 1VLNA 2RM21 4MGZE 5F5IA 1ZBE2 4WVZA 5LA9A 5BNOC 4Y24A 1RUG1 1RXFA 3KV4A 4JCKA 4AVVA 4BM8A 4UF0A 3MICA 3CJXA 1TEIA 4HN1A 4AFBA 3V0AB 4UAPA 1QDCA 4GWIA 2ZAHA 4XDQA 5FZ6A 5FZBA 5JOYA 3GJBA 2Y6LA 2QQOA 3HAGA 5DAXA 3VBSA 5JOXA 1HB3A 3LOIA 5EJ3A 4TN7A 2DU1A 3VBHB 1ZYBA 2BERA 2GN3A 4QB6A 5J09A 5IK7A 1A8MA 1JUHA 3B69A 3ZYGA 5FMOS 1FT9A 2GMEA 3IN9A 5FZKA 3WG3A 1NCQB 2D40A 3AP7A 4Y1VA 1WGPA 1J3RA 4ZXKA 1OC1A 2C4XA 3CEWA 4FOWA 1AR91 1CESA 4A2UA 1GQGA 4XIKA 1X7NA 1W6MA 3I3BA 1AYM3 1OH3A 2W1QA 3HD8B 4GMP0 2A6ZA 2VULA 2VNOA 4JGZB 4JGZA 4IV1C 2DV9A 3UV9A 2G19A 1R1A3 1LGNA 2P5BA 3JBG1 3DEMA 1W28A 2EICA 2XBO1 3WNPA 1QJZA 1AX0A 3TN92 1TME3 2E33A 1AR92 5C3PA 1T6GC 1Z78A 5T52A 4KU8A 3NJXA 4PCRA 1DGRN 3MFCA 1VBE3 1XB9A 3NJYA 4GULA 4ITCA 2WNVB 2XLAA 3BVCA 1GNZA 1UMIA 1IG0A 1EAH1 1KS4A 1LOBA 3MIDA 2XOMA 5A3OA 1S2BA 1LCLA 2D6OX 2PLV3 2R32A 3KZ4C 5FZIA 3WF4A 4CP0A 3O1VA 1W0OA 4XEZA 2K46A 1YJKA 3ZIXA 2YROA 1UIKA 1VALA 4M3CF 2TNFA 1AR72 2BJSA 1UY4A 4C1WA 5A1AA 3ORJA 1T6BX 3THTA 4CU8A 5LK5A 4XZUG 2VMDA 5FPLA 1G6NA 1KDMA 5C3RA 5FJHA 1MVEA 4GALA 1S0BA 1QWRA 2PAMA 4W65A 1PVC1 1GZTA 4L99A 5KHKA 1PVXA 2L9LA 1VBB2 3WF2A 5C9AA 3VHRA 2ZMNA 4RS5C 1AL0G 4RSUA 5KXBA 2Q8EA 1BHGA 1GOGA 2YY1A 4UI9L 3LEKA 5HBAA 2R071 2HYKA 4QX2A 2F4LA 2RS31 4CCJA 3P3NA 4HKWA 3U1XA 2IWGB 1US3A 3KV5A 4XBQA 5JSOA 2J1UA 2QE3A 3N7MA 4QX0A 2VBDA 1RVF3 4HZFA 3I2HA 5FXVA 3ATGA 1OOPA 5DZFA 4YW3A 3KQRA 1WCKA 5JMOA 2FDGA 4YM0A 2D98A 1TME1 3USSA 1Z7S3 2DU0A 2QVSB 3LIHA 3LA2A 4Y5TA 4E2QA 4JHTA 5T5LA 3VHPA 4LO5B 2Q8DA 1CGPA 4OCTA 2V4VA 1W6MB 4LOSA 1ULGA 2WNUA 5EP9A 2VZTA 2NPIA 4RR3B 3FHQA 3IBMA 1C1FA 5FY0A 3K4AA 2P37A 1OQ1A 2HWB1 4R52A 2ET1A 2FCUA 1W9WA 2JIJA 2Q1FA 1HRI1 2Y26A 3AX4A 3NJZA 4F3JA 1K5MC 4XF4A 1AX2A 3ACFA 1E5IA 5CNAA 2WLQA 3DXTA 1QOSA 2J1TA 3WDVA 5BNNB 4A7YA 2UURA 3A22A 4NAOA 3RZKA 1WWYA 1DZTA 2WNUC 4XE9A 1XNBA 1GWLA 3JXSA 5D8AB 3BIEA 3AKQA 3K48A 4HANA 4XBNA 5GLUA 1U0AA 3QH7A 4C8DA 5FO8B 3HWJA 4AHXA 5HV0A 4QDQA 3AP4A 1O3TA 4P5YA 3ZFFC 1BEV1 1J58A 1CWPA 3ZKYA 3MPPG 4KBZA 2JDKA 1W8OA 4A7KA 4AQTA 3GDBA 4OQ8A 2Y0OA 2J1RA 3J8F2 2WN3A 4YZ3A 1VBA1 4ZU5A 3BI3A 3ZYJB 2XQXA 2YBKA 4ZS3A 2R061 3HOBA 3POGA 1WCDJ 5JWPA 5LZ6A 1NE4A 4KWKA 3ZXLA 3J26N 3K2OA 1PZ7A 5FFOC 4LBOA 1I9RA 4QKBA 1XYNA 2VUCA 3ZMOA 3KLSA 5F7UA 1K42A 5ABJB 1TE1B 1SFNA 3GZAA 1WMFA 3FBYA 3IPVB 1G86A 3A7QA 4Y1XA 3OD4A 3RI9A 3P5BA 1VRH2 2BW8A 3LFIA 4JDOA 4LKSA 2WSUA 3LDRA 4LBMA 5A33A 4YW4A 5AC93 2EXHA 4YZ1A 4YW1A 4RQPA 3MUZ1 4BQWA 5IK4A 1BJQA 3LB9A 1MEC1 2Y8KA 3N9NA 1HB4A 2DUQA 2JE8A 4QX5A 3LF7A 3ETPA 2E26A 5CFCC 1OOPB 3S6PA 2J1SA 3WHUA 1M06G 3BPSA 4FP2A 4PDWB 3WDXA 3D82A 2FQPA 3AL6A 3K4DA 3MV11 1SLCA 4NHLA 2WBKA 4QPIB 4XF1A 5L9VA 1OKOA 2D5FA 4YM1A 2UWCA 4J6GA 2A6VA 3EJKA 3MPBA 3MIBA 2AACA 1GQHA 1JYXA 1AJOA 3B93A 1PX3A 2DBNA 2DVDA 3I7DA 1DLLA 4ONUA 2DVBA 4Y5SA 2XJPA 5CYYA 1VMJA 2OUJA 3PTYA 4BQ4A 1ULDA 4KMQA 4HOOA 3CNAA 1OLMA 1U12A 2VNVA 5KWRA 1POQA 1Y9QA 1CX1A 2DDUA 4BMBA 1W3VA 5ACA3 2D6LX 1UYYA 3BODA 4HKOA 3OEBA 3VDCA 2TBVA 1R083 4IV3A 4B7KA 3H3LA 3U75A 1OXCA 2YBPA 4D7YA 1MQTA 1VBA3 2BGCA 1Y9GA 1ENSA 3MV01 4LMFA 4AK3A 3CQOA 4I30A 3POWA 3WD5A 5IYYA 4CTEA 2OW4A 4B3NA 4NPLA 2BTVC 4XJZA 5GALA 2V4AA 3GZTB 1W2TA 1MZ5A 4NVPA 3T2OA 2D3RA 4L2NA 4NIAA 3P6BA 4QU1A 1JYNA 4CCNA 5C3OA 4M3CA 4DPNA 3RZZA 1H1MA 3W58A 1OD5A 5LY1A 2QQLA 3DKWA 4Q4Y2 1XU2A 1H0BA 2VUDA 3FUOA 1IKQA 3WF1A 1TNRA 4HMZA 3FE5A 1N3QA 1TMF1 2H6BA 4B8EA 1FI2A 1H6YA 4AFAA 3FWEA 4A6SA 2Y64A 4AFDA 5CFDC 5A6YA 4P14A 5C9AB 3LGRA 4Z1VA 1S1AA 4TXWA 4R4XA 3ZXGA 1RUI3 3ZFGA 4LKFA 3TEXA 4PLOA 3VBFB 4RHV1 4QPIC 3BIWE 1NX9A 3I2FA 3DUIA 2NP0A 2Z5WA 2NN8A 5FP8A 4OMCA 4M4RA 4XCBA 4XURA 5ANQA 2GC3A 4TYSA 4BU2A 1F4HA 3GF6A 2ID4A 4YRDA 1KITA 3VBRB 1W6OB 2KR2A 5C71A 3RI8A 4QQPA 4LXLA 2WNVA 4JKMA 1HKDA 3SCFA 3N4MA 4WVWA 1VMFA 3S0MA 2WKKA 5J36A 3PUIA 3J4UH 3MBWA 2J22A 3VDDC 3HPNA 4NN0A 4E27A 2BNOA 1RUG3 3N7KA 4PT6A 4LO8A 4X6QB 3IKWA 1HXS1 4NMIA 3ZM8A 3HT2A 3AMMA 1FV2A 1H8TB 1GWKA 3ITQA 3WNNA 4XJWA 1Q5OA 2C6SA 1K12A 2ZBJA 4XW3A 5FYYA 5JXHA 4TLGA 2I45A 2X5IA 2PA7A 1RUC2 1JYWA 4A44A 4HVQA 3WZ1A 1RC6A 1ZBE1 2R072 4OFGA 2NMNA 4BK4A 2VG9A 1UOGA 3VZJA 2W95A 3AXEA 3LPGA 4L9BA 1NG0A 1CONA 1SBFA 2VTXA 2WIIB 2JG8C 4AI1A 4Q0QA 5DDJ1 4UFJA 2MEV3 2QQWA 2WR9A 3VBRA 1O91A 3RRDA 2ZABA 4IXLA 2CGPA 1YXWA 4RD7A 1FNYA 3USUA 1DFQA 1MQTB 2ZGLA 3KF5A 1X8MA 2VMIA 4E2GA 1W2AX 2P3IA 5K0UA 2HWE1 4RR3C 4CZSA 3VDDA 1J59A 3WP6A 3VZMA 5BNOA 1G9DA 3WW4A 4K7JA 3ZYIB 2TUNA 1UWWA 1IGOA 1RUH1 4IGQA 1UKGA 3ST7A 4L97A 4E9KA 1F15A 2DCKA 3HMYA 3HQRA 1RUJ1 3OCPA 4K9SA 5GZFA 3KCCA 2BP6A 4LLFA 5J96B 2WS92 1MS9A 1OA4A 2DCYA 1OD3A 3DYPA 3QCWA 2PTMA 4RHV3 5FZLA 3SH4A 1FATA 3SCGA 2HKXA 4B1LA 5DAVA 4MHRA 4XQDA 1AHSA 2RJKA 3PUQA 2VM9A 4IEWA 1W9TA 2P3JA 1PVC2 3R0RA 3JZVA 3KF3A 1UY2A 3OPWA 1DU3D 2WDBA 4R4ZA 4CCEA 2KD7A 1PGW1 5T5PA 1RUG2 1DYKA 1SFYA 1GBGA 1SQ4A 4RGKA 3GBFA 5GZDA 4IL7A 5KBFA 3WV6A 1OUXA 1Y3TA 3GHMA 1DYPA 3DPRC 2OX0A 2B45X 3WP4A 3OY8A 1AYN1 4YGCA 5IAXA 4IEUA 3KQ4B 1X8EA 2EIDA 4YZ2A 2AZ5A 1SMVA 5LA0A 3WQ1A 5C5TA 3FHAA 1LULA 5FK8A 2Z4FA 3FMGA 3T2TA 4YFWA 3ZVXA 1ZA4A 4DO0A 2JE7A 3HBZA 2IXIA 1J1TA 3MIGA 1F8VA 4Q27A 2JKBA 4XXPA 3KS7A 2UYAA 2Q8OA 4XAEA 5DUWA 4WV8A 1UOFA 5FZAA 3F2ZA 4URTA 1YC61 4PF5A 3ZR6A 1PK6B 1LU2A 5FPBA 1RVF2 4NIGA 5JUVA 1W6PB 1W6PA 3MUY1 3CLPA 2H0BA 5A32B 2W0XA 1O8SA 3IPVA 2VVEA 3N9OA 3OGRA 3WW3A 2WWSA 3WG2A 3T2QA 2WT1A 2VAUA 3O7OA 1OOPC 5FPXA 4XQ4A 1RUE3 2HWD2 3OEAA 5FY5A 2IUWA 3K3OA 1UO9A 3KT1A 4FPLA 4NR1A 3E5XA 1R082 3BALA 1B35B 3RQ0A 4WM8B 3VKNA 4DQAA 2W91A 2A3YA 4PBOA 3O1UA 1JS9A 2Q5TA 2VXRA 4UFMA 3ZMNA 4AL9A 2XJVA 3IIIA 1L7LA 2DCZA 4MHUA 4Q2FA 3AMHA 3RZLA 1LODA 1LNSA 3S5AA 5D1IA 5DUXA 2WQZC 2VOWA 3OY8B 3M8LA 3J8F3 1VRH3 4Z2WA 4NAMA 4AE2A 2C9AA 2SLIA 4Q0UA 4FFGA 1BVP1 4P02B 1JMUB 1NCQC 3W9AA 5AC92 5FR3A 1BEV3 1W0PA 2ZEWA 4SLIA 1V6IA 1C8M1 1YFUA 1OVSA 3U4SA 4COVA 4G3YC 3BGAA 1UYZA 1ODMA 3V56A 3KMHA 3EBRA 2P17A 2PHUA 1CPNA 5JSPA 1LHUA 3OUHA 5J1XA 1H2KA 1LECA 2QZ2A 4AXOA 2RE9A 2WT2A 1VBC1 1RUNA 4FPYA 3P3PA 2BBAA 2P6HA 3KT4A 5IVYA 4AQ2A 4OUEA 3T1LA 4DUXA 3W5NA 3NV1A 4RFT0 4UYBA 3UKVA 5CA6A 3LE0A 4MLOA 1ODNA 5CG8A 1ENRA 1ONAA 5CKQA 1XSQA 3RYKA 1DCSA 1AF9A 4LHKA 4ZKTB 3J7LA 1OUSA 5JPMB 2IXLA 4I0WB 3V64A 4CU9A 1PO23 2Y6HA 4CP9A 1QXPA 5DAQA 2XPJA 4FPGA 3S7EA 1GWMA 1UW8A 3O1TA 1PMHX 1URXA 2XLGA 4JV4A 1MZ6A 1GOFA 2ZGPA 2OIIA 2BEOA 2XUMA 5DZEA 3UKTA 4C1XA 1O3SA 3MW3A 1W8FA 1OHFA 1UU6A 2Q30A 4S2DA 4QPGC 4A7ZA 1DGLA 2QQKA 4Q4W2 1OT5A 1WA6X 3HN1A 4WVMB 4XTMA 3WDTA 3TNQA 1W8TA 1COV1 3MZHA 1LR5A 4UW4A 2LRPA 1BXHA 1W6NB 2JG9A 1X33A 2EXJA 3OYWA 4NUBA 3O0VA 5T5OA 2OZ6A 2W52A 1VBA2 1W8HA 2PLV1 4GQ7A 5FQ0B 4DIQA 5KC5A 4A45A 1PM7A 4I0BA 4QGMA 5E88A 5L73A 4AQ6A 1XNCA 1DQ1A 1CIWA 1RUE2 2XKOA 3DYOA 2EXKA 1LHOA 4Q29A 3ZPOA 2OXBA 3HJRA 2JDPA 2IVIB 3Q8BA 4FBFA 3VHNA 5T5JA 5JI9A 1GZ9A 3USUB 3AKRA 3MO4A 2HBUA 4B4PA 4RQPC 3RYRA 1AL23 5EXOA 1AXZA 4Y22B 1SFPA 3T2PA 4AI3A 2PELA 2XUEA 1OMIA 2X05A 1RMU3 3ZYHA 4UXAA 1I6XA 5IT6A 4ZZ5A 4GWJA 1BQPA 3VKLA 2Z42A 4MGSA 2YC4A 4WVMA 2C9KA 5IVVA 2LW8A 4H7MA 1RUI2 2J1VA 3LIGA 4DRRA 5LBCA 1SPPB 1D7PM 5GLZA 1NCRA 3HR9A 2Z69A 4RN5A 5DQ0A 1C5IA 1LOFC 2ZCWA 3ZYFA 4CDXC 4YGBA 4NRPA 2XJTA 5IUQA 1VBD3 3J7MA 1SG3A 4QB2A 1HX6A 5H9QA 1DQ2A 2ZPXA 3I2JA 2JB4A 1HB2A 2VU9A 4M0HA 4UBHA 1RUI1 4AI2A 4ASLA 5LRSA 1CAXA 1ZZ8A 1W3XA 4CSWA 2CDOA 4LTAA 2PHDA 1BKZA 2ZGUA 4BMEA 4LUKA 1HW5A 2G1MA 2BOJA 1VBB3 1W9FA 2H0VA 2ES3A 3L9JT 3HQUA 1PZ8A 4AVCA 3I2KA 3OOXA 2HWF1 3QLQA 4D94A 1VAMA 4N9IA 5LA1A 1F2NA 2F6BA 2VBPA 3RZHA 1JI6A 1YIPA 1GR3A 4E8CA 3ZYBA 4Y5Z0 2A6XA 1AVBA 3M3CA 4XFBA 5HXMA 1WLWA 1ZBA2 1I3HA 5DXDA 1QJX3 5M0TA 2YGMA 1EV13 3Q8CA 4ORFA 1MPXA 3ILRA 3E6CC 4UF0B 2YMZA 4LT5A 2V09A 4AAPA 5K9YA 2BWAA 3UK9A 2EIBA 4PIYA 4DXTA 4GMP3 1IKPA 3S5QA 5A3PA 1N1TA 1POV1 1ZZBA 4LOTA 5FZ3A 3Q8FA 5LRRA 4V1PA 1U5YA 2GC1A 4XTPA 2VVFA 1JU4A 3ZDSA 3NQHA 3AK0A 1HB1A 3LEIA 1Q43A 2RDSA 1R1A2 5T55A 1UY1A 4YARA 3BTXA 4K6BA 4LE4A 5DZGA 2RS53 4Y3OA 2D7FA 3NVCA 2G9FA 4HPKA 2WZR1 5CFCB 2Y34A 3PTRB 4QX3A 2OVUA 2V72A 3I59A 1F5FA 1DP0A 5A3WA 2JIGA 2Q4SA 2CWSA 5LBBA 2HEYF 2XHNA 4IETA 1X50A 4P08A 4D3WA 4XF3A 4XZPA 4HVOA 1JOBA 2VZPA 4JKLA 4FXKB 4CRQA 1WMXA 1HIXA 5BPXA 1ND3C 1YWKA 4KH9A 2WFF3 4N43C 2FDJA 5FYVA 4MXWB 1EPZA 3FFQA 3VBUB 3L2YA 1RMU2 3GHNA 4X6RB 1ULCA 2FZ1A 4BOWA 5FOBB 3I3DA 4BQXA 4CDUC 4RQPB 3RDIA 5I93A 2ZZQA 1VAKA 4FFFA 1V6MA 2GNTA 5L9RA 3Q8EA 3U10A 2XVLA 4COWA 2FDFA 3ZXEA 4FTSA 2PAKA 2VY0A 4CDWB 3UYJA 5JIAA 2X29A 3LFMA 4ZXEA 5HCFA 5A6XA 1ZNPA 5FZHA 2NYYA 2BVVA 4FAHA 5F2WA 5ACA1 3OSDA 3M70A 2HWB3 2WQ4A 4OUSA 5F5CA 5FYUA 1EV11 3IWZA 3WXPA 4N43B 4O65A 3KVAA 4PDWA 4ES8A 3WCRA 1S0DA 4PIZA 4LR4A 1QJY3 3LPFA 4GMP1 1LJ7A 5E8AA 3H1WA 3NV2A 2ORXA 1IS6A 4AVAA 4XETA 1QJX2 1PZ9A 2DVGA 2ZHMA 3A4UA 3VD9A 2DWRA 3TWIA 2GN7A 4L8QA 1R091 3WINE 4CVUA 1W9SA 1JOJA 3PDQA 5F3IA 2VD7A 3AJYA 5A32A 3RJRA 3RSJA 2E7QA 1ND3A 2O8QA 2RS13 4GA9A 4YFZA 5BV6A 3D0SA 5A7OA 1WMDA 1C1LA 5FXWA 3NKGA 1DHKB 1J84A 4FT8A 3S57A 1S0IA 1POV0 1M4WA 2ADDA 2VOVA 4XJUA 5CKMA 1NA1B 2Q1ZB 4I3GA 4EWAA 2O14A 4LKEA 1OPOA 3TAYA 4Q1PA 2CDPA 3OGVA 4LBQD 4JVAA 4B1MA 3GYDA 2G4IA 2VMEA 3ZXJA 1K45A 1DGWA 4PI2A 4R9AA 4AWDA 1RUH2 2VQ0A 1GFF2 1J1LA 4MG2A 2RDRA 1MS8A 3JU9A 4QB1A 1PGL2 2CU5A 3RZJA 3VDDB 1OA3A 4HN0A 2EF6A 3OTFA 1H1AA 5C6CA 2JDZA 2DVFA 4IEZA 2UU8A 1FOD2 4CCLA 4FAGA 3RZGA 3VHOA 1IS5A 5T3NA 3MLKA 4P9GA 4L0PA 2UYBA 4CDUB 4E4DX 1QGLA 4FFHA 4CDQC 2WFF1 3D4KA 1ST8A 3ILNA 1YI7A 2GALA 4F8AA 5C33A 4CU7A 1COV2 3SMHA 5K0UC 4LHLA 3VL9A 1WW7A 4MX3A 2Y6KA 3VGIA 1NT0A 5I0UA 4P9XA 1SCRA 4ZPIA 2NQYA 4FOQA 5EJZB 3P1IA 2X5IB 1NAEA 1Q8SA 4GIQA 4WM8C 1UKRA 5FYIA 3VLBB 4CDWA 4Z8BA 1B35C 4KG0A 4Y1YA 1ZBE3 3NMBA 1DF0A 1PGW2 1DYOA 2WN2A 3PMEA 5K0UB 5FP4A 1RITA 1JZ4A 2XMLA 3CIHA 1SACA 3U37A 2PAEA 5FMBA 1QQP1 4BQ5A 4PHZA 3HQXA 3NNLA 5FP7A 1WCUA 1MZFA 2J1EA 1SLTA 2P4EA 2OKXA 1TVGA 1IG3A 4PLNA 3E6BA 1HRV1 3VBOA 3WF0A 2RJLA 4FPOB 2FMDA 3JD73 1LOFA 2HWF2 2Q1MA 3LEMA 1AZDA 1TG7A 5LWBA 3OGJA 3N9LA 4KG8A 2BVBA 1O4YA 2R30A 2ERFA 4LO4B 4Q4X2 2RS32 4XXAA 4UOJA 3CO2A 1YI9A 1WUVA 2WL1A 3V0AA 5LEJA 2DUOA 5DAWA 1PO21 2VCMA 1GMMA 5JDBA 2XJQA 3JQWA 1ZBA1 1V9U3 2A71A 5FZGA 2QQNA 1HRI3 1XE8A 1SPPA 2HWC3 2A3WA 5JIUA 1AL22 4N53C 4NO4A 2ZMLA 3ZSMA 1LHWA 3VBHC 3JUUA 1GNHA 3O1SA 4ASKA 3POSA 4S2FA 4K1ZA 4D7TA 5A3NA 1LEMA 2ZS6B 4JQTA 3U11A 3VN4A 4PQ9A 4FCAA 2ZMKA 1CQ9A 5DPNA 5FO7B 4JRLA 5EQUA 4FPJA 5IHRA 4N8MA 1X36A 4ET7A 1NLRA 4IEOA 2RDQA 2FMYA 3MIEA 4NHYA 5ERLA 4JC1A 3POYA 5FAXA 2R16A 3ACGA 4Q4Y3 2VR4A 5DG2A 4N53A 1AX1A 4KQ7A 4I2OA 5CZKA 5GZGA 3ZX7A 2X5IC 2DVAA 3TNPB 4MGYE 3UETA 4CUGA 4YWAA 3UGFA 4CU6A 1X82A 5FMOL 4V2WA 2CV6A 4KU7A 2ZACA 3U14A 3ROUA 3HEIA 3ZFGB 4Y1ZA 3ACLA 5CEHA 1G9AA 3E97A 2D5HA 3OGGA 5EZWA 2YV8A 1NZIA 2JWPA 4DS0A 2ADEA 5B4NA 1UYPA 3URFA 4B4QA 1KEXA 1PO11 4D7SA 3AMQA 2YGLA 3D3AA 5C9AC 1V6LA 1N47A 1OFNA 2OUHA 4Q4V2 3GZUC 4NWWA 2X09A 4Z92B 2EVXA 1ASJ1 4XJ9A 3TN93 5C3SA 3ZFFB 4OHWA 2QDNA 3FLRA 5FZOB 2MEV1 1I5PA 3SEPA 1KFUL 3ASIA 4IE0A 5FZ9A 4AEDC 1HQWA 5FLJA 3THPA 4LUMA 3POBA 4F83A 1BLZA 1NXD1 2WYFA 4GKYA 4CUCA 1RUF3 4FXGB 3A23A 4GZ9A 4SBVA 5A7SA 4CP9B 2J7MA 1V70A 4M0NA 2VZUA 5H9PA 3U07A 3MYXA 4D6SA 2ARBA 3PVNA 3TBDA 1XBFA 4FOVA 4LBJA 5DG1A 5F8PA 3GZEA 4J1XA 2RR13 4XILA 2AC1A 2KA3A 1QJU1 2BNMA 1RHI2 4GB32 5LA2A 3NAPB 5ABJA 4GD4A 1YFWA 1REDA 2JXAA 2VECA 4RL7A 2FDKA 5A3LA 1Y9MA 1H1IA 5FPVA 4AQSA 3IDBB 1UXXX 4ZHNA 4Q4V1 4D6QA 4UFLA 4CCKA 4M3CB 4CEYB 1E5SA 4H2AA 3WR0A 3LEGA 3T3YA 3OBRA 3EB7A 2NZ9A 2XVKA 3H8RA 1LESA 4FP3A 3EMRA 2WNEA 4ZU4A 1C8M2 2WABA 4FOYA 2P6CA 1POV3 1UY0A 4C0HA 4CCDA 1GICA 2CWMA 1MS0A 3VB9A 4B7EA 1S55A 3AJZA 4GH4C 5SV8A 4XDOA 4XOGA 3AYDA 3N9QA 3SKVA 3C7FA 1R1ZA 3WDYA 3EQEA 4HG6B 3MFAA 3INAA 3OB8A 5IVJA 3RVHA 3B94A 2YB7A 5BNPB 1CAWA 3I3MA 3PU3A 4LNVA 2YXSA 3I8TA 4GAZA 5AFBA 2WO1A 3PURA 1ASJ3 3NNGA 1PNGA 5J7MA 1UZ0A 3AZZA 3JB8A 4BDVB 4BISA 3OJBA 5CFDB 5L36A 1S4CA 3ECQA 2ZXQA 4AEJA 3SLIA 1G8WA 3ZSKA 3AKPA 1RUF1 2ZX3A 5EHDA 5FY4A 2R063 5CBLA 3WQ7A 1A34A 5JI7A 2YG0A 4HXCA 1O3QA 1QQP2 3B00A 5BY5A 2VUJA 4JTNA 5BXXA 4NHXA 3WNXA 4DMIA 2V5DA 2O0OA 1GU3A 1WLDA 1WW5A 1H9PA 2SBAA 3DECA 4OI2A 5D8AA 4TLFA 3KHBA 4IEXA 4GXLA 3CJIC 4XYXA 5FV3A 1GSLA 3FLTA 2DCJA 1L7QA 2RS12 4OI4A 1EUUA 3N36A 2VZ1A 2VL4A 3DN7A 4KL1A 1JYVA 2WUHA 4NHKA 4Y33A 3WVJA 4QDRA 1I1EA 3BU7A 2IXKA 5D8AC 2VMCA 3A0NA 1VR3A 1YO8A 5FZ1A 2WNUB 2WLPA 4ZONA 4FTEA 3ZDVA 2VZQA 4X8NA 5L7OB 5EFUA 2PFWA 2P1BA 2QBXA 3ZSJA 1PVC3 3BN6A 1H8VA 1OF3A 4I02A 3SCHA 1W03A 3T1MA 3F95A 4ZY9A 1XOYA 4LORA 4XDPA 2VBBA 5C8CC 4WZFA 3H9AA 4K8RB 4PIXA 1KJRA 2ZJCA 1IZ3A 2RVAA 2VQTA 1WLTA 5IFTA 2VCCA 4O9GA 4DUWA 3ETQA 5A1LA 1LEDA 5AFEA 4FVVA 2B7YA 1AXYA 4PBPA 4DFSA 1EY2A 2VH9A 2FHRA 1S0CA 3Q8AA 2XB6C 4H14A 3AVSA 4OHVA 3QD6A
chains in the Genus database with same CATH topology
5KC6A 3CJIA 3E5QA 3SNMA 1WBLA 5C8CA 1LKNA 4EN6B 1VBC3 1L3JA 2YUEA 2WZR2 4IEPA 4JDMA 4FPKA 1CVNA 5JCTA 3FFZA 1H8TC 1AR81 1HRI2 4HPKB 1FPN3 2GH8A 2R49A 2QQPA 1NQJA 2HWE3 3N35A 1O5LA 2XGXA 2VMHA 4HVRA 1ZRCA 2GU9A 4CDXB 3FX3A 1YRZA 4IEYA 1FOD1 2RMU3 4AVSA 2DFBA 1BMV2 4LE3A 5FLHA 4CEWB 4DNYA 1CAXB 2QCSB 1RUH3 1RUD2 1FMD3 2BFUS 1CN1A 1JTZX 3D8CA 1JYCA 1NE6A 1DGRA 4HL0A 3ELNA 3KD4A 4YGDA 3VBFC 3AMPA 1CAVB 4IV1A 3ZFFA 2WINB 4HSLA 3H0OA 2E7AA 2GAUA 4DB5A 1XXNA 3H7YA 3JBG2 4C90A 2XLFA 5BNNC 2QZ3A 1BYHA 1OA2A 4FTBA 3M3EA 1DQ6A 1HDKA 4WM7C 1JXNA 4FSJA 4XIOA 5JOZA 5C4WB 3VBFA 1PHMA 2RM23 5JR7B 1R092 3APBA 1MS4A 3KSCA 3M4FA 1EP0A 2C5DA 2ENRA 4QGNA 3JB4C 4Y20B 2JX9A 2R6QA 1ALYA 2YHJA 3M1HA 4LA3A 5T54A 2GH2A 1IPKA 2XG3A 3L2HA 4R8HA 2PQQA 4K20A 1HRV3 3DF0A 4QQLA 1AR83 1EPWA 3TB0A 4XHBA 1NZCA 1NQDA 1D4M2 4I3PA 5F9TA 1UPIA 2D3SA 1LHNA 1DGWX 1ND2B 1SBEA 2WZR3 1B09A 3NV3A 5KHJA 1PK6C 3MIFA 4E4ZA 4XMIA 1A6CA 1MEC3 2MHFA 5KXCA 1D0GA 3B01A 3VBRC 1MS3A 1ZBA3 5FREA 4FPCA 4EN0A 5I0TA 5F1RA 4NHMA 1XYOA 4DZGA 3OF1A 1N1VA 4MH0E 2GMMA 4AVTA 4WM7A 4IESA 5CB7A 1QH6A 1F9KA 1IOAA 1S2KA 1GLHA 4JTOA 2R041 3OYWB 4UW5A 4AGGA 2VVDA 4I09A 1QOTA 4ATFA 3AZWA 4QM8A 5FTTC 2JEMA 2CY6A 4IQPA 2O1QA 1S0JA 2HWD1 3AKTA 1XNKA 1MACA 2PHLA 4HK9A 4HETA 3V0BA 4LBKA 2XL9A 1R081 3VBSB 3LSDA 1QJX1 2E53A 1NYWA 4OI1A 3VL8A 3AZYA 4QD2A 1MZEA 2R0HA 3MF9A 1D2QA 2A6YA 2IXJA 1RUD1 4AGVA 2LALA 4QXKA 1QMJA 2MPFA 5F5QA 1R093 4OUMA 4RGGA 1REFA 1VRH1 2EA7A 1LB2A 1OQDA 2FZ2A 2V73A 3ES1A 1UPSA 1V6OA 4HK8A 1BK1A 3ZPYA 2W39A 3M2MA 1HRV2 1MR5A 4LLOA 2RHPA 3IM0A 5GKAC 5BNQA 2OPKA 3G6JB 4WM7B 2PHXA 3GBWA 1H2NA 3R05A 4KBBA 1SEFA 3EXUA 1QKQA 2HWB2 1ZZ7A 1H4HA 1H2MA 3AFKA 2IXCA 1VBD2 2ZGNA 4OVEA 1PO22 2K9ZA 4CEYC 2E6VA 3NWKA 2D6PA 1ND2A 3RG0A 1BBT1 4AG4A 1AR71 4HKLA 4KNCA 4JRAA 2BNNA 3N7LA 3JCIA 1AUYA 4R9DA 4OLLA 4U36A 3WUDA 3U4XA 3IDEA 1OQEA 1JYIA 1V6NA 3UL2A 3PVEA 5GJ6A 3H7JA 4CEWC 4YLZA 1AJKA 1UF2C 2RR12 3G7DA 1Z0HA 1PO12 5BNPA 2DUPA 3CL1A 4TZDA 2E9QA 3C2UA 4AW7A 1Y43B 3FZ3A 5ABJC 4P5HA 3FJSA 2ZA9A 1RUJ2 3KGLA 4AGRA 4M00A 1DZQA 3BCWA 4Q0PA 3O5SA 4OULA 2XWJB 4TWTA 1K5MA 3D6EA 4EWEA 4CDWC 2HWD3 3WQ0A 3V0BB 1RJ8A 2HWE2 3NO8A 2A6WA 2ZZJA 1C8M3 2D97A 1QNYA 1UZYA 3I59B 3J9SA 4HSJA 5A3MA 4YGEA 2NMOA 1NY71 5KXDA 1PIV1 4EWDA 2XKPA 1O4ZA 4Y4YA 1QHDA 1A78A 3WW1A 2QKDA 4P9LA 5CAZA 1QJU2 1RINA 2ZKLA 1DBNA 2WFF2 1V6JA 4Y20A 5JPNB 3E6DA 3IMNA 1BBT3 1AXKA 5GLVA 5CIRA 2A70A 3RWNA 5I91A 2FBEA 3PVBB 3M3IA 3D0JA 4AF9A 4RA0A 2E51A 2RM22 3CJIB 4N53B 1W6OA 4Q8KA 1EAH2 5LEKA 1YUDA 3H50A 1CAVA 4IV1B 3VBHA 5DUUA 2BPA2 3SXWA 3LKJA 3TRSB 2R043 3J8F1 3SHRA 2A73B 3ZN6A 2ZGTA 2HWF3 4BYYA 2PN5A 1CAUB 1PO13 2JG9C 4NWVA 4OHXA 4RS5A 3RMYA 3ZXFA 2I2SA 1LOEA 4QM9A 3VZLA 4NPRA 1ZZCA 2P2KA 3GNEA 2QFEA 1YFXA 3M7AA 3LAGA 2LTNA 1AYN3 3ZYRA 2XJSA 1TNFA 3I4IA 4IEVA 1RL3A 2RS51 1W2UA 4H3WA 5BNPC 1AR62 3OD0A 1PIV3 1OI6A 4LBQB 2XJRA 3AKSA 3QH6A 2B8MA 3RJ2X 3KGZA 3IT8A 2ZX2A 1RUC3 4KWLA 1Q3EA 1W6NA 2JG9B 4PDWC 5CVRA 2XL7A 1O4TA 4IV3C 3NL1A 4FQ4A 2GC2A 3LWCA 2A7AA 3H3ZA 4WVVA 5K7PA 3ENRA 3MIHA 4AEMA 3B5LB 1R1A1 1AR61 2VGDA 2XBO3 3TN91 2R1DA 5CG9A 3H1YA 3R6SA 2RMU1 1QXRA 1XRUA 4JAAA 4YSFA 1O5UA 4P9YA 1FPN2 3ILFA 1VB4A 1VBE1 1WW4A 5EYXA 4K1YA 2DTYA 3O0WA 4HT1T 1HXS2 3MLLA 1TQ5A 5FQ0A 2B46X 1G9FA 1QU0A 4DOUA 5JZGB 2PHTA 2O8OA 4R9BA 3MF6A 3WG1A 1LENA 2LM3A 4CP2A 1COV3 3KCYA 1XNDA 2JENA 2LUWA 4XF0A 4YM2A 3WP5A 5JSRA 1AR73 2QUOA 1HQLA 1ULEA 2X53S 2IXHA 2JICA 4Q0VA 2CL2A 1WW6A 1EAH3 1BBT2 1DQ0A 3VKOA 4COUA 2ZAAA 5KHGA 4ASMB 1OPMA 1UCXA 2XJUA 1HLCA 5CADA 1CD3G 2A5ZA 1SCSA 1A3KA 1YNAA 5FOJB 2YYOA 1VB2A 3DGTA 3B7MA 5GM0A 2D3PA 3ZN4A 2CTVA 1LOAA 1NA1C 1TMF2 3LZZA 2TEPA 1FYUA 3AP6A 4Z07A 4AI0A 3FC0A 4AFCA 1VJ2A 5DUVA 1AR63 4YVSC 3ZN5A 5FPZA 5C4WC 3AYEA 5ACA2 1CPMA 1ULFA 2Z79A 4QHBA 4WM8A 5E16A 1LOCA 2XVGA 3MGUA 4YZ4A 3SH3A 1NCQA 3I54A 1DQ5A 1NA1A 1ZM1A 4CYDA 1ZRFA 3UJOA 4XBLA 4BA6A 5I0SA 1RHI1 3AM2A 4GB31 5GZEA 1LGCA 2QDRA 5A33B 2BBVA 2GSYA 3O14A 2YDEA 5EYYA 1BZWA 2ZGKA 2AH2A 2ZX0A 1ZVFA 2ILMA 3AFGA 4N43A 3MW2A 1KDKA 4K40A 1G9BA 1PGL1 3MDPA 3NV4A 4YVWA 1KRIA 4UBGA 4GKXA 3AB0A 2VW0A 4XHXA 3MW4A 4B4RA 1BCXA 4S2HA 1G7YA 4I0AA 1H2LA 5EV7A 4P9WA 2YZ4A 4W6XA 4Q4V3 1N3PA 1WCSA 4LBNA 4M3CE 1H30A 2RS52 4GH4A 2WSVA 2C0ZA 1V6KA 1ZX5A 4WZCA 2ZGSA 1O3RA 4AEKA 4C0BA 2OZJA 1IHMA 3WHTA 4JDNA 1XYPA 1UU5A 1RUF2 2EAAA 4MXWA 1S0EA 3JD71 3VKFC 5BNNA 1CX4A 3VZKA 4OI0A 1UL9A 2D43A 3AZVA 1NOVA 2QNKA 2EAKA 1TMF3 4K3UA 5C8WA 1XQNA 3C3VA 3TYJA 2ZX4A 3WCSA 1WD4A 1C57A 2D6NA 4HLTA 5HCAA 2WC2A 1V9U1 2UWAA 5L7OC 1RUE1 1H8TA 5EWSA 2GNBA 3NKTA 4Q4X3 1YYNA 4QQHA 4G9SB 5C4WA 3VBUA 3B3QE 2VOXA 3ZN6B 2NP0A 2ZGOA 1Q56A 5AC91 4BHPA 3HIFA 1CJDA 1YHFA 1FOD3 1Y7BA 1C3HA 2WZPP 1NCRB 1V9U2 3DPRB 4XF9A 4CDQB 2F4PA 4AHZA 2MEV2 4B29A 1VBD1 1C28A 1UMZA 1RUJ3 1MS1A 4Q4Y1 1GZCA 4CEYA 5H9SA 5JLVA 1QY4A 4MXVA 2JD4A 1ND2C 3FHIB 4BIFA 3W59A 4Q8LA 2JJ6A 2OA2A 5BNOB 4WBBA 3WW2A 4BZ4A 3UKNA 2CYFA 1YCIA 4F7ZA 3OPZA 1J3PA 4BWOA 5BYNA 1UZZA 3RYPA 2VPVA 3AXDA 2GDFA 2B9UA 2XH6A 4XQWA 2GNMA 1SLLA 3WP3A 4BPZA 1LRHA 4EN9B 4YG6A 5AVPA 1DG6A 1ZRRA 4XJ8A 3LA3A 5HXVA 2Q0AA 5KXEA 1WLCA 1PMIA 2PLV2 2R073 5AVAA 1FV3A 4YW5A 1UAIA 4IEQA 1VIWB 4LEJA 3H8UA 4ES9A 2XWBB 5JAXA 1G9CA 3N7JA 3EHKA 5DDJ2 2WT0A 1UIJA 4JQRA 4JGZC 5FBZA 3R4SA 3VBOC 5HI0A 2Z2SB 2I74A 5E89A 4CEWA 4BLJA 3QBQA 3ZXDA 3S30A 1RB8G 5J3UA 3JBG3 2B42B 2UY8A 2VUAA 5I0RA 1D2SA 3PJYA 1SLIA 4GWMA 3NAPC 1DIWA 2GNDA 1GZWB 3ZXAC 1O7FA 5KHHA 4O9EA 5TSWA 3H3UA 3OBTA 3BB6A 2DYCA 2KM2A 1OSGA 2MNGA 2R042 1WMEA 4PLMA 4QPGB 2N7GA 1RTVA 5KHIA 3A0KA 5FO9B 3EO6A 1ENXA 3WDWA 1W6QA 4AEDB 2IFWA 1QJY1 4UW3A 1AYN2 1XE7A 1ND3B 1Z7S2 4EROA 5FDBA 4EV0A 5BUVA 1Q8VA 2EALA 3LCPA 3WLUA 1NXMA 1UU4A 4OHYA 5GZCA 2BQPA 1RMU1 3R4DB 1JN2P 3B02A 2JECA 3DPRA 5J37A 1ENQA 1WA4A 4FPEA 2D93A 3BTAA 3GBGA 3LSEA 1N3OA 1WBFA 2PHFA 4MGKE 1RUD3 1FAYA 4LA2A 5J98B 4Q4W3 2VQAA 3ZFGC 3ZSLA 5JVVA 2ZKNA 4Q1RA 3U0ZA 1J3QA 3SH5A 2VNGA 4NOTA 3KB5A 3ZFEA 2BUKA 3ZXKA 1PIV2 3DL3A 1LU1A 3M3QA 4ZU7A 1E57A 4MSVA 4YYOA 5DDJ3 4QPYA 2WNVC 1QDOA 4AHWA 1KD7A 3E5UA 3TOJA 1LOGA 4MV2A 1KFXL 3N3HA 4XFGA 1RVF1 4BH9A 4EJRA 4YNIA 4HFSA 2PYTA 3ALQA 2CGOA 2K2SA 3S7IA 1GYKA 2NM1A 4MYEA 3FUQA 2EXIA 4Q4X1 1C5HA 1LTEA 2A75A 2D44A 5GLWA 3I2DA 5I8SA 2CNAA 2G9GA 3ME2A 3ZIWA 4Y26A 1ZZ6A 3SITA 4YZ5A 3K51A 1YFYA 4QT6A 1JBCA 2D6KA 3GALA 3JD72 2RR11 3WX5A 3NAPA 2KXLA 5SV5A 4DINB 1EYBA 2IFRA 4U2AA 3PMSA 3VBSC 4P9IA 2JG8A 3AZXA 4XFIA 3RNSA 1CAWB 1RJ7A 1ZRDA 1CR7A 4MZUA 2UY9A 1Q8OA 1ZREA 4IV3B 3PNAA 4FO9A 2HWC2 4LBLA 1YJLA 1QF3A 2AUYA 1PK6A 4GH4B 4C91A 2GC0A 1HV0A 1IPJA 4M01A 3AYAA 3LA7A 1GV9A 2BYVE 4TSVA 2WA3A 1F31A 2W08A 4ISQA 5FCCA 5FLIA 4E4SA 5JMCA 4D69A 3BPZA 1U5ZA 1TME2 4I01A 4YVSA 3MI8A 4BCUA 3MLJA 4YG3A 1FPN1 1VBE2 4QMAA 3ZO0B 2ZGQA 4FQZA 1I5ZA 1S0GA 5E1RA 1PNFA 4Z82A 1RIRA 1RUOA 4A3XA 4ISRA 3ZFEB 1OFSA 2HEWF 2WS93 3WOGA 1FNZA 3IDCB 2H6CA 4RGAA 4BLIA 2ETEA 1KS5A 3IIAA 2DFCA 4RHV2 4RR3A 4XJAA 5H9RA 4Q26A 1S0FA 2YC0A 3PLQA 4H55A 4BQ1A 1MQTC 2HEVF 4KWJA 3JQXA 1GZWA 2ET7A 4N7IA 1YIFA 3NW4A 1QH7A 5JZGC 2EIGA 3HT1A 1QNWA 2B39A 1IS3A 2ZHLA 1UD1A 4FPHA 4AFMA 4W6WA 4LHNA 1WD3A 4R9CA 1ZZ9A 4L92A 1W6QB 4BIOA 1H9WA 3QOPA 2RS33 3KM5A 4LBQA 4G4FA 4YVWC 2K0GA 1LHVA 4CDQA 1RUC1 1JUIA 1QXJA 2E63A 2AGSA 3WDUA 1U5IA 3RPQA 4EN7B 2ZTNA 3DV8A 2AENA 1MS5A 1MEC2 1W39A 1SLAA 1OKQA 1XU1A 1KQRA 1Z7S1 3VV1A 2JE9A 1D4VB 2QJVA 2BFUL 4DY3A 3D5OA 3AP5A 5IK8A 1JW6A 2ZGRA 1CAUA 4RS5B 3VKMA 4DY5A 2Y0IA 3R4UA 1ASJ2 2V5YA 4LULA 3FLPA 1AYM2 4OZXA 1SBDA 4YW2A 1RGSA 3QACA 1NY72 5I8YA 3M3OA 1VAVA 2VMGA 5C8CB 4YG0A 2IC1A 2DTWA 2VNRA 4L11A 3RS6A 3VBOB 4BE3A 3UJQA 3KT7A 1AL21 1UX6A 1QQP3 2AREA 4QPGA 4OHZA 3H1MA 3WY6A 2B5HA 2ZOEB 1VBC2 4YM3A 3B9IA 1K5MB 2X8KA 1FMD2 4K8FA 2XBO2 2VOKA 4DXZA 1MVQA 1CJPA 4AYUA 5FRAA 4QGLA 2BWCA 4MUVA 4W6YA 3ZSEA 1N1YA 2RMU2 1NLSA 1HXS3 4QQOA 4S2GA 3ZFEC 3VUOA 4EN8B 3LOBA 1LGBA 1B35A 1GKBA 2W68A 4J1WA 1H4GA 1AYM1 1REEA 2E7TA 3AYCA 1FX5A 2XHKA 5LK7B 2HWC1 4XFFA 3VZOA 1OLRA 2DURA 2VW1A 4XFCA 2GMPA 3FBMA 1YLLA 1DQ4A 5GLTA 4Y22A 4FPFA 2ATFA 2WFPA 3WD5A 1VBB1 4AHYA 4CDUA 5I8TA 1HQNA 1KXGA 4META 3WUCA 4QU2A 1FMD1 1DZRA 1RHI3 4GB33 5B2GB 2I07B 4HBNA 2CAVA 4CP1A 2ZHKA 2P3KA 4MVTA 4AVBA 5L7OA 1NCRC 3CF6E 4UW6A 4CDXA 3NSTA 4XFHA 1JH5A 2IZWA 4Y1UA 1C8NA 3CU7A 4IERA 1N1SA 2R0FA 2A3XA 2ARXA 2R1BA 3Q9OA 4ATEA 5CFDA 2OYZA 1EV12 3BOWA 2NLRA 2GZWA 5T50A 2WJSA 3O12A 4YVWB 1Q8QA 4LO7A 3SISA 2WS91 1D4M3 3PHMA 1KJLA 1SDWA 5K8SA 4INDA 4QPIA 2ZHNA 5L19A 5IK5A 4XPVA 2JG8B 1Q8PA 1BMV1 3PJQA 1SLBA 4N7UA 3X29B 2C1FA 4QQ2A 4YVSB 3VZNA 1OLQA 3WT3A 2AR6A 1VP6A 2ZX1A 4Q4W1 2P34A 2R062 4X8PA 4JGYA 4JGYB 1APNA 1UN1A 4COZA 4E2SA 4Q0SA 4K21A 3AP9A 4AI8A 3WG4A 2D6MA 1BVVA 1F5JA 2PHWA 1C4RA 4XMAA 4KGQA 1BEV2 3PVOA 3MEPA 1GANA 1JHNA 1PGSA 1QJU3 2YPJA 1HV1A 2ZGMA 4LO6B 2VW2A 1IQAA 4JGYC 3RMXA 3B9CA 2CGNA 5JOWA 1AR93 2HJIA 1IS4A 1V00A 2CAUA 4XFAA 4DRVA 3KCXA 5F6KA 2DCTA 4H7LA 2PHRA 3ZYPA 4P9JA 5HCBA 3VBUC 2AYHA 1A8DA 5CFCA 4AEDA 5CU1A 1FXZA 1AR82 3AMNA 1DDLA 4N9HA 3BOPA 1QOOA 4N90A 4GWNA 1U5XA 4KGGA 2Y38A 1D4M1 2WA4A 2UWBA 2DF7A 4MGIE 3O0XA 1QJY2 4PJYA 1D0HA 3ES4A 3V65A 4COYA 2RS11 5JZGA 5F6LB 1VLNA 2RM21 4MGZE 1ZBE2 4WVZA 5BNOC 4Y24A 1RUG1 4BM8A 4JCKA 4AVVA 3MICA 3CJXA 1TEIA 4HN1A 4AFBA 3V0AB 1QDCA 2ZAHA 4XDQA 5JOYA 5JOXA 3HAGA 3VBSA 3LOIA 5EJ3A 2DU1A 3VBHB 1ZYBA 2GN3A 5J09A 5IK7A 1A8MA 1JUHA 3B69A 3ZYGA 5FMOS 1FT9A 2GMEA 3IN9A 3WG3A 1NCQB 2D40A 3AP7A 4Y1VA 1WGPA 1J3RA 4ZXKA 3CEWA 4FOWA 1AR91 1CESA 4A2UA 1GQGA 4XIKA 1X7NA 1W6MA 1AYM3 3HD8B 4GMP0 2A6ZA 2VULA 2VNOA 4JGZB 4JGZA 4IV1C 2DV9A 3UV9A 1R1A3 1LGNA 3JBG1 2XBO1 1QJZA 1AX0A 3TN92 1TME3 1AR92 1T6GC 1Z78A 5T52A 4KU8A 4PCRA 1DGRN 3MFCA 1VBE3 4GULA 4ITCA 3RYKA 2WNVB 2XLAA 1GNZA 1EAH1 1KS4A 1LOBA 3MIDA 3WHUA 1S2BA 1LCLA 2D6OX 2PLV3 2R32A 3KZ4C 4CP0A 1W0OA 4XEZA 1YJKA 3ZIXA 2YROA 1UIKA 1VALA 4M3CF 2TNFA 1AR72 4C1WA 3THTA 5LK5A 1G6NA 1KDMA 1MVEA 4GALA 1S0BA 1QWRA 2PAMA 4W65A 1PVC1 4L99A 5KHKA 1PVXA 1VBB2 5C9AA 3VHRA 2ZMNA 4RS5C 1AL0G 4RSUA 5KXBA 2YY1A 5HBAA 2R071 2HYKA 2RS31 3P3NA 4HKWA 2IWGB 4XBQA 5JSOA 2QE3A 3N7MA 1RVF3 4HZFA 3ATGA 1OOPA 5DZFA 4YW3A 3KQRA 1WCKA 4YM0A 2D98A 1TME1 3USSA 1Z7S3 2DU0A 2QVSB 3LA2A 4E2QA