4MUVA

M. loti cyclic-nucleotide binding domain mutant displaying inverted ligand selectivity, cyclic-gmp bound
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
142
structure length
142
Chain Sequence
GSQEVRRGDFVRNWQLVAAVPLFQKLGPAVLVEIVRALRARTVPAGAVICRIGEPGDRMFFVVEGSVSVASPNPSELGPGAFFGEMALISGEPRSATVSAATTVSLLSLHSADFQMLCSSSPEIAEIFRKTALERRGADASA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Nucleotide binding protein
molecule keywords Cyclic nucleotide-gated potassium channel mll3241
publication title Determinants of ligand selectivity in a cyclic nucleotide-regulated potassium channel.
pubmed doi rcsb
source organism Mesorhizobium loti
total genus 43
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4muvA00
3FX3A 4FT8A 4F8AA 3ELNA 3NW4A 4MZUA 2PHDA 3KMHA 4IEUA 2UY8A 2EAAA 4IEYA 4XETA 4MGYE 4Q0PA 4AQ2A 3OTFA 5LEJA 3IDBB 5F1RA 1CAUB 4KWJA 3H1MA 2B5HA 5KHHA 3NSTA 3KGLA 1J1LA 1YHFA 3EQEA 1YFUA 4R52A 1LKNA 5BXXA 3RZZA 4BIFA 4E2GA 3CJXA 4AVBA 3OGJA 3VHRA 3LZZA 1ZRDA 3H3UA 3PVBB 3I59B 1DZRA 1NE4A 5LRRA 2V09A 1OMIA 2Q30A 4D7SA 4FAHA 2Y0OA 4QGLA 4O9GA 4XF1A 1QXJA 3I54A 1UIKA 2QJVA 2BEOA 2H6BA 4MGIE 3GYDA 4IEVA 3SXWA 2IXCA 4I01A 1NXMA 5JSOA 1V70A 2H0VA 4IEQA 4AXOA 3H7JA 5JSRA 4IEWA 1ZRFA 5BUVA 1UPIA 1O3RA 2CV6A 5JR7B 4MUVA 3SMHA 4IEZA 1CGPA 4ONUA 5J48A 1QWRA 4LEJA 3FZ3A 2XKOA 3NL1A 4HLTA 4I0BA 2ET7A 3MPBA 3RDIA 3IWZA 2XKPA 4IEPA 3PLQA 5FLIA 4XF3A 4DINB 1ZZBA 4Q0UA 3FFQA 1YUDA 2QVSB 2XHKA 4LTAA 2DCTA 3M70A 4YARA 1O5UA 2GC3A 5I93A 1WGPA 3UKVA 3O14A 4IETA 5J7MA 3H1YA 1ZRRA 2K0GA 1O3QA 3GBFA 1LRHA 4ZU5A 2QDRA 2GZWA 4X6QB 1CX4A 4JTNA 3DKWA 1X8EA 3LA3A 5FPXA 5FLJA 2ET1A 4LUMA 4XFIA 4QX5A 1IPKA 4YYOA 4N9HA 4UXAA 4XFFA 4HVRA 3D82A 4WVZA 3H7YA 4P9GA 1RC6A 3BU7A 4EROA 4HN1A 2BNNA 1ZNPA 1CAWB 3ES1A 3RYKA 1XE7A 4QMAA 2E9QA 3IIAA 4R8HA 3C3VA 1J3PA 2BGCA 2VPVA 4KWLA 4LA2A 3U11A 2CGPA 4KU8A 4LA3A 3M3IA 1ZZ6A 2N7GA 2CAVA 1EY2A 5LRSA 1EP0A 2QCSB 1GQGA 1DZTA 3R6SA 3KCCA 4AVCA 2UYBA 1FXZA 3ES4A 1G6NA 3CEWA 1UD1A 3CF6E 4ORFA 2PFWA 4A2UA 2FMYA 3WW4A 5LEKA 4WBBA 3N4MA 3EHKA 2MNGA 2IXHA 2OZJA 5HI0A 2B8MA 2Q0AA 4XFCA 1ZZ8A 4HMZA 3E6CC 2PYTA 3FJSA 4AVAA 3ROUA 5C8WA 2D40A 2WFPA 3USSA 4XF4A 1RUNA 5BPXA 2PAMA 4EWDA 1OI6A 1UCXA 1J58A 2F4PA 2O8QA 4D7TA 3NVCA 5I8YA 5I91A 2OPKA 4JV4A 4E2SA 3EJKA 1O7FA 1QXRA 4HSLA 2K9ZA 3FE5A 4GULA 5T3NA 2GAUA 2HKXA 4L11A 2KXLA 4MV2A 1CAWA 2D5FA 1ZVFA 5KBFA 3H8UA 2GC0A 3EO6A 2Q1ZB 3RYRA 1UW8A 3L2HA 4Z07A 3CL1A 4LULA 4TLFA 4WZCA 1NZCA 2EVXA 4JTOA 2IC1A 1X8MA 3H3ZA 1VR3A 1X82A 3QACA 5AVPA 1DGWA 2XL7A 4LLOA 1HW5A 3BPZA 4LUKA 2ZCWA 3PNAA 1XRUA 1J59A 1YFYA 3MZHA 2ZKLA 2D93A 2EA7A 3BCWA 1H1IA 1Q43A 1WA4A 1ZZ9A 3KSCA 4I0AA 1YFXA 2IXIA 4MGZE 2IXKA 2Q4SA 2OZ6A 4AQ6A 5JSPA 4BHPA 3OD0A 1LB2A 1ZZCA 3HT2A 4QXKA 2H6CA 3OF1A 3HIFA 3ST7A 3NJZA 2B9UA 3BALA 3FHIB 3SCFA 5C6CA 3H9AA 3RYPA 5FCCA 3EBRA 4I09A 1XE8A 4ZU4A 2UYAA 4IEOA 2XGXA 3H50A 3IDCB 4MGKE 4UBHA 3OCPA 5BY5A 4HN0A 3DL3A 5E16A 1H1MA 1ZZ7A 1Y3TA 2I45A 2BNOA 2MHFA 3DN7A 3LAGA 1RGSA 1CAXA 4EV0A 2O1QA 2IXJA 3E6DA 3HT1A 1OD5A 1RTVA 2WC2A 3FWEA 4HZFA 4BH9A 4I2OA 3LA2A 2MPFA 3KGZA 1ZREA 2PHLA 5EZWA 4I3PA 5I0TA 4MH0E 4F7ZA 4XFGA 3WW2A 1O5LA 4IESA 5BV6A 4O9EA 2PAEA 3CLPA 1O3SA 4NVPA 4XFBA 5I0UA 4ZU7A 5D1IA 1UIJA 1X7NA 4XEZA 3MDPA 1JUHA 4J1WA 1FI2A 5I0RA 4XF0A 1O4TA 2ETEA 4PJYA 1RL3A 3SCHA 4QGMA 4B29A 1VP6A 1SFNA 1WLTA 4Q0VA 3ACLA 5FDBA 4E2QA 1CAVA 1O3TA 4PIXA 4X6RB 4JVAA 2XLFA 1NE6A 1GQHA 3D0SA 5JCTA 3MYXA 4META 3QOPA 1YWKA 3S7EA 3LWCA 5FQ0A 5CVRA 3LOIA 5FPZA 4XFAA 4CYDA 2HJIA 4XFHA 4FBFA 1I5ZA 1CAXB 2CAUA 1U12A 3TNQA 2Z2SB 4HVQA 5K8SA 3S7IA 2GC1A 5EFUA 2GC2A 4OFGA 4KU7A 1Q3EA 1Q5OA 2XL9A 4QGNA 2BNMA 1RUOA 4HSJA 1VJ2A 1SEFA 4YSFA 5JAXA 3WW1A 3UKNA 1PM7A 1PMIA 4UBGA 5KHKA 1L3JA 2VQAA 2GH2A 4XF9A 5I8TA 4PIZA 5KHJA 4FAGA 4Q0SA 2FQPA 3SCGA 2XLAA 2P17A 1OFNA 3ZDSA 1ZRCA 2VECA 2Z69A 3NKTA 4I02A 5I8SA 3TNPB 4KWKA 3U0ZA 2ATFA 2PAKA 4YRDA 4KL1A 5J3UA 1LR5A 1NYWA 2GU9A 4RD7A 1I6XA 1ZX5A 3UKTA 4IERA 1CAUA 5KHGA 4L2NA 4QM9A 1YLLA 3HQXA 1CAVB 3E97A 4HVOA 4J1XA 3LA7A 4EWEA 3D0JA 4BYYA 5KHIA 3E5XA 3SHRA 4OLLA 3CO2A 1QY4A 1YFWA 2D5HA 5FQ0B 4H7LA 3H1WA 3E5QA 1J3RA 4HBNA 4YNIA 1TQ5A 2XLGA 3E5UA 3I59A 3S0MA 1SQ4A 3ETQA 3G7DA 2PA7A 4QM8A 5E1RA 3IBMA 2UY9A 3E6BA 3BB6A 5I0SA 1FT9A 4Q29A 2PTMA 5FLHA 2OA2A 3RPQA 3JZVA 4N9IA 2PQQA 1DGRA 5CADA 3DV8A 3RNSA 4Z82A 4Q0QA 1J3QA 1Y9QA 1EPZA 3B02A 2OYZA 4PIYA 2IXLA 1IPJA 3WW3A 2C0ZA 1EYBA 2BYVE 5CU1A 3I7DA 4K8FA 4MX3A 2QNKA 4IEXA 4EWAA 3U10A
chains in the Genus database with same CATH superfamily
3FX3A 3MFCA 2JG8A 1N47A 3DXUA 2VZ3A 2PHDA 1OC1A 1ASJ3 2X05A 2QQWA 2UY8A 3ACHA 3J7NA 1XE0A 4A7ZA 4AQ2A 4RGAA 2DVGA 3K4ZA 1S2KA 2NPIA 1VB2A 3OUHA 3VBFC 2VVDA 5IFTA 3KF3A 5FPLA 4HONA 2B5HA 5C3OA 1NXD1 1PIV2 3KGLA 3MW3A 1J1LA 1GFF2 1NT0A 4QPIB 3U78A 1W9YA 4AEDB 5BNNA 2C6SA 2VMDA 3APBA 1DZQA 1YFUA 3V0AA 2FDFA 1BMV2 4BIFA 2HH9A 3W5NA 3CJXA 1AJKA 5IVFA 5JZGA 1NCRB 5IJRA 1NLRA 4GB32 2QQUA 1WW6A 5LY2A 1LGBA 2XVLA 3AMNA 4ZZ8A 3O1VA 2XJRA 1UYPA 5J96B 5FTTC 1EAH2 3UJOA 1JZ8A 1NA1B 3R4UA 2F6BA 1XYOA 3THPA 2ZHMA 4M01A 1OMIA 4IE5A 2OVUA 2VTXA 4QPGB 4FFFA 1RUF2 2Y0OA 5FMBA 4AHZA 4AK3A 4QGLA 1W8WA 3TB0A 1M4WA 1PIV1 3BTAA 1WD4A 5FYCA 3QH6A 3LEIA 3KWVA 3H0OA 3ZX7A 3VBHA 5HCHA 2WZR2 1FV3A 1UY1A 2GH8A 2FZ1A 3BIEA 2PHRA 1K3IA 1G9FA 4BDVB 1V6KA 1NXMA 5JIAA 2DUQA 3WQBA 1APNA 3GZTB 4NHYA 3FHAA 3WP3A 4AEKA 4CEWA 1V70A 2Y6FA 3C8XA 1HB2A 4EQVA 3NV3A 4IEQA 1EAH1 4P00B 2J1UA 2XMLA 3ZYRA 4BWOA 4XJWA 2ZAAA 2J42A 1ZM1A 3H7JA 2QZ2A 1XBFA 1BXHA 2VZ1A 4CDXB 2A6WA 2DDUA 3NV4A 3WNPA 1WKYA 4ATEA 2CV6A 4XHXA 4HKOA 5JR7B 5BNOA 4MUVA 2D3RA 1OURA 2ORXA 4LPLA 4CU8A 3UJQA 2WZR1 1QWRA 1YIPA 4MGTA 1LTEA 1V0AA 2JDNA 2XKOA 4JZRA 4LR4A 4NRMA 4RQPB 5FKCA 3KQRA 5FV3A 3VBOC 5CG9A 5FLIA 1PIV3 3VBUA 3V56A 3W5MA 1VBA1 3RVHA 5L7OC 2WQZC 1JZ7A 1SMVA 2ZABA 3OG2A 3ZYJB 4DINB 1JZ4A 3WUCA 2J1AA 4Q0UA 1GNYA 3DCQA 5FBJA 4BK4A 1QJX1 5LA1A 4M4RA 5FZOB 2JG9C 2ARXA 2GC3A 1AXZA 4XJUA 3O0VA 1WGPA 5I93A 1DQ2A 3JUUA 3ZIWA 2JG8C 2XONA 4QXHA 2K0GA 2TUNA 4PBPA 2E63A 4Q4V2 2X5IA 4RR3B 1MS8A 2BP6A 4S2GA 3T08A 3AKQA 3LOBA 4GWIA 2BBVA 3N7JA 1SBEA 2ZHKA 5AFBA 2VY0A 1O3TA 4A45A 1HQWA 4JTNA 4LHSA 2BERA 5FJKA 1X8EA 2CY6A 4CSWA 3GCWA 5FY9A 1H9PA 3ZYPA 3AK0A 1QDCA 3RFRA 4TLGA 5BNNC 2YHJA 3B00A 2WZR3 4PDWC 4AEMA 1AR92 2J22A 3KVBA 3IB3A 2YB7A 4XFFA 4WVZA 5FKBA 1RUE1 3Q8EA 4CPBD 5JZGC 3BU7A 3USUA 4Q4V1 4UF0A 2AR6A 1W2AX 5FZAA 2ZGOA 5LA2A 4P5YA 1QJZA 1OXCA 4YW7A 1NG0A 1VBA3 1H1AA 4A7YA 4F83A 3AXEA 4IW3A 1QJX3 1W8TA 4N53A 1TG7A 1IQDC 2VZOA 5FUIA 1XE7A 1GBGA 1MQTB 4FFIA 3S5AA 2BQPA 1JYIA 3B69A 4ATFA 5F5AA 5A3TA 5FZHA 3N35A 2B45X 4JQTA 5SV8A 2B7YA 4OUEA 1AR91 2FDGA 4FI9A 4LA3A 3POBA 1ZZ6A 4QKNA 3ZMOA 1NKGA 2N7GA 2CAVA 4XJ8A 1CZVA 4N43A 2P4EA 2XWBB 4QDRA 2D3PA 1V6JA 1OLME 4JRAA 4CEWC 3SLIA 3VBSA 4CCNA 5E89A 5FXZA 2V72A 1FXZA 3AVRA 4NAOA 4ORFA 4A2UA 5GM0A 4LBJA 2ZGPA 1RUE3 1YIFA 4BZ4A 3N4MA 4XOGA 2FDJA 4Q4X2 4Q4V3 2MNGA 4XDQA 5FWJA 3MIHA 2FDKA 3CU7A 1EPWA 2IZWA 2QQJA 4NHLA 1UO9A 3P6BA 4P9LA 5FZMA 4KG8A 3A21A 4YG3A 4QQLA 4URAA 3E6CC 4JGYA 3FJSA 2ZGTA 1VMHA 3ZFEA 1JU3A 2WYSA 4FPLA 1QF3A 1OBNA 3VBUC 4O61A 2BUKA 4P9JA 1RUNA 3EYPA 1W6QA 3BODA 2NZ9A 4BK5A 4EWDA 3LDRA 1AR93 1EUUA 4XABA 4Y26A 3LIGA 3FMGA 4BLIA 2F4PA 2O8QA 1JZ2A 3NVCA 4LT5A 2OPKA 1UX6A 2ARCA 2VZQA 3B9CA 3NNLA 2QQMA 2X5IC 4FQ4A 2Y33A 4LE4A 3NMBA 3N3HA 4FVVA 1AX1A 1CESA 5LZ6A 4OUSA 1JYNA 1Z7S2 1HRI2 2A6XA 4NOTA 5DN2A 2HKXA 1ODNA 1PMJX 2BV4A 2CGOA 4CVUA 3AB0A 4Q4Y1 1JMUB 4LO7A 1ZVFA 1LU2A 3S5QA 2GC0A 2Q1ZB 2JG9B 2IVJA 3ZYBA 3CL1A 5IVYA 1S0CA 2A73B 3AM2A 2QQPA 2VNVA 5C5TA 2C24A 1NZCA 1IOAA 2ZAHA 4RS5B 4AVTA 1LHUA 2HYKA 2W0XA 1MS4A 4LLFA 4FPYA 1VR3A 5DAVA 3I2OA 4YVSA 1X82A 5ANNA 5AVPA 4A3XA 1C4RA 4OULA 4N53C 1Z7S1 4LUKA 1HRI1 1H0BA 4ZXKA 1J59A 1YFYA 3DEMA 5DG2A 3J9SA 1UAIA 3WCRA 2EA7A 3BCWA 1LOFC 4PLNA 4QD2A 1GP4A 1Q43A 4I30A 3SH3A 4DZGA 2WNOA 2YC4A 3OGVA 5DUUA 2B42B 4FFHA 4RN5A 1YQ5A 3KVAA 1G9CA 4FXKB 1UMZA 3VD5A 3LFIA 3PUIA 3RZKA 5IAVA 5C8CB 2GNDA 3AKTA 2IVIB 2RR12 4N43C 5FYYA 4AE2A 2FZ2A 5T5PA 4AWDA 4Q4Y3 1YXWA 1NCQA 2X8KA 5JSPA 3N7LA 1JYXA 3VBSC 1PO22 1QQP2 2XOMA 2ZEXA 4A4AA 5JI9A 1ZZCA 2VL4A 3HT2A 5K0UB 1LCLA 5F32A 4Y3OA 2E6VA 2H6CA 5CKNA 5FZ3A 5IVCA 2W9XA 3OBRA 4TSVA 1RINA 3VKOA 2DUOA 5ABJA 1RUG2 3I2IA 1N3QA 3RYPA 1AR72 1DQ1A 3AZXA 2VCMA 3RSJA 2UYAA 3R0RA 4A42A 1MS0A 1SLIA 2IFRA 4QDSA 3RZGA 2XGXA 3H50A 4UBHA 1Z7S3 3OCPA 4JGYC 4XUNA 2W39A 2RR11 5J98B 5FZKA 5E16A 3ZFEC 5ACA1 4BMBA 1VBB2 3IT8A 2A6VA 3N9PA 4JDOA 3CKHA 2I45A 4HKWA 5EPAA 1QQP1 3LAGA 1PM4A 2VGDA 2E7AA 4Z8BA 1VMFA 5AFEA 4OHYA 2BWAA 2Y6KA 2W1WA 4ES9A 4Q2FA 5JOYA 2IXJA 2QZ3A 3HT1A 1JI6A 1QHDA 1REDA 3FWEA 1RUG1 1PGW2 3KF5A 4IGOA 4D6QA 4PHZA 2JENA 2XVGA 3KGZA 1AR71 2W47A 1OFSA 1HV0A 5C7GA 3OEBA 3U4XA 1SLBA 1GLHA 3MF9A 2PHLA 1UL9A 2ZOEB 5EZWA 2ZX3A 3KT4A 5I0TA 4OQ9A 4MH0E 4XFGA 3ZXDA 5IFPA 3ZXLA 4O9EA 5FP9A 3ECQA 3CLPA 4ZY9A 1VBB1 2CYFA 4Y20B 4NVPA 5D8AA 4CP0A 4QDQA 2ILMA 2YU2A 1RJ8A 2AEYA 1UIJA 2H0BA 5F7UA 1X7NA 3W20A 1CR7A 3TEWA 3AKPA 5A3NA 1ENRA 4JDNA 1VAVA 1PX4A 1FI2A 2RR13 3MI8A 2G9FA 4NWWA 3UGHA 5ACA3 5I0RA 3WXPA 4BB3A 1O4TA 1PGSA 2B39A 2YPDA 1WWYA 3JXSA 4PJYA 1QQP3 4YVWA 3OGSA 1XNKA 5LATA 4CA9A 3SCHA 4ITCA 1VP6A 3AMHA 3ZIXA 2BOJA 4LHLA 4COYA 2DTYA 1BKZA 5FDBA 3QBQA 1RUG3 3QCWA 2AYHA 1S0FA 4E2QA 1CAVA 4CZSA 1AR73 3THDA 2C4XA 4X6RB 4JVAA 1MS3A 3H8XA 3R4SA 2J7MA 1NE6A 4XILA 3SQOA 2FCVA 5FY1A 4XIKA 1GQHA 2ZHLA 4N7IA 3ZSLA 3MYXA 1POV1 1VBB3 3ZYIB 1AR62 2WT2A 2ZZJA 4IL7A 1NCQC 5FPZA 3ILFA 3O1MA 4COUA 1IHMA 3LSDA 1CONA 5CG8A 1O6UA 3J8F2 4ARXA 4NRPA 1U12A 3KM5A 2WWSA 2NMNA 2YBKA 4JDMA 1YQ8A 5FXVA 5ABJC 1LOEA 2JDYA 1DG6A 5A6ZA 5EFUA 1AX2A 2ZX2A 2GC2A 1WMXA 1Q3EA 2JB8A 4MLOA 4Q4W2 1UPSA 1HLCA 4I0WB 2XL9A 4QGNA 1RUOA 4HT1T 3WZ1A 1VJ2A 3KV4A 4LK6A 5JAXA 1CIYA 1PM7A 1AR61 1AUYA 2VBBA 3OY8A 4JCKA 4DMIA 1NLQA 4BOWA 5A3PA 3WF3A 1ND3B 2VAUA 1LHVA 2P3JA 2DURA 1BK0A 4UW5A 1L3JA 1Q8QA 1SCRA 3J8F1 4H3WA 4WM8B 5CAZA 4PBOA 2VVFA 1UWWA 2WZ8A 5FZ0A 2FQPA 4X8PA 4B4PA 1J1TA 1POV3 1XC6A 4HFSA 3NO8A 1RB8G 1JOBA 1K5MA 2AEZA 4C0HA 4I02A 4MO3M 2D97A 1KJRA 5FRAA 1PO12 1LR5A 1UZ0A 2PLV2 3AYCA 3BYWA 1S0EA 4LE3A 5FJHA 1PZ9A 5CA6A 5DAPA 3WSOA 5CFCB 2W3JA 3TEZA 1DP0A 2Q5TA 5KHGA 1UU5A 1DU3D 3TBDA 2FCUA 1SLLA 2A3WA 2I07B 4LHKA 3CDZB 2WNVB 5F9TA 3FLPA 4QPIA 5F6KA 4DXSA 1ZBE1 4AEDA 3IN9A 1EV12 2HYXA 4EN0A 1SLAA 1AR63 1LEMA 2HEWF 2QBXA 2W95A 2PXJA 4IV3B 2X53S 3MUZ1 1CVNA 1NCRA 1HQLA 1FATA 1TVGA 3H1WA 1PO11 1OLRA 1PK6B 2PHWA 2R072 1WA6X 1O59A 2PLV1 3E5QA 1JN2P 3J8F3 3RMYA 5CEHA 4YNIA 2QQOA 5GZFA 1GSLA 2XLGA 2Z5WA 2ADEA 5KC5A 3S0MA 1SQ4A 3ETQA 2LW8A 1NA1A 3G7DA 4LMFA 1LU1A 5A3OA 3UK9A 1H6YA 2DCZA 4QPGA 1QXPA 2ZGSA 1ST8A 2E51A 3AL5A 1ZRIA 5EP9A 5I0SA 2HWE3 2VBPA 4BQ4A 2VOVA 1B35B 3C7EA 2OIIA 1W03A 1XQNA 1EV11 1HIXA 1UZWA 2YU1A 4RHV2 1A8MA 1LODA 4K7JA 3V64A 2VJXA 2YBPA 3PUSA 3AZZA 3DV8A 1U0AA 3RNSA 1GANA 4Z82A 4FOYA 2R071 3DECA 1LECA 3WF2A 3H42B 3EXUA 5A80A 1EPZA 3B02A 1RMU2 3PU8A 1MS5A 2OYZA 3MW2A 2D98A 3LQCA 1ZBE3 2PQSA 2WRAA 1BEV2 4FP2A 1IPJA 3I2KA 5CBLA 1EYBA 2BYVE 3HPNA 3ME2A 1QNWA 2XBO2 2BTVC 1SCSA 1PHMA 1F5JA 3K2OA 1TEIA 3MLJA 4Q26A 2FDHA 3U37A 1T2XA 3P3NA 1PO13 4XAAA 1SBDA 3RI8A 2Y6JA 1MZ6A 4QPWA 4YFWA 3T0AA 3ELNA 3NW4A 4XUOA 4CPBA 1UQXA 4QHZA 4RHV1 4FOVA 4IEYA 3LEGA 5T55A 3BTYA 3NJXA 4RQPA 1L7LA 4Q0PA 2WLQA 2XQXA 2TBVA 4E4DX 5LEJA 1UY4A 5F1RA 1BYHA 4ISRA 1Z78A 1REEA 5DZFA 3KZ4C 1RMU1 4CU6A 1RUJ1 1WCSA 4NJ4A 2DCYA 3CIHA 2YPJA 3NSTA 3AVSA 1EV13 3MEPA 3KD4A 3UETA 4S2HA 2XBO1 1LKNA 5BXXA 1K5MC 2GALA 2ZZQA 2GMPA 4YM1A 5F37A 2ZACA 3O7OA 3KB5A 5T50A 1D0GA 2QQKA 2HWC2 3H3UA 3NQHA 4BQ5A 3I59B 1GYKA 2V09A 2RMU2 1C28A 2RM21 2VCCA 4FAHA 4RL7A 2IFWA 4W50A 1OQEA 2WT1A 1UZYA 2YUEA 2RS52 3AP9A 1ULDA 3CZUA 4QPIC 4XF1A 4XQDA 4AEDC 5FPBA 2R062 3I4IA 4OI0A 3CMGA 3J7HA 3TEXA 5SV5A 1PVXA 3KHBA 1XXNA 4RHV3 3VLBB 1IPSA 2G9GA 3ATGA 2W2IA 2A3XA 5CYYA 1NCRC 2WBKA 3SXWA 2IXCA 3KCXA 4YZ2A 3PU3A 1RMU3 3VDDB 3H8RA 1RUJ3 2HEYF 2DFBA 2BBAA 5F2WA 2CGNA 1SZBA 4CUBA 3VD7A 2HWC1 1W8HA 1ULPA 1VBC1 1NA1C 1BQPA 4AXOA 2ZGKA 2XBO3 5F39A 4W65A 4GMP0 1W06A 4QPGC 1JZ6A 1F35A 2RS51 2X09A 3D6EA 4UT5A 2R7EB 4NROA 2R061 4XIOA 3ILNA 3DKQA 2LS6A 3SMHA 4IEZA 2B4KA 4LKFA 4ZPIA 3WNMA 2JEMA 4GH4B 2R6QA 1RUC2 1LENA 1K5JA 3ETPA 5A3UA 2R32A 5EIYB 4L9BA 1OQDA 2ET7A 2RM23 4BQWA 2E53A 1ND2B 1VE0A 3IWZA 1UKRA 2BW8A 2MEV2 2OXBA 2Y6GA 3TOJA 1TMF2 1YEWA 3LKJA 1NOVA 3HJRA 1KEXA 1QEXA 2DFCA 2YGLA 3ZXGA 4LTAA 2D6LX 2VXRA 4CDXC 4D0QA 4Y5Z0 5FYVA 2OQ6A 2XQRA 3I2HA 3UKVA 2V73A 4IETA 5A3MA 3HD8B 1ODMA 4YW3A 2V4VA 1ZRRA 5J7MA 3P1IA 2DYCA 3POFA 3MO4A 4NWVA 2HWD2 2VE1A 1CJDA 2HWC3 1RUC1 1VBC3 3OPTA 4ZU5A 4RQPC 1DFQA 2QDRA 5LB6A 1MVQA 2WT0A 3B9IA 3KV6A 3AFKA 3SC7X 2MEV1 3DKWA 4XJ9A 5KXBA 2RS53 4Z92B 4UW4A 1UU4A 2R063 1R1A2 4Q8KA 2GN3A 2HWF2 2WO2A 1LGCA 2A5ZA 3FN9A 2BJSA 4UXAA 4Q27A 2K2SA 1W2OA 1GU3A 3A23A 3R05A 3NWKA 3H7YA 4GKXA 1JUIA 5FZ6A 3ZO0B 1RC6A 4W6YA 1Q8PA 4HPKB 4RR3C 5FZ9A 3ZR5A 2HWD1 1O8SA 3IPVA 4DQAA 1WCKA 3K48A 1ZNPA 2JE8A 1D2QA 3WX5A 4JKMA 5A7QA 4A6OA 3O0XA 4PI2A 1Y7BA 4BQXA 1FAYA 3AYAA 3X29B 2F4LA 4LBOA 2WWJA 5DDJ2 5C70A 4Y33A 3C7OA 2RV9A 3C3VA 5C3QA 1R1A1 2HWF1 1J3PA 2JG9A 2BGCA 2VMGA 1H2MA 3PMEA 1RUC3 2CGPA 3RGBA 5IWFA 4LQRA 3SH4A 2YDEA 3ORJA 5F8PA 2AC1A 1EY2A 2MEV3 4IXLA 2W68A 2JWPA 3PTRB 4XXAA 2OUHA 5H9RA 2QCSB 1IG0A 2BDRA 4CDQB 3U75A 1DZTA 5BNPB 2WNEA 3GZAA 3R6SA 4YGDA 4AL9A 3ES4A 4DEQA 1G6NA 1ULCA 5LBEA 3WDXA 4IGPA 5LEKA 2FMYA 1MQTC 4CCKA 3WCSA 3W21A 3VDCA 4EYUA 3WG1A 4PDWA 4IDZA 4QQOA 2HWD3 4OVEA 3IDAA 2Q0AA 4XFCA 1ZZ8A 2GP5A 4HG6B 3ZSMA 4HMZA 4LBKA 1KGYA 1W90A 2PYTA 4AVAA 4NIIA 5FZIA 5K7PA 5JPMB 3CJIB 4INDA 5EYXA 3FUOA 1R1A3 2XUMA 2HWF3 4XF4A 1QGLA 1W9WA 2YZ4A 1GZWB 2ORZA 5BPXA 3JD72 4WVWA 3WV6A 1OI6A 2BFUS 1QOSA 4V1PA 2NP0A 4FSJA 3O1RA 4PQQA 5CFDB 4CDUB 4HKLA 1ZYBA 1OQ1A 4JQRA 4EN6B 1BMV1 4LORA 4E2SA 2B46X 1O7FA 3WF0A 3BTXA 1MZEA 4Q5OA 3JQXA 1E5SA 1MS9A 2Q8CA 4GB31 3DXTA 3O1OA 2XJQA 1C1LA 1A78A 1W04A 1J83A 2GAUA 1V6MA 4L11A 4ZS2A 2KXLA 4MV2A 1GOHA 1CAWA 3J7LA 4DB5A 5KBFA 5KC6A 3T0BA 3JD71 1QOOA 1QDOA 1RUF1 1UW8A 3HOBA 3K3OA 2G4IA 3P3PA 4QB2A 1W6NB 2E33A 4QQHA 4LULA 3U4SA 1YJKA 5JOWA 1JYTA 4WZCA 3V0BA 1GZ9A 1WW4A 4BPZA 3AP7A 5FWEA 3THCA 4RGKA 4JTOA 1FX5A 2CHHA 1GOFA 5T5OA 1OKOA 2GN7A 2Z79A 3N9LA 4JHZA 1DGWA 2XL7A 4MYEA 3BPZA 4AFBA 1G8WA 4QU2A 2ZCWA 4B1MA 2ZKLA 3VKMA 2D93A 4Y20A 4V2WA 5FXWA 4FPEA 2A6ZA 4CXYA 4KNCA 1WA4A 1BVVA 1LJ7A 1JBCA 1DGRN 4XCAA 4MOAA 4GB33 3NNFA 4FPHA 2R1DA 3TWIA 3KSCA 3VKLA 1SFYA 5G05L 1YFXA 4AVSA 1MVEA 2LTNA 5EJZB 2WINB 4RS5C 4MGZE 1VBE2 2IXKA 3MHZA 5DG1A 1YJLA 3ZLIA 1EAH3 4DUXA 1GWKA 1Q8SA 5FOBB 2VW0A 3VV1A 3JD73 1RUF3 5FK8A 5FOJB 1LB2A 2L9LA 1V6OA 1GOGA 2XR4A 5LW9A 4K20A 3OF1A 3TRSB 1ULGA 1GQPA 4KBZA 5A7SA 2B9UA 5IVBA 2TEPA 2YV8A 2ZGLA 3H9AA 3T09A 1JOJA 4Y1UA 5FCCA 4I09A 4B3NA 4QAWA 4QKDA 1OHFA 5HCBA 4IEOA 4TWTA 1O91A 3LEKA 4P5HA 5F5IA 5C8CC 4ZHNA 1UXZA 2CDOA 4HN0A 1VBE1 3DL3A 3PL0A 4UFMA 5DPNA 2CU5A 4A44A 2ZX1A 4BLJA 2WA3A 5FMCA 1H1MA 2PELA 2WAAA 5FPAA 4B8EA 3AXDA 1H8TB 1Y3TA 2ZX4A 4R9BA 5A7PA 3DN7A 3FBMA 2D6KA 1FNZA 3P5BA 1QH6A 2QQVA 5K0UC 3KS7A 1LOFA 2CWSA 1ULOA 5JMCA 1FV2A 1RTVA 4LITA 4LNVA 3T1LA 3GNEA 1OA2A 4I2OA 4BH9A 4OCTA 1N3PA 3O1TA 2MPFA 2ZEWA 2J1EA 4LKDA 5JXJA 2WABA 5DZGA 3UV9A 2O8OA 4I3PA 2WNUB 2VCBA 1ULFA 4IESA 4X8NA 5BV6A 2W5FA 5GLZA 2PAEA 4AQTA 4TXWA 2VMIA 4EN8B 4LO6B 1XNBA 2BRTA 3HNYM 4E4HA 3PUQA 1AL0G 1ND3A 1PVC2 3I2FA 4WM8A 1KRIA 5K4LA 2Y34A 5D1IA 4XURA 3WINE 1UF2C 2ZS6B 5FBZA 3MDPA 2TNFA 1O8PA 3OBTA 1W8ZA 2LUWA 2LROA 3OD4A 1COV2 2JDKA 4DFSA 5JR2A 4AI9A 3DPRB 4XF0A 4GXLA 5A33B 3AC0A 3WT3A 1F5FA 1RL3A 5FYIA 3WDWA 1U5ZA 5GZCA 3RJ2X 4QGMA 3W59A 3W9AA 4B29A 4QB6A 2WLPA 2AACA 1SFNA 2BVVA 2RHPA 2WZPP 2W52A 1PVC1 4YW6A 1LOBA 1RUI2 2GMMA 4Y4YA 2WNVA 2XLFA 3ZPOA 4AI2A 4ZXEA 1IS5A 4Q4X1 3O12A 1UN1A 3ZVXA 3IKWA 5GKAC 5JVVA 4NE9A 5F6LB 2YFUA 1COV1 3QOPA 1HQNA 1FPN2 1H4HA 4IV3A 3AZWA 5DABA 3S7EA 1WBLA 4CP9B 1QJY2 3LWCA 5CVRA 3PURA 2VTXJ 4R9DA 3SH5A 4TYSA 4CCJA 1PK6A 1N1VA 4YG6A 4XFAA 1JU4A 5D2AA 3B5LB 2RG4A 2BU9A 1UZVA 4FBFA 1LOAA 1CIWA 3TNQA 5H9QA 2Z2SB 2JIGA 1TNRA 5FP3A 4H14A 2BZDA 4IV1B 3GHMA 3S7IA 1ACCA 3OSDA 1RUI1 3AX4A 4I3GA 4OFGA 2R30A 4D7YA 1X9TA 1B35A 5GALA 1Q5OA 4WVVA 1S0JA 2A1XA 1CN1A 4L0PA 2BNMA 2W92A 1H9WA 1SEFA 4YSFA 2RE9A 1FPN1 3WW1A 4ZONA 2A3YA 1PMIA 1QJY1 4ASMB 1PVC3 2QKDA 3KHCA 3HNBM 3BOWA 3SEEA 1H8VA 1E5RA 1F4HA 5KHKA 1JYVA 4CXXA 2GH2A 3ASIA 2OT7A 4Q4X3 4PIZA 4P9XA 2VNGA 5FY7A 2JDZA 1KS4A 4Q0SA 4UAPA 2IWGB 3VZNA 1COV3 1OFNA 3LPGA 2DWRA 3CBNA 4FO9A 5C71A 2VECA 3TNPB 3K46A 4E27A 1HRV2 1R092 2ZPXA 2ATFA 2PAKA 3ENRA 5J3UA 1NYWA 3MW4A 5JLVA 3WP6A 2WL1A 5L36A 4NPMA 3UKTA 3HBKA 2XH6A 1JOPA 3PUAA 2A70A 1JZ5A 3WQ7A 3OGRA 1OPMA 2NYYA 2V4AA 2AZ5A 5C5UA 1ND3C 1RUI3 2OX0A 1YLLA 1GP6A 5EYYA 4WM8C 1OT5A 2NMOA 3D0JA 3MIFA 4XXPA 1EUTA 3B94A 1GKBA 2VW1A 5F2SA 1UKGA 1W9TA 5J36A 3C7FA 4MXVA 5KHIA 3E5XA 1ONAA 2EIGA 1W28A 1FPN3 3URFA 3CO2A 1QJY3 2DCJA 4GWJA 4CP1A 4FOQA 1XU1A 1HRI3 1R091 4H7LA 2HLEA 1LULA 5DUWA 3AP5A 4QX2A 1DYOA 4YZ5A 1T6GC 3HEIA 3RZJA 4HBNA 5KXEA 1TQ5A 4AHYA 3I59A 4AYUA 1PO21 3SITA 4FTBA 2QUOA 4DRVA 5DMYA 4Y24A 5K9YA 4F3JA 1L7RA 1R1ZA 2RS12 2WNVC 3HN3A 3BB6A 5IVJA 3VBHB 1DQ0A 4PLOA 3K3NA 2I74A 3AYDA 3CNAA 4XBNA 2OA2A 3GDBA 3JZVA 1BBT2 4M3CA 4CTEA 4IV3C 5LCWL 2ZMKA 5CADA 2D44A 1PK6C 1SDWA 3BIWE 3VDDA 1QKQA 3POYA 3WG3A 4AI1A 3RZLA 4AEJA 5HBAA 1Y9QA 1DQ5A 1JZ3A 4PIYA 4CUCA 5AC92 4AZZA 2WN2A 2GDFA 3AL6A 2JD4A 4G9SB 3HQUA 4Q1RA 2VNOA 3AYEA 2C0ZA 1AYM2 4UFLA 3ZN5A 4EJRA 1OUSA 5LASA 3VD4A 4QX8A 3I7DA 3I3DA 4MX3A 2QNKA 2RS11 1OF4A 4P9WA 1POV0 2QQIA 1R093 1B35C 3U10A 1PGW1 5C4WB 3I49A 5FZDA 2BGOA 4Q1PA 4XPVA 3MBWA 4GH4A 4WM7B 3WHTA 1BBT1 1PO23 3KMHA 3N36A 4IEUA 4YGBA 2EAAA 2VUDA 3EB7A 2QFEA 4XETA 4OI1A 1W8FA 4MGYE 1ENQA 2JDUA 3RG0A 1CAUB 4KWJA 3LSEA 5A1AA 2ZX0A 3MLKA 3H1MA 4C91A 1VALA 4NPLA 2QQLA 1UMIA 5KHHA 5AC91 3OBAA 2VZVA 4RGGA 1OD3A 4A41A 4UFIA 1K42A 5C9AB 4IGQA 3EQEA 1DBNA 5HCAA 4PCRA 3OJBA 5LK7B 2JDAA 4LIVA 3ILRA 2EIDA 3RWNA 1A6CA 4AVBA 4CDWB 2WO7A 3LDKA 4P02B 3K51A 1XNDA 3OGJA 5BNQA 3LZZA 5FZFA 1PGL2 2BFUL 1W2NA 5JWPA 1ZRDA 2FBEA 5F3GA 5IT6A 4YFZA 3MV11 2KM2A 5ANQA 1C8NA 2J1VA 5LBBA 3UYJA 2Q30A 2VM9A 2RS13 2CSGA 3GZUC 4O7XA 1RUH2 4D7SA 2LRPA 5KXDA 3QLQA 2JKBA 3DF0A 5KWRA 4XJZA 4O9GA 3I54A 1KD7A 4AGGA 1UIKA 3FC0A 2BEOA 1O4YA 2H6BA 4V2VA 1NZIA 2X29A 1BBT3 2VG9A 5AVAA 2JECA 4BQ2A 5A7WA 1X9PA 3VBRB 3GYDA 4P9IA 4XBLA 2E7QA 4DO0A 3ZFGB 4I01A 1REFA 5JSOA 4E4ZA 5DZEA 5AC93 1IKQA 2H0VA 4LO4B 5JIUA 3ZKYA 4N7UA 5ISLA 5E88A 4IEWA 5G04L 1RUH1 1Z0HA 5FXXA 4BXFA 1O3RA 2ZEZA 4YZ1A 3H8OA 1WLWA 1IGOA 1AX0A 4KI5M 4Y4RA 2X10A 1PZ7A 5IK7A 3IAQA 1CGPA 1IQAA 3POSA 1ENSA 1UOGA 1UZZA 4Q4W1 4B7EA 4ZZ5A 3EMRA 1LHNA 1UYXA 1S0DA 4OQ8A 3ZMNA 3NL1A 4I0BA 2PHXA 2WKKA 4MGQA 4AAXA 3VDDC 5FYSA 1OOPB 2P6CA 1D2SA 1J84A 3MIGA 2RDNA 3POGA 3OBZA 2YBSA 4XC9A 3HVDA 4NMIA 2FDIA 2P3KA 4CU9A 5BNPA 1W3XA 2W1UA 4XUQA 3D3AA 1XYPA 1CZSA 2QVSB 2ZXQA 1GZTA 2XHKA 2DCTA 3M70A 4YARA 1O5UA 2YMZA 5A7OA 2JB4A 1CX1A 5GJ6A 4YG0A 5H9PA 1AHSA 5GZDA 3MF6A 1ZBA2 3H1YA 5M0TA 1JH5A 2VU9A 1O3QA 1W6MB 1WZXA 1X33A 2GSYA 2P34A 4GH4C 5FYTA 1YCIA 1I3HA 3I2GA 2W87A 2YY1A 2UWCA 3ZYHA 3THTA 2GZWA 4AF9A 1ND2C 4LK7A 5IK4A 1RUH3 1CX4A 3CJIA 3KQ4B 4OYUA 1DCSA 3K4DA 2ERFA 3B93A 3RJRA 4FCAA 1Q8VA 1K12A 1CQ9A 2ET1A 1YQCA 4L92A 4KWUA 1GMMA 4Q4W3 1XNAA 4QX5A 3WEZA 1WBFA 2E32A 1D0HA 5CFDA 3ZXJA 4CDUA 1RUD2 1X36A 1DHKB 4CU7A 4HVRA 3T0DA 2JICA 3ZSJA 5B4NA 3TEYA 1ZBA1 2XB6C 3UESA 3FHQA 1BJQA 3LB9A 4XTPA 4QXBA 1QOTA 5FK7A 1HJGA 4B4QA 1W9SA 2E7TA 2RJKA 4BQ3A 3WLUA 1S1AA 2R49A 4MHUA 3RS6A 4AVVA 3O1PA 4B1LA 1XJAA 3ES1A 4PT6A 1LEDA 5LBCA 2VQ0A 3ZN6B 1GWLA 3IIAA 5L73A 4CDXA 4NPRA 2VPVA 4KWLA 1W6NA 4DRRA 1W0NA 5A32B 1RUD1 2JE9A 2PLV3 1N1TA 4KU8A 3D8CA 1RJ7A 2DUPA 2QTWB 5LRSA 4QX1A 4GIQA 4MXWB 1V9U2 3HMYA 3RZHA 4XDOA 4AVCA 4CEYB 1UD1A 2Y6LA 3NNGA 2PFWA 3T2TA 4GAZA 4JGZB 3WW4A 4AAPA 4DXZA 1BEV1 4IQPA 1PNFA 4LO8A 1WW5A 1ZBA3 5FZOA 3EHKA 4K8RB 4KH9A 3AZVA 4S2FA 1W9FA 2IXHA 4AI3A 5HI0A 3T2PA 3MUY1 3ZXEA 4OHWA 1UOFA 2R073 1JHNA 4RR3A 3WNOA 3CHXA 3RQ0A 2VMEA 4LKEA 3WF1A 4FPFA 4GJZA 4QU1A 1XSRA 4GD4A 2D40A 2WFPA 4YPJA 1OVSA 3USSA 3BKZA 4CDQC 1V9U1 5BNPC 2XDVA 5JDBA 3DGTA 4MADA 1SFPA 4FPGA 1U5YA 1YO8A 1STMA 3C7GA 4OZOA 4ET7A 4L8QA 1RUD3 2HBUA 2VQTA 4AGVA 4UWDA 1VAKA 2WDBA 4PQ9A 4D7TA 2Y8KA 4HK8A 5I8YA 3A22A 1TME2 1GICA 1P8JA 3JU9A 5FYBA 1OPOA 5I91A 1WCDJ 3AJZA 1QXRA 2ZA9A 2VR4A 4QQ2A 3LGRA 4U36A 4Z2WA 1JODA 1VBD2 4Y1ZA 5B2GB 3IAPA 2V5YA 2HWB2 5T3NA 2D6NA 1GP5A 2KR2A 1BEV3 3CJIC 1CD3G 1V6NA 3NJYA 2EXJA 2UWAA 3I3EA 1H8TA 4W6WA 2D5FA 2RMU1 1PMHX 3H8UA 3EO6A 3IMMA 1MQTA 4TTGA 4AOCA 4UFJA 5CNAA 2LM3A 3L2HA 4KBBA 4Z07A 5CFDC 2WN3A 4TLFA 2Q1FA 4ISQA 4CDUC 3PVEA 1TME1 5T5JA 3IM0A 1WLCA 3SNMA 2EVXA 1HXS2 2VCAA 4UYBA 4LO5B 5FYUA 1X8MA 3H3ZA 4HXCA 4KQ7A 2BVBA 1V9U3 3WHUA 3RI9A 1OUXA 4D8MA 2WNUA 3VZMA 4LLOA 2HWB1 5D8AB 3FBYA 1NLSA 3MZHA 1YNAA 1ZA7A 4N90A 4C1XA 1SACA 1XU2A 1FYUA 4MVTA 1DLCA 5F5QA 1AXKA 1S0IA 3M4FA 3ZFFB 2YG0A 5CKMA 5CFCC 4M4PA 1GNHA 1URXA 2P1BA 3L9JT 4C1WA 5JOZA 4UFHA 1OSGA 3VL8A 2IXIA 1LOGA 2PMWB 1GR3A 4YVWB 1HXS1 5IVEA 1IS3A 2Q4SA 3DPRA 4NAMA 4XCBA 5FAXA 5A33A 2OZ6A 2DBNA 1LOCA 3VHPA 2RMU3 1R082 4F8AA 1ASJ2 5FP7A 4GWNA 3OD0A 2XWJB 3GCXA 4R9CA 1TMF1 4COWA 2KA3A 4QXKA 4DPNA 3HIFA 3ST7A 1KDKA 1TME3 3ZR6A 4GALA 5H9SA 3NJZA 3SCFA 5C6CA 5I0DA 1LAJA 3ACFA 4LBNA 5C3PA 5TSWA 4OI2A 4NIGA 3HBZA 3VKNA 2OKXA 4ZU4A 1G9AA 1F4AA 2WA4A 2WR9A 3K75B 1POQA 2D43A 2HWB3 3Q8AA 1YQ6A 1BK1A 4QX0A 2WUHA 3I2DA 3L2YA 1DLLA 2EXIA 5J37A 2YXSA 3A0NA 4J6GA 1Y9MA 5CKQA 5EQUA 1YYNA 2VXJA 4BU2A 1R081 2XJTA 3R4DB 2MHFA 1XOYA 2BNOA 1RGSA 5EJ3A 5A6YA 3JB8A 4UW3A 5CZKA 4M00A 2O1QA 5FY8A 2UURA 2WYFA 4YZ3A 4LJHA 2GNTA 2WC2A 4IV1A 2J1TA 4HZFA 1HXS3 4BE3A 3LA2A 3Q8BA 4AW7A 1KS5A 2AENA 1JXNA 3I97A 2RDQA 5EXOA 2QQNA 4QKBA 5C3SA 4RS5A 3T2OA 4F7ZA 3VHOA 4YM0A 2WWUA 3WW2A 1TMF3 2WO1A 2XJSA 1H8TC 1O3SA 4XFBA 1OLQA 2JDPA 4W4ZA 2Y60A 4YW4A 4ZU7A 1QH7A 4J25A 5DDJ1 4CCLA 3OUIA 4Z2AA 1WW7A 3T1MA 4H55A 4XEZA 1UMHA 1UY2A 3GALA 1JUHA 3D4KA 3NV1A 4J1WA 5GLUA 3Q9OA 1V00A 3LDBA 5L9VA 1AZDA 3I3QA 2NM1A 5A3WA 3ZSKA 3S30A 1R083 2ETEA 4DXTA 2O14A 5C8CA 1WMFA 2XJVA 4M0HA 4Y22B 4D69A 4DIQA 2WNUC 2WSVA 1UXXX 4WZFA 2GP3A 2OPWA 5IYYA 4FPOB 5FR3A 3NAPB 2VULA 1WUVA 4R4XA 4HANA 4YGEA 1C8M2 1SPPB 2VBDA 4NHXA 4OI4A 5K0UA 2K46A 3VZLA 3VZKA 1W6OB 2XJUA 4PIXA 4Q8LA 4DY3A 4EN9B 4IE7A 3RZMA 2JE7A 3SKVA 3LIHA 4OMCA 4NIHA 3D0SA 1E5HA 5CISA 1G7YA 4META 4PF1A 3DPRC 1YWKA 4HOOA 5FY0A 4KGGA 2WO3A 3UGFA 3U14A 3LOIA 4W8JA 3GZEA 4DOUA 5GLWA 5DDJ3 1GZCA 4XFHA 3WR0A 1I5ZA 1VLNA 1CAXB 2CAUA 1CJPA 3K77A 3MICA 4HVQA 1C8M1 5K8SA 2Y26A 1HX6A 1M06G 2GC1A 2ZKNA 1AYN2 2IUWA 4KU7A 3GF6A 1BCXA 1MPXA 2PN5A 1XSQA 3ZXKA 4M3CE 3WQ1A 4D6SA 3AJYA 2G9ZA 5FZCA 3DYPA 1MR5A 2ZGRA 4KGQA 3UKNA 1RVF2 2RDRA 1DIWA 4UBGA 3OYWB 4AHXA 1VBA2 4YM2A 1AJOA 3BVCA 3O5SA 5FZ1A 1BZWA 1CZTA 3BOPA 2GNBA 1QJX2 2VOKA 3ON7A 4N8MA 5I8TA 4FTEA 1C5IA 4FFGA 4IV1C 3SCGA 1XB9A 2XLAA 2P17A 4COVA 2I2SA 1ZRCA 1AYN1 4XQWA 5CIRA 2WAOA 2XJPA 3GJBA 1NY72 3HAGA 5FUNA 5C4WA 4A6SA 4Z1VA 4P08A 2E31A 4AR2A 4WVMB 3KCYA 4IE6A 3RRDA 1VAMA 4YRDA 1H2KA 2ARBA 5A7NA 4KL1A 5JXHA 2CWMA 2A7AA 4WM7A 3INAA 3MLLA 3PUHA 1C1FA 3TN92 1ZX5A 2WQ4A 4CUGA 5HPOA 1DGWX 1PX3A 1RITA 1C8M3 1RVF1 2BOIA 4IERA 3I8TA 1VIWB 3N7KA 1RIRA 3UL2A 1CAUA 2ZHNA 1Y9GA 4PF5A 4H2AA 1GNZA 1S0GA 2VOXA 3HQXA 3E97A 4EWEA 4J1XA 3LA7A 3KT7A 2D6OX 1JHJA 3ACIA 4FOWA 3LCPA 5DAQA 2ZMLA 4JKLA 2BGPA 4P9YA 5C33A 1A3KA 5C9AA 3T4HB 1RUE2 2RDSA 2Q1MA 3MPPG 3ZKUA 5HV4A 2SBAA 1NY71 4DEVA 2YGMA 3Q8FA 2EICA 2WQ8A 1W05A 1AL22 3A0KA 2D5HA 3VKFC 5FQ0B 4CDWA 1IZ3A 3HQRA 3VDAA 5LWBA 4QXCA 3TN91 3J26N 5FZEA 1UU6A 1AVBA 3ZPYA 5A70A 5KR7A 1U5XA 3SISA 1FNYA 2PA7A 3AMMA 4JHTA 4GA9A 5L9RA 5LY1A 1AYN3 2NN8A 1N1YA 2JJ6A 3E6BA 3ZDVA 3M3QA 4AFCA 3B01A 2Z4FA 1DQ4A 3A4UA 1H6XA 1WCUA 5FLHA 3RPQA 3SKJE 4N9IA 2SLIA 3ZYFA 1G9BA 1RVF3 3VBRA 2YROA 1DGRA 1AL21 1W3VA 3VZJA 1RXGA 4K40A 3ZFGA 4LKSA 1US2A 3VBFB 1J3QA 5FMOS 3LFMA 3RWKX 1S2BA 4NRQA 1XYNA 4ASLA 1VRBA 2EALA 1GUIA 1WMDA 5CU1A 1KXGA 3AP6A 2LALA 5A6QA 1W6PB 2KD7A 3HR9A 4K8FA 4QHBA 4IEXA 2Y64A 4EWAA 1HN1A 1R64A 3VBHC 5GLVA 4LBLA 1VBE3 1B09A 1AF9A 2OW4A 4FT8A 4XUTA 3TN93 4EZ4A 4MZUA 3PIJA 4UFKA 1F9KA 4C8DA 2A75A 4HETA 1W8UA 3GGLA 5JXGA 3OTFA 2ES3A 3WNXA 3IDBB 5L19A 1OOPA 2GMEA 1IS6A 1UOJA 4YW2A 4CCMA 3WG4A 1QJU2 4EN7B 3NKGA 1YHFA 4K1ZA 5GLTA 1JYCA 3GHNA 3HWJA 5FZ7A 5F3EA 4D3WA 5BNOC 4R52A 2XXZA 4FQZA 2A6YA 3RZZA 2QE3A 1AL23 5C4WC 4E2GA 4E8DA 3OUJA 2UWBA 1KQRA 4IE4A 4XHBA 1W6MA 3WDYA 4WM7C 3WVJA 5APAA 2OQ7A 3VHRA 2W94A 3ABZA 3QH7A 3PVBB 1DZRA 1HB1A 1NE4A 4RSUA 5LRRA 4MG2A 4Q4Y2 5FYHA 2BWCA 5DQ0A 3MFAA 5JOXA 1G86A 1OA4A 2Y38A 2VTFA 3ZN4A 2VZSA 1QJU1 1QXJA 1MZ5A 2QJVA 4NHKA 5C9AC 1VRH2 4R4ZA 3UGGA 4K9SA 1YRZA 3I3BA 4MGIE 3FLTA 3H3LA 3IPVB 1SHWB 4IEVA 4CDWC 3BPSA 4CXWA 4DUVA 3VBOB 5FO7B 4XW3A 1YI9A 3LF7A 4HK9A 4WV8A 5L7OB 3LEMA 2RS32 2XVKA 3T3YA 2VUJA 4LBQB 4BQ1A 2XHNA 4FP3A 5C3RA 3M3OA 5JSRA 3ZN6A 4BA6A 5BUVA 1ZRFA 2VOTA 1UPIA 4RFRB 1IG3A 5B4XA 1KDMA 3KV5A 3U07A 1OVPA 2P5BA 4XTMA 2JG8B 3POEA 1SLCA 3VD9A 1VRH1 2DTWA 4YW1A 4ONUA 5A32A 5J48A 2VVEA 4LEJA 3VBRC 4LOSA 1A34A 2R0FA 3FZ3A 3NJVA 2W1QA 4HLTA 1W0OA 3IMNA 4NUBA 3MPBA 3ZFGC 1WD3A 4AI8A 2WJSA 4B7KA 5FPVA 5FYZA 3RDIA 2XKPA 3GM8A 2VW2A 4IEPA 1D7PM 4SBVA 5FY4A 4MXWA 1QJU3 4CCCA 3PLQA 4XF3A 4AG4A 2ZMNA 2G1MA 1SG3A 2J1RA 1KFXL 2RS31 1ZZBA 4CEYA 3FFQA 2FMDA 5BNNB 1YUDA 4JGZA 5FMDA 1HV1A 3V0AB 3DUIA 4PDWB 5IK8A 3RYKA 2WIIB 5T54A 3O14A 5A3LA 2FD8A 3M8LA 3VUOA 2W1SA 5JZGB 2BPA2 4D6RA 3WNKA 4B4RA 4XYXA 3GBFA 3F95A 5ACA2 1HRV1 1LRHA 1S55A 1OH3A 2CNAA 1QJFA 1OH4A 4LHNA 1NQDA 1UX7A 1OOPC 2D7FA 4X6QB 3WP4A 4BXSV 1RHI2 3LA3A 5FPXA 2VD7A 5GZGA 5FLJA 4LBQD 1PZ8A 1OF3A 1ZA4A 1CPMA 1VRH3 4QKFA 4QHOA 4LUMA 4UOJA 4XFIA 5FPUA 4E9KA 3N9OA 1IPKA 4YYOA 3IIIA 1JTZX 1QJEA 1Q8OA 4N9HA 4DXRA 3IDEA 3D82A 3S57A 4YZ4A 4P9GA 2VZPA 4EROA 1WMEA 2JDMA 2OUJA 3FLRA 1JYWA 4E8CA 3M3CA 3AKSA 4CCEA 4HN1A 4COZA 2BNNA 4DS0A 4CEWB 2RS33 4UW6A 4AGRA 4QX3A 2ZGNA 5LA9A 1LNSA 1LGNA 2C26A 1CAWB 1ULEA 5FO9B 5JI7A 2RJ2A 4FPJA 1DYKA 1RHI1 2P6HA 2WS92 2PHTA 4QMAA 3AZYA 2EXKA 4RYDA 2E9QA 4LOTA 4R8HA 4R9AA 1LESA 2VUAA 4L97A 5BNOB 1NX9A 3OOXA 3V0BB 4LA2A 2B9VA 3PIGA 1DDLA 3U11A 1HRV3 4ES8A 3M3IA 1ENXA 1QU0A 2DV9A 1WLDA 4OMDA 2V5DA 1VB4A 2JD9A 4PLMA 4IUGA 1EP0A 3ZXAC 3ZSEA 1UY0A 2D6PA 1T6BX 2RVAA 3D5OA 1K45A 1GQGA 1ND2A 3BGAA 1KFUL 3VBUB 1VPHA 4XDPA 4K3UA 5HV0A 4LIUA 5DAWA 2EIEA 3KCCA 2UYBA 4JX0A 5FZGA 3CEWA 3ITQA 3CF6E 3V65A 4CP2A 3GJAA 4OUMA 5CB7A 3MGUA 2WS91 4GKYA 4WBBA 3RYRA 3WDTA 3HNMA 1W8OA 1AYM1 3FFZA 5IHRA 2NLRA 1S4CA 4MGSA 1HN0A 2R0HA 4Y5TA 3ZFFA 2XG3A 3N7MA 4XBQA 2OZJA 2X5IB 2B8MA 3AFGA 4QT6A 3ZM8A 3M3EA 3LD8A 5JPNB 2R1BA 3DYMA 4XVHA 4QX7A 3PJYA 4YVSC 3ROUA 1RHI3 1GV9A 3PMSA 3TYJA 5C8WA 1HB3A 3KV9A 1IKPA 2P3YA 2HBTA 4OHXA 5DUXA 3VD3A 1W39A 1S0BA 4FPKA 2PAMA 4CEYC 2GNMA 1QNYA 3WY6A 1UCXA 1J58A 4GJYA 1HDKA 4JGZC 1DQ6A 2EF6A 3WQ0A 3A7QA 2HEVF 5BYNA 3CQOA 4JV4A 4W6XA 1Y4WA 4KMQA 3BI3A 3EJKA 3USUB 4UF0B 4XMAA 1KJLA 4FXGB 1AXYA 1JW6A 2UU8A 4Y1YA 2DVDA 4HSLA 4HPKA 5IW0A 2K9ZA 3FE5A 4MHRA 2VZUA 4GULA 5DXDA 4CCDA 1MACA 1PGL1 1SBFA 4S2DA 4N53B 1NQJA 3WDUA 2JX9A 4XZUG 2ADDA 1O4ZA 2WS93 3MIDA 4SLIA 2ZGUA 1AYM3 2WFF2 4P14A 4IE0A 1LHWA 2VO5A 3GBGA 3ACGA 1V6LA 3JCIA 5FIXA 4OHVA 1DGLA 3VHNA 4AFMA 3KLSA 1DF0A 1XPWA 2AH2A 2EAKA 3MIBA 3T2QA 1XNTA 2VOWA 2HWE2 1HJFA 2IC1A 4N43B 4EZHA 3WNNA 1V6IA 3VZOA 3PTYA 3UNPA 3QACA 3VBSB 3VGIA 1G9DA 2O0OA 1HW5A 4C0BA 1OLMA 4CCOA 3PNAA 4CDQA 1XRUA 1F31A 3N9QA 3M1HA 1GWMA 2WFF1 2ZGMA 1H1IA 3NNJA 3O1SA 4GZ9A 4QB1A 2NQYA 1ZBE2 2ZGQA 4H7MA 3OGGA 5JUVA 1ZZ9A 1LHOA 1W8NA 4M0NA 3N9NA 4JAAA 2VNRA 2XUEA 3AP4A 5LK5A 4AQSA 2W91A 3PHMA 4I0AA 2VMCA 3ZXFA 5KXCA 1PNGA 2HWE1 3M2MA 4JGYB 4YWAA 4A3ZA 3ZFEB 4AQ6A 5GZEA 4EE2A 1A8DA 1TZOA 4Y22A 3POWA 4BHPA 2ENRA 4D94A 5LBFA 1W6QB 5D8AC 2Q8DA 3WG2A 4BQYA 1MS1A 3K4AA 3NRUA 1UYYA 2Z42A 3NAPA 2DVBA 3CZJA 1GZWA 1SPPA 1YI7A 4Y1XA 2WZEA 3BALA 2VC9A 1W6OA 3FHIB 2Q8OA 4O65A 3ZFFC 4Y5SA 4QPYA 3BU0A 3EBRA 2DF7A 1XE8A 4Y1VA 3TAYA 2YYOA 5FUPA 4TN7A 2DBIA 3IDCB 4MGKE 4YVWC 2WSUA 3Q8CA 5FZBA 5EJ1B 5BY5A 4RFT0 3NV2A 5FP4A 3ZOIA 2YC2A 2WFF3 1E5IA 1YC61 1ZZ7A 4JRLA 4ASKA 4AFDA 2FCTA 1W2UA 2RJLA 5EHDA 4XE9A 2AUYA 1CPNA 1CAXA 3KT1A 4K6BA 2JDHA 4EV0A 5FYMA 3E6DA 2P37A 3DYOA 1QIQA 1OD5A 4AI0A 5CFCA 1CWPA 4XZPA 3WP5A 3WOGA 3AKRA 3FUQA 4GWMA 3POJA 5JMOA 1QMJA 1YQ2A 5FMOL 1ZREA 2R042 1AR82 1X50A 5FZ8A 4YVSB 5T52A 5FFOC 3C2UA 4QWNA 4BISA 1NUKA 3O1UA 3T4VA 1O5LA 5IUQA 3ALQA 4XQ4A 4NIAA 3GBWA 2ARAA 5F3IA 5HXVA 4E4SA 1RUJ2 1DYPA 3IZOA 3OYWA 5F5CA 2OS2A 5I0UA 1U5IA 4M3CF 2VH9A 4XJAA 1RYYA 5D21A 3O0WA 1VMJA 1OA3A 2D3SA 5HCFA 1I1EA 4XACA 4BMEA 5A6XA 5IATA 3JB4C 3QD6A 3VDBA 4NIDA 4U2AA 4WVMA 1W2TA 5ERLA 2R041 1AR81 4LXLA 1NCQB 1UOBA 5E6HA 4ARYA 1H4GA 3POIA 4URTA 3JBG2 4DUWA 1HB4A 3WNLA 2RM22 2P3IA 1N1SA 5FZ4A 1WLTA 4PI0A 4Q0VA 3ACLA 4BM8A 3B7MA 4OHZA 5ABJB 2AGSA 2DCKA 1L7QA 2PHFA 1D4M2 2C9AA 2CDPA 5DAXA 4AFAA 5IVVA 5FO8B 1XNCA 2ZBJA 1UNBA 1UY3A 1FOD2 1MEC2 3OPZA 4G4FA 5HXMA 5JCTA 1D4VB 1SDDB 3E1F1 5FQ0A 3MIEA 3C7HA 3S6PA 2P2KA 1F15A 1VBC2 4L99A 2EIBA 2JKXA 4CYDA 5IAXA 2HJIA 3JBG1 5L9BA 3BTZA 4XUPA 1C5HA 3NAPC 4NO4A 1F8VA 2Y0IA 2VZTA 2VMFA 1ALYA 1W0PA 1D4M1 1BLZA 1UYZA 2YFZA 3WD5A 2R043 2ZTNA 1AR83 1F2NA 2G19A 4BCUA 3M7AA 3RMXA 4A7KA 4M3CB 1FOD1 1MEC1 5DUVA 2Y6HA 3HN1A 4HSJA 1BHGA 1NAEA 1JS9A 1OKQA 3VN4A 4YLZA 1FMD2 1VBD1 2C5DA 2J1SA 1C3HA 1Q56A 2JXAA 3VBFA 2VQAA 5J09A 4QQPA 4XF9A 5T5LA 4FPCA 5A1LA 4HL0A 5KHJA 1H30A 4FAGA 4FTSA 3ZDSA 1W6PA 3AMQA 3VB9A 1MZFA 3JQWA 4ZS3A 1HKDA 2Z69A 3BN6A 3NKTA 4LBMA 5I8SA 4KWKA 3U0ZA 4NHMA 2DVAA 5EWSA 5E8AA 3UT0A 4DY5A 4JKKA 3JBG3 2GU9A 4RD7A 1I6XA 1SLTA 3J4UH 4YGCA 4NR1A 2R16A 4YM3A 3I3MA 3T30A 1FMD1 2DU1A 4K1YA 4TZDA 1D4M3 4L2NA 4QM9A 5FREA 1W99A 1CAVB 4HVOA 4XMIA 2C1FA 4CRQA 3PVOA 2DVFA 3LPFA 1IS4A 3PVNA 5J1XA 2XPJA 1FOD3 1MEC3 4BYYA 4GMP1 1WCQA 4C90A 3SHRA 2W08A 4BIOA 2A71A 4OLLA 2VUCA 2YC0A 3MV01 1E57A 1QY4A 3B3QE 4XAEA 4CUAA 1VBD3 1YFWA 1H2LA 2DU0A 1RXFA 1I5PA 1BVP1 2F17A 4CP9A 2FHRA 1J3RA 4YW5A 3E5UA 5JXIA 1ASJ1 1C57A 1N3OA 3PJQA 2CTVA 4CE8A 4ZKTB 3VL9A 2ID4A 2ZEYA 2Q8EA 1S2EA 2VZRA 5FZLA 4QM8A 3WUDA 3U1XA 3F2ZA 1US3A 2VQUA 3OEAA 2D6MA 1H2NA 3IBMA 4UI9L 2UY9A 5E1RA 5FP8A 1FT9A 3OPWA 4MSVA 4Q29A 3GXUA 1Y43B 2JIJA 5LA0A 2PTMA 3FL7A 2C9KA 5A7WB 4DNYA 4JC1A 3WDVA 4RA0A 2E26A 2QDNA 2PQQA 3G6JB 1FMD3 4NN0A 5EV7A 4AHWA 2ZJCA 4G3YC 3OY8B 2CL2A 3WF4A 1TNFA 4Q0QA 3VBOA 3ZYGA 3BUCA 2PHUA 5F3CA 3I2JA 3W58A 2IXLA 4BJ0A 3SEPA 1KITA 3LE0A 4GMP3 4K21A 4KG0A 5L7OA 2W46A 4LBQA 3WW3A 5A1FA 1I9RA 3AMPA 1TE1B 2AREA 4GQ7A 3N9MA 3OB8A 5FY5A 5IK5A 3PDQA 3J7MA 1K5MB 2EXHA 3NNMA 2VMHA 4OZXA
chains in the Genus database with same CATH topology
3FX3A 3MFCA 2JG8A 1N47A 2PHDA 1ASJ3 2UY8A 4A7ZA 4AQ2A 4RGAA 2DVGA 1S2KA 2NPIA 1VB2A 3VBFC 2VVDA 2B5HA 1NXD1 1PIV2 3KGLA 3MW3A 1J1LA 1GFF2 4QPIB 4AEDB 5BNNA 3APBA 3V0AA 1DZQA 1YFUA 1BMV2 4BIFA 3CJXA 1AJKA 5JZGA 1NCRB 1NLRA 4GB32 1WW6A 1LGBA 2XVLA 3AMNA 2XJRA 5J96B 5FTTC 1EAH2 3UJOA 1NA1B 3R4UA 2F6BA 1XYOA 3THPA 2ZHMA 4M01A 1OMIA 2OVUA 4QPGB 1RUF2 2Y0OA 4AHZA 4AK3A 4QGLA 3TB0A 1M4WA 1PIV1 3BTAA 1WD4A 3QH6A 3H0OA 3ZX7A 3VBHA 2WZR2 1FV3A 2GH8A 2FZ1A 2PHRA 1G9FA 1V6KA 1NXMA 5JIAA 2DUQA 4AEKA 1APNA 3GZTB 3WP3A 4CEWA 1V70A 3NV3A 4IEQA 1EAH1 3ZYRA 4BWOA 4XJWA 2ZAAA 3H7JA 1ZM1A 2QZ2A 1BXHA 4CDXB 2A6WA 3NV4A 4ATEA 2CV6A 4XHXA 4HKOA 5JR7B 5BNOA 4MUVA 2D3RA 3UJQA 2WZR1 1QWRA 1YIPA 1LTEA 4DY5A 2XKOA 4LR4A 4RQPB 3KQRA 3VBOC 5CG9A 5FLIA 1PIV3 3VBUA 3V56A 1VBA1 5L7OC 2WQZC 1SMVA 2ZABA 3ZYJB 4DINB 3WUCA 4Q0UA 1QJX1 2JG9C 2ARXA 2GC3A 1AXZA 4XJUA 3O0VA 1WGPA 5I93A 1DQ2A 3JUUA 3ZIWA 2JG8C 2K0GA 2TUNA 4PBPA 2E63A 4Q4V2 2X5IA 4RR3B 1MS8A 4S2GA 3AKQA 3LOBA 2BBVA 3N7JA 1SBEA 2ZHKA 5AFBA 2VY0A 1HQWA 4JTNA 1X8EA 2CY6A 3ZYPA 1H9PA 3AK0A 1QDCA 5BNNC 2YHJA 3B00A 2WZR3 4PDWC 4AEMA 1AR92 4XFFA 4WVZA 1RUE1 5JZGC 3BU7A 3USUA 4Q4V1 2AR6A 2ZGOA 1QJZA 1NG0A 1VBA3 1H1AA 4A7YA 4F83A 3AXEA 1QJX3 4N53A 1XE7A 1GBGA 1MQTB 2BQPA 1JYIA 3B69A 4ATFA 3N35A 2B45X 5SV8A 2B7YA 1AR91 4LA3A 1ZZ6A 3ZMOA 2N7GA 2CAVA 4XJ8A 4N43A 2XWBB 2D3PA 1V6JA 4JRAA 4CEWC 3SLIA 3VBSA 5E89A 1FXZA 4ORFA 4A2UA 5GM0A 4LBJA 2ZGPA 1RUE3 1YIFA 4BZ4A 3N4MA 4XOGA 4Q4X2 4Q4V3 2MNGA 4XDQA 3MIHA 3CU7A 1EPWA 2IZWA 4NHLA 4P9LA 4KG8A 4YG3A 4QQLA 3E6CC 4JGYA 3FJSA 2ZGTA 3ZFEA 4FPLA 1QF3A 3VBUC 2BUKA 4P9JA 1RUNA 1W6QA 3BODA 2NZ9A 4EWDA 1AR93 4Y26A 3FMGA 4BLIA 2F4PA 2O8QA 3NVCA 4LT5A 2OPKA 1UX6A 3B9CA 4FQ4A 2X5IC 4LE4A 4FVVA 3N3HA 1AX1A 1CESA 4OUSA 1Z7S2 1HRI2 2A6XA 4NOTA 2CGOA 2HKXA 3AB0A 4Q4Y1 4LO7A 1ZVFA 1LU2A 2GC0A 2Q1ZB 2JG9B 3CL1A 1S0CA 2A73B 3AM2A 2QQPA 1NZCA 1IOAA 2ZAHA 4RS5B 4AVTA 1LHUA 2HYKA 2W0XA 1MS4A 4LLFA 4FPYA 1VR3A 4YVSA 1X82A 5AVPA 4A3XA 1C4RA 4OULA 4N53C 1Z7S1 4LUKA 1HRI1 1H0BA 4ZXKA 1J59A 1YFYA 5DG2A 3J9SA 1UAIA 3WCRA 2EA7A 3BCWA 1LOFC 4PLNA 4QD2A 1Q43A 4I30A 3SH3A 4DZGA 5DUUA 2B42B 1G9CA 4FXKB 1UMZA 5C8CB 2GNDA 3AKTA 4AE2A 2RR12 4N43C 2FZ2A 5T5PA 4AWDA 4Q4Y3 1YXWA 1NCQA 2X8KA 5JSPA 3N7LA 3VBSC 1PO22 1QQP2 5JI9A 1ZZCA 3HT2A 5K0UB 1LCLA 2E6VA 2H6CA 3OBRA 4TSVA 1RINA 3VKOA 2DUOA 5ABJA 1RUG2 1N3QA 3RYPA 1AR72 1DQ1A 3AZXA 3RSJA 2UYAA 3R0RA 1MS0A 1SLIA 2IFRA 2XGXA 3H50A 4UBHA 1Z7S3 3OCPA 4JGYC 2W39A 2RR11 5J98B 5ACA1 5E16A 3ZFEC 4BMBA 1VBB2 3IT8A 2A6VA 4JDOA 2I45A 4HKWA 1QQP1 3LAGA 2VGDA 2E7AA 4Z8BA 5AFEA 2BWAA 4ES9A 4Q2FA 5JOYA 2IXJA 2QZ3A 3HT1A 1QHDA 1REDA 3FWEA 1RUG1 1PGW2 2JENA 2XVGA 3KGZA 1AR71 1OFSA 1HV0A 3U4XA 1SLBA 1GLHA 3MF9A 2PHLA 1UL9A 2ZOEB 5EZWA 2ZX3A 3KT4A 5I0TA 4MH0E 4XFGA 3ZXDA 3ZXLA 4O9EA 3ECQA 3CLPA 1VBB1 2CYFA 4Y20B 4NVPA 5D8AA 4CP0A 2ILMA 1RJ8A 1UIJA 2H0BA 1X7NA 1CR7A 3AKPA 1ENRA 4JDNA 1VAVA 2RR13 1FI2A 3MI8A 4NWWA 2G9FA 5ACA3 5I0RA 3WXPA 1O4TA 1PGSA 2B39A 4PJYA 4YVWA 1QQP3 1XNKA 3SCHA 4ITCA 1VP6A 3AMHA 3ZIXA 4LHLA 4COYA 2DTYA 1BKZA 5FDBA 3QBQA 1RUG3 3QCWA 2AYHA 1S0FA 4E2QA 1CAVA 4CZSA 1AR73 4X6RB 4JVAA 1MS3A 3R4SA 1NE6A 4XILA 4XIKA 1GQHA 2ZHLA 4N7IA 3ZSLA 3MYXA 1POV1 1VBB3 3ZYIB 1AR62 2WT2A 2ZZJA 4IL7A 1NCQC 5FPZA 3ILFA 4COUA 1IHMA 3LSDA 1CONA 5CG8A 3J8F2 1U12A 3KM5A 2WWSA 2NMNA 4JDMA 5ABJC 1LOEA 1DG6A 5EFUA 1AX2A 2ZX2A 2GC2A 1Q3EA 4MLOA 4Q4W2 1UPSA 1HLCA 4I0WB 2XL9A 4QGNA 1RUOA 4HT1T 3WZ1A 1VJ2A 5JAXA 1PM7A 1AR61 1AUYA 4JCKA 3OY8A 4DMIA 4BOWA 1ND3B 1LHVA 2P3JA 2DURA 4UW5A 5CAZA 1L3JA 1Q8QA 1SCRA 3J8F1 4H3WA 4WM8B 4PBOA 2VVFA 4B4PA 2FQPA 4X8PA 1J1TA 1POV3 4HFSA 3NO8A 1RB8G 1K5MA 4C0HA 4I02A 2D97A 1KJRA 5FRAA 1PO12 1LR5A 2PLV2 3AYCA 5CA6A 1S0EA 4LE3A 1PZ9A 2Q5TA 5KHGA 1UU5A 1DU3D 3TBDA 1SLLA 2A3WA 2I07B 4LHKA 2WNVB 5F9TA 3FLPA 4QPIA 5F6KA 1ZBE1 4AEDA 3IN9A 1EV12 4EN0A 1SLAA 1AR63 1LEMA 2HEWF 4IV3B 2X53S 1CVNA 1NCRA 1HQLA 1FATA 3H1WA 1PO11 1OLRA 1PK6B 2PHWA 2R072 3E5QA 2PLV1 3J8F3 1JN2P 3RMYA 4YNIA 5GZFA 1GSLA 2XLGA 2Z5WA 5KC5A 3S0MA 1SQ4A 3ETQA 3G7DA 1NA1A 3UK9A 1LU1A 2DCZA 4QPGA 1QXPA 2ZGSA 2E51A 5I0SA 2HWE3 2VOVA 1B35B 2OIIA 1XQNA 1EV11 1HIXA 4RHV2 1A8MA 1LODA 4K7JA 3V64A 3AZZA 3DV8A 1U0AA 3RNSA 1GANA 4Z82A 4FOYA 2R071 1LECA 3EXUA 1EPZA 3B02A 1RMU2 2OYZA 1MS5A 3MW2A 2D98A 1ZBE3 1BEV2 4FP2A 1IPJA 5CBLA 1EYBA 2BYVE 3ME2A 1QNWA 2XBO2 2BTVC 1SCSA 1PHMA 1F5JA 1TEIA 3MLJA 4Q26A 3P3NA 1PO13 1SBDA 3RI8A 4YFWA 1MZ6A 4F8AA 3ELNA 3NW4A 4RHV1 4FOVA 4IEYA 5T55A 4RQPA 4Q0PA 2WLQA 2TBVA 4E4DX 5LEJA 5F1RA 1BYHA 4ISRA 1Z78A 1REEA 5DZFA 3KZ4C 1RMU1 1RUJ1 1WCSA 2DCYA 2YPJA 3NSTA 1EV13 3MEPA 3KD4A 4S2HA 2XBO1 1LKNA 5BXXA 1K5MC 2GALA 2ZZQA 2GMPA 4YM1A 2ZACA 3O7OA 3KB5A 5T50A 1D0GA 2HWC2 3H3UA 3I59B 1GYKA 2V09A 2RMU2 1C28A 2RM21 4FAHA 4RL7A 2IFWA 1OQEA 2WT1A 1UZYA 2YUEA 2RS52 3AP9A 1ULDA 4QPIC 4XF1A 4XQDA 4AEDC 2R062 3I4IA 4OI0A 3VLBB 5SV5A 1PVXA 4RHV3 1XXNA 2G9GA 3ATGA 2A3XA 1NCRC 3SXWA 2IXCA 3KCXA 4YZ2A 3VDDB 1RMU3 1RUJ3 2HEYF 2DFBA 2CGNA 2HWC1 1VBC1 1NA1C 1BQPA 4AXOA 2ZGKA 2XBO3 4W65A 4GMP0 4QPGC 2RS51 3D6EA 2R061 4XIOA 3ILNA 3SMHA 4IEZA 2JEMA 4GH4B 2R6QA 1RUC2 1LENA 2R32A 4L9BA 1OQDA 2ET7A 2RM23 2E53A 1ND2B 3IWZA 1UKRA 2BW8A 2MEV2 3TOJA 1TMF2 3LKJA 1NOVA 2DFCA 2YGLA 3ZXGA 4LTAA 2D6LX 2VXRA 4CDXC 4Y5Z0 3UKVA 2V73A 4IETA 5A3MA 3HD8B 4YW3A 5J7MA 1ZRRA 2DYCA 4NWVA 2HWD2 1CJDA 2HWC3 1RUC1 1VBC3 4ZU5A 4RQPC 1DFQA 2QDRA 1MVQA 2WT0A 3B9IA 3AFKA 2MEV1 3DKWA 4XJ9A 5KXBA 2RS53 4Z92B 4UW4A 1UU4A 2R063 1R1A2 4Q8KA 2GN3A 2HWF2 1LGCA 2A5ZA 4UXAA 4Q27A 2K2SA 3R05A 4GKXA 3NWKA 3H7YA 3ZO0B 1JUIA 1RC6A 4W6YA 1Q8PA 4HPKB 4RR3C 2HWD1 3IPVA 4DQAA 1WCKA 3K48A 1ZNPA 1D2QA 3WX5A 3O0XA 1Y7BA 1FAYA 3AYAA 3X29B 4LBOA 5DDJ2 3C3VA 1R1A1 2HWF1 1J3PA 2JG9A 2BGCA 2VMGA 1H2MA 3PMEA 1RUC3 2CGPA 3SH4A 2YDEA 1EY2A 2MEV3 4IXLA 2W68A 4XXAA 2OUHA 5H9RA 2QCSB 4CDQB 1DZTA 5BNPB 2WNEA 3GZAA 3R6SA 4YGDA 3ES4A 1G6NA 1ULCA 3WDXA 5LEKA 2FMYA 1MQTC 3WCSA 3WG1A 4PDWA 4QQOA 2HWD3 4OVEA 2Q0AA 4XFCA 1ZZ8A 3ZSMA 4HMZA 4LBKA 2PYTA 4AVAA 5K7PA 5JPMB 3CJIB 4INDA 5EYXA 3FUOA 1R1A3 2XUMA 2HWF3 4XF4A 1QGLA 2YZ4A 1GZWB 5BPXA 3WV6A 3JD72 4WVWA 1OI6A 2BFUS 1QOSA 4V1PA 2NP0A 4FSJA 5CFDB 4CDUB 4HKLA 1ZYBA 1OQ1A 4JQRA 4EN6B 1BMV1 4E2SA 2B46X 1O7FA 1MZEA 3JQXA 1MS9A 4GB31 2XJQA 1C1LA 1A78A 2GAUA 1V6MA 4L11A 2KXLA 4MV2A 1CAWA 4DB5A 5KBFA 5KC6A 3JD71 1QOOA 1QDOA 1RUF1 1UW8A 3P3PA 3RYRA 2G4IA 5CFCB 4QQHA 1W6NB 4OHYA 4LULA 1YJKA 5JOWA 4WZCA 3V0BA 1GZ9A 1WW4A 4BPZA 3AP7A 4JTOA 1FX5A 5T5OA 2GN7A 2Z79A 1DGWA 2XL7A 4MYEA 3BPZA 4AFBA 1G8WA 4QU2A 2ZCWA 2ZKLA 3VKMA 2D93A 4Y20A 4FPEA 2A6ZA 4KNCA 1WA4A 1BVVA 1LJ7A 1JBCA 1DGRN 4GB33 4FPHA 3VKLA 2R1DA 3TWIA 3KSCA 1SFYA 4AVSA 1YFXA 1MVEA 2LTNA 2WINB 4RS5C 4MGZE 1VBE2 2IXKA 5DG1A 1YJLA 1EAH3 1Q8SA 5FOBB 2VW0A 3VV1A 3JD73 1RUF3 5FOJB 1LB2A 1V6OA 4K20A 3OF1A 3TRSB 1ULGA 2B9UA 2TEPA 2YV8A 2ZGLA 3H9AA 1JOJA 4Y1UA 5FCCA 4I09A 4B3NA 1OHFA 5HCBA 4IEOA 4TWTA 1O91A 4P5HA 5C8CC 4HN0A 4BLJA 1VBE1 3DL3A 2ZX1A 2WA3A 4B8EA 1H1MA 2PELA 3AXDA 1H8TB 1Y3TA 2ZX4A 4R9BA 3DN7A 3FBMA 2D6KA 1FNZA 1QH6A 5K0UC 3KS7A 1LOFA 2CWSA 5JMCA 1FV2A 1RTVA 4LNVA 3T1LA 3GNEA 1OA2A 4I2OA 4BH9A 1N3PA 2MPFA 5DZGA 3UV9A 2O8OA 4I3PA 2WNUB 1ULFA 4IESA 4X8NA 5BV6A 5GLZA 2PAEA 4AQTA 4EN8B 2VMIA 4LO6B 1XNBA 1AL0G 1ND3A 1PVC2 4WM8A 1KRIA 5D1IA 3WINE 1UF2C 2ZS6B 5FBZA 3MDPA 2TNFA 3OBTA 2LUWA 3OD4A 1COV2 4DFSA 3DPRB 4XF0A 4GXLA 5A33B 3WT3A 1F5FA 1RL3A 3WDWA 5GZCA 1U5ZA 3RJ2X 4QGMA 3W59A 3W9AA 4B29A 2WLPA 1SFNA 2BVVA 2RHPA 2WZPP 2W52A 1PVC1 1LOBA 1RUI2 2GMMA 4Y4YA 2WNVA 2XLFA 4AI2A 1IS5A 4Q4X1 3O12A 1UN1A 3ZVXA 3IKWA 5GKAC 5JVVA 5F6LB 1COV1 3QOPA 1HQNA 1FPN2 1H4HA 4IV3A 3AZWA 3S7EA 1WBLA 1QJY2 3LWCA 5CVRA 3SH5A 4R9DA 4TYSA 1PK6A 1N1VA 4YG6A 4XFAA 3B5LB 4FBFA 1LOAA 1CIWA 3TNQA 5H9QA 2Z2SB 1TNRA 4H14A 4IV1B 3GHMA 3S7IA 1RUI1 3AX4A 4I3GA 4OFGA 2R30A 4D7YA 1B35A 5GALA 1Q5OA 4WVVA 1S0JA 1CN1A 2BNMA 1H9WA 1SEFA 4YSFA 2RE9A 1FPN1 3WW1A 2A3YA 1PMIA 1QJY1 4ASMB 1PVC3 2QKDA 3BOWA 1H8VA 5KHKA 2GH2A 3ASIA 4Q4X3 4PIZA 4P9XA 2VNGA 2JDZA 1KS4A 4Q0SA 2IWGB 3VZNA 1COV3 1OFNA 2DWRA 4FO9A 2VECA 3TNPB 1HRV2 1R092 2ZPXA 2ATFA 2PAKA 3ENRA 5J3UA 1NYWA 3MW4A 5JLVA 3WP6A 2WL1A 5L36A 3UKTA 2XH6A 2A70A 3WQ7A 1OPMA 2NYYA 2AZ5A 1ND3C 1RUI3 5EYYA 1YLLA 4WM8C 2NMOA 3D0JA 3MIFA 4XXPA 3B94A 1GKBA 2VW1A 1UKGA 5J36A 4MXVA 5KHIA 3E5XA 1ONAA 2EIGA 1FPN3 3URFA 3CO2A 1QJY3 2DCJA 4CP1A 4FOQA 1XU1A 1HRI3 1R091 4H7LA 5DUWA 1LULA 3AP5A 4YZ5A 1T6GC 4HBNA 5KXEA 1TQ5A 4AHYA 3I59A 4AYUA 1PO21 3SITA 4FTBA 2QUOA 4DRVA 5K9YA 4Y24A 4F3JA 1R1ZA 2RS12 2WNVC 3BB6A 3VBHB 1DQ0A 4PLOA 2I74A 3AYDA 3CNAA 4XBNA 2OA2A 3JZVA 1BBT2 4M3CA 4CTEA 4IV3C 2ZMKA 5CADA 2D44A 1PK6C 1SDWA 3BIWE 3VDDA 1QKQA 3POYA 3WG3A 4AI1A 4AEJA 5HBAA 1Y9QA 1DQ5A 4PIYA 5AC92 2GDFA 4G9SB 2JD4A 4Q1RA 2VNOA 3AYEA 1AYM2 2C0ZA 4EJRA 3ZN5A 3I7DA 4MX3A 2QNKA 2RS11 4P9WA 1POV0 5C4WB 1R093 1B35C 3U10A 1PGW1 4Q1PA 4XPVA 4GH4A 4WM7B 3WHTA 1BBT1 1PO23 3KMHA 3N36A 4IEUA 4YGBA 2EAAA 4OI1A 3RG0A 2QFEA 4XETA 4MGYE 1ENQA 1CAUB 4KWJA 3LSEA 2ZX0A 3MLKA 3H1MA 4C91A 1VALA 5KHHA 5AC91 4RGGA 5C9AB 3EQEA 1DBNA 5HCAA 4PCRA 3OJBA 5LK7B 3ILRA 3RWNA 1A6CA 4AVBA 4CDWB 5BNQA 3K51A 1XNDA 3OGJA 1PGL2 3LZZA 2BFUL 5JWPA 1ZRDA 2FBEA 5IT6A 4YFZA 2KM2A 1C8NA 2Q30A 4D7SA 2RS13 3GZUC 5KXDA 1RUH2 3QLQA 2JKBA 3DF0A 5KWRA 4XJZA 4O9GA 3I54A 1KD7A 4AGGA 1UIKA 3FC0A 2BEOA 1O4YA 2H6BA 2X29A 1BBT3 2VG9A 5AVAA 2JECA 3VBRB 3GYDA 4P9IA 4XBLA 2E7QA 3ZFGB 4I01A 1REFA 5JSOA 4E4ZA 5DZEA 5AC93 1IKQA 2H0VA 4LO4B 5JIUA 4N7UA 5E88A 4IEWA 1RUH1 1Z0HA 1O3RA 4YZ1A 1WLWA 1IGOA 1AX0A 5IK7A 1PZ7A 1CGPA 1IQAA 3POSA 1ENSA 1UZZA 4Q4W1 4B7EA 1LHNA 1S0DA 3ZMNA 3NL1A 4I0BA 2PHXA 2WKKA 3VDDC 1OOPB 1D2SA 3MIGA 2P3KA 5BNPA 1XYPA 2QVSB 2XHKA 2DCTA 3M70A 4YARA 1O5UA 2YMZA 5GJ6A 4YG0A 5H9PA 1AHSA 5GZDA 3MF6A 1ZBA2 3H1YA 1JH5A 2VU9A 1O3QA 1W6MB 1X33A 2GSYA 2P34A 4GH4C 1YCIA 1I3HA 2YY1A 2UWCA 3THTA 2GZWA 4AF9A 1ND2C 5IK4A 1RUH3 1CX4A 3CJIA 2ERFA 3B93A 3RJRA 4FCAA 1Q8VA 4L92A 1CQ9A 2ET1A 4Q4W3 4QX5A 1WBFA 1D0HA 5CFDA 3ZXJA 4CDUA 1RUD2 1X36A 1DHKB 4HVRA 2JICA 3ZSJA 1ZBA1 2XB6C 1BJQA 3LB9A 4XTPA 1QOTA 4B4QA 2RJKA 2E7TA 3WLUA 1S1AA 2R49A 3RS6A 4AVVA 3ES1A 1LEDA 2VQ0A 3ZN6B 3IIAA 5L73A 4CDXA