1FMD2

The structure and antigenicity of a type c foot-and-mouth disease virus
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
218
structure length
218
Chain Sequence
DKKTEETTLLEDRILTTRNGHTTSTTQSSVGVTFGYATAEDSTSGPNTSALETRVHQAERFFKMALFDWVPSQNFGHMHKVVLPHEPKGVYGGLVKSYAYMRNGWDVEVTAVGNQFNGGCLLVALVPEMGDISDREKYQLTLYPHQFINPRTNMTAHITVPYVGVNRYDQYKQHRPWTLVVMVVAPLTTNTAGAQQIKVYANIAPTNVHVAGELPSKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords FOOT-AND-MOUTH DISEASE VIRUS (SUBUNIT VP1)
publication title The structure and antigenicity of a type C foot-and-mouth disease virus.
pubmed doi rcsb
source organism Foot-and-mouth disease virus
total genus 38
structure length 218
sequence length 218
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1994-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1fmd200
1DDLA 3VBRA 1QJY3 1FPN2 1ZBA2 5AC92 1QJY2 2RM21 3VBSC 1ZBA1 3M8LA 5AC91 1QJY1 1RUD3 5A33A 5BNOB 2WZR2 4CDXB 4JGYA 1QJX2 1AUYA 2HWD3 2HWD2 1K5MB 1POV1 1AYN2 1RUJ3 2HWD1 1RUJ2 1BBT3 4Q4X2 2FZ2A 2X5IA 2R063 1RUJ1 1BBT1 3ZFGA 3VBHA 2R061 5C4WA 5CFCB 1VRH2 3ZFFC 1IHMA 1AR72 1AR93 2HWE3 4PDWA 4BCUA 2GH8A 1RVF2 2HWE1 2WLPA 2RS32 1TME2 3IDEA 2RS31 1TME1 1VBD3 4QPIC 1FMD3 3VBUA 1EV13 1OHFA 1PO13 5L7OB 5ABJB 1VBD1 5BNNA 1FMD1 1MEC2 4Q4Y3 4Q4Y2 5D8AA 1EV11 5C9AB 1MEC1 5CFDC 3ZXAC 4Q4Y1 1EAH2 3DPRB 4RS5C 3FBMA 4IV3B 4WM7C 4GB33 1NG0A 1RUI2 4GMP3 4CEWC 4JGZA 1RUI1 4YVWA 4GMP1 4RQPC 2XPJA 1RUC3 1FOD2 4AEDC 2GSYA 1VBA2 1AL22 1FOD1 3VBRB 1H8TA 1MQTA 1VBB3 4IV1A 4CDWA 2XBO3 5JZGB 5A33B 1VBB1 1ASJ3 1NY72 4JGYB 1R082 1ASJ2 1NY71 1ASJ1 4N43A 2BFUS 2WS92 5FMOS 2X5IB 2WS91 1SMVA 1NA1A 1E57A 1BMV1 5BNOC 2WWSA 1OPOA 5FOJB 4PDWB 1QJZA 4Y4YA 1K5MC 3TN92 1RUG3 1NCQA 1VB2A 4RHV2 4RQPB 1V9U3 4CDUA 2BPA2 1BEV2 4RHV1 1RUG1 3LOBA 2HWC3 1V9U1 3ZFEB 1BEV1 2HWC2 3VBOA 5CFCC 3JD72 3VBFB 2HWC1 1TMF2 5BNPA 1HRI3 1D4M2 4GH4A 1QQP3 1HRI1 1GFF2 5D8AB 2IZWA 4WM8A 1VBE2 1FPN3 1ZBA3 5AC93 1C8NA 3VDDA 4FTSA 1R1A2 1ND2A 2RR12 1FPN1 2WZR3 1R1A1 2HWF2 5L7OC 5ABJC 1QJX3 1POV3 2RS12 4JGZB 4N53A 2WZR1 5C9AC 1VAKA 4YVWB 2RS11 2BBVA 1QJX1 1AYN3 3NAPA 4Q4X3 3DPRC 4IV3C 1AYN1 4Q4X1 1RHI2 2PLV2 1VRH3 1H8TB 1MQTB 4IV1B 1AR73 4CDQC 4CDWB 2PLV1 1AR82 1VRH1 1AR71 2DF7A 1RVF3 1AR81 4N43B 1RVF1 1NCRA 3VBRC 2RS33 1TME3 4CEYB 4YVSB 1NA1B 2WFF2 5JZGC 1B35A 4WM7A 4JGYC 5K0UA 2WFF1 1MEC3 1WCDJ 1OOPA 1C8M3 1RMU3 4QPGB 1C8M2 1NCQB 1RMU2 2MEV2 2HWB2 4RR3A 4CDUB 1EAH3 2X5IC 1C8M1 1RMU1 1AR62 1EAH1 2VQ0A 3VBHC 3VBOB 4Q4W2 5C4WC 1RUI3 4Q4W1 4CDQB 4PDWC 3CJIA 2RS52 2BUKA 1CD3G 4GH4B 2R042 1FOD3 1PIV2 1VBA3 3ZFEC 1AL23 4WM8B 2R072 3VDDB 1VBA1 3VBFC 4Z92B 1AL21 4EJRA 1ND2B 2R071 5C8CA 1R083 4CDXA 5BNNC 1HXS2 4N53B 4FTBA 3J8F2 5D8AC 1ND3A 4GMP0 4FSJA 1R081 1HXS1 1HRV3 1PO22 2WS93 1HRV2 3J8F1 1R092 1PO21 1VB4A 5LK7B 1HRV1 5J96B 1NOVA 3ZFGB 3VBHB 5C4WB 1RB8G 2ZTNA 4JGZC 5A32A 4YVWC 3TN93 4RHV3 1Z7S2 3TN91 1BEV3 1NCRB 1ZBE2 1H8TC 1MQTC 3JD73 4IV1C 4CDWC 1TMF3 1HQNA 1COV2 2ZZQA 3VBSA 1RUE3 1B35B 3JD71 1D4M3 1RUE2 1TMF1 3VBUB 5K0UB 3JBG2 1AYM2 1F8VA 1RUE1 5BNNB 1RUF3 1PGL2 1D4M1 1OOPB 1RUF2 4N43C 1PGL1 1RUF1 1VBE3 1M06G 2RMU2 4CEYC 4YVSC 1PVC2 1NA1C 1RUH2 1R1A3 1VBE1 2RR13 2RMU1 5ACA2 4NWVA 2HWF3 2RR11 2RS13 2BFUL 3CJIB 3ZFFA 2HWF1 4QPGC 5FMOL 1AL0G 1NCQC 4CDUC 3VBOC 2RM22 1RHI3 2PLV3 5BNPC 5C8CB 1RHI1 1AR83 5JZGA 1RUD2 4GH4C 4QPIA 1RUD1 1ND3B 1POV0 4WM8C 4SBVA 5CFDA 3VDDC 1BBT2 1ND2C 4RS5A 2R062 2WFF3 4N53C 5A32B 1AR92 2HWE2 4CEWA 4RFT0 2MEV3 2HWB3 3NAPC 1AR91 4RQPA 2MEV1 1AR63 2HWB1 4AEDA 3ZFGC 4LLFA 4Q4W3 3ZFEA 3HAGA 1AR61 3VBFA 3VBSB 5BNPB 2RS53 1VBD2 1FMD2 1EV12 1PO12 2RS51 2R043 5GKAC 1PIV3 1NCRC 1PO11 2R041 1PIV1 2R073 1A6CA 1PGW2 2FZ1A 1B35C 3VBUC 1PGW1 1VBC3 5K0UC 4GB32 1VBC2 5BNOA 1HXS3 4GB31 2TBVA 1OOPC 1VBC1 3J8F3 3ZFFB 4RR3C 1PO23 1K5MA 1X33A 1R093 3NAPB 1R091 1RUC2 1CJDA 1RUC1 2ZAHA 1QJU3 2Y26A 1W39A 5CFCA 2QQPA 1F2NA 1QJU2 3CJIC 1VBB2 2XBO2 1QJU1 4QPIB 4Q4V3 3JB4C 4Q4V2 1X36A 2XBO1 1Z7S3 4Y5Z0 4NWWA 4Q4V1 1Z7S1 1ZBE3 5DDJ3 4FTEA 5DDJ2 5CFDB 1BMV2 5C8CC 1ZBE1 4RS5B 5DDJ1 1COV3 4YVSA 5J98B 4CEYA 4WM7B 3JBG3 4CDXC 1AYM3 1COV1 3JB8A 1ND3C 5L7OA 5ABJA 3JBG1 4CEWB 1AYM1 4RR3B 5C9AA 4QPGA 1RUG2 2RMU3 1HX6A 1PVC3 1V9U2 1RUH3 3DPRA 4AEDB 5ACA3 4IV3A 1PVC1 1RUH1 5ACA1 4CDQA 1HRI2 1QQP2 3S6PA 1QQP1 2RM23
chains in the Genus database with same CATH superfamily
1FPN2 1ZBA2 4BLJA 1QJY2 1UQXA 3ZN6A 5AC92 1LKNA 1QXRA 4CA9A 3CNAA 1LENA 2K9ZA 4FAGA 2Z69A 3I2JA 4W65A 4FQ4A 2WZR2 2EAKA 4JGYA 2X29A 3DYPA 1UIJA 4LK7A 4QHOA 4FOQA 1QJX2 2Q8EA 4MGZE 4QHBA 5BXXA 4COWA 1K5MB 4BIFA 4LHNA 5CKMA 4JKLA 2R1BA 3MLLA 1RUJ3 3SH4A 2XG3A 4R9AA 4XHXA 4Q4X2 3VDCA 2VUDA 2X5IA 4AVVA 4A4AA 5T5OA 5C5UA 1A8MA 1RUJ1 4M4PA 2UWAA 2W1WA 2Z5WA 4XUPA 4UOJA 3ZFGA 2XKPA 5EZWA 4DPNA 4JZRA 1PM4A 4JX0A 2FQPA 2WNOA 5EP9A 5LB6A 1AR72 2WQ4A 1UYYA 3E6BA 1S55A 2C6SA 1AR93 5T54A 3ZO0B 4CU6A 3IAPA 4BCUA 1R64A 1NLRA 2WAAA 2WZPP 4BQXA 1CWPA 2P2KA 4KNCA 1UX7A 1ULOA 2Y6JA 1REDA 4HANA 1SPPA 1ULEA 1FT9A 1WLDA 1MS5A 1N1VA 1O8SA 3KGLA 1CAVB 2LRPA 5A3NA 5FYZA 1W9SA 5J48A 4ASMB 4EWDA 5DUUA 5DG1A 2ZEYA 1PGSA 2D6KA 1BLZA 1ENQA 1TME2 5HCHA 3G7DA 2RS31 2H0BA 4BZ4A 4AVSA 1UOGA 4QPIC 3K3NA 4J1WA 4OZOA 4Y22B 1VAMA 1QMJA 2I2SA 1OXCA 3LA2A 4NO4A 3NJXA 3WY6A 2WA4A 2ZHKA 3AZVA 1UYXA 4RD7A 1W8TA 3LQCA 2JDUA 4Z2WA 1EAH2 4AAPA 5F5IA 3LB9A 4YYOA 4OLLA 4Y5TA 2Z79A 3PMSA 5BNQA 4JRAA 2FHRA 4ZKTB 3JXSA 1GANA 1A34A 3WF2A 2XHKA 1B09A 3USUA 4P00B 1HJFA 3I49A 5C3OA 4JGZA 4P9JA 3RJRA 1YFUA 1DIWA 1S0EA 4K40A 1H1MA 4RQPC 4M3CA 5IFTA 2FDIA 2H0VA 5FMBA 4XJZA 4MADA 4XXPA 1W04A 2GSYA 3FBYA 1YI7A 3NRUA 4NAOA 1BVP1 5KHGA 5AVPA 3UV9A 4NIAA 4IV1A 2Q0AA 1V6KA 1W3XA 4XQWA 1DBNA 2XBO3 4AW7A 4YRDA 2R0HA 4GULA 4NMIA 5A33B 2XJUA 1ZZ8A 3USSA 1GQPA 1NY72 2A70A 4DUVA 1ASJ2 3D0JA 3ZYBA 1GYKA 4HBNA 1TNRA 3OTFA 1W3VA 4UAPA 4URAA 2AYHA 3MPBA 5FMOS 1XYOA 4FPYA 5HV0A 4ASKA 2FDHA 3SCGA 3AZZA 3N9LA 1UZYA 2WINB 1JI6A 1SMVA 3POWA 5SV5A 1H1AA 4GJZA 1E57A 4CCOA 3ACIA 1N1SA 3BVCA 1V6JA 3KT4A 4FPFA 4LOTA 3UKNA 5FY9A 2WWSA 1OPOA 1R1ZA 4EN7B 3H8OA 3BIWE 3S5AA 4UFMA 1UY4A 3CHXA 3Q8AA 4OHYA 4IESA 1G6NA 1A8DA 5IVEA 1V9U3 4CDUA 3AMHA 3S57A 5A6QA 1BEV2 4RHV1 5GLTA 4DIQA 3LOBA 1JW6A 5GLUA 3OBZA 2HWC3 1V9U1 4D6QA 3SKVA 2P3JA 5FK7A 5A7NA 4CCNA 4HMZA 3T3YA 4L11A 3S30A 5HCBA 3JD72 1ZA4A 3VBFB 2HWC1 3FFQA 5FPXA 5F6LB 5A7WA 3T0BA 1GQHA 3H3LA 1YIPA 1J1TA 3CZUA 2VVEA 4B29A 2R30A 4F3JA 1ULPA 1LNSA 4LBQD 2GU9A 5EV7A 4L2NA 3B93A 2IZWA 1X8MA 2AEZA 4R9DA 1VBE2 2JE8A 1C8NA 2G9ZA 3KQRA 3WNNA 3ZX7A 5JXJA 4XEZA 4EN8B 1R1A2 2OZJA 4YM0A 4OI2A 4BISA 1U5YA 1XPWA 3MEPA 4OCTA 2JDYA 3WQBA 5C70A 1AHSA 5L7OC 4AL9A 3IMNA 5FLJA 1POV3 2W92A 4N53A 1NLQA 3QH7A 5FMDA 3IBMA 1W8NA 1ZRDA 3H1WA 4IEVA 1VAKA 1QDCA 2L9LA 2RS11 2BBVA 1OPMA 1LU1A 1AYN3 1Q8VA 1KD7A 2BWCA 4B4PA 4DXZA 2VPVA 4XFFA 2DUQA 4E4ZA 4O9GA 3S5QA 5JLVA 1MZ6A 5FYCA 1AYN1 5JIAA 3FJSA 4D6SA 3T2TA 1ZZBA 2ZX1A 4PQ9A 1H1IA 5JAXA 1G9DA 2XH6A 4OUMA 4HKLA 4PCRA 3W20A 1Z0HA 2WNUC 1VRH3 3OPWA 4XCAA 4AEMA 3E5UA 1ULFA 1DYOA 4S2HA 2YYOA 1VRH1 3WVJA 1O6UA 2DF7A 4QHZA 1AR81 4ITCA 1WZXA 2IXJA 1HKDA 3VZMA 1F4HA 2Q8DA 3E6DA 2WC2A 3NNFA 4E8CA 1NCRA 3OEAA 4OZXA 3VBRC 5F3GA 3AP7A 3AP6A 3IDCB 4YVSB 5F5CA 1V0AA 5FLHA 3RFRA 3HNYM 1HDKA 1LHVA 4JVAA 1HLCA 2J42A 3NNLA 3ROUA 5K4LA 4Q0QA 5K0UA 4U2AA 4UW6A 1MEC3 1NE6A 1OOPA 3SHRA 1W06A 2JDNA 1C8M2 1G7YA 1NCQB 1RMU2 3LZZA 4BQWA 4Y1XA 4AFAA 5J7MA 5K8SA 1KJLA 2XWJB 1SLCA 2I74A 1XSQA 1YEWA 2QQIA 4DO0A 2QQOA 2EIDA 5L19A 3VBHC 3VBOB 5C4WC 1D0HA 1YWKA 3UKTA 1MS1A 1QY4A 5EYXA 4CDQB 5F9TA 1ZRFA 3ME2A 3V65A 3AKQA 5IHRA 1CD3G 4GH4B 4LMFA 2XB6C 1JHJA 4MGTA 1UZVA 4P9GA 3AVSA 3ELNA 1PIV2 5D21A 2AREA 1J1LA 4OYUA 1OA2A 3UGFA 1VBA3 3ZYRA 3ZFEC 3GBWA 2I45A 1AL23 3KV9A 4WM8B 2DTWA 3LDRA 3UK9A 3RZZA 3VHOA 4GALA 1LHWA 2QBXA 4BQYA 3VDDB 1VBA1 2C9AA 3VB9A 2HBTA 1AL21 1ND2B 2W47A 5DAPA 4E4HA 5CEHA 3NMBA 5SV8A 3WNKA 5A1LA 5FZGA 4CZSA 2JEMA 1R083 2JDMA 1G9FA 2XONA 5CB7A 5BNNC 1KITA 1PVXA 3K4ZA 2QKDA 5FP7A 1WD3A 3PJYA 5D8AC 3PNAA 4Y1VA 1LEDA 1R081 5GZDA 2UWCA 1GICA 3I2FA 3ZYIB 1PO22 1C57A 4YZ4A 2WS93 3IIAA 4OULA 5JPMB 2P1BA 3WV6A 4AGGA 2CAUA 5FWJA 1NX9A 3AP4A 2XUMA 3W5NA 5BPXA 2W46A 5J96B 5CAZA 4P9WA 1BK1A 3ZMOA 5C8WA 3ZFGB 2GP3A 1SBEA 2DURA 2YPDA 3GHNA 2D3PA 2YXSA 5FPVA 4BPZA 5HCAA 1RB8G 3KS7A 3N7JA 3TEZA 2DVGA 5A32A 2NMOA 4YVWC 3TN93 2A6YA 1UZ0A 5DUVA 3TN91 2ZX3A 2YC0A 4OQ9A 1W9WA 4JDMA 2ES3A 5GZGA 4IE5A 4H2AA 1H8TC 1DG6A 5FBZA 1MVQA 3MGUA 5FO7B 4W50A 3WZ1A 5CKNA 5GZCA 1COV2 1SLLA 2Y0IA 3D0SA 3HWJA 3QOPA 4CTEA 3IN9A 1D4M3 1RUE2 3OOXA 4YZ1A 1HB1A 3RMYA 3TEWA 3WINE 4Y5SA 4MSVA 5DAWA 1D4M1 1RUF2 4XMAA 3D8CA 4FCAA 2AUYA 5GZEA 4KU8A 3WUDA 4Q26A 2FDJA 5L9VA 3ACFA 5FO8B 4M01A 4DY5A 2JDHA 3U11A 4LBLA 2YBPA 3EMRA 4X8NA 2DVFA 1H4GA 1DQ6A 5FP3A 1JYNA 2YU1A 1LRHA 2B7YA 4NHLA 3ZN4A 1GQGA 4UF0B 3AVRA 4DXTA 3NQHA 2IFRA 4ASLA 5APAA 2FDKA 3CJIB 4YM1A 3AB0A 3IMMA 1LGCA 2EXIA 1OFNA 1IQAA 4P14A 4UW4A 3LA7A 4A7YA 5FZIA 1AL0G 2B9UA 4YW7A 5CIRA 4YW5A 3OG2A 3K3OA 5L9RA 1S0DA 1G86A 5IK5A 1W2AX 2B39A 2VCMA 1K12A 1U5IA 1RHI3 4YFWA 2PLV3 1WA6X 1SCRA 3N9NA 2A7AA 3NKGA 4LKSA 4OFGA 5J37A 1BCXA 1EP0A 4OHVA 5C8CB 1RHI1 2HYKA 3ABZA 4KL1A 4LIVA 1G8WA 4GWNA 5IVYA 3WQ1A 1UWWA 3FUOA 5FQ0A 1XC6A 5IATA 1POV0 2AZ5A 4DUWA 3M3EA 1DZTA 3UJOA 3GM8A 4AI1A 4CP9A 4LBOA 5FYTA 4KI5M 4AK3A 5CFDA 1XRUA 3SC7X 1UNBA 4FQZA 2WFF3 3H50A 3PTRB 5I93A 3OGJA 4EROA 2YB7A 2HBUA 1E5SA 5FPUA 2XLGA 5I8TA 2X10A 1NZIA 4KGGA 4XE9A 1AR92 1SEFA 5LRSA 4BLIA 3LSDA 2KA3A 5C3PA 4Y1YA 3B9IA 4BXFA 5LA9A 5LBEA 3B7MA 3VUOA 2VECA 4BQ1A 2IC1A 3SEPA 2DUPA 3ZFEA 4XBLA 3ZYFA 5JOYA 4LTAA 2ADEA 4QQPA 3EBRA 2A73B 2PQQA 1CX4A 3KVBA 5FYYA 5HXMA 5A7WB 4QD2A 3LOIA 4XFAA 3WF1A 5FZBA 2JXAA 4TXWA 3N9OA 5GJ6A 1OVPA 2Y6HA 3J7HA 3RG0A 3WDXA 3UESA 3WP3A 3LAGA 1HQWA 1LU2A 1UZZA 4JTNA 2WYFA 4UW5A 2O8OA 3ZDSA 5I0SA 3JCIA 4ZPIA 2VMGA 1CX1A 4XVHA 2VTXA 2NMNA 4XCBA 1FATA 2R073 4XDPA 2D93A 1E5IA 1A6CA 1PGW2 2FZ1A 1B35C 2VZOA 1N47A 4N90A 5FZFA 3VBUC 1HW5A 4NRPA 4BJ0A 1F5JA 4C90A 3ZN5A 4WV8A 4D0QA 2BERA 3P3PA 3VD7A 1QEXA 3OUHA 3J8F3 4GB31 4X6RB 1CZVA 3KHBA 4OHWA 5T5LA 1K5MA 3BTZA 4LIUA 1VPHA 2PFWA 5FZ1A 1SLIA 1GSLA 2XQXA 4Y20B 4ES9A 2YFZA 4QQOA 3V56A 1RUC1 2VW2A 3PUAA 3VZLA 1F9KA 2Q8OA 3B3QE 2ID4A 4URTA 2XBO2 1TNFA 4PI2A 1MR5A 3I3EA 4QPIB 5FZ6A 1PMIA 1X36A 4NHXA 1Z7S3 2NLRA 3ZXLA 1GOGA 4IQPA 4NWWA 3ZPOA 3N7KA 4IE4A 4TLGA 4ZXEA 2OYZA 4JKKA 1Z7S1 2CSGA 1POQA 2J1EA 2W2IA 5DDJ2 5F3CA 2AGSA 3ILNA 2VH9A 2UWBA 4A41A 2XWBB 3ZR6A 2OUHA 4N9IA 5KBFA 3WD5A 3JBG3 1GKBA 4Y22A 1YQ2A 5JR7B 3JB8A 4CDXC 2JIGA 1S0CA 5D2AA 1ND3C 1PZ8A 1S2EA 3GZEA 1KFXL 3JBG1 2UURA 1WW6A 5K9YA 3FHQA 1JMUB 4H7LA 4X8PA 5G05L 5E6HA 5A6ZA 1HX6A 1OFSA 4IEXA 1V9U2 2V5YA 3PTYA 1UU5A 1RUH3 3K4AA 4P9LA 3LEGA 3A23A 3R4UA 5IVBA 2RJLA 2QVSB 3DL3A 2ZXQA 1RUH1 4HN0A 1RL3A 1RJ7A 1UU4A 3QH6A 2Y6GA 3U1XA 3WDVA 3IZOA 2GMPA 3BN6A 1O3QA 1BYHA 3WOGA 1ONAA 4XIKA 3POBA 5HV4A 1NLSA 3ZSJA 2ZGLA 1E5HA 5FJKA 4MG2A 2XL7A 1UZWA 4CUBA 3S6PA 4BXSV 3WCSA 4FOVA 3BU0A 1SLBA 3RWKX 2HEWF 3RYPA 1WMXA 2K2SA 4MHUA 1YYNA 3VBSC 2JICA 1Y9MA 1S2BA 3BGAA 1RUD3 2UU8A 4YW2A 5A33A 1JZ4A 5FY7A 1AJOA 5H9SA 1QJFA 5JR2A 5FZDA 3AJYA 2HEYF 2BGOA 1AUYA 4META 2ET7A 3TNQA 1XXNA 2HWD2 4B8EA 4MV2A 3OD4A 1AYN2 2IUWA 3MUZ1 4LOSA 4Y1UA 5FPZA 2WQ8A 1CVNA 1BBT3 3FC0A 1W9YA 3RDIA 3CIHA 3RYRA 1OQEA 5FP9A 1N3PA 3LF7A 1BBT1 5FK8A 2VBBA 4WZCA 1VRH2 3ZFFC 1IHMA 3PMEA 4I30A 4FAHA 3LCPA 3T4HB 5H9QA 1SFNA 4QX7A 1I6XA 2BOJA 2R1DA 5FZ9A 1XNTA 3QD6A 1TEIA 3AXEA 1WMEA 4GWIA 1C5HA 1KS4A 1X9PA 2RDQA 3PLQA 4PLMA 4XTMA 5FWEA 3T2QA 2WLPA 3WHUA 2KR2A 3VKNA 1LGBA 3SKJE 4MXWB 1U5XA 4NN0A 1SDWA 3IDEA 2UYAA 3E5XA 1QOTA 1V6MA 3B5LB 5A1AA 5IVFA 3ACHA 1VBD3 4NIGA 1W8FA 3INAA 3VBUA 3KQ4B 1EV13 1OHFA 1PO13 2DDUA 2P3KA 2VM9A 3KLSA 3ILRA 1GNHA 1VBD1 2VY0A 2XJPA 4KU7A 1MEC2 2P4EA 2Y34A 3P5BA 4NPMA 3D6EA 4L9BA 4Q4Y3 5FLIA 1EV11 2D6MA 5FZ3A 3WDWA 1YFYA 2GC2A 1OC1A 2G4IA 4OHXA 4Q4Y1 3SCHA 5KWRA 1KGYA 2W1QA 4RS5C 3FBMA 2WNEA 1YC61 3AFKA 1IS6A 4NIDA 1SQ4A 1YNAA 1BJQA 2PAEA 4GKYA 2XGXA 1QJEA 1N1TA 1W0OA 2XJQA 1AF9A 1S0IA 2QQUA 3FZ3A 2JD9A 5A3UA 3SITA 2WNUB 3OD0A 3PUQA 4COZA 5LCWL 3V64A 3VD5A 4CEWC 3N9PA 1MZFA 1WBLA 3AM2A 5HI0A 1RUI1 1EYBA 1S2KA 1DFQA 2J1VA 2BNMA 3MIHA 2Y38A 4LBJA 5DAQA 4QGNA 2DCZA 4AEDC 3CBNA 3H0OA 1VBA2 1SG3A 2YUEA 2VMIA 1AL22 1RUNA 1FOD1 4LK6A 3HVDA 3VBRB 2QE3A 1HV0A 2I07B 2VG9A 3POEA 4LO4B 3ZLIA 4IEOA 3O1PA 1CPNA 3BTYA 2P5BA 4HZFA 3ES4A 1GWKA 4ISRA 2PELA 5FQ0B 2ORZA 1R082 1J58A 1PMHX 2ZMLA 1H30A 1OI6A 3AYAA 4FO9A 4A7KA 5C5TA 1W05A 4QQ2A 4BWOA 3TNPB 2WS92 3SLIA 3U4XA 1LOFC 3ASIA 3U0ZA 1S0GA 3TB0A 3HJRA 1H9PA 1GZTA 5CBLA 1NAEA 5DG2A 5FUNA 1ODMA 4B7KA 1W6MB 1URXA 1OMIA 5BNOC 1JZ5A 1FXZA 2AR6A 4UBGA 1HN0A 5LA2A 3UL2A 5M0TA 1EUUA 1L3JA 1WA4A 1QJZA 4OUSA 1JS9A 3AP9A 1EY2A 2A6ZA 4PBOA 4JDNA 4QXHA 1IG0A 5FY5A 3TN92 1VB2A 1NCQA 3OB8A 2KM2A 3ZXGA 5T3NA 4H55A 2BPA2 3DXUA 4WVMB 2A3YA 4I01A 2K46A 1QH6A 4QAWA 3CKHA 3ZFEB 2B42B 3R4DB 3IB3A 3VBOA 5CFCC 3ECQA 3ZKUA 5A7QA 4AHWA 4E2GA 3RZGA 2E7AA 4CXYA 4YARA 4XYXA 2VC9A 2Z2SB 1I1EA 2ZGKA 1XNCA 5I0DA 1HRI3 1D4M2 1Q56A 4GH4A 1QQP3 3B94A 1DF0A 2QJVA 1HRI1 3BU7A 5D8AB 2V4VA 3POSA 5EJ1B 2WWJA 2O0OA 4K9SA 1GNZA 1C28A 4WM8A 4NROA 4QPWA 1MS3A 1IS3A 2GAUA 2OS2A 4BK5A 1ZVFA 1DHKB 3KM5A 3VDDA 1S0FA 1EUTA 1O4YA 3AX4A 1ND2A 2PYTA 4XUOA 1J3PA 3WDUA 4KWLA 2YGLA 5ISLA 3IPVB 3LEMA 2VCAA 2XKOA 3CJXA 5ABJC 2W91A 2JG8C 5IFPA 5C9AC 1ENXA 3BODA 4YW4A 4YVWB 4CU8A 2BU9A 1IKPA 3O5SA 4LUMA 4BK4A 3NAPA 4RSUA 3WNOA 4XETA 4XFBA 4XOGA 4IV3C 1DGWA 4K8FA 1GZWA 3KGZA 5KXEA 3N4MA 3R05A 1OBNA 5A6YA 5DN2A 1RHI2 4R8HA 2PLV2 1OKQA 1H8TB 5H9PA 3AMMA 3GHMA 3I3QA 3F2ZA 1QNWA 1O5LA 3E1F1 4TWTA 1WCQA 4LT5A 2AENA 2RG4A 5HCFA 4COVA 2WUHA 2J1TA 4XDOA 2FMYA 4LA3A 3AKSA 2V09A 4HL0A 4WBBA 2ENRA 2RS33 2TNFA 4I02A 4DB5A 1CZTA 1KFUL 2WFF2 2F6BA 5FRAA 3J26N 4Q1RA 2D43A 4O65A 3O1UA 1GV9A 1WCUA 2VQAA 3LPGA 4LBNA 4CPBD 2PHRA 1WKYA 1WCDJ 3RNSA 5JPNB 1NQJA 4B1MA 4CUGA 4RR3A 3MICA 3RMXA 5FY0A 4MHRA 3ZYGA 2FBEA 4GAZA 4QM9A 2KD7A 3K46A 5DAXA 5FFOC 1W6OB 2BTVC 4LO7A 2VQ0A 4KWUA 5J3UA 4H3WA 5JSRA 1XNBA 4FPEA 5JOXA 3D4KA 4UF0A 1UMHA 1S0JA 3ALQA 3MUY1 5FJHA 3BKZA 2ZHMA 3I2HA 4Q4W1 4PDWC 4FP3A 5IYYA 3CJIA 5LY1A 1FNZA 1OH4A 4AI3A 2W1UA 2HKXA 1X8EA 2BW8A 1UXZA 3PIGA 1ZRRA 4MVTA 4NJ4A 4BOWA 3RVHA 2ZACA 1MACA 1UPSA 4HSJA 3PDQA 2EXJA 4S2FA 4CCJA 5T52A 4AHZA 5C3SA 3SNMA 2R072 3H42B 3N36A 3POIA 3O1RA 2D98A 4AF9A 3ETPA 5C8CA 5KHKA 4Y33A 3VZOA 2WSUA 2YG0A 1BKZA 1HJGA 1W8OA 3O12A 4XF9A 1PX3A 2ZMKA 3J8F2 4XJAA 4YWAA 1NKGA 2OA2A 3VD3A 1HXS1 4KQ7A 4LNVA 3GZAA 1HRV2 2WBKA 3MDPA 1GNYA 5A70A 2VR4A 2LTNA 1Q8SA 3GJBA 2OIIA 4P5HA 4NHYA 5T5JA 4Q1PA 2O14A 2DCYA 3A4UA 4IDZA 3MIEA 2R32A 4TLFA 4XUNA 1CIWA 2QQVA 5JMOA 3B69A 1JYXA 1CPMA 4S2GA 2QZ3A 3WNXA 1W6PB 3AMNA 4RHV3 4QDRA 4M00A 5FXWA 4BH9A 1Z7S2 3POJA 2VTXJ 2DV9A 2QQJA 4D7TA 1UY2A 5A1FA 4XAAA 4XACA 4AOCA 1XU1A 5CYYA 2VZQA 3I2DA 3FL7A 5F2WA 3THPA 1ZZ9A 1MQTC 2MNGA 2X8KA 4CDWC 1DQ0A 2WO3A 3EHKA 4I0WB 2Q1FA 1QH7A 4IEYA 3LE0A 1B35B 2VD7A 2GH2A 4XBQA 3VBUB 3JBG2 1PNFA 1SZBA 1AVBA 4MX3A 2E6VA 2D97A 2GMMA 1PGL2 1O4TA 4N43C 4K6BA 4XFCA 1C4RA 3R6SA 2JG8A 3M7AA 5CNAA 2BJSA 3UETA 3T4VA 1OD5A 3MLKA 1M06G 3A21A 2JDAA 3UGGA 4C0BA 1NA1C 3U07A 1RUH2 1JUIA 2RR13 2RMU1 3KHCA 5FUIA 5LK5A 5FYUA 1XYNA 2HWF3 4KWKA 5A3OA 2VQUA 1XBFA 2RR11 4N9HA 4R9CA 2RS13 5E16A 3TEXA 2BFUL 1MS8A 3AJZA 3WR0A 3ZIXA 2HWF1 4B3NA 1F31A 1AXYA 3SISA 3OYWA 2YY1A 2EICA 3LA3A 4I3GA 3HMYA 4D3WA 3BPSA 2HJIA 4LKDA 4XFGA 1W2TA 4AWDA 4BU2A 2WKKA 2CDOA 2VW0A 3OBTA 3VDAA 2CL2A 4Y20A 3C2UA 1T6BX 4YZ2A 4E27A 1OA3A 3D5OA 4MUVA 2WFPA 5BNPC 2W5FA 1AR83 1RINA 1TG7A 1RTVA 2WWUA 2ZGPA 1YXWA 3WNPA 1I5ZA 1RUD2 2NM1A 4AE2A 4QPIA 1W6NB 3LIGA 5B2GB 3K77A 1W0PA 3UGHA 5JSOA 1ND3B 3HBZA 3MW2A 3HIFA 4RYDA 5GLZA 1OKOA 4AYUA 1G9AA 1PK6C 2E53A 2PHDA 3HBKA 1KEXA 4KH9A 3KMHA 2OQ7A 1BBT2 1IPJA 3KT1A 2BGCA 3ZYPA 3CEWA 1CAUB 4P9XA 4L97A 5KXDA 5B4NA 1UL9A 2PAKA 1REFA 4M3CE 1OA4A 1X9TA 1UMZA 2JJ6A 2VMEA 4EE2A 4JDOA 2WA3A 4PIZA 2ZZJA 1VLNA 1GWLA 3VKLA 4PHZA 2BVBA 2HWB3 2MEV3 3OSDA 4U36A 2IXCA 1ZZCA 4RQPA 1SFPA 1UMIA 4R52A 1RC6A 3HNBM 2MEV1 1AR63 1OLQA 2HWB1 1OF3A 4YM2A 1YQ8A 3I2OA 3OUJA 3A22A 5IK7A 4LLFA 4LJHA 3FN9A 3FLTA 3HAGA 4QWNA 1AR61 4QQHA 3WW3A 1MS4A 4PJYA 2HH9A 4W8JA 3VGIA 2P37A 3VBSB 3APBA 3T08A 1VBD2 2WDBA 3TRSB 4HVQA 3DUIA 4ORFA 4G3YC 2VOTA 1EV12 1PO12 3AYCA 4CU7A 2R043 5GKAC 4OUEA 5DUXA 4OHZA 3WXPA 4AHYA 4O61A 4XW3A 4UT5A 3ITQA 5BYNA 2R041 5IWFA 4E2QA 3H7JA 2H6CA 3BPZA 4LHLA 4LO8A 3U78A 4ZU7A 5JI7A 4CCEA 2FDGA 4QXKA 2W87A 3ETQA 3U4SA 5AFBA 2DU1A 2J1RA 3LDKA 4B4QA 1VBC3 1SHWB 2DVDA 4L92A 3Q8EA 2E51A 1QHDA 1QU0A 4DNYA 5DQ0A 2YROA 5JOWA 4K8RB 3ZFFB 1VBC1 1UO9A 4A2UA 4AFMA 2WYSA 1UD1A 5F5QA 1PHMA 4FPLA 2YU2A 1QDOA 1R093 2WNVC 2XVLA 3NAPB 4NPRA 5LA0A 3RPQA 1H6XA 4IXLA 5FZOB 4CUAA 1GZWB 2GNBA 1R091 1GUIA 1NXMA 3P6BA 3L9JT 2ZAHA 1VALA 5FPBA 1W39A 3NV2A 1QJU2 3FLPA 1JOBA 2WQZC 2RDRA 3TOJA 2XOMA 5DPNA 2JD4A 2ETEA 3I59B 3B9CA 2MHFA 4Q4V3 5E89A 2RJ2A 4FBFA 5JSPA 1JZ8A 2C9KA 1HB2A 4UWDA 5L9BA 2NN8A 4Q4V1 3SH5A 1ZBE3 4YW1A 3RZMA 2D5HA 1HN1A 4YGEA 3O1TA 2YC4A 3KF5A 5A3MA 4MXWA 2PHXA 1UY1A 3ZXFA 1ZBE1 4RS5B 5A3WA 2WN3A 3AK0A 5J98B 4B4RA 3ES1A 4IEUA 3Q8CA 5L73A 1SCSA 4CSWA 4PLNA 4LHKA 1GP4A 2JWPA 3HT2A 3MIFA 5L7OA 2PN5A 2W9XA 4CEWB 2DCTA 4MO3M 1QOOA 4QM8A 4QX3A 4RR3B 5F39A 2WRAA 4IW3A 2NPIA 1PVC3 4HG6B 5GLVA 4Q5OA 4QKDA 3EB7A 3WX5A 4AEDB 5ACA3 4CP0A 1PMJX 5JWPA 2J22A 1PVC1 1H0BA 2JDPA 2Q1MA 3NJZA 3NSTA 1O3TA 3M3OA 1IS4A 3HPNA 5ACA1 5F6KA 1JUHA 2WNUA 1DLLA 1Y3TA 2JECA 2VVDA 4JHTA 1YHFA 2X05A 5CADA 4CYDA 5HXVA 1HRI2 2HLEA 2YMZA 1J84A 3T1MA 1UN1A 3HNMA 4MGKE 3O1VA 1QQP2 2JDZA 1D2QA 1ULGA 1GZCA 3WSOA 1V6OA 4D8MA 5CVRA 2V72A 4YG6A 3WNMA 3M3QA 3M3CA 5JDBA 3VBRA 3ZSLA 1QJY3 3VD4A 1DDLA 5JI9A 4ES8A 4K1YA 3PHMA 1O4ZA 4EYUA 1SLAA 2DVBA 2JG9C 1ZBA1 5AC91 1QJY1 2FDFA 1LHUA 4HN1A 5HBAA 3GBFA 1K5JA 3OEBA 5BNOB 2O8QA 1OLME 5FDBA 4OMDA 1JZ6A 4A45A 4XJ9A 3AFGA 3AMPA 3M4FA 3HEIA 3L2HA 5K7PA 1UCXA 4P02B 4CCDA 4IETA 1W2OA 1RUJ2 5C6CA 2YDEA 1DQ4A 3N3HA 2PHUA 1W6MA 3VBHA 3O0WA 4PF5A 5C4WA 3ENRA 4YGBA 5CFCB 4K7JA 2QQNA 2E32A 4XF0A 3VZNA 5DMYA 3I3BA 3VV1A 4UFJA 3CO2A 3VN4A 4EV0A 2JKBA 3I4IA 2GH8A 3DYMA 4GA9A 1RXFA 3M2MA 2VULA 3SH3A 1O91A 1QXJA 2N7GA 2DU0A 4XTPA 5E88A 4XURA 4WVMA 5FYMA 1MVEA 1VRBA 3JQXA 1XOYA 3GZTB 1YQ5A 2RS32 2D6OX 1AJKA 3AKRA 3LDBA 3RS6A 2X53S 3ZYJB 1YFXA 1O3RA 1Q3EA 1TME1 3BI3A 4OI4A 4FP2A 2VMFA 4BQ4A 4M4RA 3VD9A 1CGPA 3J7MA 1DQ2A 1JXNA 2XLAA 2JDKA 3SCFA 4CVUA 5FBJA 5EJZB 5ABJB 4EWEA 5BNNA 4LITA 2JG8B 4I0AA 2G19A 5D8AA 4AFDA 5C9AB 4Q8KA 4LUKA 5F37A 3N9MA 1IS5A 1ZX5A 4HKWA 3W59A 4IV3B 5JVVA 2ARAA 5LEKA 4GB33 2CWMA 1GU3A 3THTA 3AKTA 1AX0A 2QZ2A 3WF3A 4ET7A 3IPVA 4Z07A 1BZWA 2ERFA 3KWVA 3T30A 3W5MA 3K4DA 1YQCA 1IPKA 3OGSA 2W0XA 3OYWB 2A3WA 1H2NA 3HQXA 4YVWA 3C7HA 3FFZA 5FV3A 5FUPA 4QX2A 3ZXKA 5CG9A 4BA6A 1KRIA 1NXD1 1UY0A 5FYHA 2XPJA 2E7TA 1PZ9A 2WJSA 1Q8PA 1RUC3 2VUJA 4ZU5A 2OVUA 2DCKA 2CDPA 2G9FA 2W94A 3KB5A 4QB6A 4V2VA 5D1IA 5EHDA 4MGIE 1YCIA 1WW7A 2QDRA 2XR4A 5FZLA 3O1SA 4CCKA 4GKXA 2QQMA 3PUSA 1H8TA 3S7IA 3BTXA 4XQDA 4C91A 2EVXA 5GALA 2XJTA 4K1ZA 4LBMA 4XC9A 1UF2C 3M1HA 1ASJ3 2TUNA 3AC0A 5TSWA 3WQ0A 4KG8A 2CNAA 2Q8CA 2GC1A 4ONUA 1NY71 4YGDA 1ASJ1 2PXJA 3GZUC 5LBBA 3WF4A 1RYYA 3N35A 4FPKA 4QB2A 1YFWA 3I7DA 4IE0A 4UFKA 5FXVA 1PM7A 3PJQA 1LOBA 3H9AA 3NVCA 4A6OA 5JIUA 3PVOA 2VZUA 5I91A 4FPHA 3ZXEA 2XDVA 4CCMA 4K3UA 4RGKA 1RGSA 3RGBA 5BY5A 1LAJA 4PDWB 3KD4A 4Y4YA 1OUSA 1REEA 2G9GA 3WNLA 2OT7A 4RHV2 1VR3A 2VZ1A 4HONA 4RQPB 3VHPA 5JXGA 2PAMA 2DCJA 3J9SA 1KDMA 1LHNA 4QX8A 2PA7A 3I8TA 1C5IA 2W52A 4AI2A 5CG8A 1W6OA 2C5DA 3UKVA 5JXHA 1BEV1 1AZDA 2HWC2 4RA0A 4AFCA 5J36A 4JQRA 2H6BA 1TZOA 3OPZA 1V00A 5ANNA 2ARBA 2E33A 2W08A 3NW4A 5ERLA 1H6YA 4CE8A 1XE8A 1RUOA 3DF0A 1JHNA 4C1XA 1V6LA 4XQ4A 3LWCA 1KJRA 1SFYA 1XSRA 2C26A 3RI8A 1MS9A 5FY1A 3OCPA 2ZX2A 4ATFA 1E5RA 4A44A 2P34A 4JRLA 3N7LA 2D3SA 1CAWB 4AVCA 4FTSA 4DUXA 1CAXB 4IERA 4DY3A 2RR12 4LEJA 2UY8A 2BNOA 3OUIA 4M0NA 1R1A1 2HWF2 1OT5A 2A71A 4QX0A 1LGNA 4PLOA 1PNGA 2RS12 2WSVA 3E5QA 4LULA 4WVZA 4HOOA 4WZFA 5FPAA 1JZ3A 3VLBB 3VHNA 1K42A 3IWZA 2W3JA 1JYCA 3DPRC 4MYEA 1WGPA 5I8YA 3DXTA 5FMCA 3URFA 3O7OA 2PHFA 1SBFA 3B01A 3WF0A 3GDBA 1YO8A 2VZTA 4F7ZA 2AH2A 1HQLA 3NV1A 1MQTB 4CDQC 4CDWB 2VZPA 1YIFA 2WZEA 3FHAA 3JQWA 1AR82 4Y4RA 5FOBB 3AYDA 4IGPA 1DGLA 3QLQA 3LPFA 4NHMA 1JH5A 1LB2A 3WW1A 1RVF3 2W95A 1W6PA 2B45X 5BUVA 2ZA9A 1V6NA 1X50A 3H3UA 4SLIA 4N43B 4FFHA 1RVF1 3WG2A 4CPBA 4CUCA 4FI9A 1ST8A 3DKWA 4X6QB 3O0VA 3WP4A 2VOKA 3JU9A 1IOAA 3QCWA 4W6YA 1CONA 4GJYA 1I3HA 1NA1B 2B4KA 2WIIB 3B02A 5I0RA 5JZGC 1DP0A 2VVFA 1B35A 4XPVA 1WMFA 3GCXA 4JGYC 4NIHA 3IDAA 3ZYHA 5DABA 2JB8A 2LUWA 4LA2A 4XJUA 5DUWA 3ZMNA 4BMBA 1GLHA 2X09A 1C8M3 1RMU3 1LHOA 4R4ZA 4RN5A 1G9CA 2MEV2 2HWB2 1J59A 1BVVA 4LE4A 4AVBA 3IT8A 1GOHA 1Q43A 1ZNPA 2X5IC 1C8M1 1RMU1 1W2NA 4XF1A 2CGOA 5FZKA 1XNDA 3MZHA 1AR62 3F95A 4Q27A 4XUTA 1DQ5A 4ZU4A 2IXIA 2Y64A 3PUIA 3T0DA 2ATFA 2PTMA 1GR3A 2ZEZA 3A0NA 3BCWA 1JTZX 1RUI3 1O8PA 1G9BA 2PMWB 1U0AA 4MGYE 1ALYA 4XF4A 1YRZA 2BUKA 2G1MA 2GNMA 3I97A 5C3QA 1UKRA 1C1LA 4YZ5A 1LULA 2YC2A 2R042 1FOD3 4IGOA 3T2OA 3BUCA 4EN6B 4JTOA 4D94A 1XJAA 1PK6B 3OGVA 3MFCA 2J7MA 1BXHA 2XVKA 2ZS6B 5LA1A 2XJSA 1MS0A 3GYDA 3PUHA 4Z92B 5C71A 2XVGA 4EJRA 2PHLA 3NV4A 5B4XA 4EN9B 1CQ9A 2LS6A 2GNDA 2IXKA 4AI9A 4CDXA 1W6NA 1N1YA 5JUVA 2CGNA 4YW6A 2BVVA 4AVTA 1ND3A 2DYCA 2BZDA 2IVIB 4L0PA 5C33A 3OBAA 4M0HA 3PL0A 1R092 2J1UA 4MXVA 4EZHA 1DGRA 1PO21 3EYPA 3VDBA 1CIYA 5T5PA 2QQLA 3N7MA 1NOVA 1Q5OA 4IGQA 3RZLA 1CAUA 4N8MA 1W03A 2C4XA 1JOPA 4O9EA 3VBHB 2RV9A 3WQ7A 5C4WB 4QU2A 5FP4A 4EWAA 1CN1A 1SBDA 2ZTNA 4JGZC 2PHTA 4JV4A 4B1LA 4MOAA 5G04L 3AZWA 3POYA 3NWKA 5J09A 3E6CC 1IZ3A 4J25A 1JYVA 2VAUA 4TN7A 3GXUA 1ZBE2 5FY8A 2VJXA 3I3MA 4IV1C 1U5ZA 1JYIA 1TMF3 3A0KA 1JBCA 3GGLA 3UT0A 3VBSA 3UNPA 1RUE3 2FD8A 2Z42A 3IDBB 1TMF1 3CQOA 1GBGA 4MGQA 4A6SA 2DWRA 3BOWA 2WO2A 4XBNA 1F8VA 1RUE1 5BNNB 1RUF3 3BALA 3SMHA 4K21A 1ZYBA 5FKCA 2F4PA 1QGLA 1RUF1 4QPYA 4FFGA 2OW4A 4CXWA 4K20A 5FZEA 4CEYC 1JYWA 1PVC2 3WDTA 5ACA2 3KZ4C 2ZPXA 2GMEA 4IE7A 4AFBA 1SACA 3THDA 4XIOA 2OKXA 5IJRA 2A6WA 1DZQA 5E8AA 2C1FA 2RVAA 3ZFFA 1NYWA 4NRQA 2ZGUA 2ZMNA 4QPGC 5FMOL 2NP0A 4CDUC 1VMHA 2A6VA 4IEPA 2HEVF 4QMAA 4XABA 3HD8B 5IAVA 1AXKA 5FZOA 1C3HA 2CV6A 2YFUA 1LJ7A 1N3OA 3MW4A 3ORJA 2VXJA 4NHKA 3ZXJA 5FYSA 2ZGOA 4PQQA 1UXXX 4P9IA 2GP5A 1KXGA 3ZIWA 1J83A 1QF3A 3IAQA 5JZGA 3R0RA 2VBDA 3I59A 4LE3A 3OY8B 3U10A 3RZHA 3H3ZA 4AEKA 4EQVA 4HSLA 4W6XA 4XAEA 4DXRA 2BWAA 2ORXA 4OI0A 1ACCA 5CISA 4SBVA 1ULCA 1W90A 3WUCA 3KCXA 1W99A 3EO6A 1YQ6A 5GZFA 2ADDA 5LBFA 3POFA 1ZZ7A 3GNEA 3KVAA 4RS5A 4QQLA 5F32A 4A3XA 3ZVXA 2R16A 2XJVA 4W4ZA 2VL4A 4IEWA 5KHIA 4N53C 3S7EA 1DGWX 2EXHA 1OURA 3Q9OA 3ZPYA 2VMHA 1WW5A 1V70A 4CEWA 4BQ3A 3CU7A 1OUXA 4QXCA 4RFT0 4LKEA 5HPOA 1BHGA 5KC5A 1UW8A 1AR91 3TWIA 1XNAA 4AQ6A 4N7IA 1YLLA 1XYPA 5LBCA 3VZKA 3WW2A 4R4XA 4ISQA 3NJYA 3ILFA 3PIJA 4AEDA 4Q4W3 2FCTA 2W1SA 2VZSA 1AX1A 1HV1A 3VKFC 5IVJA 3WT3A 5FZ0A 1DYPA 1RJ8A 3U14A 2RS53 2JG9B 2EIGA 3C8XA 4AR2A 4DXSA 2RS51 4FFIA 3W9AA 3DGTA 1M4WA 1NCRC 2D44A 4Z8BA 1D2SA 2A3XA 5KHHA 2K0GA 3FMGA 2OPWA 4FOYA 5FREA 3FUQA 3ON7A 1LOFA 2OQ6A 4RFRB 3CZJA 3T0AA 2OZ6A 3WG4A 1WLTA 1VMJA 3H8UA 1PGW1 5K0UC 4GB32 2XL9A 2GDFA 5BNOA 3AL5A 4D6RA 3GBGA 1HXS3 4DZGA 1IKQA 2IWGB 2V73A 2CY6A 2TBVA 1OOPC 1YJLA 3UYJA 3ZXDA 2FCUA 5C3RA 2EIEA 3FWEA 4OQ8A 1W28A 1S1AA 2O1QA 1XE0A 1W6QB 3KV5A 4HKOA 3H8XA 1F4AA 1UY3A 2VNRA 5FP8A 2ZGQA 1RUC2 3LGRA 3VL8A 3MBWA 1CJDA 4AHXA 2P6HA 4YSFA 2Y26A 2Y0OA 3GF6A 1F2NA 3C7GA 5CFCA 2QCSB 4TSVA 5J1XA 2VCCA 2Y6FA 3V0BB 5FCCA 4MGSA 1VE0A 3JB4C 1ZZ6A 3MO4A 2XBO1 4LO5B 3RJ2X 4Q0UA 4ZONA 1UKGA 4XFIA 4XXAA 1X82A 5T55A 5JMCA 5IVCA 2YBSA 5DDJ3 5FXXA 1L7QA 3C7EA 3PVEA 5DDJ1 4CEYA 5CA6A 3MW3A 4LBQB 1O3SA 1TQ5A 4CXXA 2ARXA 3ZSKA 3U75A 1AYM3 1L7RA 5CU1A 4BM8A 4AQSA 4N7UA 1WMDA 2ZGMA 5FKBA 2SLIA 5ABJA 2Q5TA 1AYM1 1IQDC 4ZZ8A 1LCLA 3ZSEA 5C9AA 3DN7A 4QPGA 4GZ9A 1AXZA 3O0XA 2XJRA 2RMU3 5LW9A 3MYXA 4C1WA 5A3PA 2DBIA 5FAXA 1IGOA 2WABA 4IV3A 3SQOA 3JUUA 4BQ5A 2C24A 1C1FA 3O1OA 1D0GA 1TE1B 5FIXA 1JYTA 2JE9A 2A5ZA 1LODA 4LQRA 5H9RA 3RZJA 3I2GA 5JOZA 5FY4A 2BGPA 2EF6A 3D3AA 3ZDVA 5F3EA 1BK0A 1JZ2A 1WBFA 2MPFA 4FXGB 1QOSA 3O14A 4AQTA 2RM23 4Q0SA 4AG4A 4GXLA 4AVAA 2ZHNA 2LROA 5LRRA 2V5DA 3N9QA 4HT1T 5FZCA 3MI8A 2ZOEB 2EXKA 2BEOA 2RM21 3UJQA 2BYVE 2YBKA 4MH0E 4UFLA 4ZS2A 3M8LA 3MIGA 1ZREA 1QNYA 3SEEA 1JZ7A 2BQPA 4CDXB 2XUEA 4NIIA 2WT2A 2NZ9A 4KGQA 2HWD3 2E7QA 3C3VA 4V1PA 1POV1 2OX0A 1F35A 3DKQA 1VJ2A 2W39A 2HWD1 4NE9A 5A7OA 2XQRA 2FZ2A 2R063 3DEMA 3OPTA 4O7XA 2D6LX 3AMQA 3WCRA 3LKJA 2ARCA 3HOBA 5FTTC 2Y60A 2OUJA 2R061 2A75A 2R6QA 2VO5A 2QTWB 3IIIA 2LALA 4BB3A 2HWE3 4ATEA 4PDWA 2ZKLA 4I09A 1DCSA 1FAYA 4UFIA 5IW0A 1RVF2 2HWE1 4MLOA 2GN3A 3C7OA 3FE5A 3GCWA 4YM3A 1FI2A 4BYYA 3ZSMA 3C7FA 3FX3A 3BYWA 1H8VA 2BDRA 4GD4A 1PX4A 1CJPA 4OVEA 3LFIA 2R7EB 4JAAA 2ET1A 4LPLA 4QKFA 4DEVA 3ZR5A 1FMD3 2R0FA 2JE7A 3W21A 2V4AA 2ZX4A 4PF1A 5EWSA 2CHHA 4BE3A 3TEYA 1FMD1 4XMIA 3WP6A 4Q4Y2 2UYBA 3K48A 2VNVA 3M70A 3MV11 4FXKB 1MEC1 5CFDC 1W9FA 1Y7BA 2Z4FA 3LD8A 3PURA 4QGLA 3ZXAC 4COUA 3DV8A 3KT7A 1CAWA 1OLMA 1ZRIA 2VNGA 2WT1A 3DPRB 1UOJA 3WHTA 1CAXA 1D7PM 4WM7C 4I3PA 2D7FA 4JHZA 1NG0A 1W8UA 5A6XA 3VHRA 3SXWA 4COYA 4E4SA 3WLUA 1RUI2 3W58A 3MFAA 4GMP3 4DINB 5F2SA 5LWBA 1EPZA 4YLZA 5I0TA 4DFSA 2VOWA 4TZDA 4GMP1 3MLJA 4P08A 1VP6A 5FZ8A 4FT8A 5IK4A 1FOD2 1DLCA 2GN7A 2Y6KA 1J3RA 3V0AB 1LOEA 4LR4A 3RSJA 3ZN6B 5C8CC 2IXHA 1MQTA 1NE4A 1VBB3 4CDWA 4IE6A 4UW3A 4XZPA 5AFEA 1LEMA 5IK8A 1W8ZA 2QUOA 3VKOA 5JCTA 5JZGB 4QXBA 1VBB1 2ZJCA 4FPGA 4JGYB 1WWYA 5IAXA 2VUAA 3AP5A 4N43A 2BFUS 3E97A 4I2OA 1ODNA 4YPJA 2Q1ZB 2QDNA 4C8DA 1WLCA 4YNIA 2CU5A 2VTFA 2X5IB 4DRVA 5L7OB 2WS91 2ILMA 2VOVA 4V2WA 1NA1A 1Y9GA 1BMV1 5LY2A 5F3IA 2ZGRA 4LXLA 4AGVA 1N3QA 4ZS3A 5FOJB 3LIHA 4XUQA 3K2OA 4XILA 1F5FA 4Y26A 4CU9A 1K5MC 3JZVA 1DU3D 5DZFA 3RRDA 3QBQA 5FR3A 1RUG3 3NKTA 1SPPB 3KSCA 3VZJA 3Q8BA 4ZHNA 2IFWA 4J1XA 3J7NA 1RUG1 5KHJA 5FO9B 3POGA 3IM0A 3L2YA 2EAAA 4P5YA 5DZEA 4Y24A 1TMF2 5T50A 3MIBA 5BNPA 3VL9A 4DQAA 3A7QA 1F15A 3EXUA 3PU3A 3KCCA 4GWJA 1ENSA 3K75B 4UFHA 2ZX0A 2ZAAA 1GFF2 3OGGA 4E8DA 2QQWA 4Q29A 4S2DA 1U12A 3EJKA 5E1RA 1QWRA 2DBNA 4E2SA 1PK6A 2RJKA 3CDZB 3D82A 5AC93 1FPN3 1ZBA3 2OPKA 3K51A 1HB4A 2J1AA 2ZCWA 3HN3A 2RDSA 5I8SA 4AI0A 4BQ2A 4Q0PA 1FPN1 1OF4A 4PBPA 4YGCA 1NUKA 3NV3A 4QDQA 4G9SB 2PHWA 2WZR3 1PZ7A 3PVBB 3USUB 3HN1A 1QJX3 4JGZB 3S0MA 2WZR1 4PI0A 5I0UA 5KR7A 2AC1A 4YFZA 4GWMA 1QJX1 4HVOA 5FPLA 1APNA 4HPKA 5GM0A 4M3CB 1UYPA 4Q4X3 5EJ3A 4TTGA 4F8AA 5GLWA 1DGRN 2D6NA 1Q8QA 4Q4X1 3WG3A 2Q4SA 1ZRCA 4YG3A 5KXCA 3OGRA 1GP6A 3RYKA 3NO8A 4IV1B 3U37A 1AR73 4HLTA 2PLV1 3WP5A 4CP1A 1UYZA 1WLWA 2E9QA 5LZ6A 1AR71 1JU3A 1US3A 3DYOA 2JB4A 4BMEA 1DYKA 4YZ3A 2B8MA 1GOFA 4QDSA 1XNKA 2E26A 3BB6A 4NR1A 2VXRA 3OJBA 3T2PA 4DRRA 2CWSA 1IG3A 4KBBA 1TME3 4CEYB 2SBAA 3ST7A 1STMA 3BTAA 5EXOA 2VZ3A 2LW8A 3QACA 4WM7A 1DZRA 4DOUA 4NPLA 1JU4A 2WFF1 2C0ZA 3NNJA 4Q0VA 1ENRA 1UOBA 2RHPA 3BOPA 4QPGB 3WW4A 4D7SA 4FPOB 4CDUB 1EAH3 2WNVA 4INDA 2VQTA 3ACGA 1KS5A 2PQSA 3T1LA 4UBHA 4H7MA 1W8WA 1EAH1 4JC1A 4CP2A 4FFFA 1YJKA 5FZ4A 4Q4W2 4FPCA 4QGMA 4XJWA 1QXPA 3KV4A 4LO6B 3EQEA 4YG0A 1WUVA 4KG0A 2Q30A 2RS52 1CZSA 4LHSA 1A3KA 2ZGTA 3WG1A 1VIWB 2ZBJA 2EA7A 1ULDA 4P9YA 2VCBA 2VUCA 2ZEWA 4AGRA 3V0AA 3OF1A 4Q8LA 1VMFA 3VBFC 1QIQA 5FZMA 2YV8A 5EPAA 2R071 1UAIA 1EPWA 1OSGA 4CCLA 1SDDB 2P17A 3LEKA 4XJ8A 1HXS2 4N53B 3OY8A 1W0NA 3T09A 4FTBA 4GMP0 4FSJA 2VU9A 4QU1A 1HRV3 2WL1A 2ZKNA 3J8F1 2W68A 4ZY9A 2TEPA 3IKWA 4QKBA 2XHNA 3ZKYA 2DFCA 2F4LA 1OQ1A 1VB4A 1HRV1 3Q8FA 3G6JB 5LK7B 4JQTA 1UIKA 3WDYA 4PIXA 1W8HA 2WAOA 5FYIA 4OMCA 1FNYA 4MZUA 1J3QA 2QNKA 4H14A 2Y33A 1VAVA 2CTVA 3I3DA 1BEV3 5CZKA 1NCRB 4ZZ5A 1CAVA 4NRMA 5EQUA 4L8QA 4QT6A 1CR7A 3JD73 1H4HA 4TYSA 4GIQA 5EFUA 5A7PA 5A80A 3WEZA 1HQNA 3DECA 4ARYA 2ZZQA 2J1SA 1UX6A 3JD71 2CYFA 2JG9A 5K0UB 2WN2A 3J7LA 3R4SA 1AYM2 3GALA 4CRQA 1FV3A 2WO7A 2BOIA 4HK8A 4IL7A 4Y3OA 1OOPB 5KC6A 2B9VA 2DFBA 4XF3A 4QX1A 1PGL1 5FYVA 1O5UA 2JKXA 1VBE3 5ANQA 2VMCA 4ZXKA 3ZM8A 5LEJA 2RMU2 4XDQA 4YVSC 4E4DX 2NQYA 3NNGA 1R1A3 3CL1A 4A7ZA 1MPXA 1VBE1 2DTYA 3NL1A 2A1XA 4NWVA 3HQUA 2RDNA 2DVAA 3LFMA 1H2MA 3P1IA 3ACLA 2JIJA 1S4CA 2VMDA 2YZ4A 3ATGA 4AAXA 1NCQC 1HB3A 1LOCA 4BHPA 1A78A 2D3RA 4IEZA 1W6QA 5FZHA 4KBZA 5DXDA 4BIOA 3J4UH 4EZ4A 4Z82A 1JOJA 3NNMA 3HQRA 4D7YA 2F17A 4HFSA 3VBOC 1OH3A 2RM22 4A42A 1UPIA 3KV6A 4WVWA 4E9KA 2D5FA 2GNTA 2XMLA 3AZXA 3FHIB 3LEIA 5LASA 3THCA 4XHBA 1Y9QA 1WCSA 2IVJA 1L7LA 1GWMA 2WO1A 3V0BA 3M3IA 4GH4C 5JXIA 2ZGSA 3I54A 2BBAA 3H1MA 3PU8A 2ZABA 1W2UA 1OQDA 1RUD1 2E63A 3NJVA 1NQDA 4UI9L 4AI8A 1WD4A 1XU2A 4WM8C 4HK9A 3RI9A 3VDDC 1P8JA 1WW4A 4DMIA 1IPSA 3BIEA 1ND2C 2D6PA 2LM3A 3AXDA 2OXBA 2R062 3AKPA 1XE7A 4HXCA 4LBQA 3FLRA 4UXAA 4J6GA 2GZWA 1H9WA 4XFHA 2BP6A 2VE1A 5FZAA 5A3TA 1I5PA 5F7UA 2WR9A 5DAVA 4Z1VA 1RITA 2Y6LA 1KQRA 2B46X 5A32B 4RGAA 2HWE2 2QFEA 2BNNA 4I0BA 5FZ7A 4QX5A 2XLFA 3NAPC 2WLQA 3OBRA 3MHZA 2KXLA 3HR9A 2VOXA 3CF6E 2DUOA 2P6CA 4FVVA 2UY9A 4BDVB 3MF6A 3ZFGC 1FYUA 5A3LA 2Y8KA 4RL7A 4JKMA 2YGMA 1KDKA 2EIBA 2GC3A 5A7SA 3O1MA 3PVNA 1BQPA 3CLPA 3VBFA 5BNPB 4DEQA 2HYXA 1RXGA 3TBDA 2VGDA 5LATA 4IEQA 1YUDA 2CAVA 1FMD2 2VZRA 2B5HA 2VBPA 3I2KA 4F83A 1RIRA 1PIV3 4NVPA 1LTEA 4HVRA 1LOAA 1PO11 3H7YA 2IXLA 4NAMA 4M3CF 1TVGA 4LKFA 5KXBA 1GP5A 1PIV1 2BRTA 2ZEXA 2VZVA 5FYBA 4Q2FA 4XZUG 1UU6A 5F8PA 4D69A 3MIDA 5DZGA 3MV01 1VBC2 4QKNA 1D4VB 1Y43B 3TYJA 1K45A 1ZA7A 5AVAA 4CCCA 1XQNA 1O7FA 4A3ZA 2VNOA 3TAYA 4B7EA 4PT6A 1PO23 4RR3C 1K3IA 1S0BA 4JCKA 2ZHLA 5EIYB 1X33A 4HPKB 4UYBA 3HT1A 4Y1ZA 3MPPG 2BV4A 1JN2P 1UOFA 4R9BA 1AX2A 4W6WA 1YI9A 2QQKA 1Y4WA 2AACA 3X29B 4AQ2A 1MZ5A 4WVVA 1US2A 1ZM1A 3AZYA 5L36A 4OI1A 1QJU3 4HETA 2QQPA 4AEJA 3RZKA 1T2XA 3CJIC 1VBB2 3AYEA 3KF3A 2FMDA 1H2KA 2RE9A 1I9RA 1NT0A 1QJU1 3LSEA 4L99A 3ZOIA 1FX5A 1Q8OA 2R49A 4KWJA 5F1RA 3RQ0A 4Q4V2 1LESA 1DQ1A 3B00A 4Y5Z0 1V6IA 2YPJA 2GALA 5EYYA 4CP9B 2D40A 3RWNA 4FTEA 2VW1A 2JENA 5CFDB 5IUQA 1BMV2 1OLRA 3GJAA 4FPJA 5CKQA 4DS0A 1COV3 4YVSA 4LBKA 4LLOA 4KMQA 4EN0A 2E31A 4NOTA 2WZ8A 3DCQA 4WM7B 1OVSA 3H1YA 5BV6A 2CGPA 1CESA 1COV1 3P3NA 2WT0A 2FCVA 1MZEA 3H8RA 2XXZA 2P3IA 1LR5A 4PIYA 1NZCA 1LOGA 1GMMA 4IUGA 1OD3A 1RUG2 2WNVB 2YHJA 1H2LA 1HIXA 4GQ7A 4AXOA 4ARXA 5IT6A 1O59A 1SLTA 3DPRA 2NYYA 1WCKA 2GC0A 4LORA 1W9TA 2P3YA 4Z2AA 1LECA 1QKQA 3MF9A 4RGGA 4FOWA 3I2IA 4CDQA 4QB1A 5F5AA 4G4FA 2EALA 3KCYA 2JX9A 1X7NA 5IVVA 1GZ9A 2ZGNA 4NUBA 1Z78A 3CMGA 5C7GA 1FV2A 2AEYA 4C0HA 1QQP1 1JODA 1XB9A 3AL6A 4YW3A 5FXZA 3VKMA 1T6GC 4AZZA 2A6XA
chains in the Genus database with same CATH topology
1FPN2 1ZBA2 4BLJA 1QJY2 5AC92 3ZN6A 1LKNA 1QXRA 3CNAA 1LENA 2K9ZA 4FAGA 2Z69A 4W65A 4FQ4A 2WZR2 2EAKA 4JGYA 2X29A 1UIJA 4FOQA 1QJX2 4MGZE 4QHBA 5BXXA 4COWA 1K5MB 4BIFA 4LHNA 2R1BA 3MLLA 1RUJ3 3SH4A 2XG3A 4R9AA 4XHXA 4Q4X2 2X5IA 4AVVA 5T5OA 1A8MA 1RUJ1 2UWAA 2Z5WA 3ZFGA 2XKPA 5EZWA 4DPNA 2FQPA 1AR72 2WQ4A 3E6BA 3ZO0B 1S55A 5T54A 1AR93 4BCUA 2WZPP 1NLRA 2P2KA 4KNCA 1REDA 4HANA 1ULEA 1FT9A 1WLDA 1MS5A 1N1VA 3KGLA 1CAVB 5J48A 4ASMB 4EWDA 5DUUA 5DG1A 1PGSA 2D6KA 1ENQA 1TME2 3G7DA 2RS31 2H0BA 4BZ4A 4AVSA 4QPIC 4J1WA 4Y22B 1VAMA 1QMJA 2I2SA 3LA2A 4NO4A 3WY6A 2WA4A 2ZHKA 3AZVA 4RD7A 4Z2WA 1EAH2 3LB9A 4YYOA 4OLLA 5BNQA 2Z79A 3PMSA 4JRAA 2FHRA 4ZKTB 1GANA 2XHKA 1B09A 3USUA 4JGZA 4P9JA 3RJRA 1YFUA 1DIWA 1S0EA 4K40A 1H1MA 4RQPC 4M3CA 2H0VA 4XJZA 4XXPA 2GSYA 3FBYA 1YI7A 1BVP1 5KHGA 5AVPA 3UV9A 4IV1A 2Q0AA 1V6KA 4XQWA 1DBNA 2XBO3 4AW7A 4YRDA 2R0HA 4GULA 5A33B 2XJUA 1ZZ8A 3USSA 1NY72 2A70A 1ASJ2 3D0JA 1GYKA 4HBNA 1TNRA 3OTFA 2AYHA 3MPBA 5FMOS 1XYOA 4FPYA 3SCGA 3AZZA 1UZYA 2WINB 1SMVA 3POWA 5SV5A 1H1AA 1E57A 1N1SA 3UKNA 1V6JA 3KT4A 4FPFA 2WWSA 1OPOA 1R1ZA 4EN7B 3BIWE 4OHYA 4IESA 1G6NA 1A8DA 1V9U3 4CDUA 3AMHA 1BEV2 4RHV1 5GLTA 3LOBA 1JW6A 5GLUA 2HWC3 1V9U1 2P3JA 4HMZA 4L11A 3S30A 5HCBA 3JD72 1ZA4A 3VBFB 2HWC1 3FFQA 5FPXA 5F6LB 1GQHA 1YIPA 1J1TA 2VVEA 4B29A 2R30A 4F3JA 4LBQD 2GU9A 5EV7A 4L2NA 3B93A 2IZWA 1X8MA 4R9DA 1VBE2 1C8NA 3KQRA 3ZX7A 4XEZA 4EN8B 1R1A2 2OZJA 4YM0A 4OI2A 1U5YA 3MEPA 1AHSA 5L7OC 3IMNA 5FLJA 1POV3 4N53A 3QH7A 3IBMA 3H1WA 4IEVA 1VAKA 1QDCA 2RS11 2BBVA 1OPMA 1LU1A 1AYN3 1Q8VA 1KD7A 2BWCA 4B4PA 4DXZA 2VPVA 4XFFA 2DUQA 4E4ZA 4O9GA 5JLVA 1MZ6A 1AYN1 5JIAA 3FJSA 3T2TA 1ZZBA 2ZX1A 4PQ9A 1H1IA 5JAXA 1G9DA 2XH6A 4OUMA 4HKLA 4PCRA 1Z0HA 2WNUC 1VRH3 4AEMA 3E5UA 1ULFA 4S2HA 2YYOA 1VRH1 3WVJA 2DF7A 1AR81 4ITCA 2IXJA 1HKDA 3VZMA 3E6DA 2WC2A 1NCRA 4OZXA 3VBRC 3AP7A 3AP6A 3IDCB 4YVSB 5FLHA 1HDKA 1LHVA 4JVAA 1HLCA 3ROUA 4Q0QA 5K0UA 4U2AA 4UW6A 1MEC3 1NE6A 1OOPA 3SHRA 1C8M2 1G7YA 1NCQB 1RMU2 3LZZA 5J7MA 4Y1XA 4AFAA 5K8SA 1KJLA 2XWJB 1SLCA 2I74A 5L19A 3VBHC 3VBOB 5C4WC 1D0HA 1YWKA 3UKTA 1MS1A 1QY4A 5EYXA 4CDQB 5F9TA 1ZRFA 3ME2A 3V65A 3AKQA 1CD3G 4GH4B 2XB6C 4P9GA 3ELNA 1PIV2 3ZYRA 2AREA 1J1LA 4AK3A 1OA2A 1VBA3 3ZFEC 3GBWA 2I45A 1AL23 4WM8B 2DTWA 3UK9A 3VHOA 3RZZA 4GALA 1LHWA 3VDDB 1VBA1 2C9AA 1AL21 1ND2B 5SV8A 4CZSA 2JEMA 1R083 5CB7A 1G9FA 5BNNC 1KITA 1PVXA 2QKDA 1WD3A 3PJYA 5D8AC 3PNAA 4Y1VA 1LEDA 1R081 5GZDA 2UWCA 1GICA 3ZYIB 5JPMB 1PO22 1C57A 4YZ4A 2WS93 3IIAA 4OULA 3WV6A 4AGGA 2CAUA 3AP4A 2XUMA 5BPXA 5J96B 5CAZA 4P9WA 1BK1A 3ZMOA 5C8WA 3ZFGB 1SBEA 2DURA 1RB8G 3GHNA 2D3PA 2YXSA 4BPZA 5HCAA 3KS7A 3N7JA 2DVGA 5A32A 2NMOA 4YVWC 3TN93 2A6YA 5DUVA 3TN91 2ZX3A 2YC0A 4JDMA 2ES3A 5GZGA 1H8TC 1DG6A 5FBZA 1MVQA 3MGUA 5FO7B 3WZ1A 1COV2 1SLLA 2Y0IA 3D0SA 3HWJA 3QOPA 4CTEA 3IN9A 1D4M3 1RUE2 4YZ1A 3RMYA 3WINE 4MSVA 1D4M1 1RUF2 4XMAA 3D8CA 4FCAA 2AUYA 5GZEA 4KU8A 3WUDA 4Q26A 5FO8B 4M01A 4DY5A 3U11A 4LBLA 4X8NA 2DVFA 1H4GA 1DQ6A 4NHLA 1LRHA 2B7YA 3ZN4A 1GQGA 2IFRA 4ASLA 3CJIB 4YM1A 3AB0A 1LGCA 2EXIA 1OFNA 1IQAA 4P14A 4UW4A 3LA7A 4A7YA 1AL0G 2B9UA 5CIRA 4YW5A 1S0DA 1G86A 5IK5A 2B39A 1U5IA 1RHI3 4YFWA 2PLV3 1SCRA 2A7AA 3NKGA 4OFGA 5J37A 1BCXA 1EP0A 4OHVA 5C8CB 1RHI1 2HYKA 4KL1A 1G8WA 4GWNA 3WQ1A 5FQ0A 3FUOA 1POV0 2AZ5A 3M3EA 1DZTA 3UJOA 4AI1A 4LBOA 5CFDA 1XRUA 4FQZA 2WFF3 3H50A 5I93A 3OGJA 4EROA 2XLGA 5I8TA 4KGGA 4XE9A 1AR92 1SEFA 5LRSA 4BLIA 3LSDA 2KA3A 4Y1YA 3B9IA 3B7MA 3VUOA 2VECA 4BQ1A 2IC1A 2DUPA 3ZFEA 4XBLA 4LTAA 4QQPA 3EBRA 2A73B 2PQQA 1CX4A 4QD2A 3LOIA 4XFAA 5GJ6A 2JXAA 3RG0A 3WDXA 3WP3A 3LAGA 1HQWA 1LU2A 1UZZA 4JTNA 4UW5A 3ZDSA 2O8OA 5I0SA 3JCIA 2VMGA 2NMNA 1FATA 2R073 2D93A 1A6CA 1PGW2 2FZ1A 1B35C 1N47A 4N90A 3VBUC 4C90A 1HW5A 1F5JA 3ZN5A 4WV8A 3P3PA 4GB31 3J8F3 5T5LA 4X6RB 4OHWA 1K5MA 2PFWA 1SLIA 1GSLA 4ES9A 4Y20B 4QQOA 3V56A 1RUC1 2VW2A 3VZLA 1F9KA 2Q8OA 3B3QE 4URTA 2XBO2 1TNFA 1MR5A 4QPIB 1PMIA 1X36A 1Z7S3 2NLRA 3ZXLA 4IQPA 4NWWA 3N7KA 2OYZA 1Z7S1 5DDJ2 2AGSA 3ILNA 2VH9A 2UWBA 2XWBB 2OUHA 4N9IA 5KBFA 3WD5A 3JBG3 1GKBA 4Y22A 5JR7B 4CDXC 3JB8A 1S0CA 1ND3C 1PZ8A 1KFXL 3JBG1 2UURA 1WW6A 5K9YA 4H7LA 4X8PA 1HX6A 1OFSA 4IEXA 1V9U2 2V5YA 3PTYA 1UU5A 1RUH3 4P9LA 3R4UA 2RJLA 2QVSB 3DL3A 1RUH1 4HN0A 1RL3A 1RJ7A 1UU4A 3QH6A 3WDVA 2GMPA 1O3QA 1BYHA 3WOGA 1ONAA 4XIKA 1NLSA 3ZSJA 2ZGLA 2XL7A 3S6PA 3WCSA 4FOVA 1SLBA 2HEWF 3RYPA 2K2SA 1YYNA 3VBSC 2JICA 1S2BA 1RUD3 2UU8A 4YW2A 5A33A 5H9SA 1AJOA 3AJYA 2HEYF 1AUYA 4META 2ET7A 3TNQA 1XXNA 2HWD2 4B8EA 4MV2A 3OD4A 1AYN2 5FPZA 4Y1UA 3FC0A 1CVNA 1BBT3 3RDIA 3RYRA 1OQEA 1N3PA 1BBT1 4WZCA 1VRH2 3ZFFC 1IHMA 3PMEA 4I30A 4FAHA 3LCPA 5H9QA 1SFNA 1I6XA 2R1DA 3QD6A 1TEIA 3AXEA 1WMEA 1C5HA 1KS4A 3PLQA 4PLMA 4XTMA 2WLPA 3WHUA 3VKNA 1LGBA 4MXWB 1U5XA 4NN0A 1SDWA 3IDEA 2UYAA 3E5XA 1QOTA 1V6MA 3B5LB 1VBD3 3INAA 3VBUA 1EV13 1OHFA 1PO13 2P3KA 3KLSA 4FPKA 5L7OB 3ILRA 1GNHA 1VBD1 2VY0A 2XJPA 4KU7A 1MEC2 4Q4Y3 5FLIA 3WDWA 3D6EA 4L9BA 1EV11 2D6MA 1YFYA 2GC2A 2G4IA 4OHXA 4Q4Y1 3SCHA 5KWRA 4RS5C 3FBMA 2WNEA 3AFKA 1IS6A 1SQ4A 1YNAA 1BJQA 2PAEA 4GKYA 2XGXA 1N1TA 1W0OA 2XJQA 1AF9A 1S0IA 3FZ3A 3SITA 2WNUB 3OD0A 4COZA 3V64A 4CEWC 1MZFA 1WBLA 3AM2A 5HI0A 1RUI1 1EYBA 1S2KA 1DFQA 2BNMA 3MIHA 2Y38A 4LBJA 4QGNA 2DCZA 4AEDC 3H0OA 1VBA2 2YUEA 2VMIA 1AL22 1RUNA 1FOD1 3VBRB 2QE3A 1HV0A 2I07B 2VG9A 4LO4B 4IEOA 1CPNA 4HZFA 3ES4A 4ISRA 2PELA 5FQ0B 1R082 1J58A 2ZMLA 4A7KA 1H30A 1OI6A 3AYAA 4FO9A 4QQ2A 4BWOA 3TNPB 2WS92 3SLIA 3U4XA 1LOFC 3ASIA 3U0ZA 1S0GA 3TB0A 1H9PA 5CBLA 5DG2A 4B7KA 1W6MB 1URXA 1OMIA 5BNOC 1FXZA 2AR6A 4UBGA 3UL2A 1L3JA 1WA4A 1QJZA 4OUSA 3AP9A 1EY2A 2A6ZA 4PBOA 4JDNA 3TN92 1VB2A 1NCQA 2KM2A 3ZXGA 5T3NA 4H55A 2BPA2 4WVMB 2A3YA 4I01A 1QH6A 3ZFEB 2B42B 3R4DB 3VBOA 5CFCC 3ECQA 4AHWA 4E2GA 2E7AA 4YARA 4XYXA 2Z2SB 1I1EA 2ZGKA 1XNCA 1HRI3 1D4M2 1Q56A 4GH4A 1QQP3 3B94A 1DF0A 2QJVA 1HRI1 3BU7A 5D8AB 3POSA 2O0OA 4K9SA 1GNZA 1C28A 4WM8A 1MS3A 1IS3A 2GAUA 1ZVFA 1DHKB 3KM5A 3VDDA 1S0FA 3AX4A 1O4YA 1ND2A 2PYTA 3WDUA 1J3PA 4KWLA 2YGLA 3IPVB 2XKOA 3CJXA 5ABJC 2JG8C 5C9AC 1ENXA 3BODA 4YW4A 4YVWB 1IKPA 3O5SA 4LUMA 3NAPA 4RSUA 4XETA 4XFBA 4XOGA 4IV3C 1DGWA 4K8FA 1GZWA 3KGZA 5KXEA 3N4MA 3R05A 1RHI2 4R8HA 2PLV2 1OKQA 1H8TB 5H9PA 3AMMA 3GHMA 1QNWA 1O5LA 4TWTA 4LT5A 2AENA 5HCFA 4COVA 2FMYA 4LA3A 3AKSA 2V09A 4HL0A 4WBBA 2ENRA 2RS33 2TNFA 4I02A 4DB5A 1KFUL 2WFF2 2F6BA 5FRAA 3J26N 4Q1RA 2D43A 1GV9A 2VQAA 4LBNA 2PHRA 1WCDJ 3RNSA 5JPNB 1NQJA 4RR3A 3MICA 3RMXA 3ZYGA 2FBEA 4QM9A 5FFOC 1W6OB 2BTVC 4LO7A 2VQ0A 5J3UA 4H3WA 5JSRA 1XNBA 4FPEA 5JOXA 3D4KA 1S0JA 3ALQA 2ZHMA 4Q4W1 4PDWC 4FP3A 3CJIA 1FNZA 4AI3A 2HKXA 1X8EA 2BW8A 4MVTA 1ZRRA 4BOWA 2ZACA 1MACA 1UPSA 4HSJA 2EXJA 4S2FA 5T52A 4AHZA 3SNMA 2R072 3N36A 2D98A 4AF9A 5C8CA 5KHKA 3VZOA 2WSUA 1BKZA 3O12A 4XF9A 2ZMKA 3J8F2 4XJAA 2OA2A 1HXS1 4KQ7A 4LNVA 3GZAA 1HRV2 3MDPA 2LTNA 1Q8SA 5T5JA 2OIIA 4P5HA 4Q1PA 2DCYA 3A4UA 3MIEA 2R32A 4TLFA 1CIWA 3B69A 1CPMA 4S2GA 2QZ3A 3WNXA 1W6PB 3AMNA 4RHV3 4M00A 4BH9A 1Z7S2 4D7TA 2DV9A 1XU1A 3I2DA 3THPA 2X8KA 1ZZ9A 1MQTC 2MNGA 4CDWC 1DQ0A 3EHKA 4I0WB 1QH7A 4IEYA 1B35B 4XBQA 2GH2A 3VBUB 3JBG2 1PNFA 1AVBA 4MX3A 2E6VA 2D97A 2GMMA 1PGL2 1O4TA 4N43C 4K6BA 4XFCA 1C4RA 3R6SA 2JG8A 3M7AA 5CNAA 1OD5A 3MLKA 1M06G 4C0BA 1NA1C 3U07A 1RUH2 1JUIA 2RR13 2RMU1 5LK5A 1XYNA 2HWF3 4KWKA 5E16A 2RR11 4N9HA 4R9CA 2RS13 3ZIXA 2BFUL 1MS8A 3AJZA 3WR0A 2HWF1 4B3NA 1F31A 1AXYA 3SISA 3OYWA 2YY1A 3LA3A 4I3GA 3HMYA 4D3WA 2HJIA 4XFGA 4AWDA 2WKKA 2VW0A 3OBTA 2CL2A 4Y20A 3C2UA 4YZ2A 4E27A 1OA3A 3D5OA 4MUVA 2WFPA 5BNPC 1AR83 1RINA 1RTVA 2ZGPA 4AE2A 1YXWA 1I5ZA 1RUD2 2NM1A 4QPIA 1W6NB 5B2GB 1W0PA 5JSOA 1ND3B 3HBZA 3MW2A 3HIFA 5GLZA 1G9AA 4AYUA 1PK6C 2E53A 2PHDA 4KH9A 3KMHA 1BBT2 1IPJA 3KT1A 2BGCA 3ZYPA 3CEWA 1CAUB 4P9XA 4L97A 5KXDA 1UL9A 2PAKA 1REFA 4M3CE 1OA4A 1UMZA 2JJ6A 4JDOA 2WA3A 4PIZA 2ZZJA 1VLNA 3VKLA 2BVBA 2HWB3 2MEV3 4U36A 2IXCA 1ZZCA 4RQPA 4R52A 1RC6A 2MEV1 1AR63 1OLQA 2HWB1 4YM2A 5IK7A 4LLFA 3FLTA 3HAGA 1AR61 4QQHA 3WW3A 1MS4A 4PJYA 3VGIA 2P37A 3VBSB 3APBA 1VBD2 3TRSB 4HVQA 3DUIA 4ORFA 4G3YC 1EV12 1PO12 3AYCA 2R043 5GKAC 4OHZA 5DUXA 4AHYA 3WXPA 4XW3A 5BYNA 2R041 4E2QA 3H7JA 2H6CA 3BPZA 4LHLA 4LO8A 4ZU7A 5JI7A 4QXKA 3ETQA 5AFBA 2DU1A 4B4QA 1VBC3 2DVDA 4L92A 4DNYA 2E51A 1QHDA 1QU0A 2YROA 5JOWA 3ZFFB 1VBC1 4AFMA 4A2UA 1UD1A 5F5QA 1PHMA 4FPLA 2XVLA 1QDOA 1R093 2WNVC 3NAPB 4NPRA 3RPQA 4IXLA 1GZWB 2GNBA 1R091 1NXMA 3L9JT 2ZAHA 1VALA 1W39A 3NV2A 1QJU2 3FLPA 2WQZC 3TOJA 2JD4A 2ETEA 3I59B 3B9CA 2MHFA 4Q4V3 5E89A 4FBFA 5JSPA 2NN8A 4Q4V1 3SH5A 1ZBE3 4YW1A 2D5HA 4YGEA 5A3MA 4MXWA 2PHXA 3ZXFA 1ZBE1 4RS5B 4B4RA 5J98B 3AK0A 4Q8KA 3ES1A 4IEUA 5L73A 1SCSA 4PLNA 4LHKA 3HT2A 3MIFA 5L7OA 2PN5A 4CEWB 2DCTA 1QOOA 4QM8A 4RR3B 2NPIA 1PVC3 5GLVA 3WX5A 4AEDB 5ACA3 4CP0A 5JWPA 1PVC1 1H0BA 2Q1MA 3NJZA 3NSTA 1O3TA 3M3OA 1IS4A 5ACA1 5F6KA 1JUHA 2WNUA 1DLLA 1Y3TA 2JECA 2VVDA 1YHFA 5CADA 4CYDA 5HXVA 1HRI2 2YMZA 3T1MA 1UN1A 4MGKE 1QQP2 2JDZA 1D2QA 1ULGA 1GZCA 1V6OA 5CVRA 4YG6A 3M3QA 3M3CA 5JDBA 3VBRA 3ZSLA 1QJY3 1DDLA 5JI9A 4ES8A 4K1YA 3PHMA 1O4ZA 1SLAA 2DVBA 2JG9C 1ZBA1 5AC91 1QJY1 1LHUA 4HN1A 5HBAA 3GBFA 5BNOB 2O8QA 5FDBA 4XJ9A 3AFGA 3AMPA 3M4FA 3L2HA 5K7PA 1UCXA 4IETA 1RUJ2 5C6CA 2YDEA 1DQ4A 3N3HA 2PHUA 1W6MA 3VBHA 3O0WA 4PF5A 5C4WA 3ENRA 4YGBA 5CFCB 4K7JA 4XF0A 3VZNA 3VV1A 3CO2A 3VN4A 4EV0A 2JKBA 3I4IA 2GH8A 4GA9A 3M2MA 2VULA 3SH3A 1O91A 1QXJA 2N7GA 2DU0A 4XTPA 5E88A 4WVMA 1MVEA 3JQXA 3GZTB 2RS32 2D6OX 1AJKA 3AKRA 3RS6A 2X53S 3ZYJB 1YFXA 1O3RA 1Q3EA 1TME1 4OI4A 4FP2A 1CGPA 1DQ2A 1JXNA 2XLAA 3SCFA 5ABJB 4EWEA 5BNNA 2JG8B 4I0AA 5D8AA 4AFDA 5C9AB 4LUKA 1IS5A 1ZX5A 4HKWA 3W59A 4IV3B 5JVVA 5LEKA 4GB33 2CWMA 3THTA 3AKTA 1AX0A 2QZ2A 3IPVA 4Z07A 1BZWA 2ERFA 1IPKA 2W0XA 3OYWB 2A3WA 1H2NA 3HQXA 4YVWA 3ZXKA 3FFZA 5CG9A 4BA6A 1KRIA 1NXD1 2XPJA 2E7TA 1PZ9A 2WJSA 1Q8PA 1RUC3 2VUJA 4ZU5A 2OVUA 2DCKA 5D1IA 2G9FA 1ZRDA 3KB5A 4MGIE 1YCIA 1WW7A 2QDRA 4GKXA 1H8TA 3S7IA 4XQDA 4C91A 2EVXA 5GALA 2XJTA 4K1ZA 4LBMA 1UF2C 3M1HA 1ASJ3 2TUNA 5TSWA 3WQ0A 4KG8A 2CNAA 2GC1A 4ONUA 1NY71 4YGDA 1ASJ1 3GZUC 3N35A 1YFWA 3I7DA 1PM7A 3PJQA 1LOBA 3H9AA 3NVCA 5JIUA 3PVOA 5I91A 4FPHA 3ZXEA 4K3UA 1RGSA 5BY5A 4PDWB 3KD4A 4Y4YA 1REEA 2G9GA 4RHV2 1VR3A 4RQPB 3VHPA 2PAMA 2DCJA 3J9SA 1KDMA 1LHNA 2PA7A 3I8TA 1C5IA 2W52A 4AI2A 5CG8A 1W6OA 2C5DA 3UKVA 1BEV1 1AZDA 2HWC2 4RA0A 4AFCA 5J36A 4JQRA 2H6BA 3OPZA 1V00A 2ARBA 2W08A 3NW4A