3M3OA

Crystal structure of agrocybe aegerita lectin aal mutant r85a complexed with p-nitrophenyl tf disaccharide
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
158
structure length
158
Chain Sequence
QGVNIYNISAGTSVDLAAPVTTGDIVTFFSSALNLNAGAGNPNNTTLNLFAENGAYLLHIAFRLQENVIIFNSRQPDGPWLVEQAVSDVANQFAGIDGKAMVTVFDHGDKYQVVINEKTVIQYTKQISGLTSSLSYNATEETSIFSTVVEAVTYTGLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Anti-tumor lectin
publication title Structural insights into the recognition mechanism between an antitumor galectin AAL and the Thomsen-Friedenreich antigen
pubmed doi rcsb
source organism Agrocybe aegerita
total genus 39
structure length 158
sequence length 158
ec nomenclature ec 3.1.21.-:
pdb deposition date 2010-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3m3oA00
3IKWA 4YG0A 2B7YA 4Y26A 5DUUA 3QCWA 1DHKB 1MS4A 1UZYA 1AXZA 1AXYA 2DUPA 4LBOA 2EXIA 1LOBA 4Y1XA 5F5QA 1LU2A 1CVNA 2YV8A 3M1HA 1LHVA 4YM3A 3NV4A 1AJKA 2P37A 5LK5A 5T54A 1NXD1 3HMYA 1DLLA 1LGBA 4I30A 1Y7BA 2V5YA 1QF3A 2AUYA 3WUDA 1NLSA 1FATA 2D3RA 2ZGLA 1LHUA 2ZMLA 3MEPA 3PVEA 2E7QA 3FUOA 3H0OA 3HR9A 1N3QA 4Y22A 2SBAA 2UWBA 2GMEA 2NN8A 3WVJA 4XJZA 1QNWA 1KJRA 1Q8OA 4OZXA 4PBPA 1KRIA 4Q27A 4FPCA 2XB6C 3OYWB 5IK7A 4L8QA 1LOEA 1CONA 1SLCA 5AVAA 2ZZJA 5IK5A 1CPMA 2AENA 1JYIA 1SLLA 3T2TA 1UX6A 2D6NA 2D6OX 5F9TA 2R1BA 4YW3A 4XIKA 2WNEA 5HCAA 1IKQA 3VV1A 4TZDA 1YXWA 3FLRA 1SBEA 2GN3A 3O0VA 3PVNA 2PELA 5IUQA 3SITA 1HQWA 4HL0A 3POSA 1LESA 4DRRA 1WCSA 5GZDA 4XJUA 3ZXKA 1S0EA 1BXHA 1CQ9A 4TYSA 1G8WA 3WCSA 2D3PA 2WJSA 4XMAA 1UN1A 1I1EA 5HCFA 3RMYA 4CZSA 3FUQA 1MVEA 1G9DA 1ULCA 3WG4A 1W6MB 2ZGMA 1SCSA 2A6VA 5JOWA 1W6MA 1ULGA 1SLIA 2OW4A 4BLJA 4M00A 1AX1A 4Q8LA 3VUOA 1HLCA 1Z78A 1H9PA 1LOGA 4ATFA 4KBBA 1LEMA 4M3CB 5L73A 1V6IA 2R49A 2GDFA 4M3CA 3M3OA 2W68A 4D69A 1UMZA 3V0AB 4C1XA 4FPJA 3D6EA 3V0AA 4ATEA 1SLAA 1YIFA 2CWSA 1DQ6A 2VY0A 5GLZA 1LU1A 2ZHNA 4YGDA 3AXEA 1LODA 3GNEA 2P3KA 4YGBA 2YROA 2PHWA 4FPEA 2WSUA 3D5OA 3BODA 3WV6A 4FQ4A 5GALA 1KITA 1S0CA 2A75A 4M3CF 4K1ZA 4BPZA 2D7FA 1GKBA 2PHFA 3WOGA 3W59A 5T5OA 1SACA 1JBCA 2DURA 2DTWA 4PF5A 2ENRA 4SLIA 2E6VA 4YFZA 1U0AA 1QDOA 5T52A 2PHUA 1ULEA 1Q56A 4XIOA 5GZEA 2A71A 3ZSMA 2YY1A 1C4RA 3ZXLA 2D6MA 3IN9A 1OFSA 3SNMA 1W0OA 4K21A 1SBDA 3WUCA 3AFKA 5DZEA 5DZGA 1WD3A 3ENRA 3O12A 3NV1A 4XYXA 2R16A 2A5ZA 3IPVB 1Z0HA 3IPVA 2ZA9A 4XHXA 3U4XA 5KXBA 4FPOB 4FOVA 3VKLA 5JOZA 5E88A 2ZHMA 3WDUA 1LGCA 1V6JA 3ZPYA 1DZQA 1GYKA 3CNAA 2I2SA 5CAZA 2ZBJA 4YZ5A 1DYKA 3VKFC 3ATGA 1H30A 2JECA 3JUUA 3OY8B 4PCRA 3OY8A 2WT2A 2ZAAA 1EPWA 1LOFA 2EAKA 1URXA 4YZ2A 5GLTA 3M3CA 3TAYA 3FLTA 4FPHA 3R4UA 5H9QA 1KDKA 4LBMA 3GALA 5JLVA 4GKYA 4YFWA 2ZACA 5CB7A 4XJAA 2VH9A 1IS5A 1S0BA 4DFSA 1V6OA 2D6KA 1HQLA 5EYXA 4YG3A 1JN2P 1GZ9A 5JVVA 1I3HA 4CTEA 2AYHA 4FOWA 2OUHA 2A6ZA 4PBOA 1MS8A 2VW2A 2WLQA 3SH5A 1G9AA 3FFZA 4Y22B 3AZZA 3AYEA 1S0GA 1JW6A 4XMIA 3W58A 1WBLA 2DVGA 1N1VA 2DVAA 1LJ7A 2ERFA 2ZABA 3ILFA 3WDXA 4FP3A 3ZSLA 2CTVA 4LBKA 1ONAA 1DQ5A 1JHNA 4GXLA 4FPGA 4DRVA 4ZXKA 1DQ2A 1CJPA 2YXSA 1C57A 3AXDA 1W0PA 4P14A 4R9DA 5FREA 2NM1A 1LOCA 2DYCA 1LOFC 2ZHKA 1LECA 2GMMA 4LBQD 1G86A 3N7LA 5EWSA 2NMNA 2A6YA 2WQZC 3AP4A 3WZ1A 1G9CA 2LTNA 4FOYA 1S0IA 5KXCA 3B9CA 5T5JA 4GA9A 4DQAA 2D44A 2GNMA 2JE9A 2WKKA 5EYYA 1OKQA 1S0DA 3WDWA 4IQPA 4UW5A 1IS6A 1JUIA 5DG2A 1WUVA 1LCLA 1MZ6A 1VIWB 2ZGNA 1RITA 1V6MA 4DPNA 4PQ9A 1HKDA 4AVVA 1HDKA 1QU0A 3LCPA 4XTMA 4FVVA 3OBRA 3M3EA 3M2MA 1G7YA 3NV3A 1ZM1A 3USUB 4AGGA 3ZVXA 3USUA 1SLTA 1VAVA 2ZGTA 4GWNA 1W6QB 3O5SA 2UWAA 1W6QA 2W52A 5DXDA 1IKPA 3WDVA 3INAA 3O0XA 1LULA 5DZFA 4RA0A 2PHXA 3SISA 1GICA 1FV2A 1WW6A 1V6KA 1YYNA 1CPNA 1GZWB 2TEPA 1N47A 1GZWA 2JKBA 4GKXA 4Q26A 2DVFA 2W39A 3BTAA 1DQ1A 2ES3A 2NZ9A 3OJBA 4Y24A 2ZKNA 4YW2A 1KQRA 1S1AA 1D2SA 1S0FA 3RG0A 3POWA 2CY6A 3A0NA 1APNA 1BYHA 3MW3A 1MACA 3AZWA 3LSEA 3VKMA 5CA6A 2D3SA 5DUVA 4YZ1A 4DS0A 1W6OB 1W6OA 2G4IA 1JYCA 4ZKTB 2A7AA 4NO4A 3RSJA 3ZXEA 4YG6A 5T50A 3OBTA 1RINA 1GNHA 2A3WA 1WD4A 3SH4A 3N36A 3AYDA 3WG3A 4HANA 1CIWA 2CYFA 3A0KA 2C5DA 3N7KA 3ZSKA 4LBJA 4M3CE 5JOYA 4XBNA 4JCKA 1C1LA 1JOJA 3L2YA 3AP9A 4AWDA 4Y1UA 1CN1A 3KQRA 3FLPA 4GALA 4W65A 4WV8A 1WW5A 1FV3A 3AZYA 3NV2A 1R1ZA 1V6NA 2ZGRA 5EXOA 2P2KA 3N7JA 1UKGA 1SCRA 1VALA 4ASMB 2GN7A 3AJYA 3A4UA 1G9FA 4P9XA 2DVDA 2EXHA 5IK8A 1GSLA 2ZMNA 4WVVA 2ZMKA 4XE9A 4BLIA 1O4YA 3V0BB 3HN1A 1GNZA 3V0BA 4F83A 1ENQA 3OGGA 1PZ8A 1GANA 3AP6A 1C1FA 4AGRA 4FPKA 2E7TA 4YM1A 2A70A 2UWCA 3MW4A 1ZA4A 4M01A 1SBFA 2V73A 3RS6A 3R4SA 1W6PB 4NOTA 4ISRA 1W6PA 4JRAA 4WZFA 2A6XA 2R0FA 1V00A 2DU1A 3Q9OA 1MS9A 1LOAA 1AXKA 1D0HA 1MVQA 3C2UA 4Q2FA 2GNTA 4XJWA 4LBNA 4YZ3A 2NYYA 4Q1RA 4XXPA 1LGNA 5GJ6A 1FYUA 1DIWA 4YW1A 2D6LX 2UU8A 5HCBA 2ZGQA 1S0JA 1F5FA 2W08A 1AX0A 4XBQA 1YRZA 2NP0A 1UZZA 3KM5A 4R9CA 5H9SA 3N3HA 2DV9A 3IM0A 2PHTA 5GM0A 5T5LA 1MS3A 2AR6A 2D6PA 3AZVA 4UW3A 1PZ9A 4FOQA 1Q8VA 1W6NB 3R05A 1IS3A 3UJOA 2EF6A 1W6NA 1ENRA 2JDZA 1PZ7A 3PJQA 3WCRA 1YO8A 1FAYA 2VW0A 1MS0A 1MS1A 1FX5A 2XG3A 2A3XA 3QLQA 4ISQA 3WG2A 4JC1A 1N3OA 3WHUA 2DUQA 2WSVA 5T55A 5JOXA 1V6LA 2GNDA 1TEIA 4XJ9A 3WLUA 3DUIA 4MYEA 4XBLA 5GZFA 4FPYA 2EIGA 1GZCA 2H0BA 1WBFA 2C9AA 3AJZA 4H55A 3DGTA 4AGVA 2FMDA 3ZXFA 1DYPA 2CNAA 5KXDA 1OQ1A 3WNXA 4XTPA 1G9BA 1AJOA 1ULFA 3ZXJA 1BKZA 1LTEA 2ARXA 2VUAA 2CWMA 2P34A 2ZGSA 3B00A 1KDMA 2AGSA 4CRQA 3MPPG 2PHRA 1UAIA 2ARBA 3T1MA 3OYWA 2RHPA 2BQPA 4XZPA 2P3JA 2ZGOA 4UW4A 3RRDA 4Y1YA 1YI7A 3V64A 3BIWE 1F31A 1WLCA 1WW7A 1QKQA 5E8AA 1MZ5A 2A6WA 1F9KA 3I4IA 1QOTA 5DUXA 1VLNA 3LSDA 1O4ZA 4K1YA 3N35A 3SLIA 1DGLA 2DUOA 5H9PA 1N3PA 3OPZA 5SV8A 3D4KA 1LHOA 3I8TA 1DBNA 1ENSA 4P9WA 2EXJA 2WT0A 1LEDA 4XOGA 2R0HA 3RMXA 3TB0A 2WT1A 2KM2A 2OVUA 5GLUA 1AZDA 1MR5A 5H9RA 1QOOA 4R9AA 4FP2A 3UJQA 2CL2A 2ZGPA 5GZCA 4BOWA 2YMZA 3AYAA 3N7MA 3M3QA 1VAMA 4FQZA 1IS4A 1DQ4A 3APBA 4Y1VA 1B09A 4Z8BA 4FPLA 2JJ6A 4XJ8A 5GLWA 1N1TA 2VXRA 1GV9A 4YZ4A 2GALA 3RQ0A 4GWMA 3B01A 5JDBA 4XHBA 4LBLA 4WVWA 3MW2A 2JE7A 3B3QE 3WDTA 2Q5TA 1AF9A 2EALA 1QDCA 2JD4A 4R9BA 4U2AA 1AX2A 3AZXA 1XQNA 4YW5A 4Y1ZA 1LHNA 1WLWA 1BJQA 1WW4A 2ZHLA 1A8DA 1LENA 1N1YA 2AH2A 2YZ4A 3FBYA 2EXKA 1BQPA 2GMPA 5BYNA 5GZGA 5IT6A 4RL7A 1GLHA 1CESA 1J1TA 3ZSJA 5T5PA 1FNZA 2GNBA 2NMOA 4ITCA 4U36A 1BZWA 1KJLA 4YGCA 4AVTA 4BM8A 3IMNA 1A3KA 4XILA 1Q8QA 1FNYA 3AP5A 1DQ0A 4YM0A 2D43A 2ZGUA 2Z42A 3SH3A 3ZYPA 5CBLA 5GLVA 1QMJA 4Q8KA 4AVSA 1H9WA 4BQ1A 4YM2A 1Q8SA 3WHTA 5DUWA 2DWRA 2E53A 1QNYA 4BMEA 4UW6A 3AP7A 3POYA 5JMCA 4LBQB 4LBQA 1CR7A 3ASIA 1SFYA 2R1DA 1SLBA 3JU9A 3T1LA 3B69A 3V65A 3AX4A 2E51A 3PMEA 4BMBA 2ZGKA 1RIRA 1X50A 1A78A 1DFQA 4XDQA 2VU9A 2AREA 4YW4A 4C1WA 1GBGA 2UURA 3WDYA 2A3YA 5IK4A 5FRAA 4Q1PA 1ULDA 3ILRA 3NWKA 2P3IA 5DG1A 2FHRA 4P9YA 1JXNA 1IOAA 2DTYA 1MS5A 3PVOA 4Y20B 3ZYRA 2DVBA 5KXEA 2LALA 4YGEA 4Y20A 3WG1A 3AK0A 1QOSA 3BOPA 3UK9A 1UPSA 2SLIA 3VKNA 1UL9A 1N1SA 3O0WA 3VKOA 1WLDA 2VW1A 1QGLA 3ILNA 4FPFA 4K20A 3AYCA 4XXAA 1AVBA 1LHWA 1Q8PA 2DU0A 5CNAA 4YLZA 4AYUA 5E89A 2HYKA 2OUJA 3UL2A
chains in the Genus database with same CATH superfamily
1ZBE2 1J1LA 4LULA 4LT5A 2B7YA 2YC2A 4Y26A 4FAGA 4DUWA 3QCWA 3CKHA 2Y34A 2YPDA 1POQA 3D3AA 1CVNA 3A7QA 3HPNA 2BW8A 3GBGA 3NV4A 4QXHA 1AJKA 2P37A 3J4UH 3WNNA 2K0GA 1Y9QA 5FYUA 5T54A 1ZBA2 3PU8A 3O1PA 1Y7BA 3Q8AA 4I0WB 5LASA 4EN6B 3U4SA 4EWAA 3WUDA 4HOOA 4N7IA 1LHUA 2ZMLA 3MZHA 3PVEA 1AR92 4CEYC 2E7QA 2XLGA 5AC91 3H0OA 4Y22A 2ZX2A 2DBIA 2GMEA 2NN8A 1AL22 2VMHA 2PXJA 2VCBA 1QNWA 1Q8OA 4OHXA 2OX0A 3IDEA 1RGSA 4PBPA 4ARXA 2QTWB 5ABJC 5KHIA 4HN0A 5IK7A 3WNKA 2XJPA 3AMQA 2ZEWA 5BPXA 4LLOA 1SLCA 4UOJA 1MQTB 5AVAA 5C8CB 2ZX3A 1MQTA 1RVF3 1CPMA 2AENA 4Q4Y1 5C8CA 2R062 3T2TA 3PIGA 2VOXA 1UX6A 2D5HA 2D6NA 2D6OX 1F4AA 1Z7S3 2E7AA 2VUCA 3WW1A 4JGZC 4Q4X1 4XIKA 4D6RA 4D0QA 2J1RA 5BNOC 4RGAA 2Q8DA 1PVC1 3OEAA 3T3YA 1SBEA 4K8FA 3KVBA 2ORZA 3UGFA 3ZR5A 3I3MA 1UU6A 1NLQA 1YQCA 1QJY1 3NJZA 2IXKA 3PUAA 1RUF1 1HQWA 4DRRA 5LB6A 5FPVA 3ZSEA 2VBDA 4Q4V3 5DDJ3 1NOVA 4F3JA 1S0EA 1BXHA 4OUSA 1H2NA 2RJKA 1RUH2 4QKDA 1PM7A 4XMAA 3AKTA 2BDRA 2DBNA 3FHIB 3I3EA 4BE3A 1I1EA 1VE0A 2MEV2 3NL1A 5FUNA 3SHRA 1H8TB 1WA4A 1QJX3 1H8TA 2XHKA 1MQTC 2PLV3 2OW4A 5C8CC 1AX1A 2E31A 5FLJA 1GR3A 3H8UA 3NNJA 1MZFA 5IFPA 3BGAA 1NZIA 1MEC3 4IUGA 4X6QB 4ATFA 2WZ8A 1PK6B 2R49A 2GDFA 4QX8A 3TOJA 1K42A 3VBHC 1PK6A 2WS91 4BU2A 3ETPA 3M3OA 3O1MA 2W68A 1GWMA 4A6OA 3LQCA 5C9AC 1G9CA 5JIAA 2WC2A 1SLAA 1UMHA 2XJVA 2CWSA 2QCSB 2VY0A 3IDBB 5A3MA 3EXUA 5BV6A 4FPEA 1OA3A 4XEZA 4Z2AA 3D5OA 3F2ZA 2VVFA 5DQ0A 4EE2A 1V9U3 3U75A 2WO3A 4XFFA 4IGOA 3ME2A 1PMJX 1UPIA 1GZTA 2YC0A 2XONA 1NQDA 2D7FA 2EVXA 2PHFA 4GMP3 3WOGA 3NSTA 1GOFA 5JWPA 3O1OA 2DURA 2DTWA 1OBNA 2WUHA 1QQP2 4XFHA 4LHKA 2E6VA 4YFZA 1U0AA 3POJA 5IVVA 3D0JA 1HV1A 5FY4A 5APAA 3RZJA 5FZLA 5GZEA 3M4FA 4XIOA 2A71A 4D3WA 1CAXB 2D6MA 3SNMA 3WUCA 4AQ2A 1W0OA 1CAXA 5CG8A 3ACFA 3CL1A 1WD3A 2Y6HA 1RUE3 1XNKA 2A5ZA 3V56A 1JZ3A 3B7MA 1WZXA 5FYVA 3ZPOA 4DZGA 1AYM3 4AAPA 2A1XA 2D97A 2V72A 3VBUB 3ZPYA 1OXCA 2VD7A 3VBUA 1PO11 5CAZA 2ZBJA 5FY7A 3S7EA 4HVQA 4LA3A 1DYKA 2EIDA 3LOBA 1YWKA 3MGUA 1YNAA 1NE6A 3JUUA 2VO5A 4J25A 4MGZE 4UYBA 1AR73 1LOFA 1M4WA 1VBA1 2EAKA 4YZ2A 1OA4A 2Q1FA 3M3CA 4KWLA 1JZ8A 4IETA 5H9QA 3LPGA 5BXXA 2ZACA 1VMFA 1VPHA 4XJAA 4N43A 5JMOA 5FLHA 1V6OA 1HQLA 3GCXA 2LUWA 5A7PA 3S0MA 4IEUA 1GZ9A 1VRH1 2Y64A 3MV01 1T6BX 1TME3 1ZZBA 2AYHA 4CTEA 2OUHA 4I09A 4PBOA 3T0AA 3VDDB 2VL4A 3MIFA 1MS8A 4PHZA 1B35B 3H3ZA 3VDDA 1HQNA 1B35A 2WO7A 3OG2A 2WQ8A 2W1WA 4IE7A 4META 5FZ3A 5FY0A 5D8AB 4CDXC 1S0GA 4JZRA 5D8AA 5FPAA 3VBUC 4C0BA 4QB6A 1LJ7A 2ZABA 1XNAA 3KVAA 4HONA 2HJIA 1ONAA 3CLPA 4LBKA 5GKAC 4HLTA 2JG8B 3I54A 2BUKA 3K2OA 4LHSA 4MO3M 1NQJA 2JG8A 3CU7A 4IEQA 3NNGA 5C70A 3HQUA 2DYCA 2OT7A 1LOFC 2ZHKA 3BYWA 5LA2A 5LBCA 1VBB3 3RWNA 3GXUA 2NMNA 3OD0A 1XSQA 5IATA 5AFEA 4N43C 5KXCA 2GNMA 2VMDA 3CBNA 3ZYFA 3H9AA 4IQPA 4UW5A 4ES9A 1JYWA 1ND2B 1ND2A 2ZGNA 5I8SA 2GH2A 3P5BA 2HBTA 3EMRA 2J1SA 4PQ9A 4Y4YA 1HKDA 3VDDC 2VBBA 3QOPA 1B35C 2KD7A 3HQXA 4AI9A 4YVSB 3M3EA 3OOXA 2VQUA 1UKRA 3THCA 3O7OA 3MIHA 5D8AC 3POEA 1WCDJ 4V1PA 5EQUA 1JYNA 3VBSB 3MIDA 3VDAA 3NNFA 1SLTA 1REEA 3VBSA 1WKYA 5FYCA 1YFWA 2R041 2RDNA 2E32A 1IKPA 2JG8C 3AM2A 3INAA 1GFF2 2RS33 3MIBA 1RL3A 4QDQA 1PIV1 3ZN5A 5C8WA 5JZGC 1W2AX 5C7GA 5FQ0A 4OCTA 3ZDSA 5JR2A 1UY2A 3AMHA 5EJZB 3OBZA 3J8F1 2X5IC 2W39A 1V9U2 4XUPA 2ES3A 1QJU1 2ZKNA 5EPAA 1R083 4IE4A 1DG6A 3RG0A 2PAEA 3POWA 3ZKUA 1UF2C 1C8M2 1APNA 3KV5A 4JHZA 3MW3A 1AR82 4X8PA 3AKQA 1GMMA 2VAUA 2IXHA 4ZXEA 4AW7A 2D3SA 2ZAHA 4DS0A 2PN5A 4ZKTB 2G4IA 1JYCA 4LO7A 3FHQA 2RMU1 3VLBB 1DYOA 5T50A 3JD73 3MLJA 2W1UA 3PTRB 4XFBA 2E9QA 3VBSC 1WD4A 4QU1A 4NPRA 3AYDA 2QFEA 2C5DA 3SKJE 1I6XA 4M3CE 2H0VA 5JXJA 2VBPA 1GP6A 1UMIA 2CAUA 1RYYA 2C0ZA 4CP9A 1HRI3 1ZZ9A 1WW5A 2QQLA 3O1RA 3AZYA 5I0TA 1R1ZA 1V6NA 2W46A 4MGSA 2WFF3 3J7MA 3ZMOA 4DEQA 4ASMB 2J1EA 4B4QA 4UFMA 1OLMA 2PYTA 3HBZA 2C24A 2R071 2B9UA 1GWKA 4XE9A 2WO2A 1GNZA 4RHV1 4EV0A 3C7OA 4LOTA 5I0RA 2RJ2A 2XDVA 3QD6A 2QZ2A 5FPLA 3AP6A 5FZOB 4GIQA 5BNQA 2W3JA 3GBFA 4IGQA 4M01A 2FZ1A 1JYVA 1W6PB 1QXRA 1W6PA 4CUCA 1BEV1 1O3QA 2PAKA 1PGL2 4I01A 1TME2 4Q2FA 2QJVA 1MVQA 2IZWA 4TSVA 1YI9A 2NYYA 5C3RA 4XXPA 1LGNA 1NUKA 1FYUA 2J7MA 2X29A 3VZNA 5HCBA 5IAXA 2ZGQA 1XE7A 1AX0A 2JIGA 4BJ0A 2GC3A 2L9LA 3FMGA 3JBG1 4R9CA 5BNNB 1OVSA 4B7KA 5BNNA 1OVPA 2AZ5A 2XXZA 3DXUA 1WCKA 1NYWA 2Q30A 2ZCWA 3FL7A 4Q0PA 5FZ1A 2B45X 5FZKA 3RI8A 3AB0A 4CUGA 4RFRB 1JZ2A 3PTYA 3BTYA 1Q8VA 2EF6A 1ENRA 1PZ7A 4AQTA 1VBB2 1RUJ1 1MS1A 1FX5A 5K8SA 3WG2A 3ST7A 3NMBA 4PI2A 5FOJB 1H8VA 2GC0A 2DUQA 2WSVA 5T55A 2YFUA 4MYEA 4KU8A 3GJAA 2EIGA 4GD4A 1GZCA 1UY3A 4G4FA 4H55A 2HWC3 1LNSA 3ZXFA 1DYPA 1Q5OA 5FZFA 4XTPA 3KCXA 3I2OA 4D94A 1G9BA 1AJOA 1XPWA 4R4ZA 4QDSA 4P5HA 2VMFA 1AR63 1R1A1 2JB8A 4NIGA 2QDRA 5BNNC 1O6UA 1PO23 1POV1 3MHZA 4P02B 2AGSA 3MPPG 2PHRA 4AEJA 3PU3A 2Y60A 2RM22 3MF9A 4C91A 2FD8A 2VZ3A 4NHXA 1O3RA 3KF5A 2PHLA 5FZGA 4PLNA 5JXHA 4TN7A 3ZYGA 4K7JA 5A3UA 3V64A 4B7EA 4LORA 4Z1VA 1QKQA 4QX5A 1MZ5A 4W6XA 4A41A 2YC4A 2XBO3 2WZR3 3I4IA 5A70A 2RR11 4OYUA 1VLNA 3LSDA 1O7FA 1NX9A 3SC7X 1QIQA 2DF7A 3ES4A 3N35A 5A1LA 1JYXA 2XGXA 5K4LA 1UOJA 3OPZA 2Q8CA 3D4KA 1RJ7A 4RQPB 1LHOA 3I8TA 1S2BA 1ENSA 4RQPA 3KLSA 4P9WA 1W8TA 5FZBA 4XOGA 4OI1A 4LR4A 1ZZ6A 4AL9A 5A1FA 1AZDA 4LO5B 4N53C 5DAPA 5F3IA 3WD5A 4ZONA 4R9AA 3WDYA 4OQ8A 3JXSA 1VBE1 1W8UA 4NWWA 4AFBA 3AKRA 3N7MA 4FXGB 4P9IA 4QU2A 4QMAA 2ZX0A 5E6HA 1S55A 4D6QA 4CDWB 4E4HA 2QQUA 3WP3A 3H8RA 4CDWA 5AFBA 3ECQA 4Z8BA 2RJLA 4FPLA 1UXXX 4PLMA 4UFLA 1YJKA 1GV9A 3I7DA 2GALA 3RQ0A 4GWMA 1KEXA 1DLCA 5KR7A 4FFHA 4I3GA 3VN4A 4AE2A 3NNMA 5HPOA 4M0HA 4QXBA 4BYYA 2XJUA 4IDZA 3LDKA 2Q5TA 5KHKA 2VXJA 4R9BA 4XVHA 2ET1A 4IEWA 1BJQA 1WW4A 2HEWF 2WINB 3ETQA 4AEKA 5F6KA 1W9YA 1VBD3 4NHMA 5LZ6A 1JYTA 4OHVA 3S7IA 1GLHA 4LKEA 4WZCA 5FZ0A 2GNBA 2NMOA 3WQBA 4RQPC 4DXRA 3AVSA 3IMNA 3TEZA 4QWNA 4JGYB 3VDBA 1EP0A 4JGYA 4XACA 4YM0A 1U5IA 1H1MA 3AMMA 4FCAA 1IPJA 1FOD2 5FY8A 3U1XA 1OMIA 1R091 2ZGUA 3VD4A 2RS53 3RZHA 1SDWA 2Z42A 4UAPA 3ACHA 3WF3A 3GZUC 2XVKA 4AVSA 1OLQA 4BQ1A 3FBMA 4YM2A 4CDWC 4DUVA 3RZGA 4FFGA 5DUWA 5LA9A 2YDEA 1VMJA 1DZTA 4PLOA 4XDPA 5E16A 2EICA 1X9TA 1H2LA 1IQDC 3V65A 3AX4A 5FO9B 1E5RA 2HWB3 1HN0A 5L36A 4P08A 1X50A 1A78A 4XUQA 1FT9A 2VU9A 2RDRA 3DV8A 1QJZA 1NCRB 2UURA 1RUI3 1NCRA 1RJ8A 3OUJA 4G3YC 4KQ7A 4Q1PA 1O8SA 3FWEA 5HXVA 5A3WA 3NWKA 5IK4A 1O3SA 5DG1A 1RUG1 4WVZA 3ELNA 3IB3A 3VZOA 2YFZA 4W8JA 5CADA 5J1XA 1IOAA 3CJIB 2P17A 3CJIA 3ZYRA 3I2JA 1H4GA 4W6YA 3WG1A 3WNPA 4YVWB 3MIGA 4JDMA 4YVWA 3WNLA 3LDBA 3HN3A 1BVVA 1TVGA 3ES1A 3O0WA 4QX7A 3VKOA 3ILNA 3WNXA 4K20A 3AYCA 4XXAA 1CIYA 2W95A 4RR3B 5I91A 2DCYA 3LAGA 4YLZA 4RR3A 1UY0A 5E89A 3KB5A 5FYSA 1US3A 3UL2A 5K9YA 3IKWA 1RUG3 4ZU7A 5FP9A 3OPWA 1DHKB 1WMXA 1MS4A 1AXZA 2IWGB 5F8PA 2DUPA 2Y26A 2HWF1 4KWKA 4LBOA 1LOBA 1AR62 5L9BA 2HLEA 2Z4FA 4Y1XA 4IE0A 1LU2A 2YV8A 3E6BA 1LHVA 3M1HA 2BU9A 4OMDA 2IFWA 4LA2A 1UIKA 1W8OA 2FMYA 1PO22 3AL5A 3ORJA 4HK8A 1EV11 1DLLA 4AI2A 4I30A 1FPN3 4LIVA 1ZBE3 1NCRC 3KV9A 4HK9A 3URFA 3DYMA 2WYFA 5FIXA 3MEPA 1AR91 1O5LA 4CDUA 4H7LA 5BNPB 1JU3A 4TWTA 5BNPA 2BBAA 4XETA 4MXVA 4OZXA 3S5QA 4Q4W1 2KXLA 1EY2A 1ULPA 3OYWB 1ZBA3 3CIHA 4IE5A 4CUBA 1WCUA 1F4HA 4ARYA 4FFFA 1Y4WA 1A34A 4QQLA 3DL3A 4BQ3A 4BA6A 3ZFGA 2R061 1HRV1 4QB1A 3AC0A 1AUYA 4QXCA 1JH5A 1AL23 4XDOA 4YW3A 2WNEA 1WMEA 1IKQA 3LEMA 1O59A 3VB9A 4NPLA 1YXWA 3FLRA 3ON7A 5A7QA 3WP5A 1XXNA 4QXKA 1UD1A 4XQDA 3PVNA 2GC2A 1QJEA 2GU9A 1HXS1 2R063 4IW3A 5IUQA 5EFUA 3J7LA 1LESA 4XF1A 5CG9A 1YFYA 5D1IA 1W0NA 5SV5A 2OQ7A 4GAZA 4NROA 1G8WA 3WCSA 1COV1 5BNPC 2V5DA 3KSCA 5A7SA 5JSRA 1OLRA 5KC6A 2I74A 4MV2A 3RMYA 4CZSA 4XFAA 2YG0A 1G9DA 1ULCA 2QQWA 5JOWA 1ULGA 4B29A 4QKFA 3VHRA 3ZFGC 4BLJA 1DCSA 1A8MA 2C1FA 1SQ4A 4QX1A 5FMDA 1Z78A 5EZWA 4A4AA 2XUEA 1RUH3 2YPJA 1QWRA 2VTXJ 1LEMA 1C8NA 4RSUA 1V6IA 4WM8C 5L73A 3USSA 2B46X 4EZHA 2WWSA 2MEV3 4PJYA 1UMZA 4BQ5A 4C1XA 5FYMA 2Y6KA 3MLLA 3H50A 4XUNA 2IXLA 3ZFFB 4QM8A 3ZFFA 3OF1A 5F3GA 3GNEA 4YGBA 4ET7A 2YROA 2XWBB 4QGNA 3WF4A 2WABA 3SEEA 1BK0A 4FQ4A 1KITA 5IAVA 2HWD2 2VE1A 3POIA 1S0CA 2A75A 3FHAA 4JRLA 4AEDB 4AEDA 5FP4A 4AXOA 5IVEA 5LWBA 3K3NA 2YBPA 5LEJA 4PDWB 2E26A 4IEPA 2GAUA 2HEYF 4PDWA 2PHUA 1Q56A 3TN93 2YY1A 1C4RA 2HWE2 3ZXLA 5JI9A 1OFSA 4K21A 3BALA 2BGOA 4LHLA 5F39A 3AFKA 4L11A 5LCWL 2CAVA 4QKBA 3O12A 4XPVA 3NV1A 3BI3A 3RZMA 2WAAA 3IPVB 4JHTA 1KS4A 4CEYB 3IPVA 3U4XA 4IESA 1F5JA 1QQP3 4CEYA 3MBWA 4FPOB 4N9HA 4FOVA 4QQPA 5JOZA 2EAAA 2EIEA 3LIHA 5A3TA 3UT0A 4DINB 5ABJB 1DZQA 4N90A 4K3UA 4LITA 4QB2A 5ABJA 1J3PA 2XVLA 3GZEA 4CCCA 2C26A 4OVEA 4QGMA 1F8VA 3VKFC 1C5HA 1H30A 1HJFA 2JECA 3ABZA 3H3UA 3VBOC 2XHNA 1RC6A 2W47A 4AEDC 1XC6A 4NVPA 2B4KA 3RJ2X 1EPWA 5FZDA 2LW8A 3PUHA 3KGZA 4JGZB 4QPIB 5GLTA 3TAYA 2P1BA 1ZNPA 3FC0A 3FLTA 4JGZA 4FPHA 4QPIA 1L7QA 3OGSA 4PDWC 3O1VA 5BNOB 1TMF2 3WQ1A 4GKYA 2QQKA 5BNOA 2VOKA 5FYTA 4BISA 1IZ3A 4RGGA 2VQ0A 5EYXA 2C6SA 3HJRA 4YG3A 4KNCA 4WVMB 1BLZA 1I3HA 5LBEA 4WVMA 4E4SA 4AI8A 1RVF1 3KCCA 3LA7A 2WLQA 1XSRA 3N9NA 1ND3B 5FO8B 1Z7S1 4Y22B 1ND3A 4AI3A 1TZOA 3AYEA 3BTZA 1N1VA 1XE0A 3IAQA 3THTA 5FP3A 4QPGB 2W1SA 4HFSA 4QPGA 4FPGA 2D93A 1CJPA 4DNYA 3O14A 3PMSA 1RUD2 2C4XA 2JWPA 2Y0OA 3R4DB 1NA1B 2WNUC 2OQ6A 4LUKA 4P9GA 1YFUA 1LOCA 1NA1A 4NMIA 5IJRA 2GMMA 2GZWA 5DDJ1 4Q4V1 4O7XA 1G86A 3J9SA 3N7LA 4LK7A 4QPIC 5EWSA 3MV11 4DMIA 2BFUS 3VBHB 2BP6A 3AP4A 3OB8A 4L9BA 3VBHA 5C9AB 3B9CA 4JQTA 2PQQA 5C9AA 4XCAA 2K46A 4BQXA 4XF9A 5IVYA 3UV9A 1JUIA 5DG2A 1QJX1 1WUVA 2HH9A 4BIFA 1VIWB 2YU2A 1RITA 1V6MA 2PLV1 4DPNA 5C3PA 2ATFA 2YB7A 4Q0QA 5HV4A 1ND3C 4XTMA 3I2GA 3OBRA 3EBRA 4L2NA 3M2MA 4N9IA 2VGDA 1MEC1 2WNVB 5CU1A 2WNVA 2Q1MA 1U5ZA 3USUB 3USUA 4HN1A 1NG0A 2ZGTA 1UZ0A 4S2DA 4GWNA 4O61A 4QPGC 4XW3A 1D4M2 3O5SA 1VB4A 2UWAA 5DZFA 1NA1C 4MGIE 4L97A 1GICA 3QH7A 1FV2A 3OGJA 1V6KA 1YYNA 4YARA 3B9IA 3DYOA 5ACA3 3GZAA 1N47A 1QH7A 4NIAA 2RDSA 4Q26A 1OH3A 1V9U1 5F6LB 4HPKB 4CCMA 3OGVA 1DQ1A 4LUMA 4HPKA 5FFOC 2ARCA 2Q1ZB 1KQRA 1D2SA 1ZA7A 1RHI2 3DKWA 4GMP1 4GB32 2O8OA 2OZ6A 4LE3A 3UGGA 1OD3A 5A3LA 1ODNA 3A0NA 1BYHA 3QBQA 1MACA 3MF6A 3AZWA 1D4VB 2VOTA 2FDGA 4B3NA 2XLAA 2WIIB 4QHZA 1PGW1 5IWFA 3VKMA 4JTNA 1NY72 3Q8BA 2Y33A 3TN92 4HMZA 3IDCB 1ENXA 4XAEA 3VD7A 3SMHA 2WNVC 2A7AA 1W8ZA 1VAKA 4LNVA 3ZXEA 5FP8A 1RUE1 4XZUG 2QNKA 1RINA 2XL9A 3TYJA 2A3WA 1C8M3 2GSYA 4AHYA 3BPSA 3SH4A 3VBRC 3N36A 1DGWA 4DXZA 2OZJA 1CIWA 1AR83 1GP4A 3A0KA 1AYM1 3N7KA 4HANA 3K4AA 4LBJA 4KWUA 3ZSKA 3C7HA 5CFDC 4XBNA 2W91A 5JUVA 3FFQA 3L2YA 5FKCA 3AP9A 4AWDA 3POFA 3KT7A 1VJ2A 3FLPA 4GALA 1FV3A 2WBKA 4XABA 4HKLA 5F5AA 3VGIA 4YYOA 3N7JA 1UKGA 4JQRA 4A2UA 5J09A 2GN7A 4FXKB 5FXZA 5DN2A 3AJYA 4P9XA 5CVRA 2JENA 1AR71 1OFNA 2BZDA 2XMLA 2ZMKA 4V2VA 4BLIA 3V0BB 4CDXB 2JDNA 3HN1A 3V0BA 4F83A 4CDXA 4FT8A 1X8MA 2V4AA 4B1LA 4FSJA 1XB9A 1PVXA 1GANA 3E6CC 4I02A 1MPXA 4YM1A 1H6XA 1ZA4A 2G1MA 3MW4A 4IV1C 5FKBA 2V73A 3K48A 1O5UA 4JRAA 1PGL1 1TME1 4YGDA 1HX6A 4DFSA 1MS9A 4KGGA 1XRUA 1G6NA 2GNTA 4MXWB 5FUPA 5LK7B 4MXWA 4QHOA 2F17A 2KA3A 4KWJA 5A7NA 3VZLA 1RUNA 2AACA 1YLLA 1FMD3 3H1WA 2VZVA 4HG6B 2CGOA 1W2OA 1W99A 4N43B 4EN7B 2BTVC 2W08A 5C5UA 2QQMA 1YRZA 4A45A 5H9SA 3IM0A 5GM0A 2VZTA 4ZY9A 1R64A 3DKQA 2D6PA 5C4WC 5FXVA 3IWZA 1UYPA 3AZVA 1UCXA 1EAH2 4YW6A 1IS3A 3ZYIB 5C3OA 1VBB1 3WCRA 2JKXA 5FPXA 4GWIA 3QLQA 3M70A 2A3XA 3WHUA 1L3JA 1K3IA 3WF0A 5EIYB 4MADA 2GNDA 2WA4A 4F8AA 2OIIA 3DUIA 2WWJA 4O65A 1E5IA 4C0HA 4CCNA 1WBFA 2C9AA 3WW2A 4AGVA 3DGTA 5JZGB 5JZGA 5KXDA 3LEKA 3VHOA 1OSGA 4A6SA 1OC1A 3GBWA 2X5IB 1REFA 2X5IA 2IXIA 1LTEA 5AC92 4NIDA 4S2GA 4OQ9A 4A42A 3IIIA 2GC1A 4Y4RA 3B00A 2OS2A 4AG4A 1ACCA 1UAIA 3WNMA 2ARBA 2RS31 4XF3A 5FJHA 2JX9A 4UFJA 1YQ6A 2BQPA 2P3JA 4UW4A 5F5CA 4JKKA 3RRDA 5TSWA 3BVCA 4Q4Y2 1OUSA 1YI7A 1L7RA 3BIWE 1F31A 3D8CA 1WLCA 3Q8FA 1WW7A 5E8AA 3ZLIA 5ACA2 2A6WA 2ZEZA 3THDA 3RYPA 1F9KA 2ZZQA 1QOTA 2PTMA 2BJSA 2CV6A 4Q4X2 4AOCA 1OPMA 5DUXA 2VCCA 5FZ7A 1R081 4PIZA 4NE9A 1O4ZA 2VM9A 1PVC2 4K1YA 2DUOA 2RM23 1W06A 5F3CA 5KC5A 1ZYBA 1K5JA 5FQ0B 1QJY2 3OSDA 2LM3A 1RMU3 2WT0A 3LFIA 2R0HA 3RNSA 1HB3A 4LQRA 2OVUA 4HKOA 3VD5A 4CCOA 5A6ZA 4MZUA 1QOOA 3GYDA 5FPZA 2CL2A 5GZCA 4BOWA 2RDQA 1W8FA 1W2UA 2YMZA 4MGYE 4UT5A 5LATA 3JD71 3SKVA 1DQ4A 1JOBA 3ZDVA 2RE9A 2WNOA 4Q0UA 5KHJA 2O0OA 2ADEA 4OFGA 4JV4A 4EROA 1IPSA 3WP6A 2VNOA 3H8OA 4XJ8A 1N1TA 4WM7B 4WM7A 4LLFA 5JDBA 1NXMA 1KS5A 1OPOA 3A22A 3MW2A 1HRI1 4EN0A 3B3QE 5DMYA 3W5MA 5FXWA 1AF9A 2EALA 2JD4A 4U2AA 2WAOA 3AZXA 3GDBA 2WFF1 4Y1ZA 2VZSA 4YW5A 3FN9A 2DCTA 5FBZA 1N1YA 1EUUA 2FDKA 2VR4A 4I0AA 3W5NA 2GMPA 5BYNA 2P4EA 2WS92 3BIEA 4Z82A 3N4MA 5GZGA 1CZSA 1OURA 2BEOA 1O91A 2PHDA 4F7ZA 2RS13 4U36A 4YGCA 2FDJA 4ITCA 4AVTA 4CP9B 2DDUA 4A3XA 3ACIA 5L19A 3GJBA 2JDUA 3AP5A 3MICA 5A33A 3UKNA 5IVCA 2D43A 3SH3A 3ZYPA 5CBLA 4Y3OA 4ZS2A 4KG8A 3CDZB 1QMJA 2DCZA 4Q8KA 4CVUA 3THPA 3SCFA 4LK6A 1Q8SA 3WHTA 4ZS3A 1FMD2 4WM7C 4M0NA 1CX1A 4HKWA 2ETEA 5JMCA 1O3TA 3EJKA 3ACLA 1CR7A 5JPMB 3H8XA 3JU9A 4W4ZA 2BNNA 2ZS6B 5F7UA 1CAVB 1YCIA 1CD3G 1FOD3 2QQOA 3HAGA 3J7NA 1CAVA 2E51A 2IFRA 3PMEA 4GULA 4AEMA 4CU8A 2P6CA 2AREA 3K46A 1GBGA 4A7KA 3ILRA 1J59A 4AFCA 2P3IA 3KQ4B 2H6CA 4E27A 5FZIA 3UKTA 3EB7A 4RN5A 1UY1A 2FCVA 2LALA 2XKPA 4A7ZA 3WSOA 5KXEA 4ZPIA 1QOSA 2OYZA 3UK9A 1PO12 1UL9A 3ZX7A 3ZM8A 1WLDA 1NCQB 1XNCA 2KR2A 4HSJA 5DUUA 3T1MA 1AVBA 1NCQA 2HWC1 4OI4A 1RTVA 2Q8OA 1PX4A 2HYKA 4ZU4A 1T6GC 4QGLA 4YG0A 1VBA2 1EUTA 2XQXA 3T2OA 1UZYA 1AR61 1S4CA 3HWJA 3J7HA 2Q4SA 2HBUA 3WNOA 5DAXA 1ZRCA 4YM3A 2BOIA 4Y5Z0 1PO21 4PF1A 2VMEA 1NXD1 1PM4A 3HMYA 3P6BA 1LGBA 3K75B 2EIBA 4OUEA 1GP5A 2BPA2 1VRH2 2V5YA 5LBBA 4BK4A 3WQ0A 1OD5A 2AUYA 1NLSA 1FATA 2D3RA 2ZGLA 4N53B 1H1IA 5CKQA 4N53A 3LB9A 3HT2A 3G6JB 3MFCA 1N3QA 2XBO1 2SBAA 2VCMA 2WZR1 3O1UA 3KS7A 5FYIA 4XJZA 1KRIA 2GH8A 2Q8EA 4CP0A 4FPCA 2XB6C 4LO8A 4K8RB 1LOEA 4L8QA 4NAMA 1NCQC 4GWJA 3HBKA 4CPBD 4OHYA 3CQOA 3JCIA 5KHGA 5IK5A 3IDAA 4L92A 1JYIA 1SLLA 3CF6E 4QX3A 1RMU2 4BIOA 4NHLA 1JI6A 2XJSA 4JVAA 1UWWA 4CP2A 1ULOA 2X10A 5DAQA 2R1BA 2W9XA 3K4DA 4DUXA 5HCAA 3VV1A 2PQSA 4TZDA 4FFIA 2E33A 2HYXA 3O0VA 3B5LB 3FE5A 5K0UC 3SITA 2JDAA 3U10A 4DOUA 4HL0A 4AF9A 5FYHA 4I2OA 5GZDA 4HVRA 2R32A 4XJUA 3ZXKA 2JG9B 1W28A 3U78A 1CQ9A 4EN8B 2JG9A 4P9JA 2VZOA 2RVAA 3UETA 5HCHA 3HQRA 3W9AA 4AFMA 2BYVE 2D3PA 4LEJA 1UN1A 3PLQA 1JU4A 3JB8A 1VBD1 5FZ9A 5HCFA 3FUQA 5J98B 1GUIA 1F15A 2ZGMA 4IEZA 1SCSA 1UZVA 2A6VA 3I2IA 2R042 3MI8A 4W50A 2BRTA 4BXFA 2RS12 3RYRA 1SLIA 2YGMA 1PIV2 2CDPA 1DF0A 2Z79A 4M00A 1KGYA 4OULA 2J1AA 2E63A 2QDNA 4Q8LA 2RG4A 4E8CA 2I45A 4M3CB 3RZKA 3J8F2 4MSVA 1H1AA 2RS51 3I3QA 3NAPA 4M3CA 3S6PA 4D7SA 1J3QA 3H42B 3RVHA 2W1QA 1QJU2 4CSWA 4UBHA 4FPJA 4MGQA 1BMV1 1W9SA 1HN1A 5F3EA 4OMCA 1RUOA 3DECA 1LU1A 1S2EA 2ZHNA 1J83A 5A32B 4CCJA 2P3KA 2BGPA 2PHWA 5A32A 5IVJA 4EQVA 2JG9C 1WLTA 3WV6A 3GHNA 2CHHA 2HWB1 1W3XA 2VMCA 2VVEA 2X8KA 3ZFEC 5A6XA 4QQHA 2RMU2 3RDIA 2FDIA 4K1ZA 4BPZA 3X29B 2VZQA 1RUI1 5L7OC 1UO9A 3W59A 1CX4A 5IHRA 3GM8A 2D5FA 4CU6A 5JXIA 2XUMA 1CAUB 3RZLA 3CEWA 1CAUA 1QDOA 4GQ7A 5T52A 4ES8A 4IERA 1I9RA 4IXLA 4QHBA 1QXPA 3LWCA 2I07B 3IN9A 3LGRA 2EA7A 2HWD3 3KT1A 3ZYJB 2XPJA 2WDBA 3NAPC 2A73B 3C8XA 3ENRA 4UWDA 4FAHA 2HEVF 2G9ZA 4XYXA 5JSOA 2AEYA 3K77A 4XHXA 2ZA9A 5FYYA 3VHNA 3HT1A 4LJHA 4OI0A 5KXBA 2R072 1PHMA 2WN3A 2JDYA 2ZHMA 3WDUA 4RHV2 1LGCA 1V6JA 1GYKA 3CNAA 5IW0A 1W9FA 2HWE3 4NWVA 2N7GA 2D98A 4CE8A 1UOBA 2XLFA 1UQXA 2VJXA 3ZO0B 1WWYA 4XC9A 1JZ6A 1H2MA 3OY8B 1NAEA 1FPN1 3OY8A 2BFUL 1XYNA 1BEV2 3MYXA 1ZBE1 2IXCA 2WT2A 2ZAAA 5JCTA 1VMHA 3FJSA 5K7PA 1W2NA 1GQHA 1KDKA 4LBMA 3GALA 1ALYA 4YFWA 5CB7A 2VH9A 1IS5A 1S0BA 3ZOIA 2WR9A 3ZR6A 5A6QA 2OPWA 1Q43A 4BXSV 3JBG2 2FCUA 1ZBA1 3IT8A 1ST8A 1JN2P 5JVVA 1W90A 3PUIA 4FOWA 1W2TA 4XUTA 3E5QA 5CFCA 5CISA 4NPMA 2VW2A 3SH5A 5FZ6A 3TNQA 1SEFA 2BERA 3FFZA 1J3RA 1RB8G 1TMF3 3AZZA 4AI1A 4XMIA 1AL21 1JW6A 1RUJ2 2DCKA 1WBLA 2DVGA 2YBKA 3ILFA 4Y33A 3ZSLA 4EJRA 4EN9B 2CTVA 3LOIA 2C9KA 4X6RB 2XR4A 3WINE 1D2QA 2BWCA 4BZ4A 1ASJ3 3AXDA 3NJXA 3ZFGB 5E1RA 2NM1A 2ZX4A 2JDPA 4CDUC 1LRHA 1X9PA 1LECA 1UOFA 3I3BA 4LBQD 2H6BA 5DABA 4Q0SA 1CAWB 1UYYA 4WM8B 4XFCA 2BOJA 1JMUB 3ROUA 1CAWA 2A6YA 4L99A 4WM8A 1GOHA 4D7TA 3PNAA 5BY5A 5LEKA 4LIUA 1S0IA 1WCQA 1DGRA 4GA9A 4Z92B 4DQAA 5ANNA 3OTFA 2JE9A 4C90A 1OKQA 5FMOS 1RUD3 1MZ6A 4COYA 3P3PA 5BUVA 4AR2A 1Q3EA 5CFCC 5M0TA 4B1MA 1W9WA 4CYDA 1HDKA 1QU0A 3LCPA 3M7AA 5FR3A 5I8YA 4J6GA 2D40A 1FXZA 4FVVA 3NV3A 1BHGA 1RUH1 2Y8KA 3CMGA 3H1MA 2UY8A 5DPNA 4AGGA 2Y6FA 4BCUA 3VD9A 2MEV1 2RR12 4E8DA 1YFXA 3GGLA 4QPYA 2HKXA 1OQEA 1RUC3 3J26N 1LULA 2K2SA 1FI2A 3FZ3A 4BK5A 4RA0A 2PHXA 2O14A 4INDA 3SISA 3T2QA 4ONUA 2JB4A 2WL1A 2IXJA 1CPNA 2P6HA 2TEPA 2RV9A 3T09A 2JKBA 4GKXA 4KL1A 1RXFA 2DVFA 5FMCA 3C7FA 4CXWA 3BTAA 4YW2A 3MPBA 3OJBA 1VBE2 4XAAA 4Y24A 5FCCA 1YHFA 4B8EA 4HT1T 2YU1A 1D4M3 4GB31 2B8MA 5FK8A 2CY6A 4W6WA 5CKMA 1CGPA 1PMIA 2JXAA 4COVA 5HI0A 5FV3A 1VBC3 1XJAA 3DPRC 5CA6A 3ZMNA 3MIEA 3AFGA 3GZTB 3TN91 1QJFA 1VB2A 3UNPA 3I2FA 3VL9A 2J42A 3VBOB 4NO4A 3RSJA 3VBOA 5FMBA 4YG6A 2VULA 1RHI3 3C7EA 1ZZ7A 3OBTA 4GB33 1JHJA 4COWA 4Z2WA 1H0BA 1STMA 2JDHA 2IVJA 2Y6LA 2VCAA 1QQP1 3WG3A 2P3YA 2CYFA 1AL0G 1UY4A 1XYPA 2G9FA 1AYN3 3JZVA 4ORFA 4V2WA 5FZ4A 3WEZA 5A6YA 2GP3A 1C1LA 4R4XA 1JOJA 4Y1UA 1SHWB 5C5TA 3M8LA 3KQRA 3N9OA 4BWOA 2VNRA 1V70A 4AZZA 2B9VA 5EXOA 2P2KA 1VALA 1SCRA 4CA9A 2WZPP 2PA7A 5J3UA 2FDHA 3A4UA 1R092 1I5ZA 2EXHA 4JDOA 2CGNA 2VMGA 2ZMNA 4K6BA 1NLRA 2QQVA 1LKNA 3W21A 4MOAA 1O4YA 1W9TA 4CPBA 5LA0A 2AEZA 3OGGA 1US2A 4KI5M 2R6QA 5D21A 2E7TA 1WMFA 2UWCA 3S5AA 2ORXA 3C3VA 1ZZ8A 4FO9A 4OHWA 2JE8A 3RS6A 5CKNA 3R4SA 5KBFA 4NOTA 1VP6A 3POGA 2WNUB 2A6XA 2R0FA 2WNUA 2XWJB 1AXKA 1D0HA 1LOAA 2Y38A 3C2UA 3F95A 5G05L 2PFWA 3GF6A 5C71A 4YZ3A 5GJ6A 3KZ4C 3QACA 4YW1A 5KWRA 2D6LX 4QT6A 2UU8A 1S0JA 1F5FA 2VC9A 5B4XA 4XBQA 2B42B 2VZPA 4XUOA 4MHRA 5FYZA 5LY2A 2ZKLA 1UZZA 3L2HA 4H14A 3ZIXA 5F1RA 3BU7A 3OBAA 3N3HA 2DV9A 2G9GA 2PHTA 5T5LA 1MS3A 5FWEA 3P1IA 4NRQA 2F6BA 1ASJ2 2VZUA 4MLOA 2BWAA 3KHBA 4FOQA 1TE1B 3R05A 3UJOA 1UU5A 2JDZA 2XG3A 2VW0A 2PMWB 1MS0A 3B93A 4NJ4A 4QX2A 3T08A 4EWEA 3PVBB 3H3LA 1JTZX 4RS5C 2HWF2 1V6LA 1SFPA 4XJ9A 4UF0B 3WLUA 5GZFA 1BBT3 2ET7A 4UF0A 5KHHA 2ARAA 5I0DA 5JIUA 4HXCA 3LZZA 1EAH3 2FMDA 2VQTA 4MGKE 1LR5A 1EV12 3KF3A 5J7MA 1DZRA 3P3NA 1OQ1A 3ZYBA 2YUEA 5FPBA 3ACGA 1ULFA 4SBVA 3KV6A 4MHUA 2ARXA 2VUAA 3KCYA 4RFT0 4CEWC 3LIGA 1JZ7A 2ZGSA 1KDMA 4CRQA 1OH4A 1UNBA 1RUC2 2WYSA 4Q4W2 5IVFA 1UOGA 1IG0A 4P00B 2W5FA 5A7OA 2QE3A 4E2GA 1HRV2 4Q0VA 1XNDA 3ZN4A 5ACA1 3HVDA 5AC93 2K9ZA 1X8EA 5FBJA 4LKSA 2O8QA 2VVDA 1O4TA 3VBRB 3T0BA 3VBRA 3PUSA 3SLIA 1DGLA 2LROA 5CFDB 5H9PA 5CFDA 1N3PA 5SV8A 2P5BA 2VOWA 3OGRA 4E4DX 1VBC2 4Q4Y3 4AK3A 3BTXA 1HXS2 3RMXA 1LEDA 4D7YA 2WT1A 1MR5A 2QVSB 2X09A 4Q4X3 5H9RA 2ZGPA 4XCBA 4MX3A 1BCXA 1COV2 5FZEA 4FQZA 1PVC3 1IS4A 4XFGA 4BHPA 5D2AA 2GP5A 1UIJA 1C8M1 5HV0A 4Y1VA 4CXYA 1B09A 2FZ2A 1AR81 3NKGA 1QXJA 1SZBA 3E6DA 4CU9A 1QJY3 4A3ZA 4NRMA 1AYN2 4YZ4A 5LW9A 3JQXA 1H6YA 1RUF3 5I0UA 4YNIA 4WVWA 3TNPB 4IV1B 3SQOA 1ZRDA 4IV1A 3VL8A 2ID4A 3LDRA 2ZHLA 1LENA 2AH2A 2YHJA 3FBYA 4NIHA 2EXKA 1BQPA 3I49A 3FX3A 1CZVA 1WGPA 3AKSA 5IT6A 3OUIA 3ZSJA 1J1TA 4GH4B 3PHMA 1L7LA 4GH4A 1KFXL 1BZWA 3DXTA 4OZOA 5C6CA 3R0RA 1A3KA 1OOPB 2VTFA 3RI9A 3RYKA 1Q8QA 4NIIA 1OOPA 1DQ0A 1DGRN 5C4WB 4AFAA 4QQOA 5C4WA 2WS93 1W3VA 3ALQA 1YEWA 3RGBA 3T4HB 5GLVA 1JODA 2QUOA 2YYOA 2W87A 4H2AA 1FMD1 3LF7A 2E53A 3N9PA 1H8TC 3BCWA 3POYA 5EV7A 4LBQB 3WW4A 4COZA 2JDMA 4UFKA 4LBQA 1WMDA 5JI7A 1SFYA 3TRSB 1SLBA 1W04A 2W2IA 4BMBA 4LO6B 1RIRA 4EYUA 1DFQA 4I0BA 4XDQA 4HETA 1W03A 1QH6A 1PK6C 2XJTA 2F4PA 3ITQA 4QX0A 2A3YA 2VTXA 3KGLA 4FTEA 5F2SA 3TBDA 3N9QA 2FHRA 3KD4A 4FTBA 1JXNA 4GH4C 4LKFA 1OLME 1CJDA 3PVOA 1YQ5A 4Y20B 4YGEA 4Y20A 5FLIA 5FZ8A 3KMHA 1A6CA 1OOPC 5FZMA 5FY5A 1BBT2 1N1SA 2ZEXA 3SCHA 1LB2A 1QGLA 5CNAA 3LD8A 2DU0A 1LHWA 1Q8PA 3UYJA 4ZZ8A 4OI2A 4Q29A 4AYUA 5F5IA 2OUJA 5F9TA 1UX7A 3I2HA 3EYPA 1E57A 2V4VA 2WN2A 5IVBA 1YQ2A 2WZEA 1AXYA 2WFPA 2WRAA 4HVOA 2EXIA 4TLFA 2CSGA 1GOGA 5F5QA 4IEOA 3VDCA 1PO13 2F4LA 1S2KA 1E5HA 3VZKA 3AMPA 4QAWA 5LK5A 4IEVA 2TUNA 3MO4A 5FYBA 2QBXA 1K45A 5EJ3A 1QF3A 3TWIA 4AVCA 4LE4A 3RJRA 4CCKA 1RVF2 1VBA3 4XF0A 5ERLA 2Z2SB 4C8DA 5FOBB 1XYOA 3EHKA 5CEHA 3BU0A 1OA2A 3FUOA 4CCEA 1Z7S2 5C33A 3HR9A 3ZKYA 5FPUA 2UWBA 1NT0A 2VPVA 1XBFA 1YQ8A 1ZRRA 2O1QA 2X53S 1POV0 1KJRA 4Q27A 3IIAA 2RM21 2IVIB 3BOWA 4JTOA 1UW8A 4JKMA 4QQ2A 1CONA 1SDDB 1VRH3 2YBSA 5L9RA 1BVP1 2ZZJA 4MH0E 5I93A 3G7DA 1RMU1 5T3NA 2Z5WA 2LS6A 3PJYA 3OEBA 5DDJ2 4Q4V2 2DFCA 2ZPXA 1HW5A 4P5YA 2NQYA 1ZREA 4HZFA 5FUIA 5A7WB 1GWLA 5FY9A 5A7WA 4RD7A 4MVTA 5B2GB 2GN3A 2VUDA 3D0SA 2PELA 4UFIA 1QJX2 4DIQA 1RUF2 3UGHA 3POSA 1DDLA 4NR1A 1WCSA 2PLV2 4IEYA 3WP4A 1SMVA 1EYBA 1BK1A 1ZVFA 4TYSA 1ZZCA 3CZJA 3S57A 4YVSA 5FAXA 4OHZA 5A3PA 1MEC2 2WJSA 3PURA 4Q5OA 1U5YA 4YPJA 1Y43B 3CO2A 3R6SA 1MVEA 4PI0A 3WG4A 4J1XA 4BQYA 1W6MB 5FZCA 1W6MA 2RS11 3DCQA 4QDRA 4NRPA 2QQNA 3EO6A 4NHKA 5A3OA 3BUCA 1SPPB 3VUOA 4E2QA 3U37A 1SPPA 1HLCA 1H9PA 1LOGA 2QZ3A 3NO8A 4S2FA 1UU4A 4KBBA 4BB3A 1KXGA 1X33A 3WXPA 2TNFA 4CUAA 5G04L 3AMNA 4D69A 3V0AB 1OHFA 1QEXA 1PGSA 2B39A 3D6EA 5A1AA 2R043 4BQ2A 3V0AA 1ZRIA 4ATEA 2YGLA 1YIFA 3TEYA 2OPKA 1PIV3 4AI0A 1DQ6A 4BQ4A 1ND2C 1JUHA 5GLZA 1C28A 4DEVA 1U5XA 3AXEA 1LODA 4NN0A 5A33B 1IQAA 1PGW2 1YJLA 4FTSA 2WSUA 1FOD1 4GJZA 3BODA 3MUZ1 3J8F3 4BDVB 1SG3A 4YWAA 2FDFA 4YVSC 1JOPA 2IUWA 5GALA 3NW4A 3DEMA 1VRBA 3UKVA 1OF3A 1QJU3 5LA1A 4M3CF 1K5MB 3T0DA 3N9MA 1K5MA 1RUE2 1GKBA 5FZHA 1GQGA 5T5OA 1SACA 1JBCA 4PF5A 4DB5A 2ENRA 4SLIA 2CDOA 3GHMA 1AYM2 5FJKA 3SXWA 1OI6A 1ULEA 3VZMA 4CCDA 1HV0A 2JICA 2J1TA 1OT5A 3ZSMA 3E97A 1DP0A 3HOBA 3S30A 4H3WA 1SBDA 2RMU3 3HNMA 5DZGA 5DZEA 3SEPA 3Q8EA 3VD3A 1F35A 2R16A 1UYXA 1Z0HA 4LXLA 3MLKA 4NHYA 1YC61 1AR72 3LE0A 4IV3B 4JX0A 4ZU5A 3VKLA 5FP7A 4IV3A 1LAJA 5E88A 4Y5TA 4MG2A 4CDQB 2I2SA 1W8HA 2BVVA 3O1TA 4CDQA 5FZOA 4YZ5A 1TQ5A 3WVJA 5I0SA 4KU7A 3PDQA 3PL0A 3ATGA 1X82A 3Q8CA 4PCRA 4URTA 3I2DA 1K5MC 2AC1A 1W8NA 2R073 3POBA 1URXA 1JZ4A 3MFAA 1V0AA 2Y6GA 4RHV3 2G19A 3R4UA 1YUDA 2BVBA 4XFIA 5FMOL 4E2SA 5JLVA 4N7UA 4PQQA 3LFMA 3KV4A 4CCLA 2XL7A 3WF2A 2ILMA 2D6KA 4CU7A 5K0UB 5EP9A 3U0ZA 3C7GA 5K0UA 1BEV3 3I97A 4XQ4A 3BPZA 3CJXA 3OD4A 1EPZA 2A6ZA 1HB1A 4LTAA 1G9AA 4NUBA 4IV3C 1CWPA 5FK7A 1D7PM 3W20A 3W58A 3ZXGA 5CIRA 1ZX5A 2DVAA 5J96B 2ERFA 3WDXA 4CDQC 1Y9GA 2NPIA 4FP3A 2W0XA 3JBG3 1XU1A 5DAVA 1DQ5A 2VECA 1JHNA 4GXLA 1Y9MA 4K9SA 1IGOA 2VZRA 2J1VA 4ZXKA 4DRVA 1DQ2A 5L9VA 2YXSA 1C57A 4KMQA 1W0PA 2XJRA 4P14A 4R9DA 5FREA 4UBGA 5DAWA 1JS9A 2IC1A 4EZ4A 3DYPA 4TXWA 2DFBA 2JDKA 2WWUA 2R7EB 1GU3A 4KH9A 1RUJ3 2WQZC 3B94A 1ODMA 4LOSA 3WZ1A 3E5UA 3LPFA 3IMMA 2LTNA 4FOYA 4FBFA 4D6SA 4S2HA 4XF4A 5T5JA 2MHFA 5I8TA 2WA3A 4DY3A 2D44A 2WKKA 3T4VA 5EYYA 3WDWA 1S0DA 1ZRFA 1IS6A 3QH6A 1LCLA 1TNFA 3UESA 5F2WA 2RS32 5B4NA 4LHNA 3IZOA 4BH9A 2VZ1A 3I59B 4AVVA 4R8HA 3I59A 3A21A 3RFRA 3LKJA 3ZFEB 1G7YA 4H7MA 3ZFEA 1ZM1A 4HBNA 5FDBA 3ZVXA 2ZTNA 1R1A3 4MUVA 5L7OB 5L7OA 1VAVA 1R082 1POV3 1W6QB 4J1WA 3TEWA 2XJQA 1M06G 1W6QA 1W05A 2W52A 5DXDA 3WDVA 5LRSA 3O0XA 2CU5A 3MDPA 2CGPA 2XQRA 4PIYA 2JIJA 3L9JT 1U12A 1MZEA 1WW6A 3E5XA 3HNBM 3CZUA 3LEGA 1GZWB 3DF0A 4JKLA 4NAOA 1DU3D 1GZWA 5LBFA 3NAPB 4TLGA 4QPWA 1QHDA 2VUJA 2RR13 2NZ9A 5AVPA 4O9GA 5FO7B 1S0FA 1S1AA 3JD72 3I2KA 2BGCA 1F2NA 2WQ4A 3WQ7A 4UFHA 4EWDA 4AHZA 1IHMA 4D8MA 2ZOEB 3LSEA 4YW7A 5A80A 1RXGA 3NJVA 4HSLA 4K40A 4UI9L 1PMHX 4TTGA 3H1YA 5DUVA 3K51A 3NNLA 4YZ1A 1HRI2 1W6OB 4RGKA 3CHXA 1W6OA 2HWD1 1XNTA 1VBE3 1J58A 2Y6JA 3A23A 4AQSA 2WFF2 2PAMA 1HB2A 1GNHA 1UYZA 2VG9A 3O1SA 1OQDA 1UXZA 3WW3A 5JOYA 4E9KA 5C3QA 3H7JA 4JCKA 4PIXA 4KGQA 4DXTA 3EQEA 3NJYA 5JPNB 3ZIWA 1CN1A 2HWE1 4W65A 4WV8A 4FI9A 1CZTA 2Q0AA 1XU2A 3NV2A 2ZGRA 3LA3A 3RZZA 2J22A 3IAPA 4LMFA 4X8NA 1G9FA 2DVDA 5IK8A 1HJGA 1GSLA 3JQWA 4WVVA 3ZN6B 3D82A 3ZN6A 1K12A 2LRPA 4O9EA 2XKOA 1DGWX 4KBZA 1KD7A 5J48A 3PIJA 1ENQA 3RPQA 1PZ8A 4AGRA 1JZ5A 1C1FA 3MUY1 4FPKA 2A70A 5HXMA 3E1F1 1SBFA 5A3NA 5LRRA 1R093 1W39A 2MNGA 4ISRA 4WZFA 1V00A 2DU1A 3Q9OA 4CDUB 1PNFA 2W94A 4R52A 1IG3A 1P8JA 2JD9A 4L0PA 2B5HA 4IE6A 4XJWA 4LBNA 2OXBA 3LA2A 4Q1RA 4B4PA 2ADDA 4M4PA 5FZAA 5JSPA 4P9LA 2NLRA 1DIWA 1TMF1 5CYYA 1NKGA 3U11A 3LEIA 4I3PA 2BBVA 5LY1A 1TNRA 2NP0A 2OKXA 3KM5A 4LPLA 1SFNA 3NRUA 4JGYC 2WLPA 5ISLA 1Y3TA 3KT4A 4IL7A 1ASJ1 2AR6A 4YSFA 5CFCB 3PUQA 1C5IA 1GQPA 2QQJA 4UW3A 2HWC2 1PZ9A 4URAA 2W92A 1W6NB 1W6NA 2Y0IA 3GCWA 3PJQA 1T2XA 1FAYA 1YO8A 4ISQA 4JC1A 1N3OA 1XOYA 4OLLA 5HBAA 2QKDA 5JOXA 4N8MA 1TEIA 4ASKA 4XBLA 4FPYA 3OCPA 4QD2A 2FQPA 4M4RA 1RUD1 2ZJCA 3BB6A 2H0BA 5ANQA 2WO1A 3AJZA 1NZCA 2CNAA 4GJYA 1XNBA 1GNYA 3T30A 4CP1A 2VMIA 1TG7A 2DCJA 4RYDA 5FY1A 2V09A 3NKTA 3ZXJA 1BKZA 4PT6A 4DY5A 1D0GA 2HWF3 2CWMA 3CJIC 2XBO2 2P34A 2WZR2 4JAAA 3ZXAC 1R1A2 4KG0A 3TEXA 3M3IA 4ZHNA 3JB4C 4YVWC 1RUC1 1YIPA 4Z07A 1EV13 2UY9A 2XH6A 3OYWA 3DPRB 2RHPA 4WBBA 4XZPA 2ZGOA 3DPRA 4DXSA 4RR3C 4Y1YA 1AR93 4UXAA 3VBFB 3BN6A 3VBFA 5IYYA 3OUHA 1KFUL 3K3OA 4IEXA 5IFTA 3IBMA 2ZXQA 4AAXA 1IPKA 2BNOA 2JEMA 1D4M1 2X05A 4Q4W3 4AHWA 5FWJA 3U14A 2UYAA 2BNMA 1OKOA 2VNVA 3HNYM 4XQWA 1VBC1 1DBNA 1HB4A 2EXJA 1HRV3 2VNGA 3TB0A 2UYBA 2KM2A 5JAXA 4COUA 2VQAA 3N9LA 2FCTA 1C3HA 5GLUA 5JXGA 1PNGA 3UJQA 4FP2A 4CXXA 3AYAA 2Z69A 3M3QA 4GMP0 1RHI1 1VAMA 1OUXA 4XURA 3WY6A 3APBA 2TBVA 1VBD2 5CZKA 2JJ6A 1VR3A 2J1UA 1AYN1 2VOVA 4QM9A 2VXRA 5GLWA 1HXS3 1QY4A 3B01A 4QKNA 1NY71 1O8PA 3HIFA 4IGPA 4XHBA 4LBLA 2JE7A 3WDTA 5JR7B 4B4RA 3NVCA 3VHPA 1QDCA 5J36A 3K4ZA 1AHSA 1AX2A 1XQNA 1COV3 3VBFC 4AHXA 1LHNA 1WLWA 1A8DA 2YZ4A 2FBEA 3B02A 3WF1A 3U07A 4ZZ5A 2RS52 3RWKX 4OUMA 4A7YA 5F37A 4RL7A 1CESA 3DN7A 1J84A 2ZX1A 4YRDA 1E5SA 5T5PA 1FNZA 3VZJA 1BMV2 1KJLA 4BM8A 4JDNA 1I5PA 1H4HA 4XILA 1FNYA 1WA6X 1UZWA 3AVRA 5EJ1B 5EHDA 5J37A 4Y5SA 3AKPA 2HWB2 3T2PA 4G9SB 3WX5A 5FTTC 1H9WA 3WT3A 1XE8A 4AQ6A 1RUI2 2DWRA 4BMEA 1QNYA 4UW6A 3AP7A 3BKZA 4RS5B 1W8WA 3OPTA 4RS5A 3I3DA 3ASIA 4DO0A 2R1DA 2R30A 3T1LA 4BQWA 2QQIA 4A44A 3ZXDA 3B69A 3SCGA 2ZGKA 4ASLA 1X7NA 3NQHA 5C3SA 4MGTA 3HEIA 4GZ9A 2MPFA 4YW4A 4C1WA 2ZEYA 3ZYHA 4AVAA 5F32A 5FRAA 1ULDA 3H7YA 4AFDA 3WR0A 1REDA 4P9YA 1HIXA 1RUG2 1H2KA 4LO4B 4CEWB 2DTYA 1MS5A 3HD8B 4AVBA 4CEWA 2QQPA 2DVBA 3ZFFC 1X36A 2XOMA 1NE4A 2OA2A 3AK0A 3BOPA 5FXXA 1UPSA 3AL6A 1BBT1 1OF4A 2SLIA 3KWVA 3VKNA 3KHCA 2VW1A 2XVGA 4FPFA 1EAH1 2BV4A 1PX3A 4E4ZA 4LKDA 1FPN2
chains in the Genus database with same CATH topology
1ZBE2 1J1LA 4LULA 4LT5A 2B7YA 4Y26A 4FAGA 3QCWA 1CVNA 2BW8A 3GBGA 3NV4A 1AJKA 2P37A 3J4UH 2K0GA 1Y9QA 5T54A 1ZBA2 1Y7BA 4I0WB 4EN6B 4EWAA 3WUDA 3MZHA 4N7IA 1LHUA 2ZMLA 3PVEA 1AR92 4CEYC 2E7QA 2XLGA 5AC91 3H0OA 4Y22A 2ZX2A 2GMEA 2VMHA 2NN8A 1AL22 4XQWA 3WVJA 4OHXA 1QNWA 1Q8OA 4PBPA 3ZO0B 3IDEA 1RGSA 4D7YA 5ABJC 5KHIA 4HN0A 5IK7A 2XJPA 3AMQA 5BPXA 4LLOA 1SLCA 5AVAA 1MQTB 5C8CB 2ZX3A 1MQTA 1RVF3 1CPMA 2AENA 4Q4Y1 5C8CA 2R062 3T2TA 2VOXA 1UX6A 2D5HA 2D6NA 2D6OX 1Z7S3 2E7AA 3WW1A 4JGZC 4Q4X1 4XIKA 5BNOC 4RGAA 1PVC1 1SBEA 4K8FA 1UU6A 1QJY1 3NJZA 2IXKA 1RUF1 1HQWA 4DRRA 3ZSEA 5DDJ3 4Q4V3 1NOVA 4F3JA 1S0EA 1BXHA 4OUSA 1H2NA 2RJKA 1RUH2 1PM7A 4XMAA 3AKTA 3FHIB 1I1EA 4BE3A 2MEV2 3NL1A 3SHRA 1H8TB 1WA4A 1QJX3 1H8TA 2XHKA 1MQTC 2PLV3 2OW4A 5C8CC 1AX1A 5FLJA 1GR3A 3H8UA 1MZFA 4X6QB 1MEC3 4ATFA 1PK6B 2R49A 2GDFA 3TOJA 3VBHC 1PK6A 2WS91 3M3OA 2W68A 5C9AC 5JIAA 2WC2A 1SLAA 2XJVA 2CWSA 2QCSB 2VY0A 3IDBB 5A3MA 3EXUA 5BV6A 4FPEA 1OA3A 4XEZA 3D5OA 2VVFA 1V9U3 4XFFA 3ME2A 1UPIA 2YC0A 1NQDA 2D7FA 2EVXA 2PHFA 4GMP3 3WOGA 3NSTA 5JWPA 2DURA 2DTWA 4XFHA 1QQP2 4LHKA 2E6VA 4YFZA 1U0AA 3D0JA 1HV1A 5GZEA 3M4FA 4XIOA 2A71A 4D3WA 1CAXB 2D6MA 3SNMA 3WUCA 4AQ2A 1W0OA 1CAXA 5CG8A 3CL1A 1WD3A 1RUE3 1XNKA 2A5ZA 3V56A 3B7MA 4DZGA 1AYM3 2D97A 3VBUB 3ZPYA 3VBUA 1PO11 5CAZA 2ZBJA 3S7EA 4HVQA 4LA3A 1DYKA 3LOBA 1YWKA 3MGUA 1YNAA 1NE6A 3JUUA 4MGZE 1AR73 1LOFA 1M4WA 1VBA1 2EAKA 4YZ2A 1OA4A 3M3CA 4KWLA 4IETA 5H9QA 5BXXA 2ZACA 4XJAA 4N43A 5FLHA 1V6OA 1HQLA 2LUWA 3S0MA 4IEUA 1GZ9A 1VRH1 4CTEA 1ZZBA 1TME3 2AYHA 2OUHA 4I09A 4PBOA 3VDDB 3MIFA 1MS8A 1B35B 3H3ZA 3VDDA 1HQNA 1B35A 4META 4CDXC 5D8AB 1S0GA 5D8AA 3VBUC 4C0BA 1LJ7A 2ZABA 5GKAC 4LBKA 2HJIA 1ONAA 3CLPA 4HLTA 2JG8B 3I54A 2BUKA 1NQJA 2JG8A 3CU7A 4IEQA 2DYCA 2ZHKA 1LOFC 1VBB3 3RWNA 2NMNA 3OD0A 5AFEA 4N43C 5KXCA 2GNMA 3H9AA 4IQPA 4UW5A 4ES9A 1ND2B 1ND2A 2ZGNA 5I8SA 2GH2A 4PQ9A 4Y4YA 1HKDA 3VDDC 3QOPA 1B35C 3HQXA 4YVSB 3M3EA 1UKRA 3O7OA 3MIHA 5D8AC 1WCDJ 4V1PA 3VBSB 3MIDA 1SLTA 1REEA 3VBSA 1YFWA 2R041 3AM2A 1IKPA 2JG8C 3MIBA 3INAA 1GFF2 2RS33 4Z1VA 1RL3A 1PIV1 3ZN5A 5C8WA 5JZGC 5FQ0A 3ZDSA 3AMHA 3J8F1 2X5IC 2W39A 1V9U2 2ES3A 1QJU1 2ZKNA 1R083 1DG6A 3RG0A 2PAEA 3POWA 1UF2C 1C8M2 1APNA 3MW3A 1AR82 4X8PA 3AKQA 2IXHA 4AW7A 2D3SA 2ZAHA 4DS0A 2PN5A 4ZKTB 2G4IA 1JYCA 4LO7A 2RMU1 3VLBB 5T50A 3JD73 3MLJA 4XFBA 2E9QA 3VBSC 1WD4A 4NPRA 3AYDA 2QFEA 2C5DA 1I6XA 4M3CE 2H0VA 2CAUA 2C0ZA 1HRI3 1ZZ9A 1WW5A 3AZYA 5I0TA 1R1ZA 1V6NA 3ZMOA 2WFF3 4ASMB 4B4QA 2PYTA 3HBZA 2R071 2B9UA 4XE9A 1GNZA 4RHV1 4EV0A 5I0RA 3QD6A 2QZ2A 3AP6A 4GIQA 5BNQA 3GBFA 4M01A 2FZ1A 1W6PB 1QXRA 1W6PA 1O3QA 1BEV1 2PAKA 1PGL2 4I01A 1TME2 4Q2FA 2QJVA 1MVQA 2IZWA 4TSVA 1YI9A 2NYYA 4XXPA 1LGNA 1FYUA 2X29A 3VZNA 5HCBA 2ZGQA 1XE7A 1AX0A 2GC3A 3FMGA 3JBG1 4R9CA 5BNNB 4B7KA 5BNNA 2AZ5A 1WCKA 1NYWA 2Q30A 2ZCWA 4Q0PA 2B45X 3RI8A 3AB0A 3PTYA 1Q8VA 2EF6A 1ENRA 1PZ7A 4AQTA 1VBB2 1RUJ1 1MS1A 1FX5A 5K8SA 3WG2A 3ST7A 5FOJB 1H8VA 2GC0A 2DUQA 2WSVA 5T55A 4MYEA 4KU8A 2EIGA 1GZCA 4G4FA 4H55A 2HWC3 3ZXFA 1DYPA 1Q5OA 4XTPA 3KCXA 4D94A 1G9BA 1AJOA 4R4ZA 4P5HA 1AR63 1R1A1 2QDRA 5BNNC 1POV1 1PO23 2AGSA 3MPPG 2PHRA 4AEJA 3MF9A 2RM22 4C91A 1O3RA 2PHLA 4PLNA 3ZYGA 4K7JA 3V64A 4B7EA 1QKQA 4QX5A 1MZ5A 4W6XA 2XBO3 2WZR3 3I4IA 2RR11 1VLNA 3LSDA 1O7FA 2DF7A 3ES4A 3N35A 2XGXA 3OPZA 3D4KA 1RJ7A 4RQPB 1LHOA 3I8TA 1S2BA 1ENSA 4RQPA 3KLSA 4P9WA 4XOGA 4OI1A 4LR4A 1ZZ6A 1AZDA 4LO5B 4N53C 3WD5A 4R9AA 1VBE1 4NWWA 4AFBA 3AKRA 3N7MA 4FXGB 4P9IA 4QU2A 4QMAA 2ZX0A 1S55A 4CDWB 3WP3A 4CDWA 5AFBA 3ECQA 4Z8BA 2RJLA 4FPLA 4PLMA 1YJKA 1GV9A 3I7DA 2GALA 3RQ0A 4GWMA 4I3GA 3VN4A 4AE2A 4M0HA 4BYYA 2XJUA 5KHKA 2Q5TA 4R9BA 2ET1A 4IEWA 1BJQA 1WW4A 2HEWF 2WINB 3ETQA 4AEKA 5F6KA 1VBD3 4NHMA 4OHVA 3S7IA 1GLHA 4WZCA 2GNBA 2NMOA 4RQPC 3IMNA 4JGYB 1EP0A 4JGYA 4YM0A 1U5IA 1H1MA 3AMMA 4FCAA 1IPJA 1FOD2 1OMIA 1R091 2ZGUA 2RS53 1SDWA 2Z42A 4AVSA 3GZUC 2XVKA 4CDWC 1OLQA 4BQ1A 3FBMA 4YM2A 5DUWA 2YDEA 1DZTA 4PLOA 5E16A 1H2LA 3V65A 3AX4A 5FO9B 2HWB3 5L36A 1X50A 1A78A 1FT9A 2VU9A 3DV8A 1QJZA 1NCRB 2UURA 1RUI3 1NCRA 1RJ8A 4G3YC 4KQ7A 5HXVA 4Q1PA 3FWEA 3WDYA 5IK4A 3NWKA 1O3SA 5DG1A 1RUG1 4WVZA 3ELNA 3VZOA 5CADA 1IOAA 3CJIB 2P17A 3CJIA 3ZYRA 4W6YA 1H4GA 3WG1A 4YVWB 3MIGA 4JDMA 4YVWA 4ASLA 3O0WA 1BVVA 3ES1A 3VKOA 3WNXA 3ILNA 4K20A 3AYCA 4XXAA 4RR3B 5I91A 2DCYA 3LAGA 4YLZA 4RR3A 5E89A 3KB5A 5K9YA 3UL2A 3IKWA 1RUG3 4ZU7A 1DHKB 1MS4A 1AXZA 2IWGB 2DUPA 2Y26A 2HWF1 4KWKA 4LBOA 1LOBA 1AR62 4Y1XA 1LU2A 2YV8A 3E6BA 1LHVA 3M1HA 2IFWA 4LA2A 1UIKA 2FMYA 1PO22 4HK8A 1EV11 1DLLA 4AI2A 4I30A 1FPN3 1ZBE3 1NCRC 4HK9A 3URFA 3MEPA 1AR91 1O5LA 4H7LA 5BNPB 4TWTA 5BNPA 4XETA 4MXVA 4OZXA 4Q4W1 2KXLA 1EY2A 3OYWB 1ZBA3 4QQLA 3DL3A 4BA6A 3ZFGA 2R061 1HRV1 1AUYA 1JH5A 1AL23 4YW3A 2WNEA 1WMEA 1IKQA 1YXWA 3FLRA 3WP5A 1XXNA 4QXKA 1UD1A 4XQDA 3PVNA 2GC2A 2GU9A 1HXS1 2R063 5IUQA 5EFUA 1LESA 4XF1A 5CG9A 1YFYA 5D1IA 5SV5A 1G8WA 3WCSA 1COV1 5BNPC 3KSCA 5JSRA 1OLRA 5KC6A 2I74A 4MV2A 3RMYA 4CZSA 4XFAA 1G9DA 1ULCA 5JOWA 1ULGA 4B29A 3VHRA 3ZFGC 4BLJA 1A8MA 2C1FA 1SQ4A 1Z78A 5EZWA 1RUH3 2YPJA 1QWRA 4RSUA 1LEMA 1C8NA 4WM8C 1V6IA 5L73A 3USSA 2B46X 2WWSA 2MEV3 4PJYA 1UMZA 4C1XA 3MLLA 3H50A 2IXLA 3ZFFB 4QM8A 3ZFFA 3OF1A 3GNEA 4YGBA 2YROA 2XWBB 4QGNA 4FQ4A 1KITA 2HWD2 1S0CA 2A75A 4AEDB 4JRLA 4AEDA 4AXOA 5LEJA 4PDWB 4IEPA 2GAUA 2HEYF 4PDWA 2PHUA 1Q56A 3TN93 2YY1A 1C4RA 2HWE2 3ZXLA 5JI9A 1OFSA 4K21A 3BALA 4LHLA 3AFKA 4L11A 2CAVA 3O12A 4XPVA 3NV1A 3IPVB 1KS4A 4CEYB 3IPVA 3U4XA 4IESA 1F5JA 1QQP3 4CEYA 4FPOB 4N9HA 4FOVA 4QQPA 5JOZA 2EAAA 4DINB 5ABJB 1DZQA 4N90A 4K3UA 5ABJA 1J3PA 2XVLA 4OVEA 4QGMA 1F8VA 3VKFC 1C5HA 1H30A 2JECA 3H3UA 3VBOC 1RC6A 4AEDC 4NVPA 3RJ2X 1EPWA 3KGZA 4JGZB 4QPIB 5GLTA 3TAYA 3FC0A 1ZNPA 3FLTA 4JGZA 4FPHA 4QPIA 4PDWC 5BNOB 1TMF2 3WQ1A 4GKYA 5BNOA 2VOKA 1IZ3A 4RGGA 2VQ0A 5EYXA 4YG3A 4KNCA 4WVMB 1I3HA 4WVMA 4E4SA 4AI8A 1RVF1 3KCCA 3LA7A 2WLQA 5FO8B 1ND3B 1Z7S1 4Y22B 1ND3A 4AI3A 3AYEA 1N1VA 3THTA 4QPGB 4HFSA 4QPGA 4FPGA 2D93A 1CJPA 4DNYA 3O14A 3PMSA 1RUD2 2Y0OA 3R4DB 1NA1B 2WNUC 4LUKA 4P9GA 1YFUA 1LOCA 1NA1A 2GMMA 2GZWA 5DDJ1 4Q4V1 1G86A 3J9SA 3N7LA 4QPIC 5EWSA 4DMIA 2BFUS 3VBHB 3AP4A 4L9BA 3VBHA 5C9AB 3B9CA 2PQQA 5C9AA 4XF9A 3UV9A 1JUIA 5DG2A 1QJX1 1WUVA 4BIFA 1VIWB 1RITA 1V6MA 2PLV1 4DPNA 2ATFA 4Q0QA 1ND3C 4XTMA 3OBRA 3EBRA 4L2NA 3M2MA 4N9IA 2VGDA 1MEC1 2WNVB 5CU1A 2WNVA 2Q1MA 1U5ZA 3USUB 3USUA 4HN1A 1NG0A 2ZGTA 4S2DA 4GWNA 4QPGC 4XW3A 1D4M2 3O5SA 1VB4A 2UWAA 5DZFA 1NA1C 4MGIE 4L97A 1GICA 3QH7A 1FV2A 3OGJA 1V6KA 1YYNA 4YARA 3B9IA 5ACA3 3GZAA 1N47A 1QH7A 4Q26A 1V9U1 5F6LB 4HPKB 1DQ1A 4LUMA 4HPKA 5FFOC 2Q1ZB 1KQRA 1D2SA 1RHI2 3DKWA 4GMP1 4GB32 2O8OA 2OZ6A 4LE3A 5A3LA 3A0NA 1BYHA 3QBQA 1MACA 3MF6A 3AZWA 1D4VB 4B3NA 2XLAA 2WIIB 3VKMA 1PGW1 4JTNA 1NY72 3TN92 4HMZA 3IDCB 1ENXA 3SMHA 2WNVC 2A7AA 4LNVA 1VAKA 3ZXEA 1RUE1 2QNKA 1RINA 2XL9A 3TYJA 2A3WA 1C8M3 2GSYA 4AHYA 3SH4A 3VBRC 3N36A 1DGWA 4DXZA 2OZJA 1CIWA 1AR83 3A0KA 3N7KA 1AYM1 4HANA 3ZSKA 5CFDC 4LBJA 4XBNA 3FFQA 3L2YA 4AWDA 3AP9A 3KT7A 1VJ2A 3FLPA 4GALA 1FV3A 3VGIA 4HKLA 4YYOA 3N7JA 1UKGA 4JQRA 4A2UA 5J09A 2GN7A 4FXKB 3AJYA 4P9XA 5CVRA 2JENA 1AR71 1OFNA 2ZMKA 4BLIA 3V0BB 4CDXB 3HN1A 3V0BA 4F83A 4CDXA 4FT8A 1X8MA 4FSJA 1PVXA 1GANA 3E6CC 4I02A 4YM1A 3MW4A 1ZA4A 4IV1C 2V73A 3K48A 1O5UA 4JRAA 1PGL1 1TME1 4YGDA 1HX6A 4DFSA 1MS9A 4KGGA 1XRUA 1G6NA 2GNTA 4MXWB 5LK7B 4MXWA 4KWJA 2KA3A 3VZLA 1RUNA 1YLLA 1FMD3 3H1WA 4N43B 2CGOA 4EN7B 2BTVC 2W08A 1YRZA 5H9SA 3IM0A 5GM0A 2D6PA 5C4WC 3IWZA 3AZVA 1UCXA 1EAH2 1IS3A 3ZYIB 1VBB1 3WCRA 5FPXA 3QLQA 3M70A 2A3XA 3WHUA 1L3JA 2GNDA 2WA4A 4F8AA 2OIIA 3DUIA 4C0HA 1WBFA 2C9AA 3WW2A 4AGVA 3DGTA 5JZGB 5JZGA 5KXDA 3VHOA 1OSGA 3GBWA 2X5IB 1REFA 2X5IA