1RJ8A

The crystal structure of tnf family member eda-a2
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
140
structure length
140
Chain Sequence
PAVVHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTYFIYSQVYYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKIAVKMVHADISINMSKHTTFFGAIRLGEAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hormone/growth factor
molecule keywords ectodysplasin-A isoform EDA-A2
publication title The Crystal Structure of EDA-A1 and EDA-A2: splice variants with distinct receptor specificity
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 140
sequence length 140
chains with identical sequence B, D, E, F, G
ec nomenclature
pdb deposition date 2003-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1rj8A00
1OSGA 2ZPXA 2RJLA 1U5YA 2HEYF 2RE9A 2WNVC 2JG9C 3TWIA 2WNVB 4G4FA 2JG9B 2RJKA 4KGQA 2R32A 2TUNA 4QQHA 2Q8OA 2HEVF 1JTZX 1DU3D 3TYJA 3QD6A 3V56A 2WNUC 2WNVA 2JG9A 2WNUB 4DOUA 1KXGA 1TNRA 2R30A 2QDNA 4DB5A 4MSVA 1ALYA 3B94A 2Z5WA 1PK6C 4J6GA 4OULA 1PK6B 4D7YA 2O0OA 1U5ZA 2WNUA 1DG6A 5HBAA 1RJ8A 3K48A 1PK6A 3URFA 3LKJA 4HT1T 4QQLA 3IT8A 4OUMA 1WCKA 5TSWA 4KGGA 4G3YC 2ZJCA 4NN0A 1I9RA 1C3HA 1OQDA 2E7AA 4TSVA 3MI8A 5KWRA 3FC0A 1D2QA 5L36A 1U5XA 5L19A 4OUSA 3WD5A 1JH5A 2TNFA 3L9JT 1O91A 3B9IA 4QQPA 2JG8C 1D0GA 1D4VB 2JG8B 2QE3A 3QBQA 1A8MA 4QPYA 1XU1A 4RSUA 5CIRA 5BNQA 1IQAA 1C28A 4F3JA 3AB0A 1TNFA 2JG8A 1GR3A 4N90A 3K51A 4E4DX 4MXWB 2OIIA 3B93A 2R6QA 2Q1MA 4GIQA 4TWTA 2X29A 4MXVA 1OQEA 2HEWF 1S55A 1KD7A 5KC5A 4MXWA 4EN0A 1XU2A 4E4SA 3ALQA 2AZ5A 4KG8A 2KA3A 4QQ2A 4QQOA 1RJ7A 5KC6A 3ME2A
chains in the Genus database with same CATH superfamily
1UZ0A 1OSGA 5FYMA 2RJLA 1COV2 1TEIA 4K7JA 4FQZA 2WFPA 4AF9A 4CXXA 4RR3C 4E4HA 2WNVC 3U4SA 4B7KA 4B1LA 4LXLA 2IVIB 3J26N 4XBNA 3WINE 1JXNA 1SBDA 2XWBB 3T2PA 3M2MA 4FPCA 5FLHA 5DN2A 4GWJA 3FFQA 3WG1A 3WF3A 1TMF2 1DU3D 2BOIA 4A44A 1IG3A 2WNUC 4D6SA 1HV0A 2UY9A 2ZX3A 1LR5A 1KDKA 2OPWA 2FDJA 2PLV2 2UYAA 3J7HA 4YG6A 4XACA 1C5HA 1SFPA 2RS12 3I3MA 2ZHKA 3N7LA 3FFZA 4FO9A 1Z7S1 4LO6B 3UV9A 4D7YA 3WSOA 2OT7A 5JXIA 3VKLA 2JJ6A 1W2OA 3AP7A 3IIAA 3JD72 3HJRA 4BQ5A 4ZS2A 3EBRA 2XVGA 5LBFA 3PL0A 5GLTA 4Q4X1 3SXWA 5CAZA 2I45A 4GKYA 2GN7A 4I3GA 2VW0A 1LGNA 3GBWA 2E63A 1W04A 2WDBA 4XW3A 1URXA 4OYUA 4YW6A 1YLLA 1O59A 3QOPA 4LEJA 3VZMA 3J8F2 1BMV1 1OBNA 1LJ7A 1US3A 5AC93 5CU1A 2L9LA 4NHMA 1QQP1 2WS92 2JXAA 3O1VA 1G9DA 2WQ8A 1H2LA 1R091 3U4XA 3R4SA 2DFBA 4KBZA 5BNOB 1ZBE1 5KWRA 4LO7A 4BLIA 3POIA 1HN1A 3HAGA 3PTYA 5GLVA 5FREA 4HZFA 2BW8A 4DUXA 1SEFA 2VTFA 4XJUA 4WM7C 5FZCA 2EXHA 2RS53 4RN5A 5APAA 5GM0A 5CEHA 2J1VA 1JOJA 1GZ9A 1JH5A 1RUF2 4K40A 3O7OA 4Z82A 5I93A 5FMBA 5J98B 1QXJA 2VL4A 1KFUL 3FZ3A 4FPEA 5DDJ1 4PIYA 2NMNA 2JG8C 2AGSA 5LATA 4IE6A 3WF1A 3POEA 5DZFA 1S1AA 1UZZA 1ZBA2 2RMU3 4B8EA 3RYPA 1AYN3 1XU1A 3O1MA 5GLZA 4LKEA 4FT8A 3X29B 5FUIA 3AVRA 1V00A 4D8MA 4AI8A 2R073 3AYAA 1PNFA 4D7TA 5I8SA 4XF4A 4I09A 4AHXA 2BYVE 2G9FA 4Q27A 1ND3B 1QJZA 2VOVA 5JOYA 3VBSC 4XBQA 3B93A 4MHUA 1G8WA 4J25A 3AKTA 4TN7A 4J1XA 4CA9A 3I2GA 3MYXA 1AX1A 1DFQA 3ZR5A 4CP2A 1S0EA 4QU1A 3FE5A 4LBQD 1AJKA 2J7MA 3W21A 3WQ7A 1H9PA 3ZYBA 4ATFA 3KM5A 4BH9A 3HT1A 3MV11 5FYYA 5T5PA 4YZ2A 3L2HA 4ZHNA 3DKWA 4MGSA 1DYPA 1O3QA 1ZYBA 2HWD3 4QAWA 4YVSC 5LY2A 1ZRFA 4A3XA 4YW7A 1YQCA 4L11A 1RUD3 3VHPA 3ZN6A 3N7MA 1RUH3 1AL21 2P4EA 5FYVA 3ME2A 2E6VA 5CFDB 2PAKA 3H8RA 2UWBA 4B3NA 4LITA 2OZ6A 3POJA 4PT6A 4QD2A 1WWYA 5AC91 5LBCA 3GJAA 5SV5A 3ZXGA 2PHRA 1JHJA 3V0BA 3ZFFB 2H6CA 3NWKA 4H14A 5FZMA 4OQ9A 4E9KA 1OXCA 3ACLA 3AZVA 4YW5A 3NL1A 1F4AA 2Y64A 3SISA 1IHMA 4IE4A 4GB31 2VCBA 4Q8LA 2FDIA 1S0DA 2FZ2A 2VBDA 3FLTA 2RS51 4D0QA 4EJRA 4AEKA 3LFMA 5FO7B 4XCBA 2R30A 1W6PA 4K8RB 4IV3B 5FZHA 4MGYE 4IERA 4C0HA 1WCUA 1AR73 4D6RA 5KHHA 1Q8QA 3LGRA 1SMVA 2A71A 3ZR6A 2WYSA 3I2JA 1UWWA 2RMU1 3OEAA 1AYN1 1WW7A 4FPLA 1AR93 4P14A 1PGL1 2R071 4PJYA 3IDCB 4CEYB 3CJIB 3IKWA 2JE8A 1HRI3 2UY8A 1RUI2 3OF1A 3URFA 5C5UA 4OHYA 1SFNA 2W68A 4M3CB 2WUHA 1PO12 3OSDA 4AGVA 1LB2A 1PM7A 3B5LB 5A7OA 3NVCA 3ZSLA 2YPJA 5LRRA 4AEJA 4Y1UA 4H55A 3GCWA 1HKDA 1YQ2A 3H8OA 3AMHA 2D97A 3QCWA 3RVHA 3H7YA 4UFIA 4ASKA 1AR63 1AXZA 1XYPA 2VQ0A 2HWD1 2B7YA 5FYIA 3UL2A 4GAZA 3ORJA 1RUD1 1MZ6A 2QZ2A 4QQPA 1RUH1 1GANA 3U37A 4LUMA 3I7DA 4BYYA 3NJZA 1YIFA 1MZ5A 2VULA 2VZPA 3GJBA 1JZ6A 4FQ4A 1W8UA 1JS9A 4XILA 4YW3A 3PLQA 1AX0A 1LEMA 4BZ4A 1AX2A 3RSJA 3AP5A 3IDBB 4PIZA 3Q8AA 4F8AA 2XQRA 5A3NA 2YG0A 4YRDA 3PJYA 3UGGA 4LBQA 1RMU2 2A75A 2YC0A 1F9KA 1X33A 3BTZA 3WUCA 2ZA9A 4WZFA 1AR71 3HN3A 2WSUA 4N43A 3ZXAC 5CB7A 5A70A 1KD7A 5FAXA 3ACGA 4BXFA 5AVAA 1HXS3 5F32A 3POYA 1AR91 1QJY3 2OS2A 3ZXFA 1XE0A 5C4WC 5C7GA 2DVAA 4COUA 1HRI1 5A6YA 1SBFA 1LODA 4KH9A 1QJX3 1W6MB 2WAAA 4RR3B 4CU9A 2WNVB 5D8AA 4Q8KA 2WIIB 3OPWA 3ZOIA 4Q2FA 1R1A2 3DN7A 2YXSA 2YC2A 3IPVA 4KG0A 2ZEYA 1CR7A 1YNAA 1ZZBA 2YFUA 2NYYA 3KMHA 3OCPA 3UKTA 4E8DA 4NVPA 1POV3 1NG0A 2BU9A 2WNUB 3ZPYA 3ZMOA 4CVUA 1GWKA 2HYXA 1AR61 1N3OA 5GZCA 1OF3A 4DB5A 1J3RA 2GC3A 3JXSA 4QMAA 4L8QA 4X8NA 5I0SA 1PVC3 3LA2A 3H42B 2VTXA 5K0UC 1WBLA 5FY1A 4Q4Y3 2DV9A 1U5ZA 1MZFA 1IG0A 2R062 2VR4A 3LPFA 5C3PA 3RJ2X 4C1WA 5FP9A 1GZWA 2WO7A 3AMNA 3VKNA 1PZ7A 5I0UA 2PHXA 3KV5A 3NV3A 1CAWA 2GNDA 3OGJA 1ASJ2 5I0DA 2D5FA 3HMYA 4XFHA 2DCZA 1RB8G 2FDHA 1ENQA 1YQ5A 2VPVA 5AVPA 3VUOA 4GWMA 1OI6A 3K4AA 1OUXA 1DGWA 1W0OA 1LKNA 1SFYA 4GKXA 3TEWA 3B9CA 3Q9OA 1CGPA 3NNMA 5LZ6A 4C90A 1N1YA 4P9JA 2JDKA 1JYIA 1ZRCA 2CGOA 1UZYA 1XBFA 2WNOA 4KI5M 1AVBA 3K4ZA 3JCIA 1Q3EA 1WMXA 2E7AA 4OHZA 4XDPA 2VCMA 5BY5A 4AFAA 1Q8PA 3KVBA 4AYUA 1JZ4A 3AL5A 5C8CA 1W9FA 1JU3A 1AR83 4EN9B 2XPJA 1HXS1 2Y26A 5B4NA 4I30A 3SC7X 5EZWA 1QJY1 3RDIA 3WNNA 2WZR2 4PI0A 1Q5OA 2Z2SB 1WW4A 3EO6A 3M3OA 3B9IA 4GMP0 1NCRA 4PLNA 2BTVC 3FJSA 5DZEA 2JG8B 4DMIA 3AKSA 4Y1XA 1CPNA 2J22A 3NNFA 2HWE2 1QJX1 1A8MA 4YLZA 4XF0A 3WNOA 1YYNA 1UKRA 3GHNA 3OEBA 2OUHA 5CIRA 3FHIB 1JYCA 3PU3A 1CJPA 2QNKA 1PGW1 1SCRA 2K9ZA 4I0BA 3OGRA 5H9RA 5A33A 2YBKA 3RFRA 4BJ0A 2IFRA 4XXPA 5IWFA 1V6KA 1R082 2WR9A 1MQTC 1POV1 4DINB 3VBSB 4LBKA 4UT5A 3I2IA 5FPLA 1NY72 5FZOA 5A7PA 2DDUA 5IK8A 2FCVA 2W39A 5JXGA 1HRV3 4NJ4A 2W1SA 2FDGA 1PVC1 3SKJE 3MIHA 1UD1A 3WW1A 1CN1A 3BIEA 1L7LA 2QUOA 4IV1B 4UW3A 4Q4Y1 1A78A 4FOQA 3TN92 5JR7B 4PDWC 4ES9A 1FV3A 4FFFA 3ZXDA 2PAMA 3VZOA 5F2SA 1W8OA 1EAH3 4KU8A 1W9TA 4Q1PA 5LBEA 4QPIC 4ZU4A 3V0AA 3N4MA 1Q43A 1TVGA 2VJXA 2OXBA 5KC6A 2LW8A 3K4DA 3UKVA 1UW8A 2XJQA 1BYHA 1OLRA 4MOAA 5KXDA 4E2SA 1W8FA 1UYYA 1L7QA 3ES4A 3OPZA 3WP5A 4AHYA 2QCSB 3AKQA 2VMCA 1WW5A 4PF1A 4Y26A 1ODNA 3GBGA 3IMNA 4ISQA 4FAGA 1UY4A 3H1WA 2FDKA 3PUIA 5HV0A 2VOWA 4NE9A 2RR12 4JAAA 4X8PA 2ZACA 4P5YA 1O8PA 3CBNA 3MIDA 4S2FA 2ARBA 3LCPA 1AR81 2YC4A 4GD4A 3ZSJA 4O9GA 1UYXA 1HN0A 1CPMA 3H3UA 1QMJA 3RNSA 2ZS6B 4XFIA 1RGSA 5D1IA 3VKMA 3LWCA 5LEKA 5A7NA 2CNAA 3VDDA 1XRUA 3A21A 5FCCA 3WP4A 1ONAA 4J6GA 1UF2C 4JC1A 4YFWA 3D4KA 3WHTA 1Z0HA 2MHFA 5FP8A 4Q4W2 1QH6A 2NQYA 1LOFA 4E2QA 3TRSB 1LHOA 1YXWA 4XDOA 3PUSA 1G86A 1KDMA 4K6BA 1IPKA 1GFF2 1I3HA 1XYNA 2Y38A 3C3VA 5FLIA 2XL9A 5FP3A 3GYDA 3A23A 1UY3A 3S7EA 2XBO3 5LK5A 1GNZA 3BVCA 5BNPC 2N7GA 4IW3A 1JOPA 2DFCA 4OUMA 1S2KA 3VBOA 2VQUA 2ZGSA 4RS5C 1S0JA 3PVNA 4RHV3 3THPA 3W20A 4LQRA 5F3IA 3VZNA 1ENRA 1QJU3 4UW5A 5D2AA 1O8SA 4YVWC 4D6QA 5FYTA 1HRV1 1D0HA 1FNYA 1VBB2 2X5IA 5I0RA 4RGAA 3TB0A 1WA6X 3WEZA 4NWWA 4LOSA 3MZHA 1CWPA 1STMA 1FAYA 2D98A 4PF5A 2WJSA 4QX3A 4D94A 1G9AA 4P9GA 2WAOA 1U5XA 2YGMA 1EAH1 1ZRDA 1NQDA 3RZHA 4CUBA 2Q8DA 4DPNA 1TME2 4AFCA 2DCTA 3N35A 2PHLA 5A7QA 1ENSA 3OYWB 4K1YA 3BUCA 1D0GA 1V9U2 1W0NA 4OI1A 5J48A 2CU5A 2P17A 1N3QA 2JDUA 1RUE2 2WN3A 5T5LA 3WUDA 2YDEA 3E1F1 1YIPA 3IM0A 4PHZA 1IS5A 1F5JA 2B9VA 4YGDA 5FRAA 2VW1A 3LA3A 3CLPA 3MGUA 2PHTA 1C28A 2RS33 1JUIA 2ZX2A 3FWEA 3HR9A 3JZVA 3OB8A 3ECQA 4I01A 4OI4A 5AFBA 4Y33A 5KXEA 1VRH3 5EYYA 3K51A 4QDRA 3LEGA 4BM8A 3WQBA 1GQPA 5F7UA 5FIXA 2IXKA 1JZ2A 2IXJA 2QZ3A 5FJKA 3OBTA 4AGRA 3MFCA 3HNMA 3PVBB 2VH9A 1GNHA 2VD7A 1MS0A 2E53A 3I2DA 3M3EA 3RI8A 4PQQA 1DYKA 1RTVA 4UWDA 4YG3A 5FR3A 2I07B 2ZXQA 1VBC2 3SQOA 1UU6A 1VBE2 4K8FA 3DXUA 1EV13 2J1RA 2VAUA 2VZ1A 4QDQA 3VBRC 4ARYA 4XDQA 4GZ9A 4KG8A 4WM8C 1G9FA 2IC1A 4LJHA 5DUWA 1UIKA 4HKWA 3I2HA 2D93A 2ET7A 1NXD1 3AVSA 3SITA 1BBT2 3USUB 1GV9A 1W8WA 1W9WA 1QEXA 2XBO1 5C4WB 1K5JA 2JECA 2EXIA 2R043 4I02A 4XFGA 2VMGA 2CSGA 1O5LA 1UX7A 1CONA 4TXWA 5I0TA 5A3WA 2D3SA 1JYWA 4EYUA 2JG9C 3ELNA 4RHV1 5FY9A 5GLWA 5FOJB 5FZ7A 5KBFA 4Z2AA 3WF4A 4QB1A 1QJU1 3DYPA 1MEC2 5FWJA 2XUMA 3S5AA 1CAUB 4E27A 2WYFA 2HWE1 2Q8EA 1E57A 4AFBA 3KSCA 3IWZA 4CP1A 3QH6A 2D6OX 2XONA 2NP0A 5GALA 3WDUA 3QD6A 2QQOA 4UFLA 3ZSKA 3LSDA 1XSQA 4IEWA 4N53C 2TBVA 1HJFA 1VMHA 2JENA 4QX5A 5CZKA 4IETA 4Y1ZA 1DF0A 3ZXJA 4GA9A 3JBG3 5FPUA 2XR4A 5K0UB 4ZS3A 3N9LA 1VIWB 5C8WA 2J1UA 2IWGB 2ZAHA 4XQDA 2QDRA 5EPAA 1YQ6A 4QB6A 1H9WA 2RS31 5FKCA 1C57A 3CF6E 5FY0A 1FYUA 1W05A 2V5YA 3K75B 4NIAA 1W2TA 1X82A 1W6OB 5JAXA 3T2QA 1E5RA 1VRH1 3N9NA 4HMZA 3UESA 2LTNA 5FMCA 4AR2A 4CU7A 4XVHA 5EHDA 1RVF2 4YSFA 5A7SA 2K46A 1W03A 3WNMA 3POWA 4QGNA 4Q4V2 2Y0OA 1MZEA 4NR1A 3T0DA 4AAPA 3MUZ1 3BI3A 4QPGC 1HQWA 2J1TA 4YFZA 1SQ4A 1S0CA 2VCAA 1EV11 1V6OA 4OZOA 2ORXA 3AYDA 1QJFA 1YI7A 5HXMA 2C6SA 1VJ2A 3EYPA 5C33A 2V4VA 1XQNA 4C1XA 2GP5A 1NA1C 1L7RA 3NAPA 1DQ1A 1ENXA 3AYCA 5BNOA 3PMSA 1CAVA 5FYBA 4LK7A 1UMZA 2JDAA 1OA3A 4GXLA 1FMD2 2R041 3QBQA 2AR6A 4XYXA 4JDNA 3ZX7A 1S0IA 1E5IA 4A2UA 4RSUA 3BPZA 3J7NA 1R64A 4CEWC 4CCMA 1W6QB 3NNLA 4QHBA 4XE9A 1W39A 2UU8A 3MICA 2DVGA 1RUJ2 3KB5A 3HBZA 1ZM1A 5FJHA 2HWB3 5FZLA 3NJVA 4KBBA 1WLCA 3SCFA 2GNBA 4LMFA 1MQTB 4MX3A 5I91A 4D3WA 3NV2A 3GXUA 4JZRA 4MADA 2WFF3 1UXXX 2WBKA 4LPLA 3MLJA 1H1AA 5DXDA 4MGQA 3RYKA 4NHYA 3JBG1 3OD4A 1ND3A 2VGDA 3KCCA 5IK4A 1MVQA 4IE0A 3H3LA 3P5BA 4RGGA 2JDPA 4UBHA 5JSOA 4OI2A 4PDWB 3F95A 3WW4A 5FMOS 4Y22B 2W92A 4A6SA 4XUPA 4ZPIA 4QPIB 3WR0A 4AEDC 3RZJA 4JGZC 2LALA 1LOEA 1HQLA 4K21A 3LPGA 3NSTA 1RUG3 2K0GA 3VBHA 3MF9A 5JI9A 2AC1A 4A6OA 2XLGA 3PIJA 5DUUA 3T0BA 4AHWA 1JZ7A 2BBVA 1QF3A 3MUY1 2AYHA 3PHMA 2JKBA 4XFCA 5IVYA 1LCLA 4XC9A 2YBSA 5DG1A 1PMHX 4KGQA 2ZKNA 4MZUA 2TUNA 3T4VA 3AJYA 4P9WA 1W8HA 5CFDA 4URTA 4XIOA 1UYPA 2DVFA 1BQPA 4FOWA 1S0BA 4U2AA 3RZZA 3V56A 2YBPA 4LHSA 3R4UA 4JTNA 3T08A 1FPN2 1W8ZA 2PFWA 3KQ4B 3ZFFA 2XJRA 1IKPA 4BDVB 5F8PA 3CHXA 5L73A 2QBXA 4FTEA 2WQZC 2E31A 1WMEA 4S2GA 2AEZA 2E51A 5DDJ3 4URAA 3S6PA 4LBMA 1D4M2 5D21A 1TG7A 1OT5A 2Y34A 1V6MA 3POGA 1NUKA 4K20A 4XTMA 4CCOA 3IAQA 2W08A 4HPKB 4IV3A 1CAXB 1TZOA 1PIV1 1HB1A 2ZGTA 3N9QA 3QH7A 4EE2A 4YYOA 4QXCA 5T5OA 4CU8A 1D7PM 1VBD3 4ZXKA 3D0SA 2HWB1 4XZUG 5BNPB 5CADA 3HPNA 3VL9A 1OOPC 2VZUA 2NMOA 4W6XA 4RS5B 4LHNA 5FZFA 2WFF1 1O4TA 3SH5A 4IXLA 3U07A 2GZWA 2QQJA 1LHUA 1GNYA 3BYWA 5DAPA 4YVWB 3CKHA 3CJIA 5FBJA 4L9BA 2X8KA 4FCAA 4QX8A 4BMBA 2PA7A 3MLLA 2WN2A 4RYDA 4M3CA 3DPRB 3O5SA 4LIVA 4FXGB 4COWA 4JHZA 1DGWX 3U11A 2ARXA 2EIBA 3T4HB 5LB6A 4JV4A 3MO4A 3THCA 2D6LX 2RM22 3VD3A 4BQXA 1BVP1 1RUG1 1VBA3 1AL23 3KQRA 1DIWA 3VDAA 3M70A 3R0RA 5IJRA 2WINB 3J9SA 4W4ZA 3ZDVA 1QXRA 4AAXA 3LD8A 4E4ZA 4JGYC 3DV8A 3GF6A 4NIDA 1BXHA 2G19A 1WBFA 3AXEA 2NLRA 1PMJX 1KITA 5A3OA 4M3CF 1YQ8A 5J09A 1UAIA 1OLQA 3A7QA 3N7JA 1CIYA 1LOGA 3UKNA 4Z07A 1NLSA 1OVSA 4GB33 1FOD3 4AW7A 1DYOA 3OUHA 4HANA 1X36A 1U5IA 1ULOA 4IQPA 2OVUA 4P00B 1RUC2 1GWMA 2JIGA 2CDOA 5T50A 4H7LA 2NN8A 2QQIA 3I49A 2WO3A 4B4QA 4CUGA 2GH8A 4NUBA 2A6XA 2VE1A 2A73B 3VBRB 1OFNA 3BGAA 3M3CA 3NQHA 4TZDA 4NPLA 4WM8B 2X53S 2Y6GA 5E16A 3ZKYA 5BNNC 4QQOA 2PHUA 3CDZB 4OI0A 1LENA 4HG6B 4PLOA 4AI0A 1VBD1 2XJPA 1QNWA 5DZGA 2W9XA 4N9HA 4AI2A 2GC1A 3ZKUA 5FK8A 5A1FA 1F8VA 1NCQC 2NZ9A 1E5HA 2G9ZA 2HEYF 1J84A 3TWIA 2JG9B 4SBVA 1QOTA 5FFOC 4LOTA 1COV3 2Q8OA 2B4KA 4CDXC 1YI9A 1YRZA 1DQ0A 3A0NA 2YY1A 3U1XA 5EJ1B 4EZ4A 1W6MA 4Y5SA 4RR3A 3TEXA 2WNVA 3ZYFA 4ARXA 2F17A 5IT6A 2WRAA 1US2A 1YHFA 2XHNA 2BVBA 4UXAA 3M7AA 2IXIA 4I0WB 4MVTA 1GP5A 5LA1A 5FZ9A 1TMF3 2Q0AA 1TQ5A 4R9DA 3VL8A 2FD8A 4BK5A 2ZAAA 3GALA 1U0AA 2JDMA 3B94A 1SDWA 1VBA1 3B69A 3I3BA 4OULA 3AK0A 5JLVA 4QWNA 2PLV3 1XC6A 2WLQA 2D6KA 1W6NB 2WNUA 1BKZA 2RS13 5HBAA 1YUDA 1RJ8A 2OKXA 4L97A 3KWVA 1PX4A 4IUGA 5FMDA 2VZ3A 3VHOA 3VBFC 4Z2WA 1T6BX 1WLWA 3PMEA 2EIGA 5BPXA 1S0GA 3ITQA 3JD73 5CNAA 3VZJA 1WMDA 2R1DA 5H9QA 1OA2A 2WWUA 1FOD1 2QQVA 2JD9A 4AHZA 1HQNA 3WG2A 1OVPA 1IPJA 1K5MC 3LEMA 4I0AA 1NZIA 3VBUC 1GZCA 2VQTA 3T2OA 3J8F3 1A34A 4KWUA 4QPGB 4JDMA 4IDZA 4S2HA 3ZN5A 2WWSA 3AYEA 2WS93 4M3CE 1IQDC 4A7YA 3E6DA 5K4LA 3J7LA 2ZGNA 1H8VA 4UBGA 5JXJA 3E6CC 4OMDA 3LSEA 2XKOA 3WD5A 1BEV2 1EYBA 2JWPA 1RHI2 4M01A 4ZZ8A 4GH4B 1NA1B 1W90A 1X50A 2DCJA 1J1LA 4R8HA 1PO22 1C5IA 3I2FA 4FOYA 1HLCA 5FYUA 5J36A 4PBOA 2QE3A 1EY2A 3CZJA 1RUF3 5FZ1A 1UNBA 3TNPB 4XCAA 1KJRA 2JIJA 2EVXA 4BIOA 5J3UA 1LHNA 3VDCA 2BNMA 4CEWB 3FN9A 4NRPA 4UOJA 4LR4A 4F3JA 1COV1 3INAA 2ILMA 2PMWB 2JG8A 4HONA 1ZBA3 1GWLA 4WBBA 3UGFA 4O61A 4WVMB 4X6QB 1SZBA 3T1MA 3MPBA 2VMHA 3M3IA 1UIJA 4CPBD 3MIEA 1WW6A 1VAVA 3CNAA 4ISRA 4WVVA 5FP4A 1TMF1 2D3PA 2HKXA 4YGBA 1FNZA 4YGEA 1N47A 4XJZA 2PLV1 2Y6KA 1W2AX 4XUQA 1JMUB 2AZ5A 3POSA 4MGZE 3VBSA 2RS11 4QT6A 4AI3A 5FO8B 3S0MA 4A45A 4LBJA 5FZGA 3ETPA 4H2AA 4AEDB 1GQHA 5GZEA 4JGZB 4CDQC 2RJ2A 5C71A 4FSJA 1ULCA 2RG4A 4IV1A 1HB4A 2PXJA 3JD71 2JEMA 1N1TA 5F5AA 1OPMA 2Q8CA 5IUQA 3AM2A 5DAQA 2NPIA 2XJTA 3FLRA 2JX9A 3AMMA 5A3PA 4IGQA 1R1ZA 2WQ4A 2GC2A 3DF0A 3WZ1A 1YJKA 2W46A 3E6BA 3W5MA 4NRMA 3J8F1 2Q1ZB 1B35B 3IBMA 1IS6A 5FMOL 3GZAA 3VGIA 5C8CC 3UJQA 3SEEA 2WS91 3LE0A 3ZLIA 2P6HA 2VZVA 5ACA2 2P37A 2GC0A 1JOBA 3B02A 5F39A 5IYYA 2C24A 2H6BA 4Z8BA 5FPVA 4P02B 2FZ1A 1W2NA 1E5SA 1GOHA 2QDNA 5IAVA 5BYNA 1NCRC 4TLGA 4OVEA 5JR2A 1IS3A 1V6JA 4W6WA 3T1LA 2R16A 2QQKA 3RYRA 5FLJA 4DY3A 1I5ZA 3ZIXA 1RUF1 2D5HA 5C5TA 1N1SA 1XPWA 5JXHA 4NWVA 2D7FA 5LA9A 4TYSA 3VLBB 1RYYA 2DU0A 1H1IA 4LO5B 2X05A 3WW2A 4BB3A 4R9BA 5T5JA 3UNPA 2ZBJA 5M0TA 2O14A 4UAPA 1UMHA 2E26A 1I5PA 1S2EA 1ZBA1 3AFKA 4HT1T 4QQLA 3IT8A 1LECA 4XZPA 4DUWA 4LBLA 4C8DA 5CKNA 1OOPB 2XUEA 5HXVA 4CCDA 4DNYA 1WUVA 1PZ8A 1F4HA 5FXXA 3BKZA 2P3YA 4QX2A 1C3HA 1RUI3 1EP0A 4XAAA 2BEOA 4TSVA 3OBZA 3UK9A 3I4IA 3KZ4C 3SCGA 2YU1A 4QX0A 2VBBA 1PO13 4CDWC 1AJOA 2UWAA 2W2IA 4ZU7A 1J1TA 3LOBA 2GMMA 4QX1A 2W94A 3UJOA 3ENRA 3RWKX 1OC1A 5A6ZA 4ZKTB 4XQ4A 1VPHA 2IXHA 5C3RA 1C4RA 3ZDSA 5EJ3A 3BTXA 4NIIA 4F83A 1YEWA 1LESA 3LF7A 1SLLA 4CP0A 2ARCA 1PHMA 4XABA 2A7AA 2ADDA 4JRLA 2DU1A 3AFGA 4QPYA 3H8XA 1M06G 4LHLA 4R52A 4J1WA 4JGYB 3JQWA 2VCCA 4ITCA 2HWF2 2VVFA 3V0BB 2HWC2 3LIGA 3U75A 4SLIA 1KRIA 2SBAA 4NOTA 4XUNA 3V64A 2ZMKA 3BCWA 3OYWA 3CJXA 2EIDA 2KXLA 2QQWA 4BQ2A 2PTMA 5FZ6A 3JU9A 1ZRIA 1LEDA 2G1MA 4L92A 2EIEA 5FZAA 3BU0A 2R6QA 1MS4A 2ZEZA 2J1SA 5A3LA 1MS9A 2PAEA 4GIQA 2GALA 4L99A 4TWTA 1OF4A 4WM7B 2PN5A 1PMIA 3T0AA 4QM8A 3SEPA 4AVTA 2XVLA 3I8TA 1X8EA 4PI2A 1LULA 3MIBA 5L9VA 1FI2A 1RMU3 2BDRA 3N9OA 4LA3A 1QDOA 5FPZA 1QDCA 1CZVA 2ZHNA 1H30A 3ILRA 2A6ZA 3ZXLA 4YNIA 3EMRA 2A5ZA 5BNNB 2G9GA 3RG0A 3LEIA 2VECA 4QX7A 1RJ7A 5FZ4A 4N7UA 1AXKA 1C8M2 1O3RA 3VBOC 2R49A 5IVVA 3KV6A 4XETA 1H0BA 1GZTA 1NCQB 2IXLA 4RGKA 4FBFA 4BQYA 5KHJA 1POQA 1CZTA 1RUI1 4DXTA 1XNCA 2P2KA 1UXZA 3USUA 4DO0A 4ZZ5A 3O1TA 3ST7A 5ISLA 4YW4A 3SMHA 4CDXB 5EFUA 1PO11 2VO5A 3ABZA 3ACFA 5FTTC 3SHRA 3WF0A 2QJVA 4ASMB 2D44A 3CMGA 1R1A3 3MPPG 3NJYA 3KD4A 4UF0B 1KGYA 1TNRA 2XXZA 3NW4A 3O0VA 4HSJA 3M3QA 1CAUA 4MO3M 2H0BA 4RQPC 3ZVXA 4DXSA 4FTBA 4MSVA 4YVSB 4N9IA 3LB9A 4Q0VA 1VAMA 3RS6A 5FY5A 4MG2A 1K42A 4OHWA 4LKSA 3SH3A 3V65A 3OBRA 2J1EA 4OLLA 1DZQA 1OFSA 3KT1A 4Y20B 3C7OA 4D69A 4UI9L 3AJZA 4DY5A 5L9RA 3KGLA 1OH4A 1UZWA 4JHTA 4QHOA 2E9QA 4A42A 5JVVA 1Y4WA 5FZBA 2R063 3LDBA 3UT0A 3VBFB 2WWJA 5K0UA 2UWCA 3ZO0B 4YARA 5CKMA 2BJSA 1AYM2 1WCKA 2XOMA 1QNYA 4DRVA 2O1QA 3BU7A 1ASJ3 4O9EA 1QHDA 5IFTA 3R4DB 2F4LA 2XH6A 4R4ZA 2WNEA 4QU2A 4WV8A 5IATA 1K5MB 3VBUB 1W6OA 3HQUA 3P1IA 4PCRA 1RMU1 5FYHA 2VMEA 4PBPA 5K7PA 5DG2A 4MH0E 5LWBA 4YM0A 2X10A 5C9AC 2ZX1A 2JDHA 2B9UA 1K12A 2TNFA 4BE3A 4AQSA 1W0PA 2BPA2 1HIXA 1LGCA 1NE4A 3H1YA 1QOOA 1RXGA 3K77A 5DPNA 1I1EA 1BZWA 4ES8A 3HD8B 1Y9MA 2Y8KA 2KM2A 3HVDA 1ND2A 3OY8B 4UFMA 1LOAA 4FPJA 2WZR3 4Z92B 2BV4A 4YW1A 2CWSA 4LE4A 1GLHA 3KLSA 4EWEA 4DXRA 3ZFEC 4HOOA 3KHCA 5BNQA 1FX5A 2LRPA 2HWE3 3LFIA 3O1SA 5A7WB 2WZ8A 2HBUA 4NHLA 3ACHA 5JWPA 1R1A1 4P9IA 4QB2A 2E7QA 4HN0A 3RMXA 1YJLA 2VY0A 1H4HA 1H8TC 3JB8A 1JBCA 1NZCA 1W6QA 3TOJA 3GZEA 1R083 2Y0IA 3VB9A 4XIKA 3U14A 1ZREA 4INDA 1QWRA 5KC5A 1SBEA 1V6NA 3ZPOA 2RDRA 1G6NA 1H4GA 1MQTA 4A4AA 4E4SA 1WD4A 2PQQA 4LBOA 4U36A 3ZFGC 5FBZA 3O0WA 4RA0A 4QQ2A 2WT1A 4OZXA 5IW0A 4QGMA 5L7OC 2P3IA 5IVFA 2R0FA 4DEQA 4P08A 2ZMNA 4AVSA 4KNCA 1MS1A 2E7TA 2MEV2 4LKDA 2GAUA 1UU4A 1J3QA 2R061 3TN93 4CDQB 5A3UA 3POBA 2GMEA 3K3NA 4XURA 3O1RA 5CBLA 1GSLA 4LKFA 3LIHA 5EJZB 4PDWA 4CDUC 5IVCA 1LNSA 4Y22A 2V72A 1NT0A 1ASJ1 3FBYA 3HQRA 1QIQA 1CX4A 4QPIA 5T55A 1QXPA 3RRDA 5A32B 4CYDA 2ID4A 4CCCA 4QQHA 4K3UA 3Q8BA 1J58A 4IEVA 3FBMA 5FZDA 5IAXA 4UFJA 5A6QA 2BERA 4X6RB 2OQ6A 2JICA 5F3GA 2XJVA 2IXCA 2RR13 2OZJA 1JHNA 2D43A 4XFAA 5ABJC 1SHWB 5F9TA 3NAPC 3MFAA 1IGOA 2ZMLA 2YB7A 3WNLA 4CXYA 1PK6C 1JODA 5JDBA 1H6XA 4FOVA 2DUPA 1JYNA 4LTAA 2WZR1 4BU2A 4EWAA 1SCSA 1RXFA 5E6HA 3JUUA 4XHXA 4JCKA 1BLZA 1HDKA 3H7JA 1X7NA 3K48A 4Q4W3 3AP4A 1VP6A 5A33B 2HBTA 3FLPA 2UURA 2VZTA 4XUOA 2IZWA 4JRAA 1DLCA 2VOTA 2VU9A 3IIIA 1UCXA 3WDXA 2JDNA 5LEJA 1U12A 2YV8A 4FVVA 4HPKA 1UQXA 1CAXA 3KS7A 1I9RA 2ZTNA 3IMMA 3ES1A 5FV3A 1O4YA 1UOFA 3NO8A 1R081 2PELA 3OUJA 2A3XA 2DBIA 1X8MA 5BNPA 5GJ6A 1O6UA 1EUUA 3I3QA 3WOGA 1P8JA 4CDWB 1NY71 2ZGRA 3ON7A 4JDOA 4LUKA 1Z7S2 4RS5A 5JZGC 2ZGQA 1VBB3 1G7YA 2ZKLA 4AZZA 3PUHA 5L19A 3PTRB 4YVWA 3HT2A 4CCJA 3EB7A 1TE1B 1KS4A 1HB3A 3TN91 3VBHC 5FZ8A 5A80A 2XMLA 3DPRA 4Q4X2 1OQ1A 1JU4A 3GDBA 5DQ0A 4BOWA 1TME3 3GBFA 1XNTA 5J1XA 2DUOA 4JQRA 5CG8A 4MHRA 4RFT0 1V9U3 2WT0A 2CV6A 4R9AA 1BMV2 3EHKA 1QQP2 1RUE3 2W3JA 1TNFA 3ATGA 1W3VA 4P5HA 1R092 5E1RA 2W1WA 1WLDA 1ZBE2 2Z4FA 3CU7A 3LQCA 3P3NA 3VKOA 3U0ZA 1GUIA 3WNKA 2Q1MA 2RR11 1JUHA 1MR5A 4GJZA 1UOBA 2OX0A 5CFCC 4MXVA 1LOBA 2BP6A 4TTGA 2G4IA 2HEWF 1SPPB 2OYZA 1BVVA 5F5IA 5FZ3A 5DABA 1VMJA 2Q4SA 4OHXA 1XE7A 3ALQA 2VVEA 5DDJ2 2YGLA 2OUJA 3R6SA 3W59A 1ZZ8A 3FX3A 4FP2A 1CX1A 1VBC3 4NROA 4Q0SA 4M4RA 1VBE3 4LBNA 1PIV3 1HV1A 4Q4W1 1AXYA 4MYEA 3C7GA 3VBRA 1CZSA 2YUEA 1QY4A 1ZZ7A 3ILFA 4DRRA 3VBOB 5JPNB 1RUNA 2XWJB 1Z78A 4HL0A 4WM8A 5LK7B 2W5FA 3EQEA 4LE3A 3TEZA 1REEA 1BBT3 4HK8A 3LDKA 1DGLA 1MPXA 5KXCA 5JPMB 4IEQA 2HEVF 2A3WA 1JTZX 1IZ3A 4EZHA 4P9XA 5FKBA 1DZTA 1X9TA 4AI9A 1MEC3 4V2VA 2JG9A 1IS4A 4JQTA 1VBB1 5LY1A 1KXGA 5GLUA 4F7ZA 1YFYA 4RQPB 3HNBM 3P3PA 3T30A 2A6YA 4W65A 5LRSA 1KJLA 4HLTA 4A7KA 1WCDJ 1F2NA 1V6IA 2O0OA 4JVAA 1VLNA 5HCHA 5FQ0B 2GP3A 1AL22 5C3QA 1TME1 3FUQA 4BA6A 3TEYA 2BBAA 2P3KA 3VD4A 1DGRA 3C2UA 3K2OA 2IFWA 1J83A 1UZVA 1LTEA 1K45A 1V9U1 2YMZA 2B5HA 2EF6A 3FUOA 3O14A 3P6BA 4WVWA 4XF9A 5AC92 2UYBA 4TLFA 1RUE1 3BOPA 4NHKA 1DLLA 5IHRA 4BQ4A 1W6NA 4K9SA 3FMGA 2FDFA 3WV6A 4AVVA 4I2OA 3S7IA 4AQ2A 2WSVA 1UN1A 2LS6A 4GB32 4NPMA 2A70A 3H0OA 2RS52 1H6YA 3E5QA 1OKQA 4IGPA 4MV2A 1RVF3 2GU9A 4R9CA 4XF3A 2X09A 5FYSA 1ZVFA 5HCAA 1CJDA 3MLKA 4LLFA 5FOBB 4CUAA 4Q4V3 1EUTA 5KHKA 3H9AA 4NIGA 1S4CA 5C9AB 1UKGA 5EP9A 1VBC1 4HXCA 4LIUA 2RMU2 1VBE1 1AYN2 4M4PA 5IVEA 1RITA 1YFUA 4B4RA 3C8XA 3UETA 1PGL2 1VB2A 1XNAA 4BCUA 4EWDA 2K2SA 4RD7A 2R072 5DAWA 3VKFC 3MDPA 1QU0A 2C4XA 2DF7A 2W1UA 1OA4A 1JW6A 2YYOA 1WMFA 3H50A 5FYZA 1BBT1 4NPRA 4GH4A 1GP6A 1NA1A 4XHBA 2AUYA 1AHSA 1NE6A 3DEMA 3W9AA 3BALA 3ZFEB 4AL9A 4CEYA 4W6YA 3AB0A 5JIAA 3VD5A 3KHBA 2RVAA 4FTSA 2DTWA 5JOXA 1MEC1 4XPVA 2YPDA 1K3IA 3MEPA 3W58A 4C91A 1RUJ3 1RC6A 1H8TB 2CAVA 2J42A 3ACIA 4XFFA 3T09A 4CEWA 1J59A 3OOXA 3AZWA 3KCYA 2NM1A 2OPKA 4WVMA 2HWD2 3AP9A 2ZZJA 1SDDB 2WA3A 3N7KA 4EN0A 1RUD2 4HVQA 3BTYA 1W99A 4WZCA 4PLMA 5FZKA 1RUH2 5IFPA 2HJIA 4ZONA 3ZFGB 2DVDA 2KA3A 2VZRA 4N8MA 5L7OB 3GZTB 2Y6LA 5EV7A 4CCKA 4AWDA 5L9BA 2GDFA 1LU2A 5F6KA 4ZY9A 5SV8A 3J4UH 3MW4A 4YG0A 4I3PA 5CG9A 2BRTA 3D3AA 4YM2A 1QJEA 4MLOA 4DEVA 2A3YA 1PGSA 2JB4A 4CDUB 1UPIA 3GM8A 3U78A 1DHKB 2XVKA 4DXZA 4LT5A 4YZ1A 1ZX5A 4AEDA 3ZN4A 2Q30A 4JGZA 3IDAA 2CY6A 1JZ3A 1CD3G 4GJYA 3LDRA 2DWRA 3WDYA 5F37A 1ZZCA 3DL3A 3ILNA 3WHUA 1RVF1 4OUEA 4CCNA 4EN7B 1NYWA 5AFEA 2BZDA 4Q4V1 1AR72 1BHGA 1WKYA 5T3NA 1LGBA 2VG9A 5A6XA 1Y7BA 1GQGA 5C70A 5FY8A 5ABJB 1XJAA 2EICA 2Q5TA 3KCXA 1XB9A 5J7MA 3NAPB 4G9SB 3WT3A 4ET7A 5DUVA 1CAVB 1B35A 3I3DA 4AVCA 1AR92 3BOWA 1PK6B 4Q26A 2DTYA 1FPN3 5HCBA 5EWSA 1LU1A 5HPOA 2BGPA 1HRI2 3BODA 1NLRA 3WG3A 3ZM8A 1OHFA 4ONUA 5J96B 1FMD1 4B1MA 4BWOA 2BGOA 2DURA 2TEPA 2P34A 3PUAA 1D4M3 4YZ5A 1DDLA 3OG2A 4CP9B 3M4FA 2ATFA 5FUNA 1I6XA 3NJXA 3S57A 1GYKA 3IAPA 4AOCA 4HKOA 2ES3A 3DCQA 1XNKA 3NV4A 2YHJA 1RUJ1 4KL1A 4ORFA 4N53B 5FO9B 2VC9A 1V0AA 3NNGA 4RFRB 1RINA 2EXKA 3ZMNA 1AR62 1PM4A 5FY7A 5K8SA 1UY2A 1OOPA 2BOJA 1UMIA 3LAGA 2VUDA 3D6EA 2OW4A 5JZGB 5FPXA 3I59B 3NKTA 1YO8A 4AVBA 3CQOA 4IV1C 3HQXA 4YZ4A 3VBHB 5FK7A 2ERFA 2AENA 1D4VB 2C0ZA 4GULA 3A4UA 3OTFA 4HVRA 2RM23 2YROA 2R7EB 2ZHLA 4IEOA 1O5UA 3LA7A 1CIWA 3HWJA 2VUCA 4N43C 3W5NA 5F1RA 1GP4A 4DIQA 3RZKA 2VZQA 4Y4RA 4QKFA 2E32A 5JI7A 5BV6A 1M4WA 5JIUA 4MXWB 1DBNA 4JGYA 5T54A 4YM3A 3USSA 4S2DA 1Y9GA 1IKQA 1LOCA 3B00A 5CFCB 4AK3A 2QQNA 1HXS2 2X29A 2BGCA 4IL7A 2BVVA 1QJY2 3TAYA 4AI1A 2LROA 1W06A 1FPN1 2D3RA 4BQ3A 3VD9A 2W47A 4KU7A 4IE5A 5EXOA 1RUC3 5KR7A 1AL0G 2LUWA 2P1BA 4WM7A 4E8CA 3O1OA 5D8AC 4QKNA 3NNJA 3G6JB 2ZGKA 1QJX2 4XEZA 5HCFA 4BHPA 3K3OA 2ARAA 2ZCWA 3SNMA 1D4M1 1XYOA 1W2UA 3UYJA 2EALA 3BIWE 3AXDA 3TNQA 2D6PA 2P5BA 3K46A 3QLQA 4YWAA 3A0KA 3ZYHA 4YW2A 1PGW2 2XHKA 1U5YA 1O3TA 2C26A 1JI6A 2R1BA 4QM9A 5BNNA 4D7SA 3PVEA 1B09A 2GH2A 3KV4A 4QKBA 4A7ZA 2H0VA 3I97A 3ETQA 5FZIA 4M00A 4CE8A 3DYOA 2BWAA 2ZX4A 5IVBA 5FDBA 4AFDA 3MIFA 3ZXEA 4BPZA 2CGPA 1NCQA 4JKMA 1PVC2 2JKXA 3LEKA 3O0XA 2ZZQA 5LCWL 3AL6A 3N36A 1T2XA 3WNXA 2Z69A 3RZLA 4Q4Y2 3RJRA 2KR2A 3VZKA 2Y33A 3B01A 1QH7A 4MGTA 4UYBA 5B4XA 1ALYA 4CDXA 3NRUA 1MVEA 4UW4A 4B7EA 2VNVA 2RDNA 3PDQA 4IESA 3FL7A 3C7EA 5JOZA 3C7FA 1VALA 5C3SA 1WCSA 4GMP3 1PZ9A 3ROUA 4XMAA 4UF0A 4DFSA 4Y5TA 4XFBA 5C6CA 2RM21 4AEMA 1FV2A 4YVSA 3PIGA 4IEYA 4DUVA 3H3ZA 5EIYB 5I8YA 4FPGA 3LKJA 5JSPA 4ZXEA 1GOGA 3M1HA 5HV4A 5E89A 3SKVA 4Y20A 4G3YC 4NIHA 5A1AA 3MBWA 4Q0UA 2AH2A 1OQDA 3D5OA 1AR82 4PIXA 5A1LA 1W8NA 1BK1A 1HW5A 1REDA 3MI8A 4NHXA 4AXOA 1VRBA 2V09A 1L3JA 1S0FA 3VBFA 2KD7A 2W87A 5JMCA 3PURA 4AVAA 1RUC1 2R0HA 5L36A 1UPSA 5IVJA 2QQMA 4UFHA 2VXJA 4OUSA 4V2WA 4FPYA 2XLAA 1K5MA 3HN1A 3VBUA 4CCLA 3ZSMA 1UY1A 2RDQA 1ZZ9A 3OGVA 3A22A 1RUOA 2V5DA 1UL9A 3DKQA 5BXXA 2XLFA 1BEV3 1RHI3 2YFZA 4HSLA 4CTEA 1OMIA 3ASIA 2CWMA 1PO23 2VM9A 4LULA 4XMIA 2YZ4A 3T3YA 3WDTA 4CSWA 2O8QA 1PNGA 3GHMA 3VD7A 3OY8A 1SACA 1HRV2 4HKLA 5FPAA 4R4XA 1DQ5A 2XJSA 3E5XA 3KT7A 1HB2A 3KV9A 1HJGA 1F31A 1OUSA 4YPJA 3ZXKA 1JYXA 1ST8A 4XTPA 1EAH2 5FYCA 1SLAA 3ZN6B 1GU3A 4B4PA 4CZSA 5A7WA 3RWNA 1ODMA 2IUWA 1N3PA 1OURA 4OQ8A 4GMP1 3RMYA 1GOFA 1AZDA 5LA0A 1VMFA 3KT4A 1A8DA 1ULEA 1JN2P 3RZMA 4A3ZA 2CAUA 4FXKB 2CL2A 2GSYA 4XJWA 4AQTA 1SLIA 1H2NA 4GALA 4BQWA 2B42B 2EA7A 4CPBA 2ZPXA 2FHRA 4FPHA 1CQ9A 3GCXA 3D82A 1O4ZA 4Y5Z0 2VXRA 4BK4A 2AREA 5KHIA 2ZGUA 2ZGMA 1J3PA 3SH4A 4O7XA 1AUYA 3GZUC 5A3TA 4XAEA 1W6PB 3AX4A 4HK9A 4CDQA 4Z1VA 2W1QA 3VDDC 2Y6FA 2JB8A 2VNRA 3VN4A 4QXKA 4Q0PA 2VNOA 3TYJA 3GGLA 1LOFC 3IZOA 1GICA 4ASLA 1XE8A 3L2YA 3M8LA 4META 2XQXA 4QPWA 3F2ZA 5A32A 2D40A 2GNMA 2WABA 3H8UA 1Y43B 3PNAA 3WVJA 3NV1A 4IEZA 5ACA3 2Q1FA 2FMDA 5DAXA 2P6CA 2DVBA 4JKKA 1ND2C 4PQ9A 1BEV1 4AGGA 5F6LB 1RHI1 2XBO2 3AKRA 3O1PA 1DQ2A 1PO21 1DP0A 1ULPA 5FUPA 2ADEA 3C7HA 4MGKE 4RHV2 4CU6A 1UX6A 4GQ7A 3E5UA 2X5IC 4XF1A 4B29A 5C4WA 4Q1RA 1QJU2 5LA2A 2PQSA 2PHFA 2WL1A 1GKBA 1ZA7A 3POFA 5KXBA 5TSWA 2MPFA 1SG3A 2ZJCA 1W28A 5HI0A 3IN9A 4DZGA 2WT2A 2B8MA 2W0XA 1NX9A 3N9MA 2XG3A 4IEUA 3FC0A 5H9PA 1SLTA 1CESA 1OLMA 3MF6A 1MS5A 5G04L 3O12A 3VZLA 4M0HA 4M0NA 2PYTA 4MUVA 4Y1VA 3WXPA 4BQ1A 1A6CA 2JE9A 4XQWA 5GZDA 3ZSEA 5JUVA 1ACCA 5FZEA 1A3KA 1KFXL 1O91A 1ULDA 2BFUS 4CUCA 3WDWA 1O7FA 3Q8FA 4CXWA 5F5QA 4KWKA 3S30A 4CDWA 1S2BA 3B7MA 2RS32 4K1ZA 3BN6A 5ERLA 3CIHA 4AFMA 5KHGA 2BWCA 4FPFA 4HFSA 4WVZA 5LBBA 4EQVA 1VRH2 1RL3A 1XOYA 4LBQB 4COYA 2GN3A 4XUTA 3WLUA 1H2MA 1V70A 5FXZA 2PHWA 2ZOEB 1IQAA 1POV0 2QTWB 4N43B 2YU2A 3NMBA 3VDBA 2HWF3 2RHPA 4LORA 2HWC3 2O8OA 4LHKA 5F3EA 4Q0QA 2QQPA 1WLTA 3RGBA 2P3JA 3WG4A 4OMCA 2ORZA 1AF9A 1EV12 1Q8SA 1NXMA 1OD3A 3HNYM 3D0JA 1FATA 1OQEA 5ACA1 1NKGA 4AQ6A 1IOAA 4COVA 4FI9A 1YFWA 2LM3A 1C1LA 4EN6B 1NLQA 2VTXJ 4LA2A 3WX5A 5GZFA 2R042 4FFHA 4EV0A 3RZGA 2I74A 2XJUA 3HIFA 5D8AB 4W50A 2W95A 3OUIA 2WZPP 2JE7A 5G05L 2C9AA 4XXAA 1SPPA 1Y9QA 4LNVA 4GWIA 2WC2A 2BUKA 1V6LA 3IPVB 2F4PA 5ANQA 2DCKA 1Q8OA 5JMOA 3H1MA 2VZOA 2A1XA 4FPOB 4FAHA 2AEYA 1SLCA 3OJBA 4G4FA 4NMIA 1ULGA 1C8M3 4JKLA 3WDVA 2VOKA 2WO1A 4LLOA 2VVDA 3Q8CA 4H7MA 5BUVA 2R32A 1DCSA 1F5FA 1ULFA 4KMQA 4LO8A 2A6WA 4NO4A 1QKQA 4NAMA 3PJQA 3OD0A 3JBG2 4GWNA 3ZYJB 2QQUA 3RQ0A 4UFKA 1GZWB 1JYTA 2GNTA 4YZ3A 1CVNA 1CAWB 4EN8B 4QHZA 3U10A 3CZUA 3IB3A 4CRQA 3DPRC 2D6MA 1LHWA 1XSRA 3AMPA 3PU8A 2ZEXA 3AZXA 2CHHA 1DG6A 3MV01 3WNPA 2QVSB 4KWLA 1VR3A 4RQPA 3WQ0A 1PX3A 1Q56A 2BNOA 1OD5A 3OPTA 1UOJA 5CA6A 4W8JA 3WF2A 3AKPA 1ZRRA 2XDVA 4P9YA 1BCXA 1G9BA 5FQ0A 4AE2A 1MACA 2HWF1 4BISA 2HWC1 2V73A 5C8CB 4KGGA 2DCYA 3WP6A 1NOVA 3DYMA 1NAEA 4NN0A 2E33A 3WCRA 3I3EA 5DMYA 2HLEA 2CDPA 5BNOC 1AYM3 3Q8EA 4OCTA 2ZGPA 4E2GA 1YCIA 1NCRB 5FPBA 4XJ9A 1G9CA 1OLME 1LRHA 1D2QA 1WZXA 2W91A 3IDEA 4XJAA 4BLJA 3S5QA 3WCSA 2SLIA 4HETA 3SCHA 4IEPA 4LO4B 5JCTA 2ENRA 3MW3A 4IE7A 2J1AA 1KEXA 1W3XA 2B46X 4V1PA 3VHNA 3APBA 3AP6A 2CGNA 3GNEA 3L9JT 5JSRA 1QOSA 4XOGA 1ZNPA 4L0PA 1H1MA 1C1FA 2XGXA 1OH3A 4KWJA 1PIV2 2CYFA 1JZ5A 1JYVA 1YFXA 3HOBA 3OGSA 5EYXA 4KQ7A 2HWB2 5C9AA 2HYKA 1WD3A 2ZGOA 3DXTA 1C8M1 2XKPA 1F15A 3R05A 5FZOB 5JOWA 1XNBA 2ZGLA 1XNDA 2WFF2 3PUQA 1UY0A 3T2TA 2ETEA 3I2OA 1ND3C 4E4DX 1IPSA 1OPOA 1VE0A 2C5DA 1W8TA 3CO2A 4COZA 3AZYA 4OFGA 5DUXA 3ZFEA 4Y1YA 5C3OA 3V0AB 2EXJA 1H2KA 3FHQA 4IGOA 5FY4A 5CISA 1OKOA 2VBPA 3WW3A 5FXVA 1WGPA 3BPSA 1ZA4A 2FBEA 5E8AA 2FQPA 3THDA 2BNNA 5LW9A 1Y3TA 3D8CA 1APNA 1UOGA 3BTAA 1RUG2 2ZHMA 3I54A 1RIRA 1VB4A 2ET1A 3DUIA 1N1VA 3EXUA 1H8TA 3FHAA 3J7MA 4QGLA 1DQ4A 3LZZA 2JDYA 2DBNA 2VUJA 2DUQA 3QACA 2F6BA 3ZIWA 2Y6JA 5CFDC 3HBKA 4EROA 3OBAA 5CYYA 5FP7A 2VQAA 2PHDA 3ZFGA 2IVJA 5GKAC 4A41A 2QKDA 2FCUA 2RE9A 4JTOA 4L2NA 4IEXA 2MEV3 2ZABA 2Z42A 4NRQA 5ANNA 3KGZA 3THTA 3ZFFC 3KVAA 2B45X 3AMQA 2QFEA 2RJKA 4QDSA 2BQPA 1MS8A 1ZZ6A 3B3QE 1AYM1 4BMEA 1XXNA 1REFA 1FXZA 4FFIA 4QKDA 3VDDB 1FT9A 1SLBA 4AG4A 4FFGA 1LHVA 1UYZA 1DGRN 4H3WA 4CDUA 4Y3OA 1YC61 1O3SA 5B2GB 5F3CA 3NKGA 1GMMA 3JB4C 4XBLA 4DOUA 3LOIA 4UW6A 5T52A 4IV3C 4HVOA 2OA2A 1GBGA 4HBNA 1BK0A 1F35A 4Y24A 3ZYRA 2XB6C 1W9YA 5FZ0A 1T6GC 1KQRA 2V4AA 2Z5WA 4N7IA 5FXWA 5GZGA 5IK5A 2C1FA 1ND2B 3KF5A 1W9SA 2Y6HA 1UO9A 3WQ1A 1BJQA 1VBD2 3DGTA 1UU5A 4C0BA 5ABJA 2FCTA 3MHZA 4GH4C 5EQUA 3TBDA 3ZYGA 5A3MA 3MW2A 3RI9A 2RDSA 3AZZA 5F2WA 4CEYC 3CJIC 1JZ8A 4BIFA 5E88A 2VMFA 1PK6A 2X5IB 3O1UA 5DAVA 1DZRA 3PVOA 4NAOA 3BB6A 3N3HA 1VAKA 2VUAA 4P9LA 3JQXA 1MS3A 3VV1A 5CVRA 1DQ6A 4FP3A 4ZU5A 2OQ7A 4CP9A 2VNGA 3E97A 4QXHA 4YM1A 2XL7A 5IK7A 1D2SA 1WCQA 3OGGA 3WP3A 3RPQA 4FPKA 2WZEA 1VBA2 5H9SA 2DYCA 5CKQA 3HEIA 2VZSA 4YGCA 4MGIE 2RV9A 2JDZA 2JD4A 4N53A 4RL7A 1KS5A 2I2SA 3KF3A 3G7DA 2VW2A 1WA4A 2WA4A 4Q5OA 1Z7S3 2C9KA 4Q29A 5I8TA 1LAJA 5F5CA 1Q8VA 4LK6A 2A6VA 1NQJA 2EAAA 3EJKA 5JZGA 2MEV1 1QGLA 2CTVA 2WLPA 2W52A 4Y4YA 5L7OA 3I59A 2WKKA 4Q4X3 1FOD2 3DECA 4CCEA 3ZYIB 4JX0A 3I2KA 4OHVA 1GR3A 3AC0A 4N90A 2AACA 5FWEA 4O65A 3SLIA 1EPZA 1PVXA 2VOXA 3CEWA 4XJ8A 2OIIA 3ZYPA 2BFUL 2FMYA 3MIGA 2D6NA 1QQP3 3N9PA 2EAKA 1R093 5K9YA 1B35C 2ZX0A 4DQAA 1ZBE3 1C8NA 2VMDA 1HX6A 4ATEA 1S55A 2HH9A 4QPGA 4QXBA 3CL1A 4HN1A 2Y60A 1XU2A 4MXWA 5LASA 1X9PA 2WO2A 3WY6A 2GMPA 3UGHA 3VHRA 2ZEWA 4DS0A 1YWKA 4BXSV 2QQLA 5CFCA 2B39A 1FMD3 1EPWA 2MNGA 5J37A 2Z79A 2VMIA
chains in the Genus database with same CATH topology
1OSGA 2RJLA 1COV2 1TEIA 4K7JA 4FQZA 2WFPA 4AF9A 4RR3C 2WNVC 4B7KA 3J26N 4XBNA 3WINE 1JXNA 1SBDA 2XWBB 3M2MA 4FPCA 5FLHA 3FFQA 3WG1A 1TMF2 1DU3D 2WNUC 1HV0A 2UY9A 2ZX3A 1LR5A 1KDKA 2UYAA 2PLV2 4YG6A 1C5HA 2RS12 2ZHKA 3N7LA 3FFZA 4FO9A 1Z7S1 4LO6B 3UV9A 4D7YA 3VKLA 2JJ6A 3AP7A 3JD72 3IIAA 3EBRA 2XVGA 5CAZA 3SXWA 5GLTA 4Q4X1 2I45A 4GKYA 2GN7A 4I3GA 2VW0A 1LGNA 3GBWA 2E63A 4XW3A 1URXA 1YLLA 4LEJA 3QOPA 3VZMA 3J8F2 1BMV1 1LJ7A 5AC93 5CU1A 4NHMA 1QQP1 2WS92 2JXAA 1G9DA 1H2LA 1R091 3U4XA 3R4SA 2DFBA 5KWRA 5BNOB 1ZBE1 4LO7A 4BLIA 3HAGA 3PTYA 5GLVA 5FREA 4HZFA 2BW8A 1SEFA 4XJUA 4WM7C 2EXHA 2RS53 5GM0A 1JOJA 1GZ9A 1JH5A 1RUF2 4K40A 3O7OA 4Z82A 5I93A 5J98B 1QXJA 1KFUL 3FZ3A 4FPEA 5DDJ1 4PIYA 2NMNA 2JG8C 2AGSA 5DZFA 1S1AA 1UZZA 1ZBA2 2RMU3 4B8EA 3RYPA 1AYN3 1XU1A 5GLZA 4FT8A 3X29B 1V00A 4AI8A 2R073 3AYAA 1PNFA 4D7TA 5I8SA 4XF4A 4I09A 4AHXA 2BYVE 2G9FA 4Q27A 1ND3B 1QJZA 2VOVA 5JOYA 3VBSC 4XBQA 3B93A 1G8WA 3AKTA 4J1XA 3MYXA 1AX1A 1DFQA 4CP2A 1S0EA 3FE5A 4LBQD 1AJKA 3WQ7A 4ATFA 1H9PA 3KM5A 4BH9A 3HT1A 5T5PA 4YZ2A 3L2HA 3DKWA 1DYPA 1O3QA 1ZYBA 2HWD3 4YVSC 1ZRFA 4A3XA 4L11A 3VHPA 1RUD3 3ZN6A 3N7MA 1RUH3 1AL21 3ME2A 2E6VA 5CFDB 2PAKA 2UWBA 4B3NA 4QD2A 2OZ6A 5AC91 5SV5A 3ZXGA 2PHRA 3V0BA 3ZFFB 2H6CA 3NWKA 4H14A 4E9KA 3AZVA 3ACLA 4YW5A 3NL1A 3SISA 1IHMA 4GB31 4Q8LA 1S0DA 2FZ2A 3FLTA 4EJRA 2RS51 4AEKA 5FO7B 2R30A 1W6PA 4IV3B 4MGYE 4IERA 4C0HA 1AR73 5KHHA 1Q8QA 3LGRA 1SMVA 2A71A 2RMU1 1AYN1 1WW7A 4FPLA 1AR93 4P14A 1PGL1 2R071 4PJYA 3IDCB 4CEYB 3CJIB 3IKWA 1HRI3 2UY8A 1RUI2 3OF1A 3URFA 4OHYA 1SFNA 2W68A 4M3CB 1PO12 4AGVA 1LB2A 1PM7A 3B5LB 3NVCA 3ZSLA 2YPJA 4AEJA 4Y1UA 4H55A 1HKDA 3AMHA 2D97A 3QCWA 3H7YA 1AR63 1AXZA 1XYPA 2VQ0A 2HWD1 2B7YA 3UL2A 1RUD1 1MZ6A 2QZ2A 4QQPA 1RUH1 1GANA 4LUMA 3I7DA 4BYYA 3NJZA 1YIFA 1MZ5A 2VULA 4FQ4A 4XILA 4YW3A 3PLQA 1LEMA 1AX0A 4BZ4A 1AX2A 3RSJA 3AP5A 3IDBB 4PIZA 4F8AA 4YRDA 3PJYA 4LBQA 1RMU2 2A75A 2YC0A 1F9KA 1X33A 3WUCA 2ZA9A 4WZFA 1AR71 4N43A 2WSUA 3ZXAC 5CB7A 1KD7A 5FAXA 5AVAA 1HXS3 3POYA 1AR91 1QJY3 3ZXFA 5C4WC 2DVAA 4COUA 1HRI1 1SBFA 1LODA 4KH9A 1QJX3 1W6MB 4RR3B 4Q8KA 2WNVB 5D8AA 2WIIB 4Q2FA 1R1A2 3DN7A 2YXSA 3IPVA 4KG0A 1CR7A 1YNAA 1ZZBA 3KMHA 2NYYA 3OCPA 3UKTA 4NVPA 1POV3 1NG0A 2WNUB 3ZPYA 3ZMOA 1AR61 1N3OA 5GZCA 4DB5A 1J3RA 2GC3A 4X8NA 4QMAA 4L8QA 5I0SA 1PVC3 3LA2A 5K0UC 1WBLA 4Q4Y3 2DV9A 1U5ZA 1MZFA 2R062 3RJ2X 4C1WA 1GZWA 3AMNA 3VKNA 1PZ7A 5I0UA 2PHXA 3NV3A 1CAWA 2GNDA 3OGJA 1ASJ2 2D5FA 3HMYA 4XFHA 2DCZA 1RB8G 1ENQA 2VPVA 3VUOA 5AVPA 4GWMA 1OI6A 1DGWA 1W0OA 1LKNA 1SFYA 4GKXA 1CGPA 3B9CA 3Q9OA 4C90A 1N1YA 4P9JA 1JYIA 1ZRCA 2CGOA 1UZYA 1AVBA 3JCIA 1Q3EA 2E7AA 4OHZA 5BY5A 4AFAA 1Q8PA 4AYUA 5C8CA 1AR83 4EN9B 2XPJA 1HXS1 2Y26A 4I30A 5EZWA 1QJY1 3RDIA 2WZR2 1Q5OA 2Z2SB 1WW4A 3EO6A 3M3OA 3B9IA 4GMP0 1NCRA 4PLNA 2BTVC 3FJSA 5DZEA 2JG8B 4DMIA 3AKSA 4Y1XA 1CPNA 2HWE2 1QJX1 1A8MA 4YLZA 4XF0A 1YYNA 1UKRA 3GHNA 2OUHA 5CIRA 3FHIB 1JYCA 1CJPA 2QNKA 1PGW1 1SCRA 2K9ZA 4I0BA 5H9RA 5A33A 2IFRA 4XXPA 1V6KA 1R082 1MQTC 1POV1 4DINB 3VBSB 4LBKA 1NY72 5IK8A 2W39A 1HRV3 1PVC1 3MIHA 1UD1A 3WW1A 1CN1A 2QUOA 4IV1B 4UW3A 4Q4Y1 1A78A 4FOQA 3TN92 5JR7B 4PDWC 4ES9A 1FV3A 3ZXDA 2PAMA 3VZOA 4Q1PA 1EAH3 4KU8A 4QPIC 4ZU4A 3V0AA 3N4MA 1Q43A 5KC6A 3UKVA 1UW8A 2XJQA 1BYHA 1OLRA 5KXDA 4E2SA 3ES4A 3OPZA 3WP5A 4AHYA 2QCSB 3AKQA 1WW5A 4Y26A 3GBGA 3IMNA 4ISQA 4FAGA 3H1WA 2VOWA 2RR12 4JAAA 4X8PA 2ZACA 3MIDA 4S2FA 2ARBA 3LCPA 1AR81 3ZSJA 4O9GA 1CPMA 3H3UA 1QMJA 3RNSA 2ZS6B 4XFIA 1RGSA 5D1IA 3VKMA 3LWCA 5LEKA 2CNAA 3VDDA 1XRUA 5FCCA 3WP4A 1ONAA 4J6GA 1UF2C 4JC1A 4YFWA 3D4KA 3WHTA 1Z0HA 2MHFA 4Q4W2 1QH6A 2NQYA 1LOFA 4E2QA 3TRSB 1LHOA 1YXWA 4P9XA 1G86A 1KDMA 4K6BA 1I3HA 1IPKA 1GFF2 1XYNA 2Y38A 3C3VA 5FLIA 2XL9A 3GYDA 3S7EA 2XBO3 5LK5A 1GNZA 5BNPC 2N7GA 2DFCA 4OUMA 1S2KA 3VBOA 2ZGSA 4RS5C 1S0JA 3PVNA 4RHV3 3THPA 3VZNA 1ENRA 1QJU3 4UW5A 4YVWC 1HRV1 1D0HA 1FNYA 1VBB2 2X5IA 5I0RA 4RGAA 3TB0A 4NWWA 3MZHA 1FAYA 2D98A 4PF5A 2WJSA 1G9AA 4D94A 4P9GA 1U5XA 2YGMA 1EAH1 1ZRDA 1NQDA 4DPNA 1TME2 4AFCA 2DCTA 3N35A 2PHLA 1ENSA 3OYWB 4K1YA 1D0GA 1V9U2 4OI1A 5J48A 2P17A 1N3QA 5T5LA 1RUE2 3WUDA 2YDEA 1YIPA 3IM0A 1IS5A 1F5JA 4YGDA 5FRAA 2VW1A 3LA3A 3CLPA 3MGUA 2PHTA 1C28A 2RS33 1JUIA 2ZX2A 3FWEA 3HR9A 3JZVA 4I01A 3ECQA 4OI4A 5AFBA 5KXEA 1VRH3 5EYYA 3K51A 4BM8A 2IXKA 2IXJA 2QZ3A 3OBTA 4AGRA 3MFCA 3PVBB 2VH9A 1GNHA 1MS0A 2E53A 3I2DA 3M3EA 3RI8A 1DYKA 1RTVA 4YG3A 2I07B 1VBC2 1UU6A 1VBE2 4K8FA 3VBRC 1EV13 4XDQA 4WM8C 4KG8A 1G9FA 2IC1A 5DUWA 1UIKA 4HKWA 2D93A 2ET7A 1NXD1 3SITA 1BBT2 3USUB 2XBO1 1GV9A 5C4WB 2R043 2EXIA 2JECA 4I02A 4XFGA 2VMGA 1O5LA 1CONA 5I0TA 2D3SA 2JG9C 3ELNA 4RHV1 5GLWA 5FOJB 5KBFA 1QJU1 1MEC2 2XUMA 1CAUB 4E27A 2HWE1 1E57A 4AFBA 3KSCA 3IWZA 4CP1A 3QH6A 2D6OX 2NP0A 5GALA 3WDUA 3QD6A 3ZSKA 3LSDA 4N53C 4IEWA 2TBVA 4QX5A 2JENA 4IETA 4Y1ZA 1DF0A 3ZXJA 4GA9A 3JBG3 5K0UB 1VIWB 5C8WA 2IWGB 2ZAHA 4XQDA 2QDRA 1H9WA 2RS31 1C57A 3CF6E 1FYUA 2V5YA 1X82A 1W6OB 5JAXA 1VRH1 4HMZA 2LTNA 1RVF2 4YSFA 3POWA 4QGNA 4Q4V2 2Y0OA 1MZEA 4NR1A 4QPGC 1HQWA 4YFZA 1SQ4A 1S0CA 1EV11 1V6OA 3AYDA 1YI7A 1VJ2A 5C33A 1XQNA 4C1XA 1NA1C 3NAPA 1DQ1A 1ENXA 3AYCA 5BNOA 3PMSA 1CAVA 1UMZA 1OA3A 4GXLA 1FMD2 2R041 3QBQA 2AR6A 4XYXA 4JDNA 3ZX7A 1S0IA 4A2UA 4RSUA 3BPZA 4CEWC 1W6QB 4QHBA 4XE9A 1W39A 2UU8A 3MICA 2DVGA 1RUJ2 3KB5A 3HBZA 1ZM1A 2HWB3 4KBBA 1WLCA 3SCFA 2GNBA 1MQTB 4MX3A 5I91A 4D3WA 3NV2A 2WFF3 3MLJA 1H1AA 5DXDA 3RYKA 3JBG1 3OD4A 1ND3A 2VGDA 3KCCA 5IK4A 1MVQA 4RGGA 4UBHA 5JSOA 4OI2A 4PDWB 3WW4A 5FMOS 4Y22B 4QPIB 3WR0A 4AEDC 4JGZC 2LALA 1LOEA 1HQLA 4K21A 3NSTA 3VBHA 1RUG3 2K0GA 5JI9A 3MF9A 2XLGA 5DUUA 4AHWA 2BBVA 1QF3A 2AYHA 3PHMA 2JKBA 4XFCA 1LCLA 5DG1A 4KGQA 2ZKNA 4MZUA 2TUNA 3AJYA 4P9WA 5CFDA 4URTA 4XIOA 2DVFA 1BQPA 4FOWA 1S0BA 4U2AA 3RZZA 3V56A 3R4UA 4JTNA 1FPN2 2PFWA 3ZFFA 2XJRA 1IKPA 5L73A 4FTEA 2WQZC 1WMEA 4S2GA 2E51A 5DDJ3 3S6PA 4LBMA 1D4M2 1V6MA 4K20A 4XTMA 2W08A 4HPKB 4IV3A 1CAXB 1PIV1 2ZGTA 3QH7A 4YYOA 5T5OA 1VBD3 4ZXKA 3D0SA 2HWB1 5BNPB 5CADA 3VL9A 1OOPC 2NMOA 4W6XA 4RS5B 4LHNA 3U07A 2WFF1 1O4TA 3SH5A 4IXLA 2GZWA 1LHUA 4YVWB 3CJIA 4L9BA 2X8KA 4FCAA 4BMBA 2PA7A 3MLLA 4M3CA 3DPRB 3O5SA 4FXGB 4COWA 1DGWX 3U11A 2ARXA 4JV4A 2D6LX 2RM22 1BVP1 1RUG1 1VBA3 1AL23 3KQRA 1DIWA 3M70A 3R0RA 2WINB 3J9SA 4E4ZA 1QXRA 4JGYC 3DV8A 3GF6A 1BXHA 1WBFA 3AXEA 2NLRA 1KITA 4M3CF 5J09A 1UAIA 1OLQA 3N7JA 1LOGA 3UKNA 4Z07A 1NLSA 4GB33 1FOD3 4AW7A 4HANA 1X36A 1U5IA 4IQPA 2OVUA 1RUC2 5T50A 4H7LA 2NN8A 4B4QA 2GH8A 2A6XA 2A73B 3VBRB 1OFNA 4TZDA 3M3CA 4WM8B 5E16A 2X53S 5BNNC 4QQOA 2PHUA 4OI0A 1LENA 4PLOA 4AI0A 1VBD1 2XJPA 1QNWA 5DZGA 4N9HA 4AI2A 2GC1A 1F8VA 1NCQC 2NZ9A 2HEYF 3TWIA 2JG9B 4SBVA 1QOTA 5FFOC 1COV3 2Q8OA 4CDXC 1YI9A 1YRZA 1DQ0A 3A0NA 2YY1A 1W6MA 4RR3A 5IT6A 2WNVA 1YHFA 4UXAA 2BVBA 3M7AA 2IXIA 4I0WB 4MVTA 1TMF3 2Q0AA 1TQ5A 4R9DA 3VL8A 2ZAAA 3GALA 1U0AA 3B94A 1SDWA 1VBA1 3B69A 4OULA 5JLVA 3AK0A 2PLV3 2WLQA 2D6KA 1W6NB 2WNUA 1BKZA 2RS13 5HBAA 1YUDA 1RJ8A 4L97A 3VHOA 3VBFC 4Z2WA 1WLWA 3PMEA 2EIGA 5BPXA 1S0GA 3JD73 5CNAA 3VZJA 1WMDA 2R1DA 5H9QA 1OA2A 1FOD1 4AHZA 1HQNA 3WG2A 1IPJA 1K5MC 3VBUC 4I0AA 1GZCA 3J8F3 4QPGB 4JDMA 4S2HA 3ZN5A 2WWSA 3AYEA 2WS93 4M3CE 4A7YA 3E6DA 2ZGNA 1H8VA 4UBGA 3E6CC 3LSEA 2XKOA 3WD5A 1BEV2 1EYBA 4M01A 1RHI2 4GH4B 1NA1B 1X50A 2DCJA 1J1LA 4R8HA 1PO22 1C5IA 4FOYA 1HLCA 5J36A 4PBOA 2QE3A 1EY2A 1RUF3 3TNPB 1KJRA 2EVXA 4BIOA 5J3UA 1LHNA 2BNMA 4CEWB 4LR4A 4F3JA 1COV1 3INAA 2ILMA 2JG8A 1ZBA3 4WBBA 4WVMB 4X6QB 3T1MA 3MPBA 2VMHA 3M3IA 1UIJA 3MIEA 1WW6A 1VAVA 3CNAA 4ISRA 4WVVA 1TMF1 2D3PA 2HKXA 4YGBA 1FNZA 4YGEA 1N47A 4XJZA 2PLV1 2AZ5A 3POSA 4MGZE 3VBSA 2RS11 4QT6A 4AI3A 5FO8B 3S0MA 4LBJA 4AEDB 1GQHA 5GZEA 4JGZB 4CDQC 4FSJA 1ULCA 4IV1A 3JD71 2JEMA 1N1TA 1OPMA 5IUQA 3AM2A 2NPIA 2XJTA 3FLRA 2JX9A 3AMMA 1R1ZA 2WQ4A 2GC2A 3DF0A 3WZ1A 1YJKA 3E6BA 3J8F1 2Q1ZB 1B35B 3IBMA 1IS6A 5FMOL 3GZAA 3VGIA 5C8CC 3UJQA 2WS91 5ACA2 2P37A 2GC0A 3B02A 2H6BA 4Z8BA 2FZ1A 2QDNA 5BYNA 1NCRC 4OVEA 1IS3A 1V6JA 4W6WA 3T1LA 2R16A 3RYRA 5FLJA 4DY3A 1I5ZA 3ZIXA 1RUF1 2D5HA 1N1SA 4NWVA 2D7FA 4TYSA 3VLBB 2DU0A 1H1IA 4LO5B 3WW2A 4R9BA 5T5JA 2ZBJA 4XZPA 1ZBA1 3AFKA 4HT1T 4QQLA 3IT8A 1LECA 4LBLA 1OOPB 5HXVA 4DNYA 1WUVA 1PZ8A 1C3HA 1RUI3 1EP0A 2BEOA 4TSVA 3UK9A 3I4IA 3KZ4C 3SCGA 1PO13 4CDWC 1AJOA 2UWAA 4ZU7A 1J1TA 3LOBA 2GMMA 3UJOA 3ENRA 4ZKTB 4XQ4A 2IXHA 1C4RA 3ZDSA 5EJ3A 4F83A 1LESA 4CP0A 1SLLA 1PHMA 2A7AA 4JRLA 2DU1A 3AFGA 4QPYA 1M06G 4LHLA 4R52A 4J1WA 4JGYB 3JQWA 4ITCA 2HWF2 2VVFA 3V0BB 2HWC2 4SLIA 1KRIA 2SBAA 4NOTA 3V64A 2ZMKA 3BCWA 3OYWA 3CJXA 2KXLA 2PTMA 3JU9A 1LEDA 4L92A 2R6QA 1MS4A 5A3LA 1MS9A 2PAEA 4GIQA 2GALA 4L99A 4TWTA 4WM7B 2PN5A 1PMIA 4QM8A 4AVTA 2XVLA 3I8TA 1X8EA 1LULA 3MIBA 1FI2A 1RMU3 4LA3A 1QDOA 5FPZA 1QDCA 2ZHNA 1H30A 3ILRA 2A6ZA 3ZXLA 4YNIA 2A5ZA 5BNNB 2G9GA 3RG0A 2VECA 1RJ7A 4N7UA 1AXKA 1C8M2 1O3RA 3VBOC 2R49A 4FBFA 4XETA 1H0BA 1NCQB 2IXLA 5KHJA 1RUI1 1XNCA 2P2KA 3USUA 3ST7A 4YW4A 3SMHA 4CDXB 5EFUA 1PO11 5FTTC 3SHRA 2QJVA 4ASMB 2D44A 1R1A3 3MPPG 3KD4A 1TNRA 3NW4A 3O0VA 4HSJA 4RQPC 3M3QA 1CAUA 2H0BA 3ZVXA 4FTBA 4MSVA 4YVSB 4N9IA 3LB9A 4Q0VA 1VAMA 3RS6A 4OHWA 3SH3A 3V65A 3OBRA 4OLLA 1DZQA 1OFSA 3KT1A 4Y20B 4D69A 3AJZA 4DY5A 3KGLA 2E9QA 5JVVA 2R063 3VBFB 5K0UA 2UWCA 3ZO0B 4YARA 1AYM2 1WCKA 1QNYA 4DRVA 2O1QA 3BU7A 1ASJ3 4O9EA 1QHDA 3R4DB 2XH6A 4R4ZA 2WNEA 4QU2A 4WV8A 1K5MB 3VBUB 1W6OA 4PCRA 1RMU1 4PBPA 5K7PA 5DG2A 4MH0E 4YM0A 5C9AC 2ZX1A 2B9UA 2TNFA 4BE3A 4AQSA 1W0PA 2BPA2 1LGCA 1HIXA 1NE4A 3H1YA 1QOOA 1I1EA 1BZWA 4ES8A 3HD8B 3OY8B 2KM2A 1ND2A 1LOAA 4FPJA 2WZR3 4Z92B 4YW1A 2CWSA 4LE4A 1GLHA 3KLSA 4EWEA 3ZFEC 5BNQA 1FX5A 2HWE3 4NHLA 5JWPA 1R1A1 4P9IA 2E7QA 4HN0A 3RMXA 1YJLA 2VY0A 1H4HA 1H8TC 3JB8A 1JBCA 1NZCA 1W6QA 3TOJA 1R083 2Y0IA 4XIKA 1ZREA 4INDA 1QWRA 5KC5A 1SBEA 1V6NA 4E4SA 1G6NA 1H4GA 1MQTA 1WD4A 2PQQA 4LBOA 4U36A 3ZFGC 5FBZA 3O0WA 4RA0A 4QQ2A 2WT1A 4OZXA 5L7OC 4QGMA 2P3IA 2R0FA 2ZMNA 4AVSA 4KNCA 1MS1A 2E7TA 2MEV2 3TN93 2GAUA 1UU4A 1J3QA 2R061 4CDQB 2GMEA 5CBLA 1GSLA 4CDUC 4PDWA 4Y22A 3FBYA 1ASJ1 1CX4A 4QPIA 5T55A 1QXPA 3RRDA 5A32B 4CYDA 4QQHA 4K3UA 1J58A 4IEVA 3FBMA 4X6RB 2JICA 2XJVA 2IXCA 2RR13 2OZJA 1JHNA 2D43A 4XFAA 5ABJC 5F9TA 3NAPC 3MFAA 1IGOA 2ZMLA 1PK6C 5JDBA 4FOVA 2DUPA 4LTAA 2WZR1 4EWAA 1SCSA 3JUUA 4XHXA 4JCKA 1HDKA 3H7JA 1X7NA 3K48A 4Q4W3 3AP4A 1VP6A 5A33B 3FLPA 2UURA 2IZWA 4JRAA 2VU9A 1UCXA 3WDXA 5LEJA 1U12A 2YV8A 4FVVA 4HPKA 3KS7A 1CAXA 1I9RA 2ZTNA 3ES1A 1O4YA 3NO8A 1R081 2PELA 2A3XA 1X8MA 5BNPA 5GJ6A 3WOGA 4CDWB 1NY71 2ZGRA 4JDOA 4LUKA 1Z7S2 4RS5A 5JZGC 2ZGQA 1VBB3 1G7YA 2ZKLA 5L19A 4YVWA 3HT2A 1TE1B 1KS4A 3TN91 3VBHC 3DPRA 4Q4X2 1OQ1A 4BOWA 1TME3 3GBFA 2DUOA 4JQRA 5CG8A 4RFT0 1V9U3 2WT0A 2CV6A 4R9AA 1BMV2 3EHKA 1QQP2 1RUE3 1TNFA 3ATGA 4P5HA 1R092 5E1RA 3CU7A 1WLDA 1ZBE2 3P3NA 3VKOA 3U0ZA 2Q1MA 2RR11 1JUHA 1MR5A 5CFCC 4MXVA 1LOBA 2G4IA 2HEWF 2OYZA 1BVVA 2Q4SA 4OHXA 1XE7A 3ALQA 2VVEA 5DDJ2 2YGLA 2OUJA 3R6SA 3W59A 1ZZ8A 3FX3A 4FP2A 1VBC3 4Q0SA 1VBE3 4LBNA 1PIV3 1HV1A 4Q4W1 1AXYA 4MYEA 3VBRA 5JPNB 2YUEA 1QY4A 1ZZ7A 3ILFA 4DRRA 3VBOB 1RUNA 2XWJB 1Z78A 4HL0A 4WM8A 5LK7B 3EQEA 4LE3A 1REEA 1BBT3 4HK8A 1DGLA 5KXCA 5JPMB 4IEQA 2HEVF 2A3WA 1JTZX 1IZ3A 1DZTA 1MEC3 2JG9A 1IS4A 1VBB1 1KXGA 5GLUA 4F7ZA 1YFYA 4RQPB 3P3PA 2A6YA 4W65A 5LRSA 1KJLA 4HLTA 4A7KA 1WCDJ 1F2NA 1V6IA 2O0OA 4JVAA 1VLNA 5FQ0B 1AL22 1TME1 3FUQA 4BA6A 2P3KA 1DGRA 3C2UA 2IFWA 2YMZA 3FUOA 1LTEA 4WVWA 1V9U1 5LRRA 2B5HA 2EF6A 3O14A 4XF9A 5AC92 2UYBA 4TLFA 1RUE1 3BOPA 4NHKA 1DLLA 1W6NA 4K9SA 3FMGA 3WV6A 4AVVA 4I2OA 3S7IA 4AQ2A 2WSVA 1UN1A 4GB32 2A70A 3H0OA 2RS52 3E5QA 1OKQA 4MV2A 1RVF3 2GU9A 4R9CA 4XF3A 1ZVFA 5HCAA 1CJDA 3MLKA 4LLFA 5FOBB 4Q4V3 5KHKA 3H9AA 5C9AB 1UKGA 1VBC1 2RMU2 1VBE1 1AYN2 1RITA 1YFUA 4B4RA 1PGL2 1VB2A 4BCUA 4EWDA 2K2SA 4RD7A 2R072 3VKFC 3MDPA 1QU0A 2DF7A 1OA4A 1JW6A 2YYOA 1WMFA 3H50A 1BBT1 4NPRA 4GH4A 1NA1A 4XHBA 2AUYA 1AHSA 1NE6A 3ZFEB 3W9AA 3BALA 4CEYA 4W6YA 3AB0A 5JIAA 4FTSA 2DTWA 1MEC1 4XPVA 3MEPA 3W58A 4C91A 1RUJ3 1RC6A 1H8TB 2CAVA 4XFFA 4CEWA 1J59A 3AZWA 3KCYA 2NM1A 2OPKA 4WVMA 2HWD2 3AP9A 2ZZJA 2WA3A 3N7KA 4EN0A 1RUD2 4HVQA 4WZCA 4PLMA 1RUH2 2HJIA 3ZFGB 2DVDA 2KA3A 5L7OB 3GZTB 5EV7A 4AWDA 2GDFA 1LU2A 5F6KA 5SV8A 3J4UH 3MW4A 4YG0A 4I3PA 5CG9A 4YM2A 4MLOA 2A3YA 1PGSA 4CDUB 1UPIA 4LT5A 1DHKB 2XVKA 4DXZA 4YZ1A 1ZX5A 4AEDA 3ZN4A 2Q30A 4JGZA 2CY6A 1CD3G 2DWRA 3WDYA 1ZZCA 3DL3A 3ILNA 3WHUA 1RVF1 4EN7B 1NYWA 5AFEA 4Q4V1 1AR72 5T3NA 1LGBA 2VG9A 1Y7BA 1GQGA 5ABJB 2Q5TA 3KCXA 5J7MA 3NAPB 4G9SB 3WT3A 5DUVA 1CAVB 1B35A 4AVCA 1AR92 3BOWA 1PK6B 4Q26A 2DTYA 1FPN3 5HCBA 5EWSA 1LU1A 1HRI2 3BODA 1NLRA 3WG3A 1OHFA 4ONUA 5J96B 1FMD1 4BWOA 2DURA 2TEPA 2P34A 1D4M3 4YZ5A 1DDLA 3M4FA 2ATFA 1I6XA 1GYKA 4HKOA 2ES3A 3NV4A 1XNKA 2YHJA 1RUJ1 4KL1A 4ORFA 4N53B 5FO9B 1RINA 2EXKA 3ZMNA 1AR62 5K8SA 1OOPA 3LAGA 3D6EA 2OW4A 5JZGB 5FPXA 3I59B 3NKTA 1YO8A 4AVBA 4IV1C 3VBHB 3HQXA 4YZ4A 2AENA 2ERFA 1D4VB 2C0ZA 4GULA 3A4UA 3OTFA 4HVRA 2RM23 2YROA 2ZHLA 4IEOA 1O5UA 3LA7A 1CIWA 3HWJA 4N43C 5F1RA 5JI7A 5BV6A 1M4WA 5JIUA 4MXWB 1DBNA 4JGYA 5T54A 4YM3A 3USSA 4S2DA 1IKQA 1LOCA 3B00A 5CFCB 4AK3A 2X29A 1HXS2 2BGCA 4IL7A 2BVVA