4QDRA

Physical basis for nrp2 ligand binding
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
321
structure length
314
Chain Sequence
HMQCNVPLGMESGRIANEQISASSTYSDGRWTPQQSRLHGDDNGWRPNLDSNKEYLQVDLRFLTMLTAIATQGAISRETQNGYYVKSYKLEVSTNGEDWMVYRHGKNHKVFQANNDATEVVLNKLHAPLLTRFVRIRPQTWHSGIALRLELFGCRVTDAPCSNMLGMLSGLIADSQISASSTQEYLWSPSAARLVSSRSGWFPRIPQAQPGEEWLQVDLGTPKTVKGVIIQGARGEARAFVRKFKVSYSLNGKDWEYIQDPRTQQPKLFEGNMHYDTPDIRRFDPIPAQYVRVYPERWSPAGIGMRLEVLGCDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neuropilin-2
publication title Structural Basis for VEGF-C Binding to Neuropilin-2 and Sequestration by a Soluble Splice Form.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 76
structure length 314
sequence length 321
ec nomenclature
pdb deposition date 2014-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4qdrA01
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4qdrA02
5JXHA 2W1WA 2Y6LA 2PQSA 2BZDA 1CZVA 3MV01 1XNAA 1UX7A 1OF3A 2VZVA 2J22A 1GU3A 4RN5A 3I97A 2VZQA 4UOJA 3LEGA 2QQNA 2ZXQA 5EIYB 3VD3A 1EUTA 5IFPA 4OMCA 2ORXA 1J83A 1JHJA 4QPWA 2YFZA 3FHAA 3OEAA 2YG0A 3IAQA 5JXJA 2Y6JA 2LS6A 2WABA 1UY3A 1WKYA 4XUQA 2ZEXA 1LNSA 5I0DA 1KGYA 3W5NA 3A22A 3P1IA 4HG6B 4W50A 4LKSA 3DECA 1UMIA 1F4HA 2JE8A 3WNPA 2YC4A 4LQRA 1ULOA 5LA2A 1OH4A 2QQKA 2VR4A 2J1AA 4QX2A 3IB3A 5FUIA 3UNPA 3A7QA 2VJXA 2WO1A 4CUCA 1W99A 3I2HA 3VDAA 3CQOA 4CU7A 1UWWA 3T0BA 5C7GA 2J7MA 2E33A 3WNKA 1UYYA 2W5FA 3LEIA 2VCCA 2QQLA 4MGSA 3THDA 1JZ5A 1JZ4A 2V5DA 2W94A 1KEXA 2VL4A 2WZ8A 2ORZA 4XZUG 1L7RA 3NRUA 3ABZA 1I5PA 3EYPA 4DXRA 1PMJX 4XURA 4CUAA 5IJRA 5LCWL 2KD7A 1GQPA 3OGVA 4XVHA 3THCA 2EIEA 2R7EB 4W4ZA 4CUBA 4QDRA 5HXMA 1K42A 4BK4A 4JX0A 1JYVA 5IYYA 2CDOA 2YFUA 2JD9A 1PMHX 1P8JA 4M4RA 4DXSA 4QB1A 2WAOA 2VC9A 3E1F1 4ARYA 4BJ0A 1NUKA 3HNBM 2WAAA 1NAEA 3WF1A 4QX0A 3CDZB 3MUZ1 1US2A 2LW8A 3PUIA 2Y8KA 4A42A 3F2ZA 1MPXA 4QDSA 4A4AA 3ACFA 4BDVB 1UZ0A 3GDBA 4XUPA 2VQUA 3VD5A 2JKXA 2W95A 1ULPA 5EJZB 3LQCA 5G04L 4UAPA 4QDQA 3UETA 2VZ3A 3ACIA 4KWUA 3T0DA 4ZZ8A 2Z4FA 3OEBA 2YC2A 3LE0A 4KMQA 2VM9A 3WNMA 4QB2A 1O8PA 4AG4A 3DYMA 5B4XA 1R64A 4E8DA 1TVGA 4AAXA 5CZKA 1SHWB 3SKVA 2VMFA 1DYOA 3SEEA 4ZY9A 3HN3A 4W8JA 2J1VA 5B4NA 3I2IA 2YB7A 5DPNA 4D8MA 4L0PA 2L9LA 2BGPA 3BN6A 2WN3A 2RJ2A 3LPGA 1GUIA 5IFTA 4LPLA 2X05A 5C71A 2WQ8A 4A45A 1W9TA 4LHSA 2VMCA 3ZM8A 3P6BA 4PT6A 2ZEYA 3WNLA 3WNOA 1CZSA 4BK5A 2WBKA 2WYSA 1PX4A 1GMMA 3HNMA 3I2JA 5JR2A 1H6XA 3ACGA 3OGSA 4CVUA 4XUOA 4OUEA 4QAWA 1CX1A 3SEPA 2V4VA 2XOMA 4BXSV 3FHQA 1EUUA 1W9WA 1K12A 3GM8A 3GGLA 2EIDA 4D0QA 2RVAA 2V72A 3HNYM 2W87A 1J84A 3I2GA 1JZ7A 3AC0A 5DN2A 1JU4A 2QQOA 1US3A 2W1UA 3C8XA 3C7GA 3MBWA 3NJXA 4FI9A 4OMDA 2QQMA 3T0AA 4GWJA 1XNTA 1CIYA 4M4PA 4ET7A 4MADA 5F7UA 2WN2A 1UMHA 3J7HA 4CU9A 3CKHA 4DXTA 1UYZA 3UESA 3K77A 1T2XA 2Y6GA 5JUVA 2W9XA 1CZTA 4OZOA 3FN9A 4XUNA 3DYPA 3D3AA 2QQJA 3WF3A 3NQHA 1UYXA 2VQTA 3T08A 5A1AA 3T09A 1TG7A 4P02B 3I2FA 3T2OA 3PUHA 4DEVA 1SG3A 2VTFA 1GNYA 3VD4A 3OGRA 5J1XA 4DUXA 2J1SA 4ZZ5A 3K4DA 2HLEA 2E26A 2WDBA 1NKGA 2Y64A 1GOGA 4QX3A 4DUWA 1BHGA 3C7HA 3LPFA 4TTGA 4JKMA 4MOAA 2C26A 4DEQA 1SDDB 1XPWA 3MUY1 2ZEWA 3U37A 4OYUA 1JYWA 1GOHA 2B9VA 2VCBA 1O8SA 5EJ1B 2W3JA 2J1EA 1JZ6A 2J1RA 5IHRA 3ETPA 2WZEA 4A6OA 2VZ1A 3MV11 3GXUA 4JKLA 5C70A 3T2PA 1JZ8A 4PF1A 3I3BA 3I3EA 2ZEZA 1DLCA 4MO3M 4ZXEA 1HN1A 3K4ZA 2W46A 3A23A 3I3DA 2BGOA 3MO4A 3HEIA 2BERA 2VCAA 2XHNA 4E8CA 1W8NA 4P08A 2HYXA 3CZJA 1XC6A 4P00B 4QX1A 3A21A 2W1QA 1K3IA 5G05L 3LEKA 3VD9A 3ECQA 2VZTA 3HPNA 5HPOA 1OD3A 2VZPA 1UXZA 1JYNA 1DP0A 2QQIA 2DDUA 1UXXX 5DMYA 1JU3A 2B4KA 1K45A 3WEZA 2WUHA 2WO2A 2WO3A 2VO5A 4XUTA 5JMOA 2VMDA 4A44A 1OF4A 4P5YA 5LA0A 2W92A 4YPJA 3VD7A 3I2KA 3OBAA 1NX9A 3OG2A 2CDPA 1L7QA 3WQBA 2JDAA 2QBXA 2DCJA 1IQDC 2C4XA 4JKKA 1UY4A 4MGQA 1PX3A 2XQXA 4IUGA 2VZRA 4A3ZA 2J1TA 3VDCA 3CZUA 3SKJE 3CMGA 3K46A 5JXGA 3WF4A 3BGAA 2W1SA 3CIHA 5JXIA 2VZSA 2Y6HA 3WNNA 5LA1A 4RYDA 3W5MA 3NNGA 2ID4A 2Y6KA 1YQ2A 2E31A 4GWIA 4KI5M 3IAPA 1F4AA 1UY1A 2RV9A 3WSOA 2J1UA 1W9SA 4Z2AA 1GOFA 3C7OA 1JI6A 3OB8A 1O59A 3WF2A 1RYYA 2DCKA 2W47A 3K4AA 3NJVA 1JZ3A 1UY2A 2XONA 1WCQA 3C7FA 4UI9L 2VZOA 2EIBA 4GZ9A 3JXSA 3K75B 2OKXA 2E32A 2EICA 4CU6A 2C9KA 1W0NA 3EB7A 3DYOA 2W91A 3HOBA 5DQ0A 4ARXA 4TXWA 3IIIA 1H6YA 5CYYA 2X09A 4PQQA 4A41A 4CU8A 1JZ2A 2BBAA 4QB6A 1JYXA 2VMEA 1UY0A 3T2QA 3FL7A 3C7EA 1W8OA 2VOTA 3HJRA 3ACHA 4DUVA 3WF0A 2X10A 3VDBA 1OT5A 4JHZA 2VZUA 3IDAA 1D7PM
chains in the Genus database with same CATH superfamily
4BMBA 5JXHA 1DLLA 3WLUA 4YFZA 4FQ4A 2BZDA 1CZVA 4EWEA 3WUDA 2JDMA 2ZX0A 2EXIA 4N53A 1XNAA 1UX7A 2BNNA 2D3SA 2VZVA 5KXEA 2XWBB 1DIWA 2EXHA 3NAPA 4Q0SA 3I97A 4IQPA 3OJBA 1DFQA 4CDQB 2VUDA 3O0WA 4EYUA 2ZGOA 4OULA 4FOQA 4RD7A 4WZFA 5FYSA 5GLVA 1LAJA 2VG9A 1WLCA 4AEDA 1B35A 1UAIA 2ZTNA 2RS53 3KCXA 2ORXA 4FFIA 1H9PA 5TSWA 2F17A 1OLQA 4XC9A 5FZ4A 2YFZA 3F95A 3VBSC 5LK7B 5JXJA 3OF1A 3WW4A 2AENA 1X82A 2GP3A 2D6LX 2TBVA 4B4PA 4BQWA 4AGGA 5FY8A 1YHFA 2ZEXA 1LNSA 4K7JA 3V56A 4YM0A 1E5HA 1RUD1 1ZNPA 2BFUL 5LBBA 3WP5A 3NV3A 1H4GA 1ZZBA 5FYIA 1LHVA 2UWCA 4CDUA 4XFBA 1R1A1 4F83A 3WHUA 4CCNA 4XJ9A 1SBEA 1T6BX 2JD4A 3QOPA 2JE8A 1SLIA 2HEYF 4CCCA 5C4WA 3VHRA 4WM8B 4XCBA 1Y9QA 1ACCA 4AHXA 5FP7A 2O1QA 3LGRA 2SBAA 1RXFA 2IXCA 1J58A 1ZYBA 3VBFA 4E2GA 5HCAA 1GP6A 3TWIA 4JRLA 5FZIA 4AL9A 5FLJA 2WNUA 2GMMA 2UY8A 1DDLA 3VDAA 1DYKA 1JOPA 1SBDA 3GJAA 1LKNA 5BNPA 3ILNA 2J7MA 1DZRA 2RS52 1FOD1 2E33A 4W6WA 3C3VA 3GALA 3VZJA 3MHZA 3RDIA 2VCCA 3FBYA 1VBB1 1NCQB 1MEC1 2WZ8A 3NRUA 3ABZA 1J1LA 4JQRA 1VLNA 3O1OA 2A6YA 5GZFA 4V2WA 2J42A 2R1BA 2VMHA 2ZJCA 3I54A 4XURA 4CUAA 4CRQA 1VBC1 3R0RA 4EE2A 5C3OA 1RJ7A 3FE5A 3E97A 5SV8A 1AR91 2NYYA 1SLLA 1H8TA 4DRVA 2R30A 1S0CA 3ZFEA 5CG9A 5HCBA 4MSVA 2K46A 4XVHA 2A7AA 3PUSA 4QMAA 4W4ZA 5LY1A 1W3VA 1O3SA 4AE2A 1K42A 1A8DA 3DPRA 3H9AA 3WDVA 1AL0G 4QKDA 2PTMA 4XDOA 4CCEA 4IW3A 5F2SA 1DG6A 3ZN4A 1QXPA 2YMZA 2FDIA 4FFFA 4QPIC 4AI0A 4LKFA 1WCDJ 2V5YA 2XUMA 3ORJA 4CA9A 1BQPA 2OUHA 1W6NB 2BRTA 1ZBE3 2QQUA 4QB1A 4QQLA 3RPQA 4HPKA 2QCSB 4CYDA 4ARYA 3O12A 1F2NA 2X53S 2I45A 2WAAA 1RUI1 1NAEA 1XNBA 5FZOB 3LIGA 3CDZB 1UPIA 2VXJA 4QX0A 5FMOS 3WF1A 2D43A 1ZZCA 1LESA 1ND2B 3MUZ1 4AFCA 3PUIA 4BWOA 2GSYA 5FY9A 3J7MA 4X6RB 5FMDA 5A7WB 4IEUA 3VD5A 2JKXA 4D3WA 4IGPA 1ULPA 5DDJ1 5EJZB 3I59B 4Z8BA 1V6IA 2D7FA 3LQCA 4N9HA 1OA4A 3GBGA 4K6BA 4V1PA 1OKOA 3RYRA 1AL23 3VBOB 3VDDA 1AJKA 2GAUA 3M70A 4B4RA 2FMDA 4QDQA 1GV9A 1CAWA 5JIUA 3ACIA 1LJ7A 4YVWA 4QXBA 1YXWA 2ZMLA 2WWSA 4ZONA 4ZZ8A 1VRBA 4CEYC 1RC6A 2P3YA 3LE0A 4KMQA 5FLHA 4B1MA 1G7YA 4UT5A 4CPBA 5BNNC 2DF7A 1JTZX 4DPNA 3I4IA 1R081 3EBRA 5FPBA 4I3GA 4QB2A 3T1MA 4AG4A 4CDXA 4QQHA 2XR4A 2Q8OA 1R64A 3AMQA 2DTYA 1Z7S3 1HX6A 2WS92 4E8DA 1TVGA 4AAXA 2BOJA 4W6XA 5C5TA 3VKMA 2RR13 5CZKA 4NPRA 2R0HA 3APBA 5DAXA 4QGLA 1F8VA 4W8JA 1YC61 5BY5A 1QOOA 2WZPP 4Q4Y1 2R49A 1ULEA 2XBO1 3NKTA 5CVRA 4FOVA 4OQ9A 4AHWA 2C0ZA 5FP8A 1W8FA 2BGPA 3BN6A 2R041 2UWAA 4QX8A 2WNVA 1AL22 5F1RA 3POFA 1GUIA 2RS13 4HMZA 4MXWA 4BIFA 1K5MB 1W2OA 5HV0A 1ND3C 3PIJA 4Q1PA 2WQ8A 3NJYA 4S2DA 1PO11 1ASJ2 4AQ6A 3CJIA 1OBNA 1EYBA 2NMOA 4AFAA 2WZR1 4LHSA 3UJQA 5GZGA 3WV6A 1I9RA 1H8VA 3P6BA 4PT6A 2ZEYA 2ZHLA 2GH2A 1CZSA 3E5XA 2HWD2 4YM2A 1QNWA 3KHCA 1BBT3 5A7PA 3MLJA 2XKOA 5T3NA 3EO6A 2QUOA 5A6YA 3I2JA 4V2VA 5JR2A 1XNDA 3JU9A 1C8M1 1OMIA 2RR12 3ACGA 1PO21 2X5IA 4OLLA 4XUOA 3K3OA 5FBZA 5FIXA 4QAWA 4LXLA 2RDSA 4RGAA 4NHYA 5A1LA 3M3OA 1OH3A 3CNAA 5FZLA 3LSDA 2BDRA 2VQ0A 2AYHA 2DVFA 3N7MA 4QKBA 4Z2WA 5I8YA 5IK7A 3T4VA 2EIDA 1UQXA 3ETQA 4ZU5A 1JYTA 1PNFA 1JZ7A 2W87A 5A33B 3EXUA 1ZX5A 1RUE2 3JUUA 4NN0A 1V0AA 2NLRA 3O5SA 4H55A 4DQAA 4LJHA 2PFWA 2D6KA 1JU4A 2ATFA 2QQOA 4N7IA 5DN2A 3ZYBA 5IVEA 5ACA1 2X8KA 4XFCA 5JI7A 1YI9A 4YZ5A 5K4LA 1XNTA 4FT8A 3OPZA 3ASIA 3OD4A 4PDWC 4UW6A 4XHBA 4M4PA 2Q8DA 1NA1B 2PHFA 4ITCA 4C8DA 1W6OA 2D44A 2WN2A 3KGZA 5E16A 4CSWA 2IXJA 4DXTA 1CESA 4AQTA 2XLGA 1D2QA 4AVCA 4CP9A 1UYZA 3K77A 2JG8A 5BNOB 4HT1T 4QQPA 1JHNA 2ARXA 4ZU7A 5LRSA 4GWNA 4OZOA 2ZKNA 1V00A 4LO7A 4AFBA 5F3CA 3FLTA 4IDZA 5FZKA 1UF2C 2QQJA 3TN93 1LULA 3BTAA 4AEJA 1J59A 4MH0E 2Y60A 2QQVA 1WZXA 1UYXA 1UU4A 4HN1A 2A6WA 5DUWA 2ZGUA 5C8CC 4ASMB 2DBNA 2HH9A 1UMZA 1AVBA 1D2SA 1U5YA 4P02B 2JENA 1MS0A 4AI2A 3NVCA 4LLOA 2OW4A 3I2FA 5D8AC 4TLGA 3T2OA 3PUHA 3AKQA 4XZPA 3AMNA 3IDEA 4GULA 5EXOA 2XQRA 2VTFA 4JRAA 4R9DA 1YFYA 2IFWA 3VD4A 1NXMA 4YNIA 2PXJA 4DUXA 3J8F2 1R092 2E26A 1MZEA 3IDBB 1LODA 1NKGA 5DZGA 3VBUB 5FO7B 3MGUA 3H7YA 4C91A 1RUF2 4W6YA 3U75A 3WDWA 2D6NA 1DGLA 2VMGA 1QQP1 4NROA 3ZYJB 4DB5A 2WNEA 2EA7A 3PLQA 2RM23 1BLZA 3C7HA 2JEMA 3GBFA 3LPFA 4IV1A 4KWJA 4Q1RA 4WZCA 1NZCA 3JBG3 4YYOA 1BEV3 3AVSA 1GZCA 1MQTB 4FAGA 2G4IA 2HEWF 4FP2A 3UT0A 2WR9A 4BYYA 5C8WA 5JAXA 3ZFGC 4B3NA 4WVMB 1LEDA 1STMA 4YGDA 2HWE3 3EQEA 2VW0A 2VCBA 1XYOA 2A3YA 4KBZA 5C33A 3EJKA 1WMFA 2WNOA 1J1TA 3G7DA 1JZ6A 2C5DA 3THTA 4AWDA 4BPZA 3ETPA 2WZEA 4A6OA 2DCTA 1PMIA 3AP5A 3MV11 3WG1A 4JKLA 2R073 3BYWA 5I8SA 2RS51 1ZA7A 3T2PA 2MEV3 4PF1A 4AI9A 1RUJ2 3I3BA 5DZEA 2DV9A 1ENRA 3B7MA 3KD4A 1XYPA 4MO3M 2RM22 2D98A 1CAXB 1QH6A 5LASA 4DRRA 3A23A 4I02A 3JQXA 3KV5A 4IV3B 1BEV2 1FPN3 3HEIA 2VCAA 3LIHA 4P08A 2JDHA 2HYXA 3CZJA 1XC6A 4P00B 2RMU3 2DU1A 5BUVA 2PQQA 5FXVA 1K3IA 2F4PA 3LEKA 3VD9A 4UXAA 3BIWE 1OD3A 2CNAA 2Y0OA 3MIFA 1CX4A 4H7LA 5CB7A 1NXD1 3H1WA 3SCHA 4L9BA 1UXZA 1LU1A 1UKRA 2D5FA 4HVRA 5ERLA 4Q4X1 2HWE2 1DP0A 1LGCA 1OLRA 2P6CA 3GBWA 2EVXA 4UF0A 4Q4W3 2BV4A 4C0BA 1PIV1 3CEWA 1SMVA 3RYPA 3U0ZA 3IMMA 1AJOA 1PGSA 3AZVA 5FCCA 4LOTA 4LIVA 1HRV1 5LEJA 3IWZA 1Q5OA 2OT7A 1GP5A 1Y9GA 3CJXA 4JTOA 2BPA2 1IZ3A 3RI8A 1UCXA 2VW1A 4CDQA 2FMYA 3RJ2X 4BQ4A 5LA0A 2R0FA 1CWPA 3BU7A 4B8EA 4D7SA 1RUH3 1XU1A 5L9RA 2IWGB 1DGRN 5FV3A 5FZEA 1CAVB 2YUEA 3NNMA 4GIQA 5A7OA 1IQDC 3NNLA 2C4XA 5FZHA 2BUKA 2Z5WA 2QE3A 1R1A2 4NOTA 4PIXA 3BU0A 4AVBA 2IVJA 2XQXA 4IUGA 3ZIXA 4XCAA 1RL3A 4GA9A 2BNOA 4QD2A 3K2OA 3PU8A 4FFHA 2J1TA 1HB1A 3CZUA 4H7MA 4S2FA 5JR7B 1WWYA 3K46A 1ENQA 3WF4A 5E89A 1GZWB 2RHPA 5FQ0A 3WG3A 3VBSA 5IVJA 1KXGA 2WINB 1COV1 4BQ1A 1LHUA 4MXVA 2ET1A 1X33A 3W5MA 4BU2A 2ID4A 1YWKA 5FPLA 5FZ1A 3WOGA 2YPDA 1DQ2A 2FDGA 1YQ2A 4BLJA 1ZBE1 1FOD2 4RGKA 4YZ1A 1OURA 2VCMA 1DHKB 3I2DA 2FDJA 4QX7A 1W9SA 3RZMA 2IC1A 1VBB2 1GOFA 3MFAA 4LHKA 4Q27A 1RUI3 1MEC2 1O59A 3J26N 3OY8A 4O65A 4XJWA 3ZSEA 4ZHNA 1LENA 2VGDA 2VQAA 3KHBA 4XQDA 3WY6A 3NJVA 3WZ1A 5LBEA 1RTVA 1JZ3A 3IKWA 4D69A 3S7EA 4CE8A 4B7KA 2AC1A 3JXSA 3K75B 1VAKA 1AR92 4IE4A 4XMIA 4EN7B 5I0SA 3WT3A 5FZMA 2ZHKA 4A2UA 1W6QA 1V6LA 2DVAA 3GYDA 3NJZA 4CU6A 4HVQA 2O8QA 4ARXA 1QF3A 1TNFA 4PQQA 4B1LA 2RDRA 3QLQA 3E5UA 3BCWA 4WV8A 1JZ2A 4QB6A 1QJU1 4AGVA 3O1TA 3WDYA 4IGOA 2HYKA 4UBGA 1E57A 3ZX7A 1MS5A 1FV3A 2H6CA 4R9CA 4GMP0 3MF9A 3ZN6B 4NJ4A 4J1XA 1Z7S1 4Q0PA 1Q8PA 1U0AA 2OQ6A 2VBBA 2XVKA 4OI2A 3IZOA 5ANNA 2X10A 5F2WA 1RUI2 4MG2A 4JQTA 2JDYA 3MIBA 3VDBA 2PAEA 3D6EA 2E7QA 1FXZA 2BJSA 2WFPA 2VZUA 5FZ9A 4AI3A 1GR3A 4IGQA 3SC7X 3SXWA 4QXCA 1OSGA 1W6PA 3MV01 2G9GA 2XH6A 5IUQA 5JVVA 5HV4A 1MACA 4Y5SA 3O0VA 4P9YA 2J22A 3VKOA 1FAYA 4RN5A 5DDJ2 1JUHA 4QPIA 4OZXA 3OGGA 3Q9OA 4UOJA 2RS11 2ZXQA 3VD3A 1FMD3 5FP3A 1EUTA 2DUOA 2XG3A 4JC1A 5BNQA 3LFIA 1WW6A 1GP4A 3DXUA 4FTBA 4L8QA 4M00A 2HEVF 5DABA 1J83A 1JHJA 4QPWA 1O3RA 3J4UH 3TEZA 2VUCA 2YG0A 5EZWA 2E53A 3BPZA 2WZR3 3GJBA 3JB4C 5KHHA 2Y6JA 3SH5A 4A7ZA 4MGZE 5C9AC 4FPHA 2LS6A 1HIXA 2DCZA 1SLCA 2RS33 1BBT1 2WABA 1WKYA 3QD6A 4L92A 3FFQA 4XUQA 2VXRA 4CDWC 2GC1A 4EZHA 3L2HA 5HBAA 2ENRA 3W5NA 4HG6B 3NWKA 1HB2A 1QY4A 3M3CA 5IAXA 1RGSA 2JECA 2E51A 4UFIA 4F8AA 1AYM1 1XNCA 2YC4A 2I07B 1DGRA 2BBVA 4O61A 3AL5A 1OH4A 5KHKA 2P1BA 3AMMA 4Q4Y2 2KXLA 2I74A 2R1DA 3E5QA 3GCWA 2VY0A 4CDWB 3IB3A 5FZCA 4QQ2A 2Y26A 5FUIA 2Q4SA 3V65A 1NCRC 4CEYA 5DZFA 5J48A 3K48A 5FXXA 2R042 3VV1A 5BNNA 2ZGMA 1I1EA 3PL0A 2MPFA 3RMYA 3TOJA 2A5ZA 3H50A 4ES8A 2QVSB 3CQOA 1UD1A 5IVYA 1WUVA 4HETA 1TZOA 4IE0A 3T0BA 3ZFFC 4IEYA 2OX0A 3DKWA 4MGTA 4DZGA 2CAVA 4M3CB 3D5OA 3L2YA 4I01A 4KH9A 4R9BA 1QJZA 2WZR2 4RS5C 5DUVA 4MGSA 1JZ4A 2VPVA 3OBTA 4K8RB 3H1MA 4BOWA 4GB33 1YEWA 1KEXA 2RS32 2W94A 2VL4A 3AJZA 4Z07A 3ST7A 2ORZA 1H0BA 3LA2A 1L7RA 4XDPA 3RRDA 1GZTA 1JBCA 2WA4A 4P9GA 4A7YA 4COZA 1N1YA 3EYPA 4HK8A 1PMJX 1C8M2 3OTFA 2VUAA 1QDOA 1SFYA 1EAH1 2R6QA 4MYEA 4XXPA 5IVVA 1DCSA 1PO22 1DQ4A 2VNVA 3IDCB 4KG0A 5JOYA 1XRUA 3Q8EA 5LCWL 4NIHA 3SQOA 1A6CA 5I0UA 1ND3A 1POV3 3UGGA 4UYBA 1G8WA 1RMU3 4JCKA 2LUWA 4ZKTB 5HXMA 3TN91 3LDKA 2VBPA 3TRSB 4FPEA 1AUYA 2CDOA 1LTEA 1XE0A 5JSOA 4NHMA 4BE3A 2JD9A 1PMHX 2JG9B 4C90A 2PHRA 3N7LA 4I0AA 1XE8A 5J37A 2GN7A 3O1PA 4M4RA 4ISRA 4DXSA 5F32A 2WAOA 5CA6A 5CKNA 2VC9A 4LO4B 1CGPA 1NUKA 3O1MA 2Z42A 5ACA2 4ASLA 1C1FA 1US2A 2FCVA 5CFCC 4Y1YA 4IEZA 2Y8KA 5A33A 1CPMA 4A42A 3POGA 4FXKB 5JLVA 4EQVA 4EZ4A 1OOPC 3VHPA 3USUB 4NHXA 5LEKA 4N43C 2B8MA 4XF1A 4E4SA 4NAMA 5JWPA 1H1IA 2D97A 1C28A 1C5IA 3CLPA 3CU7A 3LA7A 1Q56A 1OUSA 1HN0A 2ZZJA 4FTEA 3JBG1 1DZTA 2JIGA 4GMP1 1REDA 3UETA 3VZLA 4COUA 1RUC3 3MEPA 3CO2A 1LOGA 4OI0A 3VUOA 2ZHMA 4XYXA 4IEWA 3WXPA 2NQYA 3OEBA 2YC2A 3N4MA 3AXDA 2Q5TA 4N43B 1HQLA 5KC5A 1SLTA 4CCMA 4IETA 4PDWA 2P17A 4RSUA 1ULCA 1O3QA 3ZSJA 1O8PA 4R52A 1HV1A 3BODA 1RHI1 1W05A 2DURA 1ALYA 3DYMA 1NLSA 5B4XA 5C3RA 1IS5A 5C5UA 4H3WA 4Q0UA 5FMCA 4XJUA 1OLMA 1CJPA 1UO9A 1MZFA 4K1YA 2XXZA 3WR0A 1DYOA 3OBZA 1GQGA 2FBEA 5JZGB 5FKCA 5ABJB 2R071 1Y9MA 2PHTA 5EFUA 3AKTA 1FNYA 4JAAA 4LBNA 4NRQA 2MEV1 5A3OA 3WP6A 5IVBA 1MS9A 4Q4V3 5JPNB 3AX4A 4RR3B 5IVCA 2YB7A 3AYEA 4PIYA 4D8MA 2L9LA 3UKNA 1VRH3 2PHLA 1QQP2 1OC1A 3AMHA 1G9BA 5C8CA 4A6SA 1FPN1 3LB9A 4IEXA 3OYWA 4H14A 4WM8C 2C6SA 3KQRA 1YUDA 3WW1A 2RMU1 4KQ7A 3ME2A 2MNGA 4XTPA 1HJGA 5C71A 4Q26A 3T1LA 3POWA 5IFTA 1K5JA 5GZDA 1W9TA 2B46X 1MS3A 4RL7A 4XDQA 5D8AA 2VMCA 2ZMKA 1S4CA 4JGZC 1JYIA 2YGMA 4UFLA 3S6PA 2UYAA 3WNLA 4Q4X3 4BK5A 2NM1A 5FRAA 5FZFA 4Q4W1 2WYSA 2VOXA 4JTNA 3HNMA 3WW2A 1ZBA3 4AVSA 2P5BA 4WVMA 2RE9A 1H6XA 1PIV3 5CIRA 4BB3A 1NCQC 2XJTA 4AEKA 1H2MA 2VMIA 4GALA 3I2OA 4JGZB 1HRV3 4AI1A 2HBUA 3WQ1A 1CX1A 2HWC3 4LKEA 3SEPA 4CXWA 3KCCA 4BXSV 3FHQA 1DF0A 3WW3A 5T5JA 2FHRA 1SQ4A 2JB8A 3KVBA 2BVVA 1LEMA 2P37A 3M1HA 1LHOA 4AVAA 1AHSA 4IE5A 1KS5A 1QHDA 1RUH1 2O14A 3ZFGA 2VVFA 1O6UA 4KBBA 1K12A 3GM8A 2X29A 2XVLA 4OI4A 1OD5A 5CEHA 5IK4A 3GGLA 5M0TA 5FWJA 2RVAA 1UN1A 3ZSMA 2V72A 1V6OA 3GZAA 3HNYM 5T50A 1X9PA 2ZAAA 2LM3A 2ADEA 4PBPA 3RWNA 2GALA 2TEPA 3AC0A 4XEZA 4XW3A 1VBA3 3UL2A 3UNPA 3C7GA 3C8XA 5K7PA 4FI9A 4LKDA 4OMDA 4Q4X2 4YG3A 1DQ0A 3T0AA 3ZMOA 5L73A 5DXDA 4M0HA 3POSA 3FLRA 3V0AA 1VE0A 1F31A 2D3RA 4ET7A 4XAEA 1PIV2 4MADA 5A80A 4GJZA 2ETEA 4QPGB 1X50A 4YWAA 4PF5A 1E5IA 4EV0A 4CEWB 3AP6A 2YHJA 1HRV2 1ND2C 1W28A 1PK6B 4XHXA 2HKXA 1XB9A 1ZZ9A 5J98B 2Y6GA 1COV3 1DQ5A 2R063 5H9QA 2XJSA 1BYHA 1CZTA 4LO8A 4HXCA 1POV0 1D0HA 1N1TA 1QXJA 1N3QA 3GZUC 3FN9A 1QGLA 4K8FA 4IERA 3OD0A 1G6NA 1O91A 2K2SA 4NPLA 1YIFA 4XIKA 5FZDA 5T52A 4YZ3A 2GMPA 3KZ4C 2Q1ZB 3HMYA 3NQHA 5FKBA 3RMXA 1MS1A 4YM3A 4COYA 3VBOC 3OOXA 1UNBA 1OQ1A 4RGGA 5FK7A 5A1AA 4B7EA 4GKXA 5FYCA 1TG7A 1VP6A 1UZZA 3AYCA 1EPZA 2CGOA 2XGXA 3W58A 4ZXKA 3SMHA 2B42B 3W9AA 4XJZA 2AZ5A 2VW2A 4HOOA 5ISLA 5FBJA 1LHNA 4NRPA 1NZIA 2G19A 2DTWA 3LAGA 3AB0A 1C1LA 1GNYA 2EXKA 3BTZA 2CGNA 5A3UA 3OGRA 2ZCWA 2Q1MA 1SPPB 2J1SA 4XQ4A 2YV8A 2Y64A 3NO8A 5AFBA 4QX3A 4NIGA 4YW3A 5GLUA 5FYMA 4S2GA 2P2KA 1COV2 4G3YC 1UZVA 1BHGA 4LUKA 3VHOA 5FJKA 3WDXA 4Z82A 1QJU3 1EP0A 2WQZC 4JHTA 3U1XA 3ZXFA 2G1MA 1ZBE2 3QH6A 2H6BA 3ZDSA 4K40A 4LBQA 4X6QB 1PVXA 3NMBA 4CCKA 4Y4YA 4MOAA 3G6JB 1IPKA 3U78A 4N7UA 4DEQA 5FYUA 1QKQA 4NWWA 4ZS2A 3D0SA 1U5IA 1XPWA 3L9JT 3MUY1 4TYSA 1K5MC 4OYUA 2PLV1 2B9VA 1IQAA 1LRHA 3S5QA 5T55A 2A73B 2VVDA 3NNJA 5FP9A 1W39A 2ZGSA 1TMF3 5LBFA 3KT7A 2CAUA 2J1EA 3MIHA 5L7OA 1DBNA 1LR5A 1VAMA 1QOTA 2D93A 2GDFA 3TEWA 5IHRA 1A34A 1UIKA 1FMD1 1OVPA 5F8PA 1I6XA 2OZJA 4Y26A 5KHJA 3H8XA 5FMOL 3GXUA 1G86A 3FUQA 5C70A 1CAUB 1OVSA 4P9LA 4PJYA 1QJFA 4PBOA 4JZRA 5FWEA 2E6VA 2ZEZA 5LB6A 1SFNA 2CGPA 4URTA 4ZXEA 4AQSA 1QJU2 5EP9A 3K4ZA 1KRIA 5BPXA 1YQ8A 1SLBA 2RS31 2YROA 3E6DA 3POEA 1WMEA 3Q8AA 4E8CA 4QXHA 4Y20A 3TAYA 1QEXA 1YO8A 3KM5A 3LDBA 3N9PA 3H0OA 2R32A 1Z7S2 2W1QA 3HVDA 5F5IA 1FNZA 2TUNA 3CL1A 3ECQA 3RQ0A 1OLME 4IEOA 4K3UA 4LO6B 1U5ZA 3LSEA 3RZGA 2DDUA 1AYM3 3KMHA 3BI3A 3OUHA 2B4KA 1VB4A 1URXA 3SISA 3O0XA 2WUHA 5IATA 2ARBA 2RS12 5KHIA 2ZGTA 4K9SA 2VO5A 3AKPA 2JE9A 1OFSA 4XUTA 2VMDA 3SCGA 2ERFA 1NA1C 2BYVE 4MGYE 4YZ2A 2NMNA 2P3KA 5H9RA 4LBKA 3VLBB 1XOYA 4NE9A 4YARA 5JSRA 3FUOA 2CTVA 4YPJA 3VD7A 4D6RA 2QNKA 3AKRA 3I2KA 4GB31 1DU3D 3VKFC 5BNOC 2FZ2A 5FK8A 3OG2A 5FY4A 1LOEA 2PHXA 4BA6A 1BBT2 3ZXDA 2YZ4A 2QBXA 4NUBA 3TB0A 3T30A 1UY4A 4FXGB 3O1RA 5CG8A 1UZYA 1MVQA 4EROA 1EAH3 4XFGA 4J6GA 3UGHA 1HKDA 1S0FA 3FFZA 3BIEA 1AYM2 4A3ZA 3ELNA 1POV1 1UW8A 3B9CA 4MVTA 1RMU1 4R9AA 3CMGA 1JMUB 4MLOA 1GBGA 4AFMA 3DUIA 4WM7B 2OS2A 2AUYA 3BGAA 1XQNA 3POBA 4PIZA 1DQ1A 3RI9A 2MHFA 3VBHB 4Y22A 3D82A 2DCYA 5C9AA 4EJRA 2VZSA 2Y6HA 4UW3A 3WNNA 4BQ5A 1YFUA 4Q8KA 1IPJA 1WW4A 4CDWA 2VTXJ 2Y6KA 2E31A 5DG1A 1QJY3 3VBUC 1ZRCA 3ZYGA 5A3TA 1W9YA 1AXKA 1DGWA 2J1UA 4QGMA 3WSOA 4DOUA 3KV4A 4D7TA 3NW4A 4Z1VA 4AOCA 2A3WA 1VMJA 3FZ3A 2LROA 3N9QA 1AX1A 1JH5A 1RYYA 2OUJA 1MQTC 4OHXA 2XONA 3S7IA 1WCQA 1NCRA 1EAH2 1C4RA 2ZX2A 2EIBA 4UI9L 1FYUA 2P3JA 3AZYA 4S2HA 1NE4A 3K51A 4IE6A 2V73A 5EYXA 4N53B 3MFCA 5A3PA 2HWF3 3S5AA 3NAPB 3ZFFA 3B93A 3IBMA 3DN7A 1PGW1 1W0NA 3DYOA 3HOBA 4N8MA 4B29A 1RUC1 3POYA 5DQ0A 3ES4A 4TXWA 3IIIA 3TN92 4GMP3 1H6YA 1YIPA 2Y34A 4RS5A 4XF4A 1MS4A 5FY1A 4MHRA 4ISQA 1NQJA 4X8PA 1B35B 1X9TA 2OIIA 4OUMA 1F15A 4AEDB 4MUVA 4CCLA 1JYXA 3I3MA 1RUOA 1UY0A 3R4UA 4YW5A 1W6MA 5FAXA 4JDOA 3PVOA 4FOWA 3VL8A 1N3PA 1W8OA 5C6CA 1E5SA 1H2LA 3ZVXA 4IEPA 1RHI3 4FPOB 1SDWA 2XVGA 4YZ4A 5CFDC 2GNBA 4IV3C 3MW4A 1VBE3 4L2NA 5F5CA 1OT5A 3ZYFA 2JICA 3B94A 1TQ5A 1C8NA 1D7PM 2XDVA 2XB6C 2Y6LA 4EN0A 4XJ8A 1W8ZA 2PQSA 5JDBA 2DFCA 3KV6A 2UURA 5J7MA 2Q8CA 4Q4V1 4YW6A 5C4WB 4FVVA 1OF3A 1AXZA 5GLTA 5L9VA 4AW7A 2EAKA 1VRH1 1GU3A 1W2AX 5AC93 4GH4C 4BIOA 4I0WB 3VBFB 2VZQA 5CFDB 2WIIB 3USUA 3JBG2 5EIYB 1BKZA 2JDPA 1Y43B 3GZTB 1KJRA 2LALA 4LT5A 2YPJA 3PIGA 1A8MA 4YVSC 3LOBA 2ES3A 3IPVB 3OEAA 3HWJA 3IAQA 1KDMA 3LDRA 4SLIA 5F3IA 2IUWA 5CFCA 2ZPXA 4LHNA 3ZO0B 2KA3A 1POQA 4GH4B 5FZBA 2LTNA 3EHKA 1UY3A 2PELA 1OOPA 5JIAA 1RHI2 3R4SA 1ZBA1 4HVOA 5E88A 3PVEA 4N90A 2Q8EA 3P1IA 1VBD1 4GD4A 1M4WA 4N43A 4W50A 5FZ7A 3NKGA 2Q30A 1UMIA 3DECA 2XHKA 4QKNA 4YVSB 1F4HA 2WT1A 4BZ4A 3VGIA 3VN4A 1RUG3 2HWC1 4HFSA 2W08A 2R072 5E6HA 5LA2A 1H8TB 2DU0A 2QQKA 2WFF3 3ZFEB 3A0NA 2E63A 2MEV2 5DUUA 1UPSA 4QX2A 2BP6A 1A78A 5CKMA 4QXKA 4XACA 1W8WA 3A7QA 2VJXA 2PHWA 3DPRB 2XPJA 5I0RA 1RIRA 1FPN2 1SCSA 3AZXA 4CUCA 4COVA 1TNRA 3I2HA 1H1MA 3KS7A 4CU7A 3S57A 3UKVA 2Q0AA 2RMU2 1NG0A 1YQ6A 2HWB3 2XLAA 4NHKA 1S1AA 4LIUA 5FYZA 1VBA1 1FI2A 1UU6A 3THDA 3PNAA 1RVF3 2VD7A 3H8UA 3KT4A 4WBBA 5FZGA 1NOVA 3BOPA 1U12A 4Q4W2 2A71A 4YGBA 3IMNA 1I5PA 2GNTA 4NRMA 4NMIA 4DXRA 5CKQA 3TNPB 1B09A 3URFA 3S0MA 5B2GB 2IXIA 2RDNA 2Z2SB 4LMFA 4RHV1 1S2KA 1QJX3 4HL0A 2R061 4WM8A 1QJEA 2KD7A 1GQPA 2WFF2 5GLZA 5IT6A 1Q8VA 2R7EB 1OKQA 5LZ6A 2A70A 3H42B 4I09A 3VDDB 4HLTA 1QDCA 1HV0A 2K9ZA 4RQPC 1JYVA 4JGZA 4FBFA 4I30A 4XILA 2YFUA 3B69A 4LULA 1RUH2 4Y4RA 1IS6A 1KDKA 4FP3A 4CPBD 3AM2A 1E5RA 4CP0A 1P8JA 1JOBA 1S2BA 1J3RA 3PMEA 4E4ZA 4I0BA 4XPVA 3ZXEA 2PAMA 4FPJA 1H30A 2AACA 2QKDA 3E1F1 4RFT0 1LOFC 4CDXB 5I93A 4BJ0A 1NCQA 3HNBM 4XF9A 3AFGA 3AYDA 3ZMNA 4RQPB 3BPSA 3J7NA 2WNVC 3QH7A 5EYYA 2AH2A 2BWCA 2RG4A 1MPXA 1XSQA 2P6HA 3WUCA 3QBQA 3N35A 4SBVA 3ON7A 4M3CF 1QU0A 4A4AA 4BDVB 2A6XA 3GDBA 5A3WA 1QJX2 2CY6A 1GFF2 2VQUA 4XUPA 1YI7A 3RZZA 2ZACA 5FOBB 3WG2A 2XUEA 3B00A 4E4DX 1XYNA 5G04L 5FZ3A 3UGFA 2JXAA 5A6ZA 2WNVB 4K20A 3BKZA 3PURA 4MXWB 1JXNA 1W04A 1GWLA 5FPZA 4IEQA 4QPYA 3CBNA 4XF0A 2E7TA 4GJYA 1H4HA 1SZBA 2GC0A 3N9MA 1W6NA 3VKLA 4AFDA 3WNMA 1XE7A 4HANA 3U14A 4O9GA 3TNQA 1GICA 1WCUA 2PLV3 5FZOA 3ZDVA 4CXXA 4KNCA 3RZLA 1TMF1 1ND2A 4YM1A 3H8RA 3ZKUA 5IVFA 5JSPA 3PVBB 3SKVA 5F6LB 3MPBA 1BK0A 2VMFA 5IK5A 4YLZA 1W03A 3SEEA 2JIJA 4LTAA 3AFKA 3HN3A 4QKFA 4ZY9A 2X5IB 3W59A 4E9KA 5A7WA 4FAHA 5FR3A 5J09A 2OXBA 3MIDA 4FCAA 1QIQA 3KV9A 5CNAA 3I59A 2WT2A 3RZJA 3VBOA 5FZ6A 4Q0QA 1LOAA 2RJ2A 2WN3A 2BU9A 3LPGA 2OPKA 4BQYA 2WT0A 1RB8G 2OYZA 4L97A 2CWSA 3KCYA 4XFFA 3UJOA 5FYVA 1PNGA 4MHUA 4ZU4A 4A45A 1BMV1 1O5UA 4E2SA 5FPUA 2AGSA 1ST8A 4RA0A 3LFMA 4M0NA 1CR7A 3ZM8A 5J96B 5LY2A 1ZA4A 3MIEA 1CPNA 4LBMA 3WNOA 3E6BA 2PLV2 4AQ2A 2A75A 4FPFA 2IFRA 1IKQA 4LUMA 5GJ6A 1JODA 1LGBA 1KJLA 2B9UA 2TNFA 3FJSA 3KVAA 4XABA 1NY72 3MYXA 2DFBA 2ET7A 2W0XA 2P4EA 4YG0A 3OGSA 3VBRC 5KXBA 2NPIA 4YG6A 1WMDA 2YXSA 3WHTA 1FMD2 4FQZA 4CP9B 1BJQA 2JG8B 3O7OA 2V4VA 1WLWA 4JGYC 4ES9A 1VB2A 3HQRA 2BW8A 2ADDA 1EUUA 3AYAA 1OQEA 4QQOA 3KF5A 3ZIWA 3IIAA 5DAVA 1ZZ7A 1K5MA 1CAUA 3W20A 3IM0A 4LO5B 3VBRB 1WA6X 5T5PA 4AF9A 2UWBA 2I2SA 2C9AA 4LLFA 3U4XA 4ZPIA 3S30A 4O7XA 3I2GA 3KT1A 4Y33A 4EN9B 4JGYB 3Q8BA 1ENSA 3OUIA 3NJXA 2JG9C 1FX5A 1D4M1 3ATGA 3KQ4B 3H1YA 1HRI3 4Q0VA 3ILRA 4GWJA 5IK8A 1VAVA 4MX3A 2VOKA 2DYCA 3HN1A 3PHMA 4PI0A 5FUNA 3UK9A 4AYUA 4FFGA 4C0HA 3WNXA 4Q29A 4IEVA 5F7UA 1HXS3 1AR81 5FXZA 4DIQA 3J7HA 4CU9A 3CKHA 4XMAA 1W8UA 2D6MA 4G4FA 1YFWA 4M01A 1AX2A 1YJLA 2PAKA 3RVHA 2W9XA 5JUVA 2XJUA 2SLIA 4D7YA 1OHFA 1QJY1 4IV1B 1X8EA 2OQ7A 4XJAA 1NT0A 2HJIA 1LHWA 2RJLA 2JKBA 1O4ZA 2A6VA 4GB32 5JI9A 1WBFA 1H2KA 4J25A 4XETA 2ZHNA 3Q8CA 4ATFA 2VQTA 1V6MA 2NZ9A 3T09A 5HI0A 5BYNA 1CVNA 5DUXA 5EJ3A 1Y7BA 5KC6A 4TWTA 1PM4A 1QMJA 4YRDA 4WVWA 1ULGA 1WLDA 2XJVA 5KWRA 1UX6A 2HWF1 5GLWA 1AR73 5DAPA 4TZDA 3PUQA 5JOXA 1YYNA 2EALA 2VULA 1NA1A 1RMU2 4YGEA 1Z0HA 2N7GA 5J1XA 2YBKA 1F35A 4ZZ5A 3K4DA 2HLEA 4FPLA 5FYTA 4AVTA 5BNOA 1Q8QA 3QCWA 2VTXA 1ENXA 3SITA 3ENRA 2Y33A 5F3GA 2QQWA 1SACA 2QZ3A 2QZ2A 4OVEA 5JZGC 4XTMA 2B39A 1GQHA 5ABJC 3AMPA 3QACA 1D4VB 3GCXA 4NO4A 4DNYA 4RR3C 4AEMA 1CD3G 5F37A 2CHHA 2C26A 2UU8A 2ZBJA 4YSFA 1S0GA 4LK7A 1SDDB 4P9WA 1F5JA 1R1ZA 1VBE1 4FO9A 1KQRA 5KXDA 1VMFA 2ZEWA 3U37A 1G9FA 1JYWA 1LOBA 3AKSA 1O8SA 3DCQA 2RJKA 2W3JA 1CQ9A 1AF9A 1PHMA 4UF0B 5AC91 1AR72 5K9YA 5FPVA 2J1RA 5LA9A 4Y5Z0 3T2TA 3A0KA 1GKBA 4UBHA 4PLNA 3B3QE 1PGW2 2VZ1A 4EN6B 1OA2A 1RUC2 3VBUA 3D0JA 4KL1A 2ZS6B 3DF0A 4P9JA 1W8TA 1DGWX 1W2UA 1DLCA 4A3XA 2H0VA 5DAWA 2W46A 4XIOA 2FDHA 3I3DA 1EV11 3N7KA 4UFHA 4E4HA 3R05A 5T5OA 1MQTA 3I3QA 3A21A 1XJAA 2GNMA 3GZEA 1SFPA 2XL9A 5G05L 4BM8A 3AJYA 3W21A 1IHMA 2WSVA 4DFSA 1N1VA 3USSA 1VBD3 2VZPA 1W8HA 4YW2A 3HBZA 1LU2A 2XKPA 1RUG1 4OFGA 5LRRA 2BGCA 2OA2A 2WFF1 2YU1A 4OHYA 4Q4V2 1PZ8A 1CJDA 1SLAA 4LNVA 5DMYA 5KR7A 5FOJB 1VRH2 1HJFA 3WEZA 4TSVA 1Q8OA 3C2UA 4KU8A 4N9IA 3AP4A 5FQ0B 3VBSB 2CU5A 5APAA 3DKQA 4GKYA 2AR6A 2XWJB 2HWB1 2WA3A 1SBFA 3LKJA 4UFJA 3J9SA 2KM2A 2YBPA 4QPGC 2GN3A 3SCFA 3V0BB 5L9BA 1CAXA 3SH4A 4CZSA 5CFDA 4CEWC 1IG3A 2B5HA 4GQ7A 3DV8A 2W92A 4IV3A 4P5YA 5FO9B 1PK6C 1RVF1 4NR1A 3OBAA 4LEJA 1IG0A 1NX9A 1PGL2 1LECA 2ZGKA 2ZX4A 2CDPA 5FTTC 4GAZA 3WQBA 3OY8B 2QQPA 3MZHA 1IKPA 1ZBA2 2QFEA 3IPVA 2XMLA 3MICA 1GSLA 2GH8A 1VBD2 2FDFA 5LWBA 1W3XA 4GH4A 2YGLA 4NHLA 4HKOA 1QJX1 3WP4A 1YQ5A 4Y24A 3O1SA 4YFWA 4RHV3 1RXGA 2VZRA 1G9DA 1MS8A 1YLLA 2HWC2 2ZMNA 1W90A 1HB4A 5C3SA 1Y4WA 5GALA 3SNMA 3DL3A 4CCDA 5FDBA 3VDCA 3SKJE 1W6QB 4YVSA 2QJVA 5JPMB 2KR2A 3AZZA 1F9KA 2GP5A 4PHZA 3OSDA 3ZOIA 3R6SA 4DY3A 1L3JA 3LWCA 1V6KA 4CP2A 2BOIA 1QH7A 5LA1A 3NNGA 4FSJA 3HAGA 2PYTA 2V09A 4LA2A 3IAPA 2ZABA 5K0UC 1WW7A 1XNKA 1NLRA 1ZREA 1UY1A 1VBA2 1Q43A 3PJYA 2UYBA 2RV9A 5FJHA 4Z2AA 2W39A 3POIA 3AXEA 1GWKA 1CAVA 3P5BA 3RJRA 4FTSA 3ROUA 2ZGNA 3VZMA 2DCKA 4BMEA 4CTEA 4ONUA 2GMEA 2ZX1A 3K4AA 1AR63 1AYN3 3AP7A 3LF7A 4J1WA 1UOBA 4QM8A 1VIWB 1GWMA 1T6GC 2V4AA 1UU5A 2FZ1A 1W6PB 4GZ9A 5K0UB 3OGJA 4RHV2 3BB6A 1TME1 2JDNA 2WS93 4R8HA 1X8MA 2EICA 2R062 4CCOA 3JZVA 3ZPYA 3LOIA 3KB5A 4QPIB 1O5LA 2C9KA 4OHWA 1GZWA 2W91A 3FWEA 2GC3A 1J3QA 2VE1A 4FPYA 5BXXA 3WQ7A 5CYYA 2AEZA 2JX9A 5FREA 2X09A 4I3PA 3BTXA 2WRAA 4CU8A 2GNDA 3KLSA 2VU9A 3H3ZA 1M06G 2E7AA 2Y0IA 4FPKA 4LOSA 1HQNA 2WO7A 4UW4A 5EWSA 3T4HB 4ATEA 5A6XA 2IZWA 3FL7A 4XFHA 3POJA 2QTWB 2D40A 1XBFA 1L7LA 3RG0A 2W52A 3ACHA 4JV4A 4DUVA 1ODNA 1ASJ3 2F4LA 5L19A 1NY71 4EWDA 2G9ZA 1ODMA 3WCRA 2VH9A 5A70A 4KGQA 1WGPA 4JHZA 1AYN2 1AR62 1SEFA 2W1WA 1BCXA 3JD73 4Y1UA 2ZX3A 2HWD3 4X8NA 2YBSA 5JOWA 3OBRA 3N9NA 4RQPA 3MDPA 4QHBA 3ZYIB 4CUGA 1QNYA 2JDZA 2W2IA 3CF6E 5FFOC 2JDKA 5FMBA 1KS4A 2WQ4A 2CL2A 4QHOA 4CEYB 2ZAHA 1V9U1 3PJQA 1MR5A 2D3PA 3RS6A 1ZZ8A 2QQNA 3LEGA 5BNNB 5F39A 3THPA 1IPSA 3ZPOA 5IFPA 1LOFA 4E2QA 3WVJA 2VNOA 4PCRA 1YFXA 4OMCA 1PVC1 4PQ9A 1WD4A 1JUIA 3B9IA 3FHAA 3ES1A 4YW1A 2FCTA 3KSCA 4XBNA 5CISA 3ZN6A 4B4QA 2JDUA 1FV2A 1KITA 2CSGA 3LCPA 4P14A 2PHDA 5I0DA 2D6PA 5F5AA 1KGYA 2EAAA 3B5LB 1TMF2 3A22A 3ZXGA 5A32B 4LKSA 3X29B 3N9OA 1RUE3 4D6QA 1S0IA 5D2AA 1YRZA 2A3XA 2BNMA 3JD72 3R4DB 1V6JA 1GNHA 3HQXA 1ZRDA 1N1SA 3M4FA 4LE4A 1OI6A 3WNPA 4LQRA 1ULOA 5JCTA 2VR4A 1VMHA 2Z69A 2J1AA 1ND3B 1YNAA 2IVIB 3GNEA 2BTVC 2IXHA 5J36A 3FX3A 1WMXA 1RUNA 2F6BA 2WO1A 3N36A 1W99A 5A3LA 5LK5A 3HIFA 1UWWA 5C7GA 1PM7A 3HQUA 4WM7C 3TEXA 3VBHC 1BMV2 1LOCA 3WNKA 1Q3EA 1REEA 1ULDA 1UYYA 2W5FA 2Q1FA 3GHNA 3LEIA 1H9WA 2QQLA 4OI1A 1JZ5A 3HR9A 4AHZA 3E6CC 1GYKA 2V5DA 1HRI1 2AREA 5CBLA 1Y3TA 4XZUG 5A3NA 1CN1A 1D4M3 5GZEA 2DUQA 2VECA 3T3YA 3ZXLA 5BV6A 5EQUA 5GZCA 1BVP1 2P34A 1CIWA 2Z79A 5T5LA 2VNRA 1IOAA 1VALA 3ZSKA 3MI8A 1N3OA 1HXS1 1X36A 3H3UA 3SLIA 3H7JA 1AR83 5IJRA 1O4YA 1IGOA 4UFMA 3WINE 3OGVA 4L11A 2B45X 3THCA 2EIEA 5I91A 1G9AA 4CUBA 4NPMA 1NYWA 4OHVA 4QDRA 4BK4A 3AP9A 3ACLA 4JX0A 1JN2P 1H2NA 1UL9A 2VOVA 4KU7A 3KGLA 3J8F3 1R093 4P9XA 3D4KA 2R16A 3LZZA 4N53C 5FZ0A 5IW0A 3TBDA 5IYYA 3VZNA 4AVVA 1RUF3 4RFRB 4HZFA 3NAPC 4FPGA 1S2EA 1UKGA 1S0EA 4G9SB 4LE3A 4LK6A 4ZS3A 4M3CA 3U11A 4PDWB 3PU3A 4YW4A 2BWAA 3ZSLA 1XXNA 3U07A 1B35C 4AEDC 2A6ZA 3VBRA 5IWFA 2VOWA 1D4M2 2JE7A 3A4UA 3ZYPA 1AR71 2CYFA 2LW8A 3MF6A 4JGYA 4TLFA 3F2ZA 1DYPA 3NV4A 3P3NA 3O1VA 1D0GA 4QDSA 4NWVA 3B01A 2DUPA 3ACFA 1AR82 4AK3A 5JMCA 3M3IA 1UZ0A 1S0BA 4GWMA 4CDUC 1V70A 3PVNA 1X7NA 4NAOA 2W95A 3AVRA 4MGKE 2WL1A 4OHZA 4D6SA 4QU1A 4UAPA 3UKTA 1MVEA 4DY5A 5C8CB 1QJY2 5FZAA 5C4WC 2VZ3A 3OYWB 2NN8A 5F6KA 3ALQA 4XQWA 3WDUA 5T54A 2JG9A 1RUJ3 4KWUA 4DINB 3T0DA 2Z4FA 5E1RA 2WC2A 3VBFC 3ZR5A 2VVEA 4UWDA 5D8AB 3RNSA 1KFUL 2UY9A 1PZ9A 2VM9A 4CDUB 2GU9A 2WNUC 3NL1A 4H2AA 3HT1A 4KWKA 4ASKA 2FD8A 2WJSA 1ZRIA 1EPWA 3U4SA 4OUSA 2WWJA 5BNPC 1EY2A 2WSUA 1ZRFA 2D5HA 1DZQA 1UOJA 3BUCA 3RWKX 4BXFA 1IS3A 1G9CA 3AK0A 2DVBA 2OZ6A 3LEMA 1Z78A 2HWF2 1SHWB 4XOGA 5FY5A 1N47A 1TE1B 3DGTA 3M7AA 3GF6A 2J1VA 1GANA 4K1ZA 1OUXA 3M2MA 5B4NA 2WNUB 3ZXAC 3MW3A 3I2IA 3J7LA 4C1WA 3I8TA 3HBKA 1F5FA 5BNPB 5DPNA 5HCHA 4L0PA 1WBLA 4QWNA 2CV6A 2ZZQA 4LORA 1PGL1 3MW2A 5D1IA 1H8TC 3UYJA 3ZFEC 3ZFGB 1EV13 4JDNA 4XE9A 4XFAA 4LPLA 2X05A 3RGBA 2PN5A 5FPXA 3INAA 3ZN5A 1AZDA 2FCUA 3BOWA 5FYBA 3DPRC 2BVBA 1GZ9A 4W65A 4Y1VA 3I49A 5A6QA 1VBE2 3P3PA 2IXLA 3NNFA 4FOYA 5GKAC 2IXKA 2ZGQA 3K3NA 2WKKA 2GC2A 3IN9A 3OPWA 3IT8A 2DVGA 3ITQA 2WBKA 4IXLA 3B02A 1PX4A 1GMMA 3MIGA 1OXCA 1RUD3 4DO0A 1HDKA 1KD7A 3V0AB 5AC92 4TN7A 5JZGA 1R1A3 4CVUA 2CWMA 5DAQA 1GLHA 5ABJA 5FP4A 1C5HA 1NQDA 3JCIA 3M8LA 4OUEA 2FDKA 1FATA 4QX5A 4RR3A 1RITA 5FZ8A 2XOMA 3FMGA 4AHYA 3OCPA 1NLQA 2EIGA 5C3PA 3WQ0A 3I7DA 2JJ6A 5A7SA 5EPAA 5IAVA 1W9WA 2XJPA 1H1AA 5DG2A 1WD3A 4DS0A 4OQ8A 1JW6A 1W2TA 4HPKB 5K8SA 1EV12 2XL7A 2ZKLA 3N3HA 4URAA 1LB2A 2XJQA 4YGCA 3TEYA 4IESA 4XAAA 3VB9A 3ZLIA 4D0QA 3VDDC 1AXYA 4IE7A 4NIAA 2PMWB 1J84A 1FOD3 5I8TA 2O0OA 4YVWC 3NSTA 1WCKA 2DVDA 1US3A 2HBTA 2K0GA 2W1UA 2WLQA 2YU2A 3MBWA 1VBB3 4L99A 4MGIE 5HXVA 4AXOA 2QQMA 4NIDA 1RUG2 1OQDA 1ZZ6A 5A3MA 1MEC3 1UYPA 4ORFA 4XF3A 1RUD2 1UIJA 4OCTA 3ZR6A 1CIYA 4CDXC 3PDQA 4R4XA 2YYOA 2DBIA 1UMHA 3RFRA 3TYJA 1VBC3 1CAWB 2O8OA 3RYKA 3UESA 1AR93 4YVWB 1XSRA 1T2XA 3ILFA 3M3EA 4QGNA 2HWB2 2RDQA 4BH9A 3WDTA 2FQPA 3WCSA 4XUNA 2VAUA 3DYPA 4LBQD 3HD8B 3D3AA 4P9IA 4EN8B 4LITA 3WF3A 4COWA 3JB8A 4LBQB 1RVF2 4XBLA 5L7OC 5JOZA 5H9PA 4KG8A 1XU2A 2JWPA 3V0BA 4K21A 4XXAA 2EXJA 3VL9A 3T08A 2VBDA 4Y1XA 4F3JA 1AR61 1AYN1 1UOGA 2XJRA 5AVAA 2GZWA 3U10A 1IS4A 4IL7A 5AVPA 3MLLA 4U36A 4AR2A 1WCSA 4Y5TA 1YQCA 3CJIC 2WS91 2H0BA 5ANQA 3O14A 3WP3A 1HQWA 4DEVA 4Z92B 4LA3A 1SG3A 1TME3 3M3QA 5L7OB 2ARAA 4QPGA 2WYFA 5I0TA 1TEIA 5C3QA 3VHNA 1SCRA 4CEWA 4HONA 4NIIA 2WDBA 1VBC2 5EHDA 5FY7A 1PK6A 1GOGA 2LRPA 4JVAA 1AX0A 1W0OA 5LATA 4DUWA 3CHXA 5DDJ3 1AL21 3CJIB 2XLFA 3JQWA 1MZ6A 2X5IC 3NV1A 3LA3A 4M3CE 3WX5A 4LHLA 2BQPA 4TTGA 5SV5A 3ZYRA 4NVPA 4JKMA 3ZXKA 2BEOA 4Y20B 1ASJ1 4HKWA 5EV7A 4DXZA 2Y38A 2C1FA 2P3IA 4P5HA 4HBNA 3JD71 2HWD1 4QM9A 5H9SA 3VZOA 4D94A 4DMIA 1GOHA 1R083 1S0DA 1RINA 1W2NA 5EJ1B 1WLTA 4YW7A 4Q2FA 2RR11 4BQ3A 1V6NA 1TME2 3WD5A 4A7KA 1HW5A 4XFIA 2W68A 5FUPA 1JYCA 1SPPA 1UZWA 1PZ7A 1V9U3 2E9QA 5K0UA 5KHGA 1W06A 4Q4Y3 1JZ8A 2XBO3 3HT2A 1HLCA 1O7FA 3I3EA 2OVUA 4MZUA 4BHPA 3KWVA 1HN1A 1PVC3 2R043 1REFA 4HK9A 4QHZA 2BGOA 2JG8C 3FHIB 1C57A 1S55A 2BERA 2XHNA 3MO4A 1W8NA 5E8AA 4EWAA 5LW9A 5FYYA 4QX1A 2QDNA 2WLPA 1OPMA 2WWUA 1ULFA 3PUAA 1PO13 3V64A 1RUE1 4F7ZA 3HPNA 2VZTA 5AFEA 5HPOA 5FLIA 3H8OA 1W9FA 1VJ2A 3SHRA 1JYNA 2A1XA 5CU1A 1W6OB 2NP0A 1R082 4BCUA 1QXRA 2QQIA 1ZM1A 5HCFA 2DWRA 2QDRA 3FLPA 1UXXX 2YY1A 4FPCA 2PHUA 4I2OA 1LGNA 1ONAA 2B7YA 1VPHA 1C8M3 1I5ZA 1JU3A 1OPOA 1K45A 1APNA 4LBJA 2ZGRA 1BK1A 1PO23 4XBQA 2Y6FA 3BVCA 2WO2A 1V9U2 4UFKA 4Y22B 2ILMA 3Q8FA 5C9AB 2OPWA 2WO3A 1C3HA 5J3UA 2G9FA 2XBO2 5JMOA 3AL6A 4LBLA 5D21A 5GM0A 4A44A 1OF4A 1PVC2 1BZWA 2JB4A 4KWLA 4E27A 4C1XA 1LCLA 1ZVFA 3AZWA 4PI2A 3VKNA 3DXTA 1L7QA 3O1UA 1OFNA 4IV1C 5A7QA 2JDAA 1PO12 2DCJA 2YDEA 3N9LA 3FBMA 3NV2A 5L36A 5CAZA 4Y1ZA 4JKKA 3RSJA 5KBFA 4MGQA 4QU2A 2ZOEB 4AZZA 1PX3A 1I3HA 1NCRB 4PLMA 4JDMA 4Q5OA 5ACA3 1S0JA 4QT6A 5FO8B 3PTRB 5A32A 4CXYA 4MV2A 3RZKA 4Y3OA 1WW5A 4GXLA 3ZFFB 3BALA 5JXGA 2YC0A 1R091 3J8F1 3ZKYA 4BLIA 1DQ6A 1UOFA 2W1SA 1CONA 1RUF1 3CIHA 4RS5B 3MLKA 5LBCA 5JXIA 2VNGA 4AI8A 1YJKA 4RYDA 1VR3A 3PTYA 1WA4A 4AAPA 4GWIA 3VZKA 4R4ZA 3SH3A 1RJ8A 3FC0A 1MZ5A 4KI5M 3DEMA 1F4AA 1ZRRA 1JOJA 1W6MB 5FXWA 4PLOA 5F9TA 3WG4A 1GNZA 4BQ2A 3BTYA 5CADA 3C7OA 3RZHA 1HRI2 4HSLA 1JI6A 2EF6A 3H3LA 3OB8A 4BQXA 1QWRA 2ZGPA 4CCJA 4BISA 1NE6A 2AEYA 3WF2A 2W47A 5FPAA 3UV9A 1A3KA 3OPTA 3D8CA 1UY2A 1HXS2 3C7FA 3ZXJA 2VZOA 1BXHA 3ZYHA 1J3PA 2ARCA 3PMSA 2E32A 4WVVA 2OKXA 1Q8SA 2BFUS 1BVVA 1QOSA 5A1FA 3GHMA 2VUJA 3EB7A 4KGGA 4WM7A 3VBHA 3OUJA 1JS9A 1KFXL 4A41A 4WVZA 1RUJ1 4AGRA 1FT9A 4CP1A 4Q8LA 2BBAA 2D6OX 2RM21 4INDA 5FYHA 5FY0A 1O3TA 1QQP3 4LR4A 2VMEA 3KF3A 3T2QA 1BEV1 5CFCB 1HB3A 1U5XA 3C7EA 1O4TA 1W0PA 2VOTA 3N7JA 5F5QA 1OA3A 4UW5A 5F3EA 4HN0A 3HJRA 1YCIA 3LD8A 1OOPB 3EMRA 4U2AA 4META 3WF0A 4CDQC 4O9EA 5A7NA 5KXCA 4HSJA 2C24A 3MPPG 2PA7A 2ZA9A 2ZGLA 4LBOA 4HKLA 3IDAA 2HWE1
chains in the Genus database with same CATH topology
5JXHA 2W1WA 2Y6LA 2PQSA 2BZDA 1CZVA 3MV01 1XNAA 1UX7A 1OF3A 2VZVA 2J22A 1GU3A 4RN5A 3I97A 2VZQA 4UOJA 3LEGA 2QQNA 2ZXQA 5EIYB 3VD3A 1EUTA 5IFPA 4OMCA 2ORXA 1J83A 1JHJA 4QPWA 2YFZA 3FHAA 3OEAA 2YG0A 3IAQA 5JXJA 2Y6JA 2LS6A 2WABA 1UY3A 1WKYA 4XUQA 2ZEXA 1LNSA 5I0DA 1KGYA 3W5NA 3A22A 3P1IA 4HG6B 4W50A 4LKSA 3DECA 1UMIA 1F4HA 2JE8A 3WNPA 2YC4A 4LQRA 1ULOA 5LA2A 1OH4A 2QQKA 2VR4A 2J1AA 4QX2A 3IB3A 5FUIA 3UNPA 3A7QA 2VJXA 2WO1A 4CUCA 1W99A 3I2HA 3VDAA 3CQOA 4CU7A 1UWWA 3T0BA 5C7GA 2J7MA 2E33A 3WNKA 1UYYA 2W5FA 3LEIA 2VCCA 2QQLA 4MGSA 3THDA 1JZ5A 1JZ4A 2V5DA 2W94A 1KEXA 2VL4A 2WZ8A 2ORZA 4XZUG 1L7RA 3NRUA 3ABZA 1I5PA 3EYPA 4DXRA 1PMJX 4XURA 4CUAA 5IJRA 5LCWL 2KD7A 1GQPA 3OGVA 4XVHA 3THCA 2EIEA 2R7EB 4W4ZA 4CUBA 4QDRA 5HXMA 1K42A 4BK4A 4JX0A 1JYVA 5IYYA 2CDOA 2YFUA 2JD9A 1PMHX 1P8JA 4M4RA 4DXSA 4QB1A 2WAOA 2VC9A 3E1F1 4ARYA 4BJ0A 1NUKA 3HNBM 2WAAA 1NAEA 3WF1A 4QX0A 3CDZB 3MUZ1 1US2A 2LW8A 3PUIA 2Y8KA 4A42A 3F2ZA 1MPXA 4QDSA 4A4AA 3ACFA 4BDVB 1UZ0A 3GDBA 4XUPA 2VQUA 3VD5A 2JKXA 2W95A 1ULPA 5EJZB 3LQCA 5G04L 4UAPA 4QDQA 3UETA 2VZ3A 3ACIA 4KWUA 3T0DA 4ZZ8A 2Z4FA 3OEBA 2YC2A 3LE0A 4KMQA 2VM9A 3WNMA 4QB2A 1O8PA 4AG4A 3DYMA 5B4XA 1R64A 4E8DA 1TVGA 4AAXA 5CZKA 1SHWB 3SKVA 2VMFA 1DYOA 3SEEA 4ZY9A 3HN3A 4W8JA 2J1VA 5B4NA 3I2IA 2YB7A 5DPNA 4D8MA 4L0PA 2L9LA 2BGPA 3BN6A 2WN3A 2RJ2A 3LPGA 1GUIA 5IFTA 4LPLA 2X05A 5C71A 2WQ8A 4A45A 1W9TA 4LHSA 2VMCA 3ZM8A 3P6BA 4PT6A 2ZEYA 3WNLA 3WNOA 1CZSA 4BK5A 2WBKA 2WYSA 1PX4A 1GMMA 3HNMA 3I2JA 5JR2A 1H6XA 3ACGA 3OGSA 4CVUA 4XUOA 4OUEA 4QAWA 1CX1A 3SEPA 2V4VA 2XOMA 4BXSV 3FHQA 1EUUA 1W9WA 1K12A 3GM8A 3GGLA 2EIDA 4D0QA 2RVAA 2V72A 3HNYM 2W87A 1J84A 3I2GA 1JZ7A 3AC0A 5DN2A 1JU4A 2QQOA 1US3A 2W1UA 3C8XA 3C7GA 3MBWA 3NJXA 4FI9A 4OMDA 2QQMA 3T0AA 4GWJA 1XNTA 1CIYA 4M4PA 4ET7A 4MADA 5F7UA 2WN2A 1UMHA 3J7HA 4CU9A 3CKHA 4DXTA 1UYZA 3UESA 3K77A 1T2XA 2Y6GA 5JUVA 2W9XA 1CZTA 4OZOA 3FN9A 4XUNA 3DYPA 3D3AA 2QQJA 3WF3A 3NQHA 1UYXA 2VQTA 3T08A 5A1AA 3T09A 1TG7A 4P02B 3I2FA 3T2OA 3PUHA 4DEVA 1SG3A 2VTFA 1GNYA 3VD4A 3OGRA 5J1XA 4DUXA 2J1SA 4ZZ5A 3K4DA 2HLEA 2E26A 2WDBA 1NKGA 2Y64A 1GOGA 4QX3A 4DUWA 1BHGA 3C7HA 3LPFA 4TTGA 4JKMA 4MOAA 2C26A 4DEQA 1SDDB 1XPWA 3MUY1 2ZEWA 3U37A 4OYUA 1JYWA 1GOHA 2B9VA 2VCBA 1O8SA 5EJ1B 2W3JA 2J1EA 1JZ6A 2J1RA 5IHRA 3ETPA 2WZEA 4A6OA 2VZ1A 3MV11 3GXUA 4JKLA 5C70A 3T2PA 1JZ8A 4PF1A 3I3BA 3I3EA 2ZEZA 1DLCA 4MO3M 4ZXEA 1HN1A 3K4ZA 2W46A 3A23A 3I3DA 2BGOA 3MO4A 3HEIA 2BERA 2VCAA 2XHNA 4E8CA 1W8NA 4P08A 2HYXA 3CZJA 1XC6A 4P00B 4QX1A 3A21A 2W1QA 1K3IA 5G05L 3LEKA 3VD9A 3ECQA 2VZTA 3HPNA 5HPOA 1OD3A 2VZPA 1UXZA 1JYNA 1DP0A 2QQIA 2DDUA 1UXXX 5DMYA 1JU3A 2B4KA 1K45A 3WEZA 2WUHA 2WO2A 2WO3A 2VO5A 4XUTA 5JMOA 2VMDA 4A44A 1OF4A 4P5YA 5LA0A 2W92A 4YPJA 3VD7A 3I2KA 3OBAA 1NX9A 3OG2A 2CDPA 1L7QA 3WQBA 2JDAA 2QBXA 2DCJA 1IQDC 2C4XA 4JKKA 1UY4A 4MGQA 1PX3A 2XQXA 4IUGA 2VZRA 4A3ZA 2J1TA 3VDCA 3CZUA 3SKJE 3CMGA 3K46A 5JXGA 3WF4A 3BGAA 2W1SA 3CIHA 5JXIA 2VZSA 2Y6HA 3WNNA 5LA1A 4RYDA 3W5MA 3NNGA 2ID4A 2Y6KA 1YQ2A 2E31A 4GWIA 4KI5M 3IAPA 1F4AA 1UY1A 2RV9A 3WSOA 2J1UA 1W9SA 4Z2AA 1GOFA 3C7OA 1JI6A 3OB8A 1O59A 3WF2A 1RYYA 2DCKA 2W47A 3K4AA 3NJVA 1JZ3A 1UY2A 2XONA 1WCQA 3C7FA 4UI9L 2VZOA 2EIBA 4GZ9A 3JXSA 3K75B 2OKXA 2E32A 2EICA 4CU6A 2C9KA 1W0NA 3EB7A 3DYOA 2W91A 3HOBA 5DQ0A 4ARXA 4TXWA 3IIIA 1H6YA 5CYYA 2X09A 4PQQA 4A41A 4CU8A 1JZ2A 2BBAA 4QB6A 1JYXA 2VMEA 1UY0A 3T2QA 3FL7A 3C7EA 1W8OA 2VOTA 3HJRA 3ACHA 4DUVA 3WF0A 2X10A 3VDBA 1OT5A 4JHZA 2VZUA 3IDAA 1D7PM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JXH A;  2W1W A;  2Y6L A;  2PQS A;  2BZD A;  1CZV A;  3MV0 1;  1XNA A;  1UX7 A;  1OF3 A;  2VZV A;  2J22 A;  1GU3 A;  4RN5 A;  3I97 A;  2VZQ A;  4UOJ A;  3LEG A;  2QQN A;  2ZXQ A;  5EIY B;  3VD3 A;  1EUT A;  5IFP A;  4OMC A;  2ORX A;  1J83 A;  1JHJ A;  4QPW A;  2YFZ A;  3FHA A;  3OEA A;  2YG0 A;  3IAQ A;  5JXJ A;  2Y6J A;  2LS6 A;  2WAB A;  1UY3 A;  1WKY A;  4XUQ A;  2ZEX A;  1LNS A;  5I0D A;  1KGY A;  3W5N A;  3A22 A;  3P1I A;  4HG6 B;  4W50 A;  4LKS A;  3DEC A;  1UMI A;  1F4H A;  2JE8 A;  3WNP A;  2YC4 A;  4LQR A;  1ULO A;  5LA2 A;  1OH4 A;  2QQK A;  2VR4 A;  2J1A A;  4QX2 A;  3IB3 A;  5FUI A;  3UNP A;  3A7Q A;  2VJX A;  2WO1 A;  4CUC A;  1W99 A;  3I2H A;  3VDA A;  3CQO A;  4CU7 A;  1UWW A;  3T0B A;  5C7G A;  2J7M A;  2E33 A;  3WNK A;  1UYY A;  2W5F A;  3LEI A;  2VCC A;  2QQL A;  4MGS A;  3THD A;  1JZ5 A;  1JZ4 A;  2V5D A;  2W94 A;  1KEX A;  2VL4 A;  2WZ8 A;  2ORZ A;  4XZU G;  1L7R A;  3NRU A;  3ABZ A;  1I5P A;  3EYP A;  4DXR A;  1PMJ X;  4XUR A;  4CUA A;  5IJR A;  5LCW L;  2KD7 A;  1GQP A;  3OGV A;  4XVH A;  3THC A;  2EIE A;  2R7E B;  4W4Z A;  4CUB A;  4QDR A;  5HXM A;  1K42 A;  4BK4 A;  4JX0 A;  1JYV A;  5IYY A;  2CDO A;  2YFU A;  2JD9 A;  1PMH X;  1P8J A;  4M4R A;  4DXS A;  4QB1 A;  2WAO A;  2VC9 A;  3E1F 1;  4ARY A;  4BJ0 A;  1NUK A;  3HNB M;  2WAA A;  1NAE A;  3WF1 A;  4QX0 A;  3CDZ B;  3MUZ 1;  1US2 A;  2LW8 A;  3PUI A;  2Y8K A;  4A42 A;  3F2Z A;  1MPX A;  4QDS A;  4A4A A;  3ACF A;  4BDV B;  1UZ0 A;  3GDB A;  4XUP A;  2VQU A;  3VD5 A;  2JKX A;  2W95 A;  1ULP A;  5EJZ B;  3LQC A;  5G04 L;  4UAP A;  4QDQ A;  3UET A;  2VZ3 A;  3ACI A;  4KWU A;  3T0D A;  4ZZ8 A;  2Z4F A;  3OEB A;  2YC2 A;  3LE0 A;  4KMQ A;  2VM9 A;  3WNM A;  4QB2 A;  1O8P A;  4AG4 A;  3DYM A;  5B4X A;  1R64 A;  4E8D A;  1TVG A;  4AAX A;  5CZK A;  1SHW B;  3SKV A;  2VMF A;  1DYO A;  3SEE A;  4ZY9 A;  3HN3 A;  4W8J A;  2J1V A;  5B4N A;  3I2I A;  2YB7 A;  5DPN A;  4D8M A;  4L0P A;  2L9L A;  2BGP A;  3BN6 A;  2WN3 A;  2RJ2 A;  3LPG A;  1GUI A;  5IFT A;  4LPL A;  2X05 A;  5C71 A;  2WQ8 A;  4A45 A;  1W9T A;  4LHS A;  2VMC A;  3ZM8 A;  3P6B A;  4PT6 A;  2ZEY A;  3WNL A;  3WNO A;  1CZS A;  4BK5 A;  2WBK A;  2WYS A;  1PX4 A;  1GMM A;  3HNM A;  3I2J A;  5JR2 A;  1H6X A;  3ACG A;  3OGS A;  4CVU A;  4XUO A;  4OUE A;  4QAW A;  1CX1 A;  3SEP A;  2V4V A;  2XOM A;  4BXS V;  3FHQ A;  1EUU A;  1W9W A;  1K12 A;  3GM8 A;  3GGL A;  2EID A;  4D0Q A;  2RVA A;  2V72 A;  3HNY M;  2W87 A;  1J84 A;  3I2G A;  1JZ7 A;  3AC0 A;  5DN2 A;  1JU4 A;  2QQO A;  1US3 A;  2W1U A;  3C8X A;  3C7G A;  3MBW A;  3NJX A;  4FI9 A;  4OMD A;  2QQM A;  3T0A A;  4GWJ A;  1XNT A;  1CIY A;  4M4P A;  4ET7 A;  4MAD A;  5F7U A;  2WN2 A;  1UMH A;  3J7H A;  4CU9 A;  3CKH A;  4DXT A;  1UYZ A;  3UES A;  3K77 A;  1T2X A;  2Y6G A;  5JUV A;  2W9X A;  1CZT A;  4OZO A;  3FN9 A;  4XUN A;  3DYP A;  3D3A A;  2QQJ A;  3WF3 A;  3NQH A;  1UYX A;  2VQT A;  3T08 A;  5A1A A;  3T09 A;  1TG7 A;  4P02 B;  3I2F A;  3T2O A;  3PUH A;  4DEV A;  1SG3 A;  2VTF A;  1GNY A;  3VD4 A;  3OGR A;  5J1X A;  4DUX A;  2J1S A;  4ZZ5 A;  3K4D A;  2HLE A;  2E26 A;  2WDB A;  1NKG A;  2Y64 A;  1GOG A;  4QX3 A;  4DUW A;  1BHG A;  3C7H A;  3LPF A;  4TTG A;  4JKM A;  4MOA A;  2C26 A;  4DEQ A;  1SDD B;  1XPW A;  3MUY 1;  2ZEW A;  3U37 A;  4OYU A;  1JYW A;  1GOH A;  2B9V A;  2VCB A;  1O8S A;  5EJ1 B;  2W3J A;  2J1E A;  1JZ6 A;  2J1R A;  5IHR A;  3ETP A;  2WZE A;  4A6O A;  2VZ1 A;  3MV1 1;  3GXU A;  4JKL A;  5C70 A;  3T2P A;  1JZ8 A;  4PF1 A;  3I3B A;  3I3E A;  2ZEZ A;  1DLC A;  4MO3 M;  4ZXE A;  1HN1 A;  3K4Z A;  2W46 A;  3A23 A;  3I3D A;  2BGO A;  3MO4 A;  3HEI A;  2BER A;  2VCA A;  2XHN A;  4E8C A;  1W8N A;  4P08 A;  2HYX A;  3CZJ A;  1XC6 A;  4P00 B;  4QX1 A;  3A21 A;  2W1Q A;  1K3I A;  5G05 L;  3LEK A;  3VD9 A;  3ECQ A;  2VZT A;  3HPN A;  5HPO A;  1OD3 A;  2VZP A;  1UXZ A;  1JYN A;  1DP0 A;  2QQI A;  2DDU A;  1UXX X;  5DMY A;  1JU3 A;  2B4K A;  1K45 A;  3WEZ A;  2WUH A;  2WO2 A;  2WO3 A;  2VO5 A;  4XUT A;  5JMO A;  2VMD A;  4A44 A;  1OF4 A;  4P5Y A;  5LA0 A;  2W92 A;  4YPJ A;  3VD7 A;  3I2K A;  3OBA A;  1NX9 A;  3OG2 A;  2CDP A;  1L7Q A;  3WQB A;  2JDA A;  2QBX A;  2DCJ A;  1IQD C;  2C4X A;  4JKK A;  1UY4 A;  4MGQ A;  1PX3 A;  2XQX A;  4IUG A;  2VZR A;  4A3Z A;  2J1T A;  3VDC A;  3CZU A;  3SKJ E;  3CMG A;  3K46 A;  5JXG A;  3WF4 A;  3BGA A;  2W1S A;  3CIH A;  5JXI A;  2VZS A;  2Y6H A;  3WNN A;  5LA1 A;  4RYD A;  3W5M A;  3NNG A;  2ID4 A;  2Y6K A;  1YQ2 A;  2E31 A;  4GWI A;  4KI5 M;  3IAP A;  1F4A A;  1UY1 A;  2RV9 A;  3WSO A;  2J1U A;  1W9S A;  4Z2A A;  1GOF A;  3C7O A;  1JI6 A;  3OB8 A;  1O59 A;  3WF2 A;  1RYY A;  2DCK A;  2W47 A;  3K4A A;  3NJV A;  1JZ3 A;  1UY2 A;  2XON A;  1WCQ A;  3C7F A;  4UI9 L;  2VZO A;  2EIB A;  4GZ9 A;  3JXS A;  3K75 B;  2OKX A;  2E32 A;  2EIC A;  4CU6 A;  2C9K A;  1W0N A;  3EB7 A;  3DYO A;  2W91 A;  3HOB A;  5DQ0 A;  4ARX A;  4TXW A;  3III A;  1H6Y A;  5CYY A;  2X09 A;  4PQQ A;  4A41 A;  4CU8 A;  1JZ2 A;  2BBA A;  4QB6 A;  1JYX A;  2VME A;  1UY0 A;  3T2Q A;  3FL7 A;  3C7E A;  1W8O A;  2VOT A;  3HJR A;  3ACH A;  4DUV A;  3WF0 A;  2X10 A;  3VDB A;  1OT5 A;  4JHZ A;  2VZU A;  3IDA A;  1D7P M; 
#chains in the Genus database with same CATH topology
 4BMB A;  5JXH A;  1DLL A;  3WLU A;  4YFZ A;  4FQ4 A;  2BZD A;  1CZV A;  4EWE A;  3WUD A;  2JDM A;  2ZX0 A;  2EXI A;  4N53 A;  1XNA A;  1UX7 A;  2BNN A;  2D3S A;  2VZV A;  5KXE A;  2XWB B;  1DIW A;  2EXH A;  3NAP A;  4Q0S A;  3I97 A;  4IQP A;  3OJB A;  1DFQ A;  4CDQ B;  2VUD A;  3O0W A;  4EYU A;  2ZGO A;  4OUL A;  4FOQ A;  4RD7 A;  4WZF A;  5FYS A;  5GLV A;  1LAJ A;  2VG9 A;  1WLC A;  4AED A;  1B35 A;  1UAI A;  2ZTN A;  2RS5 3;  3KCX A;  2ORX A;  4FFI A;  1H9P A;  5TSW A;  2F17 A;  1OLQ A;  4XC9 A;  5FZ4 A;  2YFZ A;  3F95 A;  3VBS C;  5LK7 B;  5JXJ A;  3OF1 A;  3WW4 A;  2AEN A;  1X82 A;  2GP3 A;  2D6L X;  2TBV A;  4B4P A;  4BQW A;  4AGG A;  5FY8 A;  1YHF A;  2ZEX A;  1LNS A;  4K7J A;  3V56 A;  4YM0 A;  1E5H A;  1RUD 1;  1ZNP A;  2BFU L;  5LBB A;  3WP5 A;  3NV3 A;  1H4G A;  1ZZB A;  5FYI A;  1LHV A;  2UWC A;  4CDU A;  4XFB A;  1R1A 1;  4F83 A;  3WHU A;  4CCN A;  4XJ9 A;  1SBE A;  1T6B X;  2JD4 A;  3QOP A;  2JE8 A;  1SLI A;  2HEY F;  4CCC A;  5C4W A;  3VHR A;  4WM8 B;  4XCB A;  1Y9Q A;  1ACC A;  4AHX A;  5FP7 A;  2O1Q A;  3LGR A;  2SBA A;  1RXF A;  2IXC A;  1J58 A;  1ZYB A;  3VBF A;  4E2G A;  5HCA A;  1GP6 A;  3TWI A;  4JRL A;  5FZI A;  4AL9 A;  5FLJ A;  2WNU A;  2GMM A;  2UY8 A;  1DDL A;  3VDA A;  1DYK A;  1JOP A;  1SBD A;  3GJA A;  1LKN A;  5BNP A;  3ILN A;  2J7M A;  1DZR A;  2RS5 2;  1FOD 1;  2E33 A;  4W6W A;  3C3V A;  3GAL A;  3VZJ A;  3MHZ A;  3RDI A;  2VCC A;  3FBY A;  1VBB 1;  1NCQ B;  1MEC 1;  2WZ8 A;  3NRU A;  3ABZ A;  1J1L A;  4JQR A;  1VLN A;  3O1O A;  2A6Y A;  5GZF A;  4V2W A;  2J42 A;  2R1B A;  2VMH A;  2ZJC A;  3I54 A;  4XUR A;  4CUA A;  4CRQ A;  1VBC 1;  3R0R A;  4EE2 A;  5C3O A;  1RJ7 A;  3FE5 A;  3E97 A;  5SV8 A;  1AR9 1;  2NYY A;  1SLL A;  1H8T A;  4DRV A;  2R30 A;  1S0C A;  3ZFE A;  5CG9 A;  5HCB A;  4MSV A;  2K46 A;  4XVH A;  2A7A A;  3PUS A;  4QMA A;  4W4Z A;  5LY1 A;  1W3V A;  1O3S A;  4AE2 A;  1K42 A;  1A8D A;  3DPR A;  3H9A A;  3WDV A;  1AL0 G;  4QKD A;  2PTM A;  4XDO A;  4CCE A;  4IW3 A;  5F2S A;  1DG6 A;  3ZN4 A;  1QXP A;  2YMZ A;  2FDI A;  4FFF A;  4QPI C;  4AI0 A;  4LKF A;  1WCD J;  2V5Y A;  2XUM A;  3ORJ A;  4CA9 A;  1BQP A;  2OUH A;  1W6N B;  2BRT A;  1ZBE 3;  2QQU A;  4QB1 A;  4QQL A;  3RPQ A;  4HPK A;  2QCS B;  4CYD A;  4ARY A;  3O12 A;  1F2N A;  2X53 S;  2I45 A;  2WAA A;  1RUI 1;  1NAE A;  1XNB A;  5FZO B;  3LIG A;  3CDZ B;  1UPI A;  2VXJ A;  4QX0 A;  5FMO S;  3WF1 A;  2D43 A;  1ZZC A;  1LES A;  1ND2 B;  3MUZ 1;  4AFC A;  3PUI A;  4BWO A;  2GSY A;  5FY9 A;  3J7M A;  4X6R B;  5FMD A;  5A7W B;  4IEU A;  3VD5 A;  2JKX A;  4D3W A;  4IGP A;  1ULP A;  5DDJ 1;  5EJZ B;  3I59 B;  4Z8B A;  1V6I A;  2D7F A;  3LQC A;  4N9H A;  1OA4 A;  3GBG A;  4K6B A;  4V1P A;  1OKO A;  3RYR A;  1AL2 3;  3VBO B;  3VDD A;  1AJK A;  2GAU A;  3M70 A;  4B4R A;  2FMD A;  4QDQ A;  1GV9 A;  1CAW A;  5JIU A;  3ACI A;  1LJ7 A;  4YVW A;  4QXB A;  1YXW A;  2ZML A;  2WWS A;  4ZON A;  4ZZ8 A;  1VRB A;  4CEY C;  1RC6 A;  2P3Y A;  3LE0 A;  4KMQ A;  5FLH A;  4B1M A;  1G7Y A;  4UT5 A;  4CPB A;  5BNN C;  2DF7 A;  1JTZ X;  4DPN A;  3I4I A;  1R08 1;  3EBR A;  5FPB A;  4I3G A;  4QB2 A;  3T1M A;  4AG4 A;  4CDX A;  4QQH A;  2XR4 A;  2Q8O A;  1R64 A;  3AMQ A;  2DTY A;  1Z7S 3;  1HX6 A;  2WS9 2;  4E8D A;  1TVG A;  4AAX A;  2BOJ A;  4W6X A;  5C5T A;  3VKM A;  2RR1 3;  5CZK A;  4NPR A;  2R0H A;  3APB A;  5DAX A;  4QGL A;  1F8V A;  4W8J A;  1YC6 1;  5BY5 A;  1QOO A;  2WZP P;  4Q4Y 1;  2R49 A;  1ULE A;  2XBO 1;  3NKT A;  5CVR A;  4FOV A;  4OQ9 A;  4AHW A;  2C0Z A;  5FP8 A;  1W8F A;  2BGP A;  3BN6 A;  2R04 1;  2UWA A;  4QX8 A;  2WNV A;  1AL2 2;  5F1R A;  3POF A;  1GUI A;  2RS1 3;  4HMZ A;  4MXW A;  4BIF A;  1K5M B;  1W2O A;  5HV0 A;  1ND3 C;  3PIJ A;  4Q1P A;  2WQ8 A;  3NJY A;  4S2D A;  1PO1 1;  1ASJ 2;  4AQ6 A;  3CJI A;  1OBN A;  1EYB A;  2NMO A;  4AFA A;  2WZR 1;  4LHS A;  3UJQ A;  5GZG A;  3WV6 A;  1I9R A;  1H8V A;  3P6B A;  4PT6 A;  2ZEY A;  2ZHL A;  2GH2 A;  1CZS A;  3E5X A;  2HWD 2;  4YM2 A;  1QNW A;  3KHC A;  1BBT 3;  5A7P A;  3MLJ A;  2XKO A;  5T3N A;  3EO6 A;  2QUO A;  5A6Y A;  3I2J A;  4V2V A;  5JR2 A;  1XND A;  3JU9 A;  1C8M 1;  1OMI A;  2RR1 2;  3ACG A;  1PO2 1;  2X5I A;  4OLL A;  4XUO A;  3K3O A;  5FBZ A;  5FIX A;  4QAW A;  4LXL A;  2RDS A;  4RGA A;  4NHY A;  5A1L A;  3M3O A;  1OH3 A;  3CNA A;  5FZL A;  3LSD A;  2BDR A;  2VQ0 A;  2AYH A;  2DVF A;  3N7M A;  4QKB A;  4Z2W A;  5I8Y A;  5IK7 A;  3T4V A;  2EID A;  1UQX A;  3ETQ A;  4ZU5 A;  1JYT A;  1PNF A;  1JZ7 A;  2W87 A;  5A33 B;  3EXU A;  1ZX5 A;  1RUE 2;  3JUU A;  4NN0 A;  1V0A A;  2NLR A;  3O5S A;  4H55 A;  4DQA A;  4LJH A;  2PFW A;  2D6K A;  1JU4 A;  2ATF A;  2QQO A;  4N7I A;  5DN2 A;  3ZYB A;  5IVE A;  5ACA 1;  2X8K A;  4XFC A;  5JI7 A;  1YI9 A;  4YZ5 A;  5K4L A;  1XNT A;  4FT8 A;  3OPZ A;  3ASI A;  3OD4 A;  4PDW C;  4UW6 A;  4XHB A;  4M4P A;  2Q8D A;  1NA1 B;  2PHF A;  4ITC A;  4C8D A;  1W6O A;  2D44 A;  2WN2 A;  3KGZ A;  5E16 A;  4CSW A;  2IXJ A;  4DXT A;  1CES A;  4AQT A;  2XLG A;  1D2Q A;  4AVC A;  4CP9 A;  1UYZ A;  3K77 A;  2JG8 A;  5BNO B;  4HT1 T;  4QQP A;  1JHN A;  2ARX A;  4ZU7 A;  5LRS A;  4GWN A;  4OZO A;  2ZKN A;  1V00 A;  4LO7 A;  4AFB A;  5F3C A;  3FLT A;  4IDZ A;  5FZK A;  1UF2 C;  2QQJ A;  3TN9 3;  1LUL A;  3BTA A;  4AEJ A;  1J59 A;  4MH0 E;  2Y60 A;  2QQV A;  1WZX A;  1UYX A;  1UU4 A;  4HN1 A;  2A6W A;  5DUW A;  2ZGU A;  5C8C C;  4ASM B;  2DBN A;  2HH9 A;  1UMZ A;  1AVB A;  1D2S A;  1U5Y A;  4P02 B;  2JEN A;  1MS0 A;  4AI2 A;  3NVC A;  4LLO A;  2OW4 A;  3I2F A;  5D8A C;  4TLG A;  3T2O A;  3PUH A;  3AKQ A;  4XZP A;  3AMN A;  3IDE A;  4GUL A;  5EXO A;  2XQR A;  2VTF A;  4JRA A;  4R9D A;  1YFY A;  2IFW A;  3VD4 A;  1NXM A;  4YNI A;  2PXJ A;  4DUX A;  3J8F 2;  1R09 2;  2E26 A;  1MZE A;  3IDB B;  1LOD A;  1NKG A;  5DZG A;  3VBU B;  5FO7 B;  3MGU A;  3H7Y A;  4C91 A;  1RUF 2;  4W6Y A;  3U75 A;  3WDW A;  2D6N A;  1DGL A;  2VMG A;  1QQP 1;  4NRO A;  3ZYJ B;  4DB5 A;  2WNE A;  2EA7 A;  3PLQ A;  2RM2 3;  1BLZ A;  3C7H A;  2JEM A;  3GBF A;  3LPF A;  4IV1 A;  4KWJ A;  4Q1R A;  4WZC A;  1NZC A;  3JBG 3;  4YYO A;  1BEV 3;  3AVS A;  1GZC A;  1MQT B;  4FAG A;  2G4I A;  2HEW F;  4FP2 A;  3UT0 A;  2WR9 A;  4BYY A;  5C8W A;  5JAX A;  3ZFG C;  4B3N A;  4WVM B;  1LED A;  1STM A;  4YGD A;  2HWE 3;  3EQE A;  2VW0 A;  2VCB A;  1XYO A;  2A3Y A;  4KBZ A;  5C33 A;  3EJK A;  1WMF A;  2WNO A;  1J1T A;  3G7D A;  1JZ6 A;  2C5D A;  3THT A;  4AWD A;  4BPZ A;  3ETP A;  2WZE A;  4A6O A;  2DCT A;  1PMI A;  3AP5 A;  3MV1 1;  3WG1 A;  4JKL A;  2R07 3;  3BYW A;  5I8S A;  2RS5 1;  1ZA7 A;  3T2P A;  2MEV 3;  4PF1 A;  4AI9 A;  1RUJ 2;  3I3B A;  5DZE A;  2DV9 A;  1ENR A;  3B7M A;  3KD4 A;  1XYP A;  4MO3 M;  2RM2 2;  2D98 A;  1CAX B;  1QH6 A;  5LAS A;  4DRR A;  3A23 A;  4I02 A;  3JQX A;  3KV5 A;  4IV3 B;  1BEV 2;  1FPN 3;  3HEI A;  2VCA A;  3LIH A;  4P08 A;  2JDH A;  2HYX A;  3CZJ A;  1XC6 A;  4P00 B;  2RMU 3;  2DU1 A;  5BUV A;  2PQQ A;  5FXV A;  1K3I A;  2F4P A;  3LEK A;  3VD9 A;  4UXA A;  3BIW E;  1OD3 A;  2CNA A;  2Y0O A;  3MIF A;  1CX4 A;  4H7L A;  5CB7 A;  1NXD 1;  3H1W A;  3SCH A;  4L9B A;  1UXZ A;  1LU1 A;  1UKR A;  2D5F A;  4HVR A;  5ERL A;  4Q4X 1;  2HWE 2;  1DP0 A;  1LGC A;  1OLR A;  2P6C A;  3GBW A;  2EVX A;  4UF0 A;  4Q4W 3;  2BV4 A;  4C0B A;  1PIV 1;  3CEW A;  1SMV A;  3RYP A;  3U0Z A;  3IMM A;  1AJO A;  1PGS A;  3AZV A;  5FCC A;  4LOT A;  4LIV A;  1HRV 1;  5LEJ A;  3IWZ A;  1Q5O A;  2OT7 A;  1GP5 A;  1Y9G A;  3CJX A;  4JTO A;  2BPA 2;  1IZ3 A;  3RI8 A;  1UCX A;  2VW1 A;  4CDQ A;  2FMY A;  3RJ2 X;  4BQ4 A;  5LA0 A;  2R0F A;  1CWP A;  3BU7 A;  4B8E A;  4D7S A;  1RUH 3;  1XU1 A;  5L9R A;  2IWG B;  1DGR N;  5FV3 A;  5FZE A;  1CAV B;  2YUE A;  3NNM A;  4GIQ A;  5A7O A;  1IQD C;  3NNL A;  2C4X A;  5FZH A;  2BUK A;  2Z5W A;  2QE3 A;  1R1A 2;  4NOT A;  4PIX A;  3BU0 A;  4AVB A;  2IVJ A;  2XQX A;  4IUG A;  3ZIX A;  4XCA A;  1RL3 A;  4GA9 A;  2BNO A;  4QD2 A;  3K2O A;  3PU8 A;  4FFH A;  2J1T A;  1HB1 A;  3CZU A;  4H7M A;  4S2F A;  5JR7 B;  1WWY A;  3K46 A;  1ENQ A;  3WF4 A;  5E89 A;  1GZW B;  2RHP A;  5FQ0 A;  3WG3 A;  3VBS A;  5IVJ A;  1KXG A;  2WIN B;  1COV 1;  4BQ1 A;  1LHU A;  4MXV A;  2ET1 A;  1X33 A;  3W5M A;  4BU2 A;  2ID4 A;  1YWK A;  5FPL A;  5FZ1 A;  3WOG A;  2YPD A;  1DQ2 A;  2FDG A;  1YQ2 A;  4BLJ A;  1ZBE 1;  1FOD 2;  4RGK A;  4YZ1 A;  1OUR A;  2VCM A;  1DHK B;  3I2D A;  2FDJ A;  4QX7 A;  1W9S A;  3RZM A;  2IC1 A;  1VBB 2;  1GOF A;  3MFA A;  4LHK A;  4Q27 A;  1RUI 3;  1MEC 2;  1O59 A;  3J26 N;  3OY8 A;  4O65 A;  4XJW A;  3ZSE A;  4ZHN A;  1LEN A;  2VGD A;  2VQA A;  3KHB A;  4XQD A;  3WY6 A;  3NJV A;  3WZ1 A;  5LBE A;  1RTV A;  1JZ3 A;  3IKW A;  4D69 A;  3S7E A;  4CE8 A;  4B7K A;  2AC1 A;  3JXS A;  3K75 B;  1VAK A;  1AR9 2;  4IE4 A;  4XMI A;  4EN7 B;  5I0S A;  3WT3 A;  5FZM A;  2ZHK A;  4A2U A;  1W6Q A;  1V6L A;  2DVA A;  3GYD A;  3NJZ A;  4CU6 A;  4HVQ A;  2O8Q A;  4ARX A;  1QF3 A;  1TNF A;  4PQQ A;  4B1L A;  2RDR A;  3QLQ A;  3E5U A;  3BCW A;  4WV8 A;  1JZ2 A;  4QB6 A;  1QJU 1;  4AGV A;  3O1T A;  3WDY A;  4IGO A;  2HYK A;  4UBG A;  1E57 A;  3ZX7 A;  1MS5 A;  1FV3 A;  2H6C A;  4R9C A;  4GMP 0;  3MF9 A;  3ZN6 B;  4NJ4 A;  4J1X A;  1Z7S 1;  4Q0P A;  1Q8P A;  1U0A A;  2OQ6 A;  2VBB A;  2XVK A;  4OI2 A;  3IZO A;  5ANN A;  2X10 A;  5F2W A;  1RUI 2;  4MG2 A;  4JQT A;  2JDY A;  3MIB A;  3VDB A;  2PAE A;  3D6E A;  2E7Q A;  1FXZ A;  2BJS A;  2WFP A;  2VZU A;  5FZ9 A;  4AI3 A;  1GR3 A;  4IGQ A;  3SC7 X;  3SXW A;  4QXC A;  1OSG A;  1W6P A;  3MV0 1;  2G9G A;  2XH6 A;  5IUQ A;  5JVV A;  5HV4 A;  1MAC A;  4Y5S A;  3O0V A;  4P9Y A;  2J22 A;  3VKO A;  1FAY A;  4RN5 A;  5DDJ 2;  1JUH A;  4QPI A;  4OZX A;  3OGG A;  3Q9O A;  4UOJ A;  2RS1 1;  2ZXQ A;  3VD3 A;  1FMD 3;  5FP3 A;  1EUT A;  2DUO A;  2XG3 A;  4JC1 A;  5BNQ A;  3LFI A;  1WW6 A;  1GP4 A;  3DXU A;  4FTB A;  4L8Q A;  4M00 A;  2HEV F;  5DAB A;  1J83 A;  1JHJ A;  4QPW A;  1O3R A;  3J4U H;  3TEZ A;  2VUC A;  2YG0 A;  5EZW A;  2E53 A;  3BPZ A;  2WZR 3;  3GJB A;  3JB4 C;  5KHH A;  2Y6J A;  3SH5 A;  4A7Z A;  4MGZ E;  5C9A C;  4FPH A;  2LS6 A;  1HIX A;  2DCZ A;  1SLC A;  2RS3 3;  1BBT 1;  2WAB A;  1WKY A;  3QD6 A;  4L92 A;  3FFQ A;  4XUQ A;  2VXR A;  4CDW C;  2GC1 A;  4EZH A;  3L2H A;  5HBA A;  2ENR A;  3W5N A;  4HG6 B;  3NWK A;  1HB2 A;  1QY4 A;  3M3C A;  5IAX A;  1RGS A;  2JEC A;  2E51 A;  4UFI A;  4F8A A;  1AYM 1;  1XNC A;  2YC4 A;  2I07 B;  1DGR A;  2BBV A;  4O61 A;  3AL5 A;  1OH4 A;  5KHK A;  2P1B A;  3AMM A;  4Q4Y 2;  2KXL A;  2I74 A;  2R1D A;  3E5Q A;  3GCW A;  2VY0 A;  4CDW B;  3IB3 A;  5FZC A;  4QQ2 A;  2Y26 A;  5FUI A;  2Q4S A;  3V65 A;  1NCR C;  4CEY A;  5DZF A;  5J48 A;  3K48 A;  5FXX A;  2R04 2;  3VV1 A;  5BNN A;  2ZGM A;  1I1E A;  3PL0 A;  2MPF A;  3RMY A;  3TOJ A;  2A5Z A;  3H50 A;  4ES8 A;  2QVS B;  3CQO A;  1UD1 A;  5IVY A;  1WUV A;  4HET A;  1TZO A;  4IE0 A;  3T0B A;  3ZFF C;  4IEY A;  2OX0 A;  3DKW A;  4MGT A;  4DZG A;  2CAV A;  4M3C B;  3D5O A;  3L2Y A;  4I01 A;  4KH9 A;  4R9B A;  1QJZ A;  2WZR 2;  4RS5 C;  5DUV A;  4MGS A;  1JZ4 A;  2VPV A;  3OBT A;  4K8R B;  3H1M A;  4BOW A;  4GB3 3;  1YEW A;  1KEX A;  2RS3 2;  2W94 A;  2VL4 A;  3AJZ A;  4Z07 A;  3ST7 A;  2ORZ A;  1H0B A;  3LA2 A;  1L7R A;  4XDP A;  3RRD A;  1GZT A;  1JBC A;  2WA4 A;  4P9G A;  4A7Y A;  4COZ A;  1N1Y A;  3EYP A;  4HK8 A;  1PMJ X;  1C8M 2;  3OTF A;  2VUA A;  1QDO A;  1SFY A;  1EAH 1;  2R6Q A;  4MYE A;  4XXP A;  5IVV A;  1DCS A;  1PO2 2;  1DQ4 A;  2VNV A;  3IDC B;  4KG0 A;  5JOY A;  1XRU A;  3Q8E A;  5LCW L;  4NIH A;  3SQO A;  1A6C A;  5I0U A;  1ND3 A;  1POV 3;  3UGG A;  4UYB A;  1G8W A;  1RMU 3;  4JCK A;  2LUW A;  4ZKT B;  5HXM A;  3TN9 1;  3LDK A;  2VBP A;  3TRS B;  4FPE A;  1AUY A;  2CDO A;  1LTE A;  1XE0 A;  5JSO A;  4NHM A;  4BE3 A;  2JD9 A;  1PMH X;  2JG9 B;  4C90 A;  2PHR A;  3N7L A;  4I0A A;  1XE8 A;  5J37 A;  2GN7 A;  3O1P A;  4M4R A;  4ISR A;  4DXS A;  5F32 A;  2WAO A;  5CA6 A;  5CKN A;  2VC9 A;  4LO4 B;  1CGP A;  1NUK A;  3O1M A;  2Z42 A;  5ACA 2;  4ASL A;  1C1F A;  1US2 A;  2FCV A;  5CFC C;  4Y1Y A;  4IEZ A;  2Y8K A;  5A33 A;  1CPM A;  4A42 A;  3POG A;  4FXK B;  5JLV A;  4EQV A;  4EZ4 A;  1OOP C;  3VHP A;  3USU B;  4NHX A;  5LEK A;  4N43 C;  2B8M A;  4XF1 A;  4E4S A;  4NAM A;  5JWP A;  1H1I A;  2D97 A;  1C28 A;  1C5I A;  3CLP A;  3CU7 A;  3LA7 A;  1Q56 A;  1OUS A;  1HN0 A;  2ZZJ A;  4FTE A;  3JBG 1;  1DZT A;  2JIG A;  4GMP 1;  1RED A;  3UET A;  3VZL A;  4COU A;  1RUC 3;  3MEP A;  3CO2 A;  1LOG A;  4OI0 A;  3VUO A;  2ZHM A;  4XYX A;  4IEW A;  3WXP A;  2NQY A;  3OEB A;  2YC2 A;  3N4M A;  3AXD A;  2Q5T A;  4N43 B;  1HQL A;  5KC5 A;  1SLT A;  4CCM A;  4IET A;  4PDW A;  2P17 A;  4RSU A;  1ULC A;  1O3Q A;  3ZSJ A;  1O8P A;  4R52 A;  1HV1 A;  3BOD A;  1RHI 1;  1W05 A;  2DUR A;  1ALY A;  3DYM A;  1NLS A;  5B4X A;  5C3R A;  1IS5 A;  5C5U A;  4H3W A;  4Q0U A;  5FMC A;  4XJU A;  1OLM A;  1CJP A;  1UO9 A;  1MZF A;  4K1Y A;  2XXZ A;  3WR0 A;  1DYO A;  3OBZ A;  1GQG A;  2FBE A;  5JZG B;  5FKC A;  5ABJ B;  2R07 1;  1Y9M A;  2PHT A;  5EFU A;  3AKT A;  1FNY A;  4JAA A;  4LBN A;  4NRQ A;  2MEV 1;  5A3O A;  3WP6 A;  5IVB A;  1MS9 A;  4Q4V 3;  5JPN B;  3AX4 A;  4RR3 B;  5IVC A;  2YB7 A;  3AYE A;  4PIY A;  4D8M A;  2L9L A;  3UKN A;  1VRH 3;  2PHL A;  1QQP 2;  1OC1 A;  3AMH A;  1G9B A;  5C8C A;  4A6S A;  1FPN 1;  3LB9 A;  4IEX A;  3OYW A;  4H14 A;  4WM8 C;  2C6S A;  3KQR A;  1YUD A;  3WW1 A;  2RMU 1;  4KQ7 A;  3ME2 A;  2MNG A;  4XTP A;  1HJG A;  5C71 A;  4Q26 A;  3T1L A;  3POW A;  5IFT A;  1K5J A;  5GZD A;  1W9T A;  2B46 X;  1MS3 A;  4RL7 A;  4XDQ A;  5D8A A;  2VMC A;  2ZMK A;  1S4C A;  4JGZ C;  1JYI A;  2YGM A;  4UFL A;  3S6P A;  2UYA A;  3WNL A;  4Q4X 3;  4BK5 A;  2NM1 A;  5FRA A;  5FZF A;  4Q4W 1;  2WYS A;  2VOX A;  4JTN A;  3HNM A;  3WW2 A;  1ZBA 3;  4AVS A;  2P5B A;  4WVM A;  2RE9 A;  1H6X A;  1PIV 3;  5CIR A;  4BB3 A;  1NCQ C;  2XJT A;  4AEK A;  1H2M A;  2VMI A;  4GAL A;  3I2O A;  4JGZ B;  1HRV 3;  4AI1 A;  2HBU A;  3WQ1 A;  1CX1 A;  2HWC 3;  4LKE A;  3SEP A;  4CXW A;  3KCC A;  4BXS V;  3FHQ A;  1DF0 A;  3WW3 A;  5T5J A;  2FHR A;  1SQ4 A;  2JB8 A;  3KVB A;  2BVV A;  1LEM A;  2P37 A;  3M1H A;  1LHO A;  4AVA A;  1AHS A;  4IE5 A;  1KS5 A;  1QHD A;  1RUH 1;  2O14 A;  3ZFG A;  2VVF A;  1O6U A;  4KBB A;  1K12 A;  3GM8 A;  2X29 A;  2XVL A;  4OI4 A;  1OD5 A;  5CEH A;  5IK4 A;  3GGL A;  5M0T A;  5FWJ A;  2RVA A;  1UN1 A;  3ZSM A;  2V72 A;  1V6O A;  3GZA A;  3HNY M;  5T50 A;  1X9P A;  2ZAA A;  2LM3 A;  2ADE A;  4PBP A;  3RWN A;  2GAL A;  2TEP A;  3AC0 A;  4XEZ A;  4XW3 A;  1VBA 3;  3UL2 A;  3UNP A;  3C7G A;  3C8X A;  5K7P A;  4FI9 A;  4LKD A;  4OMD A;  4Q4X 2;  4YG3 A;  1DQ0 A;  3T0A A;  3ZMO A;  5L73 A;  5DXD A;  4M0H A;  3POS A;  3FLR A;  3V0A A;  1VE0 A;  1F31 A;  2D3R A;  4ET7 A;  4XAE A;  1PIV 2;  4MAD A;  5A80 A;  4GJZ A;  2ETE A;  4QPG B;  1X50 A;  4YWA A;  4PF5 A;  1E5I A;  4EV0 A;  4CEW B;  3AP6 A;  2YHJ A;  1HRV 2;  1ND2 C;  1W28 A;  1PK6 B;  4XHX A;  2HKX A;  1XB9 A;  1ZZ9 A;  5J98 B;  2Y6G A;  1COV 3;  1DQ5 A;  2R06 3;  5H9Q A;  2XJS A;  1BYH A;  1CZT A;  4LO8 A;  4HXC A;  1POV 0;  1D0H A;  1N1T A;  1QXJ A;  1N3Q A;  3GZU C;  3FN9 A;  1QGL A;  4K8F A;  4IER A;  3OD0 A;  1G6N A;  1O91 A;  2K2S A;  4NPL A;  1YIF A;  4XIK A;  5FZD A;  5T52 A;  4YZ3 A;  2GMP A;  3KZ4 C;  2Q1Z B;  3HMY A;  3NQH A;  5FKB A;  3RMX A;  1MS1 A;  4YM3 A;  4COY A;  3VBO C;  3OOX A;  1UNB A;  1OQ1 A;  4RGG A;  5FK7 A;  5A1A A;  4B7E A;  4GKX A;  5FYC A;  1TG7 A;  1VP6 A;  1UZZ A;  3AYC A;  1EPZ A;  2CGO A;  2XGX A;  3W58 A;  4ZXK A;  3SMH A;  2B42 B;  3W9A A;  4XJZ A;  2AZ5 A;  2VW2 A;  4HOO A;  5ISL A;  5FBJ A;  1LHN A;  4NRP A;  1NZI A;  2G19 A;  2DTW A;  3LAG A;  3AB0 A;  1C1L A;  1GNY A;  2EXK A;  3BTZ A;  2CGN A;  5A3U A;  3OGR A;  2ZCW A;  2Q1M A;  1SPP B;  2J1S A;  4XQ4 A;  2YV8 A;  2Y64 A;  3NO8 A;  5AFB A;  4QX3 A;  4NIG A;  4YW3 A;  5GLU A;  5FYM A;  4S2G A;  2P2K A;  1COV 2;  4G3Y C;  1UZV A;  1BHG A;  4LUK A;  3VHO A;  5FJK A;  3WDX A;  4Z82 A;  1QJU 3;  1EP0 A;  2WQZ C;  4JHT A;  3U1X A;  3ZXF A;  2G1M A;  1ZBE 2;  3QH6 A;  2H6B A;  3ZDS A;  4K40 A;  4LBQ A;  4X6Q B;  1PVX A;  3NMB A;  4CCK A;  4Y4Y A;  4MOA A;  3G6J B;  1IPK A;  3U78 A;  4N7U A;  4DEQ A;  5FYU A;  1QKQ A;  4NWW A;  4ZS2 A;  3D0S A;  1U5I A;  1XPW A;  3L9J T;  3MUY 1;  4TYS A;  1K5M C;  4OYU A;  2PLV 1;  2B9V A;  1IQA A;  1LRH A;  3S5Q A;  5T55 A;  2A73 B;  2VVD A;  3NNJ A;  5FP9 A;  1W39 A;  2ZGS A;  1TMF 3;  5LBF A;  3KT7 A;  2CAU A;  2J1E A;  3MIH A;  5L7O A;  1DBN A;  1LR5 A;  1VAM A;  1QOT A;  2D93 A;  2GDF A;  3TEW A;  5IHR A;  1A34 A;  1UIK A;  1FMD 1;  1OVP A;  5F8P A;  1I6X A;  2OZJ A;  4Y26 A;  5KHJ A;  3H8X A;  5FMO L;  3GXU A;  1G86 A;  3FUQ A;  5C70 A;  1CAU B;  1OVS A;  4P9L A;  4PJY A;  1QJF A;  4PBO A;  4JZR A;  5FWE A;  2E6V A;  2ZEZ A;  5LB6 A;  1SFN A;  2CGP A;  4URT A;  4ZXE A;  4AQS A;  1QJU 2;  5EP9 A;  3K4Z A;  1KRI A;  5BPX A;  1YQ8 A;  1SLB A;  2RS3 1;  2YRO A;  3E6D A;  3POE A;  1WME A;  3Q8A A;  4E8C A;  4QXH A;  4Y20 A;  3TAY A;  1QEX A;  1YO8 A;  3KM5 A;  3LDB A;  3N9P A;  3H0O A;  2R32 A;  1Z7S 2;  2W1Q A;  3HVD A;  5F5I A;  1FNZ A;  2TUN A;  3CL1 A;  3ECQ A;  3RQ0 A;  1OLM E;  4IEO A;  4K3U A;  4LO6 B;  1U5Z A;  3LSE A;  3RZG A;  2DDU A;  1AYM 3;  3KMH A;  3BI3 A;  3OUH A;  2B4K A;  1VB4 A;  1URX A;  3SIS A;  3O0X A;  2WUH A;  5IAT A;  2ARB A;  2RS1 2;  5KHI A;  2ZGT A;  4K9S A;  2VO5 A;  3AKP A;  2JE9 A;  1OFS A;  4XUT A;  2VMD A;  3SCG A;  2ERF A;  1NA1 C;  2BYV E;  4MGY E;  4YZ2 A;  2NMN A;  2P3K A;  5H9R A;  4LBK A;  3VLB B;  1XOY A;  4NE9 A;  4YAR A;  5JSR A;  3FUO A;  2CTV A;  4YPJ A;  3VD7 A;  4D6R A;  2QNK A;  3AKR A;  3I2K A;  4GB3 1;  1DU3 D;  3VKF C;  5BNO C;  2FZ2 A;  5FK8 A;  3OG2 A;  5FY4 A;  1LOE A;  2PHX A;  4BA6 A;  1BBT 2;  3ZXD A;  2YZ4 A;  2QBX A;  4NUB A;  3TB0 A;  3T30 A;  1UY4 A;  4FXG B;  3O1R A;  5CG8 A;  1UZY A;  1MVQ A;  4ERO A;  1EAH 3;  4XFG A;  4J6G A;  3UGH A;  1HKD A;  1S0F A;  3FFZ A;  3BIE A;  1AYM 2;  4A3Z A;  3ELN A;  1POV 1;  1UW8 A;  3B9C A;  4MVT A;  1RMU 1;  4R9A A;  3CMG A;  1JMU B;  4MLO A;  1GBG A;  4AFM A;  3DUI A;  4WM7 B;  2OS2 A;  2AUY A;  3BGA A;  1XQN A;  3POB A;  4PIZ A;  1DQ1 A;  3RI9 A;  2MHF A;  3VBH B;  4Y22 A;  3D82 A;  2DCY A;  5C9A A;  4EJR A;  2VZS A;  2Y6H A;  4UW3 A;  3WNN A;  4BQ5 A;  1YFU A;  4Q8K A;  1IPJ A;  1WW4 A;  4CDW A;  2VTX J;  2Y6K A;  2E31 A;  5DG1 A;  1QJY 3;  3VBU C;  1ZRC A;  3ZYG A;  5A3T A;  1W9Y A;  1AXK A;  1DGW A;  2J1U A;  4QGM A;  3WSO A;  4DOU A;  3KV4 A;  4D7T A;  3NW4 A;  4Z1V A;  4AOC A;  2A3W A;  1VMJ A;  3FZ3 A;  2LRO A;  3N9Q A;  1AX1 A;  1JH5 A;  1RYY A;  2OUJ A;  1MQT C;  4OHX A;  2XON A;  3S7I A;  1WCQ A;  1NCR A;  1EAH 2;  1C4R A;  2ZX2 A;  2EIB A;  4UI9 L;  1FYU A;  2P3J A;  3AZY A;  4S2H A;  1NE4 A;  3K51 A;  4IE6 A;  2V73 A;  5EYX A;  4N53 B;  3MFC A;  5A3P A;  2HWF 3;  3S5A A;  3NAP B;  3ZFF A;  3B93 A;  3IBM A;  3DN7 A;  1PGW 1;  1W0N A;  3DYO A;  3HOB A;  4N8M A;  4B29 A;  1RUC 1;  3POY A;  5DQ0 A;  3ES4 A;  4TXW A;  3III A;  3TN9 2;  4GMP 3;  1H6Y A;  1YIP A;  2Y34 A;  4RS5 A;  4XF4 A;  1MS4 A;  5FY1 A;  4MHR A;  4ISQ A;  1NQJ A;  4X8P A;  1B35 B;  1X9T A;  2OII A;  4OUM A;  1F15 A;  4AED B;  4MUV A;  4CCL A;  1JYX A;  3I3M A;  1RUO A;  1UY0 A;  3R4U A;  4YW5 A;  1W6M A;  5FAX A;  4JDO A;  3PVO A;  4FOW A;  3VL8 A;  1N3P A;  1W8O A;  5C6C A;  1E5S A;  1H2L A;  3ZVX A;  4IEP A;  1RHI 3;  4FPO B;  1SDW A;  2XVG A;  4YZ4 A;  5CFD C;  2GNB A;  4IV3 C;  3MW4 A;  1VBE 3;  4L2N A;  5F5C A;  1OT5 A;  3ZYF A;  2JIC A;  3B94 A;  1TQ5 A;  1C8N A;  1D7P M;  2XDV A;  2XB6 C;  2Y6L A;  4EN0 A;  4XJ8 A;  1W8Z A;  2PQS A;  5JDB A;  2DFC A;  3KV6 A;  2UUR A;  5J7M A;  2Q8C A;  4Q4V 1;  4YW6 A;  5C4W B;  4FVV A;  1OF3 A;  1AXZ A;  5GLT A;  5L9V A;  4AW7 A;  2EAK A;  1VRH 1;  1GU3 A;  1W2A X;  5AC9 3;  4GH4 C;  4BIO A;  4I0W B;  3VBF B;  2VZQ A;  5CFD B;  2WII B;  3USU A;  3JBG 2;  5EIY B;  1BKZ A;  2JDP A;  1Y43 B;  3GZT B;  1KJR A;  2LAL A;  4LT5 A;  2YPJ A;  3PIG A;  1A8M A;  4YVS C;  3LOB A;  2ES3 A;  3IPV B;  3OEA A;  3HWJ A;  3IAQ A;  1KDM A;  3LDR A;  4SLI A;  5F3I A;  2IUW A;  5CFC A;  2ZPX A;  4LHN A;  3ZO0 B;  2KA3 A;  1POQ A;  4GH4 B;  5FZB A;  2LTN A;  3EHK A;  1UY3 A;  2PEL A;  1OOP A;  5JIA A;  1RHI 2;  3R4S A;  1ZBA 1;  4HVO A;  5E88 A;  3PVE A;  4N90 A;  2Q8E A;  3P1I A;  1VBD 1;  4GD4 A;  1M4W A;  4N43 A;  4W50 A;  5FZ7 A;  3NKG A;  2Q30 A;  1UMI A;  3DEC A;  2XHK A;  4QKN A;  4YVS B;  1F4H A;  2WT1 A;  4BZ4 A;  3VGI A;  3VN4 A;  1RUG 3;  2HWC 1;  4HFS A;  2W08 A;  2R07 2;  5E6H A;  5LA2 A;  1H8T B;  2DU0 A;  2QQK A;  2WFF 3;  3ZFE B;  3A0N A;  2E63 A;  2MEV 2;  5DUU A;  1UPS A;  4QX2 A;  2BP6 A;  1A78 A;  5CKM A;  4QXK A;  4XAC A;  1W8W A;  3A7Q A;  2VJX A;  2PHW A;  3DPR B;  2XPJ A;  5I0R A;  1RIR A;  1FPN 2;  1SCS A;  3AZX A;  4CUC A;  4COV A;  1TNR A;  3I2H A;  1H1M A;  3KS7 A;  4CU7 A;  3S57 A;  3UKV A;  2Q0A A;  2RMU 2;  1NG0 A;  1YQ6 A;  2HWB 3;  2XLA A;  4NHK A;  1S1A A;  4LIU A;  5FYZ A;  1VBA 1;  1FI2 A;  1UU6 A;  3THD A;  3PNA A;  1RVF 3;  2VD7 A;  3H8U A;  3KT4 A;  4WBB A;  5FZG A;  1NOV A;  3BOP A;  1U12 A;  4Q4W 2;  2A71 A;  4YGB A;  3IMN A;  1I5P A;  2GNT A;  4NRM A;  4NMI A;  4DXR A;  5CKQ A;  3TNP B;  1B09 A;  3URF A;  3S0M A;  5B2G B;  2IXI A;  2RDN A;  2Z2S B;  4LMF A;  4RHV 1;  1S2K A;  1QJX 3;  4HL0 A;  2R06 1;  4WM8 A;  1QJE A;  2KD7 A;  1GQP A;  2WFF 2;  5GLZ A;  5IT6 A;  1Q8V A;  2R7E B;  1OKQ A;  5LZ6 A;  2A70 A;  3H42 B;  4I09 A;  3VDD B;  4HLT A;  1QDC A;  1HV0 A;  2K9Z A;  4RQP C;  1JYV A;  4JGZ A;  4FBF A;  4I30 A;  4XIL A;  2YFU A;  3B69 A;  4LUL A;  1RUH 2;  4Y4R A;  1IS6 A;  1KDK A;  4FP3 A;  4CPB D;  3AM2 A;  1E5R A;  4CP0 A;  1P8J A;  1JOB A;  1S2B A;  1J3R A;  3PME A;  4E4Z A;  4I0B A;  4XPV A;  3ZXE A;  2PAM A;  4FPJ A;  1H30 A;  2AAC A;  2QKD A;  3E1F 1;  4RFT 0;  1LOF C;  4CDX B;  5I93 A;  4BJ0 A;  1NCQ A;  3HNB M;  4XF9 A;  3AFG A;  3AYD A;  3ZMN A;  4RQP B;  3BPS A;  3J7N A;  2WNV C;  3QH7 A;  5EYY A;  2AH2 A;  2BWC A;  2RG4 A;  1MPX A;  1XSQ A;  2P6H A;  3WUC A;  3QBQ A;  3N35 A;  4SBV A;  3ON7 A;  4M3C F;  1QU0 A;  4A4A A;  4BDV B;  2A6X A;  3GDB A;  5A3W A;  1QJX 2;  2CY6 A;  1GFF 2;  2VQU A;  4XUP A;  1YI7 A;  3RZZ A;  2ZAC A;  5FOB B;  3WG2 A;  2XUE A;  3B00 A;  4E4D X;  1XYN A;  5G04 L;  5FZ3 A;  3UGF A;  2JXA A;  5A6Z A;  2WNV B;  4K20 A;  3BKZ A;  3PUR A;  4MXW B;  1JXN A;  1W04 A;  1GWL A;  5FPZ A;  4IEQ A;  4QPY A;  3CBN A;  4XF0 A;  2E7T A;  4GJY A;  1H4H A;  1SZB A;  2GC0 A;  3N9M A;  1W6N A;  3VKL A;  4AFD A;  3WNM A;  1XE7 A;  4HAN A;  3U14 A;  4O9G A;  3TNQ A;  1GIC A;  1WCU A;  2PLV 3;  5FZO A;  3ZDV A;  4CXX A;  4KNC A;  3RZL A;  1TMF 1;  1ND2 A;  4YM1 A;  3H8R A;  3ZKU A;  5IVF A;  5JSP A;  3PVB B;  3SKV A;  5F6L B;  3MPB A;  1BK0 A;  2VMF A;  5IK5 A;  4YLZ A;  1W03 A;  3SEE A;  2JIJ A;  4LTA A;  3AFK A;  3HN3 A;  4QKF A;  4ZY9 A;  2X5I B;  3W59 A;  4E9K A;  5A7W A;  4FAH A;  5FR3 A;  5J09 A;  2OXB A;  3MID A;  4FCA A;  1QIQ A;  3KV9 A;  5CNA A;  3I59 A;  2WT2 A;  3RZJ A;  3VBO A;  5FZ6 A;  4Q0Q A;  1LOA A;  2RJ2 A;  2WN3 A;  2BU9 A;  3LPG A;  2OPK A;  4BQY A;  2WT0 A;  1RB8 G;  2OYZ A;  4L97 A;  2CWS A;  3KCY A;  4XFF A;  3UJO A;  5FYV A;  1PNG A;  4MHU A;  4ZU4 A;  4A45 A;  1BMV 1;  1O5U A;  4E2S A;  5FPU A;  2AGS A;  1ST8 A;  4RA0 A;  3LFM A;  4M0N A;  1CR7 A;  3ZM8 A;  5J96 B;  5LY2 A;  1ZA4 A;  3MIE A;  1CPN A;  4LBM A;  3WNO A;  3E6B A;  2PLV 2;  4AQ2 A;  2A75 A;  4FPF A;  2IFR A;  1IKQ A;  4LUM A;  5GJ6 A;  1JOD A;  1LGB A;  1KJL A;  2B9U A;  2TNF A;  3FJS A;  3KVA A;  4XAB A;  1NY7 2;  3MYX A;  2DFB A;  2ET7 A;  2W0X A;  2P4E A;  4YG0 A;  3OGS A;  3VBR C;  5KXB A;  2NPI A;  4YG6 A;  1WMD A;  2YXS A;  3WHT A;  1FMD 2;  4FQZ A;  4CP9 B;  1BJQ A;  2JG8 B;  3O7O A;  2V4V A;  1WLW A;  4JGY C;  4ES9 A;  1VB2 A;  3HQR A;  2BW8 A;  2ADD A;  1EUU A;  3AYA A;  1OQE A;  4QQO A;  3KF5 A;  3ZIW A;  3IIA A;  5DAV A;  1ZZ7 A;  1K5M A;  1CAU A;  3W20 A;  3IM0 A;  4LO5 B;  3VBR B;  1WA6 X;  5T5P A;  4AF9 A;  2UWB A;  2I2S A;  2C9A A;  4LLF A;  3U4X A;  4ZPI A;  3S30 A;  4O7X A;  3I2G A;  3KT1 A;  4Y33 A;  4EN9 B;  4JGY B;  3Q8B A;  1ENS A;  3OUI A;  3NJX A;  2JG9 C;  1FX5 A;  1D4M 1;  3ATG A;  3KQ4 B;  3H1Y A;  1HRI 3;  4Q0V A;  3ILR A;  4GWJ A;  5IK8 A;  1VAV A;  4MX3 A;  2VOK A;  2DYC A;  3HN1 A;  3PHM A;  4PI0 A;  5FUN A;  3UK9 A;  4AYU A;  4FFG A;  4C0H A;  3WNX A;  4Q29 A;  4IEV A;  5F7U A;  1HXS 3;  1AR8 1;  5FXZ A;  4DIQ A;  3J7H A;  4CU9 A;  3CKH A;  4XMA A;  1W8U A;  2D6M A;  4G4F A;  1YFW A;  4M01 A;  1AX2 A;  1YJL A;  2PAK A;  3RVH A;  2W9X A;  5JUV A;  2XJU A;  2SLI A;  4D7Y A;  1OHF A;  1QJY 1;  4IV1 B;  1X8E A;  2OQ7 A;  4XJA A;  1NT0 A;  2HJI A;  1LHW A;  2RJL A;  2JKB A;  1O4Z A;  2A6V A;  4GB3 2;  5JI9 A;  1WBF A;  1H2K A;  4J25 A;  4XET A;  2ZHN A;  3Q8C A;  4ATF A;  2VQT A;  1V6M A;  2NZ9 A;  3T09 A;  5HI0 A;  5BYN A;  1CVN A;  5DUX A;  5EJ3 A;  1Y7B A;  5KC6 A;  4TWT A;  1PM4 A;  1QMJ A;  4YRD A;  4WVW A;  1ULG A;  1WLD A;  2XJV A;  5KWR A;  1UX6 A;  2HWF 1;  5GLW A;  1AR7 3;  5DAP A;  4TZD A;  3PUQ A;  5JOX A;  1YYN A;  2EAL A;  2VUL A;  1NA1 A;  1RMU 2;  4YGE A;  1Z0H A;  2N7G A;  5J1X A;  2YBK A;  1F35 A;  4ZZ5 A;  3K4D A;  2HLE A;  4FPL A;  5FYT A;  4AVT A;  5BNO A;  1Q8Q A;  3QCW A;  2VTX A;  1ENX A;  3SIT A;  3ENR A;  2Y33 A;  5F3G A;  2QQW A;  1SAC A;  2QZ3 A;  2QZ2 A;  4OVE A;  5JZG C;  4XTM A;  2B39 A;  1GQH A;  5ABJ C;  3AMP A;  3QAC A;  1D4V B;  3GCX A;  4NO4 A;  4DNY A;  4RR3 C;  4AEM A;  1CD3 G;  5F37 A;  2CHH A;  2C26 A;  2UU8 A;  2ZBJ A;  4YSF A;  1S0G A;  4LK7 A;  1SDD B;  4P9W A;  1F5J A;  1R1Z A;  1VBE 1;  4FO9 A;  1KQR A;  5KXD A;  1VMF A;  2ZEW A;  3U37 A;  1G9F A;  1JYW A;  1LOB A;  3AKS A;  1O8S A;  3DCQ A;  2RJK A;  2W3J A;  1CQ9 A;  1AF9 A;  1PHM A;  4UF0 B;  5AC9 1;  1AR7 2;  5K9Y A;  5FPV A;  2J1R A;  5LA9 A;  4Y5Z 0;  3T2T A;  3A0K A;  1GKB A;  4UBH A;  4PLN A;  3B3Q E;  1PGW 2;  2VZ1 A;  4EN6 B;  1OA2 A;  1RUC 2;  3VBU A;  3D0J A;  4KL1 A;  2ZS6 B;  3DF0 A;  4P9J A;  1W8T A;  1DGW X;  1W2U A;  1DLC A;  4A3X A;  2H0V A;  5DAW A;  2W46 A;  4XIO A;  2FDH A;  3I3D A;  1EV1 1;  3N7K A;  4UFH A;  4E4H A;  3R05 A;  5T5O A;  1MQT A;  3I3Q A;  3A21 A;  1XJA A;  2GNM A;  3GZE A;  1SFP A;  2XL9 A;  5G05 L;  4BM8 A;  3AJY A;  3W21 A;  1IHM A;  2WSV A;  4DFS A;  1N1V A;  3USS A;  1VBD 3;  2VZP A;  1W8H A;  4YW2 A;  3HBZ A;  1LU2 A;  2XKP A;  1RUG 1;  4OFG A;  5LRR A;  2BGC A;  2OA2 A;  2WFF 1;  2YU1 A;  4OHY A;  4Q4V 2;  1PZ8 A;  1CJD A;  1SLA A;  4LNV A;  5DMY A;  5KR7 A;  5FOJ B;  1VRH 2;  1HJF A;  3WEZ A;  4TSV A;  1Q8O A;  3C2U A;  4KU8 A;  4N9I A;  3AP4 A;  5FQ0 B;  3VBS B;  2CU5 A;  5APA A;  3DKQ A;  4GKY A;  2AR6 A;  2XWJ B;  2HWB 1;  2WA3 A;  1SBF A;  3LKJ A;  4UFJ A;  3J9S A;  2KM2 A;  2YBP A;  4QPG C;  2GN3 A;  3SCF A;  3V0B B;  5L9B A;  1CAX A;  3SH4 A;  4CZS A;  5CFD A;  4CEW C;  1IG3 A;  2B5H A;  4GQ7 A;  3DV8 A;  2W92 A;  4IV3 A;  4P5Y A;  5FO9 B;  1PK6 C;  1RVF 1;  4NR1 A;  3OBA A;  4LEJ A;  1IG0 A;  1NX9 A;  1PGL 2;  1LEC A;  2ZGK A;  2ZX4 A;  2CDP A;  5FTT C;  4GAZ A;  3WQB A;  3OY8 B;  2QQP A;  3MZH A;  1IKP A;  1ZBA 2;  2QFE A;  3IPV A;  2XML A;  3MIC A;  1GSL A;  2GH8 A;  1VBD 2;  2FDF A;  5LWB A;  1W3X A;  4GH4 A;  2YGL A;  4NHL A;  4HKO A;  1QJX 1;  3WP4 A;  1YQ5 A;  4Y24 A;  3O1S A;  4YFW A;  4RHV 3;  1RXG A;  2VZR A;  1G9D A;  1MS8 A;  1YLL A;  2HWC 2;  2ZMN A;  1W90 A;  1HB4 A;  5C3S A;  1Y4W A;  5GAL A;  3SNM A;  3DL3 A;  4CCD A;  5FDB A;  3VDC A;  3SKJ E;  1W6Q B;  4YVS A;  2QJV A;  5JPM B;  2KR2 A;  3AZZ A;  1F9K A;  2GP5 A;  4PHZ A;  3OSD A;  3ZOI A;  3R6S A;  4DY3 A;  1L3J A;  3LWC A;  1V6K A;  4CP2 A;  2BOI A;  1QH7 A;  5LA1 A;  3NNG A;  4FSJ A;  3HAG A;  2PYT A;  2V09 A;  4LA2 A;  3IAP A;  2ZAB A;  5K0U C;  1WW7 A;  1XNK A;  1NLR A;  1ZRE A;  1UY1 A;  1VBA 2;  1Q43 A;  3PJY A;  2UYB A;  2RV9 A;  5FJH A;  4Z2A A;  2W39 A;  3POI A;  3AXE A;  1GWK A;  1CAV A;  3P5B A;  3RJR A;  4FTS A;  3ROU A;  2ZGN A;  3VZM A;  2DCK A;  4BME A;  4CTE A;  4ONU A;  2GME A;  2ZX1 A;  3K4A A;  1AR6 3;  1AYN 3;  3AP7 A;  3LF7 A;  4J1W A;  1UOB A;  4QM8 A;  1VIW B;  1GWM A;  1T6G C;  2V4A A;  1UU5 A;  2FZ1 A;  1W6P B;  4GZ9 A;  5K0U B;  3OGJ A;  4RHV 2;  3BB6 A;  1TME 1;  2JDN A;  2WS9 3;  4R8H A;  1X8M A;  2EIC A;  2R06 2;  4CCO A;  3JZV A;  3ZPY A;  3LOI A;  3KB5 A;  4QPI B;  1O5L A;  2C9K A;  4OHW A;  1GZW A;  2W91 A;  3FWE A;  2GC3 A;  1J3Q A;  2VE1 A;  4FPY A;  5BXX A;  3WQ7 A;  5CYY A;  2AEZ A;  2JX9 A;  5FRE A;  2X09 A;  4I3P A;  3BTX A;  2WRA A;  4CU8 A;  2GND A;  3KLS A;  2VU9 A;  3H3Z A;  1M06 G;  2E7A A;  2Y0I A;  4FPK A;  4LOS A;  1HQN A;  2WO7 A;  4UW4 A;  5EWS A;  3T4H B;  4ATE A;  5A6X A;  2IZW A;  3FL7 A;  4XFH A;  3POJ A;  2QTW B;  2D40 A;  1XBF A;  1L7L A;  3RG0 A;  2W52 A;  3ACH A;  4JV4 A;  4DUV A;  1ODN A;  1ASJ 3;  2F4L A;  5L19 A;  1NY7 1;  4EWD A;  2G9Z A;  1ODM A;  3WCR A;  2VH9 A;  5A70 A;  4KGQ A;  1WGP A;  4JHZ A;  1AYN 2;  1AR6 2;  1SEF A;  2W1W A;  1BCX A;  3JD7 3;  4Y1U A;  2ZX3 A;  2HWD 3;  4X8N A;  2YBS A;  5JOW A;  3OBR A;  3N9N A;  4RQP A;  3MDP A;  4QHB A;  3ZYI B;  4CUG A;  1QNY A;  2JDZ A;  2W2I A;  3CF6 E;  5FFO C;  2JDK A;  5FMB A;  1KS4 A;  2WQ4 A;  2CL2 A;  4QHO A;  4CEY B;  2ZAH A;  1V9U 1;  3PJQ A;  1MR5 A;  2D3P A;  3RS6 A;  1ZZ8 A;  2QQN A;  3LEG A;  5BNN B;  5F39 A;  3THP A;  1IPS A;  3ZPO A;  5IFP A;  1LOF A;  4E2Q A;  3WVJ A;  2VNO A;  4PCR A;  1YFX A;  4OMC A;  1PVC 1;  4PQ9 A;  1WD4 A;  1JUI A;  3B9I A;  3FHA A;  3ES1 A;  4YW1 A;  2FCT A;  3KSC A;  4XBN A;  5CIS A;  3ZN6 A;  4B4Q A;  2JDU A;  1FV2 A;  1KIT A;  2CSG A;  3LCP A;  4P14 A;  2PHD A;  5I0D A;  2D6P A;  5F5A A;  1KGY A;  2EAA A;  3B5L B;  1TMF 2;  3A22 A;  3ZXG A;  5A32 B;  4LKS A;  3X29 B;  3N9O A;  1RUE 3;  4D6Q A;  1S0I A;  5D2A A;  1YRZ A;  2A3X A;  2BNM A;  3JD7 2;  3R4D B;  1V6J A;  1GNH A;  3HQX A;  1ZRD A;  1N1S A;  3M4F A;  4LE4 A;  1OI6 A;  3WNP A;  4LQR A;  1ULO A;  5JCT A;  2VR4 A;  1VMH A;  2Z69 A;  2J1A A;  1ND3 B;  1YNA A;  2IVI B;  3GNE A;  2BTV C;  2IXH A;  5J36 A;  3FX3 A;  1WMX A;  1RUN A;  2F6B A;  2WO1 A;  3N36 A;  1W99 A;  5A3L A;  5LK5 A;  3HIF A;  1UWW A;  5C7G A;  1PM7 A;  3HQU A;  4WM7 C;  3TEX A;  3VBH C;  1BMV 2;  1LOC A;  3WNK A;  1Q3E A;  1REE A;  1ULD A;  1UYY A;  2W5F A;  2Q1F A;  3GHN A;  3LEI A;  1H9W A;  2QQL A;  4OI1 A;  1JZ5 A;  3HR9 A;  4AHZ A;  3E6C C;  1GYK A;  2V5D A;  1HRI 1;  2ARE A;  5CBL A;  1Y3T A;  4XZU G;  5A3N A;  1CN1 A;  1D4M 3;  5GZE A;  2DUQ A;  2VEC A;  3T3Y A;  3ZXL A;  5BV6 A;  5EQU A;  5GZC A;  1BVP 1;  2P34 A;  1CIW A;  2Z79 A;  5T5L A;  2VNR A;  1IOA A;  1VAL A;  3ZSK A;  3MI8 A;  1N3O A;  1HXS 1;  1X36 A;  3H3U A;  3SLI A;  3H7J A;  1AR8 3;  5IJR A;  1O4Y A;  1IGO A;  4UFM A;  3WIN E;  3OGV A;  4L11 A;  2B45 X;  3THC A;  2EIE A;  5I91 A;  1G9A A;  4CUB A;  4NPM A;  1NYW A;  4OHV A;  4QDR A;  4BK4 A;  3AP9 A;  3ACL A;  4JX0 A;  1JN2 P;  1H2N A;  1UL9 A;  2VOV A;  4KU7 A;  3KGL A;  3J8F 3;  1R09 3;  4P9X A;  3D4K A;  2R16 A;  3LZZ A;  4N53 C;  5FZ0 A;  5IW0 A;  3TBD A;  5IYY A;  3VZN A;  4AVV A;  1RUF 3;  4RFR B;  4HZF A;  3NAP C;  4FPG A;  1S2E A;  1UKG A;  1S0E A;  4G9S B;  4LE3 A;  4LK6 A;  4ZS3 A;  4M3C A;  3U11 A;  4PDW B;  3PU3 A;  4YW4 A;  2BWA A;  3ZSL A;  1XXN A;  3U07 A;  1B35 C;  4AED C;  2A6Z A;  3VBR A;  5IWF A;  2VOW A;  1D4M 2;  2JE7 A;  3A4U A;  3ZYP A;  1AR7 1;  2CYF A;  2LW8 A;  3MF6 A;  4JGY A;  4TLF A;  3F2Z A;  1DYP A;  3NV4 A;  3P3N A;  3O1V A;  1D0G A;  4QDS A;  4NWV A;  3B01 A;  2DUP A;  3ACF A;  1AR8 2;  4AK3 A;  5JMC A;  3M3I A;  1UZ0 A;  1S0B A;  4GWM A;  4CDU C;  1V70 A;  3PVN A;  1X7N A;  4NAO A;  2W95 A;  3AVR A;  4MGK E;  2WL1 A;  4OHZ A;  4D6S A;  4QU1 A;  4UAP A;  3UKT A;  1MVE A;  4DY5 A;  5C8C B;  1QJY 2;  5FZA A;  5C4W C;  2VZ3 A;  3OYW B;  2NN8 A;  5F6K A;  3ALQ A;  4XQW A;  3WDU A;  5T54 A;  2JG9 A;  1RUJ 3;  4KWU A;  4DIN B;  3T0D A;  2Z4F A;  5E1R A;  2WC2 A;  3VBF C;  3ZR5 A;  2VVE A;  4UWD A;  5D8A B;  3RNS A;  1KFU L;  2UY9 A;  1PZ9 A;  2VM9 A;  4CDU B;  2GU9 A;  2WNU C;  3NL1 A;  4H2A A;  3HT1 A;  4KWK A;  4ASK A;  2FD8 A;  2WJS A;  1ZRI A;  1EPW A;  3U4S A;  4OUS A;  2WWJ A;  5BNP C;  1EY2 A;  2WSU A;  1ZRF A;  2D5H A;  1DZQ A;  1UOJ A;  3BUC A;  3RWK X;  4BXF A;  1IS3 A;  1G9C A;  3AK0 A;  2DVB A;  2OZ6 A;  3LEM A;  1Z78 A;  2HWF 2;  1SHW B;  4XOG A;  5FY5 A;  1N47 A;  1TE1 B;  3DGT A;  3M7A A;  3GF6 A;  2J1V A;  1GAN A;  4K1Z A;  1OUX A;  3M2M A;  5B4N A;  2WNU B;  3ZXA C;  3MW3 A;  3I2I A;  3J7L A;  4C1W A;  3I8T A;  3HBK A;  1F5F A;  5BNP B;  5DPN A;  5HCH A;  4L0P A;  1WBL A;  4QWN A;  2CV6 A;  2ZZQ A;  4LOR A;  1PGL 1;  3MW2 A;  5D1I A;  1H8T C;  3UYJ A;  3ZFE C;  3ZFG B;  1EV1 3;  4JDN A;  4XE9 A;  4XFA A;  4LPL A;  2X05 A;  3RGB A;  2PN5 A;  5FPX A;  3INA A;  3ZN5 A;  1AZD A;  2FCU A;  3BOW A;  5FYB A;  3DPR C;  2BVB A;  1GZ9 A;  4W65 A;  4Y1V A;  3I49 A;  5A6Q A;  1VBE 2;  3P3P A;  2IXL A;  3NNF A;  4FOY A;  5GKA C;  2IXK A;  2ZGQ A;  3K3N A;  2WKK A;  2GC2 A;  3IN9 A;  3OPW A;  3IT8 A;  2DVG A;  3ITQ A;  2WBK A;  4IXL A;  3B02 A;  1PX4 A;  1GMM A;  3MIG A;  1OXC A;  1RUD 3;  4DO0 A;  1HDK A;  1KD7 A;  3V0A B;  5AC9 2;  4TN7 A;  5JZG A;  1R1A 3;  4CVU A;  2CWM A;  5DAQ A;  1GLH A;  5ABJ A;  5FP4 A;  1C5H A;  1NQD A;  3JCI A;  3M8L A;  4OUE A;  2FDK A;  1FAT A;  4QX5 A;  4RR3 A;  1RIT A;  5FZ8 A;  2XOM A;  3FMG A;  4AHY A;  3OCP A;  1NLQ A;  2EIG A;  5C3P A;  3WQ0 A;  3I7D A;  2JJ6 A;  5A7S A;  5EPA A;  5IAV A;  1W9W A;  2XJP A;  1H1A A;  5DG2 A;  1WD3 A;  4DS0 A;  4OQ8 A;  1JW6 A;  1W2T A;  4HPK B;  5K8S A;  1EV1 2;  2XL7 A;  2ZKL A;  3N3H A;  4URA A;  1LB2 A;  2XJQ A;  4YGC A;  3TEY A;  4IES A;  4XAA A;  3VB9 A;  3ZLI A;  4D0Q A;  3VDD C;  1AXY A;  4IE7 A;  4NIA A;  2PMW B;  1J84 A;  1FOD 3;  5I8T A;  2O0O A;  4YVW C;  3NST A;  1WCK A;  2DVD A;  1US3 A;  2HBT A;  2K0G A;  2W1U A;  2WLQ A;  2YU2 A;  3MBW A;  1VBB 3;  4L99 A;  4MGI E;  5HXV A;  4AXO A;  2QQM A;  4NID A;  1RUG 2;  1OQD A;  1ZZ6 A;  5A3M A;  1MEC 3;  1UYP A;  4ORF A;  4XF3 A;  1RUD 2;  1UIJ A;  4OCT A;  3ZR6 A;  1CIY A;  4CDX C;  3PDQ A;  4R4X A;  2YYO A;  2DBI A;  1UMH A;  3RFR A;  3TYJ A;  1VBC 3;  1CAW B;  2O8O A;  3RYK A;  3UES A;  1AR9 3;  4YVW B;  1XSR A;  1T2X A;  3ILF A;  3M3E A;  4QGN A;  2HWB 2;  2RDQ A;  4BH9 A;  3WDT A;  2FQP A;  3WCS A;  4XUN A;  2VAU A;  3DYP A;  4LBQ D;  3HD8 B;  3D3A A;  4P9I A;  4EN8 B;  4LIT A;  3WF3 A;  4COW A;  3JB8 A;  4LBQ B;  1RVF 2;  4XBL A;  5L7O C;  5JOZ A;  5H9P A;  4KG8 A;  1XU2 A;  2JWP A;  3V0B A;  4K21 A;  4XXA A;  2EXJ A;  3VL9 A;  3T08 A;  2VBD A;  4Y1X A;  4F3J A;  1AR6 1;  1AYN 1;  1UOG A;  2XJR A;  5AVA A;  2GZW A;  3U10 A;  1IS4 A;  4IL7 A;  5AVP A;  3MLL A;  4U36 A;  4AR2 A;  1WCS A;  4Y5T A;  1YQC A;  3CJI C;  2WS9 1;  2H0B A;  5ANQ A;  3O14 A;  3WP3 A;  1HQW A;  4DEV A;  4Z92 B;  4LA3 A;  1SG3 A;  1TME 3;  3M3Q A;  5L7O B;  2ARA A;  4QPG A;  2WYF A;  5I0T A;  1TEI A;  5C3Q A;  3VHN A;  1SCR A;  4CEW A;  4HON A;  4NII A;  2WDB A;  1VBC 2;  5EHD A;  5FY7 A;  1PK6 A;  1GOG A;  2LRP A;  4JVA A;  1AX0 A;  1W0O A;  5LAT A;  4DUW A;  3CHX A;  5DDJ 3;  1AL2 1;  3CJI B;  2XLF A;  3JQW A;  1MZ6 A;  2X5I C;  3NV1 A;  3LA3 A;  4M3C E;  3WX5 A;  4LHL A;  2BQP A;  4TTG A;  5SV5 A;  3ZYR A;  4NVP A;  4JKM A;  3ZXK A;  2BEO A;  4Y20 B;  1ASJ 1;  4HKW A;  5EV7 A;  4DXZ A;  2Y38 A;  2C1F A;  2P3I A;  4P5H A;  4HBN A;  3JD7 1;  2HWD 1;  4QM9 A;  5H9S A;  3VZO A;  4D94 A;  4DMI A;  1GOH A;  1R08 3;  1S0D A;  1RIN A;  1W2N A;  5EJ1 B;  1WLT A;  4YW7 A;  4Q2F A;  2RR1 1;  4BQ3 A;  1V6N A;  1TME 2;  3WD5 A;  4A7K A;  1HW5 A;  4XFI A;  2W68 A;  5FUP A;  1JYC A;  1SPP A;  1UZW A;  1PZ7 A;  1V9U 3;  2E9Q A;  5K0U A;  5KHG A;  1W06 A;  4Q4Y 3;  1JZ8 A;  2XBO 3;  3HT2 A;  1HLC A;  1O7F A;  3I3E A;  2OVU A;  4MZU A;  4BHP A;  3KWV A;  1HN1 A;  1PVC 3;  2R04 3;  1REF A;  4HK9 A;  4QHZ A;  2BGO A;  2JG8 C;  3FHI B;  1C57 A;  1S55 A;  2BER A;  2XHN A;  3MO4 A;  1W8N A;  5E8A A;  4EWA A;  5LW9 A;  5FYY A;  4QX1 A;  2QDN A;  2WLP A;  1OPM A;  2WWU A;  1ULF A;  3PUA A;  1PO1 3;  3V64 A;  1RUE 1;  4F7Z A;  3HPN A;  2VZT A;  5AFE A;  5HPO A;  5FLI A;  3H8O A;  1W9F A;  1VJ2 A;  3SHR A;  1JYN A;  2A1X A;  5CU1 A;  1W6O B;  2NP0 A;  1R08 2;  4BCU A;  1QXR A;  2QQI A;  1ZM1 A;  5HCF A;  2DWR A;  2QDR A;  3FLP A;  1UXX X;  2YY1 A;  4FPC A;  2PHU A;  4I2O A;  1LGN A;  1ONA A;  2B7Y A;  1VPH A;  1C8M 3;  1I5Z A;  1JU3 A;  1OPO A;  1K45 A;  1APN A;  4LBJ A;  2ZGR A;  1BK1 A;  1PO2 3;  4XBQ A;  2Y6F A;  3BVC A;  2WO2 A;  1V9U 2;  4UFK A;  4Y22 B;  2ILM A;  3Q8F A;  5C9A B;  2OPW A;  2WO3 A;  1C3H A;  5J3U A;  2G9F A;  2XBO 2;  5JMO A;  3AL6 A;  4LBL A;  5D21 A;  5GM0 A;  4A44 A;  1OF4 A;  1PVC 2;  1BZW A;  2JB4 A;  4KWL A;  4E27 A;  4C1X A;  1LCL A;  1ZVF A;  3AZW A;  4PI2 A;  3VKN A;  3DXT A;  1L7Q A;  3O1U A;  1OFN A;  4IV1 C;  5A7Q A;  2JDA A;  1PO1 2;  2DCJ A;  2YDE A;  3N9L A;  3FBM A;  3NV2 A;  5L36 A;  5CAZ A;  4Y1Z A;  4JKK A;  3RSJ A;  5KBF A;  4MGQ A;  4QU2 A;  2ZOE B;  4AZZ A;  1PX3 A;  1I3H A;  1NCR B;  4PLM A;  4JDM A;  4Q5O A;  5ACA 3;  1S0J A;  4QT6 A;  5FO8 B;  3PTR B;  5A32 A;  4CXY A;  4MV2 A;  3RZK A;  4Y3O A;  1WW5 A;  4GXL A;  3ZFF B;  3BAL A;  5JXG A;  2YC0 A;  1R09 1;  3J8F 1;  3ZKY A;  4BLI A;  1DQ6 A;  1UOF A;  2W1S A;  1CON A;  1RUF 1;  3CIH A;  4RS5 B;  3MLK A;  5LBC A;  5JXI A;  2VNG A;  4AI8 A;  1YJK A;  4RYD A;  1VR3 A;  3PTY A;  1WA4 A;  4AAP A;  4GWI A;  3VZK A;  4R4Z A;  3SH3 A;  1RJ8 A;  3FC0 A;  1MZ5 A;  4KI5 M;  3DEM A;  1F4A A;  1ZRR A;  1JOJ A;  1W6M B;  5FXW A;  4PLO A;  5F9T A;  3WG4 A;  1GNZ A;  4BQ2 A;  3BTY A;  5CAD A;  3C7O A;  3RZH A;  1HRI 2;  4HSL A;  1JI6 A;  2EF6 A;  3H3L A;  3OB8 A;  4BQX A;  1QWR A;  2ZGP A;  4CCJ A;  4BIS A;  1NE6 A;  2AEY A;  3WF2 A;  2W47 A;  5FPA A;  3UV9 A;  1A3K A;  3OPT A;  3D8C A;  1UY2 A;  1HXS 2;  3C7F A;  3ZXJ A;  2VZO A;  1BXH A;  3ZYH A;  1J3P A;  2ARC A;  3PMS A;  2E32 A;  4WVV A;  2OKX A;  1Q8S A;  2BFU S;  1BVV A;  1QOS A;  5A1F A;  3GHM A;  2VUJ A;  3EB7 A;  4KGG A;  4WM7 A;  3VBH A;  3OUJ A;  1JS9 A;  1KFX L;  4A41 A;  4WVZ A;  1RUJ 1;  4AGR A;  1FT9 A;  4CP1 A;  4Q8L A;  2BBA A;  2D6O X;  2RM2 1;  4IND A;  5FYH A;  5FY0 A;  1O3T A;  1QQP 3;  4LR4 A;  2VME A;  3KF3 A;  3T2Q A;  1BEV 1;  5CFC B;  1HB3 A;  1U5X A;  3C7E A;  1O4T A;  1W0P A;  2VOT A;  3N7J A;  5F5Q A;  1OA3 A;  4UW5 A;  5F3E A;  4HN0 A;  3HJR A;  1YCI A;  3LD8 A;  1OOP B;  3EMR A;  4U2A A;  4MET A;  3WF0 A;  4CDQ C;  4O9E A;  5A7N A;  5KXC A;  4HSJ A;  2C24 A;  3MPP G;  2PA7 A;  2ZA9 A;  2ZGL A;  4LBO A;  4HKL A;  3IDA A;  2HWE 1; 
#chains in the Genus database with same CATH homology
 5JXH A;  2W1W A;  2Y6L A;  2PQS A;  2BZD A;  1CZV A;  3MV0 1;  1XNA A;  1UX7 A;  1OF3 A;  2VZV A;  2J22 A;  1GU3 A;  4RN5 A;  3I97 A;  2VZQ A;  4UOJ A;  3LEG A;  2QQN A;  2ZXQ A;  5EIY B;  3VD3 A;  1EUT A;  5IFP A;  4OMC A;  2ORX A;  1J83 A;  1JHJ A;  4QPW A;  2YFZ A;  3FHA A;  3OEA A;  2YG0 A;  3IAQ A;  5JXJ A;  2Y6J A;  2LS6 A;  2WAB A;  1UY3 A;  1WKY A;  4XUQ A;  2ZEX A;  1LNS A;  5I0D A;  1KGY A;  3W5N A;  3A22 A;  3P1I A;  4HG6 B;  4W50 A;  4LKS A;  3DEC A;  1UMI A;  1F4H A;  2JE8 A;  3WNP A;  2YC4 A;  4LQR A;  1ULO A;  5LA2 A;  1OH4 A;  2QQK A;  2VR4 A;  2J1A A;  4QX2 A;  3IB3 A;  5FUI A;  3UNP A;  3A7Q A;  2VJX A;  2WO1 A;  4CUC A;  1W99 A;  3I2H A;  3VDA A;  3CQO A;  4CU7 A;  1UWW A;  3T0B A;  5C7G A;  2J7M A;  2E33 A;  3WNK A;  1UYY A;  2W5F A;  3LEI A;  2VCC A;  2QQL A;  4MGS A;  3THD A;  1JZ5 A;  1JZ4 A;  2V5D A;  2W94 A;  1KEX A;  2VL4 A;  2WZ8 A;  2ORZ A;  4XZU G;  1L7R A;  3NRU A;  3ABZ A;  1I5P A;  3EYP A;  4DXR A;  1PMJ X;  4XUR A;  4CUA A;  5IJR A;  5LCW L;  2KD7 A;  1GQP A;  3OGV A;  4XVH A;  3THC A;  2EIE A;  2R7E B;  4W4Z A;  4CUB A;  4QDR A;  5HXM A;  1K42 A;  4BK4 A;  4JX0 A;  1JYV A;  5IYY A;  2CDO A;  2YFU A;  2JD9 A;  1PMH X;  1P8J A;  4M4R A;  4DXS A;  4QB1 A;  2WAO A;  2VC9 A;  3E1F 1;  4ARY A;  4BJ0 A;  1NUK A;  3HNB M;  2WAA A;  1NAE A;  3WF1 A;  4QX0 A;  3CDZ B;  3MUZ 1;  1US2 A;  2LW8 A;  3PUI A;  2Y8K A;  4A42 A;  3F2Z A;  1MPX A;  4QDS A;  4A4A A;  3ACF A;  4BDV B;  1UZ0 A;  3GDB A;  4XUP A;  2VQU A;  3VD5 A;  2JKX A;  2W95 A;  1ULP A;  5EJZ B;  3LQC A;  5G04 L;  4UAP A;  4QDQ A;  3UET A;  2VZ3 A;  3ACI A;  4KWU A;  3T0D A;  4ZZ8 A;  2Z4F A;  3OEB A;  2YC2 A;  3LE0 A;  4KMQ A;  2VM9 A;  3WNM A;  4QB2 A;  1O8P A;  4AG4 A;  3DYM A;  5B4X A;  1R64 A;  4E8D A;  1TVG A;  4AAX A;  5CZK A;  1SHW B;  3SKV A;  2VMF A;  1DYO A;  3SEE A;  4ZY9 A;  3HN3 A;  4W8J A;  2J1V A;  5B4N A;  3I2I A;  2YB7 A;  5DPN A;  4D8M A;  4L0P A;  2L9L A;  2BGP A;  3BN6 A;  2WN3 A;  2RJ2 A;  3LPG A;  1GUI A;  5IFT A;  4LPL A;  2X05 A;  5C71 A;  2WQ8 A;  4A45 A;  1W9T A;  4LHS A;  2VMC A;  3ZM8 A;  3P6B A;  4PT6 A;  2ZEY A;  3WNL A;  3WNO A;  1CZS A;  4BK5 A;  2WBK A;  2WYS A;  1PX4 A;  1GMM A;  3HNM A;  3I2J A;  5JR2 A;  1H6X A;  3ACG A;  3OGS A;  4CVU A;  4XUO A;  4OUE A;  4QAW A;  1CX1 A;  3SEP A;  2V4V A;  2XOM A;  4BXS V;  3FHQ A;  1EUU A;  1W9W A;  1K12 A;  3GM8 A;  3GGL A;  2EID A;  4D0Q A;  2RVA A;  2V72 A;  3HNY M;  2W87 A;  1J84 A;  3I2G A;  1JZ7 A;  3AC0 A;  5DN2 A;  1JU4 A;  2QQO A;  1US3 A;  2W1U A;  3C8X A;  3C7G A;  3MBW A;  3NJX A;  4FI9 A;  4OMD A;  2QQM A;  3T0A A;  4GWJ A;  1XNT A;  1CIY A;  4M4P A;  4ET7 A;  4MAD A;  5F7U A;  2WN2 A;  1UMH A;  3J7H A;  4CU9 A;  3CKH A;  4DXT A;  1UYZ A;  3UES A;  3K77 A;  1T2X A;  2Y6G A;  5JUV A;  2W9X A;  1CZT A;  4OZO A;  3FN9 A;  4XUN A;  3DYP A;  3D3A A;  2QQJ A;  3WF3 A;  3NQH A;  1UYX A;  2VQT A;  3T08 A;  5A1A A;  3T09 A;  1TG7 A;  4P02 B;  3I2F A;  3T2O A;  3PUH A;  4DEV A;  1SG3 A;  2VTF A;  1GNY A;  3VD4 A;  3OGR A;  5J1X A;  4DUX A;  2J1S A;  4ZZ5 A;  3K4D A;  2HLE A;  2E26 A;  2WDB A;  1NKG A;  2Y64 A;  1GOG A;  4QX3 A;  4DUW A;  1BHG A;  3C7H A;  3LPF A;  4TTG A;  4JKM A;  4MOA A;  2C26 A;  4DEQ A;  1SDD B;  1XPW A;  3MUY 1;  2ZEW A;  3U37 A;  4OYU A;  1JYW A;  1GOH A;  2B9V A;  2VCB A;  1O8S A;  5EJ1 B;  2W3J A;  2J1E A;  1JZ6 A;  2J1R A;  5IHR A;  3ETP A;  2WZE A;  4A6O A;  2VZ1 A;  3MV1 1;  3GXU A;  4JKL A;  5C70 A;  3T2P A;  1JZ8 A;  4PF1 A;  3I3B A;  3I3E A;  2ZEZ A;  1DLC A;  4MO3 M;  4ZXE A;  1HN1 A;  3K4Z A;  2W46 A;  3A23 A;  3I3D A;  2BGO A;  3MO4 A;  3HEI A;  2BER A;  2VCA A;  2XHN A;  4E8C A;  1W8N A;  4P08 A;  2HYX A;  3CZJ A;  1XC6 A;  4P00 B;  4QX1 A;  3A21 A;  2W1Q A;  1K3I A;  5G05 L;  3LEK A;  3VD9 A;  3ECQ A;  2VZT A;  3HPN A;  5HPO A;  1OD3 A;  2VZP A;  1UXZ A;  1JYN A;  1DP0 A;  2QQI A;  2DDU A;  1UXX X;  5DMY A;  1JU3 A;  2B4K A;  1K45 A;  3WEZ A;  2WUH A;  2WO2 A;  2WO3 A;  2VO5 A;  4XUT A;  5JMO A;  2VMD A;  4A44 A;  1OF4 A;  4P5Y A;  5LA0 A;  2W92 A;  4YPJ A;  3VD7 A;  3I2K A;  3OBA A;  1NX9 A;  3OG2 A;  2CDP A;  1L7Q A;  3WQB A;  2JDA A;  2QBX A;  2DCJ A;  1IQD C;  2C4X A;  4JKK A;  1UY4 A;  4MGQ A;  1PX3 A;  2XQX A;  4IUG A;  2VZR A;  4A3Z A;  2J1T A;  3VDC A;  3CZU A;  3SKJ E;  3CMG A;  3K46 A;  5JXG A;  3WF4 A;  3BGA A;  2W1S A;  3CIH A;  5JXI A;  2VZS A;  2Y6H A;  3WNN A;  5LA1 A;  4RYD A;  3W5M A;  3NNG A;  2ID4 A;  2Y6K A;  1YQ2 A;  2E31 A;  4GWI A;  4KI5 M;  3IAP A;  1F4A A;  1UY1 A;  2RV9 A;  3WSO A;  2J1U A;  1W9S A;  4Z2A A;  1GOF A;  3C7O A;  1JI6 A;  3OB8 A;  1O59 A;  3WF2 A;  1RYY A;  2DCK A;  2W47 A;  3K4A A;  3NJV A;  1JZ3 A;  1UY2 A;  2XON A;  1WCQ A;  3C7F A;  4UI9 L;  2VZO A;  2EIB A;  4GZ9 A;  3JXS A;  3K75 B;  2OKX A;  2E32 A;  2EIC A;  4CU6 A;  2C9K A;  1W0N A;  3EB7 A;  3DYO A;  2W91 A;  3HOB A;  5DQ0 A;  4ARX A;  4TXW A;  3III A;  1H6Y A;  5CYY A;  2X09 A;  4PQQ A;  4A41 A;  4CU8 A;  1JZ2 A;  2BBA A;  4QB6 A;  1JYX A;  2VME A;  1UY0 A;  3T2Q A;  3FL7 A;  3C7E A;  1W8O A;  2VOT A;  3HJR A;  3ACH A;  4DUV A;  3WF0 A;  2X10 A;  3VDB A;  1OT5 A;  4JHZ A;  2VZU A;  3IDA A;  1D7P M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...