4QDRA

Physical basis for nrp2 ligand binding
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
321
structure length
314
Chain Sequence
b'HMQCNVPLGMESGRIANEQISASSTYSDGRWTPQQSRLHGDDNGWRPNLDSNKEYLQVDLRFLTMLTAIATQGAISRETQNGYYVKSYKLEVSTNGEDWMVYRHGKNHKVFQANNDATEVVLNKLHAPLLTRFVRIRPQTWHSGIALRLELFGCRVTDAPCSNMLGMLSGLIADSQISASSTQEYLWSPSAARLVSSRSGWFPRIPQAQPGEEWLQVDLGTPKTVKGVIIQGARGEARAFVRKFKVSYSLNGKDWEYIQDPRTQQPKLFEGNMHYDTPDIRRFDPIPAQYVRVYPERWSPAGIGMRLEVLGCDW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neuropilin-2
publication title Structural Basis for VEGF-C Binding to Neuropilin-2 and Sequestration by a Soluble Splice Form.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 76
structure length 314
sequence length 321
ec nomenclature
pdb deposition date 2014-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4qdrA01
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4qdrA02
5JMOA 4GWJA 3IB3A 4CUAA 2R7EB 2HYXA 1W8NA 2XOMA 1SHWB 2VMDA 2VCBA 2QQIA 2QQOA 4CUBA 5C7GA 4OYUA 2J22A 3WF0A 1NUKA 2WO1A 1SDDB 2EIBA 2XQXA 1JZ6A 4UOJA 3NRUA 4MGQA 3HN3A 4OUEA 2BBAA 3THDA 2XHNA 5JXGA 3HOBA 5EJ1B 2KD7A 4DEVA 1JYNA 1NKGA 5G05L 3EYPA 2WN2A 3GXUA 3SEPA 2W1QA 3VDBA 2QQLA 3DYPA 4RYDA 4ARYA 3BGAA 3I2IA 4OZOA 1UX7A 2Y64A 3CDZB 2VZ3A 3K4ZA 1UWWA 4XURA 4DXSA 4D8MA 2WAOA 3MBWA 2J1UA 2W91A 5A1AA 4ZXEA 2J1RA 2J1AA 5CYYA 1GOHA 5LA2A 2Y6KA 3EB7A 2J1TA 4JKKA 3MUY1 2LW8A 3J7HA 4XUQA 1DP0A 1PX3A 3I97A 5IFTA 4UAPA 2QQJA 2Y6LA 2Z4FA 1W0NA 3NJXA 5JXIA 3SKJE 4LHSA 2YG0A 5JR2A 5DQ0A 2W1SA 3A23A 2BGOA 5LA1A 2DCKA 4BJ0A 3MUZ1 4MOAA 4MGSA 4BDVB 1RYYA 4QX3A 3LQCA 1XNTA 3D3AA 1CIYA 2VQTA 3ABZA 4CU8A 3W5MA 5LCWL 3WF1A 3E1F1 3C7GA 1DYOA 4L0PA 2VZTA 2J1EA 1UMIA 2VO5A 3PUHA 1K42A 1XC6A 5I0DA 1JZ7A 5DN2A 4XUTA 3NNGA 4QB6A 2ORXA 2J7MA 1OT5A 4QX2A 3AC0A 1UY4A 2VMCA 4KMQA 2J1VA 1LNSA 2ZEWA 4YPJA 3K75B 1JU4A 3C7HA 1US3A 3LPGA 1JZ5A 1JHJA 4GWIA 3HNBM 3VD4A 1PMJX 1UYYA 3WNMA 3NJVA 3CIHA 3LEGA 2W87A 5B4NA 3IAPA 5CZKA 3T09A 5C71A 4CU6A 2WYSA 4DXTA 1OD3A 1CZTA 1JZ2A 4OMDA 2BGPA 2X10A 3F2ZA 1UYZA 4MO3M 2V4VA 1UMHA 1J83A 3DYOA 2WDBA 2YB7A 2L9LA 2WZEA 4JKMA 1DLCA 4LPLA 4A42A 1TG7A 3LE0A 3P6BA 3HNYM 2ZEZA 4LKSA 2EIEA 2ID4A 2E32A 1H6YA 1SG3A 5DPNA 2C4XA 2VCCA 2W46A 1I5PA 2JKXA 2BZDA 2V5DA 2EIDA 3VD9A 1K45A 1GU3A 3WF2A 2VZ1A 5JXJA 3I2GA 4P5YA 2E33A 3ETPA 2B4KA 1NAEA 3WNOA 4E8CA 1L7RA 3OGRA 3CMGA 4CUCA 2YFZA 1IQDC 4QAWA 2VZRA 2VQUA 3ECQA 3LEIA 3FN9A 4XUOA 2C9KA 2W3JA 3LPFA 4M4PA 1UYXA 4HG6B 4PF1A 1D7PM 1CX1A 4A44A 4MADA 4QX1A 2WQ8A 3ACGA 1JZ3A 5LA0A 1F4AA 4ET7A 2DDUA 2W1WA 3T0BA 5JUVA 1JYVA 3ACFA 2VMFA 4AG4A 1UXXX 3IAQA 3MV11 1CZVA 3GDBA 1JZ8A 1WKYA 1W9TA 3FL7A 2QQMA 1CZSA 1J84A 1GQPA 3T2PA 5EIYB 1BHGA 4QB1A 3WF3A 4E8DA 2VM9A 4XVHA 2WZ8A 3VD5A 5F7UA 3T2QA 2VOTA 3MO4A 2QBXA 3A21A 3C8XA 5IFPA 1O8SA 2VZQA 2ZEXA 3I2JA 1GOGA 1K12A 2QQNA 3FHAA 4XZUG 2YFUA 4BXSV 3VDCA 3SEEA 4XUPA 4DXRA 1R64A 4ARXA 1L7QA 4JKLA 5JXHA 1W9SA 3MV01 2RJ2A 4QX0A 4GZ9A 2Y6GA 1UY3A 1W9WA 2VTFA 1UY1A 1H6XA 2WABA 4CU7A 2PQSA 1UY0A 3IDAA 1O8PA 3OEAA 2ZXQA 3CKHA 2RVAA 3HPNA 1UY2A 2WBKA 3VD7A 4BK4A 2VJXA 3UETA 1EUUA 4ZZ5A 2C26A 1EUTA 3WNNA 3GM8A 2EICA 5IHRA 1GMMA 3CQOA 4FI9A 2HLEA 4XUNA 2Y6JA 2WO3A 1OH4A 3I2FA 3I2HA 3WF4A 3ZM8A 2WO2A 1JYXA 1GNYA 4QDRA 3OG2A 1GUIA 2X09A 4A45A 3WEZA 2E31A 1PX4A 2RV9A 3WNKA 3WQBA 1JYWA 5HXMA 3OGSA 4AAXA 3I3EA 1JI6A 3ACIA 4DUWA 1PMHX 4IUGA 3OEBA 5HPOA 3WSOA 3PUIA 2VZVA 3W5NA 3A7QA 2VCAA 4ZY9A 3JXSA 3HJRA 2XONA 4A41A 4D0QA 3I2KA 1KGYA 3OBAA 1KEXA 2JD9A 2X05A 3OGVA 2VMEA 3HNMA 4TTGA 3GGLA 2WUHA 5IJRA 2J1SA 1HN1A 3WNLA 2CDOA 4RN5A 2B9VA 3T0DA 3CZJA 1GOFA 2W95A 3IIIA 2Y8KA 4BK5A 3A22A 3NQHA 2ORZA 4TXWA 2OKXA 3C7FA 2VC9A 4CU9A 3SKVA 3C7OA 3VDAA 5FUIA 1F4HA 4QB2A 2E26A 2W5FA 1US2A 4P02B 4A3ZA 4DUVA 3T2OA 2QQKA 2W94A 3U37A 2W1UA 5DMYA 4KI5M 1ULOA 4JX0A 4QDSA 4UI9L 1MPXA 2BERA 3C7EA 3I3DA 5C70A 2WAAA 3P1IA 4P00B 3UESA 4OMCA 4QDQA 3ACHA 5J1XA 1UZ0A 2VR4A 1OF4A 1OF3A 4LQRA 1ULPA 3THCA 2V72A 1K3IA 3FHQA 2W9XA 5EJZB 4A6OA 4M4RA 4A4AA 3K77A 2WN3A 4ZZ8A 1XPWA 3K4DA 2CDPA 1JZ4A 3I3BA 4JHZA 4DUXA 2ZEYA 2VL4A 2LS6A 1UXZA 1P8JA 1XNAA 2YC2A 3LEKA 4PT6A 4Z2AA 2JDAA 4CVUA 3UNPA 4W4ZA 3T0AA 3K46A 1W99A 2VZSA 5G04L 1W8OA 2Y6HA 2YC4A 4QPWA 1TVGA 2VZPA 3OB8A 2W92A 4PQQA 1YQ2A 3HEIA 2VZUA 5IYYA 2JE8A 4KWUA 2DCJA 5B4XA 3BN6A 1JU3A 4DEQA 3CZUA 3K4AA 3VD3A 1WCQA 4P08A 2VZOA 1T2XA 3WNPA 1O59A 3DYMA 4W8JA 3T08A 1NX9A 4W50A 2W47A 3DECA
chains in the Genus database with same CATH superfamily
3MIDA 5JMOA 1W8ZA 2VECA 2NPIA 1RUI3 2GZWA 3ZXDA 1BK1A 5F5CA 3IB3A 2DTYA 1AYM2 2B5HA 4CUAA 3H0OA 5ISLA 2HYXA 3SCGA 2JG9C 1UYPA 1X33A 4WM8A 2D6NA 4XF9A 2P17A 3M3QA 5LEKA 4CXWA 3BTXA 3PMEA 3NAPA 3RGBA 1WMXA 3WDTA 2YGLA 1CQ9A 2JDHA 2AREA 2H0VA 3HBZA 2VCBA 1DQ0A 3GZAA 4P5HA 1HKDA 4L8QA 4CUBA 3KV4A 1GZWB 1PK6C 1VAVA 2P1BA 3ALQA 4QPGB 1XNBA 2B7YA 5BNOA 3JD71 2IUWA 5D1IA 2GDFA 3USSA 2ZPXA 2XLGA 2ARXA 2WWSA 1SDDB 5A6XA 4R9CA 1ULEA 5E88A 4UOJA 1JZ6A 5IUQA 3WUDA 4NROA 4IEVA 3H1WA 3ES1A 3ES4A 2BBAA 3HN3A 3THDA 1BEV1 2WSVA 2E6VA 2XHNA 5JXGA 2A3YA 4P9LA 3AZZA 1FPN3 1YQ8A 4LHLA 4QPIA 3INAA 5EJ1B 5FZCA 4YW6A 2ZACA 3LSEA 5LBFA 2OYZA 1M06G 5I91A 1H9PA 1ZBE3 1OPMA 3IIAA 3ORJA 2CYFA 1DQ5A 1F9KA 5C8WA 1MQTC 3GALA 3ZYPA 2PAMA 3DYPA 2FDFA 3MIGA 3DF0A 5F6LB 4YM1A 4CDWB 2DU1A 5FZLA 1FI2A 3BGAA 5FPZA 5BNPB 4OQ8A 1HB1A 1MS3A 3VBHC 1CJDA 2Y64A 3AL5A 3CDZB 3VKMA 2VU9A 4UWDA 1H2NA 3RQ0A 1FNYA 3MBWA 1UO9A 3EO6A 2OPWA 5I8SA 5LB6A 2ZAAA 4LLOA 3S30A 2XXZA 3FUOA 1XXNA 2Y6KA 2D93A 2VD7A 1GYKA 1HV0A 2J1TA 1GV9A 4LBNA 4JKKA 3ZIWA 3ZR6A 1UNBA 2CL2A 3J7HA 3V56A 3D8CA 5T50A 3WCSA 4B7EA 4XDQA 2O8OA 3I97A 2G19A 2XUMA 2VG9A 4ZXKA 4N8MA 1N1YA 1F15A 2ZX0A 3J4UH 1Y43B 4LE4A 4RGAA 1XB9A 5FBJA 1X50A 2GSYA 5F3IA 2YG0A 4Y5SA 2XBO3 1UOBA 4DINB 4YZ3A 1AX2A 3A23A 1OA2A 4YM2A 2DCKA 5EFUA 1HDKA 4YVWB 5A7QA 1PGL1 1KJRA 2ET1A 1RYYA 3R4DB 2VVEA 1ENRA 4M0HA 4QX3A 1LU2A 2ZHNA 2E7TA 3LQCA 4GMP3 5AC91 1WD4A 4Y33A 4UFJA 2CAVA 2VQTA 4FFHA 3SH5A 2VCMA 3WP6A 2ZMNA 2OPKA 4AE2A 2HWE2 3GBWA 3E1F1 4RGKA 1LCLA 3UYJA 2NMOA 1DYOA 1NG0A 1F31A 2Q0AA 2VZTA 2J1EA 3PVBB 4NHMA 4Y3OA 4NPLA 1RUH3 3SHRA 3DPRB 3NL1A 1TEIA 2IC1A 5I0DA 4MYEA 2VGDA 1SBEA 1VMFA 3H8XA 4Z8BA 2X5IC 1KXGA 4E4HA 5JPMB 4P9XA 2CU5A 4QXKA 2WT0A 1TMF1 2BU9A 1VRH2 2FCTA 5FP9A 5A32A 4N53B 3A0NA 5D8AC 1HX6A 2ORXA 1C28A 1QY4A 2WKKA 2GMEA 3H7YA 2OQ7A 2J1VA 5FYVA 4KL1A 1AYM1 1LNSA 2ZEWA 4CTEA 1R083 1QH6A 4LTAA 3V0BB 3KT1A 1REDA 1JU4A 1V6OA 2E9QA 5DUVA 3BB6A 4AEJA 4UW6A 3LPGA 3O5SA 4GH4A 5F5QA 5FRAA 1OHFA 4UW4A 1DHKB 3HNBM 3QBQA 3VD4A 1UYYA 4GWNA 3NV1A 1BBT3 2WT2A 1AR82 2NMNA 1OUSA 3KCXA 4CEWA 3IAPA 5CZKA 3HIFA 5JOZA 4CU6A 4TSVA 2IXIA 3NSTA 4DXTA 2DCYA 5CB7A 2YBSA 1OD3A 3MF6A 3P3PA 4LBMA 3F2ZA 4IGQA 1UYZA 4NO4A 5EHDA 2R063 5BV6A 2YDEA 3BALA 4UT5A 5FO9B 1HXS3 3N7KA 2WDBA 3MIBA 3NV2A 4GIQA 4FPOB 4AW7A 1YUDA 1LECA 5FZ9A 1PM7A 4H14A 2E53A 1U5IA 4Z82A 1GNZA 1J3RA 1LKNA 4KBBA 3EBRA 4PBOA 4ZS2A 4HVRA 1VALA 1VP6A 1W3XA 1NLQA 4Q8LA 5DPNA 4OUMA 5A80A 3HWJA 3MW3A 4CDQA 2JIJA 4R9BA 5BNNA 3VBOB 1I5PA 1OVSA 4N9IA 3ZSEA 2EIDA 5J96B 3VD9A 1QJX2 2WT1A 1K45A 3KCYA 2SLIA 5AVAA 5LBBA 2Y60A 1NYWA 2E33A 3ETPA 5C33A 5J7MA 5EP9A 2HWB3 4JZRA 1COV2 2G1MA 5FMOL 2BNNA 5FZEA 4OHYA 1L7RA 1K5MC 4UW3A 4RSUA 3O7OA 1PO12 1VBE2 4CUCA 2YFZA 1IHMA 1YXWA 2W0XA 3ENRA 1DGRA 2VVDA 2H0BA 3ECQA 4CPBD 3UGFA 1WCSA 3V0AB 4D7TA 4R4ZA 2AYHA 5FZ1A 4PDWA 4ZS3A 5LBCA 3LD8A 1UYXA 4HG6B 4LUMA 4NHXA 3T4VA 1U5XA 2Q1MA 3HBKA 5F5IA 1DGRN 4R9DA 2A70A 3CBNA 1H2KA 1S4CA 2DBIA 1AR72 1JZ3A 2D3PA 3ZMNA 2BFUS 1BZWA 2W2IA 2VNOA 3VBRC 2DDUA 4AFCA 2W1WA 3UL2A 3AP6A 5JUVA 1QKQA 2VMFA 4AG4A 4K7JA 1V9U3 2HWE1 1RUI2 1UXXX 1G7YA 3MV11 5IK4A 2B9UA 1VBD3 1URXA 2BDRA 1RJ8A 3GDBA 3NAPB 2WA4A 4RHV3 2XWBB 5DAXA 3VGIA 4S2DA 3RYKA 3ATGA 4KGQA 4YLZA 3CLPA 1UZYA 1BHGA 3KF3A 4XEZA 3WF3A 1VRH1 4Y1ZA 4BQ3A 4ES8A 4Q0SA 5I8TA 2XL9A 3FWEA 3WDWA 1S0GA 2ADEA 2D5FA 2WZ8A 1HRV3 3VL9A 3VHNA 3VD5A 5F7UA 4N7UA 3AYAA 2DVDA 4AEMA 3ZPYA 3A21A 3C8XA 1L7LA 4XF3A 2E7QA 4IQPA 3MFAA 2EXKA 2ZEXA 3I2JA 2WZR3 2JDMA 3NNMA 4CE8A 1IGOA 2WFPA 5C5UA 1W6OA 2BVBA 3HT2A 5FUPA 3VDCA 1DQ4A 1FPN2 4FXGB 3ZR5A 5KXCA 5I0SA 3RI9A 4ARXA 1OD5A 2OA2A 1JTZX 2YPJA 1Q8OA 4JDMA 1AR81 5FJHA 2XL7A 1ZBE2 2RDRA 2XUEA 1AHSA 1W6QB 3FUQA 3ZLIA 5FPLA 3Q8CA 1ZRIA 1OC1A 4OUSA 2Y6GA 5L7OA 1W9WA 1WW4A 3H3LA 1XSQA 1VBC3 2VOKA 5GLVA 2F4LA 5C3RA 2ZZJA 1N3OA 1ZVFA 2PQSA 4FQZA 1AR93 1ND3A 1V6NA 4FFGA 2RR13 3I3MA 1H1IA 4PIYA 3DCQA 2XG3A 3W9AA 5A7SA 1ZZ6A 4BK4A 4YG6A 2OQ6A 4YW1A 1QH7A 1X82A 1EUUA 3RRDA 4D6SA 4ZZ5A 1G86A 1FOD3 1LR5A 3KHBA 2JWPA 4LKDA 4YWAA 1RINA 4NHKA 4UF0A 5F9TA 5IHRA 3CU7A 4JQTA 5I8YA 5FUNA 5F3CA 1OH4A 1SLCA 3I2HA 4LHNA 4QU1A 3VZKA 1UIJA 5JDBA 2GN7A 2XBO2 1COV1 4AEDA 1IZ3A 2WO2A 3TWIA 4KWLA 3OGGA 3FBYA 1S2EA 5CFDA 4WM7C 2XVGA 4A45A 1PO11 1VBE1 4CXXA 3WW2A 3WP3A 5C8CC 4BISA 3AKTA 1RUOA 3GZEA 3WQBA 3QACA 2NLRA 4N9HA 4ZONA 3VBFA 5HXMA 5JLVA 3JQXA 5A3TA 1V6MA 4QHBA 2FDKA 1C4RA 1OOPB 2BYVE 3LDRA 4Q27A 4YG3A 5KC5A 4I0AA 1H8TC 4DUWA 1PMHX 2VPVA 4IUGA 5CNAA 1MS0A 5ERLA 5HPOA 3KWVA 1BEV3 3VLBB 3PUIA 3S5AA 4IV1C 1LRHA 1NCQC 2P5BA 4BYYA 4AR2A 1AR71 2ZHKA 4NRPA 4XABA 3WZ1A 1ZZBA 3HJRA 5A32B 4CDXC 4D0QA 4AAPA 3TEWA 3BU0A 4A6SA 3HQRA 1KGYA 5ABJC 3U4XA 1L3JA 4O61A 4CEYC 5LK7B 2IVJA 3NNLA 2EXHA 3ME2A 2WNUC 2CGOA 2E63A 1R082 4OHVA 4FP3A 4TTGA 3GGLA 4FPLA 2WNVA 4GH4B 3FFQA 4AFAA 4XETA 4QQHA 4YW7A 1H4HA 2ETEA 1MS9A 1T6BX 4R8HA 5F32A 3R0RA 2JXAA 4EWEA 1YFYA 4JV4A 1POV1 2XJSA 1Y9MA 4DXZA 2QQPA 4ASMB 4TXWA 4CEWB 3WW4A 2VBBA 3QLQA 1G9BA 3C7FA 1IS4A 2RDNA 1OI6A 1NLRA 2VC9A 1WBLA 1IPJA 1SPPB 3PU3A 5H9SA 3VDAA 2DFCA 4XTMA 5FUIA 2KR2A 1LGCA 4QHZA 4Q0QA 3WUCA 4LITA 3H8OA 3KQRA 3T1MA 2ZBJA 1US2A 4ISQA 1FPN1 4MVTA 2R062 3FLTA 1LJ7A 1HXS2 4F8AA 1UKGA 2WQZC 2LROA 2H6CA 5JZGC 1RUD1 3J9SA 4PIZA 1CAWB 3ZFGA 1ZBE1 4PQ9A 2W1UA 1O4TA 5DMYA 4E4ZA 1V6JA 3K3NA 4QKNA 1I9RA 2P3KA 5FMBA 3CJIB 3M3CA 4HVQA 1AF9A 3PVNA 2JDYA 2A6WA 2CGNA 3ELNA 3N7JA 1DYPA 2GMPA 1DDLA 3P3NA 1RUF1 4QDQA 3WCRA 1VBB3 2VNVA 3HQUA 3WX5A 1W03A 2VR4A 5FY5A 1ZRCA 1OF4A 1UOFA 4FP2A 4CDUC 4LQRA 1ULPA 3N9NA 2HWB2 2A3WA 3ZKYA 4L99A 1NA1C 4K9SA 4GAZA 4Q4X3 4G3YC 3LOBA 3OBTA 1TZOA 5JSRA 2R30A 3ZO0B 5FY8A 1CAVB 1LOAA 2IXKA 4HN0A 4A4AA 5IAXA 5KHKA 2QNKA 1IS3A 1QGLA 1TNRA 2AEYA 5GKAC 5FXVA 1DZRA 3K51A 3K77A 5JMCA 1W8WA 1WA6X 3LIGA 3ZSJA 1YHFA 4ZZ8A 3U1XA 5JI9A 5DAVA 3WXPA 2XVLA 2CSGA 5FYTA 5I93A 4C90A 1ULGA 2XBO1 5FXXA 1NLSA 5F6KA 3WLUA 2VL4A 2LS6A 4W6YA 4BB3A 4YZ2A 1UXZA 2A6ZA 2RJKA 5C4WC 2JB4A 2K0GA 2B46X 1VR3A 3HVDA 2YC2A 5FYMA 2P3JA 3IBMA 1JBCA 1WGPA 2WNOA 3KB5A 3ZX7A 5A1FA 3AVRA 4KU7A 1V9U2 1LODA 2XJPA 4NIGA 4C0BA 3UNPA 1WLDA 1VBD2 4Y22A 4HSLA 4ATFA 1NCRA 3K46A 3LDKA 3VB9A 1B35C 4RHV2 4CCDA 2FDGA 2A71A 1XE8A 2ARCA 2Y6HA 4DRRA 3ZYIB 4RR3C 1DZQA 3ZYFA 1HB4A 1KDMA 2W92A 4PQQA 1V6KA 3HEIA 4O7XA 3D0JA 2GN3A 5CKMA 2VZUA 4AGGA 3B02A 4KWKA 2CTVA 5DAPA 4R9AA 1HRV2 5E6HA 2Y0IA 1YQ6A 3ZOIA 4MHUA 1R081 1PZ7A 1WW6A 2D3RA 1DZTA 1U5YA 1W6PB 3BN6A 3IDCB 5FZ6A 1BXHA 2DTWA 2HEVF 1EPWA 1POV0 5GZDA 1ACCA 2WZR2 2JDNA 3M3EA 3VD3A 1W6OB 4LT5A 3IPVB 4N90A 4AHZA 4XDOA 1O59A 4FPJA 1H1AA 4XOGA 2VW0A 2BBVA 1JUIA 2PHRA 3DYMA 4W8JA 4FPKA 2OXBA 1NX9A 4W50A 3TEZA 1BLZA 2VULA 5HBAA 4QGMA 5E16A 1IQAA 4EROA 3VV1A 1EP0A 1S0IA 2ZGRA 5L7OB 4RFRB 1MZEA 3PLQA 5KHIA 3MZHA 4QPGC 1VBC2 5LY1A 2MHFA 4NAMA 2RS13 2LUWA 2R061 4XJ8A 3B01A 5BY5A 5FQ0A 1HXS1 5A7PA 1S0FA 4D6QA 2JDZA 1Q5OA 4N43C 1QDOA 2R073 1O7FA 4OYUA 1KS4A 4HK8A 2RR12 4YGCA 3ZFFA 4OI2A 5EWSA 3WF0A 1LB2A 1SCRA 2WO1A 2YMZA 4GWMA 3ZXJA 1A78A 2EIBA 5FO8B 2Q8CA 2XQXA 2VTXJ 3GNEA 2R16A 5FZ4A 1CJPA 1LGBA 3NRUA 1PHMA 1FOD2 4PLMA 1IG3A 5A7NA 1CVNA 4NWVA 1GZTA 5FREA 3HOBA 4AFBA 2FCVA 5FZ7A 2F17A 4FOQA 4LJHA 5K0UA 4EWAA 4WVMA 4CDWC 5DG1A 1CN1A 1MZ5A 3EYPA 4P9WA 4IGPA 1HQNA 5CFDB 3M4FA 4QQPA 2QQLA 5FOJB 3WP5A 1JS9A 2JENA 5FY0A 4Y4YA 3UV9A 2VBPA 3PJYA 1MS5A 1W8FA 3VBFB 1UX7A 4CCOA 4LA2A 3PU8A 3MDPA 3RG0A 4XFAA 4D8MA 5L9BA 3VDDB 2WAOA 3VHOA 5FPUA 3BYWA 4AVCA 4FFFA 3I54A 4PHZA 4SLIA 2J1RA 1A6CA 2CNAA 1MEC3 2HWC3 3R05A 4FPEA 2CHHA 4FOYA 1AVBA 3RMYA 4RQPC 4CCKA 3MUY1 2LW8A 3AXDA 1RUE3 2VMGA 4IL7A 3MYXA 3OUIA 2EA7A 3MPPG 1MVEA 1V9U1 4AFDA 1QJY3 2A1XA 4UAPA 4X6QB 1D2QA 1VBD1 1JYCA 3U0ZA 2UWBA 2Z4FA 2HBUA 3WW1A 2WNVB 2WZPP 4RHV1 5GLWA 1ZZ9A 5FKBA 2BGOA 4JQRA 5A1LA 3MUZ1 4MGSA 4JGYB 1CESA 1SFPA 5HCBA 1XNTA 2WIIB 5CFCA 4M3CB 4FT8A 4OHZA 3RI8A 4CU8A 1HRV1 1WA4A 4IEQA 1GSLA 1ZREA 5K7PA 3J8F3 4I0WB 4B1MA 4YVSB 1LHOA 3AZWA 1IOAA 2BVVA 1TNFA 1C5HA 2WZR1 4N53C 2D6PA 1C57A 3VZNA 1XC6A 4CXYA 3MHZA 4XUTA 2WRAA 3OPTA 1FMD3 1ENQA 1YO8A 3SH4A 4R4XA 4BLIA 5JOWA 5LBEA 2J7MA 1OT5A 4QX2A 3AC0A 2CWMA 2VXJA 2AC1A 4ZKTB 2BV4A 3TB0A 3K75B 4QKFA 3S57A 1U0AA 3VZOA 2JG9A 1VBC1 3HR9A 4GKXA 2D43A 1W2OA 1STMA 5GM0A 1HQLA 1KDKA 1G9FA 4OHWA 2X53S 1PMJX 1VBB2 3ETQA 3GF6A 3ZXGA 3NJVA 1Z0HA 3JU9A 4I0BA 2RR11 3CIHA 4COUA 1PK6A 3E5XA 3GZTB 3LEGA 2W87A 5A3LA 5B4NA 5C9AB 4MSVA 1AR73 3LDBA 2DF7A 4Q4X2 1Y9QA 3ZN5A 1QJEA 1G9CA 1JZ2A 3GYDA 1RUJ3 1FOD1 2FMYA 2BGPA 1YIPA 2GNMA 2V4VA 1Y3TA 4OULA 1QU0A 2RS52 1UMHA 2MNGA 1J83A 2P3YA 3MI8A 2OZ6A 5A6YA 4IW3A 2YB7A 3LGRA 1ZX5A 3VN4A 4CPBA 3VBOC 5K4LA 4A42A 1TG7A 3LE0A 1MQTA 4NRMA 3U14A 4C0HA 3VBSB 2WWUA 2EIEA 1HJFA 1H6YA 1SG3A 3R4UA 1H2LA 1POV3 3LB9A 4WV8A 1QNYA 4CCCA 4P9GA 2V5DA 1R093 5CKNA 3VBHA 4IEWA 3CL1A 1Y9GA 3J7NA 1GU3A 1E5RA 3EXUA 3WF2A 4CCNA 2XKOA 3IMMA 4QX8A 1NCRB 2EXIA 5FK7A 5GLTA 4IGOA 4V2VA 5CVRA 1GICA 2HYKA 5EV7A 5EPAA 5EQUA 4D69A 4Y5Z0 4LO4B 1RUD3 2B42B 2YGMA 4PJYA 1IQDC 4XF0A 3T30A 3WG4A 2DURA 2VZRA 3FFZA 3U4SA 3BI3A 3LEIA 2HJIA 4L2NA 5DABA 5F1RA 2W3JA 4AFMA 2WO7A 1LEDA 1HQWA 1UL9A 1A34A 1ZYBA 4PF1A 1D7PM 1OBNA 3I59B 2YU2A 4P9IA 4DMIA 5FP8A 4ATEA 1RUF3 3WP4A 4A44A 5FLJA 4MADA 1OA3A 3T1LA 1XYPA 1OSGA 2WQ8A 3ACGA 1RMU2 1GKBA 3ZYRA 3TBDA 5HV4A 1AR63 1F4AA 1QEXA 4ET7A 1ASJ3 3PHMA 2I07B 4FAGA 1HV1A 2YHJA 3VHPA 2GALA 4NJ4A 2QCSB 2XLAA 3PUSA 1S0DA 3RDIA 4K1ZA 1WKYA 1I3HA 5JPNB 2RS12 3L2HA 3I2OA 1YJKA 3IWZA 2CAUA 4IETA 2C0ZA 3AMMA 3FHIB 5EIYB 2X5IA 4LKEA 2A3XA 4LUKA 5E8AA 2VM9A 2GP3A 2R072 3O12A 3ZFFB 4ZPIA 5D8AA 3OD4A 4XXAA 5F8PA 1OLQA 3MO4A 1W0OA 1DU3D 2PELA 5IFPA 5FZ0A 1K12A 1V6LA 4AWDA 3FHAA 4MGTA 1DLLA 5A3PA 3EHKA 1VBB1 2UY9A 1Z7S3 1VBA3 4WVMB 3RVHA 3N35A 4JKLA 1GWMA 1GZCA 1UU4A 2DUQA 2VE1A 2LM3A 4LBQD 5JXHA 4Q4X1 4GZ9A 3MLJA 2AACA 3AB0A 3PIGA 4MZUA 3ASIA 1UY3A 2BNOA 1UOJA 3VKOA 3ZN4A 3UJQA 3SISA 1UZWA 1UY1A 3KSCA 4NR1A 1H6XA 2KXLA 1DFQA 2D7FA 2RS51 2WABA 4BU2A 1AXYA 5FZHA 4CP2A 1KD7A 4QX5A 1QHDA 3IDAA 1UY0A 4ITCA 5H9QA 2ZXQA 1ND2C 4ISRA 1OQEA 1GWKA 1Z78A 4XIOA 5CISA 1PO23 1MEC2 2HWC2 2XJTA 2WBKA 3VD7A 2D40A 5F2WA 2EAAA 1SQ4A 2WLQA 1XBFA 1YI7A 2VNGA 2ZMKA 1RUE2 3ILNA 3O1OA 4DEVA 1C5IA 4E9KA 4IE4A 4GKYA 1CAXA 4XPVA 3GM8A 5DUUA 2EICA 3TOJA 4D7YA 3NJYA 3ZSLA 2OS2A 4YZ1A 1QJY2 1PMIA 3U10A 1X36A 4E4DX 4LIUA 2IZWA 2WO3A 3SCFA 3KF5A 4LO5B 4JGZC 4XC9A 4HMZA 2ZABA 2P6CA 4HLTA 4QDRA 1OOPC 4GJZA 1OFNA 3ZSMA 5A7WA 1K5MA 5FYBA 1W6MA 2RV9A 2UURA 3U07A 2JG8C 2XVKA 4PF5A 1XJAA 3WHUA 1ULDA 4I02A 3J8F2 3I3EA 1JI6A 3ACIA 4QU2A 3UK9A 3UKTA 2IXHA 3O1TA 3OEBA 3O0VA 4EE2A 4YZ4A 3ROUA 2I45A 3BTAA 5FZKA 1XNDA 3CF6E 2A73B 2Y33A 1OKQA 3A7QA 3AMNA 4QXHA 5ANQA 1RMU1 2BWCA 4ZY9A 1JXNA 1WLTA 3KHCA 4HK9A 4A41A 1FMD2 3AJYA 4PIXA 4QHOA 3I2KA 4FAHA 2XJUA 3OBAA 1KEXA 3VBRA 1MS4A 1YJLA 4DPNA 3KGZA 4DNYA 2YXSA 3OGVA 1LHVA 2C24A 4LO7A 2D6LX 3HN1A 3FZ3A 3A0KA 5FV3A 5K8SA 5L36A 1OVPA 2OW4A 4C1WA 2JB8A 5FK8A 5IVBA 4HOOA 1PZ9A 2RS11 2A6XA 4HKOA 2ARAA 2B9VA 4XW3A 3N9QA 3WW3A 4HSJA 1EV13 2R0FA 2PHFA 2PAKA 3CZJA 4FXKB 3USUB 4YGDA 2Y8KA 2R071 1W04A 1PK6B 4AHWA 3A22A 3LA2A 2ORZA 3NQHA 3LSDA 1NT0A 1YLLA 3U75A 2GH8A 4OHXA 5AFBA 5CA6A 4CU9A 3C7OA 4YRDA 2XGXA 4AI9A 4BQ5A 3LZZA 4B4RA 1RUJ2 1VMHA 5FMCA 5K9YA 3O1VA 1JHNA 3WDUA 4MLOA 1WW5A 4CYDA 2YV8A 4IERA 3CJIC 3ZXKA 3HT1A 3N3HA 4K1YA 4WM8B 3T2OA 1I6XA 3EJKA 5JCTA 1O3TA 3U37A 2RDQA 2JDPA 5EYYA 1UZVA 2IFWA 1O91A 4AVAA 1MQTB 4WVZA 1YQCA 1GQHA 3FLPA 4YGEA 4D3WA 4IEYA 1OLRA 2BERA 3C7EA 3I3DA 3BU7A 2WAAA 5BNOB 5FZ3A 5IVJA 4XJAA 5JVVA 1R092 4IDZA 2IFRA 1ZNPA 3ACHA 1VJ2A 3HAGA 5J1XA 5LW9A 5F39A 1UZ0A 1X7NA 2ILMA 1IKQA 4BA6A 4Q5OA 4HBNA 4MX3A 1UAIA 4WVVA 2PTMA 1F5JA 5B2GB 4QPIB 2HWC1 2B8MA 1MEC1 1FX5A 2RM23 4JHTA 3OPZA 3AP4A 4DZGA 1RUD2 2W9XA 1RUE1 2A6VA 2O14A 4LULA 3SQOA 3RZJA 1GR3A 4I3GA 1OPOA 3S6PA 1QJY1 2VAUA 1KITA 4JTOA 2VXRA 3POBA 2BGCA 2GNBA 1XPWA 1RB8G 1QOSA 3K4DA 4KNCA 5J48A 5IK7A 3LEMA 4AHYA 5HV0A 3AVSA 1RUF2 1ZZCA 3B9IA 2ZEYA 5GZEA 3NW4A 1AL0G 1UW8A 4WM7A 5DUWA 1DQ2A 5C8CA 5KXBA 1IG0A 4XHBA 4FBFA 1AYN3 2FCUA 3AYDA 3O1UA 1P8JA 1XNAA 1AR62 2JDAA 1ASJ2 2FQPA 3FE5A 2V09A 5C3SA 4CVUA 3J8F1 3JBG2 2ZHLA 1DGWX 1G6NA 3Q8AA 5FLIA 1H8TA 4Q29A 4XJWA 2YU1A 3SNMA 5LRRA 1QWRA 1QIQA 4UYBA 5T52A 2ZCWA 1GP5A 5G04L 4IV1A 1W8OA 1NCQA 2YC4A 3KV6A 4QPWA 4AGVA 5IT6A 1E5HA 3M8LA 2VZPA 3OB8A 4ASKA 1FMD1 4CDXA 5C3OA 5D21A 3RZZA 5FDBA 4OFGA 1KFXL 3JZVA 4BXFA 1CAUA 2ES3A 2R041 4YM0A 5F5AA 2JE8A 1KRIA 2BW8A 3BCWA 5B4XA 1NXMA 1A8MA 1UPIA 3UT0A 4CEYA 4YW3A 5DAQA 5FXWA 2DVGA 4B7KA 2WNUA 5LEJA 2WL1A 3RZLA 4DEQA 4YNIA 3OYWA 1W39A 3M1HA 3GJBA 4LK7A 2GH2A 1LEMA 3NKTA 1W8TA 4P08A 3RWKX 1T2XA 2WR9A 2R6QA 1LU1A 1Z7S2 5L7OC 1VBA2 2CWSA 1VAMA 3T4HB 2PHDA 3TEYA 4LMFA 4XQWA 2ET7A 2QUOA 4TLGA 4ZHNA 5BUVA 4AHXA 1GBGA 4IEOA 3THTA 4AEKA 3K3OA 4RGGA 5FYSA 5IVEA 2WSUA 4RS5C 2R7EB 1RUJ1 2N7GA 2VH9A 1VMJA 4AVVA 4LKFA 3OD0A 4XF4A 4E2GA 2VMDA 1REFA 2XJVA 1AL23 4Y1VA 1FYUA 3PDQA 4TN7A 3IKWA 2QQIA 2QQOA 2FDIA 1LOFC 5C7GA 1LAJA 1POQA 2EIGA 3T3YA 5JZGA 1DQ1A 2Y0OA 2OVUA 1QDCA 2J22A 5DG2A 4E4SA 4BMEA 1PO22 1NUKA 3S0MA 2O0OA 1APNA 4AI1A 1J3PA 3T2TA 4GALA 4OUEA 4K20A 4D7SA 1CAXB 1R091 5CADA 3H3ZA 2PHLA 1UF2C 1N1SA 2J42A 2KD7A 4HXCA 1JYNA 3RFRA 1NKGA 4L97A 1WZXA 1MZFA 1CIWA 4XAEA 2WN2A 3GXUA 4CDUA 4MGZE 3SITA 3POJA 2W1QA 3AKRA 3VDBA 5IATA 3GZUC 1NA1A 1IPSA 3IMNA 3LFIA 3MLKA 3N7MA 5FPAA 3VDDC 1NZCA 4ARYA 1W2TA 1C1FA 1W6MB 2P6HA 1GANA 4XE9A 4W65A 5LWBA 4DRVA 3D5OA 5FY7A 3TAYA 3K4ZA 1TQ5A 5FYCA 3RPQA 1LENA 4CDQB 3KMHA 2W91A 4RD7A 5T5JA 4BIOA 5BNNB 4XACA 4ZXEA 3LIHA 2J1AA 2NM1A 3KLSA 1UIKA 3EB7A 2Y6FA 3ZYGA 5LK5A 1JODA 3L2YA 4ASLA 1N3PA 2GU9A 1AXZA 1J1LA 1JMUB 1AR61 3ILFA 3GBFA 1DP0A 1UX6A 4BHPA 2PXJA 1ASJ1 3UKNA 3MFCA 4TWTA 3JBG1 5T54A 4NVPA 1RL3A 1LOCA 4JGYC 1XE0A 2QZ3A 2Y6LA 3NJXA 3SKJE 4KBZA 4LHSA 5JWPA 4BPZA 5HCHA 4XMAA 2NZ9A 4OCTA 4EJRA 3JQWA 1B35A 5DQ0A 2Z42A 2RS53 1ZZ8A 3KT4A 4PDWB 4BJ0A 1WMFA 1D4VB 2ZOEB 1EV12 3LFMA 3WOGA 3WNXA 4BDVB 1GNHA 4RR3A 4YVSC 3WY6A 2QQVA 3MW2A 1JYIA 3U11A 1UU6A 1CIYA 4B8EA 3H50A 5HCAA 2AR6A 3ABZA 5A33A 4QMAA 3H1MA 1LTEA 2PN5A 1QOTA 3WF1A 5DDJ3 3VBUC 1HRI3 3POIA 4L0PA 2JIGA 1W2UA 2VOXA 4M00A 1UMIA 1MR5A 3J26N 4Q1RA 2VO5A 5FPBA 4QPYA 1K42A 2XWJB 2PQQA 2VUCA 2DVBA 4META 2EXJA 3CO2A 1Z7S1 5DN2A 1VBA1 3NNGA 4DFSA 1J1TA 2C5DA 1ZBA3 4EN9B 4IV3A 1S0JA 1YI9A 1EYBA 4IE6A 1WLCA 5J36A 1SFYA 2VMCA 3OSDA 3E6DA 4IE7A 1S2BA 1FV2A 4QT6A 4YPJA 2RHPA 3AL6A 3C7HA 1CR7A 3AJZA 3KT7A 5HCFA 1ZRFA 1GZWA 2CV6A 2WQ4A 4QPGA 1US3A 5CKQA 4J25A 5E1RA 3ZFEC 4ONUA 5C9AC 2XDVA 1JZ5A 3UJOA 3ZYHA 3N9OA 3HMYA 4N43A 5C3PA 4TZDA 5TSWA 5FPXA 4OLLA 3BTYA 1PO21 3T09A 4IE0A 3Q9OA 4E2QA 1RMU3 2RM22 3EQEA 3Q8FA 3OOXA 3NMBA 3VKFC 4INDA 4DS0A 3ST7A 3LAGA 1R1ZA 2X10A 3URFA 2WINB 5J98B 2BFUL 3VBSC 2DYCA 5FR3A 1S2KA 2DCZA 3WQ7A 3KM5A 5L9RA 5LA9A 4B29A 4CDWA 4Z1VA 2L9LA 2WZEA 3R4SA 3PTRB 3GBGA 4HFSA 4LPLA 2PLV3 1ODNA 3LWCA 4COYA 2HWF2 4TYSA 4C91A 1U5ZA 2VQAA 3HNYM 4UFMA 2QQWA 5FOBB 1ND3B 4Y26A 1GQGA 3B93A 4M3CE 1AYN2 3WINE 5FY9A 2A5ZA 2JKXA 3POEA 1YYNA 4AYUA 2ATFA 2BZDA 3TNQA 4D6RA 1LOBA 2WJSA 2Q8EA 4Q1PA 5GJ6A 5KHJA 2VZ1A 2YROA 1H8TB 2Y38A 4FOVA 2Y34A 3RJRA 3N4MA 4P5YA 4I30A 2YY1A 3WNOA 4NIDA 1NAEA 3BODA 4MUVA 4UF0B 4WZFA 2FZ2A 2P34A 4UBGA 4E8CA 4IV1B 1NCQB 1WWYA 1RUC3 3DXUA 4BZ4A 4FPHA 3S7IA 4U36A 1YCIA 5FJKA 3CMGA 4HZFA 3W59A 4URTA 4XFGA 1S1AA 2W39A 4NHYA 4RQPA 5BNPC 5FO7B 4AEDB 5FZ8A 2FZ1A 5L9VA 3FN9A 4IEPA 1H2MA 5FTTC 3AMHA 2BUKA 1F2NA 4XHXA 1TME3 4YFWA 2ZGQA 2WNUB 3POGA 5DZEA 3IZOA 3KV5A 4J1XA 2QE3A 3FC0A 3OYWB 1R1A3 2VVFA 1ZRDA 5F37A 1OLME 1LHNA 2DUOA 3LKJA 4WZCA 4FTEA 1EV11 3POFA 4LEJA 2DWRA 2Z79A 5FZOA 3N7LA 4GA9A 4FOWA 4QX7A 4GB33 4Q4V3 4DY3A 1RUG3 4BE3A 2WLPA 3AP9A 1YC61 4BQ4A 4IEZA 4EN8B 1CX4A 1CZVA 2AH2A 2W08A 4X6RB 3RZKA 4BWOA 4KG0A 4L92A 4LBQA 2TUNA 4N53A 2RDSA 1W9TA 2QQMA 4Z07A 1CZSA 5IK5A 4YVWC 1AL22 2P4EA 3JUUA 4NRQA 3T2PA 4FVVA 3ZPOA 2D98A 2UY8A 1BMV2 1YFWA 4X8PA 2Z5WA 4XVHA 1E57A 3SH3A 1N3QA 1DQ6A 1C1LA 3AP5A 3THPA 2UU8A 3ZKUA 4M01A 2ZAHA 3T2QA 2UWCA 5GALA 4MV2A 2QBXA 1QJU3 1X9TA 3MICA 1OXCA 4LA3A 3KVBA 5FMOS 1O8SA 2VZQA 4EWDA 4AI2A 4U2AA 3POYA 3DPRC 1GOGA 2QQNA 1LOEA 3MW4A 1S0BA 2ZA9A 2GAUA 4H55A 1HB2A 3SEEA 4BXSV 3W21A 4XUPA 5F3GA 4JRLA 1R64A 4KQ7A 2R1DA 2HEWF 3PUQA 3TYJA 1L7QA 2R1BA 1WUVA 3OJBA 1PNGA 3B94A 4BLJA 4G9SB 3DEMA 1NE4A 1W9SA 1CONA 2RM21 1J58A 2RJ2A 3MV01 4UXAA 2RS33 1NA1B 1N1VA 4QX0A 4QQLA 3ZFGB 2FDJA 2EVXA 4XJZA 1PIV3 3P5BA 5ANNA 1EAH3 1VRBA 2V5YA 2VTFA 1BYHA 2R043 2ZZQA 2BJSA 2GC0A 3NVCA 3GHNA 3PNAA 4LE3A 1JUHA 1DGLA 2ZGKA 4Q4Y3 4AOCA 4AGRA 4EQVA 3B9CA 1D2SA 2G9GA 3H9AA 4F3JA 4Q2FA 4OQ9A 1YFUA 3VBOA 2HWF1 3HPNA 4P14A 4EV0A 1UY2A 4LBKA 4DOUA 2VJXA 3DV8A 2I2SA 5J37A 1AYN1 1SLLA 2B45X 2R32A 4NPRA 3KGLA 1XYOA 5IVVA 1RVF3 2B39A 2OIIA 1GMMA 2WFF1 4AQTA 1AX0A 4XUNA 2PHTA 3ZYJB 4XFBA 1H4GA 1PZ8A 4NAOA 4OI0A 2XKPA 2MPFA 3I2FA 3OGJA 1UCXA 4IEUA 3ZM8A 1FT9A 2R49A 3AKPA 1JYXA 5IVCA 1GNYA 3V0AA 1GUIA 2WNEA 2X09A 4RR3B 3WQ0A 4YG0A 3VZMA 1OQDA 2WA3A 3I3QA 4AQ6A 2ZMLA 1Q3EA 3WEZA 1PX4A 1SFNA 2AEZA 4QKBA 2WYFA 1WMDA 1V00A 2A75A 3BIWE 1ULFA 1W2AX 4FO9A 4DB5A 3OGSA 3ZSKA 5HXVA 2P3IA 3WG3A 5FZBA 5A6QA 1SDWA 4AAXA 1NOVA 1JYTA 4HANA 3RYRA 4HPKA 5DDJ2 4ES9A 4HKLA 1HRI2 4HETA 3AX4A 3WSOA 1F8VA 2O8QA 1WD3A 2NYYA 2VUDA 3O0WA 1BCXA 4HVOA 4BQWA 5LZ6A 2PHUA 4Y22B 3W20A 3MEPA 4IV3B 1ZBA2 5FCCA 4YGBA 3RMXA 5FZFA 2JD9A 5JOYA 1WMEA 1BJQA 3IN9A 2VMEA 2UYBA 4CRQA 3LF7A 2WUHA 1HB3A 2E51A 5IJRA 1Q8PA 1HN1A 2IVIB 2CDOA 4CA9A 4RN5A 1H30A 3TNPB 3KS7A 1AL21 3UKVA 2OT7A 2ZX3A 4AI0A 5CBLA 2VMHA 3T0DA 5J3UA 2ZTNA 3ZMOA 1BMV1 2W95A 2GC2A 4N43B 4C8DA 5L19A 4K6BA 4BK5A 4YARA 4FSJA 4EZHA 1W6NA 2D6KA 2JECA 3IDEA 3WT3A 1O3QA 1QQP1 1SLAA 3FLRA 2OKXA 1YNAA 3SXWA 2BOJA 1O4YA 2AUYA 3SKVA 4WM8C 1G8WA 2D3SA 3OUJA 4PLOA 4ZU5A 3NAPC 3PVOA 4JDNA 4XQDA 1PGSA 2VOVA 2W5FA 1W6QA 4P02B 3JBG3 1SBDA 5LASA 4A3ZA 5FY4A 2D6OX 1N1TA 1W90A 3E5QA 5DUXA 1N47A 4XAAA 3CEWA 5D2AA 2XLFA 3D82A 4XCAA 1NE6A 4XF1A 2PYTA 4BQYA 5BNOC 1ULOA 2PLV2 3SCHA 1FV3A 5FQ0B 4JX0A 4QDSA 4MH0E 1MPXA 2BPA2 4JTNA 2RMU1 1PVXA 4O9GA 1AX1A 4BM8A 3P1IA 4NUBA 1V6IA 2IXJA 4QPIC 1C8M3 4P00B 5LY2A 4WBBA 4XCBA 3H42B 4MHRA 4LXLA 5FYUA 5BNQA 4A7ZA 4XFHA 1ND2A 3PURA 3OBZA 3V64A 4B4PA 1WBFA 3THCA 1H8VA 1WLWA 2GMMA 1QJFA 1K3IA 1OA4A 1RUC2 1WCKA 5K0UB 4CCMA 3FHQA 1OKOA 4RQPB 5A6ZA 1BK0A 3ZVXA 4DIQA 5GZGA 2GP5A 5JR7B 1DBNA 1Y4WA 4FQ4A 4MGYE 1I5ZA 3BOPA 1TME2 3WR0A 3AMQA 4NE9A 5GZFA 3AK0A 1UU5A 1R1A2 2CDPA 1SMVA 1JZ4A 2QZ2A 4ZU4A 3I3BA 1VB4A 4JGZA 5FP4A 3PIJA 5FZIA 3DN7A 2UYAA 2ZKLA 1OOPA 3O0XA 5FZOB 1LESA 3WD5A 5A3UA 2BP6A 3GHMA 4FPYA 4B4QA 3BPSA 1NQDA 2Q4SA 1XU1A 1EY2A 4GB32 4PT6A 4Q4V2 2JG8A 1RUG2 2X29A 2SBAA 3VL8A 3M2MA 1CWPA 4LBLA 3AM2A 2D6MA 5DDJ1 3RWNA 1HRI1 2ZS6B 2XPJA 1H9WA 3T0AA 3OPWA 3VKNA 4LBQB 4K8RB 4URAA 4NMIA 5CEHA 2NP0A 3I7DA 4QGLA 4QQOA 4UBHA 1LHUA 5FFOC 4AF9A 4AVBA 3SC7X 3A4UA 1ZBA1 3RS6A 1XU2A 1YQ2A 4N7IA 5FKCA 2Q8DA 5IYYA 2FDHA 1JOBA 3DL3A 4KWUA 3EMRA 4CP1A 1REEA 4I3PA 4UFKA 1W8UA 2G9ZA 1QJU2 2KA3A 3NWKA 4V2WA 4FPGA 5CFCB 1MVQA 2EF6A 2G4IA 1VE0A 3CZUA 3K4AA 1O3SA 3AFGA 4Y1YA 3N9PA 4KH9A 1WCQA 2YBKA 2VZOA 3ACLA 2OX0A 4W6WA 2KM2A 3TRSB 1ZZ7A 2VY0A 2Q5TA 3WNPA 4YYOA 5A70A 4QM9A 1SPPA 5JSOA 1ENSA 1FATA 2GNDA 5M0TA 1XSRA 3DECA 5J09A 1Q43A 4XDPA 1D4M3 4E2SA 2DCTA 2RS32 4GWJA 5DXDA 4FPCA 4PI2A 4HN1A 2WWJA 1W8NA 2ZGOA 4BQ1A 1PIV2 2XOMA 4DO0A 1CAWA 1EAH2 1SHWB 1W9FA 4GH4C 2R042 5T3NA 3IDBB 2VUAA 4Q4Y2 1ENXA 2VQ0A 3OY8A 4Z92B 1XNKA 1MS8A 4CCEA 2OUJA 4UFLA 3CJIA 2JG9B 2YC0A 1QXJA 5C5TA 3POSA 3TN93 2PLV1 5IWFA 1J3QA 4LO8A 1LGNA 4DQAA 4CEWC 4OI4A 1RITA 5GLZA 1PVC3 2HWD2 1CGPA 3WV6A 4YW4A 2QDNA 3H8UA 2BWAA 1IS6A 4MGQA 5IW0A 1O5LA 1X8EA 1YFXA 5BXXA 4LOTA 1UD1A 5A3WA 3ZXEA 1RVF2 2LRPA 4JCKA 1UOGA 3K48A 5G05L 4CP9A 2BNMA 1CAVA 1KS5A 3SEPA 4Y20A 3UGHA 2IXLA 4NHLA 1Y7BA 4XTPA 1RUC1 3FBMA 1G9DA 4ZU7A 2BOIA 3HD8B 4FTSA 4RYDA 4YW5A 4L11A 4CDQC 4Q4W3 1ULCA 5BNNC 2RE9A 3KV9A 3I2IA 5BPXA 1UKRA 4OZOA 4YFZA 4NIAA 1E5SA 4PBPA 2X8KA 2VZ3A 3KD4A 1UWWA 1TME1 4XURA 5FAXA 4DXSA 3RZMA 2HKXA 4HPKB 5FP3A 2J1UA 4NWWA 3DUIA 4FPFA 1R1A1 2GC3A 1GP4A 4Y4RA 5EXOA 3M3IA 3ZN6A 5A1AA 1RHI3 3D4KA 2Z2SB 1DIWA 1OH3A 5CYYA 3VBHB 1GOHA 5KBFA 1RUNA 5LA2A 1BVVA 3E5UA 4Y1UA 4LR4A 5IAVA 5FYZA 4XUQA 4JAAA 1ST8A 4GB31 1C8NA 1H1MA 4Q4V1 1PX3A 3ZIXA 5IFTA 1RUG1 5FIXA 1CPNA 4LOSA 4PDWC 3OUHA 3B3QE 4AQ2A 4SBVA 2Q8OA 3N36A 3RJ2X 1KFUL 2QQJA 3G7DA 1W0NA 4GULA 4R52A 5JXIA 1U12A 4LBOA 2D44A 5FPVA 5FMDA 5JR2A 5F3EA 5SV8A 2W1SA 3WQ1A 2D5HA 4QM8A 5LA1A 4MOAA 3I2DA 2LALA 2HEYF 3Q8BA 4WVWA 1ONAA 1TE1B 3LOIA 4XYXA 4JRAA 1W6PA 5DZFA 3I4IA 1SEFA 3D3AA 3NV3A 1QXPA 1W6NB 3W5MA 2HWF3 1FNZA 1KJLA 1QMJA 2ZGUA 3JB4C 4S2HA 4CSWA 3IPVA 5LCWL 2VMIA 1QJU1 1VAKA 3C7GA 2EAKA 3D0SA 5FYIA 4L9BA 5F2SA 3H1YA 1F35A 5FY1A 2V73A 2XJQA 2ZX4A 1W0PA 2WFF3 3PUHA 4J1WA 4K21A 4K40A 2BQPA 1JZ7A 5HI0A 1WW7A 3SLIA 4UFHA 2BTVC 1JOPA 3RNSA 4D94A 2BRTA 3MGUA 4JDOA 3AZXA 3GCXA 4C1XA 1DCSA 2C6SA 5CIRA 5ACA3 3AYCA 1UY4A 1SZBA 2OZJA 4KMQA 2RS31 2X5IB 3QH6A 4NN0A 3QH7A 1Q56A 1UZZA 4RL7A 4RS5A 2A6YA 1PIV1 2MEV3 1EAH1 5IVFA 1ZM1A 5D8AB 4V1PA 4EN7B 5ABJA 2Q30A 4Q4Y1 5A3MA 1JHJA 1C8M2 1LULA 4GWIA 4QQ2A 5H9PA 1Q8QA 4BCUA 1O3RA 5FLHA 1I1EA 4LLFA 3GJAA 3WHTA 4Y1XA 3NV4A 1LOFA 3WNMA 1ND2B 4KG8A 3WG2A 1VB2A 5JSPA 2NN8A 2WS93 1QF3A 2FMDA 2K9ZA 2YUEA 4XXPA 3V65A 5L73A 3E6CC 5KXEA 3DGTA 1DF0A 5C71A 2HWD1 4CP0A 2WYSA 4JVAA 1QJX1 5T5PA 5C3QA 4A3XA 1CZTA 4MGIE 5BYNA 1W9YA 4OMDA 4BQ2A 5A3NA 1VLNA 4UW5A 2P2KA 5DAWA 1RVF1 4MO3M 4Q0PA 4LK6A 4CCJA 4I2OA 2JD4A 4LIVA 5CG9A 3J7LA 3DYOA 1ND3C 4Q8KA 2JICA 2DFBA 3DKWA 4JKMA 1DLCA 1HJGA 4JGZB 3JD73 3W58A 5JOXA 3P6BA 4FTBA 4KU8A 1V0AA 2ZEZA 4LKSA 3VUOA 2ID4A 2E32A 2RJLA 2E7AA 4NOTA 1RXGA 4PI0A 2NQYA 4X8NA 2C4XA 2DVAA 2VCCA 3VDDA 4BOWA 2QTWB 4PCRA 2W46A 3PJQA 2VW2A 4H7MA 2JG8B 4BMBA 3H8RA 1QQP3 1RUH2 1UPSA 2A7AA 3DXTA 1QXRA 5CU1A 2AGSA 5JXJA 3GCWA 2FD8A 3I2GA 4XQ4A 1OURA 2DU0A 5CAZA 1GZ9A 2Q1ZB 1ZA7A 1IPKA 2JX9A 3OCPA 4LBJA 2B4KA 3O14A 1GFF2 4AEDC 1OQ1A 1LOGA 1A3KA 2PFWA 4XBNA 5CFDC 2ZGTA 2K46A 3K2OA 3KVAA 3WG1A 1BQPA 1RUI1 4W6XA 3I8TA 1WCUA 3OGRA 5KWRA 3O1MA 4XFFA 1SBFA 3ZDSA 4QAWA 1W05A 3VBFC 2VQUA 1XNCA 2P37A 4XUOA 5EJ3A 2C9KA 1X9PA 3ITQA 2PHXA 5A7WB 3LPFA 4OVEA 1K5MB 5DZGA 2CY6A 1FXZA 2PA7A 2YBPA 4M4PA 4JGYA 2RMU3 3VZLA 3WVJA 2F6BA 1BBT2 1PM4A 1CX1A 1O5UA 1QNWA 4M3CA 4EYUA 5KR7A 1GP6A 5FYHA 4NIIA 3CHXA 1S0EA 4LNVA 3AXEA 4QX1A 4MG2A 4QKDA 3U78A 1XQNA 2Y26A 3N9MA 1AJOA 1XE7A 4YVSA 2VOWA 5LA0A 2DBNA 5I0TA 2Q1FA 2PHWA 3T0BA 5KXDA 1G9AA 1O4ZA 4RFT0 3ACFA 3M3OA 1JYVA 1D4M2 4O65A 2ENRA 3IAQA 4K8FA 3BUCA 2HH9A 2YYOA 5C4WA 2WNVC 3VBUA 4H3WA 3BVCA 3VBRB 1SLTA 3DKQA 4J6GA 1JZ8A 2VBDA 5GZCA 2FHRA 1HIXA 2XHKA 3FL7A 3OY8B 1J84A 1NQJA 4H7LA 1GQPA 1MS1A 4BQXA 4YM3A 1D0HA 1MZ6A 2GC1A 4QB1A 4E8DA 3AZYA 3D6EA 5AC93 4CZSA 4YW2A 1W3VA 2TBVA 2ZGPA 4M3CF 4S2FA 5E89A 2O1QA 4Y5TA 3TN92 2C9AA 1JH5A 3H3UA 1PVC2 4RA0A 1OLMA 3AKSA 2UWAA 2VOTA 2QJVA 4FFIA 3E97A 1JN2P 4I09A 3PMSA 2ARBA 1S0CA 3POWA 3B5LB 1UN1A 2ADDA 1C8M1 3FJSA 4XZUG 2YFUA 3AP7A 2V4AA 5A3OA 3ZFEA 1OUXA 5C9AA 3IM0A 1SCSA 3RZHA 5KC6A 2XJRA 4DXRA 4MXWA 1YRZA 2IXCA 3OF1A 5IVYA 3ZFGC 4CP9B 1TMF3 2ZHMA 4H2AA 3MIFA 4XJ9A 4HONA 5LATA 4Y20B 2QDRA 1ZRRA 5FP7A 2QQUA 2XMLA 4LORA 1NXD1 3PL0A 3PVEA 1AYM3 2TNFA 5CG8A 3ILRA 4Q4W2 2ZJCA 2ZX1A 3QCWA 4JC1A 5EYXA 3O1SA 1ALYA 3L9JT 3M70A 2JDKA 4AXOA 3O1RA 3LA3A 3B7MA 1W2NA 1DGWA 1OMIA 3CJXA 4COZA 5T55A 4CU7A 3NO8A 1SLBA 1X8MA 3VBSA 1O8PA 3OEAA 3CKHA 4B1LA 1RIRA 3ZN6B 4GMP1 1RHI2 3WDVA 4XILA 2RVAA 2EALA 1HN0A 3MIHA 2QFEA 1WCDJ 4Q0VA 3UETA 2K2SA 5IK8A 2DV9A 4CUGA 1XRUA 2C26A 1EUTA 3TEXA 3WNNA 1RUH1 3KQ4B 3Q8EA 5JI7A 4KGGA 4A7YA 1D0GA 1A8DA 5GLUA 1W06A 3CQOA 4FI9A 1AJKA 2HLEA 3UGGA 2Y6JA 4GQ7A 5APAA 2D97A 1QOOA 5A7OA 5I0UA 4AVTA 3WF4A 4Q0UA 4NPMA 1E5IA 4ORFA 5FBZA 3OG2A 1F5FA 2ZGNA 2XH6A 3E6BA 4QXCA 1KQRA 4QGNA 4M0NA 2HBTA 4F7ZA 2E31A 4Y24A 1FAYA 3JB8A 3HQXA 3WNKA 3I59A 4A2UA 5BNPA 1JYWA 3N9LA 3KZ4C 1W8HA 1CPMA 4WM7B 2IWGB 3QD6A 5C8CB 4OZXA 3WDXA 1BKZA 1NCRC 1T6GC 4IV3C 4OI1A 2DUPA 1BBT1 3MLLA 4MGKE 5FYYA 3ON7A 4Z2WA 5LRSA 1SACA 4P9YA 1YQ5A 1DG6A 2WFF2 2VZVA 3G6JB 3MPBA 3W5NA 2VCAA 2JE9A 1PGW2 3JXSA 4HL0A 4FCAA 3MIEA 4YZ5A 3RZGA 2XONA 1NY72 2XR4A 4HKWA 2AZ5A 1AXKA 4NIHA 5T5LA 3B00A 5ACA2 2X05A 1D4M1 1Q8VA 4MXVA 2VUJA 4AI3A 3HNMA 4CDXB 1UMZA 4RS5B 5C6CA 1AR92 2J1SA 2MEV2 1CAUB 2TEPA 3WNLA 5ABJB 4CEYB 4XMIA 3ZDVA 3LCPA 4AQSA 4IESA 4YVWA 5T5OA 3NJZA 3S5QA 1GOFA 4BH9A 3IIIA 3QOPA 4YSFA 4XIKA 3SMHA 5KHHA 1GWLA 1EPZA 2WS92 3TN91 4AK3A 4BIFA 4S2GA 1M4WA 1PVC1 2HWE3 4AVSA 2XQRA 1RGSA 1RJ7A 2Z69A 4IXLA 4EN0A 5JAXA 1JW6A 4O9EA 4AL9A 3RYPA 1F4HA 1QJZA 2F4PA 4KWJA 2AENA 4XBLA 3OTFA 1IKPA 3DPRA 2E26A 2HWB1 4QB2A 3M7AA 4DUVA 1AZDA 5AFEA 2OUHA 2VW1A 5FWJA 2R0HA 1VRH3 2ZGLA 3H7JA 3ZFFC 2QQKA 2W94A 2ZGSA 4AZZA 3NKGA 2VTXA 4KI5M 5I0RA 3KCCA 1XOYA 2JJ6A 5H9RA 2ZGMA 2JKBA 3VZJA 3JD72 4K3UA 4HT1T 4UI9L 3ZXLA 2BEOA 2QKDA 1CD3G 3NNFA 3V0BA 5JZGB 1H0BA 4Q4W1 3AKQA 1HLCA 5C70A 1V70A 3F95A 1W28A 4GMP0 4PLNA 2ZX2A 4AI8A 1BEV2 1QQP2 4XJUA 2LTNA 1GLHA 3OBRA 5AVPA 4OMCA 3UESA 3ZXAC 5K0UC 1YIFA 4COVA 1RTVA 2RG4A 4QXBA 5FZMA 2H6BA 1AR83 1OF3A 2W52A 4XZPA 1RHI1 2YZ4A 1O6UA 1YWKA 4EN6B 2V72A 3S7EA 1UQXA 1DYKA 4LHKA 3IT8A 3VHRA 2CGPA 4XFCA 3AYEA 4GXLA 5EJZB 3RSJA 1HW5A 5FXZA 3J7MA 4CCLA 4COWA 4CDUB 4GJYA 1JOJA 4M4RA 4A6OA 5JIUA 2W68A 3AZVA 3FMGA 4B3NA 2GNTA 3MF9A 2WC2A 2WN3A 5FZAA 3X29B 1K5JA 4I01A 2RMU2 2G9FA 2ZKNA 3AMPA 3BOWA 1LHWA 1PNFA 2DVFA 3C3VA 4IE5A 4JHZA 3JCIA 1ZA4A 3LA7A 4DUXA 3APBA 2PMWB 3CNAA 3AFKA 2JDUA 4Q26A 3WDYA 5SV5A 5KHGA 1RXFA 4DY5A 3I49A 3LEKA 1ODMA 2QVSB 4LO6B 3R6SA 3BKZA 4EZ4A 4Z2AA 1YEWA 1B09A 2HWD3 2XB6C 1QJX3 2JE7A 4E27A 5C4WB 4F83A 3VBUB 4W4ZA 2FBEA 5FWEA 1IS5A 5FZGA 1W99A 1S55A 2VZSA 1NZIA 1OFSA 1COV3 1VPHA 1PGW1 1BVP1 1TVGA 4A7KA 1PGL2 1XYNA 3FX3A 1PO13 1VBE3 1NY71 3ZXFA 4G4FA 3BPZA 4GD4A 3ZYBA 5CFCC 1C3HA 5FZDA 5AC92 3BTZA 5JIAA 1B35B 5ACA1 1J59A 2DCJA 1RC6A 1Q8SA 3B69A 4IEXA 2JEMA 3NNJA 5EZWA 4UFIA 1AUYA 4XFIA 1AR91 2MEV1 3PUAA 3USUA 1JU3A 2C1FA 2YPDA 4P9JA 4QD2A 1SLIA 2ERFA 5A33B 3BIEA 3ZFEB 4XBQA 1VIWB 4QWNA 2PAEA 3C2UA 4MXWB 3PTYA 2I74A 3VKLA 1TMF2 2VNRA 3T08A 3O1PA 2WS91 1MACA 2W47A 4TLFA 4QB6A
chains in the Genus database with same CATH topology
5JMOA 4GWJA 3IB3A 4CUAA 2R7EB 2HYXA 1W8NA 2XOMA 1SHWB 2VMDA 2VCBA 2QQIA 2QQOA 4CUBA 5C7GA 4OYUA 2J22A 3WF0A 1NUKA 2WO1A 1SDDB 2EIBA 2XQXA 1JZ6A 4UOJA 3NRUA 4MGQA 3HN3A 4OUEA 2BBAA 3THDA 2XHNA 5JXGA 3HOBA 5EJ1B 2KD7A 4DEVA 1JYNA 1NKGA 5G05L 3EYPA 2WN2A 3GXUA 3SEPA 2W1QA 3VDBA 2QQLA 3DYPA 4RYDA 4ARYA 3BGAA 3I2IA 4OZOA 1UX7A 2Y64A 3CDZB 2VZ3A 3K4ZA 1UWWA 4XURA 4DXSA 4D8MA 2WAOA 3MBWA 2J1UA 2W91A 5A1AA 4ZXEA 2J1RA 2J1AA 5CYYA 1GOHA 5LA2A 2Y6KA 3EB7A 2J1TA 4JKKA 3MUY1 2LW8A 3J7HA 4XUQA 1DP0A 1PX3A 3I97A 5IFTA 4UAPA 2QQJA 2Y6LA 2Z4FA 1W0NA 3NJXA 5JXIA 3SKJE 4LHSA 2YG0A 5JR2A 5DQ0A 2W1SA 3A23A 2BGOA 5LA1A 2DCKA 4BJ0A 3MUZ1 4MOAA 4MGSA 4BDVB 1RYYA 4QX3A 3LQCA 1XNTA 3D3AA 1CIYA 2VQTA 3ABZA 4CU8A 3W5MA 5LCWL 3WF1A 3E1F1 3C7GA 1DYOA 4L0PA 2VZTA 2J1EA 1UMIA 2VO5A 3PUHA 1K42A 1XC6A 5I0DA 1JZ7A 5DN2A 4XUTA 3NNGA 4QB6A 2ORXA 2J7MA 1OT5A 4QX2A 3AC0A 1UY4A 2VMCA 4KMQA 2J1VA 1LNSA 2ZEWA 4YPJA 3K75B 1JU4A 3C7HA 1US3A 3LPGA 1JZ5A 1JHJA 4GWIA 3HNBM 3VD4A 1PMJX 1UYYA 3WNMA 3NJVA 3CIHA 3LEGA 2W87A 5B4NA 3IAPA 5CZKA 3T09A 5C71A 4CU6A 2WYSA 4DXTA 1OD3A 1CZTA 1JZ2A 4OMDA 2BGPA 2X10A 3F2ZA 1UYZA 4MO3M 2V4VA 1UMHA 1J83A 3DYOA 2WDBA 2YB7A 2L9LA 2WZEA 4JKMA 1DLCA 4LPLA 4A42A 1TG7A 3LE0A 3P6BA 3HNYM 2ZEZA 4LKSA 2EIEA 2ID4A 2E32A 1H6YA 1SG3A 5DPNA 2C4XA 2VCCA 2W46A 1I5PA 2JKXA 2BZDA 2V5DA 2EIDA 3VD9A 1K45A 1GU3A 3WF2A 2VZ1A 5JXJA 3I2GA 4P5YA 2E33A 3ETPA 2B4KA 1NAEA 3WNOA 4E8CA 1L7RA 3OGRA 3CMGA 4CUCA 2YFZA 1IQDC 4QAWA 2VZRA 2VQUA 3ECQA 3LEIA 3FN9A 4XUOA 2C9KA 2W3JA 3LPFA 4M4PA 1UYXA 4HG6B 4PF1A 1D7PM 1CX1A 4A44A 4MADA 4QX1A 2WQ8A 3ACGA 1JZ3A 5LA0A 1F4AA 4ET7A 2DDUA 2W1WA 3T0BA 5JUVA 1JYVA 3ACFA 2VMFA 4AG4A 1UXXX 3IAQA 3MV11 1CZVA 3GDBA 1JZ8A 1WKYA 1W9TA 3FL7A 2QQMA 1CZSA 1J84A 1GQPA 3T2PA 5EIYB 1BHGA 4QB1A 3WF3A 4E8DA 2VM9A 4XVHA 2WZ8A 3VD5A 5F7UA 3T2QA 2VOTA 3MO4A 2QBXA 3A21A 3C8XA 5IFPA 1O8SA 2VZQA 2ZEXA 3I2JA 1GOGA 1K12A 2QQNA 3FHAA 4XZUG 2YFUA 4BXSV 3VDCA 3SEEA 4XUPA 4DXRA 1R64A 4ARXA 1L7QA 4JKLA 5JXHA 1W9SA 3MV01 2RJ2A 4QX0A 4GZ9A 2Y6GA 1UY3A 1W9WA 2VTFA 1UY1A 1H6XA 2WABA 4CU7A 2PQSA 1UY0A 3IDAA 1O8PA 3OEAA 2ZXQA 3CKHA 2RVAA 3HPNA 1UY2A 2WBKA 3VD7A 4BK4A 2VJXA 3UETA 1EUUA 4ZZ5A 2C26A 1EUTA 3WNNA 3GM8A 2EICA 5IHRA 1GMMA 3CQOA 4FI9A 2HLEA 4XUNA 2Y6JA 2WO3A 1OH4A 3I2FA 3I2HA 3WF4A 3ZM8A 2WO2A 1JYXA 1GNYA 4QDRA 3OG2A 1GUIA 2X09A 4A45A 3WEZA 2E31A 1PX4A 2RV9A 3WNKA 3WQBA 1JYWA 5HXMA 3OGSA 4AAXA 3I3EA 1JI6A 3ACIA 4DUWA 1PMHX 4IUGA 3OEBA 5HPOA 3WSOA 3PUIA 2VZVA 3W5NA 3A7QA 2VCAA 4ZY9A 3JXSA 3HJRA 2XONA 4A41A 4D0QA 3I2KA 1KGYA 3OBAA 1KEXA 2JD9A 2X05A 3OGVA 2VMEA 3HNMA 4TTGA 3GGLA 2WUHA 5IJRA 2J1SA 1HN1A 3WNLA 2CDOA 4RN5A 2B9VA 3T0DA 3CZJA 1GOFA 2W95A 3IIIA 2Y8KA 4BK5A 3A22A 3NQHA 2ORZA 4TXWA 2OKXA 3C7FA 2VC9A 4CU9A 3SKVA 3C7OA 3VDAA 5FUIA 1F4HA 4QB2A 2E26A 2W5FA 1US2A 4P02B 4A3ZA 4DUVA 3T2OA 2QQKA 2W94A 3U37A 2W1UA 5DMYA 4KI5M 1ULOA 4JX0A 4QDSA 4UI9L 1MPXA 2BERA 3C7EA 3I3DA 5C70A 2WAAA 3P1IA 4P00B 3UESA 4OMCA 4QDQA 3ACHA 5J1XA 1UZ0A 2VR4A 1OF4A 1OF3A 4LQRA 1ULPA 3THCA 2V72A 1K3IA 3FHQA 2W9XA 5EJZB 4A6OA 4M4RA 4A4AA 3K77A 2WN3A 4ZZ8A 1XPWA 3K4DA 2CDPA 1JZ4A 3I3BA 4JHZA 4DUXA 2ZEYA 2VL4A 2LS6A 1UXZA 1P8JA 1XNAA 2YC2A 3LEKA 4PT6A 4Z2AA 2JDAA 4CVUA 3UNPA 4W4ZA 3T0AA 3K46A 1W99A 2VZSA 5G04L 1W8OA 2Y6HA 2YC4A 4QPWA 1TVGA 2VZPA 3OB8A 2W92A 4PQQA 1YQ2A 3HEIA 2VZUA 5IYYA 2JE8A 4KWUA 2DCJA 5B4XA 3BN6A 1JU3A 4DEQA 3CZUA 3K4AA 3VD3A 1WCQA 4P08A 2VZOA 1T2XA 3WNPA 1O59A 3DYMA 4W8JA 3T08A 1NX9A 4W50A 2W47A 3DECA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JMO A;  4GWJ A;  3IB3 A;  4CUA A;  2R7E B;  2HYX A;  1W8N A;  2XOM A;  1SHW B;  2VMD A;  2VCB A;  2QQI A;  2QQO A;  4CUB A;  5C7G A;  4OYU A;  2J22 A;  3WF0 A;  1NUK A;  2WO1 A;  1SDD B;  2EIB A;  2XQX A;  1JZ6 A;  4UOJ A;  3NRU A;  4MGQ A;  3HN3 A;  4OUE A;  2BBA A;  3THD A;  2XHN A;  5JXG A;  3HOB A;  5EJ1 B;  2KD7 A;  4DEV A;  1JYN A;  1NKG A;  5G05 L;  3EYP A;  2WN2 A;  3GXU A;  3SEP A;  2W1Q A;  3VDB A;  2QQL A;  3DYP A;  4RYD A;  4ARY A;  3BGA A;  3I2I A;  4OZO A;  1UX7 A;  2Y64 A;  3CDZ B;  2VZ3 A;  3K4Z A;  1UWW A;  4XUR A;  4DXS A;  4D8M A;  2WAO A;  3MBW A;  2J1U A;  2W91 A;  5A1A A;  4ZXE A;  2J1R A;  2J1A A;  5CYY A;  1GOH A;  5LA2 A;  2Y6K A;  3EB7 A;  2J1T A;  4JKK A;  3MUY 1;  2LW8 A;  3J7H A;  4XUQ A;  1DP0 A;  1PX3 A;  3I97 A;  5IFT A;  4UAP A;  2QQJ A;  2Y6L A;  2Z4F A;  1W0N A;  3NJX A;  5JXI A;  3SKJ E;  4LHS A;  2YG0 A;  5JR2 A;  5DQ0 A;  2W1S A;  3A23 A;  2BGO A;  5LA1 A;  2DCK A;  4BJ0 A;  3MUZ 1;  4MOA A;  4MGS A;  4BDV B;  1RYY A;  4QX3 A;  3LQC A;  1XNT A;  3D3A A;  1CIY A;  2VQT A;  3ABZ A;  4CU8 A;  3W5M A;  5LCW L;  3WF1 A;  3E1F 1;  3C7G A;  1DYO A;  4L0P A;  2VZT A;  2J1E A;  1UMI A;  2VO5 A;  3PUH A;  1K42 A;  1XC6 A;  5I0D A;  1JZ7 A;  5DN2 A;  4XUT A;  3NNG A;  4QB6 A;  2ORX A;  2J7M A;  1OT5 A;  4QX2 A;  3AC0 A;  1UY4 A;  2VMC A;  4KMQ A;  2J1V A;  1LNS A;  2ZEW A;  4YPJ A;  3K75 B;  1JU4 A;  3C7H A;  1US3 A;  3LPG A;  1JZ5 A;  1JHJ A;  4GWI A;  3HNB M;  3VD4 A;  1PMJ X;  1UYY A;  3WNM A;  3NJV A;  3CIH A;  3LEG A;  2W87 A;  5B4N A;  3IAP A;  5CZK A;  3T09 A;  5C71 A;  4CU6 A;  2WYS A;  4DXT A;  1OD3 A;  1CZT A;  1JZ2 A;  4OMD A;  2BGP A;  2X10 A;  3F2Z A;  1UYZ A;  4MO3 M;  2V4V A;  1UMH A;  1J83 A;  3DYO A;  2WDB A;  2YB7 A;  2L9L A;  2WZE A;  4JKM A;  1DLC A;  4LPL A;  4A42 A;  1TG7 A;  3LE0 A;  3P6B A;  3HNY M;  2ZEZ A;  4LKS A;  2EIE A;  2ID4 A;  2E32 A;  1H6Y A;  1SG3 A;  5DPN A;  2C4X A;  2VCC A;  2W46 A;  1I5P A;  2JKX A;  2BZD A;  2V5D A;  2EID A;  3VD9 A;  1K45 A;  1GU3 A;  3WF2 A;  2VZ1 A;  5JXJ A;  3I2G A;  4P5Y A;  2E33 A;  3ETP A;  2B4K A;  1NAE A;  3WNO A;  4E8C A;  1L7R A;  3OGR A;  3CMG A;  4CUC A;  2YFZ A;  1IQD C;  4QAW A;  2VZR A;  2VQU A;  3ECQ A;  3LEI A;  3FN9 A;  4XUO A;  2C9K A;  2W3J A;  3LPF A;  4M4P A;  1UYX A;  4HG6 B;  4PF1 A;  1D7P M;  1CX1 A;  4A44 A;  4MAD A;  4QX1 A;  2WQ8 A;  3ACG A;  1JZ3 A;  5LA0 A;  1F4A A;  4ET7 A;  2DDU A;  2W1W A;  3T0B A;  5JUV A;  1JYV A;  3ACF A;  2VMF A;  4AG4 A;  1UXX X;  3IAQ A;  3MV1 1;  1CZV A;  3GDB A;  1JZ8 A;  1WKY A;  1W9T A;  3FL7 A;  2QQM A;  1CZS A;  1J84 A;  1GQP A;  3T2P A;  5EIY B;  1BHG A;  4QB1 A;  3WF3 A;  4E8D A;  2VM9 A;  4XVH A;  2WZ8 A;  3VD5 A;  5F7U A;  3T2Q A;  2VOT A;  3MO4 A;  2QBX A;  3A21 A;  3C8X A;  5IFP A;  1O8S A;  2VZQ A;  2ZEX A;  3I2J A;  1GOG A;  1K12 A;  2QQN A;  3FHA A;  4XZU G;  2YFU A;  4BXS V;  3VDC A;  3SEE A;  4XUP A;  4DXR A;  1R64 A;  4ARX A;  1L7Q A;  4JKL A;  5JXH A;  1W9S A;  3MV0 1;  2RJ2 A;  4QX0 A;  4GZ9 A;  2Y6G A;  1UY3 A;  1W9W A;  2VTF A;  1UY1 A;  1H6X A;  2WAB A;  4CU7 A;  2PQS A;  1UY0 A;  3IDA A;  1O8P A;  3OEA A;  2ZXQ A;  3CKH A;  2RVA A;  3HPN A;  1UY2 A;  2WBK A;  3VD7 A;  4BK4 A;  2VJX A;  3UET A;  1EUU A;  4ZZ5 A;  2C26 A;  1EUT A;  3WNN A;  3GM8 A;  2EIC A;  5IHR A;  1GMM A;  3CQO A;  4FI9 A;  2HLE A;  4XUN A;  2Y6J A;  2WO3 A;  1OH4 A;  3I2F A;  3I2H A;  3WF4 A;  3ZM8 A;  2WO2 A;  1JYX A;  1GNY A;  4QDR A;  3OG2 A;  1GUI A;  2X09 A;  4A45 A;  3WEZ A;  2E31 A;  1PX4 A;  2RV9 A;  3WNK A;  3WQB A;  1JYW A;  5HXM A;  3OGS A;  4AAX A;  3I3E A;  1JI6 A;  3ACI A;  4DUW A;  1PMH X;  4IUG A;  3OEB A;  5HPO A;  3WSO A;  3PUI A;  2VZV A;  3W5N A;  3A7Q A;  2VCA A;  4ZY9 A;  3JXS A;  3HJR A;  2XON A;  4A41 A;  4D0Q A;  3I2K A;  1KGY A;  3OBA A;  1KEX A;  2JD9 A;  2X05 A;  3OGV A;  2VME A;  3HNM A;  4TTG A;  3GGL A;  2WUH A;  5IJR A;  2J1S A;  1HN1 A;  3WNL A;  2CDO A;  4RN5 A;  2B9V A;  3T0D A;  3CZJ A;  1GOF A;  2W95 A;  3III A;  2Y8K A;  4BK5 A;  3A22 A;  3NQH A;  2ORZ A;  4TXW A;  2OKX A;  3C7F A;  2VC9 A;  4CU9 A;  3SKV A;  3C7O A;  3VDA A;  5FUI A;  1F4H A;  4QB2 A;  2E26 A;  2W5F A;  1US2 A;  4P02 B;  4A3Z A;  4DUV A;  3T2O A;  2QQK A;  2W94 A;  3U37 A;  2W1U A;  5DMY A;  4KI5 M;  1ULO A;  4JX0 A;  4QDS A;  4UI9 L;  1MPX A;  2BER A;  3C7E A;  3I3D A;  5C70 A;  2WAA A;  3P1I A;  4P00 B;  3UES A;  4OMC A;  4QDQ A;  3ACH A;  5J1X A;  1UZ0 A;  2VR4 A;  1OF4 A;  1OF3 A;  4LQR A;  1ULP A;  3THC A;  2V72 A;  1K3I A;  3FHQ A;  2W9X A;  5EJZ B;  4A6O A;  4M4R A;  4A4A A;  3K77 A;  2WN3 A;  4ZZ8 A;  1XPW A;  3K4D A;  2CDP A;  1JZ4 A;  3I3B A;  4JHZ A;  4DUX A;  2ZEY A;  2VL4 A;  2LS6 A;  1UXZ A;  1P8J A;  1XNA A;  2YC2 A;  3LEK A;  4PT6 A;  4Z2A A;  2JDA A;  4CVU A;  3UNP A;  4W4Z A;  3T0A A;  3K46 A;  1W99 A;  2VZS A;  5G04 L;  1W8O A;  2Y6H A;  2YC4 A;  4QPW A;  1TVG A;  2VZP A;  3OB8 A;  2W92 A;  4PQQ A;  1YQ2 A;  3HEI A;  2VZU A;  5IYY A;  2JE8 A;  4KWU A;  2DCJ A;  5B4X A;  3BN6 A;  1JU3 A;  4DEQ A;  3CZU A;  3K4A A;  3VD3 A;  1WCQ A;  4P08 A;  2VZO A;  1T2X A;  3WNP A;  1O59 A;  3DYM A;  4W8J A;  3T08 A;  1NX9 A;  4W50 A;  2W47 A;  3DEC A; 
#chains in the Genus database with same CATH topology
 3MID A;  5JMO A;  1W8Z A;  2VEC A;  2NPI A;  1RUI 3;  2GZW A;  3ZXD A;  1BK1 A;  5F5C A;  3IB3 A;  2DTY A;  1AYM 2;  2B5H A;  4CUA A;  3H0O A;  5ISL A;  2HYX A;  3SCG A;  2JG9 C;  1UYP A;  1X33 A;  4WM8 A;  2D6N A;  4XF9 A;  2P17 A;  3M3Q A;  5LEK A;  4CXW A;  3BTX A;  3PME A;  3NAP A;  3RGB A;  1WMX A;  3WDT A;  2YGL A;  1CQ9 A;  2JDH A;  2ARE A;  2H0V A;  3HBZ A;  2VCB A;  1DQ0 A;  3GZA A;  4P5H A;  1HKD A;  4L8Q A;  4CUB A;  3KV4 A;  1GZW B;  1PK6 C;  1VAV A;  2P1B A;  3ALQ A;  4QPG B;  1XNB A;  2B7Y A;  5BNO A;  3JD7 1;  2IUW A;  5D1I A;  2GDF A;  3USS A;  2ZPX A;  2XLG A;  2ARX A;  2WWS A;  1SDD B;  5A6X A;  4R9C A;  1ULE A;  5E88 A;  4UOJ A;  1JZ6 A;  5IUQ A;  3WUD A;  4NRO A;  4IEV A;  3H1W A;  3ES1 A;  3ES4 A;  2BBA A;  3HN3 A;  3THD A;  1BEV 1;  2WSV A;  2E6V A;  2XHN A;  5JXG A;  2A3Y A;  4P9L A;  3AZZ A;  1FPN 3;  1YQ8 A;  4LHL A;  4QPI A;  3INA A;  5EJ1 B;  5FZC A;  4YW6 A;  2ZAC A;  3LSE A;  5LBF A;  2OYZ A;  1M06 G;  5I91 A;  1H9P A;  1ZBE 3;  1OPM A;  3IIA A;  3ORJ A;  2CYF A;  1DQ5 A;  1F9K A;  5C8W A;  1MQT C;  3GAL A;  3ZYP A;  2PAM A;  3DYP A;  2FDF A;  3MIG A;  3DF0 A;  5F6L B;  4YM1 A;  4CDW B;  2DU1 A;  5FZL A;  1FI2 A;  3BGA A;  5FPZ A;  5BNP B;  4OQ8 A;  1HB1 A;  1MS3 A;  3VBH C;  1CJD A;  2Y64 A;  3AL5 A;  3CDZ B;  3VKM A;  2VU9 A;  4UWD A;  1H2N A;  3RQ0 A;  1FNY A;  3MBW A;  1UO9 A;  3EO6 A;  2OPW A;  5I8S A;  5LB6 A;  2ZAA A;  4LLO A;  3S30 A;  2XXZ A;  3FUO A;  1XXN A;  2Y6K A;  2D93 A;  2VD7 A;  1GYK A;  1HV0 A;  2J1T A;  1GV9 A;  4LBN A;  4JKK A;  3ZIW A;  3ZR6 A;  1UNB A;  2CL2 A;  3J7H A;  3V56 A;  3D8C A;  5T50 A;  3WCS A;  4B7E A;  4XDQ A;  2O8O A;  3I97 A;  2G19 A;  2XUM A;  2VG9 A;  4ZXK A;  4N8M A;  1N1Y A;  1F15 A;  2ZX0 A;  3J4U H;  1Y43 B;  4LE4 A;  4RGA A;  1XB9 A;  5FBJ A;  1X50 A;  2GSY A;  5F3I A;  2YG0 A;  4Y5S A;  2XBO 3;  1UOB A;  4DIN B;  4YZ3 A;  1AX2 A;  3A23 A;  1OA2 A;  4YM2 A;  2DCK A;  5EFU A;  1HDK A;  4YVW B;  5A7Q A;  1PGL 1;  1KJR A;  2ET1 A;  1RYY A;  3R4D B;  2VVE A;  1ENR A;  4M0H A;  4QX3 A;  1LU2 A;  2ZHN A;  2E7T A;  3LQC A;  4GMP 3;  5AC9 1;  1WD4 A;  4Y33 A;  4UFJ A;  2CAV A;  2VQT A;  4FFH A;  3SH5 A;  2VCM A;  3WP6 A;  2ZMN A;  2OPK A;  4AE2 A;  2HWE 2;  3GBW A;  3E1F 1;  4RGK A;  1LCL A;  3UYJ A;  2NMO A;  1DYO A;  1NG0 A;  1F31 A;  2Q0A A;  2VZT A;  2J1E A;  3PVB B;  4NHM A;  4Y3O A;  4NPL A;  1RUH 3;  3SHR A;  3DPR B;  3NL1 A;  1TEI A;  2IC1 A;  5I0D A;  4MYE A;  2VGD A;  1SBE A;  1VMF A;  3H8X A;  4Z8B A;  2X5I C;  1KXG A;  4E4H A;  5JPM B;  4P9X A;  2CU5 A;  4QXK A;  2WT0 A;  1TMF 1;  2BU9 A;  1VRH 2;  2FCT A;  5FP9 A;  5A32 A;  4N53 B;  3A0N A;  5D8A C;  1HX6 A;  2ORX A;  1C28 A;  1QY4 A;  2WKK A;  2GME A;  3H7Y A;  2OQ7 A;  2J1V A;  5FYV A;  4KL1 A;  1AYM 1;  1LNS A;  2ZEW A;  4CTE A;  1R08 3;  1QH6 A;  4LTA A;  3V0B B;  3KT1 A;  1RED A;  1JU4 A;  1V6O A;  2E9Q A;  5DUV A;  3BB6 A;  4AEJ A;  4UW6 A;  3LPG A;  3O5S A;  4GH4 A;  5F5Q A;  5FRA A;  1OHF A;  4UW4 A;  1DHK B;  3HNB M;  3QBQ A;  3VD4 A;  1UYY A;  4GWN A;  3NV1 A;  1BBT 3;  2WT2 A;  1AR8 2;  2NMN A;  1OUS A;  3KCX A;  4CEW A;  3IAP A;  5CZK A;  3HIF A;  5JOZ A;  4CU6 A;  4TSV A;  2IXI A;  3NST A;  4DXT A;  2DCY A;  5CB7 A;  2YBS A;  1OD3 A;  3MF6 A;  3P3P A;  4LBM A;  3F2Z A;  4IGQ A;  1UYZ A;  4NO4 A;  5EHD A;  2R06 3;  5BV6 A;  2YDE A;  3BAL A;  4UT5 A;  5FO9 B;  1HXS 3;  3N7K A;  2WDB A;  3MIB A;  3NV2 A;  4GIQ A;  4FPO B;  4AW7 A;  1YUD A;  1LEC A;  5FZ9 A;  1PM7 A;  4H14 A;  2E53 A;  1U5I A;  4Z82 A;  1GNZ A;  1J3R A;  1LKN A;  4KBB A;  3EBR A;  4PBO A;  4ZS2 A;  4HVR A;  1VAL A;  1VP6 A;  1W3X A;  1NLQ A;  4Q8L A;  5DPN A;  4OUM A;  5A80 A;  3HWJ A;  3MW3 A;  4CDQ A;  2JIJ A;  4R9B A;  5BNN A;  3VBO B;  1I5P A;  1OVS A;  4N9I A;  3ZSE A;  2EID A;  5J96 B;  3VD9 A;  1QJX 2;  2WT1 A;  1K45 A;  3KCY A;  2SLI A;  5AVA A;  5LBB A;  2Y60 A;  1NYW A;  2E33 A;  3ETP A;  5C33 A;  5J7M A;  5EP9 A;  2HWB 3;  4JZR A;  1COV 2;  2G1M A;  5FMO L;  2BNN A;  5FZE A;  4OHY A;  1L7R A;  1K5M C;  4UW3 A;  4RSU A;  3O7O A;  1PO1 2;  1VBE 2;  4CUC A;  2YFZ A;  1IHM A;  1YXW A;  2W0X A;  3ENR A;  1DGR A;  2VVD A;  2H0B A;  3ECQ A;  4CPB D;  3UGF A;  1WCS A;  3V0A B;  4D7T A;  4R4Z A;  2AYH A;  5FZ1 A;  4PDW A;  4ZS3 A;  5LBC A;  3LD8 A;  1UYX A;  4HG6 B;  4LUM A;  4NHX A;  3T4V A;  1U5X A;  2Q1M A;  3HBK A;  5F5I A;  1DGR N;  4R9D A;  2A70 A;  3CBN A;  1H2K A;  1S4C A;  2DBI A;  1AR7 2;  1JZ3 A;  2D3P A;  3ZMN A;  2BFU S;  1BZW A;  2W2I A;  2VNO A;  3VBR C;  2DDU A;  4AFC A;  2W1W A;  3UL2 A;  3AP6 A;  5JUV A;  1QKQ A;  2VMF A;  4AG4 A;  4K7J A;  1V9U 3;  2HWE 1;  1RUI 2;  1UXX X;  1G7Y A;  3MV1 1;  5IK4 A;  2B9U A;  1VBD 3;  1URX A;  2BDR A;  1RJ8 A;  3GDB A;  3NAP B;  2WA4 A;  4RHV 3;  2XWB B;  5DAX A;  3VGI A;  4S2D A;  3RYK A;  3ATG A;  4KGQ A;  4YLZ A;  3CLP A;  1UZY A;  1BHG A;  3KF3 A;  4XEZ A;  3WF3 A;  1VRH 1;  4Y1Z A;  4BQ3 A;  4ES8 A;  4Q0S A;  5I8T A;  2XL9 A;  3FWE A;  3WDW A;  1S0G A;  2ADE A;  2D5F A;  2WZ8 A;  1HRV 3;  3VL9 A;  3VHN A;  3VD5 A;  5F7U A;  4N7U A;  3AYA A;  2DVD A;  4AEM A;  3ZPY A;  3A21 A;  3C8X A;  1L7L A;  4XF3 A;  2E7Q A;  4IQP A;  3MFA A;  2EXK A;  2ZEX A;  3I2J A;  2WZR 3;  2JDM A;  3NNM A;  4CE8 A;  1IGO A;  2WFP A;  5C5U A;  1W6O A;  2BVB A;  3HT2 A;  5FUP A;  3VDC A;  1DQ4 A;  1FPN 2;  4FXG B;  3ZR5 A;  5KXC A;  5I0S A;  3RI9 A;  4ARX A;  1OD5 A;  2OA2 A;  1JTZ X;  2YPJ A;  1Q8O A;  4JDM A;  1AR8 1;  5FJH A;  2XL7 A;  1ZBE 2;  2RDR A;  2XUE A;  1AHS A;  1W6Q B;  3FUQ A;  3ZLI A;  5FPL A;  3Q8C A;  1ZRI A;  1OC1 A;  4OUS A;  2Y6G A;  5L7O A;  1W9W A;  1WW4 A;  3H3L A;  1XSQ A;  1VBC 3;  2VOK A;  5GLV A;  2F4L A;  5C3R A;  2ZZJ A;  1N3O A;  1ZVF A;  2PQS A;  4FQZ A;  1AR9 3;  1ND3 A;  1V6N A;  4FFG A;  2RR1 3;  3I3M A;  1H1I A;  4PIY A;  3DCQ A;  2XG3 A;  3W9A A;  5A7S A;  1ZZ6 A;  4BK4 A;  4YG6 A;  2OQ6 A;  4YW1 A;  1QH7 A;  1X82 A;  1EUU A;  3RRD A;  4D6S A;  4ZZ5 A;  1G86 A;  1FOD 3;  1LR5 A;  3KHB A;  2JWP A;  4LKD A;  4YWA A;  1RIN A;  4NHK A;  4UF0 A;  5F9T A;  5IHR A;  3CU7 A;  4JQT A;  5I8Y A;  5FUN A;  5F3C A;  1OH4 A;  1SLC A;  3I2H A;  4LHN A;  4QU1 A;  3VZK A;  1UIJ A;  5JDB A;  2GN7 A;  2XBO 2;  1COV 1;  4AED A;  1IZ3 A;  2WO2 A;  3TWI A;  4KWL A;  3OGG A;  3FBY A;  1S2E A;  5CFD A;  4WM7 C;  2XVG A;  4A45 A;  1PO1 1;  1VBE 1;  4CXX A;  3WW2 A;  3WP3 A;  5C8C C;  4BIS A;  3AKT A;  1RUO A;  3GZE A;  3WQB A;  3QAC A;  2NLR A;  4N9H A;  4ZON A;  3VBF A;  5HXM A;  5JLV A;  3JQX A;  5A3T A;  1V6M A;  4QHB A;  2FDK A;  1C4R A;  1OOP B;  2BYV E;  3LDR A;  4Q27 A;  4YG3 A;  5KC5 A;  4I0A A;  1H8T C;  4DUW A;  1PMH X;  2VPV A;  4IUG A;  5CNA A;  1MS0 A;  5ERL A;  5HPO A;  3KWV A;  1BEV 3;  3VLB B;  3PUI A;  3S5A A;  4IV1 C;  1LRH A;  1NCQ C;  2P5B A;  4BYY A;  4AR2 A;  1AR7 1;  2ZHK A;  4NRP A;  4XAB A;  3WZ1 A;  1ZZB A;  3HJR A;  5A32 B;  4CDX C;  4D0Q A;  4AAP A;  3TEW A;  3BU0 A;  4A6S A;  3HQR A;  1KGY A;  5ABJ C;  3U4X A;  1L3J A;  4O61 A;  4CEY C;  5LK7 B;  2IVJ A;  3NNL A;  2EXH A;  3ME2 A;  2WNU C;  2CGO A;  2E63 A;  1R08 2;  4OHV A;  4FP3 A;  4TTG A;  3GGL A;  4FPL A;  2WNV A;  4GH4 B;  3FFQ A;  4AFA A;  4XET A;  4QQH A;  4YW7 A;  1H4H A;  2ETE A;  1MS9 A;  1T6B X;  4R8H A;  5F32 A;  3R0R A;  2JXA A;  4EWE A;  1YFY A;  4JV4 A;  1POV 1;  2XJS A;  1Y9M A;  4DXZ A;  2QQP A;  4ASM B;  4TXW A;  4CEW B;  3WW4 A;  2VBB A;  3QLQ A;  1G9B A;  3C7F A;  1IS4 A;  2RDN A;  1OI6 A;  1NLR A;  2VC9 A;  1WBL A;  1IPJ A;  1SPP B;  3PU3 A;  5H9S A;  3VDA A;  2DFC A;  4XTM A;  5FUI A;  2KR2 A;  1LGC A;  4QHZ A;  4Q0Q A;  3WUC A;  4LIT A;  3H8O A;  3KQR A;  3T1M A;  2ZBJ A;  1US2 A;  4ISQ A;  1FPN 1;  4MVT A;  2R06 2;  3FLT A;  1LJ7 A;  1HXS 2;  4F8A A;  1UKG A;  2WQZ C;  2LRO A;  2H6C A;  5JZG C;  1RUD 1;  3J9S A;  4PIZ A;  1CAW B;  3ZFG A;  1ZBE 1;  4PQ9 A;  2W1U A;  1O4T A;  5DMY A;  4E4Z A;  1V6J A;  3K3N A;  4QKN A;  1I9R A;  2P3K A;  5FMB A;  3CJI B;  3M3C A;  4HVQ A;  1AF9 A;  3PVN A;  2JDY A;  2A6W A;  2CGN A;  3ELN A;  3N7J A;  1DYP A;  2GMP A;  1DDL A;  3P3N A;  1RUF 1;  4QDQ A;  3WCR A;  1VBB 3;  2VNV A;  3HQU A;  3WX5 A;  1W03 A;  2VR4 A;  5FY5 A;  1ZRC A;  1OF4 A;  1UOF A;  4FP2 A;  4CDU C;  4LQR A;  1ULP A;  3N9N A;  2HWB 2;  2A3W A;  3ZKY A;  4L99 A;  1NA1 C;  4K9S A;  4GAZ A;  4Q4X 3;  4G3Y C;  3LOB A;  3OBT A;  1TZO A;  5JSR A;  2R30 A;  3ZO0 B;  5FY8 A;  1CAV B;  1LOA A;  2IXK A;  4HN0 A;  4A4A A;  5IAX A;  5KHK A;  2QNK A;  1IS3 A;  1QGL A;  1TNR A;  2AEY A;  5GKA C;  5FXV A;  1DZR A;  3K51 A;  3K77 A;  5JMC A;  1W8W A;  1WA6 X;  3LIG A;  3ZSJ A;  1YHF A;  4ZZ8 A;  3U1X A;  5JI9 A;  5DAV A;  3WXP A;  2XVL A;  2CSG A;  5FYT A;  5I93 A;  4C90 A;  1ULG A;  2XBO 1;  5FXX A;  1NLS A;  5F6K A;  3WLU A;  2VL4 A;  2LS6 A;  4W6Y A;  4BB3 A;  4YZ2 A;  1UXZ A;  2A6Z A;  2RJK A;  5C4W C;  2JB4 A;  2K0G A;  2B46 X;  1VR3 A;  3HVD A;  2YC2 A;  5FYM A;  2P3J A;  3IBM A;  1JBC A;  1WGP A;  2WNO A;  3KB5 A;  3ZX7 A;  5A1F A;  3AVR A;  4KU7 A;  1V9U 2;  1LOD A;  2XJP A;  4NIG A;  4C0B A;  3UNP A;  1WLD A;  1VBD 2;  4Y22 A;  4HSL A;  4ATF A;  1NCR A;  3K46 A;  3LDK A;  3VB9 A;  1B35 C;  4RHV 2;  4CCD A;  2FDG A;  2A71 A;  1XE8 A;  2ARC A;  2Y6H A;  4DRR A;  3ZYI B;  4RR3 C;  1DZQ A;  3ZYF A;  1HB4 A;  1KDM A;  2W92 A;  4PQQ A;  1V6K A;  3HEI A;  4O7X A;  3D0J A;  2GN3 A;  5CKM A;  2VZU A;  4AGG A;  3B02 A;  4KWK A;  2CTV A;  5DAP A;  4R9A A;  1HRV 2;  5E6H A;  2Y0I A;  1YQ6 A;  3ZOI A;  4MHU A;  1R08 1;  1PZ7 A;  1WW6 A;  2D3R A;  1DZT A;  1U5Y A;  1W6P B;  3BN6 A;  3IDC B;  5FZ6 A;  1BXH A;  2DTW A;  2HEV F;  1EPW A;  1POV 0;  5GZD A;  1ACC A;  2WZR 2;  2JDN A;  3M3E A;  3VD3 A;  1W6O B;  4LT5 A;  3IPV B;  4N90 A;  4AHZ A;  4XDO A;  1O59 A;  4FPJ A;  1H1A A;  4XOG A;  2VW0 A;  2BBV A;  1JUI A;  2PHR A;  3DYM A;  4W8J A;  4FPK A;  2OXB A;  1NX9 A;  4W50 A;  3TEZ A;  1BLZ A;  2VUL A;  5HBA A;  4QGM A;  5E16 A;  1IQA A;  4ERO A;  3VV1 A;  1EP0 A;  1S0I A;  2ZGR A;  5L7O B;  4RFR B;  1MZE A;  3PLQ A;  5KHI A;  3MZH A;  4QPG C;  1VBC 2;  5LY1 A;  2MHF A;  4NAM A;  2RS1 3;  2LUW A;  2R06 1;  4XJ8 A;  3B01 A;  5BY5 A;  5FQ0 A;  1HXS 1;  5A7P A;  1S0F A;  4D6Q A;  2JDZ A;  1Q5O A;  4N43 C;  1QDO A;  2R07 3;  1O7F A;  4OYU A;  1KS4 A;  4HK8 A;  2RR1 2;  4YGC A;  3ZFF A;  4OI2 A;  5EWS A;  3WF0 A;  1LB2 A;  1SCR A;  2WO1 A;  2YMZ A;  4GWM A;  3ZXJ A;  1A78 A;  2EIB A;  5FO8 B;  2Q8C A;  2XQX A;  2VTX J;  3GNE A;  2R16 A;  5FZ4 A;  1CJP A;  1LGB A;  3NRU A;  1PHM A;  1FOD 2;  4PLM A;  1IG3 A;  5A7N A;  1CVN A;  4NWV A;  1GZT A;  5FRE A;  3HOB A;  4AFB A;  2FCV A;  5FZ7 A;  2F17 A;  4FOQ A;  4LJH A;  5K0U A;  4EWA A;  4WVM A;  4CDW C;  5DG1 A;  1CN1 A;  1MZ5 A;  3EYP A;  4P9W A;  4IGP A;  1HQN A;  5CFD B;  3M4F A;  4QQP A;  2QQL A;  5FOJ B;  3WP5 A;  1JS9 A;  2JEN A;  5FY0 A;  4Y4Y A;  3UV9 A;  2VBP A;  3PJY A;  1MS5 A;  1W8F A;  3VBF B;  1UX7 A;  4CCO A;  4LA2 A;  3PU8 A;  3MDP A;  3RG0 A;  4XFA A;  4D8M A;  5L9B A;  3VDD B;  2WAO A;  3VHO A;  5FPU A;  3BYW A;  4AVC A;  4FFF A;  3I54 A;  4PHZ A;  4SLI A;  2J1R A;  1A6C A;  2CNA A;  1MEC 3;  2HWC 3;  3R05 A;  4FPE A;  2CHH A;  4FOY A;  1AVB A;  3RMY A;  4RQP C;  4CCK A;  3MUY 1;  2LW8 A;  3AXD A;  1RUE 3;  2VMG A;  4IL7 A;  3MYX A;  3OUI A;  2EA7 A;  3MPP G;  1MVE A;  1V9U 1;  4AFD A;  1QJY 3;  2A1X A;  4UAP A;  4X6Q B;  1D2Q A;  1VBD 1;  1JYC A;  3U0Z A;  2UWB A;  2Z4F A;  2HBU A;  3WW1 A;  2WNV B;  2WZP P;  4RHV 1;  5GLW A;  1ZZ9 A;  5FKB A;  2BGO A;  4JQR A;  5A1L A;  3MUZ 1;  4MGS A;  4JGY B;  1CES A;  1SFP A;  5HCB A;  1XNT A;  2WII B;  5CFC A;  4M3C B;  4FT8 A;  4OHZ A;  3RI8 A;  4CU8 A;  1HRV 1;  1WA4 A;  4IEQ A;  1GSL A;  1ZRE A;  5K7P A;  3J8F 3;  4I0W B;  4B1M A;  4YVS B;  1LHO A;  3AZW A;  1IOA A;  2BVV A;  1TNF A;  1C5H A;  2WZR 1;  4N53 C;  2D6P A;  1C57 A;  3VZN A;  1XC6 A;  4CXY A;  3MHZ A;  4XUT A;  2WRA A;  3OPT A;  1FMD 3;  1ENQ A;  1YO8 A;  3SH4 A;  4R4X A;  4BLI A;  5JOW A;  5LBE A;  2J7M A;  1OT5 A;  4QX2 A;  3AC0 A;  2CWM A;  2VXJ A;  2AC1 A;  4ZKT B;  2BV4 A;  3TB0 A;  3K75 B;  4QKF A;  3S57 A;  1U0A A;  3VZO A;  2JG9 A;  1VBC 1;  3HR9 A;  4GKX A;  2D43 A;  1W2O A;  1STM A;  5GM0 A;  1HQL A;  1KDK A;  1G9F A;  4OHW A;  2X53 S;  1PMJ X;  1VBB 2;  3ETQ A;  3GF6 A;  3ZXG A;  3NJV A;  1Z0H A;  3JU9 A;  4I0B A;  2RR1 1;  3CIH A;  4COU A;  1PK6 A;  3E5X A;  3GZT B;  3LEG A;  2W87 A;  5A3L A;  5B4N A;  5C9A B;  4MSV A;  1AR7 3;  3LDB A;  2DF7 A;  4Q4X 2;  1Y9Q A;  3ZN5 A;  1QJE A;  1G9C A;  1JZ2 A;  3GYD A;  1RUJ 3;  1FOD 1;  2FMY A;  2BGP A;  1YIP A;  2GNM A;  2V4V A;  1Y3T A;  4OUL A;  1QU0 A;  2RS5 2;  1UMH A;  2MNG A;  1J83 A;  2P3Y A;  3MI8 A;  2OZ6 A;  5A6Y A;  4IW3 A;  2YB7 A;  3LGR A;  1ZX5 A;  3VN4 A;  4CPB A;  3VBO C;  5K4L A;  4A42 A;  1TG7 A;  3LE0 A;  1MQT A;  4NRM A;  3U14 A;  4C0H A;  3VBS B;  2WWU A;  2EIE A;  1HJF A;  1H6Y A;  1SG3 A;  3R4U A;  1H2L A;  1POV 3;  3LB9 A;  4WV8 A;  1QNY A;  4CCC A;  4P9G A;  2V5D A;  1R09 3;  5CKN A;  3VBH A;  4IEW A;  3CL1 A;  1Y9G A;  3J7N A;  1GU3 A;  1E5R A;  3EXU A;  3WF2 A;  4CCN A;  2XKO A;  3IMM A;  4QX8 A;  1NCR B;  2EXI A;  5FK7 A;  5GLT A;  4IGO A;  4V2V A;  5CVR A;  1GIC A;  2HYK A;  5EV7 A;  5EPA A;  5EQU A;  4D69 A;  4Y5Z 0;  4LO4 B;  1RUD 3;  2B42 B;  2YGM A;  4PJY A;  1IQD C;  4XF0 A;  3T30 A;  3WG4 A;  2DUR A;  2VZR A;  3FFZ A;  3U4S A;  3BI3 A;  3LEI A;  2HJI A;  4L2N A;  5DAB A;  5F1R A;  2W3J A;  4AFM A;  2WO7 A;  1LED A;  1HQW A;  1UL9 A;  1A34 A;  1ZYB A;  4PF1 A;  1D7P M;  1OBN A;  3I59 B;  2YU2 A;  4P9I A;  4DMI A;  5FP8 A;  4ATE A;  1RUF 3;  3WP4 A;  4A44 A;  5FLJ A;  4MAD A;  1OA3 A;  3T1L A;  1XYP A;  1OSG A;  2WQ8 A;  3ACG A;  1RMU 2;  1GKB A;  3ZYR A;  3TBD A;  5HV4 A;  1AR6 3;  1F4A A;  1QEX A;  4ET7 A;  1ASJ 3;  3PHM A;  2I07 B;  4FAG A;  1HV1 A;  2YHJ A;  3VHP A;  2GAL A;  4NJ4 A;  2QCS B;  2XLA A;  3PUS A;  1S0D A;  3RDI A;  4K1Z A;  1WKY A;  1I3H A;  5JPN B;  2RS1 2;  3L2H A;  3I2O A;  1YJK A;  3IWZ A;  2CAU A;  4IET A;  2C0Z A;  3AMM A;  3FHI B;  5EIY B;  2X5I A;  4LKE A;  2A3X A;  4LUK A;  5E8A A;  2VM9 A;  2GP3 A;  2R07 2;  3O12 A;  3ZFF B;  4ZPI A;  5D8A A;  3OD4 A;  4XXA A;  5F8P A;  1OLQ A;  3MO4 A;  1W0O A;  1DU3 D;  2PEL A;  5IFP A;  5FZ0 A;  1K12 A;  1V6L A;  4AWD A;  3FHA A;  4MGT A;  1DLL A;  5A3P A;  3EHK A;  1VBB 1;  2UY9 A;  1Z7S 3;  1VBA 3;  4WVM B;  3RVH A;  3N35 A;  4JKL A;  1GWM A;  1GZC A;  1UU4 A;  2DUQ A;  2VE1 A;  2LM3 A;  4LBQ D;  5JXH A;  4Q4X 1;  4GZ9 A;  3MLJ A;  2AAC A;  3AB0 A;  3PIG A;  4MZU A;  3ASI A;  1UY3 A;  2BNO A;  1UOJ A;  3VKO A;  3ZN4 A;  3UJQ A;  3SIS A;  1UZW A;  1UY1 A;  3KSC A;  4NR1 A;  1H6X A;  2KXL A;  1DFQ A;  2D7F A;  2RS5 1;  2WAB A;  4BU2 A;  1AXY A;  5FZH A;  4CP2 A;  1KD7 A;  4QX5 A;  1QHD A;  3IDA A;  1UY0 A;  4ITC A;  5H9Q A;  2ZXQ A;  1ND2 C;  4ISR A;  1OQE A;  1GWK A;  1Z78 A;  4XIO A;  5CIS A;  1PO2 3;  1MEC 2;  2HWC 2;  2XJT A;  2WBK A;  3VD7 A;  2D40 A;  5F2W A;  2EAA A;  1SQ4 A;  2WLQ A;  1XBF A;  1YI7 A;  2VNG A;  2ZMK A;  1RUE 2;  3ILN A;  3O1O A;  4DEV A;  1C5I A;  4E9K A;  4IE4 A;  4GKY A;  1CAX A;  4XPV A;  3GM8 A;  5DUU A;  2EIC A;  3TOJ A;  4D7Y A;  3NJY A;  3ZSL A;  2OS2 A;  4YZ1 A;  1QJY 2;  1PMI A;  3U10 A;  1X36 A;  4E4D X;  4LIU A;  2IZW A;  2WO3 A;  3SCF A;  3KF5 A;  4LO5 B;  4JGZ C;  4XC9 A;  4HMZ A;  2ZAB A;  2P6C A;  4HLT A;  4QDR A;  1OOP C;  4GJZ A;  1OFN A;  3ZSM A;  5A7W A;  1K5M A;  5FYB A;  1W6M A;  2RV9 A;  2UUR A;  3U07 A;  2JG8 C;  2XVK A;  4PF5 A;  1XJA A;  3WHU A;  1ULD A;  4I02 A;  3J8F 2;  3I3E A;  1JI6 A;  3ACI A;  4QU2 A;  3UK9 A;  3UKT A;  2IXH A;  3O1T A;  3OEB A;  3O0V A;  4EE2 A;  4YZ4 A;  3ROU A;  2I45 A;  3BTA A;  5FZK A;  1XND A;  3CF6 E;  2A73 B;  2Y33 A;  1OKQ A;  3A7Q A;  3AMN A;  4QXH A;  5ANQ A;  1RMU 1;  2BWC A;  4ZY9 A;  1JXN A;  1WLT A;  3KHC A;  4HK9 A;  4A41 A;  1FMD 2;  3AJY A;  4PIX A;  4QHO A;  3I2K A;  4FAH A;  2XJU A;  3OBA A;  1KEX A;  3VBR A;  1MS4 A;  1YJL A;  4DPN A;  3KGZ A;  4DNY A;  2YXS A;  3OGV A;  1LHV A;  2C24 A;  4LO7 A;  2D6L X;  3HN1 A;  3FZ3 A;  3A0K A;  5FV3 A;  5K8S A;  5L36 A;  1OVP A;  2OW4 A;  4C1W A;  2JB8 A;  5FK8 A;  5IVB A;  4HOO A;  1PZ9 A;  2RS1 1;  2A6X A;  4HKO A;  2ARA A;  2B9V A;  4XW3 A;  3N9Q A;  3WW3 A;  4HSJ A;  1EV1 3;  2R0F A;  2PHF A;  2PAK A;  3CZJ A;  4FXK B;  3USU B;  4YGD A;  2Y8K A;  2R07 1;  1W04 A;  1PK6 B;  4AHW A;  3A22 A;  3LA2 A;  2ORZ A;  3NQH A;  3LSD A;  1NT0 A;  1YLL A;  3U75 A;  2GH8 A;  4OHX A;  5AFB A;  5CA6 A;  4CU9 A;  3C7O A;  4YRD A;  2XGX A;  4AI9 A;  4BQ5 A;  3LZZ A;  4B4R A;  1RUJ 2;  1VMH A;  5FMC A;  5K9Y A;  3O1V A;  1JHN A;  3WDU A;  4MLO A;  1WW5 A;  4CYD A;  2YV8 A;  4IER A;  3CJI C;  3ZXK A;  3HT1 A;  3N3H A;  4K1Y A;  4WM8 B;  3T2O A;  1I6X A;  3EJK A;  5JCT A;  1O3T A;  3U37 A;  2RDQ A;  2JDP A;  5EYY A;  1UZV A;  2IFW A;  1O91 A;  4AVA A;  1MQT B;  4WVZ A;  1YQC A;  1GQH A;  3FLP A;  4YGE A;  4D3W A;  4IEY A;  1OLR A;  2BER A;  3C7E A;  3I3D A;  3BU7 A;  2WAA A;  5BNO B;  5FZ3 A;  5IVJ A;  4XJA A;  5JVV A;  1R09 2;  4IDZ A;  2IFR A;  1ZNP A;  3ACH A;  1VJ2 A;  3HAG A;  5J1X A;  5LW9 A;  5F39 A;  1UZ0 A;  1X7N A;  2ILM A;  1IKQ A;  4BA6 A;  4Q5O A;  4HBN A;  4MX3 A;  1UAI A;  4WVV A;  2PTM A;  1F5J A;  5B2G B;  4QPI B;  2HWC 1;  2B8M A;  1MEC 1;  1FX5 A;  2RM2 3;  4JHT A;  3OPZ A;  3AP4 A;  4DZG A;  1RUD 2;  2W9X A;  1RUE 1;  2A6V A;  2O14 A;  4LUL A;  3SQO A;  3RZJ A;  1GR3 A;  4I3G A;  1OPO A;  3S6P A;  1QJY 1;  2VAU A;  1KIT A;  4JTO A;  2VXR A;  3POB A;  2BGC A;  2GNB A;  1XPW A;  1RB8 G;  1QOS A;  3K4D A;  4KNC A;  5J48 A;  5IK7 A;  3LEM A;  4AHY A;  5HV0 A;  3AVS A;  1RUF 2;  1ZZC A;  3B9I A;  2ZEY A;  5GZE A;  3NW4 A;  1AL0 G;  1UW8 A;  4WM7 A;  5DUW A;  1DQ2 A;  5C8C A;  5KXB A;  1IG0 A;  4XHB A;  4FBF A;  1AYN 3;  2FCU A;  3AYD A;  3O1U A;  1P8J A;  1XNA A;  1AR6 2;  2JDA A;  1ASJ 2;  2FQP A;  3FE5 A;  2V09 A;  5C3S A;  4CVU A;  3J8F 1;  3JBG 2;  2ZHL A;  1DGW X;  1G6N A;  3Q8A A;  5FLI A;  1H8T A;  4Q29 A;  4XJW A;  2YU1 A;  3SNM A;  5LRR A;  1QWR A;  1QIQ A;  4UYB A;  5T52 A;  2ZCW A;  1GP5 A;  5G04 L;  4IV1 A;  1W8O A;  1NCQ A;  2YC4 A;  3KV6 A;  4QPW A;  4AGV A;  5IT6 A;  1E5H A;  3M8L A;  2VZP A;  3OB8 A;  4ASK A;  1FMD 1;  4CDX A;  5C3O A;  5D21 A;  3RZZ A;  5FDB A;  4OFG A;  1KFX L;  3JZV A;  4BXF A;  1CAU A;  2ES3 A;  2R04 1;  4YM0 A;  5F5A A;  2JE8 A;  1KRI A;  2BW8 A;  3BCW A;  5B4X A;  1NXM A;  1A8M A;  1UPI A;  3UT0 A;  4CEY A;  4YW3 A;  5DAQ A;  5FXW A;  2DVG A;  4B7K A;  2WNU A;  5LEJ A;  2WL1 A;  3RZL A;  4DEQ A;  4YNI A;  3OYW A;  1W39 A;  3M1H A;  3GJB A;  4LK7 A;  2GH2 A;  1LEM A;  3NKT A;  1W8T A;  4P08 A;  3RWK X;  1T2X A;  2WR9 A;  2R6Q A;  1LU1 A;  1Z7S 2;  5L7O C;  1VBA 2;  2CWS A;  1VAM A;  3T4H B;  2PHD A;  3TEY A;  4LMF A;  4XQW A;  2ET7 A;  2QUO A;  4TLG A;  4ZHN A;  5BUV A;  4AHX A;  1GBG A;  4IEO A;  3THT A;  4AEK A;  3K3O A;  4RGG A;  5FYS A;  5IVE A;  2WSU A;  4RS5 C;  2R7E B;  1RUJ 1;  2N7G A;  2VH9 A;  1VMJ A;  4AVV A;  4LKF A;  3OD0 A;  4XF4 A;  4E2G A;  2VMD A;  1REF A;  2XJV A;  1AL2 3;  4Y1V A;  1FYU A;  3PDQ A;  4TN7 A;  3IKW A;  2QQI A;  2QQO A;  2FDI A;  1LOF C;  5C7G A;  1LAJ A;  1POQ A;  2EIG A;  3T3Y A;  5JZG A;  1DQ1 A;  2Y0O A;  2OVU A;  1QDC A;  2J22 A;  5DG2 A;  4E4S A;  4BME A;  1PO2 2;  1NUK A;  3S0M A;  2O0O A;  1APN A;  4AI1 A;  1J3P A;  3T2T A;  4GAL A;  4OUE A;  4K20 A;  4D7S A;  1CAX B;  1R09 1;  5CAD A;  3H3Z A;  2PHL A;  1UF2 C;  1N1S A;  2J42 A;  2KD7 A;  4HXC A;  1JYN A;  3RFR A;  1NKG A;  4L97 A;  1WZX A;  1MZF A;  1CIW A;  4XAE A;  2WN2 A;  3GXU A;  4CDU A;  4MGZ E;  3SIT A;  3POJ A;  2W1Q A;  3AKR A;  3VDB A;  5IAT A;  3GZU C;  1NA1 A;  1IPS A;  3IMN A;  3LFI A;  3MLK A;  3N7M A;  5FPA A;  3VDD C;  1NZC A;  4ARY A;  1W2T A;  1C1F A;  1W6M B;  2P6H A;  1GAN A;  4XE9 A;  4W65 A;  5LWB A;  4DRV A;  3D5O A;  5FY7 A;  3TAY A;  3K4Z A;  1TQ5 A;  5FYC A;  3RPQ A;  1LEN A;  4CDQ B;  3KMH A;  2W91 A;  4RD7 A;  5T5J A;  4BIO A;  5BNN B;  4XAC A;  4ZXE A;  3LIH A;  2J1A A;  2NM1 A;  3KLS A;  1UIK A;  3EB7 A;  2Y6F A;  3ZYG A;  5LK5 A;  1JOD A;  3L2Y A;  4ASL A;  1N3P A;  2GU9 A;  1AXZ A;  1J1L A;  1JMU B;  1AR6 1;  3ILF A;  3GBF A;  1DP0 A;  1UX6 A;  4BHP A;  2PXJ A;  1ASJ 1;  3UKN A;  3MFC A;  4TWT A;  3JBG 1;  5T54 A;  4NVP A;  1RL3 A;  1LOC A;  4JGY C;  1XE0 A;  2QZ3 A;  2Y6L A;  3NJX A;  3SKJ E;  4KBZ A;  4LHS A;  5JWP A;  4BPZ A;  5HCH A;  4XMA A;  2NZ9 A;  4OCT A;  4EJR A;  3JQW A;  1B35 A;  5DQ0 A;  2Z42 A;  2RS5 3;  1ZZ8 A;  3KT4 A;  4PDW B;  4BJ0 A;  1WMF A;  1D4V B;  2ZOE B;  1EV1 2;  3LFM A;  3WOG A;  3WNX A;  4BDV B;  1GNH A;  4RR3 A;  4YVS C;  3WY6 A;  2QQV A;  3MW2 A;  1JYI A;  3U11 A;  1UU6 A;  1CIY A;  4B8E A;  3H50 A;  5HCA A;  2AR6 A;  3ABZ A;  5A33 A;  4QMA A;  3H1M A;  1LTE A;  2PN5 A;  1QOT A;  3WF1 A;  5DDJ 3;  3VBU C;  1HRI 3;  3POI A;  4L0P A;  2JIG A;  1W2U A;  2VOX A;  4M00 A;  1UMI A;  1MR5 A;  3J26 N;  4Q1R A;  2VO5 A;  5FPB A;  4QPY A;  1K42 A;  2XWJ B;  2PQQ A;  2VUC A;  2DVB A;  4MET A;  2EXJ A;  3CO2 A;  1Z7S 1;  5DN2 A;  1VBA 1;  3NNG A;  4DFS A;  1J1T A;  2C5D A;  1ZBA 3;  4EN9 B;  4IV3 A;  1S0J A;  1YI9 A;  1EYB A;  4IE6 A;  1WLC A;  5J36 A;  1SFY A;  2VMC A;  3OSD A;  3E6D A;  4IE7 A;  1S2B A;  1FV2 A;  4QT6 A;  4YPJ A;  2RHP A;  3AL6 A;  3C7H A;  1CR7 A;  3AJZ A;  3KT7 A;  5HCF A;  1ZRF A;  1GZW A;  2CV6 A;  2WQ4 A;  4QPG A;  1US3 A;  5CKQ A;  4J25 A;  5E1R A;  3ZFE C;  4ONU A;  5C9A C;  2XDV A;  1JZ5 A;  3UJO A;  3ZYH A;  3N9O A;  3HMY A;  4N43 A;  5C3P A;  4TZD A;  5TSW A;  5FPX A;  4OLL A;  3BTY A;  1PO2 1;  3T09 A;  4IE0 A;  3Q9O A;  4E2Q A;  1RMU 3;  2RM2 2;  3EQE A;  3Q8F A;  3OOX A;  3NMB A;  3VKF C;  4IND A;  4DS0 A;  3ST7 A;  3LAG A;  1R1Z A;  2X10 A;  3URF A;  2WIN B;  5J98 B;  2BFU L;  3VBS C;  2DYC A;  5FR3 A;  1S2K A;  2DCZ A;  3WQ7 A;  3KM5 A;  5L9R A;  5LA9 A;  4B29 A;  4CDW A;  4Z1V A;  2L9L A;  2WZE A;  3R4S A;  3PTR B;  3GBG A;  4HFS A;  4LPL A;  2PLV 3;  1ODN A;  3LWC A;  4COY A;  2HWF 2;  4TYS A;  4C91 A;  1U5Z A;  2VQA A;  3HNY M;  4UFM A;  2QQW A;  5FOB B;  1ND3 B;  4Y26 A;  1GQG A;  3B93 A;  4M3C E;  1AYN 2;  3WIN E;  5FY9 A;  2A5Z A;  2JKX A;  3POE A;  1YYN A;  4AYU A;  2ATF A;  2BZD A;  3TNQ A;  4D6R A;  1LOB A;  2WJS A;  2Q8E A;  4Q1P A;  5GJ6 A;  5KHJ A;  2VZ1 A;  2YRO A;  1H8T B;  2Y38 A;  4FOV A;  2Y34 A;  3RJR A;  3N4M A;  4P5Y A;  4I30 A;  2YY1 A;  3WNO A;  4NID A;  1NAE A;  3BOD A;  4MUV A;  4UF0 B;  4WZF A;  2FZ2 A;  2P34 A;  4UBG A;  4E8C A;  4IV1 B;  1NCQ B;  1WWY A;  1RUC 3;  3DXU A;  4BZ4 A;  4FPH A;  3S7I A;  4U36 A;  1YCI A;  5FJK A;  3CMG A;  4HZF A;  3W59 A;  4URT A;  4XFG A;  1S1A A;  2W39 A;  4NHY A;  4RQP A;  5BNP C;  5FO7 B;  4AED B;  5FZ8 A;  2FZ1 A;  5L9V A;  3FN9 A;  4IEP A;  1H2M A;  5FTT C;  3AMH A;  2BUK A;  1F2N A;  4XHX A;  1TME 3;  4YFW A;  2ZGQ A;  2WNU B;  3POG A;  5DZE A;  3IZO A;  3KV5 A;  4J1X A;  2QE3 A;  3FC0 A;  3OYW B;  1R1A 3;  2VVF A;  1ZRD A;  5F37 A;  1OLM E;  1LHN A;  2DUO A;  3LKJ A;  4WZC A;  4FTE A;  1EV1 1;  3POF A;  4LEJ A;  2DWR A;  2Z79 A;  5FZO A;  3N7L A;  4GA9 A;  4FOW A;  4QX7 A;  4GB3 3;  4Q4V 3;  4DY3 A;  1RUG 3;  4BE3 A;  2WLP A;  3AP9 A;  1YC6 1;  4BQ4 A;  4IEZ A;  4EN8 B;  1CX4 A;  1CZV A;  2AH2 A;  2W08 A;  4X6R B;  3RZK A;  4BWO A;  4KG0 A;  4L92 A;  4LBQ A;  2TUN A;  4N53 A;  2RDS A;  1W9T A;  2QQM A;  4Z07 A;  1CZS A;  5IK5 A;  4YVW C;  1AL2 2;  2P4E A;  3JUU A;  4NRQ A;  3T2P A;  4FVV A;  3ZPO A;  2D98 A;  2UY8 A;  1BMV 2;  1YFW A;  4X8P A;  2Z5W A;  4XVH A;  1E57 A;  3SH3 A;  1N3Q A;  1DQ6 A;  1C1L A;  3AP5 A;  3THP A;  2UU8 A;  3ZKU A;  4M01 A;  2ZAH A;  3T2Q A;  2UWC A;  5GAL A;  4MV2 A;  2QBX A;  1QJU 3;  1X9T A;  3MIC A;  1OXC A;  4LA3 A;  3KVB A;  5FMO S;  1O8S A;  2VZQ A;  4EWD A;  4AI2 A;  4U2A A;  3POY A;  3DPR C;  1GOG A;  2QQN A;  1LOE A;  3MW4 A;  1S0B A;  2ZA9 A;  2GAU A;  4H55 A;  1HB2 A;  3SEE A;  4BXS V;  3W21 A;  4XUP A;  5F3G A;  4JRL A;  1R64 A;  4KQ7 A;  2R1D A;  2HEW F;  3PUQ A;  3TYJ A;  1L7Q A;  2R1B A;  1WUV A;  3OJB A;  1PNG A;  3B94 A;  4BLJ A;  4G9S B;  3DEM A;  1NE4 A;  1W9S A;  1CON A;  2RM2 1;  1J58 A;  2RJ2 A;  3MV0 1;  4UXA A;  2RS3 3;  1NA1 B;  1N1V A;  4QX0 A;  4QQL A;  3ZFG B;  2FDJ A;  2EVX A;  4XJZ A;  1PIV 3;  3P5B A;  5ANN A;  1EAH 3;  1VRB A;  2V5Y A;  2VTF A;  1BYH A;  2R04 3;  2ZZQ A;  2BJS A;  2GC0 A;  3NVC A;  3GHN A;  3PNA A;  4LE3 A;  1JUH A;  1DGL A;  2ZGK A;  4Q4Y 3;  4AOC A;  4AGR A;  4EQV A;  3B9C A;  1D2S A;  2G9G A;  3H9A A;  4F3J A;  4Q2F A;  4OQ9 A;  1YFU A;  3VBO A;  2HWF 1;  3HPN A;  4P14 A;  4EV0 A;  1UY2 A;  4LBK A;  4DOU A;  2VJX A;  3DV8 A;  2I2S A;  5J37 A;  1AYN 1;  1SLL A;  2B45 X;  2R32 A;  4NPR A;  3KGL A;  1XYO A;  5IVV A;  1RVF 3;  2B39 A;  2OII A;  1GMM A;  2WFF 1;  4AQT A;  1AX0 A;  4XUN A;  2PHT A;  3ZYJ B;  4XFB A;  1H4G A;  1PZ8 A;  4NAO A;  4OI0 A;  2XKP A;  2MPF A;  3I2F A;  3OGJ A;  1UCX A;  4IEU A;  3ZM8 A;  1FT9 A;  2R49 A;  3AKP A;  1JYX A;  5IVC A;  1GNY A;  3V0A A;  1GUI A;  2WNE A;  2X09 A;  4RR3 B;  3WQ0 A;  4YG0 A;  3VZM A;  1OQD A;  2WA3 A;  3I3Q A;  4AQ6 A;  2ZML A;  1Q3E A;  3WEZ A;  1PX4 A;  1SFN A;  2AEZ A;  4QKB A;  2WYF A;  1WMD A;  1V00 A;  2A75 A;  3BIW E;  1ULF A;  1W2A X;  4FO9 A;  4DB5 A;  3OGS A;  3ZSK A;  5HXV A;  2P3I A;  3WG3 A;  5FZB A;  5A6Q A;  1SDW A;  4AAX A;  1NOV A;  1JYT A;  4HAN A;  3RYR A;  4HPK A;  5DDJ 2;  4ES9 A;  4HKL A;  1HRI 2;  4HET A;  3AX4 A;  3WSO A;  1F8V A;  2O8Q A;  1WD3 A;  2NYY A;  2VUD A;  3O0W A;  1BCX A;  4HVO A;  4BQW A;  5LZ6 A;  2PHU A;  4Y22 B;  3W20 A;  3MEP A;  4IV3 B;  1ZBA 2;  5FCC A;  4YGB A;  3RMX A;  5FZF A;  2JD9 A;  5JOY A;  1WME A;  1BJQ A;  3IN9 A;  2VME A;  2UYB A;  4CRQ A;  3LF7 A;  2WUH A;  1HB3 A;  2E51 A;  5IJR A;  1Q8P A;  1HN1 A;  2IVI B;  2CDO A;  4CA9 A;  4RN5 A;  1H30 A;  3TNP B;  3KS7 A;  1AL2 1;  3UKV A;  2OT7 A;  2ZX3 A;  4AI0 A;  5CBL A;  2VMH A;  3T0D A;  5J3U A;  2ZTN A;  3ZMO A;  1BMV 1;  2W95 A;  2GC2 A;  4N43 B;  4C8D A;  5L19 A;  4K6B A;  4BK5 A;  4YAR A;  4FSJ A;  4EZH A;  1W6N A;  2D6K A;  2JEC A;  3IDE A;  3WT3 A;  1O3Q A;  1QQP 1;  1SLA A;  3FLR A;  2OKX A;  1YNA A;  3SXW A;  2BOJ A;  1O4Y A;  2AUY A;  3SKV A;  4WM8 C;  1G8W A;  2D3S A;  3OUJ A;  4PLO A;  4ZU5 A;  3NAP C;  3PVO A;  4JDN A;  4XQD A;  1PGS A;  2VOV A;  2W5F A;  1W6Q A;  4P02 B;  3JBG 3;  1SBD A;  5LAS A;  4A3Z A;  5FY4 A;  2D6O X;  1N1T A;  1W90 A;  3E5Q A;  5DUX A;  1N47 A;  4XAA A;  3CEW A;  5D2A A;  2XLF A;  3D82 A;  4XCA A;  1NE6 A;  4XF1 A;  2PYT A;  4BQY A;  5BNO C;  1ULO A;  2PLV 2;  3SCH A;  1FV3 A;  5FQ0 B;  4JX0 A;  4QDS A;  4MH0 E;  1MPX A;  2BPA 2;  4JTN A;  2RMU 1;  1PVX A;  4O9G A;  1AX1 A;  4BM8 A;  3P1I A;  4NUB A;  1V6I A;  2IXJ A;  4QPI C;  1C8M 3;  4P00 B;  5LY2 A;  4WBB A;  4XCB A;  3H42 B;  4MHR A;  4LXL A;  5FYU A;  5BNQ A;  4A7Z A;  4XFH A;  1ND2 A;  3PUR A;  3OBZ A;  3V64 A;  4B4P A;  1WBF A;  3THC A;  1H8V A;  1WLW A;  2GMM A;  1QJF A;  1K3I A;  1OA4 A;  1RUC 2;  1WCK A;  5K0U B;  4CCM A;  3FHQ A;  1OKO A;  4RQP B;  5A6Z A;  1BK0 A;  3ZVX A;  4DIQ A;  5GZG A;  2GP5 A;  5JR7 B;  1DBN A;  1Y4W A;  4FQ4 A;  4MGY E;  1I5Z A;  3BOP A;  1TME 2;  3WR0 A;  3AMQ A;  4NE9 A;  5GZF A;  3AK0 A;  1UU5 A;  1R1A 2;  2CDP A;  1SMV A;  1JZ4 A;  2QZ2 A;  4ZU4 A;  3I3B A;  1VB4 A;  4JGZ A;  5FP4 A;  3PIJ A;  5FZI A;  3DN7 A;  2UYA A;  2ZKL A;  1OOP A;  3O0X A;  5FZO B;  1LES A;  3WD5 A;  5A3U A;  2BP6 A;  3GHM A;  4FPY A;  4B4Q A;  3BPS A;  1NQD A;  2Q4S A;  1XU1 A;  1EY2 A;  4GB3 2;  4PT6 A;  4Q4V 2;  2JG8 A;  1RUG 2;  2X29 A;  2SBA A;  3VL8 A;  3M2M A;  1CWP A;  4LBL A;  3AM2 A;  2D6M A;  5DDJ 1;  3RWN A;  1HRI 1;  2ZS6 B;  2XPJ A;  1H9W A;  3T0A A;  3OPW A;  3VKN A;  4LBQ B;  4K8R B;  4URA A;  4NMI A;  5CEH A;  2NP0 A;  3I7D A;  4QGL A;  4QQO A;  4UBH A;  1LHU A;  5FFO C;  4AF9 A;  4AVB A;  3SC7 X;  3A4U A;  1ZBA 1;  3RS6 A;  1XU2 A;  1YQ2 A;  4N7I A;  5FKC A;  2Q8D A;  5IYY A;  2FDH A;  1JOB A;  3DL3 A;  4KWU A;  3EMR A;  4CP1 A;  1REE A;  4I3P A;  4UFK A;  1W8U A;  2G9Z A;  1QJU 2;  2KA3 A;  3NWK A;  4V2W A;  4FPG A;  5CFC B;  1MVQ A;  2EF6 A;  2G4I A;  1VE0 A;  3CZU A;  3K4A A;  1O3S A;  3AFG A;  4Y1Y A;  3N9P A;  4KH9 A;  1WCQ A;  2YBK A;  2VZO A;  3ACL A;  2OX0 A;  4W6W A;  2KM2 A;  3TRS B;  1ZZ7 A;  2VY0 A;  2Q5T A;  3WNP A;  4YYO A;  5A70 A;  4QM9 A;  1SPP A;  5JSO A;  1ENS A;  1FAT A;  2GND A;  5M0T A;  1XSR A;  3DEC A;  5J09 A;  1Q43 A;  4XDP A;  1D4M 3;  4E2S A;  2DCT A;  2RS3 2;  4GWJ A;  5DXD A;  4FPC A;  4PI2 A;  4HN1 A;  2WWJ A;  1W8N A;  2ZGO A;  4BQ1 A;  1PIV 2;  2XOM A;  4DO0 A;  1CAW A;  1EAH 2;  1SHW B;  1W9F A;  4GH4 C;  2R04 2;  5T3N A;  3IDB B;  2VUA A;  4Q4Y 2;  1ENX A;  2VQ0 A;  3OY8 A;  4Z92 B;  1XNK A;  1MS8 A;  4CCE A;  2OUJ A;  4UFL A;  3CJI A;  2JG9 B;  2YC0 A;  1QXJ A;  5C5T A;  3POS A;  3TN9 3;  2PLV 1;  5IWF A;  1J3Q A;  4LO8 A;  1LGN A;  4DQA A;  4CEW C;  4OI4 A;  1RIT A;  5GLZ A;  1PVC 3;  2HWD 2;  1CGP A;  3WV6 A;  4YW4 A;  2QDN A;  3H8U A;  2BWA A;  1IS6 A;  4MGQ A;  5IW0 A;  1O5L A;  1X8E A;  1YFX A;  5BXX A;  4LOT A;  1UD1 A;  5A3W A;  3ZXE A;  1RVF 2;  2LRP A;  4JCK A;  1UOG A;  3K48 A;  5G05 L;  4CP9 A;  2BNM A;  1CAV A;  1KS5 A;  3SEP A;  4Y20 A;  3UGH A;  2IXL A;  4NHL A;  1Y7B A;  4XTP A;  1RUC 1;  3FBM A;  1G9D A;  4ZU7 A;  2BOI A;  3HD8 B;  4FTS A;  4RYD A;  4YW5 A;  4L11 A;  4CDQ C;  4Q4W 3;  1ULC A;  5BNN C;  2RE9 A;  3KV9 A;  3I2I A;  5BPX A;  1UKR A;  4OZO A;  4YFZ A;  4NIA A;  1E5S A;  4PBP A;  2X8K A;  2VZ3 A;  3KD4 A;  1UWW A;  1TME 1;  4XUR A;  5FAX A;  4DXS A;  3RZM A;  2HKX A;  4HPK B;  5FP3 A;  2J1U A;  4NWW A;  3DUI A;  4FPF A;  1R1A 1;  2GC3 A;  1GP4 A;  4Y4R A;  5EXO A;  3M3I A;  3ZN6 A;  5A1A A;  1RHI 3;  3D4K A;  2Z2S B;  1DIW A;  1OH3 A;  5CYY A;  3VBH B;  1GOH A;  5KBF A;  1RUN A;  5LA2 A;  1BVV A;  3E5U A;  4Y1U A;  4LR4 A;  5IAV A;  5FYZ A;  4XUQ A;  4JAA A;  1ST8 A;  4GB3 1;  1C8N A;  1H1M A;  4Q4V 1;  1PX3 A;  3ZIX A;  5IFT A;  1RUG 1;  5FIX A;  1CPN A;  4LOS A;  4PDW C;  3OUH A;  3B3Q E;  4AQ2 A;  4SBV A;  2Q8O A;  3N36 A;  3RJ2 X;  1KFU L;  2QQJ A;  3G7D A;  1W0N A;  4GUL A;  4R52 A;  5JXI A;  1U12 A;  4LBO A;  2D44 A;  5FPV A;  5FMD A;  5JR2 A;  5F3E A;  5SV8 A;  2W1S A;  3WQ1 A;  2D5H A;  4QM8 A;  5LA1 A;  4MOA A;  3I2D A;  2LAL A;  2HEY F;  3Q8B A;  4WVW A;  1ONA A;  1TE1 B;  3LOI A;  4XYX A;  4JRA A;  1W6P A;  5DZF A;  3I4I A;  1SEF A;  3D3A A;  3NV3 A;  1QXP A;  1W6N B;  3W5M A;  2HWF 3;  1FNZ A;  1KJL A;  1QMJ A;  2ZGU A;  3JB4 C;  4S2H A;  4CSW A;  3IPV A;  5LCW L;  2VMI A;  1QJU 1;  1VAK A;  3C7G A;  2EAK A;  3D0S A;  5FYI A;  4L9B A;  5F2S A;  3H1Y A;  1F35 A;  5FY1 A;  2V73 A;  2XJQ A;  2ZX4 A;  1W0P A;  2WFF 3;  3PUH A;  4J1W A;  4K21 A;  4K40 A;  2BQP A;  1JZ7 A;  5HI0 A;  1WW7 A;  3SLI A;  4UFH A;  2BTV C;  1JOP A;  3RNS A;  4D94 A;  2BRT A;  3MGU A;  4JDO A;  3AZX A;  3GCX A;  4C1X A;  1DCS A;  2C6S A;  5CIR A;  5ACA 3;  3AYC A;  1UY4 A;  1SZB A;  2OZJ A;  4KMQ A;  2RS3 1;  2X5I B;  3QH6 A;  4NN0 A;  3QH7 A;  1Q56 A;  1UZZ A;  4RL7 A;  4RS5 A;  2A6Y A;  1PIV 1;  2MEV 3;  1EAH 1;  5IVF A;  1ZM1 A;  5D8A B;  4V1P A;  4EN7 B;  5ABJ A;  2Q30 A;  4Q4Y 1;  5A3M A;  1JHJ A;  1C8M 2;  1LUL A;  4GWI A;  4QQ2 A;  5H9P A;  1Q8Q A;  4BCU A;  1O3R A;  5FLH A;  1I1E A;  4LLF A;  3GJA A;  3WHT A;  4Y1X A;  3NV4 A;  1LOF A;  3WNM A;  1ND2 B;  4KG8 A;  3WG2 A;  1VB2 A;  5JSP A;  2NN8 A;  2WS9 3;  1QF3 A;  2FMD A;  2K9Z A;  2YUE A;  4XXP A;  3V65 A;  5L73 A;  3E6C C;  5KXE A;  3DGT A;  1DF0 A;  5C71 A;  2HWD 1;  4CP0 A;  2WYS A;  4JVA A;  1QJX 1;  5T5P A;  5C3Q A;  4A3X A;  1CZT A;  4MGI E;  5BYN A;  1W9Y A;  4OMD A;  4BQ2 A;  5A3N A;  1VLN A;  4UW5 A;  2P2K A;  5DAW A;  1RVF 1;  4MO3 M;  4Q0P A;  4LK6 A;  4CCJ A;  4I2O A;  2JD4 A;  4LIV A;  5CG9 A;  3J7L A;  3DYO A;  1ND3 C;  4Q8K A;  2JIC A;  2DFB A;  3DKW A;  4JKM A;  1DLC A;  1HJG A;  4JGZ B;  3JD7 3;  3W58 A;  5JOX A;  3P6B A;  4FTB A;  4KU8 A;  1V0A A;  2ZEZ A;  4LKS A;  3VUO A;  2ID4 A;  2E32 A;  2RJL A;  2E7A A;  4NOT A;  1RXG A;  4PI0 A;  2NQY A;  4X8N A;  2C4X A;  2DVA A;  2VCC A;  3VDD A;  4BOW A;  2QTW B;  4PCR A;  2W46 A;  3PJQ A;  2VW2 A;  4H7M A;  2JG8 B;  4BMB A;  3H8R A;  1QQP 3;  1RUH 2;  1UPS A;  2A7A A;  3DXT A;  1QXR A;  5CU1 A;  2AGS A;  5JXJ A;  3GCW A;  2FD8 A;  3I2G A;  4XQ4 A;  1OUR A;  2DU0 A;  5CAZ A;  1GZ9 A;  2Q1Z B;  1ZA7 A;  1IPK A;  2JX9 A;  3OCP A;  4LBJ A;  2B4K A;  3O14 A;  1GFF 2;  4AED C;  1OQ1 A;  1LOG A;  1A3K A;  2PFW A;  4XBN A;  5CFD C;  2ZGT A;  2K46 A;  3K2O A;  3KVA A;  3WG1 A;  1BQP A;  1RUI 1;  4W6X A;  3I8T A;  1WCU A;  3OGR A;  5KWR A;  3O1M A;  4XFF A;  1SBF A;  3ZDS A;  4QAW A;  1W05 A;  3VBF C;  2VQU A;  1XNC A;  2P37 A;  4XUO A;  5EJ3 A;  2C9K A;  1X9P A;  3ITQ A;  2PHX A;  5A7W B;  3LPF A;  4OVE A;  1K5M B;  5DZG A;  2CY6 A;  1FXZ A;  2PA7 A;  2YBP A;  4M4P A;  4JGY A;  2RMU 3;  3VZL A;  3WVJ A;  2F6B A;  1BBT 2;  1PM4 A;  1CX1 A;  1O5U A;  1QNW A;  4M3C A;  4EYU A;  5KR7 A;  1GP6 A;  5FYH A;  4NII A;  3CHX A;  1S0E A;  4LNV A;  3AXE A;  4QX1 A;  4MG2 A;  4QKD A;  3U78 A;  1XQN A;  2Y26 A;  3N9M A;  1AJO A;  1XE7 A;  4YVS A;  2VOW A;  5LA0 A;  2DBN A;  5I0T A;  2Q1F A;  2PHW A;  3T0B A;  5KXD A;  1G9A A;  1O4Z A;  4RFT 0;  3ACF A;  3M3O A;  1JYV A;  1D4M 2;  4O65 A;  2ENR A;  3IAQ A;  4K8F A;  3BUC A;  2HH9 A;  2YYO A;  5C4W A;  2WNV C;  3VBU A;  4H3W A;  3BVC A;  3VBR B;  1SLT A;  3DKQ A;  4J6G A;  1JZ8 A;  2VBD A;  5GZC A;  2FHR A;  1HIX A;  2XHK A;  3FL7 A;  3OY8 B;  1J84 A;  1NQJ A;  4H7L A;  1GQP A;  1MS1 A;  4BQX A;  4YM3 A;  1D0H A;  1MZ6 A;  2GC1 A;  4QB1 A;  4E8D A;  3AZY A;  3D6E A;  5AC9 3;  4CZS A;  4YW2 A;  1W3V A;  2TBV A;  2ZGP A;  4M3C F;  4S2F A;  5E89 A;  2O1Q A;  4Y5T A;  3TN9 2;  2C9A A;  1JH5 A;  3H3U A;  1PVC 2;  4RA0 A;  1OLM A;  3AKS A;  2UWA A;  2VOT A;  2QJV A;  4FFI A;  3E97 A;  1JN2 P;  4I09 A;  3PMS A;  2ARB A;  1S0C A;  3POW A;  3B5L B;  1UN1 A;  2ADD A;  1C8M 1;  3FJS A;  4XZU G;  2YFU A;  3AP7 A;  2V4A A;  5A3O A;  3ZFE A;  1OUX A;  5C9A A;  3IM0 A;  1SCS A;  3RZH A;  5KC6 A;  2XJR A;  4DXR A;  4MXW A;  1YRZ A;  2IXC A;  3OF1 A;  5IVY A;  3ZFG C;  4CP9 B;  1TMF 3;  2ZHM A;  4H2A A;  3MIF A;  4XJ9 A;  4HON A;  5LAT A;  4Y20 B;  2QDR A;  1ZRR A;  5FP7 A;  2QQU A;  2XML A;  4LOR A;  1NXD 1;  3PL0 A;  3PVE A;  1AYM 3;  2TNF A;  5CG8 A;  3ILR A;  4Q4W 2;  2ZJC A;  2ZX1 A;  3QCW A;  4JC1 A;  5EYX A;  3O1S A;  1ALY A;  3L9J T;  3M70 A;  2JDK A;  4AXO A;  3O1R A;  3LA3 A;  3B7M A;  1W2N A;  1DGW A;  1OMI A;  3CJX A;  4COZ A;  5T55 A;  4CU7 A;  3NO8 A;  1SLB A;  1X8M A;  3VBS A;  1O8P A;  3OEA A;  3CKH A;  4B1L A;  1RIR A;  3ZN6 B;  4GMP 1;  1RHI 2;  3WDV A;  4XIL A;  2RVA A;  2EAL A;  1HN0 A;  3MIH A;  2QFE A;  1WCD J;  4Q0V A;  3UET A;  2K2S A;  5IK8 A;  2DV9 A;  4CUG A;  1XRU A;  2C26 A;  1EUT A;  3TEX A;  3WNN A;  1RUH 1;  3KQ4 B;  3Q8E A;  5JI7 A;  4KGG A;  4A7Y A;  1D0G A;  1A8D A;  5GLU A;  1W06 A;  3CQO A;  4FI9 A;  1AJK A;  2HLE A;  3UGG A;  2Y6J A;  4GQ7 A;  5APA A;  2D97 A;  1QOO A;  5A7O A;  5I0U A;  4AVT A;  3WF4 A;  4Q0U A;  4NPM A;  1E5I A;  4ORF A;  5FBZ A;  3OG2 A;  1F5F A;  2ZGN A;  2XH6 A;  3E6B A;  4QXC A;  1KQR A;  4QGN A;  4M0N A;  2HBT A;  4F7Z A;  2E31 A;  4Y24 A;  1FAY A;  3JB8 A;  3HQX A;  3WNK A;  3I59 A;  4A2U A;  5BNP A;  1JYW A;  3N9L A;  3KZ4 C;  1W8H A;  1CPM A;  4WM7 B;  2IWG B;  3QD6 A;  5C8C B;  4OZX A;  3WDX A;  1BKZ A;  1NCR C;  1T6G C;  4IV3 C;  4OI1 A;  2DUP A;  1BBT 1;  3MLL A;  4MGK E;  5FYY A;  3ON7 A;  4Z2W A;  5LRS A;  1SAC A;  4P9Y A;  1YQ5 A;  1DG6 A;  2WFF 2;  2VZV A;  3G6J B;  3MPB A;  3W5N A;  2VCA A;  2JE9 A;  1PGW 2;  3JXS A;  4HL0 A;  4FCA A;  3MIE A;  4YZ5 A;  3RZG A;  2XON A;  1NY7 2;  2XR4 A;  4HKW A;  2AZ5 A;  1AXK A;  4NIH A;  5T5L A;  3B00 A;  5ACA 2;  2X05 A;  1D4M 1;  1Q8V A;  4MXV A;  2VUJ A;  4AI3 A;  3HNM A;  4CDX B;  1UMZ A;  4RS5 B;  5C6C A;  1AR9 2;  2J1S A;  2MEV 2;  1CAU B;  2TEP A;  3WNL A;  5ABJ B;  4CEY B;  4XMI A;  3ZDV A;  3LCP A;  4AQS A;  4IES A;  4YVW A;  5T5O A;  3NJZ A;  3S5Q A;  1GOF A;  4BH9 A;  3III A;  3QOP A;  4YSF A;  4XIK A;  3SMH A;  5KHH A;  1GWL A;  1EPZ A;  2WS9 2;  3TN9 1;  4AK3 A;  4BIF A;  4S2G A;  1M4W A;  1PVC 1;  2HWE 3;  4AVS A;  2XQR A;  1RGS A;  1RJ7 A;  2Z69 A;  4IXL A;  4EN0 A;  5JAX A;  1JW6 A;  4O9E A;  4AL9 A;  3RYP A;  1F4H A;  1QJZ A;  2F4P A;  4KWJ A;  2AEN A;  4XBL A;  3OTF A;  1IKP A;  3DPR A;  2E26 A;  2HWB 1;  4QB2 A;  3M7A A;  4DUV A;  1AZD A;  5AFE A;  2OUH A;  2VW1 A;  5FWJ A;  2R0H A;  1VRH 3;  2ZGL A;  3H7J A;  3ZFF C;  2QQK A;  2W94 A;  2ZGS A;  4AZZ A;  3NKG A;  2VTX A;  4KI5 M;  5I0R A;  3KCC A;  1XOY A;  2JJ6 A;  5H9R A;  2ZGM A;  2JKB A;  3VZJ A;  3JD7 2;  4K3U A;  4HT1 T;  4UI9 L;  3ZXL A;  2BEO A;  2QKD A;  1CD3 G;  3NNF A;  3V0B A;  5JZG B;  1H0B A;  4Q4W 1;  3AKQ A;  1HLC A;  5C70 A;  1V70 A;  3F95 A;  1W28 A;  4GMP 0;  4PLN A;  2ZX2 A;  4AI8 A;  1BEV 2;  1QQP 2;  4XJU A;  2LTN A;  1GLH A;  3OBR A;  5AVP A;  4OMC A;  3UES A;  3ZXA C;  5K0U C;  1YIF A;  4COV A;  1RTV A;  2RG4 A;  4QXB A;  5FZM A;  2H6B A;  1AR8 3;  1OF3 A;  2W52 A;  4XZP A;  1RHI 1;  2YZ4 A;  1O6U A;  1YWK A;  4EN6 B;  2V72 A;  3S7E A;  1UQX A;  1DYK A;  4LHK A;  3IT8 A;  3VHR A;  2CGP A;  4XFC A;  3AYE A;  4GXL A;  5EJZ B;  3RSJ A;  1HW5 A;  5FXZ A;  3J7M A;  4CCL A;  4COW A;  4CDU B;  4GJY A;  1JOJ A;  4M4R A;  4A6O A;  5JIU A;  2W68 A;  3AZV A;  3FMG A;  4B3N A;  2GNT A;  3MF9 A;  2WC2 A;  2WN3 A;  5FZA A;  3X29 B;  1K5J A;  4I01 A;  2RMU 2;  2G9F A;  2ZKN A;  3AMP A;  3BOW A;  1LHW A;  1PNF A;  2DVF A;  3C3V A;  4IE5 A;  4JHZ A;  3JCI A;  1ZA4 A;  3LA7 A;  4DUX A;  3APB A;  2PMW B;  3CNA A;  3AFK A;  2JDU A;  4Q26 A;  3WDY A;  5SV5 A;  5KHG A;  1RXF A;  4DY5 A;  3I49 A;  3LEK A;  1ODM A;  2QVS B;  4LO6 B;  3R6S A;  3BKZ A;  4EZ4 A;  4Z2A A;  1YEW A;  1B09 A;  2HWD 3;  2XB6 C;  1QJX 3;  2JE7 A;  4E27 A;  5C4W B;  4F83 A;  3VBU B;  4W4Z A;  2FBE A;  5FWE A;  1IS5 A;  5FZG A;  1W99 A;  1S55 A;  2VZS A;  1NZI A;  1OFS A;  1COV 3;  1VPH A;  1PGW 1;  1BVP 1;  1TVG A;  4A7K A;  1PGL 2;  1XYN A;  3FX3 A;  1PO1 3;  1VBE 3;  1NY7 1;  3ZXF A;  4G4F A;  3BPZ A;  4GD4 A;  3ZYB A;  5CFC C;  1C3H A;  5FZD A;  5AC9 2;  3BTZ A;  5JIA A;  1B35 B;  5ACA 1;  1J59 A;  2DCJ A;  1RC6 A;  1Q8S A;  3B69 A;  4IEX A;  2JEM A;  3NNJ A;  5EZW A;  4UFI A;  1AUY A;  4XFI A;  1AR9 1;  2MEV 1;  3PUA A;  3USU A;  1JU3 A;  2C1F A;  2YPD A;  4P9J A;  4QD2 A;  1SLI A;  2ERF A;  5A33 B;  3BIE A;  3ZFE B;  4XBQ A;  1VIW B;  4QWN A;  2PAE A;  3C2U A;  4MXW B;  3PTY A;  2I74 A;  3VKL A;  1TMF 2;  2VNR A;  3T08 A;  3O1P A;  2WS9 1;  1MAC A;  2W47 A;  4TLF A;  4QB6 A; 
#chains in the Genus database with same CATH homology
 5JMO A;  4GWJ A;  3IB3 A;  4CUA A;  2R7E B;  2HYX A;  1W8N A;  2XOM A;  1SHW B;  2VMD A;  2VCB A;  2QQI A;  2QQO A;  4CUB A;  5C7G A;  4OYU A;  2J22 A;  3WF0 A;  1NUK A;  2WO1 A;  1SDD B;  2EIB A;  2XQX A;  1JZ6 A;  4UOJ A;  3NRU A;  4MGQ A;  3HN3 A;  4OUE A;  2BBA A;  3THD A;  2XHN A;  5JXG A;  3HOB A;  5EJ1 B;  2KD7 A;  4DEV A;  1JYN A;  1NKG A;  5G05 L;  3EYP A;  2WN2 A;  3GXU A;  3SEP A;  2W1Q A;  3VDB A;  2QQL A;  3DYP A;  4RYD A;  4ARY A;  3BGA A;  3I2I A;  4OZO A;  1UX7 A;  2Y64 A;  3CDZ B;  2VZ3 A;  3K4Z A;  1UWW A;  4XUR A;  4DXS A;  4D8M A;  2WAO A;  3MBW A;  2J1U A;  2W91 A;  5A1A A;  4ZXE A;  2J1R A;  2J1A A;  5CYY A;  1GOH A;  5LA2 A;  2Y6K A;  3EB7 A;  2J1T A;  4JKK A;  3MUY 1;  2LW8 A;  3J7H A;  4XUQ A;  1DP0 A;  1PX3 A;  3I97 A;  5IFT A;  4UAP A;  2QQJ A;  2Y6L A;  2Z4F A;  1W0N A;  3NJX A;  5JXI A;  3SKJ E;  4LHS A;  2YG0 A;  5JR2 A;  5DQ0 A;  2W1S A;  3A23 A;  2BGO A;  5LA1 A;  2DCK A;  4BJ0 A;  3MUZ 1;  4MOA A;  4MGS A;  4BDV B;  1RYY A;  4QX3 A;  3LQC A;  1XNT A;  3D3A A;  1CIY A;  2VQT A;  3ABZ A;  4CU8 A;  3W5M A;  5LCW L;  3WF1 A;  3E1F 1;  3C7G A;  1DYO A;  4L0P A;  2VZT A;  2J1E A;  1UMI A;  2VO5 A;  3PUH A;  1K42 A;  1XC6 A;  5I0D A;  1JZ7 A;  5DN2 A;  4XUT A;  3NNG A;  4QB6 A;  2ORX A;  2J7M A;  1OT5 A;  4QX2 A;  3AC0 A;  1UY4 A;  2VMC A;  4KMQ A;  2J1V A;  1LNS A;  2ZEW A;  4YPJ A;  3K75 B;  1JU4 A;  3C7H A;  1US3 A;  3LPG A;  1JZ5 A;  1JHJ A;  4GWI A;  3HNB M;  3VD4 A;  1PMJ X;  1UYY A;  3WNM A;  3NJV A;  3CIH A;  3LEG A;  2W87 A;  5B4N A;  3IAP A;  5CZK A;  3T09 A;  5C71 A;  4CU6 A;  2WYS A;  4DXT A;  1OD3 A;  1CZT A;  1JZ2 A;  4OMD A;  2BGP A;  2X10 A;  3F2Z A;  1UYZ A;  4MO3 M;  2V4V A;  1UMH A;  1J83 A;  3DYO A;  2WDB A;  2YB7 A;  2L9L A;  2WZE A;  4JKM A;  1DLC A;  4LPL A;  4A42 A;  1TG7 A;  3LE0 A;  3P6B A;  3HNY M;  2ZEZ A;  4LKS A;  2EIE A;  2ID4 A;  2E32 A;  1H6Y A;  1SG3 A;  5DPN A;  2C4X A;  2VCC A;  2W46 A;  1I5P A;  2JKX A;  2BZD A;  2V5D A;  2EID A;  3VD9 A;  1K45 A;  1GU3 A;  3WF2 A;  2VZ1 A;  5JXJ A;  3I2G A;  4P5Y A;  2E33 A;  3ETP A;  2B4K A;  1NAE A;  3WNO A;  4E8C A;  1L7R A;  3OGR A;  3CMG A;  4CUC A;  2YFZ A;  1IQD C;  4QAW A;  2VZR A;  2VQU A;  3ECQ A;  3LEI A;  3FN9 A;  4XUO A;  2C9K A;  2W3J A;  3LPF A;  4M4P A;  1UYX A;  4HG6 B;  4PF1 A;  1D7P M;  1CX1 A;  4A44 A;  4MAD A;  4QX1 A;  2WQ8 A;  3ACG A;  1JZ3 A;  5LA0 A;  1F4A A;  4ET7 A;  2DDU A;  2W1W A;  3T0B A;  5JUV A;  1JYV A;  3ACF A;  2VMF A;  4AG4 A;  1UXX X;  3IAQ A;  3MV1 1;  1CZV A;  3GDB A;  1JZ8 A;  1WKY A;  1W9T A;  3FL7 A;  2QQM A;  1CZS A;  1J84 A;  1GQP A;  3T2P A;  5EIY B;  1BHG A;  4QB1 A;  3WF3 A;  4E8D A;  2VM9 A;  4XVH A;  2WZ8 A;  3VD5 A;  5F7U A;  3T2Q A;  2VOT A;  3MO4 A;  2QBX A;  3A21 A;  3C8X A;  5IFP A;  1O8S A;  2VZQ A;  2ZEX A;  3I2J A;  1GOG A;  1K12 A;  2QQN A;  3FHA A;  4XZU G;  2YFU A;  4BXS V;  3VDC A;  3SEE A;  4XUP A;  4DXR A;  1R64 A;  4ARX A;  1L7Q A;  4JKL A;  5JXH A;  1W9S A;  3MV0 1;  2RJ2 A;  4QX0 A;  4GZ9 A;  2Y6G A;  1UY3 A;  1W9W A;  2VTF A;  1UY1 A;  1H6X A;  2WAB A;  4CU7 A;  2PQS A;  1UY0 A;  3IDA A;  1O8P A;  3OEA A;  2ZXQ A;  3CKH A;  2RVA A;  3HPN A;  1UY2 A;  2WBK A;  3VD7 A;  4BK4 A;  2VJX A;  3UET A;  1EUU A;  4ZZ5 A;  2C26 A;  1EUT A;  3WNN A;  3GM8 A;  2EIC A;  5IHR A;  1GMM A;  3CQO A;  4FI9 A;  2HLE A;  4XUN A;  2Y6J A;  2WO3 A;  1OH4 A;  3I2F A;  3I2H A;  3WF4 A;  3ZM8 A;  2WO2 A;  1JYX A;  1GNY A;  4QDR A;  3OG2 A;  1GUI A;  2X09 A;  4A45 A;  3WEZ A;  2E31 A;  1PX4 A;  2RV9 A;  3WNK A;  3WQB A;  1JYW A;  5HXM A;  3OGS A;  4AAX A;  3I3E A;  1JI6 A;  3ACI A;  4DUW A;  1PMH X;  4IUG A;  3OEB A;  5HPO A;  3WSO A;  3PUI A;  2VZV A;  3W5N A;  3A7Q A;  2VCA A;  4ZY9 A;  3JXS A;  3HJR A;  2XON A;  4A41 A;  4D0Q A;  3I2K A;  1KGY A;  3OBA A;  1KEX A;  2JD9 A;  2X05 A;  3OGV A;  2VME A;  3HNM A;  4TTG A;  3GGL A;  2WUH A;  5IJR A;  2J1S A;  1HN1 A;  3WNL A;  2CDO A;  4RN5 A;  2B9V A;  3T0D A;  3CZJ A;  1GOF A;  2W95 A;  3III A;  2Y8K A;  4BK5 A;  3A22 A;  3NQH A;  2ORZ A;  4TXW A;  2OKX A;  3C7F A;  2VC9 A;  4CU9 A;  3SKV A;  3C7O A;  3VDA A;  5FUI A;  1F4H A;  4QB2 A;  2E26 A;  2W5F A;  1US2 A;  4P02 B;  4A3Z A;  4DUV A;  3T2O A;  2QQK A;  2W94 A;  3U37 A;  2W1U A;  5DMY A;  4KI5 M;  1ULO A;  4JX0 A;  4QDS A;  4UI9 L;  1MPX A;  2BER A;  3C7E A;  3I3D A;  5C70 A;  2WAA A;  3P1I A;  4P00 B;  3UES A;  4OMC A;  4QDQ A;  3ACH A;  5J1X A;  1UZ0 A;  2VR4 A;  1OF4 A;  1OF3 A;  4LQR A;  1ULP A;  3THC A;  2V72 A;  1K3I A;  3FHQ A;  2W9X A;  5EJZ B;  4A6O A;  4M4R A;  4A4A A;  3K77 A;  2WN3 A;  4ZZ8 A;  1XPW A;  3K4D A;  2CDP A;  1JZ4 A;  3I3B A;  4JHZ A;  4DUX A;  2ZEY A;  2VL4 A;  2LS6 A;  1UXZ A;  1P8J A;  1XNA A;  2YC2 A;  3LEK A;  4PT6 A;  4Z2A A;  2JDA A;  4CVU A;  3UNP A;  4W4Z A;  3T0A A;  3K46 A;  1W99 A;  2VZS A;  5G04 L;  1W8O A;  2Y6H A;  2YC4 A;  4QPW A;  1TVG A;  2VZP A;  3OB8 A;  2W92 A;  4PQQ A;  1YQ2 A;  3HEI A;  2VZU A;  5IYY A;  2JE8 A;  4KWU A;  2DCJ A;  5B4X A;  3BN6 A;  1JU3 A;  4DEQ A;  3CZU A;  3K4A A;  3VD3 A;  1WCQ A;  4P08 A;  2VZO A;  1T2X A;  3WNP A;  1O59 A;  3DYM A;  4W8J A;  3T08 A;  1NX9 A;  4W50 A;  2W47 A;  3DEC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...