4QDRA

Physical basis for nrp2 ligand binding
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
321
structure length
314
Chain Sequence
HMQCNVPLGMESGRIANEQISASSTYSDGRWTPQQSRLHGDDNGWRPNLDSNKEYLQVDLRFLTMLTAIATQGAISRETQNGYYVKSYKLEVSTNGEDWMVYRHGKNHKVFQANNDATEVVLNKLHAPLLTRFVRIRPQTWHSGIALRLELFGCRVTDAPCSNMLGMLSGLIADSQISASSTQEYLWSPSAARLVSSRSGWFPRIPQAQPGEEWLQVDLGTPKTVKGVIIQGARGEARAFVRKFKVSYSLNGKDWEYIQDPRTQQPKLFEGNMHYDTPDIRRFDPIPAQYVRVYPERWSPAGIGMRLEVLGCDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for VEGF-C Binding to Neuropilin-2 and Sequestration by a Soluble Splice Form.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Neuropilin-2
total genus 76
structure length 314
sequence length 321
ec nomenclature
pdb deposition date 2014-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4qdrA01
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4qdrA02
2VZVA 4A45A 2VZ1A 3ABZA 1W9SA 1SDDB 2BGOA 3GXUA 4BXSV 1W9TA 3SKJE 5LA2A 1NUKA 4JHZA 3WF4A 2YB7A 1O8PA 1PX3A 2YFUA 1W8NA 1GOFA 2W3JA 2X05A 4A42A 1UZ0A 3A23A 2VZOA 2EICA 3FHAA 3I2HA 2LS6A 4L0PA 3NRUA 2VMCA 1CIYA 4PQQA 2BZDA 1NX9A 1TG7A 4LQRA 2XONA 1K3IA 2JDAA 4D8MA 3T08A 4BK5A 2WBKA 5J1XA 1HN1A 4GWIA 1SG3A 4E8CA 3HEIA 4A6OA 2BGPA 1GQPA 2W46A 4DXRA 5LA1A 5JR2A 1R64A 3WF2A 2Y6JA 3SEPA 1W8OA 1JYVA 1US3A 2V5DA 5JMOA 1H6XA 2QBXA 3MO4A 3I2JA 3HNMA 4GZ9A 3VD9A 1H6YA 3CZUA 3DYPA 1RYYA 2OKXA 4ZZ8A 2QQKA 3A22A 2ZEWA 3MV01 5IFTA 3WF0A 2J1TA 2VZTA 1CZSA 2VCAA 1JZ4A 4RYDA 1DLCA 4MGQA 4BK4A 3OGRA 4QAWA 3OEBA 3IIIA 1O8SA 3GM8A 2ID4A 4QX0A 2W1SA 1WKYA 4UI9L 2QQMA 2Y6GA 4MO3M 2WUHA 3T2PA 2VZ3A 2V4VA 2CDOA 2E32A 2X09A 2VMDA 3WF3A 2LW8A 3MV11 3T0AA 2ZEZA 3OGSA 4MGSA 2BBAA 5IJRA 3K4AA 3NJXA 5DMYA 1BHGA 3FN9A 2VM9A 3NJVA 1W99A 3I97A 1XNTA 4DEVA 1UY4A 1KGYA 3I2FA 4DXSA 5C7GA 3K4ZA 2B4KA 4W8JA 1K12A 2BERA 3MBWA 4AG4A 3I2GA 4CUAA 1JYNA 5CZKA 2E31A 3C7EA 1PMHX 4OZOA 1IQDC 3MUY1 1J83A 3LE0A 3W5MA 3VD3A 3WNOA 5I0DA 5LA0A 4M4RA 4XZUG 5C70A 5DN2A 4CU9A 3A21A 4CU7A 4LKSA 4LHSA 1UYZA 2VMEA 3I3EA 5IYYA 3T0BA 3CIHA 4ZXEA 4XUTA 4ZZ5A 4MADA 1GUIA 4JKKA 2WAOA 4RN5A 1JU3A 2JE8A 2L9LA 3WF1A 4IUGA 4Z2AA 2VMFA 3VDBA 3EB7A 3I3DA 1UMHA 2WYSA 4W4ZA 4QX1A 1NAEA 2XQXA 2HYXA 4ZY9A 2WABA 3OBAA 3IDAA 3ECQA 1I5PA 2VCBA 2VC9A 2WDBA 4ARXA 4OYUA 5FUIA 3VD5A 5HXMA 3WNPA 1L7QA 1UXZA 3IB3A 2QQOA 2W1QA 3LEKA 3T2QA 3WNLA 1JZ7A 4P5YA 2RVAA 2Z4FA 3ACHA 1K42A 4TTGA 3DECA 2QQJA 1UYXA 2DDUA 2WAAA 4QX3A 4XUQA 2VL4A 4XURA 4W50A 4BDVB 1GU3A 1UY1A 3JXSA 2WZ8A 3OEAA 2X10A 4KWUA 3AC0A 3HJRA 1UXXX 3IAPA 2JD9A 4AAXA 5G05L 2J1AA 1CZTA 1DYOA 1OF4A 1LNSA 4MOAA 2J22A 3CMGA 2ZEYA 3CQOA 1UY2A 5EIYB 3HN3A 1EUUA 4DUWA 4QDSA 2PQSA 1PX4A 1OH4A 4A4AA 2W92A 3C8XA 3UESA 4P08A 2J1SA 4E8DA 3HNYM 3SEEA 2Y6LA 3J7HA 2W9XA 1GOGA 2W1WA 5HPOA 2ORXA 3I2KA 2C4XA 2VTFA 4PF1A 4YPJA 3OG2A 5DPNA 2YG0A 4A3ZA 2DCJA 2XHNA 3F2ZA 4JKLA 3NQHA 5JXIA 4DUXA 4QX2A 2YC4A 2QQIA 3PUHA 1JI6A 2QQLA 5B4NA 4OMCA 4P02B 2Y8KA 4CU6A 5JXJA 5B4XA 4XUNA 3FL7A 2C9KA 2J1UA 3ACFA 5IFPA 1GMMA 2EIDA 3VD7A 5F7UA 5LCWL 2J1EA 4QB1A 2W1UA 1CZVA 3K4DA 4XVHA 4A44A 2YC2A 4DUVA 3BN6A 1T2XA 2XOMA 1ULOA 4KI5M 2Y6HA 1XC6A 1OF3A 1JZ8A 3LQCA 5EJ1B 1GOHA 2VJXA 2C26A 2WQ8A 4OUEA 3HOBA 4ARYA 3UNPA 3C7FA 1F4HA 2ZEXA 5JXHA 4BJ0A 4CUCA 3LPGA 2QQNA 4OMDA 3C7OA 3T09A 2WO1A 2W95A 3DYOA 3IAQA 4JKMA 3DYMA 2E26A 4P00B 3HPNA 4A41A 3LPFA 2EIBA 4UOJA 1J84A 2Y6KA 4DXTA 3WEZA 2W94A 4JX0A 1UMIA 2YFZA 1D7PM 3T0DA 3ACGA 2DCKA 1KEXA 1MPXA 1SHWB 2VO5A 3LEGA 4ET7A 2J1RA 2Y64A 3CKHA 4QDQA 1JHJA 1EUTA 2VCCA 3K77A 3P6BA 3WQBA 3VDAA 2R7EB 3ACIA 2VZRA 1PMJX 3CZJA 4CUBA 2VR4A 2ORZA 1UWWA 3SKVA 3VDCA 3VD4A 2RJ2A 1P8JA 4QB6A 2RV9A 3MUZ1 3UETA 2VQTA 1OT5A 2JKXA 3WSOA 4M4PA 1UX7A 1XPWA 3THCA 2VZUA 3A7QA 1XNAA 2WN2A 1JYWA 2VZQA 5JXGA 4CVUA 1GNYA 3GDBA 2B9VA 3C7HA 4QPWA 4XUOA 1JZ6A 1W0NA 2VOTA 1F4AA 3K46A 4FI9A 1UYYA 2J7MA 3W5NA 3PUIA 1K45A 3THDA 1UY3A 4CU8A 3GGLA 4XUPA 4KMQA 2W47A 5DQ0A 1ULPA 3WNKA 2W87A 2ZXQA 3ZM8A 4GWJA 3U37A 5A1AA 5JUVA 4PT6A 4D0QA 2CDPA 4HG6B 1NKGA 1JU4A 3I2IA 3NNGA 5CYYA 3BGAA 2VZPA 3K75B 2E33A 2J1VA 2W5FA 1WCQA 1W9WA 2EIEA 3ETPA 1JYXA 1YQ2A 2WN3A 2WO3A 1TVGA 2WZEA 1JZ5A 5C71A 4UAPA 3CDZB 2W91A 2VZSA 4TXWA 1JZ2A 2WO2A 1OD3A 2V72A 1DP0A 1L7RA 3D3AA 3E1F1 5IHRA 1O59A 3OB8A 3I3BA 4DEQA 3HNBM 1US2A 5EJZB 2VQUA 1UY0A 3T2OA 3C7GA 3OGVA 3WNMA 3EYPA 3P1IA 4QB2A 1CX1A 3LEIA 5G04L 2HLEA 3FHQA 2KD7A 3WNNA 4QDRA 4LPLA 1JZ3A
chains in the Genus database with same CATH superfamily
5FYTA 2VZVA 2FMYA 3OGJA 5GLTA 4RA0A 4D7YA 1KD7A 3UL2A 4XMAA 4META 4FFIA 1D2QA 2QQPA 4BXSV 1W9TA 3SKJE 5F1RA 5FPUA 2CGOA 1NUKA 2XJTA 2XMLA 1PX3A 2XLGA 4C91A 3HBKA 1RUG3 4D6SA 3PTYA 1LR5A 4M3CE 1D4M1 3SLIA 3WUDA 1LHWA 1QGLA 1QOOA 1G6NA 4L2NA 3KV6A 4QXHA 3E97A 5CKMA 3APBA 3LDBA 4LBKA 4R9DA 1NCQA 1O3QA 5E88A 1UU6A 2D5HA 2OXBA 3CJIC 1RUC2 4BU2A 1OA3A 3WCSA 1FATA 2GN3A 1AR92 4CXXA 5D8AA 3N9QA 2XONA 4LQRA 3AFKA 4NAMA 1K3IA 1W39A 3INAA 4HKLA 5FLHA 2OQ7A 3UJQA 5BNOA 2GNDA 4CEWB 4D8MA 1Q8OA 4JZRA 3T08A 2YV8A 1MR5A 4RS5B 3I59B 1LTEA 2VU9A 1HN1A 3UYJA 4GWIA 5FP4A 1QJX3 2K9ZA 5FY1A 2R30A 3HEIA 1N47A 1OBNA 3WINE 1RUI1 3QBQA 4FXGB 2BYVE 3SXWA 1QJU2 1Z78A 2W46A 2N7GA 4KU8A 5LA1A 4GMP1 5JR2A 5T55A 2IWGB 1WLTA 1G86A 2Y6JA 1FXZA 3IKWA 2B8MA 4O7XA 4P9JA 5BY5A 2X5IA 1CAWB 2HEVF 5I0TA 5IK8A 3AJZA 3N36A 3VD9A 1W2AX 2IXIA 3OOXA 3CZUA 4EZHA 3BVCA 3FUQA 5A3TA 1E5IA 2ZGLA 1I5ZA 1WGPA 2RE9A 3N9NA 4QPGB 5I0SA 2R041 1SACA 2BRTA 1QJU1 4YFWA 1AR81 2BOIA 5E1RA 1F5JA 4RGKA 4RYDA 5TSWA 2DCYA 3C2UA 2ZHKA 4QQ2A 2HWB3 4CP2A 3OGRA 1HJGA 3D4KA 3M1HA 4WVWA 1VALA 1F31A 2FCTA 1O8SA 3IIIA 3CEWA 3M3CA 4GH4B 1NYWA 5IWFA 1WKYA 3DGTA 2DVBA 1EYBA 3WW1A 1CAVA 1PZ7A 4LKFA 4BQ5A 5LBEA 3UK9A 2AACA 1HV1A 1AXZA 1JHNA 2GNBA 2VZ3A 2V4VA 2GC0A 5CNAA 2CDOA 2DWRA 5FMOL 3SQOA 1COV2 1MQTB 1LOGA 2BJSA 4QKBA 1AR71 5FZOA 4Z2WA 2LW8A 3MIDA 2VOXA 3MV11 4IE5A 4JGYB 1AZDA 1E5RA 4MGSA 1NZIA 3AXDA 2JG9C 2VE1A 5F9TA 4OUSA 3V0AB 4AHXA 2RDRA 4EYUA 4CP0A 3FFQA 4ATFA 3NJXA 4YRDA 1UKGA 2ZX0A 1WD3A 4N7IA 3IDBB 3WZ1A 2WSUA 3NJVA 5K7PA 1V0AA 3AKRA 4EN7B 4GQ7A 2E51A 4PHZA 2BWCA 4JTNA 3W21A 3U78A 2R16A 3OPZA 2Y0OA 4FO9A 4F83A 2C6SA 3K4ZA 2D6OX 4GB32 3VBFA 1V6MA 4W8JA 3M3OA 2BERA 3OJBA 4AG4A 2VBBA 1DDLA 3I2GA 4KU7A 1VRBA 4KWLA 1RITA 5AC91 1H8VA 1FPN3 1H9PA 1OUXA 3L2HA 1KXGA 3C7EA 4K20A 4OZOA 1IQDC 4RQPB 3VUOA 2Q8EA 1MS0A 2F17A 4HSLA 5HBAA 2BGCA 1DF0A 5FDBA 3RZLA 1HRV2 1J83A 1W90A 2JECA 1XB9A 2W52A 2ZX3A 2ZZQA 3ZPOA 3LB9A 3ZYRA 1RUE1 5FFOC 1H2NA 4NHKA 1V9U3 3VD3A 1VBD3 2C9AA 5I0DA 1ND3B 4YW6A 1QQP3 3RPQA 4BOWA 2JG8A 4R4XA 4UT5A 5JAXA 1SLCA 2XG3A 2JDYA 1PGL1 5A7PA 1QJU3 3QH6A 1AL0G 2P5BA 4I3GA 3UKVA 3H1WA 4CP1A 4YW7A 4H7MA 1EPWA 3GBFA 2OPWA 4P5HA 3L2YA 3E5UA 3ME2A 2JWPA 4Q4Y1 3T0BA 1B35A 3VKNA 4CPBD 3KT7A 2GC1A 1V70A 4NWWA 3ELNA 2OUJA 4MLOA 3B9CA 5JOWA 3BU0A 4FCAA 4XEZA 1GQGA 1O4ZA 2JG8B 4LBQA 1NQDA 4UYBA 1C3HA 4YZ3A 2DUOA 2UWBA 2ZCWA 3OTFA 4RR3B 3MIHA 4IUGA 1U5YA 2G9FA 4MXVA 3WHTA 4AHZA 2CU5A 2VMFA 1K5JA 2GC2A 4CDWA 4AZZA 2JICA 4BQ3A 3I3DA 5LK7B 5M0TA 1Y9MA 1PVC1 2ZGKA 4ZY9A 4AEDA 3AMQA 4Y33A 1IZ3A 3OBAA 3J8F3 1SLAA 4NJ4A 4LITA 2PQQA 4RR3A 3HWJA 2EXIA 1ULFA 1VJ2A 3VD5A 1W05A 3AB0A 1ALYA 1D4M3 3J8F1 1CAVB 5DZFA 5FXWA 2QVSB 2JEMA 4LUMA 4XF0A 5FPLA 5FMCA 1W6QB 3LEKA 4GALA 1AL22 1UZVA 5JZGB 1JZ7A 4P5YA 2VD7A 1OQDA 2Z4FA 4E27A 4PIXA 1ASJ1 3ILFA 2W0XA 4UW6A 2DFBA 4WVMA 1CR7A 4TTGA 1A34A 2MEV1 4YW2A 1K42A 2QQJA 2H6BA 2OX0A 2WAAA 3MPPG 3POGA 4QX3A 5A7QA 2VL4A 4XURA 3T2TA 3UKNA 2DUQA 2BU9A 4QPIC 4FPLA 1PGL2 1QDOA 3S30A 1OQ1A 2BV4A 2X8KA 1ND3A 1VLNA 3OD0A 1HV0A 2X10A 2VXJA 3AM2A 4NHMA 4B7KA 4U36A 3AC0A 2WLPA 1FOD1 1HXS2 2C0ZA 4QGLA 5G05L 2I2SA 1OF4A 1MQTA 2A75A 1LNSA 2P3IA 1O4TA 1LHOA 1S0FA 1CJPA 2J22A 2R061 2ZEYA 4IV1B 4COUA 3OUJA 2NQYA 4V1PA 4DY3A 2CHHA 4R9AA 5FP9A 2W39A 3BPSA 5FUNA 1RUE3 2PQSA 3M4FA 3NNLA 3TAYA 1S2EA 1C8NA 1J58A 1OH4A 4CEWA 3J9SA 2W92A 4PLOA 4WM7A 5CA6A 1PM7A 3C8XA 4DS0A 3UESA 1EV12 1NA1C 2Y6LA 1U5ZA 2WNUC 3VBSA 4O61A 1ND3C 4CCEA 1OD5A 5ACA2 2VTFA 4MHRA 1HRI3 3C3VA 1I3HA 5HV4A 5GZGA 2VUAA 5DDJ1 4A3ZA 2WT1A 5AC92 3PUSA 1QH7A 1W2UA 4JKLA 1AF9A 5HCFA 3V56A 3ZSKA 2RS11 1E5HA 4WVZA 4XXAA 4Y26A 5JSRA 5JZGC 2QQIA 4S2DA 3ASIA 3B9IA 2HKXA 3LF7A 4YM1A 2BDRA 4OMCA 1S0BA 4CU6A 1UD1A 1HB2A 5B4XA 3FL7A 4GH4A 4R4ZA 1AR62 4AAXA 2VW2A 3ACFA 4HN1A 1RMU3 2OA2A 3WDXA 3K3NA 5LK5A 3VD7A 5D8AB 5F7UA 3EBRA 1X33A 3MLLA 2HWD3 4L8QA 1CZVA 2P1BA 4XIKA 3UGHA 4A44A 2WZPP 2R062 1K5MC 3H1MA 2YC2A 1QXPA 2BEOA 3D8CA 3EXUA 3NSTA 3NV4A 1YYNA 5ERLA 2GMMA 2ZGNA 3JUUA 3N7LA 3BTZA 1H8TC 1NE4A 2GMEA 5C5UA 5FKBA 1V6LA 4OI2A 5CKQA 2XOMA 4I0BA 2HWF3 1FPN2 2OPKA 2X53S 3GZEA 1YJKA 4K3UA 4XIOA 3FLPA 4KI5M 5GZEA 2YBSA 3BYWA 2IVJA 1XC6A 3QH7A 4I01A 4IV3A 5DUVA 4QXBA 1OLRA 4MSVA 5EJ1B 2JIGA 4OUEA 2YUEA 3JB8A 3QOPA 1PGW1 1S0CA 3C7FA 4NVPA 2JDNA 1VE0A 1Q43A 5CAZA 1W6PA 1F4HA 3HQUA 2JDUA 4XYXA 5A6YA 2ARCA 2BWAA 2R1DA 4BJ0A 4HLTA 4WZCA 4BQXA 2AEZA 3CJIB 4PI2A 4FPGA 2WZR1 4SLIA 3MW3A 4BZ4A 2QQNA 3DXTA 3C7OA 1WMDA 3D82A 2W95A 3DYOA 4Z92B 1YFXA 3GHMA 5FPZA 2CWMA 3RYRA 4XQ4A 4PIYA 1ZZ7A 3CU7A 4YZ1A 5H9QA 4M0HA 1ULGA 1LAJA 4Q0PA 1SPPA 5FPAA 3TYJA 1RUG1 3HPNA 4A41A 2ZKNA 1C4RA 4ZHNA 4FPCA 4P14A 3OD4A 1J84A 2Y6KA 4Y1VA 1W9YA 1REEA 4CCOA 3HN1A 3U07A 4P9WA 3I54A 1HIXA 4LA2A 3FUOA 1O6UA 1KEXA 4D3WA 1MPXA 2WWSA 2JKBA 2VO5A 4IEQA 5CADA 1SCRA 3ZXDA 1AR91 2PELA 5JI7A 4ASKA 4QDRA 3BALA 5FZ4A 1NCQC 3RGBA 4ET7A 2XR4A 2J1RA 2RDNA 5FP7A 3ZYPA 1REFA 4Q0UA 4ISQA 1AR93 4LOSA 5ANQA 4QDQA 4Y20B 1JHJA 4COWA 1BJQA 2AENA 1HDKA 1Q5OA 3B7MA 4CXYA 4NUBA 1VRH2 1VAVA 4M3CB 3WQBA 4Z8BA 2R7EB 1DGWX 3VHPA 1JODA 4OULA 5FYHA 4YVSA 2VR4A 5L19A 5AVPA 2ORZA 2GAUA 1H4HA 2Q30A 4Y5SA 1CAWA 3VD4A 2B46X 1P8JA 3E6DA 1RUE2 3ETQA 3MUZ1 3ZOIA 4HPKB 4TSVA 5A3MA 1OUSA 5LRSA 5T3NA 4D7SA 4M4PA 1DGWA 1UX7A 3LGRA 3BIWE 3THCA 3ZN6B 1O4YA 3A7QA 1CWPA 2H0VA 1VBA2 2VECA 2ZGTA 5KHJA 1BBT3 1XNAA 1JYWA 2WINB 1ST8A 1OPOA 1OSGA 1DZQA 1QEXA 2A6VA 5A3LA 5FXVA 2ZABA 1POV1 1RXFA 5FYIA 2B9UA 3KQ4B 1S0GA 2ZJCA 3AJYA 1W0OA 4AQSA 2NMOA 4XUOA 1H1AA 1JZ6A 1VMHA 5J96B 5I93A 4XTMA 4B4PA 2J7MA 1NA1B 3AMHA 4S2FA 5IVYA 2VY0A 1SLTA 1UX6A 2QQUA 5CBLA 1RJ7A 1GZCA 3OUHA 3THDA 3W5NA 4UFJA 2FD8A 4Y3OA 1SLBA 1JYCA 4BH9A 3ZXJA 4KMQA 3ZXFA 3ZR5A 1RHI2 1XNKA 4H2AA 1APNA 3ZFEC 1ULPA 4WVVA 2DBNA 2P3YA 5D2AA 2W87A 5FZ6A 3KB5A 4EN8B 3ZMNA 1NY72 2SBAA 2RS32 1LB2A 1QXRA 4ORFA 2WWUA 2XJRA 4MYEA 5JUVA 4WM8A 4QU2A 2CL2A 5DABA 2NN8A 2FDGA 3VGIA 3HQRA 4PCRA 3SHRA 2FDIA 1JU4A 2Q4SA 3I2IA 3OY8A 3OYWB 2R071 4Y4YA 3ROUA 4XJZA 3ITQA 1QJY2 1UU4A 2D43A 2D6NA 1X50A 2VXRA 3A0KA 4JRAA 5LB6A 2Q5TA 1HJFA 3IMMA 2RS31 2YGMA 2YYOA 4NN0A 1AR82 4NIHA 2D3SA 3BUCA 3UJOA 1V6IA 2O8OA 5I8SA 3P3NA 5A6ZA 2RDSA 1YQ2A 1TVGA 1OOPC 1LGCA 3ZFFB 5JR7B 1QKQA 5C8CA 1PO22 5D1IA 3WP3A 2VZSA 2TNFA 4AI9A 1RUJ1 1DP0A 3PMSA 4HETA 1RUC1 2DCZA 3E1F1 5FKCA 5FPVA 1O59A 3OB8A 1POV3 4DEQA 2AREA 2FCUA 1UY0A 3VB9A 3DPRC 2NYYA 3C7GA 1W3VA 3Q9OA 3ZIXA 3WOGA 1FNYA 2WQZC 4RD7A 3WNMA 4JRLA 4QB2A 4SBVA 1VRH3 4WV8A 1NCRC 5G04L 3FHQA 2WFF1 5ACA1 3TEYA 3HT2A 4UFKA 4Y1XA 1STMA 2JXAA 1VRH1 4BQ4A 1RUF2 4FOQA 3ZSEA 4EWDA 5FQ0A 2VZ1A 1W04A 3CF6E 4YGBA 4KWJA 4BQ2A 2ADEA 3B02A 1VAMA 4QM9A 2ZX2A 1CD3G 1EV11 2ZGSA 1UW8A 3BU7A 4XW3A 4YWAA 4B4QA 4TN7A 2B42B 1XE8A 1XSRA 4NWVA 3VZJA 4AFCA 1ZBE3 2VVEA 2JDPA 3VBHC 2YFUA 1W8NA 4NPLA 2ZA9A 2EIGA 5KXEA 2EXKA 3N7MA 4Q4Y3 2IZWA 3PLQA 2GDFA 2QQWA 3MDPA 3EJKA 2ZPXA 5L9RA 1Q8SA 4LUKA 3ON7A 4BXFA 2EICA 5FY5A 1W6NB 2A3XA 3I2HA 3QCWA 2LS6A 1Q3EA 4AQTA 1MEC2 1PVXA 1PM4A 1RVF2 1TMF1 1GP4A 5CFCA 1IS3A 5L73A 2BZDA 5DUXA 1NX9A 1PO21 1G7YA 1UYPA 4FPHA 3ZVXA 4Q1RA 4QM8A 2VUCA 2DF7A 5C9AB 2LM3A 5FZDA 3NWKA 1COV3 1VBB3 2UU8A 2WZR2 4IE4A 5FY4A 4BK5A 2RS33 5JIUA 2WBKA 4AR2A 3ZN6A 3HAGA 1L3JA 3IN9A 3WW2A 1XNCA 3M8LA 4FTBA 4A6OA 2C5DA 3Q8BA 2BGPA 4P9YA 4BQ1A 3ZFEB 5HXVA 1W8UA 3NMBA 3J7MA 4MGIE 2ES3A 1GBGA 3SCGA 4CA9A 1R64A 3SEPA 1W8OA 5FYYA 2OQ6A 3ST7A 4NIIA 1WLWA 4LE3A 5FAXA 2WNOA 2NPIA 2ZMKA 5JMOA 2GNTA 1H6XA 1PZ8A 4OZXA 3TB0A 2HWC1 3KT4A 1GSLA 2A71A 1A3KA 2IVIB 3QLQA 1O3SA 1RUF3 4BQWA 4J1XA 1AYN1 3MFAA 1EY2A 4NR1A 5LBBA 3GYDA 4KL1A 5IFTA 1CZSA 4RFRB 3H9AA 1XXNA 4LKDA 3TWIA 4Y20A 2ATFA 1IKQA 3AYCA 4LIUA 4WVMB 1G9BA 5A7OA 2V4AA 3AYEA 2OS2A 1VBE3 1GYKA 4JGZB 3GM8A 4CP9A 1XYPA 5FZ1A 3O1OA 3WUCA 1NOVA 4LIVA 5IAXA 1LKNA 1ODMA 2XJSA 4OCTA 4WM7C 3T2PA 1W2TA 4XF9A 3O0XA 4QQLA 1C8M1 3FBYA 4LHLA 4LO5B 2C1FA 1I6XA 4DB5A 2ZKLA 2VULA 1ZX5A 3JBG1 5FV3A 3DEMA 4D94A 2UY8A 3U0ZA 2YGLA 4QT6A 5IVBA 3N9LA 5FLJA 1WLDA 5C3SA 2D6MA 4Y1UA 3MPBA 1S0EA 4RHV1 3TN93 1T6GC 4QPGC 1RJ8A 2VQ0A 1QJY3 4XC9A 3NNJA 5DG2A 4XZPA 1XNTA 3PHMA 5J98B 3RMYA 1X82A 3V65A 1RUI3 2XB6C 4DXSA 5C7GA 5IVEA 2XH6A 2VOKA 4C0HA 3I2DA 3PIJA 3BB6A 4XJUA 3ZLIA 1NLRA 4HOOA 3NV1A 3ACLA 3H3UA 3PU8A 4WBBA 5A7WB 4HMZA 3NKTA 2DYCA 4BM8A 1PIV3 1M4WA 5FBZA 3ZN4A 3OCPA 2YDEA 2P3JA 3FX3A 4LO8A 3P5BA 4QWNA 3RJ2X 2JDMA 4IW3A 2LRPA 1R083 3ZXGA 4CDWB 2NLRA 3E5QA 3KGLA 3RVHA 3WNOA 1XQNA 4YG3A 3R05A 2W2IA 2VPVA 5A33B 5LA0A 4AK3A 4XZUG 3VZLA 3O7OA 2ZGRA 2Z69A 1AYN3 1WBLA 3LFMA 5DN2A 3SC7X 1YFWA 4JGYC 5FJKA 5KHHA 2D6PA 1S0JA 3A21A 1REDA 3GZTB 2RR11 4MH0E 3GJBA 3S0MA 1RXGA 3POWA 5D21A 1YXWA 3I3EA 1Z0HA 1SBFA 5BNPB 1U5XA 4IV1A 3O1SA 2PHFA 5FP8A 2AC1A 5K4LA 3ZN5A 1HW5A 3CIHA 4CEYC 4ZZ5A 3CL1A 3L9JT 4FQ4A 4JKKA 4W65A 4QX5A 5BNPC 3POSA 1JU3A 5GLUA 3B93A 3GBGA 4YGDA 2L9LA 3E6CC 5LASA 3ZFGB 5J3UA 2CTVA 5FYMA 3B3QE 2ZHLA 1EAH3 1BEV1 2JG9A 3VKLA 1RUH1 1DQ0A 3VDBA 1W06A 1MVEA 1VBC1 4OQ8A 1QQP2 5FY7A 2P2KA 1RMU1 1UMHA 5GZFA 2WYSA 2OZJA 2XQXA 4A3XA 2HWD2 1AYM3 5KHIA 4DRRA 3WP5A 1POQA 3DF0A 3IDAA 3QD6A 4CCMA 4B1LA 1I5PA 4HXCA 2WDBA 1YC61 4Q26A 3KMHA 1QJY1 4O9GA 1HLCA 4AI8A 1Y7BA 2HYKA 3DV8A 1FPN1 3PVOA 4IV1C 4N43A 5FYZA 1QXJA 4XJWA 4HZFA 1HQWA 1OURA 1WCDJ 3JQWA 1LOEA 4XQWA 1J59A 1RUNA 5FZEA 3MFCA 4XETA 4UBHA 5JMCA 2HWD1 2RVAA 4QKDA 3U14A 2WS93 3ACHA 1T6BX 2ZZJA 4Y5Z0 3ZSJA 2DBIA 1O5LA 4WM8C 1DHKB 5JCTA 5KXBA 1N3PA 4O9EA 1J3PA 1RUD2 1DZTA 1CAXA 1MS4A 3WDUA 4Q4V1 3T4VA 1QU0A 1RL3A 4UF0A 5JSOA 3OEAA 1CPMA 4MGZE 3H8RA 4GIQA 2BPA2 2JG8C 2VQAA 4IL7A 1R1A3 2YZ4A 3ZSLA 5EHDA 1WA4A 1UXXX 2ZGUA 2P4EA 2AYHA 2JD9A 1MEC1 5E8AA 3VBRC 5F37A 1F35A 1WWYA 3LKJA 4EZ4A 4E4DX 2BFUL 1MZ6A 1DYOA 5IK4A 1DZRA 4MOAA 3AKTA 3CMGA 4LEJA 2X29A 5BYNA 3AZYA 4BE3A 1KJRA 5DDJ2 1IPKA 5T5JA 4AI0A 2PHDA 4Q2FA 4H7LA 2VW0A 3HN3A 5FZ9A 1UMZA 4YLZA 4L9BA 4QDSA 2R49A 4YVWB 2G9GA 4A4AA 1HXS3 1N3OA 3RYKA 5J09A 1SQ4A 4W6YA 4P08A 2J1SA 5EPAA 5ACA3 1NXD1 4RHV3 1VAKA 3CO2A 1YI9A 5EXOA 3TN91 4E8DA 4IGPA 4PLNA 5FQ0B 1RTVA 2W9XA 3WXPA 1NG0A 3NAPB 5KXDA 2A73B 1YNAA 5SV8A 3ZYJB 3D0JA 4J25A 1CX4A 1UPIA 2C4XA 1MACA 2X5IB 3I2KA 4AEDC 2ZAAA 3OG2A 3R0RA 5APAA 1Q56A 4I02A 4XF1A 1SFPA 3O1MA 1CN1A 1AL23 3WDTA 1W8TA 3RMXA 2E9QA 4DUXA 3HBZA 1ENSA 3AVSA 3ZIWA 1SDWA 5K0UA 2PA7A 2NP0A 1JI6A 1WW7A 2AGSA 2QQLA 5E6HA 3MIGA 4P02B 3VV1A 4F7ZA 5B4NA 1V6OA 3H8UA 4DQAA 5JXJA 4BCUA 4ES8A 4FAGA 3POBA 3RI9A 3O1RA 4C8DA 1GMMA 4Z1VA 2PFWA 3MW2A 5LCWL 4QB1A 1QWRA 2W1UA 3WDYA 5FXZA 5GKAC 3WCRA 4LO7A 4LBOA 1C5HA 2B39A 1V6KA 4QPIA 5FLIA 3WG1A 4KWKA 1K5MA 4K7JA 3GHNA 4Q5OA 1RUC3 2CAUA 3JU9A 5A6XA 5FZOB 1YQCA 1H0BA 3BN6A 5F2SA 1XRUA 3I8TA 1H8TA 4AI2A 1T2XA 1W2NA 3OY8B 3OYWA 4BMBA 5JPMB 5T5OA 2CSGA 3MF6A 1YFUA 4B29A 3OF1A 4BYYA 2VCMA 1ZA4A 4Z07A 5A7NA 1JZ8A 1RHI3 2Q1MA 4PJYA 1J3QA 4IESA 2JENA 4X8PA 5FP3A 2ZHMA 2GMPA 4GWNA 4FP2A 3GCXA 3KZ4C 1MS8A 1W8HA 2ZEXA 3MZHA 1KS4A 1QQP1 2NM1A 3JZVA 4A6SA 5KHGA 4N53A 4KGQA 1RUOA 2IC1A 1PK6B 4RS5C 4Q8KA 3MGUA 3LPGA 5F6KA 1AYM1 1F8VA 3TRSB 5ANNA 3T09A 2WNUA 2GU9A 1PNFA 2WO1A 2WSVA 3J8F2 4RSUA 5JOZA 5LW9A 3IAQA 4OHWA 4Q4W3 4XF4A 5I0UA 5LY1A 3DYMA 2QZ3A 3SH3A 5D8AC 1RVF1 1TMF2 2CAVA 2PAEA 1VBA3 1VIWB 4NRQA 3ZSMA 1WW4A 1PHMA 3Q8FA 5IAVA 3AL5A 4UOJA 1DGRA 2RDQA 2EVXA 4I0AA 4YM3A 1Q8QA 5FPBA 4TWTA 1ZYBA 3H1YA 1UNBA 3JBG3 3T0DA 4JQTA 4L97A 2Y34A 3ILRA 4IQPA 2RS13 2PLV1 1SHWB 2E53A 4W6XA 2K46A 2WRAA 4QXKA 5C9AA 4OHZA 5LWBA 2GZWA 1QJX1 3PURA 4I3PA 1W6OA 4J6GA 4JC1A 2ZMLA 3LEGA 3OBZA 2Y64A 1JS9A 2WA4A 1SFNA 2GH8A 3FBMA 1VBD2 1R1A1 1JW6A 3K77A 2TEPA 1WCSA 3ZDVA 1PIV1 3FLTA 1XE0A 4LBLA 3VDDB 2RMU1 4KG0A 3JQXA 3WDWA 1GZTA 1PO13 1OA2A 2VZRA 3M3IA 3TOJA 1R081 4AEKA 1W28A 1SMVA 3OUIA 4NRMA 1TME3 4YVSC 5F5CA 1HKDA 5AFEA 5F3EA 3JB4C 4R9CA 4I2OA 2OZ6A 1LOCA 1DCSA 1X9PA 5I0RA 3KHBA 1DBNA 2P3KA 2GN7A 2BNNA 4LHKA 3JCIA 1XU1A 3SCHA 1ZBE2 1OT5A 2SLIA 3WSOA 2V5YA 4XDOA 1DQ6A 3LA2A 5FXXA 4DZGA 3H50A 4BIOA 1XPWA 4QKFA 1YEWA 1N1SA 3T3YA 5HI0A 3P3PA 4B7EA 1TME2 1WCKA 3B94A 2WNEA 3LOBA 1W8FA 5FO7B 4Y4RA 3V0BA 2H0BA 2BVVA 2MEV2 3FE5A 4XHBA 4LLFA 1ASJ2 2BW8A 3GDBA 2B9VA 3ENRA 2EXHA 4R9BA 2NZ9A 3C7HA 1G9AA 4IEOA 4QPWA 2PN5A 5BNOC 5K9YA 5B2GB 1EAH1 1UYYA 4MUVA 3BTXA 3KGZA 4NPRA 3ZXLA 1OKOA 1K45A 1OMIA 3RYPA 1H30A 4CCCA 1BVVA 2D93A 2QUOA 5I8TA 2W47A 1G9CA 3KVBA 2WIIB 1KFXL 5DDJ3 3NJYA 3AYAA 2RM23 3SNMA 2UURA 2XVGA 4S2HA 4LK6A 1WMFA 3EHKA 4OQ9A 4HL0A 5GZDA 2X5IC 5A1AA 1IKPA 1RUH2 3GZAA 2DTYA 3OBTA 4PT6A 3RG0A 3WG3A 3ZKYA 4EJRA 1NKGA 5JSPA 1HRI2 5FCCA 1G9DA 4D6RA 2FZ2A 3MIFA 5CYYA 1UOGA 4OI1A 4BISA 3IBMA 4XJ8A 2VZPA 2HWE1 2WA3A 3JD71 1O3TA 3U4XA 1OQEA 2JE9A 5DG1A 1DIWA 3KCYA 1GANA 5C6CA 2J1VA 4UFIA 1UN1A 5T5PA 4UBGA 3V64A 5FPXA 4QHZA 1FV2A 1WCQA 4IV3C 4NOTA 3UT0A 4A7YA 4XHXA 1O7FA 2RR12 1JYXA 4B8EA 4Q4X2 2WN3A 4N43C 4AFBA 2WZEA 1JZ5A 2E63A 4GKXA 4DMIA 3J7NA 2P17A 2WWJA 3IWZA 3TNQA 2VAUA 2W91A 1W03A 5C4WC 4HANA 1TEIA 4RGAA 3D3AA 1HB4A 2TUNA 5IHRA 2EXJA 2VBPA 4ES9A 5J48A 5FYUA 3HNBM 3WT3A 3T4HB 4YM2A 2YY1A 3OGVA 2XUEA 1TE1B 3EYPA 5A3NA 4TZDA 2VNGA 1C8M3 4PF5A 5FZFA 3VBOB 2WJSA 2ZACA 3PJQA 1W8ZA 5HV0A 2D5FA 1PIV2 4CCJA 1PK6C 4YARA 3ILNA 3KCXA 1M06G 3ABZA 1W9SA 1VBC3 4AFMA 5FY9A 4D7TA 2WO7A 4N7UA 2BGOA 1W6OB 2D7FA 2IFRA 2YC0A 4HPKA 1FI2A 1XNDA 3GXUA 2PMWB 3BIEA 1Y4WA 4JHZA 1FX5A 5LA2A 4YVWA 1QJX2 4MGYE 3WF4A 2GP5A 2BOJA 3U1XA 5ABJC 5KC5A 1WW5A 1O8PA 4IEUA 2XL9A 4YFZA 2HEYF 1X8EA 1HB3A 1WZXA 5A32A 1WA6X 2KR2A 5JLVA 2W3JA 5J37A 3ORJA 1BMV2 4Y22A 4M0NA 3NJZA 2X05A 1JUHA 2QE3A 3KS7A 2JDKA 3A23A 3DXUA 1CGPA 5CIRA 4M3CA 4JDNA 1NLQA 4EQVA 3NNMA 4YGCA 3WLUA 3CLPA 4L0PA 1C8M2 4ZU5A 2CV6A 3LIHA 4LXLA 2JG9B 4AOCA 2R32A 2DVFA 4BLJA 4MXWB 5C33A 1JYIA 4HK8A 4ASLA 2JDAA 5BPXA 1CAUB 3ZYGA 5A6QA 1DU3D 1QHDA 3TEWA 4CCLA 2IFWA 4E2QA 3KM5A 1AUYA 2UY9A 5J1XA 4S2GA 4NIGA 4E8CA 5EZWA 1AR72 4RQPC 4YZ5A 2ENRA 3U4SA 1RUG2 1GQPA 2XKOA 1J3RA 4Q1PA 1IS4A 4AWDA 5BXXA 1F15A 4N43B 4PDWA 5FMBA 5FYBA 3WQ0A 5CFDB 4FPEA 1BXHA 3AK0A 1V9U1 2YPDA 2V5DA 1H1IA 1ULEA 3DPRA 3I2JA 3MI8A 4KH9A 4YG6A 4QU1A 3ZXEA 1DYKA 3DYPA 3Q8CA 1QDCA 4LBQD 5A33A 2G9ZA 3FFZA 3RRDA 1SFYA 4AGVA 4C90A 4ZZ8A 5A3PA 3H42B 2QQKA 2VMHA 3MV01 3AP9A 3G7DA 4W6WA 1H9WA 3PU3A 1ZVFA 4HKOA 3GNEA 1S2KA 4XFBA 2VCAA 2F4PA 1JZ4A 1DLCA 4L11A 4MGQA 2RG4A 3R4DB 4IEPA 2Y38A 4MVTA 5E89A 4BK4A 3RZJA 3ZX7A 4ARXA 2RM22 2IXCA 1L7LA 1UIJA 4QX0A 2PYTA 2ZGMA 2W1SA 4UI9L 1DLLA 5FZMA 3AFGA 1BZWA 3I3QA 1LRHA 1YJLA 4O65A 2WUHA 3GALA 1MS1A 2WFF3 4I09A 4OHXA 2X09A 3VBRB 2VMDA 4C0BA 1WMEA 4JV4A 3S57A 2EF6A 3T1MA 5LRRA 4XCAA 2VG9A 4XACA 1GV9A 3TBDA 2D3PA 2WS91 4XFAA 5IJRA 3K4AA 3VBOC 4AGRA 1GQHA 3FN9A 2RJLA 2VM9A 3GZUC 1EAH2 1OLQA 1W99A 2JJ6A 4HONA 4XFHA 5L36A 1N1YA 2XPJA 5T50A 4JHTA 4JVAA 1CAXB 1UY4A 3D6EA 4YZ2A 1KGYA 2XL7A 3DL3A 3I2FA 2B7YA 2E7QA 2D3RA 2B4KA 1R091 4AVAA 1X9TA 1MZFA 1OOPA 3WY6A 3T1LA 2FHRA 4CUAA 2G1MA 4XAEA 1JYNA 1GWLA 1C57A 1ND2B 5FZAA 2FZ1A 4FOVA 1EP0A 1PMHX 1O5UA 5FTTC 5L7OA 2R0FA 1V6JA 1GR3A 4AL9A 1KDKA 3RI8A 1GZWB 2P6HA 1AX2A 1VBD1 3AL6A 2YHJA 1ODNA 3MUY1 4JGZC 3PUQA 2ZHNA 3DCQA 4LBJA 4LE4A 3HD8B 4TYSA 3LE0A 2KXLA 4FT8A 4YW3A 4G3YC 3W5MA 3N9PA 1AR83 4NPMA 3WV6A 3ES1A 1OPMA 1QY4A 3OPWA 3OPTA 3N35A 2Q8OA 2DVAA 1FOD3 4IGOA 4LORA 4DPNA 4QHBA 1YI7A 5F5IA 1RUD3 3S7IA 4UF0B 3ZYIB 3VDDC 4AF9A 4MG2A 3O1PA 1R082 1EV13 2KM2A 3D5OA 3V0AA 2ILMA 3N9OA 1OHFA 4QGNA 4CU7A 4N8MA 4NAOA 4XE9A 4AAPA 3IDEA 4LHSA 1HX6A 4XOGA 1GKBA 2VMEA 1LULA 2OW4A 4EV0A 1KRIA 3HMYA 1POV0 4ZXEA 4DOUA 3AYDA 4Q8LA 1GUIA 4PBOA 4Q0SA 4GH4C 3BCWA 1IS5A 1A8DA 3PUAA 3NNFA 1ENRA 1NLSA 5BNPA 5I8YA 1CAUA 5FZIA 2I74A 2DU1A 3NL1A 5BUVA 5JOXA 2R6QA 2DVGA 3THPA 4Z2AA 1YIPA 5CFCB 2A3YA 1U0AA 1DG6A 2A1XA 1Z7S3 3EB7A 2I07B 4W4ZA 4QX1A 1NAEA 4FFFA 4HFSA 4QPGA 5F6LB 5SV5A 3AXEA 4AW7A 1IS6A 4AEMA 3RZKA 3UKTA 1JTZX 4GJYA 4IDZA 3UGFA 4CCDA 2VCBA 5FYVA 2K0GA 1IOAA 1BEV2 4NO4A 5DAQA 2BFUS 2WNVC 5FYSA 5A32B 3S7EA 5HXMA 2CGPA 3WNPA 4CDUA 4AVSA 1LOBA 1NZCA 1YRZA 1L7QA 1OOPB 3IB3A 1D0HA 1QJEA 3GCWA 4HN0A 1ULCA 1H2KA 4CDXC 2QKDA 4XABA 1FNZA 3A0NA 4LO6B 2R073 2QFEA 2BTVC 1U5IA 2YPJA 4ZU4A 3RZMA 3NO8A 4EROA 1D2SA 3ZR6A 4FTEA 5EYXA 1XYOA 4G4FA 2AZ5A 3AKQA 1VBC2 3POYA 1GP5A 3IM0A 4W50A 5GLWA 2VW1A 4LJHA 3KT1A 3FWEA 4EE2A 1GU3A 1NCRB 1UY1A 3JXSA 5T52A 3K2OA 2ZGOA 3VKFC 1YWKA 5FYCA 4C1XA 2ERFA 4M01A 2EAAA 4HK9A 1QNYA 4YNIA 5DUUA 1SLIA 4BWOA 3DPRB 4CSWA 2FDFA 3E6BA 4H3WA 4BB3A 2GP3A 1UL9A 3GJAA 3F95A 2AH2A 3W20A 2XHKA 3B69A 4YW4A 5IW0A 3VBRA 5FOJB 2R043 5KWRA 2Z5WA 2RR13 3FLRA 1H1MA 4YM0A 5F3CA 3WR0A 2XXZA 5L7OB 2BVBA 1UY2A 2JD4A 4NHLA 1FT9A 5F39A 1DGRN 1A6CA 3SCFA 3ZXAC 5EIYB 3O1VA 1EUUA 4DUWA 3I49A 1E57A 4BIFA 3MEPA 1PX4A 3AMNA 3KF3A 4GAZA 2Q1ZB 1QOTA 2Q1FA 1LESA 4P9GA 4QQPA 5EFUA 3BI3A 3N3HA 3WW4A 2ET7A 3HNYM 1N1TA 4BA6A 4XJ9A 4E4SA 1UF2C 4PLMA 4A7KA 3WDVA 4XQDA 1GOGA 2W1WA 1LGBA 1LODA 4YZ4A 2ORXA 4YPJA 3IMNA 4PF1A 4RHV2 1BK0A 1BMV1 2Y33A 4XFCA 5DPNA 5F3IA 3VKMA 3S5AA 4I30A 4AQ6A 3RWKX 2XHNA 3F2ZA 3T30A 2OT7A 5J36A 4CPBA 4JDOA 4QQOA 4NIAA 4ITCA 2PLV3 4XCBA 1MVQA 4IE7A 4QX2A 5A80A 2HEWF 4AVBA 1GP6A 5BNNA 1DQ1A 3I4IA 1LJ7A 5FZ3A 4KGGA 1IGOA 3PUHA 4B1MA 3HR9A 1BEV3 4QQHA 5K0UC 2Y8KA 1F5FA 2A5ZA 4XUNA 4AVTA 4DXZA 1JMUB 2C9KA 3GF6A 3G6JB 4YW1A 4Y1YA 1Y43B 4ZKTB 3KCCA 3M3QA 5FZ8A 5L9VA 2RM21 4CDQB 3USUA 2RS53 4CXWA 1WD4A 1ZNPA 2DCTA 3K4DA 4XVHA 5FK8A 1OC1A 1RUD1 2Y26A 5DAXA 5FZGA 1W6MB 3H0OA 3IIAA 1V6NA 2MEV3 1OXCA 4GMP3 1H2MA 1N3QA 1X8MA 4H55A 2OYZA 1WMXA 4Z82A 1FAYA 1LU1A 2J42A 5I91A 2FDKA 2PXJA 1RUJ2 1ZZ8A 4IEZA 4MHUA 1AR63 1ZZBA 3H8XA 2WQ4A 2UWCA 4E4HA 1U12A 5FY8A 1F2NA 4CCNA 4CEYB 4CDQC 2WL1A 5CFDA 3VZOA 4Y22B 1OF3A 5BNNC 1GLHA 1XJAA 2VNOA 3LSEA 1YQ5A 1GOHA 5T5LA 3CJXA 5J7MA 3RSJA 1LENA 1VBE1 4UW5A 1PNGA 3POIA 2XLAA 2HWE2 5JXHA 4FVVA 4XBNA 5IUQA 4FFGA 2D40A 2H6CA 3VZMA 2BUKA 4HVQA 2HH9A 1HRI1 1MEC3 4AVCA 4J1WA 3RJRA 4JKMA 3WP6A 5FY0A 2ZOEB 5LBFA 3W59A 2CNAA 2E26A 1NY71 4P00B 1PVC2 1Y9QA 3M2MA 5C3PA 2RS12 4YG0A 4UXAA 4PI0A 2EIBA 4XMIA 4GMP0 5CU1A 4YVWC 1AX1A 4DXTA 1UMIA 5LZ6A 3LDKA 4LR4A 1LHUA 5FMDA 1AR73 3WQ7A 5C8CB 4FTSA 4A7ZA 2DCKA 3VL9A 2WNVB 4ONUA 5A3OA 3SITA 1TMF3 2HBUA 2HWB2 1CQ9A 3NV3A 3U75A 1IG0A 4COVA 3K3OA 3CKHA 4U2AA 1HRV1 2LTNA 1EUTA 1LOFA 4RGGA 2WNUB 3P6BA 2DUPA 4LBMA 4NRPA 1PZ9A 1ASJ3 3VBOA 3VDAA 4HKWA 5F5QA 3CJIA 2A6WA 2PAMA 3CBNA 2ZTNA 2QTWB 2Y6FA 4F3JA 2WFF2 1X7NA 2D44A 1ONAA 3CZJA 3VHRA 4CUBA 1BBT2 1UWWA 4XBQA 1VMFA 4P9IA 1PO23 2LROA 1UAIA 3VDCA 3ES4A 1R092 2WR9A 1D4VB 4FP3A 2B45X 4QB6A 1RC6A 1ENQA 1XOYA 3D0SA 3IT8A 3PVBB 4QKNA 4AYUA 4FAHA 4MX3A 4DO0A 1OFNA 3K51A 2FMDA 5LATA 1DQ2A 1ZZ6A 2KA3A 4LKEA 4OFGA 4PIZA 5F5AA 1ZRRA 2PTMA 4AXOA 2GSYA 1LEDA 4Q4X1 2DV9A 4XF3A 4OI4A 1NXMA 1YFYA 3CNAA 3RZGA 2E7AA 2VZQA 5JXGA 1HQNA 1K5MB 2VH9A 2ETEA 5LY2A 3TEXA 2A7AA 1AXYA 1YQ6A 2EAKA 1DFQA 3K46A 4FI9A 1YCIA 4DFSA 3WG2A 5LEKA 5K8SA 5IK7A 1OH3A 1ND2C 1UIKA 1ENXA 1W6PB 3I2OA 1MS3A 1BYHA 1QOSA 3RFRA 1COV1 5JDBA 1S0DA 4JDMA 4Q29A 1GNZA 1FMD3 2VVDA 3W9AA 3ZM8A 2VUJA 3KLSA 5JVVA 1AL21 1ZRIA 2F4LA 1Q8VA 3FHIB 4NIDA 5CG8A 4Q4W1 2O14A 5FUPA 3VL8A 4HG6B 4X8NA 3AMMA 2YU1A 3M7AA 1NA1A 1ZZ9A 3NNGA 5E16A 2AUYA 1LGNA 1V9U2 3VBUA 2YBKA 4ZS2A 1Z7S2 3BGAA 1O3RA 5JWPA 1HQLA 1HRV3 3K75B 3LOIA 2IUWA 3RWNA 2A6YA 4GULA 3ZDSA 2VVFA 2XJUA 3WNXA 4IEWA 3V0BB 2G4IA 1B09A 5GJ6A 2CY6A 1RHI1 1VB4A 1W9WA 2EIEA 3H7YA 5IK5A 3AZVA 3BOPA 3ETPA 4LO4B 4AHWA 1R1ZA 3DKQA 1YQ8A 5F2WA 4LK7A 2BNMA 5C71A 4FSJA 1URXA 4CEYA 4YYOA 3CDZB 4CDXB 4NHXA 1JZ2A 4TXWA 1WLCA 1UO9A 2FDJA 2V72A 1H8TB 5GZCA 1CONA 2RMU3 3ALQA 2AR6A 2YBPA 4GB33 3T2OA 1PO12 1UQXA 2IXLA 1S55A 4YVSB 3P1IA 3NAPC 2RHPA 2DURA 1J1LA 2XUMA 1UZWA 4QPIB 2HWC3 3VDDA 1ZRDA 4IETA 1ULDA 3WNNA 3LWCA 1OVSA 2PHLA 1OVPA 1JZ3A 3VBSB 4GJZA 3CHXA 3ZFGC 4A45A 5LEJA 5IATA 4ZXKA 2QQVA 1S4CA 1SDDB 1PK6A 2OIIA 4HBNA 4L92A 2JB4A 1TNRA 3LEMA 1BK1A 2A3WA 4Q4X3 4AI1A 4KBZA 1XE7A 3EQEA 2HWB1 3FC0A 5A3UA 2YB7A 1JN2P 4COYA 3NW4A 4DRVA 5FJHA 2AEYA 3ZPYA 1GOFA 2TBVA 4ATEA 1MS5A 4IV3B 4A42A 2Z42A 4QXCA 1UZ0A 4GKYA 1CJDA 2VZOA 1NQJA 1FV3A 1SPPB 1W0PA 3FHAA 1SLLA 1KJLA 1KITA 1X36A 2P34A 2XDVA 3NAPA 4ASMB 5A70A 1W6MA 5C3RA 3NRUA 2PHUA 3PVEA 4BMEA 2LALA 1OLME 2CYFA 2VMCA 1CIYA 3O14A 1OI6A 4PQQA 4JCKA 1TG7A 2JE7A 3ZFGA 3VZKA 1HB1A 2XJVA 4LOTA 3O0VA 2XLFA 5FZ7A 2BP6A 1RINA 1W2OA 2WNVA 4KNCA 4UFMA 1JOBA 2JX9A 5EJ3A 3WD5A 2VOVA 1FMD2 4RR3C 5K0UB 2XGXA 1CIWA 3ATGA 3BKZA 1SCSA 1SG3A 4WZFA 4D69A 3KVAA 5HCHA 1PO11 3JBG2 5C3QA 2RS51 4CTEA 4XBLA 5EP9A 4R52A 4DINB 4K8FA 4E9KA 4DXRA 5ISLA 2K2SA 4AHYA 1KQRA 2ET1A 4FPOB 2W68A 1ZRCA 3WF2A 4LNVA 2YU2A 5AC93 1JYVA 3DKWA 5FZHA 3HIFA 2IXJA 2WLQA 3B01A 3KSCA 1US3A 1OKQA 4LLOA 2QBXA 3MO4A 5DAPA 4GZ9A 3HNMA 3U10A 4CCKA 1H6YA 1RGSA 2XJPA 1S0IA 1RYYA 2OKXA 5A1FA 5IVVA 4ZS3A 4OI0A 4YW5A 3H3LA 1BQPA 3A22A 1QJZA 4XTPA 2ZEWA 4XDQA 1XBFA 3WF0A 2J1TA 2UYBA 1E5SA 2E7TA 2VZTA 4GD4A 4K6BA 4Q0VA 5IVFA 5GLZA 1RMU2 1BKZA 1Y3TA 2EALA 1JOJA 2WFPA 2XVLA 3WX5A 1JYTA 5DUWA 1Z7S1 2DU0A 4QAWA 1C1FA 3OEBA 4WM7B 3ZKUA 1VB2A 2ID4A 5KC6A 4LHNA 5FZ0A 4UFHA 1SEFA 4AGGA 4CDUB 2QQMA 1NE6A 2Y6GA 1GFF2 2OVUA 3QACA 4RFT0 4MO3M 2DFCA 2QJVA 2Y60A 1XNBA 3IPVA 4Q0QA 1QMJA 2E32A 1RUI2 1UZYA 4N9HA 4B3NA 3WF3A 3T0AA 4FPYA 2ADDA 2ZEZA 3OGSA 3E5XA 3S5QA 3RNSA 4XFGA 1FMD1 2BBAA 1W8WA 2A6XA 4QX8A 3SISA 5DMYA 1UPSA 1BHGA 1KFUL 4AFDA 1CVNA 3H3ZA 5FIXA 3I97A 3VBFC 4DEVA 3M70A 4BPZA 1OLMA 4N53B 1G9FA 1VR3A 1UU5A 2LUWA 1K12A 1YIFA 3ZMOA 3MBWA 2C24A 2PAKA 3HVDA 4RQPA 2VTXJ 5CZKA 1R093 3VBHA 5JZGA 2E31A 4HVOA 1D4M2 4NMIA 3KV4A 1OFSA 4H14A 1DYPA 4MV2A 5L7OC 4XPVA 1MS9A 5FMOS 5IVCA 1CPNA 3LA3A 3VBFB 4FBFA 1D0GA 5FO8B 4N53C 5CVRA 3BTAA 5FOBB 4K21A 1QNWA 3J26N 2Z2SB 3MICA 1LOFC 4P9XA 3A4UA 3LFIA 1UOBA 4M4RA 1BBT1 4AI3A 1RUF1 1YUDA 3J4UH 5C70A 3KV5A 3AMPA 3HQXA 1KS5A 5EWSA 5C5TA 4CU9A 3OBRA 3N7KA 4YGEA 5FRAA 5A7WA 4LKSA 4CDQA 4JTOA 2ZS6B 4E4ZA 1NT0A 3B5LB 4LBQB 4L99A 2O0OA 1UYZA 2VNRA 4G9SB 2MPFA 3LCPA 1ZREA 2QCSB 3SH5A 2RJKA 2XQRA 5KXCA 2CWSA 2G19A 2OUHA 3MLJA 4GB31 1W6QA 5IYYA 2HWF1 1ZBA1 4XUTA 2VMIA 4MADA 3O1TA 4E2SA 5BNNB 1AX0A 2WAOA 5GM0A 1AVBA 4RN5A 4LBNA 4V2VA 4FFHA 4CEWC 2JE8A 2QNKA 2ARBA 4K9SA 2D98A 4MGTA 2D97A 3WF1A 4V2WA 1YHFA 5CG9A 3MW4A 1C28A 1NCRA 5FR3A 4AEDB 1BVP1 2I45A 4JAAA 5EV7A 1A78A 5DZEA 4NE9A 3ZYFA 3ZYHA 4QX7A 5AVAA 4HVRA 4D6QA 1VBB1 2O8QA 2HYXA 1GZWA 2Q8DA 2WABA 5DZGA 2UWAA 4XXPA 4XFFA 3BODA 3AP7A 2VC9A 3ECQA 4OYUA 5FUIA 5GALA 3RZZA 5JI9A 4A2UA 2EA7A 1PGSA 3GBWA 3R6SA 3FZ3A 1GWKA 1UXZA 2QQOA 1QJFA 2W1QA 1S1AA 5LA9A 1B35B 1OA4A 3T2QA 4FPKA 2MHFA 3WNLA 4K1YA 1TZOA 1ZBA2 4LT5A 4EWAA 5BV6A 5CISA 5DAWA 3DECA 1UYXA 2DDUA 3I59A 4IEYA 1JUIA 3R4SA 4QHOA 1I9RA 3Q8EA 3LDRA 4RS5A 4XUQA 3O1UA 1AYN2 1JOPA 2ZGPA 4BDVB 3KHCA 1GWMA 1SZBA 4AEJA 5CFCC 3AP6A 2HWC2 2WZ8A 2R0HA 3VBUC 1IG3A 5FO9B 4COZA 5FREA 5H9SA 3LAGA 2O1QA 1DGLA 4KWUA 3HJRA 3H7JA 1RIRA 1Q8PA 1TQ5A 1V00A 2DTWA 3IAPA 2ZGQA 1MQTC 1NCQB 2WC2A 4INDA 4Y1ZA 2J1AA 3WG4A 3TEZA 1CZTA 2RS52 1W9FA 2Q8CA 5JIAA 3VN4A 1UZZA 4C1WA 3POEA 2BQPA 3CQOA 4XJAA 3VZNA 1UOJA 1VBA1 3PVNA 2Y0IA 4NROA 2IXKA 1O91A 3S6PA 2JB8A 5C9AC 3VLBB 2ZX4A 4UW4A 4X6RB 3AP4A 4QMAA 5FK7A 3N9MA 2GNMA 3Q8AA 3USSA 5BNQA 1UCXA 4CRQA 2CGNA 2GC3A 3O5SA 3X29B 1ZRFA 1GICA 3SEEA 3VBSC 3H8OA 1C1LA 1ZM1A 3J7HA 4QPYA 3FJSA 1RVF3 4PBPA 1DQ5A 3AP5A 1DQ4A 4AVVA 4CE8A 1LOAA 4KG8A 5HPOA 3I7DA 3OGGA 4IGQA 3VHOA 2PHXA 4B4RA 2WS92 3WQ1A 2RMU2 2YG0A 2DCJA 4JGYA 3W58A 2HBTA 3VBHB 1ND2A 4N90A 5AFBA 3NQHA 1AJKA 1IPSA 4LMFA 5L9BA 5JXIA 2YXSA 2YC4A 5CB7A 2PHTA 4BQYA 2E6VA 2XWJB 4LULA 1Y9GA 4TLGA 4CDXA 3SH4A 1WUVA 4Q27A 3ZFEA 3PNAA 3AVRA 4CP9B 1LHNA 2XBO3 2J1UA 2JDZA 4JGZA 2PLV2 3URFA 2VNVA 3EMRA 4ISRA 3B00A 5GLVA 5C4WA 3MYXA 5CKNA 2EIDA 5IFPA 3TNPB 2BBVA 3IZOA 2ARAA 4Q4V2 2J1EA 2GH2A 4YSFA 2V09A 4IEVA 4PQ9A 4M00A 3U11A 2ZX1A 4E2GA 4Y24A 1W6NA 4CYDA 4GWMA 4DUVA 3WHUA 1PGW2 3KD4A 4Q4V3 1LCLA 2PHRA 3PL0A 2XKPA 3JD72 1TNFA 4M3CF 3BTYA 3VBUB 3IPVB 4CUGA 1JXNA 4QD2A 5A7SA 2PHWA 3BOWA 1ULOA 1WW6A 2R072 3NVCA 5HCAA 3AZWA 1IPJA 2B5HA 2Y6HA 3AX4A 5IVJA 4Y5TA 3LQCA 4K40A 2VJXA 3I3MA 2C26A 2WQ8A 4QGMA 2XVKA 3HOBA 4ARYA 5ABJA 1B35C 3UNPA 1VBE2 3N4MA 4NHYA 4EN6B 3THTA 3MF9A 4EN0A 2R042 3PJYA 1LU2A 5HCBA 5T54A 4CUCA 2WKKA 4OMDA 1VMJA 5BNOB 1UKRA 1FYUA 1YO8A 5A1LA 4DY5A 4LTAA 5H9RA 3ZO0B 5FWJA 4UFLA 1AJOA 5CEHA 3KWVA 3K48A 3KQRA 4PDWB 1MZ5A 4F8AA 3J7LA 2V73A 4DIQA 1AHSA 1LEMA 1ZZCA 3M3EA 4CDUC 3LPFA 3KV9A 3WEZA 2W94A 4JX0A 2XWBB 2YFZA 3LA7A 4KQ7A 1D7PM 5FZKA 3VKOA 1LHVA 4GXLA 4FPFA 3ACGA 3LIGA 1SBDA 4AQ2A 3RDIA 3RZHA 3FMGA 4HSJA 3MLKA 2NMNA 1ZBE1 1MZEA 4PDWC 2IXHA 1XSQA 1PVC3 2HWF2 3TN92 2A6ZA 2XBO1 3NV2A 2FDHA 3DUIA 3PDQA 3JD73 4IERA 2VCCA 4GA9A 4N9IA 5KHKA 3KF5A 4IEXA 1N1VA 4LA3A 1TME1 2A70A 5JOYA 3ACIA 4RL7A 2Q0AA 3WP4A 2ZAHA 1PMJX 1ZA7A 3NKGA 4OUMA 4R8HA 2P37A 2R063 2UYAA 1KDMA 4XFIA 2YMZA 2HWE3 3SKVA 1VP6A 2ZBJA 4FOWA 4CZSA 3N7JA 2RJ2A 4ZU7A 1BLZA 2WT0A 2XBO2 1HN0A 4WM8B 3SMHA 3WW3A 3PIGA 2RV9A 3RQ0A 5CFDC 3UETA 2DVDA 1EPZA 5A3WA 5FZLA 2VQTA 4K8RB 4K1ZA 4URTA 4ZONA 3ZFFA 5KBFA 2JKXA 3POFA 4ZPIA 3AZZA 5C8CC 3MIBA 2VZUA 1CESA 4DNYA 1GNHA 2WN2A 2D6KA 4MGKE 1RUJ3 4CVUA 1R1A2 1ACCA 2VTXA 3AKPA 4MZUA 1GNYA 2ARXA 5EQUA 1S2BA 4BLIA 5H9PA 4CDWC 1A8MA 1YLLA 3BPZA 4MXWA 1QH6A 1FOD2 1HXS1 2QZ2A 4IE6A 5LBCA 4I0WB 4FOYA 1W0NA 2YROA 2VOTA 2VBDA 1F4AA 1BCXA 2VUDA 3IDCB 1ZBA3 3POJA 1QF3A 1RUH3 2R1BA 2JDHA 4UWDA 3R4UA 2P6CA 2BNOA 1SBEA 5FZBA 2Z79A 3PUIA 2D6LX 1UY3A 1W3XA 5EYYA 4FQZA 3GGLA 4CU8A 1RB8G 4XUPA 1WCUA 3DN7A 2VMGA 5DQ0A 1PMIA 3OSDA 4JQRA 3UV9A 2WYFA 3ZFFC 3ZXKA 2W08A 3WNKA 1VBB2 2WZR3 4HT1T 2ZXQA 5ABJB 1JH5A 2WT2A 2JIJA 1GZ9A 2FBEA 1WBFA 4GWJA 4OLLA 4FXKB 1F9KA 1UOFA 3U37A 3HT1A 5FWEA 3AKSA 4BHPA 5KR7A 3MIEA 4D0QA 2CDPA 5C8WA 2ZMNA 4XAAA 1IQAA 1AYM2 2FQPA 4FPJA 2GALA 4AFAA 3LSDA 4Q4W2 5F8PA 3UGGA 4P9LA 4TLFA 3ZYBA 5JPNB 2HJIA 5FZCA 5DAVA 3LD8A 3O0WA 2E33A 4Q4Y2 2VGDA 5F32A 2W5FA 3EO6A 1G8WA 5C3OA 2FCVA 3RS6A 4AE2A 3USUB 1XYNA 2MNGA 4URAA 3VHNA 5C4WB 1C5IA 4XILA 2WO3A 1JBCA 5DXDA 5IT6A 1AR61 4UAPA 3PMEA 4UW3A 2VOWA 2QDNA 5F3GA 1AXKA 1J1TA 2WO2A 1OD3A 3LZZA 1LECA 3MHZA 4EWEA 4OHYA 1L7RA 3AZXA 4IXLA 3PTRB 2QDRA 3I3BA 1H2LA 1US2A 5EJZB 4KBBA 2VQUA 4OHVA 1XU2A 5FBJA 4X6QB 4XDPA 1QIQA 1VPHA 1CX1A 3LEIA 4EN9B 2HLEA 4IE0A 3WVJA 1IHMA 1H4GA 2KD7A 1I1EA 3O12A 2F6BA 4OVEA 2XJQA 4LPLA
chains in the Genus database with same CATH topology
2VZVA 4A45A 2VZ1A 3ABZA 1W9SA 1SDDB 2BGOA 3GXUA 4BXSV 1W9TA 3SKJE 5LA2A 1NUKA 4JHZA 3WF4A 2YB7A 1O8PA 1PX3A 2YFUA 1W8NA 1GOFA 2W3JA 2X05A 4A42A 1UZ0A 3A23A 2VZOA 2EICA 3FHAA 3I2HA 2LS6A 4L0PA 3NRUA 2VMCA 1CIYA 4PQQA 2BZDA 1NX9A 1TG7A 4LQRA 2XONA 1K3IA 2JDAA 4D8MA 3T08A 4BK5A 2WBKA 5J1XA 1HN1A 4GWIA 1SG3A 4E8CA 3HEIA 4A6OA 2BGPA 1GQPA 2W46A 4DXRA 5LA1A 5JR2A 1R64A 3WF2A 2Y6JA 3SEPA 1W8OA 1JYVA 1US3A 2V5DA 5JMOA 1H6XA 2QBXA 3MO4A 3I2JA 3HNMA 4GZ9A 3VD9A 1H6YA 3CZUA 3DYPA 1RYYA 2OKXA 4ZZ8A 2QQKA 3A22A 2ZEWA 3MV01 5IFTA 3WF0A 2J1TA 2VZTA 1CZSA 2VCAA 1JZ4A 4RYDA 1DLCA 4MGQA 4BK4A 3OGRA 4QAWA 3OEBA 3IIIA 1O8SA 3GM8A 2ID4A 4QX0A 2W1SA 1WKYA 4UI9L 2QQMA 2Y6GA 4MO3M 2WUHA 3T2PA 2VZ3A 2V4VA 2CDOA 2E32A 2X09A 2VMDA 3WF3A 2LW8A 3MV11 3T0AA 2ZEZA 3OGSA 4MGSA 2BBAA 5IJRA 3K4AA 3NJXA 5DMYA 1BHGA 3FN9A 2VM9A 3NJVA 1W99A 3I97A 1XNTA 4DEVA 1UY4A 1KGYA 3I2FA 4DXSA 5C7GA 3K4ZA 2B4KA 4W8JA 1K12A 2BERA 3MBWA 4AG4A 3I2GA 4CUAA 1JYNA 5CZKA 2E31A 3C7EA 1PMHX 4OZOA 1IQDC 3MUY1 1J83A 3LE0A 3W5MA 3VD3A 3WNOA 5I0DA 5LA0A 4M4RA 4XZUG 5C70A 5DN2A 4CU9A 3A21A 4CU7A 4LKSA 4LHSA 1UYZA 2VMEA 3I3EA 5IYYA 3T0BA 3CIHA 4ZXEA 4XUTA 4ZZ5A 4MADA 1GUIA 4JKKA 2WAOA 4RN5A 1JU3A 2JE8A 2L9LA 3WF1A 4IUGA 4Z2AA 2VMFA 3VDBA 3EB7A 3I3DA 1UMHA 2WYSA 4W4ZA 4QX1A 1NAEA 2XQXA 2HYXA 4ZY9A 2WABA 3OBAA 3IDAA 3ECQA 1I5PA 2VCBA 2VC9A 2WDBA 4ARXA 4OYUA 5FUIA 3VD5A 5HXMA 3WNPA 1L7QA 1UXZA 3IB3A 2QQOA 2W1QA 3LEKA 3T2QA 3WNLA 1JZ7A 4P5YA 2RVAA 2Z4FA 3ACHA 1K42A 4TTGA 3DECA 2QQJA 1UYXA 2DDUA 2WAAA 4QX3A 4XUQA 2VL4A 4XURA 4W50A 4BDVB 1GU3A 1UY1A 3JXSA 2WZ8A 3OEAA 2X10A 4KWUA 3AC0A 3HJRA 1UXXX 3IAPA 2JD9A 4AAXA 5G05L 2J1AA 1CZTA 1DYOA 1OF4A 1LNSA 4MOAA 2J22A 3CMGA 2ZEYA 3CQOA 1UY2A 5EIYB 3HN3A 1EUUA 4DUWA 4QDSA 2PQSA 1PX4A 1OH4A 4A4AA 2W92A 3C8XA 3UESA 4P08A 2J1SA 4E8DA 3HNYM 3SEEA 2Y6LA 3J7HA 2W9XA 1GOGA 2W1WA 5HPOA 2ORXA 3I2KA 2C4XA 2VTFA 4PF1A 4YPJA 3OG2A 5DPNA 2YG0A 4A3ZA 2DCJA 2XHNA 3F2ZA 4JKLA 3NQHA 5JXIA 4DUXA 4QX2A 2YC4A 2QQIA 3PUHA 1JI6A 2QQLA 5B4NA 4OMCA 4P02B 2Y8KA 4CU6A 5JXJA 5B4XA 4XUNA 3FL7A 2C9KA 2J1UA 3ACFA 5IFPA 1GMMA 2EIDA 3VD7A 5F7UA 5LCWL 2J1EA 4QB1A 2W1UA 1CZVA 3K4DA 4XVHA 4A44A 2YC2A 4DUVA 3BN6A 1T2XA 2XOMA 1ULOA 4KI5M 2Y6HA 1XC6A 1OF3A 1JZ8A 3LQCA 5EJ1B 1GOHA 2VJXA 2C26A 2WQ8A 4OUEA 3HOBA 4ARYA 3UNPA 3C7FA 1F4HA 2ZEXA 5JXHA 4BJ0A 4CUCA 3LPGA 2QQNA 4OMDA 3C7OA 3T09A 2WO1A 2W95A 3DYOA 3IAQA 4JKMA 3DYMA 2E26A 4P00B 3HPNA 4A41A 3LPFA 2EIBA 4UOJA 1J84A 2Y6KA 4DXTA 3WEZA 2W94A 4JX0A 1UMIA 2YFZA 1D7PM 3T0DA 3ACGA 2DCKA 1KEXA 1MPXA 1SHWB 2VO5A 3LEGA 4ET7A 2J1RA 2Y64A 3CKHA 4QDQA 1JHJA 1EUTA 2VCCA 3K77A 3P6BA 3WQBA 3VDAA 2R7EB 3ACIA 2VZRA 1PMJX 3CZJA 4CUBA 2VR4A 2ORZA 1UWWA 3SKVA 3VDCA 3VD4A 2RJ2A 1P8JA 4QB6A 2RV9A 3MUZ1 3UETA 2VQTA 1OT5A 2JKXA 3WSOA 4M4PA 1UX7A 1XPWA 3THCA 2VZUA 3A7QA 1XNAA 2WN2A 1JYWA 2VZQA 5JXGA 4CVUA 1GNYA 3GDBA 2B9VA 3C7HA 4QPWA 4XUOA 1JZ6A 1W0NA 2VOTA 1F4AA 3K46A 4FI9A 1UYYA 2J7MA 3W5NA 3PUIA 1K45A 3THDA 1UY3A 4CU8A 3GGLA 4XUPA 4KMQA 2W47A 5DQ0A 1ULPA 3WNKA 2W87A 2ZXQA 3ZM8A 4GWJA 3U37A 5A1AA 5JUVA 4PT6A 4D0QA 2CDPA 4HG6B 1NKGA 1JU4A 3I2IA 3NNGA 5CYYA 3BGAA 2VZPA 3K75B 2E33A 2J1VA 2W5FA 1WCQA 1W9WA 2EIEA 3ETPA 1JYXA 1YQ2A 2WN3A 2WO3A 1TVGA 2WZEA 1JZ5A 5C71A 4UAPA 3CDZB 2W91A 2VZSA 4TXWA 1JZ2A 2WO2A 1OD3A 2V72A 1DP0A 1L7RA 3D3AA 3E1F1 5IHRA 1O59A 3OB8A 3I3BA 4DEQA 3HNBM 1US2A 5EJZB 2VQUA 1UY0A 3T2OA 3C7GA 3OGVA 3WNMA 3EYPA 3P1IA 4QB2A 1CX1A 3LEIA 5G04L 2HLEA 3FHQA 2KD7A 3WNNA 4QDRA 4LPLA 1JZ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VZV A;  4A45 A;  2VZ1 A;  3ABZ A;  1W9S A;  1SDD B;  2BGO A;  3GXU A;  4BXS V;  1W9T A;  3SKJ E;  5LA2 A;  1NUK A;  4JHZ A;  3WF4 A;  2YB7 A;  1O8P A;  1PX3 A;  2YFU A;  1W8N A;  1GOF A;  2W3J A;  2X05 A;  4A42 A;  1UZ0 A;  3A23 A;  2VZO A;  2EIC A;  3FHA A;  3I2H A;  2LS6 A;  4L0P A;  3NRU A;  2VMC A;  1CIY A;  4PQQ A;  2BZD A;  1NX9 A;  1TG7 A;  4LQR A;  2XON A;  1K3I A;  2JDA A;  4D8M A;  3T08 A;  4BK5 A;  2WBK A;  5J1X A;  1HN1 A;  4GWI A;  1SG3 A;  4E8C A;  3HEI A;  4A6O A;  2BGP A;  1GQP A;  2W46 A;  4DXR A;  5LA1 A;  5JR2 A;  1R64 A;  3WF2 A;  2Y6J A;  3SEP A;  1W8O A;  1JYV A;  1US3 A;  2V5D A;  5JMO A;  1H6X A;  2QBX A;  3MO4 A;  3I2J A;  3HNM A;  4GZ9 A;  3VD9 A;  1H6Y A;  3CZU A;  3DYP A;  1RYY A;  2OKX A;  4ZZ8 A;  2QQK A;  3A22 A;  2ZEW A;  3MV0 1;  5IFT A;  3WF0 A;  2J1T A;  2VZT A;  1CZS A;  2VCA A;  1JZ4 A;  4RYD A;  1DLC A;  4MGQ A;  4BK4 A;  3OGR A;  4QAW A;  3OEB A;  3III A;  1O8S A;  3GM8 A;  2ID4 A;  4QX0 A;  2W1S A;  1WKY A;  4UI9 L;  2QQM A;  2Y6G A;  4MO3 M;  2WUH A;  3T2P A;  2VZ3 A;  2V4V A;  2CDO A;  2E32 A;  2X09 A;  2VMD A;  3WF3 A;  2LW8 A;  3MV1 1;  3T0A A;  2ZEZ A;  3OGS A;  4MGS A;  2BBA A;  5IJR A;  3K4A A;  3NJX A;  5DMY A;  1BHG A;  3FN9 A;  2VM9 A;  3NJV A;  1W99 A;  3I97 A;  1XNT A;  4DEV A;  1UY4 A;  1KGY A;  3I2F A;  4DXS A;  5C7G A;  3K4Z A;  2B4K A;  4W8J A;  1K12 A;  2BER A;  3MBW A;  4AG4 A;  3I2G A;  4CUA A;  1JYN A;  5CZK A;  2E31 A;  3C7E A;  1PMH X;  4OZO A;  1IQD C;  3MUY 1;  1J83 A;  3LE0 A;  3W5M A;  3VD3 A;  3WNO A;  5I0D A;  5LA0 A;  4M4R A;  4XZU G;  5C70 A;  5DN2 A;  4CU9 A;  3A21 A;  4CU7 A;  4LKS A;  4LHS A;  1UYZ A;  2VME A;  3I3E A;  5IYY A;  3T0B A;  3CIH A;  4ZXE A;  4XUT A;  4ZZ5 A;  4MAD A;  1GUI A;  4JKK A;  2WAO A;  4RN5 A;  1JU3 A;  2JE8 A;  2L9L A;  3WF1 A;  4IUG A;  4Z2A A;  2VMF A;  3VDB A;  3EB7 A;  3I3D A;  1UMH A;  2WYS A;  4W4Z A;  4QX1 A;  1NAE A;  2XQX A;  2HYX A;  4ZY9 A;  2WAB A;  3OBA A;  3IDA A;  3ECQ A;  1I5P A;  2VCB A;  2VC9 A;  2WDB A;  4ARX A;  4OYU A;  5FUI A;  3VD5 A;  5HXM A;  3WNP A;  1L7Q A;  1UXZ A;  3IB3 A;  2QQO A;  2W1Q A;  3LEK A;  3T2Q A;  3WNL A;  1JZ7 A;  4P5Y A;  2RVA A;  2Z4F A;  3ACH A;  1K42 A;  4TTG A;  3DEC A;  2QQJ A;  1UYX A;  2DDU A;  2WAA A;  4QX3 A;  4XUQ A;  2VL4 A;  4XUR A;  4W50 A;  4BDV B;  1GU3 A;  1UY1 A;  3JXS A;  2WZ8 A;  3OEA A;  2X10 A;  4KWU A;  3AC0 A;  3HJR A;  1UXX X;  3IAP A;  2JD9 A;  4AAX A;  5G05 L;  2J1A A;  1CZT A;  1DYO A;  1OF4 A;  1LNS A;  4MOA A;  2J22 A;  3CMG A;  2ZEY A;  3CQO A;  1UY2 A;  5EIY B;  3HN3 A;  1EUU A;  4DUW A;  4QDS A;  2PQS A;  1PX4 A;  1OH4 A;  4A4A A;  2W92 A;  3C8X A;  3UES A;  4P08 A;  2J1S A;  4E8D A;  3HNY M;  3SEE A;  2Y6L A;  3J7H A;  2W9X A;  1GOG A;  2W1W A;  5HPO A;  2ORX A;  3I2K A;  2C4X A;  2VTF A;  4PF1 A;  4YPJ A;  3OG2 A;  5DPN A;  2YG0 A;  4A3Z A;  2DCJ A;  2XHN A;  3F2Z A;  4JKL A;  3NQH A;  5JXI A;  4DUX A;  4QX2 A;  2YC4 A;  2QQI A;  3PUH A;  1JI6 A;  2QQL A;  5B4N A;  4OMC A;  4P02 B;  2Y8K A;  4CU6 A;  5JXJ A;  5B4X A;  4XUN A;  3FL7 A;  2C9K A;  2J1U A;  3ACF A;  5IFP A;  1GMM A;  2EID A;  3VD7 A;  5F7U A;  5LCW L;  2J1E A;  4QB1 A;  2W1U A;  1CZV A;  3K4D A;  4XVH A;  4A44 A;  2YC2 A;  4DUV A;  3BN6 A;  1T2X A;  2XOM A;  1ULO A;  4KI5 M;  2Y6H A;  1XC6 A;  1OF3 A;  1JZ8 A;  3LQC A;  5EJ1 B;  1GOH A;  2VJX A;  2C26 A;  2WQ8 A;  4OUE A;  3HOB A;  4ARY A;  3UNP A;  3C7F A;  1F4H A;  2ZEX A;  5JXH A;  4BJ0 A;  4CUC A;  3LPG A;  2QQN A;  4OMD A;  3C7O A;  3T09 A;  2WO1 A;  2W95 A;  3DYO A;  3IAQ A;  4JKM A;  3DYM A;  2E26 A;  4P00 B;  3HPN A;  4A41 A;  3LPF A;  2EIB A;  4UOJ A;  1J84 A;  2Y6K A;  4DXT A;  3WEZ A;  2W94 A;  4JX0 A;  1UMI A;  2YFZ A;  1D7P M;  3T0D A;  3ACG A;  2DCK A;  1KEX A;  1MPX A;  1SHW B;  2VO5 A;  3LEG A;  4ET7 A;  2J1R A;  2Y64 A;  3CKH A;  4QDQ A;  1JHJ A;  1EUT A;  2VCC A;  3K77 A;  3P6B A;  3WQB A;  3VDA A;  2R7E B;  3ACI A;  2VZR A;  1PMJ X;  3CZJ A;  4CUB A;  2VR4 A;  2ORZ A;  1UWW A;  3SKV A;  3VDC A;  3VD4 A;  2RJ2 A;  1P8J A;  4QB6 A;  2RV9 A;  3MUZ 1;  3UET A;  2VQT A;  1OT5 A;  2JKX A;  3WSO A;  4M4P A;  1UX7 A;  1XPW A;  3THC A;  2VZU A;  3A7Q A;  1XNA A;  2WN2 A;  1JYW A;  2VZQ A;  5JXG A;  4CVU A;  1GNY A;  3GDB A;  2B9V A;  3C7H A;  4QPW A;  4XUO A;  1JZ6 A;  1W0N A;  2VOT A;  1F4A A;  3K46 A;  4FI9 A;  1UYY A;  2J7M A;  3W5N A;  3PUI A;  1K45 A;  3THD A;  1UY3 A;  4CU8 A;  3GGL A;  4XUP A;  4KMQ A;  2W47 A;  5DQ0 A;  1ULP A;  3WNK A;  2W87 A;  2ZXQ A;  3ZM8 A;  4GWJ A;  3U37 A;  5A1A A;  5JUV A;  4PT6 A;  4D0Q A;  2CDP A;  4HG6 B;  1NKG A;  1JU4 A;  3I2I A;  3NNG A;  5CYY A;  3BGA A;  2VZP A;  3K75 B;  2E33 A;  2J1V A;  2W5F A;  1WCQ A;  1W9W A;  2EIE A;  3ETP A;  1JYX A;  1YQ2 A;  2WN3 A;  2WO3 A;  1TVG A;  2WZE A;  1JZ5 A;  5C71 A;  4UAP A;  3CDZ B;  2W91 A;  2VZS A;  4TXW A;  1JZ2 A;  2WO2 A;  1OD3 A;  2V72 A;  1DP0 A;  1L7R A;  3D3A A;  3E1F 1;  5IHR A;  1O59 A;  3OB8 A;  3I3B A;  4DEQ A;  3HNB M;  1US2 A;  5EJZ B;  2VQU A;  1UY0 A;  3T2O A;  3C7G A;  3OGV A;  3WNM A;  3EYP A;  3P1I A;  4QB2 A;  1CX1 A;  3LEI A;  5G04 L;  2HLE A;  3FHQ A;  2KD7 A;  3WNN A;  4QDR A;  4LPL A;  1JZ3 A; 
#chains in the Genus database with same CATH topology
 5FYT A;  2VZV A;  2FMY A;  3OGJ A;  5GLT A;  4RA0 A;  4D7Y A;  1KD7 A;  3UL2 A;  4XMA A;  4MET A;  4FFI A;  1D2Q A;  2QQP A;  4BXS V;  1W9T A;  3SKJ E;  5F1R A;  5FPU A;  2CGO A;  1NUK A;  2XJT A;  2XML A;  1PX3 A;  2XLG A;  4C91 A;  3HBK A;  1RUG 3;  4D6S A;  3PTY A;  1LR5 A;  4M3C E;  1D4M 1;  3SLI A;  3WUD A;  1LHW A;  1QGL A;  1QOO A;  1G6N A;  4L2N A;  3KV6 A;  4QXH A;  3E97 A;  5CKM A;  3APB A;  3LDB A;  4LBK A;  4R9D A;  1NCQ A;  1O3Q A;  5E88 A;  1UU6 A;  2D5H A;  2OXB A;  3CJI C;  1RUC 2;  4BU2 A;  1OA3 A;  3WCS A;  1FAT A;  2GN3 A;  1AR9 2;  4CXX A;  5D8A A;  3N9Q A;  2XON A;  4LQR A;  3AFK A;  4NAM A;  1K3I A;  1W39 A;  3INA A;  4HKL A;  5FLH A;  2OQ7 A;  3UJQ A;  5BNO A;  2GND A;  4CEW B;  4D8M A;  1Q8O A;  4JZR A;  3T08 A;  2YV8 A;  1MR5 A;  4RS5 B;  3I59 B;  1LTE A;  2VU9 A;  1HN1 A;  3UYJ A;  4GWI A;  5FP4 A;  1QJX 3;  2K9Z A;  5FY1 A;  2R30 A;  3HEI A;  1N47 A;  1OBN A;  3WIN E;  1RUI 1;  3QBQ A;  4FXG B;  2BYV E;  3SXW A;  1QJU 2;  1Z78 A;  2W46 A;  2N7G A;  4KU8 A;  5LA1 A;  4GMP 1;  5JR2 A;  5T55 A;  2IWG B;  1WLT A;  1G86 A;  2Y6J A;  1FXZ A;  3IKW A;  2B8M A;  4O7X A;  4P9J A;  5BY5 A;  2X5I A;  1CAW B;  2HEV F;  5I0T A;  5IK8 A;  3AJZ A;  3N36 A;  3VD9 A;  1W2A X;  2IXI A;  3OOX A;  3CZU A;  4EZH A;  3BVC A;  3FUQ A;  5A3T A;  1E5I A;  2ZGL A;  1I5Z A;  1WGP A;  2RE9 A;  3N9N A;  4QPG B;  5I0S A;  2R04 1;  1SAC A;  2BRT A;  1QJU 1;  4YFW A;  1AR8 1;  2BOI A;  5E1R A;  1F5J A;  4RGK A;  4RYD A;  5TSW A;  2DCY A;  3C2U A;  2ZHK A;  4QQ2 A;  2HWB 3;  4CP2 A;  3OGR A;  1HJG A;  3D4K A;  3M1H A;  4WVW A;  1VAL A;  1F31 A;  2FCT A;  1O8S A;  3III A;  3CEW A;  3M3C A;  4GH4 B;  1NYW A;  5IWF A;  1WKY A;  3DGT A;  2DVB A;  1EYB A;  3WW1 A;  1CAV A;  1PZ7 A;  4LKF A;  4BQ5 A;  5LBE A;  3UK9 A;  2AAC A;  1HV1 A;  1AXZ A;  1JHN A;  2GNB A;  2VZ3 A;  2V4V A;  2GC0 A;  5CNA A;  2CDO A;  2DWR A;  5FMO L;  3SQO A;  1COV 2;  1MQT B;  1LOG A;  2BJS A;  4QKB A;  1AR7 1;  5FZO A;  4Z2W A;  2LW8 A;  3MID A;  2VOX A;  3MV1 1;  4IE5 A;  4JGY B;  1AZD A;  1E5R A;  4MGS A;  1NZI A;  3AXD A;  2JG9 C;  2VE1 A;  5F9T A;  4OUS A;  3V0A B;  4AHX A;  2RDR A;  4EYU A;  4CP0 A;  3FFQ A;  4ATF A;  3NJX A;  4YRD A;  1UKG A;  2ZX0 A;  1WD3 A;  4N7I A;  3IDB B;  3WZ1 A;  2WSU A;  3NJV A;  5K7P A;  1V0A A;  3AKR A;  4EN7 B;  4GQ7 A;  2E51 A;  4PHZ A;  2BWC A;  4JTN A;  3W21 A;  3U78 A;  2R16 A;  3OPZ A;  2Y0O A;  4FO9 A;  4F83 A;  2C6S A;  3K4Z A;  2D6O X;  4GB3 2;  3VBF A;  1V6M A;  4W8J A;  3M3O A;  2BER A;  3OJB A;  4AG4 A;  2VBB A;  1DDL A;  3I2G A;  4KU7 A;  1VRB A;  4KWL A;  1RIT A;  5AC9 1;  1H8V A;  1FPN 3;  1H9P A;  1OUX A;  3L2H A;  1KXG A;  3C7E A;  4K20 A;  4OZO A;  1IQD C;  4RQP B;  3VUO A;  2Q8E A;  1MS0 A;  2F17 A;  4HSL A;  5HBA A;  2BGC A;  1DF0 A;  5FDB A;  3RZL A;  1HRV 2;  1J83 A;  1W90 A;  2JEC A;  1XB9 A;  2W52 A;  2ZX3 A;  2ZZQ A;  3ZPO A;  3LB9 A;  3ZYR A;  1RUE 1;  5FFO C;  1H2N A;  4NHK A;  1V9U 3;  3VD3 A;  1VBD 3;  2C9A A;  5I0D A;  1ND3 B;  4YW6 A;  1QQP 3;  3RPQ A;  4BOW A;  2JG8 A;  4R4X A;  4UT5 A;  5JAX A;  1SLC A;  2XG3 A;  2JDY A;  1PGL 1;  5A7P A;  1QJU 3;  3QH6 A;  1AL0 G;  2P5B A;  4I3G A;  3UKV A;  3H1W A;  4CP1 A;  4YW7 A;  4H7M A;  1EPW A;  3GBF A;  2OPW A;  4P5H A;  3L2Y A;  3E5U A;  3ME2 A;  2JWP A;  4Q4Y 1;  3T0B A;  1B35 A;  3VKN A;  4CPB D;  3KT7 A;  2GC1 A;  1V70 A;  4NWW A;  3ELN A;  2OUJ A;  4MLO A;  3B9C A;  5JOW A;  3BU0 A;  4FCA A;  4XEZ A;  1GQG A;  1O4Z A;  2JG8 B;  4LBQ A;  1NQD A;  4UYB A;  1C3H A;  4YZ3 A;  2DUO A;  2UWB A;  2ZCW A;  3OTF A;  4RR3 B;  3MIH A;  4IUG A;  1U5Y A;  2G9F A;  4MXV A;  3WHT A;  4AHZ A;  2CU5 A;  2VMF A;  1K5J A;  2GC2 A;  4CDW A;  4AZZ A;  2JIC A;  4BQ3 A;  3I3D A;  5LK7 B;  5M0T A;  1Y9M A;  1PVC 1;  2ZGK A;  4ZY9 A;  4AED A;  3AMQ A;  4Y33 A;  1IZ3 A;  3OBA A;  3J8F 3;  1SLA A;  4NJ4 A;  4LIT A;  2PQQ A;  4RR3 A;  3HWJ A;  2EXI A;  1ULF A;  1VJ2 A;  3VD5 A;  1W05 A;  3AB0 A;  1ALY A;  1D4M 3;  3J8F 1;  1CAV B;  5DZF A;  5FXW A;  2QVS B;  2JEM A;  4LUM A;  4XF0 A;  5FPL A;  5FMC A;  1W6Q B;  3LEK A;  4GAL A;  1AL2 2;  1UZV A;  5JZG B;  1JZ7 A;  4P5Y A;  2VD7 A;  1OQD A;  2Z4F A;  4E27 A;  4PIX A;  1ASJ 1;  3ILF A;  2W0X A;  4UW6 A;  2DFB A;  4WVM A;  1CR7 A;  4TTG A;  1A34 A;  2MEV 1;  4YW2 A;  1K42 A;  2QQJ A;  2H6B A;  2OX0 A;  2WAA A;  3MPP G;  3POG A;  4QX3 A;  5A7Q A;  2VL4 A;  4XUR A;  3T2T A;  3UKN A;  2DUQ A;  2BU9 A;  4QPI C;  4FPL A;  1PGL 2;  1QDO A;  3S30 A;  1OQ1 A;  2BV4 A;  2X8K A;  1ND3 A;  1VLN A;  3OD0 A;  1HV0 A;  2X10 A;  2VXJ A;  3AM2 A;  4NHM A;  4B7K A;  4U36 A;  3AC0 A;  2WLP A;  1FOD 1;  1HXS 2;  2C0Z A;  4QGL A;  5G05 L;  2I2S A;  1OF4 A;  1MQT A;  2A75 A;  1LNS A;  2P3I A;  1O4T A;  1LHO A;  1S0F A;  1CJP A;  2J22 A;  2R06 1;  2ZEY A;  4IV1 B;  4COU A;  3OUJ A;  2NQY A;  4V1P A;  4DY3 A;  2CHH A;  4R9A A;  5FP9 A;  2W39 A;  3BPS A;  5FUN A;  1RUE 3;  2PQS A;  3M4F A;  3NNL A;  3TAY A;  1S2E A;  1C8N A;  1J58 A;  1OH4 A;  4CEW A;  3J9S A;  2W92 A;  4PLO A;  4WM7 A;  5CA6 A;  1PM7 A;  3C8X A;  4DS0 A;  3UES A;  1EV1 2;  1NA1 C;  2Y6L A;  1U5Z A;  2WNU C;  3VBS A;  4O61 A;  1ND3 C;  4CCE A;  1OD5 A;  5ACA 2;  2VTF A;  4MHR A;  1HRI 3;  3C3V A;  1I3H A;  5HV4 A;  5GZG A;  2VUA A;  5DDJ 1;  4A3Z A;  2WT1 A;  5AC9 2;  3PUS A;  1QH7 A;  1W2U A;  4JKL A;  1AF9 A;  5HCF A;  3V56 A;  3ZSK A;  2RS1 1;  1E5H A;  4WVZ A;  4XXA A;  4Y26 A;  5JSR A;  5JZG C;  2QQI A;  4S2D A;  3ASI A;  3B9I A;  2HKX A;  3LF7 A;  4YM1 A;  2BDR A;  4OMC A;  1S0B A;  4CU6 A;  1UD1 A;  1HB2 A;  5B4X A;  3FL7 A;  4GH4 A;  4R4Z A;  1AR6 2;  4AAX A;  2VW2 A;  3ACF A;  4HN1 A;  1RMU 3;  2OA2 A;  3WDX A;  3K3N A;  5LK5 A;  3VD7 A;  5D8A B;  5F7U A;  3EBR A;  1X33 A;  3MLL A;  2HWD 3;  4L8Q A;  1CZV A;  2P1B A;  4XIK A;  3UGH A;  4A44 A;  2WZP P;  2R06 2;  1K5M C;  3H1M A;  2YC2 A;  1QXP A;  2BEO A;  3D8C A;  3EXU A;  3NST A;  3NV4 A;  1YYN A;  5ERL A;  2GMM A;  2ZGN A;  3JUU A;  3N7L A;  3BTZ A;  1H8T C;  1NE4 A;  2GME A;  5C5U A;  5FKB A;  1V6L A;  4OI2 A;  5CKQ A;  2XOM A;  4I0B A;  2HWF 3;  1FPN 2;  2OPK A;  2X53 S;  3GZE A;  1YJK A;  4K3U A;  4XIO A;  3FLP A;  4KI5 M;  5GZE A;  2YBS A;  3BYW A;  2IVJ A;  1XC6 A;  3QH7 A;  4I01 A;  4IV3 A;  5DUV A;  4QXB A;  1OLR A;  4MSV A;  5EJ1 B;  2JIG A;  4OUE A;  2YUE A;  3JB8 A;  3QOP A;  1PGW 1;  1S0C A;  3C7F A;  4NVP A;  2JDN A;  1VE0 A;  1Q43 A;  5CAZ A;  1W6P A;  1F4H A;  3HQU A;  2JDU A;  4XYX A;  5A6Y A;  2ARC A;  2BWA A;  2R1D A;  4BJ0 A;  4HLT A;  4WZC A;  4BQX A;  2AEZ A;  3CJI B;  4PI2 A;  4FPG A;  2WZR 1;  4SLI A;  3MW3 A;  4BZ4 A;  2QQN A;  3DXT A;  3C7O A;  1WMD A;  3D82 A;  2W95 A;  3DYO A;  4Z92 B;  1YFX A;  3GHM A;  5FPZ A;  2CWM A;  3RYR A;  4XQ4 A;  4PIY A;  1ZZ7 A;  3CU7 A;  4YZ1 A;  5H9Q A;  4M0H A;  1ULG A;  1LAJ A;  4Q0P A;  1SPP A;  5FPA A;  3TYJ A;  1RUG 1;  3HPN A;  4A41 A;  2ZKN A;  1C4R A;  4ZHN A;  4FPC A;  4P14 A;  3OD4 A;  1J84 A;  2Y6K A;  4Y1V A;  1W9Y A;  1REE A;  4CCO A;  3HN1 A;  3U07 A;  4P9W A;  3I54 A;  1HIX A;  4LA2 A;  3FUO A;  1O6U A;  1KEX A;  4D3W A;  1MPX A;  2WWS A;  2JKB A;  2VO5 A;  4IEQ A;  5CAD A;  1SCR A;  3ZXD A;  1AR9 1;  2PEL A;  5JI7 A;  4ASK A;  4QDR A;  3BAL A;  5FZ4 A;  1NCQ C;  3RGB A;  4ET7 A;  2XR4 A;  2J1R A;  2RDN A;  5FP7 A;  3ZYP A;  1REF A;  4Q0U A;  4ISQ A;  1AR9 3;  4LOS A;  5ANQ A;  4QDQ A;  4Y20 B;  1JHJ A;  4COW A;  1BJQ A;  2AEN A;  1HDK A;  1Q5O A;  3B7M A;  4CXY A;  4NUB A;  1VRH 2;  1VAV A;  4M3C B;  3WQB A;  4Z8B A;  2R7E B;  1DGW X;  3VHP A;  1JOD A;  4OUL A;  5FYH A;  4YVS A;  2VR4 A;  5L19 A;  5AVP A;  2ORZ A;  2GAU A;  1H4H A;  2Q30 A;  4Y5S A;  1CAW A;  3VD4 A;  2B46 X;  1P8J A;  3E6D A;  1RUE 2;  3ETQ A;  3MUZ 1;  3ZOI A;  4HPK B;  4TSV A;  5A3M A;  1OUS A;  5LRS A;  5T3N A;  4D7S A;  4M4P A;  1DGW A;  1UX7 A;  3LGR A;  3BIW E;  3THC A;  3ZN6 B;  1O4Y A;  3A7Q A;  1CWP A;  2H0V A;  1VBA 2;  2VEC A;  2ZGT A;  5KHJ A;  1BBT 3;  1XNA A;  1JYW A;  2WIN B;  1ST8 A;  1OPO A;  1OSG A;  1DZQ A;  1QEX A;  2A6V A;  5A3L A;  5FXV A;  2ZAB A;  1POV 1;  1RXF A;  5FYI A;  2B9U A;  3KQ4 B;  1S0G A;  2ZJC A;  3AJY A;  1W0O A;  4AQS A;  2NMO A;  4XUO A;  1H1A A;  1JZ6 A;  1VMH A;  5J96 B;  5I93 A;  4XTM A;  4B4P A;  2J7M A;  1NA1 B;  3AMH A;  4S2F A;  5IVY A;  2VY0 A;  1SLT A;  1UX6 A;  2QQU A;  5CBL A;  1RJ7 A;  1GZC A;  3OUH A;  3THD A;  3W5N A;  4UFJ A;  2FD8 A;  4Y3O A;  1SLB A;  1JYC A;  4BH9 A;  3ZXJ A;  4KMQ A;  3ZXF A;  3ZR5 A;  1RHI 2;  1XNK A;  4H2A A;  1APN A;  3ZFE C;  1ULP A;  4WVV A;  2DBN A;  2P3Y A;  5D2A A;  2W87 A;  5FZ6 A;  3KB5 A;  4EN8 B;  3ZMN A;  1NY7 2;  2SBA A;  2RS3 2;  1LB2 A;  1QXR A;  4ORF A;  2WWU A;  2XJR A;  4MYE A;  5JUV A;  4WM8 A;  4QU2 A;  2CL2 A;  5DAB A;  2NN8 A;  2FDG A;  3VGI A;  3HQR A;  4PCR A;  3SHR A;  2FDI A;  1JU4 A;  2Q4S A;  3I2I A;  3OY8 A;  3OYW B;  2R07 1;  4Y4Y A;  3ROU A;  4XJZ A;  3ITQ A;  1QJY 2;  1UU4 A;  2D43 A;  2D6N A;  1X50 A;  2VXR A;  3A0K A;  4JRA A;  5LB6 A;  2Q5T A;  1HJF A;  3IMM A;  2RS3 1;  2YGM A;  2YYO A;  4NN0 A;  1AR8 2;  4NIH A;  2D3S A;  3BUC A;  3UJO A;  1V6I A;  2O8O A;  5I8S A;  3P3N A;  5A6Z A;  2RDS A;  1YQ2 A;  1TVG A;  1OOP C;  1LGC A;  3ZFF B;  5JR7 B;  1QKQ A;  5C8C A;  1PO2 2;  5D1I A;  3WP3 A;  2VZS A;  2TNF A;  4AI9 A;  1RUJ 1;  1DP0 A;  3PMS A;  4HET A;  1RUC 1;  2DCZ A;  3E1F 1;  5FKC A;  5FPV A;  1O59 A;  3OB8 A;  1POV 3;  4DEQ A;  2ARE A;  2FCU A;  1UY0 A;  3VB9 A;  3DPR C;  2NYY A;  3C7G A;  1W3V A;  3Q9O A;  3ZIX A;  3WOG A;  1FNY A;  2WQZ C;  4RD7 A;  3WNM A;  4JRL A;  4QB2 A;  4SBV A;  1VRH 3;  4WV8 A;  1NCR C;  5G04 L;  3FHQ A;  2WFF 1;  5ACA 1;  3TEY A;  3HT2 A;  4UFK A;  4Y1X A;  1STM A;  2JXA A;  1VRH 1;  4BQ4 A;  1RUF 2;  4FOQ A;  3ZSE A;  4EWD A;  5FQ0 A;  2VZ1 A;  1W04 A;  3CF6 E;  4YGB A;  4KWJ A;  4BQ2 A;  2ADE A;  3B02 A;  1VAM A;  4QM9 A;  2ZX2 A;  1CD3 G;  1EV1 1;  2ZGS A;  1UW8 A;  3BU7 A;  4XW3 A;  4YWA A;  4B4Q A;  4TN7 A;  2B42 B;  1XE8 A;  1XSR A;  4NWV A;  3VZJ A;  4AFC A;  1ZBE 3;  2VVE A;  2JDP A;  3VBH C;  2YFU A;  1W8N A;  4NPL A;  2ZA9 A;  2EIG A;  5KXE A;  2EXK A;  3N7M A;  4Q4Y 3;  2IZW A;  3PLQ A;  2GDF A;  2QQW A;  3MDP A;  3EJK A;  2ZPX A;  5L9R A;  1Q8S A;  4LUK A;  3ON7 A;  4BXF A;  2EIC A;  5FY5 A;  1W6N B;  2A3X A;  3I2H A;  3QCW A;  2LS6 A;  1Q3E A;  4AQT A;  1MEC 2;  1PVX A;  1PM4 A;  1RVF 2;  1TMF 1;  1GP4 A;  5CFC A;  1IS3 A;  5L73 A;  2BZD A;  5DUX A;  1NX9 A;  1PO2 1;  1G7Y A;  1UYP A;  4FPH A;  3ZVX A;  4Q1R A;  4QM8 A;  2VUC A;  2DF7 A;  5C9A B;  2LM3 A;  5FZD A;  3NWK A;  1COV 3;  1VBB 3;  2UU8 A;  2WZR 2;  4IE4 A;  5FY4 A;  4BK5 A;  2RS3 3;  5JIU A;  2WBK A;  4AR2 A;  3ZN6 A;  3HAG A;  1L3J A;  3IN9 A;  3WW2 A;  1XNC A;  3M8L A;  4FTB A;  4A6O A;  2C5D A;  3Q8B A;  2BGP A;  4P9Y A;  4BQ1 A;  3ZFE B;  5HXV A;  1W8U A;  3NMB A;  3J7M A;  4MGI E;  2ES3 A;  1GBG A;  3SCG A;  4CA9 A;  1R64 A;  3SEP A;  1W8O A;  5FYY A;  2OQ6 A;  3ST7 A;  4NII A;  1WLW A;  4LE3 A;  5FAX A;  2WNO A;  2NPI A;  2ZMK A;  5JMO A;  2GNT A;  1H6X A;  1PZ8 A;  4OZX A;  3TB0 A;  2HWC 1;  3KT4 A;  1GSL A;  2A71 A;  1A3K A;  2IVI B;  3QLQ A;  1O3S A;  1RUF 3;  4BQW A;  4J1X A;  1AYN 1;  3MFA A;  1EY2 A;  4NR1 A;  5LBB A;  3GYD A;  4KL1 A;  5IFT A;  1CZS A;  4RFR B;  3H9A A;  1XXN A;  4LKD A;  3TWI A;  4Y20 A;  2ATF A;  1IKQ A;  3AYC A;  4LIU A;  4WVM B;  1G9B A;  5A7O A;  2V4A A;  3AYE A;  2OS2 A;  1VBE 3;  1GYK A;  4JGZ B;  3GM8 A;  4CP9 A;  1XYP A;  5FZ1 A;  3O1O A;  3WUC A;  1NOV A;  4LIV A;  5IAX A;  1LKN A;  1ODM A;  2XJS A;  4OCT A;  4WM7 C;  3T2P A;  1W2T A;  4XF9 A;  3O0X A;  4QQL A;  1C8M 1;  3FBY A;  4LHL A;  4LO5 B;  2C1F A;  1I6X A;  4DB5 A;  2ZKL A;  2VUL A;  1ZX5 A;  3JBG 1;  5FV3 A;  3DEM A;  4D94 A;  2UY8 A;  3U0Z A;  2YGL A;  4QT6 A;  5IVB A;  3N9L A;  5FLJ A;  1WLD A;  5C3S A;  2D6M A;  4Y1U A;  3MPB A;  1S0E A;  4RHV 1;  3TN9 3;  1T6G C;  4QPG C;  1RJ8 A;  2VQ0 A;  1QJY 3;  4XC9 A;  3NNJ A;  5DG2 A;  4XZP A;  1XNT A;  3PHM A;  5J98 B;  3RMY A;  1X82 A;  3V65 A;  1RUI 3;  2XB6 C;  4DXS A;  5C7G A;  5IVE A;  2XH6 A;  2VOK A;  4C0H A;  3I2D A;  3PIJ A;  3BB6 A;  4XJU A;  3ZLI A;  1NLR A;  4HOO A;  3NV1 A;  3ACL A;  3H3U A;  3PU8 A;  4WBB A;  5A7W B;  4HMZ A;  3NKT A;  2DYC A;  4BM8 A;  1PIV 3;  1M4W A;  5FBZ A;  3ZN4 A;  3OCP A;  2YDE A;  2P3J A;  3FX3 A;  4LO8 A;  3P5B A;  4QWN A;  3RJ2 X;  2JDM A;  4IW3 A;  2LRP A;  1R08 3;  3ZXG A;  4CDW B;  2NLR A;  3E5Q A;  3KGL A;  3RVH A;  3WNO A;  1XQN A;  4YG3 A;  3R05 A;  2W2I A;  2VPV A;  5A33 B;  5LA0 A;  4AK3 A;  4XZU G;  3VZL A;  3O7O A;  2ZGR A;  2Z69 A;  1AYN 3;  1WBL A;  3LFM A;  5DN2 A;  3SC7 X;  1YFW A;  4JGY C;  5FJK A;  5KHH A;  2D6P A;  1S0J A;  3A21 A;  1RED A;  3GZT B;  2RR1 1;  4MH0 E;  3GJB A;  3S0M A;  1RXG A;  3POW A;  5D21 A;  1YXW A;  3I3E A;  1Z0H A;  1SBF A;  5BNP B;  1U5X A;  4IV1 A;  3O1S A;  2PHF A;  5FP8 A;  2AC1 A;  5K4L A;  3ZN5 A;  1HW5 A;  3CIH A;  4CEY C;  4ZZ5 A;  3CL1 A;  3L9J T;  4FQ4 A;  4JKK A;  4W65 A;  4QX5 A;  5BNP C;  3POS A;  1JU3 A;  5GLU A;  3B93 A;  3GBG A;  4YGD A;  2L9L A;  3E6C C;  5LAS A;  3ZFG B;  5J3U A;  2CTV A;  5FYM A;  3B3Q E;  2ZHL A;  1EAH 3;  1BEV 1;  2JG9 A;  3VKL A;  1RUH 1;  1DQ0 A;  3VDB A;  1W06 A;  1MVE A;  1VBC 1;  4OQ8 A;  1QQP 2;  5FY7 A;  2P2K A;  1RMU 1;  1UMH A;  5GZF A;  2WYS A;  2OZJ A;  2XQX A;  4A3X A;  2HWD 2;  1AYM 3;  5KHI A;  4DRR A;  3WP5 A;  1POQ A;  3DF0 A;  3IDA A;  3QD6 A;  4CCM A;  4B1L A;  1I5P A;  4HXC A;  2WDB A;  1YC6 1;  4Q26 A;  3KMH A;  1QJY 1;  4O9G A;  1HLC A;  4AI8 A;  1Y7B A;  2HYK A;  3DV8 A;  1FPN 1;  3PVO A;  4IV1 C;  4N43 A;  5FYZ A;  1QXJ A;  4XJW A;  4HZF A;  1HQW A;  1OUR A;  1WCD J;  3JQW A;  1LOE A;  4XQW A;  1J59 A;  1RUN A;  5FZE A;  3MFC A;  4XET A;  4UBH A;  5JMC A;  2HWD 1;  2RVA A;  4QKD A;  3U14 A;  2WS9 3;  3ACH A;  1T6B X;  2ZZJ A;  4Y5Z 0;  3ZSJ A;  2DBI A;  1O5L A;  4WM8 C;  1DHK B;  5JCT A;  5KXB A;  1N3P A;  4O9E A;  1J3P A;  1RUD 2;  1DZT A;  1CAX A;  1MS4 A;  3WDU A;  4Q4V 1;  3T4V A;  1QU0 A;  1RL3 A;  4UF0 A;  5JSO A;  3OEA A;  1CPM A;  4MGZ E;  3H8R A;  4GIQ A;  2BPA 2;  2JG8 C;  2VQA A;  4IL7 A;  1R1A 3;  2YZ4 A;  3ZSL A;  5EHD A;  1WA4 A;  1UXX X;  2ZGU A;  2P4E A;  2AYH A;  2JD9 A;  1MEC 1;  5E8A A;  3VBR C;  5F37 A;  1F35 A;  1WWY A;  3LKJ A;  4EZ4 A;  4E4D X;  2BFU L;  1MZ6 A;  1DYO A;  5IK4 A;  1DZR A;  4MOA A;  3AKT A;  3CMG A;  4LEJ A;  2X29 A;  5BYN A;  3AZY A;  4BE3 A;  1KJR A;  5DDJ 2;  1IPK A;  5T5J A;  4AI0 A;  2PHD A;  4Q2F A;  4H7L A;  2VW0 A;  3HN3 A;  5FZ9 A;  1UMZ A;  4YLZ A;  4L9B A;  4QDS A;  2R49 A;  4YVW B;  2G9G A;  4A4A A;  1HXS 3;  1N3O A;  3RYK A;  5J09 A;  1SQ4 A;  4W6Y A;  4P08 A;  2J1S A;  5EPA A;  5ACA 3;  1NXD 1;  4RHV 3;  1VAK A;  3CO2 A;  1YI9 A;  5EXO A;  3TN9 1;  4E8D A;  4IGP A;  4PLN A;  5FQ0 B;  1RTV A;  2W9X A;  3WXP A;  1NG0 A;  3NAP B;  5KXD A;  2A73 B;  1YNA A;  5SV8 A;  3ZYJ B;  3D0J A;  4J25 A;  1CX4 A;  1UPI A;  2C4X A;  1MAC A;  2X5I B;  3I2K A;  4AED C;  2ZAA A;  3OG2 A;  3R0R A;  5APA A;  1Q56 A;  4I02 A;  4XF1 A;  1SFP A;  3O1M A;  1CN1 A;  1AL2 3;  3WDT A;  1W8T A;  3RMX A;  2E9Q A;  4DUX A;  3HBZ A;  1ENS A;  3AVS A;  3ZIW A;  1SDW A;  5K0U A;  2PA7 A;  2NP0 A;  1JI6 A;  1WW7 A;  2AGS A;  2QQL A;  5E6H A;  3MIG A;  4P02 B;  3VV1 A;  4F7Z A;  5B4N A;  1V6O A;  3H8U A;  4DQA A;  5JXJ A;  4BCU A;  4ES8 A;  4FAG A;  3POB A;  3RI9 A;  3O1R A;  4C8D A;  1GMM A;  4Z1V A;  2PFW A;  3MW2 A;  5LCW L;  4QB1 A;  1QWR A;  2W1U A;  3WDY A;  5FXZ A;  5GKA C;  3WCR A;  4LO7 A;  4LBO A;  1C5H A;  2B39 A;  1V6K A;  4QPI A;  5FLI A;  3WG1 A;  4KWK A;  1K5M A;  4K7J A;  3GHN A;  4Q5O A;  1RUC 3;  2CAU A;  3JU9 A;  5A6X A;  5FZO B;  1YQC A;  1H0B A;  3BN6 A;  5F2S A;  1XRU A;  3I8T A;  1H8T A;  4AI2 A;  1T2X A;  1W2N A;  3OY8 B;  3OYW A;  4BMB A;  5JPM B;  5T5O A;  2CSG A;  3MF6 A;  1YFU A;  4B29 A;  3OF1 A;  4BYY A;  2VCM A;  1ZA4 A;  4Z07 A;  5A7N A;  1JZ8 A;  1RHI 3;  2Q1M A;  4PJY A;  1J3Q A;  4IES A;  2JEN A;  4X8P A;  5FP3 A;  2ZHM A;  2GMP A;  4GWN A;  4FP2 A;  3GCX A;  3KZ4 C;  1MS8 A;  1W8H A;  2ZEX A;  3MZH A;  1KS4 A;  1QQP 1;  2NM1 A;  3JZV A;  4A6S A;  5KHG A;  4N53 A;  4KGQ A;  1RUO A;  2IC1 A;  1PK6 B;  4RS5 C;  4Q8K A;  3MGU A;  3LPG A;  5F6K A;  1AYM 1;  1F8V A;  3TRS B;  5ANN A;  3T09 A;  2WNU A;  2GU9 A;  1PNF A;  2WO1 A;  2WSV A;  3J8F 2;  4RSU A;  5JOZ A;  5LW9 A;  3IAQ A;  4OHW A;  4Q4W 3;  4XF4 A;  5I0U A;  5LY1 A;  3DYM A;  2QZ3 A;  3SH3 A;  5D8A C;  1RVF 1;  1TMF 2;  2CAV A;  2PAE A;  1VBA 3;  1VIW B;  4NRQ A;  3ZSM A;  1WW4 A;  1PHM A;  3Q8F A;  5IAV A;  3AL5 A;  4UOJ A;  1DGR A;  2RDQ A;  2EVX A;  4I0A A;  4YM3 A;  1Q8Q A;  5FPB A;  4TWT A;  1ZYB A;  3H1Y A;  1UNB A;  3JBG 3;  3T0D A;  4JQT A;  4L97 A;  2Y34 A;  3ILR A;  4IQP A;  2RS1 3;  2PLV 1;  1SHW B;  2E53 A;  4W6X A;  2K46 A;  2WRA A;  4QXK A;  5C9A A;  4OHZ A;  5LWB A;  2GZW A;  1QJX 1;  3PUR A;  4I3P A;  1W6O A;  4J6G A;  4JC1 A;  2ZML A;  3LEG A;  3OBZ A;  2Y64 A;  1JS9 A;  2WA4 A;  1SFN A;  2GH8 A;  3FBM A;  1VBD 2;  1R1A 1;  1JW6 A;  3K77 A;  2TEP A;  1WCS A;  3ZDV A;  1PIV 1;  3FLT A;  1XE0 A;  4LBL A;  3VDD B;  2RMU 1;  4KG0 A;  3JQX A;  3WDW A;  1GZT A;  1PO1 3;  1OA2 A;  2VZR A;  3M3I A;  3TOJ A;  1R08 1;  4AEK A;  1W28 A;  1SMV A;  3OUI A;  4NRM A;  1TME 3;  4YVS C;  5F5C A;  1HKD A;  5AFE A;  5F3E A;  3JB4 C;  4R9C A;  4I2O A;  2OZ6 A;  1LOC A;  1DCS A;  1X9P A;  5I0R A;  3KHB A;  1DBN A;  2P3K A;  2GN7 A;  2BNN A;  4LHK A;  3JCI A;  1XU1 A;  3SCH A;  1ZBE 2;  1OT5 A;  2SLI A;  3WSO A;  2V5Y A;  4XDO A;  1DQ6 A;  3LA2 A;  5FXX A;  4DZG A;  3H50 A;  4BIO A;  1XPW A;  4QKF A;  1YEW A;  1N1S A;  3T3Y A;  5HI0 A;  3P3P A;  4B7E A;  1TME 2;  1WCK A;  3B94 A;  2WNE A;  3LOB A;  1W8F A;  5FO7 B;  4Y4R A;  3V0B A;  2H0B A;  2BVV A;  2MEV 2;  3FE5 A;  4XHB A;  4LLF A;  1ASJ 2;  2BW8 A;  3GDB A;  2B9V A;  3ENR A;  2EXH A;  4R9B A;  2NZ9 A;  3C7H A;  1G9A A;  4IEO A;  4QPW A;  2PN5 A;  5BNO C;  5K9Y A;  5B2G B;  1EAH 1;  1UYY A;  4MUV A;  3BTX A;  3KGZ A;  4NPR A;  3ZXL A;  1OKO A;  1K45 A;  1OMI A;  3RYP A;  1H30 A;  4CCC A;  1BVV A;  2D93 A;  2QUO A;  5I8T A;  2W47 A;  1G9C A;  3KVB A;  2WII B;  1KFX L;  5DDJ 3;  3NJY A;  3AYA A;  2RM2 3;  3SNM A;  2UUR A;  2XVG A;  4S2H A;  4LK6 A;  1WMF A;  3EHK A;  4OQ9 A;  4HL0 A;  5GZD A;  2X5I C;  5A1A A;  1IKP A;  1RUH 2;  3GZA A;  2DTY A;  3OBT A;  4PT6 A;  3RG0 A;  3WG3 A;  3ZKY A;  4EJR A;  1NKG A;  5JSP A;  1HRI 2;  5FCC A;  1G9D A;  4D6R A;  2FZ2 A;  3MIF A;  5CYY A;  1UOG A;  4OI1 A;  4BIS A;  3IBM A;  4XJ8 A;  2VZP A;  2HWE 1;  2WA3 A;  3JD7 1;  1O3T A;  3U4X A;  1OQE A;  2JE9 A;  5DG1 A;  1DIW A;  3KCY A;  1GAN A;  5C6C A;  2J1V A;  4UFI A;  1UN1 A;  5T5P A;  4UBG A;  3V64 A;  5FPX A;  4QHZ A;  1FV2 A;  1WCQ A;  4IV3 C;  4NOT A;  3UT0 A;  4A7Y A;  4XHX A;  1O7F A;  2RR1 2;  1JYX A;  4B8E A;  4Q4X 2;  2WN3 A;  4N43 C;  4AFB A;  2WZE A;  1JZ5 A;  2E63 A;  4GKX A;  4DMI A;  3J7N A;  2P17 A;  2WWJ A;  3IWZ A;  3TNQ A;  2VAU A;  2W91 A;  1W03 A;  5C4W C;  4HAN A;  1TEI A;  4RGA A;  3D3A A;  1HB4 A;  2TUN A;  5IHR A;  2EXJ A;  2VBP A;  4ES9 A;  5J48 A;  5FYU A;  3HNB M;  3WT3 A;  3T4H B;  4YM2 A;  2YY1 A;  3OGV A;  2XUE A;  1TE1 B;  3EYP A;  5A3N A;  4TZD A;  2VNG A;  1C8M 3;  4PF5 A;  5FZF A;  3VBO B;  2WJS A;  2ZAC A;  3PJQ A;  1W8Z A;  5HV0 A;  2D5F A;  1PIV 2;  4CCJ A;  1PK6 C;  4YAR A;  3ILN A;  3KCX A;  1M06 G;  3ABZ A;  1W9S A;  1VBC 3;  4AFM A;  5FY9 A;  4D7T A;  2WO7 A;  4N7U A;  2BGO A;  1W6O B;  2D7F A;  2IFR A;  2YC0 A;  4HPK A;  1FI2 A;  1XND A;  3GXU A;  2PMW B;  3BIE A;  1Y4W A;  4JHZ A;  1FX5 A;  5LA2 A;  4YVW A;  1QJX 2;  4MGY E;  3WF4 A;  2GP5 A;  2BOJ A;  3U1X A;  5ABJ C;  5KC5 A;  1WW5 A;  1O8P A;  4IEU A;  2XL9 A;  4YFZ A;  2HEY F;  1X8E A;  1HB3 A;  1WZX A;  5A32 A;  1WA6 X;  2KR2 A;  5JLV A;  2W3J A;  5J37 A;  3ORJ A;  1BMV 2;  4Y22 A;  4M0N A;  3NJZ A;  2X05 A;  1JUH A;  2QE3 A;  3KS7 A;  2JDK A;  3A23 A;  3DXU A;  1CGP A;  5CIR A;  4M3C A;  4JDN A;  1NLQ A;  4EQV A;  3NNM A;  4YGC A;  3WLU A;  3CLP A;  4L0P A;  1C8M 2;  4ZU5 A;  2CV6 A;  3LIH A;  4LXL A;  2JG9 B;  4AOC A;  2R32 A;  2DVF A;  4BLJ A;  4MXW B;  5C33 A;  1JYI A;  4HK8 A;  4ASL A;  2JDA A;  5BPX A;  1CAU B;  3ZYG A;  5A6Q A;  1DU3 D;  1QHD A;  3TEW A;  4CCL A;  2IFW A;  4E2Q A;  3KM5 A;  1AUY A;  2UY9 A;  5J1X A;  4S2G A;  4NIG A;  4E8C A;  5EZW A;  1AR7 2;  4RQP C;  4YZ5 A;  2ENR A;  3U4S A;  1RUG 2;  1GQP A;  2XKO A;  1J3R A;  4Q1P A;  1IS4 A;  4AWD A;  5BXX A;  1F15 A;  4N43 B;  4PDW A;  5FMB A;  5FYB A;  3WQ0 A;  5CFD B;  4FPE A;  1BXH A;  3AK0 A;  1V9U 1;  2YPD A;  2V5D A;  1H1I A;  1ULE A;  3DPR A;  3I2J A;  3MI8 A;  4KH9 A;  4YG6 A;  4QU1 A;  3ZXE A;  1DYK A;  3DYP A;  3Q8C A;  1QDC A;  4LBQ D;  5A33 A;  2G9Z A;  3FFZ A;  3RRD A;  1SFY A;  4AGV A;  4C90 A;  4ZZ8 A;  5A3P A;  3H42 B;  2QQK A;  2VMH A;  3MV0 1;  3AP9 A;  3G7D A;  4W6W A;  1H9W A;  3PU3 A;  1ZVF A;  4HKO A;  3GNE A;  1S2K A;  4XFB A;  2VCA A;  2F4P A;  1JZ4 A;  1DLC A;  4L11 A;  4MGQ A;  2RG4 A;  3R4D B;  4IEP A;  2Y38 A;  4MVT A;  5E89 A;  4BK4 A;  3RZJ A;  3ZX7 A;  4ARX A;  2RM2 2;  2IXC A;  1L7L A;  1UIJ A;  4QX0 A;  2PYT A;  2ZGM A;  2W1S A;  4UI9 L;  1DLL A;  5FZM A;  3AFG A;  1BZW A;  3I3Q A;  1LRH A;  1YJL A;  4O65 A;  2WUH A;  3GAL A;  1MS1 A;  2WFF 3;  4I09 A;  4OHX A;  2X09 A;  3VBR B;  2VMD A;  4C0B A;  1WME A;  4JV4 A;  3S57 A;  2EF6 A;  3T1M A;  5LRR A;  4XCA A;  2VG9 A;  4XAC A;  1GV9 A;  3TBD A;  2D3P A;  2WS9 1;  4XFA A;  5IJR A;  3K4A A;  3VBO C;  4AGR A;  1GQH A;  3FN9 A;  2RJL A;  2VM9 A;  3GZU C;  1EAH 2;  1OLQ A;  1W99 A;  2JJ6 A;  4HON A;  4XFH A;  5L36 A;  1N1Y A;  2XPJ A;  5T50 A;  4JHT A;  4JVA A;  1CAX B;  1UY4 A;  3D6E A;  4YZ2 A;  1KGY A;  2XL7 A;  3DL3 A;  3I2F A;  2B7Y A;  2E7Q A;  2D3R A;  2B4K A;  1R09 1;  4AVA A;  1X9T A;  1MZF A;  1OOP A;  3WY6 A;  3T1L A;  2FHR A;  4CUA A;  2G1M A;  4XAE A;  1JYN A;  1GWL A;  1C57 A;  1ND2 B;  5FZA A;  2FZ1 A;  4FOV A;  1EP0 A;  1PMH X;  1O5U A;  5FTT C;  5L7O A;  2R0F A;  1V6J A;  1GR3 A;  4AL9 A;  1KDK A;  3RI8 A;  1GZW B;  2P6H A;  1AX2 A;  1VBD 1;  3AL6 A;  2YHJ A;  1ODN A;  3MUY 1;  4JGZ C;  3PUQ A;  2ZHN A;  3DCQ A;  4LBJ A;  4LE4 A;  3HD8 B;  4TYS A;  3LE0 A;  2KXL A;  4FT8 A;  4YW3 A;  4G3Y C;  3W5M A;  3N9P A;  1AR8 3;  4NPM A;  3WV6 A;  3ES1 A;  1OPM A;  1QY4 A;  3OPW A;  3OPT A;  3N35 A;  2Q8O A;  2DVA A;  1FOD 3;  4IGO A;  4LOR A;  4DPN A;  4QHB A;  1YI7 A;  5F5I A;  1RUD 3;  3S7I A;  4UF0 B;  3ZYI B;  3VDD C;  4AF9 A;  4MG2 A;  3O1P A;  1R08 2;  1EV1 3;  2KM2 A;  3D5O A;  3V0A A;  2ILM A;  3N9O A;  1OHF A;  4QGN A;  4CU7 A;  4N8M A;  4NAO A;  4XE9 A;  4AAP A;  3IDE A;  4LHS A;  1HX6 A;  4XOG A;  1GKB A;  2VME A;  1LUL A;  2OW4 A;  4EV0 A;  1KRI A;  3HMY A;  1POV 0;  4ZXE A;  4DOU A;  3AYD A;  4Q8L A;  1GUI A;  4PBO A;  4Q0S A;  4GH4 C;  3BCW A;  1IS5 A;  1A8D A;  3PUA A;  3NNF A;  1ENR A;  1NLS A;  5BNP A;  5I8Y A;  1CAU A;  5FZI A;  2I74 A;  2DU1 A;  3NL1 A;  5BUV A;  5JOX A;  2R6Q A;  2DVG A;  3THP A;  4Z2A A;  1YIP A;  5CFC B;  2A3Y A;  1U0A A;  1DG6 A;  2A1X A;  1Z7S 3;  3EB7 A;  2I07 B;  4W4Z A;  4QX1 A;  1NAE A;  4FFF A;  4HFS A;  4QPG A;  5F6L B;  5SV5 A;  3AXE A;  4AW7 A;  1IS6 A;  4AEM A;  3RZK A;  3UKT A;  1JTZ X;  4GJY A;  4IDZ A;  3UGF A;  4CCD A;  2VCB A;  5FYV A;  2K0G A;  1IOA A;  1BEV 2;  4NO4 A;  5DAQ A;  2BFU S;  2WNV C;  5FYS A;  5A32 B;  3S7E A;  5HXM A;  2CGP A;  3WNP A;  4CDU A;  4AVS A;  1LOB A;  1NZC A;  1YRZ A;  1L7Q A;  1OOP B;  3IB3 A;  1D0H A;  1QJE A;  3GCW A;  4HN0 A;  1ULC A;  1H2K A;  4CDX C;  2QKD A;  4XAB A;  1FNZ A;  3A0N A;  4LO6 B;  2R07 3;  2QFE A;  2BTV C;  1U5I A;  2YPJ A;  4ZU4 A;  3RZM A;  3NO8 A;  4ERO A;  1D2S A;  3ZR6 A;  4FTE A;  5EYX A;  1XYO A;  4G4F A;  2AZ5 A;  3AKQ A;  1VBC 2;  3POY A;  1GP5 A;  3IM0 A;  4W50 A;  5GLW A;  2VW1 A;  4LJH A;  3KT1 A;  3FWE A;  4EE2 A;  1GU3 A;  1NCR B;  1UY1 A;  3JXS A;  5T52 A;  3K2O A;  2ZGO A;  3VKF C;  1YWK A;  5FYC A;  4C1X A;  2ERF A;  4M01 A;  2EAA A;  4HK9 A;  1QNY A;  4YNI A;  5DUU A;  1SLI A;  4BWO A;  3DPR B;  4CSW A;  2FDF A;  3E6B A;  4H3W A;  4BB3 A;  2GP3 A;  1UL9 A;  3GJA A;  3F95 A;  2AH2 A;  3W20 A;  2XHK A;  3B69 A;  4YW4 A;  5IW0 A;  3VBR A;  5FOJ B;  2R04 3;  5KWR A;  2Z5W A;  2RR1 3;  3FLR A;  1H1M A;  4YM0 A;  5F3C A;  3WR0 A;  2XXZ A;  5L7O B;  2BVB A;  1UY2 A;  2JD4 A;  4NHL A;  1FT9 A;  5F39 A;  1DGR N;  1A6C A;  3SCF A;  3ZXA C;  5EIY B;  3O1V A;  1EUU A;  4DUW A;  3I49 A;  1E57 A;  4BIF A;  3MEP A;  1PX4 A;  3AMN A;  3KF3 A;  4GAZ A;  2Q1Z B;  1QOT A;  2Q1F A;  1LES A;  4P9G A;  4QQP A;  5EFU A;  3BI3 A;  3N3H A;  3WW4 A;  2ET7 A;  3HNY M;  1N1T A;  4BA6 A;  4XJ9 A;  4E4S A;  1UF2 C;  4PLM A;  4A7K A;  3WDV A;  4XQD A;  1GOG A;  2W1W A;  1LGB A;  1LOD A;  4YZ4 A;  2ORX A;  4YPJ A;  3IMN A;  4PF1 A;  4RHV 2;  1BK0 A;  1BMV 1;  2Y33 A;  4XFC A;  5DPN A;  5F3I A;  3VKM A;  3S5A A;  4I30 A;  4AQ6 A;  3RWK X;  2XHN A;  3F2Z A;  3T30 A;  2OT7 A;  5J36 A;  4CPB A;  4JDO A;  4QQO A;  4NIA A;  4ITC A;  2PLV 3;  4XCB A;  1MVQ A;  4IE7 A;  4QX2 A;  5A80 A;  2HEW F;  4AVB A;  1GP6 A;  5BNN A;  1DQ1 A;  3I4I A;  1LJ7 A;  5FZ3 A;  4KGG A;  1IGO A;  3PUH A;  4B1M A;  3HR9 A;  1BEV 3;  4QQH A;  5K0U C;  2Y8K A;  1F5F A;  2A5Z A;  4XUN A;  4AVT A;  4DXZ A;  1JMU B;  2C9K A;  3GF6 A;  3G6J B;  4YW1 A;  4Y1Y A;  1Y43 B;  4ZKT B;  3KCC A;  3M3Q A;  5FZ8 A;  5L9V A;  2RM2 1;  4CDQ B;  3USU A;  2RS5 3;  4CXW A;  1WD4 A;  1ZNP A;  2DCT A;  3K4D A;  4XVH A;  5FK8 A;  1OC1 A;  1RUD 1;  2Y26 A;  5DAX A;  5FZG A;  1W6M B;  3H0O A;  3IIA A;  1V6N A;  2MEV 3;  1OXC A;  4GMP 3;  1H2M A;  1N3Q A;  1X8M A;  4H55 A;  2OYZ A;  1WMX A;  4Z82 A;  1FAY A;  1LU1 A;  2J42 A;  5I91 A;  2FDK A;  2PXJ A;  1RUJ 2;  1ZZ8 A;  4IEZ A;  4MHU A;  1AR6 3;  1ZZB A;  3H8X A;  2WQ4 A;  2UWC A;  4E4H A;  1U12 A;  5FY8 A;  1F2N A;  4CCN A;  4CEY B;  4CDQ C;  2WL1 A;  5CFD A;  3VZO A;  4Y22 B;  1OF3 A;  5BNN C;  1GLH A;  1XJA A;  2VNO A;  3LSE A;  1YQ5 A;  1GOH A;  5T5L A;  3CJX A;  5J7M A;  3RSJ A;  1LEN A;  1VBE 1;  4UW5 A;  1PNG A;  3POI A;  2XLA A;  2HWE 2;  5JXH A;  4FVV A;  4XBN A;  5IUQ A;  4FFG A;  2D40 A;  2H6C A;  3VZM A;  2BUK A;  4HVQ A;  2HH9 A;  1HRI 1;  1MEC 3;  4AVC A;  4J1W A;  3RJR A;  4JKM A;  3WP6 A;  5FY0 A;  2ZOE B;  5LBF A;  3W59 A;  2CNA A;  2E26 A;  1NY7 1;  4P00 B;  1PVC 2;  1Y9Q A;  3M2M A;  5C3P A;  2RS1 2;  4YG0 A;  4UXA A;  4PI0 A;  2EIB A;  4XMI A;  4GMP 0;  5CU1 A;  4YVW C;  1AX1 A;  4DXT A;  1UMI A;  5LZ6 A;  3LDK A;  4LR4 A;  1LHU A;  5FMD A;  1AR7 3;  3WQ7 A;  5C8C B;  4FTS A;  4A7Z A;  2DCK A;  3VL9 A;  2WNV B;  4ONU A;  5A3O A;  3SIT A;  1TMF 3;  2HBU A;  2HWB 2;  1CQ9 A;  3NV3 A;  3U75 A;  1IG0 A;  4COV A;  3K3O A;  3CKH A;  4U2A A;  1HRV 1;  2LTN A;  1EUT A;  1LOF A;  4RGG A;  2WNU B;  3P6B A;  2DUP A;  4LBM A;  4NRP A;  1PZ9 A;  1ASJ 3;  3VBO A;  3VDA A;  4HKW A;  5F5Q A;  3CJI A;  2A6W A;  2PAM A;  3CBN A;  2ZTN A;  2QTW B;  2Y6F A;  4F3J A;  2WFF 2;  1X7N A;  2D44 A;  1ONA A;  3CZJ A;  3VHR A;  4CUB A;  1BBT 2;  1UWW A;  4XBQ A;  1VMF A;  4P9I A;  1PO2 3;  2LRO A;  1UAI A;  3VDC A;  3ES4 A;  1R09 2;  2WR9 A;  1D4V B;  4FP3 A;  2B45 X;  4QB6 A;  1RC6 A;  1ENQ A;  1XOY A;  3D0S A;  3IT8 A;  3PVB B;  4QKN A;  4AYU A;  4FAH A;  4MX3 A;  4DO0 A;  1OFN A;  3K51 A;  2FMD A;  5LAT A;  1DQ2 A;  1ZZ6 A;  2KA3 A;  4LKE A;  4OFG A;  4PIZ A;  5F5A A;  1ZRR A;  2PTM A;  4AXO A;  2GSY A;  1LED A;  4Q4X 1;  2DV9 A;  4XF3 A;  4OI4 A;  1NXM A;  1YFY A;  3CNA A;  3RZG A;  2E7A A;  2VZQ A;  5JXG A;  1HQN A;  1K5M B;  2VH9 A;  2ETE A;  5LY2 A;  3TEX A;  2A7A A;  1AXY A;  1YQ6 A;  2EAK A;  1DFQ A;  3K46 A;  4FI9 A;  1YCI A;  4DFS A;  3WG2 A;  5LEK A;  5K8S A;  5IK7 A;  1OH3 A;  1ND2 C;  1UIK A;  1ENX A;  1W6P B;  3I2O A;  1MS3 A;  1BYH A;  1QOS A;  3RFR A;  1COV 1;  5JDB A;  1S0D A;  4JDM A;  4Q29 A;  1GNZ A;  1FMD 3;  2VVD A;  3W9A A;  3ZM8 A;  2VUJ A;  3KLS A;  5JVV A;  1AL2 1;  1ZRI A;  2F4L A;  1Q8V A;  3FHI B;  4NID A;  5CG8 A;  4Q4W 1;  2O14 A;  5FUP A;  3VL8 A;  4HG6 B;  4X8N A;  3AMM A;  2YU1 A;  3M7A A;  1NA1 A;  1ZZ9 A;  3NNG A;  5E16 A;  2AUY A;  1LGN A;  1V9U 2;  3VBU A;  2YBK A;  4ZS2 A;  1Z7S 2;  3BGA A;  1O3R A;  5JWP A;  1HQL A;  1HRV 3;  3K75 B;  3LOI A;  2IUW A;  3RWN A;  2A6Y A;  4GUL A;  3ZDS A;  2VVF A;  2XJU A;  3WNX A;  4IEW A;  3V0B B;  2G4I A;  1B09 A;  5GJ6 A;  2CY6 A;  1RHI 1;  1VB4 A;  1W9W A;  2EIE A;  3H7Y A;  5IK5 A;  3AZV A;  3BOP A;  3ETP A;  4LO4 B;  4AHW A;  1R1Z A;  3DKQ A;  1YQ8 A;  5F2W A;  4LK7 A;  2BNM A;  5C71 A;  4FSJ A;  1URX A;  4CEY A;  4YYO A;  3CDZ B;  4CDX B;  4NHX A;  1JZ2 A;  4TXW A;  1WLC A;  1UO9 A;  2FDJ A;  2V72 A;  1H8T B;  5GZC A;  1CON A;  2RMU 3;  3ALQ A;  2AR6 A;  2YBP A;  4GB3 3;  3T2O A;  1PO1 2;  1UQX A;  2IXL A;  1S55 A;  4YVS B;  3P1I A;  3NAP C;  2RHP A;  2DUR A;  1J1L A;  2XUM A;  1UZW A;  4QPI B;  2HWC 3;  3VDD A;  1ZRD A;  4IET A;  1ULD A;  3WNN A;  3LWC A;  1OVS A;  2PHL A;  1OVP A;  1JZ3 A;  3VBS B;  4GJZ A;  3CHX A;  3ZFG C;  4A45 A;  5LEJ A;  5IAT A;  4ZXK A;  2QQV A;  1S4C A;  1SDD B;  1PK6 A;  2OII A;  4HBN A;  4L92 A;  2JB4 A;  1TNR A;  3LEM A;  1BK1 A;  2A3W A;  4Q4X 3;  4AI1 A;  4KBZ A;  1XE7 A;  3EQE A;  2HWB 1;  3FC0 A;  5A3U A;  2YB7 A;  1JN2 P;  4COY A;  3NW4 A;  4DRV A;  5FJH A;  2AEY A;  3ZPY A;  1GOF A;  2TBV A;  4ATE A;  1MS5 A;  4IV3 B;  4A42 A;  2Z42 A;  4QXC A;  1UZ0 A;  4GKY A;  1CJD A;  2VZO A;  1NQJ A;  1FV3 A;  1SPP B;  1W0P A;  3FHA A;  1SLL A;  1KJL A;  1KIT A;  1X36 A;  2P34 A;  2XDV A;  3NAP A;  4ASM B;  5A70 A;  1W6M A;  5C3R A;  3NRU A;  2PHU A;  3PVE A;  4BME A;  2LAL A;  1OLM E;  2CYF A;  2VMC A;  1CIY A;  3O14 A;  1OI6 A;  4PQQ A;  4JCK A;  1TG7 A;  2JE7 A;  3ZFG A;  3VZK A;  1HB1 A;  2XJV A;  4LOT A;  3O0V A;  2XLF A;  5FZ7 A;  2BP6 A;  1RIN A;  1W2O A;  2WNV A;  4KNC A;  4UFM A;  1JOB A;  2JX9 A;  5EJ3 A;  3WD5 A;  2VOV A;  1FMD 2;  4RR3 C;  5K0U B;  2XGX A;  1CIW A;  3ATG A;  3BKZ A;  1SCS A;  1SG3 A;  4WZF A;  4D69 A;  3KVA A;  5HCH A;  1PO1 1;  3JBG 2;  5C3Q A;  2RS5 1;  4CTE A;  4XBL A;  5EP9 A;  4R52 A;  4DIN B;  4K8F A;  4E9K A;  4DXR A;  5ISL A;  2K2S A;  4AHY A;  1KQR A;  2ET1 A;  4FPO B;  2W68 A;  1ZRC A;  3WF2 A;  4LNV A;  2YU2 A;  5AC9 3;  1JYV A;  3DKW A;  5FZH A;  3HIF A;  2IXJ A;  2WLQ A;  3B01 A;  3KSC A;  1US3 A;  1OKQ A;  4LLO A;  2QBX A;  3MO4 A;  5DAP A;  4GZ9 A;  3HNM A;  3U10 A;  4CCK A;  1H6Y A;  1RGS A;  2XJP A;  1S0I A;  1RYY A;  2OKX A;  5A1F A;  5IVV A;  4ZS3 A;  4OI0 A;  4YW5 A;  3H3L A;  1BQP A;  3A22 A;  1QJZ A;  4XTP A;  2ZEW A;  4XDQ A;  1XBF A;  3WF0 A;  2J1T A;  2UYB A;  1E5S A;  2E7T A;  2VZT A;  4GD4 A;  4K6B A;  4Q0V A;  5IVF A;  5GLZ A;  1RMU 2;  1BKZ A;  1Y3T A;  2EAL A;  1JOJ A;  2WFP A;  2XVL A;  3WX5 A;  1JYT A;  5DUW A;  1Z7S 1;  2DU0 A;  4QAW A;  1C1F A;  3OEB A;  4WM7 B;  3ZKU A;  1VB2 A;  2ID4 A;  5KC6 A;  4LHN A;  5FZ0 A;  4UFH A;  1SEF A;  4AGG A;  4CDU B;  2QQM A;  1NE6 A;  2Y6G A;  1GFF 2;  2OVU A;  3QAC A;  4RFT 0;  4MO3 M;  2DFC A;  2QJV A;  2Y60 A;  1XNB A;  3IPV A;  4Q0Q A;  1QMJ A;  2E32 A;  1RUI 2;  1UZY A;  4N9H A;  4B3N A;  3WF3 A;  3T0A A;  4FPY A;  2ADD A;  2ZEZ A;  3OGS A;  3E5X A;  3S5Q A;  3RNS A;  4XFG A;  1FMD 1;  2BBA A;  1W8W A;  2A6X A;  4QX8 A;  3SIS A;  5DMY A;  1UPS A;  1BHG A;  1KFU L;  4AFD A;  1CVN A;  3H3Z A;  5FIX A;  3I97 A;  3VBF C;  4DEV A;  3M70 A;  4BPZ A;  1OLM A;  4N53 B;  1G9F A;  1VR3 A;  1UU5 A;  2LUW A;  1K12 A;  1YIF A;  3ZMO A;  3MBW A;  2C24 A;  2PAK A;  3HVD A;  4RQP A;  2VTX J;  5CZK A;  1R09 3;  3VBH A;  5JZG A;  2E31 A;  4HVO A;  1D4M 2;  4NMI A;  3KV4 A;  1OFS A;  4H14 A;  1DYP A;  4MV2 A;  5L7O C;  4XPV A;  1MS9 A;  5FMO S;  5IVC A;  1CPN A;  3LA3 A;  3VBF B;  4FBF A;  1D0G A;  5FO8 B;  4N53 C;  5CVR A;  3BTA A;  5FOB B;  4K21 A;  1QNW A;  3J26 N;  2Z2S B;  3MIC A;  1LOF C;  4P9X A;  3A4U A;  3LFI A;  1UOB A;  4M4R A;  1BBT 1;  4AI3 A;  1RUF 1;  1YUD A;  3J4U H;  5C70 A;  3KV5 A;  3AMP A;  3HQX A;  1KS5 A;  5EWS A;  5C5T A;  4CU9 A;  3OBR A;  3N7K A;  4YGE A;  5FRA A;  5A7W A;  4LKS A;  4CDQ A;  4JTO A;  2ZS6 B;  4E4Z A;  1NT0 A;  3B5L B;  4LBQ B;  4L99 A;  2O0O A;  1UYZ A;  2VNR A;  4G9S B;  2MPF A;  3LCP A;  1ZRE A;  2QCS B;  3SH5 A;  2RJK A;  2XQR A;  5KXC A;  2CWS A;  2G19 A;  2OUH A;  3MLJ A;  4GB3 1;  1W6Q A;  5IYY A;  2HWF 1;  1ZBA 1;  4XUT A;  2VMI A;  4MAD A;  3O1T A;  4E2S A;  5BNN B;  1AX0 A;  2WAO A;  5GM0 A;  1AVB A;  4RN5 A;  4LBN A;  4V2V A;  4FFH A;  4CEW C;  2JE8 A;  2QNK A;  2ARB A;  4K9S A;  2D98 A;  4MGT A;  2D97 A;  3WF1 A;  4V2W A;  1YHF A;  5CG9 A;  3MW4 A;  1C28 A;  1NCR A;  5FR3 A;  4AED B;  1BVP 1;  2I45 A;  4JAA A;  5EV7 A;  1A78 A;  5DZE A;  4NE9 A;  3ZYF A;  3ZYH A;  4QX7 A;  5AVA A;  4HVR A;  4D6Q A;  1VBB 1;  2O8Q A;  2HYX A;  1GZW A;  2Q8D A;  2WAB A;  5DZG A;  2UWA A;  4XXP A;  4XFF A;  3BOD A;  3AP7 A;  2VC9 A;  3ECQ A;  4OYU A;  5FUI A;  5GAL A;  3RZZ A;  5JI9 A;  4A2U A;  2EA7 A;  1PGS A;  3GBW A;  3R6S A;  3FZ3 A;  1GWK A;  1UXZ A;  2QQO A;  1QJF A;  2W1Q A;  1S1A A;  5LA9 A;  1B35 B;  1OA4 A;  3T2Q A;  4FPK A;  2MHF A;  3WNL A;  4K1Y A;  1TZO A;  1ZBA 2;  4LT5 A;  4EWA A;  5BV6 A;  5CIS A;  5DAW A;  3DEC A;  1UYX A;  2DDU A;  3I59 A;  4IEY A;  1JUI A;  3R4S A;  4QHO A;  1I9R A;  3Q8E A;  3LDR A;  4RS5 A;  4XUQ A;  3O1U A;  1AYN 2;  1JOP A;  2ZGP A;  4BDV B;  3KHC A;  1GWM A;  1SZB A;  4AEJ A;  5CFC C;  3AP6 A;  2HWC 2;  2WZ8 A;  2R0H A;  3VBU C;  1IG3 A;  5FO9 B;  4COZ A;  5FRE A;  5H9S A;  3LAG A;  2O1Q A;  1DGL A;  4KWU A;  3HJR A;  3H7J A;  1RIR A;  1Q8P A;  1TQ5 A;  1V00 A;  2DTW A;  3IAP A;  2ZGQ A;  1MQT C;  1NCQ B;  2WC2 A;  4IND A;  4Y1Z A;  2J1A A;  3WG4 A;  3TEZ A;  1CZT A;  2RS5 2;  1W9F A;  2Q8C A;  5JIA A;  3VN4 A;  1UZZ A;  4C1W A;  3POE A;  2BQP A;  3CQO A;  4XJA A;  3VZN A;  1UOJ A;  1VBA 1;  3PVN A;  2Y0I A;  4NRO A;  2IXK A;  1O91 A;  3S6P A;  2JB8 A;  5C9A C;  3VLB B;  2ZX4 A;  4UW4 A;  4X6R B;  3AP4 A;  4QMA A;  5FK7 A;  3N9M A;  2GNM A;  3Q8A A;  3USS A;  5BNQ A;  1UCX A;  4CRQ A;  2CGN A;  2GC3 A;  3O5S A;  3X29 B;  1ZRF A;  1GIC A;  3SEE A;  3VBS C;  3H8O A;  1C1L A;  1ZM1 A;  3J7H A;  4QPY A;  3FJS A;  1RVF 3;  4PBP A;  1DQ5 A;  3AP5 A;  1DQ4 A;  4AVV A;  4CE8 A;  1LOA A;  4KG8 A;  5HPO A;  3I7D A;  3OGG A;  4IGQ A;  3VHO A;  2PHX A;  4B4R A;  2WS9 2;  3WQ1 A;  2RMU 2;  2YG0 A;  2DCJ A;  4JGY A;  3W58 A;  2HBT A;  3VBH B;  1ND2 A;  4N90 A;  5AFB A;  3NQH A;  1AJK A;  1IPS A;  4LMF A;  5L9B A;  5JXI A;  2YXS A;  2YC4 A;  5CB7 A;  2PHT A;  4BQY A;  2E6V A;  2XWJ B;  4LUL A;  1Y9G A;  4TLG A;  4CDX A;  3SH4 A;  1WUV A;  4Q27 A;  3ZFE A;  3PNA A;  3AVR A;  4CP9 B;  1LHN A;  2XBO 3;  2J1U A;  2JDZ A;  4JGZ A;  2PLV 2;  3URF A;  2VNV A;  3EMR A;  4ISR A;  3B00 A;  5GLV A;  5C4W A;  3MYX A;  5CKN A;  2EID A;  5IFP A;  3TNP B;  2BBV A;  3IZO A;  2ARA A;  4Q4V 2;  2J1E A;  2GH2 A;  4YSF A;  2V09 A;  4IEV A;  4PQ9 A;  4M00 A;  3U11 A;  2ZX1 A;  4E2G A;  4Y24 A;  1W6N A;  4CYD A;  4GWM A;  4DUV A;  3WHU A;  1PGW 2;  3KD4 A;  4Q4V 3;  1LCL A;  2PHR A;  3PL0 A;  2XKP A;  3JD7 2;  1TNF A;  4M3C F;  3BTY A;  3VBU B;  3IPV B;  4CUG A;  1JXN A;  4QD2 A;  5A7S A;  2PHW A;  3BOW A;  1ULO A;  1WW6 A;  2R07 2;  3NVC A;  5HCA A;  3AZW A;  1IPJ A;  2B5H A;  2Y6H A;  3AX4 A;  5IVJ A;  4Y5T A;  3LQC A;  4K40 A;  2VJX A;  3I3M A;  2C26 A;  2WQ8 A;  4QGM A;  2XVK A;  3HOB A;  4ARY A;  5ABJ A;  1B35 C;  3UNP A;  1VBE 2;  3N4M A;  4NHY A;  4EN6 B;  3THT A;  3MF9 A;  4EN0 A;  2R04 2;  3PJY A;  1LU2 A;  5HCB A;  5T54 A;  4CUC A;  2WKK A;  4OMD A;  1VMJ A;  5BNO B;  1UKR A;  1FYU A;  1YO8 A;  5A1L A;  4DY5 A;  4LTA A;  5H9R A;  3ZO0 B;  5FWJ A;  4UFL A;  1AJO A;  5CEH A;  3KWV A;  3K48 A;  3KQR A;  4PDW B;  1MZ5 A;  4F8A A;  3J7L A;  2V73 A;  4DIQ A;  1AHS A;  1LEM A;  1ZZC A;  3M3E A;  4CDU C;  3LPF A;  3KV9 A;  3WEZ A;  2W94 A;  4JX0 A;  2XWB B;  2YFZ A;  3LA7 A;  4KQ7 A;  1D7P M;  5FZK A;  3VKO A;  1LHV A;  4GXL A;  4FPF A;  3ACG A;  3LIG A;  1SBD A;  4AQ2 A;  3RDI A;  3RZH A;  3FMG A;  4HSJ A;  3MLK A;  2NMN A;  1ZBE 1;  1MZE A;  4PDW C;  2IXH A;  1XSQ A;  1PVC 3;  2HWF 2;  3TN9 2;  2A6Z A;  2XBO 1;  3NV2 A;  2FDH A;  3DUI A;  3PDQ A;  3JD7 3;  4IER A;  2VCC A;  4GA9 A;  4N9I A;  5KHK A;  3KF5 A;  4IEX A;  1N1V A;  4LA3 A;  1TME 1;  2A70 A;  5JOY A;  3ACI A;  4RL7 A;  2Q0A A;  3WP4 A;  2ZAH A;  1PMJ X;  1ZA7 A;  3NKG A;  4OUM A;  4R8H A;  2P37 A;  2R06 3;  2UYA A;  1KDM A;  4XFI A;  2YMZ A;  2HWE 3;  3SKV A;  1VP6 A;  2ZBJ A;  4FOW A;  4CZS A;  3N7J A;  2RJ2 A;  4ZU7 A;  1BLZ A;  2WT0 A;  2XBO 2;  1HN0 A;  4WM8 B;  3SMH A;  3WW3 A;  3PIG A;  2RV9 A;  3RQ0 A;  5CFD C;  3UET A;  2DVD A;  1EPZ A;  5A3W A;  5FZL A;  2VQT A;  4K8R B;  4K1Z A;  4URT A;  4ZON A;  3ZFF A;  5KBF A;  2JKX A;  3POF A;  4ZPI A;  3AZZ A;  5C8C C;  3MIB A;  2VZU A;  1CES A;  4DNY A;  1GNH A;  2WN2 A;  2D6K A;  4MGK E;  1RUJ 3;  4CVU A;  1R1A 2;  1ACC A;  2VTX A;  3AKP A;  4MZU A;  1GNY A;  2ARX A;  5EQU A;  1S2B A;  4BLI A;  5H9P A;  4CDW C;  1A8M A;  1YLL A;  3BPZ A;  4MXW A;  1QH6 A;  1FOD 2;  1HXS 1;  2QZ2 A;  4IE6 A;  5LBC A;  4I0W B;  4FOY A;  1W0N A;  2YRO A;  2VOT A;  2VBD A;  1F4A A;  1BCX A;  2VUD A;  3IDC B;  1ZBA 3;  3POJ A;  1QF3 A;  1RUH 3;  2R1B A;  2JDH A;  4UWD A;  3R4U A;  2P6C A;  2BNO A;  1SBE A;  5FZB A;  2Z79 A;  3PUI A;  2D6L X;  1UY3 A;  1W3X A;  5EYY A;  4FQZ A;  3GGL A;  4CU8 A;  1RB8 G;  4XUP A;  1WCU A;  3DN7 A;  2VMG A;  5DQ0 A;  1PMI A;  3OSD A;  4JQR A;  3UV9 A;  2WYF A;  3ZFF C;  3ZXK A;  2W08 A;  3WNK A;  1VBB 2;  2WZR 3;  4HT1 T;  2ZXQ A;  5ABJ B;  1JH5 A;  2WT2 A;  2JIJ A;  1GZ9 A;  2FBE A;  1WBF A;  4GWJ A;  4OLL A;  4FXK B;  1F9K A;  1UOF A;  3U37 A;  3HT1 A;  5FWE A;  3AKS A;  4BHP A;  5KR7 A;  3MIE A;  4D0Q A;  2CDP A;  5C8W A;  2ZMN A;  4XAA A;  1IQA A;  1AYM 2;  2FQP A;  4FPJ A;  2GAL A;  4AFA A;  3LSD A;  4Q4W 2;  5F8P A;  3UGG A;  4P9L A;  4TLF A;  3ZYB A;  5JPN B;  2HJI A;  5FZC A;  5DAV A;  3LD8 A;  3O0W A;  2E33 A;  4Q4Y 2;  2VGD A;  5F32 A;  2W5F A;  3EO6 A;  1G8W A;  5C3O A;  2FCV A;  3RS6 A;  4AE2 A;  3USU B;  1XYN A;  2MNG A;  4URA A;  3VHN A;  5C4W B;  1C5I A;  4XIL A;  2WO3 A;  1JBC A;  5DXD A;  5IT6 A;  1AR6 1;  4UAP A;  3PME A;  4UW3 A;  2VOW A;  2QDN A;  5F3G A;  1AXK A;  1J1T A;  2WO2 A;  1OD3 A;  3LZZ A;  1LEC A;  3MHZ A;  4EWE A;  4OHY A;  1L7R A;  3AZX A;  4IXL A;  3PTR B;  2QDR A;  3I3B A;  1H2L A;  1US2 A;  5EJZ B;  4KBB A;  2VQU A;  4OHV A;  1XU2 A;  5FBJ A;  4X6Q B;  4XDP A;  1QIQ A;  1VPH A;  1CX1 A;  3LEI A;  4EN9 B;  2HLE A;  4IE0 A;  3WVJ A;  1IHM A;  1H4G A;  2KD7 A;  1I1E A;  3O12 A;  2F6B A;  4OVE A;  2XJQ A;  4LPL A; 
#chains in the Genus database with same CATH homology
 2VZV A;  4A45 A;  2VZ1 A;  3ABZ A;  1W9S A;  1SDD B;  2BGO A;  3GXU A;  4BXS V;  1W9T A;  3SKJ E;  5LA2 A;  1NUK A;  4JHZ A;  3WF4 A;  2YB7 A;  1O8P A;  1PX3 A;  2YFU A;  1W8N A;  1GOF A;  2W3J A;  2X05 A;  4A42 A;  1UZ0 A;  3A23 A;  2VZO A;  2EIC A;  3FHA A;  3I2H A;  2LS6 A;  4L0P A;  3NRU A;  2VMC A;  1CIY A;  4PQQ A;  2BZD A;  1NX9 A;  1TG7 A;  4LQR A;  2XON A;  1K3I A;  2JDA A;  4D8M A;  3T08 A;  4BK5 A;  2WBK A;  5J1X A;  1HN1 A;  4GWI A;  1SG3 A;  4E8C A;  3HEI A;  4A6O A;  2BGP A;  1GQP A;  2W46 A;  4DXR A;  5LA1 A;  5JR2 A;  1R64 A;  3WF2 A;  2Y6J A;  3SEP A;  1W8O A;  1JYV A;  1US3 A;  2V5D A;  5JMO A;  1H6X A;  2QBX A;  3MO4 A;  3I2J A;  3HNM A;  4GZ9 A;  3VD9 A;  1H6Y A;  3CZU A;  3DYP A;  1RYY A;  2OKX A;  4ZZ8 A;  2QQK A;  3A22 A;  2ZEW A;  3MV0 1;  5IFT A;  3WF0 A;  2J1T A;  2VZT A;  1CZS A;  2VCA A;  1JZ4 A;  4RYD A;  1DLC A;  4MGQ A;  4BK4 A;  3OGR A;  4QAW A;  3OEB A;  3III A;  1O8S A;  3GM8 A;  2ID4 A;  4QX0 A;  2W1S A;  1WKY A;  4UI9 L;  2QQM A;  2Y6G A;  4MO3 M;  2WUH A;  3T2P A;  2VZ3 A;  2V4V A;  2CDO A;  2E32 A;  2X09 A;  2VMD A;  3WF3 A;  2LW8 A;  3MV1 1;  3T0A A;  2ZEZ A;  3OGS A;  4MGS A;  2BBA A;  5IJR A;  3K4A A;  3NJX A;  5DMY A;  1BHG A;  3FN9 A;  2VM9 A;  3NJV A;  1W99 A;  3I97 A;  1XNT A;  4DEV A;  1UY4 A;  1KGY A;  3I2F A;  4DXS A;  5C7G A;  3K4Z A;  2B4K A;  4W8J A;  1K12 A;  2BER A;  3MBW A;  4AG4 A;  3I2G A;  4CUA A;  1JYN A;  5CZK A;  2E31 A;  3C7E A;  1PMH X;  4OZO A;  1IQD C;  3MUY 1;  1J83 A;  3LE0 A;  3W5M A;  3VD3 A;  3WNO A;  5I0D A;  5LA0 A;  4M4R A;  4XZU G;  5C70 A;  5DN2 A;  4CU9 A;  3A21 A;  4CU7 A;  4LKS A;  4LHS A;  1UYZ A;  2VME A;  3I3E A;  5IYY A;  3T0B A;  3CIH A;  4ZXE A;  4XUT A;  4ZZ5 A;  4MAD A;  1GUI A;  4JKK A;  2WAO A;  4RN5 A;  1JU3 A;  2JE8 A;  2L9L A;  3WF1 A;  4IUG A;  4Z2A A;  2VMF A;  3VDB A;  3EB7 A;  3I3D A;  1UMH A;  2WYS A;  4W4Z A;  4QX1 A;  1NAE A;  2XQX A;  2HYX A;  4ZY9 A;  2WAB A;  3OBA A;  3IDA A;  3ECQ A;  1I5P A;  2VCB A;  2VC9 A;  2WDB A;  4ARX A;  4OYU A;  5FUI A;  3VD5 A;  5HXM A;  3WNP A;  1L7Q A;  1UXZ A;  3IB3 A;  2QQO A;  2W1Q A;  3LEK A;  3T2Q A;  3WNL A;  1JZ7 A;  4P5Y A;  2RVA A;  2Z4F A;  3ACH A;  1K42 A;  4TTG A;  3DEC A;  2QQJ A;  1UYX A;  2DDU A;  2WAA A;  4QX3 A;  4XUQ A;  2VL4 A;  4XUR A;  4W50 A;  4BDV B;  1GU3 A;  1UY1 A;  3JXS A;  2WZ8 A;  3OEA A;  2X10 A;  4KWU A;  3AC0 A;  3HJR A;  1UXX X;  3IAP A;  2JD9 A;  4AAX A;  5G05 L;  2J1A A;  1CZT A;  1DYO A;  1OF4 A;  1LNS A;  4MOA A;  2J22 A;  3CMG A;  2ZEY A;  3CQO A;  1UY2 A;  5EIY B;  3HN3 A;  1EUU A;  4DUW A;  4QDS A;  2PQS A;  1PX4 A;  1OH4 A;  4A4A A;  2W92 A;  3C8X A;  3UES A;  4P08 A;  2J1S A;  4E8D A;  3HNY M;  3SEE A;  2Y6L A;  3J7H A;  2W9X A;  1GOG A;  2W1W A;  5HPO A;  2ORX A;  3I2K A;  2C4X A;  2VTF A;  4PF1 A;  4YPJ A;  3OG2 A;  5DPN A;  2YG0 A;  4A3Z A;  2DCJ A;  2XHN A;  3F2Z A;  4JKL A;  3NQH A;  5JXI A;  4DUX A;  4QX2 A;  2YC4 A;  2QQI A;  3PUH A;  1JI6 A;  2QQL A;  5B4N A;  4OMC A;  4P02 B;  2Y8K A;  4CU6 A;  5JXJ A;  5B4X A;  4XUN A;  3FL7 A;  2C9K A;  2J1U A;  3ACF A;  5IFP A;  1GMM A;  2EID A;  3VD7 A;  5F7U A;  5LCW L;  2J1E A;  4QB1 A;  2W1U A;  1CZV A;  3K4D A;  4XVH A;  4A44 A;  2YC2 A;  4DUV A;  3BN6 A;  1T2X A;  2XOM A;  1ULO A;  4KI5 M;  2Y6H A;  1XC6 A;  1OF3 A;  1JZ8 A;  3LQC A;  5EJ1 B;  1GOH A;  2VJX A;  2C26 A;  2WQ8 A;  4OUE A;  3HOB A;  4ARY A;  3UNP A;  3C7F A;  1F4H A;  2ZEX A;  5JXH A;  4BJ0 A;  4CUC A;  3LPG A;  2QQN A;  4OMD A;  3C7O A;  3T09 A;  2WO1 A;  2W95 A;  3DYO A;  3IAQ A;  4JKM A;  3DYM A;  2E26 A;  4P00 B;  3HPN A;  4A41 A;  3LPF A;  2EIB A;  4UOJ A;  1J84 A;  2Y6K A;  4DXT A;  3WEZ A;  2W94 A;  4JX0 A;  1UMI A;  2YFZ A;  1D7P M;  3T0D A;  3ACG A;  2DCK A;  1KEX A;  1MPX A;  1SHW B;  2VO5 A;  3LEG A;  4ET7 A;  2J1R A;  2Y64 A;  3CKH A;  4QDQ A;  1JHJ A;  1EUT A;  2VCC A;  3K77 A;  3P6B A;  3WQB A;  3VDA A;  2R7E B;  3ACI A;  2VZR A;  1PMJ X;  3CZJ A;  4CUB A;  2VR4 A;  2ORZ A;  1UWW A;  3SKV A;  3VDC A;  3VD4 A;  2RJ2 A;  1P8J A;  4QB6 A;  2RV9 A;  3MUZ 1;  3UET A;  2VQT A;  1OT5 A;  2JKX A;  3WSO A;  4M4P A;  1UX7 A;  1XPW A;  3THC A;  2VZU A;  3A7Q A;  1XNA A;  2WN2 A;  1JYW A;  2VZQ A;  5JXG A;  4CVU A;  1GNY A;  3GDB A;  2B9V A;  3C7H A;  4QPW A;  4XUO A;  1JZ6 A;  1W0N A;  2VOT A;  1F4A A;  3K46 A;  4FI9 A;  1UYY A;  2J7M A;  3W5N A;  3PUI A;  1K45 A;  3THD A;  1UY3 A;  4CU8 A;  3GGL A;  4XUP A;  4KMQ A;  2W47 A;  5DQ0 A;  1ULP A;  3WNK A;  2W87 A;  2ZXQ A;  3ZM8 A;  4GWJ A;  3U37 A;  5A1A A;  5JUV A;  4PT6 A;  4D0Q A;  2CDP A;  4HG6 B;  1NKG A;  1JU4 A;  3I2I A;  3NNG A;  5CYY A;  3BGA A;  2VZP A;  3K75 B;  2E33 A;  2J1V A;  2W5F A;  1WCQ A;  1W9W A;  2EIE A;  3ETP A;  1JYX A;  1YQ2 A;  2WN3 A;  2WO3 A;  1TVG A;  2WZE A;  1JZ5 A;  5C71 A;  4UAP A;  3CDZ B;  2W91 A;  2VZS A;  4TXW A;  1JZ2 A;  2WO2 A;  1OD3 A;  2V72 A;  1DP0 A;  1L7R A;  3D3A A;  3E1F 1;  5IHR A;  1O59 A;  3OB8 A;  3I3B A;  4DEQ A;  3HNB M;  1US2 A;  5EJZ B;  2VQU A;  1UY0 A;  3T2O A;  3C7G A;  3OGV A;  3WNM A;  3EYP A;  3P1I A;  4QB2 A;  1CX1 A;  3LEI A;  5G04 L;  2HLE A;  3FHQ A;  2KD7 A;  3WNN A;  4QDR A;  4LPL A;  1JZ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...