4QDRA

Physical basis for nrp2 ligand binding
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
321
structure length
314
Chain Sequence
HMQCNVPLGMESGRIANEQISASSTYSDGRWTPQQSRLHGDDNGWRPNLDSNKEYLQVDLRFLTMLTAIATQGAISRETQNGYYVKSYKLEVSTNGEDWMVYRHGKNHKVFQANNDATEVVLNKLHAPLLTRFVRIRPQTWHSGIALRLELFGCRVTDAPCSNMLGMLSGLIADSQISASSTQEYLWSPSAARLVSSRSGWFPRIPQAQPGEEWLQVDLGTPKTVKGVIIQGARGEARAFVRKFKVSYSLNGKDWEYIQDPRTQQPKLFEGNMHYDTPDIRRFDPIPAQYVRVYPERWSPAGIGMRLEVLGCDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for VEGF-C Binding to Neuropilin-2 and Sequestration by a Soluble Splice Form.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Neuropilin-2
total genus 76
structure length 314
sequence length 321
ec nomenclature
pdb deposition date 2014-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4qdrA01
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4qdrA02
1NUKA 3U37A 3PUIA 1UXZA 5EIYB 4CU8A 2EICA 1CZTA 2QQLA 5DQ0A 3C7EA 2YC2A 1I5PA 5G05L 2E33A 3I2IA 1UY3A 2RVAA 2QQIA 2C4XA 1JYXA 3I2GA 2VZQA 3ACIA 3K4DA 4FI9A 1ULPA 3T0DA 2VMFA 3OGRA 4DUVA 4DEVA 5LA1A 3CKHA 2X09A 4AG4A 3WNLA 4LKSA 5JXHA 3C7OA 2R7EB 1OF3A 4DXSA 2JD9A 1GOHA 2DCKA 1UYXA 3I97A 1OH4A 3K46A 2X10A 2ORZA 5C7GA 2Y64A 1TVGA 4JKKA 5JXIA 2RV9A 4OMDA 1JZ2A 1US2A 3WSOA 2EIEA 5IHRA 1XPWA 5JUVA 2VCBA 3MUY1 1US3A 1W9TA 3DECA 4QX3A 2W1SA 4BJ0A 3IIIA 3I3DA 1TG7A 3OGVA 3P1IA 3A7QA 1JZ8A 4DEQA 4ZZ8A 2W91A 5A1AA 3LEIA 4UAPA 3WF0A 1PX3A 3T0AA 2WO3A 4LQRA 2V72A 2W1QA 1GU3A 3HJRA 3K4AA 4E8DA 3T2QA 2ZEWA 3IDAA 5C70A 3GXUA 4JHZA 2YFUA 2VO5A 1K3IA 3I2KA 4KMQA 3OEBA 3K75B 3OB8A 3T2OA 1EUTA 4XUTA 1OD3A 5HXMA 2VOTA 1UWWA 1UY1A 2LS6A 3C7GA 1W0NA 2VZVA 1XNAA 2BBAA 2ZEZA 3T09A 2VZ1A 4KWUA 3CIHA 4XUNA 1LNSA 1J84A 1GUIA 3I2HA 1W9SA 5IJRA 3I3EA 4P02B 3CZJA 1GOFA 4W8JA 4QDRA 4QX0A 2QQJA 5G04L 4ZY9A 5IFTA 1WKYA 4GWIA 3E1F1 1W8OA 1F4AA 1PMHX 2QQOA 3MUZ1 3VDBA 4JKLA 4CUAA 2VCAA 4QB6A 2VL4A 3WF4A 2CDPA 4OUEA 4L0PA 4A6OA 3WEZA 2VM9A 3K4ZA 1KGYA 4OMCA 4A4AA 1GOGA 2YB7A 5CYYA 5B4XA 2VTFA 3GM8A 1NAEA 3MV11 1NX9A 2W1WA 2W1UA 2J1UA 3THDA 2KD7A 3HOBA 2VMEA 3ACGA 3A23A 2XHNA 3C7FA 1JHJA 1P8JA 1SG3A 2WN3A 1H6YA 2VMDA 1KEXA 2E31A 4UOJA 3A21A 3CMGA 4ZXEA 3SKVA 2Z4FA 4GZ9A 1OT5A 4CU9A 2BGPA 1L7QA 2B9VA 2WDBA 3A22A 4XUOA 1UY2A 2XONA 3ACHA 5FUIA 1UYZA 4MO3M 1WCQA 2WUHA 1PMJX 3LPGA 3WNNA 4LHSA 1R64A 3CQOA 3NJXA 4P08A 1ULOA 3WNMA 4LPLA 5LA0A 2QQMA 2VZRA 4XZUG 1W99A 1UY0A 3UETA 2QQKA 4P5YA 3HEIA 3DYPA 2HYXA 3C8XA 4BDVB 3FHAA 3D3AA 2YG0A 4OYUA 2VR4A 3SEPA 2PQSA 1UXXX 4XVHA 4RN5A 4MGSA 1JZ5A 4A42A 3WQBA 3IAQA 5JR2A 3WNKA 4A44A 3PUHA 2WQ8A 1O59A 4HG6B 4QDSA 4ET7A 5C71A 3VDAA 3FL7A 5JXJA 2W46A 2Y6LA 2W87A 2VZTA 2EIDA 1JI6A 2QBXA 2ORXA 4MOAA 3UESA 3T08A 4RYDA 2E26A 1JYVA 2E32A 2W47A 3VDCA 2YC4A 3WF2A 2L9LA 3AC0A 3LPFA 3THCA 3NQHA 1OF4A 2WAOA 2LW8A 4MADA 2WO2A 3DYMA 1YQ2A 5JMOA 2VC9A 3VD3A 4PF1A 5JXGA 2W3JA 2VJXA 4BK4A 3WF3A 4DXRA 2WN2A 2WAAA 1JZ3A 2XQXA 3J7HA 4CU7A 3VD7A 4Z2AA 3LQCA 1JU4A 2J1RA 1K45A 1CZVA 3SKJE 1GMMA 3FHQA 3MO4A 4ARYA 2W9XA 4QB1A 4PT6A 1JZ7A 2VZOA 1DLCA 1UY4A 4CUBA 1GNYA 1EUUA 2ZEYA 4JKMA 2B4KA 4CU6A 2J1VA 3LEGA 4IUGA 4W4ZA 1H6XA 5EJ1B 4ZZ5A 2HLEA 4OZOA 3VD5A 3I2FA 2JKXA 1L7RA 4P00B 1DP0A 3C7HA 4XUQA 2Y8KA 3CDZB 4AAXA 2W5FA 1JZ6A 1UYYA 2BGOA 4CVUA 3MBWA 2DCJA 1SDDB 4JX0A 3IAPA 3WF1A 3FN9A 1GQPA 5LA2A 1D7PM 1JYWA 4M4PA 2J1AA 2WO1A 5IYYA 3ETPA 4D8MA 2JE8A 5F7UA 2JDAA 3LEKA 3DYOA 4DXTA 5LCWL 1W9WA 5DMYA 3I3BA 4QAWA 3NNGA 3MV01 3LE0A 1CX1A 3HNYM 1UX7A 3CZUA 2VCCA 4QX2A 2OKXA 2Y6JA 4KI5M 5B4NA 2DDUA 4DUWA 3SEEA 3T2PA 4CUCA 5IFPA 1RYYA 2Y6GA 4QPWA 3ECQA 5HPOA 1DYOA 2J22A 2VMCA 2BERA 2VZUA 4QDQA 4UI9L 2BZDA 1W8NA 1T2XA 3OBAA 3W5NA 4GWJA 4D0QA 2EIBA 5J1XA 4YPJA 3HN3A 2CDOA 3HNBM 3P6BA 5DN2A 4A45A 2QQNA 1O8PA 4MGQA 1J83A 3ZM8A 3OEAA 2ZXQA 2WZEA 4TXWA 1UMHA 4BK5A 2VZSA 3IB3A 3I2JA 5EJZB 1HN1A 1MPXA 2W92A 4QB2A 2Y6KA 2RJ2A 2WBKA 1JYNA 3EB7A 3HPNA 1PX4A 2ZEXA 1F4HA 4W50A 3JXSA 2XOMA 2WABA 2VQTA 3OGSA 3WNOA 4XUPA 3NRUA 1SHWB 2WYSA 3BGAA 3BN6A 2YFZA 3VD4A 3F2ZA 3W5MA 3GDBA 2J1TA 1NKGA 2VQUA 1UMIA 4M4RA 3WNPA 2VZ3A 1JU3A 1UZ0A 1IQDC 1XC6A 1K12A 4DUXA 1CIYA 3EYPA 4TTGA 1K42A 3K77A 2W94A 2V5DA 2J7MA 2ID4A 3ACFA 3GGLA 4QX1A 2VZPA 2W95A 2J1EA 2C26A 4A41A 3HNMA 3UNPA 2C9KA 1CZSA 5DPNA 3VD9A 4BXSV 1BHGA 4XURA 4ARXA 2WZ8A 2J1SA 1O8SA 1XNTA 4PQQA 3T0BA 4E8CA 5CZKA 3OG2A 2V4VA 5I0DA 1JZ4A 2X05A 3NJVA 3ABZA 4A3ZA 2Y6HA
chains in the Genus database with same CATH superfamily
2KR2A 4QM9A 4ZPIA 2TNFA 4JRAA 1NUKA 2RG4A 1RGSA 3PUIA 3R0RA 5CFCC 3AKSA 3WG1A 1LESA 3N9MA 4XFCA 4YFWA 2XL7A 3VZJA 2D44A 1V6KA 2WKKA 3Q9OA 1DCSA 1LKNA 1F5FA 3C7EA 3KM5A 3POJA 4Q0SA 1WMXA 2QFEA 1VBA2 3WQ0A 2WFF3 1UY3A 5FZOB 1GP6A 2ZHKA 1OSGA 1COV1 4XFAA 3UGFA 1MQTC 1W3XA 2QQIA 4AI1A 1BVP1 3ALQA 4UFHA 3FLTA 1W03A 3K4DA 4FI9A 3WDTA 4URTA 5IW0A 2VMFA 3NKGA 2VQAA 5HCFA 1PO12 1RVF1 5FZLA 3WNLA 3C7OA 1CAUB 2ENRA 4YW6A 5CEHA 3W21A 3ZN4A 4BOWA 2Y33A 4N43C 4NIIA 4DNYA 4Z92B 4IE0A 4XZPA 5SV5A 5KC5A 2VXJA 2ARAA 1AYM3 1UYXA 3QBQA 4LK6A 4Z1VA 1LOFC 1PO23 4XJAA 3THTA 2Y64A 3H0OA 3LFIA 1BQPA 4NR1A 2ZA9A 1WWYA 3KCCA 1JZ2A 5LK5A 2MEV3 2A6ZA 1WA4A 1D0GA 1YWKA 4Y1XA 5FZCA 5LASA 2EIEA 4HT1T 3D6EA 1LHUA 4XFBA 5JUVA 3ITQA 5JOYA 1RIRA 2JDMA 1US3A 3MUY1 1W9TA 5EWSA 3DECA 3GCXA 4KU7A 4QX3A 2W1SA 5FQ0B 3I3DA 3P1IA 2OIIA 1GSLA 4HL0A 4MXVA 4OZXA 3E6CC 4ITCA 2BGCA 2AEYA 1J3QA 2CSGA 2D6MA 2R061 4Q29A 4OHVA 2RS52 3M4FA 2B7YA 2CHHA 5A1AA 3RWKX 5JPNB 3WF0A 2IUWA 2R072 3SQOA 5A1FA 1PX3A 1RINA 3R6SA 3I3MA 1I5ZA 1SMVA 1W2NA 2R062 3GBGA 4UYBA 4BQ4A 5C3OA 3V0BA 3LOBA 1CPMA 1H4HA 1QDOA 2ZEWA 2Q4SA 3IDAA 5C70A 3JB8A 1HLCA 3GZUC 4Y5Z0 4CUGA 1WLDA 5JAXA 2VO5A 3S5AA 1W6OA 2I45A 1QJEA 3I2KA 3ILNA 3K75B 5T5OA 4QPYA 3O1TA 1KS5A 2D6LX 1MVQA 4Y20A 1UWWA 4AVCA 2XJSA 5HXMA 3PIGA 2LS6A 2AC1A 3K3OA 1BBT1 1W0NA 3T09A 3ENRA 3MICA 3CIHA 4XUNA 5FMOL 2BPA2 3WDVA 1GUIA 1GQGA 1HXS2 4JGYC 2LALA 1ND3C 3HMYA 4MVTA 4BQ5A 1GOFA 3POIA 5KC6A 1G9FA 2VPVA 1LULA 4DXZA 4XXPA 5CNAA 3ZLIA 2PN5A 4Y1UA 3POSA 1KFXL 5JDBA 1BEV1 4GWIA 3CJIA 1HJFA 1KXGA 4QWNA 1PMHX 2VGDA 4X6QB 5DZEA 1PGSA 2R0HA 1RL3A 2QQOA 3DXTA 1BBT2 3MUZ1 1AR63 4D7SA 3LF7A 4ZHNA 2XLGA 4KQ7A 4SBVA 1UU6A 3ZFEC 1D4M1 3QH7A 1MEC3 3U14A 2CL2A 5L9RA 3WEZA 5IK4A 2PHDA 4I01A 4B3NA 2VMHA 5KBFA 3FUOA 3TNQA 2AEZA 3I7DA 2ZAAA 3N7MA 4YZ4A 2XJRA 3WY6A 4LXLA 5FZ0A 2BWAA 3KV5A 3OCPA 2JKBA 1XNBA 2WWSA 3C3VA 4QMAA 5B4XA 3H9AA 2RM22 1L3JA 2MEV1 1S2KA 1D4VB 2VTFA 4NHYA 1ZZ7A 2A6YA 3POGA 4N7IA 2R043 1GV9A 3MV11 1ZRIA 2W1UA 1AR62 3AYAA 2KD7A 3HOBA 3RZJA 3FFQA 2C1FA 4PF5A 3A23A 4RQPA 5FZKA 4I0BA 1DGRA 5LW9A 1RUJ3 1P8JA 3LCPA 5GZFA 4BWOA 3SMHA 1RUH2 2WN3A 4BISA 1H6YA 4QKFA 1YXWA 2VMDA 1RUI2 3N9OA 3NJZA 4AI0A 1QOTA 5FY9A 2Z4FA 2ZACA 5LBFA 1IS6A 2D6OX 1WBFA 2OPKA 1SQ4A 4MX3A 4R9DA 3RS6A 4JGZB 4YARA 2BNNA 1W8TA 2RDSA 5IVEA 2BGPA 1Y9GA 4RS5C 5HBAA 2P4EA 1R1A2 5I93A 1XBFA 1H9WA 1UOFA 2FMYA 3IPVA 1ZA7A 5L73A 5K0UB 1RUD1 1OFSA 3GHMA 4LBQA 5FMCA 1RTVA 2W08A 4V1PA 5FUIA 2WUHA 2YV8A 3LAGA 1WW6A 1IS4A 1OQDA 3AK0A 1X36A 3OOXA 3LZZA 5H9QA 5CAZA 5FOBB 4CRQA 1XE7A 1PVC2 2PHXA 2WYFA 2WRAA 3NJXA 3KHCA 1ULOA 3UKNA 1Z7S3 2PAMA 3ETQA 5LA0A 2RS31 1RITA 2HEYF 1TEIA 1WD3A 2ZTNA 3NMBA 3S30A 2OQ7A 4AGRA 3ZYHA 2F17A 4AVBA 2V4AA 3LDBA 3LSEA 3WP5A 3UETA 4E27A 1RXGA 4CE8A 1KITA 4P5YA 2CWMA 1XOYA 1AVBA 2KM2A 5A33B 2JDPA 2BFUS 4GMP1 1OOPA 5E8AA 1RVF3 3BKZA 4LITA 2GAUA 3OPWA 4OYUA 3BTZA 1DU3D 2ZGPA 1OA2A 1ULFA 5F5QA 2RJKA 2UU8A 4YVSC 1CPNA 1IG0A 1HN0A 1ZRCA 3BTYA 4FSJA 2BFUL 4XAAA 3IM0A 5HCHA 1JZ5A 5JR2A 2QVSB 4PDWB 3V65A 3ZX7A 3W58A 2YBPA 5ABJC 3AYEA 4GH4A 3U07A 4HG6B 2BJSA 4IE4A 5BY5A 4QDSA 5J36A 2YROA 4IEPA 3FL7A 3I2OA 4YGDA 4LBNA 4LBMA 4AEDB 1PGW2 2QE3A 2EIDA 4W6WA 1ZZ9A 3LFMA 1BK1A 1G86A 2RS33 2UWAA 1SDWA 4YGEA 1RHI1 1U5ZA 2DUPA 4FQ4A 3T08A 4RYDA 4CEYA 3RZLA 2ZZQA 2E26A 4JC1A 3LA2A 2W47A 4U2AA 2OZJA 4Q1RA 5C5UA 5F9TA 3NAPC 5A7WB 4HVOA 4JDNA 1SBFA 3LPFA 3SH5A 1Q56A 1QQP1 1W0OA 3AP5A 1N1SA 5I91A 3LIGA 1IKQA 1OF4A 3LOIA 1CJDA 1O6UA 2WAOA 4FVVA 4LBJA 2UY8A 4HFSA 4NE9A 5FY5A 2WO2A 3UGGA 1JOBA 2DUQA 5SV8A 2P2KA 3MW4A 4QPGA 3MPBA 1B35C 3DGTA 5JMOA 5JXGA 5A6ZA 4Q4W1 1YRZA 2GSYA 1RUC3 2HWB3 2W3JA 2VJXA 4AEMA 4N53C 1AR92 4DXRA 2WQZC 5FMBA 2R0FA 1RUD3 2WAAA 1HRI1 1CVNA 4WZFA 4KWJA 3KT7A 4FFHA 4Q4X2 1GZ9A 1JZ3A 3V0BB 4LHNA 4P5HA 3RMXA 3B9CA 4FTEA 2ZGSA 3OYWB 1LHVA 3LQCA 4LA3A 4A3XA 2JG9C 1KQRA 1K45A 1TMF3 4NWVA 2JG9A 4XF3A 4GB33 2WZR3 3FHQA 2RE9A 1MACA 4HPKA 5DDJ3 2PELA 4XFGA 5C4WA 3WDWA 4ATEA 3Q8EA 5JSPA 2ZX2A 1DYKA 1WMEA 3M7AA 3O14A 4JDMA 4CEWA 4CCOA 3MW3A 1ZBE2 4MGIE 3WW4A 1DLCA 1UY4A 4H55A 2QKDA 5T54A 2Z2SB 1IGOA 2FD8A 2DWRA 1GNYA 1B35A 3HVDA 1QOSA 1VALA 1EUUA 1GP5A 1W8WA 2VVFA 3WDXA 1LENA 2WT2A 1MEC1 4CU6A 2J1VA 3LEGA 4IUGA 1MVEA 2ZCWA 2HWE3 4I09A 4R9CA 4XBQA 1LOBA 3AZXA 4EQVA 1VBB2 1GWMA 2NMOA 1CONA 2XJPA 3JD73 3VD5A 5A3WA 1YYNA 3B02A 3H3LA 3NAPA 1FNZA 5GLTA 1KRIA 2JXAA 4EJRA 1ULGA 2F4PA 1OC1A 2ZS6B 3URFA 2IFRA 4EZHA 2OXBA 3H42B 4PBPA 4XF9A 1AJOA 4HVRA 4AAXA 4AGVA 5C3PA 1UX6A 4CVUA 3WUCA 1FOD3 5C8WA 4JX0A 4MG2A 1A34A 3DV8A 3I49A 1QOOA 5EHDA 3VBUA 4Q0UA 1D7PM 1OXCA 2C24A 1JN2P 4M4PA 4CCNA 4EWDA 4UFJA 1AR91 2J1AA 3TEYA 3B9IA 3IT8A 1AL23 3GJAA 1E5RA 5FZ3A 1LGBA 1NA1A 3DKWA 3IKWA 4J1XA 3ORJA 4P9GA 3ZKYA 5C9AA 1YUDA 4FCAA 1J58A 4H7MA 2ZX1A 4M01A 4TLFA 1NA1C 1JTZX 5LB6A 5I0UA 1W05A 5F1RA 1HQNA 5A7WA 5FYTA 1DQ1A 1STMA 2X8KA 3LEKA 4Y1ZA 3ZSLA 1TQ5A 2DFBA 3Q8FA 3RPQA 1C3HA 4QHOA 4MLOA 5FY0A 3BI3A 3ZFGB 2QUOA 1SLIA 3AKPA 4Y4RA 2XBO1 4CYDA 4IEYA 1H2LA 1VLNA 4N8MA 3LE0A 3OBTA 1PK6A 1XB9A 1GLHA 2BRTA 2DURA 5DG2A 1H4GA 4XDPA 3WQ7A 1GANA 2AYHA 3RI8A 3ZSJA 4DUWA 3RZGA 1LOCA 1VBC3 1Q3EA 1HRV2 2PLV3 4IGPA 4OLLA 2LUWA 1Q8PA 4QPWA 5HI0A 4CDUA 1CAVB 4AYUA 3VBOC 5HPOA 1RUE3 3POFA 3CL1A 1LHWA 3J4UH 2VUCA 4RQPC 5GKAC 3WR0A 4CXWA 3BALA 2HKXA 3AZYA 1RUG2 1AXZA 4BPZA 3B7MA 2E7QA 1FAYA 1RMU1 3MIBA 2QQPA 1DGLA 3DKQA 4RR3A 5CFCA 1W8NA 2VNRA 2JG9B 2ET7A 2JICA 1O3RA 2WNUC 2AUYA 1POV1 4GWJA 3OBZA 4D0QA 3BOWA 2Q1MA 4AZZA 3GNEA 3UGHA 3BPSA 3C2UA 2G9ZA 4YPJA 1RUC2 2QQNA 4KGQA 3SISA 1V6JA 1O8PA 3ZXAC 1J83A 3VHNA 3OEAA 3S0MA 3CEWA 2VUJA 3UJQA 2WA4A 1EY2A 3A4UA 4UFLA 3I8TA 2Y26A 3I2JA 2JIJA 2W39A 2W92A 3DPRC 3VBHA 3ZYRA 4GB31 2P5BA 3NNMA 3G7DA 4CP9A 1CN1A 4AEKA 1RUG1 1R093 4IE6A 3S57A 1ZREA 1PX4A 2X29A 2WNOA 2ZEXA 4PLOA 4W50A 2P3IA 4QQ2A 3JXSA 4AHWA 2ZGKA 4N9IA 4QX7A 3U75A 2WABA 2VQTA 3OGSA 5JZGA 3NV4A 2DBIA 1UZWA 2GALA 1S0DA 1FX5A 4DINB 1NY72 1VBC1 1OLRA 5IVCA 5K0UC 3BGAA 5A33A 3WD5A 2VXRA 3H7JA 4BQXA 1FOD2 1VJ2A 3RJ2X 4CA9A 3NNFA 4XMIA 5KHJA 1UF2C 1PVC3 4DOUA 3VZKA 5DUUA 1NKGA 5GZEA 4S2HA 4LKFA 3ZFFA 1M06G 2RHPA 2VZ3A 1JU3A 1QH6A 1PVXA 1XC6A 4AK3A 1CAXB 1RUF1 1CIYA 4CZSA 1Z7S1 5BNOB 4DUXA 3TEZA 4TTGA 4A6SA 2ADEA 1OH3A 1F5JA 2RR13 3ACLA 4XDOA 2OA2A 2QTWB 5FY8A 3VKNA 4C1WA 2UWCA 3ACFA 5FZ1A 2ZX4A 3CJXA 1F9KA 2VG9A 3L2HA 3OY8A 3M3IA 3J8F1 4LO5B 5IVVA 1QJU1 3HNMA 4BXFA 2HH9A 5FO9B 1F31A 2LTNA 2C9KA 4FOQA 2WO7A 1C5IA 5BYNA 3WHUA 2TUNA 1BHGA 3D5OA 3PHMA 1OKQA 4ARXA 1QNWA 4ZU4A 2IXCA 2WZPP 1JH5A 4HOOA 1V9U3 1S55A 5F2WA 1PHMA 2P3JA 2WC2A 4PQQA 1Y4WA 5CZKA 4AI8A 3OG2A 2XBO3 3RYRA 2HWB1 3ES1A 3RYKA 4DY5A 1VBA3 2LM3A 2V4VA 4MSVA 4DFSA 3D8CA 4XACA 3PIJA 1JZ4A 4NHKA 1OD5A 1IPKA 1YI7A 1IQAA 2P37A 3ON7A 1BCXA 4HK8A 1FMD1 2ZGLA 3BCWA 3PUQA 5DABA 1PGL2 2Y6HA 2CGNA 1KJLA 1G9AA 4QGNA 4P14A 1URXA 4L11A 1ND3B 4BMEA 1LOFA 3DF0A 1FMD2 1W9FA 4RD7A 1OOPB 5E16A 2E6VA 5EYXA 1V9U2 3VBOA 1TZOA 2GU9A 3HD8B 1S0BA 5FZ9A 2FMDA 2B8MA 2QQLA 1IS5A 3T1MA 4AXOA 5A3MA 4IEWA 1H0BA 3BU0A 1ODMA 3I2IA 1BYHA 5JWPA 3I59A 4QU2A 1WLCA 2CGPA 1D4M3 4HONA 3RZZA 5JPMB 3FLRA 5KHKA 2C4XA 1XSRA 3ACIA 1O91A 3T0DA 1F15A 3FWEA 1DFQA 4DUVA 2XJUA 3QD6A 5KXBA 5FWEA 4COWA 3A0KA 1SLLA 4L2NA 2DYCA 4AG4A 1Q8QA 2YU2A 3FHIB 1MZEA 3MI8A 1OF3A 5DZFA 2TEPA 2HBUA 3ZYJB 3INAA 4BA6A 1ZBA1 5DUWA 2XKOA 4JGYA 4QQHA 4R4ZA 1W8FA 4OQ9A 1ENXA 4IEOA 5LY2A 3I97A 1VBE2 4EYUA 4AHYA 4H3WA 2FZ2A 2ORZA 2V09A 4HETA 4Q2FA 4H7LA 1OA3A 4OMDA 1H2NA 3PU3A 1ZZ8A 3RJRA 1US2A 1YFWA 4D3WA 4L99A 3WSOA 3AVRA 3TEXA 2XG3A 5T5LA 4CDQC 1FPN3 3QH6A 4E9KA 1GNZA 1UIJA 4FP3A 4XJ8A 2Y38A 1FOD1 3IIIA 4B4RA 4RL7A 1TG7A 3USSA 1VPHA 3EHKA 4IV3A 5K9YA 3A7QA 4CSWA 1LOEA 4TZDA 1RUI3 2YU1A 1W90A 4OHXA 5FZGA 3DPRA 3RZHA 4QGMA 1YHFA 2W91A 1J1TA 3LEIA 3BTXA 2C5DA 4OCTA 3WW3A 1VAKA 2ARCA 4B7KA 3H7YA 2P6HA 3HJRA 3K51A 2R30A 1H1MA 1S1AA 1WCSA 5FDBA 3E5QA 4I0WB 3ROUA 4LOTA 2IXJA 4GIQA 4BQWA 1RJ8A 4NN0A 4C8DA 2Z42A 2YFUA 5FPUA 4CDXC 4P9IA 4YW1A 3OEBA 4CEYB 5FP9A 3T2OA 4IETA 1R083 5A3TA 1OD3A 1PO11 3N9NA 1WGPA 2D5HA 4PCRA 2WR9A 1W28A 4IE5A 3C7GA 4Y22A 1XNAA 2BBAA 4TLGA 5FP7A 4OQ8A 1YQ8A 4JQRA 3KCXA 2PHLA 1OI6A 5KHGA 3ZXJA 2HWF3 1Y3TA 4IV3C 3P3PA 3EBRA 4XJ9A 1O4YA 3I3EA 3CZJA 4P02B 5FWJA 1ASJ2 4L9BA 4NMIA 4QDRA 3BUCA 4NIGA 2QQJA 4M00A 4XE9A 1N3OA 1W8UA 5IFTA 3E1F1 1G8WA 4NROA 5J96B 4CPBA 1MS1A 2RMU3 3BPZA 3WOGA 4YW3A 5I0TA 4AW7A 4OVEA 5JIUA 5EPAA 3IN9A 3VDBA 4F7ZA 2VCAA 1POV0 2VL4A 3WF4A 1YC61 3R4UA 2CDPA 2JE7A 3AL5A 3TYJA 1R1A1 2DU1A 3UJOA 1FNYA 2BTVC 1PMIA 1UIKA 2VBBA 5DAPA 3U11A 3K4ZA 1KGYA 3VHPA 4A4AA 4UT5A 1FPN1 4LULA 2HWE1 1NZCA 4YW7A 2BVBA 1PM7A 4LO4B 3QOPA 2ARBA 2BDRA 4ISQA 5JMCA 2GC1A 3VZMA 1PIV2 2CU5A 4LO6B 1W8ZA 4DIQA 3J9SA 2WWJA 3IDBB 1RUD2 3VDDB 4GXLA 5CG9A 2W1WA 1YLLA 4HANA 5JR7B 3ZFGA 2J1UA 1QIQA 4V2VA 2HWF1 2VMEA 5FZ7A 1UOGA 2XHNA 3AMPA 3C7FA 2R1BA 3B01A 4BLIA 3AP7A 1EAH2 2DCYA 2Z5WA 1SG3A 2PHFA 2A71A 4D7YA 4GWNA 1CR7A 4ZXEA 5C9AC 1HQLA 3I3QA 4JTOA 5FCCA 2D6PA 1H1IA 2ZHNA 4CU9A 1NXMA 3HT2A 4WZCA 1VRH1 2PXJA 4NOTA 5FK8A 3VL9A 2GMEA 1VBD1 4GMP0 1FI2A 3SC7X 4JVAA 3OY8B 1IHMA 3VLBB 1UY2A 2XONA 3TN92 4QXHA 1VMHA 4YVWC 4QPIA 4JCKA 2VNVA 2RS11 4J1WA 5L9BA 4EWEA 1QF3A 4PBOA 3GALA 4LHSA 2DTYA 1UPSA 2ARXA 4H2AA 4B1MA 4P08A 4OI2A 3WNMA 2WZR2 3VZNA 2K0GA 4CDWC 3AKQA 4QKBA 2EAAA 1C1FA 4PIXA 1B09A 1AR81 4XZUG 4IE7A 4AI3A 4QXBA 1CESA 1HXS3 3MLKA 4UW6A 5D21A 1OKOA 1LAJA 1OA4A 3VDDC 1GICA 4CDXB 5AFEA 2WSUA 3ZSMA 5FY7A 2WNUA 5A1LA 2IWGB 2I07B 1UU5A 3MYXA 5JI9A 4FTBA 3HEIA 4NIDA 3DYPA 5IATA 5KXCA 4BDVB 4BHPA 5LRRA 1TMF1 2DFCA 3D3AA 2GH8A 2VAUA 2YG0A 3H8UA 3RSJA 4AE2A 4BQ3A 5IK8A 2YC0A 4UF0B 1QMJA 3AZZA 2BOIA 4AQ2A 2FDHA 1PZ7A 1NT0A 4Q4W2 1V6MA 2PQSA 3GJBA 3RG0A 5FLJA 2PHRA 4FPJA 1YI9A 3VBFB 4RN5A 1G7YA 2VW0A 3RGBA 1H8TB 5L36A 3WQBA 3IAQA 4GMP3 4LO7A 2P6CA 4QQOA 4TN7A 4COUA 1W39A 5IK5A 1OPOA 1EPWA 4D94A 1OQEA 3PTYA 4ET7A 5C71A 2DCTA 5AC92 5CBLA 1X9TA 2YGLA 3O5SA 1LB2A 5JXJA 3FC0A 3LDKA 1QJU2 2W46A 2Y6LA 2W87A 2VZTA 3UK9A 1S0EA 1CGPA 3ES4A 2ORXA 4MOAA 4HVQA 5BNOC 1FMD3 3LEMA 5GLUA 2D6NA 1PGW1 3W59A 1VBB1 4Y26A 3ZDSA 3WF2A 2L9LA 1NE4A 1O7FA 4XQ4A 4CDWB 3GZTB 5L7OA 5FYHA 2NLRA 4O61A 4AFAA 4AQ6A 1WBLA 1D2QA 4YW5A 1DLLA 4WV8A 5LWBA 1QJZA 1AZDA 1YQ2A 2XVLA 4AFMA 4GB32 2BYVE 3U78A 2VH9A 1TME1 3ZXKA 4RR3C 4LKEA 4R9BA 1RUE1 1JYCA 4BK4A 3PMEA 1MZ6A 2R042 2WN2A 4WBBA 2PHUA 5T5PA 3MGUA 2JG8A 3EMRA 4WM7B 4XBLA 1BLZA 2ZGQA 1WW4A 1X8EA 3KD4A 4N43B 3S7IA 5FIXA 1X82A 3ASIA 3M1HA 4MZUA 2G19A 3BODA 4KL1A 1ZYBA 1LGNA 3MO4A 4RHV3 5F5AA 2HWD1 5IAVA 4HSLA 2HWB2 3S7EA 2FHRA 4YM2A 3UV9A 2XR4A 2XUMA 4P9JA 4QB1A 1F35A 4AL9A 4CDQB 2DTWA 2D98A 5EZWA 4YZ5A 3JUUA 3HQUA 1MZ5A 1TNRA 4QQLA 2VZOA 3FFZA 4ZS3A 4ZU7A 3VBRA 3POYA 5FV3A 2BW8A 3E6DA 2AH2A 4LOSA 3KT1A 1RMU3 4LMFA 4D69A 2CYFA 1H6XA 2YXSA 1OMIA 1V6LA 5FJKA 4YGCA 4E4DX 4ZZ5A 4AGGA 2HLEA 1VIWB 4OZOA 4LA2A 5I8TA 4YM0A 3KLSA 4P00B 4RGGA 5C3QA 2I74A 5H9SA 5F3CA 4AF9A 1W06A 4TWTA 4K8RB 4Y1YA 5EYYA 5C8CC 1APNA 4FFFA 2RDNA 5D8AA 2ZHMA 1O3SA 4PHZA 2E51A 3FN9A 1ND3A 1UL9A 2ZX0A 3B00A 4HMZA 4R8HA 5LA2A 3WX5A 3KQRA 2VOKA 1CAXA 4JTNA 2GC0A 1JOJA 3LA3A 4XPVA 1W0PA 3ETPA 5LRSA 3CNAA 3KQ4B 4EWAA 3OYWA 4NIAA 4Q1PA 4I30A 4IESA 2HBTA 5CVRA 1Q8SA 4AHXA 1NZIA 1RUE2 1S0FA 3KB5A 5FPZA 3WCRA 1QU0A 5DDJ1 4OI4A 4LNVA 4OUSA 1WZXA 3RZMA 2DVAA 2BNMA 4NPRA 1HRI3 3MV01 3RMYA 3X29B 4K3UA 1H2KA 2MPFA 1BXHA 1UX7A 3O12A 3EO6A 2DVDA 3D82A 4QX2A 3NNJA 4FFGA 1ACCA 3SEEA 1X50A 4BH9A 4CDUC 3O1SA 1XYOA 3OUJA 3T2PA 3AXDA 4AVAA 4K40A 3WCSA 4JZRA 1RYYA 3MZHA 2Y6GA 4P9LA 5J98B 3WINE 1NE6A 2K9ZA 2OQ6A 2ZKNA 3OD4A 3J8F3 2BERA 4PIYA 4XCBA 5FAXA 5T3NA 2CAVA 1D4M2 1LEDA 1KDMA 1Q8VA 1WW7A 4UI9L 2OPWA 1LTEA 5GJ6A 4ASKA 4GJZA 5JOZA 1HB3A 5E6HA 1PK6B 3VN4A 3ZIWA 1PIV3 4QX8A 3H1MA 2EIBA 3K2OA 4IV1C 1XSQA 1V0AA 2CDOA 3HNBM 1NCRC 5DN2A 4YYOA 4CDXA 4CTEA 5JSOA 3TNPB 4B7EA 4G3YC 1C28A 2YBSA 2Q8OA 1W6PA 2ZXQA 5LEJA 1IPSA 2WZEA 1UMHA 1MZFA 2K2SA 2XVKA 3PNAA 4AVVA 2KXLA 1AYM2 1PZ9A 4TSVA 1RUJ2 2Y0IA 1LJ7A 4EV0A 4XC9A 2WBKA 1XU1A 1G9CA 5CADA 1KJRA 1XXNA 1TMF2 1J3RA 4TYSA 1YQ6A 2Q0AA 1BK0A 2XOMA 3SCFA 2NN8A 2JB8A 1R1A3 3WNOA 4HN0A 5K8SA 3NSTA 4Q0QA 2Q30A 4XUPA 2FCTA 3NRUA 2RDRA 2WYSA 2D7FA 1QJY1 4YG0A 1XU2A 5GZGA 4XEZA 5EV7A 4E4SA 1V6NA 1AR73 3VD4A 4CCDA 3F2ZA 3GDBA 3I54A 1EV13 5I8SA 2P1BA 2J1TA 3CLPA 4UBGA 1SACA 1Z7S2 3EXUA 2VY0A 4CP9B 4S2FA 1Z78A 2XH6A 3ZFFB 1SLAA 4Z2WA 2R071 3DPRB 5F3EA 3U4XA 5A3NA 3FZ3A 3M2MA 4JQTA 1UZ0A 3MLJA 1PO21 5JLVA 2H6BA 3PU8A 4FPEA 5CG8A 1K42A 4QPIC 5A3PA 3K77A 3VKFC 2JENA 3MDPA 3J7NA 4I3PA 2Q5TA 3GGLA 4QT6A 2W95A 3NNLA 3WZ1A 1YFYA 5FLIA 2J1EA 2FDGA 2C26A 3O0WA 1IZ3A 1ZZBA 2NMNA 3KWVA 2F4LA 5JZGC 3FE5A 4UBHA 2AR6A 3KVAA 1XQNA 1ZVFA 1RUC1 1CZSA 3H1WA 4B1LA 2WJSA 3ZXLA 3DUIA 4YWAA 1W6QB 5FFOC 1ZZ6A 1WUVA 3ZYPA 4CCJA 2E7TA 3OGJA 2WZ8A 4LTAA 4C1XA 4P9YA 1XNTA 2GC2A 4LE3A 4LHLA 3T0BA 3HWJA 2XXZA 4HKOA 1I6XA 3L9JT 1AX1A 2DVGA 3EQEA 1Q5OA 3AFKA 4M3CA 3M3EA 4M0NA 3VHRA 3MF6A 3NJVA 2A3XA 2X5IB 1QJU3 3W9AA 3WUDA 1JZ6A 2QQWA 3E5UA 3U37A 4LE4A 3WW1A 1HQWA 1QJFA 1UPIA 2EF6A 3TOJA 4BQ2A 2ZZJA 1GKBA 2FCVA 4Q4X1 1H30A 3WP6A 5EIYB 4MXWB 4CU8A 2B46X 2EICA 2VNOA 1CZTA 5BPXA 1A8MA 2GC3A 1QXRA 2HWD3 3S6PA 3JBG2 1VB4A 1I5PA 3J7LA 1RHI2 2E33A 2HWC3 1VBE3 1KS4A 3AVSA 5T5JA 4D6RA 3TBDA 5C4WB 1RJ7A 2WQ4A 5BNOA 4MGYE 1DQ6A 3T4HB 4NHMA 2D43A 2VMGA 3PTRB 2JX9A 1BKZA 3O1VA 1JYXA 1QXPA 2VZQA 4UFMA 3OGRA 5J48A 3ZOIA 1LODA 3KVBA 2ZGOA 4LK7A 4ZXKA 3ZPOA 4DEVA 1QKQA 4FAHA 5HCAA 5JXHA 2JIGA 4FO9A 4LKSA 4RGAA 3VBRB 1KFUL 4LO8A 5ANNA 2A6WA 3AXEA 5A3LA 5C4WC 2JD9A 1G6NA 2ZHLA 3BOPA 2CNAA 4GKYA 1AR72 1GOHA 1YNAA 3JBG3 4GAZA 5DAVA 3MIEA 4BM8A 2RM21 4ZS2A 1SCRA 2DCKA 3MIHA 2QZ3A 4CP2A 1OH4A 1E5HA 1JXNA 2VUDA 3K46A 4Y24A 1UO9A 5ACA2 1AX0A 1ENQA 5C7GA 1SFYA 1ZRDA 1N1YA 5APAA 1E57A 4RS5B 4KG0A 1TVGA 4FOVA 5FZDA 1DZTA 1S2EA 2GP5A 5HXVA 4XIKA 3VV1A 1C8M3 4WM7C 4RHV1 3WXPA 1W6MA 1AYN3 2O1QA 5CIRA 1OUSA 4F3JA 5I8YA 2VCBA 4WM7A 4KBZA 1R1ZA 4XJZA 5D1IA 2ZOEB 5CA6A 1GNHA 1YFXA 5CKNA 5ABJB 4AFBA 1SZBA 2Y34A 1S2BA 3OGVA 4UW5A 3JQXA 3BYWA 2IXLA 4KWKA 1JZ8A 1ZBA3 2AACA 2ZJCA 2OYZA 3VBFA 2DBNA 4ZZ8A 1PVC1 4HXCA 1WA6X 1Y7BA 1U0AA 1OVSA 4UAPA 1NCRB 2DVBA 2ILMA 2XLAA 5F39A 4WM8A 4N43A 3T0AA 2FDJA 2WO3A 4QKNA 4PI2A 3ZSKA 2W1QA 1GU3A 3K4AA 4E4ZA 3T2QA 3WP4A 5CFDA 1ENSA 5T52A 5FZAA 4LBQB 1W9YA 1I9RA 1W6NA 2OX0A 1XYNA 5DAQA 3RI9A 3ME2A 4YG3A 1QGLA 1C4RA 4HZFA 2VOTA 3FBYA 2XMLA 4NO4A 1RUI1 1AXKA 4EROA 1KDKA 1BBT3 3L2YA 4KWUA 1RB8G 4ASLA 3O0XA 1ND2A 1ODNA 2NZ9A 1LNSA 3T30A 1Z0HA 2VE1A 5KHHA 5IJRA 3ATGA 2O14A 4MXWA 3ZSEA 4YVSA 1X9PA 5CU1A 1H8TA 4W8JA 4YGBA 5FPXA 4QX0A 1VMJA 5F32A 4ZY9A 5G04L 3AP9A 3DN7A 4W65A 4WVWA 5BNPA 4GJYA 4XHBA 3RVHA 1SFPA 1WKYA 2FCUA 3ZXEA 4RSUA 1O5UA 1IKPA 3USUB 3GBWA 1W8OA 1Q8OA 1F4AA 2WINB 4BZ4A 1JHNA 3PDQA 2ZX3A 1SEFA 2WFPA 4GWMA 1OURA 5LBEA 3RYPA 4CUAA 2XJVA 4PDWC 3O1PA 2YPDA 1FYUA 1YFUA 4OUEA 4L0PA 4A6OA 2HWC1 4QM8A 1BVVA 2VM9A 1QQP2 5BUVA 2RS51 1QHDA 2RS12 4OMCA 4XTPA 5A7SA 1W2OA 1GOGA 2YB7A 3WQ1A 2CV6A 2W52A 1XNCA 2F6BA 4YM1A 4XTMA 5FYMA 4OI0A 1BEV2 3IZOA 3D0JA 3JCIA 3PLQA 1VBD2 4IV1B 1VRH2 3GM8A 5KHIA 2H0BA 4XDQA 2WZR1 2OW4A 4J25A 5FPBA 2AENA 5LA9A 3U1XA 1D2SA 1K5MA 2B42B 1MEC2 2G1MA 3ACGA 1HV0A 3KSCA 2V73A 1POQA 4NHXA 4LORA 4YZ3A 3THPA 3N4MA 1JHJA 1O5LA 1VP6A 2VULA 4Z07A 3OGGA 4URAA 5FREA 1DIWA 2ZAHA 1REFA 2CTVA 2E31A 3A21A 3CMGA 1W6QA 3SKVA 5EP9A 3FBMA 4LT5A 4GZ9A 1LHNA 2UYAA 1UMZA 5C3SA 4LUMA 1VBD3 1OT5A 2YYOA 1W2UA 2YZ4A 3FUQA 4O7XA 2R063 4Q0PA 1L7QA 2GNTA 2EA7A 4YLZA 2B9VA 2GN3A 1C8M2 2WDBA 3NWKA 3VGIA 3A22A 1MS3A 4XUOA 4FOYA 3CBNA 1NLRA 1FPN2 4YSFA 3AZWA 4JGZC 5BXXA 1H9PA 1K5MB 1PMJX 2ZGUA 3LPGA 3R4SA 4HKLA 1RMU2 3WNNA 1K5JA 3ZXGA 3VB9A 1J1LA 4FAGA 3CQOA 1COV3 2PQQA 3BU7A 1I3HA 3KF3A 3SITA 3VZLA 5F3GA 1EYBA 4RR3B 2IZWA 1MS4A 2Z79A 1DYPA 2VVEA 2VZRA 1JOPA 1HB2A 2JDNA 4G9SB 4C91A 5FUNA 3JU9A 2OUHA 3FJSA 3DL3A 4AI2A 1ZRFA 1Y9MA 4YVSB 5H9PA 1RUH1 4D7TA 1W2AX 4WVMB 4EZ4A 3AYCA 4E4HA 3AP4A 2X5IC 3NW4A 1CIWA 5FLHA 1SBDA 1YCIA 4NUBA 3AMNA 3KF5A 3FHAA 2ZGRA 4FPHA 1QDCA 1LGCA 2GN7A 2W2IA 5LBBA 5AVAA 3SEPA 2K46A 3KZ4C 2D97A 3F95A 2AREA 4XVHA 3KV6A 2CGOA 3G6JB 4G4FA 1OLQA 2PYTA 4IXLA 4NPLA 3LDRA 2JDZA 4CPBD 2BEOA 4QU1A 2VU9A 5E89A 3WNKA 3ZYBA 1CAWA 1M4WA 1WLWA 4LBKA 5FXVA 1O59A 1RC6A 1TNFA 1JUHA 3BTAA 4IEQA 1XE0A 1HJGA 5T50A 3ZO0B 1GR3A 3KMHA 5C6CA 1QH7A 1LU1A 3CHXA 4AFCA 4COYA 1DQ2A 3ZKUA 1UCXA 2VOWA 1JI6A 2QBXA 2P17A 3ZMNA 2A3WA 1UQXA 2VW1A 3AB0A 2VMIA 4JHTA 4QPIB 1AL21 2E32A 1WMFA 2YC4A 5FQ0A 3AC0A 3UL2A 1HRV1 2OT7A 1XNDA 3W20A 4UXAA 3ZFFC 3NQHA 1K5MC 5FXWA 1V70A 4MADA 1V9U1 3H3ZA 4I02A 4XFFA 2GDFA 3DYMA 4WM8B 4YNIA 1WMDA 3MFAA 4X8PA 3LKJA 3U4SA 5LZ6A 2BNOA 4MYEA 1NCQA 2WLPA 4C0BA 2VC9A 3B93A 4PF1A 2HEVF 3HT1A 1VBA1 4A7YA 1SLCA 3VKOA 1NCQC 2A6XA 1OHFA 3N9QA 3WF3A 5FZBA 2PMWB 4DS0A 4BMBA 2D6KA 3IBMA 5EQUA 4YW4A 5IVYA 2W0XA 2XQXA 3UYJA 1N3QA 1AUYA 1S0GA 5L7OB 1FV3A 1XE8A 3PVBB 2C0ZA 3VD7A 4CU7A 4Z2AA 2WS91 5DZGA 4EN0A 3SNMA 1HXS1 3IPVB 3WDUA 2J1RA 5IVFA 4DRVA 4HPKB 3QCWA 1CZVA 3SKJE 3UT0A 4FPGA 3VBHC 1WCDJ 5CFCB 5ACA3 4V2WA 2XDVA 4CCEA 5FZOA 2VUAA 2UYBA 4B4QA 4MGTA 4UFIA 4A7KA 2WNVA 4GA9A 3ZYFA 3ZPYA 4XMAA 4PT6A 4XAEA 2XPJA 1REDA 1CD3G 1VB2A 3RQ0A 2JG8B 2JDKA 2QJVA 4W6XA 4A2UA 1OUXA 5H9RA 3N35A 1ZBA2 4AFDA 1W2TA 4IEXA 3M3QA 3S5QA 2XQRA 1DZRA 2B4KA 2VVDA 2BBVA 4W4ZA 4JAAA 1R092 4LLOA 1T6GC 2ETEA 4I3GA 2YBKA 3GHNA 3JD71 4IQPA 1CX4A 3TWIA 2JKXA 2QQVA 1L7RA 2B9UA 3VL8A 3HBZA 1IG3A 1DP0A 3C7HA 3TB0A 3ZFEB 4Z8BA 1QJX2 1SFNA 2Y8KA 1BMV2 1PNGA 4R9AA 1CAUA 3BIWE 4QX5A 4F83A 2W5FA 1OOPC 4LBOA 1XYPA 1HW5A 1WCUA 2D3RA 2XB6C 3IIAA 4UWDA 4QHZA 3MBWA 4GD4A 2BP6A 1JS9A 4LIVA 3IAPA 3WF1A 5FMOS 1EP0A 4HLTA 4Q8LA 1NQJA 3ZXFA 1MQTB 2UURA 2G9GA 4WM8C 1RVF2 5DG1A 5GLZA 4AAPA 1ASJ1 1SCSA 5FXXA 1DGRN 3FLPA 4XXAA 1E5IA 5LEKA 4CDWA 4NJ4A 1UYPA 2JE8A 2Q8CA 4DY3A 3B94A 3H8RA 4EE2A 4FOWA 2JDAA 4PDWA 2ES3A 3DYOA 4WVZA 3WG4A 5LCWL 1ASJ3 1W9WA 4FXKB 3GF6A 5DMYA 1GZTA 3PUSA 3VDDA 4IGQA 4QAWA 3AFGA 3NNGA 3IMNA 3VBSC 5GM0A 4PI0A 1MS8A 5FYYA 1CX1A 1SLTA 2JDYA 3AX4A 4FPCA 3ZN6A 2VCCA 1GP4A 4H14A 1VAVA 3GYDA 3AKRA 5B4NA 1ZA4A 5IVBA 1A78A 2FDFA 1H2MA 2JDHA 3J7MA 3GBFA 4DQAA 4DB5A 2QNKA 2P3YA 1LOAA 5F6LB 1FT9A 3AMMA 1DYOA 3ZN5A 4K21A 4B4PA 5JOXA 2CWSA 5M0TA 1F8VA 3NVCA 1WLTA 1QQP3 4KNCA 4Z82A 4QDQA 3ILRA 3TRSB 4ASMB 2BZDA 1DBNA 1T2XA 3OBAA 3W5NA 3HBKA 1OFNA 1NCRA 1GWKA 4FQZA 4MV2A 5J1XA 4M3CB 4NWWA 4Q4V3 3HN3A 3P6BA 1W04A 4PLNA 4WVMA 2Q8DA 5FZ6A 3MEPA 3BB6A 2PA7A 2GMPA 3ZM8A 1W6PB 4UFKA 3ZXDA 4BK5A 2VZSA 3IB3A 5ISLA 1RHI3 5EJZB 1MPXA 1DQ0A 1UKRA 4DO0A 1YO8A 2Y6KA 4LHKA 4Y4YA 1LU2A 3ZR5A 1JYNA 3H8XA 4Y22B 4FPLA 2HWE2 3VBRC 5F5CA 1NY71 2LRPA 3EB7A 3VHOA 4E2GA 1F4HA 4UF0A 1LHOA 1AL0G 1YIFA 2C6SA 1AX2A 3JBG1 1SPPA 2AZ5A 2DCZA 2ZABA 1JYIA 2VQ0A 5FPAA 2E53A 4XFHA 4HSJA 4YZ2A 1HKDA 1UKGA 2RR12 1AR61 4N53A 1WCKA 1U5YA 3BN6A 1CQ9A 3UKVA 1ZBE3 4N90A 2QCSB 2YFZA 3AMHA 3MPPG 5FYBA 3AP6A 3VBSA 3PURA 5BNNC 2JB4A 4NVPA 2ZMKA 1C8M1 3PUAA 4Q8KA 4CCKA 3ZIXA 3B69A 1N3PA 4L92A 4YW2A 1AF9A 4D6QA 1V6OA 5FTTC 1YQCA 3WNPA 1L7LA 3AKTA 1IQDC 1NYWA 3OUIA 5GLVA 2VBDA 4AQTA 4AWDA 3AJYA 1GYKA 4CCMA 4GKXA 2W94A 1LOGA 3VBSB 2VD7A 3EJKA 3ZYIB 3O1OA 2J7MA 4M0HA 4XQDA 2RR11 4QHBA 2ID4A 1ZNPA 3D4KA 4GALA 4NRPA 4QX1A 4WVVA 2IXKA 3TN91 1KD7A 4HKWA 1YQ5A 2XL9A 3CJIC 4XQWA 5CKMA 5FYIA 2ZKLA 3CF6E 4LJHA 4MHRA 4EN9B 5L19A 3ST7A 5JVVA 3UNPA 5LBCA 5C5TA 1AHSA 2HYKA 2PFWA 5FYVA 5DPNA 4IEUA 4Q4W3 4MUVA 4IEZA 1ZZCA 4XURA 2VOVA 2Y0OA 3O7OA 4XJWA 4FBFA 4LLFA 1SBEA 2OUJA 2J1SA 3GZEA 2DUOA 1QJY2 2IXHA 5FY1A 1O8SA 1RUOA 2WFF1 3AYDA 1DGWX 1T6BX 4RFRB 4E8CA 2FDIA 3POWA 1WW5A 4AVTA 5CFDB 2IVIB 4AHZA 3M70A 2HWC2 2WNVC 4W6YA 2YDEA 5I0DA 2WT1A 3AL6A 1LRHA 4JRLA 2FZ1A 3WT3A 4LR4A 3R05A 5A6XA 5A3UA 2OZ6A 1VBE1 1EPZA 1HN1A 4A3ZA 2XVGA 4Q4V1 3SHRA 1C57A 5FP8A 4Y5TA 2KA3A 3HIFA 3I4IA 3BVCA 4HBNA 1UW8A 2XHKA 1UXZA 5J09A 1O3QA 3PL0A 4BYYA 5A6QA 5EJ3A 1O3TA 5DQ0A 3I2DA 1ND2B 4IEVA 2YC2A 2RS13 5BNNA 5G05L 4XW3A 3FX3A 4XBNA 1YJLA 3OTFA 1NG0A 5KXEA 4I2OA 1UN1A 1YEWA 1YIPA 2RVAA 5FZFA 2RM23 4A7ZA 1ENRA 5HV0A 5D8AC 3I2GA 3KGZA 4AOCA 1ULPA 1CJPA 3H50A 5DUXA 2EXJA 3VBHB 3AJZA 4K7JA 4COZA 5LA1A 1JW6A 1GQHA 2X09A 3CKHA 1PZ8A 2R7EB 3T1LA 4DXSA 1SLBA 3MIFA 4Q26A 1EAH3 4FFIA 5KWRA 4LEJA 2UY9A 1Y43B 1ULDA 4XILA 3N9PA 5FK7A 5FR3A 2J42A 3KHBA 5FKCA 1PGL1 2H0VA 4ATFA 3OJBA 4NRQA 4DZGA 1E5SA 2NQYA 2X10A 4AQSA 1NCQB 4RHV2 2E9QA 1BJQA 2JWPA 2R073 5FBZA 5E1RA 5DDJ2 1DQ4A 3TAYA 3QLQA 4JKKA 3KT4A 3NJYA 2RV9A 5JXIA 3V0AA 4LBQD 4HN1A 3KV4A 1DGWA 4QD2A 5DAWA 5FZIA 3WNXA 5GZDA 1OQ1A 5ACA1 3MW2A 1ONAA 1PK6C 5IHRA 1JBCA 1XPWA 1FV2A 2BWCA 2R6QA 1REEA 1RUF3 2A7AA 3JB4C 4P9XA 1CAWB 2HJIA 4BJ0A 2LROA 5GZCA 4QQPA 1J3PA 1UD1A 1D0HA 1COV2 3ZN6B 1MS0A 1R082 2XLFA 4DEQA 1ZRRA 1EV11 4KGGA 1C5HA 3HAGA 4LQRA 2V72A 2VECA 4Q4Y3 5ANQA 4M3CF 3M3OA 4E8DA 3CO2A 2VNGA 2ZMNA 2AGSA 4U36A 2A75A 2H6CA 5D2AA 5FP3A 3GXUA 4JHZA 2YPJA 3U10A 1HX6A 5K4LA 4PLMA 4BB3A 1K3IA 5J37A 4KMQA 4BIFA 1VMFA 2DV9A 3OB8A 5IWFA 1EUTA 4XUTA 3E97A 1UY1A 2NPIA 2YUEA 4MGZE 2A6VA 1W8HA 2VZVA 2QQUA 5L9VA 1Q43A 1RUJ1 2ZEZA 1GBGA 4PJYA 2VZ1A 4INDA 3WLUA 2WL1A 4P9WA 3H8OA 2EIGA 3DXUA 2XUEA 3APBA 1J84A 4FPOB 4IGOA 3I2HA 1W9SA 2ZBJA 5EFUA 1S0IA 2A5ZA 4CXXA 4IERA 1V00A 2Q1ZB 5AVPA 2G9FA 3ZFGC 4NAOA 1HB4A 5FYCA 4UW3A 4AI9A 3O0VA 4BCUA 4K20A 4YVWA 5K0UA 3KCYA 5F6KA 1UOJA 2ET1A 2P3KA 2YGMA 5JOWA 5IVJA 1X8MA 3ZMOA 5JZGB 1VRBA 4YM3A 2R32A 1C8NA 4KBBA 4QXCA 4BQ1A 5IT6A 5F37A 4NHLA 4JKLA 4Y1VA 2R16A 4JV4A 5HCBA 4OHYA 3N7KA 3VBUB 5ABJA 4QB6A 5E88A 4META 3WVJA 3IDEA 1CAVA 1ULEA 1VBC2 3E6BA 3ELNA 4IDZA 2XWJB 2PLV2 4FP2A 3V56A 3OD0A 1W6MB 1UZYA 2HWD2 1H1AA 1GZWA 2B5HA 2GNDA 3D0SA 3LIHA 4XFIA 4Q5OA 5LATA 2ZGTA 5AC93 1TME3 4XF0A 2EVXA 3NV3A 5CYYA 1XRUA 4N7UA 3CU7A 2EAKA 2EXIA 1C1LA 1AR93 2JJ6A 2RS32 4XIOA 2WNUB 1NAEA 2VTXA 5JIAA 1NX9A 4CEWC 1OBNA 5IAXA 4R4XA 3THDA 2OVUA 4GH4B 2QZ2A 2R041 4RQPB 3LD8A 3V64A 4Y5SA 2BV4A 5KXDA 2PHTA 2JE9A 3A0NA 1KEXA 4UOJA 2FBEA 4BE3A 5F7UA 2RS53 4XF4A 1PO22 5DXDA 4UW4A 1VRH3 2V5YA 2GZWA 4B29A 2MEV2 4FTSA 1UAIA 1ULCA 4J6GA 4LKDA 3B5LB 2R49A 1X33A 3ACHA 3VBOB 1UYZA 3RRDA 4MO3M 3IMMA 1WCQA 2DVFA 5BNPC 4OFGA 5FYZA 5FY4A 3OPTA 1V6IA 5LK7B 1RUH3 3OSDA 3PVEA 3KS7A 4ZONA 3JQWA 1R64A 3AM2A 1EV12 4EN8B 2GP3A 4I0AA 1HV1A 3MF9A 2PTMA 3UKTA 5A7OA 3JD72 4LPLA 4R52A 3SLIA 1I1EA 3V0AB 2QQMA 1NLQA 2IC1A 3LGRA 3PJQA 2XGXA 1W99A 2FQPA 1MR5A 3ILFA 1UY0A 3E5XA 3Q8CA 3MLLA 3T3YA 4E2SA 4F8AA 3RZKA 2WLQA 5F8PA 1W6OB 2ZGMA 2QQKA 3K48A 4Y3OA 1AR82 4CEWB 5J7MA 3B3QE 2WNVB 4ORFA 4OHZA 5C3RA 1QXJA 2YHJA 2W68A 4IV1A 3Q8BA 1UZVA 2HYXA 1NA1B 3C8XA 4Q0VA 4S2GA 4S2DA 4BIOA 1H8TC 2ERFA 3HQXA 3U0ZA 2RMU2 2VR4A 4MHUA 2JEMA 2GNBA 4MGKE 2WT0A 3H3UA 1UXXX 2GMMA 2X53S 4E2QA 2IXIA 3NV2A 5F5IA 2RMU1 3GCWA 5DUVA 4JGYB 4MGSA 4AEDC 4A42A 1QJY3 2PAKA 4ISRA 3OUHA 5FPLA 5TSWA 3SH3A 3VBUC 1N1VA 3PUHA 1DQ5A 1NQDA 4A44A 1GWLA 2JECA 3ZFEA 2WQ8A 3KV9A 4O9GA 1OLME 4XF1A 3VDAA 1TME2 4CP0A 4CDQA 5FJHA 2Q1FA 1BMV1 2GNMA 5FZHA 5BNPB 4RS5A 5A32B 5CKQA 1MQTA 5A3OA 3UESA 2RDQA 1GFF2 1HRV3 5A80A 5C8CB 1JYVA 3VDCA 2C9AA 2EXHA 3H1YA 4EN7B 3T4VA 1G9BA 5BNQA 2BUKA 4BQYA 3BIEA 1W3VA 3THCA 1HB1A 3J8F2 3LSDA 1LR5A 2WA3A 5FZMA 4NIHA 5B2GB 2LW8A 1LCLA 1PIV1 1QNYA 4CCLA 4DMIA 4RA0A 3IWZA 4Y20B 2WS93 4X8NA 5KR7A 2HEWF 3JZVA 4L97A 2ZMLA 2XWBB 3VD3A 5BV6A 2VOXA 5A6YA 1AR71 4XETA 3M8LA 5D8AB 3DCQA 3AZVA 4GH4C 4EN6B 2EXKA 2D5FA 4K1ZA 4FPYA 3TN93 3J7HA 3HQRA 3P5BA 4N9HA 5F3IA 5FPVA 5BNNB 1JODA 4YFZA 5CB7A 4FPFA 3SCHA 1ND2C 4K6BA 1TE1B 5A7QA 4BU2A 4C90A 2SBAA 3O1MA 3HN1A 1JU4A 2VCMA 1A8DA 3K3NA 1RUG3 4YZ1A 3POEA 4CXYA 4JGZA 3MFCA 4K8FA 1GMMA 1UU4A 1N1TA 3ZDVA 1B35B 4ARYA 2W9XA 3I59B 2VBPA 3NV1A 4CDUB 1FATA 2YY1A 4K9SA 1R081 1UOBA 4X6RB 2QDNA 1VAMA 4YG6A 2O8QA 3RWNA 3VKMA 3GZAA 1AR83 4NPMA 1JZ7A 3TEWA 2FDKA 1AXYA 2PAEA 4CUBA 5CFDC 5LY1A 5FYUA 2A1XA 2D3SA 1POV3 4ONUA 2NM1A 3SXWA 1OLMA 3P3NA 3NAPB 4JDOA 2WIIB 3WV6A 4DRRA 2ZEYA 1OVPA 2E7AA 2PLV1 4JKMA 3VUOA 1U5IA 3OF1A 1YJKA 2B45X 4IW3A 3USUA 4COVA 5EJ1B 1AL22 5FBJA 1ALYA 3J26N 5FOJB 2IFWA 1BZWA 1VE0A 2BOJA 3I2FA 3N7JA 4FXGB 2SLIA 3VZOA 1CWPA 2WSVA 4XUQA 2O8OA 3N7LA 3CDZB 3QACA 3PJYA 1UYYA 2BGOA 2DCJA 1SDDB 2VW2A 5C8CA 3HR9A 4QPGC 3WHTA 1GQPA 1AYN1 1HDKA 1JYWA 3O1RA 1PM4A 2GH2A 4NRMA 3RDIA 1JYTA 1PNFA 3LB9A 2WO1A 2P34A 3NO8A 1VBB3 3NL1A 4MH0E 3ZYGA 4BLJA 2XJQA 4AEDA 4XYXA 5IYYA 2UWBA 3LWCA 3M3CA 3KGLA 4D8MA 2EALA 4SLIA 2ATFA 1HIXA 2HWF2 2XBO2 4XHXA 5A7NA 4QXKA 3SH4A 4LIUA 2NYYA 2WNEA 4CEYC 4DXTA 1J59A 1DG6A 2OS2A 1VR3A 4D6SA 1H8VA 4GULA 3I3BA 1GZCA 2QDRA 3FMGA 5FP4A 4O9EA 3HNYM 4Q4Y1 1S0JA 3CZUA 5JI7A 3WG2A 5I0SA 2I2SA 3DEMA 5CISA 4Q4V2 2OKXA 2Y6JA 4KI5M 2D3PA 4DPNA 3O1UA 2DDUA 3NKTA 1QJX1 4O65A 4NAMA 2DU0A 5A7PA 1DF0A 4CUCA 3WP3A 2N7GA 3VBFC 3PMSA 1WD4A 5IFPA 2A73B 3ECQA 3ZR6A 2J22A 4M3CE 2VMCA 1R091 2VZUA 2Y6FA 3N36A 2JG8C 5FMDA 3N9LA 3RNSA 1IPJA 1BEV3 4KWLA 5FRAA 4ES9A 4KH9A 5FKBA 3SCGA 3ZVXA 2WS92 2X5IA 5FZ8A 2G4IA 3CJIB 5HV4A 1PO13 1U12A 4OI1A 2YMZA 4OUMA 4A45A 4YVWB 5K7PA 5F2SA 4KG8A 2ZGNA 4LBLA 4FT8A 4MGQA 4XCAA 2B39A 1UNBA 1DZQA 4LUKA 5J3UA 4TXWA 4Q4X3 5FZ4A 4XJUA 2WFF2 4YRDA 4QB2A 5L7OC 5DAXA 2RJ2A 1ZBE1 2JDUA 2A3YA 3HPNA 5ERLA 1AYM1 3WDYA 1QEXA 2E63A 2BU9A 1F2NA 4QKDA 2DF7A 4ZU5A 4IL7A 1FXZA 2BQPA 2VTXJ 4HK9A 1A3KA 1X7NA 2JD4A 4PIZA 1AYN2 4PQ9A 4XABA 1O4ZA 1QJX3 5AFBA 5FYSA 1SHWB 3T2TA 4N53B 1S4CA 4ZKTB 3Q8AA 4RGKA 3LA7A 5IUQA 2O0OA 3WW2A 4CP1A 5GALA 3VKLA 5FO8B 2XKPA 4XOGA 1LEMA 5IK7A 5JSRA 1SPPB 1RUNA 3W5MA 4B8EA 2BVVA 1O4TA 1S0CA 5A32A 4C0HA 4AEJA 4OHWA 1RXFA 3R4DB 1JUIA 2Z69A 4RFT0 1ST8A 3PVNA 2Q8EA 5EXOA 2VQUA 1UMIA 4M4RA 5FXZA 2TBVA 1XNKA 2NP0A 2RJLA 2MHFA 4GQ7A 1N47A 4CCCA 2ADDA 1K12A 2PHWA 3EYPA 1DDLA 5C33A 2D93A 1MS5A 4KU8A 5GLWA 1IOAA 1DHKB 1QWRA 1UZZA 2V5DA 4Y33A 3WG3A 2CAUA 2R1DA 1RUF2 1EAH1 1W6NB 1NLSA 2VZPA 3IDCB 5AC91 3MIDA 5JCTA 3OBRA 2CY6A 4A41A 5I0RA 4L8QA 4FPKA 1HRI2 4AVSA 1NOVA 3PVOA 3N3HA 4K1YA 1NXD1 4QGLA 1XJAA 2Y60A 3POBA 2A70A 3VD9A 5FZEA 1IS3A 4OULA 4BXSV 1ZX5A 4Q27A 1A6CA 1GZWB 4AR2A 4Q4Y2 4ES8A 3MHZA 5C9AB 3OPZA 4IV3B 3RFRA 3AMQA 1G9DA 1JMUB 1ZM1A 2XJTA 1Y9QA 2D40A 2ZPXA 3MIGA 2X05A 1OPMA 5A70A 2MNGA 5FUPA 1U5XA 2IVJA 5T55A 1MS9A 2WWUA 5FO7B 1QY4A 3ABZA 1LECA 4QPGB 1AJKA
chains in the Genus database with same CATH topology
1NUKA 3U37A 3PUIA 1UXZA 5EIYB 4CU8A 2EICA 1CZTA 2QQLA 5DQ0A 3C7EA 2YC2A 1I5PA 5G05L 2E33A 3I2IA 1UY3A 2RVAA 2QQIA 2C4XA 1JYXA 3I2GA 2VZQA 3ACIA 3K4DA 4FI9A 1ULPA 3T0DA 2VMFA 3OGRA 4DUVA 4DEVA 5LA1A 3CKHA 2X09A 4AG4A 3WNLA 4LKSA 5JXHA 3C7OA 2R7EB 1OF3A 4DXSA 2JD9A 1GOHA 2DCKA 1UYXA 3I97A 1OH4A 3K46A 2X10A 2ORZA 5C7GA 2Y64A 1TVGA 4JKKA 5JXIA 2RV9A 4OMDA 1JZ2A 1US2A 3WSOA 2EIEA 5IHRA 1XPWA 5JUVA 2VCBA 3MUY1 1US3A 1W9TA 3DECA 4QX3A 2W1SA 4BJ0A 3IIIA 3I3DA 1TG7A 3OGVA 3P1IA 3A7QA 1JZ8A 4DEQA 4ZZ8A 2W91A 5A1AA 3LEIA 4UAPA 3WF0A 1PX3A 3T0AA 2WO3A 4LQRA 2V72A 2W1QA 1GU3A 3HJRA 3K4AA 4E8DA 3T2QA 2ZEWA 3IDAA 5C70A 3GXUA 4JHZA 2YFUA 2VO5A 1K3IA 3I2KA 4KMQA 3OEBA 3K75B 3OB8A 3T2OA 1EUTA 4XUTA 1OD3A 5HXMA 2VOTA 1UWWA 1UY1A 2LS6A 3C7GA 1W0NA 2VZVA 1XNAA 2BBAA 2ZEZA 3T09A 2VZ1A 4KWUA 3CIHA 4XUNA 1LNSA 1J84A 1GUIA 3I2HA 1W9SA 5IJRA 3I3EA 4P02B 3CZJA 1GOFA 4W8JA 4QDRA 4QX0A 2QQJA 5G04L 4ZY9A 5IFTA 1WKYA 4GWIA 3E1F1 1W8OA 1F4AA 1PMHX 2QQOA 3MUZ1 3VDBA 4JKLA 4CUAA 2VCAA 4QB6A 2VL4A 3WF4A 2CDPA 4OUEA 4L0PA 4A6OA 3WEZA 2VM9A 3K4ZA 1KGYA 4OMCA 4A4AA 1GOGA 2YB7A 5CYYA 5B4XA 2VTFA 3GM8A 1NAEA 3MV11 1NX9A 2W1WA 2W1UA 2J1UA 3THDA 2KD7A 3HOBA 2VMEA 3ACGA 3A23A 2XHNA 3C7FA 1JHJA 1P8JA 1SG3A 2WN3A 1H6YA 2VMDA 1KEXA 2E31A 4UOJA 3A21A 3CMGA 4ZXEA 3SKVA 2Z4FA 4GZ9A 1OT5A 4CU9A 2BGPA 1L7QA 2B9VA 2WDBA 3A22A 4XUOA 1UY2A 2XONA 3ACHA 5FUIA 1UYZA 4MO3M 1WCQA 2WUHA 1PMJX 3LPGA 3WNNA 4LHSA 1R64A 3CQOA 3NJXA 4P08A 1ULOA 3WNMA 4LPLA 5LA0A 2QQMA 2VZRA 4XZUG 1W99A 1UY0A 3UETA 2QQKA 4P5YA 3HEIA 3DYPA 2HYXA 3C8XA 4BDVB 3FHAA 3D3AA 2YG0A 4OYUA 2VR4A 3SEPA 2PQSA 1UXXX 4XVHA 4RN5A 4MGSA 1JZ5A 4A42A 3WQBA 3IAQA 5JR2A 3WNKA 4A44A 3PUHA 2WQ8A 1O59A 4HG6B 4QDSA 4ET7A 5C71A 3VDAA 3FL7A 5JXJA 2W46A 2Y6LA 2W87A 2VZTA 2EIDA 1JI6A 2QBXA 2ORXA 4MOAA 3UESA 3T08A 4RYDA 2E26A 1JYVA 2E32A 2W47A 3VDCA 2YC4A 3WF2A 2L9LA 3AC0A 3LPFA 3THCA 3NQHA 1OF4A 2WAOA 2LW8A 4MADA 2WO2A 3DYMA 1YQ2A 5JMOA 2VC9A 3VD3A 4PF1A 5JXGA 2W3JA 2VJXA 4BK4A 3WF3A 4DXRA 2WN2A 2WAAA 1JZ3A 2XQXA 3J7HA 4CU7A 3VD7A 4Z2AA 3LQCA 1JU4A 2J1RA 1K45A 1CZVA 3SKJE 1GMMA 3FHQA 3MO4A 4ARYA 2W9XA 4QB1A 4PT6A 1JZ7A 2VZOA 1DLCA 1UY4A 4CUBA 1GNYA 1EUUA 2ZEYA 4JKMA 2B4KA 4CU6A 2J1VA 3LEGA 4IUGA 4W4ZA 1H6XA 5EJ1B 4ZZ5A 2HLEA 4OZOA 3VD5A 3I2FA 2JKXA 1L7RA 4P00B 1DP0A 3C7HA 4XUQA 2Y8KA 3CDZB 4AAXA 2W5FA 1JZ6A 1UYYA 2BGOA 4CVUA 3MBWA 2DCJA 1SDDB 4JX0A 3IAPA 3WF1A 3FN9A 1GQPA 5LA2A 1D7PM 1JYWA 4M4PA 2J1AA 2WO1A 5IYYA 3ETPA 4D8MA 2JE8A 5F7UA 2JDAA 3LEKA 3DYOA 4DXTA 5LCWL 1W9WA 5DMYA 3I3BA 4QAWA 3NNGA 3MV01 3LE0A 1CX1A 3HNYM 1UX7A 3CZUA 2VCCA 4QX2A 2OKXA 2Y6JA 4KI5M 5B4NA 2DDUA 4DUWA 3SEEA 3T2PA 4CUCA 5IFPA 1RYYA 2Y6GA 4QPWA 3ECQA 5HPOA 1DYOA 2J22A 2VMCA 2BERA 2VZUA 4QDQA 4UI9L 2BZDA 1W8NA 1T2XA 3OBAA 3W5NA 4GWJA 4D0QA 2EIBA 5J1XA 4YPJA 3HN3A 2CDOA 3HNBM 3P6BA 5DN2A 4A45A 2QQNA 1O8PA 4MGQA 1J83A 3ZM8A 3OEAA 2ZXQA 2WZEA 4TXWA 1UMHA 4BK5A 2VZSA 3IB3A 3I2JA 5EJZB 1HN1A 1MPXA 2W92A 4QB2A 2Y6KA 2RJ2A 2WBKA 1JYNA 3EB7A 3HPNA 1PX4A 2ZEXA 1F4HA 4W50A 3JXSA 2XOMA 2WABA 2VQTA 3OGSA 3WNOA 4XUPA 3NRUA 1SHWB 2WYSA 3BGAA 3BN6A 2YFZA 3VD4A 3F2ZA 3W5MA 3GDBA 2J1TA 1NKGA 2VQUA 1UMIA 4M4RA 3WNPA 2VZ3A 1JU3A 1UZ0A 1IQDC 1XC6A 1K12A 4DUXA 1CIYA 3EYPA 4TTGA 1K42A 3K77A 2W94A 2V5DA 2J7MA 2ID4A 3ACFA 3GGLA 4QX1A 2VZPA 2W95A 2J1EA 2C26A 4A41A 3HNMA 3UNPA 2C9KA 1CZSA 5DPNA 3VD9A 4BXSV 1BHGA 4XURA 4ARXA 2WZ8A 2J1SA 1O8SA 1XNTA 4PQQA 3T0BA 4E8CA 5CZKA 3OG2A 2V4VA 5I0DA 1JZ4A 2X05A 3NJVA 3ABZA 4A3ZA 2Y6HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NUK A;  3U37 A;  3PUI A;  1UXZ A;  5EIY B;  4CU8 A;  2EIC A;  1CZT A;  2QQL A;  5DQ0 A;  3C7E A;  2YC2 A;  1I5P A;  5G05 L;  2E33 A;  3I2I A;  1UY3 A;  2RVA A;  2QQI A;  2C4X A;  1JYX A;  3I2G A;  2VZQ A;  3ACI A;  3K4D A;  4FI9 A;  1ULP A;  3T0D A;  2VMF A;  3OGR A;  4DUV A;  4DEV A;  5LA1 A;  3CKH A;  2X09 A;  4AG4 A;  3WNL A;  4LKS A;  5JXH A;  3C7O A;  2R7E B;  1OF3 A;  4DXS A;  2JD9 A;  1GOH A;  2DCK A;  1UYX A;  3I97 A;  1OH4 A;  3K46 A;  2X10 A;  2ORZ A;  5C7G A;  2Y64 A;  1TVG A;  4JKK A;  5JXI A;  2RV9 A;  4OMD A;  1JZ2 A;  1US2 A;  3WSO A;  2EIE A;  5IHR A;  1XPW A;  5JUV A;  2VCB A;  3MUY 1;  1US3 A;  1W9T A;  3DEC A;  4QX3 A;  2W1S A;  4BJ0 A;  3III A;  3I3D A;  1TG7 A;  3OGV A;  3P1I A;  3A7Q A;  1JZ8 A;  4DEQ A;  4ZZ8 A;  2W91 A;  5A1A A;  3LEI A;  4UAP A;  3WF0 A;  1PX3 A;  3T0A A;  2WO3 A;  4LQR A;  2V72 A;  2W1Q A;  1GU3 A;  3HJR A;  3K4A A;  4E8D A;  3T2Q A;  2ZEW A;  3IDA A;  5C70 A;  3GXU A;  4JHZ A;  2YFU A;  2VO5 A;  1K3I A;  3I2K A;  4KMQ A;  3OEB A;  3K75 B;  3OB8 A;  3T2O A;  1EUT A;  4XUT A;  1OD3 A;  5HXM A;  2VOT A;  1UWW A;  1UY1 A;  2LS6 A;  3C7G A;  1W0N A;  2VZV A;  1XNA A;  2BBA A;  2ZEZ A;  3T09 A;  2VZ1 A;  4KWU A;  3CIH A;  4XUN A;  1LNS A;  1J84 A;  1GUI A;  3I2H A;  1W9S A;  5IJR A;  3I3E A;  4P02 B;  3CZJ A;  1GOF A;  4W8J A;  4QDR A;  4QX0 A;  2QQJ A;  5G04 L;  4ZY9 A;  5IFT A;  1WKY A;  4GWI A;  3E1F 1;  1W8O A;  1F4A A;  1PMH X;  2QQO A;  3MUZ 1;  3VDB A;  4JKL A;  4CUA A;  2VCA A;  4QB6 A;  2VL4 A;  3WF4 A;  2CDP A;  4OUE A;  4L0P A;  4A6O A;  3WEZ A;  2VM9 A;  3K4Z A;  1KGY A;  4OMC A;  4A4A A;  1GOG A;  2YB7 A;  5CYY A;  5B4X A;  2VTF A;  3GM8 A;  1NAE A;  3MV1 1;  1NX9 A;  2W1W A;  2W1U A;  2J1U A;  3THD A;  2KD7 A;  3HOB A;  2VME A;  3ACG A;  3A23 A;  2XHN A;  3C7F A;  1JHJ A;  1P8J A;  1SG3 A;  2WN3 A;  1H6Y A;  2VMD A;  1KEX A;  2E31 A;  4UOJ A;  3A21 A;  3CMG A;  4ZXE A;  3SKV A;  2Z4F A;  4GZ9 A;  1OT5 A;  4CU9 A;  2BGP A;  1L7Q A;  2B9V A;  2WDB A;  3A22 A;  4XUO A;  1UY2 A;  2XON A;  3ACH A;  5FUI A;  1UYZ A;  4MO3 M;  1WCQ A;  2WUH A;  1PMJ X;  3LPG A;  3WNN A;  4LHS A;  1R64 A;  3CQO A;  3NJX A;  4P08 A;  1ULO A;  3WNM A;  4LPL A;  5LA0 A;  2QQM A;  2VZR A;  4XZU G;  1W99 A;  1UY0 A;  3UET A;  2QQK A;  4P5Y A;  3HEI A;  3DYP A;  2HYX A;  3C8X A;  4BDV B;  3FHA A;  3D3A A;  2YG0 A;  4OYU A;  2VR4 A;  3SEP A;  2PQS A;  1UXX X;  4XVH A;  4RN5 A;  4MGS A;  1JZ5 A;  4A42 A;  3WQB A;  3IAQ A;  5JR2 A;  3WNK A;  4A44 A;  3PUH A;  2WQ8 A;  1O59 A;  4HG6 B;  4QDS A;  4ET7 A;  5C71 A;  3VDA A;  3FL7 A;  5JXJ A;  2W46 A;  2Y6L A;  2W87 A;  2VZT A;  2EID A;  1JI6 A;  2QBX A;  2ORX A;  4MOA A;  3UES A;  3T08 A;  4RYD A;  2E26 A;  1JYV A;  2E32 A;  2W47 A;  3VDC A;  2YC4 A;  3WF2 A;  2L9L A;  3AC0 A;  3LPF A;  3THC A;  3NQH A;  1OF4 A;  2WAO A;  2LW8 A;  4MAD A;  2WO2 A;  3DYM A;  1YQ2 A;  5JMO A;  2VC9 A;  3VD3 A;  4PF1 A;  5JXG A;  2W3J A;  2VJX A;  4BK4 A;  3WF3 A;  4DXR A;  2WN2 A;  2WAA A;  1JZ3 A;  2XQX A;  3J7H A;  4CU7 A;  3VD7 A;  4Z2A A;  3LQC A;  1JU4 A;  2J1R A;  1K45 A;  1CZV A;  3SKJ E;  1GMM A;  3FHQ A;  3MO4 A;  4ARY A;  2W9X A;  4QB1 A;  4PT6 A;  1JZ7 A;  2VZO A;  1DLC A;  1UY4 A;  4CUB A;  1GNY A;  1EUU A;  2ZEY A;  4JKM A;  2B4K A;  4CU6 A;  2J1V A;  3LEG A;  4IUG A;  4W4Z A;  1H6X A;  5EJ1 B;  4ZZ5 A;  2HLE A;  4OZO A;  3VD5 A;  3I2F A;  2JKX A;  1L7R A;  4P00 B;  1DP0 A;  3C7H A;  4XUQ A;  2Y8K A;  3CDZ B;  4AAX A;  2W5F A;  1JZ6 A;  1UYY A;  2BGO A;  4CVU A;  3MBW A;  2DCJ A;  1SDD B;  4JX0 A;  3IAP A;  3WF1 A;  3FN9 A;  1GQP A;  5LA2 A;  1D7P M;  1JYW A;  4M4P A;  2J1A A;  2WO1 A;  5IYY A;  3ETP A;  4D8M A;  2JE8 A;  5F7U A;  2JDA A;  3LEK A;  3DYO A;  4DXT A;  5LCW L;  1W9W A;  5DMY A;  3I3B A;  4QAW A;  3NNG A;  3MV0 1;  3LE0 A;  1CX1 A;  3HNY M;  1UX7 A;  3CZU A;  2VCC A;  4QX2 A;  2OKX A;  2Y6J A;  4KI5 M;  5B4N A;  2DDU A;  4DUW A;  3SEE A;  3T2P A;  4CUC A;  5IFP A;  1RYY A;  2Y6G A;  4QPW A;  3ECQ A;  5HPO A;  1DYO A;  2J22 A;  2VMC A;  2BER A;  2VZU A;  4QDQ A;  4UI9 L;  2BZD A;  1W8N A;  1T2X A;  3OBA A;  3W5N A;  4GWJ A;  4D0Q A;  2EIB A;  5J1X A;  4YPJ A;  3HN3 A;  2CDO A;  3HNB M;  3P6B A;  5DN2 A;  4A45 A;  2QQN A;  1O8P A;  4MGQ A;  1J83 A;  3ZM8 A;  3OEA A;  2ZXQ A;  2WZE A;  4TXW A;  1UMH A;  4BK5 A;  2VZS A;  3IB3 A;  3I2J A;  5EJZ B;  1HN1 A;  1MPX A;  2W92 A;  4QB2 A;  2Y6K A;  2RJ2 A;  2WBK A;  1JYN A;  3EB7 A;  3HPN A;  1PX4 A;  2ZEX A;  1F4H A;  4W50 A;  3JXS A;  2XOM A;  2WAB A;  2VQT A;  3OGS A;  3WNO A;  4XUP A;  3NRU A;  1SHW B;  2WYS A;  3BGA A;  3BN6 A;  2YFZ A;  3VD4 A;  3F2Z A;  3W5M A;  3GDB A;  2J1T A;  1NKG A;  2VQU A;  1UMI A;  4M4R A;  3WNP A;  2VZ3 A;  1JU3 A;  1UZ0 A;  1IQD C;  1XC6 A;  1K12 A;  4DUX A;  1CIY A;  3EYP A;  4TTG A;  1K42 A;  3K77 A;  2W94 A;  2V5D A;  2J7M A;  2ID4 A;  3ACF A;  3GGL A;  4QX1 A;  2VZP A;  2W95 A;  2J1E A;  2C26 A;  4A41 A;  3HNM A;  3UNP A;  2C9K A;  1CZS A;  5DPN A;  3VD9 A;  4BXS V;  1BHG A;  4XUR A;  4ARX A;  2WZ8 A;  2J1S A;  1O8S A;  1XNT A;  4PQQ A;  3T0B A;  4E8C A;  5CZK A;  3OG2 A;  2V4V A;  5I0D A;  1JZ4 A;  2X05 A;  3NJV A;  3ABZ A;  4A3Z A;  2Y6H A; 
#chains in the Genus database with same CATH topology
 2KR2 A;  4QM9 A;  4ZPI A;  2TNF A;  4JRA A;  1NUK A;  2RG4 A;  1RGS A;  3PUI A;  3R0R A;  5CFC C;  3AKS A;  3WG1 A;  1LES A;  3N9M A;  4XFC A;  4YFW A;  2XL7 A;  3VZJ A;  2D44 A;  1V6K A;  2WKK A;  3Q9O A;  1DCS A;  1LKN A;  1F5F A;  3C7E A;  3KM5 A;  3POJ A;  4Q0S A;  1WMX A;  2QFE A;  1VBA 2;  3WQ0 A;  2WFF 3;  1UY3 A;  5FZO B;  1GP6 A;  2ZHK A;  1OSG A;  1COV 1;  4XFA A;  3UGF A;  1MQT C;  1W3X A;  2QQI A;  4AI1 A;  1BVP 1;  3ALQ A;  4UFH A;  3FLT A;  1W03 A;  3K4D A;  4FI9 A;  3WDT A;  4URT A;  5IW0 A;  2VMF A;  3NKG A;  2VQA A;  5HCF A;  1PO1 2;  1RVF 1;  5FZL A;  3WNL A;  3C7O A;  1CAU B;  2ENR A;  4YW6 A;  5CEH A;  3W21 A;  3ZN4 A;  4BOW A;  2Y33 A;  4N43 C;  4NII A;  4DNY A;  4Z92 B;  4IE0 A;  4XZP A;  5SV5 A;  5KC5 A;  2VXJ A;  2ARA A;  1AYM 3;  1UYX A;  3QBQ A;  4LK6 A;  4Z1V A;  1LOF C;  1PO2 3;  4XJA A;  3THT A;  2Y64 A;  3H0O A;  3LFI A;  1BQP A;  4NR1 A;  2ZA9 A;  1WWY A;  3KCC A;  1JZ2 A;  5LK5 A;  2MEV 3;  2A6Z A;  1WA4 A;  1D0G A;  1YWK A;  4Y1X A;  5FZC A;  5LAS A;  2EIE A;  4HT1 T;  3D6E A;  1LHU A;  4XFB A;  5JUV A;  3ITQ A;  5JOY A;  1RIR A;  2JDM A;  1US3 A;  3MUY 1;  1W9T A;  5EWS A;  3DEC A;  3GCX A;  4KU7 A;  4QX3 A;  2W1S A;  5FQ0 B;  3I3D A;  3P1I A;  2OII A;  1GSL A;  4HL0 A;  4MXV A;  4OZX A;  3E6C C;  4ITC A;  2BGC A;  2AEY A;  1J3Q A;  2CSG A;  2D6M A;  2R06 1;  4Q29 A;  4OHV A;  2RS5 2;  3M4F A;  2B7Y A;  2CHH A;  5A1A A;  3RWK X;  5JPN B;  3WF0 A;  2IUW A;  2R07 2;  3SQO A;  5A1F A;  1PX3 A;  1RIN A;  3R6S A;  3I3M A;  1I5Z A;  1SMV A;  1W2N A;  2R06 2;  3GBG A;  4UYB A;  4BQ4 A;  5C3O A;  3V0B A;  3LOB A;  1CPM A;  1H4H A;  1QDO A;  2ZEW A;  2Q4S A;  3IDA A;  5C70 A;  3JB8 A;  1HLC A;  3GZU C;  4Y5Z 0;  4CUG A;  1WLD A;  5JAX A;  2VO5 A;  3S5A A;  1W6O A;  2I45 A;  1QJE A;  3I2K A;  3ILN A;  3K75 B;  5T5O A;  4QPY A;  3O1T A;  1KS5 A;  2D6L X;  1MVQ A;  4Y20 A;  1UWW A;  4AVC A;  2XJS A;  5HXM A;  3PIG A;  2LS6 A;  2AC1 A;  3K3O A;  1BBT 1;  1W0N A;  3T09 A;  3ENR A;  3MIC A;  3CIH A;  4XUN A;  5FMO L;  2BPA 2;  3WDV A;  1GUI A;  1GQG A;  1HXS 2;  4JGY C;  2LAL A;  1ND3 C;  3HMY A;  4MVT A;  4BQ5 A;  1GOF A;  3POI A;  5KC6 A;  1G9F A;  2VPV A;  1LUL A;  4DXZ A;  4XXP A;  5CNA A;  3ZLI A;  2PN5 A;  4Y1U A;  3POS A;  1KFX L;  5JDB A;  1BEV 1;  4GWI A;  3CJI A;  1HJF A;  1KXG A;  4QWN A;  1PMH X;  2VGD A;  4X6Q B;  5DZE A;  1PGS A;  2R0H A;  1RL3 A;  2QQO A;  3DXT A;  1BBT 2;  3MUZ 1;  1AR6 3;  4D7S A;  3LF7 A;  4ZHN A;  2XLG A;  4KQ7 A;  4SBV A;  1UU6 A;  3ZFE C;  1D4M 1;  3QH7 A;  1MEC 3;  3U14 A;  2CL2 A;  5L9R A;  3WEZ A;  5IK4 A;  2PHD A;  4I01 A;  4B3N A;  2VMH A;  5KBF A;  3FUO A;  3TNQ A;  2AEZ A;  3I7D A;  2ZAA A;  3N7M A;  4YZ4 A;  2XJR A;  3WY6 A;  4LXL A;  5FZ0 A;  2BWA A;  3KV5 A;  3OCP A;  2JKB A;  1XNB A;  2WWS A;  3C3V A;  4QMA A;  5B4X A;  3H9A A;  2RM2 2;  1L3J A;  2MEV 1;  1S2K A;  1D4V B;  2VTF A;  4NHY A;  1ZZ7 A;  2A6Y A;  3POG A;  4N7I A;  2R04 3;  1GV9 A;  3MV1 1;  1ZRI A;  2W1U A;  1AR6 2;  3AYA A;  2KD7 A;  3HOB A;  3RZJ A;  3FFQ A;  2C1F A;  4PF5 A;  3A23 A;  4RQP A;  5FZK A;  4I0B A;  1DGR A;  5LW9 A;  1RUJ 3;  1P8J A;  3LCP A;  5GZF A;  4BWO A;  3SMH A;  1RUH 2;  2WN3 A;  4BIS A;  1H6Y A;  4QKF A;  1YXW A;  2VMD A;  1RUI 2;  3N9O A;  3NJZ A;  4AI0 A;  1QOT A;  5FY9 A;  2Z4F A;  2ZAC A;  5LBF A;  1IS6 A;  2D6O X;  1WBF A;  2OPK A;  1SQ4 A;  4MX3 A;  4R9D A;  3RS6 A;  4JGZ B;  4YAR A;  2BNN A;  1W8T A;  2RDS A;  5IVE A;  2BGP A;  1Y9G A;  4RS5 C;  5HBA A;  2P4E A;  1R1A 2;  5I93 A;  1XBF A;  1H9W A;  1UOF A;  2FMY A;  3IPV A;  1ZA7 A;  5L73 A;  5K0U B;  1RUD 1;  1OFS A;  3GHM A;  4LBQ A;  5FMC A;  1RTV A;  2W08 A;  4V1P A;  5FUI A;  2WUH A;  2YV8 A;  3LAG A;  1WW6 A;  1IS4 A;  1OQD A;  3AK0 A;  1X36 A;  3OOX A;  3LZZ A;  5H9Q A;  5CAZ A;  5FOB B;  4CRQ A;  1XE7 A;  1PVC 2;  2PHX A;  2WYF A;  2WRA A;  3NJX A;  3KHC A;  1ULO A;  3UKN A;  1Z7S 3;  2PAM A;  3ETQ A;  5LA0 A;  2RS3 1;  1RIT A;  2HEY F;  1TEI A;  1WD3 A;  2ZTN A;  3NMB A;  3S30 A;  2OQ7 A;  4AGR A;  3ZYH A;  2F17 A;  4AVB A;  2V4A A;  3LDB A;  3LSE A;  3WP5 A;  3UET A;  4E27 A;  1RXG A;  4CE8 A;  1KIT A;  4P5Y A;  2CWM A;  1XOY A;  1AVB A;  2KM2 A;  5A33 B;  2JDP A;  2BFU S;  4GMP 1;  1OOP A;  5E8A A;  1RVF 3;  3BKZ A;  4LIT A;  2GAU A;  3OPW A;  4OYU A;  3BTZ A;  1DU3 D;  2ZGP A;  1OA2 A;  1ULF A;  5F5Q A;  2RJK A;  2UU8 A;  4YVS C;  1CPN A;  1IG0 A;  1HN0 A;  1ZRC A;  3BTY A;  4FSJ A;  2BFU L;  4XAA A;  3IM0 A;  5HCH A;  1JZ5 A;  5JR2 A;  2QVS B;  4PDW B;  3V65 A;  3ZX7 A;  3W58 A;  2YBP A;  5ABJ C;  3AYE A;  4GH4 A;  3U07 A;  4HG6 B;  2BJS A;  4IE4 A;  5BY5 A;  4QDS A;  5J36 A;  2YRO A;  4IEP A;  3FL7 A;  3I2O A;  4YGD A;  4LBN A;  4LBM A;  4AED B;  1PGW 2;  2QE3 A;  2EID A;  4W6W A;  1ZZ9 A;  3LFM A;  1BK1 A;  1G86 A;  2RS3 3;  2UWA A;  1SDW A;  4YGE A;  1RHI 1;  1U5Z A;  2DUP A;  4FQ4 A;  3T08 A;  4RYD A;  4CEY A;  3RZL A;  2ZZQ A;  2E26 A;  4JC1 A;  3LA2 A;  2W47 A;  4U2A A;  2OZJ A;  4Q1R A;  5C5U A;  5F9T A;  3NAP C;  5A7W B;  4HVO A;  4JDN A;  1SBF A;  3LPF A;  3SH5 A;  1Q56 A;  1QQP 1;  1W0O A;  3AP5 A;  1N1S A;  5I91 A;  3LIG A;  1IKQ A;  1OF4 A;  3LOI A;  1CJD A;  1O6U A;  2WAO A;  4FVV A;  4LBJ A;  2UY8 A;  4HFS A;  4NE9 A;  5FY5 A;  2WO2 A;  3UGG A;  1JOB A;  2DUQ A;  5SV8 A;  2P2K A;  3MW4 A;  4QPG A;  3MPB A;  1B35 C;  3DGT A;  5JMO A;  5JXG A;  5A6Z A;  4Q4W 1;  1YRZ A;  2GSY A;  1RUC 3;  2HWB 3;  2W3J A;  2VJX A;  4AEM A;  4N53 C;  1AR9 2;  4DXR A;  2WQZ C;  5FMB A;  2R0F A;  1RUD 3;  2WAA A;  1HRI 1;  1CVN A;  4WZF A;  4KWJ A;  3KT7 A;  4FFH A;  4Q4X 2;  1GZ9 A;  1JZ3 A;  3V0B B;  4LHN A;  4P5H A;  3RMX A;  3B9C A;  4FTE A;  2ZGS A;  3OYW B;  1LHV A;  3LQC A;  4LA3 A;  4A3X A;  2JG9 C;  1KQR A;  1K45 A;  1TMF 3;  4NWV A;  2JG9 A;  4XF3 A;  4GB3 3;  2WZR 3;  3FHQ A;  2RE9 A;  1MAC A;  4HPK A;  5DDJ 3;  2PEL A;  4XFG A;  5C4W A;  3WDW A;  4ATE A;  3Q8E A;  5JSP A;  2ZX2 A;  1DYK A;  1WME A;  3M7A A;  3O14 A;  4JDM A;  4CEW A;  4CCO A;  3MW3 A;  1ZBE 2;  4MGI E;  3WW4 A;  1DLC A;  1UY4 A;  4H55 A;  2QKD A;  5T54 A;  2Z2S B;  1IGO A;  2FD8 A;  2DWR A;  1GNY A;  1B35 A;  3HVD A;  1QOS A;  1VAL A;  1EUU A;  1GP5 A;  1W8W A;  2VVF A;  3WDX A;  1LEN A;  2WT2 A;  1MEC 1;  4CU6 A;  2J1V A;  3LEG A;  4IUG A;  1MVE A;  2ZCW A;  2HWE 3;  4I09 A;  4R9C A;  4XBQ A;  1LOB A;  3AZX A;  4EQV A;  1VBB 2;  1GWM A;  2NMO A;  1CON A;  2XJP A;  3JD7 3;  3VD5 A;  5A3W A;  1YYN A;  3B02 A;  3H3L A;  3NAP A;  1FNZ A;  5GLT A;  1KRI A;  2JXA A;  4EJR A;  1ULG A;  2F4P A;  1OC1 A;  2ZS6 B;  3URF A;  2IFR A;  4EZH A;  2OXB A;  3H42 B;  4PBP A;  4XF9 A;  1AJO A;  4HVR A;  4AAX A;  4AGV A;  5C3P A;  1UX6 A;  4CVU A;  3WUC A;  1FOD 3;  5C8W A;  4JX0 A;  4MG2 A;  1A34 A;  3DV8 A;  3I49 A;  1QOO A;  5EHD A;  3VBU A;  4Q0U A;  1D7P M;  1OXC A;  2C24 A;  1JN2 P;  4M4P A;  4CCN A;  4EWD A;  4UFJ A;  1AR9 1;  2J1A A;  3TEY A;  3B9I A;  3IT8 A;  1AL2 3;  3GJA A;  1E5R A;  5FZ3 A;  1LGB A;  1NA1 A;  3DKW A;  3IKW A;  4J1X A;  3ORJ A;  4P9G A;  3ZKY A;  5C9A A;  1YUD A;  4FCA A;  1J58 A;  4H7M A;  2ZX1 A;  4M01 A;  4TLF A;  1NA1 C;  1JTZ X;  5LB6 A;  5I0U A;  1W05 A;  5F1R A;  1HQN A;  5A7W A;  5FYT A;  1DQ1 A;  1STM A;  2X8K A;  3LEK A;  4Y1Z A;  3ZSL A;  1TQ5 A;  2DFB A;  3Q8F A;  3RPQ A;  1C3H A;  4QHO A;  4MLO A;  5FY0 A;  3BI3 A;  3ZFG B;  2QUO A;  1SLI A;  3AKP A;  4Y4R A;  2XBO 1;  4CYD A;  4IEY A;  1H2L A;  1VLN A;  4N8M A;  3LE0 A;  3OBT A;  1PK6 A;  1XB9 A;  1GLH A;  2BRT A;  2DUR A;  5DG2 A;  1H4G A;  4XDP A;  3WQ7 A;  1GAN A;  2AYH A;  3RI8 A;  3ZSJ A;  4DUW A;  3RZG A;  1LOC A;  1VBC 3;  1Q3E A;  1HRV 2;  2PLV 3;  4IGP A;  4OLL A;  2LUW A;  1Q8P A;  4QPW A;  5HI0 A;  4CDU A;  1CAV B;  4AYU A;  3VBO C;  5HPO A;  1RUE 3;  3POF A;  3CL1 A;  1LHW A;  3J4U H;  2VUC A;  4RQP C;  5GKA C;  3WR0 A;  4CXW A;  3BAL A;  2HKX A;  3AZY A;  1RUG 2;  1AXZ A;  4BPZ A;  3B7M A;  2E7Q A;  1FAY A;  1RMU 1;  3MIB A;  2QQP A;  1DGL A;  3DKQ A;  4RR3 A;  5CFC A;  1W8N A;  2VNR A;  2JG9 B;  2ET7 A;  2JIC A;  1O3R A;  2WNU C;  2AUY A;  1POV 1;  4GWJ A;  3OBZ A;  4D0Q A;  3BOW A;  2Q1M A;  4AZZ A;  3GNE A;  3UGH A;  3BPS A;  3C2U A;  2G9Z A;  4YPJ A;  1RUC 2;  2QQN A;  4KGQ A;  3SIS A;  1V6J A;  1O8P A;  3ZXA C;  1J83 A;  3VHN A;  3OEA A;  3S0M A;  3CEW A;  2VUJ A;  3UJQ A;  2WA4 A;  1EY2 A;  3A4U A;  4UFL A;  3I8T A;  2Y26 A;  3I2J A;  2JIJ A;  2W39 A;  2W92 A;  3DPR C;  3VBH A;  3ZYR A;  4GB3 1;  2P5B A;  3NNM A;  3G7D A;  4CP9 A;  1CN1 A;  4AEK A;  1RUG 1;  1R09 3;  4IE6 A;  3S57 A;  1ZRE A;  1PX4 A;  2X29 A;  2WNO A;  2ZEX A;  4PLO A;  4W50 A;  2P3I A;  4QQ2 A;  3JXS A;  4AHW A;  2ZGK A;  4N9I A;  4QX7 A;  3U75 A;  2WAB A;  2VQT A;  3OGS A;  5JZG A;  3NV4 A;  2DBI A;  1UZW A;  2GAL A;  1S0D A;  1FX5 A;  4DIN B;  1NY7 2;  1VBC 1;  1OLR A;  5IVC A;  5K0U C;  3BGA A;  5A33 A;  3WD5 A;  2VXR A;  3H7J A;  4BQX A;  1FOD 2;  1VJ2 A;  3RJ2 X;  4CA9 A;  3NNF A;  4XMI A;  5KHJ A;  1UF2 C;  1PVC 3;  4DOU A;  3VZK A;  5DUU A;  1NKG A;  5GZE A;  4S2H A;  4LKF A;  3ZFF A;  1M06 G;  2RHP A;  2VZ3 A;  1JU3 A;  1QH6 A;  1PVX A;  1XC6 A;  4AK3 A;  1CAX B;  1RUF 1;  1CIY A;  4CZS A;  1Z7S 1;  5BNO B;  4DUX A;  3TEZ A;  4TTG A;  4A6S A;  2ADE A;  1OH3 A;  1F5J A;  2RR1 3;  3ACL A;  4XDO A;  2OA2 A;  2QTW B;  5FY8 A;  3VKN A;  4C1W A;  2UWC A;  3ACF A;  5FZ1 A;  2ZX4 A;  3CJX A;  1F9K A;  2VG9 A;  3L2H A;  3OY8 A;  3M3I A;  3J8F 1;  4LO5 B;  5IVV A;  1QJU 1;  3HNM A;  4BXF A;  2HH9 A;  5FO9 B;  1F31 A;  2LTN A;  2C9K A;  4FOQ A;  2WO7 A;  1C5I A;  5BYN A;  3WHU A;  2TUN A;  1BHG A;  3D5O A;  3PHM A;  1OKQ A;  4ARX A;  1QNW A;  4ZU4 A;  2IXC A;  2WZP P;  1JH5 A;  4HOO A;  1V9U 3;  1S55 A;  5F2W A;  1PHM A;  2P3J A;  2WC2 A;  4PQQ A;  1Y4W A;  5CZK A;  4AI8 A;  3OG2 A;  2XBO 3;  3RYR A;  2HWB 1;  3ES1 A;  3RYK A;  4DY5 A;  1VBA 3;  2LM3 A;  2V4V A;  4MSV A;  4DFS A;  3D8C A;  4XAC A;  3PIJ A;  1JZ4 A;  4NHK A;  1OD5 A;  1IPK A;  1YI7 A;  1IQA A;  2P37 A;  3ON7 A;  1BCX A;  4HK8 A;  1FMD 1;  2ZGL A;  3BCW A;  3PUQ A;  5DAB A;  1PGL 2;  2Y6H A;  2CGN A;  1KJL A;  1G9A A;  4QGN A;  4P14 A;  1URX A;  4L11 A;  1ND3 B;  4BME A;  1LOF A;  3DF0 A;  1FMD 2;  1W9F A;  4RD7 A;  1OOP B;  5E16 A;  2E6V A;  5EYX A;  1V9U 2;  3VBO A;  1TZO A;  2GU9 A;  3HD8 B;  1S0B A;  5FZ9 A;  2FMD A;  2B8M A;  2QQL A;  1IS5 A;  3T1M A;  4AXO A;  5A3M A;  4IEW A;  1H0B A;  3BU0 A;  1ODM A;  3I2I A;  1BYH A;  5JWP A;  3I59 A;  4QU2 A;  1WLC A;  2CGP A;  1D4M 3;  4HON A;  3RZZ A;  5JPM B;  3FLR A;  5KHK A;  2C4X A;  1XSR A;  3ACI A;  1O91 A;  3T0D A;  1F15 A;  3FWE A;  1DFQ A;  4DUV A;  2XJU A;  3QD6 A;  5KXB A;  5FWE A;  4COW A;  3A0K A;  1SLL A;  4L2N A;  2DYC A;  4AG4 A;  1Q8Q A;  2YU2 A;  3FHI B;  1MZE A;  3MI8 A;  1OF3 A;  5DZF A;  2TEP A;  2HBU A;  3ZYJ B;  3INA A;  4BA6 A;  1ZBA 1;  5DUW A;  2XKO A;  4JGY A;  4QQH A;  4R4Z A;  1W8F A;  4OQ9 A;  1ENX A;  4IEO A;  5LY2 A;  3I97 A;  1VBE 2;  4EYU A;  4AHY A;  4H3W A;  2FZ2 A;  2ORZ A;  2V09 A;  4HET A;  4Q2F A;  4H7L A;  1OA3 A;  4OMD A;  1H2N A;  3PU3 A;  1ZZ8 A;  3RJR A;  1US2 A;  1YFW A;  4D3W A;  4L99 A;  3WSO A;  3AVR A;  3TEX A;  2XG3 A;  5T5L A;  4CDQ C;  1FPN 3;  3QH6 A;  4E9K A;  1GNZ A;  1UIJ A;  4FP3 A;  4XJ8 A;  2Y38 A;  1FOD 1;  3III A;  4B4R A;  4RL7 A;  1TG7 A;  3USS A;  1VPH A;  3EHK A;  4IV3 A;  5K9Y A;  3A7Q A;  4CSW A;  1LOE A;  4TZD A;  1RUI 3;  2YU1 A;  1W90 A;  4OHX A;  5FZG A;  3DPR A;  3RZH A;  4QGM A;  1YHF A;  2W91 A;  1J1T A;  3LEI A;  3BTX A;  2C5D A;  4OCT A;  3WW3 A;  1VAK A;  2ARC A;  4B7K A;  3H7Y A;  2P6H A;  3HJR A;  3K51 A;  2R30 A;  1H1M A;  1S1A A;  1WCS A;  5FDB A;  3E5Q A;  4I0W B;  3ROU A;  4LOT A;  2IXJ A;  4GIQ A;  4BQW A;  1RJ8 A;  4NN0 A;  4C8D A;  2Z42 A;  2YFU A;  5FPU A;  4CDX C;  4P9I A;  4YW1 A;  3OEB A;  4CEY B;  5FP9 A;  3T2O A;  4IET A;  1R08 3;  5A3T A;  1OD3 A;  1PO1 1;  3N9N A;  1WGP A;  2D5H A;  4PCR A;  2WR9 A;  1W28 A;  4IE5 A;  3C7G A;  4Y22 A;  1XNA A;  2BBA A;  4TLG A;  5FP7 A;  4OQ8 A;  1YQ8 A;  4JQR A;  3KCX A;  2PHL A;  1OI6 A;  5KHG A;  3ZXJ A;  2HWF 3;  1Y3T A;  4IV3 C;  3P3P A;  3EBR A;  4XJ9 A;  1O4Y A;  3I3E A;  3CZJ A;  4P02 B;  5FWJ A;  1ASJ 2;  4L9B A;  4NMI A;  4QDR A;  3BUC A;  4NIG A;  2QQJ A;  4M00 A;  4XE9 A;  1N3O A;  1W8U A;  5IFT A;  3E1F 1;  1G8W A;  4NRO A;  5J96 B;  4CPB A;  1MS1 A;  2RMU 3;  3BPZ A;  3WOG A;  4YW3 A;  5I0T A;  4AW7 A;  4OVE A;  5JIU A;  5EPA A;  3IN9 A;  3VDB A;  4F7Z A;  2VCA A;  1POV 0;  2VL4 A;  3WF4 A;  1YC6 1;  3R4U A;  2CDP A;  2JE7 A;  3AL5 A;  3TYJ A;  1R1A 1;  2DU1 A;  3UJO A;  1FNY A;  2BTV C;  1PMI A;  1UIK A;  2VBB A;  5DAP A;  3U11 A;  3K4Z A;  1KGY A;  3VHP A;  4A4A A;  4UT5 A;  1FPN 1;  4LUL A;  2HWE 1;  1NZC A;  4YW7 A;  2BVB A;  1PM7 A;  4LO4 B;  3QOP A;  2ARB A;  2BDR A;  4ISQ A;  5JMC A;  2GC1 A;  3VZM A;  1PIV 2;  2CU5 A;  4LO6 B;  1W8Z A;  4DIQ A;  3J9S A;  2WWJ A;  3IDB B;  1RUD 2;  3VDD B;  4GXL A;  5CG9 A;  2W1W A;  1YLL A;  4HAN A;  5JR7 B;  3ZFG A;  2J1U A;  1QIQ A;  4V2V A;  2HWF 1;  2VME A;  5FZ7 A;  1UOG A;  2XHN A;  3AMP A;  3C7F A;  2R1B A;  3B01 A;  4BLI A;  3AP7 A;  1EAH 2;  2DCY A;  2Z5W A;  1SG3 A;  2PHF A;  2A71 A;  4D7Y A;  4GWN A;  1CR7 A;  4ZXE A;  5C9A C;  1HQL A;  3I3Q A;  4JTO A;  5FCC A;  2D6P A;  1H1I A;  2ZHN A;  4CU9 A;  1NXM A;  3HT2 A;  4WZC A;  1VRH 1;  2PXJ A;  4NOT A;  5FK8 A;  3VL9 A;  2GME A;  1VBD 1;  4GMP 0;  1FI2 A;  3SC7 X;  4JVA A;  3OY8 B;  1IHM A;  3VLB B;  1UY2 A;  2XON A;  3TN9 2;  4QXH A;  1VMH A;  4YVW C;  4QPI A;  4JCK A;  2VNV A;  2RS1 1;  4J1W A;  5L9B A;  4EWE A;  1QF3 A;  4PBO A;  3GAL A;  4LHS A;  2DTY A;  1UPS A;  2ARX A;  4H2A A;  4B1M A;  4P08 A;  4OI2 A;  3WNM A;  2WZR 2;  3VZN A;  2K0G A;  4CDW C;  3AKQ A;  4QKB A;  2EAA A;  1C1F A;  4PIX A;  1B09 A;  1AR8 1;  4XZU G;  4IE7 A;  4AI3 A;  4QXB A;  1CES A;  1HXS 3;  3MLK A;  4UW6 A;  5D21 A;  1OKO A;  1LAJ A;  1OA4 A;  3VDD C;  1GIC A;  4CDX B;  5AFE A;  2WSU A;  3ZSM A;  5FY7 A;  2WNU A;  5A1L A;  2IWG B;  2I07 B;  1UU5 A;  3MYX A;  5JI9 A;  4FTB A;  3HEI A;  4NID A;  3DYP A;  5IAT A;  5KXC A;  4BDV B;  4BHP A;  5LRR A;  1TMF 1;  2DFC A;  3D3A A;  2GH8 A;  2VAU A;  2YG0 A;  3H8U A;  3RSJ A;  4AE2 A;  4BQ3 A;  5IK8 A;  2YC0 A;  4UF0 B;  1QMJ A;  3AZZ A;  2BOI A;  4AQ2 A;  2FDH A;  1PZ7 A;  1NT0 A;  4Q4W 2;  1V6M A;  2PQS A;  3GJB A;  3RG0 A;  5FLJ A;  2PHR A;  4FPJ A;  1YI9 A;  3VBF B;  4RN5 A;  1G7Y A;  2VW0 A;  3RGB A;  1H8T B;  5L36 A;  3WQB A;  3IAQ A;  4GMP 3;  4LO7 A;  2P6C A;  4QQO A;  4TN7 A;  4COU A;  1W39 A;  5IK5 A;  1OPO A;  1EPW A;  4D94 A;  1OQE A;  3PTY A;  4ET7 A;  5C71 A;  2DCT A;  5AC9 2;  5CBL A;  1X9T A;  2YGL A;  3O5S A;  1LB2 A;  5JXJ A;  3FC0 A;  3LDK A;  1QJU 2;  2W46 A;  2Y6L A;  2W87 A;  2VZT A;  3UK9 A;  1S0E A;  1CGP A;  3ES4 A;  2ORX A;  4MOA A;  4HVQ A;  5BNO C;  1FMD 3;  3LEM A;  5GLU A;  2D6N A;  1PGW 1;  3W59 A;  1VBB 1;  4Y26 A;  3ZDS A;  3WF2 A;  2L9L A;  1NE4 A;  1O7F A;  4XQ4 A;  4CDW B;  3GZT B;  5L7O A;  5FYH A;  2NLR A;  4O61 A;  4AFA A;  4AQ6 A;  1WBL A;  1D2Q A;  4YW5 A;  1DLL A;  4WV8 A;  5LWB A;  1QJZ A;  1AZD A;  1YQ2 A;  2XVL A;  4AFM A;  4GB3 2;  2BYV E;  3U78 A;  2VH9 A;  1TME 1;  3ZXK A;  4RR3 C;  4LKE A;  4R9B A;  1RUE 1;  1JYC A;  4BK4 A;  3PME A;  1MZ6 A;  2R04 2;  2WN2 A;  4WBB A;  2PHU A;  5T5P A;  3MGU A;  2JG8 A;  3EMR A;  4WM7 B;  4XBL A;  1BLZ A;  2ZGQ A;  1WW4 A;  1X8E A;  3KD4 A;  4N43 B;  3S7I A;  5FIX A;  1X82 A;  3ASI A;  3M1H A;  4MZU A;  2G19 A;  3BOD A;  4KL1 A;  1ZYB A;  1LGN A;  3MO4 A;  4RHV 3;  5F5A A;  2HWD 1;  5IAV A;  4HSL A;  2HWB 2;  3S7E A;  2FHR A;  4YM2 A;  3UV9 A;  2XR4 A;  2XUM A;  4P9J A;  4QB1 A;  1F35 A;  4AL9 A;  4CDQ B;  2DTW A;  2D98 A;  5EZW A;  4YZ5 A;  3JUU A;  3HQU A;  1MZ5 A;  1TNR A;  4QQL A;  2VZO A;  3FFZ A;  4ZS3 A;  4ZU7 A;  3VBR A;  3POY A;  5FV3 A;  2BW8 A;  3E6D A;  2AH2 A;  4LOS A;  3KT1 A;  1RMU 3;  4LMF A;  4D69 A;  2CYF A;  1H6X A;  2YXS A;  1OMI A;  1V6L A;  5FJK A;  4YGC A;  4E4D X;  4ZZ5 A;  4AGG A;  2HLE A;  1VIW B;  4OZO A;  4LA2 A;  5I8T A;  4YM0 A;  3KLS A;  4P00 B;  4RGG A;  5C3Q A;  2I74 A;  5H9S A;  5F3C A;  4AF9 A;  1W06 A;  4TWT A;  4K8R B;  4Y1Y A;  5EYY A;  5C8C C;  1APN A;  4FFF A;  2RDN A;  5D8A A;  2ZHM A;  1O3S A;  4PHZ A;  2E51 A;  3FN9 A;  1ND3 A;  1UL9 A;  2ZX0 A;  3B00 A;  4HMZ A;  4R8H A;  5LA2 A;  3WX5 A;  3KQR A;  2VOK A;  1CAX A;  4JTN A;  2GC0 A;  1JOJ A;  3LA3 A;  4XPV A;  1W0P A;  3ETP A;  5LRS A;  3CNA A;  3KQ4 B;  4EWA A;  3OYW A;  4NIA A;  4Q1P A;  4I30 A;  4IES A;  2HBT A;  5CVR A;  1Q8S A;  4AHX A;  1NZI A;  1RUE 2;  1S0F A;  3KB5 A;  5FPZ A;  3WCR A;  1QU0 A;  5DDJ 1;  4OI4 A;  4LNV A;  4OUS A;  1WZX A;  3RZM A;  2DVA A;  2BNM A;  4NPR A;  1HRI 3;  3MV0 1;  3RMY A;  3X29 B;  4K3U A;  1H2K A;  2MPF A;  1BXH A;  1UX7 A;  3O12 A;  3EO6 A;  2DVD A;  3D82 A;  4QX2 A;  3NNJ A;  4FFG A;  1ACC A;  3SEE A;  1X50 A;  4BH9 A;  4CDU C;  3O1S A;  1XYO A;  3OUJ A;  3T2P A;  3AXD A;  4AVA A;  4K40 A;  3WCS A;  4JZR A;  1RYY A;  3MZH A;  2Y6G A;  4P9L A;  5J98 B;  3WIN E;  1NE6 A;  2K9Z A;  2OQ6 A;  2ZKN A;  3OD4 A;  3J8F 3;  2BER A;  4PIY A;  4XCB A;  5FAX A;  5T3N A;  2CAV A;  1D4M 2;  1LED A;  1KDM A;  1Q8V A;  1WW7 A;  4UI9 L;  2OPW A;  1LTE A;  5GJ6 A;  4ASK A;  4GJZ A;  5JOZ A;  1HB3 A;  5E6H A;  1PK6 B;  3VN4 A;  3ZIW A;  1PIV 3;  4QX8 A;  3H1M A;  2EIB A;  3K2O A;  4IV1 C;  1XSQ A;  1V0A A;  2CDO A;  3HNB M;  1NCR C;  5DN2 A;  4YYO A;  4CDX A;  4CTE A;  5JSO A;  3TNP B;  4B7E A;  4G3Y C;  1C28 A;  2YBS A;  2Q8O A;  1W6P A;  2ZXQ A;  5LEJ A;  1IPS A;  2WZE A;  1UMH A;  1MZF A;  2K2S A;  2XVK A;  3PNA A;  4AVV A;  2KXL A;  1AYM 2;  1PZ9 A;  4TSV A;  1RUJ 2;  2Y0I A;  1LJ7 A;  4EV0 A;  4XC9 A;  2WBK A;  1XU1 A;  1G9C A;  5CAD A;  1KJR A;  1XXN A;  1TMF 2;  1J3R A;  4TYS A;  1YQ6 A;  2Q0A A;  1BK0 A;  2XOM A;  3SCF A;  2NN8 A;  2JB8 A;  1R1A 3;  3WNO A;  4HN0 A;  5K8S A;  3NST A;  4Q0Q A;  2Q30 A;  4XUP A;  2FCT A;  3NRU A;  2RDR A;  2WYS A;  2D7F A;  1QJY 1;  4YG0 A;  1XU2 A;  5GZG A;  4XEZ A;  5EV7 A;  4E4S A;  1V6N A;  1AR7 3;  3VD4 A;  4CCD A;  3F2Z A;  3GDB A;  3I54 A;  1EV1 3;  5I8S A;  2P1B A;  2J1T A;  3CLP A;  4UBG A;  1SAC A;  1Z7S 2;  3EXU A;  2VY0 A;  4CP9 B;  4S2F A;  1Z78 A;  2XH6 A;  3ZFF B;  1SLA A;  4Z2W A;  2R07 1;  3DPR B;  5F3E A;  3U4X A;  5A3N A;  3FZ3 A;  3M2M A;  4JQT A;  1UZ0 A;  3MLJ A;  1PO2 1;  5JLV A;  2H6B A;  3PU8 A;  4FPE A;  5CG8 A;  1K42 A;  4QPI C;  5A3P A;  3K77 A;  3VKF C;  2JEN A;  3MDP A;  3J7N A;  4I3P A;  2Q5T A;  3GGL A;  4QT6 A;  2W95 A;  3NNL A;  3WZ1 A;  1YFY A;  5FLI A;  2J1E A;  2FDG A;  2C26 A;  3O0W A;  1IZ3 A;  1ZZB A;  2NMN A;  3KWV A;  2F4L A;  5JZG C;  3FE5 A;  4UBH A;  2AR6 A;  3KVA A;  1XQN A;  1ZVF A;  1RUC 1;  1CZS A;  3H1W A;  4B1L A;  2WJS A;  3ZXL A;  3DUI A;  4YWA A;  1W6Q B;  5FFO C;  1ZZ6 A;  1WUV A;  3ZYP A;  4CCJ A;  2E7T A;  3OGJ A;  2WZ8 A;  4LTA A;  4C1X A;  4P9Y A;  1XNT A;  2GC2 A;  4LE3 A;  4LHL A;  3T0B A;  3HWJ A;  2XXZ A;  4HKO A;  1I6X A;  3L9J T;  1AX1 A;  2DVG A;  3EQE A;  1Q5O A;  3AFK A;  4M3C A;  3M3E A;  4M0N A;  3VHR A;  3MF6 A;  3NJV A;  2A3X A;  2X5I B;  1QJU 3;  3W9A A;  3WUD A;  1JZ6 A;  2QQW A;  3E5U A;  3U37 A;  4LE4 A;  3WW1 A;  1HQW A;  1QJF A;  1UPI A;  2EF6 A;  3TOJ A;  4BQ2 A;  2ZZJ A;  1GKB A;  2FCV A;  4Q4X 1;  1H30 A;  3WP6 A;  5EIY B;  4MXW B;  4CU8 A;  2B46 X;  2EIC A;  2VNO A;  1CZT A;  5BPX A;  1A8M A;  2GC3 A;  1QXR A;  2HWD 3;  3S6P A;  3JBG 2;  1VB4 A;  1I5P A;  3J7L A;  1RHI 2;  2E33 A;  2HWC 3;  1VBE 3;  1KS4 A;  3AVS A;  5T5J A;  4D6R A;  3TBD A;  5C4W B;  1RJ7 A;  2WQ4 A;  5BNO A;  4MGY E;  1DQ6 A;  3T4H B;  4NHM A;  2D43 A;  2VMG A;  3PTR B;  2JX9 A;  1BKZ A;  3O1V A;  1JYX A;  1QXP A;  2VZQ A;  4UFM A;  3OGR A;  5J48 A;  3ZOI A;  1LOD A;  3KVB A;  2ZGO A;  4LK7 A;  4ZXK A;  3ZPO A;  4DEV A;  1QKQ A;  4FAH A;  5HCA A;  5JXH A;  2JIG A;  4FO9 A;  4LKS A;  4RGA A;  3VBR B;  1KFU L;  4LO8 A;  5ANN A;  2A6W A;  3AXE A;  5A3L A;  5C4W C;  2JD9 A;  1G6N A;  2ZHL A;  3BOP A;  2CNA A;  4GKY A;  1AR7 2;  1GOH A;  1YNA A;  3JBG 3;  4GAZ A;  5DAV A;  3MIE A;  4BM8 A;  2RM2 1;  4ZS2 A;  1SCR A;  2DCK A;  3MIH A;  2QZ3 A;  4CP2 A;  1OH4 A;  1E5H A;  1JXN A;  2VUD A;  3K46 A;  4Y24 A;  1UO9 A;  5ACA 2;  1AX0 A;  1ENQ A;  5C7G A;  1SFY A;  1ZRD A;  1N1Y A;  5APA A;  1E57 A;  4RS5 B;  4KG0 A;  1TVG A;  4FOV A;  5FZD A;  1DZT A;  1S2E A;  2GP5 A;  5HXV A;  4XIK A;  3VV1 A;  1C8M 3;  4WM7 C;  4RHV 1;  3WXP A;  1W6M A;  1AYN 3;  2O1Q A;  5CIR A;  1OUS A;  4F3J A;  5I8Y A;  2VCB A;  4WM7 A;  4KBZ A;  1R1Z A;  4XJZ A;  5D1I A;  2ZOE B;  5CA6 A;  1GNH A;  1YFX A;  5CKN A;  5ABJ B;  4AFB A;  1SZB A;  2Y34 A;  1S2B A;  3OGV A;  4UW5 A;  3JQX A;  3BYW A;  2IXL A;  4KWK A;  1JZ8 A;  1ZBA 3;  2AAC A;  2ZJC A;  2OYZ A;  3VBF A;  2DBN A;  4ZZ8 A;  1PVC 1;  4HXC A;  1WA6 X;  1Y7B A;  1U0A A;  1OVS A;  4UAP A;  1NCR B;  2DVB A;  2ILM A;  2XLA A;  5F39 A;  4WM8 A;  4N43 A;  3T0A A;  2FDJ A;  2WO3 A;  4QKN A;  4PI2 A;  3ZSK A;  2W1Q A;  1GU3 A;  3K4A A;  4E4Z A;  3T2Q A;  3WP4 A;  5CFD A;  1ENS A;  5T52 A;  5FZA A;  4LBQ B;  1W9Y A;  1I9R A;  1W6N A;  2OX0 A;  1XYN A;  5DAQ A;  3RI9 A;  3ME2 A;  4YG3 A;  1QGL A;  1C4R A;  4HZF A;  2VOT A;  3FBY A;  2XML A;  4NO4 A;  1RUI 1;  1AXK A;  4ERO A;  1KDK A;  1BBT 3;  3L2Y A;  4KWU A;  1RB8 G;  4ASL A;  3O0X A;  1ND2 A;  1ODN A;  2NZ9 A;  1LNS A;  3T30 A;  1Z0H A;  2VE1 A;  5KHH A;  5IJR A;  3ATG A;  2O14 A;  4MXW A;  3ZSE A;  4YVS A;  1X9P A;  5CU1 A;  1H8T A;  4W8J A;  4YGB A;  5FPX A;  4QX0 A;  1VMJ A;  5F32 A;  4ZY9 A;  5G04 L;  3AP9 A;  3DN7 A;  4W65 A;  4WVW A;  5BNP A;  4GJY A;  4XHB A;  3RVH A;  1SFP A;  1WKY A;  2FCU A;  3ZXE A;  4RSU A;  1O5U A;  1IKP A;  3USU B;  3GBW A;  1W8O A;  1Q8O A;  1F4A A;  2WIN B;  4BZ4 A;  1JHN A;  3PDQ A;  2ZX3 A;  1SEF A;  2WFP A;  4GWM A;  1OUR A;  5LBE A;  3RYP A;  4CUA A;  2XJV A;  4PDW C;  3O1P A;  2YPD A;  1FYU A;  1YFU A;  4OUE A;  4L0P A;  4A6O A;  2HWC 1;  4QM8 A;  1BVV A;  2VM9 A;  1QQP 2;  5BUV A;  2RS5 1;  1QHD A;  2RS1 2;  4OMC A;  4XTP A;  5A7S A;  1W2O A;  1GOG A;  2YB7 A;  3WQ1 A;  2CV6 A;  2W52 A;  1XNC A;  2F6B A;  4YM1 A;  4XTM A;  5FYM A;  4OI0 A;  1BEV 2;  3IZO A;  3D0J A;  3JCI A;  3PLQ A;  1VBD 2;  4IV1 B;  1VRH 2;  3GM8 A;  5KHI A;  2H0B A;  4XDQ A;  2WZR 1;  2OW4 A;  4J25 A;  5FPB A;  2AEN A;  5LA9 A;  3U1X A;  1D2S A;  1K5M A;  2B42 B;  1MEC 2;  2G1M A;  3ACG A;  1HV0 A;  3KSC A;  2V73 A;  1POQ A;  4NHX A;  4LOR A;  4YZ3 A;  3THP A;  3N4M A;  1JHJ A;  1O5L A;  1VP6 A;  2VUL A;  4Z07 A;  3OGG A;  4URA A;  5FRE A;  1DIW A;  2ZAH A;  1REF A;  2CTV A;  2E31 A;  3A21 A;  3CMG A;  1W6Q A;  3SKV A;  5EP9 A;  3FBM A;  4LT5 A;  4GZ9 A;  1LHN A;  2UYA A;  1UMZ A;  5C3S A;  4LUM A;  1VBD 3;  1OT5 A;  2YYO A;  1W2U A;  2YZ4 A;  3FUQ A;  4O7X A;  2R06 3;  4Q0P A;  1L7Q A;  2GNT A;  2EA7 A;  4YLZ A;  2B9V A;  2GN3 A;  1C8M 2;  2WDB A;  3NWK A;  3VGI A;  3A22 A;  1MS3 A;  4XUO A;  4FOY A;  3CBN A;  1NLR A;  1FPN 2;  4YSF A;  3AZW A;  4JGZ C;  5BXX A;  1H9P A;  1K5M B;  1PMJ X;  2ZGU A;  3LPG A;  3R4S A;  4HKL A;  1RMU 2;  3WNN A;  1K5J A;  3ZXG A;  3VB9 A;  1J1L A;  4FAG A;  3CQO A;  1COV 3;  2PQQ A;  3BU7 A;  1I3H A;  3KF3 A;  3SIT A;  3VZL A;  5F3G A;  1EYB A;  4RR3 B;  2IZW A;  1MS4 A;  2Z79 A;  1DYP A;  2VVE A;  2VZR A;  1JOP A;  1HB2 A;  2JDN A;  4G9S B;  4C91 A;  5FUN A;  3JU9 A;  2OUH A;  3FJS A;  3DL3 A;  4AI2 A;  1ZRF A;  1Y9M A;  4YVS B;  5H9P A;  1RUH 1;  4D7T A;  1W2A X;  4WVM B;  4EZ4 A;  3AYC A;  4E4H A;  3AP4 A;  2X5I C;  3NW4 A;  1CIW A;  5FLH A;  1SBD A;  1YCI A;  4NUB A;  3AMN A;  3KF5 A;  3FHA A;  2ZGR A;  4FPH A;  1QDC A;  1LGC A;  2GN7 A;  2W2I A;  5LBB A;  5AVA A;  3SEP A;  2K46 A;  3KZ4 C;  2D97 A;  3F95 A;  2ARE A;  4XVH A;  3KV6 A;  2CGO A;  3G6J B;  4G4F A;  1OLQ A;  2PYT A;  4IXL A;  4NPL A;  3LDR A;  2JDZ A;  4CPB D;  2BEO A;  4QU1 A;  2VU9 A;  5E89 A;  3WNK A;  3ZYB A;  1CAW A;  1M4W A;  1WLW A;  4LBK A;  5FXV A;  1O59 A;  1RC6 A;  1TNF A;  1JUH A;  3BTA A;  4IEQ A;  1XE0 A;  1HJG A;  5T50 A;  3ZO0 B;  1GR3 A;  3KMH A;  5C6C A;  1QH7 A;  1LU1 A;  3CHX A;  4AFC A;  4COY A;  1DQ2 A;  3ZKU A;  1UCX A;  2VOW A;  1JI6 A;  2QBX A;  2P17 A;  3ZMN A;  2A3W A;  1UQX A;  2VW1 A;  3AB0 A;  2VMI A;  4JHT A;  4QPI B;  1AL2 1;  2E32 A;  1WMF A;  2YC4 A;  5FQ0 A;  3AC0 A;  3UL2 A;  1HRV 1;  2OT7 A;  1XND A;  3W20 A;  4UXA A;  3ZFF C;  3NQH A;  1K5M C;  5FXW A;  1V70 A;  4MAD A;  1V9U 1;  3H3Z A;  4I02 A;  4XFF A;  2GDF A;  3DYM A;  4WM8 B;  4YNI A;  1WMD A;  3MFA A;  4X8P A;  3LKJ A;  3U4S A;  5LZ6 A;  2BNO A;  4MYE A;  1NCQ A;  2WLP A;  4C0B A;  2VC9 A;  3B93 A;  4PF1 A;  2HEV F;  3HT1 A;  1VBA 1;  4A7Y A;  1SLC A;  3VKO A;  1NCQ C;  2A6X A;  1OHF A;  3N9Q A;  3WF3 A;  5FZB A;  2PMW B;  4DS0 A;  4BMB A;  2D6K A;  3IBM A;  5EQU A;  4YW4 A;  5IVY A;  2W0X A;  2XQX A;  3UYJ A;  1N3Q A;  1AUY A;  1S0G A;  5L7O B;  1FV3 A;  1XE8 A;  3PVB B;  2C0Z A;  3VD7 A;  4CU7 A;  4Z2A A;  2WS9 1;  5DZG A;  4EN0 A;  3SNM A;  1HXS 1;  3IPV B;  3WDU A;  2J1R A;  5IVF A;  4DRV A;  4HPK B;  3QCW A;  1CZV A;  3SKJ E;  3UT0 A;  4FPG A;  3VBH C;  1WCD J;  5CFC B;  5ACA 3;  4V2W A;  2XDV A;  4CCE A;  5FZO A;  2VUA A;  2UYB A;  4B4Q A;  4MGT A;  4UFI A;  4A7K A;  2WNV A;  4GA9 A;  3ZYF A;  3ZPY A;  4XMA A;  4PT6 A;  4XAE A;  2XPJ A;  1RED A;  1CD3 G;  1VB2 A;  3RQ0 A;  2JG8 B;  2JDK A;  2QJV A;  4W6X A;  4A2U A;  1OUX A;  5H9R A;  3N35 A;  1ZBA 2;  4AFD A;  1W2T A;  4IEX A;  3M3Q A;  3S5Q A;  2XQR A;  1DZR A;  2B4K A;  2VVD A;  2BBV A;  4W4Z A;  4JAA A;  1R09 2;  4LLO A;  1T6G C;  2ETE A;  4I3G A;  2YBK A;  3GHN A;  3JD7 1;  4IQP A;  1CX4 A;  3TWI A;  2JKX A;  2QQV A;  1L7R A;  2B9U A;  3VL8 A;  3HBZ A;  1IG3 A;  1DP0 A;  3C7H A;  3TB0 A;  3ZFE B;  4Z8B A;  1QJX 2;  1SFN A;  2Y8K A;  1BMV 2;  1PNG A;  4R9A A;  1CAU A;  3BIW E;  4QX5 A;  4F83 A;  2W5F A;  1OOP C;  4LBO A;  1XYP A;  1HW5 A;  1WCU A;  2D3R A;  2XB6 C;  3IIA A;  4UWD A;  4QHZ A;  3MBW A;  4GD4 A;  2BP6 A;  1JS9 A;  4LIV A;  3IAP A;  3WF1 A;  5FMO S;  1EP0 A;  4HLT A;  4Q8L A;  1NQJ A;  3ZXF A;  1MQT B;  2UUR A;  2G9G A;  4WM8 C;  1RVF 2;  5DG1 A;  5GLZ A;  4AAP A;  1ASJ 1;  1SCS A;  5FXX A;  1DGR N;  3FLP A;  4XXA A;  1E5I A;  5LEK A;  4CDW A;  4NJ4 A;  1UYP A;  2JE8 A;  2Q8C A;  4DY3 A;  3B94 A;  3H8R A;  4EE2 A;  4FOW A;  2JDA A;  4PDW A;  2ES3 A;  3DYO A;  4WVZ A;  3WG4 A;  5LCW L;  1ASJ 3;  1W9W A;  4FXK B;  3GF6 A;  5DMY A;  1GZT A;  3PUS A;  3VDD A;  4IGQ A;  4QAW A;  3AFG A;  3NNG A;  3IMN A;  3VBS C;  5GM0 A;  4PI0 A;  1MS8 A;  5FYY A;  1CX1 A;  1SLT A;  2JDY A;  3AX4 A;  4FPC A;  3ZN6 A;  2VCC A;  1GP4 A;  4H14 A;  1VAV A;  3GYD A;  3AKR A;  5B4N A;  1ZA4 A;  5IVB A;  1A78 A;  2FDF A;  1H2M A;  2JDH A;  3J7M A;  3GBF A;  4DQA A;  4DB5 A;  2QNK A;  2P3Y A;  1LOA A;  5F6L B;  1FT9 A;  3AMM A;  1DYO A;  3ZN5 A;  4K21 A;  4B4P A;  5JOX A;  2CWS A;  5M0T A;  1F8V A;  3NVC A;  1WLT A;  1QQP 3;  4KNC A;  4Z82 A;  4QDQ A;  3ILR A;  3TRS B;  4ASM B;  2BZD A;  1DBN A;  1T2X A;  3OBA A;  3W5N A;  3HBK A;  1OFN A;  1NCR A;  1GWK A;  4FQZ A;  4MV2 A;  5J1X A;  4M3C B;  4NWW A;  4Q4V 3;  3HN3 A;  3P6B A;  1W04 A;  4PLN A;  4WVM A;  2Q8D A;  5FZ6 A;  3MEP A;  3BB6 A;  2PA7 A;  2GMP A;  3ZM8 A;  1W6P B;  4UFK A;  3ZXD A;  4BK5 A;  2VZS A;  3IB3 A;  5ISL A;  1RHI 3;  5EJZ B;  1MPX A;  1DQ0 A;  1UKR A;  4DO0 A;  1YO8 A;  2Y6K A;  4LHK A;  4Y4Y A;  1LU2 A;  3ZR5 A;  1JYN A;  3H8X A;  4Y22 B;  4FPL A;  2HWE 2;  3VBR C;  5F5C A;  1NY7 1;  2LRP A;  3EB7 A;  3VHO A;  4E2G A;  1F4H A;  4UF0 A;  1LHO A;  1AL0 G;  1YIF A;  2C6S A;  1AX2 A;  3JBG 1;  1SPP A;  2AZ5 A;  2DCZ A;  2ZAB A;  1JYI A;  2VQ0 A;  5FPA A;  2E53 A;  4XFH A;  4HSJ A;  4YZ2 A;  1HKD A;  1UKG A;  2RR1 2;  1AR6 1;  4N53 A;  1WCK A;  1U5Y A;  3BN6 A;  1CQ9 A;  3UKV A;  1ZBE 3;  4N90 A;  2QCS B;  2YFZ A;  3AMH A;  3MPP G;  5FYB A;  3AP6 A;  3VBS A;  3PUR A;  5BNN C;  2JB4 A;  4NVP A;  2ZMK A;  1C8M 1;  3PUA A;  4Q8K A;  4CCK A;  3ZIX A;  3B69 A;  1N3P A;  4L92 A;  4YW2 A;  1AF9 A;  4D6Q A;  1V6O A;  5FTT C;  1YQC A;  3WNP A;  1L7L A;  3AKT A;  1IQD C;  1NYW A;  3OUI A;  5GLV A;  2VBD A;  4AQT A;  4AWD A;  3AJY A;  1GYK A;  4CCM A;  4GKX A;  2W94 A;  1LOG A;  3VBS B;  2VD7 A;  3EJK A;  3ZYI B;  3O1O A;  2J7M A;  4M0H A;  4XQD A;  2RR1 1;  4QHB A;  2ID4 A;  1ZNP A;  3D4K A;  4GAL A;  4NRP A;  4QX1 A;  4WVV A;  2IXK A;  3TN9 1;  1KD7 A;  4HKW A;  1YQ5 A;  2XL9 A;  3CJI C;  4XQW A;  5CKM A;  5FYI A;  2ZKL A;  3CF6 E;  4LJH A;  4MHR A;  4EN9 B;  5L19 A;  3ST7 A;  5JVV A;  3UNP A;  5LBC A;  5C5T A;  1AHS A;  2HYK A;  2PFW A;  5FYV A;  5DPN A;  4IEU A;  4Q4W 3;  4MUV A;  4IEZ A;  1ZZC A;  4XUR A;  2VOV A;  2Y0O A;  3O7O A;  4XJW A;  4FBF A;  4LLF A;  1SBE A;  2OUJ A;  2J1S A;  3GZE A;  2DUO A;  1QJY 2;  2IXH A;  5FY1 A;  1O8S A;  1RUO A;  2WFF 1;  3AYD A;  1DGW X;  1T6B X;  4RFR B;  4E8C A;  2FDI A;  3POW A;  1WW5 A;  4AVT A;  5CFD B;  2IVI B;  4AHZ A;  3M70 A;  2HWC 2;  2WNV C;  4W6Y A;  2YDE A;  5I0D A;  2WT1 A;  3AL6 A;  1LRH A;  4JRL A;  2FZ1 A;  3WT3 A;  4LR4 A;  3R05 A;  5A6X A;  5A3U A;  2OZ6 A;  1VBE 1;  1EPZ A;  1HN1 A;  4A3Z A;  2XVG A;  4Q4V 1;  3SHR A;  1C57 A;  5FP8 A;  4Y5T A;  2KA3 A;  3HIF A;  3I4I A;  3BVC A;  4HBN A;  1UW8 A;  2XHK A;  1UXZ A;  5J09 A;  1O3Q A;  3PL0 A;  4BYY A;  5A6Q A;  5EJ3 A;  1O3T A;  5DQ0 A;  3I2D A;  1ND2 B;  4IEV A;  2YC2 A;  2RS1 3;  5BNN A;  5G05 L;  4XW3 A;  3FX3 A;  4XBN A;  1YJL A;  3OTF A;  1NG0 A;  5KXE A;  4I2O A;  1UN1 A;  1YEW A;  1YIP A;  2RVA A;  5FZF A;  2RM2 3;  4A7Z A;  1ENR A;  5HV0 A;  5D8A C;  3I2G A;  3KGZ A;  4AOC A;  1ULP A;  1CJP A;  3H50 A;  5DUX A;  2EXJ A;  3VBH B;  3AJZ A;  4K7J A;  4COZ A;  5LA1 A;  1JW6 A;  1GQH A;  2X09 A;  3CKH A;  1PZ8 A;  2R7E B;  3T1L A;  4DXS A;  1SLB A;  3MIF A;  4Q26 A;  1EAH 3;  4FFI A;  5KWR A;  4LEJ A;  2UY9 A;  1Y43 B;  1ULD A;  4XIL A;  3N9P A;  5FK7 A;  5FR3 A;  2J42 A;  3KHB A;  5FKC A;  1PGL 1;  2H0V A;  4ATF A;  3OJB A;  4NRQ A;  4DZG A;  1E5S A;  2NQY A;  2X10 A;  4AQS A;  1NCQ B;  4RHV 2;  2E9Q A;  1BJQ A;  2JWP A;  2R07 3;  5FBZ A;  5E1R A;  5DDJ 2;  1DQ4 A;  3TAY A;  3QLQ A;  4JKK A;  3KT4 A;  3NJY A;  2RV9 A;  5JXI A;  3V0A A;  4LBQ D;  4HN1 A;  3KV4 A;  1DGW A;  4QD2 A;  5DAW A;  5FZI A;  3WNX A;  5GZD A;  1OQ1 A;  5ACA 1;  3MW2 A;  1ONA A;  1PK6 C;  5IHR A;  1JBC A;  1XPW A;  1FV2 A;  2BWC A;  2R6Q A;  1REE A;  1RUF 3;  2A7A A;  3JB4 C;  4P9X A;  1CAW B;  2HJI A;  4BJ0 A;  2LRO A;  5GZC A;  4QQP A;  1J3P A;  1UD1 A;  1D0H A;  1COV 2;  3ZN6 B;  1MS0 A;  1R08 2;  2XLF A;  4DEQ A;  1ZRR A;  1EV1 1;  4KGG A;  1C5H A;  3HAG A;  4LQR A;  2V72 A;  2VEC A;  4Q4Y 3;  5ANQ A;  4M3C F;  3M3O A;  4E8D A;  3CO2 A;  2VNG A;  2ZMN A;  2AGS A;  4U36 A;  2A75 A;  2H6C A;  5D2A A;  5FP3 A;  3GXU A;  4JHZ A;  2YPJ A;  3U10 A;  1HX6 A;  5K4L A;  4PLM A;  4BB3 A;  1K3I A;  5J37 A;  4KMQ A;  4BIF A;  1VMF A;  2DV9 A;  3OB8 A;  5IWF A;  1EUT A;  4XUT A;  3E97 A;  1UY1 A;  2NPI A;  2YUE A;  4MGZ E;  2A6V A;  1W8H A;  2VZV A;  2QQU A;  5L9V A;  1Q43 A;  1RUJ 1;  2ZEZ A;  1GBG A;  4PJY A;  2VZ1 A;  4IND A;  3WLU A;  2WL1 A;  4P9W A;  3H8O A;  2EIG A;  3DXU A;  2XUE A;  3APB A;  1J84 A;  4FPO B;  4IGO A;  3I2H A;  1W9S A;  2ZBJ A;  5EFU A;  1S0I A;  2A5Z A;  4CXX A;  4IER A;  1V00 A;  2Q1Z B;  5AVP A;  2G9F A;  3ZFG C;  4NAO A;  1HB4 A;  5FYC A;  4UW3 A;  4AI9 A;  3O0V A;  4BCU A;  4K20 A;  4YVW A;  5K0U A;  3KCY A;  5F6K A;  1UOJ A;  2ET1 A;  2P3K A;  2YGM A;  5JOW A;  5IVJ A;  1X8M A;  3ZMO A;  5JZG B;  1VRB A;  4YM3 A;  2R32 A;  1C8N A;  4KBB A;  4QXC A;  4BQ1 A;  5IT6 A;  5F37 A;  4NHL A;  4JKL A;  4Y1V A;  2R16 A;  4JV4 A;  5HCB A;  4OHY A;  3N7K A;  3VBU B;  5ABJ A;  4QB6 A;  5E88 A;  4MET A;  3WVJ A;  3IDE A;  1CAV A;  1ULE A;  1VBC 2;  3E6B A;  3ELN A;  4IDZ A;  2XWJ B;  2PLV 2;  4FP2 A;  3V56 A;  3OD0 A;  1W6M B;  1UZY A;  2HWD 2;  1H1A A;  1GZW A;  2B5H A;  2GND A;  3D0S A;  3LIH A;  4XFI A;  4Q5O A;  5LAT A;  2ZGT A;  5AC9 3;  1TME 3;  4XF0 A;  2EVX A;  3NV3 A;  5CYY A;  1XRU A;  4N7U A;  3CU7 A;  2EAK A;  2EXI A;  1C1L A;  1AR9 3;  2JJ6 A;  2RS3 2;  4XIO A;  2WNU B;  1NAE A;  2VTX A;  5JIA A;  1NX9 A;  4CEW C;  1OBN A;  5IAX A;  4R4X A;  3THD A;  2OVU A;  4GH4 B;  2QZ2 A;  2R04 1;  4RQP B;  3LD8 A;  3V64 A;  4Y5S A;  2BV4 A;  5KXD A;  2PHT A;  2JE9 A;  3A0N A;  1KEX A;  4UOJ A;  2FBE A;  4BE3 A;  5F7U A;  2RS5 3;  4XF4 A;  1PO2 2;  5DXD A;  4UW4 A;  1VRH 3;  2V5Y A;  2GZW A;  4B29 A;  2MEV 2;  4FTS A;  1UAI A;  1ULC A;  4J6G A;  4LKD A;  3B5L B;  2R49 A;  1X33 A;  3ACH A;  3VBO B;  1UYZ A;  3RRD A;  4MO3 M;  3IMM A;  1WCQ A;  2DVF A;  5BNP C;  4OFG A;  5FYZ A;  5FY4 A;  3OPT A;  1V6I A;  5LK7 B;  1RUH 3;  3OSD A;  3PVE A;  3KS7 A;  4ZON A;  3JQW A;  1R64 A;  3AM2 A;  1EV1 2;  4EN8 B;  2GP3 A;  4I0A A;  1HV1 A;  3MF9 A;  2PTM A;  3UKT A;  5A7O A;  3JD7 2;  4LPL A;  4R52 A;  3SLI A;  1I1E A;  3V0A B;  2QQM A;  1NLQ A;  2IC1 A;  3LGR A;  3PJQ A;  2XGX A;  1W99 A;  2FQP A;  1MR5 A;  3ILF A;  1UY0 A;  3E5X A;  3Q8C A;  3MLL A;  3T3Y A;  4E2S A;  4F8A A;  3RZK A;  2WLQ A;  5F8P A;  1W6O B;  2ZGM A;  2QQK A;  3K48 A;  4Y3O A;  1AR8 2;  4CEW B;  5J7M A;  3B3Q E;  2WNV B;  4ORF A;  4OHZ A;  5C3R A;  1QXJ A;  2YHJ A;  2W68 A;  4IV1 A;  3Q8B A;  1UZV A;  2HYX A;  1NA1 B;  3C8X A;  4Q0V A;  4S2G A;  4S2D A;  4BIO A;  1H8T C;  2ERF A;  3HQX A;  3U0Z A;  2RMU 2;  2VR4 A;  4MHU A;  2JEM A;  2GNB A;  4MGK E;  2WT0 A;  3H3U A;  1UXX X;  2GMM A;  2X53 S;  4E2Q A;  2IXI A;  3NV2 A;  5F5I A;  2RMU 1;  3GCW A;  5DUV A;  4JGY B;  4MGS A;  4AED C;  4A42 A;  1QJY 3;  2PAK A;  4ISR A;  3OUH A;  5FPL A;  5TSW A;  3SH3 A;  3VBU C;  1N1V A;  3PUH A;  1DQ5 A;  1NQD A;  4A44 A;  1GWL A;  2JEC A;  3ZFE A;  2WQ8 A;  3KV9 A;  4O9G A;  1OLM E;  4XF1 A;  3VDA A;  1TME 2;  4CP0 A;  4CDQ A;  5FJH A;  2Q1F A;  1BMV 1;  2GNM A;  5FZH A;  5BNP B;  4RS5 A;  5A32 B;  5CKQ A;  1MQT A;  5A3O A;  3UES A;  2RDQ A;  1GFF 2;  1HRV 3;  5A80 A;  5C8C B;  1JYV A;  3VDC A;  2C9A A;  2EXH A;  3H1Y A;  4EN7 B;  3T4V A;  1G9B A;  5BNQ A;  2BUK A;  4BQY A;  3BIE A;  1W3V A;  3THC A;  1HB1 A;  3J8F 2;  3LSD A;  1LR5 A;  2WA3 A;  5FZM A;  4NIH A;  5B2G B;  2LW8 A;  1LCL A;  1PIV 1;  1QNY A;  4CCL A;  4DMI A;  4RA0 A;  3IWZ A;  4Y20 B;  2WS9 3;  4X8N A;  5KR7 A;  2HEW F;  3JZV A;  4L97 A;  2ZML A;  2XWB B;  3VD3 A;  5BV6 A;  2VOX A;  5A6Y A;  1AR7 1;  4XET A;  3M8L A;  5D8A B;  3DCQ A;  3AZV A;  4GH4 C;  4EN6 B;  2EXK A;  2D5F A;  4K1Z A;  4FPY A;  3TN9 3;  3J7H A;  3HQR A;  3P5B A;  4N9H A;  5F3I A;  5FPV A;  5BNN B;  1JOD A;  4YFZ A;  5CB7 A;  4FPF A;  3SCH A;  1ND2 C;  4K6B A;  1TE1 B;  5A7Q A;  4BU2 A;  4C90 A;  2SBA A;  3O1M A;  3HN1 A;  1JU4 A;  2VCM A;  1A8D A;  3K3N A;  1RUG 3;  4YZ1 A;  3POE A;  4CXY A;  4JGZ A;  3MFC A;  4K8F A;  1GMM A;  1UU4 A;  1N1T A;  3ZDV A;  1B35 B;  4ARY A;  2W9X A;  3I59 B;  2VBP A;  3NV1 A;  4CDU B;  1FAT A;  2YY1 A;  4K9S A;  1R08 1;  1UOB A;  4X6R B;  2QDN A;  1VAM A;  4YG6 A;  2O8Q A;  3RWN A;  3VKM A;  3GZA A;  1AR8 3;  4NPM A;  1JZ7 A;  3TEW A;  2FDK A;  1AXY A;  2PAE A;  4CUB A;  5CFD C;  5LY1 A;  5FYU A;  2A1X A;  2D3S A;  1POV 3;  4ONU A;  2NM1 A;  3SXW A;  1OLM A;  3P3N A;  3NAP B;  4JDO A;  2WII B;  3WV6 A;  4DRR A;  2ZEY A;  1OVP A;  2E7A A;  2PLV 1;  4JKM A;  3VUO A;  1U5I A;  3OF1 A;  1YJK A;  2B45 X;  4IW3 A;  3USU A;  4COV A;  5EJ1 B;  1AL2 2;  5FBJ A;  1ALY A;  3J26 N;  5FOJ B;  2IFW A;  1BZW A;  1VE0 A;  2BOJ A;  3I2F A;  3N7J A;  4FXG B;  2SLI A;  3VZO A;  1CWP A;  2WSV A;  4XUQ A;  2O8O A;  3N7L A;  3CDZ B;  3QAC A;  3PJY A;  1UYY A;  2BGO A;  2DCJ A;  1SDD B;  2VW2 A;  5C8C A;  3HR9 A;  4QPG C;  3WHT A;  1GQP A;  1AYN 1;  1HDK A;  1JYW A;  3O1R A;  1PM4 A;  2GH2 A;  4NRM A;  3RDI A;  1JYT A;  1PNF A;  3LB9 A;  2WO1 A;  2P34 A;  3NO8 A;  1VBB 3;  3NL1 A;  4MH0 E;  3ZYG A;  4BLJ A;  2XJQ A;  4AED A;  4XYX A;  5IYY A;  2UWB A;  3LWC A;  3M3C A;  3KGL A;  4D8M A;  2EAL A;  4SLI A;  2ATF A;  1HIX A;  2HWF 2;  2XBO 2;  4XHX A;  5A7N A;  4QXK A;  3SH4 A;  4LIU A;  2NYY A;  2WNE A;  4CEY C;  4DXT A;  1J59 A;  1DG6 A;  2OS2 A;  1VR3 A;  4D6S A;  1H8V A;  4GUL A;  3I3B A;  1GZC A;  2QDR A;  3FMG A;  5FP4 A;  4O9E A;  3HNY M;  4Q4Y 1;  1S0J A;  3CZU A;  5JI7 A;  3WG2 A;  5I0S A;  2I2S A;  3DEM A;  5CIS A;  4Q4V 2;  2OKX A;  2Y6J A;  4KI5 M;  2D3P A;  4DPN A;  3O1U A;  2DDU A;  3NKT A;  1QJX 1;  4O65 A;  4NAM A;  2DU0 A;  5A7P A;  1DF0 A;  4CUC A;  3WP3 A;  2N7G A;  3VBF C;  3PMS A;  1WD4 A;  5IFP A;  2A73 B;  3ECQ A;  3ZR6 A;  2J22 A;  4M3C E;  2VMC A;  1R09 1;  2VZU A;  2Y6F A;  3N36 A;  2JG8 C;  5FMD A;  3N9L A;  3RNS A;  1IPJ A;  1BEV 3;  4KWL A;  5FRA A;  4ES9 A;  4KH9 A;  5FKB A;  3SCG A;  3ZVX A;  2WS9 2;  2X5I A;  5FZ8 A;  2G4I A;  3CJI B;  5HV4 A;  1PO1 3;  1U12 A;  4OI1 A;  2YMZ A;  4OUM A;  4A45 A;  4YVW B;  5K7P A;  5F2S A;  4KG8 A;  2ZGN A;  4LBL A;  4FT8 A;  4MGQ A;  4XCA A;  2B39 A;  1UNB A;  1DZQ A;  4LUK A;  5J3U A;  4TXW A;  4Q4X 3;  5FZ4 A;  4XJU A;  2WFF 2;  4YRD A;  4QB2 A;  5L7O C;  5DAX A;  2RJ2 A;  1ZBE 1;  2JDU A;  2A3Y A;  3HPN A;  5ERL A;  1AYM 1;  3WDY A;  1QEX A;  2E63 A;  2BU9 A;  1F2N A;  4QKD A;  2DF7 A;  4ZU5 A;  4IL7 A;  1FXZ A;  2BQP A;  2VTX J;  4HK9 A;  1A3K A;  1X7N A;  2JD4 A;  4PIZ A;  1AYN 2;  4PQ9 A;  4XAB A;  1O4Z A;  1QJX 3;  5AFB A;  5FYS A;  1SHW B;  3T2T A;  4N53 B;  1S4C A;  4ZKT B;  3Q8A A;  4RGK A;  3LA7 A;  5IUQ A;  2O0O A;  3WW2 A;  4CP1 A;  5GAL A;  3VKL A;  5FO8 B;  2XKP A;  4XOG A;  1LEM A;  5IK7 A;  5JSR A;  1SPP B;  1RUN A;  3W5M A;  4B8E A;  2BVV A;  1O4T A;  1S0C A;  5A32 A;  4C0H A;  4AEJ A;  4OHW A;  1RXF A;  3R4D B;  1JUI A;  2Z69 A;  4RFT 0;  1ST8 A;  3PVN A;  2Q8E A;  5EXO A;  2VQU A;  1UMI A;  4M4R A;  5FXZ A;  2TBV A;  1XNK A;  2NP0 A;  2RJL A;  2MHF A;  4GQ7 A;  1N47 A;  4CCC A;  2ADD A;  1K12 A;  2PHW A;  3EYP A;  1DDL A;  5C33 A;  2D93 A;  1MS5 A;  4KU8 A;  5GLW A;  1IOA A;  1DHK B;  1QWR A;  1UZZ A;  2V5D A;  4Y33 A;  3WG3 A;  2CAU A;  2R1D A;  1RUF 2;  1EAH 1;  1W6N B;  1NLS A;  2VZP A;  3IDC B;  5AC9 1;  3MID A;  5JCT A;  3OBR A;  2CY6 A;  4A41 A;  5I0R A;  4L8Q A;  4FPK A;  1HRI 2;  4AVS A;  1NOV A;  3PVO A;  3N3H A;  4K1Y A;  1NXD 1;  4QGL A;  1XJA A;  2Y60 A;  3POB A;  2A70 A;  3VD9 A;  5FZE A;  1IS3 A;  4OUL A;  4BXS V;  1ZX5 A;  4Q27 A;  1A6C A;  1GZW B;  4AR2 A;  4Q4Y 2;  4ES8 A;  3MHZ A;  5C9A B;  3OPZ A;  4IV3 B;  3RFR A;  3AMQ A;  1G9D A;  1JMU B;  1ZM1 A;  2XJT A;  1Y9Q A;  2D40 A;  2ZPX A;  3MIG A;  2X05 A;  1OPM A;  5A70 A;  2MNG A;  5FUP A;  1U5X A;  2IVJ A;  5T55 A;  1MS9 A;  2WWU A;  5FO7 B;  1QY4 A;  3ABZ A;  1LEC A;  4QPG B;  1AJK A; 
#chains in the Genus database with same CATH homology
 1NUK A;  3U37 A;  3PUI A;  1UXZ A;  5EIY B;  4CU8 A;  2EIC A;  1CZT A;  2QQL A;  5DQ0 A;  3C7E A;  2YC2 A;  1I5P A;  5G05 L;  2E33 A;  3I2I A;  1UY3 A;  2RVA A;  2QQI A;  2C4X A;  1JYX A;  3I2G A;  2VZQ A;  3ACI A;  3K4D A;  4FI9 A;  1ULP A;  3T0D A;  2VMF A;  3OGR A;  4DUV A;  4DEV A;  5LA1 A;  3CKH A;  2X09 A;  4AG4 A;  3WNL A;  4LKS A;  5JXH A;  3C7O A;  2R7E B;  1OF3 A;  4DXS A;  2JD9 A;  1GOH A;  2DCK A;  1UYX A;  3I97 A;  1OH4 A;  3K46 A;  2X10 A;  2ORZ A;  5C7G A;  2Y64 A;  1TVG A;  4JKK A;  5JXI A;  2RV9 A;  4OMD A;  1JZ2 A;  1US2 A;  3WSO A;  2EIE A;  5IHR A;  1XPW A;  5JUV A;  2VCB A;  3MUY 1;  1US3 A;  1W9T A;  3DEC A;  4QX3 A;  2W1S A;  4BJ0 A;  3III A;  3I3D A;  1TG7 A;  3OGV A;  3P1I A;  3A7Q A;  1JZ8 A;  4DEQ A;  4ZZ8 A;  2W91 A;  5A1A A;  3LEI A;  4UAP A;  3WF0 A;  1PX3 A;  3T0A A;  2WO3 A;  4LQR A;  2V72 A;  2W1Q A;  1GU3 A;  3HJR A;  3K4A A;  4E8D A;  3T2Q A;  2ZEW A;  3IDA A;  5C70 A;  3GXU A;  4JHZ A;  2YFU A;  2VO5 A;  1K3I A;  3I2K A;  4KMQ A;  3OEB A;  3K75 B;  3OB8 A;  3T2O A;  1EUT A;  4XUT A;  1OD3 A;  5HXM A;  2VOT A;  1UWW A;  1UY1 A;  2LS6 A;  3C7G A;  1W0N A;  2VZV A;  1XNA A;  2BBA A;  2ZEZ A;  3T09 A;  2VZ1 A;  4KWU A;  3CIH A;  4XUN A;  1LNS A;  1J84 A;  1GUI A;  3I2H A;  1W9S A;  5IJR A;  3I3E A;  4P02 B;  3CZJ A;  1GOF A;  4W8J A;  4QDR A;  4QX0 A;  2QQJ A;  5G04 L;  4ZY9 A;  5IFT A;  1WKY A;  4GWI A;  3E1F 1;  1W8O A;  1F4A A;  1PMH X;  2QQO A;  3MUZ 1;  3VDB A;  4JKL A;  4CUA A;  2VCA A;  4QB6 A;  2VL4 A;  3WF4 A;  2CDP A;  4OUE A;  4L0P A;  4A6O A;  3WEZ A;  2VM9 A;  3K4Z A;  1KGY A;  4OMC A;  4A4A A;  1GOG A;  2YB7 A;  5CYY A;  5B4X A;  2VTF A;  3GM8 A;  1NAE A;  3MV1 1;  1NX9 A;  2W1W A;  2W1U A;  2J1U A;  3THD A;  2KD7 A;  3HOB A;  2VME A;  3ACG A;  3A23 A;  2XHN A;  3C7F A;  1JHJ A;  1P8J A;  1SG3 A;  2WN3 A;  1H6Y A;  2VMD A;  1KEX A;  2E31 A;  4UOJ A;  3A21 A;  3CMG A;  4ZXE A;  3SKV A;  2Z4F A;  4GZ9 A;  1OT5 A;  4CU9 A;  2BGP A;  1L7Q A;  2B9V A;  2WDB A;  3A22 A;  4XUO A;  1UY2 A;  2XON A;  3ACH A;  5FUI A;  1UYZ A;  4MO3 M;  1WCQ A;  2WUH A;  1PMJ X;  3LPG A;  3WNN A;  4LHS A;  1R64 A;  3CQO A;  3NJX A;  4P08 A;  1ULO A;  3WNM A;  4LPL A;  5LA0 A;  2QQM A;  2VZR A;  4XZU G;  1W99 A;  1UY0 A;  3UET A;  2QQK A;  4P5Y A;  3HEI A;  3DYP A;  2HYX A;  3C8X A;  4BDV B;  3FHA A;  3D3A A;  2YG0 A;  4OYU A;  2VR4 A;  3SEP A;  2PQS A;  1UXX X;  4XVH A;  4RN5 A;  4MGS A;  1JZ5 A;  4A42 A;  3WQB A;  3IAQ A;  5JR2 A;  3WNK A;  4A44 A;  3PUH A;  2WQ8 A;  1O59 A;  4HG6 B;  4QDS A;  4ET7 A;  5C71 A;  3VDA A;  3FL7 A;  5JXJ A;  2W46 A;  2Y6L A;  2W87 A;  2VZT A;  2EID A;  1JI6 A;  2QBX A;  2ORX A;  4MOA A;  3UES A;  3T08 A;  4RYD A;  2E26 A;  1JYV A;  2E32 A;  2W47 A;  3VDC A;  2YC4 A;  3WF2 A;  2L9L A;  3AC0 A;  3LPF A;  3THC A;  3NQH A;  1OF4 A;  2WAO A;  2LW8 A;  4MAD A;  2WO2 A;  3DYM A;  1YQ2 A;  5JMO A;  2VC9 A;  3VD3 A;  4PF1 A;  5JXG A;  2W3J A;  2VJX A;  4BK4 A;  3WF3 A;  4DXR A;  2WN2 A;  2WAA A;  1JZ3 A;  2XQX A;  3J7H A;  4CU7 A;  3VD7 A;  4Z2A A;  3LQC A;  1JU4 A;  2J1R A;  1K45 A;  1CZV A;  3SKJ E;  1GMM A;  3FHQ A;  3MO4 A;  4ARY A;  2W9X A;  4QB1 A;  4PT6 A;  1JZ7 A;  2VZO A;  1DLC A;  1UY4 A;  4CUB A;  1GNY A;  1EUU A;  2ZEY A;  4JKM A;  2B4K A;  4CU6 A;  2J1V A;  3LEG A;  4IUG A;  4W4Z A;  1H6X A;  5EJ1 B;  4ZZ5 A;  2HLE A;  4OZO A;  3VD5 A;  3I2F A;  2JKX A;  1L7R A;  4P00 B;  1DP0 A;  3C7H A;  4XUQ A;  2Y8K A;  3CDZ B;  4AAX A;  2W5F A;  1JZ6 A;  1UYY A;  2BGO A;  4CVU A;  3MBW A;  2DCJ A;  1SDD B;  4JX0 A;  3IAP A;  3WF1 A;  3FN9 A;  1GQP A;  5LA2 A;  1D7P M;  1JYW A;  4M4P A;  2J1A A;  2WO1 A;  5IYY A;  3ETP A;  4D8M A;  2JE8 A;  5F7U A;  2JDA A;  3LEK A;  3DYO A;  4DXT A;  5LCW L;  1W9W A;  5DMY A;  3I3B A;  4QAW A;  3NNG A;  3MV0 1;  3LE0 A;  1CX1 A;  3HNY M;  1UX7 A;  3CZU A;  2VCC A;  4QX2 A;  2OKX A;  2Y6J A;  4KI5 M;  5B4N A;  2DDU A;  4DUW A;  3SEE A;  3T2P A;  4CUC A;  5IFP A;  1RYY A;  2Y6G A;  4QPW A;  3ECQ A;  5HPO A;  1DYO A;  2J22 A;  2VMC A;  2BER A;  2VZU A;  4QDQ A;  4UI9 L;  2BZD A;  1W8N A;  1T2X A;  3OBA A;  3W5N A;  4GWJ A;  4D0Q A;  2EIB A;  5J1X A;  4YPJ A;  3HN3 A;  2CDO A;  3HNB M;  3P6B A;  5DN2 A;  4A45 A;  2QQN A;  1O8P A;  4MGQ A;  1J83 A;  3ZM8 A;  3OEA A;  2ZXQ A;  2WZE A;  4TXW A;  1UMH A;  4BK5 A;  2VZS A;  3IB3 A;  3I2J A;  5EJZ B;  1HN1 A;  1MPX A;  2W92 A;  4QB2 A;  2Y6K A;  2RJ2 A;  2WBK A;  1JYN A;  3EB7 A;  3HPN A;  1PX4 A;  2ZEX A;  1F4H A;  4W50 A;  3JXS A;  2XOM A;  2WAB A;  2VQT A;  3OGS A;  3WNO A;  4XUP A;  3NRU A;  1SHW B;  2WYS A;  3BGA A;  3BN6 A;  2YFZ A;  3VD4 A;  3F2Z A;  3W5M A;  3GDB A;  2J1T A;  1NKG A;  2VQU A;  1UMI A;  4M4R A;  3WNP A;  2VZ3 A;  1JU3 A;  1UZ0 A;  1IQD C;  1XC6 A;  1K12 A;  4DUX A;  1CIY A;  3EYP A;  4TTG A;  1K42 A;  3K77 A;  2W94 A;  2V5D A;  2J7M A;  2ID4 A;  3ACF A;  3GGL A;  4QX1 A;  2VZP A;  2W95 A;  2J1E A;  2C26 A;  4A41 A;  3HNM A;  3UNP A;  2C9K A;  1CZS A;  5DPN A;  3VD9 A;  4BXS V;  1BHG A;  4XUR A;  4ARX A;  2WZ8 A;  2J1S A;  1O8S A;  1XNT A;  4PQQ A;  3T0B A;  4E8C A;  5CZK A;  3OG2 A;  2V4V A;  5I0D A;  1JZ4 A;  2X05 A;  3NJV A;  3ABZ A;  4A3Z A;  2Y6H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...