3WP4A

The crystal structure of native cdbfv from neocallimastix patriciarum
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
228
structure length
228
Chain Sequence
AEFQSFCSSASHSGQSVKVTGNKVGTIGGVGYELWADSGNNSATFYSDGSFSCTFQNAGDYLCRSGLSFDSTKTPSQIGRMKADFKLVKQNSSNVGYSYVGVYGWTRSPLVEYYIVDNWLSPFPPGDWVGNKKHGSFTIDGAQYTVYENTRTGPSIDGDTTFNQYFSIRQQARDCGTIDISAHFDQWEKLGMTMGKLHEAKVLGEAGNVNGGASGTADFPYAKVYIGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CDBFV
publication title Structural Analysis of a Glycoside Hydrolase Family 11 Xylanase from Neocallimastix patriciarum: Insights into the Molecular Basis of a Thermophilic Enzyme
doi rcsb
source organism Neocallimastix patriciarum
total genus 62
structure length 228
sequence length 228
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wp4A00
2JENA 3AKSA 3VHNA 3O7OA 2Z79A 2B42B 5K9YA 3AKPA 4XQWA 3ZSEA 1ENXA 3VL9A 5K7PA 1BK1A 1OA2A 3RI8A 1UU4A 5HXVA 2VG9A 1AXKA 4IXLA 3VHOA 4S2GA 1YNAA 3VZKA 3MFCA 1QH6A 4XPVA 3AKQA 3WQ0A 3LGRA 2BVVA 2DCJA 1OLQA 1M4WA 3WQ7A 4S2FA 1NLRA 3WP6A 1XNCA 1OA3A 3AMNA 3EXUA 2VUJA 1REDA 1H1AA 3MF6A 3WY6A 3AMHA 1HV1A 3AKRA 1XYNA 3LB9A 2B45X 4XQDA 1XNBA 3VHPA 1OLRA 4XQ4A 3WP3A 2NLRA 2VGDA 2BWCA 3VZOA 2QZ3A 3VGIA 4HKLA 3WX5A 2DCKA 1UKRA 3VZMA 2DCZA 3AMPA 2BWAA 1PVXA 4HKWA 3AKTA 1XXNA 3VZLA 1H4HA 4S2HA 3MF9A 4HKOA 1C5IA 2JICA 4H7MA 2DFBA 3VL8A 1KS5A 1HV0A 1XNDA 4S2DA 3M4FA 2B46X 1H4GA 1BCXA 1BVVA 3WXPA 4NPRA 4HK8A 2BW8A 2DFCA 1KS4A 3AMMA 3RI9A 2DCYA 3VLBB 2F6BA 4HK9A 1F5JA 3WP4A 3WR0A 1REFA 3VZJA 1XNKA 3WP5A 3WQ1A 1W2UA 2NQYA 2JEMA 3VZNA 1C5HA 1IGOA 1TE1B 1H0BA 3WT3A 2C1FA 3AMQA 5EJ3A 2VULA 1UU5A 1OA4A 1UU6A 1XYOA 1XYPA 2QZ2A 3B5LB 3HD8B 2D97A 1REEA 1QH7A 1H8VA 2D98A 3MFAA 3B7MA 1HIXA 1T6GC
chains in the Genus database with same CATH superfamily
4LORA 5FY7A 5BYNA 5A32A 3H1WA 3ZIXA 4LKDA 3K75B 5F5QA 1C1LA 1ZZBA 1NXD1 2VMHA 1S0IA 4YFWA 5CYYA 1W8TA 3VDCA 2ZHKA 3VL9A 3H8RA 1ULFA 3VBRC 1TMF1 4RHV2 5FJKA 5F9TA 1QMJA 1Q8OA 4GWIA 4AEDB 5KHIA 3VD4A 2XJQA 4P9GA 1F4AA 3PU3A 4JKKA 4WVMA 1QHDA 2RR11 3UGFA 4NIDA 4BDVB 2PMWB 1YEWA 1H30A 3LPGA 2VQUA 4DS0A 5ABJA 2HEWF 1WA6X 2JDUA 4EN9B 4F7ZA 1YIFA 2X09A 1YO8A 3UESA 2E7QA 2IXLA 4YM0A 2XJTA 2ZPXA 1UOBA 2D6NA 1COV3 5FK7A 5FPXA 3IMNA 1LOAA 2BFUL 4Q4Y3 4DXZA 2ARBA 3FLPA 2R041 2CDPA 2R30A 3NNFA 2VR4A 4XAEA 5LRRA 2R16A 5FYTA 4UFJA 2WNUA 3WG2A 4CCKA 3ELNA 5FP4A 5DQ0A 1JZ6A 2B45X 1GUIA 1XNBA 5CFCB 2JIGA 4CDWC 4Q4V3 1POV0 2KA3A 1YQ8A 2NLRA 2QQIA 2YC4A 3POFA 4IEZA 4LO5B 1MS3A 2EALA 3CJXA 3CJIA 4F3JA 3OOXA 4JC1A 2WZ8A 5JUVA 3NV4A 1UY2A 4B7EA 3ACFA 1VBD3 4CU9A 2V72A 3WNPA 2XHKA 1V6OA 4G9SB 1MEC1 2VW0A 1W6PA 4NHMA 3LIHA 2GH2A 4FOQA 1OVPA 1H9WA 3O12A 1SLIA 5FMOL 3MLLA 1UPIA 4XHBA 1DF0A 3ZYIB 4CP0A 5LA2A 2ZJCA 1HB1A 1W90A 4IV3B 1H8TC 1WD3A 2HWE3 1FATA 1RUE3 4N43B 3ZXAC 3AYAA 5DABA 3M4FA 1SPPA 1RUG2 2RV9A 3PURA 4IQPA 3ES1A 1ZBA3 2CV6A 2VCMA 2WO7A 5GLUA 3P6BA 3NVCA 3NO8A 2XB6C 4AAPA 2HWB2 1HXS2 4DIQA 1L7RA 2D5HA 2DCYA 3CHXA 3E6DA 4HK9A 3VLBB 4E4ZA 1REFA 5H9RA 1XNKA 3OGGA 4GH4B 4CCNA 2B4KA 4JRLA 5H9QA 1V6IA 4Q1RA 5SV8A 3RDIA 1OUSA 3RJ2X 4DNYA 4XIKA 3O1SA 3BTXA 5L36A 2Y6LA 1H1IA 4GMP0 4IEPA 2LM3A 4KL1A 2J1UA 2J1SA 3BPZA 4N8MA 4NO4A 1KFXL 1PHMA 2HEVF 4JTNA 3WW1A 1EYBA 3LA2A 5I0DA 4XFCA 1GZCA 4QQHA 1MACA 2GN7A 3AM2A 4KBZA 4A7KA 2WT0A 4CDUC 1K42A 5FV3A 3B5LB 4MXWA 3CF6E 5CKNA 3S0MA 1MQTB 1AR91 3C7HA 3JD72 3N9OA 2ZGTA 2QNKA 3GJAA 5DN2A 4D6SA 1K3IA 3MFAA 1UYZA 2VPVA 1H2MA 1HDKA 2FBEA 4IL7A 2RS11 1ZRDA 1US2A 3KT7A 5IWFA 4C1XA 2WZR3 4Q29A 3RYKA 4HETA 2IVIB 4DO0A 1MZFA 1VBC2 4K9SA 5HV4A 4AEDC 3T1MA 3GXUA 3EO6A 3JCIA 1NT0A 1XNAA 2K46A 2D40A 2A5ZA 3URFA 4BZ4A 4D6QA 1GANA 2VZOA 3HMYA 3WV6A 5F32A 2V4VA 4IXLA 4XCBA 3N36A 4IE6A 4W8JA 3V0BB 2GNDA 1HRV1 3VZKA 4ATEA 1GU3A 1D2QA 2WO2A 1OQEA 3AZWA 2Y6HA 4LKFA 4Y5Z0 5FUNA 5FWJA 4W4ZA 1ZZCA 2WC2A 4LLOA 2ZGQA 1ULEA 1TMF3 3A21A 4AK3A 3LFIA 4NRQA 4AQ2A 3AVSA 3J7MA 4B7KA 2BVBA 2RR13 1WCDJ 5CFCC 3PUAA 2NP0A 2CGPA 3USUB 2PTMA 2W0XA 4Y26A 2ZGUA 2ZX1A 1XYNA 3KD4A 2ZMNA 4MSVA 3UJOA 2CAUA 1OVSA 2ADEA 2RDNA 3AYDA 4DMIA 2WBKA 3H3LA 2DUQA 3BALA 5FPBA 1RUH1 1OD3A 4XDPA 1S0EA 1TG7A 4CCEA 2R043 5A6XA 1DGWA 3TBDA 3BCWA 5F3EA 3CKHA 5CNAA 2GC2A 1W06A 5HXMA 5L9BA 2HWF1 4IEXA 1XOYA 2JKXA 2ZHMA 3I2JA 5DZGA 4YNIA 2WS92 2FHRA 1LGBA 4XCAA 3S5QA 1QJU1 2DV9A 2VQ0A 1IPSA 1AL22 4IV3C 1F5FA 3P3PA 2LS6A 1WCKA 4CXWA 4N43C 3SCHA 3BN6A 5GLTA 4Z8BA 5T55A 1O3RA 3FUOA 4FI9A 4ZU5A 3ZXEA 1CGPA 4GIQA 4CYDA 2GNTA 1LOGA 1OSGA 2ZAAA 3AK0A 4QMAA 4XF4A 3AP7A 4MADA 3ZDSA 2WQ8A 1MEC3 1N3OA 4QB6A 4GH4C 5A3NA 1KQRA 2OT7A 2Y33A 1RYYA 1ND3A 4QX0A 4BOWA 4QPIB 3MYXA 4QT6A 1ENQA 1QDOA 1AYM2 4QKFA 1QY4A 2OXBA 2VMFA 4FQZA 5EYXA 3ZXDA 4H14A 4BLIA 3HIFA 1D4M2 2NQYA 2XMLA 2FCVA 5DAWA 1QKQA 1V0AA 1VR3A 2A6VA 4YG3A 5FBJA 1TE1B 4AFDA 1N1VA 3GHMA 5JOYA 1QU0A 1VMJA 4NHXA 4XBQA 1G8WA 2W94A 3OG2A 1K45A 4LO4B 5FYZA 5G05L 5FZ8A 3C8XA 5C5UA 4UFHA 3AMQA 3H3UA 4RGGA 3I2KA 1YJLA 2JE9A 4K3UA 5GZGA 4QQLA 4UI9L 3SXWA 4D0QA 1W2AX 4XJ9A 2QDRA 5CFDC 1OLME 1VMFA 4V1PA 5F5AA 5J7MA 1QOSA 2Y34A 2ZMLA 4XACA 4RGAA 1S2KA 5C8CB 3AFGA 1NOVA 4PQQA 4URTA 3U10A 4EROA 4U36A 1TZOA 2VXRA 1I5ZA 3FBYA 3ME2A 5C7GA 3TOJA 3N9QA 1ULDA 4PIYA 3JZVA 5FMBA 4JKMA 1YFXA 2DYCA 1RMU2 2HBUA 4Q2FA 1BYHA 3ZSEA 2X8KA 5JXIA 3AX4A 1AR93 1FNYA 1CAUB 1VBC1 3WUCA 4P02B 1OD5A 1WMDA 1DQ5A 1C8M1 2GMMA 5C33A 2NM1A 1W8UA 2SBAA 5FZDA 3FJSA 4K8RB 1XU1A 5FZGA 5JZGA 3KT1A 1R64A 1OKOA 5FKBA 2RS13 1JMUB 3IDBB 5HCBA 3DCQA 1UNBA 4C0BA 5FLHA 1HQLA 5K0UB 2GC1A 3PVEA 4WM8B 5T5PA 1HQWA 3A4UA 3THCA 4MHUA 2VECA 5CKQA 5FQ0B 1PGL1 1YQ2A 1Y43B 2YFZA 2FDJA 1W0PA 3H42B 3IB3A 2A70A 4QPGB 5GZEA 4ASMB 4BYYA 1GYKA 1UAIA 1SFYA 5BNNA 5C4WA 3KLSA 3H8OA 5E6HA 1VAKA 3GYDA 4RR3A 1HRV3 1V6NA 5JLVA 4TXWA 2R32A 1TQ5A 2JIJA 3POBA 4QX3A 2OW4A 1V6JA 4UT5A 5A6ZA 3KHCA 5IT6A 4CCJA 3WP3A 5JXGA 2KR2A 3MLJA 3LA3A 4BQ2A 4WVVA 3WX5A 3WCRA 3MGUA 3ZFFA 3BGAA 3KV6A 4AI3A 3B01A 5LBEA 2MPFA 4CE8A 2EICA 3ACIA 1J83A 4ASKA 2BWAA 3H7JA 1E5RA 4QWNA 1PO11 1O4ZA 3NSTA 1BQPA 4DRVA 4FCAA 1Y7BA 3DXTA 2Q8OA 5A1LA 4QX8A 5JOXA 3RZMA 4FOVA 4OI0A 3HR9A 2H6CA 3J8F1 1RUH3 4XFBA 4CRQA 3FFZA 2D6LX 4Q4W2 1TEIA 2TBVA 2X10A 3WDYA 3BTYA 2CYFA 2C9AA 2Q1MA 2BFUS 3H7YA 4S2DA 3ZOIA 2HWF3 3GZTB 5EXOA 3WQBA 1GZWA 3PIJA 3U0ZA 4QPIC 1FXZA 3KZ4C 4LBQD 1QJU3 4AF9A 5JOWA 1FMD2 1S0CA 5T5LA 1LENA 5FLIA 2P5BA 4LO8A 1W8HA 4R9DA 1NA1A 1G9AA 1AX2A 4UBHA 1LU1A 1CX4A 5FZFA 2PHXA 1G9DA 5FYHA 2OQ6A 1O59A 4TZDA 4KWUA 1UX7A 1BLZA 3FBMA 5JR7B 2CDOA 2VMEA 3O0WA 4H55A 1SBEA 1J3QA 2D7FA 3B9IA 3NNMA 3O1TA 3IZOA 4XJ8A 2A75A 2VZVA 1OA4A 2FZ1A 4AEJA 3GZAA 3FE5A 2LTNA 1LEMA 2FCUA 2WNVA 1IKQA 2GNMA 5JVVA 3T0DA 5FAXA 5C8CC 3TEZA 1G6NA 1ZRIA 4DXTA 2YC0A 2GZWA 1YQ5A 1FX5A 4Y22A 1X9PA 1RJ8A 5A3WA 2I07B 1UIJA 1MVEA 4JHZA 4AFMA 1CZVA 1DG6A 1O5LA 2MEV2 1Q3EA 4AW7A 4PBPA 2GC3A 4CU7A 3NNGA 2RG4A 1YRZA 3I2OA 2OQ7A 1NCQB 5T50A 3U11A 2VTFA 3O0XA 3GDBA 4RL7A 2GMEA 4TN7A 5KC6A 4XF9A 3SCFA 2HEYF 1H2KA 3I2IA 3RI8A 3VBHB 4BK5A 5K0UC 1ZBE2 4WM8C 1POQA 1U5XA 1X8EA 3T4VA 3PVNA 3VHOA 1JS9A 2HWC1 4QPGC 1C3HA 2BZDA 1F8VA 5EIYB 1GV9A 3IBMA 4AI9A 4O7XA 1UYXA 3ZXJA 2Y0IA 2P1BA 4XJAA 1VBC3 2O8QA 3OBRA 4P08A 3U4XA 3AYEA 4CDQB 1KRIA 1WWYA 1UY1A 2W47A 4QM8A 4PHZA 4LHLA 2R1DA 5FPLA 5FYUA 2C24A 1V00A 4O9EA 1UMIA 3M7AA 4PLMA 1O3QA 4JDNA 4META 1I5PA 1QWRA 2KM2A 2WAAA 1GOFA 1DZTA 2D44A 3MW2A 5F3GA 1GWMA 5J3UA 2FDKA 4XQ4A 3D3AA 2BWCA 2QQUA 1FT9A 2Y8KA 4JZRA 1SBDA 4XMAA 3VBUB 3B02A 3DN7A 5KWRA 5CG9A 1UKRA 2RMU2 1US3A 2X53S 4XC9A 2B7YA 4NROA 1YXWA 4MX3A 3WW2A 2ZGRA 1TNRA 1YFUA 1X9TA 1QJX2 1R1A1 5FYCA 3RGBA 1JUHA 1A3KA 4M0HA 1U5YA 1H4HA 4LBOA 3VBOC 4HPKA 4FFGA 3SKVA 4FPYA 4FSJA 5HPOA 4LHKA 2EXKA 2VTXJ 1SBFA 3TB0A 3RS6A 2W08A 5C9AA 1XRUA 1D2SA 2DTWA 2GSYA 3VKLA 2RJLA 3IPVB 3KM5A 4QB1A 3MV11 4IGQA 5ERLA 5I8SA 1W9YA 4CEYB 4EE2A 1UY0A 2E53A 1JOJA 1PO13 1TNFA 2XDVA 1SACA 2WJSA 3OUHA 4L99A 4NPRA 1F15A 1DP0A 1OMIA 2A3WA 4LEJA 5FFOC 2VQTA 1ZZ6A 5A80A 4IV1A 1WW6A 1PVC1 3J8F3 2D3SA 1XPWA 2AACA 2P34A 2C4XA 3AL5A 3AP9A 4Y1UA 2FDFA 3W5MA 4HXCA 1DQ2A 2JX9A 2W1WA 1YFWA 4ISRA 5ISLA 3H1YA 2PN5A 4NUBA 1FPN2 1QJFA 4FOYA 4E4SA 3RMYA 5FTTC 5TSWA 2WZEA 1VRH2 1NLQA 4LUMA 4UWDA 5FUIA 2GU9A 4ISQA 5A7OA 1I9RA 5BV6A 4XUOA 3FL7A 1RUI1 4FPFA 2BERA 1FV3A 1ULGA 4BQ1A 1Q43A 4HG6B 4PDWC 4CP9A 2EVXA 2OPKA 4W65A 2XJRA 1QH7A 5FKCA 3CMGA 2ID4A 5EPAA 3GALA 1WGPA 3PJYA 3BODA 3NAPA 3Q8EA 4BA6A 3OBAA 4PIXA 2OX0A 4Y3OA 1T6GC 1NCQC 3RMXA 3W9AA 5JI7A 4MOAA 4I0WB 4JGYB 2ET1A 3BUCA 1PK6A 2ZBJA 3A0KA 3PUQA 2B9VA 1WA4A 4JTOA 4UFIA 5EJZB 3VBHC 3O7OA 3OD0A 2B42B 2JG8B 3NKTA 3V65A 1W0NA 2XBO1 3A7QA 4DEQA 3HN1A 3V0AB 1OA2A 2ADDA 3IN9A 1E5IA 3HEIA 1NX9A 4FVVA 2RDSA 3DGTA 2IXIA 3FZ3A 1QQP2 2CGOA 3DYMA 5AC92 4JV4A 1YC61 3PVBB 2RS31 1J3PA 4NHLA 1S0BA 3S57A 4OHYA 4Q0UA 2BTVC 1ZREA 5LK5A 3O1UA 3T30A 3UJQA 2YY1A 3SKJE 1EAH1 5FY5A 4YWAA 3WQ7A 4OHWA 1UXZA 4GB31 1JYWA 3GM8A 4NIHA 3VV1A 4QQPA 2JXAA 1XU2A 1CAVB 5CKMA 1RHI2 4AZZA 4ARXA 4LBQA 1W9FA 5LY2A 4DUWA 2VUAA 3QLQA 4ITCA 1O3TA 2HWC3 4GA9A 4NRMA 3SC7X 3VBUC 3RZHA 1E5SA 1SDWA 2QQPA 2Z69A 4A45A 5FPAA 4XF1A 1NUKA 5LEKA 5HCHA 5FXZA 2BEOA 2AZ5A 4YW2A 3VBRB 1PNFA 4XFIA 3RFRA 1PIV2 1R1ZA 1H9PA 4IERA 2VE1A 2WWUA 1CAWB 4Y1XA 2Q0AA 1VB4A 4XJZA 1PVXA 5IYYA 5GZDA 5D1IA 1RUF1 4KU8A 2DTYA 3GJBA 1EY2A 2PQQA 1R091 1QJX1 1ZX5A 1Z7S2 5BNPB 4QDRA 4QX7A 3MF9A 3N7KA 4Y20B 5B4XA 2MNGA 2VZTA 1SDDB 4YG6A 4CEYC 2FQPA 4QPWA 3OD4A 4RN5A 1LOEA 3WNNA 2D3PA 4AQ6A 4KU7A 4BIOA 4AQTA 4AXOA 5F3CA 1A34A 2N7GA 4A7ZA 1ND2C 4B3NA 2Q8CA 1W2OA 4HBNA 1R1A3 3PJQA 3WINE 1WW5A 4YZ3A 1OFNA 1GSLA 1XBFA 2ZA9A 2VMIA 1SCSA 3VDDA 3WF3A 3W20A 4INDA 5JIAA 4CDWB 1UZYA 4CUCA 3NKGA 1KS4A 1AX0A 3B93A 1MZ6A 3T4HB 5A3PA 5HI0A 3M3IA 2K0GA 1ZRFA 1Q8PA 4D94A 4E27A 1CAXA 5FZHA 4Y4YA 1CVNA 4ZHNA 3OTFA 1K5MB 1J1LA 1UOGA 1AR82 1JOPA 3VBFB 5KHHA 3ZYHA 4BISA 3WT3A 1AX1A 5F2WA 5LA0A 2BNMA 5LZ6A 3E6CC 3NJXA 4N7UA 5KHGA 4QB2A 1LHWA 1GQHA 4EV0A 3IAQA 1PVC3 2YGMA 3R4DB 3LEGA 1BBT1 2XVGA 4R4ZA 4BU2A 3HNYM 2QZ2A 1RGSA 2RVAA 2WZPP 2OZ6A 3BOWA 2D97A 3NNLA 3S7IA 1JHJA 2LALA 4YW7A 1GWKA 4JGYC 2G9ZA 5A3MA 5L73A 1JZ8A 3C2UA 1Z0HA 4NRPA 4A44A 2Y0OA 4X8NA 2XQXA 1OFSA 3MIEA 3V56A 4YVSB 1RUI3 3HQRA 5ANNA 1DBNA 1HRI1 3EJKA 3CO2A 1M06G 2E31A 2CTVA 3AZZA 2VCCA 1FYUA 5FP8A 3GZUC 1YI9A 1GP4A 5L7OB 2XOMA 1LRHA 3ZMOA 2JG9A 1N3PA 2OIIA 4CDUA 1R082 2R1BA 2VUCA 4BQ5A 4RYDA 1DYPA 3DPRA 3BKZA 5IK5A 4CEWB 3N4MA 2Y38A 3IDEA 5FZ6A 5I93A 3OPTA 1PGW2 1KXGA 1QH6A 4XPVA 5JXJA 1XB9A 3LGRA 5FP3A 4BHPA 4W50A 2XBO3 4BQWA 3TN91 1X33A 3DEMA 3R0RA 3E5QA 1ST8A 3I7DA 3KVBA 2YXSA 3ZYFA 2DVFA 2D43A 5E8AA 4YVWA 1X7NA 1LHNA 1PM4A 3ITQA 3HN3A 5DG1A 4CCCA 3WCSA 1EUUA 2X05A 2RS33 3K2OA 1HB3A 1SZBA 3DYPA 5FZ4A 1H6XA 3EBRA 4JGZB 1EAH3 1RVF2 4MH0E 3ZN6B 4CDXA 1KITA 5FP7A 3I59B 4GB33 1W05A 2C5DA 2YU1A 4MVTA 1CIWA 2FMYA 1AR62 4BQ3A 1W6MB 4TLGA 5LBBA 2F4LA 3KV4A 1BEV1 2HWD2 5BNPC 3MEPA 2IFRA 4HKWA 5LW9A 1NY71 5FZKA 2PFWA 5JCTA 2FCTA 4KG8A 4ONUA 1GBGA 3SEPA 5FREA 3T0AA 2YBPA 3M2MA 4JX0A 5FP9A 5CFCA 3OB8A 1TME1 3QOPA 4XAAA 5D21A 5LWBA 1GQGA 1BK0A 2CWMA 5A32B 2DFBA 3ZYBA 4E8DA 1LOFA 5IFTA 5B4NA 3I49A 2YZ4A 2AEZA 5F8PA 2GN3A 5FOBB 2JECA 4TYSA 1FOD2 1UOFA 3RRDA 1QJY2 1PO22 3W59A 1RUF3 1AJOA 3FMGA 1EV11 3ZYPA 1V6KA 4C91A 3UV9A 1R093 4QQ2A 1QJX3 5FZAA 4URAA 4HK8A 4RA0A 1JW6A 4Q4X2 4YM3A 4IE5A 3THDA 1GP6A 3VBSB 3TNQA 5ABJB 1K5MC 5ACA2 1XC6A 3VBFC 3VZJA 3IMMA 2WT2A 1W6QA 1W0OA 3I4IA 2GP5A 2VNOA 3WSOA 3LF7A 5JWPA 3OEBA 1VMHA 4P9XA 5DUUA 2VH9A 2YPJA 2FZ2A 1A78A 2JD9A 3WF1A 4JDOA 1IPKA 2YHJA 1QNYA 2XG3A 3EHKA 4WZFA 5FY4A 1J3RA 1ZA7A 3PTRB 4UW3A 1WD4A 1CPNA 4L0PA 4P9WA 4RD7A 2JDMA 4AFBA 1XYOA 4Y1VA 2VW2A 4QDSA 3I2HA 2NYYA 4HONA 3ENRA 1AHSA 1OT5A 2ZCWA 3CIHA 3AC0A 4P9LA 4R9AA 4W6YA 1VBE1 2VMDA 2R072 1T6BX 1UY3A 1L3JA 2JWPA 4YVSC 3CEWA 3TEXA 2ZEYA 2QKDA 2Z4FA 2WFPA 3ZYGA 4MGTA 1Z78A 2WFF1 3ZM8A 3IKWA 2W46A 1IOAA 3I8TA 4CVUA 1ENSA 2VUDA 4OLLA 1UZWA 5L7OC 1RUNA 3POGA 1BBT3 5IHRA 2ILMA 4Z2WA 1UF2C 4CEWC 4C1WA 1W6PB 2YDEA 5K7PA 1MQTA 5FZ1A 5C6CA 3PIGA 4QKNA 2PAKA 4LUKA 1V9U1 2XKOA 3L2YA 4OUEA 1U5IA 2E6VA 2BV4A 4IETA 4AGRA 1PZ9A 2XLFA 1WW4A 4AGGA 2RM22 3IIIA 1WCUA 5J48A 4OQ8A 1APNA 5FYBA 3AKQA 2DCJA 1HRI3 3LOIA 5C70A 1DQ6A 1JN2P 1MS8A 2J1EA 3ILFA 1DQ4A 3JB8A 4FPLA 5EP9A 3CU7A 3MHZA 3WDVA 5CFDB 4X8PA 2G9GA 1O4TA 3E97A 1XNCA 3BTAA 3I3DA 3DUIA 4MXVA 1VBB1 4AI1A 4L97A 3D5OA 3FHIB 1Q5OA 5A7WB 3H9AA 2WNEA 4LTAA 4JGZC 3V0BA 4KGQA 3P3NA 3D6EA 3AZXA 5DUXA 2R0FA 2IXKA 2Y60A 3ACLA 5C3RA 2JDYA 1UKGA 1AYN2 3TN93 3FX3A 4RHV1 2QUOA 1WW7A 1YWKA 4M3CE 3K48A 1OI6A 4K20A 5FO8B 1I3HA 4UAPA 1SLLA 3M3OA 2CHHA 2VBBA 3FHAA 3AMPA 3MW3A 1UMHA 4WV8A 1QIQA 1W39A 2QFEA 5IVEA 2YMZA 4J1XA 4MXWB 1MVQA 4G3YC 3OYWB 3USUA 1QOTA 2HWD1 3R05A 3SH4A 3C7OA 4C0HA 1UX6A 4A42A 4ZS3A 4PIZA 4S2HA 3PNAA 1C5IA 4HFSA 4HSJA 1SHWB 3TAYA 3UKVA 1BEV3 2WWJA 3K3NA 4JRAA 3O1RA 5FCCA 3ZDVA 2KD7A 3ON7A 2GC0A 2WO1A 3VBSC 4LKSA 1QJY1 2BQPA 1S1AA 5E89A 5ABJC 2BRTA 2K2SA 3J9SA 1O8SA 1TME3 3H0OA 1CZTA 5FXVA 3LDRA 1F9KA 1HB4A 2QJVA 3N7LA 3WP4A 3WR0A 5JOZA 1HJFA 4OFGA 2PYTA 1XNTA 2PHRA 1X8MA 3IAPA 5IVCA 3WOGA 1CPMA 4BQ4A 1C5HA 2ARXA 5BPXA 1QF3A 1EV13 2IXCA 2WNUC 4YLZA 3U07A 3RSJA 1IS5A 4AVTA 2PHDA 4M01A 4FXKB 2ZX0A 1QXPA 1RUOA 4Q0PA 2VVDA 1VP6A 3HAGA 4KNCA 4ZU4A 1BJQA 2GP3A 3BIEA 5FYIA 2X5IA 1XYPA 5APAA 4QPIA 1D7PM 4P00B 2JKBA 4TLFA 1RUD2 3LEKA 4BJ0A 1GLHA 1RUG1 1VAMA 1QEXA 4QD2A 1WLWA 4XBNA 2RJ2A 5GZFA 3UKTA 1SCRA 3JBG2 4FQ4A 1NXMA 4AHYA 5A3LA 2YYOA 2DF7A 1HIXA 1LULA 3B00A 1DIWA 4ATFA 1CIYA 3POYA 1GNYA 2HWB1 1NCRA 3VDBA 1HXS1 3M70A 2XR4A 3M1HA 4AGVA 5FY8A 3N9PA 2LRPA 4EZHA 2O8OA 2QQVA 1N1YA 2XJPA 1B35B 1IKPA 3TEYA 5C3OA 1Q8VA 1UU4A 1VBE3 2HLEA 2VBDA 4HL0A 2A73B 2WLQA 3WHUA 5FLJA 2VXJA 3VN4A 5C8CA 3AJZA 1QGLA 3RJRA 2JDKA 2WFF3 1DLCA 3CBNA 1SLCA 4LMFA 4S2GA 3T2TA 4CXXA 4KI5M 5C3PA 3Q9OA 3F2ZA 1LECA 4JQTA 1IHMA 4BXSV 1NE4A 5JSOA 3MBWA 3WNKA 4XUTA 2YUEA 4UW4A 3JD71 4HSLA 2ZGPA 1PMJX 3RPQA 5IVVA 2DBIA 1OH3A 3EYPA 3PVOA 5IK4A 1CAUA 1W2TA 1Y4WA 3NRUA 4K21A 4BQYA 1URXA 2BOJA 4CZSA 1V9U3 1W9SA 2ZEWA 2VUJA 3ZSMA 2NMOA 3CLPA 5GLVA 1S55A 1HV1A 3AMHA 3NV3A 3ABZA 4AR2A 4AFCA 2XVLA 4QGNA 4AG4A 5K0UA 5CADA 5FO9B 2PLV2 4NAOA 3M3QA 2TNFA 4WM8A 5A7SA 3PMSA 4XFFA 4B1MA 4DQAA 1NKGA 4AL9A 3HBKA 5F6LB 1VRBA 4LBMA 1AYN1 4OI4A 3VDAA 2YB7A 1IS3A 2DCZA 3AP6A 3J7LA 3GHNA 3U75A 1VBB3 3LKJA 3PMEA 2ZGLA 4SLIA 5A7QA 3DKWA 4XOGA 1ACCA 1W8WA 3WUDA 1S4CA 4XETA 3WEZA 5GJ6A 5DDJ2 1H2NA 2AYHA 3LE0A 4QX1A 5A7PA 5SV5A 3WF2A 1AR72 2TEPA 4RHV3 3HQXA 1PGL2 5JIUA 1WMXA 2XGXA 1PMIA 3LIGA 4FPOB 2C26A 5KBFA 1UIKA 1X50A 2IC1A 2VOKA 1L7LA 1W6NB 2RHPA 2Q1FA 3LZZA 5J37A 3U37A 2HWD3 4NIGA 4UOJA 5A3UA 1RC6A 4WBBA 4IEQA 4OZXA 3MIBA 2DFCA 3M3EA 4EWDA 1DHKB 2Y6FA 5AVAA 2JDZA 2WKKA 5EZWA 3DV8A 2AH2A 5DAXA 2PHFA 4QGLA 1NQDA 3ZX7A 2JDAA 3H50A 3RQ0A 3VD9A 2WS91 2R7EB 4LK7A 1OPOA 1H0BA 5JDBA 3ZYRA 1QJY3 2ZEXA 1AL21 3O5SA 4DRRA 5C4WB 4MV2A 1RUC2 2W1SA 3JXSA 3VBOB 1DFQA 4XIOA 4FPGA 1KD7A 4LBNA 4LE4A 2Q1ZB 2V73A 1UU6A 3VKOA 1ASJ2 4XXAA 4GWMA 2UWBA 2OA2A 4IUGA 1F2NA 1LGNA 1Q56A 3AL6A 2ZHLA 3W21A 3V64A 1RUD1 1Y9QA 3O1PA 4L9BA 2D6MA 4XBLA 2FDGA 2WDBA 2DU0A 3SCGA 2UWCA 4OUSA 2UWAA 4CXYA 3SNMA 5CEHA 2ARAA 2YROA 2GDFA 2RS52 3AKSA 3U4SA 3LSEA 1B35C 3U14A 3CQOA 1JZ3A 4J25A 1AYM1 3HWJA 3MZHA 1UY4A 5C71A 5K9YA 1OC1A 4NWVA 1D4M1 1RUG3 4PCRA 2E33A 4CSWA 1JYIA 1O4YA 5DAPA 2CWSA 4N53B 5BNOA 1W8NA 4RFT0 2QQNA 3QCWA 4GKYA 2HH9A 2ATFA 3MIFA 4R52A 4D8MA 2WQ4A 5FOJB 1OF3A 4D7TA 2HWB3 3UK9A 2CU5A 1HXS3 2G9FA 2Q5TA 1W04A 4AEKA 4A2UA 5FMOS 1M4WA 4M0NA 2VZ3A 4PDWB 4D69A 1U5ZA 2P3JA 2J1VA 4Q27A 1GKBA 2YG0A 2R062 3OY8A 4QGMA 3VBHA 3T2OA 2NPIA 5A3OA 1QJZA 2WT1A 4AI8A 4CUAA 1K12A 4HN1A 4XTMA 2ZOEB 1RMU1 1CD3G 5JXHA 4P5HA 1GR3A 5IVBA 5FZ9A 4HVQA 3I54A 5IVJA 1VALA 4MO3M 1MS1A 2ZKLA 4EN0A 2VGDA 3JD73 3RNSA 1HQNA 4GJYA 4RQPA 4YSFA 5CISA 5EHDA 5L9RA 4AYUA 1L7QA 4CDQA 3O14A 3OPWA 1OQ1A 4BPZA 1ULOA 3C7EA 4LO7A 4OMCA 5A6YA 2VD7A 3RWKX 3UGGA 4CUGA 1XE7A 4COVA 5FZOB 1JHNA 1RUJ2 1YHFA 4MHRA 1VJ2A 2EXHA 3WDXA 3UNPA 3D0JA 1ODNA 3PUSA 4L11A 5ACA1 4HVOA 3MIDA 4FPCA 3ZR5A 4E9KA 3H3ZA 3VKMA 4H7MA 3VBUA 1AYN3 1LHOA 1SLBA 2ZGSA 5FYSA 5I8TA 2BPA2 4HVRA 4ZKTB 4QHOA 1XNDA 5KC5A 5JZGC 3WW4A 4AE2A 1VE0A 4MUVA 2Y6JA 3AVRA 1T2XA 2W1UA 3C7FA 4HOOA 4Y1YA 5I0UA 3WG1A 3OGSA 4YM1A 4LT5A 2VVEA 2ZTNA 4FOWA 3IDAA 4BCUA 3MPBA 5FY9A 4KMQA 3KMHA 3RVHA 1KFUL 1H1MA 3ILNA 3WQ1A 1COV2 2E63A 2MHFA 4Q4Y2 4O65A 3IPVA 3TWIA 3VB9A 2I74A 3VZNA 5BNNC 5C4WC 5T52A 5CIRA 4BWOA 4CEYA 3KCXA 4RR3C 1GQPA 1UO9A 3CDZB 4QU1A 4GJZA 5LA9A 4AVVA 5A6QA 3ZFEB 1SMVA 1WMEA 1CR7A 4NVPA 3N9MA 1J58A 1CJPA 1NE6A 5CZKA 2BNOA 1JU3A 3WG3A 4IGOA 4Q4W1 5JI9A 5CB7A 2XVKA 3P1IA 4Q4V2 3ZR6A 1W3VA 4XDOA 1DZQA 1LB2A 2ETEA 1ND2B 2D98A 3ILRA 2WS93 4YW4A 4FTEA 4Q8LA 3G7DA 1X36A 1FMD1 1AL23 3FLTA 3KV9A 2IVJA 2UY8A 2DWRA 2DVDA 2PHTA 4XUNA 1OOPA 1VBD2 1O8PA 4Y4RA 4TWTA 5D8AA 2ZX3A 2EIDA 3VHNA 3GGLA 5A70A 2FDHA 3K46A 1RL3A 4YZ1A 4MGZE 1DU3D 2Z79A 4N53C 1N1TA 1OURA 3J4UH 5IK8A 3CZUA 1YI7A 1BK1A 1G9CA 2R0HA 3EB7A 4DY5A 3SISA 2B5HA 1RUD3 5HXVA 4O9GA 2I45A 4UFKA 4IEUA 5GKAC 4P9IA 2HWE2 4GZ9A 1RUE2 4BM8A 2ZX2A 5CG8A 3GBWA 3RWNA 3RYPA 2BNNA 3NV1A 3I3QA 4R9BA 4JGYA 4RS5B 4H7LA 1ZBA2 1AYM3 2B8MA 3OBTA 4LITA 4MLOA 1MS5A 1NA1C 5T3NA 1JTZX 1UPSA 1D4M3 2JG8A 3TEWA 1NLRA 1LU2A 2UY9A 1NG0A 2O0OA 3NV2A 3QH7A 1YLLA 4I02A 1VLNA 2X29A 3V0AA 3AMNA 1W6OA 4XEZA 1ENRA 2ERFA 2VNGA 1FV2A 2NZ9A 1JZ5A 2YPDA 4R8HA 3ORJA 2MEV1 3MF6A 3WY6A 4J1WA 3LB9A 4F83A 4NR1A 4PF5A 3MIGA 4XQDA 2JDNA 2O1QA 1ZRRA 2CGNA 2R49A 3WLUA 4KWJA 3VGIA 3OGJA 2QVSB 3NL1A 5EWSA 3LDBA 4AI2A 2EAAA 1VBA2 2VVFA 4COWA 1ZBE1 3VZMA 1ZVFA 3LD8A 1MPXA 2A3YA 5JMOA 2J1AA 3MUY1 2P2KA 4BB3A 3DL3A 1BHGA 3SQOA 3POSA 1RMU3 1RJ7A 3RG0A 1XXNA 1K5JA 2W5FA 1RUJ1 3NAPB 4LXLA 2D6OX 5FJHA 3N9NA 1DGRN 2EIGA 4YW1A 4KWLA 1WCSA 2WZR2 5T5OA 4LR4A 5FMCA 4E2SA 3WDTA 3VBRA 4DOUA 4JAAA 3GCWA 4QXKA 4QHBA 5FZLA 3VL8A 5J98B 5AVPA 4Q0QA 1UYPA 1H6YA 1CAWA 3S30A 3LAGA 2E32A 1W8FA 4OYUA 5JAXA 1HLCA 2OS2A 4Y5SA 1EPWA 3O0VA 5EQUA 2VOTA 5ACA3 2Y64A 3I2DA 4LA3A 5A33B 4Y20A 4EJRA 1RXFA 2RMU1 4N9HA 4YW5A 1F5JA 4LO6B 5H9SA 3WP5A 4I2OA 3ZFEC 2A6WA 4YYOA 1W2UA 4R9CA 5LRSA 4UFLA 1TMF2 3ZFGB 3W5NA 4AAXA 1GOGA 1ULPA 2E9QA 2RR12 3ZSKA 1ZA4A 1Y9MA 2YBKA 3BYWA 4LBQB 3ZXKA 4CDWA 4DUVA 4OZOA 1OQDA 1AXZA 4GWJA 3JUUA 1N47A 1IZ3A 4PLNA 1KDKA 2VZUA 4WM7B 5C8WA 3O1VA 2R042 4JVAA 2WN2A 1K5MA 1WBLA 1LODA 2AUYA 3B7MA 3PU8A 4GXLA 3VBFA 2E26A 2R6QA 4I09A 3AXEA 4B29A 1W99A 3MW4A 4XFHA 5FXWA 5FZ7A 4AWDA 4Q4W3 4F8AA 2J1RA 4QDQA 4DFSA 3L9JT 1ENXA 4OI1A 1C8NA 4BE3A 4M3CB 3E1F1 5C9AC 1H8TA 1FPN1 4YPJA 2VM9A 3MV01 4OCTA 2CSGA 2BU9A 1JZ4A 1PNGA 2PXJA 1S2EA 4J6GA 4RS5C 1FMD3 1VRH1 1MZ5A 3OJBA 3WF4A 5FO7B 3NNJA 4WVWA 1B09A 1NAEA 2WYSA 2F17A 2JB8A 4E2GA 3SH3A 1SFNA 5EFUA 1W2NA 5K8SA 2OPWA 3KF5A 2CY6A 1WUVA 3SEEA 2DVGA 4QM9A 4IE0A 2WA3A 4XF0A 5FZEA 4PI2A 3UGHA 1UZ0A 3KSCA 4XXPA 3T2PA 4EN6B 3H1MA 1OPMA 4EZ4A 5L7OA 2WYFA 1VAVA 4D7YA 4UF0B 1OA3A 2VW1A 2ES3A 3C3VA 2Z42A 3LPFA 3N35A 4JKLA 4LK6A 4OHXA 2FDIA 1LHVA 4YG0A 1H1AA 5IVFA 1DGLA 2D6KA 2ZHNA 2DUPA 3OPZA 2P3KA 3A22A 1YJKA 2HKXA 1CESA 3LQCA 3LEMA 1AZDA 1FI2A 4HKLA 3ZYJB 3H8XA 2HYXA 3R4SA 2DCKA 1WZXA 4XZUG 1QQP1 2JDHA 1ZZ8A 4WVZA 4IE7A 2FMDA 4YZ4A 5AC91 3ZIWA 1VBA1 2D5FA 3H8UA 1SFPA 1AF9A 3I2FA 1UZVA 4FAHA 2MEV3 3NAPC 2ZABA 3UKNA 2G19A 2ZGMA 2UU8A 3VZLA 3OUJA 4FBFA 4MGKE 4Q0SA 3N9LA 2QQLA 4IE4A 3THTA 4OHVA 3ZN6A 4AEDA 2VO5A 1V6MA 2XL9A 4OUMA 3KQ4B 4CCOA 1JYNA 1ZBE3 2A7AA 4L2NA 4M00A 1RHI1 4KGGA 1W6MA 2DUOA 2JB4A 2XXZA 3E5XA 3W58A 3VUOA 3SMHA 4M4PA 1OHFA 1Y3TA 4ES9A 2JG9B 2F4PA 4GKXA 5FPZA 1RUJ3 2VTXA 3DPRB 3MPPG 1KDMA 2RS12 4MZUA 3OF1A 4B4QA 3OGVA 3LWCA 1UYYA 1PIV1 1OLMA 3ZFGC 4DPNA 2VCBA 1D0GA 2DURA 2VZRA 1UXXX 1VIWB 1O5UA 3WW3A 4AFAA 4AVAA 2ARCA 1Q8QA 5DPNA 5IUQA 5FYYA 2W91A 5FMDA 3ZO0B 2QE3A 1Z7S1 4OQ9A 4YVWB 1UQXA 2CL2A 1HRV2 1WCQA 4WM7C 1HJGA 1NZCA 4HN0A 2WAOA 3VBSA 4LHNA 2RMU3 1S0DA 3INAA 3D82A 1U0AA 2J7MA 1YIPA 4Q1PA 4YGEA 4Z82A 4I0AA 4K1YA 1UL9A 1XE8A 1H8VA 2WSVA 3USSA 4CDXB 3JB4C 5DZEA 4FXGB 4WVMB 3ZN5A 3X29B 4COYA 1MS0A 1JH5A 1VPHA 3DKQA 2L9LA 3ALQA 2VBPA 5FZBA 2JENA 1CN1A 4FFHA 2VNRA 1N1SA 4GD4A 5KHKA 1HN1A 1UD1A 2XJVA 4IV3A 3GZEA 4A3ZA 4UFMA 2LROA 4DXSA 5HV0A 1LCLA 4N43A 3OCPA 5BNQA 2BGPA 4NPLA 3ZMNA 1HKDA 1S2BA 1SQ4A 4BMEA 4IEVA 4Q26A 3ETQA 2ZX4A 1AR81 1RUH2 1LOBA 3KGZA 5FWEA 2IWGB 2WNUB 4HLTA 1STMA 1NQJA 5FYMA 3DYOA 3MO4A 1BKZA 1LOCA 5I91A 3MFCA 4CPBD 1LJ7A 2HWF2 1W9WA 2V09A 4GH4A 1POV1 4ZY9A 3MLKA 3VDDC 4BIFA 1W28A 1PX3A 1NLSA 1QJEA 1QJU2 4LBLA 1V70A 3CJIB 3KT4A 1FPN3 1SLTA 3HT2A 3HVDA 5AFEA 4AHXA 5FXXA 1RTVA 1VRH3 3DF0A 3LSDA 1W6QB 1LR5A 4YRDA 4BK4A 2VOXA 4D3WA 5FPVA 3R6SA 3RZKA 4GALA 4JCKA 3ACGA 3ROUA 3VZOA 3VKFC 5CFDA 1R081 4NJ4A 5DG2A 2PQSA 1QOOA 2JE7A 1O6UA 2PAMA 3E5UA 2XHNA 1LGCA 5IW0A 1SPPB 1PGW1 1YFYA 3IWZA 4BXFA 4XTPA 5A7WA 2ZZJA 4AHWA 5LEJA 3HT1A 5DZFA 1YQ6A 4FFIA 1W03A 2VY0A 4HKOA 4LBKA 4UBGA 1JBCA 3PTYA 2QQKA 2JICA 1J84A 3HBZA 4K1ZA 1QQP3 4HT1T 4Q8KA 5JSPA 5AC93 4JHTA 1VBA3 4M4RA 1KS5A 3AB0A 2JG9C 1HN0A 2VZ1A 4MGQA 5CBLA 4GMP1 3B9CA 2OUJA 3DPRC 2WN3A 2HBTA 5J1XA 2BUKA 3HPNA 3OYWA 2VU9A 4Z07A 1RVF1 4A7YA 4PI0A 1G7YA 1S0FA 5F1RA 3POWA 2EIEA 2BJSA 1AR61 2RDQA 3RI9A 4RSUA 5F7UA 1D4VB 1RHI3 3JQWA 2W92A 2YFUA 2EAKA 4YVWC 1LEDA 4UYBA 4LULA 2QTWB 4XMIA 1JYVA 4WZCA 1C8M2 2W2IA 2Z5WA 4NWWA 3WNXA 3P5BA 1BVP1 1A8DA 4RGKA 5J96B 4PBOA 1UU5A 2QDNA 1GNHA 4DXRA 1PIV3 2EIBA 1A6CA 5C3QA 4BMBA 4CDXC 1YCIA 3Q8FA 4IEYA 1FOD1 5IVYA 1UOJA 3HD8B 3R4UA 5FRAA 3ZXGA 5JSRA 1PO21 4K6BA 1RINA 1FNZA 1I1EA 4H2AA 5F39A 4X6RB 1Z7S3 3K4AA 3ZXFA 4EYUA 4Q4X1 4XYXA 4XFGA 5F2SA 3QACA 2C0ZA 4Z92B 3I3BA 5DMYA 1PZ8A 4FP2A 5IFPA 1PZ7A 3I97A 2P4EA 2VQAA 4QPYA 4DB5A 5IK7A 2ENRA 1LOFC 4OHZA 2WA4A 2VG9A 3ZKYA 4LKEA 4XUQA 5LK7B 3LEIA 4FTSA 2RJKA 4JQRA 4CCDA 3J7NA 4DY3A 1YNAA 4M3CF 2Y6GA 3CJIC 5KXDA 1I6XA 1PO12 2A6XA 1RIRA 3OUIA 2ZEZA 2BVVA 3QD6A 3S5AA 5FY0A 1JODA 1OLQA 5IATA 4MGSA 5EYYA 1S0GA 2VAUA 1WLDA 3N7JA 2AGSA 5JMCA 2RDRA 3J8F2 1AR83 1B35A 2R071 3PHMA 4NPMA 1IG0A 4GULA 3KQRA 4P9YA 3LCPA 3D4KA 5FR3A 2YBSA 1PX4A 4E2QA 4PT6A 1GZTA 4RFRB 4P5YA 3PUIA 2VC9A 3HNBM 4KQ7A 2Z2SB 3SHRA 4YW3A 5FZ0A 3WD5A 2GH8A 1POV3 2ZMKA 4PJYA 4AQSA 1OLRA 1C28A 2WSUA 2AR6A 2AC1A 2EXJA 2QCSB 1DQ1A 1UCXA 1FAYA 5J36A 2GNBA 2GAUA 3FC0A 4YGCA 5KHJA 3ZPYA 4ZZ8A 2VZPA 4XFAA 3D8CA 2Q8EA 4Q0VA 2Q8DA 2X5IB 2ZS6B 5KR7A 5JPNB 2I2SA 4ZZ5A 5FZMA 2RM21 5LATA 2P37A 2VZQA 3WDWA 2EXIA 4I0BA 3BVCA 1YQCA 4E8CA 4CP1A 3N3HA 2P3YA 3JU9A 4LA2A 1LAJA 1ND3B 3MIHA 1O7FA 2W9XA 3GBFA 1KGYA 1R083 1NCRB 5I8YA 3VD7A 1IS4A 2B9UA 4IEOA 1LESA 1MQTC 5E88A 1HV0A 2XONA 4ARYA 2UURA 5FQ0A 2IXJA 3NJVA 2B46X 1JXNA 3POJA 4ET7A 4QPGA 3AP5A 2BYVE 4ZXEA 1AL0G 2DBNA 4YZ5A 2OZJA 2RE9A 3HNMA 2ORXA 2BGCA 5LBFA 3AMMA 3I3MA 3RZLA 4KBBA 1W9TA 1W8ZA 2PHWA 3I2GA 3GNEA 1XQNA 3IDCB 2PELA 3K4ZA 4GMP3 2XJUA 4CU8A 3VD5A 1W6NA 4D6RA 1UWWA 3U1XA 2W87A 4LIUA 4CPBA 1XSQA 5GM0A 3ZXLA 1RVF3 4L8QA 1RXGA 4HMZA 4NMIA 4QXCA 2PAEA 5DUWA 2WUHA 2A71A 5C3SA 2VULA 4V2VA 3GCXA 2HWC2 1AR63 3TNPB 1MS9A 5A7NA 4AOCA 3ECQA 1ZZ7A 3KB5A 3POEA 3MICA 4B4PA 3FWEA 3RZJA 5JZGB 3WNLA 5CU1A 1JYCA 5DAVA 1KJLA 4FT8A 2GALA 5LY1A 2W68A 1F35A 4NE9A 4V2WA 1ALYA 1OF4A 4YGBA 3VBOA 3UYJA 5BY5A 4A6SA 3D0SA 1JYXA 5FYVA 5A1FA 3S7EA 2LUWA 3AKPA 4XQWA 5IAXA 1FOD3 2A3XA 3HQUA 5ANQA 1IS6A 1LKNA 1PO23 2NMNA 4FO9A 2DU1A 4YM2A 4W6WA 3WNMA 5BNNB 3NJZA 3A0NA 3OEAA 5EJ1B 4CP2A 4RR3B 1AXKA 3BB6A 3J7HA 5CA6A 4Q4X3 1CONA 5KXCA 3FFQA 2DDUA 1R1A2 2WO3A 4PF1A 4C90A 4NHKA 5HCFA 3E6BA 2XH6A 5D2AA 4SBVA 3OBZA 1IQDC 3JBG1 5JR2A 2FD8A 2JE8A 4IGPA 3ZFFB 3KF3A 4N53A 1EUTA 4E4HA 4GAZA 1KEXA 4ES8A 5F3IA 1BMV2 5LA1A 5IJRA 3WF0A 4XILA 1G86A 1YUDA 1DZRA 1GNZA 3VHPA 4FFFA 5T54A 4I01A 5LBCA 2AREA 4ZPIA 5LB6A 2X5IC 3IT8A 1UW8A 2G4IA 2H0VA 2XUMA 4XDQA 4PDWA 1GOHA 1PVC2 2R073 4EQVA 2P6CA 4AVBA 1GWLA 1GP5A 4NOTA 4QXBA 4MG2A 1GZWB 2WABA 1ND3C 1NCQA 1OH4A 3ZLIA 4DUXA 2NN8A 3BU7A 2ZZQA 5LCWL 1C1FA 1PM7A 1NCRC 2BP6A 5HCAA 5FK8A 4ZXKA 4BQXA 1NA1B 4AHZA 4I30A 3KS7A 2W39A 1J1TA 2PA7A 2VCAA 4AEMA 4CCLA 1JOBA 1Q8SA 1RUI2 3VHRA 4YFZA 4ZONA 1LTEA 3T2QA 2VMCA 5BXXA 1O3SA 4Q5OA 4JDMA 2RM23 3FHQA 4P9JA 1MS4A 1VB2A 3ATGA 3LA7A 1ODMA 2PLV1 4ZS2A 3OSDA 5FZOA 3ZSLA 4Z1VA 1SG3A 1SLAA 2YC2A 4XZPA 5BNOB 2A1XA 4QAWA 4XUPA 2ZGNA 2E7TA 3ZPOA 4O61A 4MGIE 2WNVB 1GICA 1AJKA 5E16A 2H6BA 2EF6A 2YV8A 3THPA 2XBO2 4Y5TA 3LDKA 3CNAA 3J26N 1CX1A 1TVGA 4Y22B 2QQWA 4LJHA 2XPJA 5DDJ1 1AXYA 1XE0A 2WINB 5E1RA 2IXHA 1GFF2 4EWAA 3NW4A 3OY8B 4GWNA 1RB8G 1G9BA 1AR71 1WBFA 2OUHA 5EJ3A 3KCYA 2BGOA 2VOWA 3MI8A 2RS32 3PDQA 4FP3A 4K8FA 5F5CA 2GMPA 2WIIB 4NIAA 2VOVA 3SITA 3WDUA 3GBGA 3OGRA 2G1MA 4AI0A 3O1OA 3K51A 1ZNPA 4CCMA 1DYKA 4N90A 1A8MA 1EAH2 2WL1A 3M8LA 1WLCA 1DGWX 4LOTA 4GB32 5F6KA 4CTEA 4RQPB 3JQXA 4Z2AA 2YU2A 3WHTA 5FDBA 4NHYA 3CZJA 3ZFEA 1C8M3 2TUNA 1ZZ9A 2BOIA 4QQOA 2JJ6A 2WWSA 4DINB 4IESA 5F5IA 1W8OA 2UYBA 4QXHA 5DUVA 5GLZA 1UMZA 4CU6A 1NZIA 2IUWA 3EMRA 2CNAA 1CWPA 3POIA 5M0TA 3I3EA 4LOSA 5B2GB 3APBA 2Y6KA 1ND2A 1J59A 2P3IA 2VNVA 3HOBA 4IEWA 4NAMA 1RUC1 4LBJA 4FAGA 1S0JA 3G6JB 1GZ9A 4LLFA 2PHUA 3FLRA 3KHBA 4AVSA 3AZYA 2KXLA 3S6PA 4XVHA 5IAVA 2C9KA 3BOPA 1ASJ1 1RUF2 3PLQA 4I3PA 5H9PA 3L2HA 5BUVA 4IDZA 3ZFFC 1R092 3IM0A 4CA9A 2HYKA 2WNOA 2E7AA 4QU2A 4XHXA 1N3QA 4QHZA 4XW3A 3WP6A 2ORZA 1Y9GA 1E57A 2PHLA 2QBXA 3T08A 4ASLA 5GLWA 1EPZA 1MZEA 1REDA 3PL0A 3QH6A 4ORFA 2RS51 4DZGA 5CVRA 1D0HA 4FPHA 2ZXQA 2IFWA 5F37A 5KXEA 1BMV1 4Y33A 3O1MA 3K4DA 4HPKB 2DVAA 4RS5A 4EN8B 1LHUA 1QDCA 4KH9A 1IPJA 4N9IA 2IZWA 1OXCA 4HANA 1RITA 3HJRA 3JBG3 1IG3A 5C9AB 3BI3A 4CUBA 3F95A 5T5JA 5FIXA 3ZVXA 1ONAA 4KG0A 4TTGA 4QX5A 1MR5A 5KXBA 1DGRA 1ZM1A 3Q8AA 2HJIA 4XF3A 1UZZA 3K3OA 4IV1B 3B3QE 4FPEA 2O14A 4KWKA 4L92A 4C8DA 2VL4A 1SEFA 1OOPB 2R061 5D8AB 2A6ZA 3LFMA 1BBT2 1V6LA 2XWBB 3T1LA 4D7SA 2W95A 1XSRA 5FUPA 1UN1A 3T0BA 5BNOC 1PMHX 3FUQA 5FY1A 1AVBA 2WR9A 2P6HA 5I0RA 3UT0A 2WQZC 1BCXA 1BVVA 2WNVC 4IW3A 4K40A 3WXPA 4Y1ZA 2SLIA 1KJRA 2H0BA 3AZVA 3Q8CA 2Q30A 3KCCA 5I0SA 1BZWA 4FPKA 1CAVA 2AENA 2XWJB 4X6QB 2F6BA 5I0TA 4HZFA 1NYWA 1JUIA 1JU4A 3ACHA 3NMBA 1W3XA 4CP9B 1HRI2 1AUYA 5J09A 4UW6A 3UETA 3TYJA 4DEVA 3N7MA 3AP4A 4QX2A 2ZAHA 4B1LA 4BH9A 5DAQA 5FZIA 2PLV3 3MDPA 3Q8BA 2XL7A 3BU0A 2C1FA 2V4AA 1WMFA 3KVAA 2ZKNA 1W6OB 1JZ7A 1HX6A 1PK6B 2P17A 5A33A 2CAVA 4AVCA 4A3XA 2C6SA 1F4HA 1WKYA 4XABA 4LNVA 4XJUA 1E5HA 1EP0A 3BPSA 4RQPC 3SH5A 4A41A 4XJWA 3RYRA 3KV5A 4P14A 3TN92 4CDQC 3LOBA 4XURA 3ES4A 2QQJA 5BNPA 5DDJ3 4EWEA 2DCTA 3RZGA 2DVBA 1DQ0A 1JI6A 2Y26A 4NIIA 3ZFGA 1AR73 2B39A 4K7JA 4R4XA 4NN0A 2YGLA 1DCSA 1WLTA 2WLPA 4LE3A 4B4RA 4OULA 4COUA 5HBAA 2D3RA 1COV1 2ZGKA 2J22A 2ET7A 4Q4Y1 5GZCA 1ZYBA 4GQ7A 4WM7A 3NJYA 1DLLA 2JDPA 3SLIA 4LQRA 4UW5A 4UXAA 2QQMA 1XJAA 4PLOA 5G04L 1BEV2 2OKXA 3CL1A 3ST7A 1O91A 2W3JA 1DYOA 5CAZA 4OVEA 3WVJA 1NY72 1X82A 1JZ2A 1P8JA 3KGLA 3WQ0A 4Q4V1 4ZU7A 4FTBA 1OUXA 2D93A 2E51A 4EN7B 2OVUA 4LIVA 2WRAA 2XUEA 1TME2 2AEYA 3B69A 1C4RA 4S2FA 5EV7A 4M3CA 5AFBA 4YZ2A 3EXUA 2W52A 3MUZ1 4OMDA 4YARA 1RUC3 1VBD1 5FZ3A 3T09A 2BDRA 3WZ1A 2XQRA 3AKRA 4XE9A 3ZSJA 1ZRCA 5LASA 1ASJ3 5K4LA 1EV12 1GMMA 1QXJA 4N7IA 2QQOA 1YYNA 5FPUA 2QZ3A 5L19A 3EQEA 3NQHA 2EA7A 4A6OA 1H2LA 2W1QA 3PUHA 1CZSA 2UYAA 4YW6A 5FZCA 3T3YA 5A1AA 4UF0A 2HWE1 1RUE1 4COZA 2OYZA 3DXUA 1U12A 4YVSA 1HW5A 2RS53 4IV1C 1MEC2 5L9VA 4LPLA 4I3GA 1ZBA1 3AKTA 1OOPC 4OI2A 3VDDB 5D8AC 2J1TA 2Q4SA 3ZKUA 2A6YA 4B8EA 1JYTA 3VD3A 3BTZA 4G4FA 3BIWE 1F31A 4CEWA 2BBVA 3IIAA 1CQ9A 2XLAA 4QKBA 3K77A 1CAXB 2J42A 5A3TA 3AJYA 2ZACA 4MGYE 2K9ZA 3A23A 3FN9A 1C57A 5GALA 1QNWA 1VBE2 1H8TB 3AFKA 1H4GA 4Y24A 3ZN4A 3WG4A 3DECA 3TRSB 5C5TA 3AYCA 2BW8A 2WFF2 4FPJA 2XJSA 1QXRA 1DDLA 2R063 2V5DA 2JG8C 3NWKA 4U2AA 1OKQA 3C7GA 2VZSA 1IQAA 3B94A 1OBNA 3ETPA 4E4DX 4QKDA 3M3CA 4YGDA 3U78A 2JEMA 1HB2A 1IGOA 1PK6C 4MYEA 4TSVA 5JPMB 2XKPA 4W6XA 4JGZA 4A4AA 3ASIA 4BLJA 4PQ9A 3KWVA 1V9U2 3I59A 2WZR1 2ZGOA 2VMGA 2XLGA 2LW8A 3AXDA 1AR92 1ULCA 2VJXA 4H3WA 5DXDA 3UL2A 5FBZA 4LHSA 1BXHA 2BBAA 3GF6A 1PGSA 1REEA 1G9FA 3RZZA 2D6PA 4CDUB 2V5YA 1CJDA 1LNSA 3QBQA 3VKNA 1VBB2 3WNOA 2JD4A
chains in the Genus database with same CATH topology
5BYNA 5A32A 3H1WA 3ZIXA 5F5QA 1C1LA 1ZZBA 1NXD1 2VMHA 1S0IA 4YFWA 2ZHKA 3VL9A 1ULFA 3VBRC 1TMF1 4RHV2 5F9TA 1QMJA 1Q8OA 4AEDB 5KHIA 2XJQA 4P9GA 4WVMA 1QHDA 2RR11 1H30A 4DS0A 5ABJA 2HEWF 4EN9B 4F7ZA 1YIFA 1YO8A 2E7QA 2IXLA 4YM0A 2XJTA 2ZPXA 2D6NA 1COV3 5FPXA 3IMNA 1LOAA 2BFUL 4Q4Y3 4DXZA 2ARBA 3FLPA 2R041 2R30A 5LRRA 2R16A 2WNUA 3WG2A 3ELNA 2B45X 1XNBA 5CFCB 4CDWC 4Q4V3 1POV0 2KA3A 2NLRA 4IEZA 4LO5B 1MS3A 2EALA 3CJXA 3CJIA 4F3JA 4JC1A 3NV4A 4B7EA 1VBD3 2XHKA 1V6OA 4G9SB 1MEC1 2VW0A 1W6PA 4NHMA 2GH2A 4FOQA 3O12A 1H9WA 1SLIA 5FMOL 3MLLA 1UPIA 4XHBA 1DF0A 3ZYIB 4CP0A 2ZJCA 4IV3B 1H8TC 1WD3A 2HWE3 1FATA 1RUE3 4N43B 3ZXAC 3AYAA 3M4FA 1RUG2 4IQPA 3ES1A 1ZBA3 2CV6A 5GLUA 3NVCA 3NO8A 2XB6C 2HWB2 1HXS2 3VLBB 2D5HA 2DCYA 3E6DA 4E4ZA 4HK9A 1REFA 5H9RA 1XNKA 3OGGA 4GH4B 5H9QA 4JRLA 1V6IA 4Q1RA 5SV8A 3RDIA 3RJ2X 4DNYA 4XIKA 5L36A 4KL1A 1H1IA 4GMP0 4IEPA 2LM3A 4NO4A 3BPZA 1KFXL 1PHMA 2HEVF 4JTNA 3WW1A 1EYBA 3LA2A 4XFCA 1GZCA 4QQHA 1MACA 2GN7A 3AM2A 4A7KA 4CDUC 2WT0A 3B5LB 4MXWA 3CF6E 3S0MA 1MQTB 1AR91 3JD72 2ZGTA 2QNKA 3MFAA 2VPVA 1H2MA 1HDKA 2FBEA 4IL7A 2RS11 1ZRDA 3KT7A 4C1XA 2WZR3 4Q29A 3RYKA 4HETA 1MZFA 1VBC2 4K9SA 4AEDC 3T1MA 3EO6A 3JCIA 2D40A 2A5ZA 3URFA 4BZ4A 1GANA 3HMYA 3WV6A 4IXLA 3N36A 3V0BB 2GNDA 1HRV1 3VZKA 4ATEA 1D2QA 1OQEA 3AZWA 4Y5Z0 1ZZCA 2WC2A 4LLOA 2ZGQA 1ULEA 1TMF3 4AK3A 4AQ2A 4B7KA 2BVBA 2RR13 1WCDJ 5CFCC 2NP0A 2CGPA 3USUB 2PTMA 2W0XA 4Y26A 2ZGUA 2ZX1A 1XYNA 3KD4A 2ZMNA 4MSVA 3UJOA 2CAUA 3AYDA 4DMIA 2DUQA 3BALA 1RUH1 1S0EA 2R043 1DGWA 3TBDA 3BCWA 5CNAA 2GC2A 2HWF1 4IEXA 2ZHMA 5DZGA 4YNIA 2WS92 2FHRA 1LGBA 1QJU1 2DV9A 2VQ0A 1AL22 4IV3C 1F5FA 3P3PA 1WCKA 4N43C 3SCHA 5GLTA 4Z8BA 5T55A 1O3RA 3FUOA 4ZU5A 3ZXEA 1CGPA 4GIQA 4CYDA 2GNTA 1LOGA 1OSGA 2ZAAA 3AK0A 4QMAA 4XF4A 3AP7A 3ZDSA 1MEC3 1N3OA 4GH4C 1KQRA 1ND3A 4BOWA 4QPIB 3MYXA 4QT6A 1ENQA 1QDOA 1AYM2 3ZXDA 1QY4A 4FQZA 5EYXA 4BLIA 4H14A 3HIFA 1D4M2 2NQYA 1QKQA 1VR3A 2A6VA 4YG3A 4AFDA 1TE1B 1N1VA 3GHMA 5JOYA 1QU0A 4XBQA 3WG1A 1G8WA 5J48A 4LO4B 3AMQA 3H3UA 4RGGA 5GZGA 1YJLA 2JE9A 4K3UA 4QQLA 3SXWA 4XJ9A 2QDRA 5CFDC 4V1PA 5J7MA 1QOSA 2ZMLA 4RGAA 1S2KA 5C8CB 3AFGA 1NOVA 4URTA 4EROA 3U10A 4U36A 2VXRA 1I5ZA 3FBYA 3ME2A 3TOJA 1ULDA 4PIYA 3JZVA 1YFXA 2DYCA 1RMU2 4Q2FA 1BYHA 3ZSEA 2X8KA 3AX4A 1AR93 1FNYA 1CAUB 1VBC1 3WUCA 1OD5A 1WMDA 1DQ5A 1C8M1 2GMMA 5C33A 2NM1A 2SBAA 5JZGA 3FJSA 1XU1A 3KT1A 2RS13 3IDBB 5HCBA 4C0BA 5FLHA 1HQLA 5K0UB 2GC1A 3PVEA 4WM8B 5T5PA 1HQWA 3A4UA 2VECA 5FQ0B 1Y43B 4QPGB 4BYYA 1W0PA 5ACA2 2A70A 5GZEA 4ASMB 1GYKA 1UAIA 1SFYA 5BNNA 5C4WA 3KLSA 1VAKA 3GYDA 4RR3A 1HRV3 1V6NA 5JLVA 2R32A 1TQ5A 2OW4A 1V6JA 5IT6A 3WP3A 3MLJA 3LA3A 4WVVA 3WX5A 3WCRA 3MGUA 3ZFFA 4AI3A 3B01A 2MPFA 2BWAA 3H7JA 1PO11 1O4ZA 3NSTA 1BQPA 4DRVA 4FCAA 1Y7BA 2Q8OA 5JOXA 4FOVA 4OI0A 3HR9A 2H6CA 3J8F1 1RUH3 4XFBA 4CRQA 3FFZA 2D6LX 4Q4W2 1TEIA 2TBVA 3WDYA 2CYFA 2C9AA 2Q1MA 2BFUS 3H7YA 4S2DA 2HWF3 3GZTB 5EXOA 1GZWA 3U0ZA 4QPIC 1FXZA 3KZ4C 4LBQD 1QJU3 4AF9A 5JOWA 1FMD2 1S0CA 5T5LA 1LENA 5FLIA 4LO8A 4R9DA 1NA1A 1G9AA 1AX2A 4UBHA 1LU1A 1CX4A 2PHXA 1G9DA 4TZDA 3FBMA 5JR7B 4H55A 3O0WA 1SBEA 1J3QA 2D7FA 3B9IA 4XJ8A 2A75A 1OA4A 2FZ1A 4AEJA 3GZAA 3FE5A 2LTNA 1LEMA 5JVVA 2WNVA 1IKQA 2GNMA 5FAXA 5C8CC 1G6NA 2YC0A 2GZWA 1FX5A 4Y22A 1RJ8A 2I07B 1UIJA 1MVEA 4AFMA 1DG6A 1O5LA 2MEV2 1Q3EA 4AW7A 4PBPA 2GC3A 1YRZA 5T50A 1NCQB 3U11A 3O0XA 4RL7A 2GMEA 5KC6A 4XF9A 3SCFA 2HEYF 1H2KA 3RI8A 3VBHB 5K0UC 1ZBE2 4WM8C 1U5XA 1X8EA 3VHOA 3PVNA 2HWC1 4QPGC 1C3HA 1F8VA 1GV9A 3IBMA 3ZXJA 2Y0IA 4XJAA 1VBC3 2O8QA 3OBRA 3U4XA 3AYEA 4CDQB 1KRIA 4QM8A 4LHLA 2R1DA 1V00A 4O9EA 4PLMA 3M7AA 1O3QA 4JDNA 4META 1QWRA 2KM2A 2D44A 1DZTA 3MW2A 5J3UA 4XQ4A 2BWCA 1FT9A 1SBDA 4XMAA 3VBUB 3B02A 3DN7A 5KWRA 5CG9A 1UKRA 2RMU2 2X53S 2B7YA 1YXWA 4MX3A 3WW2A 2ZGRA 1TNRA 1YFUA 1QJX2 1R1A1 1JUHA 1A3KA 4M0HA 1U5YA 1H4HA 4LBOA 3VBOC 4HPKA 4FPYA 4FSJA 4LHKA 2EXKA 3TB0A 1SBFA 3RS6A 2W08A 5C9AA 1XRUA 1D2SA 2DTWA 2GSYA 3VKLA 2RJLA 3IPVB 3KM5A 5I8SA 4CEYB 2E53A 1JOJA 1PO13 1TNFA 4L99A 1SACA 2WJSA 5FFOC 4NPRA 4LEJA 1OMIA 2A3WA 1ZZ6A 4IV1A 1WW6A 1PVC1 3J8F3 2D3SA 2P34A 3AP9A 4Y1UA 1DQ2A 2JX9A 1YFWA 4ISRA 3H1YA 2PN5A 1FPN2 4FOYA 4E4SA 3RMYA 5FTTC 5TSWA 1VRH2 4LUMA 2GU9A 4ISQA 1I9RA 5BV6A 1RUI1 4FPFA 1FV3A 1ULGA 4BQ1A 1Q43A 4PDWC 2EVXA 2OPKA 4W65A 2XJRA 1QH7A 3GALA 1WGPA 3PJYA 3BODA 3NAPA 4BA6A 4PIXA 1T6GC 1NCQC 3RMXA 3W9AA 5JI7A 4I0WB 4JGYB 2ET1A 1PK6A 2ZBJA 3A0KA 1WA4A 4JTOA 3VBHC 3O7OA 3OD0A 2B42B 2JG8B 3NKTA 3V65A 2XBO1 3HN1A 3V0AB 1OA2A 3IN9A 4FVVA 3DGTA 3FZ3A 2IXIA 1QQP2 2CGOA 5AC92 4JV4A 3PVBB 2RS31 1J3PA 4NHLA 1S0BA 4OHYA 4Q0UA 2BTVC 1ZREA 5LK5A 3UJQA 2YY1A 1EAH1 3WQ7A 4OHWA 4GB31 3VV1A 4QQPA 2JXAA 1XU2A 1CAVB 1RHI2 4LBQA 2VUAA 3QLQA 4ITCA 1O3TA 2HWC3 4GA9A 3VBUC 1SDWA 2QQPA 2Z69A 4XF1A 5LEKA 2BEOA 2AZ5A 4YW2A 3VBRB 1PNFA 4XFIA 1PIV2 1R1ZA 1H9PA 4IERA 1CAWB 4Y1XA 2Q0AA 1VB4A 4XJZA 1PVXA 5GZDA 5D1IA 1RUF1 4KU8A 2DTYA 1EY2A 2PQQA 1R091 1QJX1 1ZX5A 1Z7S2 5BNPB 3MF9A 3N7KA 4Y20B 2MNGA 4YG6A 4CEYC 2FQPA 3OD4A 1LOEA 2D3PA 4AQ6A 4KU7A 4BIOA 4AQTA 4AXOA 2N7GA 4A7ZA 1ND2C 4B3NA 4HBNA 1R1A3 3PJQA 3WINE 1WW5A 4YZ3A 1OFNA 1GSLA 2ZA9A 2VMIA 1SCSA 3VDDA 4CDWB 4INDA 5JIAA 1UZYA 3NKGA 1KS4A 1AX0A 3B93A 1MZ6A 5HI0A 3M3IA 2K0GA 1ZRFA 1Q8PA 4D94A 4E27A 1CAXA 4Y4YA 1CVNA 3OTFA 1K5MB 1J1LA 3VBFB 1AR82 5KHHA 3WT3A 1AX1A 2BNMA 3E6CC 4N7UA 5KHGA 1LHWA 1GQHA 4EV0A 1PVC3 2YGMA 3R4DB 1BBT1 2XVGA 4R4ZA 2QZ2A 1RGSA 2WZPP 2OZ6A 3BOWA 2D97A 3S7IA 2LALA 4JGYC 5A3MA 5L73A 3C2UA 1Z0HA 2Y0OA 4X8NA 1OFSA 3MIEA 3V56A 4YVSB 1RUI3 1DBNA 1HRI1 3EJKA 3CO2A 1M06G 2CTVA 3AZZA 1FYUA 3GZUC 1YI9A 5L7OB 1LRHA 3ZMOA 2JG9A 1N3PA 2OIIA 4CDUA 1R082 2R1BA 3N4MA 1DYPA 3DPRA 5IK5A 4CEWB 2Y38A 3IDEA 5I93A 1PGW2 1KXGA 1QH6A 4XPVA 3LGRA 4BHPA 2XBO3 3TN91 1X33A 3R0RA 3E5QA 3I7DA 2YXSA 2DVFA 2D43A 5E8AA 4YVWA 1X7NA 1LHNA 5DG1A 3WCSA 2RS33 3EBRA 4JGZB 1EAH3 1RVF2 4MH0E 3ZN6B 4CDXA 1KITA 3I59B 4GB33 2C5DA 4MVTA 1CIWA 2FMYA 1AR62 1W6MB 1BEV1 2HWD2 5BNPC 3MEPA 2IFRA 4HKWA 1NY71 2PFWA 5JCTA 4KG8A 4ONUA 1GBGA 5FREA 3M2MA 5CFCA 1TME1 3QOPA 1GQGA 2CWMA 5A32B 2DFBA 1LOFA 2YZ4A 2GN3A 5FOBB 2JECA 4TYSA 1FOD2 3RRDA 1QJY2 1PO22 3W59A 1RUF3 1AJOA 3FMGA 1EV11 3ZYPA 1V6KA 4C91A 3UV9A 1R093 4QQ2A 1QJX3 4HK8A 4RA0A 1JW6A 4Q4X2 4YM3A 3VBSB 3TNQA 5ABJB 1K5MC 3VBFC 3VZJA 2WT2A 1W6QA 1W0OA 3I4IA 2VNOA 5JWPA 4P9XA 5DUUA 2VH9A 2YPJA 2FZ2A 1A78A 4JDOA 1IPKA 2YHJA 1QNYA 2XG3A 3EHKA 4WZFA 1J3RA 4UW3A 1WD4A 1CPNA 4RD7A 4P9WA 4AFBA 1XYOA 4Y1VA 2VW2A 2NYYA 3ENRA 1AHSA 4P9LA 2ZCWA 4R9AA 4W6YA 1VBE1 2R072 1L3JA 4YVSC 3CEWA 2QKDA 2WFPA 3ZYGA 1Z78A 2WFF1 3IKWA 1IOAA 3I8TA 1ENSA 4OLLA 1RUNA 5L7OC 1BBT3 2ILMA 4Z2WA 1UF2C 4CEWC 4C1WA 1W6PB 2YDEA 5K7PA 1MQTA 5C6CA 2PAKA 4LUKA 1V9U1 2XKOA 3L2YA 1U5IA 2E6VA 4IETA 4AGRA 1PZ9A 2XLFA 1WW4A 4AGGA 2RM22 1APNA 3AKQA 2DCJA 1HRI3 3LOIA 1DQ6A 1JN2P 1MS8A 4FPLA 3ILFA 1DQ4A 3JB8A 3WDVA 5CFDB 3CU7A 4X8PA 2G9GA 1O4TA 3E97A 1XNCA 3BTAA 4MXVA 3DUIA 1VBB1 4AI1A 4L97A 3D5OA 3FHIB 1Q5OA 3V0BA 3H9AA 2WNEA 4LTAA 4JGZC 4KGQA 3P3NA 3D6EA 3AZXA 5DUXA 2R0FA 2IXKA 3ACLA 1UKGA 1AYN2 3TN93 3FX3A 4RHV1 2QUOA 1WW7A 1YWKA 4M3CE 3K48A 1OI6A 4K20A 5FO8B 1I3HA 1SLLA 3M3OA 3AMPA 3MW3A 4WV8A 1W39A 2QFEA 3MZHA 2YMZA 4J1XA 4MXWB 1MVQA 4G3YC 3OYWB 3USUA 1QOTA 2HWD1 3R05A 3SH4A 4C0HA 1UX6A 4PIZA 4S2HA 3PNAA 1C5IA 4HFSA 4HSJA 3TAYA 3UKVA 1BEV3 4JRAA 5FCCA 2GC0A 3VBSC 1QJY1 2BQPA 1S1AA 5E89A 5ABJC 2K2SA 3J9SA 1TME3 3H0OA 1F9KA 2QJVA 3N7LA 3WP4A 3WR0A 5JOZA 4OFGA 2PYTA 2PHRA 1X8MA 3WOGA 1CPMA 1C5HA 2ARXA 5BPXA 1QF3A 1EV13 2IXCA 2WNUC 4YLZA 3U07A 3RSJA 1IS5A 4AVTA 2PHDA 4M01A 4FXKB 2ZX0A 1QXPA 1RUOA 4Q0PA 2VVDA 1VP6A 3HAGA 4KNCA 4ZU4A 1BJQA 2X5IA 1XYPA 4QPIA 2JKBA 4TLFA 1RUD2 1GLHA 1RUG1 1VAMA 5GZFA 4QD2A 1WLWA 4XBNA 3UKTA 5A3LA 1SCRA 3JBG2 4FQ4A 1NXMA 4AHYA 2YYOA 2DF7A 1HIXA 1LULA 3B00A 1DIWA 4ATFA 3POYA 2HWB1 1NCRA 1HXS1 3M70A 3M1HA 4AGVA 2O8OA 1N1YA 2XJPA 1B35B 1IKPA 1Q8VA 1UU4A 1VBE3 4HL0A 2A73B 2WLQA 3WHUA 5FLJA 3VN4A 5C8CA 3AJZA 1QGLA 3RJRA 2WFF3 4S2GA 1SLCA 3T2TA 3Q9OA 1LECA 1IHMA 5JSOA 1NE4A 2YUEA 4UW4A 3JD71 4HSLA 2ZGPA 3RPQA 3PVOA 5IK4A 1CAUA 4K21A 1URXA 4CZSA 1V9U3 3ZSMA 2VUJA 2NMOA 3CLPA 5GLVA 1S55A 1HV1A 3AMHA 3NV3A 5FO9B 4AFCA 2XVLA 4QGNA 4AG4A 5K0UA 5CADA 2PLV2 4WM8A 3M3QA 2TNFA 4DQAA 3PMSA 4XFFA 5F6LB 4LBMA 1AYN1 4OI4A 1IS3A 2DCZA 3AP6A 3GHNA 1VBB3 3LKJA 3PMEA 2ZGLA 4SLIA 3DKWA 4XOGA 3WUDA 4XETA 5GJ6A 5DDJ2 1H2NA 2AYHA 5SV5A 1AR72 2TEPA 4RHV3 3HQXA 1PGL2 5JIUA 2XGXA 1PMIA 4FPOB 5KBFA 1UIKA 1X50A 2IC1A 2VOKA 1W6NB 2RHPA 3LZZA 5J37A 2HWD3 1RC6A 4WBBA 4IEQA 4OZXA 3MIBA 2DFCA 3M3EA 4EWDA 1DHKB 5AVAA 2JDZA 2WKKA 5EZWA 3DV8A 2AH2A 2PHFA 4QGLA 1NQDA 3ZX7A 3H50A 3RQ0A 2WS91 5JDBA 1OPOA 1H0BA 3ZYRA 1QJY3 1AL21 3O5SA 4DRRA 5C4WB 4MV2A 1RUC2 3VBOB 1DFQA 4XIOA 4FPGA 1KD7A 4LBNA 4LE4A 2Q1ZB 2V73A 1UU6A 3VKOA 1ASJ2 4XXAA 4GWMA 2UWBA 2OA2A 1F2NA 1LGNA 1Q56A 2ZHLA 3V64A 1RUD1 1Y9QA 4L9BA 2D6MA 4XBLA 2DU0A 3SCGA 2UWCA 4OUSA 2UWAA 3SNMA 2YROA 2GDFA 2RS52 3AKSA 3LSEA 1B35C 1AYM1 3HWJA 5K9YA 4NWVA 1D4M1 1RUG3 4PCRA 1JYIA 1O4YA 2CWSA 4N53B 5BNOA 4RFT0 4GKYA 3QCWA 4R52A 2ATFA 3MIFA 2WQ4A 5FOJB 4D7TA 2HWB3 3UK9A 1HXS3 2G9FA 2Q5TA 4AEKA 4A2UA 5FMOS 1M4WA 4M0NA 4PDWB 4D69A 1U5ZA 2P3JA 4Q27A 1GKBA 2R062 3OY8A 4QGMA 3VBHA 2NPIA 1QJZA 2WT1A 4AI8A 4HN1A 4XTMA 2ZOEB 1RMU1 1CD3G 4P5HA 1GR3A 4HVQA 3I54A 1VALA 1MS1A 2ZKLA 4EN0A 2VGDA 3JD73 3RNSA 1HQNA 4RQPA 4YSFA 4AYUA 4CDQA 3O14A 1OQ1A 4BPZA 4LO7A 1XE7A 4COVA 1JHNA 1RUJ2 1YHFA 1VJ2A 2EXHA 3WDXA 3D0JA 4L11A 5ACA1 4HVOA 3MIDA 4FPCA 4E9KA 3H3ZA 3VKMA 4H7MA 3VBUA 1AYN3 1LHOA 1SLBA 2ZGSA 5I8TA 2BPA2 4HVRA 4ZKTB 1XNDA 5KC5A 5JZGC 3WW4A 4AE2A 4MUVA 4Y1YA 5I0UA 4LT5A 4YM1A 2VVEA 2ZTNA 4FOWA 4BCUA 3MPBA 3KMHA 1KFUL 1H1MA 3ILNA 3WQ1A 1COV2 2E63A 2MHFA 4Q4Y2 3TWIA 3IPVA 5BNNC 5C4WC 2I74A 3VZNA 5T52A 5CIRA 4BWOA 4CEYA 3KCXA 4RR3C 4AVVA 3ZFEB 1SMVA 1WMEA 1CR7A 4NVPA 1J58A 1CJPA 1NE6A 2BNOA 3WG3A 4Q4W1 5JI9A 5CB7A 2XVKA 4Q4V2 1DZQA 1LB2A 2ETEA 1ND2B 2D98A 3ILRA 2WS93 4YW4A 4FTEA 4Q8LA 3G7DA 1X36A 1FMD1 1AL23 3FLTA 2UY8A 2DWRA 2DVDA 2PHTA 1OOPA 1VBD2 4TWTA 5D8AA 2ZX3A 3VHNA 1RL3A 4YZ1A 4MGZE 1DU3D 2Z79A 4N53C 1N1TA 3J4UH 5IK8A 1YI7A 1BK1A 1G9CA 2R0HA 4DY5A 3SISA 2B5HA 1RUD3 5HXVA 4O9GA 2I45A 5GKAC 4IEUA 4P9IA 2HWE2 1RUE2 4BM8A 2ZX2A 3GBWA 3RWNA 3RYPA 2BNNA 3NV1A 4RS5B 4R9BA 4JGYA 4H7LA 1ZBA2 1AYM3 2B8MA 3OBTA 4MLOA 1MS5A 1NA1C 5T3NA 1JTZX 1UPSA 1D4M3 2JG8A 1NLRA 1LU2A 2UY9A 1NG0A 2O0OA 3NV2A 3QH7A 1YLLA 4I02A 1VLNA 2X29A 3V0AA 3AMNA 1W6OA 4XEZA 1ENRA 2ERFA 2VNGA 1FV2A 2NZ9A 4R8HA 2MEV1 3MF6A 3WY6A 4J1WA 3LB9A 4F83A 4NR1A 4PF5A 3MIGA 4XQDA 2O1QA 1ZRRA 2CGNA 2R49A 3WLUA 4KWJA 3VGIA 3OGJA 2QVSB 3NL1A 5EWSA 4AI2A 2EAAA 1VBA2 2VVFA 4COWA 1ZBE1 3VZMA 1ZVFA 2A3YA 2P2KA 3DL3A 3POSA 1RMU3 1RJ7A 3RG0A 1XXNA 1RUJ1 3NAPB 2D6OX 1DGRN 2EIGA 4YW1A 4KWLA 1WCSA 2WZR2 5T5OA 4LR4A 4E2SA 3WDTA 3VBRA 4DOUA 4JAAA 4QXKA 4QHBA 3VL8A 5J98B 5AVPA 4Q0QA 1CAWA 3S30A 3LAGA 5JAXA 1HLCA 1EPWA 3O0VA 5ACA3 3I2DA 4LA3A 5A33B 4Y20A 4EJRA 2RMU1 4N9HA 4YW5A 1F5JA 4LO6B 5H9SA 3WP5A 4I2OA 3ZFEC 2A6WA 4YYOA 1W2UA 4R9CA 5LRSA 1TMF2 3ZFGB 2E9QA 2RR12 3ZSKA 1ZA4A 4LBQB 3ZXKA 4CDWA 1OQDA 1AXZA 3JUUA 1N47A 1IZ3A 4PLNA 1KDKA 4WM7B 5C8WA 2R042 4JVAA 1K5MA 1WBLA 1LODA 2AUYA 3B7MA 4GXLA 3VBFA 2R6QA 4I09A 3AXEA 4B29A 3MW4A 4XFHA 4AWDA 4Q4W3 4F8AA 4DFSA 3L9JT 1ENXA 4OI1A 1C8NA 4BE3A 4M3CB 5C9AC 1H8TA 1FPN1 1PNGA 4J6GA 4RS5C 1FMD3 1VRH1 1MZ5A 3OJBA 5FO7B 4WVWA 1B09A 4E2GA 3SH3A 1SFNA 5EFUA 5K8SA 2CY6A 1WUVA 2DVGA 4QM9A 4XF0A 2WA3A 3KSCA 4XXPA 4EN6B 3H1MA 1OPMA 5L7OA 1VAVA 4D7YA 1OA3A 2VW1A 2ES3A 3C3VA 2Z42A 3N35A 4OHXA 1LHVA 4YG0A 1H1AA 1DGLA 2D6KA 2ZHNA 2DUPA 3OPZA 2P3KA 1YJKA 2HKXA 1CESA 1AZDA 1FI2A 4HKLA 3ZYJB 3R4SA 2DCKA 1QQP1 4WVZA 1ZZ8A 4YZ4A 2FMDA 5AC91 3ZIWA 1VBA1 2D5FA 3H8UA 1AF9A 4FAHA 2MEV3 3NAPC 2ZABA 3UKNA 2ZGMA 2UU8A 3VZLA 4FBFA 4MGKE 4Q0SA 3THTA 3ZN6A 4OHVA 4AEDA 4OUMA 1V6MA 2XL9A 1ZBE3 2A7AA 4L2NA 4M00A 1RHI1 4KGGA 1W6MA 2DUOA 3E5XA 3W58A 3VUOA 3SMHA 1OHFA 1Y3TA 4ES9A 2JG9B 2F4PA 4GKXA 5FPZA 1RUJ3 4MZUA 3DPRB 3MPPG 1KDMA 2RS12 3OF1A 4B4QA 3LWCA 1PIV1 4DPNA 3ZFGC 1D0GA 2DURA 3WW3A 1VIWB 4AFAA 1O5UA 4AVAA 1Q8QA 5IUQA 3ZO0B 2QE3A 1Z7S1 4YVWB 1HRV2 2CL2A 4WM7C 1NZCA 4HN0A 3VBSA 4LHNA 2RMU3 1S0DA 3INAA 3D82A 1U0AA 1YIPA 4Q1PA 4YGEA 4Z82A 4I0AA 4K1YA 1UL9A 1XE8A 1H8VA 2WSVA 3USSA 4CDXB 3JB4C 5DZEA 4FXGB 4WVMB 3ZN5A 3X29B 4COYA 1MS0A 1JH5A 3ALQA 2JENA 1CN1A 2VNRA 1N1SA 5KHKA 1UD1A 4IV3A 2XJVA 1LCLA 4N43A 3OCPA 5BNQA 3ZMNA 1HKDA 1S2BA 1SQ4A 4BMEA 4IEVA 4Q26A 3ETQA 2ZX4A 1AR81 1RUH2 1LOBA 3KGZA 2IWGB 2WNUB 4HLTA 1NQJA 1BKZA 1LOCA 5I91A 3MFCA 1LJ7A 2HWF2 2V09A 4BIFA 4GH4A 1POV1 3VDDC 3MLKA 1NLSA 1QJU2 4LBLA 1V70A 3CJIB 3KT4A 1FPN3 1SLTA 3HT2A 5AFEA 4AHXA 1RTVA 1VRH3 3DF0A 3LSDA 1W6QB 1LR5A 4YRDA 2VOXA 4D3WA 3R6SA 4GALA 4JCKA 3VZOA 3ROUA 3VKFC 5CFDA 1R081 5DG2A 1QOOA 2JE7A 2PAMA 3E5UA 1LGCA 1YFYA 1PGW1 3IWZA 4XTPA 2ZZJA 4AHWA 5LEJA 3HT1A 5DZFA 2VY0A 4HKOA 4LBKA 4UBGA 1JBCA