3WP4A

The crystal structure of native cdbfv from neocallimastix patriciarum
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
228
structure length
228
Chain Sequence
AEFQSFCSSASHSGQSVKVTGNKVGTIGGVGYELWADSGNNSATFYSDGSFSCTFQNAGDYLCRSGLSFDSTKTPSQIGRMKADFKLVKQNSSNVGYSYVGVYGWTRSPLVEYYIVDNWLSPFPPGDWVGNKKHGSFTIDGAQYTVYENTRTGPSIDGDTTFNQYFSIRQQARDCGTIDISAHFDQWEKLGMTMGKLHEAKVLGEAGNVNGGASGTADFPYAKVYIGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CDBFV
publication title Structural Analysis of a Glycoside Hydrolase Family 11 Xylanase from Neocallimastix patriciarum: Insights into the Molecular Basis of a Thermophilic Enzyme
doi rcsb
source organism Neocallimastix patriciarum
molecule tags Hydrolase
total genus 62
structure length 228
sequence length 228
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wp4A00
4S2GA 2JEMA 3WP4A 3VHNA 4H7MA 1BVVA 2VG9A 3MFAA 1H1AA 1TE1B 1NLRA 2DCKA 2D98A 2BVVA 2B46X 2DCJA 3VZOA 3VZNA 1HV1A 2D97A 1KS4A 3VGIA 3VZKA 3VL9A 1H8VA 2B42B 2VGDA 3AKTA 4XQWA 3VZMA 3VLBB 3WQ7A 4HKLA 3AMMA 3MFCA 2VUJA 2JENA 1XXNA 3MF9A 4NPRA 3WR0A 3AMPA 3B7MA 1XNBA 2VULA 1UU4A 3AKSA 3WT3A 1HV0A 5K9YA 1OLQA 3WX5A 3B5LB 2BWCA 4HKOA 2QZ3A 3M4FA 1XYOA 3AKRA 3WP3A 4XQ4A 1UKRA 3VHOA 1UU6A 3WXPA 1PVXA 1BCXA 3WQ0A 3RI8A 2B45X 4XPVA 2DCZA 2F6BA 3AKQA 4HK9A 3AKPA 2NQYA 1M4WA 3AMQA 4S2FA 2DFBA 1BK1A 1T6GC 1OLRA 2NLRA 4S2HA 1XNCA 4S2DA 3O7OA 1H4GA 1ENXA 3VZLA 1REFA 3VHPA 3VL8A 1UU5A 2BWAA 3WY6A 3LGRA 1XNKA 3ZSEA 2Z79A 1C5HA 2JICA 1YNAA 4XQDA 2QZ2A 1XYNA 1REDA 3WQ1A 1H0BA 1REEA 3AMNA 2DFCA 1H4HA 1C5IA 5HXVA 1KS5A 1HIXA 1QH7A 4IXLA 3VZJA 5K7PA 4HKWA 1OA2A 2DCYA 3MF6A 3RI9A 3AMHA 1W2UA 1F5JA 1QH6A 3WP5A 3LB9A 2BW8A 1IGOA 5EJ3A 1OA3A 1OA4A 1AXKA 1XYPA 3EXUA 4HK8A 1XNDA 3HD8B 3WP6A 2C1FA
chains in the Genus database with same CATH superfamily
4WZCA 5AC92 1EUUA 1C8NA 1OPOA 3MLKA 5EQUA 3QH7A 1YYNA 1POV1 5FOJB 1JYWA 2J1SA 4O61A 4ATEA 1TE1B 2GP5A 3TEZA 1OFNA 2ADEA 1ZA4A 4KU7A 5EPAA 5A7NA 2RJ2A 2WDBA 4OMCA 5FO8B 1S0IA 2BVVA 1LEMA 2RM21 5LB6A 4XILA 4DNYA 1S2EA 5C7GA 5JCTA 5I91A 5K0UB 2NPIA 3FUOA 3TN91 3AJZA 4IESA 4Q4W3 4FVVA 4Z2WA 1H2LA 1XU1A 2IWGB 4HLTA 4UW5A 1LB2A 4WVMB 4CEWA 4URAA 1JZ6A 5L7OC 1I6XA 2R042 5CG8A 3JD71 3VDDB 4BQ1A 1W28A 2PA7A 3NJVA 1ZRCA 4ZXKA 2VUJA 2D6KA 2JENA 4NPRA 2CNAA 2D43A 4QB1A 4G9SB 1RUNA 1ASJ3 1N3PA 1W05A 2OXBA 4META 2W46A 4CCLA 4LOSA 2CTVA 1IKQA 2R073 3GM8A 3KV9A 3V64A 4IEXA 5I0SA 2JG8B 5EJ1B 2ZACA 5F9TA 1X8EA 2CV6A 4RGKA 3HNBM 5IVCA 3GJAA 4KWKA 3QCWA 5GZGA 5FP9A 3UESA 3JU9A 2XJTA 5FCCA 5FTTC 2BP6A 2XWJB 3H7JA 5D2AA 4QQPA 3AJYA 4PIXA 1XE0A 2WAOA 2ZX4A 3BVCA 3ITQA 2P34A 1NKGA 1J83A 3B94A 3POFA 4FPYA 3MBWA 1BEV1 1Q56A 4Y26A 2OT7A 2VOVA 3UGGA 1BK1A 1T6GC 4DEVA 1EP0A 5C3SA 4RHV1 3CF6E 4NWVA 5JZGA 1IPJA 4S2HA 4NVPA 3U1XA 2C0ZA 4EWDA 1UZ0A 1SLBA 1SBFA 3ZFFC 5A3NA 2YROA 1AYN2 4HVOA 1STMA 3ABZA 1FPN2 2GMEA 4BXFA 1UU5A 1ZZ6A 2FBEA 1JU3A 4RFT0 4CP9A 1W6MA 4QX2A 2JICA 3M3QA 2V73A 3H1YA 5FRAA 1UYXA 3ASIA 5FLHA 2YU1A 3MUY1 3RYRA 3WQ1A 1GNHA 1C4RA 2A6VA 3I2HA 4R8HA 1AR93 1ENRA 1NQJA 1PMHX 2EIDA 4ZHNA 4NO4A 4ZZ8A 3BUCA 3AP9A 5C71A 1GSLA 4IGQA 3P3NA 4XZPA 3RVHA 1QH7A 1GQHA 1HN1A 2QE3A 5FY7A 2QBXA 5LY1A 1AL0G 5LEJA 2BOIA 4LK7A 4K1YA 3SEEA 1RUC3 3VD3A 5IK4A 3HBKA 3KV5A 5LRRA 2OZ6A 4BQ4A 4YVSA 1UN1A 2HWB2 1QH6A 1U5ZA 1VPHA 2SLIA 1OT5A 3LDRA 2B7YA 4MGSA 4YPJA 4Q4Y1 3MIFA 1POV3 3W20A 1QOOA 3USUA 3RZLA 3MIGA 5IVJA 3RJ2X 5FP8A 1NZIA 4Q4X1 4QDQA 3PNAA 3NJXA 1O8SA 1AUYA 1CWPA 4LBKA 1GWKA 1JW6A 5HV0A 2RM23 3M2MA 4IERA 5L9RA 3VHNA 4H7MA 5GLTA 1MPXA 3WDXA 3WNXA 3TN93 1ZZ7A 1YXWA 2ARAA 4NHXA 3V0BB 1QEXA 3T0BA 1BLZA 3KQ4B 1KDKA 1UZWA 3CJXA 4PQQA 5J3UA 4ATFA 3TEWA 3JD73 3WDWA 3TAYA 2WINB 3IN9A 1O4TA 3HBZA 4HL0A 4PDWB 4XAAA 1PK6C 2Q8EA 3T2OA 4FO9A 2CWSA 3VL9A 4CA9A 4B4RA 4YGDA 4FTSA 3T4HB 4E2SA 2Z2SB 3MFCA 1AXYA 4LOTA 2A7AA 1YFXA 4MGQA 3FBYA 4SLIA 1O3SA 3ZFGC 3TBDA 3VD4A 3VKMA 1VLNA 1C3HA 3MZHA 1CVNA 4IUGA 3SKJE 4GKYA 2C9AA 2ORZA 1QJEA 1U5IA 1XSRA 1O5UA 1VBD1 5LA9A 3C7EA 2WT2A 4UW4A 4HKOA 2R6QA 4X6RB 3SH4A 3A23A 3O1VA 3VBHC 5L73A 1BEV3 2Q8OA 4E2QA 2GDFA 3NAPA 5CKNA 3O1SA 5FPLA 1GZCA 2VECA 1PZ7A 3AKQA 4RHV3 1FT9A 3OD4A 1F4AA 1SPPA 1GP6A 4JVAA 4RS5B 4J25A 3MGUA 3NV3A 2P37A 1S1AA 4A42A 5FUIA 2W92A 3AZVA 1Q8QA 1JBCA 4Q4W2 5JI9A 4L2NA 5LK5A 1YJLA 4JGYC 1B09A 4XAEA 4BQXA 1KGYA 1VBC1 5FZ0A 4AQTA 2CGPA 3LE0A 3RWKX 1O6UA 1IG3A 2EA7A 2D93A 4MXVA 4JQRA 1O7FA 3HN1A 2J1EA 1XNKA 4CUGA 4RYDA 3U10A 2ID4A 1LOBA 2JE9A 2JB4A 5D21A 1J3PA 3WCSA 2SBAA 2ZGKA 2GAUA 5HCBA 3EHKA 4O9EA 1V6MA 1HB4A 2CYFA 1JOBA 5F37A 5KHIA 2G9GA 1C5IA 3PMSA 3RZGA 4K20A 4ONUA 2E7AA 1KS5A 2QKDA 4LULA 1ND2C 5JOWA 3PUAA 5E88A 2AYHA 3G7DA 1W6QA 4JAAA 4UF0A 3V56A 2WT0A 3M3EA 3S7EA 3CL1A 5C3PA 1KXGA 4Q4Y3 1LHOA 1LJ7A 4A7ZA 4D7TA 2V5DA 1MS9A 2PXJA 1AL22 1VAKA 2RV9A 4I01A 4INDA 4LUMA 4Q4X3 4CEWB 1U5XA 5LBEA 5ACA1 4A41A 1XSQA 2ES3A 3IM0A 4NIDA 5F3IA 3VBOA 2HWE1 4XF4A 1BMV2 3DKQA 4BIOA 4B8EA 3IDCB 5E6HA 5SV5A 5EIYB 4UFMA 1WA4A 3EB7A 1X8MA 2Y38A 3VHRA 5KXDA 5G05L 3F95A 1WCUA 4XETA 3AYAA 3C7OA 3THDA 2VQTA 3MFAA 2LTNA 2DCKA 5CZKA 1PO12 1SCSA 2R49A 1YRZA 2WQ4A 1RXGA 1HN0A 1VAMA 1AR92 4Y20A 2FDKA 1Y9GA 1VBE1 3VBUB 3LQCA 2OZJA 3RQ0A 3E6DA 3KHCA 2RS52 2WA4A 1VJ2A 1AX1A 1E57A 3AKTA 3R0RA 5T52A 2PLV1 1GBGA 3OBZA 1HXS1 4CEYA 2W68A 5FOBB 2RDQA 1VBD3 3WR0A 1NZCA 4E9KA 5FUPA 3WOGA 5KXCA 2ZMLA 2UURA 4GB31 1JUIA 3C7GA 2WNOA 3OUHA 3WZ1A 4AFAA 1X9TA 3BPSA 4EQVA 4WVVA 1S4CA 4AZZA 5A3TA 1W6MB 3I2IA 1US3A 4CCJA 2PTMA 2UY8A 3K3NA 5JVVA 1R64A 2W87A 2WO1A 4GQ7A 1UIJA 4QPGC 3VDCA 1Q8VA 2W95A 3ES1A 1H1MA 1GKBA 4DFSA 1OBNA 4ISRA 1FV3A 2VOTA 4MGTA 2B9UA 2ZZJA 3KM5A 3POGA 1W04A 2BV4A 1W8UA 2GC3A 3OGSA 3UKTA 1ZRDA 2UYBA 2YHJA 1FMD1 1VBC3 2PQQA 4IV1A 5IW0A 3PUSA 4WVZA 5C8CC 4P9JA 5C9AA 3RZKA 4DXTA 4JTOA 2VR4A 4LBOA 1MEC2 4Q27A 4QB2A 5L19A 1BJQA 2CGNA 1QY4A 5D8AB 5T5OA 5ABJC 1OKOA 2QQWA 1HQLA 5E1RA 1EPZA 2ZTNA 3OUIA 1SCRA 4CU8A 2HH9A 2PAKA 3WY6A 2WNUA 1CZTA 2XVKA 2W52A 5BNOC 4HOOA 3USUB 3O1UA 1C5HA 2X10A 3WUCA 1YNAA 2BBAA 1N1YA 3PIGA 1VBB2 4KG0A 4TN7A 1WW4A 4CDWC 1DQ1A 4DRVA 1YFWA 2F4PA 2GALA 1XYNA 4WM7C 4UI9L 4N8MA 2R1BA 1AX2A 3S30A 1REEA 5DABA 2ZJCA 4J1XA 1W8TA 3POJA 5JPNB 4B4PA 1QXPA 1W3XA 1H4HA 5DAVA 5APAA 2Y0OA 1UWWA 2XONA 2J22A 2WRAA 1BEV2 2ZS6B 1Q8OA 1DGWA 5ACA3 5FPAA 3BU7A 1CIYA 5FYYA 5H9QA 2HYKA 1XJAA 2VZRA 3AFKA 1HQWA 2HWE3 5FYTA 1MZEA 2CHHA 5GJ6A 3AMHA 3OEBA 4Y22A 3I97A 3MICA 3ZMOA 4CXYA 1MZFA 1SLCA 5F32A 2YGLA 4LITA 1L7LA 3LB9A 1D2SA 3HQRA 1R1ZA 2JIJA 5T5PA 3S5QA 2AGSA 3U11A 4N9IA 2BW8A 4QKFA 1L7QA 3VD7A 4Z07A 4JKLA 4GALA 2FZ1A 1QJX1 5JXGA 3PIJA 1XYPA 4YM3A 1COV3 3IDBB 2DVBA 3ZYRA 3AL6A 4CCDA 2EXHA 3IBMA 1HKDA 3IAQA 3WF4A 2GC0A 1DCSA 2VBPA 4MADA 3T1LA 1VBE3 4NIHA 1F8VA 4YGCA 4W6XA 5FZOA 1NA1A 4GMP0 4XFAA 1NY71 4Q8KA 1WD3A 5EHDA 4F7ZA 1G9BA 1SBEA 4D7YA 1O3TA 5AFBA 2PLV3 3NAPB 1HXS3 1Z0HA 2ZOEB 4KU8A 2MEV1 1CAXA 1Y3TA 5JXHA 1Q8SA 1KS4A 2X5IC 4AK3A 4XJWA 3HR9A 1WLWA 4GB33 3I2OA 1LRHA 1UO9A 1QHDA 1RUD1 4NJ4A 1ULGA 2ZGMA 1G9CA 1G86A 1DDLA 4Q4Y2 3ZN5A 2GNMA 2WQ8A 4BE3A 3FLPA 3PTRB 4LKFA 2XDVA 2MNGA 2EVXA 3GHNA 4D6RA 1NOVA 5IVVA 1DU3D 3SCHA 2Y0IA 3K3OA 3FLTA 4GA9A 4NRQA 4UFHA 5LY2A 4YFWA 1B35A 5TSWA 4WBBA 5IATA 3NV4A 2EIBA 2QQKA 4JZRA 2WNVA 3O14A 3POSA 3QBQA 4I0BA 4XQ4A 1UU6A 1FMD3 5T5JA 4K9SA 2TEPA 3MV11 2G19A 4N43C 1DQ5A 3W5MA 1YJKA 2Q1MA 3DKWA 2A6WA 4OUEA 3SQOA 4D8MA 4AHXA 3AMQA 1QXRA 3GZTB 2V09A 3MLJA 2VU9A 3VBRA 4HN0A 1HB2A 1W6QB 5B4XA 2CDPA 2A6ZA 4MH0E 3LA2A 1F9KA 5FZAA 1NUKA 1YI7A 3GXUA 4PIYA 2GNTA 4L97A 5FMOL 3ZN4A 4A3XA 1ZZ9A 4AHWA 4CUCA 5DMYA 2WQZC 1POQA 3PUQA 2K2SA 1UMIA 1FPN1 4QX0A 1VBD2 5DZEA 3THTA 3UL2A 3VBOB 1CGPA 4AFMA 4U2AA 2XJUA 4M3CE 1J58A 2W1WA 3H1WA 5C6CA 5K0UA 1G9FA 1XPWA 1OH4A 4EWEA 3V65A 2QQMA 2QQIA 3IIAA 4JCKA 2XXZA 3ZXEA 3INAA 4XTPA 1ZM1A 2E33A 2CAVA 4OUSA 2B4KA 4CUAA 5AFEA 3VDDA 2XUEA 1T6BX 5FYIA 4BDVB 2NM1A 2QQUA 2J7MA 4ZXEA 1RJ8A 4R9AA 5A3UA 2J1TA 3TRSB 3Q8AA 3RWNA 3SXWA 1SFPA 4IV3B 4YGBA 3ZN6A 1QJX3 3T2PA 2NN8A 5T3NA 2HWC1 1KJRA 1VBC2 1VBA1 1W2UA 2WA3A 5J7MA 2BEOA 4RD7A 3SHRA 3HIFA 2IZWA 4YG0A 2A6YA 2JG8A 1IGOA 5FR3A 4GJYA 4XFIA 4CCEA 3T1MA 3FL7A 3ZYPA 4AVBA 1WCKA 1WGPA 2FMDA 1LGCA 1GZWA 2WO3A 4CTEA 1AXKA 1Y4WA 3ZFEC 2HEWF 2IUWA 4K8FA 4LO6B 4A6SA 4AHZA 1H6XA 1JUHA 2ZA9A 3ACFA 4QDSA 3HD8B 2W3JA 1DBNA 3U75A 2XKOA 1SLLA 3AC0A 1VMFA 5FY8A 3WW4A 4BQ2A 3AP6A 5BV6A 2MEV3 3OUJA 2D40A 3K4DA 1IZ3A 2QUOA 1NLRA 3ZSJA 4XC9A 2YBKA 1MQTC 2XQRA 4K1ZA 4FP2A 1U12A 2FHRA 4AI3A 2WWSA 4NIIA 3ALQA 1RUD3 2DCJA 4OMDA 4DY5A 3VD9A 3VZNA 2Q1ZB 1QJFA 4L0PA 1UYYA 4GWJA 2ARXA 1RUF1 2XKPA 5LW9A 3VZKA 2I2SA 1PGW2 3SMHA 4LA3A 1V0AA 2QQPA 1BYHA 4P9WA 4IV1B 1HRI2 2V4VA 2Z42A 5C9AB 5KBFA 2VZOA 1ODMA 4AG4A 3AK0A 1GP4A 2ZGOA 3OSDA 3UK9A 5BNNB 4AI1A 5L7OA 2NMOA 1X50A 4EN9B 1R082 4I3GA 4XUNA 4YM1A 1ZRFA 2VMDA 4CDQC 3K48A 4KH9A 3D8CA 1Z7S1 1M06G 4ZZ5A 1W0NA 1LOGA 2WNUB 3I3EA 4JGZA 1YQ6A 2O0OA 1FOD2 3G6JB 3B3QE 3WP3A 4NRMA 3EMRA 2TBVA 4CDXB 3CDZB 3W5NA 5FY5A 5F5QA 1KDMA 1X36A 5E16A 3WXPA 4BK5A 1V6JA 5BPXA 2V5YA 1A8MA 5EYXA 4XUOA 5A7WB 4AOCA 1LTEA 1H6YA 3FMGA 2IXIA 2J1AA 2PQSA 2WO7A 2KR2A 1AX0A 2DWRA 4JX0A 4KMQA 1K5MB 1JYXA 5KHGA 2DFBA 2EAAA 1FPN3 3WHUA 4A7KA 5A6QA 1LEDA 2YPJA 1OH3A 3CZJA 2P2KA 3T0AA 2D3RA 5FY0A 4Y22B 3H8UA 3C3VA 3NNGA 1ST8A 4IGOA 5CNAA 2WABA 1CQ9A 1MS4A 1R091 3N7JA 4M3CB 3DYOA 4RN5A 3H8RA 4OHZA 1TZOA 3V0BA 3DXTA 4RQPB 3VHPA 3ZFFA 2IXLA 3CO2A 4LO7A 2EIGA 3ZYJB 5JSPA 4IEWA 5CG9A 5I0TA 3HT1A 3LIHA 3CKHA 4JDMA 5IVBA 4Y1UA 4XF3A 1JU4A 5FZHA 1I5PA 2R30A 4EWAA 2G4IA 4PDWA 1W2NA 4NHKA 2JG9C 1LESA 1OUXA 2A70A 4TZDA 5CFDC 2W08A 3WNLA 4QXHA 2VZUA 2DBNA 2HWC3 1VBA3 4ORFA 1WZXA 3RSJA 4RL7A 5CADA 4XABA 2VOKA 2OUHA 2B9VA 2GP3A 3ES4A 3VV1A 4EN6B 3ZXLA 4CU6A 1UYPA 3PUHA 4QMAA 4YZ1A 4PI2A 1AL21 1W8WA 4QX3A 4B1LA 5A1AA 4RR3C 5C4WB 1ULCA 4FQZA 4BM8A 1C57A 3ZX7A 3SH5A 4O65A 4CVUA 3HEIA 1OA4A 1OKQA 1HLCA 2PAEA 3AZZA 3HT2A 5HCHA 2FDFA 2XPJA 5FPBA 1GYKA 4CP2A 2VOXA 3N7LA 1SDWA 4XCAA 2JEMA 3D0SA 2YUEA 4FOQA 4JKKA 3RYKA 2VMCA 3WP4A 3OGJA 4RS5A 5EFUA 1B35B 1OC1A 1PO11 3CJIC 1RUG1 1RUF3 1XE7A 3JXSA 3ZIXA 2ZBJA 3ME2A 4JC1A 2WNVB 2YYOA 4NR1A 1IQAA 4OI1A 4ES8A 5CISA 2K0GA 3O0WA 5DAWA 3N4MA 4N53C 1Q3EA 2ZEYA 5IFTA 2RS51 4F83A 2WBKA 4BK4A 4ZY9A 3VBRB 5K8SA 5A32B 3WQ7A 4DIQA 4CDUB 1WBFA 2AREA 3N9QA 1SQ4A 1SLAA 1Z7S3 4O9GA 1QJX2 4P5HA 4QHOA 2KD7A 4WVWA 3MF9A 2ZEWA 3LEGA 1PZ8A 2ZGLA 3VKOA 4AVCA 3B7MA 3OYWA 5GALA 4UBHA 1DZQA 1OI6A 3M1HA 2QQOA 5DPNA 3ZFGA 1ACCA 5K9YA 3U0ZA 2OPKA 4FPGA 2YC0A 3FX3A 1VALA 2VVFA 4OHYA 4KWLA 1NY72 1OF4A 4XW3A 2QZ3A 2UWCA 1QGLA 4CXWA 5HXMA 2HEVF 4COUA 2MEV2 1DQ4A 1LGNA 3CIHA 4Q1RA 4LXLA 4UWDA 4A4AA 5JIUA 3M3OA 2NQYA 1ENQA 3IIIA 3ZXDA 1LU1A 4AQ6A 4FTEA 1J3QA 2XLAA 2P1BA 2R32A 1R093 1W2AX 3P1IA 5FXVA 1RUD2 2VMHA 1MEC1 2GNDA 2QDRA 4XMIA 1DP0A 3WNNA 2BZDA 5CYYA 1EYBA 4ZPIA 4KI5M 5C8WA 1W03A 1PGSA 4H3WA 2I07B 4LKSA 3ZN6B 1VIWB 2ERFA 4Q29A 5EYYA 2BGCA 2VMGA 5T50A 4JGYA 4C8DA 4Q1PA 3ZSLA 3RG0A 1UYZA 3VKNA 2JD9A 1WMEA 1UCXA 2BWAA 3GHMA 1GZWB 1VBB1 2GH8A 2WKKA 3FFQA 4JHZA 1K45A 1TNFA 3CNAA 2RMU2 5F2WA 2P3KA 2WZPP 4QPIC 3ZKYA 3PJQA 5FZ6A 3SITA 3VBUA 1S0GA 4AR2A 4D69A 3ACLA 3ATGA 4XJ8A 1H0BA 4E8CA 2XMLA 5GKAC 3SH3A 4GH4C 1SFYA 4AVSA 3J26N 1UXXX 1APNA 2D5FA 3VBSC 1AL23 2DCTA 1N1SA 4N90A 5HXVA 2VUAA 4FFFA 4TSVA 4P5YA 4I30A 4QDRA 4AHYA 1QJY1 5FBJA 3K2OA 3PTYA 3IDAA 3OPZA 1IS6A 2X09A 4LORA 2C5DA 3O0VA 4ZONA 4CCOA 2DCYA 5BNPC 3OGVA 5JR7B 1LOFC 2RS11 4JTNA 2JDNA 1UOGA 1W6NA 2Y8KA 2Z4FA 2E26A 1RVF1 1Q43A 4LBQD 1N3OA 3NL1A 2EICA 5L7OB 2EXJA 4Q0PA 1PO13 2QJVA 1FXZA 1I5ZA 1YUDA 4HK8A 4IEVA 1RC6A 1XNDA 3J7NA 5K4LA 3T2QA 1YLLA 2QQJA 4BWOA 3GBGA 4A7YA 4S2GA 4H55A 2D6OX 1SFNA 4JGZB 4OUMA 2D44A 4I2OA 3I2FA 4LO8A 2RS53 3DPRC 3KD4A 1H1AA 5ANQA 2A3WA 4E4ZA 1ULEA 2DUQA 2J1RA 3LF7A 1GNYA 4EN8B 3KV6A 2D6LX 3FHIB 1UY2A 5D8AA 3MW2A 2QFEA 3VKLA 3O1TA 1HB1A 2VAUA 1MS1A 1XRUA 2HWC2 1VBA2 2VMEA 4TWTA 5FKBA 4R4XA 5GM0A 2XL9A 3T30A 5IVFA 2ORXA 1H8VA 5I0DA 5DUWA 2VPVA 1KEXA 1LCLA 3WNPA 5I0RA 4YNIA 1LHUA 1XU2A 3I2KA 1DIWA 1V70A 3UYJA 4YVWC 1AF9A 1G8WA 3NQHA 1UY1A 2FCVA 2WZR1 2L9LA 1OLQA 1LOAA 3ZFFB 4XUPA 4QGLA 3JZVA 5DQ0A 1PMJX 1NXMA 3N36A 3RZMA 2WAAA 1VRBA 3NNFA 4LHSA 4TTGA 2JDYA 1UKRA 3CZUA 4LKDA 4M00A 1JS9A 3POEA 3GBFA 4LE3A 4C0HA 1MEC3 4DXZA 2WYSA 1OHFA 1G9DA 3RMXA 1YFYA 4LJHA 1VB2A 1RUF2 3MW4A 4QPGA 2VTFA 5FREA 3RNSA 3M3IA 1WW6A 1W9YA 4S2FA 1OQ1A 1QWRA 5FZ7A 5JXJA 2YB7A 1IS5A 2AC1A 1SG3A 4YLZA 2XJQA 3WF0A 4LLOA 2OKXA 1VBB3 2ZXQA 4DMIA 4S2DA 4YZ4A 3BN6A 2LROA 2VZSA 4M0HA 2ZZQA 4JRLA 4M0NA 4P9LA 1Z7S2 5F5IA 4C1XA 5F39A 3OBRA 4BPZA 1REFA 2JDKA 3EQEA 1BHGA 3JBG2 3AYCA 4YGEA 5JOZA 3K4ZA 3RJRA 4CCCA 2WUHA 1SBDA 1PNFA 2YGMA 3KF3A 3OF1A 4IE7A 4XIOA 2PHLA 5FXXA 5KWRA 4BQ3A 5FAXA 1QJY3 1O8PA 5GZFA 1AVBA 1F2NA 3J8F1 2XOMA 3AMNA 4XACA 1CAVA 2Q30A 2VW2A 2RS13 4HSJA 1RMU2 2W1UA 2E31A 4W6WA 1DGRN 3WG2A 2E9QA 3J7LA 2LW8A 3HOBA 2XJRA 4EZHA 5ERLA 1RVF3 2VD7A 5F8PA 3LZZA 5FPVA 5JXIA 4ASMB 5LK7B 5IHRA 2ZPXA 3BIEA 4KBZA 1R092 1AYM2 4BMBA 4CEWC 4BOWA 5FP3A 1OPMA 3O1PA 1PK6B 4AGVA 4B4QA 1ULDA 1CZSA 4YW3A 1S0FA 3SISA 5GLUA 1H2MA 3CQOA 3URFA 1AZDA 3ZPOA 3LEKA 3C7FA 1OVSA 1WW5A 3MIBA 4BCUA 2CSGA 1BBT2 3OYWB 4W8JA 2B5HA 1JYIA 1W99A 4Z92B 3ZFGB 2HBTA 5LRSA 3NWKA 1WCDJ 2AENA 3F2ZA 5CFCA 3KGZA 1W6PA 1IOAA 4XZUG 4F3JA 1LECA 2ZX0A 5J1XA 1L3JA 3ZSMA 3WNMA 3DECA 1UPIA 1LOCA 3ZXFA 3IDEA 4OZOA 1ZYBA 1O5LA 3NVCA 1PGW1 4CP1A 3SCGA 3VGIA 1HRI1 3WVJA 3WQBA 3Q9OA 3APBA 2Y60A 5EJZB 2VQUA 2XBO2 5JAXA 2X5IA 4HKLA 3RZHA 1BQPA 1TEIA 1YQ5A 2WZR3 3AZWA 5JZGC 2Z69A 4UT5A 1OLMA 4CPBD 1R081 2UYAA 3HWJA 3NKGA 3AMPA 4LUKA 4QQHA 1XNBA 3OY8B 3BALA 4ASLA 3E5UA 4GMP1 3IMNA 2VNOA 4JGYB 4FCAA 1PO21 2Q5TA 1QQP2 2RDSA 4QGMA 1T2XA 2VNRA 3JQXA 3RFRA 1AR82 3C2UA 1FOD1 5IAXA 3W59A 4A45A 4YG6A 1RUG2 1Y43B 5AVAA 4CZSA 2BWCA 1GANA 1FATA 2KA3A 4LBQA 4XDQA 4GKXA 3VHOA 1PMIA 2P3YA 4IV3A 1EY2A 2JDHA 5FDBA 2Q0AA 2DCZA 4LHLA 1JH5A 2W39A 3I59A 3R05A 5FYHA 4BZ4A 4N43A 3VDBA 1YQ8A 3KWVA 5FMCA 2PN5A 4NWWA 2ZEZA 3E1F1 5F2SA 3W58A 2ZAHA 1ND2B 5FZFA 4J6GA 4D94A 3AL5A 2FDGA 3WDYA 1EPWA 4DZGA 1FX5A 3WF3A 3ZLIA 3H7YA 4YVSC 1W6NB 2XLFA 4ISQA 3HQUA 5KR7A 2WT1A 4MXWA 2R061 5BUVA 1BXHA 2RDNA 4E2GA 4H14A 5FZEA 1MS5A 3J8F3 2XQXA 1VE0A 1WA6X 1KQRA 3T4VA 1SHWB 3L9JT 4L9BA 1W2OA 2F4LA 4HANA 1W9TA 2ADDA 5JMOA 4OI0A 4NROA 2VBDA 4AWDA 5IVEA 5ANNA 1PZ9A 3MIDA 2Q1FA 1TG7A 3DL3A 1X82A 3WUDA 2HJIA 3KHBA 3VB9A 4FFIA 2YZ4A 4DPNA 3PMEA 5BNNA 5M0TA 4I09A 3H8OA 4KNCA 1RGSA 4W65A 3VZJA 3I2DA 3MO4A 3KMHA 1K5JA 4AYUA 1MS8A 3A0NA 5GZEA 1H8TC 5JSOA 5EP9A 2XB6C 3BTZA 2BNOA 2HWF1 2D5HA 5CA6A 5FFOC 4YW2A 4EN7B 1ZZ8A 4UFLA 3WP5A 1RJ7A 2ZX1A 1GWMA 4LA2A 1UKGA 4DINB 1LAJA 3MPBA 1U0AA 3WNKA 3QH6A 4CYDA 1CX1A 3OD0A 1D0HA 4QQOA 3WDTA 2GC2A 4CDXA 3EXUA 5J37A 3BODA 2GMPA 4WM8C 4LHNA 4Z8BA 4Q8LA 1MS0A 5JR2A 3ZFEA 5A7WA 2RG4A 1ZRIA 5JOXA 1Y9QA 1PGL2 1WKYA 2B8MA 4QKBA 3CU7A 5EXOA 2VG9A 3ZDVA 1OLME 4FPJA 1UY4A 1CX4A 4P14A 2GC1A 2DVDA 4LO4B 3ENRA 1K5MA 1HRI3 2JX9A 4AEDC 4C0BA 1QJY2 4Y24A 3I49A 5CIRA 1KJLA 1GOHA 3LFMA 5J09A 2B46X 2VCCA 4MYEA 5CKQA 5DG1A 3FE5A 1F35A 2RS12 3O0XA 4M3CA 4QPGB 1ZZCA 1R083 5FQ0B 3BTXA 5KHHA 5C5UA 4AF9A 3OBAA 5FKCA 1FV2A 3RS6A 5GZDA 4GMP3 1RVF2 3BYWA 4RQPA 4XBQA 5DUVA 4I0WB 2BGOA 1HB3A 1PO23 5FZLA 3U4SA 4FFHA 2BVBA 1FOD3 4IDZA 5C8CB 1ZBA1 1H2NA 3Q8BA 2RDRA 1RTVA 3E97A 4QM8A 2YV8A 2JIGA 4YSFA 1VB4A 2VULA 5DDJ1 3PURA 1W9WA 3QOPA 2B39A 4Y1ZA 4FOYA 1ZX5A 2ZMKA 3S57A 2VXJA 2PAMA 1GR3A 4HVRA 2ZMNA 1PX4A 3MIHA 5BNOB 2XWBB 1AJKA 2PHTA 3PUIA 5IUQA 5FYUA 2VBBA 1UL9A 1OQDA 2O8OA 2B45X 2VW1A 3KSCA 4CDWB 2F6BA 2H6CA 2OVUA 4WM7B 1CAVB 5B2GB 1XB9A 5C4WA 3IZOA 1KFUL 2PFWA 3BTAA 5DXDA 4OHWA 5FY1A 1GZTA 3VDAA 2O14A 2R063 4YG3A 1SACA 1V6KA 2DF7A 1CESA 4B7EA 3WNOA 2NLRA 4CRQA 3H9AA 3LEIA 2UU8A 2W94A 3PVBB 4Q4V1 3MUZ1 1D4VB 4XXPA 3V0AB 1W8FA 2QDNA 2WZR2 3GZAA 4HVQA 1LR5A 3WF2A 3VL8A 3H3LA 5F7UA 3P3PA 2VL4A 4LIVA 4E4HA 5FIXA 4YRDA 4DS0A 5CEHA 2VZVA 3ZSEA 4CU7A 2RMU1 5LBCA 1SMVA 3WCRA 4XHBA 3OGRA 3EBRA 2JD4A 5A3WA 2FZ2A 4YFZA 1UZVA 4LT5A 4JDNA 1CD3G 2LUWA 3ACGA 4CPBA 1SLIA 2VZ1A 5FZGA 3DEMA 4XJUA 1AR62 5FZ3A 2UWAA 5CFCB 2VC9A 4XURA 4NE9A 5A32A 1W6PB 2HWF3 4QPWA 2JG9A 4CDUA 2KXLA 2GN7A 4FOWA 5FLJA 4QX7A 1A3KA 3TEXA 1YIPA 4P02B 4MGIE 4NPMA 1AJOA 1UY3A 2PHRA 1S0BA 2W91A 1RHI1 4HKWA 2ZHLA 1GFF2 3AM2A 3OOXA 4Y5SA 3ZKUA 5A6XA 3GCXA 3U4XA 4XFCA 2KM2A 2X5IB 1EAH2 1CAWA 3PVOA 1UPSA 5GLZA 5IWFA 4B29A 3GBWA 2DVAA 4BQ5A 5EJ3A 4RR3A 1ULOA 4ZS2A 1VP6A 3UKVA 4COWA 5FPUA 2Y64A 2WC2A 3S0MA 1CN1A 2WSVA 2Y6HA 5J48A 3WP6A 1GV9A 5C33A 4C91A 1GOFA 3J8F2 3HNYM 3CHXA 2AUYA 4QPYA 1QKQA 4OULA 2XR4A 2FDIA 5FZ1A 1MZ6A 3JCIA 2QNKA 4BHPA 4R4ZA 4ASKA 1XQNA 2ZGTA 5FK7A 4LBQB 5JUVA 1D2QA 1CPNA 2DYCA 3AP5A 3CJIA 3I4IA 2D98A 3LOIA 3ZXKA 1V6IA 2BNNA 3KF5A 1URXA 2ZAAA 3GZUC 4G3YC 3I59B 4MGZE 1MACA 3VBFC 1ZBA3 2A71A 4N43B 4QD2A 4AVTA 5LZ6A 3KT1A 3S7IA 3SEPA 2B42B 1GQGA 3VLBB 1W6OB 1E5IA 2RR12 5FP7A 3FZ3A 4OHXA 5DDJ3 4YARA 4QB6A 1ND3A 3VKFC 1NG0A 1RUOA 5T54A 1NCQC 1WLTA 1NLQA 4PLOA 4PHZA 3ZPYA 2P3IA 2FDHA 3DXUA 4TYSA 4IW3A 3MDPA 4OLLA 4MXWB 4W4ZA 4ES9A 2X8KA 2A3XA 1HV0A 2EXKA 2G1MA 3AP7A 4QXBA 1QOTA 3H1MA 3AB0A 2YDEA 3E5QA 2R1DA 4QHBA 3SKVA 4LBLA 5LEKA 3DUIA 4KBBA 2OYZA 3B93A 2NZ9A 1D7PM 3T09A 1Q8PA 2WO2A 1UX6A 1R1A2 3UGFA 4QT6A 1MVQA 3KVAA 4J1WA 1OOPC 4NHLA 4QAWA 3FN9A 4WZFA 5IJRA 4RGGA 2Y6FA 2O8QA 1GLHA 3LAGA 4FI9A 3GDBA 2LM3A 1OXCA 4HFSA 3LSDA 4Q4V3 3RPQA 4GULA 3UJQA 1KD7A 1O4ZA 2W2IA 2MHFA 3B01A 4CE8A 4AFBA 1S55A 4BQYA 2JXAA 4QKDA 4P9IA 1QJU2 1LENA 3ZO0B 3O1OA 2RMU3 2VNGA 3AFGA 2ENRA 2P17A 1PO22 5LATA 1G7YA 3CEWA 3NKTA 2BJSA 1ENXA 3JBG1 4MSVA 3SCFA 4DOUA 2W5FA 1ZA7A 5FO7B 2C9KA 1PVC2 2YBPA 3GALA 2BDRA 3RYPA 3USSA 4Y4RA 1NAEA 1S0EA 4MGYE 2UY9A 3ZFEB 3BPZA 2BBVA 1C1FA 3KZ4C 3LA7A 4OHVA 4QPIA 5CB7A 3S5AA 5HBAA 1IS3A 2Y33A 4YW6A 1RMU1 1NCRC 2PHUA 4GJZA 4H7LA 4CP0A 4UFKA 4EROA 1NA1C 2WJSA 5F3GA 3H42B 3KT4A 1BK0A 2VW0A 1N1TA 2XGXA 1J59A 2IXKA 4SBVA 1UOBA 2VMIA 5DUXA 1TMF1 2CDOA 4Y4YA 2XG3A 1UNBA 1MQTB 5KXBA 1IHMA 5G04L 5JPMB 1S2BA 4FPHA 2D3SA 2WN2A 1AYM1 4IEYA 2Q8DA 3VUOA 2OA2A 2IFRA 5GZCA 1V9U1 2R062 4KG8A 4LPLA 1W9FA 4YYOA 2WWUA 4URTA 2JB8A 4AI0A 1BBT1 3RMYA 4Z82A 2EF6A 5A3PA 1GUIA 4Q5OA 3R6SA 2DU1A 2ZKLA 4IEQA 2IC1A 1QU0A 1QMJA 3LWCA 5A1LA 1V6OA 2WFPA 3Q8CA 2X53S 4CDQB 5L9VA 2H6BA 4X8PA 3RDIA 3DYMA 5BYNA 2C4XA 4COZA 5DAPA 2VQ0A 1F4HA 1FI2A 3WF1A 4NHYA 2R0FA 2WZEA 4FXGB 3DPRA 4XCBA 2Y6GA 4XEZA 3UKNA 2VM9A 3WLUA 4E4SA 3FHQA 1U5YA 4Z2AA 1LU2A 1QNWA 1VMHA 4XIKA 3I7DA 4Y1YA 5FYVA 1RUH2 1UIKA 5FZ8A 4CU9A 4UYBA 4CUBA 5C3OA 2HWF2 3ZYGA 1HV1A 1RIRA 4FPLA 3ZVXA 1AR72 2XBO1 2RJKA 2BERA 3BGAA 4XQWA 1SLTA 2VGDA 2FQPA 1X33A 2OQ7A 4BH9A 2YFZA 1FNYA 1GQPA 5DZGA 3VD5A 4AW7A 2CL2A 2EXIA 1C8M2 4RA0A 2D6NA 4AE2A 1BVP1 1UAIA 4Y1VA 1JYVA 3K75B 2BFUL 2BUKA 3BOPA 1G6NA 1F31A 1UMHA 3THPA 1QQP1 1X7NA 1QF3A 1UU4A 2W1SA 1AR81 3N7KA 5A6ZA 3H8XA 1JODA 4YVWA 3ELNA 3CLPA 2RJLA 4P00B 3WHTA 1LHVA 2JKBA 4UFIA 2AEYA 2I45A 1JZ3A 1AHSA 4G4FA 3H50A 4OQ8A 1VR3A 1X9PA 3LD8A 3PVEA 2OQ6A 2RS32 2HWD2 4HETA 3H0OA 3SC7X 5K0UC 2ETEA 3B69A 4XPVA 2P4EA 2WS91 3BCWA 1QXJA 2PHWA 5FLIA 3WDVA 3AYEA 2FDJA 1PK6A 4HN1A 4XBNA 2X05A 2C6SA 2JG9B 3VDDC 4CXXA 5CFDB 5F3EA 5F6KA 5DZFA 3PU8A 3JBG3 4W50A 4XDPA 3WINE 3M3CA 1XE8A 1C1LA 1OLRA 1ZBA2 4XUQA 1SEFA 2IXJA 3EO6A 3JQWA 4HBNA 4O7XA 1IS4A 1QDCA 2X29A 2IFWA 2PHXA 4UFJA 3T08A 1YHFA 1ENSA 2ZGNA 2XUMA 5DDJ2 1WCSA 5JIAA 1CAWB 1S0CA 2JG8C 1NE4A 3E6BA 3FWEA 3MW3A 4CCKA 5BNQA 4RR3B 3AZYA 4FFGA 5T55A 1RMU3 2VVDA 4JV4A 1JHJA 4AQ2A 2PELA 5CU1A 3BTYA 3VBHA 1PIV1 5DAXA 3N7MA 1NX9A 4QHZA 4UBGA 2RVAA 3NW4A 3J9SA 5FY9A 2K9ZA 4ZKTB 1KITA 4OVEA 4CSWA 4DY3A 5LCWL 1AYM3 1CJPA 4OCTA 4XFBA 1W06A 3CJIB 1V9U3 2NP0A 5FP4A 2P3JA 3PLQA 3GGLA 3OY8A 1F5FA 1BBT3 4N53B 1NT0A 4Q4V2 2VQAA 2VNVA 1ZBE2 2YFUA 1UOFA 1OQEA 2A3YA 1LHNA 2BTVC 2OX0A 2PYTA 2WSUA 3JUUA 3MEPA 4ARYA 4B7KA 3N3HA 1ND3B 2ARBA 1UD1A 5FZ9A 4IEOA 1YQ2A 2A73B 5LBBA 2E32A 5H9PA 1BKZA 1W8OA 1CR7A 3ZXJA 5F1RA 1CZVA 1PGL1 3KV4A 5FV3A 4HMZA 1DGRA 4QU1A 1WMDA 1QNYA 5EWSA 2Y6KA 4M4PA 2WWJA 1K42A 4JGZC 4DXRA 3J4UH 5I93A 1VAVA 3ZMNA 1RITA 3AXEA 3FLRA 2XBO3 2YU2A 4GIQA 4NIAA 4ARXA 4YZ2A 2WLQA 1ND2A 1KFXL 5A6YA 3CMGA 5CKMA 3AXDA 4JRAA 3P5BA 1DZRA 1RHI2 1H9WA 1EV12 3VZOA 4PIZA 1YI9A 2IVIB 3NO8A 3ZOIA 3LPGA 3ZXAC 1NXD1 5IK7A 5E8AA 2BGPA 5C70A 3GCWA 1QQP3 5JDBA 1AR83 4PF1A 1RUG3 1IKPA 4BISA 3B00A 3GF6A 1HJFA 2VTXJ 2ZGPA 1OMIA 3KGLA 3SNMA 4CEYC 2OS2A 3AP4A 4XMAA 3N35A 4PBPA 4GD4A 3PL0A 5FZ4A 1UW8A 2ZGSA 2OW4A 5CBLA 4D6QA 2TNFA 3ON7A 5C3RA 3WW1A 3NJYA 3K51A 3DCQA 2WS93 1S0JA 4Y5TA 2RE9A 3B5LB 3NNMA 1VRH1 5E89A 2WR9A 2WFF2 1CAUA 3LDBA 2P6HA 1OUSA 4QX1A 4XFFA 1BCXA 1J84A 2HEYF 4Q0UA 4PDWC 3FFZA 1JOPA 2ZCWA 4QPIB 1C28A 5FXZA 2D3PA 1H1IA 1DQ0A 2VXRA 1YFUA 3ORJA 4HPKB 5LA1A 2Q8CA 5D1IA 2OPWA 4GH4B 1IPKA 1W3VA 3K4AA 1RXFA 4V2VA 1UZZA 3VBSB 3UT0A 1DGWX 5LA0A 3OGGA 4OZXA 2O1QA 4W6YA 2IXHA 2WL1A 3ROUA 2BOJA 3LIGA 3Q8EA 4ITCA 4LTAA 3B9IA 1S0DA 4KWUA 1H30A 3LFIA 5BNPB 2W1QA 4QGNA 1PIV3 1WCQA 4KL1A 4K7JA 5KC6A 1NQDA 2CAUA 2WYFA 1DQ6A 4M01A 3IT8A 4JKMA 2JECA 3I3DA 4PQ9A 4XQDA 2ZHNA 4I3PA 3QD6A 4JQTA 5FZMA 2QZ2A 2XJPA 3IPVA 2AACA 1D4M2 1RUJ1 2HYXA 3PDQA 3TWIA 4E8DA 1I1EA 4BXSV 1OF3A 1JYTA 1AR61 2VOWA 4Q2FA 3ETPA 4EN0A 5FQ0A 3FBMA 4RS5C 3NV2A 4XDOA 1BZWA 3O1RA 2BU9A 1NLSA 3EJKA 4XUTA 3DPRB 3LDKA 4XFHA 2JE7A 2JWPA 1RUE1 5C8CA 5GLWA 3HMYA 5HV4A 2VO5A 5JWPA 1POV0 4H2AA 4HG6B 4N9HA 3H3ZA 5GLVA 5CAZA 5J96B 2R7EB 2E51A 5ABJA 1GICA 2CWMA 2GNBA 3HPNA 4V2WA 5JLVA 1H8TA 1F5JA 1WMFA 1EAH1 1W0OA 2G9ZA 2JDUA 3I54A 2AR6A 3AX4A 4AI9A 3FJSA 1RYYA 4MX3A 2CU5A 3AVRA 3UJOA 5BNOA 4MVTA 1OA3A 2TUNA 2ILMA 2DTWA 2IXCA 3LCPA 4XF0A 4CDWA 1LOEA 4NHMA 4WM8A 4WM7A 4BMEA 3D0JA 4YVWB 3DN7A 2JDZA 1PM4A 1BVVA 5A3LA 3T0DA 5FUNA 4XF1A 4FAHA 5FO9B 1ALYA 5FK8A 1MR5A 2H0BA 4EE2A 1RUI2 1TMF2 1O3RA 3A4UA 2XJSA 1G9AA 2HLEA 5DG2A 4K3UA 5FMBA 4AEDA 3POIA 3DF0A 5H9RA 1DYPA 1HJGA 2DDUA 5BXXA 3V0AA 3ECQA 3WV6A 4ZU5A 4EYUA 1V9U2 1WUVA 4IE4A 4UW3A 4XJ9A 2RR11 4MUVA 1UF2C 2VE1A 4FT8A 3HVDA 3OPWA 5A1FA 5C5TA 2FMYA 3N9OA 5A33A 4DUXA 1DLLA 1VRH3 4CCMA 2LALA 1E5RA 3FC0A 4XOGA 4HONA 5A7QA 1JHNA 5IYYA 1PHMA 1W8ZA 2R0HA 3O12A 3TB0A 4IE5A 4OQ9A 2Q4SA 4I0AA 4AGRA 1XYOA 2GZWA 1ASJ2 2ZEXA 3Q8FA 4Q0SA 3KS7A 4FPFA 3VBHB 1R1A1 3VBUC 4DB5A 4FP3A 1DQ2A 2R072 5FZDA 2VUCA 5FWEA 3HJRA 1KRIA 2YY1A 2QQNA 3OG2A 2R16A 1M4WA 3POBA 4MG2A 1GNZA 3C7HA 5FMOS 2XLGA 3L2YA 3R4DB 3AVSA 2DURA 4MHRA 1XNAA 2N7GA 2YC2A 1CONA 1QJU1 2V4AA 4HSLA 1JYNA 2ZHKA 1CPMA 2LS6A 4YZ5A 5KC5A 4PT6A 4OFGA 1RUJ3 5DN2A 3PHMA 3OCPA 3E5XA 3O5SA 1OFSA 1AR63 2XHKA 5DUUA 1PVC1 4GAZA 3TOJA 5BY5A 1O3QA 1W39A 4A3ZA 4MO3M 2ZKNA 4Q0VA 1LGBA 1ULFA 4AQSA 1FAYA 1YO8A 4GXLA 3IB3A 1RUE3 5I8SA 2WS92 3WG4A 2EALA 1DYKA 3OBTA 1XOYA 3I3BA 3NJZA 3DV8A 2NYYA 4GZ9A 1WMXA 3NRUA 5A7SA 1W6OA 4QM9A 1FYUA 1ZREA 4IEUA 4B1MA 1Y9MA 1COV1 1EAH3 2Y6JA 3MI8A 4FPKA 2ZHMA 1UQXA 5D8AC 1OA2A 5FJKA 2D6PA 2DBIA 3RI9A 5IT6A 2D7FA 3R4SA 3ZR5A 2E7TA 2XHNA 4A6OA 1UZYA 4HT1T 5FPZA 3POYA 2A6XA 1RL3A 2BRTA 3LKJA 4AFDA 3BIWE 1PM7A 4L11A 2RHPA 1K12A 2Z5WA 3BB6A 1RUC2 2Y26A 2XJVA 1CJDA 1GOGA 5JZGB 2AEZA 5FXWA 1YCIA 1PIV2 4A44A 4PI0A 2AZ5A 4OI4A 1TME1 1W8NA 2VZ3A 4AAPA 5FYMA 1JOJA 3EYPA 2EAKA 2NMNA 4JDOA 4XJAA 4YW1A 1CAUB 2RR13 4CP9B 1GP5A 3ILRA 3UETA 4LK6A 1ZNPA 1RUH1 5FYZA 3U14A 4AVAA 3WDUA 3U07A 2E6VA 4FTBA 5HI0A 1AR71 2RM22 4HZFA 4DQAA 2OUJA 4ZS3A 1OD3A 2D97A 3ETQA 3TN92 3VBFA 4P9GA 1OURA 2DV9A 3DYPA 1C8M1 1UMZA 4DUVA 1W90A 4LIUA 4QWNA 2YPDA 3JD72 4K40A 3UV9A 4XBLA 2VZQA 2YC4A 4BB3A 1NCQA 1WBLA 4BLIA 3THCA 4NOTA 3VN4A 1R1A3 4YVSB 3WT3A 4DRRA 3I2JA 5C3QA 3WX5A 3D4KA 3ACIA 4YM2A 1HRV1 1W0PA 1JI6A 1ONAA 4NPLA 4RGAA 5J98B 4Y1XA 1UOJA 2J1UA 3NAPC 1MQTA 2RS31 2HWD1 3IPVB 3PU3A 1O91A 2ARCA 2IVJA 2VCMA 1HDKA 1Y7BA 1N47A 2FCUA 3A7QA 3RI8A 1K3IA 2PMWB 3JB8A 1QJU3 1V6LA 3RZJA 4NAMA 4DXSA 5LWBA 4D0QA 1E5SA 4ET7A 1OOPA 5IVYA 3I8TA 4D3WA 4EJRA 3QACA 3LA3A 5L9BA 4QX5A 3A21A 3I3QA 2A1XA 1F15A 3MYXA 1PVC3 2W47A 3W21A 3ZYHA 1JN2P 1SZBA 3E6CC 4OYUA 4RHV2 5ABJB 1MS3A 2VUDA 4COVA 2PHFA 1H8TB 3J7HA 1GU3A 4IEZA 4FPEA 3MPPG 4KGGA 4QX8A 3WG3A 4CDQA 2MPFA 4XE9A 4A2UA 2VZTA 5KHKA 4XVHA 1VRH2 1WD4A 2J1VA 4R9DA 3W9AA 3ACHA 4DEQA 4NIGA 5LBFA 3IMMA 1JZ4A 3TEYA 4FAGA 4WM8B 5FBZA 2GMMA 1IPSA 3C8XA 1W9SA 3FHAA 3BOWA 4PBOA 5AC91 2DFCA 5CFCC 1OVPA 3IKWA 5LA2A 4PLNA 1UY0A 4BA6A 1YIFA 3PVNA 1NCRA 4IXLA 5L36A 2E53A 2YMZA 1XNTA 4BJ0A 4KQ7A 4GWMA 1JXNA 4AEDB 5HCAA 1W8HA 1H2KA 2P6CA 3WW2A 1ZBE1 4E4DX 1FNZA 3M7AA 5IFPA 5B4NA 5FY4A 1N1VA 5I0UA 3VBOC 2QQLA 3T2TA 1QDOA 1SPPB 2JE8A 2BFUS 2C26A 2VTXA 4D6SA 1TME3 4BLJA 2R041 1DLCA 1QOSA 2XL7A 4KGQA 5FZCA 1WLDA 5A33B 3ILNA 2W9XA 3KB5A 1RUJ2 3BKZA 3DGTA 1J1TA 3CBNA 2C1FA 3D82A 3J7MA 4Q4X2 2BYVE 5LASA 1LKNA 2VCBA 1RUH3 1YEWA 3IWZA 2VVEA 2ZGRA 1AR73 4RSUA 3I3MA 1TVGA 5F6LB 5CFDA 3GJBA 1YQCA 4MV2A 1DF0A 4MZUA 4NAOA 3N9MA 3WSOA 1RUE2 3B02A 4IV3C 3OPTA 1JTZX 4XFGA 1C8M3 4QXCA 1EV11 4AEMA 4YWAA 5A70A 2VZPA 2OIIA 3JB4C 2GH2A 4XXAA 2VCAA 2DVFA 2HBUA 2BPA2 2VY0A 3VZMA 1HQNA 1A78A 3NNLA 2ATFA 2WNEA 4N7UA 1HRV3 3OEAA 4UF0B 4K6BA 3KQRA 1WW7A 4KWJA 1HW5A 2XVLA 4BIFA 3ILFA 2JJ6A 2HWD3 1D0GA 1J3RA 1L7RA 2QCSB 2RS33 3BU0A 1AYN1 1CIWA 5KHJA 1AXZA 5HCFA 3O1MA 5CVRA 4DO0A 2WFF1 4D7SA 3KCXA 2DU0A 5IK8A 3ZDSA 3HAGA 1IG0A 2JDMA 1P8JA 2F17A 4Q0QA 4IEPA 5FWJA 4JHTA 4N53A 2E7QA 5JSRA 2FD8A 1DYOA 1JMUB 2ZX3A 3MV01 1TQ5A 4IV1C 3U37A 5IK5A 5C9AC 1H9PA 4OI2A 1Z78A 3ZR6A 4LNVA 4WVMA 5BNNC 3UNPA 4WV8A 1ODNA 2QTWB 1ZVFA 3TNPB 4IETA 4L8QA 2XVGA 1DGLA 5HPOA 3KCYA 4Y20B 4XTMA 4TLGA 3QLQA 1XNCA 2VH9A 5H9SA 4BYYA 4TXWA 1US2A 3NV1A 1H4GA 2GN3A 3O7OA 3WEZA 5FPXA 2HWB1 2JDAA 4GWNA 2WNUC 2Y34A 3VZLA 4AVVA 4IE6A 4FSJA 3K46A 1W2TA 2GU9A 5DAQA 3N9LA 3HN3A 4IE0A 2DUOA 2WZ8A 3KT7A 4CEYB 4CDXC 3MLLA 4LE4A 5AC93 1QIQA 2Z79A 2QQVA 3FUQA 1D4M1 2GSYA 3LPFA 3M8LA 1A8DA 3NNJA 5FZIA 5J36A 4R9CA 4B3NA 4LBMA 5I8TA 4L92A 3GNEA 2K46A 4Q26A 3NSTA 4YW5A 2DTYA 4F8AA 4PF5A 3N9PA 1IQDC 1EUTA 1PNGA 1ZBE3 3A22A 1K5MC 5JI7A 3HQXA 4LHKA 1ZZBA 1UXZA 5FZKA 3WQ0A 4AEKA 2ZX2A 4Y33A 4EZ4A 4AL9A 1N3QA 2R043 3OJBA 5K7PA 1JZ7A 1J1LA 5EZWA 4FOVA 1I9RA 2XH6A 1DG6A 3ZM8A 4AFCA 4TLFA 1DZTA 2AH2A 3VBFB 4RQPC 4QXKA 4YM0A 3GZEA 2VJXA 3LSEA 4LBNA 4E27A 4MGKE 4LBJA 5ACA2 3RGBA 5IAVA 3U78A 1OSGA 3WD5A 1XBFA 2WLPA 4K8RB 2HWE2 5F5AA 4EV0A 1NCQB 1HX6A 2JDPA 2LRPA 3ZYBA 1WLCA 4YZ3A 3UGHA 1RHI3 1EV13 3RZZA 4MLOA 4X6QB 3WW3A 4HPKA 3T3YA 5T5LA 5JOYA 4GH4A 5A7OA 1XC6A 1A6CA 5KXEA 1RUI1 3VBSA 1ULPA 3POWA 4LLFA 4AAXA 4L99A 1COV2 3TYJA 1S2KA 4HXCA 1QJZA 4XYXA 3AYDA 4BQWA 2P5BA 5A80A 1V00A 5A3MA 4GWIA 3NMBA 2FCTA 4R52A 1MVEA 3M70A 3D3AA 2UWBA 4LQRA 5BNPA 1VBE2 1LOFA 3OB8A 4Z1VA 5C4WC 5FYSA 4AI8A 4COYA 1OOPB 3A0KA 4V1PA 1JZ8A 3N9NA 2DVGA 4UAPA 3AMMA 4XJZA 2ZABA 1AYN3 2PLV2 1HXS2 2H0VA 4QQLA 5F5CA 1XXNA 2CGOA 4X8NA 4M4RA 5ISLA 2JKXA 4Q4W1 2WFF3 3BI3A 3I2GA 4FBFA 1TME2 3R4UA 4GB32 3AKSA 1B35C 2HKXA 4PJYA 4YW4A 2YXSA 3ZIWA 1GMMA 4LR4A 2WNVC 4UXAA 3D5OA 1ZRRA 4AXOA 4QU2A 3PJYA 1ASJ1 2ZGQA 3M4FA 3AKRA 3ZYFA 1LNSA 3TNQA 4IL7A 2R071 4LO5B 1E5HA 1PVXA 1JYCA 1UX7A 2DUPA 2Y6LA 3X29B 3ZYIB 3LEMA 1YC61 1O4YA 2G9FA 4R9BA 5FMDA 4HK9A 3K77A 3P6BA 4ZU7A 4PCRA 3AKPA 3VBRC 2I74A 2WIIB 4P9YA 3MHZA 4C1WA 3GYDA 3ZSKA 4CDUC 1WWYA 4NN0A 1NE6A 1NCRB 2BNMA 4K21A 4MOAA 5FZOB 2HWB3 4ZU4A 1NA1B 4IGPA 1FMD2 1LULA 4LMFA 3ST7A 4DUWA 1I3HA 5JMCA 2QVSB 3WG1A 4IQPA 1CAXB 1O59A 4QQ2A 1D4M3 2VMFA 3KVBA 1PX3A 4FQ4A 4AI2A 2A75A 4P9XA 3LOBA 4C90A 2CY6A 1HRV2 2ET7A 1OD5A 1GWLA 4Y3OA 1DFQA 2ET1A 3IAPA 3LGRA 1BMV1 2A5ZA 3MIEA 2EIEA 4FPOB 1TNRA 3L2HA 4LEJA 4PLMA 5FJHA 5FZBA 1RB8G 4LKEA 4YW7A 1REDA 1NYWA 3ZXGA 4XF9A 2C24A 3SLIA 3KCCA 4XHXA 1Q5OA 4U36A 1LODA 2YG0A 3B9CA 1VMJA 4I02A 5FYCA 4UOJA 4NUBA 5A7PA 4RFRB 1HIXA 2D6MA 4NMIA 1JZ5A 5I8YA 5FYBA 1MZ5A 5AVPA 2J42A 1AR91 4Y5Z0 3OTFA 4N7IA 2V72A 3AZXA 3MF6A 4NRPA 1RINA 3HNMA 3S6PA 1A34A 2BQPA 2YBSA 4AGGA 3RRDA 4AEJA 4BU2A 2E63A 5SV8A 4CCNA 1LHWA 2W0XA 4FPCA 1ND3C 3KLSA 4MHUA 4P08A 5EV7A 1RUC1 2PHDA 1JZ2A 4UW6A 5A3OA 1SDDB 3D6EA 1GZ9A 1YWKA 4FXKB 5F3CA 1RUI3 4QKNA 1V6NA 1TMF3 4M3CF 2ZGUA 1DHKB 2WN3A 3H3UA
chains in the Genus database with same CATH topology
4WZCA 5AC92 1OPOA 1C8NA 3MLKA 5FOJB 3QH7A 1YYNA 1POV1 4ATEA 1TE1B 1OFNA 1ZA4A 4KU7A 5FO8B 1S0IA 2BVVA 1LEMA 2RM21 4XILA 4DNYA 5JCTA 5I91A 5K0UB 2NPIA 3FUOA 3TN91 3AJZA 4IESA 4Q4W3 4FVVA 4Z2WA 1H2LA 1XU1A 2IWGB 4HLTA 4UW5A 1LB2A 4WVMB 4CEWA 5L7OC 1I6XA 2R042 5CG8A 3JD71 3VDDB 4BQ1A 2PA7A 1ZRCA 4ZXKA 2VUJA 2D6KA 2JENA 4NPRA 2CNAA 2D43A 1RUNA 4G9SB 1ASJ3 1N3PA 4META 2CTVA 1IKQA 2R073 3V64A 4IEXA 2JG8B 5F9TA 2ZACA 1X8EA 2CV6A 4KWKA 5GZGA 3QCWA 3JU9A 2XJTA 5FCCA 5FTTC 2XWJB 3H7JA 4QQPA 3AJYA 4PIXA 2ZX4A 2P34A 3B94A 4FPYA 1BEV1 1Q56A 4Y26A 2VOVA 1BK1A 1T6GC 1EP0A 4RHV1 3CF6E 4NWVA 5JZGA 1IPJA 4S2HA 4NVPA 2C0ZA 4EWDA 1SLBA 1SBFA 3ZFFC 2YROA 1AYN2 4HVOA 1FPN2 2GMEA 1UU5A 1ZZ6A 2FBEA 4RFT0 1W6MA 2JICA 3M3QA 2V73A 3H1YA 5FRAA 3ASIA 5FLHA 3RYRA 3WQ1A 1GNHA 1C4RA 2A6VA 4R8HA 1AR93 1ENRA 1NQJA 4NO4A 3AP9A 1GSLA 4XZPA 3P3NA 1QH7A 1GQHA 2QE3A 5LEJA 1AL0G 4K1YA 1RUC3 5IK4A 5LRRA 2OZ6A 4YVSA 1UN1A 2HWB2 1QH6A 1U5ZA 2SLIA 2B7YA 4Q4Y1 3MIFA 1POV3 1QOOA 3USUA 3MIGA 3RJ2X 4Q4X1 3PNAA 1AUYA 4LBKA 1JW6A 2RM23 3M2MA 4IERA 3VHNA 4H7MA 5GLTA 3WDXA 3WNXA 3TN93 1ZZ7A 1YXWA 3V0BB 1KDKA 3CJXA 5J3UA 4ATFA 3JD73 3WDWA 3TAYA 2WINB 3IN9A 1O4TA 3HBZA 4HL0A 4PDWB 1PK6C 3VL9A 4FO9A 2CWSA 4B4RA 4YGDA 4E2SA 2Z2SB 3MFCA 1AXYA 2A7AA 1YFXA 1O3SA 3FBYA 4SLIA 3ZFGC 3TBDA 3VKMA 1VLNA 1C3HA 3MZHA 1CVNA 4GKYA 2C9AA 1U5IA 1O5UA 1VBD1 2WT2A 4UW4A 4HKOA 2R6QA 4X6RB 3SH4A 3VBHC 5L73A 1BEV3 2Q8OA 4E2QA 2GDFA 3NAPA 1GZCA 2VECA 1PZ7A 3AKQA 4RHV3 1FT9A 3OD4A 4JVAA 4RS5B 3MGUA 3NV3A 2P37A 1S1AA 3AZVA 1Q8QA 1JBCA 4Q4W2 5JI9A 4L2NA 5LK5A 1YJLA 4JGYC 1B09A 1VBC1 4AQTA 2CGPA 2EA7A 2D93A 4MXVA 4JQRA 1O7FA 3HN1A 1XNKA 3U10A 1LOBA 2JE9A 1J3PA 3WCSA 2SBAA 2ZGKA 2GAUA 5HCBA 3EHKA 4O9EA 1V6MA 2CYFA 5KHIA 1C5IA 2G9GA 3PMSA 4K20A 4ONUA 2E7AA 1KS5A 2QKDA 4LULA 1ND2C 5JOWA 5E88A 2AYHA 3G7DA 1W6QA 4JAAA 3V56A 2WT0A 3M3EA 3S7EA 3CL1A 1KXGA 4Q4Y3 1LHOA 1LJ7A 4A7ZA 4D7TA 1MS9A 4LUMA 1AL22 1VAKA 4I01A 4Q4X3 4INDA 4CEWB 1U5XA 5ACA1 2ES3A 3IM0A 3VBOA 2HWE1 4XF4A 1BMV2 4BIOA 4B8EA 3IDCB 5SV5A 1WA4A 1X8MA 2Y38A 3VHRA 5KXDA 4XETA 3AYAA 3MFAA 2LTNA 2DCKA 1PO12 1SCSA 2R49A 1YRZA 2WQ4A 1VAMA 1AR92 4Y20A 1VBE1 3VBUB 2OZJA 3RQ0A 3E6DA 2RS52 2WA4A 1VJ2A 1AX1A 1E57A 3AKTA 3R0RA 5T52A 2PLV1 1GBGA 4CEYA 1HXS1 2W68A 5FOBB 1VBD3 3WR0A 1NZCA 4E9KA 3WOGA 2ZMLA 2UURA 4GB31 1JUIA 3WZ1A 4AFAA 4WVVA 1W6MB 2PTMA 2UY8A 5JVVA 4GQ7A 4QPGC 1UIJA 1Q8VA 3ES1A 1H1MA 1GKBA 4DFSA 4ISRA 1FV3A 2B9UA 2ZZJA 3KM5A 2GC3A 3UKTA 1ZRDA 2UYBA 2YHJA 1FMD1 1VBC3 2PQQA 4IV1A 4WVZA 5C9AA 5C8CC 4P9JA 4JTOA 4LBOA 1MEC2 4Q27A 5L19A 1BJQA 2CGNA 1QY4A 5D8AB 5T5OA 5ABJC 1HQLA 5E1RA 1EPZA 2ZTNA 1SCRA 2PAKA 3WY6A 2WNUA 5BNOC 2XVKA 2W52A 3USUB 1C5HA 3WUCA 1YNAA 1N1YA 1VBB2 4KG0A 4CDWC 1WW4A 4DRVA 1DQ1A 1YFWA 2F4PA 2GALA 1XYNA 4WM7C 2R1BA 1AX2A 3S30A 1REEA 2ZJCA 4J1XA 5JPNB 4B4PA 1QXPA 1H4HA 2Y0OA 1BEV2 2ZS6B 1Q8OA 1DGWA 5ACA3 3BU7A 5H9QA 2HYKA 3AFKA 1HQWA 2HWE3 1MZEA 5GJ6A 3AMHA 4Y22A 3MICA 3ZMOA 1MZFA 1SLCA 2YGLA 3LB9A 1D2SA 1R1ZA 5T5PA 3U11A 2AGSA 4N9IA 2BW8A 4Z07A 4GALA 2FZ1A 1QJX1 1XYPA 1COV3 3IDBB 2DVBA 3ZYRA 2EXHA 3IBMA 1HKDA 2GC0A 3T1LA 1F8VA 1VBE3 4YGCA 4W6XA 1NA1A 4GMP0 4XFAA 1NY71 4Q8KA 1WD3A 4F7ZA 1G9BA 1SBEA 4D7YA 1O3TA 5AFBA 2PLV3 3NAPB 1HXS3 1Z0HA 2ZOEB 4KU8A 2MEV1 1CAXA 1Y3TA 1Q8SA 1KS4A 2X5IC 4AK3A 4XJWA 3HR9A 1WLWA 4GB33 1LRHA 1QHDA 1RUD1 1G9CA 1ULGA 2ZGMA 1G86A 1DDLA 4Q4Y2 3ZN5A 2GNMA 4BE3A 3FLPA 3GHNA 2MNGA 2EVXA 1NOVA 1DU3D 3SCHA 2Y0IA 4GA9A 3FLTA 4YFWA 1B35A 5TSWA 4WBBA 3NV4A 2WNVA 3O14A 3POSA 3QBQA 4I0BA 4XQ4A 1UU6A 1FMD3 5T5JA 4K9SA 2TEPA 4N43C 1DQ5A 1YJKA 2Q1MA 3DKWA 2A6WA 4AHXA 3AMQA 1QXRA 3GZTB 2V09A 3MLJA 2VU9A 3VBRA 4HN0A 1W6QB 2A6ZA 4MH0E 3LA2A 1F9KA 1YI7A 4PIYA 2GNTA 4L97A 5FMOL 3ZN4A 4A3XA 1ZZ9A 4AHWA 2WQZC 2K2SA 1FPN1 1VBD2 5DZEA 3THTA 3UL2A 3VBOB 1CGPA 4AFMA 4U2AA 2XJUA 4M3CE 1J58A 3H1WA 5C6CA 5K0UA 1G9FA 4EWEA 3V65A 3IIAA 4JCKA 3ZXEA 3INAA 4XTPA 1ZM1A 2CAVA 4OUSA 5AFEA 3VDDA 2NM1A 1RJ8A 4R9AA 3TRSB 3SXWA 3RWNA 4IV3B 4YGBA 3ZN6A 1QJX3 2NN8A 5T3NA 2HWC1 1KJRA 1VBC2 1VBA1 1W2UA 2WA3A 5J7MA 2BEOA 4RD7A 3SHRA 3HIFA 2IZWA 4YG0A 2A6YA 2JG8A 1IGOA 4XFIA 3T1MA 3ZYPA 4AVBA 1WCKA 1WGPA 2FMDA 1LGCA 1GZWA 4CTEA 5I0SA 1AXKA 3ZFEC 4AHZA 2HEWF 4K8FA 4LO6B 1JUHA 2ZA9A 3HD8B 1DBNA 2XKOA 1SLLA 3WW4A 5BV6A 3AP6A 2MEV3 2D40A 1IZ3A 2QUOA 1NLRA 3ZSJA 1MQTC 4K1ZA 4FP2A 1U12A 2FHRA 4AI3A 2WWSA 3ALQA 1RUD3 2DCJA 4DY5A 3VZNA 2Q1ZB 2ARXA 1RUF1 2XKPA 3VZKA 2I2SA 1PGW2 3SMHA 4LA3A 2QQPA 1BYHA 4P9WA 4IV1B 1HRI2 2Z42A 5C9AB 5KBFA 4AG4A 3AK0A 3UK9A 2ZGOA 5BNNB 5L7OA 4AI1A 2NMOA 1X50A 4EN9B 1R082 4I3GA 4YM1A 1ZRFA 4CDQC 3K48A 4KH9A 3D8CA 1Z7S1 1M06G 1LOGA 2WNUB 4JGZA 2O0OA 1FOD2 3G6JB 3B3QE 3WP3A 4CDXB 2TBVA 3WXPA 5F5QA 1KDMA 1X36A 5E16A 1V6JA 5BPXA 2V5YA 1A8MA 5EYXA 1LTEA 3FMGA 2IXIA 1AX0A 2DWRA 1K5MB 5KHGA 2DFBA 2EAAA 1FPN3 3WHUA 4A7KA 1LEDA 2YPJA 2P2KA 2D3RA 4Y22B 3H8UA 3C3VA 5CNAA 3N7JA 1CQ9A 1MS4A 1R091 4M3CB 4OHZA 3V0BA 3ZFFA 4RQPB 3VHPA 2IXLA 3CO2A 4LO7A 2EIGA 3ZYJB 5JSPA 4IEWA 5CG9A 5I0TA 3HT1A 4JDMA 4Y1UA 4XF3A 2R30A 4EWAA 2G4IA 4PDWA 4NHKA 2JG9C 1LESA 2A70A 4TZDA 5CFDC 2W08A 2HWC3 1VBA3 4ORFA 3RSJA 4RL7A 5CADA 2VOKA 2OUHA 3ES4A 3VV1A 4EN6B 3ZXLA 4QMAA 4YZ1A 1AL21 4RR3C 5C4WB 1ULCA 4FQZA 4BM8A 1C57A 3ZX7A 3SH5A 1OA4A 1OKQA 1HLCA 2PAEA 3AZZA 3HT2A 2XPJA 1GYKA 4CP2A 2VOXA 3N7LA 1SDWA 2JEMA 3D0SA 2YUEA 4FOQA 3RYKA 3WP4A 3OGJA 4RS5A 5EFUA 1B35B 1PO11 3CJIC 1RUG1 1RUF3 1XE7A 3ZIXA 4YM3A 2ZBJA 3ME2A 4JC1A 2WNVB 2YYOA 4NR1A 1IQAA 4OI1A 4ES8A 2K0GA 3O0WA 3N4MA 4N53C 1Q3EA 2RS51 4F83A 3VBRB 5K8SA 5A32B 3WQ7A 4CDUB 1WBFA 2AREA 1SQ4A 1SLAA 1Z7S3 4O9GA 1QJX2 4P5HA 4WVWA 3MF9A 1PZ8A 2ZGLA 3VKOA 4AVCA 3B7MA 3OYWA 5GALA 4UBHA 1DZQA 1OI6A 3M1HA 3ZFGA 5K9YA 3U0ZA 2OPKA 4FPGA 2YC0A 3FX3A 1VALA 2VVFA 4OHYA 4KWLA 1NY72 4XW3A 2QZ3A 2UWCA 1QGLA 2HEVF 4COUA 2MEV2 1DQ4A 1LGNA 4Q1RA 5JIUA 3M3OA 2NQYA 1ENQA 3ZXDA 1LU1A 4AQ6A 4FTEA 1J3QA 2XLAA 2R32A 1R093 1RUD2 2VMHA 1MEC1 2GNDA 2QDRA 4XMIA 1EYBA 5C8WA 1PGSA 4H3WA 2I07B 3ZN6B 1VIWB 2ERFA 4Q29A 5EYYA 2BGCA 2VMGA 5T50A 4JGYA 4Q1PA 3ZSLA 3RG0A 3VKNA 1WMEA 1UCXA 2BWAA 3GHMA 1GZWB 1VBB1 2GH8A 2WKKA 3FFQA 1TNFA 3CNAA 2RMU2 2WZPP 2P3KA 4QPIC 3PJQA 3SITA 3VBUA 1S0GA 4D69A 3ACLA 3ATGA 4XJ8A 1H0BA 5GKAC 3SH3A 4GH4C 1SFYA 4AVSA 3J26N 2D5FA 1APNA 3VBSC 1AL23 2DCTA 1N1SA 4N90A 5HXVA 2VUAA 4TSVA 4I30A 4AHYA 1QJY1 3PTYA 3OPZA 1IS6A 2C5DA 3O0VA 2DCYA 5BNPC 5JR7B 1LOFC 2RS11 4JTNA 1W6NA 1RVF1 1Q43A 4LBQD 1N3OA 3NL1A 5L7OB 2EXJA 4Q0PA 1PO13 2QJVA 1FXZA 1I5ZA 1YUDA 4HK8A 4IEVA 1RC6A 1XNDA 1YLLA 4BWOA 3GBGA 4A7YA 4S2GA 4H55A 2D6OX 1SFNA 4JGZB 4OUMA 2D44A 4I2OA 4LO8A 2RS53 3DPRC 3KD4A 1H1AA 2A3WA 4E4ZA 1ULEA 2DUQA 4EN8B 2D6LX 3FHIB 5D8AA 3MW2A 2QFEA 3VKLA 1MS1A 1XRUA 2HWC2 1VBA2 4TWTA 4R4XA 5GM0A 2XL9A 1H8VA 5DUWA 2VPVA 1LCLA 5I0RA 4YNIA 1LHUA 1XU2A 1DIWA 1V70A 4YVWC 1AF9A 1G8WA 2WZR1 1OLQA 1LOAA 3ZFFB 4QGLA 3JZVA 3N36A 1NXMA 1UKRA 4M00A 4C0HA 4LE3A 3GBFA 1MEC3 4DXZA 1G9DA 1OHFA 3RMXA 1YFYA 1VB2A 1RUF2 3MW4A 4QPGA 5FREA 3RNSA 3M3IA 1WW6A 4S2FA 1OQ1A 1QWRA 1IS5A 4YLZA 2XJQA 4LLOA 1VBB3 4DMIA 4S2DA 4YZ4A 4M0HA 2ZZQA 4JRLA 4M0NA 4P9LA 1Z7S2 4C1XA 3OBRA 4BPZA 1REFA 3EQEA 3JBG2 3AYCA 4YGEA 5JOZA 3RJRA 2YGMA 1SBDA 1PNFA 4XIOA 3OF1A 5KWRA 2PHLA 5FAXA 1QJY3 5GZFA 1AVBA 1F2NA 3J8F1 3AMNA 1CAVA 2Q30A 2VW2A 2RS13 4HSJA 1RMU2 4W6WA 1DGRN 3WG2A 2E9QA 2XJRA 1RVF3 3LZZA 5LK7B 4ASMB 2ZPXA 1R092 1AYM2 4BMBA 4CEWC 4BOWA 1OPMA 1PK6B 4AGVA 4B4QA 1ULDA 4YW3A 3SISA 1S0FA 5KXCA 5GLUA 1H2MA 3URFA 1AZDA 1WW5A 3MIBA 4BCUA 1BBT2 3OYWB 2B5HA 1JYIA 4Z92B 3ZFGB 5LRSA 3NWKA 1WCDJ 2AENA 5CFCA 3KGZA 1W6PA 1IOAA 4F3JA 1LECA 2ZX0A 1L3JA 3ZSMA 1UPIA 1LOCA 3ZXFA 3IDEA 1ZYBA 1O5LA 3NVCA 1PGW1 4CP1A 3SCGA 3VGIA 1HRI1 3WVJA 3Q9OA 3APBA 2XBO2 5JAXA 2X5IA 4HKLA 1BQPA 1TEIA 2WZR3 3AZWA 5JZGC 2Z69A 1R081 2UYAA 3HWJA 3NKGA 3AMPA 4LUKA 4QQHA 1XNBA 3OY8B 3BALA 4ASLA 3E5UA 4GMP1 3IMNA 2VNOA 4JGYB 4FCAA 1PO21 2Q5TA 1QQP2 4QGMA 2VNRA 3JQXA 1AR82 3C2UA 1FOD1 3W59A 4YG6A 1RUG2 1Y43B 5AVAA 4CZSA 2BWCA 1GANA 1FATA 2KA3A 4LBQA 4XDQA 4GKXA 3VHOA 1PMIA 4IV3A 1EY2A 5FDBA 2Q0AA 2DCZA 4LHLA 1JH5A 2W39A 3I59A 3R05A 4BZ4A 4N43A 2PN5A 4NWWA 3W58A 2ZAHA 1ND2B 4J6GA 4D94A 3WDYA 1EPWA 4DZGA 1FX5A 3H7YA 4YVSC 1W6NB 2XLFA 4ISQA 2WT1A 4MXWA 2R061 5BUVA 1BXHA 4E2GA 4H14A 1MS5A 3J8F3 1KQRA 3L9JT 4L9BA 4HANA 4OI0A 4AWDA 1PZ9A 3MIDA 3DL3A 4DPNA 3WUDA 1X82A 2HJIA 2YZ4A 5BNNA 3PMEA 4I09A 4KNCA 1RGSA 4W65A 3VZJA 3I2DA 4AYUA 3KMHA 1MS8A 3A0NA 5GZEA 1H8TC 5JSOA 2XB6C 2BNOA 2HWF1 2D5HA 5CA6A 5FFOC 4YW2A 4EN7B 1ZZ8A 3WP5A 1RJ7A 2ZX1A 4LA2A 1UKGA 4DINB 3MPBA 1U0AA 3QH6A 4CYDA 3OD0A 1D0HA 4QQOA 3WDTA 2GC2A 4CDXA 3EXUA 5J37A 3BODA 2GMPA 4WM8C 4LHNA 4Z8BA 4Q8LA 1MS0A 3ZFEA 5JOXA 1Y9QA 1PGL2 2B8MA 3CU7A 5EXOA 2VG9A 4FPJA 1CX4A 4P14A 2GC1A 2DVDA 4LO4B 3ENRA 1K5MA 1HRI3 2JX9A 4AEDC 4C0BA 1QJY2 4Y24A 5CIRA 1KJLA 5J09A 2B46X 4MYEA 5DG1A 3FE5A 2RS12 3O0XA 4M3CA 4QPGB 1ZZCA 1R083 5FQ0B 5KHHA 4AF9A 3RS6A 1FV2A 5GZDA 4GMP3 1RVF2 4RQPA 4XBQA 5DUVA 4I0WB 1PO23 2BVBA 1FOD3 5C8CB 1ZBA1 1H2NA 4QM8A 1RTVA 3E97A 2YV8A 4YSFA 1VB4A 2VULA 5DDJ1 3QOPA 2B39A 4Y1ZA 4FOYA 1ZX5A 2ZMKA 2PAMA 1GR3A 4HVRA 2ZMNA 5BNOB 3MIHA 2XWBB 1AJKA 2PHTA 5IUQA 1UL9A 1OQDA 2O8OA 2B45X 2VW1A 3KSCA 4CDWB 2F6BA 2H6CA 2OVUA 4WM7B 1CAVB 5B2GB 5C4WA 5DXDA 1KFUL 2PFWA 3BTAA 4OHWA 2R063 4YG3A 1SACA 1V6KA 2DF7A 1CESA 4B7EA 2NLRA 4CRQA 3H9AA 2UU8A 3PVBB 4Q4V1 1D4VB 4XXPA 3V0AB 2WZR2 2QDNA 4HVQA 3GZAA 1LR5A 3VL8A 3P3PA 4DS0A 4YRDA 3ZSEA 2RMU1 1SMVA 3WCRA 4XHBA 3EBRA 2JD4A 2FZ2A 4YFZA 4LT5A 4JDNA 1CD3G 2LUWA 1SLIA 4XJUA 1AR62 2UWAA 5CFCB 5A32A 1W6PB 2HWF3 4CDUA 2JG9A 2KXLA 2GN7A 4FOWA 5FLJA 1A3KA 1YIPA 4MGIE 1AJOA 2PHRA 1S0BA 4HKWA 1RHI1 2ZHLA 1GFF2 3AM2A 3U4XA 4XFCA 2KM2A 2X5IB 1EAH2 1CAWA 3PVOA 1UPSA 5GLZA 4CEYC 4B29A 3GBWA 2DVAA 5EJ3A 4RR3A 4COWA 1VP6A 3UKVA 2WC2A 3S0MA 1CN1A 2WSVA 5J48A 3WP6A 1GV9A 5C33A 4C91A 3J8F2 2AUYA 4QPYA 1QKQA 4OULA 1MZ6A 3JCIA 2QNKA 4BHPA 4R4ZA 1XQNA 2ZGTA 4LBQB 1D2QA 1CPNA 2DYCA 3AP5A 3CJIA 3I4IA 2D98A 3LOIA 3ZXKA 1V6IA 2BNNA 4G3YC 1URXA 2ZAAA 3GZUC 3VBFC 3I59B 4MGZE 1MACA 4AVTA 1ZBA3 2A71A 4N43B 4QD2A 3KT1A 3S7IA 2B42B 1GQGA 3VLBB 1W6OB 2RR12 4YARA 3FZ3A 4OHXA 5DDJ3 1ND3A 3VKFC 1NG0A 1RUOA 5T54A 1NCQC 1WLTA 4PLOA 3ZPYA 2P3IA 4TYSA 3MDPA 4OLLA 4MXWB 4ES9A 2X8KA 2A3XA 1HV0A 2EXKA 3AP7A 1QOTA 3H1MA 3AB0A 2YDEA 3E5QA 2R1DA 4QHBA 4LBLA 5LEKA 3DUIA 4KBBA 2OYZA 3B93A 2NZ9A 3WQ0A 1Q8PA 1UX6A 1R1A2 4QT6A 1MVQA 4J1WA 1OOPC 4NHLA 4WZFA 4RGGA 2O8QA 1GLHA 3LAGA 2LM3A 4HFSA 3LSDA 4Q4V3 3RPQA 4GULA 3UJQA 1KD7A 1O4ZA 3B01A 2MHFA 4AFBA 1S55A 2JXAA 4P9IA 1QJU2 1LENA 3ZO0B 2RMU3 2VNGA 3AFGA 2ENRA 2P17A 1PO22 1G7YA 3CEWA 3NKTA 3JBG1 1ENXA 4MSVA 3SCFA 4DOUA 5FO7B 1PVC2 3GALA 3RYPA 3USSA 1S0EA 4MGYE 2UY9A 3ZFEB 3BPZA 2BBVA 1C1FA 3KZ4C 3LA7A 4OHVA 4QPIA 5CB7A 5HBAA 1IS3A 1RMU1 1NCRC 2PHUA 4H7LA 4CP0A 4EROA 1NA1C 2WJSA 3KT4A 2XGXA 2VW0A 1N1TA 1J59A 2IXKA 4SBVA 2VMIA 5DUXA 1TMF1 4Y4YA 2XG3A 1MQTB 5KXBA 1IHMA 5JPMB 1S2BA 4FPHA 2D3SA 4IEYA 1AYM1 3VUOA 2OA2A 2IFRA 5GZCA 1V9U1 2R062 4KG8A 4YYOA 4URTA 4AI0A 1BBT1 3RMYA 4Z82A 2EF6A 3R6SA 2DU1A 2ZKLA 4IEQA 2IC1A 1QU0A 1QMJA 3LWCA 1V6OA 2WFPA 2X53S 4CDQB 2H6BA 4X8PA 3RDIA 5BYNA 4COZA 2VQ0A 1FI2A 2R0FA 4FXGB 3DPRA 4XEZA 3UKNA 3WLUA 4E4SA 1U5YA 1LU2A 1QNWA 4Y1YA 4XIKA 3I7DA 1RUH2 1UIKA 2HWF2 3ZYGA 1HV1A 1RIRA 4FPLA 3ZVXA 1AR72 2XBO1 2RJKA 4XQWA 1SLTA 2VGDA 2FQPA 1X33A 4BH9A 1FNYA 4AW7A 5DZGA 2CL2A 2EXIA 1C8M2 4RA0A 2D6NA 4AE2A 1BVP1 1UAIA 4Y1VA 2BFUL 2BUKA 3BOPA 1G6NA 1F31A 3THPA 1QQP1 1X7NA 1QF3A 1UU4A 3N7KA 1AR81 4YVWA 3ELNA 3CLPA 2RJLA 3WHTA 1LHVA 2JKBA 2I45A 1AHSA 4G4FA 3H50A 1VR3A 4HETA 5K0UC 3PVEA 2RS32 2HWD2 3H0OA 2ETEA 3B69A 4XPVA 2WS91 3BCWA 1QXJA 2PHWA 5FLIA 3WDVA 3AYEA 4HN1A 1PK6A 4XBNA 2JG9B 3VDDC 5CFDB 5F6KA 5DZFA 3JBG3 3WINE 3M3CA 1XE8A 1C1LA 1OLRA 1ZBA2 1SEFA 2IXJA 3EO6A 3JQWA 4HBNA 1IS4A 1QDCA 2X29A 2IFWA 2PHXA 1YHFA 1ENSA 2ZGNA 2XUMA 5DDJ2 1WCSA 5JIAA 1CAWB 1S0CA 2JG8C 1NE4A 3E6BA 3FWEA 3MW3A 5BNQA 4RR3B 3AZYA 5T55A 1RMU3 2VVDA 4JV4A 4AQ2A 2PELA 5CU1A 3VBHA 1PIV1 3N7MA 4UBGA 3NW4A 3J9SA 2K9ZA 4ZKTB 1KITA 4OVEA 4DY3A 1AYM3 1CJPA 4XFBA 3CJIB 1V9U3 2NP0A 2P3JA 3PLQA 3OY8A 1F5FA 1BBT3 4N53B 4Q4V2 2VQAA 1ZBE2 1OQEA 2A3YA 1LHNA 2BTVC 2PYTA 2WSUA 3MEPA 3JUUA 4B7KA 3N3HA 1ND3B 2ARBA 1UD1A 4IEOA 2A73B 5H9PA 1BKZA 3ZXJA 1CR7A 5F1RA 1PGL1 4HMZA 1DGRA 5EWSA 1WMDA 1QNYA 4JGZC 3J4UH 5I93A 1VAVA 3ZMNA 1RITA 3AXEA 3FLRA 2XBO3 4GIQA 4YZ2A 2WLQA 1ND2A 1KFXL 3AXDA 4JRAA 1DZRA 1RHI2 1H9WA 1EV12 3VZOA 4PIZA 1YI9A 3NO8A 3ZXAC 1NXD1 5IK7A 5E8AA 1QQP3 5JDBA 1AR83 1RUG3 1IKPA 3B00A 3GF6A 2ZGPA 3KGLA 3SNMA 1OMIA 3AP4A 4XMAA 3N35A 4PBPA 1UW8A 2ZGSA 2OW4A 5CBLA 2TNFA 3WW1A 3K51A 2WS93 1S0JA 2RE9A 3B5LB 1VRH1 5E89A 2WFF2 1CAUA 4XFFA 1BCXA 2HEYF 4Q0UA 4PDWC 3FFZA 2ZCWA 4QPIB 1C28A 2D3PA 1H1IA 1DQ0A 2VXRA 1YFUA 4HPKB 5D1IA 4GH4B 1IPKA 1UZZA 3VBSB 1DGWX 3OGGA 4OZXA 2O1QA 4W6YA 2IXHA 2WL1A 3ROUA 4ITCA 4LTAA 3B9IA 1S0DA 1H30A 5BNPB 4QGNA 1PIV3