3WP4A

The crystal structure of native cdbfv from neocallimastix patriciarum
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
228
structure length
228
Chain Sequence
b'AEFQSFCSSASHSGQSVKVTGNKVGTIGGVGYELWADSGNNSATFYSDGSFSCTFQNAGDYLCRSGLSFDSTKTPSQIGRMKADFKLVKQNSSNVGYSYVGVYGWTRSPLVEYYIVDNWLSPFPPGDWVGNKKHGSFTIDGAQYTVYENTRTGPSIDGDTTFNQYFSIRQQARDCGTIDISAHFDQWEKLGMTMGKLHEAKVLGEAGNVNGGASGTADFPYAKVYIGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CDBFV
publication title Structural Analysis of a Glycoside Hydrolase Family 11 Xylanase from Neocallimastix patriciarum: Insights into the Molecular Basis of a Thermophilic Enzyme
doi rcsb
source organism Neocallimastix patriciarum
molecule tags Hydrolase
total genus 62
structure length 228
sequence length 228
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wp4A00
1BCXA 4S2GA 2NLRA 2DCKA 4XPVA 2BWAA 3WXPA 1NLRA 1XNCA 2QZ2A 3AMMA 3WT3A 3VZKA 1UU6A 3WP5A 4S2HA 1BVVA 2B46X 4NPRA 1H4HA 1TE1B 1REEA 1XNDA 1UKRA 4HKOA 3AMHA 3WQ0A 3RI9A 4XQWA 2VULA 2BWCA 2DCJA 1AXKA 3WP4A 4IXLA 3VLBB 2DFBA 2VG9A 3B5LB 3HD8B 3VZOA 2JEMA 4H7MA 1T6GC 1XNKA 1C5IA 3AMQA 4HKLA 1REFA 1H8VA 1H4GA 1ENXA 3MF9A 5K7PA 2BW8A 2NQYA 3ZSEA 1OA2A 3MFAA 2JENA 3WQ1A 5EJ3A 1UU4A 3AMPA 3VL9A 1XXNA 1REDA 2D98A 2F6BA 1YNAA 3VZMA 3VZNA 4S2DA 1BK1A 2QZ3A 4HK9A 4XQDA 3WP3A 2Z79A 2VGDA 1HV0A 3LB9A 3WY6A 1HIXA 1XYPA 3VZLA 4HKWA 3VZJA 1KS4A 1IGOA 3M4FA 2B45X 1KS5A 1HV1A 1PVXA 2C1FA 4HK8A 1H0BA 2BVVA 3RI8A 1QH6A 3AKTA 3WX5A 1QH7A 1XYNA 1OLRA 1W2UA 4XQ4A 3AMNA 2DFCA 3B7MA 3VL8A 1UU5A 1OA3A 3LGRA 3AKSA 2B42B 3AKRA 3VHNA 4S2FA 3MFCA 3MF6A 2DCYA 3O7OA 3VGIA 3WR0A 1M4WA 1XNBA 3VHOA 3AKQA 2VUJA 1XYOA 1H1AA 3VHPA 2DCZA 1C5HA 1OLQA 1OA4A 5K9YA 2JICA 2D97A 3WP6A 1F5JA 3WQ7A 3AKPA 5HXVA 3EXUA
chains in the Genus database with same CATH superfamily
5A3WA 1JXNA 4KWUA 1UOJA 5IAVA 1W2AX 2WS91 4BLJA 2ZCWA 2E32A 5C3PA 1JUHA 1VBD2 4DIQA 1E5IA 3PHMA 4QPWA 1EAH2 2X5IA 5FYHA 3WV6A 4OMCA 2AGSA 4LHNA 4B3NA 4CSWA 1KQRA 3JU9A 4UI9L 4FFIA 4QB1A 2R042 2XBO1 4PF1A 1MACA 4QDSA 1AXYA 3JB8A 5A1FA 1YIFA 3KT1A 1H2LA 4Q5OA 1SFNA 3OUIA 2YG0A 2YU1A 2W3JA 4QGNA 4FPJA 5F6KA 2A73B 2E33A 2IVJA 1NE4A 2WC2A 3GZAA 5LA1A 1AR81 2ZEXA 1QF3A 3VBOC 4BOWA 5FZEA 4NAMA 4LO4B 2CTVA 2RS13 3R4DB 3KQ4B 4FOVA 1G9DA 3T2OA 1KRIA 3EBRA 4QU1A 1ZYBA 2DURA 3B01A 1C8M1 4LNVA 5E88A 1N1YA 2PN5A 3VZOA 1ND2B 5FP7A 5FY5A 1UIKA 2OPWA 3KF5A 2V5DA 1XNKA 1QOTA 2FMYA 1RUJ2 4D6QA 3WNLA 3VDBA 2QUOA 4O61A 5C9AC 3BOPA 1RJ7A 3CLPA 2B7YA 1JYVA 2KR2A 2YXSA 2JENA 1C8M3 5CB7A 5CNAA 2D7FA 2VY0A 3ZFGC 1OVPA 1RTVA 1N47A 1REDA 1NCRC 2KA3A 3VBOA 2GNDA 2I07B 3AL6A 4JGYC 4XHXA 2Y6GA 2WABA 3LAGA 1RUH2 2WWUA 5L7OB 4RSUA 1BYHA 3DF0A 1Q5OA 1DBNA 1OKOA 3BOWA 4JGZB 1BQPA 2CAVA 1SZBA 1O59A 4HKWA 1ZX5A 4OUEA 3LSEA 4K20A 4LUMA 3WG4A 1RUD3 2HWD1 4QKDA 3RSJA 1W39A 2ZX3A 4FPCA 5JPNB 3RZKA 2OVUA 3VDDB 1H1MA 4CEYB 4QB2A 4Q0VA 1Y9QA 4BIOA 1N1TA 2BVVA 2D6KA 3NWKA 3N9PA 1GZWA 3KVBA 2RM21 5C9AA 5EHDA 4A41A 2VCCA 2ZX1A 2C24A 3HEIA 4OCTA 4KWLA 5EIYB 4R8HA 3ZFGA 4P9XA 4WBBA 2DVFA 4QHBA 3T0DA 2V72A 1TVGA 3JXSA 1NCRA 4QX2A 3MF6A 4JGYA 2DCYA 2WQZC 1UY1A 3O1VA 4FQ4A 2NN8A 2K0GA 1LKNA 1R092 1NY71 1XNBA 3P3NA 4XE9A 2EXIA 3OBTA 1AR61 1HKDA 2SLIA 3BIEA 5LW9A 2X5IB 3WEZA 5F3IA 2WRAA 5CFCC 3WQBA 1OD5A 3GHMA 4YW1A 3TN93 1QXJA 1HJGA 3HN1A 4LEJA 4Y26A 1EV12 3D0SA 4Y1YA 4UW6A 5FXXA 3USUA 3ZYBA 2WL1A 4P00B 3ALQA 1AR63 2VTXA 4PQQA 3LD8A 2G4IA 4BK5A 1AYM3 2Z42A 1QKQA 2CWMA 4AI3A 3KV5A 4K9SA 2IUWA 1D4M3 4CTEA 2Q8EA 1T6BX 1ST8A 4OVEA 1QJX3 5AC93 1HXS1 2HJIA 4IGOA 5I93A 3WHTA 1OMIA 2UYBA 4LITA 4XDQA 3E6BA 3IM0A 1NLSA 2FD8A 1V6LA 1QJEA 2A6XA 5CFCA 4ARYA 4XJ9A 1VMFA 2HWC3 2D6PA 3IWZA 5KXDA 2VMEA 1YO8A 4NR1A 2GDFA 4JCKA 1KDMA 1BEV2 3HD8B 1ASJ1 1VBE1 1UYPA 4PQ9A 4R9DA 3KV9A 2WNUC 2WO7A 1RYYA 2VOVA 4MGIE 4WZFA 3CO2A 2XGXA 4X8PA 4MH0E 3C7EA 2RS32 4CVUA 1TMF1 3RYKA 4DEQA 3LA3A 3VBOB 3LEKA 2TEPA 4GMP3 4QXBA 4DO0A 4IW3A 1O91A 1MPXA 2NQYA 1XPWA 2BQPA 2JDMA 2B9VA 4K40A 4YM0A 4DRRA 2AC1A 1TME3 1VBE3 5FCCA 4LIUA 1AL23 1SBEA 4Q0UA 3WLUA 2Y26A 4FBFA 5IT6A 1BJQA 4QPYA 4ZZ8A 4ZHNA 3MPBA 5A3MA 2F6BA 2D98A 3VZMA 2ORZA 1JOPA 2R30A 1GZWB 4CCJA 5C8WA 5C9AB 2R49A 3WP3A 3VBUC 4GH4C 2J1AA 1SEFA 1FMD1 1GNHA 3VZLA 5JI7A 2WNUA 3FUOA 4Y4YA 3T30A 4P14A 1RUG1 2Z4FA 1GKBA 3ZFGB 3ZR6A 4YLZA 5LRRA 4FAHA 3ZLIA 3MGUA 4AL9A 3J8F1 1S55A 1UYXA 2VZSA 2VCAA 4YNIA 1NCRB 1QH6A 1W8NA 5JOZA 4JGYB 1W2UA 2K2SA 4J6GA 2AR6A 2VU9A 3OEAA 4JZRA 3AMNA 4M01A 2XJQA 1FMD3 3N36A 4Q4Y1 1VBB2 4WVWA 5I0RA 4NIDA 1RVF2 3CNAA 1IHMA 3EJKA 5GALA 1EUUA 3FMGA 4E2GA 4QDQA 5IVEA 3RZZA 4NN0A 3SNMA 3M2MA 1WMDA 2ZGUA 3J8F3 4FFFA 3T0BA 4ZS2A 4CZSA 2WS92 3MFCA 2ZGQA 1QNYA 4Y5SA 2WINB 2VNGA 5A1LA 4Z92B 5EP9A 3AK0A 3O7OA 1VE0A 4HT1T 5ANQA 2VZQA 2WJSA 4GH4A 4IV1C 5T3NA 1ACCA 3VBUA 3ZXJA 4PI2A 1W6QA 4COWA 2D6LX 3USUB 1UMIA 3MBWA 4PLOA 2XBO2 1QJY1 2W08A 4MGKE 5BNOC 2GC2A 3RVHA 4DPNA 1N3PA 4YWAA 3EYPA 1ULFA 1PZ7A 1LGCA 3PMEA 1A8MA 1R64A 1QIQA 1OD3A 1SLIA 4IGQA 2BYVE 3VKOA 2PLV2 2P6CA 3V56A 4LO8A 5BUVA 4FSJA 5LA9A 1OQ1A 3E1F1 1AR82 4KBBA 1NLRA 1OI6A 1RC6A 3DGTA 4P9IA 4QHOA 4B7EA 3UJQA 1DGRN 1H6XA 3DXUA 3WDVA 5CFCB 2VTXJ 4TLGA 4XDPA 5KWRA 3ZYPA 3C7FA 4Q2FA 1HB1A 4E4ZA 1XE7A 4FCAA 3NVCA 5C3OA 4AFAA 2EAKA 4TLFA 1DF0A 2CNAA 2I2SA 2YMZA 3HPNA 1YCIA 1XU1A 3AP4A 1XQNA 3HIFA 1JOBA 3R4SA 5J7MA 3LF7A 1CAWA 2XLGA 4K8FA 1GQGA 2J22A 4P9WA 2IXKA 5BNOA 1AR91 1NKGA 1QOOA 1SDWA 4KBZA 5LA0A 5IK7A 3BGAA 1U12A 2GU9A 1W8WA 1O4ZA 2Y0OA 3LQCA 3VD7A 4JC1A 1POQA 4BQWA 5IFPA 4V1PA 3J7NA 1RUI2 5EQUA 1F35A 3DYPA 4M0NA 1O7FA 5DDJ1 5L19A 1GOGA 2JIJA 5JLVA 3LPGA 1F4HA 3LE0A 3N7LA 4CDWC 4EN9B 4GWJA 4PIZA 4QU2A 1AR93 5FZFA 1KGYA 1OFNA 1V6MA 3I7DA 2JWPA 3TWIA 5DUXA 3NKTA 2B39A 4GWNA 1Y7BA 4DXRA 1UXXX 1PX3A 3M3CA 3BCWA 4UFLA 4MGSA 5AVPA 3USSA 2AH2A 3ZXGA 2HWD2 1CZVA 1RUE1 3NJVA 4UXAA 2WNUB 5SV5A 4AAPA 4NAOA 4QQ2A 4RHV3 4ZPIA 3VD9A 2RM22 1H2NA 1JZ4A 2QCSB 4EE2A 1J3RA 3MW4A 4AE2A 2C9AA 2P3IA 3M1HA 4UFMA 2HWE1 4ZU5A 5C70A 4QWNA 5FYIA 2VBBA 5FJKA 1S0IA 1OLME 3ILFA 2X05A 3T0AA 3I4IA 4AVCA 2Q4SA 3GZEA 1R083 1HN1A 1RUE3 4PCRA 1ZA4A 2DF7A 2QVSB 4MYEA 4NPLA 1QY4A 1SLBA 1LOGA 3WCRA 5FMBA 5A6XA 2E7AA 1D0GA 4XZPA 4CDWA 3N3HA 5G04L 2VVFA 4AVAA 1JBCA 4HMZA 4JTNA 2FDHA 1VMHA 4OI1A 3S57A 1WWYA 3W58A 2HWE3 3U11A 3C7HA 5ANNA 5DZFA 3WF2A 1FV2A 5GZDA 1PIV1 4UBGA 3H0OA 2OUHA 4OLLA 5FAXA 3VBUB 2BP6A 4GH4B 3ZYJB 1WMXA 5HCAA 2FCVA 1WCKA 1W6QB 4BQYA 2XJVA 3D5OA 3R05A 4O9GA 3WW2A 4M00A 5DPNA 1KXGA 3RDIA 3LGRA 4CXXA 3NNMA 4JKKA 2ZEWA 3ZO0B 4MGTA 5FYMA 5JR7B 5BNNC 4AI8A 5EFUA 3ZKYA 1GR3A 3POJA 1PIV3 1G9CA 4R9AA 4A7KA 5FZ8A 2D6MA 4MOAA 4CCLA 2E51A 3KS7A 5LCWL 2VUJA 5BYNA 4XUNA 5LEKA 1HB2A 1KITA 4EZHA 1OPMA 5FZ4A 4ZY9A 3GNEA 1H6YA 4GKXA 3RWKX 2HEVF 4LBNA 3WP6A 5HPOA 4NRPA 4Z1VA 1HXS2 2VZOA 2WWSA 4BZ4A 2VOTA 3B94A 4YG3A 3RGBA 1K42A 4FPGA 2ENRA 4N9IA 4Y33A 2DV9A 4WVMA 3GCWA 2IZWA 1H1IA 2EIDA 4XCAA 1GQHA 1CAWB 1MZ5A 2QJVA 4BHPA 3H7YA 1NQDA 4CPBA 1GZCA 5BNOB 5D8AC 1NT0A 4LO5B 5DAVA 1S0DA 1ASJ2 4Q29A 4HSLA 1VBE2 4XHBA 2A3WA 2P3JA 3I8TA 5A3LA 5BNNA 5C4WC 2BERA 4XJZA 4DXSA 4BQXA 4BQ1A 4DOUA 1PK6C 2LALA 5HV4A 1JODA 2PHWA 1TMF2 5I0DA 4H3WA 5T5JA 4GQ7A 1DQ6A 5KR7A 1S2KA 2VULA 1V70A 2JDKA 4I0WB 4GB31 2XWBB 1WCSA 4YM2A 1GP4A 3WVJA 1DP0A 4P9YA 1R1ZA 3SQOA 2JE9A 4NJ4A 3I59A 1ENSA 4XUTA 5A3TA 2J1RA 5JSOA 4HXCA 3POEA 5JZGC 1VBA2 3FE5A 1N1VA 4XF3A 1W3VA 1JYNA 5JSRA 1WLTA 1TG7A 5D8AA 2RS51 4JKLA 4FQZA 4A42A 3OPTA 3ZR5A 2E9QA 3NJYA 3KVAA 4GB33 4YZ3A 2BW8A 5C4WA 3U10A 3VKFC 2NZ9A 4I2OA 1RUG2 2YFUA 1PK6A 5DABA 2P5BA 1HB4A 1DZQA 4HVQA 1Z0HA 2VNVA 4H55A 4P02B 4RGAA 5FK7A 3ZSMA 1R1A2 4CDWB 3RZMA 1NA1C 2RJLA 2Q5TA 2PMWB 2XMLA 2RS53 4FP3A 1SPPA 5FY8A 5J3UA 4QB6A 4Q4Y2 4CRQA 3OUHA 5JSPA 4N8MA 2R041 5DG1A 5FOBB 2A71A 2NM1A 5JZGA 1PHMA 4Q1RA 1RIRA 4Q0PA 3BU0A 3H8XA 1VBD3 1U0AA 1XOYA 1FV3A 2ADEA 2CAUA 4BLIA 2VZTA 2B45X 4C8DA 1WW7A 2C1FA 2OQ6A 5E16A 3URFA 5FP8A 3IAPA 4LMFA 5FZMA 1SBFA 1DQ4A 2R043 4PIYA 4A2UA 5JXHA 3ZN4A 1D2QA 3TBDA 2A5ZA 3MIEA 1O3QA 1RUOA 1QJY2 1DG6A 3ROUA 2GNMA 3JCIA 1X9PA 2J1EA 4FPYA 2ZEYA 4XFBA 1MS5A 4YGCA 3U0ZA 2V09A 5JMOA 4R9BA 1NA1A 5FWEA 2QQVA 4RGKA 2ARAA 2WO2A 3IMNA 1RUJ1 2DUQA 3FN9A 3MICA 4Z2WA 2EXKA 5JWPA 3D0JA 3G6JB 3OG2A 1XNAA 1DQ2A 2VUCA 3IB3A 3POBA 3CU7A 4AI1A 3ZFFC 4BQ4A 3VBSC 3NRUA 1H1AA 4WVMB 1URXA 1C5HA 1IQDC 4GWMA 4CP9A 4D7TA 5C33A 5GLWA 3PDQA 1MS9A 2HEWF 2ET1A 1LU2A 2W1QA 4LBQD 5FZ1A 1RUJ3 2VZVA 1ULPA 5BNNB 2R1DA 3U1XA 3LKJA 1G7YA 4LORA 4FT8A 3RPQA 3SISA 4DXZA 1JOJA 4QQOA 2P37A 4LK6A 2BWAA 2D5FA 1CAVA 4WM8C 4CDQC 5KXEA 1VALA 1W04A 4D6SA 2XHNA 4QPGA 3J7MA 5JOXA 5FFOC 4FPKA 3WP5A 1DGRA 1LGBA 1PVC2 2VOKA 1NXMA 4YW3A 2GAUA 5DDJ2 1MZ6A 3M3IA 2ZHKA 4XIOA 3CIHA 5FRAA 2X29A 3HQRA 3I59B 4XJUA 3ZFFA 5DG2A 3VBSA 2WSUA 5F32A 4C0HA 1PO22 3IDAA 1BXHA 4HKOA 5BY5A 4L0PA 1XSRA 2OX0A 3OOXA 4MXVA 3ZOIA 2GP5A 4GZ9A 1H2KA 3T08A 2GC1A 2GP3A 1QNWA 5D8AB 4MXWA 3ZYIB 2QFEA 2EALA 3KGZA 3VLBB 2Y6KA 5C4WB 2JDAA 1LB2A 3E97A 2VECA 3RRDA 4Y5Z0 1PK6B 2WT1A 1R091 2ZGPA 2LS6A 1SMVA 2WA4A 1W9WA 3EHKA 5A3NA 1H9PA 3MLLA 4WM8A 4CDQA 4BQ3A 4QDRA 1Q8OA 2BTVC 4KMQA 1CZSA 3PUIA 1VR3A 2BGPA 4HKLA 2ARXA 3A21A 4IE4A 1SPPB 4XAEA 1AVBA 4YPJA 2Q8OA 2XKPA 2QQJA 4IUGA 1AJKA 5K4LA 3WSOA 2GALA 1KJLA 2BU9A 5J09A 5F3GA 1R093 3AFGA 5AVAA 1VB2A 4ES8A 5JZGB 2EIEA 3SMHA 1W8TA 4XUOA 3AZVA 3P6BA 4AAXA 2E26A 4UW5A 3HN3A 5F5CA 1CAXA 4JRLA 4MX3A 3VZNA 2DTWA 3CQOA 1LODA 2ZZQA 3PUHA 1YHFA 1EV13 3D8CA 1GZTA 5CG9A 1YQ2A 3SKJE 5IYYA 1ZRRA 3H3UA 4CCKA 2VUDA 3K77A 4PLMA 3VZJA 4EN0A 2XUEA 1XC6A 5T55A 4X6QB 3I2IA 4CUGA 2Q0AA 4HK8A 4KGGA 1WD4A 1NA1B 3LZZA 1LJ7A 3H3ZA 1RUF2 2VZ1A 3AB0A 3T1LA 1OLRA 4AQTA 2X53S 5ABJC 1GV9A 4DS0A 1UL9A 1YI9A 1YUDA 2G9FA 2WT0A 4K3UA 1MQTC 1JI6A 2V73A 4IEZA 4AZZA 1WGPA 1UKGA 1DYPA 2ZMLA 3ACLA 4LXLA 3ZXAC 4CP9B 1I1EA 2ES3A 4A44A 2ETEA 5FZBA 2YGMA 4CA9A 4NHMA 3Q8CA 4OFGA 3BODA 3O1UA 5EYYA 3AZYA 3VHOA 1DDLA 4ASKA 4R52A 2ZEZA 2WNOA 5I8SA 1CAVB 3H1YA 2J7MA 3MIHA 2ZGMA 5GKAC 4CCEA 5L7OA 1JYTA 4CU8A 1OUXA 2RS33 2RDQA 5CU1A 5LEJA 3INAA 1UZVA 4O9EA 3WUDA 5ABJA 2W91A 3IT8A 2GNTA 5KHJA 1X8MA 1MQTA 2R062 3ZFFB 3VBSB 4CEYA 2PAEA 1Q3EA 4NIAA 3N9QA 2Y60A 3WT3A 3S7IA 2IXCA 3BB6A 1UY4A 3ZKUA 4W6WA 1VJ2A 4JVAA 4ZXKA 5I8YA 3B9IA 2VL4A 4XABA 4MXWB 5IK4A 2FDIA 3N9OA 2ZGKA 1ENRA 1W9SA 2L9LA 3CMGA 3MHZA 4EV0A 1UCXA 2WUHA 4I01A 3KM5A 3B3QE 2BFUL 2W9XA 1VBB1 1XU2A 2BNMA 4PIXA 1ZVFA 1RVF1 2Q8DA 2WZEA 4B7KA 4E9KA 4MO3M 3DYMA 3KHBA 4WM8B 5FP9A 2YB7A 4JKMA 1J1LA 4CDQB 3MW2A 4IL7A 1W6MA 3TNQA 5EJZB 3OCPA 2DUOA 4COZA 1FX5A 1VIWB 4LQRA 3VDCA 4D0QA 3JBG1 2E6VA 4INDA 4KL1A 1G86A 1W99A 4WVZA 5F8PA 3MO4A 1Y43B 2O0OA 3DECA 1GFF2 1RGSA 1VBB3 2Y0IA 3ZSLA 5DMYA 1RVF3 1FOD1 2OUJA 3KCCA 3N9NA 1UPSA 2F4PA 1I5PA 5C71A 3LFIA 2BFUS 4D3WA 3T4VA 5CA6A 3DEMA 1CAXB 5EJ1B 4AW7A 5FMDA 2WS93 3JBG3 1MEC1 4LHKA 2JB8A 4OI0A 3MLJA 4DMIA 3WZ1A 2DBIA 2JIGA 4AHXA 2XPJA 1MS8A 2PLV1 3OGSA 2ZX2A 2KXLA 2VMHA 2YUEA 3LFMA 1GSLA 3FBMA 4L9BA 3NJZA 4CCOA 2AEZA 2XBO3 3MIBA 3DL3A 4HLTA 1YNAA 4XTPA 3C7OA 2GMMA 1CJDA 2GZWA 2ZOEB 4CCNA 4QQPA 2GH2A 3GGLA 4AQSA 3EMRA 5BNPC 2PHFA 2RVAA 2PLV3 3GM8A 3LWCA 2UU8A 4FO9A 2AYHA 3E5XA 1AR83 5CVRA 4AF9A 4H14A 5F3EA 3M4FA 4D94A 1PVXA 4OI2A 1US2A 3ACIA 3PL0A 1A8DA 4DUXA 4NIGA 3HR9A 3MLKA 1WLCA 4MSVA 1VLNA 4DNYA 3ZMNA 1RUI1 1V6IA 3AYAA 4FPLA 3PVOA 3UETA 2CDOA 2C9KA 2XG3A 2QQNA 3I2GA 1CR7A 3OB8A 3D4KA 1DQ1A 3PVBB 1ZREA 1HW5A 3RS6A 3TRSB 2A6YA 2C6SA 5ABJB 4MV2A 2BBAA 3QD6A 1YRZA 5BNPA 1RUI3 4F3JA 3AKQA 1LOEA 1O4YA 1MQTB 3IAQA 3Q8BA 4LKSA 4XYXA 2RMU2 1IS3A 4RA0A 4LE4A 2D6OX 2JICA 3WINE 4JRAA 3T4HB 4LHSA 4AFCA 2VOXA 3NW4A 3EXUA 5FPZA 4PF5A 1BCXA 4MGYE 4BU2A 5FY9A 5A6ZA 1AJOA 5L73A 3W59A 1F9KA 4N7IA 4UFIA 4Z8BA 3KLSA 4K1ZA 4XFIA 4EZ4A 1WZXA 4UFKA 4Y24A 1U5XA 2HWD3 3VD5A 1C8NA 4DUVA 1DZRA 1HLCA 2PAMA 2WQ4A 2J42A 4BXFA 4BDVB 2AACA 1WBFA 3VZKA 4AEJA 1CPNA 1YQ6A 1DGWX 2ILMA 3E6DA 2RM23 4FXKB 4KNCA 4MADA 4S2HA 4MLOA 4QKFA 1W6MB 1NCQC 4FOWA 5FPBA 1HRV1 1GWKA 2XJUA 5FYBA 1QDOA 3NL1A 2ERFA 2JDPA 3J7LA 4M3CE 4X8NA 5I0SA 1MS4A 1X33A 4XQWA 4FPEA 2R32A 4Q4W1 4KG0A 3ATGA 1TZOA 5KHHA 1W6PA 5A80A 5ACA1 4CCDA 2A6WA 3HNBM 3NNJA 1ND3C 2VJXA 2CV6A 2GN7A 1N3QA 3ETQA 2VZUA 1N1SA 4KU8A 3BUCA 2FDGA 4IGPA 5FO7B 1JHJA 3AZXA 2OQ7A 1ENXA 1I6XA 3VBRC 1NCQA 1NX9A 3CDZB 3BTAA 1DFQA 3DXTA 1E57A 3DUIA 3PJQA 4IE0A 4J1XA 1FXZA 2LROA 3L9JT 5DAQA 3SHRA 3ZSEA 1NOVA 3H50A 4JHTA 4LE3A 5FUPA 4LA2A 2VMGA 1UN1A 3AVSA 4KGQA 1ZA7A 4NPMA 1DCSA 3NKGA 5GJ6A 1OT5A 2F17A 2IXHA 3BTXA 2VW1A 2BUKA 3VL9A 4I09A 1ZRIA 5T54A 5DUUA 4CU9A 3KHCA 5I0UA 3GF6A 3M70A 1YFYA 1HXS3 2MEV1 4URTA 4OHYA 2Z79A 1HV0A 2E7QA 4RL7A 4IE7A 3LB9A 1ND3A 2UURA 5T52A 5FYTA 1H9WA 3WNPA 4LPLA 1KS4A 3UGHA 3RNSA 4AR2A 3NQHA 1O6UA 2QQLA 4BMBA 1WLWA 3CKHA 1H2MA 3PLQA 4DQAA 5GZGA 3VBRA 1S2EA 3AKTA 2UY9A 5CADA 5C3RA 1ASJ3 1PO11 1S0EA 4XQ4A 1OXCA 1LOBA 4EN6B 2B9UA 3CF6E 3M3EA 4ARXA 4E4SA 5BNPB 2FHRA 5BPXA 1BHGA 4I0AA 1VBA1 1TMF3 4TN7A 4L2NA 3POYA 4A4AA 2PXJA 4IEUA 5LATA 1PGL1 4CUAA 3KCYA 2K9ZA 4UFJA 1PO13 1POV0 4JAAA 5KHGA 3OGRA 1W9FA 2VCBA 4W6XA 5LBCA 1VMJA 4D69A 3O0VA 4WM7C 4EYUA 2DCZA 1Q56A 1VBA3 3AZZA 2XB6C 3JQXA 2J1VA 3ZDSA 3L2HA 1R1A1 4RN5A 1LULA 2PHTA 4K8RB 3K51A 4ONUA 1JZ7A 3FX3A 5FPVA 3T3YA 1DIWA 3J26N 3NMBA 4HPKA 1RUG3 3OUJA 5C8CC 4OUSA 5F3CA 1FPN1 2FZ1A 2KM2A 2JECA 4QM8A 4R4XA 4FOQA 3D6EA 4IERA 2QZ2A 2VW0A 4KU7A 3ZSJA 4PHZA 2C4XA 2W1UA 4QT6A 3JBG2 1PZ8A 3RZHA 1E5RA 1WW6A 5E6HA 1R1A3 1STMA 1ULEA 2IVIB 2EIBA 3CZJA 4QD2A 1CN1A 1NXD1 1LRHA 1GYKA 1ZNPA 2YBKA 3JUUA 4Q4Y3 5GZFA 1W6PB 1FOD2 1VRH1 1Z7S1 2UYAA 4CU7A 3ABZA 1JYWA 3MEPA 4CEWC 1OH3A 4WM7A 4U2AA 3JZVA 5FKBA 3HT1A 3VD3A 4A3ZA 3PU3A 2ZAHA 5GLUA 1MEC2 3FLTA 2XR4A 3OGJA 4ISRA 5FBJA 4CP0A 5HXMA 1AYN1 1ENQA 3LEMA 1UW8A 5D21A 1UPIA 3ILRA 4BWOA 1NCQB 2CWSA 4IEVA 5FPUA 4YGDA 5JVVA 4AVVA 1S1AA 1Z7S3 1CD3G 4C1WA 3V0BA 3RMYA 5C8CA 2CGOA 3PVNA 3OYWA 1CWPA 2WYFA 5LB6A 1RMU1 1ZM1A 2CY6A 2YBPA 1QJY3 1UOFA 2WNEA 4H7MA 5L9RA 5FKCA 4ZZ5A 2R1BA 3I3DA 4L8QA 5FPXA 1BBT1 1A3KA 1HJFA 1OOPC 1AYN3 4XW3A 4COYA 3O0XA 5T50A 2QNKA 1FI2A 3ZYHA 4IV1A 5FIXA 4RD7A 2RG4A 3POFA 4YW7A 1YIPA 4A6OA 3OD4A 1OA2A 5LRSA 5JI9A 1PGW1 4QHZA 1V00A 5FYZA 2WIIB 3S0MA 5FPLA 2VTFA 1RMU3 4CEWA 1ND3B 1LHWA 1Y3TA 2WN3A 3ZXEA 1PGSA 4F83A 2XKOA 3AMPA 3AX4A 4TXWA 1GP5A 1SBDA 2NP0A 1WBLA 2LTNA 3MUZ1 3ELNA 1PM4A 2NYYA 2P6HA 3VBRB 1MS0A 1PVC1 2BRTA 1F8VA 1ZZBA 1JYIA 1DYOA 3WY6A 4IE6A 4HVRA 1UMHA 3SH5A 3IPVA 3WDTA 1S0BA 3H8RA 3WW1A 2YC2A 2BEOA 3APBA 4C90A 1PO21 1IS5A 2FDJA 2Y8KA 3ZVXA 2H0BA 4W50A 4YZ1A 1KS5A 4RFRB 4EROA 1OOPA 4NOTA 3BVCA 4NVPA 4NRMA 1NE6A 3O1TA 3ACHA 1PVC3 2LM3A 4GA9A 4V2VA 5FP4A 5L9VA 3W9AA 4CP1A 5DDJ3 2IXLA 1OURA 2DFCA 3B7MA 1COV1 3UKVA 4FOYA 5FZ9A 2ZKLA 3UK9A 1CJPA 2ARBA 3AZWA 2ZTNA 4MGQA 4UYBA 4E2QA 4E4DX 4G9SB 1HN0A 1PO23 2XJPA 5FZ0A 3TEXA 2DYCA 1YWKA 1WKYA 2ZHMA 1CAUB 3EB7A 2WFF1 1LHOA 1RXGA 5JXIA 4ATEA 2PYTA 3PUAA 3VD4A 1U5YA 1KDKA 2P4EA 3MIGA 4GULA 3I3EA 1M4WA 4HPKB 4ET7A 3WCSA 2QQOA 4XBLA 1OA4A 2VC9A 5A33A 1KEXA 5FZDA 1YFXA 1HRV2 1ZZCA 3VBFC 2CGNA 4LBKA 3ME2A 4MG2A 1UD1A 3WNNA 1K5MC 4LA3A 1KFXL 1WCQA 2NLRA 4UT5A 2D5HA 3MW3A 4IDZA 3WNKA 4Q4W2 3MUY1 4WM7B 2CGPA 1XNCA 4R4ZA 1U5IA 3S7EA 1RHI1 4L99A 1O8SA 4HZFA 1Q43A 2BNOA 5ACA2 4XMAA 4NPRA 3X29B 4YFZA 3H7JA 5JCTA 5AFEA 2D3PA 3OJBA 1RUF1 1PX4A 1EYBA 2R071 3KF3A 3V0BB 2VMDA 4Y1VA 5C8CB 3OYWB 4DEVA 1JW6A 1UYYA 5FYVA 3W5MA 3AMHA 3O14A 3HWJA 3WQ0A 3AP6A 1D4VB 4KI5M 5D2AA 1A6CA 5CAZA 5DAPA 2XH6A 2BNNA 3VBFA 4K6BA 4ZONA 4AFBA 3O1PA 1OSGA 1RUF3 2YV8A 3MIDA 4YSFA 2JX9A 4IV1B 1K5MA 5EZWA 4M4PA 4BPZA 1IZ3A 2D40A 2WR9A 4JV4A 3T1MA 2IC1A 3KZ4C 2UWBA 4LHLA 2ZGSA 4CEWB 1DZTA 4XILA 2ZS6B 4B4PA 3B02A 3ORJA 3FC0A 1PMIA 4IEWA 4XBNA 2MEV2 5LBBA 2X09A 4W65A 3MI8A 4URAA 5LK5A 1MVQA 3LEIA 2ZGLA 1LU1A 3ZN6A 4BISA 3O1MA 3PTRB 1MZFA 2P1BA 3LEGA 4B8EA 3JD71 1J59A 1PMJX 3IPVB 4GXLA 1X50A 2R061 5K8SA 4CXYA 2XUMA 5DUVA 1JYXA 1PO12 1WW4A 4JTOA 4M3CF 4XAAA 1UO9A 2VMFA 3M7AA 4HETA 1OOPB 3EO6A 4GJZA 5JMCA 3WG1A 1SCSA 1BK1A 5CKMA 4E4HA 2NMOA 4BIFA 1HIXA 4G3YC 5H9RA 5F2WA 1K12A 3SCGA 3U78A 3GDBA 1POV1 2ZGOA 3OD0A 4XBQA 4XDOA 2R063 1IGOA 1PGL2 3U14A 1K45A 4HVOA 3RMXA 2RHPA 5JOYA 3RI8A 2DU0A 1UY0A 1XYNA 2WSVA 4QXKA 3AC0A 4B1MA 1GLHA 1OVSA 4QKBA 2N7GA 3I3QA 3ZSKA 3AVRA 1SLCA 2W47A 2VO5A 4XUQA 3OPWA 3KD4A 4QGMA 4RQPC 3UKTA 2PHLA 4DY3A 2JKXA 1O8PA 4CP2A 1WW5A 3F2ZA 5A33B 3HBKA 1JYCA 3UL2A 1EY2A 3R6SA 1V6JA 2XLFA 2EIGA 3PJYA 4I30A 4NMIA 1FPN2 3SCFA 1LEMA 2SBAA 3T2PA 2ZKNA 4W8JA 4RFT0 3IKWA 1S0CA 3T2QA 2JDZA 5I91A 3VHPA 5FYCA 2C26A 2YROA 2Y64A 2GN3A 5K9YA 2Z5WA 1NUKA 2A75A 1MS3A 4P5YA 2I45A 1J58A 4LIVA 4ZU7A 1YI7A 1VRH2 1Z7S2 1QEXA 2XVKA 1FAYA 1GICA 2JXAA 3U4SA 1OF3A 5H9SA 2WNVC 3WD5A 1OKQA 4RQPA 1AR71 2VR4A 4ITCA 3WUCA 5IUQA 1AYN2 4BQ2A 3PVEA 1J83A 3H1MA 1FATA 2LUWA 4H2AA 4YW5A 3ZYGA 2CYFA 3FBYA 5EPAA 1CQ9A 1W6OA 3VBFB 5CKQA 3KGLA 4LTAA 1RMU2 2VW2A 5C5TA 1K5MB 1ZZ9A 1IG0A 1BBT2 1JHNA 2XL7A 2VCMA 3BKZA 2YZ4A 2OYZA 5ERLA 4QX3A 2WQ8A 1A78A 1IPSA 3OBRA 4J25A 1QJU1 5J37A 1PGW2 3VBHC 2OA2A 4QMAA 1GMMA 3WP4A 2CU5A 4XCBA 4DXTA 1MVEA 1RITA 3FFZA 1C1LA 5L36A 3Q8AA 4XFCA 1CGPA 3B5LB 2DCTA 4XZUG 3HMYA 1XRUA 3WF3A 2WNVA 1GP6A 3ZN6B 1CPMA 3WHUA 1DU3D 1GQPA 1OUSA 2EF6A 2DVBA 5EWSA 3U07A 4YVWC 2RMU1 2VXRA 3A0KA 2IFRA 1LOAA 1REFA 2A70A 2LW8A 1YQ8A 2J1SA 3G7DA 1EUTA 2GC0A 2FCUA 5FZOB 1YJLA 5K7PA 3DN7A 3UNPA 4ISQA 4AHYA 3AP9A 2K46A 4PDWC 1Y4WA 1O3TA 3THPA 5JDBA 1S0JA 4OQ9A 3RG0A 4ZXEA 4BQ5A 2RMU3 3HJRA 3J9SA 3AP5A 1QDCA 1GWLA 3VBHA 2BZDA 1AX1A 2EAAA 3TEWA 3GCXA 3TEZA 1COV2 3ZDVA 4TTGA 5FLIA 3NAPC 2TBVA 2FZ2A 1RUC2 4A45A 2WZR1 4F8AA 2VQ0A 2PTMA 3RJRA 4YZ4A 2ZGNA 4HOOA 2P3KA 1CESA 3I2HA 3NV4A 4YVWA 2DWRA 5FK8A 3UGGA 5HI0A 2VM9A 2WFF2 1HV1A 3ZYRA 4MGZE 3BTZA 1DGLA 3HBZA 1QH7A 2ET7A 1ONAA 2W87A 2ZJCA 4HG6B 4QAWA 3SXWA 3HNMA 4Q4X1 3AXDA 3F95A 4PDWA 3BI3A 4N7UA 5APAA 5FWJA 3KT4A 2D3SA 5IATA 2XQXA 3CBNA 2MPFA 1F5FA 2ZAAA 5LBFA 2H0VA 2WO1A 4HL0A 2PFWA 5KC5A 2CHHA 2GH8A 4XACA 1QOSA 1OQDA 1ZBE1 1FNZA 2XL9A 1UOBA 4L97A 3L2YA 1AZDA 2ZGRA 1SHWB 3NAPA 4DRVA 4PI0A 5BXXA 1AX0A 3ACGA 4AGVA 1RHI2 2QE3A 3QACA 3WOGA 2HWF1 4MHUA 5A6QA 5HCHA 1SG3A 4RQPB 5LY2A 2VE1A 1K3IA 2D97A 2VQUA 5GLZA 3WQ7A 3KT7A 2R072 2A3YA 1X7NA 1W6OB 2AZ5A 1O3RA 4S2GA 3S30A 4OHWA 3ZM8A 2D44A 3VKMA 3BU7A 4OULA 3NJXA 1JUIA 2PHUA 3NV2A 2QQMA 1LEDA 2OKXA 1NZIA 4FAGA 4CPBD 4RGGA 5A1AA 1UX7A 1V9U1 1BVVA 1ZBA1 5FZCA 2FMDA 2QDRA 4JDOA 1W8ZA 1VBC1 4V2WA 2JE7A 1UQXA 3LCPA 4SBVA 5A7OA 2RR11 3WF4A 2W52A 3RWNA 4Y3OA 4ZU4A 1PNFA 3CJIC 3FLRA 4NUBA 2ZPXA 4I3PA 3WDYA 2XJSA 2YC0A 3RZGA 2EXHA 2WNVB 4OYUA 1Q8VA 3PIGA 2JDYA 4GMP0 1VAMA 2OIIA 4UWDA 1RB8G 4UW3A 1G9FA 2OXBA 1V9U3 3IMMA 4FPFA 2JJ6A 4D7SA 4EWAA 3N4MA 4FPOB 2HWB1 3JD72 4X6RB 3C8XA 2YU2A 4XF0A 5JOWA 2YY1A 2JEMA 5CZKA 2Y38A 5JXJA 3CL1A 4LK7A 1YQ5A 4NWVA 4Q0QA 4AEDC 4KWKA 1HX6A 5IHRA 1J3QA 2WT2A 4NHYA 2BGOA 1H8VA 3AP7A 4QQLA 3VBHB 5J1XA 4XFAA 5IVJA 3BTYA 2HWB3 2XONA 1B35C 3I2DA 4KH9A 3CJIA 2QKDA 3GBGA 2Y6JA 1LOFC 3IDEA 1CZTA 4W6YA 2QBXA 3MDPA 5DAXA 3BPSA 1IPKA 4YVWB 3QBQA 1IS4A 3E5UA 1NZCA 1V6KA 5A7WA 1G9AA 4YG6A 4YGEA 4B4QA 2ZZJA 4OZXA 2QZ3A 1W9YA 1QMJA 2JDNA 3UYJA 5B4NA 1BMV1 4PDWB 5FYSA 4FFHA 3O5SA 2HLEA 3OEBA 3LDBA 2XQRA 3Q8EA 2ID4A 3LOBA 4UAPA 3E6CC 1GNYA 3FHQA 5E89A 4CYDA 3MIFA 2R0FA 5HCFA 4AEDA 2ZABA 3MZHA 2P34A 2QQIA 3WNXA 4AK3A 3S5AA 3SCHA 1N3OA 3DPRC 2JG9C 3BN6A 5IAXA 1B35A 5SV8A 2EXJA 2ZHNA 3NAPB 4DINB 1VP6A 1FOD3 1LOFA 3I3BA 1ULCA 4IQPA 3WDWA 1GU3A 4BM8A 1AX2A 4L11A 4U36A 1GNZA 1Q8QA 3MPPG 4QX1A 1PMHX 4YARA 5CBLA 3VHNA 5DQ0A 4HSJA 5T5PA 3KWVA 1MEC3 2E53A 4Q4V2 1OHFA 1W2NA 2XWJB 3ES1A 5FO8B 2O1QA 4QQHA 1AR72 5FBZA 2VMCA 2RS11 2VQTA 3HNYM 4HBNA 4QX5A 1RUNA 4XUPA 5KHKA 4C1XA 1K5JA 1D2SA 4XIKA 1SDDB 5FLJA 5FDBA 3U4XA 2YC4A 5F1RA 3QOPA 2VH9A 1NYWA 2VZ3A 4KQ7A 5A7SA 1A34A 4NRQA 1D7PM 5KBFA 1HRI2 4LO6B 3DPRA 2JG9A 3NNLA 4Y22A 2IWGB 2VBDA 1QGLA 2WAAA 4NIHA 4XPVA 2WBKA 1QJU2 3S6PA 1DHKB 3PNAA 2QTWB 5FY4A 3ZPOA 3H3LA 2AENA 3I2FA 4N43C 5A3UA 1BVP1 2OPKA 3W5NA 1RINA 4BYYA 2P17A 3K4DA 2RJ2A 4NO4A 1JZ3A 4QX7A 4AGGA 3KV4A 5IW0A 1UKRA 4GIQA 1VPHA 4QM9A 4LO7A 1NG0A 3AYDA 1KD7A 1UMZA 1I9RA 1RUD1 2A6VA 4FP2A 5DXDA 2DCJA 3ITQA 2JDUA 4HFSA 2ZX0A 4D7YA 1AXKA 1X9TA 4CDXC 4Z07A 1OLMA 3SH4A 4Y20A 2GMPA 3CJIB 1B09A 3CEWA 4LOSA 1MR5A 3BPZA 5A7PA 2DTYA 3FFQA 2ZBJA 2HKXA 2HBUA 5A7NA 2BPA2 4C0BA 1I5ZA 2X10A 3AYEA 2HBTA 4YW2A 1C5IA 2PHRA 2OS2A 1S4CA 2VVEA 3N9MA 3ZIXA 2FDFA 2A3XA 3Q8FA 1SLTA 4N43A 1ODNA 4O65A 2WZR2 4OZOA 2E63A 4YFWA 4QGLA 5A7WB 4B4RA 4XXPA 1W90A 3RJ2X 4E8DA 1Y9GA 1DQ5A 4QX0A 2DVGA 1W0OA 1CX4A 3AYCA 3WDXA 3WQ1A 5FXZA 3WW4A 4K21A 5IVVA 1C3HA 4ASLA 4QX8A 5J98B 2P3YA 1W8UA 4AEDB 1M06G 4Q4X2 3LOIA 4LBMA 3KV6A 4P5HA 3THDA 1HRV3 2TUNA 2OW4A 1X82A 3POIA 3TN91 4HK9A 4CDXA 2B5HA 3PUSA 4FI9A 3N7JA 4JHZA 1B35B 1XBFA 2YGLA 2WLQA 4ASMB 3TEYA 1W0PA 3CZUA 3THCA 1ZBE2 4OQ8A 4Q4W3 3IBMA 5C3SA 3DYOA 4IV3C 4BK4A 2ORXA 2JKBA 1AYM1 1XNTA 3PU8A 1GANA 2MHFA 5ACA3 2W1SA 3PUQA 1OQEA 1D4M1 3VKLA 2HWF2 1QJX1 4EQVA 4RYDA 3MV01 5AC91 2OZ6A 1ODMA 5JR2A 2ZX4A 4LLFA 3O0WA 1WD3A 3LDKA 4Q27A 4M0HA 2J1UA 4FFGA 1OH4A 4AG4A 5FYYA 1L7LA 2HWC1 2AUYA 5IK8A 3O12A 2Q1ZB 4AI2A 1AL0G 1KFUL 4EN8B 3DPRB 2C0ZA 2JG9B 1HQNA 4Y22B 2VZRA 3LA7A 3MV11 3JQWA 1Q8SA 3AFKA 3K75B 3ZPYA 1VRBA 4TSVA 4FTBA 1QU0A 1V9U2 4TYSA 3VB9A 1ZBA2 2QQPA 1HB3A 4IV3A 4P9GA 1VBC2 2QQKA 3ILNA 4R9CA 3WDUA 2RR12 2MEV3 5HXVA 2H6CA 2MNGA 2Q1FA 5F7UA 1VB4A 1RJ8A 4AQ2A 4GMP1 3OBZA 3NV1A 2BGCA 3D3AA 3DKQA 2VVDA 1TME1 2HH9A 4UBHA 4A6SA 1AL21 1UOGA 3WF1A 4AEKA 1CIWA 5CEHA 1LTEA 2HWB2 3VHRA 1ZRFA 3WNOA 1GOFA 4XF4A 2ZGTA 2TNFA 4RS5C 4Q8KA 2BV4A 4N9HA 4AI0A 2DDUA 1UF2C 3HQUA 3OGGA 5FTTC 2YBSA 1UAIA 1UXZA 2VD7A 1RL3A 1W06A 4GAZA 4GKYA 4Y20B 4NWWA 5JIUA 3I2OA 1GOHA 3D82A 3RI9A 1LENA 1QXRA 5LZ6A 1ZZ8A 1OFSA 1CAUA 4KWJA 1SFPA 4HN1A 4N43B 4IXLA 5I8TA 5F39A 3M3QA 3QCWA 5GZCA 4AYUA 3BALA 5CIRA 3GALA 4BB3A 1Q8PA 2Y6FA 1T6GC 1GZ9A 2R0HA 4IESA 3HT2A 1UIJA 3ZX7A 4AHZA 3TOJA 5KHIA 3I3MA 3AMQA 4XFHA 4MZUA 1LCLA 3EQEA 5LASA 3IZOA 4RS5A 4OUMA 4YZ2A 1BMV2 4XFGA 1IQAA 3QLQA 1H8TC 1XSQA 5DZGA 4FTEA 4CDXB 2XJRA 1L7QA 1FPN3 3B00A 3WG3A 5EJ3A 5FUNA 2EVXA 1ZZ7A 2D93A 4D8MA 2RDSA 1UU4A 5A3OA 2VPVA 2VQAA 4XMIA 1IPJA 5LWBA 1TNFA 1VRH3 4BE3A 1O5LA 2VGDA 3UT0A 2G19A 4TWTA 4NHKA 4RR3C 5A6YA 2LRPA 1G6NA 1QWRA 2VNRA 1F2NA 3O1RA 5F5QA 4I0BA 5DZEA 4CXWA 2XXZA 2VNOA 1IKPA 2W2IA 4LKDA 3P5BA 3WX5A 2RS12 3ENRA 2B8MA 4K1YA 1H8TA 3I97A 5FP3A 1JZ2A 1CX1A 4DZGA 3UV9A 1J1TA 1SCRA 3V0AA 1FYUA 1ALYA 1Y9MA 3I2KA 2YPDA 3C3VA 4LBOA 5FREA 5BV6A 4W4ZA 3SH3A 4ES9A 1BBT3 3DV8A 3ES4A 1US3A 2BOJA 1GBGA 2CL2A 4AFMA 1XB9A 2B42B 3H1WA 3H8UA 4IV3B 4IEOA 4S2FA 1V0AA 1SFYA 3ST7A 3FWEA 4QKNA 2PAKA 5FXWA 1PNGA 1SLAA 3A7QA 2UWAA 4N53C 2WWJA 1U5ZA 1C8M2 5EYXA 4QPIC 3VGIA 3FL7A 4RR3A 5L9BA 4ZKTB 4XOGA 4IEQA 2V4VA 4O7XA 1JMUB 3OSDA 2HYKA 4LBQA 4XF1A 3RZLA 1TEIA 3Q9OA 4P9LA 5FZIA 3ASIA 3OTFA 4E27A 4AI9A 2FCTA 5IVCA 2PQQA 1IOAA 3U75A 4Y1UA 4BH9A 1ZZ6A 3P3PA 4WV8A 1RUC1 1RUD2 3THTA 1ZRDA 5LY1A 3I49A 1LOCA 2A6ZA 3CHXA 4IEXA 2RE9A 5FY1A 4YGBA 2WYSA 1UU6A 4RHV1 4I3GA 1OC1A 2ADDA 3VUOA 4N53A 1COV3 2VZPA 2OT7A 3M8LA 4Q26A 4QPIA 1JU3A 2FQPA 1RUC3 1JS9A 1GWMA 1R081 5CISA 2WZPP 3H9AA 2BVBA 1W2TA 5CFDC 5CYYA 5EXOA 4LOTA 3GZTB 1AF9A 2BWCA 2WFF3 3ZIWA 4BXSV 2PHXA 1VAKA 5TSWA 5FOJB 2G1MA 4RS5B 4META 1F15A 2BBVA 3OGVA 4F7ZA 3C7GA 5F6LB 2KD7A 5IVBA 5I0TA 5FJHA 1S2BA 1OF4A 2PA7A 3PIJA 4YYOA 2WO3A 4GALA 1V6OA 5FY0A 1XE0A 1YFWA 5KC6A 3TN92 2JG8C 2ZACA 4LKFA 4Y1XA 1WUVA 2NMNA 2VXJA 4MUVA 3MF9A 2V4AA 3SC7X 2W95A 3QH6A 2EICA 4B29A 5M0TA 1UWWA 1NY72 2WLPA 5FZ3A 3MFAA 1NAEA 2VUAA 4GD4A 5GLTA 4HANA 4XXAA 4AHWA 3C2UA 1Z78A 3P1IA 5FV3A 3W20A 1AR62 5IK5A 1KJRA 1RHI3 1IG3A 1AYM2 1O4TA 1YLLA 4DY5A 3I54A 5G05L 5CFDA 4M4RA 3ZXKA 1AXZA 1D4M2 1H30A 2Q1MA 2XLAA 1ULOA 4YVSC 1QJX2 2QQWA 2BDRA 5F9TA 3GBFA 3ZMOA 1LHUA 3SEPA 5AC92 1JZ8A 2R073 1D0HA 2Z2SB 1H8TB 1WA4A 3RQ0A 2QQUA 2WFPA 2RV9A 3GJAA 1E5HA 4YW4A 5LBEA 1W0NA 1WMEA 3V0AB 1EPZA 4MHRA 3KB5A 2D3RA 4Y5TA 1LAJA 2HWC2 2RDRA 3ON7A 1TQ5A 5JIAA 3WW3A 2JG8A 3N9LA 4Z2AA 3ZXFA 1H0BA 4GJYA 5IJRA 3HOBA 5DN2A 1JZ6A 3PTYA 3R4UA 2XDVA 3LDRA 5A70A 4E2SA 2FDKA 5LK7B 3H8OA 4BMEA 4RR3B 3RYPA 4XC9A 1CIYA 3FHIB 3NV3A 4BJ0A 1OA3A 3AL5A 4CUBA 4EWEA 1QQP1 5LA2A 4AVBA 1T2XA 3TB0A 1UYZA 5FZOA 3R0RA 1F4AA 4YVSA 2G9ZA 2Y6LA 2UY8A 3KCXA 4LBQB 1I3HA 1QJFA 1TME2 1IS6A 5C5UA 5J36A 3KSCA 1AL22 4XURA 3JD73 5FZ7A 3GJBA 2YPJA 3JB4C 5FYUA 5DAWA 3ZYFA 1QQP3 3LIGA 3B93A 3CJXA 1OLQA 3VV1A 4BA6A 4COUA 2GC3A 3V64A 4CE8A 5ISLA 2O8QA 3AKPA 1SQ4A 1ULGA 3PURA 1JZ5A 4KG8A 1S0GA 3GYDA 1LGNA 5AFBA 3ECQA 1QHDA 2Q30A 4N53B 4QPIB 1POV3 1W05A 5E8AA 3UKNA 1JN2P 2DCKA 3B69A 4FPHA 5GLVA 2YYOA 2CDPA 2IXIA 2XJTA 3OY8A 2RJKA 1TNRA 2ZMNA 3WXPA 3AMMA 4J1WA 1JU4A 1IKQA 5F2SA 5HCBA 1CONA 2V5YA 4P08A 3U37A 1W2OA 1UZYA 2B46X 4H7LA 4MVTA 4AWDA 4CDUC 3A22A 2AREA 1FMD2 1H4HA 3DCQA 3K3OA 4OMDA 2R16A 1BZWA 3GBWA 3SKVA 1W8HA 4PBPA 4C91A 2PQSA 3IDCB 3J8F2 3VN4A 3UJOA 1BLZA 1VBD1 4NHXA 4HONA 1EAH1 1PZ9A 2DVAA 3BIWE 3N7MA 4I02A 5FZHA 1YJKA 2W92A 4K7JA 1L3JA 4Y4RA 4E8CA 3POGA 2ATFA 2RDNA 3LPFA 3RYRA 4Q4V1 2VG9A 4XTMA 3ZXLA 4ATFA 5JPMB 2BOIA 1UZ0A 1UZZA 3ZFEC 5FLHA 4JQRA 5F5IA 1XJAA 2VBPA 4NHLA 2O14A 5B4XA 4XEZA 3AJYA 2O8OA 3E5QA 5GZEA 5CFDB 4NE9A 2R6QA 1EAH3 3GHNA 4NROA 1H4GA 1VAVA 3J4UH 3LSDA 3NNGA 5D1IA 4CDUA 1RXFA 3SEEA 4AVTA 1MS1A 1PM7A 2DVDA 5F37A 1C1FA 1E5SA 4LR4A 1HRI1 2W0XA 4Q4V3 5H9QA 1AR73 4L92A 1WA6X 4G4FA 4A7ZA 2DUPA 3K4AA 3W21A 1BK0A 3RZJA 2P2KA 2W39A 1APNA 5JAXA 5JUVA 4QPGC 2JG8B 5C7GA 2IXJA 5FMOL 2VOWA 4SLIA 4CCCA 4S2DA 2E7TA 1WMFA 4BCUA 1HRI3 4PBOA 4AFDA 4LT5A 4QXCA 2B4KA 1YC61 2J1TA 4LUKA 4FVVA 3ZFEA 2VAUA 1UNBA 1J3PA 2W5FA 4AGRA 5IWFA 2YFZA 2A7AA 2HEYF 4Z82A 4DFSA 1QJU3 5FQ0A 1W6NA 5K0UC 2FBEA 4YVSB 1JH5A 3IIAA 4QXHA 5FR3A 4JX0A 5T5OA 4A3XA 1DQ0A 3K46A 4HN0A 2HYXA 3GXUA 2PHDA 4IEPA 5FMOS 3O1OA 3K4ZA 1RUH1 3B9CA 5FY7A 1EPWA 3VL8A 3VDAA 4LLOA 2D6NA 3A4UA 3M3OA 4UF0A 3UGFA 1AR92 3V65A 5A32A 3IDBB 5C6CA 1DGWA 4UW4A 1LESA 2EA7A 2W94A 3MYXA 3ACFA 2WDBA 1X36A 3ETPA 2DBNA 1UY3A 5FZKA 3AM2A 5FZAA 5HV0A 3TNPB 1LHVA 3DKWA 3KMHA 1X8EA 5A7QA 4AEMA 2WKKA 4NIIA 4DUWA 4XJWA 4IEYA 1RUH3 2JD4A 5E1RA 2F4LA 5B2GB 1SLLA 2QDNA 3FLPA 5JXGA 4RHV2 2XVGA 5FO9B 3NNFA 3OBAA 4GWIA 1YFUA 3OY8B 4TZDA 2JD9A 1YXWA 2OZJA 5K0UA 1UZWA 4M3CA 1LR5A 2XVLA 3J7HA 4WZCA 4B1LA 2ARCA 5IFTA 4Q0SA 2WZR3 1R082 1RUE2 3TYJA 4AXOA 1HQLA 1F31A 5DUWA 3RFRA 3NO8A 4WVVA 4XETA 3S5QA 5A3PA 5FZGA 3OPZA 2GSYA 3QH7A 5IVYA 3UESA 2ZA9A 3ZXDA 1W28A 2HWE2 1HDKA 4FTSA 5J48A 1QJZA 1WLDA 4JDMA 3K2OA 3K3NA 1DLCA 2VMIA 4Q4X3 4XJAA 5BNQA 4LJHA 4XF9A 1O5UA 1TE1B 4DB5A 1REEA 1WCUA 1OBNA 2WA3A 2E31A 2W1WA 3FZ3A 2Y33A 1ND2C 1XNDA 1EV11 5EV7A 3WG2A 2C5DA 4COVA 1J84A 2WAOA 3A23A 3ZN5A 1EP0A 1LHNA 3FJSA 4YW6A 4OHZA 1ZBE3 1W9TA 2GNBA 1C57A 5CKNA 1NQJA 4CCMA 1PIV2 2WZ8A 4CDUB 1MZEA 2Y34A 4IETA 4OHXA 3T09A 2ZXQA 2DFBA 5HBAA 2HWF3 4OI4A 4CU6A 2DU1A 3IIIA 5KXCA 2AEYA 1NLQA 2YHJA 1CVNA 1XE8A 1FT9A 1ZRCA 3AJZA 1SACA 1DLLA 2GMEA 1LECA 4JQTA 1ULDA 4LBLA 4EJRA 5F5AA 1HQWA 3KQRA 3LA2A 5L7OC 1AHSA 1DYKA 1YQCA 4FXGB 3POSA 4JGZC 3VKNA 4XVHA 5KXBA 4LKEA 2W46A 5FUIA 1ND2A 2W68A 3BYWA 3LIHA 2CSGA 4YG0A 1BEV1 3POWA 5FMCA 3ZFEB 2WN2A 2Z69A 3FHAA 4XFFA 3HQXA 5GM0A 3VDDC 4AQ6A 4CEYC 1O3SA 4IE5A 4UFHA 1C28A 4YM1A 1ZBA3 1XXNA 2BJSA 1W03A 5FPAA 5FQ0B 3WF0A 1W6NB 4YRDA 1VBC3 2YDEA 4EN7B 5CG8A 1FNYA 2RR13 2G9GA 1W8FA 4PT6A 2XHKA 2RS31 3HVDA 4XQDA 4ZS3A 1V6NA 1GUIA 1QQP2 2I74A 1XYPA 1YYNA 3N35A 1BKZA 3H42B 3PMSA 1BEV3 4Q8LA 4UOJA 4UF0B 2X8KA 1W8OA 3GZUC 5A32B 4XJ8A 3TAYA 3OF1A 4AVSA 4PLNA 3FUQA 3O1SA 4QPGB 3K48A 4JGZA 5FZ6A 5J96B 2IFWA 1UY2A 3SITA 2H6BA 4AOCA 1G9BA 2XOMA 5FXVA 2ZHLA 3AXEA 4CUCA 2Q8CA 1UU5A 4YM3A 1LNSA 2Y6HA 4D6RA 3VDDA 3AKSA 2X5IC 3T2TA 5C3QA 1G8WA 4Y1ZA 3AKRA 3HAGA 4GB32 5K0UB 4M3CB 2UWCA 3A0NA 4N90A 3SLIA 4LBJA 1P8JA 4JDNA 1W3XA 1JTZX 1S0FA 2A1XA 2D43A 1AUYA 5T5LA 4YZ5A 4P9JA 5FZLA 1OPOA 2NPIA 2ZMKA 1L7RA 2JB4A 3N7KA 2JDHA 1C4RA 3WR0A 3NSTA 4LULA 1XYOA 4EWDA 2JE8A 1YEWA 4A7YA 4PJYA 1WCDJ 3I2JA 5H9PA 4Q1PA 5IVFA 2RS52 4ORFA 4OHVA 3IN9A 3WNMA 1F5JA 2PELA 2R7EB 1UX6A 1QXPA
chains in the Genus database with same CATH topology
1JXNA 2WS91 4BLJA 2ZCWA 1JUHA 1VBD2 3PHMA 1EAH2 2X5IA 3WV6A 2AGSA 4LHNA 4B3NA 1KQRA 3JU9A 2R042 2XBO1 1MACA 1AXYA 3JB8A 1YIFA 3KT1A 1H2LA 1SFNA 4QGNA 4FPJA 5F6KA 2A73B 1NE4A 2WC2A 3GZAA 1AR81 1QF3A 3VBOC 4BOWA 4LO4B 2CTVA 2RS13 3R4DB 4FOVA 1G9DA 1KRIA 3EBRA 3VZOA 1ZYBA 2DURA 3B01A 1C8M1 4LNVA 5E88A 1N1YA 2PN5A 1ND2B 1UIKA 1XNKA 1QOTA 2FMYA 1RUJ2 2QUOA 5C9AC 3BOPA 1RJ7A 3CLPA 2B7YA 2YXSA 2JENA 1C8M3 5CB7A 5CNAA 2D7FA 2VY0A 3ZFGC 1RTVA 1N47A 1REDA 1NCRC 2KA3A 3VBOA 2GNDA 2I07B 4JGYC 4XHXA 3LAGA 1RUH2 5L7OB 4RSUA 1BYHA 3DF0A 1Q5OA 1DBNA 3BOWA 4JGZB 1BQPA 2CAVA 4HKWA 1ZX5A 3LSEA 4K20A 4LUMA 3WG4A 1RUD3 2HWD1 3RSJA 1W39A 2ZX3A 4FPCA 5JPNB 2OVUA 3VDDB 1H1MA 4CEYB 4Q0VA 1Y9QA 4BIOA 1N1TA 2BVVA 2D6KA 3NWKA 1GZWA 2RM21 5C9AA 2ZX1A 4KWLA 4R8HA 3ZFGA 4P9XA 4WBBA 2DVFA 4QHBA 1NCRA 3MF6A 4JGYA 2DCYA 2WQZC 4FQ4A 2NN8A 2K0GA 1LKNA 1R092 1NY71 1XNBA 3P3NA 4XE9A 2EXIA 3OBTA 1AR61 1HKDA 2SLIA 2X5IB 5CFCC 1OD5A 3GHMA 4YW1A 3TN93 1QXJA 3HN1A 4LEJA 4Y26A 1EV12 3D0SA 4Y1YA 4UW6A 3USUA 2WL1A 3ALQA 1AR63 2G4IA 1AYM3 2Z42A 1QKQA 2CWMA 4AI3A 4K9SA 4CTEA 1D4M3 4OVEA 1QJX3 5AC93 1HXS1 2HJIA 5I93A 3WHTA 1OMIA 2UYBA 4XDQA 3E6BA 3IM0A 1NLSA 1V6LA 2A6XA 5CFCA 4XJ9A 2HWC3 2D6PA 3IWZA 5KXDA 1YO8A 4NR1A 2GDFA 4JCKA 1KDMA 1BEV2 3HD8B 1ASJ1 1VBE1 4PQ9A 4R9DA 2WNUC 2VOVA 4MGIE 4WZFA 3CO2A 2XGXA 4X8PA 4MH0E 2RS32 1TMF1 3RYKA 3LA3A 3VBOB 4GMP3 2TEPA 3E6CC 1O91A 2NQYA 2BQPA 4K40A 4YM0A 4DRRA 1TME3 1VBE3 5FCCA 1AL23 1SBEA 4Q0UA 3WLUA 2Y26A 4FBFA 5IT6A 1BJQA 4QPYA 3MPBA 5A3MA 2F6BA 2D98A 3VZMA 2R30A 1GZWB 5C8WA 5C9AB 2R49A 3WP3A 3VBUC 4GH4C 1SEFA 1FMD1 1GNHA 3VZLA 5JI7A 2WNUA 3FUOA 4Y4YA 4P14A 1RUG1 3ZFGB 1GKBA 4YLZA 5LRRA 4FAHA 3MGUA 3J8F1 1S55A 4YNIA 1NCRB 1QH6A 5JOZA 4JGYB 1W2UA 2K2SA 4J6GA 2AR6A 2VU9A 4M01A 4WVWA 3AMNA 4Q4Y1 2XJQA 1FMD3 3N36A 5I0RA 1VBB2 1RVF2 3CNAA 1IHMA 3EJKA 5GALA 4E2GA 3FMGA 3RZZA 4NN0A 3SNMA 3M2MA 1WMDA 2ZGUA 3J8F3 4CZSA 2WS92 3MFCA 2ZGQA 1QNYA 4Z92B 2WINB 2VNGA 3AK0A 3O7OA 4HT1T 5T3NA 3VBUA 2WJSA 4GH4A 4IV1C 3ZXJA 1W6QA 4COWA 2D6LX 3USUB 4PLOA 2XBO2 1QJY1 2W08A 4MGKE 5BNOC 2GC2A 4DPNA 1N3PA 1ULFA 1PZ7A 1LGCA 3PMEA 1A8MA 1SLIA 3VKOA 2BYVE 2PLV2 3V56A 4LO8A 5BUVA 4FSJA 1OQ1A 4KBBA 1AR82 1NLRA 1OI6A 1RC6A 3DGTA 4P9IA 4B7EA 3UJQA 1DGRN 5CFCB 5KWRA 3ZYPA 4Q2FA 4E4ZA 1XE7A 4FCAA 3NVCA 4AFAA 2EAKA 4TLFA 1DF0A 2CNAA 2I2SA 2YMZA 1YCIA 1XU1A 3AP4A 1XQNA 3HIFA 3R4SA 5J7MA 1CAWA 2XLGA 4K8FA 1GQGA 4P9WA 2IXKA 5BNOA 1AR91 1QOOA 1SDWA 5IK7A 1U12A 2GU9A 1O4ZA 2Y0OA 4JC1A 4V1PA 1RUI2 4M0NA 1O7FA 5DDJ1 5L19A 5JLVA 4CDWC 4EN9B 3N7LA 4PIZA 4QU2A 1AR93 1OFNA 1V6MA 3I7DA 3TWIA 5DUXA 3NKTA 2B39A 4GWNA 1Y7BA 3M3CA 3BCWA 5AVPA 3USSA 3ZXGA 2AH2A 2HWD2 1RUE1 4UXAA 2WNUB 5SV5A 4QQ2A 4RHV3 2RM22 1H2NA 2QCSB 1J3RA 3MW4A 4AE2A 2C9AA 2P3IA 3M1HA 2HWE1 4ZU5A 1S0IA 3ILFA 4AVCA 3I4IA 2Q4SA 1R083 1RUE3 4PCRA 1ZA4A 2DF7A 2QVSB 4MYEA 1QY4A 1SLBA 1LOGA 3WCRA 2E7AA 1D0GA 4XZPA 4CDWA 3N3HA 2VVFA 4AVAA 1JBCA 4HMZA 4JTNA 4OI1A 3W58A 2HWE3 3U11A 5DZFA 1FV2A 5GZDA 1PIV1 4UBGA 3H0OA 2OUHA 4OLLA 5FAXA 3VBUB 5HCAA 4GH4B 3ZYJB 1WCKA 1W6QB 2XJVA 3D5OA 3R05A 4O9GA 3WW2A 4M00A 3RDIA 1KXGA 3LGRA 3ZO0B 5JR7B 5BNNC 4AI8A 5EFUA 1GR3A 1PIV3 1G9CA 4R9AA 4A7KA 2D6MA 2E51A 3KS7A 2VUJA 5BYNA 5LEKA 1KITA 1OPMA 3GNEA 4GKXA 2HEVF 4LBNA 3WP6A 4Z1VA 1HXS2 2WWSA 4BZ4A 3B94A 4YG3A 4FPGA 2ENRA 4N9IA 2DV9A 4WVMA 2IZWA 1H1IA 1GQHA 1CAWB 1MZ5A 2QJVA 4BHPA 3H7YA 1NQDA 1GZCA 5BNOB 5D8AC 4LO5B 1S0DA 1ASJ2 4Q29A 4HSLA 1VBE2 4XHBA 2A3WA 2P3JA 3I8TA 5A3LA 5BNNA 5C4WC 4XJZA 4BQ1A 4DOUA 1PK6C 2LALA 2PHWA 1TMF2 4H3WA 5T5JA 4GQ7A 1DQ6A 1S2KA 2VULA 1V70A 4I0WB 4GB31 2XWBB 1WCSA 4YM2A 3WVJA 4P9YA 1R1ZA 2JE9A 3I59A 1ENSA 5JSOA 5JZGC 1VBA2 3FE5A 1N1VA 4XF3A 5JSRA 1WLTA 5D8AA 2RS51 4FQZA 2E9QA 4GB33 4YZ3A 2BW8A 5C4WA 3U10A 3VKFC 2NZ9A 4I2OA 1RUG2 1PK6A 1DZQA 4HVQA 1Z0HA 4H55A 4RGAA 3ZSMA 1R1A2 4CDWB 1NA1C 2RJLA 2Q5TA 4FP3A 2RS53 5J3UA 4CRQA 4Q4Y2 5JSPA 2R041 5DG1A 5FOBB 2A71A 2NM1A 5JZGA 1PHMA 4Q1RA 1RIRA 4Q0PA 1VBD3 1U0AA 1FV3A 2CAUA 4BLIA 2B45X 1WW7A 2C1FA 5E16A 3URFA 1SBFA 1DQ4A 2R043 4PIYA 4A2UA 3ZN4A 1D2QA 3TBDA 2A5ZA 3MIEA 1O3QA 1RUOA 1QJY2 1DG6A 3ROUA 2GNMA 3JCIA 4FPYA 4XFBA 1MS5A 4YGCA 3U0ZA 2V09A 4R9BA 1NA1A 3IMNA 1RUJ1 2DUQA 5JWPA 3MICA 4Z2WA 2EXKA 3D0JA 3G6JB 1DQ2A 3CU7A 4AI1A 3ZFFC 3VBSC 1H1AA 4WVMB 1URXA 1C5HA 4GWMA 5C33A 4D7TA 5GLWA 1MS9A 2HEWF 2ET1A 1LU2A 4LBQD 1RUJ3 5BNNB 2R1DA 3LKJA 1G7YA 4FT8A 3RPQA 3SISA 4DXZA 1JOJA 4QQOA 2P37A 2BWAA 2D5FA 1CAVA 4WM8C 4CDQC 5KXEA 1VALA 4QPGA 5JOXA 5FFOC 4FPKA 3WP5A 1DGRA 1LGBA 1PVC2 2VOKA 1NXMA 4YW3A 2GAUA 5DDJ2 1MZ6A 3M3IA 2ZHKA 4XIOA 5FRAA 2X29A 3I59B 4XJUA 3ZFFA 5DG2A 3VBSA 2WSUA 4C0HA 1PO22 4HKOA 1BXHA 5BY5A 4MXVA 1H2KA 2GC1A 1QNWA 5D8AB 4MXWA 3ZYIB 2QFEA 2EALA 3KGZA 3VLBB 5C4WB 1LB2A 3E97A 2VECA 3RRDA 4Y5Z0 1PK6B 2WT1A 1R091 2ZGPA 1SMVA 2WA4A 3EHKA 1H9PA 3MLLA 4WM8A 4CDQA 1Q8OA 2BTVC 1VR3A 4HKLA 2ARXA 1AVBA 2Q8OA 2XKPA 1AJKA 2GALA 1KJLA 5J09A 5AVAA 1R093 3AFGA 1VB2A 4ES8A 5JZGB 3SMHA 3AZVA 4UW5A 1CAXA 4JRLA 4MX3A 3VZNA 2DTWA 1LODA 2ZZQA 1YHFA 1EV13 3D8CA 5CG9A 1ZRRA 3H3UA 3VZJA 4PLMA 4EN0A 5T55A 4X6QB 2Q0AA 4HK8A 4KGGA 1WD4A 1NA1B 3LZZA 1LJ7A 3H3ZA 1RUF2 3AB0A 3T1LA 1OLRA 4AQTA 2X53S 5ABJC 1GV9A 4DS0A 1UL9A 1YI9A 1YUDA 2G9FA 2WT0A 4K3UA 1MQTC 2V73A 4IEZA 1WGPA 1UKGA 1DYPA 2ZMLA 3ACLA 3ZXAC 1I1EA 2ES3A 2ETEA 2YGMA 4NHMA 4OFGA 3BODA 5EYYA 3AZYA 3VHOA 4R52A 5I8SA 1CAVB 3H1YA 3MIHA 2ZGMA 5GKAC 5L7OA 2RS33 5CU1A 5LEJA 3INAA 3WUDA 4O9EA 5ABJA 3IT8A 2GNTA 5KHJA 1X8MA 1MQTA 2R062 3ZFFB 3VBSB 4CEYA 2PAEA 1Q3EA 3WT3A 3S7IA 2IXCA 3BB6A 4W6WA 1VJ2A 4JVAA 4ZXKA 5I8YA 3B9IA 5IK4A 4MXWB 2ZGKA 1ENRA 4EV0A 1UCXA 4I01A 3KM5A 3B3QE 2BFUL 1VBB1 1XU2A 2BNMA 4PIXA 1ZVFA 1RVF1 4B7KA 4E9KA 4WM8B 4CDQB 1J1LA 3MW2A 4IL7A 1W6MA 3TNQA 3OCPA 2DUOA 4COZA 1FX5A 1VIWB 3JBG1 2E6VA 4INDA 4KL1A 1G86A 4WVZA 1Y43B 2O0OA 3ZSLA 1GFF2 1RGSA 1VBB3 2Y0IA 1RVF3 1FOD1 2OUJA 3KCCA 1UPSA 2F4PA 2BFUS 4D3WA 5CA6A 4AW7A 1CAXB 2WS93 3JBG3 1MEC1 4LHKA 4OI0A 3MLJA 4DMIA 3WZ1A 4AHXA 2XPJA 1MS8A 2PLV1 2ZX2A 2KXLA 2VMHA 2YUEA 1GSLA 3FBMA 4L9BA 3NJZA 2XBO3 3MIBA 3DL3A 4HLTA 1YNAA 4XTPA 2GMMA 1CJDA 2GZWA 2ZOEB 4QQPA 2GH2A 4AQSA 5BNPC 2PHFA 3LWCA 2PLV3 2UU8A 4FO9A 2AYHA 3E5XA 1AR83 5CVRA 4AF9A 4H14A 4D94A 3M4FA 1PVXA 4OI2A 1A8DA 3HR9A 3MLKA 1WLCA 4MSVA 1VLNA 4DNYA 3ZMNA 1RUI1 1V6IA 3AYAA 4FPLA 3PVOA 2XG3A 1CR7A 3D4KA 1DQ1A 3PVBB 1ZREA 1HW5A 3RS6A 3TRSB 2A6YA 5ABJB 4MV2A 3QD6A 1YRZA 5BNPA 1RUI3 4F3JA 3AKQA 1LOEA 1O4YA 1MQTB 4XYXA 2RMU2 1IS3A 4RA0A 4LE4A 2D6OX 2JICA 3WINE 4JRAA 4AFCA 2VOXA 3NW4A 3EXUA 5FPZA 4PF5A 1BCXA 4MGYE 1AJOA 5L73A 3W59A 1F9KA 4N7IA 4Z8BA 3KLSA 4K1ZA 4XFIA 4Y24A 1U5XA 2HWD3 1C8NA 1DZRA 1HLCA 2PAMA 2WQ4A 1WBFA 3VZKA 4AEJA 1CPNA 2ILMA 1DGWX 3E6DA 4FXKB 2RM23 4KNCA 4S2HA 4MLOA 1W6MB 1NCQC 4FOWA 1HRV1 2XJUA 1QDOA 3NL1A 2ERFA 4M3CE 4X8NA 5I0SA 1MS4A 1X33A 4XQWA 4FPEA 2R32A 4Q4W1 4KG0A 3ATGA 5KHHA 1W6PA 5ACA1 2A6WA 1ND3C 2CV6A 2GN7A 1N3QA 3ETQA 1N1SA 4KU8A 5FO7B 3AZXA 1ENXA 1I6XA 3VBRC 1NCQA 3BTAA 1DFQA 4J1XA 1E57A 3DUIA 3PJQA 3SHRA 3ZSEA 1FXZA 3L9JT 1NOVA 3H50A 4LE3A 4LA2A 2VMGA 1UN1A 4KGQA 3NKGA 5GJ6A 2IXHA 2VW1A 2BUKA 3VL9A 4I09A 5T54A 5DUUA 5I0UA 3GF6A 3M70A 1YFYA 1HXS3 2MEV1 4URTA 4OHYA 2Z79A 1HV0A 2E7QA 4RL7A 3LB9A 1ND3A 2UURA 5T52A 1H9WA 1KS4A 3RNSA 4BMBA 1WLWA 1H2MA 3PLQA 4DQAA 5GZGA 3VBRA 3AKTA 2UY9A 5CADA 1ASJ3 1PO11 1S0EA 4XQ4A 1LOBA 4EN6B 2B9UA 3CF6E 3M3EA 4E4SA 5BNPB 2FHRA 5BPXA 4I0AA 1VBA1 1TMF3 4L2NA 3POYA 4IEUA 1PGL1 3KCYA 2K9ZA 5KHGA 1PO13 1POV0 4JAAA 4W6XA 4D69A 3O0VA 4WM7C 2DCZA 1Q56A 1VBA3 3AZZA 2XB6C 3JQXA 3ZDSA 3L2HA 1R1A1 1LULA 2PHTA 3K51A 4ONUA 3FX3A 1DIWA 3J26N 4HPKA 5C8CC 1RUG3 4OUSA 1FPN1 2FZ1A 2KM2A 2JECA 4QM8A 4R4XA 4FOQA 3D6EA 4IERA 2QZ2A 2VW0A 4KU7A 3ZSJA 4QT6A 3JBG2 1PZ8A 1WW6A 1R1A3 1ULEA 4QD2A 1CN1A 1NXD1 1LRHA 1GYKA 1ZNPA 3JUUA 4Q4Y3 5GZFA 1W6PB 1FOD2 1VRH1 1Z7S1 2UYAA 3MEPA 4CEWC 4WM7A 4U2AA 3JZVA 3HT1A 2ZAHA 5GLUA 1MEC2 3FLTA 4ISRA 3OGJA 4CP0A 1AYN1 1ENQA 1UW8A 1UPIA 3ILRA 4BWOA 1NCQB 2CWSA 4IEVA 4YGDA 5JVVA 4AVVA 1S1AA 1Z7S3 1CD3G 4C1WA 3V0BA 3RMYA 5C8CA 2CGOA 3PVNA 3OYWA 1RMU1 1ZM1A 2CY6A 4H7MA 1QJY3 2WNEA 2R1BA 4L8QA 5FPXA 1BBT1 1A3KA 1OOPC 1AYN3 4XW3A 4COYA 3O0XA 5T50A 2QNKA 1FI2A 4IV1A 4RD7A 1YIPA 3OD4A 1OA2A 5LRSA 5JI9A 1PGW1 3S0MA 1V00A 2WIIB 1RMU3 4CEWA 1ND3B 1LHWA 1Y3TA 3ZXEA 1PGSA 4F83A 2XKOA 3AMPA 3AX4A 1SBDA 2NP0A 1WBLA 2LTNA 3ELNA 2NYYA 3VBRB 1MS0A 1PVC1 1F8VA 1ZZBA 1JYIA 3WY6A 4HVRA 3SH5A 3IPVA 3WDTA 1S0BA 3WW1A 2BEOA 3APBA 4C90A 1PO21 1IS5A 3ZVXA 2H0BA 4YZ1A 1KS5A 4EROA 1OOPA 4NOTA 4NVPA 1NE6A 4GA9A 1PVC3 2LM3A 3W9AA 4CP1A 5DDJ3 2IXLA 2DFCA 3B7MA 1COV1 3UKVA 4FOYA 3WDVA 2ZKLA 3UK9A 1CJPA 2ARBA 3AZWA 2ZTNA 4E4DX 4E2QA 4G9SB 1PO23 2XJPA 2DYCA 1YWKA 2ZHMA 1CAUB 2WFF1 1LHOA 4ATEA 2PYTA 1U5YA 1KDKA 4GULA 3MIGA 1M4WA 4HPKB 3WCSA 4XBLA 1OA4A 5A33A 1YFXA 1HRV2 1ZZCA 3VBFC 2CGNA 4LBKA 3ME2A 1UD1A 1K5MC 4LA3A 1KFXL 2NLRA 2D5HA 3MW3A 4Q4W2 4WM7B 2CGPA 1XNCA 4R4ZA 1U5IA 3S7EA 1RHI1 4L99A 4HZFA 1Q43A 2BNOA 5ACA2 4XMAA 4NPRA 3X29B 4YFZA 3H7JA 5JCTA 5AFEA 2D3PA 3OJBA 1RUF1 1EYBA 2R071 3V0BB 4Y1VA 5C8CB 3OYWB 1JW6A 3AMHA 3O14A 3HWJA 3WQ0A 3AP6A 1D4VB 1A6CA 5CAZA 3VBFA 2XH6A 2BNNA 4AFBA 4K6BA 1OSGA 1RUF3 2YV8A 3MIDA 4YSFA 2JX9A 4IV1B 1K5MA 5EZWA 4BPZA 1IZ3A 2D40A 4JV4A 3T1MA 2IC1A 3KZ4C 2UWBA 4LHLA 2ZGSA 4CEWB 1DZTA 4XILA 2ZS6B 4B4PA 3B02A 3FC0A 1PMIA 4IEWA 4XBNA 2MEV2 4W65A 3MI8A 5LK5A 1MVQA 2ZGLA 1LU1A 3ZN6A 4B8EA 1MZFA 3JD71 1J59A 3IPVB 4GXLA 1X50A 2R061 5K8SA 2XUMA 5DUVA 1PO12 1WW4A 4JTOA 4M3CF 3M7AA 4HETA 1OOPB 3EO6A 5JMCA 3WG1A 1SCSA 1BK1A 2NMOA 4BIFA 1HIXA 4G3YC 5H9RA 3SCGA 1POV1 2ZGOA 3OD0A 4XBQA 2R063 1IGOA 1PGL2 4HVOA 3RMXA 2RHPA 5JOYA 3RI8A 2DU0A 1XYNA 2WSVA 4QXKA 1GLHA 2N7GA 3ZSKA 1SLCA 3KD4A 4QGMA 4RQPC 3UKTA 2PHLA 4DY3A 4CP2A 1WW5A 5A33B 1JYCA 3UL2A 1EY2A 3R6SA 1V6JA 2XLFA 2EIGA 3PJYA 4I30A 1FPN2 3SCFA 1LEMA 2SBAA 2ZKNA 4RFT0 3IKWA 1S0CA 2JDZA 5I91A 3VHPA 2YROA 2GN3A 5K9YA 2Z5WA 2A75A 1MS3A 2I45A 1J58A 4ZU7A 1YI7A 1VRH2 1Z7S2 2XVKA 1FAYA 1GICA 2JXAA 5H9SA 2WNVC 3WD5A 1OKQA 4RQPA 1AR71 4ITCA 3WUCA 5IUQA 1AYN2 3PVEA 3H1MA 3ZYGA 1FATA 2LUWA 4YW5A 2CYFA 3FBYA 1CQ9A 1W6OA 3VBFB 3KGLA 4LTAA 1RMU2 2VW2A 1K5MB 1ZZ9A 1BBT2 1JHNA 2XL7A 2YZ4A 2OYZA 1A78A 3OBRA 1QJU1 5J37A 1PGW2 3VBHC 2OA2A 4QMAA 3WP4A 1MVEA 1RITA 3FFZA 1C1LA 5L36A 4XFCA 1CGPA 3B5LB 2DCTA 3HMYA 1XRUA 2WNVA 3ZN6B 1CPMA 3WHUA 1DU3D 2EF6A 2DVBA 5EWSA 3U07A 4YVWC 2RMU1 2VXRA 3A0KA 2IFRA 1LOAA 1REFA 2A70A 3G7DA 2GC0A 5K7PA 1YJLA 3DN7A 4ISQA 4AHYA 3AP9A 4PDWC 1O3TA 3THPA 5JDBA 1S0JA 3RG0A 2RMU3 3J9SA 3AP5A 1QDCA 3VBHA 1AX1A 2EAAA 1COV2 5FLIA 3NAPC 2TBVA 2FZ2A 1RUC2 2WZR1 4F8AA 2VQ0A 2PTMA 3RJRA 4YZ4A 2ZGNA 2P3KA 1CESA 4YVWA 3NV4A 5HI0A 2DWRA 2WFF2 1HV1A 3ZYRA 4MGZE 1DGLA 3HBZA 1QH7A 2ET7A 1ONAA 2ZJCA 3SXWA 4Q4X1 3AXDA 4PDWA 4N7UA 3KT4A 2D3SA 2MPFA 1F5FA 2ZAAA 2H0VA 4HL0A 2PFWA 5KC5A 2GH8A 1QOSA 1OQDA 1ZBE1 1FNZA 2XL9A 4L97A 3L2YA 1AZDA 2ZGRA 3NAPA 4DRVA 5BXXA 1AX0A 4AGVA 1RHI2 2QE3A 3QACA 3WOGA 2HWF1 4RQPB 2D97A 5GLZA 3WQ7A 3KT7A 2R072 2A3YA 1X7NA 1W6OB 2AZ5A 1O3RA 4S2GA 3S30A 4OHWA 2D44A 3VKMA 3BU7A 4OULA 1JUIA 2PHUA 3NV2A 1LEDA 4FAGA 4RGGA 1V9U1 1BVVA 1ZBA1 2FMDA 2QDRA 4JDOA 1VBC1 2JE7A 3LCPA 4SBVA 2RR11 2W52A 3RWNA 4ZU4A 1PNFA 3CJIC 3FLRA 2ZPXA 4I3PA 3WDYA 2XJSA 2YC0A 2EXHA 2WNVB 1Q8VA 4GMP0 1VAMA 2OIIA 1RB8G 4UW3A 1G9FA 4D7SA 1V9U3 3N4MA 4FPFA 2JJ6A 4EWAA 4FPOB 2HWB1 3JD72 4X6RB 4XF0A 5JOWA 2YY1A 2JEMA 2Y38A 3CL1A 4NWVA 4Q0QA 4AEDC 4KWKA 1HX6A 1J3QA 2WT2A 1H8VA 3AP7A 4QQLA 3VBHB 4XFAA 2HWB3 1B35C 3I2DA 4KH9A 3CJIA 2QKDA 3GBGA 3IDEA 1LOFC 4W6YA 3MDPA 1IPKA 4YVWB 3QBQA 1IS4A 3E5UA 1NZCA 1V6KA 1G9AA 4YG6A 4YGEA 4B4QA 2ZZJA 4OZXA 2QZ3A 1QMJA 1BMV1 4PDWB 3O5SA 3LOBA 5E89A 4CYDA 3MIFA 2R0FA 5HCFA 4AEDA 2ZABA 3MZHA 2P34A 3WNXA 4AK3A 3SCHA 1N3OA 3DPRC 2JG9C 1B35A 5SV8A 2EXJA 2ZHNA 3NAPB 4DINB 1VP6A 1FOD3 1LOFA 1ULCA 4IQPA 3WDWA 4BM8A 1AX2A 4L11A 4U36A 1GNZA 1Q8QA 3MPPG 4YARA 5CBLA 3VHNA 4HSJA 5T5PA 1MEC3 2E53A 4Q4V2 1OHFA 2XWJB 3ES1A 5FO8B 2O1QA 4QQHA 1AR72 5FBZA 2RS11 4HBNA 4QX5A 5KHKA 4C1XA 5FLJA 1D2SA 4XIKA 5FDBA 3U4XA 5F1RA 3QOPA 2VH9A 1NYWA 4KQ7A 5KBFA 1HRI2 4LO6B 3DPRA 2JG9A 4Y22A 2IWGB 1QGLA 4XPVA 1QJU2 3S6PA 1DHKB 3PNAA 2AENA 4N43C 1BVP1 2OPKA 1RINA 4BYYA 2P17A 4NO4A 4AGGA 1UKRA 4GIQA 4QM9A 4LO7A 1NG0A 3AYDA 1KD7A 1UMZA 1I9RA 1RUD1 2A6VA 4FP2A 5DXDA 2DCJA 4HFSA 4D7YA 2ZX0A 1AXKA 4CDXC 4Z07A 3SH4A 4Y20A 2GMPA 3CJIB 1B09A 3CEWA 1MR5A 3BPZA 2BPA2 2DTYA 3FFQA 2ZBJA 2HKXA 4C0BA 1I5ZA 3AYEA 4YW2A 1C5IA 2PHRA 2VVEA 3ZIXA 2A3XA 1RUNA 1SLTA 4N43A 4YFWA 4B4RA 2WZR2 2E63A 4QGLA 4XXPA 3RJ2X 1DQ5A 2DVGA 1W0OA 1CX4A 3AYCA 3WDXA 3WQ1A 3WW4A 4K21A 1C3HA 4ASLA 5J98B 4AEDB 1M06G 4Q4X2 3LOIA 4LBMA 4P5HA 1HRV3 2TUNA 2OW4A 1X82A 3TN91 4HK9A 4CDXA 2B5HA 3N7JA 1B35B 2YGLA 2WLQA 4ASMB 1W0PA 1ZBE2 4Q4W3 3IBMA 4IV3C 2JKBA 1AYM1 1GANA 2MHFA 5ACA3 1OQEA 1D4M1 3VKLA 2HWF2 1QJX1 5AC91 2OZ6A 2ZX4A 4LLFA 3O0WA 1WD3A 4Q27A 4M0HA 4AG4A 2AUYA