5CFDC

Crystal structure of dtt treated human cardiovirus safv-3
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
258
structure length
258
Chain Sequence
SDRVSSDTAGNTATNTQSTVGRLFGFGQRHKGKHPASCADTATDKVLAAERYYTIKLASWTKTQESFDHIRVPLPHALAGENGGVFSSTLRRHYLCKCGWRIQVQCNASQFHAGSLLVFMAPEFDTSNHSTEVEPRADTAFKVDANWQKHAQILTGHAYVNTTTKVNVPLALNHQNFWQWTTYPHQILNLRTNTTCDLEVPYVNVCPTSSWTQHANWTLVIAVLTPLQYSQGSATTIEITASIQPVKPVFNGLRHTVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Genome Release Mechanism of the Human Cardiovirus Saffold Virus 3.
pubmed doi rcsb
source organism Saffold virus
molecule tags Virus
molecule keywords VP1
total genus 57
structure length 258
sequence length 258
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5cfdC00
2WS91 4GMP3 1AR83 5L7OB 2HWC1 1FPN3 1AR91 5D8AB 2R063 5C4WA 4GH4A 1C8M1 5GKAC 4Q4W2 1RUF1 3JD72 3ZFFB 2R042 1NG0A 1EAH2 1V9U1 1QJY1 4GMP1 1AR81 4CDQC 2RM21 1FPN1 4YVSA 1AL23 1ND3B 1TMF2 4GB32 4RQPC 1ND2A 5CFCB 1RUJ1 3ZFFC 1NY71 4WM7B 1QJU2 1RUI2 4NWVA 2RM23 4QPIC 4EJRA 2R071 2RMU1 1AL21 4WM8A 1NCRC 5ACA1 4Y4YA 5DDJ3 2HWF3 2RS32 4QPGC 1AR82 3JB4C 3VBSC 1QJX1 1RUE3 1AYN1 1BEV2 1PGL1 2RMU3 1R1A3 4GH4C 1NCQC 1TME3 1RHI1 1AR72 1POV0 5CFCC 5ABJC 1FOD3 2HWE2 5BNPC 1D4M2 5J96B 4CEYA 2R072 1X36A 4JGYC 3VBFB 1TME2 1VBB3 1R1A1 2RR11 3VBUB 4CEYC 3ZXAC 3CJIA 1RUF2 2QQPA 1X33A 1VRH2 1HRI2 3J8F1 5L7OA 1COV2 2XPJA 2ZZQA 1NA1A 3NAPC 1RMU1 4PDWC 4CDWB 5A33A 3LOBA 3DPRA 1POV3 4Q4Y2 1WCDJ 4FTSA 1HRI3 1BBT1 5DDJ2 4N53B 1RUG2 3ZFEB 5C9AA 3J8F3 1RUC1 3JD71 1RVF2 3ZFGA 1RUH1 3ZFGC 4Q4Y3 5JZGB 1BMV2 2DF7A 1ZBE2 1POV1 1HRI1 1ND3A 1ASJ2 1D4M3 1FOD2 2HWE3 1RVF3 1R093 1VB2A 4CDUA 5FMOS 3JD73 1VBC2 5K0UB 5BNOB 2R062 5A32A 1PIV2 1F2NA 4YVSB 1QJU1 1RUD1 1RUI1 4RQPA 2WZR2 5K0UC 4NWWA 4RR3C 1HXS1 5C4WB 1BBT2 1VBA2 1ZBA1 2HWE1 1PVC1 1EV12 1QQP3 3ZFFA 1VBE1 2RS12 1PO13 1RUH2 3TN93 4GB33 5C9AB 4N53A 4RS5C 1VB4A 1RUD3 3VDDA 2WS93 4Q4W1 1OOPB 1CJDA 1HXS3 1E57A 1EV13 4WM8C 1AR93 5J98B 2WWSA 4RS5A 2RS13 3VBRB 1EAH3 1C8M3 1QQP1 4RS5B 3VBSA 4RHV1 1VBE3 5C9AC 1PO11 2PLV1 2HWC2 2WZR1 4Y5Z0 4GB31 1V9U3 1OOPA 1AUYA 1AR63 1QJY3 3NAPB 1Z7S3 2HWF2 3VBOB 1NY72 1VBD1 1EV11 4RR3B 2R041 1F8VA 3JB8A 2HWD2 1EAH1 1RUG1 1R092 4YVSC 4RHV3 4CDUC 3VBFA 5C8CB 1RUC2 2RM22 2PLV3 4CEYB 1HRV2 1FPN2 4JGYB 1ND2C 2X5IA 2GH8A 1VBD3 2FZ1A 3HAGA 1RMU2 4SBVA 5JZGC 5ABJB 1QQP2 1H8TC 5ACA3 1H8TA 1RUE2 5FMOL 4RFT0 2WLPA 2RMU2 4YVWB 4IV1A 1RUD2 3ZFEC 4N53C 5ACA2 1DDLA 1BMV1 1AL0G 4PDWB 1NCRB 4CDWC 2WFF1 2ZTNA 1QJX2 1PGW1 1VBB2 1W39A 2MEV2 1PGL2 1QJY2 1RHI2 4WM7C 3FBMA 1NCQA 1B35A 1TMF1 3VBHC 1B35C 2XBO1 3VBUC 4AEDA 2X5IC 1RB8G 1FMD1 1ND3C 5FOJB 1PVC2 1M06G 1ZBE3 4JGZA 5BNNA 2HWB1 5BNNB 2BFUL 4CDQB 1RMU3 4Q4V2 1VBD2 1AL22 1PGW2 1GFF2 1TMF3 5AC93 3J8F2 2XBO3 1NCQB 4IV3A 1QJZA 1VRH1 4Q4X2 1FMD3 1BBT3 4FTBA 5D8AC 3VBSB 2BUKA 2HWB3 1RUJ2 5L7OC 3VDDC 1RUH3 1HQNA 5CFDA 2BPA2 3VDDB 4Q4Y1 1FMD2 4N43A 4FSJA 1PO21 4CEWA 1VRH3 2ZAHA 3JBG3 1MQTA 4QPIB 1OHFA 1RVF1 1AR73 1R091 1PIV3 5BNPA 1AR92 1H8TB 1Z7S2 4RQPB 4JGZB 4CDXB 2HWC3 5BNNC 5K0UA 1ND2B 2R061 1PVC3 4CDXA 2X5IB 1PIV1 1B35B 3VBHA 3VBHB 1RUF3 2RS52 1MEC2 3TN91 5BNOA 5C8CC 4CDUB 4RHV2 4GMP0 1COV3 4FTEA 4Q4W3 2XBO2 3VBOC 1MQTB 2RS11 4QPIA 4BCUA 1NCRA 5JZGA 1MEC3 4Z92B 4N43B 5LK7B 1RUJ3 2WZR3 3DPRB 1AR61 1COV1 1Z7S1 1C8NA 5A33B 5CFDC 1K5MB 1NOVA 4IV1C 4QPGA 4YVWC 2Y26A 2GSYA 2R043 2R073 4CEWC 1RUG3 1MEC1 1HRV3 1A6CA 5ABJA 4CDWA 5DDJ1 2HWF1 1NA1B 1VBC1 3S6PA 3M8LA 4CDQA 4JGYA 1AYM2 1R082 4IV3B 1QJX3 1RUE1 2HWD1 5C4WC 1AYN3 2VQ0A 1IHMA 1CD3G 4AEDB 2MEV3 1TME1 1HRV1 1RHI3 3CJIB 1AR62 1R1A2 3VBUA 1VBA3 5A32B 1VBC3 1FOD1 1AYM3 1R083 2TBVA 3VBOA 1VAKA 2HWD3 1VBB1 2RR13 2MEV1 2IZWA 4PDWA 1HXS2 5AC92 1PO22 2WFF3 1K5MA 4Q4V3 1VBA1 1ZBA2 2BBVA 1PO12 1AYM1 1R081 3VBRC 3TN92 1VBE2 4WM8B 4IV1B 1K5MC 4YVWA 1OOPC 3ZFEA 1BEV3 2HWB2 4WM7A 4N43C 1OPOA 4Q4V1 3JBG2 2BFUS 1MQTC 1ZBE1 1RUC3 2PLV2 1ASJ1 1AYN2 1BEV1 2RS51 4Q4X3 3CJIC 5CFCA 5BNOC 5C8CA 4AEDC 5AC91 2WS92 3VBFC 4RR3A 1D4M1 4IV3C 4CDXC 2RS31 4JGZC 5BNPB 1NA1C 3NAPA 1ASJ3 1C8M2 2RS53 2RR12 4Q4X1 3ZFGB 2FZ2A 1QJU3 1RUI3 1SMVA 1V9U2 4GH4B 1PO23 4CEWB 5D8AA 3JBG1 3VBRA 2WFF2 1ZBA3 5CFDB 1AR71 2RS33 4LLFA 3DPRC 3IDEA 4QPGB 1HX6A
chains in the Genus database with same CATH superfamily
4CCNA 1BCXA 4UF0B 3IMNA 3PU3A 1PX4A 2BGOA 1EPZA 1W03A 2XL9A 2XKPA 4O9GA 4LBQB 4KWKA 2UYAA 1ENRA 1P8JA 2QQMA 3F2ZA 2OPKA 1RUF1 2VUJA 3GM8A 3ZFFB 2R042 1O5UA 4NPLA 2PFWA 5JDBA 1ZRCA 1LHOA 2XJSA 3HMYA 4KG0A 1BVP1 4QXCA 2GC2A 3ES1A 1QJY1 5KHGA 4HANA 4QM9A 2H0BA 2J42A 3VHRA 2JE8A 4H55A 2WQ4A 4PIYA 5F3GA 1AL23 4GWMA 1MZ6A 4XHXA 2ZHNA 2E9QA 1H2NA 1ND2A 4OVEA 4YGCA 4TSVA 2PYTA 4CPBD 2QDNA 5IATA 1SACA 4AGRA 1RUJ1 2J22A 3ZFFC 1UOBA 4MVTA 3OGVA 4CVUA 1HQWA 1JU3A 1Y43B 4GIQA 4WM7B 2QQWA 5BNQA 3AZYA 4QPIC 4EJRA 2R071 4EROA 1UW8A 5HCFA 2ZX3A 5LATA 2QQOA 4E2GA 2WAAA 4Z2AA 5KWRA 1KDMA 2E26A 5FZAA 2EXIA 1W2OA 2LROA 2FHRA 3EJKA 5E16A 2FDIA 3K77A 2HWF3 2Y8KA 1JXNA 2AUYA 4XJZA 3NNGA 3B00A 2BV4A 2R0FA 2WNUC 4AFBA 2JDMA 3NJXA 1WMEA 2Z69A 1J3RA 1F35A 3VBSC 1W05A 1K3IA 3POBA 4HSJA 4A6OA 1RUE3 4CYDA 4QKBA 1YIPA 2RMU3 4PLMA 1JOBA 2VTXJ 5IVFA 1L3JA 1D0HA 4MO3M 1H1IA 3WP4A 2XGXA 5F6KA 2A6WA 3CNAA 1Y7BA 2GMEA 2Q8EA 3VKLA 5GZGA 2HEYF 3J7HA 3IDAA 4BXFA 2VW1A 3POJA 5BNPC 3DYMA 2J1RA 4D7SA 4DPNA 1GNZA 4BA6A 4YGEA 4Z1VA 1DZTA 1X36A 4JGYC 5DAXA 2ARXA 3O1TA 1TME2 4GWIA 4TWTA 4BQWA 1R1A1 4XZUG 4JRAA 5DAWA 5I0RA 4LOSA 3KV5A 3R05A 1VMJA 4P02B 5FYHA 1AXKA 4CCCA 3CJIA 1BK0A 3LDBA 1BQPA 2V73A 1F9KA 1NE4A 5L9RA 4U2AA 1SDDB 2D97A 3U11A 1XNBA 2VECA 3J8F1 4DS0A 3VKNA 5I8TA 3KLSA 2XPJA 1W06A 2PHRA 2AREA 1NA1A 3NAPC 4XQ4A 2QQKA 4Z82A 3MW2A 3OY8A 5LY2A 3WDXA 2A6VA 4N9HA 1W8HA 5LBFA 3M4FA 3KGLA 3WHUA 4EE2A 4L0PA 5JPMB 3HJRA 3WD5A 1IQDC 1VAMA 1H8VA 1XQNA 2CDOA 3S7IA 5FP7A 3JXSA 4HMZA 1IPJA 5FPLA 2HEVF 2IXCA 1JN2P 4RFRB 1YWKA 3ALQA 3AX4A 3NNMA 4Z07A 2AACA 4OHYA 2ADDA 5HV0A 3NL1A 1WD4A 3ZFGC 1W0NA 1QDCA 1Q8VA 1WW7A 2E53A 4Q1PA 5JZGB 5A1AA 3T30A 5I8YA 4KI5M 4YYOA 1BMV2 3LSDA 3O1PA 5FPAA 5ANQA 3VD9A 3AVRA 5BYNA 4JV4A 1W6OA 2YZ4A 4LNVA 4AWDA 1RVF3 3BCWA 1Q8QA 2VPVA 3O1VA 2J1SA 2HEWF 2VUDA 3JD73 1VBC2 5CYYA 5FZDA 4ES8A 1CR7A 3FUOA 5D1IA 1RJ8A 3AZWA 5A7NA 3SITA 3ZXFA 5CKMA 5EYYA 4NPRA 3I54A 3RG0A 1PIV2 1F2NA 1TNRA 1RUD1 5JVVA 3UKNA 2WZEA 5LA2A 1HKDA 3GZEA 2D6PA 4I0BA 4JX0A 4NHKA 1JI6A 1ZBA1 2ZGSA 3D3AA 4G3YC 4X8PA 2HWE1 1PVC1 5FLJA 2VNVA 3ZFFA 3RZGA 2Q0AA 1CAWA 5TSWA 1RUH2 2YB7A 4LHSA 4NVPA 3HD8B 4DNYA 4GB33 4DUXA 2IVIB 1GR3A 1KS5A 2G1MA 4N53A 4RS5C 2WS93 1MS0A 2OW4A 3OGJA 2LUWA 5K8SA 2CGOA 3RZHA 3AKRA 3AMNA 4WZCA 3TWIA 1HXS3 1E57A 1EV13 3M3EA 3O14A 3IDBB 1F4AA 2WWSA 4R4XA 5J98B 1JZ4A 4K9SA 1VMHA 1YUDA 2GH2A 3PVBB 2Y33A 4YZ5A 4LO6B 1PO11 3EHKA 5JXHA 1A34A 3C2UA 1ULOA 3DGTA 4Y5Z0 2Q30A 4GB31 1V9U3 1UN1A 5FMBA 3NAPB 5F2WA 1OXCA 1MVEA 4BPZA 1VP6A 1UKRA 4R4ZA 3ABZA 1VBD1 2WQ8A 5GLVA 5FBZA 2VW0A 2W1UA 5IT6A 5FTTC 3WINE 4A7ZA 2VCMA 1F8VA 1X7NA 2E32A 1I6XA 5CEHA 1CX4A 5F3IA 4YVSC 4AFAA 4CDUC 5A7OA 3ZOIA 1FI2A 4NOTA 5C8CB 1C1FA 1O59A 2ZCWA 3WUDA 1OKQA 3NV1A 1GICA 2PHTA 5FIXA 4QQOA 1QOOA 4IGQA 2GMPA 3O0WA 2PA7A 1XJAA 1VBD3 4IE7A 1YLLA 3LQCA 2VC9A 4YW4A 4AQ6A 1H8TC 4HFSA 4IL7A 1H8TA 1RUE2 3H3ZA 5FY0A 3BIWE 1N3QA 3CBNA 3CL1A 2WLPA 4R9CA 4WVMA 1KQRA 2NMOA 1YJKA 2LTNA 2DCTA 3NJVA 5G05L 4GWJA 1GZCA 2WNUB 2X29A 5L36A 1FATA 5ACA2 1JYIA 1I3HA 2ZEZA 3FX3A 4JHTA 1LODA 2QQVA 1BMV1 4F8AA 5LBEA 4P08A 3HOBA 3UK9A 1LHNA 1QH6A 2VZTA 2VY0A 4KQ7A 4URTA 1DQ5A 3ZDSA 1W39A 2MEV2 3OYWB 2XWBB 1PGL2 5DG1A 2G4IA 4NHLA 2PTMA 3FBMA 5A70A 3VL8A 2P3JA 5D21A 5A3TA 2VTFA 1LGBA 2XBO1 1UMHA 3VBUC 3IPVB 2X5IC 1OH4A 2C26A 3KWVA 4MGZE 5C33A 3ATGA 2A75A 4KGQA 3I2DA 2JDUA 4BYYA 1J1TA 1PVC2 1Q8SA 1M06G 1MS3A 1OD5A 1D2QA 1ZBE3 3MHZA 4HKOA 1AXYA 3HT2A 4JGZA 4BB3A 1T2XA 3BIEA 2FCVA 1TZOA 5GZFA 5A3LA 5JSOA 4QXHA 5JOWA 1CPNA 3NMBA 4NHYA 1AL22 3N7JA 1PGW2 2R30A 4AE2A 1IOAA 4IGPA 3W20A 1OMIA 4FVVA 2VCCA 3POSA 2YC2A 2PAEA 1BBT3 2OKXA 1S55A 3LFIA 4PF5A 2HWB3 3OYWA 1RXFA 3K4AA 4Q27A 4Y26A 2DTWA 5HCHA 1S1AA 3VDDC 1L7QA 1W6MB 1APNA 1MS5A 2ZPXA 1OT5A 4HK9A 1MS8A 1LEMA 3POIA 4XILA 3WDTA 3JU9A 5CVRA 3VDDB 1FMD2 4FSJA 3KMHA 4O9EA 1NX9A 3O1SA 1I1EA 1PO21 5K7PA 1VRH3 2R7EB 2WO2A 1MQTA 2J7MA 4QPIB 1OHFA 2Y0OA 1FAYA 2EIGA 4P9XA 4QGLA 1AR73 2ZGMA 2VZ1A 5F37A 5BNPA 1U5XA 5JPNB 3FN9A 3MUZ1 4Q0UA 2XHKA 2VCAA 5C8WA 5F6LB 3RPQA 2OIIA 3CU7A 4QX5A 2ET1A 4LUMA 5KHKA 4XE9A 3WF2A 5BNNC 4Q29A 3FFQA 5K0UA 1ND2B 3DKQA 2WT1A 1PVC3 4YRDA 3LDKA 1PIV1 3ZN6B 1B35B 3TYJA 3VBHA 5FMDA 3I2HA 4MX3A 4P5HA 4LBKA 4JHZA 3LF7A 3TN91 3U37A 1NAEA 3ZX7A 1U5YA 3ZPYA 4KMQA 2XR4A 4IE6A 1WW6A 1JYTA 1JZ8A 2XBO2 1LGNA 3FL7A 5B4XA 5L9BA 3G7DA 1NCRA 1MEC3 4QDRA 3FE5A 3VKOA 4XCAA 1O4YA 1RUJ3 4R8HA 2YG0A 4J6GA 1W9SA 3ILRA 1Z7S1 3LKJA 1BXHA 2VBPA 1K5MB 2A1XA 4PJYA 2DVDA 1WCUA 4HPKB 4XZPA 4BQYA 2IWGB 4D69A 2VOVA 2ORZA 1UD1A 2KM2A 3MV01 4I3PA 4CEWC 4QHOA 2FDHA 4A41A 4LJHA 2VULA 1MEC1 2C9AA 3C8XA 4LBNA 4UYBA 2BEOA 5FYUA 2XJTA 3VD3A 3LEIA 4LE4A 5A7WA 4O7XA 4XBQA 5F7UA 2VMDA 4RN5A 1H6XA 1QMJA 1AYM2 1GQGA 2GN7A 1HB1A 2OYZA 2CSGA 1A8MA 1GU3A 4S2HA 5FWEA 5C4WC 1AYN3 5K4LA 1OPMA 1RL3A 1TE1B 2VQ0A 1IHMA 2W0XA 3K51A 4K7JA 4N7UA 4HKLA 4E2SA 4O61A 1XYPA 5JWPA 4LHKA 4MXVA 1R1A2 1VBA3 2CL2A 4BE3A 4XFCA 5FYYA 1VBC3 5FZ7A 1DZQA 2DUOA 2TBVA 1SPPB 3KV9A 1W8NA 3E6CC 5FZ4A 4JRLA 3ZSEA 4CA9A 1PM4A 5KHJA 4XFBA 1FV3A 1W3VA 5FZ1A 3ETQA 1K5JA 4Q0PA 4IEPA 1OUXA 3GNEA 1LOFA 5CA6A 2RR13 3J7NA 4LIVA 4OI4A 5FZIA 5FOBB 1YO8A 4H7MA 5FZKA 3AVSA 1PO22 3H0OA 1K5MA 1PMHX 1ZBA2 1OH3A 3KB5A 1R081 2C4XA 2EALA 3TN92 5CU1A 5CADA 1GV9A 3KF5A 1SFPA 2Y60A 2JDHA 3RMYA 5KHIA 1W9FA 5E1RA 5E88A 1VRBA 2VVDA 1MS1A 1X82A 1PX3A 4BMEA 1ZZBA 2HWB2 4HN0A 4CUAA 2YC0A 2GMMA 1DG6A 5B4NA 2WA4A 1YQCA 4N43C 3E1F1 3IDCB 2VZ3A 4H7LA 5CB7A 1G9DA 1DIWA 4KGGA 1S0DA 4OULA 4P9WA 1RUC3 3CKHA 1GNYA 2PLV2 1NYWA 1SFYA 1JUHA 2ZABA 4LMFA 1AYN2 4HSLA 4QX8A 1UY4A 2XWJB 4K8RB 4A3ZA 2JDNA 1YI7A 2JKXA 2RJLA 3MBWA 4MLOA 4RGKA 4AEDC 4CRQA 5BNOC 1J58A 2PXJA 5C8CA 3GDBA 5FYIA 1JZ5A 4RYDA 3AZZA 4META 2V5YA 3GJBA 4W6XA 5FP9A 1S0FA 1W6QB 1D4M1 5CKQA 3L2YA 4RSUA 2RHPA 1XSRA 5LCWL 1WLCA 1NLQA 2RS31 2NN8A 3T0BA 1XE8A 1EYBA 1NA1C 1LESA 1C8M2 2A71A 2RS53 3GZAA 3NAPA 5F9TA 1CAVA 1YI9A 1DGRA 1H2KA 4UW4A 3M3QA 3ZFGB 2FZ2A 1QJU3 3N9QA 4ITCA 3MLKA 4UT5A 1PO23 2PMWB 5IVBA 2HYKA 2OQ7A 2B5HA 1MZEA 2Y6JA 1HQLA 1Q56A 3PUIA 2VJXA 4CPBA 2DYCA 5AFBA 1UF2C 1UMZA 3MIHA 2X8KA 3ILFA 3SISA 4BMBA 4JQTA 5JUVA 4QPGB 3FHIB 2DCJA 5T52A 5LRRA 4BM8A 4ATFA 2CGPA 1VR3A 1ZZ7A 3U14A 3M3CA 3ZKUA 1AR83 1KITA 4QB6A 3FLRA 5EIYB 2F4PA 1LR5A 2DU0A 2ZEYA 1PK6B 5GLTA 1LU1A 1RTVA 5C4WA 4FPKA 5EP9A 3OB8A 3FLTA 3I3DA 4G4FA 1QJFA 2PHXA 1LOBA 4Q4W2 2B39A 3JD72 3LA2A 4AW7A 4YW5A 1NG0A 2BOJA 4LK7A 1EAH2 1V9U1 2GP3A 5KXDA 1XU1A 3KV4A 3AYEA 1L7RA 4JAAA 4FPOB 2FD8A 3IPVA 3P1IA 1XB9A 3JQWA 2JDYA 2WT2A 2JB4A 4P5YA 5L9VA 1K42A 4Y5TA 5FY7A 1ZZ6A 3V64A 5FO8B 4RQPC 3WV6A 1UZZA 4NRQA 1T6BX 4AHWA 4Y1XA 1UX6A 1NY71 2BU9A 4QWNA 3CO2A 3LOIA 4ARXA 2I2SA 2VG9A 3NWKA 4XCBA 2RM23 1UX7A 2DCKA 1W0OA 5HCAA 3LGRA 1JYWA 5JMCA 1I9RA 5J36A 1AL21 4FP3A 4V2VA 2BZDA 1SLAA 1AHSA 4XTMA 1ZX5A 4WM8A 2ZGKA 3WG3A 4NHXA 1GYKA 2XLAA 1NCRC 3MW3A 4UF0A 4C1WA 3OBZA 2W2IA 5DDJ3 5FP3A 2WWUA 4LK6A 4GAZA 4QX0A 1LB2A 4XOGA 3NW4A 1W8ZA 4OCTA 5K0UB 3E5UA 2IXHA 1AR82 5DPNA 2VQTA 1QJX1 1W2TA 1YXWA 2DBNA 1AYN1 3ZMOA 1RINA 3OF1A 3GXUA 3J9SA 3VHOA 1HLCA 4XUPA 4NROA 4LTAA 3AJYA 3RI8A 5CFCC 1YQ6A 5LWBA 2NQYA 3NVCA 1NT0A 3E6BA 1D4M2 4MXWB 4DXRA 3OPWA 2JG8A 3AP7A 4DXZA 2QE3A 2JIJA 1XU2A 2QCSB 3MYXA 4JKKA 2JG8B 3H1YA 2Y6GA 3HPNA 3VBFB 1OLMA 2ZACA 3I8TA 4FCAA 5GLZA 5IHRA 3AKSA 3KT7A 1UIKA 4MH0E 3WP6A 1XE0A 4CCKA 1S0IA 4AVVA 3POEA 2R32A 2V5DA 3E97A 1NXD1 1C3HA 2AH2A 4X6QB 4W6YA 5IVEA 3WNXA 2Z42A 1RUF2 4ZHNA 2ZMLA 1UYPA 2QZ3A 2VBBA 1PZ7A 4DEVA 3S5AA 1ZRDA 1FT9A 4CU8A 3PUHA 3P3PA 5C71A 4FAGA 5IK4A 3CLPA 2IFWA 3H7YA 1XNTA 3CF6E 4LHNA 4D6RA 1AX0A 4DOUA 2KR2A 2YROA 1AJKA 1W99A 4FFHA 4AZZA 4Q4Y2 3QOPA 2Q8CA 4FTSA 1BBT1 4DY5A 4N53B 1RUG2 2XONA 3UYJA 3ZFEB 4BQXA 3R4DB 4NIIA 1J1LA 4AI1A 4F83A 2X09A 4PLOA 1UZVA 2YBSA 3JD71 1RVF2 1G9CA 1RUH1 2CV6A 3ILNA 2ZGPA 3TBDA 1JYNA 1GWMA 2ZJCA 3BB6A 2VGDA 1X9PA 2DF7A 1LOEA 4MGSA 3T09A 3MIEA 1POV1 2D44A 4NAOA 4YG6A 2DVAA 1HRI1 4AHZA 4Y20A 1D4M3 2FDJA 2X05A 4OHVA 4EYUA 2FQPA 4HLTA 3S57A 1V6LA 2WABA 2XJRA 1W9WA 2ILMA 4MUVA 4NRPA 4CDUA 1AX1A 1ULDA 5FMOS 4A42A 4YZ2A 2ARAA 2P4EA 3LAGA 4WVWA 1UQXA 3G6JB 5JR7B 3WF1A 4LPLA 1QU0A 5FBJA 3WF0A 3S7EA 4RA0A 1WD3A 4IGOA 4YPJA 4RR3C 4BK4A 4IEZA 3RDIA 5C4WB 1WMDA 3P6BA 1VBA2 2WQZC 5C3QA 3OPZA 1JHNA 3HQXA 1ZZ9A 4E4HA 4XDPA 4C91A 3O1RA 2AR6A 1R1ZA 3LA7A 4N90A 4UFJA 3T4VA 3A22A 4XFGA 3HBKA 3MDPA 5DMYA 2LW8A 3I2KA 2W92A 4HBNA 4YFWA 4R52A 5FJKA 1BLZA 3VDDA 5J37A 1OOPB 2EXHA 3WQ1A 5FPXA 3IBMA 1UPSA 3NNJA 3PURA 4XQDA 3VZNA 3NRUA 1O3QA 2YYOA 4H14A 4WM8C 4QXKA 1AR93 4X6RB 5FRAA 3PIGA 4Q2FA 2WZ8A 3ASIA 1EAH3 1OQEA 1QQP1 3BU7A 5A3NA 5CG9A 5C3OA 1QNYA 4NIHA 2VZQA 5C9AC 5EYXA 1CZVA 2D3SA 2VAUA 5J1XA 3GCXA 4P9GA 4A2UA 2WZR1 3CEWA 1WCKA 1H1AA 1UYYA 1H9WA 2DWRA 1QJY3 3EXUA 3LWCA 1O4ZA 3PL0A 4Q5OA 4XUNA 1UY1A 3DL3A 4DXTA 5FYBA 3IAPA 2YGLA 3I59B 5JIUA 2RDNA 3JB8A 4JDNA 1EAH1 3PVEA 4IEQA 4KG8A 3M2MA 1GSLA 2WO7A 2Z2SB 3B9IA 2RM22 2Q4SA 4AQ2A 5IAXA 1L7LA 2PLV3 4LBJA 5IW0A 1U5IA 4CEYB 5EQUA 5KHHA 3BVCA 3WW4A 3VKFC 1CONA 1OSGA 1C5HA 5CZKA 1F15A 4D6QA 4K3UA 1GANA 3AKTA 1W8TA 3THDA 4KU7A 1SZBA 3DECA 3RZMA 3UKTA 3EB7A 1VIWB 3BTAA 5EWSA 2JD9A 2J1EA 4LBLA 1N1YA 2VD7A 2C5DA 1Q5OA 2XXZA 5FMOL 5FYVA 4FOWA 4RFT0 3KM5A 5FCCA 2BDRA 1IKPA 2BBAA 3AYCA 5LB6A 2ZGNA 2WINB 1RUD2 1W8UA 4N53C 1JYXA 4B7EA 4ZZ5A 4DRVA 5JAXA 4DRRA 1WA6X 3AMHA 2GNBA 3ON7A 4FI9A 2Y6KA 4XMAA 2R49A 4QGNA 2E7AA 1AL0G 2HBUA 2JEMA 4JVAA 4AEJA 1W2AX 2LS6A 3OSDA 2ZTNA 4TLGA 1QJX2 3UGHA 1PGW1 1YFUA 1WA4A 2VZVA 2J1AA 1LCLA 3M7AA 1JU4A 1VALA 1O6UA 5DUXA 4BIFA 4LULA 5E6HA 3IT8A 4Y22B 4BJ0A 3ZO0B 3MIFA 2WFPA 3M70A 1Y3TA 3T2PA 5IK7A 3VBHC 1W6NA 2P2KA 1YIFA 4AEDA 1RB8G 1FMD1 5L73A 3AP9A 2JG8C 4Q0QA 3BUCA 1NKGA 1V6KA 4XJAA 3SLIA 1W8OA 1UOGA 5BNNA 3AXDA 1N1TA 3BODA 4FQ4A 4IEUA 5T5LA 2Y64A 3DV8A 3I3EA 4Q4V2 1UNBA 1VBD2 1IGOA 3ITQA 2WNVB 4M0HA 4BXSV 4E4SA 3BOWA 1YNAA 4EZ4A 1GFF2 1TMF3 4YZ3A 3JUUA 5AC93 2XBO3 4IV3A 1QJZA 4LKEA 3OEAA 4L9BA 4CXYA 5D8AC 3PTRB 4FTBA 1PK6C 4C0BA 5GLWA 2ZS6B 1RUJ2 4UBHA 2D6KA 3N36A 4COZA 3DXTA 3CDZB 3SH3A 1X9TA 4KWLA 4QXBA 1QKQA 2GP5A 4MGYE 3D4KA 1G8WA 3ZSJA 1C4RA 1KS4A 1W6PB 1IQAA 1GOFA 2BPA2 4Q4Y1 4FPCA 1ZVFA 3TAYA 4B1LA 2P6HA 2A3XA 1CIYA 2KD7A 2R1DA 1ODMA 5BV6A 1W8FA 3FJSA 5IVJA 4UFMA 1LOCA 1S2EA 4NRMA 4JTNA 2E33A 3B01A 4HL0A 1Q3EA 5T5PA 2CYFA 4A7KA 1OFNA 3LE0A 2XLFA 3WDVA 1W3XA 2A6XA 3MLJA 3I3MA 2B9UA 1Z7S2 2GC0A 4P14A 3HIFA 4D7YA 1C57A 5KC5A 2FDKA 2V09A 4XHBA 1OVSA 1X8EA 2HWC3 2X10A 4UFKA 3HNMA 4TLFA 4XIKA 1SFNA 1NE6A 1WBFA 3OUJA 3SNMA 1HN0A 2R061 1LJ7A 1MACA 5A6ZA 5JOZA 1BK1A 3MF6A 1BKZA 4Y1UA 2VR4A 1WKYA 3AB0A 1F5FA 1YFXA 1QIQA 1MEC2 2VOTA 3ME2A 4V1PA 4B4RA 4A4AA 2HKXA 4FPJA 3KF3A 5BNOA 4JDOA 5C8CC 4CDUB 4FPFA 3OBTA 1COV3 4GMP0 4RHV2 4ZS2A 3VD7A 5I93A 1TG7A 4XDOA 4Y1VA 1O8PA 3TOJA 3W5NA 2J1UA 5FJHA 2XL7A 3WY6A 1QHDA 1MQTB 4QPIA 1DGLA 3CQOA 2QJVA 4K20A 3N9OA 1VLNA 5LK7B 2DBIA 5B2GB 3T08A 2XUEA 3I2FA 3TRSB 1DYOA 1XNKA 1W6MA 1SCRA 1AR61 2ZBJA 3VD4A 5LA9A 1BVVA 3OY8B 4ORFA 4A45A 2WA3A 3E6DA 3MPBA 5BPXA 2P6CA 1OLRA 3OUHA 4AYUA 1OI6A 4CCOA 1RUG3 5FZEA 3P3NA 4I09A 1HRV3 5HXMA 5FXZA 2AEYA 1A6CA 4HK8A 4CDWA 5ABJA 2HWF1 1S2KA 2W91A 2VNOA 3LCPA 3MIGA 2QBXA 1VMFA 2I45A 1J84A 2PN5A 3O5SA 1YQ2A 4JGYA 1QGLA 1R082 3WG2A 3I3BA 1LKNA 5FZOB 2IC1A 1QJX3 3H8OA 1LULA 2PHFA 3R6SA 4BQ5A 2FMYA 3TB0A 5FPBA 4CP0A 4I02A 3Q8AA 4NIDA 4AI8A 3RVHA 1HB2A 2HH9A 4PHZA 1RHI3 4UFHA 5LA1A 1REFA 1DF0A 4Y4RA 2SLIA 3VBUA 1ENQA 5A32B 5F5AA 3OJBA 3KHCA 3DEMA 3EQEA 3S30A 3VBOA 1LHUA 3OCPA 3U1XA 1S0EA 1W6NB 1JH5A 3RWNA 4J1XA 4QQLA 1KJRA 5F3EA 4CE8A 3LD8A 3O1OA 1W04A 4Z2WA 3MIBA 5JMOA 4PDWA 5LY1A 5H9RA 2ZX4A 5ANNA 3VZJA 4Q4V3 4IE4A 1VBA1 5I0UA 3KD4A 4FOYA 3B5LB 4XVHA 2JDKA 5FYSA 2KXLA 2PHWA 3B93A 1RXGA 1WW4A 2OQ6A 3MFCA 2ZX2A 1JODA 1OF4A 3PNAA 3OBRA 4IV1B 1CPMA 1K5MC 1CVNA 1Q8OA 2CDPA 1BEV3 4JKLA 2TNFA 4XAAA 4XFAA 1PGSA 4M4PA 3TEXA 3UJOA 4HXCA 5FREA 4AVCA 4QB2A 4WM7A 3RZKA 2Q8OA 5FZHA 1OPOA 1UY0A 1HN1A 1TNFA 3U07A 1URXA 3JBG2 2QQIA 3IZOA 1GZ9A 5LK5A 4ARYA 4PQ9A 3MPPG 4I30A 2ZGUA 2EIDA 4Z8BA 1S0BA 3OG2A 5EV7A 4BQ4A 2O0OA 3GZUC 3AL6A 5FAXA 5FP4A 3K2OA 4EN0A 1CAXA 1Y9QA 1YRZA 5FY5A 3LIGA 1A78A 1BHGA 1ODNA 2BNOA 2E7QA 3BYWA 4GWNA 4AQSA 2D6LX 1Y9MA 2GNDA 2JD4A 2X53S 5AC91 1G9AA 5A80A 2XG3A 4H2AA 1DQ4A 2EIEA 4BK5A 2BOIA 4RR3A 2DVGA 5HI0A 4IV3C 4CCDA 5CKNA 4HG6B 3HWJA 3T1MA 1I5ZA 3GHMA 3LEGA 3QLQA 2WDBA 1C5IA 4MV2A 1ULPA 1ZA4A 2NYYA 5A6QA 4UW3A 5JI9A 1RUI3 3A0KA 1XYNA 2PQQA 4B29A 4BHPA 1V9U2 2O8OA 4GH4B 3ZIWA 4CEWB 4MGIE 3LEKA 4XABA 3DYOA 1RIRA 5DN2A 5C7GA 1ZBA3 1G6NA 1WMFA 3VHNA 5LASA 1GZWB 3LFMA 1O7FA 1JHJA 5FKBA 1UXXX 1W9TA 2EF6A 4FFIA 2V72A 4GULA 2UWCA 1V0AA 1V6IA 1PHMA 4Q8KA 2VQUA 4AI9A 3N3HA 3ORJA 1HB4A 1G9BA 4OI1A 5IVYA 1Q8PA 3AC0A 4PT6A 3OPTA 4BOWA 1YFYA 5I0TA 3TEWA 1UPIA 5FY1A 1HIXA 2P5BA 2R063 4GH4A 3VD5A 5LZ6A 2ZGOA 1SCSA 4Y24A 4YGDA 3VV1A 5FQ0A 4XW3A 3V56A 5GKAC 3NSTA 4B1MA 2JG9B 2VZUA 3V0AB 2W95A 3N35A 4QDQA 2ZGTA 4AOCA 1O3TA 2A6ZA 4W50A 2VXJA 3N4MA 1XSQA 3THTA 4ONUA 2G9FA 4GMP1 5M0TA 1AR81 1CJPA 2RM21 3GZTB 1FPN1 2E63A 2DDUA 4PBOA 4PIXA 4YVSA 2UURA 3HR9A 1AX2A 3VL9A 4AQTA 4PIZA 4GB32 1CZSA 1GOHA 5FZ0A 2VO5A 5EJ1B 3ZVXA 1OVPA 3I2GA 5CFCB 2Q5TA 2VBDA 3ACLA 3WP3A 2JG9C 4GALA 5T3NA 1SDWA 3ZYBA 4M4RA 3C7GA 1RUI2 3EYPA 5F2SA 2WUHA 4NWVA 5T5JA 4ATEA 1DQ2A 4OI0A 3H3LA 2EA7A 3T0AA 2W9XA 4BQ3A 1ULCA 2VL4A 4LE3A 4EN8B 2GC3A 2LRPA 4I0AA 5L19A 1JUIA 2F6BA 1AXZA 4L11A 4QPYA 4XBNA 5APAA 5JCTA 1IZ3A 4M3CA 2RS32 4QB1A 4DQAA 2ENRA 3BKZA 1M4WA 4Q0SA 2W1QA 3SXWA 1U12A 5LBBA 5LW9A 5CAZA 4KBBA 3JB4C 1OC1A 4B4QA 1VAVA 4EWDA 4NE9A 3HNYM 3LEMA 3D0JA 1YEWA 4RL7A 2YC4A 5JXGA 4GH4C 1NCQC 4DIQA 1WCQA 2FDFA 1SBEA 3O0XA 1E5RA 1BYHA 3IAQA 3LZZA 3OTFA 1K12A 5FYTA 4BU2A 3K46A 5A3OA 3AM2A 1POV0 3BGAA 5F1RA 3ZR6A 1UOJA 4KWUA 2TEPA 4GXLA 2FBEA 5IVVA 2NM1A 4XFHA 2WSUA 3WQBA 3MEPA 3V0BA 2R072 1LHVA 1E5IA 3ZXKA 4PI0A 4YG3A 3WP5A 5FDBA 1CAUA 2AYHA 1VBB3 3Q9OA 3VBUB 4BDVB 2VOKA 3WHTA 3ACFA 2JKBA 3KT4A 2JG9A 3E5QA 4XETA 3ZXAC 4YW1A 4D94A 1VPHA 1CESA 3ACGA 4DMIA 3IIAA 1KXGA 1GZTA 3WNKA 1CIWA 2ETEA 4QU1A 4NMIA 3UGFA 3PJYA 3AZVA 2ZOEB 1PZ8A 4FOQA 1X33A 2GAUA 1VRH2 2VUCA 4AFMA 3ZYPA 5A3PA 1HRI2 4ES9A 5C3RA 1S4CA 5L7OA 1JOPA 3MIDA 1COV2 1XXNA 4FBFA 1XPWA 5ERLA 2ZZQA 1W8WA 1RMU1 3ZXLA 3CHXA 4LKSA 3C7FA 2VZSA 4CP1A 4CDWB 3CIHA 1V6NA 3LOBA 2HBTA 5T5OA 1SLBA 3H9AA 3VDAA 3DPRA 2IXJA 4PI2A 1POV3 4Y1YA 2YPJA 1WCDJ 1ZNPA 4OUSA 4P9IA 3UETA 5DDJ2 3N7KA 5DUWA 3W58A 2B4KA 3RZZA 3T4HB 3K48A 4XUQA 5C9AA 2CTVA 1S0GA 3A7QA 3H1WA 4OHXA 2JICA 3RGBA 4QD2A 3USUA 2EICA 2ZGQA 1MR5A 4N9IA 3J26N 4NN0A 3KCCA 4PCRA 1CX1A 4ISQA 3WG4A 2CWSA 2D40A 4AF9A 3RZLA 4GJZA 3H7JA 5GALA 5JIAA 1UCXA 3RNSA 4Q4Y3 1H0BA 1ZBE2 1NZIA 2YHJA 5DZGA 1ND3A 5FY9A 4S2DA 3IB3A 1ASJ2 2P3IA 1ZREA 2JXAA 4W8JA 1FOD2 1UYXA 2HWE3 5FY4A 1PNFA 4YM0A 1VB2A 1Z0HA 4UXAA 5DAVA 4GJYA 1SLCA 4K6BA 1S0JA 2VUAA 4BISA 4XF9A 5BNOB 1LAJA 2R062 1SBDA 1FX5A 2IXIA 4MADA 4UFIA 3WT3A 3N9MA 3ZSLA 3ZN6A 2WIIB 1RUI1 4RQPA 4YVSB 3RWKX 2DVBA 3BN6A 5FUIA 5K0UC 3BTZA 3X29B 4A44A 1HXS1 1UIJA 3SCGA 1EY2A 2XLGA 4YW6A 3VZKA 2OZ6A 4CP9B 1OLQA 4M3CF 5FUNA 5FZOA 4D7TA 3WCRA 1C1LA 4DO0A 4O65A 1VBE1 2RS12 1PO13 2GN3A 4CP2A 2C6SA 4CU6A 3TN93 1SQ4A 3AKQA 2K0GA 1VB4A 1RUD3 1MS4A 1QY4A 4Q4W1 2VH9A 2J1VA 4I3GA 2VQAA 2N7GA 5IYYA 1DLLA 2IXKA 1J3PA 5F5CA 2MPFA 4BLIA 4Q0VA 4RS5A 4XURA 3VBRB 4FT8A 2WJSA 1OUSA 4N7IA 1UOFA 4R9AA 4RS5B 2GALA 4XQWA 1F5JA 4M00A 3WUCA 1RUNA 1LGCA 1GZWA 4ASMB 4RGGA 1AUYA 3VZMA 1Z7S3 3GJAA 1BZWA 3J7LA 4XPVA 2QQJA 2HWF2 2YBKA 5FZLA 3H8XA 2VM9A 4DUVA 3NJYA 1EV11 3I97A 3UL2A 4CCEA 5J7MA 2QUOA 3ZMNA 1CAVB 5IFPA 1UZYA 4LT5A 1ENXA 1RUG1 5I91A 2VOWA 3ZN4A 1W2UA 2Q1MA 4L99A 2ZKNA 3UKVA 2EAKA 3HQUA 4L8QA 5A7PA 2ZA9A 2BNMA 5KXBA 3LPGA 3WW3A 2VMIA 1GP5A 4K1ZA 4ZU7A 4QKDA 2IFRA 1FXZA 4JGYB 3KT1A 3ZIXA 2X5IA 2BBVA 2FZ1A 4IERA 1RMU2 3QH7A 2W5FA 4DFSA 3LB9A 1GWLA 2I07B 5EZWA 5JZGC 1WGPA 2ZAAA 2KA3A 2ERFA 1JZ3A 3OD4A 1QWRA 1YQ8A 2IXLA 5GLUA 3WR0A 3T2OA 3ZLIA 2JIGA 4OQ8A 3H8RA 5EHDA 2RMU2 3C7OA 4YVWB 3CZUA 5JSPA 4OI2A 1WLDA 3ECQA 3MV11 4JKMA 1I5PA 3KVBA 2BVBA 4XXPA 1W90A 4ASLA 2BRTA 3JZVA 1HJFA 1N3PA 3NJZA 4CDWC 4QQ2A 2DTYA 1OA3A 3OEBA 3AL5A 4N8MA 2WYFA 1VBB2 1NLSA 1IS6A 2JECA 2Y38A 3B69A 4W65A 3WCSA 2YDEA 2GDFA 5LBCA 4EN7B 4QX3A 4I2OA 1QJY2 2Y6HA 3ROUA 4WVMB 2JE9A 3B7MA 2WBKA 3A23A 2NP0A 4WM7C 1A8DA 4MGKE 1ZYBA 1ZZ8A 3ES4A 3D8CA 1NCQA 2UY8A 1NUKA 3C3VA 3R4SA 4HT1T 1DZRA 1TMF1 1RGSA 2QTWB 2WNVC 1B35C 4XTPA 2W46A 4E4ZA 4GKXA 4B3NA 2WSVA 1DBNA 3N7LA 4HZFA 4AG4A 4CUBA 4A3XA 2HWB1 2VVEA 2K2SA 1YYNA 4XJ9A 2CNAA 1WBLA 2BFUL 2RV9A 3B94A 5EJZB 1Q43A 4WBBA 3V0AA 1NQJA 3SKJE 2WN2A 1RMU3 3DYPA 4YGBA 4AEMA 5J09A 2XB6C 3IM0A 1SEFA 4MG2A 3DUIA 2VZPA 4YFZA 4ZY9A 4XFFA 1NCQB 3Q8FA 4FO9A 3NQHA 4I0WB 4Q4X2 4FAHA 4TXWA 2F17A 3U78A 3C7EA 3I2IA 5I0SA 3VBSB 2A5ZA 2BUKA 1QXJA 4PBPA 3WZ1A 3W9AA 4AHXA 1SLIA 3ZYFA 3VUOA 1K45A 5CFDA 2WL1A 3UESA 4EWEA 1YQ5A 2UWAA 2Z5WA 4I01A 4N43A 2ET7A 4WZFA 4WVZA 4OHWA 1QNWA 3C7HA 2OVUA 4KL1A 2XQXA 3AZXA 4CEWA 2VU9A 3JBG3 1J59A 3QACA 3SC7X 5KBFA 3WQ7A 4LR4A 2QKDA 3CMGA 1RVF1 5BY5A 3U75A 1R091 4QM8A 1PIV3 2V4VA 4ZPIA 4AAXA 4AI0A 5GJ6A 5BXXA 4KNCA 2NPIA 1PMJX 4OYUA 3ZSKA 2SBAA 3VHPA 5GZDA 3FUQA 3DF0A 3AP4A 1V70A 5KC6A 1ZZCA 5JSRA 4FPYA 2F4LA 4CDXB 5JOXA 3NKTA 3K3NA 3T0DA 1PNGA 1EP0A 1D7PM 1CAXB 1XNDA 3LDRA 3KQ4B 3NV3A 4LITA 2X5IB 1PMIA 3H42B 1UU6A 1CQ9A 4JDMA 2VMHA 2FCTA 2QQLA 1RUF3 1V6JA 2WNOA 4FXGB 5IK5A 2OX0A 4HVQA 3MGUA 1LOFC 2VNGA 4CCMA 5AFEA 3TEZA 2EIBA 3RSJA 3R0RA 4FTEA 1KJLA 2YFZA 2ZEWA 2ZHLA 2I74A 2WT0A 4Q4W3 1HDKA 4ZKTB 1DU3D 3ZYGA 3VBOC 4NHMA 3PDQA 2B46X 2YMZA 3USUB 3P5BA 1WW5A 4BCUA 5IVCA 3A0NA 5JZGA 3WOGA 3LA3A 4Z92B 2VCBA 2PAMA 4L97A 1ULGA 2QVSB 3ZYHA 3DPRB 2QQUA 3FBYA 2DURA 4XFIA 1QDOA 2W1WA 4XUTA 1C8NA 4DINB 4NAMA 1JBCA 5A33B 1NOVA 2G9ZA 3KV6A 4IV1C 1XRUA 2J1TA 2QDRA 2W94A 2GSYA 3AFKA 1PM7A 4YVWC 4Y3OA 1R64A 4LXLA 4MGTA 2RDQA 4YW7A 3DXUA 5FO7B 1LHWA 4D3WA 1NZCA 1AVBA 1HV1A 3MLLA 1XE7A 5CG8A 2A7AA 3OGRA 4LA3A 5DDJ1 4F3JA 3POFA 1VBC1 2ZZJA 3S6PA 1MZ5A 3M8LA 2BW8A 1ST8A 2LM3A 1GLHA 4QKFA 4XACA 5GZCA 4CDQA 4IV3B 3O12A 4P9YA 2ZEXA 3WNMA 1RUE1 3B02A 3ZM8A 4CP9A 4HKWA 2ATFA 2D6OX 2H6CA 4IEWA 3WQ0A 1LTEA 4Y33A 3KCYA 1G7YA 2MEV3 5H9QA 1UXZA 4Q8LA 1MS9A 3QBQA 1UAIA 1DP0A 2JE7A 4Q26A 1JYCA 3JQXA 5A3WA 2ADEA 2DUQA 3FHAA 1R083 5F32A 3USSA 1RJ7A 2D3RA 5H9SA 5BUVA 3WDUA 1UMIA 5T55A 1LOGA 1VAKA 2ZMKA 3ZYIB 2EXJA 5F39A 3EBRA 2R16A 2W87A 1W28A 1SHWB 3PLQA 4BQ1A 4EV0A 2D98A 2MEV1 4H3WA 4R9DA 2IZWA 2JWPA 4MHUA 4B4PA 5AC92 3AXEA 1S2BA 1W2NA 3GBWA 5KXCA 4XIOA 5E8AA 3HT1A 4COWA 2XUMA 1PO12 3VBRC 4LQRA 3MFAA 3UV9A 2PHUA 2YUEA 5DZFA 3W21A 3GBFA 5E89A 1VBE2 3W5MA 1LENA 4LO8A 2D5FA 3K4DA 2YPDA 1IG3A 2VMGA 2WWJA 4YG0A 1ACCA 2Q1FA 5FXXA 3ZYJB 1TQ5A 4MSVA 4W4ZA 5FLIA 3ZFEA 1JYVA 4C1XA 5BNNB 2WNEA 3FHQA 3I2OA 2RJKA 2WO3A 4HN1A 1KD7A 5JI7A 1CWPA 4WVVA 3AMQA 5A3MA 4QU2A 1LNSA 4Q4V1 2DUPA 3VZOA 1SBFA 1MQTC 1ULFA 1IPSA 1ZM1A 2A3WA 3INAA 4IE0A 4INDA 2OXBA 1ZBE1 2OZJA 2Y0IA 1YCIA 5FZ6A 4E8CA 1ASJ1 4YSFA 1BEV1 2PHLA 2W3JA 3FZ3A 1H2MA 1DGWX 3HN3A 3MF9A 4GKYA 2YU1A 4Q4X3 2VNRA 5FY8A 3CJIC 2O1QA 2AC1A 2YV8A 3RQ0A 1W0PA 2QFEA 1UZ0A 4ZS3A 2ORXA 4KBZA 3VBFC 4XDQA 2YBPA 1LECA 3AFGA 1GQHA 2ZHMA 2E7TA 4HOOA 5CIRA 4JGZC 3DN7A 4P00B 3RYRA 4NIAA 5FZ8A 4AXOA 4CUCA 5CNAA 5IJRA 2RR12 4XC9A 4Q4X1 3THPA 3GALA 4JQRA 4QQPA 1OQ1A 1OKOA 1H30A 3BPZA 3LIHA 4X8NA 3GCWA 1REEA 1XOYA 3KQRA 5HXVA 3KZ4C 1FNYA 3IMMA 2P17A 3K3OA 3WNPA 4LBQA 3THCA 3VBRA 2CGNA 2WFF2 1NLRA 4QKNA 3PIJA 3AYAA 2WAOA 2ZX0A 5CFDB 3BI3A 2RE9A 1AR71 3KSCA 3WDYA 2B42B 2K46A 2RS33 4J25A 5T50A 3VZLA 5A1FA 2FCUA 1O3RA 1H9PA 3L2HA 3ST7A 2XVGA 2BJSA 3BOPA 5A6XA 1HX6A 5FK8A 4G9SB 4ISRA 4M01A 1X8MA 4IEYA 4Q1RA 4YNIA 2WS91 4GMP3 2CU5A 4E9KA 5L7OB 4M3CE 1IPKA 2HWC1 2NZ9A 2ZGRA 3NV2A 4UBGA 1UL9A 1FPN3 4EWAA 3O1MA 1AR91 2GNTA 5D8AB 4WV8A 2VOXA 4QAWA 1GNHA 1C8M1 1Z78A 4AFDA 1JZ6A 2Z79A 1XNCA 3ZXJA 4C8DA 4UOJA 4QX2A 4CCJA 1Y9GA 4CXXA 2BTVC 5GZEA 4CDQC 2VTXA 3PUSA 3V65A 2AEZA 4QHZA 3VN4A 3BTXA 2VMFA 4UWDA 4QPWA 4XYXA 5DXDA 4EN9B 1ND3B 1KDKA 3WF4A 1TMF2 1YFWA 2IUWA 2Y6LA 1NQDA 1AZDA 1X50A 2ZX1A 4TTGA 1WUVA 4ZZ8A 3H1MA 5IWFA 2C24A 1CGPA 1W6OB 3D0SA 3OBAA 5FZBA 3KHBA 3DKWA 1QJU2 3RJ2X 3SEPA 4YZ4A 5FQ0B 4FPGA 1FYUA 4LA2A 1DHKB 1ZA7A 2GU9A 2RMU1 2WO1A 2XDVA 4M3CB 5HV4A 5IFTA 2K9ZA 3R4UA 1OD3A 2D43A 2JJ6A 3ACHA 5EPAA 2G9GA 4YW3A 5HCBA 5A7SA 4Y4YA 4AVSA 5ACA1 2VMCA 4QPGC 4Y5SA 3PU8A 2PQSA 4IEXA 4LO7A 4OZOA 4AVBA 5HBAA 1JOJA 2GZWA 4IUGA 3ZDVA 1XNAA 3VDBA 1WMXA 5F3CA 3WG1A 3TNQA 1BEV2 3WDWA 1PGL1 1QF3A 1R1A3 4AAPA 5CFCA 2A3YA 4XF3A 3HN1A 1O4TA 1TME3 4HVRA 2Y34A 1RHI1 4FQZA 5CBLA 5CISA 1AR72 3RYPA 3OD0A 4CCLA 2AGSA 4FOVA 1QH7A 2WLQA 4GA9A 5ABJC 1UU5A 1FOD3 2HWE2 5FZ3A 2NMNA 1CAUB 4XUOA 3AJZA 5J96B 4CEYA 3S0MA 3OGSA 1G86A 2WNVA 3J7MA 4LUKA 4BQ2A 1N47A 2FMDA 2H0VA 2XMLA 4RGAA 2P3KA 2QZ2A 1W6QA 2XVLA 3ZKYA 2RR11 3WNOA 4CEYC 5IAVA 5DG2A 1W9YA 1HV0A 3NNFA 2ZGLA 4CXWA 3UJQA 1ENSA 2C9KA 3WX5A 5FXVA 3LPFA 1ULEA 3WNNA 4AVAA 3U0ZA 4MXWA 2B9VA 1A3KA 1STMA 1T6GC 5AVPA 4E4DX 2QQPA 3WXPA 3O7OA 2VVFA 2R6QA 2WZPP 5JXIA 1IS5A 1UZWA 2XH6A 2PHDA 1VJ2A 4K40A 3GGLA 1QXPA 1Y4WA 5FZMA 5DAPA 3PMSA 4PDWC 4E2QA 1DYPA 3N9NA 4NUBA 2ID4A 4PF1A 5A33A 4COVA 5JLVA 2JB8A 1GP4A 1KGYA 4YM1A 4XBLA 1HRI3 3NNLA 1EUTA 4AR2A 4U36A 3RS6A 4JCKA 3J8F3 2RVAA 1RUC1 4P9LA 4YM2A 1IKQA 4IQPA 5FXWA 4AI2A 2LALA 2AZ5A 2WNUA 4V2WA 5FYZA 1OQDA 4D6SA 2HYXA 3ZFGA 4JZRA 2O8QA 4S2GA 2Q8DA 4OLLA 2GNMA 1NXMA 2YU2A 3VLBB 1KFXL 4K21A 4MYEA 5FZGA 3F95A 4IEVA 2YGMA 2P1BA 1LOAA 1EUUA 1DLCA 3S5QA 4C0HA 3AK0A 2XJQA 2BP6A 2P37A 3CZJA 2HJIA 3K75B 2E31A 3MO4A 1TEIA 1R093 3SHRA 4PQQA 5FV3A 2Y6FA 1GQPA 4CZSA 5A32A 1XC6A 4IETA 1JS9A 3CJXA 1QJU1 4FXKB 4OUMA 2WZR2 2QNKA 4NWWA 1F4HA 2BYVE 4AFCA 4CU7A 2RDSA 3ACIA 1BBT2 3I3QA 3H3UA 1EV12 2MHFA 3WF3A 1QQP3 4QGMA 5FPVA 2WR9A 2W39A 4FFFA 4MGQA 2CAUA 3I59A 1G9FA 1SLTA 1UKGA 5JOYA 5EJ3A 5EFUA 3SCFA 4QQHA 2Z4FA 5SV8A 2IVJA 5C9AB 2W08A 5FPUA 1W6PA 2V4AA 2D6MA 4QX7A 3ZYRA 3ZPOA 1CJDA 4A7YA 2OS2A 3TEYA 4LIUA 3W59A 1GBGA 4CSWA 4FPLA 3BU0A 2DU1A 4YARA 1MVQA 1DFQA 1OFSA 2RS13 3POGA 4UW5A 1C8M3 4D0QA 5HPOA 2JDPA 2BVVA 4GZ9A 4RHV1 1VBE3 3QCWA 5FUPA 3VBSA 2JENA 3ZR5A 1U5ZA 4OHZA 3AMMA 3PTYA 2PLV1 2HWC2 5I0DA 3VKMA 2VZOA 3I49A 1OOPA 5JR2A 1AR63 1UY2A 3VB9A 3LSEA 3Q8EA 4QDSA 4OFGA 5EXOA 3VBOB 1NY72 2RG4A 2YXSA 3FFZA 1DGWA 3PJQA 3PVNA 3IIIA 3AP6A 4HETA 4RR3B 2R041 4DXSA 4ZXEA 4ET7A 2HWD2 1UU4A 1REDA 2DFBA 1DYKA 5F8PA 1R092 4QT6A 1ONAA 4RHV3 3VBFA 4AK3A 1DQ1A 1RUC2 4FPEA 1CN1A 2DV9A 4LBMA 4AI3A 5A1LA 1YHFA 1GOGA 2DVFA 3ELNA 3M1HA 1HRV2 2WC2A 1FPN2 2UYBA 4P9JA 1ND2C 1XYOA 2PELA 4UFLA 2GH8A 3HAGA 4A6SA 3KS7A 1RYYA 2H6BA 5FZFA 3PUAA 2ZMNA 4IDZA 4SBVA 5ABJB 5FZ9A 1QQP2 2XKOA 3WVJA 5G04L 2OA2A 5ACA3 1US2A 1RUOA 1DCSA 1GKBA 1QEXA 1OF3A 3ZSMA 4B8EA 1OLME 3KCXA 4AVTA 1O3SA 4IXLA 5FWJA 3FLPA 4IV1A 4LBQD 1DGRN 3SMHA 3T3YA 1MPXA 3ZFEC 3I7DA 3M3OA 3EMRA 3OUIA 3T2QA 3VDCA 1DDLA 1IS3A 5FLHA 2YFUA 2B7YA 4PDWB 1NCRB 2ZHKA 5A3UA 2WFF1 5FPZA 3J4UH 3HBZA 4NJ4A 5FK7A 2UWBA 4R9BA 5LEJA 4IEOA 2RDRA 1UO9A 3B3QE 1IG0A 5JXJA 1RHI2 1V00A 1D4VB 2D93A 2R1BA 3AKPA 3HNBM 4B7KA 3KGZA 2WYSA 4AHYA 4M0NA 4MZUA 4XMIA 2P34A 4AGGA 1B35A 3RFRA 3SQOA 4YM3A 5IK8A 2D7FA 3D6EA 1GP6A 1OA4A 1DQ6A 3MW4A 5LEKA 1D0GA 1ND3C 1YJLA 2C1FA 4C90A 5FOJB 4KWJA 5LA0A 4PLNA 2WKKA 4BIOA 1J83A 1VE0A 5SV5A 1LRHA 1J3QA 2MNGA 5FR3A 3HEIA 4YLZA 3U4SA 3AMPA 4CDQB 2D6NA 5D2AA 2NLRA 1H4HA 1LU2A 1O91A 4OUEA 5F5QA 3ENRA 3KVAA 1QOSA 3N9PA 3PHMA 2BWAA 4W6WA 2XHNA 3RI9A 4COYA 2JDZA 2A6YA 4GQ7A 5A7QA 2ZKLA 3J8F2 4CUGA 3N7MA 1UY3A 1VRH1 2VW2A 4RD7A 4Y1ZA 1FMD3 1EPWA 1JMUB 2BGPA 5A7WB 4HONA 3T2TA 4D8MA 3ZN5A 3RZJA 3MUY1 4ZXKA 3GYDA 4CTEA 4GD4A 5FFOC 2VXRA 5L7OC 1N3OA 1RUH3 1C28A 5DUUA 5FO9B 1HQNA 4NR1A 5H9PA 4XJWA 5J3UA 4IW3A 1F31A 3VGIA 2R0HA 4LEJA 1H4GA 4LORA 4MHRA 4FP2A 1FV2A 1HJGA 2ZAHA 5C5UA 1O5LA 1QOTA 1H1MA 2OT7A 3MZHA 4XAEA 2TUNA 4LKFA 1FNZA 4LBOA 5DQ0A 3E5XA 3WEZA 4LLOA 4E8DA 2BGCA 5K9YA 5DUVA 3PUQA 3BPSA 4XJUA 5T54A 1B09A 1AR92 3H8UA 3QD6A 5KR7A 2CY6A 3TNPB 1H8TB 4ZONA 4DZGA 3D82A 1BJQA 1OBNA 3HVDA 4RQPB 4FPHA 3APBA 3K4ZA 2ES3A 4JGZB 3ETPA 5DZEA 3WW1A 5ISLA 4NIGA 1KRIA 1AF9A 1V6MA 1ZRIA 2VMEA 4IE5A 1HB3A 3IN9A 4LHLA 2D3PA 3FWEA 4HVOA 3RJRA 4CDXA 1TVGA 1N1VA 1OURA 1O8SA 2OUJA 3VBHB 3M3IA 3OOXA 2XJVA 2RS52 4TN7A 4JC1A 4QHBA 1WLTA 2CAVA 4BLJA 4L92A 3Q8CA 4MOAA 3GHNA 3IWZA 5LRSA 4ASKA 4YWAA 2EVXA 2OUHA 2FDGA 2RS11 3SCHA 1JTZX 1XBFA 1H6YA 4S2FA 4LOTA 2QQNA 4YZ1A 1US3A 1PK6A 4N43B 5A6YA 3UT0A 1JZ7A 2WZR3 2UU8A 1KFUL 2CWMA 3PMEA 3GF6A 1COV1 4K1YA 3FMGA 4JTOA 1N1SA 3AP5A 4COUA 4EN6B 5CFDC 3UNPA 1HW5A 4QPGA 2W68A 1QJEA 2Y26A 4AGVA 1CZTA 2R043 2R073 2AENA 1YC61 1OA2A 2JX9A 2O14A 3IKWA 2BERA 2E51A 4EZHA 1E5HA 2WRAA 3Q8BA 4QMAA 3SKVA 4URAA 4E27A 1NA1B 1WCSA 4OZXA 3UGGA 4AEKA 5FP8A 1SPPA 3B9CA 5GM0A 3URFA 3OGGA 4ZU4A 3POWA 5J48A 1QXRA 4XEZA 2UY9A 3RRDA 2HWD1 1S0CA 2VZRA 5C5TA 4XF0A 5FZCA 4DY3A 1MZFA 3A21A 3SH4A 3WLUA 1CD3G 2C0ZA 5FMCA 4AEDB 1TME1 4OMCA 2W1SA 2GC1A 1HRV1 2DCZA 3CJIB 3H50A 4ZU5A 3ZXEA 2B8MA 2G19A 4IESA 5KXEA 1AR62 5C3PA 4QX1A 4Y22A 1FOD1 1AYM3 3WNLA 2A70A 3U10A 1WLWA 1KEXA 2ZXQA 3JCIA 4CU9A 5C3SA 4OQ9A 4BWOA 1GMMA 2ARCA 2HWD3 5DAQA 4Y20B 4BH9A 1VBB1 3I4IA 2BWCA 2EXKA 4XJ8A 1H2LA 1HXS2 4FFGA 2RJ2A 4HPKA 4SLIA 2WFF3 5AVAA 1AYM1 4EQVA 3D5OA 1DQ0A 4KH9A 4WM8B 2E6VA 4DEQA 1PZ9A 2DFCA 2VE1A 4UW6A 4YVWA 2A73B 2BQPA 1OOPC 3A4UA 1PVXA 2W47A 5DABA 1V6OA 2ARBA 1CAWB 4L2NA 1UYZA 2BNNA 2XVKA 2OPWA 3O0VA 4NO4A 5FYMA 3SEEA 1ZRRA 1AJOA 5FKCA 3WSOA 4DB5A 2D5HA 1JW6A 2BFUS 2PAKA 2HLEA 3N9LA 2XJUA 1LEDA 2DCYA 3NV4A 3O1UA 1ZRFA 2Q1ZB 4F7ZA 3FC0A 4UAPA 3BTYA 4J1WA 4NPMA 1POQA 2RS51 4UI9L 1ALYA 5I8SA 5C6CA 3ZXDA 4XXAA 2P3YA 2XQRA 4DUWA 1WZXA 3MI8A 4K8FA 4BZ4A 2B45X 3MICA 1GUIA 5F5IA 2WS92 3RMXA 1U0AA 3L9JT 1IS4A 2XJPA 1SG3A 1WWYA 3DCQA 3BALA 3T1LA 3NKGA 2CHHA 2W52A 4YW2A 3WW2A 3HQRA 4LO5B 4CDXC 5BNPB 3RYKA 1ASJ3 3NO8A 3POYA 1JZ2A 4TZDA 1RC6A 1SLLA 2YY1A 5IUQA 2WN3A 3EO6A 1SMVA 2L9LA 4KU8A 4LO4B 5C70A 5D8AA 3JBG1 3GBGA 3U4XA 1UWWA 1D2SA 3QH6A 3ZXGA 1RITA 4TYSA 2JDAA 4OMDA 4AL9A 1E5SA 4XF4A 5FYCA 3SH5A 3I2JA 2XOMA 3V0BB 4LLFA 2EAAA 3DPRC 3PVOA 3IDEA 4LKDA 1GWKA 4XF1A 3AYDA
chains in the Genus database with same CATH topology
1BCXA 3IMNA 1EPZA 2XL9A 4O9GA 2XKPA 4LBQB 4KWKA 2UYAA 1ENRA 2OPKA 1RUF1 2VUJA 3ZFFB 2R042 1O5UA 2PFWA 5JDBA 1ZRCA 1LHOA 2XJSA 3HMYA 4KG0A 1BVP1 2GC2A 3ES1A 1QJY1 5KHGA 4HANA 4QM9A 2H0BA 3VHRA 4H55A 2WQ4A 4PIYA 1AL23 4GWMA 1MZ6A 4XHXA 2ZHNA 2E9QA 1H2NA 1ND2A 4OVEA 4YGCA 4TSVA 2PYTA 2QDNA 1SACA 4AGRA 1RUJ1 3ZFFC 4MVTA 1HQWA 1Y43B 4GIQA 4WM7B 5BNQA 3AZYA 4QPIC 4EJRA 2R071 4EROA 1UW8A 5HCFA 2ZX3A 4E2GA 5KWRA 1KDMA 2EXIA 3EJKA 2FHRA 5E16A 2HWF3 1JXNA 2AUYA 4XJZA 3B00A 2R0FA 2WNUC 4AFBA 1WMEA 2Z69A 1J3RA 3VBSC 4HSJA 4CYDA 1RUE3 1YIPA 2RMU3 4PLMA 1L3JA 1D0HA 1H1IA 3WP4A 2XGXA 5F6KA 2A6WA 3CNAA 1Y7BA 2GMEA 3VKLA 5GZGA 2HEYF 2VW1A 5BNPC 4D7SA 4DPNA 1GNZA 4BA6A 4YGEA 4Z1VA 1DZTA 1X36A 4JGYC 2ARXA 1TME2 4TWTA 5I0RA 1R1A1 4JRAA 3R05A 1AXKA 3CJIA 1BQPA 2V73A 1F9KA 1NE4A 4U2AA 2D97A 3U11A 1XNBA 2VECA 3J8F1 4DS0A 3VKNA 5I8TA 3KLSA 2XPJA 2PHRA 2AREA 1NA1A 3NAPC 4XQ4A 4Z82A 3MW2A 3OY8A 3WDXA 2A6VA 4N9HA 3M4FA 3KGLA 3WHUA 5JPMB 3WD5A 1VAMA 1XQNA 1H8VA 3S7IA 4HMZA 1IPJA 2HEVF 2IXCA 1JN2P 4Z07A 1YWKA 3ALQA 3AX4A 4OHYA 3NL1A 1WD4A 3ZFGC 1QDCA 1Q8VA 1WW7A 2E53A 4Q1PA 5JZGB 5I8YA 1BMV2 4YYOA 3LSDA 5BYNA 4JV4A 1W6OA 2YZ4A 4LNVA 4AWDA 1RVF3 3BCWA 1Q8QA 2VPVA 2HEWF 3JD73 1VBC2 4ES8A 5K0UB 1CR7A 3FUOA 5D1IA 1RJ8A 3AZWA 3SITA 3ZXFA 5EYYA 4NPRA 3I54A 3RG0A 1PIV2 1F2NA 1TNRA 1RUD1 5JVVA 3UKNA 1HKDA 2D6PA 4I0BA 4NHKA 1ZBA1 2ZGSA 4G3YC 5FLJA 4X8PA 2HWE1 1PVC1 3ZFFA 2Q0AA 1CAWA 5TSWA 1RUH2 4NVPA 3HD8B 4DNYA 4GB33 1GR3A 1KS5A 4N53A 4RS5C 2WS93 1MS0A 2OW4A 3OGJA 2LUWA 5K8SA 2CGOA 3AMNA 3AKRA 4WZCA 1HXS3 1E57A 1EV13 3M3EA 3O14A 3IDBB 4R4XA 2WWSA 5J98B 4K9SA 1YUDA 2GH2A 3PVBB 4YZ5A 4LO6B 1PO11 3EHKA 3C2UA 3DGTA 4Y5Z0 2Q30A 4GB31 1V9U3 1UN1A 3NAPB 1MVEA 4BPZA 1VP6A 1UKRA 4R4ZA 5GLVA 1VBD1 5FBZA 2VW0A 5IT6A 5FTTC 3WINE 4A7ZA 1F8VA 1X7NA 1I6XA 1CX4A 4YVSC 4AFAA 4CDUC 1FI2A 4NOTA 5C8CB 1C1FA 2ZCWA 3WUDA 1OKQA 3NV1A 1GICA 2PHTA 4QQOA 1QOOA 2GMPA 3O0WA 2PA7A 1VBD3 1YLLA 4YW4A 4AQ6A 1H8TC 4HFSA 4IL7A 1H8TA 1RUE2 3H3ZA 3BIWE 1N3QA 4R9CA 3CL1A 2WLPA 4WVMA 1KQRA 2NMOA 1YJKA 2LTNA 2DCTA 1GZCA 2WNUB 2X29A 5L36A 1FATA 5ACA2 1JYIA 1I3HA 3FX3A 1LODA 1BMV1 4F8AA 3UK9A 1LHNA 1QH6A 2VY0A 4KQ7A 4URTA 1DQ5A 3ZDSA 1W39A 2MEV2 3OYWB 2XWBB 1PGL2 5DG1A 2G4IA 4NHLA 2PTMA 3FBMA 3VL8A 2P3JA 1LGBA 2XBO1 3VBUC 3IPVB 2X5IC 4MGZE 5C33A 3ATGA 2A75A 4KGQA 3I2DA 4BYYA 1J1TA 1PVC2 1Q8SA 1M06G 1MS3A 1OD5A 1D2QA 1ZBE3 4HKOA 4JGZA 1AXYA 3HT2A 5A3LA 5GZFA 5JSOA 5JOWA 1CPNA 1AL22 3N7JA 1PGW2 2R30A 4AE2A 1IOAA 1OMIA 4FVVA 3POSA 2PAEA 1BBT3 1S55A 4PF5A 2HWB3 3OYWA 4Q27A 4Y26A 2DTWA 1S1AA 3VDDC 1W6MB 2ZPXA 1APNA 1MS5A 4HK9A 1MS8A 1LEMA 4XILA 3WDTA 3JU9A 5CVRA 3VDDB 1FMD2 4FSJA 3KMHA 4O9EA 1I1EA 1PO21 5K7PA 1VRH3 1MQTA 4QPIB 1OHFA 2Y0OA 1FAYA 2EIGA 4P9XA 4QGLA 1AR73 2ZGMA 5BNPA 1U5XA 5JPNB 4Q0UA 2XHKA 5C8WA 5F6LB 3RPQA 2OIIA 3CU7A 4QX5A 2ET1A 4LUMA 5KHKA 4XE9A 5BNNC 4Q29A 3FFQA 5K0UA 1ND2B 2WT1A 1PVC3 4YRDA 1PIV1 3ZN6B 1B35B 3TYJA 3VBHA 4MX3A 4P5HA 4LBKA 3TN91 3ZX7A 1U5YA 3ZPYA 1WW6A 2XBO2 1LGNA 3G7DA 1NCRA 1MEC3 3VKOA 3FE5A 1O4YA 1RUJ3 4R8HA 4J6GA 3ILRA 1Z7S1 3LKJA 1BXHA 4PJYA 1K5MB 2DVDA 4HPKB 4XZPA 4D69A 2IWGB 2VOVA 1UD1A 2KM2A 4I3PA 4CEWC 2VULA 1MEC1 2C9AA 4LBNA 2BEOA 2XJTA 4LE4A 4XBQA 1QMJA 1AYM2 1GQGA 2GN7A 2OYZA 1A8MA 4S2HA 5C4WC 1AYN3 1OPMA 1RL3A 1TE1B 2VQ0A 1IHMA 2W0XA 3K51A 4K7JA 4N7UA 4HKLA 4E2SA 1XYPA 5JWPA 4LHKA 4MXVA 1R1A2 1VBA3 2CL2A 4BE3A 4XFCA 1VBC3 1DZQA 2DUOA 2TBVA 3E6CC 4JRLA 3ZSEA 5KHJA 4XFBA 1FV3A 3ETQA 4Q0PA 4IEPA 3GNEA 1LOFA 5CA6A 2RR13 4OI4A 5FOBB 1YO8A 4H7MA 1PO22 3H0OA 1K5MA 1ZBA2 3KB5A 1R081 2EALA 3TN92 5CU1A 5CADA 1GV9A 5KHIA 3RMYA 5E1RA 5E88A 2VVDA 1MS1A 1X82A 4BMEA 1ZZBA 2HWB2 4HN0A 2YC0A 2GMMA 1DG6A 2WA4A 4N43C 3IDCB 4H7LA 5CB7A 1DIWA 4KGGA 1S0DA 4OULA 4P9WA 1RUC3 2PLV2 1NYWA 1SFYA 1JUHA 2ZABA 1AYN2 4HSLA 2XWJB 5CFCA 2RJLA 1YI7A 4MLOA 1G9DA 5BNOC 5C8CA 4AEDC 4CRQA 1J58A 3AZZA 4META 2V5YA 4W6XA 1S0FA 1W6QB 1D4M1 3L2YA 4RSUA 2RHPA 1WLCA 2RS31 2NN8A 1XE8A 1EYBA 1NA1C 1LESA 1C8M2 2A71A 2RS53 3GZAA 3NAPA 5F9TA 1CAVA 1YI9A 1DGRA 1H2KA 4UW4A 3M3QA 3ZFGB 2FZ2A 1QJU3 4ITCA 3MLKA 1PO23 2HYKA 2B5HA 1MZEA 1HQLA 1Q56A 2DYCA 5AFBA 1UF2C 1UMZA 3MIHA 2X8KA 3ILFA 3SISA 4BMBA 4QPGB 3FHIB 2DCJA 5T52A 5LRRA 4BM8A 4ATFA 2CGPA 1VR3A 1ZZ7A 3M3CA 1AR83 1KITA 3FLRA 2F4PA 1LR5A 2DU0A 1PK6B 5GLTA 1LU1A 1RTVA 5C4WA 4FPKA 3FLTA 4G4FA 2PHXA 1LOBA 4Q4W2 2B39A 3JD72 3LA2A 4AW7A 4YW5A 1NG0A 1EAH2 1V9U1 5KXDA 1XU1A 3AYEA 4JAAA 4FPOB 3IPVA 3JQWA 2WT2A 1ZZ6A 3V64A 5FO8B 4RQPC 3WV6A 1UZZA 4AHWA 4Y1XA 1UX6A 1NY71 3CO2A 3LOIA 2I2SA 2VG9A 3NWKA 2RM23 2DCKA 1W0OA 5HCAA 3LGRA 5JMCA 1I9RA 5J36A 1AL21 4FP3A 1SLAA 1AHSA 4XTMA 1ZX5A 4WM8A 2ZGKA 3WG3A 1GYKA 2XLAA 1NCRC 3MW3A 4C1WA 5DDJ3 1LB2A 4XOGA 3NW4A 3E5UA 2IXHA 1AR82 1QJX1 1YXWA 1AYN1 3ZMOA 1RINA 3OF1A 3J9SA 3VHOA 1HLCA 3RI8A 4LTAA 3AJYA 5CFCC 2NQYA 3NVCA 3E6BA 1D4M2 4MXWB 2JG8A 3AP7A 2QE3A 1XU2A 2QCSB 3MYXA 2JG8B 3H1YA 3VBFB 2ZACA 3I8TA 4FCAA 5GLZA 3AKSA 3KT7A 1UIKA 4MH0E 3WP6A 1S0IA 4AVVA 2R32A 3E97A 1NXD1 1C3HA 2AH2A 4X6QB 4W6YA 3WNXA 2Z42A 1RUF2 2ZMLA 2QZ3A 1PZ7A 1ZRDA 1FT9A 3P3PA 4FAGA 5IK4A 3CLPA 2IFWA 3H7YA 4LHNA 3CF6E 1AX0A 4DOUA 2YROA 1AJKA 4Q4Y2 3QOPA 4FTSA 1BBT1 4DY5A 4N53B 1RUG2 3ZFEB 3R4DB 1J1LA 4AI1A 4F83A 4PLOA 3JD71 1RVF2 1G9CA 1RUH1 2CV6A 3ILNA 2ZGPA 3TBDA 2ZJCA 3BB6A 2VGDA 2DF7A 1LOEA 3MIEA 1POV1 2D44A 4YG6A 2DVAA 1HRI1 4AHZA 4Y20A 1D4M3 4OHVA 2FQPA 4HLTA 1V6LA 2XJRA 2ILMA 4MUVA 4CDUA 1AX1A 1ULDA 5FMOS 4YZ2A 3LAGA 4WVWA 3G6JB 5JR7B 1QU0A 3S7EA 4RA0A 1WD3A 4RR3C 4IEZA 3RDIA 5C4WB 1WMDA 1VBA2 2WQZC 3OPZA 1JHNA 3HQXA 1ZZ9A 4C91A 2AR6A 1R1ZA 3LA7A 4N90A 4XFGA 3MDPA 4HBNA 4YFWA 4R52A 3VDDA 5J37A 1OOPB 2EXHA 3WQ1A 5FPXA 3IBMA 1UPSA 4XQDA 1O3QA 3VZNA 2YYOA 4H14A 4WM8C 4QXKA 1AR93 4X6RB 5FRAA 4Q2FA 3ASIA 1EAH3 1OQEA 1QQP1 3BU7A 5CG9A 1QNYA 5C9AC 5EYXA 2D3SA 4P9GA 4A2UA 2WZR1 3CEWA 1WCKA 1H1AA 1H9WA 2DWRA 1QJY3 3EXUA 3LWCA 1O4ZA 3DL3A 2YGLA 3I59B 5JIUA 3JB8A 4JDNA 1EAH1 3PVEA 4IEQA 4KG8A 3M2MA 1GSLA 2Z2SB 3B9IA 2RM22 2Q4SA 4AQ2A 2PLV3 4LBJA 1U5IA 4CEYB 5KHHA 3WW4A 3VKFC 1CONA 1OSGA 1C5HA 4K3UA 1GANA 3AKTA 4KU7A 3UKTA 1VIWB 3BTAA 5EWSA 4LBLA 1N1YA 2C5DA 1Q5OA 5FMOL 4FOWA 4RFT0 3KM5A 5FCCA 1IKPA 3AYCA 2ZGNA 2WINB 1RUD2 4N53C 4B7EA 4DRVA 5JAXA 4DRRA 3AMHA 2GNBA 4XMAA 2R49A 4QGNA 2E7AA 1AL0G 2JEMA 4JVAA 4AEJA 2ZTNA 1QJX2 1PGW1 1YFUA 1WA4A 1LCLA 3M7AA 4BIFA 1VALA 5DUXA 4LULA 3IT8A 4Y22B 3ZO0B 3MIFA 2WFPA 3M70A 1Y3TA 5IK7A 3VBHC 1W6NA 2P2KA 1YIFA 4AEDA 1RB8G 1FMD1 5L73A 3AP9A 2JG8C 4Q0QA 1V6KA 4XJAA 3SLIA 5BNNA 3AXDA 1N1TA 3BODA 4FQ4A 4IEUA 5T5LA 3DV8A 4Q4V2 1VBD2 1IGOA 4M0HA 2WNVB 4E4SA 3BOWA 1YNAA 1GFF2 1TMF3 4YZ3A 3JUUA 5AC93 2XBO3 4IV3A 1QJZA 4L9BA 4FTBA 5D8AC 1PK6C 4C0BA 5GLWA 2ZS6B 1RUJ2 4UBHA 2D6KA 3N36A 4COZA 3SH3A 4KWLA 1QKQA 4MGYE 3D4KA 1G8WA 3ZSJA 1C4RA 1KS4A 1W6PB 1IQAA 2BPA2 4Q4Y1 4FPCA 1ZVFA 3TAYA 2A3XA 2R1DA 5BV6A 3FJSA 1LOCA 4JTNA 3B01A 4HL0A 1Q3EA 5T5PA 2CYFA 4A7KA 1OFNA 2XLFA 3WDVA 2A6XA 3MLJA 2B9UA 1Z7S2 2GC0A 4P14A 3HIFA 4D7YA 1C57A 5KC5A 2V09A 4XHBA 1X8EA 2HWC3 4TLFA 4XIKA 1SFNA 1NE6A 1WBFA 3SNMA 2R061 1LJ7A 1MACA 5JOZA 1BK1A 3MF6A 1BKZA 4Y1UA 3AB0A 1F5FA 1YFXA 3ME2A 1MEC2 4V1PA 4B4RA 2HKXA 4FPJA 5BNOA 5C8CC 4JDOA 4CDUB 4FPFA 3OBTA 1COV3 4GMP0 4RHV2 5I93A 4Y1VA 3TOJA 2XL7A 3WY6A 1QHDA 1MQTB 4QPIA 1DGLA 2QJVA 4K20A 1VLNA 5LK7B 5B2GB 3TRSB 1XNKA 1W6MA 1SCRA 1AR61 2ZBJA 1BVVA 3OY8B 4ORFA 2WA3A 3E6DA 3MPBA 5BPXA 1OLRA 4AYUA 1OI6A 1RUG3 3P3NA 4I09A 1HRV3 1A6CA 4HK8A 4CDWA 5ABJA 2HWF1 1S2KA 2VNOA 3LCPA 3MIGA 2I45A 2PN5A 3O5SA 4JGYA 1QGLA 1R082 3WG2A 1LKNA 2IC1A 1QJX3 1LULA 2PHFA 3R6SA 2FMYA 3TB0A 4CP0A 4I02A 4AI8A 1RHI3 1REFA 1DF0A 2SLIA 3VBUA 1ENQA 5A32B 3OJBA 3EQEA 3S30A 3VBOA 1LHUA 3OCPA 1S0EA 1W6NB 1JH5A 3RWNA 4J1XA 4QQLA 1KJRA 4Z2WA 3MIBA 4PDWA 5H9RA 2ZX4A 3VZJA 4Q4V3 4A3XA 1VBA1 5I0UA 3KD4A 4FOYA 3B5LB 2BBVA 2KXLA 2PHWA 3B93A 1WW4A 3MFCA 2ZX2A 3PNAA 3OBRA 4IV1B 1CPMA 1CVNA 1K5MC 1Q8OA 1BEV3 2TNFA 4XFAA 3UJOA 1PGSA 5FREA 4AVCA 4WM7A 2Q8OA 1OPOA 1TNFA 3U07A 1URXA 3JBG2 1GZ9A 5LK5A 4PQ9A 3MPPG 4I30A 2ZGUA 4Z8BA 1S0BA 5EV7A 2O0OA 3GZUC 5FAXA 4EN0A 1CAXA 1Y9QA 1YRZA 1A78A 2BNOA 2E7QA 5AC91 4GWNA 4AQSA 2D6LX 2GNDA 1G9AA 2JD4A 2X53S 2XG3A 1DQ4A 5HI0A 4RR3A 2DVGA 4IV3C 3HWJA 3T1MA 1I5ZA 3GHMA 3QLQA 1C5IA 4MV2A 1ZA4A 2NYYA 4UW3A 5JI9A 1RUI3 3A0KA 1XYNA 2PQQA 4B29A 4BHPA 1V9U2 2O8OA 4GH4B 3ZIWA 4CEWB 4MGIE 1RIRA 1ZBA3 1G6NA 1WMFA 3VHNA 1GZWB 1O7FA 2EF6A 4GULA 2UWCA 1V6IA 1PHMA 4Q8KA 3N3HA 1G9BA 4OI1A 1Q8PA 4BOWA 1YFYA 5I0TA 1UPIA 1HIXA 2R063 4GH4A 2ZGOA 1SCSA 4Y24A 4YGDA 3VV1A 5FQ0A 4XW3A 3V56A 5GKAC 3NSTA 3V0AB 2JG9B 3N35A 2ZGTA 1O3TA 2A6ZA 3N4MA 3THTA 4ONUA 2G9FA 4GMP1 1AR81 1CJPA 2RM21 3GZTB 1FPN1 2E63A 4PIXA 4PBOA 4YVSA 2UURA 3HR9A 1AX2A 3VL9A 4AQTA 4PIZA 4GB32 3ZVXA 5CFCB 2Q5TA 3WP3A 3ACLA 2JG9C 4GALA 5T3NA 1SDWA 1RUI2 4NWVA 5T5JA 4ATEA 1DQ2A 4OI0A 2EA7A 1ULCA 4LE3A 4EN8B 2GC3A 4I0AA 5L19A 1JUIA 2F6BA 1AXZA 4L11A 4QPYA 4XBNA 5JCTA 1IZ3A 4M3CA 2RS32 4DQAA 2ENRA 1M4WA 4Q0SA 3SXWA 1U12A 5CAZA 4KBBA 3JB4C 4B4QA 1VAVA 4EWDA 3D0JA 4RL7A 4GH4C 1NCQC 1SBEA 3O0XA 3LZZA 1BYHA 3OTFA 3AM2A 1POV0 5F1RA 2TEPA 4GXLA 2FBEA 2NM1A 4XFHA 2WSUA 3MEPA 3V0BA 2R072 1LHVA 3ZXKA 4YG3A 3WP5A 5FDBA 1CAUA 2AYHA 1VBB3 3Q9OA 3VBUB 2VOKA 3WHTA 3KT4A 2JKBA 2JG9A 3E5QA 4XETA 3ZXAC 4YW1A 4D94A 1CESA 4DMIA 3IIAA 1KXGA 1CIWA 2ETEA 3PJYA 3AZVA 2ZOEB 1PZ8A 4FOQA 1X33A 2GAUA 1VRH2 4AFMA 3ZYPA 1HRI2 4ES9A 5L7OA 3MIDA 1COV2 1XXNA 4FBFA 2ZZQA 1RMU1 3ZXLA 4CP1A 4CDWB 1V6NA 3LOBA 5T5OA 1SLBA 3H9AA 3DPRA 2IXJA 1POV3 4Y1YA 2YPJA 1WCDJ 1ZNPA 4OUSA 4P9IA 3W58A 5DDJ2 3N7KA 5DUWA 3RZZA 3K48A 5C9AA 2CTVA 1S0GA 3H1WA 4OHXA 2JICA 4QD2A 3USUA 2ZGQA 1MR5A 4N9IA 3J26N 4NN0A 3KCCA 4PCRA 4ISQA 3WG4A 2CWSA 2D40A 4AF9A 3H7JA 5GALA 5JIAA 1UCXA 3RNSA 4Q4Y3 1H0BA 1ZBE2 2YHJA 5DZGA 1ND3A 4S2DA 1ASJ2 2P3IA 1ZREA 2JXAA 1FOD2 2HWE3 1PNFA 4YM0A 1VB2A 1Z0HA 4UXAA 4K6BA 1SLCA 5BNOB 1S0JA 2VUAA 4XF9A 2R062 1SBDA 1FX5A 2IXIA 3WT3A 3ZSLA 3ZN6A 2WIIB 1RUI1 4RQPA 4YVSB 2DVBA 5K0UC 3X29B 1HXS1 1UIJA 3SCGA 1EY2A 2XLGA 3VZKA 2OZ6A 1OLQA 4M3CF 4D7TA 3WCRA 1C1LA 1VBE1 2RS12 1PO13 2GN3A 4CP2A 3TN93 1SQ4A 3AKQA 2K0GA 1VB4A 1RUD3 1MS4A 1QY4A 4Q4W1 2VH9A 4I3GA 2VQAA 2N7GA 1DLLA 2IXKA 1J3PA 2MPFA 4BLIA 4Q0VA 4RS5A 3VBRB 4FT8A 2WJSA 4N7IA 4R9AA 4RS5B 4XQWA 2GALA 1F5JA 4M00A 3WUCA 1RUNA 1LGCA 1GZWA 4ASMB 4RGGA 1AUYA 3VZMA 1Z7S3 1BZWA 4XPVA 2HWF2 1EV11 3UL2A 5J7MA