5CFDC

Crystal structure of dtt treated human cardiovirus safv-3
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
258
structure length
258
Chain Sequence
SDRVSSDTAGNTATNTQSTVGRLFGFGQRHKGKHPASCADTATDKVLAAERYYTIKLASWTKTQESFDHIRVPLPHALAGENGGVFSSTLRRHYLCKCGWRIQVQCNASQFHAGSLLVFMAPEFDTSNHSTEVEPRADTAFKVDANWQKHAQILTGHAYVNTTTKVNVPLALNHQNFWQWTTYPHQILNLRTNTTCDLEVPYVNVCPTSSWTQHANWTLVIAVLTPLQYSQGSATTIEITASIQPVKPVFNGLRHTVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP1
publication title Structure and Genome Release Mechanism of the Human Cardiovirus Saffold Virus 3.
pubmed doi rcsb
source organism Saffold virus
molecule tags Virus
total genus 57
structure length 258
sequence length 258
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5cfdC00
5L7OA 4RS5B 1ASJ3 4CDXC 4JGYB 5FMOS 5BNOC 1COV2 2RS32 5C4WA 3ZFFA 1BMV2 1HXS1 3CJIC 3VBOB 4Q4V1 2RM23 1AUYA 1RUG2 4N53C 1RMU1 2WZR1 1RVF1 1VBC1 4CEYB 4RQPB 1R081 1AYM1 3VDDC 1AYN1 4IV1C 5ACA2 2FZ2A 1PIV1 1RUE1 1VBB1 3ZFGA 4FSJA 1ZBA1 2R072 4IV3C 2RS33 1EAH2 1HRI2 1PVC3 2RMU1 1AR62 5C8CB 4CDQA 5GKAC 2BBVA 2HWF1 1VBE1 5BNPC 5ACA3 1AL21 1B35A 2HWB3 1R091 1FPN1 4CDUA 1VRH3 3JD71 1WCDJ 1AR71 3DPRA 5ABJA 1PO11 4WM7A 1D4M1 1RUJ3 1EAH3 3JBG3 5CFCB 1HXS2 1RUI1 4Q4V2 1E57A 2TBVA 5CFDC 4QPGB 1VB2A 1OHFA 1PO21 1QJU1 1RMU2 2WZR2 1RVF2 1VBC2 5J98B 1RUC1 5D8AA 5C9AB 1GFF2 1AR92 1R082 1AYM2 2ZAHA 4FTEA 4CDXB 1PIV2 1MEC3 4GH4C 2WS91 1RUE2 1AR81 1VBB2 1NA1C 1ZBA2 2BPA2 3CJIB 3VBSA 1K5MB 5FOJB 4RS5C 1HXS3 1MQTB 1QQP1 1RUH1 1TME1 3JB4C 2WZR3 2HWF2 4JGYC 4N43A 1AYM3 1AYN3 3NAPB 1PIV3 1NCRA 5A33A 3VBOC 2RS13 4Z92B 1FPN2 1VBB3 3JD72 1ZBA3 1AR72 5JZGC 1PO12 1D4M2 4CEYC 4RQPC 5DDJ1 4RFT0 4AEDA 1R1A1 4GB31 5BNNB 1RUI2 1COV1 1EV11 2RMU3 5BNPB 4BCUA 1PGL2 1QJU2 1V9U1 3LOBA 2HWC3 1VBE3 4Q4X1 1RUF3 1AL23 1NG0A 1QJX1 4WM7B 2WS92 1R093 1VBD1 1AR82 1OOPB 5C8CC 4RR3C 1PO13 2X5IA 1NCQA 1D4M3 4Q4Y1 2R071 1ND3B 2Y26A 1HRV2 1RUI3 4CDWB 1ND2C 1QQP2 3ZXAC 1RUH2 2MEV2 3VBFB 1TME2 2R043 1PO23 2R062 1RUC3 4QPIA 2GH8A 4JGZB 2PLV1 5CFCC 1BEV1 1X36A 4YVWB 1BBT1 4QPGC 1HX6A 5C9AC 5DDJ2 1R1A2 2VQ0A 4GB32 1EV12 1C8NA 1TME3 1V9U2 1NCRB 1H8TA 3J8F1 4CEWA 5JZGB 1K5MC 4Q4X2 2XBO1 2IZWA 1QJX2 1AR91 1MQTC 1VBD2 4EJRA 2WWSA 4NWWA 4Q4Y2 5DDJ3 4YVSA 1TMF1 3NAPC 1R1A3 4GB33 5BNOA 1COV3 1EV13 3VBUA 1FMD1 1RHI2 3VBHB 1RUG3 4RR3B 4N53A 2PLV2 4Q4X3 4WM8B 5BNNC 1QJX3 1BEV2 3VDDA 4IV1A 4PDWB 1BBT2 1ND2B 4CDUC 2R073 4Q4W1 4IV3A 4WM7C 4QPIB 2RR11 1OOPC 1FOD1 3VBRB 2BUKA 1HRI3 1OPOA 5J96B 2GSYA 2RS51 5L7OB 1AR63 3J8F2 1QJY1 2FZ1A 1ND3C 1PGL1 2PLV3 2XBO2 2HWE2 1BEV3 4CDWC 3VBFC 4Y4YA 1BBT3 5AC91 4SBVA 3ZFFB 5C4WB 4JGZC 3TN92 1TMF2 1NOVA 1VBA1 3VBSC 1ZBE1 1F8VA 3HAGA 1HRV1 4YVWC 2QQPA 2MEV1 1FMD2 4Q4V3 5CFDA 1RMU3 2R061 1RVF3 1VBC3 2ZZQA 3ZFGB 1AR93 1R083 4GH4A 1NCRC 1RUE3 1NA1A 4Q4W2 1TMF3 1IHMA 1C8M1 3FBMA 2RR12 4CDQB 4RS5A 2XPJA 1FOD2 3S6PA 2RS52 1F2NA 1FMD3 1PGW1 3M8LA 3IDEA 1CJDA 1QJY2 1B35B 3ZFEA 1X33A 2HWF3 4JGYA 4CDUB 2RM21 3DPRB 1RB8G 3JB8A 5ABJB 1QJZA 3VBOA 5AC92 1FPN3 3VBHC 2WFF1 3JD73 1AR73 4Q4W3 1VBA2 4WM8C 2X5IC 1ZBE2 4NWVA 4GMP0 4RHV2 4PDWC 5A32A 5K0UA 5D8AB 2RS53 1QJU3 1RHI1 2ZTNA 4QPIC 3VBSB 3VBRC 2WS93 5L7OC 1AR83 5C8CA 2HWB1 1VBA3 2WLPA 4LLFA 1C8M2 1CD3G 1Z7S1 1HRV3 1RUJ1 4N43B 1QQP3 1RUH3 2MEV3 1PGW2 3ZFFC 5C4WC 3JBG1 1RUD1 2R063 5A33B 2RM22 4FTBA 2HWD1 5CFCA 2HWE1 2WFF2 4AEDB 4QPGA 1MEC1 1NY71 5C9AA 4GMP1 3ZFGC 1C8M3 3TN91 4CDXA 4YVSC 3ZFEB 5LK7B 2DF7A 1POV0 3CJIA 1PVC2 3VBUC 1V9U3 1K5MA 4CDQC 2BFUS 2X5IB 1MQTA 1NCQB 1VBD3 2WFF3 1B35C 2HWB2 5A32B 5K0UB 2RS11 1VRH2 4Q4Y3 1Z7S2 3NAPA 3DPRC 5ABJC 1RUJ2 3JBG2 1RUD2 1RHI3 2HWD2 5BNNA 1AL0G 5D8AC 2HWC1 5BNPA 1RUF1 1MEC2 1NY72 1Z7S3 1POV1 1H8TB 1OOPA 4CEWB 4RHV1 1RUD3 3J8F3 2HWD3 1ND3A 2R041 1M06G 2XBO3 4CDWA 2HWE3 4N43C 3VBFA 1AYN2 4YVSB 5BNOB 2RS12 1VAKA 4GMP3 4JGZA 3TN93 3VBUB 1ASJ1 4N53B 4AEDC 1SMVA 4YVWA 2RMU2 3VDDB 4IV1B 1W39A 3ZFEC 1HQNA 2HWC2 1VBE2 1RUF2 1AL22 4IV3B 1R092 5JZGA 4FTSA 4CEYA 4RQPA 1NCQC 2RR13 1DDLA 1FOD3 5K0UC 2RS31 1BMV1 1QJY3 1PVC1 2R042 1PO22 1RUC2 1A6CA 1RUG1 5AC93 3VBHA 4RR3A 5ACA1 1VB4A 4WM8A 5FMOL 1VRH1 1ZBE3 1POV3 1ASJ2 5CFDB 4RHV3 4PDWA 1ND2A 4Y5Z0 1EAH1 2BFUL 1HRI1 4GH4B 1AR61 1NA1B 1H8TC 4CEWC 3VBRA
chains in the Genus database with same CATH superfamily
1Q5OA 4UF0B 4F7ZA 1WLTA 3EHKA 4G9SB 2VMIA 3G6JB 4KWUA 3ZMNA 3ZSLA 3WF2A 2XUMA 1UKGA 1ASJ3 2YFUA 2DCYA 4Y1UA 4CDXC 2J1EA 3JCIA 4C1WA 3I8TA 2FMDA 4R9BA 2RDSA 5C4WA 4DB5A 1W2OA 4ZONA 1W9WA 4XFFA 2B5HA 1DZRA 1H6XA 4MX3A 2XJTA 3GCXA 3N9OA 1AUYA 1KGYA 1QMJA 4S2GA 3PIJA 3RFRA 3OEBA 1VBC1 4RQPB 1R081 2JENA 1AYM1 2E26A 2G9FA 4J1WA 4FPFA 4QHBA 4IV1C 4QWNA 3T2QA 3TNPB 3ILFA 5F5IA 1TEIA 5FZ9A 5I0TA 1FXZA 3HNMA 3ZFGA 1Q56A 4UFHA 1U5IA 1RTVA 2R072 5FZ0A 1RUOA 3IDAA 3ALQA 3VB9A 5EPAA 3WLUA 3FWEA 4FBFA 2A6YA 1GOFA 2AEZA 1EAH2 2NYYA 3RZJA 4XTPA 1UYXA 1EPZA 1PVC3 2D6MA 1ZRRA 2RMU1 4QX2A 5FXXA 3WP6A 3I3QA 4CCKA 4DXSA 1WMEA 1SLIA 1JZ2A 1AF9A 4CPBD 2QVSB 1CESA 1UY0A 3T2TA 1CJPA 4R9CA 2BBVA 4OCTA 2YPJA 4LTAA 4CUAA 5KXBA 5FYBA 5FWEA 1G9FA 3FHAA 4MGIE 1R091 2WQ4A 1VRH3 3FUQA 1OH4A 1XU2A 2D3PA 3K2OA 3O1UA 2Y34A 2QQNA 3DPRA 4TLFA 4MXVA 5F8PA 1PO11 5FZ4A 5GZFA 2ZPXA 1RUJ3 1EAH3 2KM2A 4FXGB 1BHGA 3OG2A 1LOFA 4JDOA 4RL7A 2B4KA 3HNBM 3BU7A 5C5UA 4M0NA 4PQ9A 2BNMA 5IVJA 2TBVA 1OHFA 1VB2A 1RMU2 2WZR2 2QCSB 3PUIA 3PHMA 1SEFA 2PQQA 1RUC1 1CN1A 2W3JA 3VDAA 5A1FA 4UWDA 5LA1A 4YGDA 4D8MA 4QDRA 4YW3A 2ZJCA 2JIGA 4GH4C 2P4EA 2JIJA 1OT5A 3AKSA 3GHMA 2W1WA 3H1YA 3OPZA 5FJKA 2ES3A 2BPA2 2ZKNA 4MADA 1UZWA 2AGSA 5CG8A 4LMFA 1WLCA 2R7EB 4LA2A 4O65A 4A42A 4QXBA 2C1FA 1FI2A 1K5MB 2UU8A 3AYEA 4NAMA 5EJ1B 4ZU7A 4CYDA 1RUH1 4HK9A 2BOIA 4L0PA 5LEKA 4LK7A 3JB4C 2DV9A 2WZR3 2HWF2 3AP6A 5F5CA 4N43A 2YFZA 2IXLA 3THTA 2V4AA 3LZZA 2WAOA 3DKWA 4LE4A 5FLIA 4E2SA 2CDOA 3I2HA 1SPPB 4QHOA 2DVBA 5A7SA 3VBOC 1UPIA 1JZ3A 4ZZ5A 4MGZE 3H1MA 4Q0QA 5EZWA 3A0NA 1D4M2 2YBSA 3VHNA 4CEYC 4DXZA 1UZVA 4RFT0 3HR9A 3I7DA 2Y0IA 3P3NA 1DZTA 5BNNB 1JZ5A 4DQAA 5BNPB 2PHUA 5BPXA 2X05A 5FO8B 3WSOA 1QJU2 1V9U1 3J26N 4B4PA 2RDQA 1JYTA 4K9SA 4FI9A 1VBE3 2VUDA 5DMYA 2W2IA 4MLOA 1AL23 1NG0A 5C3RA 1NXD1 1VMHA 3RZHA 4WM7B 1V6JA 2WS92 2LROA 5A6ZA 2W0XA 2A6VA 3FX3A 1QJEA 2DCZA 3N9PA 5JDBA 5JCTA 3AKRA 4N7UA 4QXHA 1DGWX 1QGLA 1D4M3 1LHUA 4H14A 1ND3B 4A41A 4FPYA 2W08A 4HETA 4L8QA 4FPHA 2E7QA 1ND2C 4CDWB 2VY0A 3VBFB 1T6GC 4LBOA 2WO2A 5IVBA 3VZKA 1TME2 2R043 1AHSA 1QEXA 2QQMA 4Y22A 1J1LA 4P9YA 1DLCA 4YG3A 4NR1A 3UK9A 2J7MA 2K46A 3OYWB 2UWCA 3FC0A 4UBGA 5F2SA 3ZKUA 4COWA 4I2OA 1OMIA 3KMHA 2AACA 1X36A 1AX0A 5EHDA 1HQWA 4KU8A 4YVWB 4BISA 2RV9A 3MPPG 3H8OA 2QDNA 4AQTA 1WMDA 5C9AC 4NRMA 1RJ7A 2WNOA 4LO6B 5DDJ2 5T5OA 3HQRA 2BBAA 4GB32 3NQHA 1EV12 2E32A 1LKNA 4E8CA 4R9DA 2EALA 1OBNA 1S2EA 1LOAA 2WNUB 3SH3A 1TME3 3KD4A 2D3SA 2ZMNA 3LD8A 3ZXLA 2WA4A 4D0QA 1H8TA 2FQPA 2FHRA 1N3PA 1BVP1 5GZDA 4CEWA 3MW3A 3AP9A 1LOBA 1DQ0A 2PYTA 4ZXEA 4EE2A 2IZWA 3H42B 3AZWA 2XKPA 3KCXA 1GBGA 3KHBA 1LOCA 2CV6A 3NMBA 1HJGA 1ZRIA 4EJRA 2XL9A 1PVXA 3K4AA 5A3MA 1MR5A 4LKFA 2R0FA 4NWWA 3RI9A 4LORA 5DDJ3 1LU1A 3POSA 4QGNA 3HD8B 4PI2A 5KXCA 1H1MA 3CZJA 4GB33 4BM8A 1KDMA 1EV13 4QB1A 5HXVA 5A6XA 5IVVA 1HIXA 4HPKA 3WP3A 4GWNA 4TTGA 3P5BA 5IAVA 3B5LB 2A3WA 2PLV2 2ZGMA 4WM8B 4KGQA 4R4ZA 2JDNA 2BGPA 2EXKA 1CR7A 2CNAA 4IV1A 4AFDA 2ZOEB 1NLSA 4L99A 5FK7A 4DRRA 3T1LA 3X29B 2QE3A 3MICA 3ZMOA 4Q4W1 2ETEA 4LUMA 5LRRA 5KWRA 3J7LA 1LR5A 4QGLA 3SXWA 4QPIB 4Z82A 3WINE 1LODA 1FOD1 2BUKA 5FZIA 1HRI3 2P3IA 4YFWA 2BOJA 2HYKA 3J8F2 1QJY1 2PLV3 4PIXA 2QUOA 2XBO2 1S0CA 2B46X 3R4SA 5LY2A 2A73B 1J83A 1JODA 3EJKA 3J4UH 5LA0A 1QHDA 3CIHA 3U14A 5AC91 4LLOA 5C4WB 4UFLA 1WBLA 4BH9A 4AFCA 4CCOA 1S0GA 2CAUA 4BMEA 4HOOA 2D40A 3CU7A 1KD7A 4TYSA 1F8VA 2CTVA 2YY1A 4B7EA 3ZR5A 3MFCA 3L2YA 2CDPA 2MEV1 1FMD2 4Q4V3 2WQ8A 4QDQA 4Z8BA 3ZXKA 1XYOA 2A6WA 2R061 4XF4A 5CIRA 5JOZA 1JYXA 3R6SA 3ZFGB 4ES8A 1SLAA 5J3UA 4R52A 4EN7B 3I49A 1I3HA 4GH4A 5DAVA 2B45X 1GQHA 2GMPA 2D98A 1NCRC 4W4ZA 1RUE3 4IE6A 1BQPA 1GLHA 1GP6A 3A22A 1SLCA 2RDRA 4FQZA 3S0MA 1BCXA 1W2NA 2RR12 2Q4SA 5B4NA 5F32A 4A7YA 3WD5A 2B9UA 4C8DA 3S6PA 5FK8A 5DN2A 5FZ6A 1FMD3 2VGDA 3POFA 2PXJA 3QH7A 3SEPA 3AYAA 3ZO0B 2ZMKA 1UPSA 1WMXA 4UT5A 4CCNA 3DPRB 4CCLA 1RB8G 3VBOA 4UFJA 1JH5A 1VLNA 2B9VA 1Q43A 4ZZ8A 4FOQA 1C4RA 1IS6A 1ULEA 2NMNA 3IB3A 2ORZA 2D97A 4GALA 3VL8A 1L3JA 2W87A 5FYMA 1D4VB 4NPMA 3E5XA 4GMP0 4NWVA 2F6BA 4PLOA 4Y33A 1C1LA 4Z1VA 4PDWC 1PK6C 2E31A 3K3OA 1H9PA 5FZOA 1ENSA 5K0UA 4D69A 4QX3A 2ZMLA 1BK1A 5LBBA 3WP5A 1QJFA 1EP0A 2JG8A 3VKFC 2VCAA 2Y38A 5HXMA 4K7JA 2GN7A 3NV4A 1RHI1 1GR3A 1LHVA 1ONAA 2ZTNA 3D4KA 1RYYA 3ZIXA 5JWPA 3POEA 1DGRA 1KFXL 1NUKA 3VBRC 1JYIA 3IAPA 1ZNPA 1CAUA 5E8AA 5L7OC 4LBQA 4AGVA 2ZGUA 4XF3A 4LO8A 2RDNA 3D82A 1H8VA 2V09A 3AZZA 2VNVA 3UGHA 1CD3G 1Z7S1 2D93A 4OLLA 5C3OA 3B7MA 3ACHA 1QOOA 2WLQA 3AM2A 1RUJ1 4N43B 1QQP3 1N1TA 4Y5SA 3O14A 1UL9A 2Z42A 3DECA 1YC61 4RGGA 3EMRA 2Y0OA 3HOBA 1DGWA 1ENQA 5IVFA 3H1WA 4NUBA 4AQ6A 3B01A 1RL3A 5DZFA 1YXWA 3VZMA 1XB9A 4FP3A 2ZGTA 5C9AA 1NY71 1MPXA 1UOFA 1WA4A 1ZM1A 2YC0A 3M3OA 5AFEA 5FTTC 3RS6A 3CQOA 3Q9OA 3PUQA 3NW4A 3ZFEB 5FYCA 3ILRA 4P02B 1UY1A 4NHLA 1Q8PA 2K9ZA 1V6OA 2JDKA 4MUVA 1POV0 3O12A 1O3SA 3DCQA 5A6QA 5KBFA 2QQLA 2VCBA 3ZYHA 3PTRB 2VC9A 2D6KA 1K42A 2IVIB 4BQXA 1CPNA 2WAAA 2VOTA 1VBD3 4M3CA 1JOBA 2WFPA 1JYNA 4IESA 3ZXJA 4LEJA 4MV2A 1UN1A 3BCWA 5LCWL 1YQ5A 5CAZA 2WN3A 1WD3A 5LWBA 4GA9A 1BK0A 2YC4A 2XWBB 4ZS3A 5ABJC 2WO7A 1REEA 4Y22B 1AZDA 1LGBA 4XUNA 3T3YA 3POYA 5JVVA 4A3ZA 4DFSA 3IIIA 4UW4A 1RUD2 4FVVA 3BTYA 4I01A 3VD4A 2D6OX 1OD5A 2HWD2 4W50A 3VKMA 4BZ4A 3RZMA 1IKPA 1WCSA 3H8UA 4GD4A 4RGAA 3WDYA 4E4HA 3OUIA 5KC5A 1S0EA 1CAXA 2VCCA 4P9JA 1GSLA 5D8AC 5FY4A 3L9JT 4AI8A 3DV8A 2OT7A 1ZA7A 2W9XA 1ULOA 5AFBA 2W5FA 1XNKA 3DXTA 4JDMA 2WQZC 4ZU4A 4AG4A 4BIFA 4CXWA 4A7KA 4XABA 1H8TB 4EWAA 4CEWB 1RUNA 4RHV1 1X50A 3RMXA 2HLEA 1RUD3 2VXRA 3GBGA 3GYDA 2RJ2A 3D6EA 5GLUA 5C6CA 1K5JA 3RJRA 2HWD3 3B94A 2R041 1M06G 4IDZA 3ZSEA 2A6XA 1DQ5A 1J3RA 1XJAA 2P2KA 3LIGA 4CCJA 4EZ4A 1OQEA 5FY9A 2XHKA 1UF2C 2GNBA 2VNRA 2O1QA 1OFNA 5FAXA 4O61A 2RS12 5JIAA 1QY4A 2VZTA 3SH4A 3AVRA 4IE0A 4NPLA 4HPKB 4HG6B 5FJHA 4M00A 2O8QA 3NV2A 4YGCA 4AFMA 3AVSA 4K8FA 1SMVA 1VPHA 2C24A 4XBNA 2RMU2 5SV5A 4NIGA 2EAAA 4IEXA 4QQ2A 4IV1B 4YZ3A 4LUKA 3ZDSA 1MZEA 4NIHA 4Z2WA 2D6PA 4DY3A 3T1MA 2XJRA 1HQNA 2VVDA 3O1PA 2VCMA 1V00A 5FZAA 3KVAA 4QKDA 5F37A 4DPNA 4AVTA 2XH6A 2CU5A 4CZSA 2L9LA 1R092 3DGTA 4XBQA 2X53S 4QB6A 1SCRA 1AXKA 1O4ZA 1WW5A 2VR4A 4UOJA 3SCGA 4FTSA 4IEUA 3NKGA 1W2TA 1VP6A 3AMQA 3C7EA 3OF1A 1IG0A 2ILMA 4OI4A 4RQPA 4UFKA 4XXAA 4OHYA 2Y6JA 2DVGA 1UCXA 1YQ2A 4TSVA 4XFGA 1ZZ8A 5A3TA 4OQ9A 4P9IA 5J09A 5JMOA 1BMV1 3TAYA 4CP1A 4Q2FA 3TBDA 4CUBA 2DWRA 4Q8KA 4XJZA 1RUC2 2BWAA 4WVVA 5F5AA 4K40A 1SLBA 1W6OA 3KLSA 4AXOA 5C70A 2BVBA 1SBFA 1ST8A 2HEVF 4G3YC 4XZUG 5FY7A 5FYUA 4ZS2A 1W0PA 2F17A 4RR3A 1VB4A 5FMOL 1LU2A 3OBRA 4H7LA 3RSJA 4COZA 4CU9A 1ULFA 3PVEA 3VD9A 4JCKA 3ILNA 4A2UA 4PDWA 3TYJA 1CAWA 3LDRA 5CEHA 2HEWF 1XPWA 5IFPA 2C5DA 3AZXA 2BFUL 1HRI1 2YUEA 3B9IA 4GH4B 2H0BA 3FE5A 4LO4B 3ZPOA 2VMEA 1E5SA 3KQRA 4QXCA 4K1YA 4QU1A 3VBRA 5GZEA 4ZHNA 1QH6A 4JRAA 5L7OA 3T4HB 2X10A 4KL1A 5CYYA 1JZ6A 4LHKA 2Z4FA 5G04L 4B7KA 4EWDA 3ROUA 2VW0A 5EIYB 3I2OA 4QM8A 4XQWA 1TQ5A 1XNAA 3DYPA 2ZGSA 4XHBA 2BV4A 2W1SA 5H9RA 5BNOC 4NHYA 2FDIA 3T08A 2RS32 2JDUA 1GZTA 5FMBA 3BU0A 1C5IA 2QQOA 4XE9A 1QDOA 4AHWA 1HXS1 3MV01 3CJIC 3SEEA 4ZXKA 3VBOB 3MIDA 5FR3A 1DQ6A 1YJLA 4ISQA 4Q4V1 4OHZA 2P5BA 2NM1A 3U07A 2NP0A 2WIIB 3QH6A 4CEYB 3VDDC 5IK5A 2PELA 5F7UA 2ENRA 1W2AX 5FZOB 3Q8CA 1RUE1 2Q1ZB 4FSJA 2R6QA 4HBNA 2JG8B 3K3NA 2VQTA 4BIOA 5JR2A 3SNMA 3FUOA 2EXJA 2RS33 4B1LA 4CP9A 5IT6A 5FZMA 5HBAA 3RZZA 4XJ9A 1CAUB 4LBQB 4Y20A 2CWMA 2GP3A 4YW6A 1GZCA 4CP0A 5GKAC 1BKZA 5DQ0A 1D0HA 4RD7A 2ARAA 2ZEXA 1DGRN 2OW4A 1F31A 2HWB3 1WW6A 2ZX4A 3ACIA 5A80A 2XB6C 1WCDJ 2IFRA 2DU1A 3POJA 1N1VA 4RA0A 3WNMA 2QQJA 1APNA 3ZYRA 1CIYA 5ABJA 1O3QA 4WM7A 3CL1A 2GU9A 1RGSA 4HVRA 5A7QA 1US3A 2ZHKA 3O1SA 1PZ7A 3RVHA 2YZ4A 3GALA 1C57A 3LSEA 4BXFA 1X8MA 4D6QA 1PO21 5C9AB 5BNQA 1RVF2 5D8AA 4QQPA 1CGPA 1WMFA 2FMYA 3EXUA 1ZRFA 3I2GA 1PIV2 4N90A 4P9LA 3J7MA 4BQ2A 1OLMA 1VBB2 2R32A 5FUIA 1MS0A 1ZBA2 2A7AA 3NRUA 3VBSA 4BYYA 3BYWA 4FFHA 1JBCA 5LBCA 1DFQA 3OD0A 5F5QA 2RG4A 1PGSA 2XDVA 4QX7A 1QQP1 2GAUA 2WWUA 5FZBA 4JHTA 2Q8OA 1YNAA 3NJVA 2VZSA 1T2XA 5DUVA 3PUSA 4JGYC 2Q0AA 1YI7A 2R1DA 5FPAA 1AYN3 3MLJA 4DXTA 1PIV3 3WG4A 3WDXA 4D3WA 4Z92B 3MYXA 2B7YA 1FPN2 4LKEA 1VBB3 2UWBA 3JD72 5IYYA 3N4MA 1ZBA3 2IXHA 4OUEA 1AVBA 1AR72 2JWPA 3ZXDA 5JZGC 4UW3A 5IVYA 4A7ZA 3WNXA 1LAJA 4HSJA 1JU4A 4LK6A 1IS4A 2JB8A 1NZIA 3WDVA 2LW8A 1GMMA 1WCKA 1RUI2 3CEWA 1CAXB 1COV1 3GDBA 3KM5A 4R9AA 3K4DA 4DUWA 4BCUA 4XETA 2VECA 3LOBA 2J1VA 4OFGA 2HWC3 3DF0A 2BEOA 1WA6X 2CSGA 1RUF3 2EXIA 3N9MA 2X8KA 4Q4X1 5FY5A 1Y9QA 4FAHA 1LECA 2SLIA 2I74A 3I3DA 4META 1VBD1 1AR82 4YW1A 5C8CC 1LGCA 2YPDA 4I09A 4XZPA 2NQYA 2QQKA 3LDKA 4RFRB 2EIDA 4AVBA 5L9VA 1O8SA 3MLKA 3ZN4A 5HV0A 1RUI3 4OVEA 3NV1A 3ZXAC 1LEMA 2MEV2 3DYMA 2IUWA 2VOWA 4GWIA 2CYFA 2R062 4LKDA 1DYPA 4AEJA 2DBNA 2W94A 4AZZA 5A3NA 3M70A 2GH8A 3AFKA 3MW4A 4QPIA 5FUPA 4EWEA 1ZA4A 3FLPA 4FPJA 5GLVA 2P3YA 2YDEA 2JE7A 3CLPA 4PBOA 3JU9A 4CTEA 1QWRA 1BBT1 2V5YA 4CUGA 1JU3A 1YI9A 1Y4WA 3FL7A 1R1A2 4XUOA 3T0DA 2W95A 3GXUA 2C9AA 5L36A 1HN1A 3BPSA 1C8NA 2GC3A 4COUA 2QTWB 4ZKTB 3WF3A 3IMNA 1H30A 4LKSA 2VZPA 3PJQA 3WNNA 4MZUA 1NCRB 2Z5WA 4FT8A 1XE7A 1GWKA 1UYYA 3NNLA 4Q0UA 1XSQA 4S2HA 4TXWA 5IVCA 1LHWA 5FY0A 1GNZA 4AHXA 4XUQA 3IM0A 4MGKE 1QJX2 5G05L 1AR91 1MQTC 1L7RA 1Z78A 4CCDA 2GN3A 1H2KA 1SBEA 2OA2A 3HN1A 2VO5A 1UXZA 4Q4Y2 4URTA 1XE8A 4OHVA 4YVSA 1TMF1 3AX4A 2D5FA 3NAPC 1R1A3 4C0BA 3MF6A 1V70A 1ULGA 5BNOA 3W9AA 3AP5A 3OPWA 1W6OB 3H7JA 2PHLA 1NQDA 4XMIA 2VMFA 3VBUA 1UIKA 4QHZA 1W8UA 1HQLA 5DG1A 2IXCA 1RHI2 3P1IA 3H9AA 3APBA 4WVWA 4RR3B 3H3ZA 5FMDA 4WZFA 4NHKA 1QJX3 1BEV2 1JYVA 3ES1A 4HZFA 3VDDA 3I2FA 1VJ2A 2Q30A 4PDWB 2E33A 3N7JA 1CAWB 5DABA 5FP4A 4B1MA 2R1BA 2WABA 4CDUC 5FQ0A 1W0NA 4XIKA 2TUNA 2R073 4I3PA 4E4DX 3TEWA 4KU7A 5GLZA 1CQ9A 4PCRA 3S57A 2P6HA 1OOPC 3VBRB 4PIZA 3M3CA 3ZDVA 5L7OB 1UYZA 3OPTA 2EICA 3OGRA 2MPFA 3WW1A 4ZY9A 3POGA 2JG9C 3A23A 4F8AA 4M3CF 1BEV3 5EYYA 5CKQA 4CU7A 5EQUA 3AC0A 4Y4YA 3VD3A 2WINB 2ZKLA 3F2ZA 1JUHA 4XC9A 2BW8A 4DOUA 3QLQA 4JGZC 3MIEA 2XUEA 5CVRA 2B42B 5K8SA 3WW4A 5LA9A 2RHPA 2C9KA 2FCUA 1HRV1 4LOTA 3RPQA 3MIGA 5EJZB 3ON7A 2QQPA 2R49A 5KXDA 1BXHA 5DXDA 1S0IA 2LTNA 1RMU3 1OXCA 3HNYM 4F3JA 1XC6A 2J1AA 2W46A 3H50A 4G4FA 3N7LA 4M3CE 5FLHA 4AI3A 3N35A 2UURA 1W6PB 2AUYA 4CP9B 4UBHA 3RDIA 1LESA 4MGYE 5FZHA 3I59A 1IHMA 1KEXA 1GP4A 3OB8A 3FBMA 1OVSA 2E7AA 2F4LA 4Y20B 5GM0A 3RMYA 3KHCA 1BZWA 5JPNB 4HN0A 2FBEA 2PAKA 4KWLA 4JQRA 4XFCA 5FY8A 2RS52 1F2NA 3OGGA 3TRSB 1PGW1 3OCPA 1NAEA 3M8LA 2DTWA 2Y6HA 2Y64A 3ZFEA 4JKLA 2HWF3 4JGYA 5LW9A 2YHJA 1W9TA 4OULA 3HN3A 2BRTA 2Y6LA 3Q8BA 4MGQA 3JB8A 5ABJB 3WZ1A 1MZFA 3NNFA 3AKTA 5EYXA 4FXKB 3ACFA 4MVTA 1WD4A 4FFIA 3ZYIB 1LGNA 1GICA 3MW2A 3JQXA 4P9XA 5T52A 1VBA2 3M3QA 3EQEA 4YPJA 5BNPC 2X5IC 1LTEA 1ZBE2 5IAXA 2W92A 5FPLA 5JIUA 4RHV2 3LF7A 4M4RA 5D8AB 1OKOA 2RS53 3C3VA 1XNTA 2EF6A 5DAXA 4YG6A 3LFIA 3WQBA 3TEZA 1QJU3 2YU1A 3I3MA 3SCHA 3AL6A 3VKOA 2OKXA 2JB4A 1GU3A 3TEXA 3VBSB 5LY1A 5KXEA 3WDTA 3MF9A 1QNYA 2UWAA 2WS93 3FHIB 5FBZA 4FPCA 1S55A 3NO8A 5FP7A 4XCAA 5CZKA 5C8CA 5CG9A 2HWB1 1VBA3 1XYNA 1GWMA 4LLFA 1C8M2 5I8SA 5LA2A 1VMJA 5CKMA 1NYWA 1QXJA 3THCA 1OC1A 2GALA 3PIGA 1GNYA 3ZFFC 2D43A 1TG7A 4Q5OA 2W47A 2P6CA 2WUHA 3S5AA 4PF1A 3PUAA 4Q27A 5JSPA 4OQ8A 1AJKA 4XW3A 1PZ9A 1DBNA 2RM22 3IDBB 4YZ4A 4FTBA 4AHZA 3ENRA 2XMLA 4Q0PA 2HWE1 2OZJA 5FZEA 1IS5A 4BDVB 3H8RA 1O3TA 1L7QA 2WFF2 3HT1A 3V0AA 1O5LA 1Q8SA 1ACCA 1C8M3 3TN91 2AENA 1ZYBA 2PHTA 1GP5A 3NJZA 3NNJA 1XSRA 4NVPA 4N8MA 3SHRA 4N9HA 1UMHA 2G9GA 2DF7A 5FZKA 3RG0A 3USUA 4D7SA 5JOWA 3PTYA 3KCYA 2VTFA 1LB2A 5BYNA 1F15A 4AEKA 1LULA 2OPWA 1OFSA 3O7OA 2EVXA 1JZ8A 2BFUS 2RJKA 2LRPA 2F4PA 1MQTA 3N3HA 2XWJB 3ZXGA 4AYUA 2XXZA 1J58A 3HPNA 2WFF3 4KNCA 3SITA 3PVOA 4HMZA 4PLMA 1B35C 4QQHA 5K4LA 5IVEA 5D2AA 5T5LA 3CHXA 2GNDA 4LPLA 4ASKA 2WL1A 3ACLA 4ZU5A 3NAPA 3RYKA 1DU3D 1UAIA 3UJOA 1PM7A 4LNVA 4XILA 4FFFA 1VMFA 4XEZA 1Q8OA 3GZTB 5EWSA 2WA3A 3JBG2 4HL0A 4FCAA 5JXGA 1GKBA 1KITA 4UW6A 5LATA 3WCSA 3CJXA 1S2KA 3PMEA 3WV6A 1SLLA 1V6IA 3W21A 1KRIA 1YFWA 3HBKA 1AL0G 1QU0A 1W04A 2HWC1 4GULA 1P8JA 2C26A 1RUF1 2VQUA 2Y6GA 1OD3A 5JR7B 2XVGA 3LWCA 1MEC2 3I54A 2FD8A 3WR0A 1C28A 3MIBA 4LR4A 4LBNA 4Q0SA 2OPKA 2WR9A 1OPMA 5IHRA 4ASLA 1O3RA 5JPMB 4I0WB 1ULDA 1OOPA 3M4FA 1YCIA 1MS9A 3O1MA 5J37A 2PN5A 2O14A 2HYXA 3FHQA 2VAUA 2VM9A 2Z69A 3J8F3 1W6QA 1K3IA 3GZUC 3H7YA 4YW4A 2PHRA 3R05A 2XBO3 1MVQA 2ZEYA 4YVSB 2ORXA 4R8HA 5BNOB 3B93A 3KT7A 1VAKA 4GMP3 3ACGA 4JGZA 3BALA 1A34A 1EUTA 3VBUB 1UZ0A 4XFAA 3N9QA 1IS3A 1YYNA 3BGAA 1ASJ1 4HK8A 4J25A 1NE6A 4XBLA 3VDDB 4IERA 5CNAA 4DIQA 4LIVA 5GALA 1W8HA 4I3GA 4DZGA 1YHFA 3AJZA 1KS5A 3U78A 2VBPA 3ELNA 5FQ0B 3LQCA 3OOXA 4I0BA 2Y6FA 3LSDA 4ARXA 1VE0A 3PUHA 3ZSJA 4IEQA 3ZSMA 1WLWA 3WF0A 1FV2A 1HN0A 2MHFA 2Q5TA 2QKDA 2WYSA 5FV3A 4HXCA 3KV6A 4CEYA 1BVVA 1NCQC 5FPZA 4ES9A 2RR13 3ZYBA 3RJ2X 4GQ7A 2Q8DA 3WDUA 3PDQA 2DBIA 5FYYA 4Q0VA 4E8DA 1XXNA 3K77A 3AFGA 1PVC1 2QZ3A 4NMIA 2D7FA 1PO22 4E27A 1VR3A 2PA7A 1KJRA 1J59A 4JC1A 2FCVA 1GUIA 3TEYA 4HVQA 1ENXA 5HCHA 3K51A 3UGFA 4I02A 1OLME 4PJYA 3BI3A 1H4GA 1W03A 1G7YA 2OXBA 1FV3A 3AMNA 4QQOA 1RXGA 1VRH1 1POV3 3W59A 2EIBA 3RNSA 1GZWA 3VGIA 1ND2A 1X9TA 1UOBA 2TEPA 1EAH1 4QX0A 3WXPA 2WZEA 5JUVA 5A7NA 4IGQA 3E6CC 4COVA 4QPYA 3I59B 1W99A 2BP6A 4K3UA 5FZFA 1MACA 4EROA 1HV0A 2VU9A 1ZRCA 3DYOA 1UOJA 4DS0A 5I0RA 3HEIA 2QDRA 2JEMA 2NZ9A 1I5ZA 4JDNA 1VIWB 2JDYA 2XQRA 4NOTA 4BK5A 1NX9A 2P34A 4JGYB 3S7IA 1COV2 1DP0A 1LCLA 3UNPA 3ZFFA 4AI0A 4ARYA 2A71A 3QOPA 3TOJA 5AVAA 4ATFA 4FPLA 1RUG2 4KG8A 5J36A 1JHNA 1HB1A 2UYAA 3A0KA 3K75B 4N53C 5A3OA 1RMU1 2AEYA 2WZR1 4JVAA 4U36A 4ATEA 5H9SA 2JJ6A 5FZ8A 5C3SA 1OI6A 4OZOA 4LHLA 4LOSA 2DURA 5ACA2 2FZ2A 3KV5A 1DG6A 3AZVA 4XQDA 5D1IA 2ZHMA 3WT3A 5JXIA 1HLCA 4CRQA 4FOWA 4X6QB 4GZ9A 3GJAA 1IPJA 3KSCA 3Q8FA 4ONUA 1FT9A 4IV3C 4XJ8A 4AW7A 2V72A 1BJQA 1DZQA 2ZGPA 5FP3A 2ZGRA 3VZOA 1XNDA 1B09A 4XUTA 3BTZA 1SQ4A 1UX7A 4IUGA 4U2AA 1ENRA 1AR62 2J1SA 4GXLA 5C8CB 1XE0A 4BB3A 3BN6A 2ZHLA 3OUHA 3AMPA 3AL5A 2HWF1 3FLTA 1AJOA 1MS5A 1OQDA 2CGNA 5H9QA 4DUVA 1TE1B 1VBE1 4ISRA 4NAOA 3R4DB 4XCBA 4AFAA 1AL21 1B35A 5ACA3 1WW7A 3WQ7A 4YW2A 4AAPA 1NLQA 3RRDA 3FFZA 3H0OA 2I2SA 3UT0A 1D4M1 2YBPA 4JV4A 4O7XA 4DUXA 4LT5A 4Y1ZA 5CU1A 3BODA 2KA3A 2WNEA 3RYPA 4AGGA 1JOJA 1JS9A 1K45A 2DVFA 1E57A 3B9CA 4P5YA 3Q8EA 4AI9A 5CFDC 1QJU1 3V0AB 2EAKA 5J98B 1VBC2 3ZYFA 4NN0A 1AR92 1R082 1AYM2 2ZACA 3WG1A 4CVUA 4FTEA 2V5DA 1YLLA 4CDXB 3USUB 1AX1A 2VMDA 1F4AA 3PJYA 3RI8A 2WS91 3RGBA 2VW2A 4WBBA 1UU5A 5DAPA 3TNQA 2BNOA 2XVLA 2HBTA 1UQXA 2WZPP 3T2OA 5FOJB 4RS5C 1HDKA 1E5RA 2ZS6B 4P14A 1MQTB 4K20A 1ZX5A 2QBXA 4UAPA 3V56A 2QQIA 1S0DA 3VZJA 3VDCA 4AFBA 1TME1 2WO3A 4MSVA 2HH9A 4FPOB 5JXHA 1AYM3 1UD1A 4D7YA 3NAPB 4QB2A 5FWJA 2P1BA 1NCRA 2GC2A 3AP4A 2RS13 3C7OA 2PAEA 5ANQA 1W8TA 1J84A 1PO12 1QXPA 5E6HA 2O0OA 4JQTA 5DDJ1 1H0BA 5EP9A 1G8WA 2V73A 2OUHA 4GB31 4YLZA 4Q1PA 1EV11 2RMU3 3VD7A 5F3GA 3NNGA 4INDA 3MZHA 1KQRA 1IOAA 3KF5A 1UO9A 3SMHA 2W39A 2VQAA 1W0OA 3D0SA 1QOTA 1W6MA 1XNCA 2D5HA 2HKXA 4EN0A 1TZOA 2OYZA 3UKTA 4PF5A 4AL9A 1R093 4YW5A 3KZ4C 1OOPB 4F83A 1O7FA 4XFHA 1DF0A 3ME2A 3E6DA 4A44A 1PO13 5KHIA 1NCQA 1HW5A 3G7DA 4AVAA 2FDKA 1W6QB 2XJSA 1EUUA 1YIPA 3FBYA 1HRV2 1PK6A 3GBFA 4DO0A 5I93A 3ZOIA 4BA6A 5I8TA 2NMOA 3THPA 5KR7A 3CNAA 1RUH2 4XPVA 4OI2A 5IK7A 1PNFA 4O9EA 1UU6A 3ZM8A 3WCRA 3POIA 2XGXA 2GMEA 1OLRA 1RUC3 4AVSA 4JGZB 4XDPA 2PLV1 5E1RA 5I0DA 1RINA 4BLJA 5CFCC 2XR4A 1OKQA 3SQOA 1GWLA 2KR2A 3T30A 3N9NA 5JI9A 5BY5A 4QPGC 1HX6A 3FLRA 3SH5A 4OUMA 1TNRA 3LPFA 4KQ7A 3KS7A 5T5PA 3WHUA 5T54A 4JKMA 4HSLA 4KWJA 2HEYF 1MS4A 2K0GA 2OVUA 2LUWA 2EA7A 2WRAA 1ULPA 1V9U2 5I8YA 3KVBA 4LBKA 3ZKYA 3OEAA 2EIGA 3J8F1 5C33A 4UFIA 1LOEA 3QCWA 2BNNA 3I4IA 3IIAA 2XBO1 1UIJA 2ZX0A 3ZYGA 3UV9A 4LQRA 3TWIA 1C1FA 3ZX7A 3KV4A 1DHKB 1DYKA 4GJYA 2WWSA 1CZTA 3H3LA 1STMA 4MH0E 5A3PA 4C90A 4W6XA 3U75A 3K4ZA 4IQPA 1PGL1 1GOHA 1YFYA 1W6PA 4QXKA 2BGCA 4FO9A 4GIQA 4MHRA 1U12A 3SLIA 5A1AA 1FMD1 2A3YA 4N53A 5C71A 2QNKA 4FFGA 2FDGA 4YZ1A 1V6KA 2W91A 3JZVA 1J1TA 4LBLA 5CISA 1WW4A 5LK5A 1CWPA 1FYUA 3LEIA 4X8NA 5IK4A 1GZWB 1MVEA 1ND2B 4EYUA 5FO9B 5F3IA 1RIRA 1HB2A 2BU9A 3BOWA 1O91A 4QDSA 5FPVA 1U5YA 2WT1A 3SKJE 4A6SA 5JOYA 4IV3A 5L9RA 2RR11 3FFQA 3CMGA 1O8PA 1A8DA 3O0VA 1OPOA 4YRDA 4B3NA 5J96B 2GSYA 4H7MA 2G4IA 3IBMA 5L9BA 1JOPA 4KH9A 2FZ1A 5EXOA 2ZAAA 3UJQA 1UMZA 4JTNA 4CP2A 4EN6B 5I91A 4Y1XA 2VZOA 4FPGA 1GQGA 1QKQA 2A75A 2HWE2 5F2WA 3MGUA 3U1XA 1WGPA 4BXSV 5FO7B 1YFXA 3C7GA 3I97A 1W2UA 1T6BX 1ZZBA 3M3IA 1KS4A 4SBVA 3ZFFB 4LITA 3TN92 3LB9A 3OY8B 1NOVA 1CVNA 2GDFA 3LKJA 1MZ5A 1S2BA 4XUPA 4YG0A 5CA6A 1IG3A 3JQWA 2ZX2A 2VE1A 2ZBJA 2WKKA 4YGBA 2W1QA 5FBJA 1A78A 4XDQA 2A5ZA 4YYOA 5CFDA 4YGEA 5B4XA 3B00A 4L92A 1RVF3 2ZZQA 1NKGA 2E63A 2D44A 4DY5A 5C8WA 3CBNA 2WSUA 2ZGLA 1SHWB 3WG2A 4XACA 2UY9A 3O0WA 1W9SA 3VZNA 4V2VA 3BTAA 1AXZA 3CZUA 4Q4W2 2C6SA 1XU1A 3NJXA 5DAWA 4RS5A 5IUQA 2E53A 1FOD2 3KQ4B 4WVZA 3ZYJB 3I2DA 4LJHA 4COYA 4QT6A 3PLQA 4HKWA 3ZYPA 3BIEA 1CJDA 1QJY2 1B35B 2OX0A 1WZXA 4DXRA 3VUOA 1LOGA 2E6VA 3AB0A 1S0FA 4Y4RA 2VUCA 2Q8CA 5JSOA 2IXKA 1L7LA 3CF6E 4YM3A 5AC92 1FPN3 3VBHC 1IKQA 3JD73 5A70A 2VUAA 1AR73 5L19A 4Q4W3 3M2MA 2CGPA 2ID4A 2VZ1A 4BE3A 5T50A 4B29A 2IXJA 5HCFA 3WW2A 2ARXA 3BVCA 4YM2A 2BWCA 1Q3EA 2RE9A 2WN2A 3AP7A 4QGMA 2D6LX 2BTVC 5HCAA 1N1YA 2WNVC 5APAA 2CWSA 4OMDA 1UU4A 3K48A 5K9YA 4ET7A 2XL7A 4AQSA 1AR83 5A7OA 5DUWA 3AKQA 2WDBA 3LPGA 4CXXA 2XJUA 2VVFA 2WLPA 2YGLA 4NRPA 3C7HA 3LIHA 1I9RA 4LBMA 5C3PA 1W3VA 2XLAA 4QPWA 2MEV3 3NJYA 4HLTA 4QQLA 5FMCA 5FIXA 1U5ZA 1RUD1 1CAVA 4TWTA 2R063 4I30A 5FZ1A 4QMAA 3OTFA 4AI1A 2HWD1 4M4PA 1D2SA 3VN4A 5CFCA 5CADA 1CPMA 1DYOA 2JD9A 4XF1A 4NPRA 4I0AA 2BZDA 2QZ2A 2RVAA 4DRVA 1A3KA 5FZCA 2ADDA 3OUJA 4QPGA 1OA2A 5I0UA 3OJBA 1RITA 1G9DA 1DQ1A 4Y1VA 1R64A 5C7GA 1RJ8A 5JXJA 3PURA 1OF4A 3U4XA 1IGOA 2VMHA 2PHDA 4QKNA 4QKFA 2WJSA 2YG0A 4LHSA 1WKYA 2ZGQA 4AQ2A 4CCCA 1W6MB 2VZRA 3CJIA 3DN7A 1PVC2 1SCSA 3DEMA 3E97A 3JUUA 3NL1A 5BV6A 4BWOA 4CDQC 3WNKA 2VVEA 3HIFA 3WY6A 3OGJA 2VW1A 1NCQB 2YV8A 3RZGA 2QFEA 5LBEA 1N3QA 2LALA 5FY1A 1N1SA 1PK6B 5A32B 2RS11 1XQNA 4K21A 4KBBA 3VKNA 2D3RA 1VRH2 4PQQA 4Q4Y3 2Y33A 1O6UA 1Z7S2 2CL2A 5DPNA 4YNIA 1EY2A 1YWKA 2ZHNA 1EPWA 2ET1A 3WF4A 1VAMA 1RUJ2 4P00B 3VHOA 2AZ5A 3WNLA 3BTXA 1G9CA 2PHWA 5IWFA 1RXFA 4A4AA 3HQUA 1RHI3 1AXYA 4WV8A 5LASA 2A3XA 1GANA 1ODMA 5GLTA 1REDA 2YGMA 2W52A 1G9BA 3WG3A 1HB4A 2N7GA 1UZZA 2NLRA 3NSTA 1XNBA 1NY72 1F35A 3MUZ1 1IQAA 3BPZA 3FJSA 4M01A 1UNBA 1Z7S3 1X8EA 1JTZX 3UL2A 1O5UA 4YW7A 1SFPA 1N3OA 1ZZCA 1UY2A 2E51A 2ZXQA 5A3LA 2A70A 4NE9A 3SC7X 4BOWA 3AZYA 3GNEA 3MIFA 2FDFA 1UWWA 1X9PA 4QAWA 5FZLA 3N7KA 2ZX3A 4HANA 3PU3A 4QM9A 4A6OA 1Y9MA 2VZUA 4E4SA 4EZHA 4AR2A 5LK7B 1G9AA 2C4XA 1W8NA 1YJKA 4V1PA 1SDDB 2GNMA 4BPZA 3I3BA 5KHGA 2J22A 4H55A 1UOGA 5JLVA 5H9PA 4MYEA 1E5IA 2IC1A 3AYDA 4ORFA 1W8WA 1GV9A 4FOYA 2CY6A 3WW3A 1NZCA 4N53B 3O5SA 4AEDC 4TZDA 2AH2A 1V6MA 2JDAA 4P5HA 1W6NA 2WT0A 2UYBA 3D5OA 2P37A 2YYOA 2YB7A 3NNMA 5FZ7A 2OUJA 4XDOA 3SCFA 4CA9A 4KI5M 4CUCA 1AX2A 2JDPA 5FLJA 3MEPA 2DUPA 1A8MA 2VH9A 4PIYA 2P17A 2VBDA 4O9GA 4XOGA 5ANNA 2WWJA 3P6BA 1OUXA 3HT2A 2BYVE 1VBE2 4EQVA 1AL22 2NN8A 4IV3B 1YQ8A 2P3JA 5LRSA 2JXAA 4OZXA 5JZGA 2G9ZA 1H1IA 4L11A 1POQA 4IGOA 3IAQA 2R16A 2RJLA 3RZLA 3N36A 1DDLA 1O59A 5DG2A 4URAA 5KC6A 1G6NA 1KXGA 1H2LA 5K0UC 2RS31 4H3WA 5FKCA 3FN9A 1S1AA 2JG8C 4LA3A 2R042 3GGLA 1YFUA 3E1F1 4YM1A 4JKKA 3C7FA 3LAGA 5FP8A 4OMCA 3PNAA 2ZA9A 4IEWA 4QD2A 4HFSA 3D0JA 3VBHA 3WUCA 4X8PA 1W8FA 1SFNA 3VD5A 3RWNA 3OBZA 1C3HA 1ZBE3 1VALA 2VL4A 4GJZA 4Z07A 2W68A 5CFDB 4RHV3 4MGTA 5BUVA 2A6ZA 3C8XA 4X6RB 2SBAA 4E4ZA 5KHHA 3THDA 4Y5Z0 1FX5A 5A1LA 5FZGA 2WYFA 1DIWA 4GAZA 4BQ5A 1ZZ6A 4GWMA 2WNVA 4H2AA 2OIIA 5FYIA 1DLLA 3GZEA 1ULCA 1WCQA 2CAVA 1PX4A 1R1ZA 4B4RA 1ZREA 3U10A 2Q1MA 3LGRA 4RS5B 3GHNA 1OURA 1W8ZA 4UI9L 4LO7A 4XHXA 1BYHA 5IK8A 3MFAA 3LEGA 4XMAA 5AVPA 1WCUA 3IWZA 3WQ1A 1W05A 5FMOS 3LA3A 3IMMA 2VOXA 4W8JA 3HWJA 4XXPA 2VTXA 4MXWB 1W9FA 1BMV2 4NIDA 1GOGA 2E7TA 2VOVA 1ALYA 2DDUA 2QQUA 3RQ0A 5HI0A 2RM23 3AKPA 4YSFA 5A3WA 2BERA 1RVF1 3BB6A 2R0HA 3KCCA 2VULA 1DGLA 2XQXA 5FKBA 1AYN1 2DVDA 4HKLA 5J48A 4ITCA 1PIV1 4AE2A 3WF1A 5J7MA 2GNTA 5A7PA 4IL7A 1VBB1 5JI7A 2OS2A 1UMIA 1ZBA1 3URFA 5FREA 2YROA 2B39A 4AAXA 2HBUA 1URXA 3NWKA 2VTXJ 4HT1T 2JICA 3UGGA 1JW6A 4W65A 1HRI2 1LRHA 1WBFA 2GMMA 3VKLA 2VXJA 3P3PA 4CDQA 4D6RA 2G1MA 3POBA 1CZSA 4FQ4A 5K7PA 5T55A 1JZ7A 2JDMA 1H9WA 1PNGA 1Y3TA 1WUVA 1ZVFA 1DQ4A 1U0AA 4FPEA 5FXVA 1OA3A 1C5HA 2QQWA 3GF6A 4WVMA 2IWGB 2K2SA 2XOMA 3MI8A 5EV7A 2CHHA 4CDUA 1FPN1 4K1ZA 1MZ6A 1QNWA 2YU2A 3JD71 1US2A 5SV8A 1QOSA 4EN8B 1AR71 2DTYA 5HV4A 1CAVB 2ARCA 3I3EA 4BQYA 2GH2A 4DNYA 3B02A 3PVBB 4Q26A 3JBG3 2J1TA 3ZN6A 1HXS2 3AK0A 1RUI1 4XFBA 1X82A 5CFCB 1HB3A 4Q4V2 4AHYA 2ERFA 1YRZA 3SISA 4QPGB 2JG9A 1PZ8A 1YO8A 1GFF2 2OQ7A 4KGGA 4XFIA 2ZAHA 4W6YA 5D21A 3OBAA 1OF3A 4YZ2A 1MEC3 4EN9B 1SZBA 3AYCA 1CX4A 1RUE2 1AR81 2VMCA 5FCCA 3S5QA 1NA1C 4BHPA 5IATA 2Q1FA 1PMJX 3CJIB 1LENA 3N9LA 4GKXA 4HVOA 4NO4A 5F9TA 3HJRA 5CKNA 2H6CA 1QIQA 5FXZA 2JDHA 3ZIWA 1SBDA 2CGOA 1CIWA 3M1HA 1I5PA 4C1XA 1W28A 3A4UA 1HXS3 3KV9A 1TNFA 4ZPIA 1H2MA 1HV1A 3VV1A 1Z0HA 4QKBA 4YZ5A 2PQSA 3WOGA 2VG9A 1NLRA 4LE3A 3RZKA 1PX3A 4NRQA 5A33A 2EIEA 3MV11 2PHXA 5GZGA 5IJRA 4LULA 1SDWA 1J3PA 3QACA 1W90A 3S7EA 2ARBA 3LA2A 3B3QE 3R0RA 2VOKA 2HJIA 4RQPC 2YC2A 4AEDA 3LFMA 3D8CA 1R1A1 2WO1A 1OVPA 2JDZA 4IGPA 4OUSA 3WP4A 3V0BA 2W1UA 3USSA 4BQ1A 5KHJA 1HKDA 2XG3A 4FP2A 1PGL2 1XBFA 2ZEWA 1UYPA 2DYCA 3MDPA 4AI2A 4IEZA 1FNZA 2VZQA 3UKVA 1S0JA 4L97A 4BQWA 1GZ9A 1J3QA 3WNPA 4XURA 4FOVA 1QJX1 5LB6A 3WEZA 4C0HA 1QH7A 3OBTA 1FATA 3DKQA 3ES4A 1GYKA 4Q29A 4RR3C 5A3UA 2XJVA 4R4XA 2X5IA 3SKVA 4OI0A 3U37A 1I6XA 2A1XA 3PVNA 2R071 4Q4Y1 2Y26A 5A6YA 2C0ZA 1V0AA 4JX0A 5FZ3A 1Y43B 1QQP2 5B2GB 3VDBA 1Y9GA 2DUOA 4LO5B 2JECA 1PO23 5FYSA 3U0ZA 1UXXX 4XVHA 2H0VA 3M7AA 2H6BA 2YXSA 3J7HA 1CONA 3V64A 2VNOA 1D0GA 3U4SA 1BEV1 4IETA 1GQPA 1OH3A 4CDXA 1W6NB 4JTOA 1SG3A 1KJLA 2FDHA 2Y60A 4Y3OA 4NHMA 2VQ0A 4IW3A 5HCBA 4XF9A 3VHPA 3O1TA 2E9QA 4PHZA 3OY8A 1D7PM 1JN2P 3BUCA 4S2FA 4YWAA 2GZWA 4CE8A 5JZGB 1K5MC 4Q4X2 1JUIA 3AXEA 3IPVA 3ZXEA 5EFUA 2AYHA 1VBD2 2XKOA 1LHOA 2ET7A 5A7WA 4QU2A 4BQ3A 1NQJA 3L2HA 5FOBB 3J9SA 2VUJA 5F1RA 1MS1A 5FYZA 5FPXA 1COV3 1JMUB 2GC1A 3O1VA 2WBKA 2DFCA 1YEWA 2VMGA 2DCTA 4XQ4A 3LA7A 2MNGA 2XVKA 3IDCB 2DCKA 3VBHB 5FUNA 1H6YA 1RUG3 2BQPA 1Q8QA 1S4CA 4Q4X3 5BNNC 4FAGA 2JX9A 4AGRA 5IW0A 3WUDA 1OLQA 3D3AA 4IE7A 2VZVA 5JAXA 1BBT2 2PAMA 2VJXA 1M4WA 1WWYA 1ODNA 5F3CA 4Y26A 3IZOA 1W8OA 2WNVB 3PL0A 3W20A 4WM7C 5LBFA 5LEJA 4PI0A 5GJ6A 5F6KA 1JXNA 3VZLA 4IE5A 1S0BA 2R30A 2RS51 1AR63 1PHMA 1LNSA 4CPBA 4J6GA 2J1UA 1ND3C 3U11A 4E2QA 4JAAA 4M0HA 1CZVA 5J1XA 3IT8A 4CDWC 1UY4A 1N47A 3VBFC 2IFWA 4BQ4A 3MLLA 2WSVA 4Y1YA 1BBT3 3IKWA 3UKNA 3DL3A 3FMGA 1OA4A 3AJYA 3S30A 1WLDA 1KDKA 3MPBA 4LXLA 4XJAA 4GWJA 5KHKA 5E89A 3H8XA 2QQVA 1TMF2 1VBA1 3R4UA 3VBSC 3ITQA 3ZSKA 5GLWA 1ZBE1 4NROA 3HAGA 3H3UA 1MS3A 3A21A 4K6BA 2Z79A 4YVWC 1W9YA 5DUUA 5FP9A 3A7QA 1H1AA 4SLIA 1IPSA 1JYCA 3RYRA 2ZGOA 1NT0A 3KGZA 5HPOA 2DUQA 4TN7A 4MHUA 3BKZA 1VBC3 4A45A 1AR93 1R083 3DXUA 2YBKA 2Y6KA 3DUIA 2VPVA 4IEYA 3T09A 3T2PA 2WNUC 3INAA 1NA1A 1PMHX 3E5QA 1UX6A 3MBWA 3K46A 4E9KA 4AOCA 1D2QA 1KFUL 5LZ6A 1TMF3 2QJVA 4IEOA 1RC6A 1C8M1 2JD4A 1UW8A 4UF0A 4CDQB 3MHZA 3ZVXA 5JOXA 2XPJA 2LM3A 2JKBA 3I2JA 4MOAA 3ZR6A 4DEVA 1NXMA 4IXLA 5DAQA 1LHNA 3E6BA 3IDEA 3PMSA 4WVMB 1TVGA 1X33A 2J42A 4PLNA 4AWDA 1OSGA 4CDUB 4HONA 3VLBB 2RM21 4K8RB 4CSWA 1K12A 3POWA 2J1RA 3HQXA 3N7MA 1QJZA 4D94A 3PU8A 4LIUA 2WFF1 5M0TA 4XAAA 4ASMB 2BDRA 4KBZA 3ZN6B 4WM8C 3WX5A 2I45A 3WQ0A 5F3EA 3WHTA 1CX1A 4NIIA 2JG9B 2ZEZA 2ZZJA 2V4VA 1YQCA 5A32A 1JHJA 3O0XA 5GZCA 2PFWA 4V2WA 3VHRA 3LDBA 1NE4A 1F4HA 4B8EA 4KG0A 3GCWA 4QPIC 4MGSA 5E88A 1UKRA 2X09A 4EV0A 3JXSA 4CXYA 5FYVA 3EO6A 2VD7A 4KMQA 5DUXA 3C2UA 5TSWA 4NIAA 3EBRA 4BLIA 2DVAA 2B8MA 3GBWA 3ORJA 3W5NA 4KWKA 5FZDA 4UYBA 3GM8A 4IEPA 1F9KA 3UETA 4TLGA 3WVJA 4QX5A 4D7TA 1HRV3 2IVJA 3TB0A 3BIWE 1PMIA 1LJ7A 1RUH3 3NKTA 3OSDA 4BK4A 1PGW2 3WDWA 5C4WC 5I0SA 3JBG1 3O1OA 4N9IA 3AMMA 4N7IA 3KT4A 5ERLA 5A33B 5CB7A 2AR6A 1MS8A 5JMCA 4OI1A 4MG2A 4XYXA 1FAYA 1OUSA 3HVDA 4AF9A 3OD4A 2GC0A 3GJBA 4RGKA 4RYDA 4B4QA 4JHZA 4DMIA 4L2NA 4AEDB 1YUDA 1O4TA 2FCTA 4GKYA 2GP5A 1MEC1 3V0BB 4DINB 4JZRA 4GMP1 3ZFGC 3HBZA 5FYHA 4BMBA 4YARA 4RSUA 3J7NA 4YVSC 4L9BA 1REFA 3EYPA 4XJWA 4CCEA 3QD6A 4NJ4A 3ECQA 1V9U3 2TNFA 4Q1RA 2KD7A 2VBBA 4PBPA 3VBUC 5FRAA 2I07B 1K5MA 4YFZA 2IXIA 2X5IB 5FDBA 4CU8A 4JRLA 4PT6A 1IZ3A 1SFYA 1X7NA 2HWB2 1LEDA 2JE9A 2D6NA 5K0UB 4D6SA 5E16A 2BVVA 4XTMA 4S2DA 3KWVA 3DPRC 4BJ0A 2ATFA 1SPPA 2ZABA 2XLGA 1OQ1A 4MO3M 2DCJA 2XHNA 2XJQA 1F5FA 4P08A 3T0BA 1EYBA 1LOFC 4QX8A 4P9GA 1E5HA 4J1XA 5F39A 3ABZA 1JYWA 3KF3A 5CBLA 3NV3A 4XJUA 5BNNA 4UFMA 3WNOA 3VL9A 4XF0A 3ZN5A 3ZLIA 1SACA 2PHFA 4C91A 5BNPA 3CKHA 4QX1A 1JI6A 3LOIA 3T0AA 2WC2A 4AVVA 3V65A 2BGOA 3I2KA 2PTMA 3HMYA 4Y5TA 2P3KA 3LCPA 2Z2SB 3BOPA 1XRUA 1POV1 1QF3A 4AEMA 2VZ3A 2XJPA 3ATGA 3IPVB 5FXWA 4W6WA 4Z2AA 3F95A 4OHXA 3Q8AA 1ND3A 3UYJA 4BU2A 5F6LB 5A7WB 3FZ3A 1IQDC 1DQ2A 4CDWA 1ZRDA 2HWE3 4N43C 1H2NA 4UXAA 3VBFA 4A3XA 2PMWB 1AYN2 4XIOA 2WT2A 5FFOC 5IFTA 3NVCA 5FYTA 2DU0A 4HN1A 4NHXA 2ZCWA 4P9WA 2OQ6A 3OYWA 3W58A 3W5MA 3TN93 3MUY1 4Q8LA 1W06A 4OYUA 4FPKA 1F5JA 2Q8EA 3RWKX 5C5TA 5FPUA 1I1EA 3ST7A 4IEVA 2NPIA 1SLTA 4YM0A 3ZXFA 4YVWA 3O1RA 2LS6A 5BXXA 3ETQA 2O8OA 1HJFA 4M3CB 1BLZA 1W39A 2ZGKA 4IE4A 4WZCA 4CCMA 2UY8A 3IN9A 3ZFEC 2DFBA 1DCSA 1XYPA 4LHNA 3KT1A 4XAEA 2HWC2 4MXWA 1RUF2 2WNUA 3LEMA 1ZZ9A 1PM4A 4UW5A 2VNGA 1Q8VA 1YIFA 4HKOA 1Y7BA 1QXRA 3CDZB 5T5JA 2AREA 4E2GA 2G19A 1O4YA 5DZEA 5EJ3A 4Y24A 1JZ4A 1FOD3 2ZGNA 3I2IA 3QBQA 2ZX1A 5DZGA 1XOYA 1G86A 3ETPA 1GNHA 1QJY3 2BJSA 2EXHA 3E5UA 3LEKA 2WZ8A 3LE0A 1A6CA 1RUG1 1FNYA 5ISLA 1W3XA 1ZZ7A 4AVCA 3AMHA 3B69A 3ZPYA 1H4HA 2KXLA 4LBJA 2JE8A 4CU6A 5AC93 1VAVA 1VRBA 4DEQA 2FDJA 4LBQD 5ACA1 2YMZA 3ASIA 2X29A 4RN5A 2JKXA 4WM8A 1UY3A 2Y8KA 3CO2A 1QDCA 3M3EA 1ASJ2 2OZ6A 3MO4A 3KB5A 5T3NA 1IPKA 3T4VA 2AC1A 2XLFA 3KGLA 2XONA 2ADEA 4OHWA 3EB7A 1V6NA 3UESA 4AK3A 5FPBA 1AR61 1NA1B 3GZAA 3OGVA 1YQ6A 3OGSA 5C3QA 1H8TC 5JSRA 5L73A 1U5XA 1V6LA 3MIHA 4CEWC 1UZYA 3AXDA
chains in the Genus database with same CATH topology
1Q5OA 4F7ZA 1WLTA 3EHKA 4G9SB 2VMIA 3G6JB 3ZMNA 3ZSLA 2XUMA 1UKGA 1ASJ3 2DCYA 4Y1UA 4CDXC 3JCIA 4C1WA 3I8TA 2FMDA 4R9BA 5C4WA 4DB5A 4XFFA 2B5HA 1DZRA 4MX3A 2XJTA 1AUYA 1QMJA 4S2GA 1VBC1 4RQPB 1R081 2JENA 1AYM1 2G9FA 4J1WA 4QHBA 4FPFA 4IV1C 3TNPB 3ILFA 1TEIA 5I0TA 1FXZA 3ZFGA 1Q56A 1U5IA 1RTVA 2R072 1RUOA 3ALQA 3WLUA 3FWEA 4FBFA 2A6YA 1EAH2 2NYYA 4XTPA 1ZRRA 1EPZA 1PVC3 2D6MA 2RMU1 3WP6A 1WMEA 1SLIA 1AF9A 2QVSB 1CESA 3T2TA 1CJPA 4R9CA 2BBVA 2YPJA 4LTAA 5KXBA 1G9FA 4MGIE 1R091 2WQ4A 1VRH3 3FUQA 1XU2A 2D3PA 3DPRA 4TLFA 4MXVA 5GZFA 1PO11 2ZPXA 1RUJ3 1EAH3 2KM2A 4FXGB 1LOFA 4JDOA 4RL7A 3BU7A 4M0NA 4PQ9A 2BNMA 2TBVA 1OHFA 1VB2A 1RMU2 2WZR2 2QCSB 1F8VA 3PHMA 1SEFA 2PQQA 1RUC1 1CN1A 4YGDA 4YW3A 2ZJCA 4GH4C 3AKSA 3GHMA 3H1YA 3OPZA 2ES3A 2BPA2 2ZKNA 2AGSA 5CG8A 1WLCA 4LA2A 2C1FA 1FI2A 1K5MB 2UU8A 3AYEA 4ZU7A 4CYDA 1RUH1 4HK9A 5LEKA 3JB4C 2DV9A 2WZR3 2HWF2 3AP6A 4N43A 3THTA 2IXLA 3LZZA 4E2SA 4LE4A 3DKWA 5FLIA 3VBOC 2DVBA 1UPIA 4MGZE 3H1MA 4Q0QA 5EZWA 3A0NA 1D4M2 4CEYC 3VHNA 4DXZA 4RFT0 3HR9A 3I7DA 2Y0IA 3P3NA 1DZTA 5BNNB 4DQAA 5BNPB 2PHUA 5BPXA 5FO8B 1QJU2 1V9U1 3J26N 4B4PA 4K9SA 1VBE3 4MLOA 1AL23 1NG0A 1NXD1 4WM7B 1V6JA 2WS92 2W0XA 2A6VA 3FX3A 5JDBA 2DCZA 5JCTA 3AKRA 4N7UA 1DGWX 1QGLA 1D4M3 1LHUA 4H14A 1ND3B 4FPYA 2W08A 4HETA 4L8QA 4FPHA 2E7QA 1ND2C 4CDWB 2VY0A 3VBFB 1T6GC 4LBOA 3VZKA 1TME2 2R043 1AHSA 4YG3A 4Y22A 1J1LA 4P9YA 4NR1A 3UK9A 3OYWB 4UBGA 2UWCA 3FC0A 4COWA 4I2OA 1OMIA 3KMHA 1X36A 1AX0A 1HQWA 4KU8A 4YVWB 3MPPG 2QDNA 4AQTA 1WMDA 5C9AC 1RJ7A 4LO6B 5DDJ2 5T5OA 4GB32 1EV12 1LKNA 4R9DA 2EALA 2WNUB 3SH3A 1LOAA 3ZXLA 1TME3 3KD4A 2D3SA 2ZMNA 2WA4A 1H8TA 2FQPA 2FHRA 1N3PA 1BVP1 5GZDA 4CEWA 3MW3A 3AP9A 1LOBA 1DQ0A 2PYTA 2IZWA 3AZWA 2XKPA 3KCXA 1GBGA 1LOCA 2CV6A 4EJRA 2XL9A 1PVXA 5A3MA 1MR5A 2R0FA 4NWWA 3RI9A 5DDJ3 1LU1A 3POSA 4QGNA 3HD8B 5KXCA 1H1MA 4GB33 4BM8A 1KDMA 1EV13 5HXVA 1HIXA 4HPKA 3WP3A 4GWNA 3B5LB 2A3WA 2PLV2 2ZGMA 4WM8B 4KGQA 4R4ZA 2EXKA 1CR7A 2CNAA 4IV1A 4AFDA 2ZOEB 1NLSA 4L99A 4DRRA 3T1LA 3X29B 2QE3A 3MICA 3ZMOA 4Q4W1 2ETEA 4LUMA 5LRRA 5KWRA 1LR5A 4QGLA 3SXWA 4QPIB 4Z82A 3WINE 1LODA 1FOD1 2BUKA 1HRI3 2P3IA 4YFWA 2HYKA 3J8F2 1QJY1 2PLV3 4PIXA 2QUOA 2XBO2 1S0CA 2B46X 3R4SA 2A73B 3EJKA 3J4UH 1QHDA 5AC91 4LLOA 5C4WB 1WBLA 4BH9A 4AFCA 1S0GA 2CAUA 4BMEA 2D40A 3CU7A 1KD7A 4TYSA 2CTVA 2YY1A 4B7EA 3MFCA 3L2YA 2MEV1 1FMD2 4Q4V3 4Z8BA 3ZXKA 1XYOA 2A6WA 2R061 4XF4A 5CIRA 5JOZA 3R6SA 3ZFGB 4ES8A 1SLAA 5J3UA 4R52A 4EN7B 1I3HA 4GH4A 2B45X 1GQHA 2GMPA 2D98A 1NCRC 1RUE3 1BQPA 1GLHA 1SLCA 4FQZA 3S0MA 1BCXA 2RR12 2Q4SA 4A7YA 3WD5A 2B9UA 3S6PA 1FMD3 2VGDA 3QH7A 3ZO0B 3AYAA 2ZMKA 1UPSA 3DPRB 1RB8G 3VBOA 1JH5A 1VLNA 1Q43A 4FOQA 1C4RA 1IS6A 1ULEA 2NMNA 4GALA 2D97A 3VL8A 1L3JA 1D4VB 4NWVA 3E5XA 4GMP0 4Z1VA 2F6BA 4PLOA 1C1LA 4PDWC 1PK6C 5K0UA 1H9PA 1ENSA 4D69A 2ZMLA 1BK1A 3WP5A 2JG8A 1EP0A 3VKFC 2Y38A 4K7JA 2GN7A 3NV4A 1RHI1 1GR3A 1LHVA 1ONAA 2ZTNA 3D4KA 3ZIXA 5JWPA 1DGRA 1KFXL 3VBRC 1JYIA 1ZNPA 1CAUA 5E8AA 5L7OC 4LBQA 4AGVA 2ZGUA 4XF3A 4LO8A 3D82A 1H8VA 2V09A 3AZZA 1CD3G 1Z7S1 2D93A 4OLLA 3B7MA 3AM2A 1QOOA 2WLQA 1RUJ1 4N43B 1QQP3 1N1TA 3O14A 1UL9A 2Z42A 4RGGA 2Y0OA 1DGWA 1ENQA 3H1WA 4AQ6A 3B01A 1RL3A 5DZFA 1YXWA 3VZMA 4FP3A 2ZGTA 5C9AA 1NY71 1WA4A 1ZM1A 5AFEA 2YC0A 3M3OA 5FTTC 3RS6A 3Q9OA 3NW4A 3ZFEB 3ILRA 4NHLA 1Q8PA 2K9ZA 1V6OA 4MUVA 1POV0 3O12A 1O3SA 5KBFA 2D6KA 1CPNA 1VBD3 4M3CA 2WFPA 4IESA 3ZXJA 4LEJA 4MV2A 1UN1A 3BCWA 5CAZA 1WD3A 4GA9A 2XWBB 5ABJC 1REEA 4Y22B 1AZDA 1LGBA 3POYA 5JVVA 4DFSA 4UW4A 1RUD2 4FVVA 4I01A 2D6OX 1OD5A 2HWD2 3VKMA 4BZ4A 1IKPA 1WCSA 3H8UA 4RGAA 3WDYA 5KC5A 1S0EA 1CAXA 4P9JA 1GSLA 5D8AC 3L9JT 4AI8A 3DV8A 5AFBA 1XNKA 4JDMA 2WQZC 4ZU4A 4AG4A 4BIFA 4A7KA 1H8TB 4EWAA 4CEWB 1RUNA 4RHV1 1X50A 3RMXA 1RUD3 2VXRA 3GBGA 3GYDA 3D6EA 5C6CA 3RJRA 2HWD3 3B94A 2R041 1M06G 3ZSEA 2A6XA 1DQ5A 1J3RA 2P2KA 1OQEA 2XHKA 1UF2C 2GNBA 2VNRA 2O1QA 1OFNA 5FAXA 5JIAA 2RS12 1QY4A 3SH4A 4HPKB 4M00A 2O8QA 3NV2A 4YGCA 4AFMA 4K8FA 1SMVA 4XBNA 2RMU2 5SV5A 2EAAA 4IEXA 4QQ2A 4IV1B 4YZ3A 4LUKA 3ZDSA 1MZEA 4Z2WA 2D6PA 4DY3A 3T1MA 2XJRA 1HQNA 2VVDA 1V00A 4DPNA 4AVTA 2XH6A 4CZSA 1R092 3DGTA 4XBQA 2X53S 3SCGA 1SCRA 1AXKA 1O4ZA 1WW5A 4FTSA 4IEUA 3NKGA 3AMQA 1VP6A 3OF1A 4OI4A 5GLUA 2ILMA 4RQPA 4XXAA 4OHYA 2DVGA 1UCXA 4TSVA 4XFGA 1ZZ8A 4P9IA 5J09A 1BMV1 3TAYA 4CP1A 4Q2FA 3TBDA 4Q8KA 2DWRA 4XJZA 1RUC2 2BWAA 4WVVA 4K40A 1SLBA 1W6OA 3KLSA 4AXOA 2BVBA 1SBFA 2HEVF 4G3YC 1W0PA 4RR3A 1VB4A 5FMOL 1LU2A 3OBRA 4H7LA 3RSJA 4COZA 1ULFA 3PVEA 4JCKA 3ILNA 4A2UA 4PDWA 3TYJA 1CAWA 2HEWF 2C5DA 3AZXA 2BFUL 1HRI1 2YUEA 3B9IA 4GH4B 2H0BA 3FE5A 4LO4B 3KQRA 3VBRA 4K1YA 5GZEA 1QH6A 4JRAA 5L7OA 4KL1A 4LHKA 4B7KA 4EWDA 3ROUA 2VW0A 4QM8A 4XQWA 1TQ5A 2ZGSA 4XHBA 5H9RA 5BNOC 2RS32 1C5IA 4XE9A 4AHWA 1QDOA 1HXS1 3CJIC 3VBOB 4ZXKA 3MIDA 1DQ6A 1YJLA 4ISQA 4Q4V1 4OHZA 2NM1A 3U07A 2NP0A 2WIIB 3QH6A 4CEYB 3VDDC 5IK5A 2PELA 2ENRA 1RUE1 2Q1ZB 4FSJA 2R6QA 4HBNA 2JG8B 4BIOA 3SNMA 3FUOA 2EXJA 2RS33 5IT6A 5HBAA 3RZZA 4XJ9A 1CAUB 4LBQB 4Y20A 2CWMA 4CP0A 1GZCA 5GKAC 1BKZA 1D0HA 4RD7A 1DGRN 2OW4A 1F31A 2HWB3 1WW6A 2ZX4A 2XB6C 1WCDJ 2IFRA 2DU1A 4RA0A 1N1VA 3ZYRA 1APNA 5ABJA 1O3QA 4WM7A 3CL1A 2GU9A 1RGSA 4HVRA 2ZHKA 1PZ7A 2YZ4A 3GALA 1C57A 3LSEA 1X8MA 1PO21 5C9AB 5BNQA 1RVF2 5D8AA 4QQPA 1CGPA 1WMFA 2FMYA 3EXUA 1ZRFA 1PIV2 4N90A 4P9LA 1VBB2 2R32A 1MS0A 1ZBA2 2A7AA 3VBSA 4BYYA 1JBCA 1DFQA 3OD0A 5F5QA 1PGSA 1QQP1 2GAUA 2Q8OA 1YNAA 5DUVA 4JGYC 2Q0AA 1YI7A 2R1DA 1AYN3 3MLJA 1PIV3 3WG4A 3WDXA 4D3WA 4Z92B 3MYXA 2B7YA 1FPN2 3N4MA 1VBB3 2UWBA 3JD72 1ZBA3 2IXHA 1AVBA 1AR72 3ZXDA 5JZGC 4UW3A 4A7ZA 3WNXA 4HSJA 1IS4A 3WDVA 1WCKA 1RUI2 3CEWA 1CAXB 1COV1 3KM5A 4R9AA 4BCUA 4XETA 2VECA 3LOBA 4OFGA 2HWC3 3DF0A 2BEOA 2EXIA 4Q4X1 1RUF3 2X8KA 1Y9QA 4FAHA 1LECA 2SLIA 2I74A 4META 1VBD1 1AR82 4YW1A 5C8CC 1LGCA 4I09A 4XZPA 2NQYA 4AVBA 3MLKA 3ZN4A 1RUI3 4OVEA 3NV1A 3ZXAC 1LEMA 2MEV2 2VOWA 2CYFA 2R062 4AEJA 1DYPA 3M70A 2GH8A 3AFKA 3MW4A 4QPIA 4EWEA 1ZA4A 3FLPA 4FPJA 5GLVA 2YDEA 2JE7A 3CLPA 4PBOA 3JU9A 4CTEA 1QWRA 1BBT1 2V5YA 1YI9A 1R1A2 2C9AA 5L36A 1C8NA 2GC3A 4COUA 4ZKTB 3IMNA 1H30A 3PJQA 4MZUA 1NCRB 2Z5WA 4FT8A 1XE7A 4Q0UA 4S2HA 1LHWA 1GNZA 4AHXA 3IM0A 4MGKE 1QJX2 1AR91 1MQTC 1Z78A 1H2KA 1SBEA 2GN3A 2OA2A 3HN1A 4Q4Y2 4URTA 1XE8A 4OHVA 4YVSA 1TMF1 3AX4A 2D5FA 3NAPC 1R1A3 4C0BA 3MF6A 1V70A 1ULGA 5BNOA 3W9AA 3AP5A 1W6OB 3H7JA 2PHLA 1NQDA 4XMIA 3VBUA 1UIKA 1HQLA 5DG1A 2IXCA 1RHI2 3H9AA 3APBA 4WVWA 4RR3B 3H3ZA 4WZFA 4NHKA 1QJX3 1BEV2 3ES1A 4HZFA 3VDDA 1VJ2A 2Q30A 4PDWB 3N7JA 1CAWB 2R1BA 4CDUC 5FQ0A 4XIKA 2TUNA 2R073 4I3PA 4E4DX 4KU7A 5GLZA 1CQ9A 4PCRA 1OOPC 3VBRB 4PIZA 3M3CA 5L7OB 2MPFA 3WW1A 2JG9C 4F8AA 4M3CF 1BEV3 5EYYA 4Y4YA 2WINB 2ZKLA 1JUHA 4DOUA 2BW8A 3QLQA 4JGZC 3MIEA 5CVRA 2B42B 5K8SA 3WW4A 2RHPA 1HRV1 3RPQA 3MIGA 2QQPA 2R49A 5KXDA 1BXHA 5DXDA 1S0IA 2LTNA 1RMU3 4F3JA 4G4FA 3H50A 4M3CE 3N7LA 5FLHA 4AI3A 3N35A 2UURA 1W6PB 2AUYA 4UBHA 3RDIA 1LESA 4MGYE 3I59A 1IHMA 4Y20B 3FBMA 2E7AA 5GM0A 3RMYA 1BZWA 5JPNB 4HN0A 2FBEA 2PAKA 4KWLA 4JQRA 4XFCA 2RS52 1F2NA 3OGGA 3TRSB 1PGW1 3OCPA 3M8LA 2DTWA 3ZFEA 2HWF3 4JGYA 2YHJA 4OULA 3JB8A 5ABJB 3WZ1A 1MZFA 3AKTA 5EYXA 4FXKB 4MVTA 1WD4A 3ZYIB 1LGNA 1GICA 3MW2A 3JQXA 4P9XA 5T52A 1VBA2 3M3QA 3EQEA 2X5IC 1LTEA 1ZBE2 5JIUA 4RHV2 5D8AB 2RS53 3C3VA 2EF6A 4YG6A 1QJU3 3SCHA 3VKOA 3VBSB 5KXEA 3WDTA 3MF9A 1QNYA 2UWAA 2WS93 3FHIB 5FBZA 4FPCA 1S55A 3NO8A 5C8CA 5CG9A 2HWB1 1VBA3 1XYNA 4LLFA 1C8M2 5I8SA 1NYWA 1QXJA 2GALA 3ZFFC 2D43A 4Q27A 5JSPA 1AJKA 4XW3A 1PZ9A 1DBNA 2RM22 3IDBB 4YZ4A 4FTBA 4AHZA 3ENRA 4Q0PA 1O3TA 2HWE1 2OZJA 1IS5A 2WFF2 3HT1A 3V0AA 1O5LA 1Q8SA 1C8M3 3TN91 2AENA 1ZYBA 2PHTA 3NJZA 4NVPA 4CDXA 5LK7B 3SHRA 3USUA 4N9HA 3RG0A 2G9GA 2DF7A 5JOWA 4D7SA 3PTYA 3KCYA 1LB2A 5BYNA 4AEKA 1LULA 1OFSA 3O7OA 2EVXA 2BFUS 2RJKA 2F4PA 1MQTA 3N3HA 2XWJB 3ZXGA 4AYUA 4KNCA 1J58A 2WFF3 3SITA 3PVOA 4HMZA 4PLMA 1B35C 4QQHA 5T5LA 2GNDA 2WL1A 3ACLA 4ZU5A 3NAPA 3RYKA 1DU3D 1UAIA 3UJOA 1PM7A 4LNVA 4XILA 4XEZA 1Q8OA 3GZTB 5EWSA 2WA3A 3JBG2 4HL0A 4FCAA 1GKBA 1KITA 4UW6A 3WCSA 3CJXA 1S2KA 3PMEA 3WV6A 1SLLA 1V6IA 1KRIA 1YFWA 1AL0G 1QU0A 2HWC1 4GULA 1RUF1 5JR7B 2XVGA 3LWCA 1MEC2 3I54A 3WR0A 1C28A 3MIBA 4LR4A 4LBNA 4Q0SA 2OPKA 1OPMA 4ASLA 1O3RA 5JPMB 4I0WB 1ULDA 1OOPA 3M4FA 1YCIA 1MS9A 5J37A 2PN5A 2Z69A 3J8F3 1W6QA 3GZUC 3H7YA 4YW4A 2PHRA 3R05A 2XBO3 1MVQA 4YVSB 4R8HA 5BNOB 3B93A 3KT7A 1VAKA 4GMP3 4JGZA 3BALA 3VBUB 4XFAA 1IS3A 1YYNA 4HK8A 1ASJ1 1NE6A 4XBLA 3VDDB 4IERA 5CNAA 5GALA 4I3GA 4DZGA 1YHFA 3AJZA 1KS5A 3ELNA 5FQ0B 4I0BA 3LSDA 3ZSJA 4IEQA 3ZSMA 1WLWA 1FV2A 2Q5TA 2QKDA 2MHFA 4CEYA 1BVVA 1NCQC 5FPZA 4ES9A 2RR13 3RJ2X 4GQ7A 3WDUA 4Q0VA 1XXNA 3AFGA 1PVC1 2QZ3A 2D7FA 1PO22 4E27A 1VR3A 2PA7A 1KJRA 4JC1A 4HVQA 1ENXA 3K51A 4I02A 4PJYA 1H4GA 1G7YA 1FV3A 3AMNA 4QQOA 1VRH1 1POV3 3W59A 3RNSA 1GZWA 3VGIA 1ND2A 2TEPA 1EAH1 3WXPA 3E6CC 4COVA 4QPYA 3I59B 4K3UA 4EROA 1MACA 1HV0A 2VU9A 1ZRCA 4DS0A 5I0RA 2QDRA 2JEMA 2NZ9A 1I5ZA 4JDNA 1VIWB 4NOTA 2P34A 4JGYB 3S7IA 1COV2 1LCLA 3ZFFA 4AI0A 2A71A 3QOPA 3TOJA 5AVAA 4ATFA 4FPLA 1RUG2 4KG8A 5J36A 1JHNA 2UYAA 3A0KA 4ATEA 4N53C 1RMU1 2WZR1 4JVAA 4U36A 5H9SA 2JJ6A 1OI6A 4LHLA 2DURA 5ACA2 2FZ2A 1DG6A 3AZVA 4XQDA 5D1IA 2ZHMA 3WT3A 1HLCA 4CRQA 4FOWA 4X6QB 1IPJA 3KSCA 4ONUA 4AW7A 1FT9A 4IV3C 4XJ8A 1BJQA 1DZQA 2ZGPA 3VZOA 2ZGRA 1XNDA 1B09A 1SQ4A 4U2AA 1ENRA 1AR62 4GXLA 5C8CB 2ZHLA 3AMPA 5H9QA 2HWF1 3FLTA 1AJOA 1MS5A 1OQDA 2CGNA 1TE1B 1VBE1 4ISRA 5BNPC 3R4DB 5ACA3 4AFAA 1AL21 1B35A 1WW7A 3WQ7A 4YW2A 3RRDA 3FFZA 3H0OA 2I2SA 1D4M1 4JV4A 4LT5A 4Y1ZA 5CU1A 3BODA 2KA3A 2WNEA 3RYPA 4AGGA 1JOJA 2DVFA 1E57A 3B9CA 5CFDC 3V0AB 1QJU1 2EAKA 5J98B 1VBC2 4NN0A 1AR92 1R082 1AYM2 2ZACA 3WG1A 4FTEA 1YLLA 4CDXB 3USUB 1AX1A 3PJYA 3RI8A 2WS91 2VW2A 4WBBA 1UU5A 3TNQA 2BNOA 2XVLA 2WZPP 5FOJB 4RS5C 1HDKA 2ZS6B 4P14A 1MQTB 4K20A 1ZX5A 3V56A 3VZJA 1S0DA 4AFBA 1TME1 4MSVA 4FPOB 1AYM3 1UD1A 4D7YA 3NAPB 1NCRA 2GC2A 3AP4A 2RS13 2PAEA 1PO12 1QXPA 2O0OA 5DDJ1 1H0BA 1G8WA 2V73A 2OUHA 4GB31 4YLZA 4Q1PA 1EV11 2RMU3 4INDA 3MZHA 1KQRA 1IOAA 3SMHA 2W39A 2VQAA 1W0OA 3D0SA 1QOTA 1W6MA 1XNCA 2D5HA 2HKXA 4EN0A 2OYZA 3UKTA 4PF5A 1R093 4YW5A 3KZ4C 1OOPB 4F83A 1O7FA 4XFHA 1DF0A 3ME2A 3E6DA 1PO13 5KHIA 1NCQA 1HW5A 3G7DA 4AVAA 1W6QB 2XJSA 1YIPA 3FBYA 1HRV2 1PK6A 3GBFA 5I93A 5I8TA 4BA6A 2NMOA 3THPA 3CNAA 1RUH2 4XPVA 4OI2A 5IK7A 1PNFA 4O9EA 1UU6A 3WCRA 2XGXA 2GMEA 1OLRA 1RUC3 4AVSA 4JGZB