5CFDC

Crystal structure of dtt treated human cardiovirus safv-3
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
258
structure length
258
Chain Sequence
SDRVSSDTAGNTATNTQSTVGRLFGFGQRHKGKHPASCADTATDKVLAAERYYTIKLASWTKTQESFDHIRVPLPHALAGENGGVFSSTLRRHYLCKCGWRIQVQCNASQFHAGSLLVFMAPEFDTSNHSTEVEPRADTAFKVDANWQKHAQILTGHAYVNTTTKVNVPLALNHQNFWQWTTYPHQILNLRTNTTCDLEVPYVNVCPTSSWTQHANWTLVIAVLTPLQYSQGSATTIEITASIQPVKPVFNGLRHTVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP1
publication title Structure and Genome Release Mechanism of the Human Cardiovirus Saffold Virus 3.
pubmed doi rcsb
source organism Saffold virus
molecule tags Virus
total genus 57
structure length 258
sequence length 258
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5cfdC00
1QJZA 4PDWA 3J8F2 5ACA3 2WFF2 1AL23 2RS33 1FMD2 1AYM2 1PGL2 1VBD1 4GB33 1AR62 1BEV3 1HRI2 1CJDA 1H8TA 4WM8A 3J8F1 4EJRA 1HXS2 5AC93 2WFF1 1R1A2 1FMD1 1AYM1 1PGL1 4JGYA 2HWB2 2HWD3 1RUG2 1AR61 5A33B 4Q4W3 2R072 1RUC3 5A32B 1PGW2 1NA1A 3ZFFC 2PLV2 1AR83 1HXS1 4RHV3 2RMU2 5C8CC 3ZFFB 1E57A 2HWB1 3TN93 3VBSC 1DDLA 1ND3A 1RUG1 2X5IC 1VBA3 2R071 5C8CB 1RUE3 2IZWA 1VBE3 1BBT2 1WCDJ 1PGW1 2X5IB 2PLV1 2RMU1 5J96B 1AR73 2WS93 4CDQA 3CJIA 4RR3A 2ZZQA 2FZ2A 1AYN2 1BBT1 1ZBA3 3VBHC 2BPA2 1R082 3JD72 2Y26A 3VBHB 4Q4Y3 5DDJ2 1K5MC 1W39A 1AYN1 1EAH3 1K5MB 3DPRC 4GMP3 1POV3 4QPIC 5J98B 1R081 4RFT0 3VDDB 3JD71 5FOJB 1Z7S3 1RMU1 4Z92B 2ZAHA 4QPIB 5DDJ1 1RUJ2 5K0UA 5ABJC 5JZGC 1PO12 1RUH2 4IV1A 5CFDA 1F8VA 1VB2A 5ABJB 5JZGB 3VBFC 1RHI2 4AEDC 4RQPC 3ZFEA 3VBFB 1MQTC 1VBC3 5C9AA 1VBB2 1RUJ1 1HRV2 1PO11 1RUH1 3VBOA 4RQPB 1SMVA 4QPGC 2R063 1AL22 4FTSA 1RHI1 1QJU2 4LLFA 4GB32 4QPGB 4CEYC 1NG0A 1VBB1 1HRV1 2TBVA 1EV12 4CEYB 4JGZA 2BBVA 1ASJ3 1RUF3 4Y5Z0 5D8AB 1QJU1 1ZBE3 3NAPC 4BCUA 1CD3G 2XBO3 5C4WB 3NAPB 2VQ0A 1EV11 1OOPC 4SBVA 5CFCC 1C8M2 1NCQA 1RUI2 3JB4C 1OOPB 1R093 5CFCB 1GFF2 1COV2 1RUE2 2MEV2 5A33A 1PVC3 5L7OC 1V9U3 1C8NA 1D4M3 2HWE2 5A32A 1QJY3 5FMOS 1NOVA 1VAKA 1C8M1 5L7OB 1TME3 4CDWC 1RUI1 2RR12 3ZFFA 1COV1 4CDWB 2MEV1 2HWC3 1TMF3 5C8CA 1VRH3 2FZ1A 2HWE1 2X5IA 4N53C 2RR11 1RVF3 1HRI1 1IHMA 5BNPC 1M06G 1MEC3 1FOD3 4WM7C 1R1A1 5BNPB 3IDEA 2RS52 3VBHA 4PDWC 4Q4X3 2HWF2 2RS13 2R043 2ZTNA 3VBSB 2WZR3 1AR92 1K5MA 1QJX2 1PIV2 3JBG2 3VDDA 1NY72 2RM22 2RS51 4YVSC 2HWF1 4YVSB 3M8LA 1AR91 1VBD3 5JZGA 1ND2C 1QJX1 1QQP2 1PIV1 1FPN2 3JBG1 1NY71 3J8F3 2RM21 1X36A 1ND2B 3VBFA 2WFF3 1FMD3 1AYM3 4RQPA 3LOBA 4CDXC 1AR63 1QQP1 3DPRB 1FPN1 1PO22 4CDXB 1RUD2 4QPGA 5BNNA 4Y4YA 3VBUA 1HXS3 2WLPA 4CEYA 4Q4V2 2HWB3 1RUG3 2GH8A 4GH4C 5FMOL 2R073 5D8AA 1PO21 1RUD1 4AEDB 2DF7A 4GH4B 2PLV3 5C4WA 2RMU3 3NAPA 1MQTB 5ACA2 2RS32 1AUYA 4Q4V1 1VB4A 4IV3A 1OOPA 1BEV2 1BBT3 5CFCA 1TMF2 4CEWC 2QQPA 4GMP0 1POV0 5AC92 5ACA1 1AL21 1HX6A 2RS31 3JB8A 4CEWB 2HWD2 4GB31 1AYN3 4N43C 1BEV1 4Q4W2 1RUC2 4FSJA 5K0UC 4CDWA 2BFUS 1B35C 1R083 1AR82 4N43B 4IV1C 4RHV2 5CFDC 3JD73 5AC91 1RMU3 5GKAC 5K0UB 5DDJ3 1B35B 3TN92 5CFDB 2HWD1 1NCRC 1VBA2 4Q4W1 1RUC1 1VBE2 5LK7B 1NCRB 4RHV1 1AR81 4CDUC 1AR72 2WS92 3TN91 1X33A 1RUJ3 1PO13 5BNPA 2GSYA 1RUH3 1VBA1 4YVWC 4CDUB 1RUE1 1VBE1 1A6CA 1ZBA2 1RHI3 3VBRC 4RS5C 4JGZC 3VBSA 4YVWB 2XPJA 1AR71 2WS91 3VBRB 4RS5B 1VBB3 4JGZB 4Q4Y2 1HRV3 1OHFA 4N53B 5BNOC 3FBMA 1ZBA1 1EAH2 1QJU3 5BNOB 4YVSA 1Z7S2 1NCQC 1RB8G 4Q4Y1 3ZFGC 1EV13 4WM7B 1NCQB 1ND2A 1EAH1 3ZFGB 4GMP1 1POV1 4PDWB 4NWWA 1Z7S1 3S6PA 1VBC2 3DPRA 4QPIA 4CDXA 1C8M3 1H8TC 2R062 4WM8C 1RUI3 5ABJA 1H8TB 1COV3 4WM8B 2MEV3 4JGYC 1VBC1 2HWE3 4AEDA 4JGYB 4GH4A 2R061 1NA1C 2RR13 3ZXAC 1ASJ2 1RUF2 1MQTA 2BFUL 1OPOA 1ZBE2 4FTBA 1NA1B 1HRI3 2XBO2 1ND3C 1BMV2 1R1A3 1RMU2 1ND3B 1ASJ1 1RUF1 1ZBE1 1R092 1F2NA 4CEWA 3VDDC 4CDQC 3CJIC 4RR3C 2XBO1 1PVC2 1V9U2 1D4M2 1BMV1 1QJY2 4CDQB 3CJIB 4RR3B 4N43A 1TME2 3HAGA 1R091 2RS53 1B35A 2HWF3 2HWC2 1PVC1 2WWSA 1V9U1 1AR93 1D4M1 1VRH2 1QJY1 1QJX3 1PIV3 1NCRA 1HQNA 1TME1 3JBG3 4FTEA 1RVF2 2RM23 5L7OA 4NWVA 5BNNC 2HWC1 1TMF1 4CDUA 3VBUC 1VRH1 5BNNB 1QQP3 1MEC2 1FOD2 4YVWA 1FPN3 3VBUB 1RVF1 4IV1B 5D8AC 4RS5A 3VBRA 3ZFEC 4Q4X2 5C9AC 2BUKA 2RS12 2R042 4N53A 2WZR2 3VBOC 5C4WC 3ZFEB 1MEC1 5C9AB 1FOD1 1PO23 5BNOA 1RUD3 3VBOB 4IV3C 1AL0G 4Q4X1 4WM7A 4IV3B 2RS11 2R041 4Q4V3 2WZR1 1VBD2 3ZFGA
chains in the Genus database with same CATH superfamily
1QJZA 4ZONA 3SKJE 3WF3A 1SPPA 4XUPA 2KR2A 4DUXA 4QQ2A 2HEVF 1DYPA 2JDAA 1CZTA 2E7TA 4FOVA 4XIOA 4FO9A 1LCLA 2CAUA 2JE7A 3WCRA 1JOPA 1AL23 2VQUA 3WW2A 3ORJA 4DXSA 4KBBA 1SBFA 1XNKA 1JZ7A 1VBD1 3B02A 3WHUA 3L2HA 4BQ5A 3FLRA 3KCXA 4FFGA 1JN2P 1HRI2 1W0OA 2D6OX 4IW3A 4YW5A 4GXLA 4WM8A 3LA2A 2H0BA 3J26N 3LWCA 4GD4A 4OYUA 2D6MA 3JXSA 4R9CA 3USUA 3H42B 3USSA 4BZ4A 4PHZA 4QMAA 4Q26A 1V0AA 2PHFA 3QH6A 2JDPA 2HWB2 5C5UA 2DTWA 2HWD3 1ZM1A 4LO8A 4P9JA 5A33B 3CEWA 3NMBA 3FUQA 2ZOEB 1UZVA 1PGW2 2O8OA 4XF0A 4CZSA 5C5TA 1XNTA 1AR83 2PLV2 5FV3A 5J48A 3UKVA 4GWMA 4AHZA 4FPKA 2WO7A 2HWB1 1A8MA 3TN93 3IDBB 2ZPXA 1HIXA 4AVBA 1UIKA 2X5IC 3SCGA 5C3QA 4GWJA 1VBE3 3RVHA 1BBT2 4UFKA 3H7JA 1DCSA 1PGW1 1WCDJ 2JB4A 5DABA 2PLV1 3C8XA 4AFAA 2XVLA 3H0OA 1BVVA 1OKOA 2J1RA 2R0FA 4URAA 1F5FA 2ZGLA 1WLWA 2PTMA 2WL1A 3GDBA 1QOOA 1S55A 3T0AA 4BXFA 1D2QA 1QJEA 5IVFA 1AYN2 2VW1A 1W0NA 4MGZE 3TEXA 1BBT1 4YW3A 4AAXA 1RIRA 2GC2A 3HMYA 4NIIA 3VBHC 1U5ZA 3WCSA 4EV0A 3V0AA 1IOAA 2E63A 3T08A 1R082 2V4AA 2EIBA 2MNGA 3OEBA 2DBNA 4R8HA 2WAAA 3I59A 3W5MA 4MXWA 3LKJA 4CP2A 1AYN1 4QXHA 2J1UA 3MICA 4QPIC 2D6PA 2DUPA 4LO5B 1R081 2D3RA 5KXDA 4AHXA 4NIGA 3CL1A 4MH0E 5FOJB 1RMU1 3OD4A 1OUXA 2JIJA 2IXHA 4LMFA 3WUCA 4LPLA 1RUJ2 1BCXA 1PO12 5F7UA 1RUH2 2RDRA 1MVQA 2CSGA 1QXPA 3MIBA 4IV1A 5ANQA 1EP0A 2ZGOA 3WW4A 5ABJB 5A3OA 3GNEA 5JZGB 2X53S 2HLEA 3LFIA 2DCTA 3PJYA 2A6ZA 4ZU5A 4XDQA 2IXLA 5G04L 3MGUA 1Y9MA 4FPGA 2LRPA 3G6JB 3VBFB 2X09A 1HQWA 4F3JA 1RUJ1 1PO11 1RUH1 1UMIA 1KS5A 5EYXA 3SKVA 4QPGC 1LEMA 4Q2FA 3VGIA 2CDOA 3A4UA 4FPJA 2PHUA 3VZNA 4GWIA 4YWAA 4PLNA 3WDVA 5L9VA 1SCRA 1JZ6A 3W5NA 5A3LA 2AZ5A 3I2OA 3T09A 4GB32 1LB2A 5DQ0A 3N9LA 2C4XA 1NG0A 3TBDA 1QGLA 2AH2A 3KSCA 4WVMB 4BM8A 1I1EA 4IGOA 4BDVB 2TBVA 3GCWA 1EV12 4CEYB 4YGEA 1ZRFA 4XFIA 2PAMA 3LCPA 3RNSA 3R4SA 1RUF3 5I0RA 1GP5A 4Y5Z0 1Q5OA 1JXNA 4COZA 2UWCA 1UMHA 4DO0A 1CD3G 3FFZA 1HB4A 3BYWA 1GZCA 3NAPB 2VQ0A 1W8ZA 4H7MA 1EV11 4P08A 5H9SA 4Z2WA 1U5XA 5JOWA 4DXRA 3OUIA 2FDGA 4LKEA 3PTYA 5CFCC 5LWBA 3O1SA 1OOPB 1FV2A 4QDRA 3WG1A 4BE3A 1SFYA 5EYYA 1DLCA 4DRRA 1GFF2 3GZAA 3GBFA 1SLCA 1WCQA 4XFCA 1PVC3 4FFHA 5L7OC 1V9U3 3B00A 5CVRA 3WDWA 1GQGA 1QJY3 1WLDA 3DV8A 4IE6A 5FMOS 4FPFA 4A6OA 1VAKA 5KXEA 4LKFA 1ENSA 3N9OA 4Q27A 3VKOA 4CCEA 5A1AA 4N9IA 1UIJA 2GN7A 4HFSA 2KM2A 5FCCA 2P3KA 1PNGA 2R49A 3I2DA 4AI9A 3DECA 1CAXB 5FZIA 3OBZA 4CDWB 1TMF3 1IS6A 2Z4FA 3MIHA 1XQNA 1NZIA 1W9FA 2FZ1A 1GLHA 2VAUA 3AKQA 1ACCA 2VMDA 2AGSA 4XTMA 3UYJA 4F83A 5HCAA 4HLTA 3LA7A 5LB6A 3PVOA 3BUCA 5FYHA 1UAIA 3LZZA 1UXXX 1O59A 2J1TA 4C91A 4A3XA 3ZPYA 1M06G 2BTVC 1R1A1 2DVAA 2K9ZA 3K2OA 2YU2A 4J25A 3MIEA 2G4IA 2WIIB 4LO4B 3ZN4A 3B93A 2A6WA 1C4RA 1RYYA 2RS13 2R043 3HOBA 3VBSB 5JUVA 2WZR3 1AR92 3KT7A 2B7YA 3WF0A 5JPMB 3ILNA 4HG6B 1PIV2 3ACGA 4I09A 4Q8LA 1I3HA 4LBNA 1NY72 2Y6FA 5HXVA 4OHYA 4P9YA 1TNFA 2IXCA 4HONA 3OGVA 4H55A 3UJQA 4LHLA 4HK8A 1NZCA 1GZTA 2W47A 1AR91 1VBD3 3QCWA 5A3WA 3DEMA 3PU8A 3HQXA 3P5BA 1ND2C 1S0JA 5KHGA 1PIV1 2JEMA 3NNJA 5FZEA 3KHCA 4A7ZA 5BPXA 1UXZA 4R4XA 3WDYA 4CCDA 1NY71 2EXKA 1X82A 2QKDA 2W1WA 4IE0A 3OB8A 1OLQA 4DZGA 4QKDA 3RZZA 1HV0A 2BOIA 3VD9A 5DAQA 4WVWA 3LOBA 3SCFA 5JXIA 1VALA 3WG3A 4XBQA 4XUQA 1OQDA 3D0SA 2XLGA 3DXUA 5IVCA 4BYYA 1LJ7A 1YRZA 5AFEA 2OUHA 1U5IA 3JUUA 1J84A 1CX1A 3T2OA 4D7SA 4IESA 4BK5A 3UETA 1GKBA 4CRQA 4XJ8A 2EICA 2C26A 4X8NA 4Q4V2 2NMOA 2LALA 2A70A 2HWB3 2ZHMA 4GJZA 1YHFA 4W4ZA 5EJ1B 3VUOA 4H3WA 3U07A 5FMOL 2IXIA 2JG9C 1EUTA 1OD5A 3ZIWA 4SLIA 5JXGA 5DG1A 5A7QA 5LA1A 4XFAA 1PX4A 4JKKA 4OFGA 4AEDB 3B9IA 4UFHA 4WVZA 4GH4B 2PLV3 4YARA 2VE1A 3NV4A 4LQRA 5C4WA 2RG4A 3LPGA 4LOSA 5LBBA 5ACA2 2CWMA 3B69A 1EUUA 1VB4A 4HZFA 1DU3D 4Q4V1 2D3SA 3TWIA 4EZHA 1CJPA 5FAXA 1T2XA 2WKKA 1ZRCA 1OFSA 3ES1A 1BBT3 4P9LA 3POGA 2BOJA 3K48A 1LHNA 3S5AA 3OBAA 4EN8B 4LA3A 1F31A 1FI2A 2VTFA 4GMP0 5AC92 2GDFA 5ACA1 1HX6A 3JB8A 2C1FA 1KFUL 3EJKA 1YC61 2PHTA 4MXWB 2C24A 4MXVA 3URFA 4DUWA 1YFYA 1DYOA 1AYN3 2UY9A 5DAWA 1CWPA 5FPZA 4Z1VA 2YC0A 1O8PA 3DKWA 2O14A 1JUHA 3HQRA 1Y43B 2YG0A 5GZEA 1SDDB 4ZXKA 4CTEA 5ISLA 2BFUS 1B35C 1R083 1LHUA 4N43B 5I93A 4XETA 5CFDC 4HVRA 2OPWA 5AC91 3LE0A 1HV1A 1RMU3 2YFUA 3NV2A 5FQ0A 1TEIA 1EPZA 2XQXA 3T30A 3A23A 3OJBA 2WNVC 4QX8A 4MO3M 5HI0A 5F6LB 1HB3A 4YYOA 1W8UA 1ULCA 2V72A 3IPVA 1WUVA 1NCRB 3ME2A 4DEVA 5T5OA 3ZIXA 3O7OA 4CDUC 2W0XA 1CZSA 3JQWA 2WS92 5CAZA 1RUJ3 1SACA 5FY4A 1PO13 2GSYA 1RUH3 5FZ4A 2EXIA 2OUJA 4YVWC 2E51A 2ARXA 3KCCA 4COVA 2YU1A 2ZGKA 5KHHA 1RUNA 3DXTA 4PBOA 5GM0A 1V6KA 3T1MA 4E4ZA 2ES3A 4RS5C 4JGZC 3FMGA 3AZXA 3WD5A 3RYPA 1UYPA 1VMHA 1Y3TA 4CUCA 2WS91 2AYHA 4K20A 2EAAA 1AVBA 2JB8A 2K2SA 3Q8FA 4C0BA 5C3SA 1NXD1 1OXCA 1YXWA 2ZXQA 3O0WA 3GGLA 1K45A 1ULEA 1AF9A 3HWJA 1DZRA 5H9QA 3WNPA 1BVP1 2CV6A 3WDUA 4D6RA 5M0TA 5BNOB 2ZBJA 3E97A 4AI3A 1QH7A 2VPVA 3AMMA 4DEQA 1NCQC 4JRAA 2ZGRA 4UBGA 1X8EA 1LNSA 3ZVXA 5FZ0A 3V0BA 1RB8G 3N3HA 4NIDA 4H7LA 4I0AA 4PLOA 4XC9A 3KV6A 1EV13 4PI2A 5HBAA 2H6CA 4BOWA 4TTGA 5DUUA 1BXHA 1O6UA 3E1F1 3HT2A 1LOFA 1OURA 4AI0A 3FN9A 5JSRA 4LUMA 2R16A 4GMP1 1NUKA 4PDWB 4NWWA 1WBFA 2GAUA 1O3QA 4BLIA 2P6CA 2YPJA 2YV8A 4QDSA 1OMIA 3FE5A 1ZA4A 4NE9A 1PZ9A 4QPIA 4CDXA 4META 5JLVA 1NYWA 5LA0A 1H1AA 3GJAA 4WM8C 4GJYA 1LHOA 3ZLIA 2UYBA 5E8AA 2WNUB 2WAOA 3HN3A 4ISQA 1E5HA 1ZRIA 2VZOA 1H8TB 1R1ZA 2ZHNA 4A6SA 2J1SA 3WP4A 3SMHA 1IKPA 1O91A 5A6YA 4XXPA 4AOCA 1AJOA 3WVJA 3B5LB 4QAWA 4GKYA 4IEOA 2BFUL 3PDQA 4I30A 1RGSA 4QB1A 1W03A 2ILMA 2WQ4A 3PMSA 1W2OA 2W39A 2YROA 4OUEA 1UZYA 2WSUA 5FK8A 4AQ6A 4YG0A 5T52A 5IVJA 4BISA 1FAYA 1LGBA 2BGOA 1I5PA 3ZN6A 1R1A3 4LHSA 4CXYA 1W2AX 5A3MA 3THDA 1QWRA 2D44A 5FYIA 2J1EA 3RG0A 5F9TA 4A42A 4HSLA 2DFBA 3PUSA 3HVDA 4CEWA 2UWBA 3RYRA 1WD3A 2EF6A 1ZA7A 1WMFA 3AX4A 1MPXA 4QU2A 1KD7A 3T3YA 3RJ2X 2ZEWA 1D4M2 2FCUA 1NT0A 3CBNA 5F32A 1M4WA 1RL3A 4CDQB 3HJRA 4AGGA 2W91A 4AFBA 2A7AA 1H30A 3LDRA 2WZPP 3CZJA 3MO4A 1DGRN 2ZGMA 3MF9A 3RGBA 1DG6A 2VNGA 4QHBA 2HWC2 4QKBA 1JMUB 4LOTA 1REEA 1AR93 3E6DA 1D4M1 1VRH2 5FYVA 3JZVA 1K42A 2C6SA 1PIV3 3L2YA 2HBUA 3KV9A 4Q8KA 3I2IA 2A1XA 4Y4RA 1NQJA 5ERLA 5IJRA 2EIEA 2PHXA 4A41A 1RVF2 5L7OA 4YRDA 3MLJA 4NJ4A 4XF4A 2VZSA 4Y1UA 1JZ2A 1WLCA 3NJXA 2HWC1 4K8RB 3R4UA 2NN8A 3T2TA 3ZXLA 2VNOA 1VRH1 2VOXA 2YGMA 1F5JA 1MEC2 2FCTA 2QQLA 2VD7A 5CKMA 1W6PA 4AEMA 2JDNA 2DWRA 4LHNA 2VOWA 1Q3EA 1RVF1 4QDQA 5FTTC 1GOGA 5FZ6A 4C1WA 1L7QA 4Q0VA 5FK7A 2J42A 2D93A 3I3MA 4JQRA 3LIGA 4QQPA 1RITA 3F95A 3ES4A 1MEC1 3M1HA 1XSRA 1T6BX 4AR2A 4NHLA 5C6CA 1YI7A 4CXXA 4IV3C 1S0IA 3N36A 4R52A 2D6KA 4FVVA 3TEYA 2Y33A 1O4TA 2DUQA 4NRPA 1RJ7A 5CA6A 2W94A 4CPBA 1YQ5A 5LEJA 5FYUA 1DFQA 1X8MA 4LULA 1NE4A 4Q4V3 2Y6JA 2HJIA 1VAVA 3POIA 4IXLA 4MADA 4XTPA 5APAA 2ZMKA 1C5HA 2I45A 3RYKA 3ZFGA 1EY2A 3QACA 3MBWA 4G3YC 2DUOA 2EIDA 3T2PA 2AR6A 4ASLA 1WZXA 2A6VA 3HBZA 3V56A 5A6XA 4M00A 2PHRA 2VL4A 1VJ2A 3IT8A 5FKCA 2WFF2 4NPRA 3ZR5A 5ACA3 3TEZA 4L2NA 2WSVA 4NAOA 1ZZBA 4E8DA 4UOJA 1KDMA 1JI6A 1CAUB 2DU0A 2NP0A 4XJUA 3R0RA 4EJRA 1REFA 4YW7A 2Y6KA 2XL7A 1HXS2 3H3UA 1POQA 4HKLA 5FQ0B 4AK3A 5AC93 1SG3A 4BQWA 2WFF1 1ZX5A 4N7UA 3IMMA 3OY8B 4JGYA 1SBDA 2KXLA 4FOQA 3AP9A 2B9VA 2W92A 4UF0B 3VL9A 3ZYHA 3PL0A 1UOJA 3ZN5A 2OPKA 5A32B 1NA1A 3B94A 1CAWB 3MPBA 3AFGA 4CPBD 1HXS1 2ZGSA 4FP2A 1YO8A 4TLFA 1OH3A 2WN3A 2IXJA 1E57A 1YJLA 4JV4A 5FZ3A 1WW6A 1W2NA 4AFDA 1DDLA 2I07B 1ND3A 4Y20A 5SV8A 3CLPA 4MGTA 4N9HA 1OF3A 3POYA 1SFPA 3POSA 3P1IA 2IZWA 3GALA 5E89A 5EWSA 4CSWA 1OA2A 4LORA 4R9AA 3E5UA 1S4CA 1WKYA 5FYTA 2X5IB 2BVVA 4ET7A 5J96B 1W8WA 4L99A 2JG9A 4TWTA 2WS93 4B4RA 1DGWA 4RR3A 2Q1FA 3TOJA 3AYDA 1WCKA 4A3ZA 5L19A 3NL1A 2QQWA 2NPIA 5FY5A 2P17A 3MI8A 3FZ3A 3IIIA 4EZ4A 4PCRA 4UYBA 3OOXA 2BPA2 1GWLA 2VMCA 5IK5A 3JD72 4QKNA 2ZACA 2Y26A 2PHDA 1IPSA 3VBHB 2E33A 4YW4A 3N4MA 4LBMA 1MS8A 2CWSA 1V6OA 3AMNA 2VVFA 1VR3A 4CP9B 2TNFA 2JDZA 2LUWA 4JKLA 4Y24A 5FRAA 4GMP3 1XYNA 4MGYE 1S0GA 4O7XA 3SEEA 5F8PA 3VDDB 4HOOA 2WJSA 3JD71 5CB7A 2ZAHA 4QPIB 2VTXA 2GC3A 5IVYA 1VAMA 5HV0A 4FSJA 4XABA 1Q8QA 3D82A 3S30A 3UL2A 3D3AA 2XWBB 2C9KA 1LKNA 5CFDA 3RZJA 5FZBA 2RHPA 4TZDA 4XMIA 2XLFA 4O9GA 2WQ8A 3BTZA 1QHDA 2ZABA 4NHXA 5FXZA 1QH6A 3ZFEA 1GQPA 1MQTC 2RDSA 3HPNA 5K7PA 3ZYJB 1VBB2 4NVPA 2G9FA 1G9AA 2WT0A 1CX4A 4BJ0A 5FY0A 3NW4A 2ZEXA 4XOGA 1DGRA 5F37A 2WO2A 1UY4A 1WBLA 1NLQA 4JX0A 1ZVFA 2NQYA 3RMXA 1HDKA 5JI7A 1H6YA 1QJU2 5FP4A 1WA6X 1UYXA 5EJZB 4LA2A 4FBFA 3K4AA 3ASIA 2BRTA 2JWPA 4QPGB 3WY6A 1J59A 3GM8A 4ORFA 4I02A 2ARBA 1UW8A 1D2SA 4AHYA 1VBB1 4HL0A 2JJ6A 2ZGUA 1TNRA 1UY0A 4JGZA 2D5HA 5IK8A 5DXDA 5FY1A 3VN4A 5CADA 4QX1A 3PJQA 5EJ3A 3H8RA 2ADDA 4Y5TA 4KH9A 1QJU1 5D8AB 3ZSMA 2P3YA 2XVGA 3IZOA 3ZSKA 5I91A 1LOCA 2XKOA 3WUDA 2W1QA 5I8YA 2WC2A 1W3XA 3NKTA 4LBQD 1EYBA 1PK6A 2ENRA 2Z42A 5FMBA 3FC0A 5J7MA 3FLPA 1NCQA 1J1LA 1MACA 3H3ZA 4IEYA 5CFCB 1GWKA 4D7YA 1RUE2 4BQXA 2ARAA 1Q56A 4B4QA 1GR3A 3LB9A 4S2HA 1D4M3 2RVAA 5C70A 1IQAA 1GOFA 3WG2A 3NKGA 4Y1YA 1OLRA 2XJPA 2QQKA 5L7OB 2NLRA 2VULA 2W95A 3KVAA 3KD4A 3OG2A 4MLOA 4DY5A 1AXYA 1PZ7A 1UY3A 4Q1PA 3RPQA 3ZFFA 2BP6A 2X29A 2XG3A 1QNYA 1UN1A 1XYPA 3A22A 4OMDA 2HWC3 3ZXJA 5C8CA 2W1SA 1VRH3 3RWKX 1VMFA 1N47A 5E1RA 3AC0A 3MDPA 2WZ8A 1G9BA 4PF1A 1VIWB 2L9LA 2OZ6A 1H1IA 2A5ZA 3LPFA 2J22A 1RVF3 2BGPA 1UF2C 2NMNA 4AHWA 2Q4SA 1S2KA 3VKNA 2X10A 5HCFA 1VE0A 3T2QA 1HRI1 3WNNA 1F4AA 1IHMA 3DL3A 3DCQA 3DYMA 4MGKE 5AFBA 3GZTB 4L97A 1FNZA 3MW2A 3O14A 1MEC3 4UFIA 4DRVA 4FAHA 2Q1ZB 1UY2A 2G1MA 4CCOA 1BKZA 1CZVA 4TLGA 4BB3A 1S0EA 4K6BA 3NNGA 3LEKA 1X9TA 3N9PA 4LIUA 2VBBA 4XQDA 3ZDVA 2ZTNA 3GZEA 5FZKA 2ZEYA 1CPMA 2B4KA 4QX0A 4YGCA 4DXTA 5JWPA 1K5MA 4XFGA 3RZMA 1QJX2 5CG9A 2X05A 4IETA 4OUMA 5GALA 3OTFA 3H8OA 2BJSA 2GNTA 1KITA 2JG8A 4YM3A 1JH5A 2ZJCA 4PIZA 2Y6HA 1OUSA 4XF1A 5LATA 2QE3A 4TXWA 4CU8A 4YGDA 2VZQA 2ZGQA 4NROA 2HH9A 2VZ1A 4OMCA 4LXLA 3QBQA 1LOFC 1QJX1 1SZBA 5FZFA 5JVVA 5FWJA 1X50A 4JAAA 1PM7A 3ACHA 1MS3A 1ND2B 4UAPA 4OI1A 3W9AA 5KBFA 4AVTA 5IHRA 2QJVA 3JU9A 5FUNA 5KHIA 2WFF3 2JENA 1GZWA 4RQPA 5JR2A 2P34A 4CDXC 4BA6A 3BOWA 2D3PA 3GJBA 2H6BA 2I74A 3INAA 3KT1A 2Q5TA 3DPRB 4E4SA 2Q30A 4PF5A 1NKGA 1AJKA 3BKZA 4Y4YA 1Q8PA 2JKXA 1HXS3 1KFXL 3QD6A 3C3VA 4IGQA 4X6RB 2QUOA 1N3OA 3RQ0A 3WNMA 2CHHA 2QDNA 1GOHA 1GBGA 3AZYA 3BPSA 4E27A 4AVAA 2A3XA 2PQSA 3AVRA 3AZZA 5LRRA 3FLTA 3BODA 5LW9A 2BVBA 3OGSA 5L73A 5FZOA 4OI2A 4Y22B 2DF7A 3CZUA 2JG9B 4S2DA 5DUWA 1W9SA 3H1WA 3VD7A 2RS32 2VMIA 2WZEA 3APBA 5KC5A 2XJUA 2YBKA 4IV3A 3ZDSA 1G9DA 5FP3A 1DQ2A 1BZWA 2GU9A 3HD8B 1BEV2 5JAXA 2GH2A 3BTXA 4XZPA 2VG9A 3MYXA 2YXSA 5FZ9A 2ET7A 4MZUA 5BV6A 4CEWC 4ZPIA 4K8FA 5FZGA 2DFCA 4QPWA 4LT5A 1JS9A 1CAVA 2RS31 4P02B 3SNMA 5FZ8A 1ZNPA 2ZGNA 1OF4A 5DAVA 4GB31 1BEV1 3S7EA 4AQTA 2HYKA 2OA2A 3ZYGA 5K0UC 2ZMLA 1GNHA 4P9IA 2FDIA 2VUJA 1S2BA 4RHV2 5LA2A 5KXBA 3JD73 2C0ZA 2VTXJ 5GKAC 3K77A 3CO2A 1O3RA 2CTVA 2Z79A 4ZY9A 1UPIA 1B35B 4FQ4A 4ZS2A 5CFDB 4LBQB 4AAPA 1SLIA 3J7NA 5CKQA 1VBA2 2GMPA 4ZXEA 5KWRA 4W6WA 1QU0A 2W2IA 3KF3A 2WNVB 5FY8A 4CCCA 1C28A 4RHV1 3W21A 2ZHKA 4BLJA 4HKOA 4AF9A 2VMGA 2R30A 1X33A 3CMGA 5EFUA 4JTOA 5BNPA 1WW4A 4TYSA 1VBA1 4HETA 3SITA 1O5UA 4GULA 4CDUB 5C3RA 3H8XA 1W6OB 3PVBB 4QX3A 5EV7A 5H9PA 2B46X 3VZKA 3OPWA 1D4VB 4CCJA 4YVWB 2VCMA 2W3JA 5FYMA 2ZX3A 1YUDA 1VLNA 4RS5B 1VBB3 4JGZB 4Q1RA 4QHOA 2DTYA 4E4DX 3I3DA 4QHZA 1ONAA 2QQJA 4N53B 2DVGA 4FPYA 4JTNA 4UI9L 1DBNA 1OSGA 3O1OA 1QJU3 5HCBA 1FNYA 3MIGA 1SBEA 5A7WB 3NWKA 4YVSA 4B8EA 5CEHA 4HSJA 5I0DA 4LHKA 3WSOA 1Z7S2 4FPEA 3EXUA 1UZ0A 2CNAA 3Q8BA 3ZFGC 5FO7B 4WM7B 1YYNA 1NCQB 1ENQA 2V5DA 3AZWA 1UD1A 1QF3A 3M70A 2JKBA 3IMNA 4OI0A 1SPPB 1HJFA 2EIGA 4AGRA 4LNVA 1ULDA 4AFMA 4AW7A 4OQ9A 1Z7S1 4CYDA 1WMXA 2IVIB 4LE4A 1VBC2 5BXXA 1W2TA 1ULPA 5FMCA 2B39A 3OUHA 5L9BA 1O8SA 2AUYA 3SEPA 4YZ2A 5A3UA 1PX3A 2XGXA 5EQUA 5FMDA 3DKQA 3JCIA 4AVVA 3LDBA 3MF6A 4QPYA 4WM8B 2PMWB 3USUB 3VHOA 3U10A 4JGYC 1BK0A 1W06A 4GA9A 4BQ4A 1VBC1 4P5HA 2ET1A 2WA4A 4B1LA 3IBMA 5J1XA 4O9EA 1STMA 2Y64A 3MUY1 4D6SA 3E6CC 5H9RA 4CCKA 4EE2A 4V1PA 1NA1C 3DGTA 1QJFA 5TSWA 3ZXAC 1ASJ2 3WDXA 1ENRA 4Z07A 3T4HB 1MQTA 2VM9A 4FTBA 5DPNA 3N7JA 2JX9A 1HRI3 1AX2A 5FXWA 2CGOA 5FUIA 2PHWA 2XBO2 1H1MA 1ND3C 2WA3A 4NN0A 4R4ZA 5IUQA 5BY5A 1DQ1A 3C7HA 2VCAA 5FPVA 2ZAAA 4XYXA 1XU1A 1YQ6A 2XR4A 5JIAA 3WOGA 4ISRA 1REDA 1ASJ1 1Y4WA 2BNMA 3AP4A 4XFBA 2YMZA 2P6HA 4AEKA 4FOYA 1R092 3BIWE 2XVKA 1A34A 4Y33A 3I2GA 3NSTA 2GALA 4P00B 3VDAA 4LKDA 4RR3C 1KXGA 1YFUA 2UYAA 2XBO1 1RXGA 2W87A 1NAEA 5F3CA 4W65A 5FIXA 2F6BA 1HKDA 4Q0SA 4Q0UA 4JDMA 1TME2 1OT5A 3RRDA 1O3SA 1F35A 2A3YA 4QM8A 4ARXA 3BVCA 4YW1A 1R091 4C1XA 5I8SA 1N1VA 4HPKA 3V0AB 3HNYM 3I2HA 5SV5A 4H14A 3OBRA 3O0VA 1UKRA 4W8JA 4J6GA 2Q8EA 1D0HA 1QJX3 3CHXA 3H1MA 1HQNA 3UK9A 3UKTA 1TME1 2WT2A 3I59B 4P14A 5JXHA 2B45X 1KGYA 3O1PA 4YW6A 4BQ3A 2GNMA 1US3A 4XZUG 2ZX4A 4NWVA 1WMEA 3NO8A 3LEMA 1UCXA 3U4XA 2O1QA 2VNRA 5FP7A 2QCSB 3FUOA 1XE7A 5B4XA 2XQRA 1FOD2 2A3WA 4NOTA 2BERA 1H4GA 4JKMA 1J3PA 2AC1A 4IEQA 4IV1B 2DCYA 2YB7A 3SCHA 2XMLA 2QZ3A 3VBRA 2YBSA 3ZFEC 1OA3A 2P3IA 2BUKA 4YFZA 5EPAA 1XRUA 4RGGA 4K40A 3KMHA 2IFRA 1C5IA 4QM9A 5J09A 5FZHA 1YEWA 1FOD1 2TEPA 3DYOA 4AVCA 4L8QA 5B2GB 5FO9B 1LTEA 3ZKUA 1OD3A 1GP4A 5C7GA 3KWVA 1KDKA 4LO6B 4IV3B 1YJKA 5ANNA 2V5YA 2W46A 4ZZ5A 2A6XA 1CJDA 5F6KA 3ABZA 3O0XA 3KLSA 4NHMA 3P6BA 3W20A 5FFOC 3R6SA 1F15A 1W6MA 1WLTA 1UY1A 1V6NA 1WCSA 3ELNA 2HYXA 5DUXA 2IFWA 2FDHA 3B3QE 4XCAA 4M3CA 3O1TA 1MZFA 2D7FA 1I9RA 5DAPA 5HPOA 1XOYA 2RS33 2DV9A 1V6LA 4MGQA 1AYM2 4JRLA 3MW4A 5EIYB 2QFEA 3KT4A 1PGL2 1S0CA 1PK6C 2KD7A 2OVUA 1FATA 4GB33 4RFRB 4EWDA 1BEV3 3MFCA 3EQEA 4XHXA 5LCWL 3R4DB 1W04A 5A7OA 2BWCA 1DHKB 4PQ9A 1L3JA 2D5FA 1AYM1 1PGL1 4HVOA 1CN1A 1KEXA 4IEXA 3UGHA 2VGDA 1RUG2 4Z2AA 1UU5A 4D69A 2R072 5FXVA 5IK4A 4WZCA 4DB5A 3KGZA 3ZFFC 4A7YA 4RHV3 1VRBA 3ZXDA 2Q8OA 4CU7A 4MYEA 2JD4A 1CGPA 5F5AA 2OW4A 5C8CC 3AFKA 2Y0IA 4IEVA 3VBSC 4XF9A 1RUG1 4QGMA 4IE7A 1VBA3 3VL8A 2R071 5FKBA 3ECQA 3PVNA 3O12A 3EHKA 1NLSA 3IDAA 4EWAA 5GZCA 1TG7A 3B7MA 2FD8A 2N7GA 3BPZA 3FHAA 4HANA 2GZWA 1XB9A 3CJIA 1MZ6A 1O4ZA 4UWDA 2C9AA 2J7MA 2ZZQA 3FWEA 1IZ3A 3GCXA 3I8TA 1K5JA 3AKPA 5FYZA 1WCUA 3P3NA 4YM2A 2X8KA 4CU6A 3DF0A 3AJYA 2A73B 4EN6B 2XLAA 2AREA 3BTAA 4AYUA 4ZS3A 2JDMA 5JOXA 2D97A 3N35A 1ZRDA 4NMIA 3IDCB 4XDOA 3WT3A 5DDJ2 1K5MC 1QXRA 2LROA 1W39A 2VZRA 1VP6A 4L92A 3PIGA 3R05A 3WP6A 2JG8C 4O65A 4AI8A 4H2AA 1ALYA 4XEZA 4LO7A 5J98B 5A6ZA 1Z7S3 2BNNA 1SLAA 2PA7A 1OQ1A 1JBCA 3VZLA 4AG4A 2IXKA 3BALA 5DDJ1 4UW3A 2D98A 5K0UA 1GYKA 1JOBA 2A75A 4LK7A 2W52A 5FBJA 1Q43A 5KC6A 1TQ5A 5IT6A 1J58A 3LDKA 1VB2A 4CCMA 1UO9A 3AB0A 3O5SA 3ZYBA 4AEDC 4K1YA 4OHWA 3GYDA 5IK7A 4L0PA 1UZWA 3HN1A 4RQPC 3IIAA 3BN6A 2OT7A 1VBC3 1LODA 5C9AA 2W9XA 4BHPA 4YSFA 1D7PM 1HRV2 4LK6A 5FZDA 1UU4A 2VZ3A 5L9RA 1G8WA 3VBOA 3S7IA 2RJ2A 1W6QA 4X8PA 3U37A 1AL22 4DNYA 2IC1A 1GU3A 3J4UH 2AENA 1O5LA 3I4IA 3AXEA 4OLLA 4Q0PA 4S2GA 1HRV1 2VUDA 5A80A 3UGFA 1UWWA 1X9PA 5FXXA 2BBVA 1ST8A 4OZOA 5A1LA 2JE9A 1ASJ3 3V65A 5G05L 2ZGTA 3NQHA 1IGOA 1UNBA 3TRSB 2SBAA 1FX5A 2XBO3 5C4WB 4LBLA 3MFAA 4LBOA 3EB7A 1RINA 1KJRA 1ZZ8A 4PQQA 4N8MA 1RUI2 1ZYBA 4BPZA 2XONA 3RFRA 2Y8KA 1R093 3OYWA 3WF1A 4NPMA 2BV4A 3HQUA 4QQOA 3U11A 4BXSV 1COV2 2Z69A 1YFXA 1G9FA 1IS3A 3EO6A 3UJOA 4C0HA 5A33A 4DY3A 4M01A 5JPNB 3RZGA 2GP5A 2HWE2 4I3PA 4M4RA 5FY7A 4XJAA 1NOVA 1TME3 4IE4A 1RUI1 3MW3A 2RR12 3S5QA 2FDKA 3OGRA 4XURA 3WNKA 1COV1 3TB0A 3J7LA 2P2KA 4XE9A 3CKHA 1W8TA 3OF1A 5L36A 2QVSB 3ZR6A 2A6YA 2FCVA 2HWE1 2NM1A 4FI9A 2ERFA 4DINB 2CAVA 2HEWF 3AYEA 1JYVA 2RR11 4Y3OA 4XF3A 3SISA 3Q9OA 1QEXA 3ST7A 4XHBA 3IPVB 4UFJA 3ATGA 3T0BA 2ZS6B 5BNPC 1N3PA 2WT1A 4FPLA 4INDA 4CCLA 4W6YA 1FOD3 5DZEA 3WR0A 3KGLA 4FPHA 4NIAA 3UKNA 3MLKA 3NVCA 4JHZA 4KGGA 4R9DA 4IE5A 2VQAA 2P5BA 1XYOA 1S1AA 3A21A 2PAEA 5F2SA 5A70A 4PDWC 3VKLA 2HWF2 1UOBA 3AMHA 2R0HA 1DQ0A 3UGGA 2VJXA 3ZX7A 1P8JA 3ALQA 3ZPOA 4BMBA 4C90A 1QY4A 4QWNA 3H1YA 5FJKA 5I0TA 4XUNA 4Z82A 2DBIA 3JBG2 5IAVA 3POJA 2F4PA 3N7LA 2NZ9A 4EQVA 5A1FA 2RM22 2OXBA 4YVSC 5GLUA 5T5JA 4EWEA 4FCAA 2ZZJA 4KU7A 2HWF1 3KVBA 4YM1A 3GHNA 5A7NA 4KL1A 4I0WB 3SQOA 3VD5A 5IVVA 1BK1A 1OFNA 3SH5A 5JZGA 2W08A 2Y0OA 4AE2A 3V0BB 4NRQA 3VZOA 1FPN2 3JBG1 2JDUA 2XH6A 3C7OA 3NNMA 1VPHA 3WNXA 2RM21 1X36A 4E9KA 5JCTA 3VBFA 1BHGA 1YLLA 1U12A 2VVEA 4LITA 2OS2A 1XPWA 2WUHA 1TE1B 2KA3A 3FJSA 4ITCA 3BU0A 1AYM3 1V70A 1KS4A 2WDBA 4LUKA 3VDCA 3VHPA 1V00A 5JXJA 1YI9A 1FPN1 4CDXB 5KHJA 1QIQA 4Y26A 3PIJA 1W8HA 1W90A 4LBKA 4WVMA 3PURA 4NRMA 3VHNA 2V4VA 5CU1A 2WLPA 4CEYA 5CISA 2BW8A 2MPFA 1MS0A 2P37A 4IEZA 1RUG3 3MUZ1 2R073 4LLOA 5LZ6A 2B8MA 4FFFA 1OQEA 4DMIA 3AM2A 4PT6A 5FY9A 2XB6C 3VZMA 3WNLA 3NAPA 1ZZ6A 1ENXA 2HEYF 2WYSA 3D6EA 4I0BA 1AUYA 2EVXA 4LIVA 1ODMA 2WWUA 4XAEA 4LE3A 1PGSA 4EYUA 4QU1A 4FFIA 3QLQA 3T1LA 1OOPA 4OVEA 2E26A 4YFWA 4XBLA 1TMF2 2CGPA 2Z2SB 2JDYA 3ZN6B 1XU2A 1QKQA 1UZZA 4QX5A 2QQPA 3GZUC 1POV0 3SXWA 4LKSA 4CEWB 2JECA 3J7MA 2WLQA 3ETQA 5F5QA 3KQRA 2ZA9A 4I3GA 5FYYA 4Q4W2 4AI1A 1RUC2 2I2SA 3DN7A 4E4HA 4XBNA 2ZKLA 4CDWA 1PMIA 5T54A 1W8FA 3BOPA 4GIQA 4U36A 1S0FA 1C1LA 2XHKA 5FLHA 1K3IA 3J9SA 1YQ8A 3BIEA 4OUSA 1AX0A 5K0UB 5DDJ3 5DZGA 4B29A 3AP6A 3TAYA 3HBKA 2BU9A 1XXNA 4XUOA 1AZDA 5DN2A 1GP6A 3OUJA 4COUA 4Q4W1 4AWDA 4ES9A 3H50A 1RUC1 1W99A 4NO4A 2LM3A 1W05A 3HNMA 3NJYA 5GZDA 5LK7B 1GUIA 1GZ9A 5BNNA 4FXGB 4NUBA 3U1XA 3THPA 3GXUA 1AR72 3POBA 4NHYA 2ZEZA 5D21A 4BIOA 1J3QA 3WEZA 2G9GA 4HK9A 5IVEA 2ZKNA 1RUE1 5FPLA 2QQUA 1A6CA 2DURA 2OQ7A 1ZBA2 4IQPA 1LU1A 1W6PB 3VBRC 1ULOA 3LD8A 2V09A 3VBSA 3ZO0B 4FOWA 1MVEA 1AR71 4JQTA 3U14A 3UESA 4JDOA 1K12A 4Q4Y2 1HN0A 1HRV3 5IW0A 5FO8B 2XUMA 2BZDA 4KGQA 1MR5A 2VECA 1ZBA1 2QQMA 1EAH2 2WWJA 2XHNA 3FBMA 4W50A 3K51A 4KBZA 1SHWB 1LGCA 4YLZA 1PHMA 5EZWA 5B4NA 1MZ5A 1H8VA 5I0UA 4D94A 2ZX1A 4RN5A 1NX9A 2VOKA 3ZYPA 1JZ4A 2BEOA 2VU9A 4Q4Y1 4AQ2A 1RC6A 4KWUA 4Q5OA 3K4ZA 5T5PA 3B01A 1NXMA 1UL9A 2XUEA 1EAH1 3BCWA 3OYWB 3ZFGB 2E6VA 1POV1 2P3JA 1EPWA 4MSVA 3HEIA 1W9YA 4DS0A 1OPMA 3D0JA 3HR9A 3NRUA 3WINE 4KG8A 1BJQA 2Y6LA 2YGLA 4RGKA 3O1VA 1IG3A 4XFFA 2UU8A 1UYYA 2R062 1RUI3 4AGVA 1HJGA 4P9WA 1JU4A 4M3CE 3D4KA 3GBGA 3LEGA 1APNA 4OCTA 4Y1VA 2ORXA 1COV3 3FBYA 3AKSA 5F3EA 4AL9A 4QXCA 5FLJA 2XJVA 3EBRA 2E53A 2HWE3 1XC6A 1DGWX 3PNAA 3ACLA 1GICA 4AEDA 5LASA 4JGYB 5KHKA 4GH4A 2R061 4JC1A 5A6QA 2RR13 5FREA 3ZMNA 3MLLA 1JODA 1YCIA 5JSPA 1ZBE2 4F8AA 2ID4A 5CKNA 1PMHX 5A3NA 1NA1B 2ARCA 2LS6A 3CQOA 4W6XA 3POFA 4BK4A 3S57A 4MX3A 1W6NA 2VZUA 3POEA 3PUQA 2OYZA 4YGBA 5FYBA 4B3NA 5J37A 2F4LA 4L9BA 3LOIA 1ZZCA 4ES8A 4I2OA 1XE8A 3PUHA 2DVDA 1RMU2 1ND3B 4Y20B 5T3NA 1YFWA 5IVBA 2YUEA 5CIRA 2XL9A 5J3UA 2E7AA 1JYXA 1ZBE1 4JCKA 4OHVA 1F2NA 2OQ6A 4ZU4A 3VDDC 2ORZA 3CJIC 5FZAA 4OULA 4RD7A 4U2AA 3ZYFA 1UKGA 4F7ZA 4QQLA 4HN0A 2NYYA 4XVHA 3OPZA 1XE0A 2GP3A 2R7EB 2Q8CA 4RR3B 2UWAA 1SLBA 4YZ5A 2J1VA 1DIWA 4N43A 5EXOA 4RSUA 3ILFA 3C7GA 1Q8VA 3HAGA 4XFHA 3KHBA 3M3IA 5CYYA 3K3NA 4A7KA 4IGPA 4QB6A 2HWF3 2WABA 4R9BA 1OVPA 1XNAA 1UX6A 1GQHA 4QXKA 1GNYA 3WQ7A 3OPTA 2B5HA 3I2FA 4O61A 1NCRA 3JBG3 1DGLA 5JR7B 4GWNA 4FTEA 2LW8A 2RM23 4QGNA 4COWA 2WNOA 5BNNC 1KQRA 1DQ4A 4XW3A 4DIQA 5FPXA 1GMMA 2PHLA 4I01A 3PTRB 3VBUC 4KWKA 1HB1A 4YZ1A 3S0MA 1LENA 1FPN3 5D1IA 4FAGA 1G86A 5DUVA 4AXOA 4NIHA 5D8AC 1LULA 1LOGA 4Q29A 4HBNA 3O1UA 4HMZA 2YHJA 4Q4X2 5C9AC 2YFZA 3SHRA 1LU2A 2E7QA 3VBOC 5J36A 1WD4A 3ZFEB 3OGGA 3M3EA 1JUIA 3LEIA 5F3IA 3WQBA 2QBXA 4UW5A 5BNOA 3QOPA 1HB2A 3I7DA 3HT1A 3J7HA 3K46A 1WW7A 3MV11 3C7EA 5DZFA 2J1AA 4YNIA 4BQ1A 2G19A 1H0BA 2IUWA 1H2LA 1AX1A 1AL0G 1UYZA 5CG8A 4Q4X1 5K4LA 4OHXA 2VY0A 2PYTA 3RWNA 2G9ZA 5C3OA 5JOZA 4FQZA 2XOMA 3HNBM 1WA4A 2D6NA 1W8NA 4FXKB 4PDWA 2WN2A 4UFLA 1JZ3A 5FBZA 2VR4A 2UY8A 1Z0HA 1L7RA 3J8F2 4M0NA 1V6IA 1Y7BA 4MGIE 4XJWA 3A7QA 3SLIA 5A3TA 1VMJA 2A71A 2YC4A 1YQCA 1LOBA 3OEAA 4RYDA 2RDQA 4E2SA 1Y9QA 3IN9A 4QX2A 4XJZA 1FMD2 5FP8A 4IEWA 2AEZA 2K0GA 2Q0AA 2VBPA 2BDRA 3WP3A 3ZXGA 1AR62 3U75A 2WNUA 3WF4A 4ASMB 5D2AA 1FV3A 4YZ3A 4CXWA 1H8TA 4FT8A 5F3GA 1PK6B 3A0KA 3J8F1 3O1RA 1GNZA 3D8CA 1O7FA 3FX3A 3NV3A 4IL7A 2YYOA 4XDPA 5KXCA 4AQSA 3ZMOA 3VDBA 3E5XA 3DYPA 4KU8A 1R1A2 3RZKA 2WINB 1FMD1 2PXJA 3AKRA 1PNFA 2O8QA 2QNKA 2OKXA 5FP9A 1AR61 2GMEA 4Q4W3 1RUC3 4KWLA 2ZX0A 2JDHA 1YIPA 2WBKA 4YPJA 3ZYIB 3N9MA 5T5LA 1N1YA 4DFSA 3CJXA 3Q8EA 3AJZA 4Y1XA 2GC0A 4UFMA 1ULFA 2RMU2 4Y1ZA 3RZHA 1AXZA 1OLMA 1W3VA 3LGRA 4UBHA 3ZFFB 4DOUA 3TEWA 3RS6A 2YPDA 3VV1A 3ZM8A 5HCHA 3GBWA 2Z5WA 5C8CB 1RUE3 3E5QA 4P5YA 5E88A 5K9YA 1JW6A 3LAGA 4MUVA 1SFNA 4MG2A 2FQPA 1ULGA 2RMU1 3EYPA 2WO3A 3KZ4C 1J3RA 4FPOB 4J1WA 1AR73 1DYKA 1OC1A 3NV1A 4COYA 1AHSA 4CDQA 2P4EA 2FZ2A 1SEFA 1XJAA 3FHQA 4K1ZA 5T55A 1W8OA 1ZBA3 3UV9A 4X6QB 5IWFA 2DYCA 1OH4A 2W68A 2YY1A 4KG0A 3WQ0A 2FMDA 2PELA 5DAXA 2EXJA 4Q4Y3 2SLIA 1H6XA 2VMFA 1JYTA 5F5CA 4ATEA 5CNAA 1DF0A 2B9UA 2BBAA 3LSDA 4KI5M 1FXZA 4CUAA 5F2WA 5IYYA 1Y9GA 1EAH3 5FZMA 1U0AA 3F2ZA 1K5MB 4A2UA 3DPRC 1POV3 1CONA 4IDZA 2VZVA 1W0PA 4NAMA 4RGAA 3DUIA 4RFT0 5FPBA 4AZZA 4MVTA 2JG8B 4Z92B 3VD3A 1QMJA 2R1DA 1SLTA 5ABJC 5JZGC 3MV01 3WNOA 2ZMNA 1S0BA 1OI6A 2JIGA 2DU1A 4BQYA 2DDUA 1MS9A 4PBPA 3OCPA 4JHTA 4QB2A 5FOBB 1MS1A 4B4PA 1F8VA 2RV9A 1V6MA 1H2MA 4NPLA 1RHI2 2E31A 3AL5A 3AMPA 3VBFC 2LTNA 4KWJA 2ZX2A 3T4VA 4C8DA 2CU5A 5BUVA 3G7DA 2V73A 3H8UA 1LR5A 1D0GA 3RI9A 2VO5A 1H4HA 2BQPA 2D43A 3TNPB 3MIDA 3OBTA 1JZ8A 1GZWB 4MHRA 4RQPB 1SMVA 2WRAA 2R063 3T0DA 3H9AA 3NNLA 4M4PA 1CR7A 4FTSA 4UW6A 1F4HA 1RHI1 2YZ4A 2O0OA 4LLFA 3CF6E 1UX7A 1W6NB 4QD2A 2ADEA 3FHIB 3POWA 3TNQA 4CEYC 3LSEA 2EXHA 4XUTA 5FWEA 1W28A 2GNBA 3M3CA 5BNQA 1C1FA 3K75B 5AVPA 1JTZX 1ZBE3 3KF5A 3NAPC 5FZOB 4S2FA 2VQTA 5FJHA 4BCUA 1LAJA 1O4YA 4E8CA 5JDBA 3ZSLA 5IFPA 3KB5A 1JYCA 1CAUA 1BYHA 4D0QA 1OOPC 3OD0A 4XIKA 1DQ5A 2VH9A 2OZJA 4K3UA 2EA7A 2VCCA 4SBVA 2VNVA 3IAPA 5HXMA 1C8M2 1NLRA 3JB4C 4LBJA 4D6QA 4OQ8A 1IPJA 1I6XA 5GJ6A 1QDOA 2ZHLA 4KNCA 4XPVA 3OY8A 5FR3A 3BU7A 5JOYA 1Z78A 1Q8SA 2MEV2 2FHRA 4UF0A 2VUCA 4BWOA 2XDVA 4EN7B 1G9CA 1C8NA 1H2KA 5LA9A 1CAVB 5A32A 1HLCA 1N1SA 1G7YA 4YZ4A 1CAWA 2R1BA 3ITQA 1C8M1 5LK5A 4CDWC 2IWGB 2GMMA 3AXDA 2Q1MA 4M3CF 2D6LX 4M0HA 2FDFA 5EHDA 5A7SA 2P1BA 4QXBA 2R32A 3ENRA 4YG6A 1CVNA 2MEV1 1XNDA 2CL2A 3M3QA 2PN5A 3EMRA 2RJKA 4BIFA 3D5OA 4OZXA 4B1MA 1JYNA 3MZHA 1XBFA 2X5IA 1KJLA 1LRHA 4N53C 4ZZ8A 3NNFA 3L9JT 4NHKA 5FLIA 3X29B 1O3TA 4UXAA 1LHVA 4AFCA 3IM0A 3BI3A 5A7PA 3ZOIA 2VMHA 3LQCA 4D8MA 3RSJA 3ETPA 2CDPA 4XQ4A 3CDZB 1V6JA 4JDNA 2ATFA 4WM7C 5FUPA 4QGLA 5BNPB 1PVXA 2E9QA 3IDEA 3SH3A 2B42B 4AEJA 2RS52 2E32A 3VBHA 1TZOA 5GZGA 1MZEA 3AK0A 3C2UA 4DXZA 1E5IA 4Q4X3 4XILA 1CPNA 3AYAA 5I0SA 1OKQA 4GAZA 4JVAA 2QQVA 4KQ7A 3H7YA 5CZKA 1RTVA 4CP9A 2JD9A 1J1TA 1PZ8A 1CIYA 1LECA 5LEKA 2RJLA 2OX0A 3VDDA 2K46A 2GN3A 2VW0A 3Q8CA 1QOTA 2JICA 5FYSA 5GLVA 2RS51 4Q0QA 3I97A 3MPPG 2XJQA 4XAAA 5KR7A 1SLLA 4J1XA 1PM4A 2QQOA 3AL6A 5AVAA 1FT9A 3THTA 1IG0A 1J83A 1TVGA 2D40A 3M8LA 4YVSB 5JMCA 2R6QA 1ZZ9A 1MS4A 1YIFA 4K21A 4XXAA 1H2NA 1QQP2 3I3EA 2WFPA 3VLBB 3I49A 2WR9A 3LF7A 1GWMA 3B9CA 1IQDC 3PHMA 4D7TA 3J8F3 2YBPA 1WMDA 1WW5A 3N7MA 2BYVE 4OI4A 4V2WA 1QNWA 1XNCA 1DP0A 5IAXA 3LIHA 1UQXA 2VCBA 1YNAA 1E5SA 3OSDA 4JZRA 3N9NA 3KV4A 1FMD3 1I5ZA 3W59A 2Y34A 1LEDA 1CQ9A 1AR63 4EN0A 2JE8A 1QQP1 3PU3A 1BQPA 3VKMA 1PO22 1X7NA 1RUD2 1DZTA 1H9PA 4ONUA 4QPGA 3VKFC 4GZ9A 4CCNA 3VBUA 5LBCA 3ZSEA 5FZLA 5BYNA 4P9XA 1A3KA 5FZ7A 3HIFA 1N1TA 4V2VA 5I8TA 3N7KA 4K9SA 1T6GC 2GH8A 4GH4C 2GC1A 3KS7A 5F5IA 5D8AA 4CVUA 1XSQA 4LJHA 3BGAA 3KCYA 1PO21 4TSVA 1RUD1 2AEYA 2F17A 2CY6A 1HQLA 2DCKA 3WP5A 1ODNA 1WGPA 1ZREA 3VB9A 1W2UA 3ZXEA 2XKPA 4OHZA 3TYJA 2RMU3 5DMYA 5FPAA 2OIIA 1MQTB 2XXZA 4HXCA 4QQHA 3I2KA 2WQZC 3ZXKA 2ZGPA 1IS4A 2VC9A 3AP5A 4PJYA 2CYFA 4AI2A 5JSOA 1UU6A 3WX5A 2QQIA 5C8WA 4DQAA 3AP7A 1QDCA 5FZCA 5CFCA 2PAKA 5LRSA 5JMOA 3PUAA 4AVSA 3CIHA 3IKWA 3WG4A 4WV8A 5LY2A 2YC2A 3U4SA 1CIWA 1AL21 4MGSA 4YM0A 4XQWA 1C57A 4B7EA 2QQNA 3UT0A 5GLWA 2HWD2 3PMEA 5K8SA 2BNOA 5FDBA 3AYCA 2VUAA 4LR4A 4N43C 1R64A 3O1MA 4WBBA 1G6NA 3M4FA 1SQ4A 5F1RA 4CP0A 1SDWA 1S0DA 1JYWA 3I3BA 1AR82 3RI8A 1OA4A 4IV1C 2XWJB 4NR1A 4Y5SA 5LBEA 3TN92 4HPKB 2HWD1 5C71A 4PIYA 1NCRC 3M2MA 1W9TA 4DUVA 1VBE2 1OVSA 2VZPA 1UMZA 1AR81 2VZTA 1U5YA 1PMJX 3ZXFA 4ARYA 2ZCWA 5F39A 3IAQA 3UNPA 2WYFA 1LHWA 2IVJA 3TN91 1RUOA 3N9QA 3WLUA 3WZ1A 3ZSJA 5FPUA 1VBE1 1CESA 4BH9A 5CBLA 5A3PA 4HT1T 2PQQA 1W9WA 4IEUA 1RHI3 3W58A 5GLTA 1LOAA 3KM5A 4QKFA 3PVEA 1MS5A 1LOEA 2XPJA 3VBRB 4L11A 1DZQA 3NJVA 1OHFA 3RMYA 1AXKA 3ILRA 5BNOC 4G9SB 4A45A 1LGNA 5C33A 3M3OA 3QH7A 4BQ2A 4QT6A 1RXFA 2EALA 3IB3A 4P9GA 3SC7X 2VMEA 3MEPA 1E5RA 5LY1A 2QDRA 5E16A 4CUBA 5GLZA 3GHMA 2H0VA 4UT5A 2Y60A 1YQ2A 2WO1A 1HN1A 1Q8OA 3M7AA 3RJRA 1ND2A 4E2QA 1UPSA 2Q8DA 3ZKYA 5JIUA 4LEJA 1DLLA 4RA0A 1S2EA 4HVQA 4YG3A 1W6MB 3MIFA 5DG2A 1WWYA 2QZ2A 1DQ6A 4GKXA 3S6PA 4E2GA 5FZ1A 4A4AA 1L7LA 4M3CB 5IATA 2YDEA 4BU2A 3DPRA 4CUGA 3THCA 3VD4A 2WNUC 3WV6A 5T50A 1URXA 4EROA 1A8DA 3SH4A 1C8M3 1H8TC 3GF6A 4N7IA 1N3QA 2VOTA 2VOVA 1QOSA 1SCSA 3AKTA 4PI0A 2DCJA 5ABJA 1JZ5A 3WDTA 1B09A 2MEV3 5JI9A 4CA9A 3BB6A 3P3PA 4HN1A 3I54A 4Y22A 4FPCA 4K7JA 4DPNA 4MV2A 1H9WA 1RUF2 5LBFA 1OPOA 1JHJA 3ACIA 1ZRRA 2VXJA 2PFWA 3U0ZA 2FDJA 1C3HA 2BWAA 4URTA 3NJZA 1YWKA 3WW1A 4TN7A 3WW3A 4CE8A 1BMV2 4FP3A 2FBEA 4G4FA 3IWZA 4XACA 2RE9A 4WZFA 1GV9A 1OBNA 3RDIA 1A78A 1RUF1 4PLMA 3CU7A 4GALA 1JHNA 1QXJA 1US2A 3H3LA 1IKQA 1OLME 4D3WA 1XNBA 1JU3A 4HKWA 4IUGA 4B7KA 4CDQC 1LESA 2JDKA 2HBTA 2VW2A 1PVC2 2W1UA 1V9U2 2Y6GA 3AVSA 1BMV1 4EN9B 3BTYA 4XCBA 1QJY2 2Y38A 3CJIB 2UURA 4IEPA 5HV4A 3CNAA 1ZZ7A 1RJ8A 5FYCA 4ZU7A 4ZKTB 1F9KA 2DCZA 4N90A 1UOFA 4CP1A 3OGJA 2RS53 4Z8BA 1KRIA 4CU9A 1B35A 3ZYRA 4LBQA 3LA3A 1GANA 5EP9A 1PVC1 2WWSA 3ON7A 3WXPA 1V9U1 3KQ4B 4MOAA 3Q8AA 3RZLA 3LFMA 1QJY1 3C7FA 2XJTA 2WNVA 5E6HA 2C5DA 1JOJA 4LTAA 2VBDA 2GNDA 5IFTA 3WQ1A 3PLQA 3FL7A 1FYUA 2DVBA 4BMEA 2W5FA 4ATFA 4IERA 3I3QA 4A44A 1TMF1 3JQXA 2FMYA 4CDUA 1CAXA 2BGCA 2MHFA 3VZJA 1W6OA 4KMQA 1UOGA 5BNNB 1QQP3 2CGNA 3PUIA 4XMAA 2WNEA 4YVWA 4YW2A 5C3PA 1BLZA 3VBUB 4QX7A 1JYIA 1IPKA 3AMQA 4PIXA 4ASKA 2DVFA 3K3OA 1IS5A 2XJRA 4RS5A 4GQ7A 4XJ9A 3I2JA 3ROUA 1NQDA 2RS12 2R042 3K4DA 2AACA 2TUNA 4N53A 4RL7A 3V64A 2WZR2 2ETEA 2RDNA 3A0NA 4MHUA 4UW4A 5C4WC 5GZFA 3AZVA 3KV5A 3FFQA 5C9AB 2XJSA 1GSLA 4ZHNA 1PO23 4WVVA 1RUD3 5A7WA 2JXAA 1NE6A 2WZR1 3VBOB 2QTWB 1W6QB 2EAKA 3MHZA 3WF2A 2VXRA 2HKXA 3U78A 1HW5A 4WM7A 2RS11 2R041 3E6BA 2VVDA 3ACFA 1VBD2 3VHRA 3WHTA
chains in the Genus database with same CATH topology
1QJZA 4QQ2A 2HEVF 1DYPA 2E7TA 4FOVA 4XIOA 4FO9A 1LCLA 2CAUA 2JE7A 3WCRA 1AL23 3WW2A 4KBBA 1SBFA 1XNKA 1VBD1 3B02A 3WHUA 3L2HA 3FLRA 3KCXA 1JN2P 1HRI2 1W0OA 2D6OX 4YW5A 4GXLA 4WM8A 3LA2A 2H0BA 3J26N 3LWCA 4R9CA 3USUA 2D6MA 3USSA 4QMAA 4Q26A 2PHFA 3QH6A 2HWB2 2DTWA 2HWD3 1ZM1A 4LO8A 4P9JA 5A33B 3CEWA 3FUQA 2ZOEB 1PGW2 2O8OA 4XF0A 4CZSA 2PLV2 1AR83 5J48A 3UKVA 4GWMA 4AHZA 4FPKA 2HWB1 1A8MA 3TN93 3IDBB 2ZPXA 1HIXA 4AVBA 1UIKA 2X5IC 3SCGA 1VBE3 1BBT2 3H7JA 1WCDJ 1PGW1 2PLV1 4AFAA 2XVLA 3H0OA 1BVVA 2R0FA 1F5FA 2ZGLA 1WLWA 2PTMA 2WL1A 1QOOA 1S55A 1D2QA 1AYN2 2VW1A 4MGZE 1BBT1 4YW3A 1RIRA 2GC2A 3HMYA 3VBHC 1U5ZA 3WCSA 4EV0A 3V0AA 1IOAA 2E63A 1R082 2MNGA 4R8HA 3I59A 4MXWA 3LKJA 4CP2A 1AYN1 3MICA 4QPIC 2D6PA 2DUPA 4LO5B 1R081 2D3RA 5KXDA 4AHXA 3CL1A 4MH0E 5FOJB 1RMU1 3OD4A 2IXHA 3WUCA 1RUJ2 1BCXA 1PO12 1RUH2 1MVQA 3MIBA 1QXPA 4IV1A 1EP0A 2ZGOA 3WW4A 5ABJB 5JZGB 3GNEA 2X53S 3PJYA 2DCTA 4ZU5A 2A6ZA 4XDQA 2IXLA 3MGUA 4FPGA 3G6JB 3VBFB 4F3JA 1HQWA 1RUJ1 1PO11 1RUH1 5EYXA 1KS5A 3VGIA 4AXOA 4QPGC 1LEMA 4Q2FA 1G9CA 3A4UA 3VZNA 4FPJA 2PHUA 4PLNA 3WDVA 1SCRA 5A3LA 2AZ5A 4GB32 1LB2A 3TBDA 1NG0A 1QGLA 2AH2A 3KSCA 4WVMB 4BM8A 1I1EA 2TBVA 1EV12 4CEYB 4YGEA 1ZRFA 4XFIA 2PAMA 3LCPA 3RNSA 3R4SA 1RUF3 5I0RA 4Y5Z0 1Q5OA 1JXNA 4COZA 2UWCA 1CD3G 3FFZA 1GZCA 3NAPB 2VQ0A 4H7MA 5H9SA 1EV11 4Z2WA 1U5XA 5JOWA 5CFCC 3PTYA 1OOPB 1FV2A 4BE3A 3WG1A 1SFYA 5EYYA 4DRRA 1GFF2 3GZAA 3GBFA 1SLCA 4XFCA 1PVC3 5L7OC 1V9U3 3B00A 5CVRA 3WDWA 1GQGA 1QJY3 1WLDA 3DV8A 5FMOS 4FPFA 1VAKA 5KXEA 1ENSA 4Q27A 3VKOA 4N9IA 1UIJA 2GN7A 4HFSA 2KM2A 5FCCA 2P3KA 1PNGA 2R49A 3I2DA 4CDWB 1CAXB 1TMF3 1IS6A 3MIHA 1XQNA 2FZ1A 1GLHA 3AKQA 2AGSA 4XTMA 4F83A 5HCAA 4HLTA 3LA7A 3PVOA 1UAIA 3LZZA 4C91A 4A3XA 3ZPYA 1M06G 2BTVC 1R1A1 2DVAA 2K9ZA 3MIEA 2G4IA 2WIIB 4LO4B 3ZN4A 3B93A 2A6WA 1C4RA 2RS13 2R043 3VBSB 2WZR3 1AR92 3KT7A 2B7YA 5JPMB 3ILNA 1PIV2 4I09A 4Q8LA 1I3HA 4LBNA 1NY72 5HXVA 4OHYA 4P9YA 1TNFA 2IXCA 4H55A 3UJQA 4LHLA 4HK8A 1NZCA 3QCWA 1AR91 1VBD3 3HQXA 1ND2C 1S0JA 5KHGA 1PIV1 2JEMA 4A7ZA 5BPXA 4R4XA 3WDYA 1NY71 2EXKA 1X82A 2QKDA 1OLQA 4DZGA 3RZZA 1HV0A 4WVWA 3LOBA 3SCFA 1VALA 3WG3A 4XBQA 1OQDA 3D0SA 2XLGA 4BYYA 1LJ7A 1YRZA 5AFEA 2OUHA 1U5IA 3JUUA 4D7SA 4IESA 1GKBA 4CRQA 4XJ8A 4X8NA 4Q4V2 2NMOA 2LALA 2A70A 2HWB3 2ZHMA 1YHFA 3VUOA 4H3WA 3U07A 5FMOL 2IXIA 2JG9C 1OD5A 3ZIWA 4SLIA 5DG1A 4XFAA 4OFGA 4AEDB 3B9IA 4WVZA 4GH4B 2PLV3 4YARA 3NV4A 5C4WA 5ACA2 2CWMA 3B69A 4HZFA 1VB4A 4Q4V1 1DU3D 2D3SA 3TWIA 1CJPA 5FAXA 2WKKA 1ZRCA 1OFSA 3ES1A 1BBT3 4P9LA 3K48A 1LHNA 4EN8B 4LA3A 1F31A 1FI2A 4GMP0 5AC92 2GDFA 5ACA1 1HX6A 3JB8A 2C1FA 1KFUL 3EJKA 4MXWB 2PHTA 4MXVA 3URFA 1YFYA 1AYN3 2UY9A 5FPZA 4Z1VA 2YC0A 3DKWA 4CTEA 1JUHA 5GZEA 1Y43B 4FSJA 4ZXKA 2BFUS 1B35C 1R083 1LHUA 4N43B 5I93A 4XETA 5CFDC 4HVRA 5AC91 1HV1A 1RMU3 3NV2A 5FQ0A 1TEIA 1EPZA 3OJBA 2WNVC 5HI0A 5F6LB 4YYOA 1ULCA 3IPVA 1WUVA 1NCRB 3ME2A 5T5OA 3ZIXA 3O7OA 4CDUC 2W0XA 3JQWA 2WS92 5CAZA 1RUJ3 1SACA 1PO13 2GSYA 1RUH3 2EXIA 2OUJA 4YVWC 2E51A 2ARXA 3KCCA 4COVA 5KHHA 2ZGKA 4PBOA 5GM0A 1V6KA 3T1MA 4E4ZA 2ES3A 4RS5C 4JGZC 3FMGA 3AZXA 3WD5A 3RYPA 1Y3TA 2WS91 2AYHA 4K20A 2EAAA 1AVBA 2K2SA 4C0BA 1NXD1 1YXWA 3O0WA 5H9QA 1ULEA 1AF9A 3HWJA 1DZRA 1BVP1 2CV6A 3WDUA 5BNOB 2ZBJA 3E97A 4AI3A 1QH7A 2VPVA 3AMMA 1NCQC 4JRAA 2ZGRA 4UBGA 1X8EA 3ZVXA 1RB8G 3V0BA 3N3HA 4H7LA 4I0AA 4PLOA 5HBAA 1EV13 2H6CA 4BOWA 5DUUA 1BXHA 3HT2A 1LOFA 4AI0A 5JSRA 4LUMA 2R16A 4GMP1 4PDWB 4NWWA 1WBFA 2GAUA 1O3QA 4BLIA 2YPJA 2YV8A 1OMIA 3FE5A 1ZA4A 1PZ9A 4QPIA 4CDXA 4META 5JLVA 1NYWA 1H1AA 4WM8C 1LHOA 2UYBA 5E8AA 2WNUB 4ISQA 1H8TB 1R1ZA 2ZHNA 3WP4A 3SMHA 1IKPA 1O91A 4XXPA 1AJOA 3WVJA 3B5LB 4GKYA 4IEOA 2BFUL 4I30A 1RGSA 2ILMA 2WQ4A 3PMSA 2YROA 2W39A 1UZYA 2WSUA 4AQ6A 4YG0A 5T52A 1FAYA 1LGBA 3ZN6A 1R1A3 5A3MA 1QWRA 2D44A 3RG0A 5F9TA 4HSLA 2DFBA 4CEWA 2UWBA 3RYRA 1WD3A 2EF6A 1WMFA 3AX4A 4QU2A 1KD7A 3RJ2X 1D4M2 1M4WA 1RL3A 4CDQB 4AGGA 4AFBA 2A7AA 1H30A 2WZPP 1DGRN 2ZGMA 3MF9A 1DG6A 2VNGA 4QHBA 2HWC2 1REEA 1AR93 3E6DA 1D4M1 1VRH2 3JZVA 1PIV3 3L2YA 4Q8KA 1NQJA 2PHXA 1RVF2 5L7OA 4YRDA 3MLJA 4XF4A 4Y1UA 1WLCA 2HWC1 3R4UA 2NN8A 3T2TA 3ZXLA 2VNOA 1VRH1 2VOXA 2YGMA 1F5JA 1MEC2 4AEMA 1W6PA 2DWRA 4LHNA 2VOWA 1Q3EA 1RVF1 5FTTC 4C1WA 4Q0VA 2D93A 4JQRA 4QQPA 1RITA 3ES4A 1MEC1 3M1HA 4NHLA 5C6CA 1YI7A 4IV3C 1S0IA 3N36A 4R52A 2D6KA 4FVVA 1O4TA 2DUQA 5CA6A 1RJ7A 5LEJA 1DFQA 1X8MA 4LULA 1NE4A 4Q4V3 2HJIA 1VAVA 4IXLA 4XTPA 2ZMKA 1C5HA 2I45A 3RYKA 3ZFGA 1EY2A 3QACA 4G3YC 2DUOA 2AR6A 4ASLA 2A6VA 3HBZA 3V56A 4M00A 2PHRA 1VJ2A 3IT8A 5ACA3 2WFF2 4NPRA 4L2NA 2WSVA 1ZZBA 1KDMA 1CAUB 2DU0A 2NP0A 4XJUA 3R0RA 4EJRA 1REFA 2XL7A 1HXS2 3H3UA 4HKLA 5FQ0B 4AK3A 5AC93 2WFF1 1ZX5A 4N7UA 3OY8B 4JGYA 1SBDA 2KXLA 4FOQA 3AP9A 3VL9A 3ZN5A 2OPKA 5A32B 1NA1A 3B94A 1CAWB 3MPBA 3AFGA 1HXS1 2ZGSA 4FP2A 1YO8A 4TLFA 2IXJA 1E57A 1YJLA 4JV4A 4AFDA 1WW6A 1DDLA 2I07B 1ND3A 4Y20A 5SV8A 3CLPA 4N9HA 3POYA 3POSA 2IZWA 3GALA 5E89A 5EWSA 1OA2A 4R9AA 3E5UA 2X5IB 2BVVA 5J96B 4L99A 2JG9A 4TWTA 2WS93 4B4RA 1DGWA 4RR3A 3TOJA 3AYDA 1WCKA 5L19A 3NL1A 2NPIA 2P17A 3MI8A 3FZ3A 4PCRA 2BPA2 5IK5A 3JD72 2ZACA 2Y26A 2PHDA 3VBHB 4YW4A 3N4MA 4LBMA 1MS8A 2CWSA 1V6OA 3AMNA 2VVFA 1VR3A 2TNFA 2JDZA 2LUWA 4Y24A 5FRAA 4GMP3 1XYNA 4MGYE 1S0GA 3VDDB 2WJSA 3JD71 5CB7A 2ZAHA 4QPIB 2GC3A 1VAMA 1Q8QA 3D82A 3S30A 3UL2A 2XWBB 1LKNA 5CFDA 2RHPA 4TZDA 4XMIA 2XLFA 4O9GA 1QHDA 2ZABA 1QH6A 3ZFEA 1MQTC 1G9AA 5K7PA 3ZYJB 1VBB2 4NVPA 2G9FA 2WT0A 1CX4A 3NW4A 4XOGA 1DGRA 1WBLA 1ZVFA 2NQYA 3RMXA 1HDKA 5JI7A 1QJU2 4FBFA 4LA2A 1J59A 4QPGB 3ASIA 3WY6A 4ORFA 4I02A 2ARBA 1UW8A 1D2SA 4AHYA 1VBB1 4HL0A 2JJ6A 2ZGUA 1TNRA 4JGZA 2D5HA 5IK8A 5DXDA 3VN4A 5CADA 3PJQA 5EJ3A 5D8AB 4KH9A 1QJU1 3ZSMA 2XVGA 3ZSKA 5I91A 1LOCA 2XKOA 3WUDA 5I8YA 2WC2A 3NKTA 4LBQD 1EYBA 1PK6A 2ENRA 2Z42A 5J7MA 3FC0A 3FLPA 1NCQA 1J1LA 1MACA 3H3ZA 4IEYA 5CFCB 4D7YA 1RUE2 1Q56A 4B4QA 1GR3A 3LB9A 4S2HA 1D4M3 1IQAA 3WG2A 3NKGA 4Y1YA 1OLRA 2XJPA 5L7OB 2NLRA 2VULA 3KD4A 4MLOA 4DY5A 1AXYA 1PZ7A 3RPQA 4Q1PA 3ZFFA 2X29A 2XG3A 1QNYA 1UN1A 1XYPA 2HWC3 3ZXJA 5C8CA 1VRH3 1N47A 5E1RA 3MDPA 1G9BA 1VIWB 2OZ6A 1H1IA 2A5ZA 1RVF3 1UF2C 2NMNA 4AHWA 2Q4SA 1S2KA 3VKNA 5HCFA 1HRI1 1IHMA 3DL3A 4MGKE 5AFBA 3GZTB 4L97A 1FNZA 3MW2A 3O14A 1MEC3 4DRVA 4FAHA 2Q1ZB 1BKZA 1S0EA 4K6BA 4XQDA 2ZTNA 1CPMA 4YGCA 5JWPA 1K5MA 4XFGA 1QJX2 5CG9A 4IETA 4OUMA 5GALA 3OTFA 2GNTA 2JG8A 1KITA 4YM3A 1JH5A 2ZJCA 4PIZA 4XF1A 2QE3A 4YGDA 2ZGQA 3QBQA 1LOFC 1QJX1 5JVVA 1X50A 4JAAA 1PM7A 1MS3A 1ND2B 4OI1A 3W9AA 5KBFA 4AVTA 2QJVA 3JU9A 5KHIA 2WFF3 2JENA 1GZWA 4RQPA 2P34A 4CDXC 4BA6A 3BOWA 2D3PA 2H6BA 2I74A 3INAA 3KT1A 2Q5TA 3DPRB 4E4SA 2Q30A 4PF5A 1AJKA 4Y4YA 1Q8PA 1HXS3 1KFXL 3QD6A 3C3VA 4X6RB 3RQ0A 2QUOA 1N3OA 2QDNA 1GBGA 3AZYA 4E27A 4AVAA 2A3XA 3AZZA 5LRRA 3FLTA 3BODA 2BVBA 5L73A 4OI2A 4Y22B 2DF7A 2JG9B 4S2DA 5DUWA 3H1WA 2RS32 2VMIA 3APBA 5KC5A 2XJUA 4IV3A 1G9DA 3ZDSA 1DQ2A 1BZWA 2GU9A 3HD8B 1BEV2 5JAXA 2GH2A 4XZPA 2VG9A 3MYXA 2YXSA 2ET7A 4MZUA 5BV6A 4CEWC 4K8FA 2DFCA 4LT5A 2RS31 1CAVA 3SNMA 1ZNPA 2ZGNA 4GB31 1BEV1 3S7EA 4AQTA 2HYKA 2OA2A 3ZYGA 5K0UC 2ZMLA 1GNHA 4P9IA 2VUJA 1S2BA 4RHV2 5KXBA 3JD73 2C0ZA 5GKAC 1O3RA 3CO2A 2CTVA 2Z79A 1UPIA 1B35B 4FQ4A 5CFDB 4LBQB 1SLIA 1VBA2 2GMPA 5KWRA 4W6WA 1QU0A 2WNVB 1C28A 4RHV1 2ZHKA 4BLJA 4HKOA 4AF9A 2VMGA 2R30A 1X33A 5EFUA 4JTOA 5BNPA 1WW4A 4TYSA 1VBA1 4HETA 3SITA 1O5UA 4GULA 4CDUB 1W6OB 3PVBB 5EV7A 5H9PA 2B46X 3VZKA 1D4VB 4YVWB 2ZX3A 1YUDA 1VLNA 4RS5B 1VBB3 4JGZB 4Q1RA 2DTYA 4E4DX 1ONAA 4N53B 2DVGA 4FPYA 4JTNA 1DBNA 1OSGA 1QJU3 5HCBA 1FNYA 3MIGA 1SBEA 4B8EA 3NWKA 4YVSA 4HSJA 4LHKA 1Z7S2 4FPEA 3EXUA 2CNAA 3ZFGC 5FO7B 4WM7B 1YYNA 1NCQB 1ENQA 3AZWA 1UD1A 1QF3A 3M70A 2JKBA 3IMNA 4OI0A 2EIGA 4AGRA 4LNVA 1ULDA 4AFMA 4AW7A 1Z7S1 4CYDA 4LE4A 1VBC2 5BXXA 2B39A 2AUYA 4YZ2A 2XGXA 3JCIA 4AVVA 3MF6A 4QPYA 4WM8B 3USUB 3VHOA 3U10A 4JGYC 4GA9A 1VBC1 4P5HA 2ET1A 2WA4A 3IBMA 4O9EA 3E6CC 5H9RA 4V1PA 1NA1C 3DGTA 5TSWA 3ZXAC 1ASJ2 3WDXA 1ENRA 4Z07A 1MQTA 4FTBA 3N7JA 2JX9A 1HRI3 1AX2A 2CGOA 2PHWA 2XBO2 1H1MA 1ND3C 2WA3A 4NN0A 4R4ZA 5IUQA 5BY5A 1DQ1A 2ZAAA 4XYXA 1XU1A 5JIAA 3WOGA 4ISRA 1REDA 1ASJ1 2BNMA 4XFBA 3AP4A 4AEKA 2YMZA 4FOYA 1R092 3BIWE 2XVKA 3NSTA 2GALA 4RR3C 1KXGA 1YFUA 2UYAA 2XBO1 4W65A 2F6BA 1HKDA 4Q0SA 4Q0UA 4JDMA 1TME2 3RRDA 1O3SA 4QM8A 2A3YA 4YW1A 1R091 4C1XA 5I8SA 1N1VA 4HPKA 3V0AB 5SV5A 4H14A 3OBRA 3O0VA 1UKRA 4J6GA 1D0HA 1QJX3 3H1MA 3UKTA 1HQNA 3UK9A 1TME1 2WT2A 3I59B 4P14A 2B45X 2GNMA 2ZX4A 4NWVA 1WMEA 3NO8A 1UCXA 3U4XA 2O1QA 2VNRA 2QCSB 3FUOA 1XE7A 1FOD2 2A3WA 4NOTA 1H4GA 1J3PA 4IEQA 4IV1B 2DCYA 3SCHA 2QZ3A 3VBRA 3ZFEC 1OA3A 2P3IA 2BUKA 4YFZA 1XRUA 4RGGA 4K40A 3KMHA 2IFRA 1C5IA 4QM9A 5J09A 1FOD1 2TEPA 5B2GB 4AVCA 4L8QA 5FO9B 1LTEA 1KDKA 4LO6B 4IV3B 1YJKA 2V5YA 2A6XA 1CJDA 5F6KA 3O0XA 3KLSA 4NHMA 5FFOC 3R6SA 1W6MA 1WLTA 1V6NA 1WCSA 3ELNA 5DUXA 2IFWA 3B3QE 4M3CA 1MZFA 2D7FA 1I9RA 2RS33 2DV9A 1V6LA 1AYM2 4JRLA 3MW4A 1PGL2 2QFEA 3KT4A 1S0CA 1PK6C 2OVUA 4GB33 1FATA 4EWDA 1BEV3 3MFCA 3EQEA 4XHXA 3R4DB 2BWCA 1DHKB 4PQ9A 1L3JA 2D5FA 1AYM1 1PGL1 4HVOA 1CN1A 4IEXA 2VGDA 1RUG2 1UU5A 4D69A 2R072 5IK4A 4WZCA 4DB5A 3KGZA 3ZFFC 4A7YA 4RHV3 3ZXDA 2Q8OA 1CGPA 4MYEA 2JD4A 2OW4A 5C8CC 3AFKA 2Y0IA 4IEVA 3VBSC 4XF9A 1RUG1 4QGMA 1VBA3 3VL8A 2R071 3ECQA 3PVNA 3O12A 3EHKA 1NLSA 4EWAA 5GZCA 3B7MA 2N7GA 3BPZA 4HANA 2GZWA 3CJIA 1MZ6A 1O4ZA 2C9AA 2ZZQA 3FWEA 1IZ3A 3I8TA 3AKPA 3P3NA 4YM2A 2X8KA 3DF0A 3AJYA 2A73B 4EN6B 2XLAA 2AREA 3BTAA 4AYUA 5JOXA 2D97A 3N35A 1ZRDA 3IDCB 3WT3A 5DDJ2 1K5MC 1QXRA 1W39A 1VP6A 4L92A 3R05A 3WP6A 2JG8C 4AI8A 1ALYA 4XEZA 4LO7A 5J98B 1Z7S3 2BNNA 1SLAA 2PA7A 1OQ1A 1JBCA 3VZLA 4AG4A 2IXKA 3BALA 5DDJ1 4UW3A 2D98A 5K0UA 1GYKA 2A75A 2W52A 1Q43A 5KC6A 1TQ5A 5IT6A 1J58A 1VB2A 3AB0A 3O5SA 4AEDC 4K1YA 4OHWA 3GYDA 5IK7A 3HN1A 4RQPC 3IIAA 1VBC3 1LODA 5C9AA 4BHPA 4YSFA 1HRV2 1UU4A 1G8WA 3VBOA 3S7IA 1W6QA 4X8PA 1AL22 4DNYA 2IC1A 3J4UH 2AENA 1O5LA 3I4IA 3AXEA 4OLLA 4Q0PA 4S2GA 1HRV1 2BBVA 2JE9A 1ASJ3 3V65A 2ZGTA 1IGOA 3TRSB 2SBAA 1FX5A 2XBO3 5C4WB 4LBLA 3MFAA 4LBOA 1RINA 1KJRA 1ZZ8A 1RUI2 1ZYBA 4BPZA 1R093 3OYWA 4QQOA 3U11A 1COV2 2Z69A 1YFXA 1G9FA 1IS3A 3EO6A 3UJOA 4C0HA 5A33A 4DY3A 4M01A 5JPNB 2HWE2 4I3PA 4XJAA 1NOVA 1TME3 1RUI1 3MW3A 2RR12 1COV1 3TB0A 2P2KA 4XE9A 3OF1A 2QVSB 2A6YA 2HWE1 2NM1A 2ERFA 4DINB 2CAVA 2HEWF 3AYEA 2RR11 4XF3A 3SISA 3Q9OA 3ST7A 4XHBA 3IPVB 3ATGA 2ZS6B 5BNPC 1N3PA 2WT1A