5CFDC

Crystal structure of dtt treated human cardiovirus safv-3
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
258
structure length
258
Chain Sequence
SDRVSSDTAGNTATNTQSTVGRLFGFGQRHKGKHPASCADTATDKVLAAERYYTIKLASWTKTQESFDHIRVPLPHALAGENGGVFSSTLRRHYLCKCGWRIQVQCNASQFHAGSLLVFMAPEFDTSNHSTEVEPRADTAFKVDANWQKHAQILTGHAYVNTTTKVNVPLALNHQNFWQWTTYPHQILNLRTNTTCDLEVPYVNVCPTSSWTQHANWTLVIAVLTPLQYSQGSATTIEITASIQPVKPVFNGLRHTVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords VP1
publication title Structure and Genome Release Mechanism of the Human Cardiovirus Saffold Virus 3.
pubmed doi rcsb
source organism Saffold virus
total genus 57
structure length 258
sequence length 258
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5cfdC00
4RFT0 1POV1 1BBT1 3JB4C 1B35C 1COV2 1VBC1 3VBFA 2Y26A 1AL0G 4CDUB 4RHV2 5J98B 4IV1A 1VBE1 4CEYB 3TN91 1RUI2 3VBRC 4GMP3 4CDXB 4CDWA 1BEV2 1ND3C 1VRH2 3M8LA 1RVF2 4Q4Y3 1AR62 4AEDA 3NAPB 4Z92B 1ND2A 1Z7S3 5FMOL 1QJY3 4YVWC 2X5IC 1R1A1 1R1A2 5ACA1 5ACA2 5C8CC 5L7OB 3VBHA 2R043 1GFF2 4LLFA 5BNNA 2RR11 1QJX3 3DPRC 1MQTA 3ZFFC 2HWC1 2XPJA 1FPN3 5K0UC 2DF7A 4RR3B 2QQPA 1HRV3 2HWF3 2HWB1 2HWB2 2WFF1 3VBRB 2WFF2 1ZBA1 1C8M1 1PO12 1QJZA 1V9U2 1RUG1 1FMD1 1ND3B 2R072 1EAH3 4IV3C 5C9AC 1PO23 1AR71 4WM8C 1AR72 5ABJA 2PLV1 5AC91 1ASJ1 4Q4X1 1ASJ2 4EJRA 4YVWB 2R063 2XBO3 1NCQC 5A33B 3DPRB 3ZFFB 3JBG2 1RMU2 5D8AC 4JGZB 1PVC2 1ZBE2 1HRI1 1CD3G 4NWVA 1HRI2 1COV3 3IDEA 1R092 1NCRB 4QPGA 4GMP1 1R081 4IV3B 5BNOA 1R082 1VBD1 1PGL1 1AYM2 5CFDB 2RM22 4WM8B 1PIV3 5A32B 1NY71 3JD73 3VBOA 4GB32 1QJU3 4FSJA 4QPIA 2GSYA 4N43A 3ZFEA 1VRH3 1QJY1 2HWD3 5JZGB 1D4M1 1NA1C 1D4M2 3VBUB 1AR63 1VBB3 2R041 1H8TC 1AYN1 1AR81 1AYN2 1AR82 5D8AB 4CEYC 2RMU2 1FPN1 2BUKA 5DDJ1 1K5MC 1AR91 1BMV1 4CDUA 1RUH2 1AL23 4RQPA 3VDDC 2WS91 1EV12 4RS5C 2RS51 4CDXA 4N53B 4CDQC 3ZXAC 1BBT2 1PO13 1V9U3 5BNPB 5L7OC 3NAPA 3J8F3 2RS11 1VBC2 2RS12 1QQP3 1NA1B 1RHI1 2R061 4FTEA 2RS33 1H8TB 4RR3C 1PGW1 1PGW2 1B35A 4GH4C 1VBE2 1HX6A 3TN92 1K5MB 4YVSB 1VBA3 2FZ2A 4JGYC 3VDDB 1TMF1 4RS5B 3VBRA 1A6CA 3JBG3 1RUC1 2BFUS 5FMOS 4CDQB 1E57A 4CEWB 1ND3A 3HAGA 1WCDJ 4Q4W3 1TME1 1TME2 3JD71 1RUF3 1FOD1 4PDWC 4Q4V3 1AYM3 2RR12 2RM23 1DDLA 4YVWA 2HWD1 2HWC2 2X5IA 5C8CA 2MEV1 1MEC3 1RUJ3 4GH4B 4JGZC 4GB33 1NG0A 5A33A 1X36A 1ZBA2 1C8M2 1HXS1 1NCRC 3DPRA 3ZFFA 1RUG2 1FMD2 5K0UA 5CFDC 4JGYB 2WZR1 1RUD1 2WZR2 2BBVA 1RUD2 1RB8G 2PLV2 5AC92 4CDWB 4Q4X2 1RUE1 4IV3A 5C9AA 1RUE2 1OOPC 4WM8A 4AEDB 2HWE3 1RUH3 1ND2B 5JZGC 3VBUC 4PDWB 3CJIC 5A32A 3J8F1 5FOJB 2ZAHA 1QQP1 3VBHB 3JB8A 1NCQA 1POV3 1BBT3 2RS31 2FZ1A 3ZFGC 1VBC3 5CFCC 1HQNA 1VBD2 1PGL2 5D8AA 2WLPA 4RHV3 4N53C 1VAKA 4Q4Y1 1VBE3 1RUI3 1NY72 1Z7S1 5C4WC 5BNPC 1OOPB 1BEV3 3VBSC 1C8NA 5ABJB 1QJY2 1RVF3 1AUYA 3CJIB 2R042 4Q4V1 1QJX1 2ZZQA 1R1A3 1NOVA 4FTBA 1FPN2 3ZFGB 1NA1A 5ACA3 5DDJ2 1HRV1 3LOBA 4YVSC 1HRV2 1AR92 2HWF1 1BMV2 1H8TA 4WM7C 5CFCB 1POV0 2WS92 4CEYA 1EAH1 2RS52 1PO21 1PO22 1K5MA 2HWB3 4CEWC 2WFF3 4QPGB 4RQPC 1ZBA3 1C8M3 5C4WB 3VDDA 3VBSB 2R073 1FMD3 4RS5A 1RHI2 2R062 1AR73 4CDQA 2XBO1 2XBO2 2HWE1 2PLV3 5AC93 1ASJ3 2WWSA 4Q4X3 4N43B 5L7OA 3VBFC 2BPA2 4WM7B 2VQ0A 4RR3A 4IV1C 1COV1 1TMF2 4Y5Z0 4GH4A 1VB4A 1RMU3 1RUC2 4CDWC 1F8VA 1PIV1 1PVC3 1ZBE3 1PIV2 4RHV1 1HRI3 4RQPB 4JGYA 1R093 4AEDC 1RUI1 1ND2C 3JD72 1QJU1 1R083 1QJU2 1FOD2 1VBD3 5J96B 1BEV1 1VRH1 1RVF1 1M06G 2HWD2 2IZWA 1AR61 1VBB1 2MEV2 1VBB2 3S6PA 3VBHC 3VBFB 4PDWA 5BNNC 2BFUL 1HXS2 1MQTC 1D4M3 4IV1B 1B35B 4JGZA 1AYN3 1AR83 1AL21 1AL22 1NCRA 2RMU3 1X33A 5DDJ3 5CFDA 1AR93 5ABJC 1F2NA 1PO11 1V9U1 1EV13 2WS93 4BCUA 4Y4YA 2R071 2RS53 3J8F2 5LK7B 1CJDA 1QQP2 1OOPA 4GMP0 2GH8A 2RS32 5JZGA 3VBUA 5BNNB 3CJIA 1MQTB 1W39A 2RS13 2X5IB 1RHI3 4SBVA 5C8CB 1VBA1 1VBA2 3ZFGA 4Q4Y2 3TN93 4QPGC 5BNOC 5CFCA 5K0UB 1Z7S2 3JBG1 1RMU1 5GKAC 1PVC1 1ZBE1 4Q4W1 4Q4W2 4N53A 1R091 1TMF3 3VBOC 1RUF1 1RUF2 5C9AB 4FTSA 1SMVA 1RUC3 4QPIC 1AYM1 5C4WA 4Q4V2 5BNPA 4N43C 2RM21 3VBSA 3ZFEC 1QJX2 1OPOA 1TME3 1MEC1 1RUJ1 1MEC2 2HWF2 1RUJ2 4GB31 1FOD3 2RR13 1VB2A 2HWC3 1NCQB 1EAH2 2MEV3 4YVSA 2ZTNA 4CDUC 4WM7A 5BNOB 4NWWA 1HXS3 3FBMA 1RUG3 2RMU1 4CDXC 2WZR3 4CEWA 3VBOB 1RUD3 1RUH1 2HWE2 1OHFA 4QPIB 1EV11 1IHMA 2TBVA 3ZFEB 3NAPC 1RUE3
chains in the Genus database with same CATH superfamily
4BWOA 1WW6A 4RFT0 1I5ZA 1POV1 1BBT1 1W8FA 1X9TA 2GH2A 1W8WA 5FJHA 1W6NB 3A22A 3KV6A 2FD8A 1GZWA 4M3CE 1HB2A 4PIZA 4SLIA 5CVRA 2BYVE 3ZN6B 1XNBA 4IE7A 5G05L 3PLQA 5H9SA 5B4NA 1QU0A 2XUEA 1BJQA 1H30A 4IEWA 5J98B 2O1QA 5LK5A 3WOGA 2XG3A 1Q3EA 3RJ2X 3T0AA 1OQEA 3GALA 3CJXA 4YM1A 2ZABA 2R0FA 4Q26A 1W28A 2XR4A 1WMFA 1VRH2 2YGMA 5AVPA 3NWKA 4LBNA 2VL4A 4MSVA 4QXKA 2D6KA 2W1WA 4KG0A 1XNAA 2EF6A 1BVVA 5I0RA 5FBJA 2CSGA 1Z7S3 2EAAA 1CAXB 4KQ7A 4JTOA 1QY4A 5AFEA 1L7QA 1YCIA 2X5IC 4EWAA 1R1A2 4UF0A 2XKOA 5A6ZA 5ACA2 3GZUC 3WNLA 4LPLA 4A3ZA 1GFF2 1GSLA 2JDMA 3CDZB 5F3IA 5BNNA 1UIJA 1NKGA 2RR11 3DGTA 4HSJA 3P3NA 4DXRA 4QQOA 5FZAA 1OQ1A 2XPJA 5EQUA 2RVAA 5GLUA 4ET7A 4MXWB 5A6YA 2Y6GA 1HRV3 2W92A 4UW5A 5C3PA 3AP4A 2XJRA 2HWB1 4LITA 4P9WA 1WD3A 3AZZA 2F6BA 3TBDA 2PAEA 1ULCA 1C8M1 1YJKA 1W6OB 3K4ZA 3AZWA 4YW2A 5HXMA 3ETPA 1FMD1 5BPXA 5CNAA 2PN5A 4M4RA 4EN9B 4FOYA 1J59A 1KQRA 3FZ3A 2Y6HA 5LEKA 5ABJA 3WF4A 4AI8A 1WZXA 5AC91 4MGYE 2F17A 5G04L 1ASJ1 4DUXA 2Y6KA 1OA2A 2C6SA 1KDKA 2OUHA 3FHIB 1GP5A 3OD4A 1Q56A 3C7GA 3FFQA 1LKNA 2D93A 2R063 4XDPA 3WDYA 2HEYF 1HLCA 3ELNA 4IETA 3R4UA 3DN7A 1EUTA 2GC1A 1XYNA 3DPRB 3ZFFB 3C2UA 2R32A 3E5XA 4F8AA 3JBG2 3MYXA 1RMU2 3DV8A 4NOTA 5D8AC 4FQZA 3WDWA 4KGQA 5FYBA 2VMIA 1LGBA 4EQVA 2DTWA 1COV3 1OUSA 2OPWA 4H14A 4LBOA 1R092 2AENA 5LCWL 1YFYA 4QPGA 2YPDA 1OT5A 5EPAA 5FO8B 4XFIA 1S0BA 3WP3A 2X09A 4LNVA 2A5ZA 4PI0A 3HNYM 2B39A 4I2OA 1FATA 2UWAA 2EA7A 2B4KA 3NJVA 5FZ0A 5A32B 3SITA 3WG4A 2LRPA 2AUYA 1QHDA 5FY4A 1JZ6A 1QJU3 5FLHA 4FPHA 1K5JA 2E6VA 2UY9A 5FZCA 3PTYA 1NLQA 3RWNA 1G9FA 1D4M2 1VBB3 3WSOA 3FUQA 2ZGMA 2IFWA 5IWFA 5LY2A 2X10A 4MH0E 2CAUA 2XJVA 2CY6A 4FPKA 4R9DA 1YC61 2VZVA 2XLFA 4DNYA 1BMV1 1OI6A 3E97A 2DUOA 1WKYA 5T5OA 4XURA 5JCTA 1OD3A 2AGSA 3BPSA 2WS91 3POFA 4ISRA 3RZZA 1W6PB 5FUIA 4OLLA 4OYUA 4OZXA 5DN2A 1V6NA 2DBIA 4CCKA 4CDXA 4MYEA 2YY1A 2FMYA 5FPLA 4OMDA 1BBT2 1UOFA 3ZXAC 1PO13 1V9U3 4Y24A 2J1SA 1OVPA 2A6ZA 4OMCA 4ZPIA 3UK9A 3ZVXA 3D8CA 3E6CC 2ZHKA 3NAPA 3NVCA 3UJQA 2VULA 3W59A 1W2NA 3D0SA 2PHWA 4LBKA 2R061 2D6LX 3HQRA 1XNTA 3HN1A 2XVGA 1G9DA 3I2FA 1PGW2 4NIIA 2WT1A 2VZUA 1O4ZA 1UYYA 2I2SA 1TNRA 2BOJA 2WSUA 3LPFA 1W2UA 1XSQA 2ZGPA 3OOXA 3HBKA 4FAHA 4HN1A 1GZCA 4U36A 2VE1A 3ES4A 3TOJA 4XC9A 5EZWA 2C4XA 3TEXA 1TMF1 3ZDSA 1AXZA 4IERA 1KITA 1CPMA 3HJRA 5TSWA 1DYPA 1U5ZA 1VP6A 3NNFA 1J58A 1A6CA 1RUC1 1YRZA 2AACA 3AFGA 5IVJA 4BIFA 2Z4FA 1S0FA 2ZOEB 3H3LA 3SKJE 5A3UA 1WCDJ 2PYTA 4BK4A 1YXWA 2W95A 4OZOA 4B4RA 3MW4A 1TME2 1SZBA 1UMHA 4K8RB 5A7OA 1H4GA 3MGUA 4UWDA 5FMDA 1RUF3 3KM5A 3OPTA 1XE0A 4P9YA 3ILNA 5FP8A 4PDWC 3IAQA 3USSA 4CVUA 4Q4V3 2VUAA 2RR12 1BVP1 3KS7A 1NQDA 1CIYA 1AXYA 1X9PA 2OXBA 2X5IA 3SXWA 3ZYFA 1APNA 3U0ZA 2MEV1 2O14A 3WDXA 3T0BA 3OGRA 2CWSA 4GH4B 1TQ5A 3NNMA 1H2KA 3KT7A 4BLJA 2TUNA 1C8M2 1HXS1 2ZEXA 1C5HA 3WW1A 4PIYA 1NLRA 3GGLA 1FMD2 1OLRA 3P1IA 2WAOA 4URTA 5C7GA 1TE1B 3ZKYA 5IK5A 4XF9A 4B7KA 1RUD1 2VOWA 2WZR2 3KMHA 2BBVA 3HMYA 3I3MA 5FZOB 5AC92 4R4XA 2VZRA 2VZPA 3CQOA 1SG3A 1UOBA 1FYUA 1V00A 1O8PA 1Q8QA 1OOPC 2Q30A 3PHMA 3POSA 4YM0A 4YGBA 3UGHA 4W6YA 1UY0A 3POEA 5DG1A 4YW5A 3SCHA 2VMCA 3VL8A 3IDCB 1OF3A 4QXBA 2XH6A 2XQRA 3MIBA 4ASMB 2H0VA 4E2QA 5ERLA 2G9ZA 3P3PA 5FYUA 3ZXFA 4LUKA 4AQ2A 3D82A 3GM8A 2V5YA 1LEMA 2TNFA 2PHXA 3I3EA 5A3TA 1GUIA 3J7NA 3JB8A 1ENXA 2XJQA 1GNYA 4KI5M 3M7AA 5A70A 1WBLA 2XONA 1LULA 2Q0AA 4MGTA 1OURA 5IFTA 3H3UA 5IK4A 1QDOA 4K21A 1XYOA 1VBC3 5CFCC 1WMXA 3AB0A 4BQ4A 5C6CA 1CAVB 3RS6A 5D8AA 4HVRA 1DBNA 4YSFA 2B46X 4XACA 5IUQA 2KXLA 2GMEA 1VAKA 2ZACA 4LKFA 1RUI3 3RI8A 1JHNA 2DDUA 2JG8B 1ZZ9A 1IS5A 4LBQB 3VBSC 1BEV3 1JU3A 4B29A 1NT0A 5BXXA 3ME2A 1YIPA 2D3SA 4R9CA 1UY4A 5CEHA 3O1RA 1ZREA 4XBNA 4LLOA 2A7AA 5FZHA 3ENRA 1QKQA 4W8JA 4Q4V1 3LDKA 1S1AA 1MZ5A 3ZDVA 4XJ8A 1RIRA 3GYDA 1ULDA 3ZN6A 2BV4A 2LW8A 3ZFGB 4YWAA 1WUVA 4Z8BA 1NYWA 1XPWA 1HRV2 2V4VA 3QCWA 2UYAA 3S57A 1BMV2 2DCYA 4LKSA 3TEWA 4IUGA 5FO9B 3VDCA 2WS92 5IK7A 2FDJA 5FKBA 3MDPA 1WWYA 2WQZC 5IK8A 1UOJA 2P3IA 2CWMA 1US3A 5JMOA 2RDSA 3WF0A 4Z2AA 2RV9A 2QQIA 3O1MA 2WC2A 4RQPC 5C4WB 3OGJA 4XPVA 3J26N 3VL9A 2QQLA 3VDBA 5IATA 3SEEA 4XF1A 4G4FA 3ZYJB 1CAXA 4BQ2A 2VECA 5IVEA 2R062 1AR73 2I45A 5DAWA 3AMPA 2UYBA 1W8OA 5FY7A 2ZGRA 5F8PA 5FZ6A 4RSUA 4NVPA 5JXJA 3ZR5A 4Q4X3 3N9PA 4N43B 3OCPA 2JE7A 3IB3A 3VBFC 2WT0A 5EXOA 4C90A 1VMJA 4Y20A 4N9IA 2PFWA 2FCTA 3FHQA 4CYDA 4GALA 1XE7A 2XJSA 1UL9A 1OD5A 1J84A 4WM7B 5GZGA 5JUVA 4MXWA 3BVCA 3KWVA 1TMF2 4IEVA 1GU3A 5FZ4A 2P2KA 1QDCA 1H6YA 1OSGA 3TEZA 2VOXA 1RUC2 3RZGA 1RUOA 3POIA 4MZUA 5FZGA 4RGKA 5FPBA 3WW2A 1PIV1 3ZR6A 3V0AB 1UX6A 5FZLA 4JZRA 3GBGA 4QGNA 4IEZA 1RUI1 4MXVA 4QX0A 1QJU2 1KFUL 2ZEYA 4G3YC 3HNMA 1O3TA 1BEV1 2OZ6A 5L9VA 1LOGA 3CHXA 4EWDA 2Q4SA 3DKWA 4HKWA 2IZWA 4KG8A 4X8NA 3I2JA 1N1VA 1K45A 1VBB2 2MEV2 3PJYA 3RPQA 1OA4A 1LNSA 2XJUA 1H1AA 2CTVA 3UGGA 2DVGA 4PDWA 4Q1PA 2AC1A 5DG2A 2BFUL 2I74A 3MZHA 2QQOA 3E1F1 1HXS2 3S5AA 2W94A 5KBFA 4XJ9A 4W4ZA 4JX0A 1WBFA 5IJRA 4AXOA 2V09A 1AYN3 1AR83 1XRUA 1AL21 5GLZA 1WLDA 4Q0UA 2WQ8A 5J09A 1CAUA 3IN9A 4YGDA 2E9QA 2RMU3 1G6NA 4IESA 3EO6A 4DOUA 5LA0A 2P5BA 5DDJ3 3WUCA 2BWAA 2XUMA 2ADEA 2ZS6B 4FI9A 4AG4A 5A3LA 4Z1VA 1EV13 5A6XA 3GXUA 3ZMNA 3IAPA 4TN7A 2RS53 2YU1A 5LK7B 4UF0B 3VLBB 5IYYA 3TEYA 1OOPA 1UU5A 4N7IA 4INDA 5FTTC 4FBFA 1JOBA 1JYXA 1GZTA 1QWRA 3BOWA 5SV8A 3TRSB 4AFBA 3THTA 1LECA 1ENSA 2WL1A 3D4KA 5ANNA 1H6XA 3Q8FA 2YV8A 5BNNB 2P4EA 4MOAA 1CPNA 1AX0A 2WO7A 3OY8A 3CO2A 4NHLA 4COUA 1PX3A 1RITA 1LGNA 1KD7A 4AVCA 2V5DA 5HXVA 3ZXDA 3T1LA 2W3JA 2C9AA 1LHNA 4X6RB 2WN3A 1LTEA 1G9BA 3RZMA 3A4UA 4MADA 3LQCA 3MHZA 1ACCA 5CFCA 4DS0A 3UKNA 3KCXA 4B4QA 1GYKA 4NUBA 1BZWA 4XYXA 4DRVA 4E4HA 4ZU7A 5L9RA 1OXCA 4Q4W1 2WWUA 1C1FA 1JXNA 2E32A 5FMBA 1NZCA 1RC6A 5A7PA 1RUF2 2BGPA 1SMVA 3ZXJA 2ETEA 4OHYA 1AYM1 2DTYA 2NLRA 4Q4V2 4N43C 2RM21 1VMHA 3VBSA 4UXAA 4E27A 3GCWA 2ZCWA 2JG9C 4YZ3A 4YLZA 1MEC1 4K9SA 4N8MA 2DCKA 5FZ8A 1I3HA 2R0HA 4Y3OA 1OLME 1YFUA 2WAAA 5LA9A 1W8UA 1UKRA 1G7YA 1NCQB 1PM7A 5I8SA 3VDAA 3PNAA 4HETA 4DXTA 5F6LB 3T4HB 1KDMA 3A7QA 3BODA 3S7IA 2ARAA 1WD4A 4NWWA 4XF3A 3EXUA 4QDSA 4A6OA 4I0WB 4ITCA 2RMU1 2ZKLA 3IMMA 1LOFC 4QKBA 5F3EA 3VKNA 1U5IA 5KR7A 1H9PA 2GAUA 5KHIA 4XJZA 3RVHA 1GR3A 5DUWA 2VQAA 3KSCA 2VOKA 2WIIB 4AEMA 2RJLA 2RG4A 3B9IA 1EV11 4PCRA 2RJ2A 2YBKA 2D3RA 2Y6FA 4Y5SA 4AI1A 3KGLA 5FZMA 4P02B 3WNKA 4QHZA 4O7XA 1R64A 4F3JA 1MS0A 1Y3TA 3FLPA 1IG3A 4CP2A 5HCFA 3JB4C 2H6CA 4I09A 4J25A 2I07B 1QOTA 5CU1A 4NROA 3FX3A 1POQA 4P08A 4X8PA 1W90A 2B42B 4OUMA 3SHRA 3VBFA 3ZYGA 4A6SA 4ATEA 5FR3A 5IVVA 5JPNB 2WYFA 3VUOA 4QM8A 3RWKX 2UY8A 2CGOA 3OBRA 2XXZA 3Q8BA 4FFGA 2RDNA 1CAWA 2Q8OA 2LALA 1EUUA 2A3YA 4OHXA 3C7OA 4AWDA 2PTMA 5LRRA 4WVZA 1VBE1 4K40A 1F15A 2Y60A 3HQUA 3UKTA 1RUI2 1JYNA 3OGVA 2R30A 4BQYA 4LK7A 4CDXB 4AVAA 4AFAA 1BEV2 1E5RA 2XJPA 3M8LA 2JIGA 3MLKA 2EIDA 2VBDA 3AYCA 3DYPA 4I0AA 1W04A 4Q4Y3 1DZTA 1ZA7A 3SC7X 2L9LA 3NAPB 3RMYA 4TLGA 4HKOA 2C5DA 4EROA 1GNZA 1W2TA 1W9SA 2IXKA 2VZ3A 3KT1A 3PUIA 3WHTA 4IDZA 4QX1A 5FZDA 1R1A1 5I0SA 4DIQA 1Q8SA 4QQHA 5ACA1 1GKBA 3WW4A 5L7OB 2R043 3SCGA 5JVVA 2UWCA 2OX0A 4ZXEA 1LB2A 3ZSKA 4IE6A 3EMRA 1S0CA 3DCQA 2X05A 1ZRFA 1CAVA 4XCAA 4CCLA 3NKTA 2HWF3 3KB5A 3WW3A 5CB7A 1NE6A 5A80A 2FCVA 4M3CF 4PIXA 2K9ZA 1S0IA 5DZEA 4LJHA 4IV3C 1GOFA 1EAH3 1IOAA 3H50A 4XJWA 1PO23 3ACIA 1JMUB 4IEUA 5FYYA 4Z07A 4WM8C 1AR72 5I0DA 3U4XA 3ZLIA 4A41A 4D6SA 1GLHA 1Q43A 2PELA 3Q9OA 3NQHA 3KVBA 4H55A 3JUUA 1O59A 4DB5A 4UFLA 1PNGA 3B69A 3TAYA 1S0DA 1ZYBA 3APBA 3IKWA 5FV3A 2UURA 5J7MA 2JD4A 2A6XA 4AGVA 3ZIWA 1RINA 3OG2A 4A7KA 1NCQC 5LRSA 3M3IA 4W6XA 2W1UA 3VHRA 4P9IA 3W21A 5FZ7A 1CIWA 2VQTA 3RSJA 4CUBA 5I0TA 1Y7BA 4AE2A 4PF5A 3AMHA 4AHXA 2XQXA 2ORZA 5DMYA 2VOTA 5FZ3A 2QFEA 2VW0A 1L7LA 1ONAA 1CD3G 4NWVA 3WUDA 4NHXA 3Q8AA 2ZMKA 3SMHA 3E5QA 4YW1A 2GC2A 2P34A 4HZFA 4LULA 4ZS2A 4HONA 1VBD1 3CIHA 5F5QA 1AYM2 1UZ0A 3FLRA 3J4UH 2RM22 5GZDA 2VD7A 4GWJA 2P6CA 1XNKA 4FOWA 1HQLA 4CXWA 2BNMA 1N1YA 4XE9A 1IQDC 5FKCA 2FCUA 2ZHNA 3GBFA 3LKJA 5KXDA 3O1VA 3N7MA 5FY0A 4N43A 4GJYA 4XTMA 1D4M1 1NA1C 2JG9A 4IXLA 1AR63 2VTXJ 5FOBB 2P6HA 4A7ZA 2R041 3T30A 2J1AA 3U11A 4UYBA 4LIUA 4PHZA 1AYN2 1AR82 3WT3A 1LESA 5D8AB 3S30A 5L19A 2RMU2 2YBSA 4MHRA 4CRQA 3SKVA 2IXIA 4Q0VA 2FDGA 1X82A 4XVHA 3V0AA 3QOPA 4QPYA 4AHWA 5A3WA 4ZZ5A 1QIQA 2DU0A 2JDPA 2WFPA 5FK8A 3VDDC 1EV12 4IEXA 4NHYA 4RS5C 3UGFA 4TLFA 1LOFA 4QD2A 1HB3A 2WKKA 3VZJA 1XNDA 4N53B 3ZSMA 2JEMA 5JSPA 1QF3A 4FOVA 5CKNA 3WNPA 5EV7A 1AJOA 1VRBA 4LBLA 3V0BA 1LOAA 3B7MA 5FXXA 3WLUA 5F2SA 5L7OC 3E5UA 3ZPYA 2WZPP 1SFYA 1QQP3 4FTEA 4B4PA 5KXEA 4MV2A 5LW9A 1ZZ7A 1UYXA 3AKQA 4O9GA 3VD3A 1NXMA 4E8CA 4QT6A 1V0AA 2Z42A 1PGW1 4A4AA 3DKQA 3H8RA 1ENRA 4DEQA 2D98A 1O5UA 5FZBA 1VBE2 1W0OA 2VZSA 3W5MA 4AW7A 5J48A 2YHJA 3HWJA 1VBA3 4LE4A 4OI2A 1PK6C 2YFZA 2LUWA 4Q0SA 3G7DA 3M3OA 3VD9A 4JGYC 1E5SA 4JC1A 4LHSA 3ZIXA 3TNQA 2Y64A 2XVKA 3UYJA 3D3AA 3DL3A 2XKPA 1OUXA 2YDEA 4QDQA 5FYHA 3BGAA 2ZHMA 2DVDA 1YIFA 3AKRA 3FE5A 3N9MA 5FY9A 5FXZA 4DPNA 4LA3A 2E33A 1UF2C 1TME1 1URXA 2D5HA 2BQPA 4K7JA 4Q29A 2EXHA 3H3ZA 4FP3A 2Y6LA 5FYTA 4BB3A 3AJYA 4C0BA 1FOD1 4MGKE 4Y20B 5C5TA 2W08A 2WNUC 1Y9QA 5FZFA 3U78A 5LBEA 4TZDA 4CE8A 4P00B 1DDLA 3ZYPA 3B9CA 1ZRDA 4YYOA 3NNLA 1TNFA 2WO3A 1ULFA 1CX1A 1RUJ3 4FFIA 4L97A 4GB33 4GD4A 1QXJA 4XJUA 3OYWA 4BDVB 1NG0A 1HV1A 5A33A 1S0JA 2YXSA 3MIDA 5FLIA 2D97A 5DZFA 3RG0A 2AYHA 2ILMA 2VVEA 2W0XA 2WZR1 5F1RA 3WQ1A 3U37A 2VH9A 2IC1A 2WNVC 1O3SA 5ANQA 5KC5A 3M70A 5CA6A 1S55A 1WLWA 3O0WA 4Y33A 2Q8CA 4IV3A 4NMIA 2ZXQA 5KHKA 1REDA 5CYYA 4UFJA 1BXHA 4WM8A 2IXCA 2VMFA 3AMNA 4S2DA 4WZFA 3VKMA 4AEDB 1RUH3 1ND2B 3BCWA 4BE3A 4Q8KA 4PDWB 2OZJA 4XABA 1FX5A 1NXD1 3WDTA 3LSEA 5JMCA 3HEIA 4XBLA 4KWKA 4YPJA 3ST7A 4ASLA 3PTRB 4W50A 4BK5A 1QQP1 4CXXA 1YI9A 3A21A 3ROUA 4QU1A 2W1QA 3VBHB 2BGOA 1NCQA 1LRHA 2FBEA 2WR9A 2WUHA 3EHKA 2VAUA 5T5LA 3P6BA 1CAUB 4ES9A 2YMZA 4IGPA 5KXBA 2IUWA 2ZMLA 3AKPA 1JI6A 2ZX1A 1O6UA 1VBD2 1XOYA 1BYHA 2VG9A 3I2IA 1WA4A 4YG0A 1CVNA 4RHV3 3ZXEA 1SFPA 2WT2A 4N53C 2C0ZA 3KQ4B 3WEZA 2GN7A 3AX4A 1Z7S1 5I8YA 1GV9A 4XF4A 5JOXA 1JYIA 1OOPB 1C8NA 2ET7A 1RL3A 3AKSA 1YLLA 1AUYA 3NV2A 5FCCA 3B94A 4E2SA 2C1FA 2Z5WA 4BMEA 3OY8B 2YBPA 1MVEA 1RXGA 1YWKA 1ZA4A 2R042 1UXZA 4ZY9A 3FUOA 4YG3A 4IGOA 1UX7A 4DMIA 4FTBA 1NA1A 5JOZA 4M0NA 5JDBA 1HRV1 3MEPA 1MACA 4YW3A 4EN6B 4L8QA 4LOTA 3LOBA 1CONA 2ES3A 2MPFA 5BNQA 2YROA 5CFCB 3VV1A 2WO1A 5FDBA 1LU1A 4UI9L 1PO22 1W99A 2EXIA 3KV4A 4P5HA 3WQBA 4BYYA 2WFF3 1XJAA 1K12A 1ZBA3 4PI2A 4P9JA 3VDDA 5LBCA 3VBSB 5DQ0A 3AM2A 4S2GA 2R073 2QQVA 1O8SA 4RS5A 2KR2A 4DQAA 2DVAA 3K51A 3R4DB 4QQLA 1UY1A 2QE3A 3DXUA 4WZCA 4URAA 3IZOA 2PLV3 4V2WA 4XOGA 2PXJA 3OSDA 5A7NA 4QXHA 1WW4A 2ID4A 1V6KA 2GNDA 5L7OA 2ZGQA 3ACLA 4Y4RA 1CQ9A 2WYSA 1NLSA 1YQ6A 2BPA2 4JDOA 1O4YA 4FO9A 5KXCA 2ORXA 3T2QA 3ZSLA 5LASA 4AGRA 1WLTA 2Y38A 5AVAA 4PQQA 3CEWA 2ZAAA 2CAVA 4JQRA 1COV1 3SCFA 5SV5A 3RNSA 4AI2A 1W9WA 2A6YA 4IGQA 1D2SA 5A1FA 5EIYB 1ZNPA 2VNRA 3C3VA 1VB4A 1N1SA 1UZYA 4NJ4A 4WVWA 1HDKA 3OUIA 1F8VA 3EB7A 1F4AA 2RE9A 4WBBA 1EY2A 2CNAA 2CGPA 4BA6A 4RHV1 1HRI3 1PK6A 2ZZJA 1UU4A 4RQPB 1OH4A 4JGYA 1DZRA 4AEDC 5EHDA 3J7MA 4XMAA 5F7UA 4NIGA 1ND2C 5D1IA 4B7EA 1QJU1 1R083 4AOCA 5CADA 1FOD2 2LS6A 3U14A 5J96B 2KM2A 4OVEA 2IFRA 4LQRA 1VAMA 1GANA 5FZ9A 4XJAA 3N7LA 3LEGA 1XC6A 3T4VA 3M3QA 1VBB1 3MV01 3VBHC 2NN8A 1GZ9A 3VBFB 2DWRA 1SDWA 4FPYA 4QGLA 4ZKTB 2WNUA 3POJA 3NJXA 1ZRIA 2ZBJA 4P9LA 4XIOA 5L73A 1QNYA 3ALQA 1CR7A 4AAXA 1JZ8A 1CAWB 5APAA 1JYCA 3I8TA 3NV1A 5F3CA 3V56A 4RA0A 2ENRA 4JKLA 3H1MA 1IG0A 4KBBA 4FXKB 3HBZA 2VPVA 3AMQA 3AZYA 2ZGNA 4BQXA 5JAXA 4HMZA 1X33A 4MX3A 5EP9A 2JE8A 5D2AA 5E6HA 2OT7A 5FYVA 2PAMA 2OQ7A 2GC3A 1AR93 1LOCA 4LR4A 2GP5A 2CU5A 3VKFC 2VTFA 4LMFA 5JR2A 2HEVF 2YFUA 1GWLA 3OBAA 1W6MA 4M3CA 4R8HA 2FDFA 1PO11 1V9U1 2WNVA 3IWZA 2X53S 5IVYA 5LBBA 1BHGA 2ZX4A 2WZ8A 4AVTA 1DF0A 5L36A 2GNMA 2R071 5HV4A 3IPVA 1CJDA 3VKLA 5A3MA 5FPXA 1JYWA 2D6PA 3AP7A 1QQP2 1OBNA 2XOMA 4K1YA 4LBJA 4CP9A 4OCTA 2GH8A 4DRRA 2K2SA 2BNNA 1ODMA 2W9XA 2QQNA 3CKHA 3GBWA 2MNGA 4OULA 5A1LA 5FYZA 3PVNA 2DVBA 2VUJA 3DUIA 3MO4A 3MUY1 1W39A 2RS13 2D43A 3N9OA 1RHI3 3RRDA 4GZ9A 1HN0A 1S2EA 1YQ5A 3LIGA 5FPZA 1C5IA 2Y8KA 4NHMA 2J7MA 1VBA2 4XW3A 4Q27A 4AHZA 4E4DX 1VPHA 4UW4A 3OUHA 4YZ5A 2WNEA 2BVVA 4IE0A 3KT4A 3FHAA 2ZKNA 3TN93 5D21A 5T5PA 4GIQA 1XB9A 1Z7S2 2PHTA 4HANA 2VMEA 2KD7A 5K0UB 1J83A 3K77A 4FQ4A 4Y1VA 4CA9A 3L9JT 3MBWA 3LGRA 4N53A 5JSRA 5DUVA 3H1WA 3VBOC 3WZ1A 4IE5A 1RUF1 1IKPA 1U5YA 3J7HA 2GP3A 2JENA 3ZFEC 4YNIA 2QKDA 1JZ7A 1UAIA 4J1WA 2W68A 3EYPA 4Q0PA 1SFNA 3HQXA 5I0UA 3WDVA 4BQ5A 1RUJ2 5KC6A 3UL2A 4CCEA 1K3IA 3OF1A 4MHUA 3TYJA 3WY6A 4GA9A 3PDQA 2JDYA 3J9SA 1VJ2A 1DQ2A 1RUNA 2HWC3 2JDUA 2YPJA 4P14A 1LODA 3KV5A 5GZCA 1H1MA 1DYOA 1OA3A 4R9AA 5FJKA 2BZDA 3O7OA 4CDUC 1H8VA 5DAQA 2GC0A 4AFCA 4AI3A 3QBQA 4QKNA 3POYA 3NKGA 3M2MA 4CCCA 1X50A 3WINE 2EIEA 5A6QA 3AKTA 4XUOA 3RDIA 3FWEA 1DCSA 3FLTA 2JXAA 2ZA9A 1JOPA 4QHOA 1FNYA 3V64A 3BI3A 2ZGTA 2ZGOA 3UKVA 4W6WA 1KEXA 5DXDA 1RUE3 5FP7A 4FPEA 2JG9B 2CDPA 1G86A 1XU2A 3JZVA 1EYBA 2QJVA 4META 1UW8A 3LIHA 1AZDA 3WQ7A 1SLBA 3WNMA 4I3GA 2ZPXA 3WNNA 5KHJA 5HCHA 4HPKB 2R1DA 1AHSA 3WCRA 1COV2 3MUZ1 2Z69A 3H8XA 5HI0A 1VBC1 4BM8A 1X8MA 3NL1A 1REEA 4HL0A 2Y26A 1UY2A 1AL0G 1JH5A 4TSVA 5FUNA 2CV6A 4RHV2 1TVGA 3N3HA 2XVLA 3JCIA 4BQ3A 5C3QA 5FFOC 5GLVA 3S0MA 4LO6B 4CEYB 3TN91 3VBRC 2LM3A 3BU0A 1YI7A 3BUCA 3KCCA 1ND3C 3ZN4A 2A6WA 2O0OA 3NW4A 3V0BB 3LA2A 1SHWB 1WW5A 3LPGA 4AEDA 5BY5A 3UESA 1R1ZA 1ND2A 3ACFA 4JHTA 1I9RA 3OD0A 1J1LA 2VNGA 4EYUA 3WDUA 3GCXA 3K3NA 3RQ0A 4YVWC 2RDQA 4B1MA 4KGGA 4QB1A 4KH9A 1GMMA 4NPLA 1V6IA 4OQ8A 2V73A 2DU1A 3VBHA 2YYOA 4IEYA 4Y1ZA 4CCMA 3WF2A 4LLFA 2JDZA 4GULA 3C7HA 4AI9A 2XHNA 5FQ0A 3GJAA 1QJX3 3B02A 4UBHA 2R7EB 2HWC1 1F4HA 4KBZA 5K0UC 4RR3B 2QQPA 3NNJA 1DQ4A 2GNBA 4M4PA 5J1XA 3KLSA 1V6JA 1YQCA 3HPNA 3AFKA 2E7AA 3IDBB 2WFF2 2WA3A 3UJOA 1PO12 1V9U2 4LO7A 3WCSA 1DQ1A 5K8SA 2DYCA 2ET1A 2R072 2YC0A 3AVRA 1ZZCA 2PHLA 3NO8A 5FZKA 1AR71 5A7SA 1D7PM 3AL5A 4RGAA 5LZ6A 1I5PA 3SLIA 1DHKB 1PMJX 1H0BA 4UW3A 3NRUA 4Q4X1 3I4IA 5EYXA 5DAPA 4EJRA 3I2DA 4MGSA 1MS5A 4RGGA 2BBAA 4JCKA 4EE2A 2EXKA 2EVXA 4GKXA 4BXSV 5FRAA 3G6JB 3JXSA 2XBO3 4L92A 1T2XA 2UU8A 1F5JA 3OYWB 5EFUA 4BZ4A 4CZSA 2HBUA 5F39A 5A33B 4E2GA 3H42B 5FLJA 1JN2P 3U10A 2VJXA 3RYKA 4BISA 1ST8A 3INAA 2VNVA 5LA2A 2W39A 4FPJA 3QACA 3ZX7A 4CU8A 1J3QA 5DUXA 1W2AX 4JGZB 2PHRA 1HRI2 1E5IA 3BTAA 1MS3A 3IDEA 4UFKA 1J3RA 4IV3B 3ZPOA 4AFMA 1R082 4I0BA 3TWIA 5CFDB 4WM8B 5CZKA 3USUB 4NE9A 3K48A 1UIKA 4GWIA 4I30A 3K3OA 4EN0A 2VQUA 3MF6A 1NY71 1HQWA 3JD73 3VBOA 5I93A 1UNBA 4XFBA 3AP6A 1QEXA 2GSYA 2VZOA 1C57A 3ZFEA 1VRH3 3E6DA 1H2LA 3KF5A 4XFFA 2VVDA 2E7TA 3PUHA 2JDNA 4TYSA 3U07A 3VBUB 4IL7A 4UFMA 1SCRA 4BQ1A 2NPIA 1DU3D 4GJZA 1H8TC 2ZX2A 4EV0A 3O1PA 1AYN1 1AR81 2VY0A 1N1TA 4ZXKA 4HSLA 3IIAA 2D3PA 3POWA 1DQ6A 2QQWA 4CEYC 1O4TA 4K3UA 5HBAA 4Q8LA 5DDJ1 2PQSA 1SBDA 1KJRA 1K5MC 1LR5A 4C1XA 1FT9A 1XBFA 5IW0A 5GZEA 4CDUA 2R16A 5C3OA 2O8OA 4RQPA 4L2NA 4XUTA 5B4XA 4OQ9A 3ZXGA 3HT2A 2JB4A 3KD4A 4XQ4A 1UPIA 5IVFA 2RS51 1UO9A 2ATFA 4LTAA 1I1EA 3ZSEA 2XDVA 1UYPA 4CDQC 4RD7A 5JI9A 1YQ8A 3LF7A 4YFZA 4CXYA 4AVBA 4LXLA 1KXGA 5BNPB 4CP1A 2E7QA 3J8F3 3VHOA 3VZLA 3WV6A 1VBC2 2RS12 4NRQA 1NA1B 1A78A 1US2A 4XDOA 4PBOA 4CU7A 1TZOA 2VCAA 2AREA 2D7FA 1JHJA 4RR3C 3H9AA 1AX1A 4CUCA 4BJ0A 2IVJA 5FXWA 3P5BA 1H2MA 3F2ZA 4KWLA 5FP3A 3TN92 2GNTA 3RZLA 1O91A 1YYNA 1DQ5A 4YVSB 2FZ2A 4D6RA 4XQDA 1QMJA 3H7YA 1DGRN 4UBGA 3VDDB 3N36A 4M00A 3BIEA 4RS5B 5FZ1A 3VBRA 3WP5A 2RDRA 3JBG3 4COWA 4E4ZA 1BKZA 2BFUS 1L3JA 2Q8DA 1E57A 2TEPA 1ND3A 1C28A 1LOBA 2JIJA 2YC2A 3EBRA 3ZYRA 3BALA 3MIHA 1N3PA 4J6GA 4KNCA 3JD71 3N35A 1UWWA 4XEZA 5K9YA 2Y0OA 5JXHA 4AL9A 4ASKA 4YVWA 2ZEZA 3AP9A 2HWC2 3S7EA 4C1WA 4YZ1A 3C7FA 3O0VA 3ZXKA 4KWJA 4JGZC 4FPFA 3T08A 1BQPA 1EPWA 2P3YA 1DLCA 3CMGA 3ZN5A 4B3NA 1SLIA 2HKXA 2J1TA 3PIJA 4QX8A 5A3OA 2CL2A 4N9HA 5FMCA 4OI1A 5T54A 1DYKA 3BTYA 2SBAA 1PK6B 5K0UA 1WCQA 3FJSA 4IQPA 4H7LA 4HVOA 3LE0A 4JGYB 5CFDC 2VGDA 2W47A 1GP6A 1B09A 5A7QA 3NV3A 2WNOA 1RB8G 1W9YA 1NQJA 3M3EA 4NN0A 5FYSA 3U4SA 4CDWB 1JODA 2SLIA 4IEQA 4Q4X2 5T55A 4DEVA 1HV0A 5BUVA 1IPSA 4ZONA 3A23A 4CCJA 1RUE2 4LO5B 4PJYA 2QTWB 1JOJA 2OUJA 1QH7A 1W3XA 5DAXA 1S2BA 5T52A 1UU6A 3NJYA 2A3WA 2HWE3 3VZMA 1NX9A 3K75B 2JDHA 5KWRA 3VBUC 2G9GA 2WNUB 3CJIC 3K4AA 4IW3A 1OQDA 3PL0A 5DUUA 2ARBA 5FWEA 4CCOA 3HT1A 4CP0A 3J8F1 5FOJB 3WQ0A 2ZAHA 1DLLA 4FPOB 3OUJA 3T3YA 1POV3 1BBT3 4AEKA 2LROA 3MW3A 3UT0A 4YGCA 1N3QA 1NE4A 3ILRA 1QXRA 3OBZA 3OB8A 4XXPA 5A3NA 1ZZBA 3L2HA 3MI8A 2XL9A 4CPBD 2QQKA 1HQNA 1MS4A 2Q1MA 4PQ9A 1XQNA 1BK1A 1WGPA 2W87A 1UZWA 1GOGA 1SBEA 2WLPA 3HR9A 3NSTA 4JVAA 1W6MB 4M3CB 4R52A 3LZZA 2WNVB 1TEIA 4AQTA 4Q4Y1 1OC1A 1IS3A 1NY72 3SQOA 3IPVB 4FXGB 1A34A 1PZ9A 1HJGA 4MGQA 4Q0QA 5BNPC 4CP9B 3DYMA 4XUNA 1RVF3 4UFIA 4UOJA 2DFBA 3I2GA 1YNAA 5HV0A 3LWCA 3MIGA 3HIFA 2F4LA 4Q1RA 1UCXA 2WSVA 3M1HA 4P9GA 2HYKA 1O7FA 4OI0A 2G9FA 4HN0A 4HPKA 2VM9A 3GNEA 1NZIA 1C4RA 4UT5A 1D2QA 2PAKA 1UY3A 5DDJ2 1AVBA 4YVSC 2HWF1 4FFFA 1GWMA 2ARCA 1H8TA 3LA3A 4XTPA 3RI9A 4CUGA 4HVQA 1JUHA 3M3CA 4YM2A 4YW7A 4CEYA 3SH3A 1EAH1 2RS52 4CU6A 1PO21 3CF6E 3JQXA 1F35A 1OPMA 3K4DA 1OKQA 1K5MA 4LIVA 2HWB3 4COZA 3I7DA 4DO0A 4WVVA 5GJ6A 1STMA 3AYAA 2QDNA 1C8M3 1YJLA 2R49A 1FAYA 1RJ8A 5C8WA 2HH9A 4BMBA 3WF3A 1FMD3 1Q5OA 3GJBA 4WV8A 4QWNA 2P17A 5LBFA 4CDQA 4LBQD 4KMQA 1VE0A 2HWE1 2XBO2 3ILFA 4JV4A 5FY1A 3RMXA 5FPVA 3VGIA 1W6QA 5AC93 4DUWA 1ASJ3 3VD5A 3W20A 2NZ9A 2YB7A 1JYVA 3OTFA 4YARA 3CL1A 3VHPA 3JQWA 2C26A 2G1MA 2VQ0A 4RR3A 3ZOIA 2E26A 3PUQA 4IV1C 1GQHA 3R0RA 4Y5Z0 4HBNA 5JPMB 1FV3A 1JZ3A 3UV9A 5FUPA 3U75A 3IT8A 4CDWC 5JSOA 3IDAA 1PVC3 1ZBE3 5JWPA 1O3QA 1S2KA 3MF9A 5LWBA 2OW4A 1CZTA 2WZEA 2ARXA 2G19A 4ZU5A 3GF6A 3O0XA 3AZVA 4HFSA 4XMIA 1MZ6A 1OLMA 2QBXA 1J1TA 1W06A 3JD72 4LE3A 4Q2FA 4S2HA 4YW4A 5FYCA 2JICA 4AI0A 4I02A 1PZ8A 4W65A 3OBTA 1HB4A 1RVF1 2IXJA 1GNHA 1M06G 1GICA 1VMFA 1AR61 3BTXA 5IVBA 3S6PA 1FNZA 4D3WA 2AZ5A 2YU2A 1W03A 1G9AA 3N7JA 1MQTC 4NO4A 5T50A 4DY5A 3ES1A 1UN1A 5C5UA 4ZZ8A 4F7ZA 1B35B 3Q8CA 2XJTA 2BWCA 4JGZA 4J1XA 4YW6A 4OUSA 2VC9A 1JZ4A 1IS4A 4PLMA 1U0AA 2D6OX 4Y22A 5B2GB 3I59B 4LT5A 3ASIA 2MHFA 1MPXA 3GZTB 5F5IA 4BXFA 5CFDA 1X8EA 4KL1A 3RJRA 3O1TA 4XETA 4CCNA 3LAGA 3USUA 1YHFA 3PU3A 2O8QA 4Q5OA 2H6BA 3DYOA 4XDQA 1JUIA 3THPA 2WS93 4BCUA 2VXJA 1D4VB 4IEPA 2YZ4A 5DPNA 3LDBA 2DCZA 2ZJCA 3J8F2 5GLWA 5HCAA 5JIUA 2VMDA 2VMGA 1CZVA 3MV11 1VAVA 4GMP0 2BP6A 3LSDA 4XZUG 5F5AA 3QH6A 4OFGA 1JW6A 5FQ0B 2PHUA 3VBUA 4MO3M 4I01A 3CJIA 1UQXA 4OUEA 3ITQA 4H7MA 1QOSA 1A3KA 2WJSA 1OMIA 4RL7A 5AFBA 3KHBA 3ORJA 3B93A 1SQ4A 1HN1A 4O9EA 4XUPA 4TWTA 4BPZA 1GWKA 1VBA1 3B00A 3PMEA 5C8CB 3KQRA 1KGYA 1S4CA 2XMLA 3JU9A 2V4AA 4K1ZA 5CG8A 3N9QA 5I8TA 4Q4Y2 5ISLA 3CLPA 4FPCA 5BNOC 1PM4A 4C8DA 2VO5A 4ZS3A 3H7JA 1PVC1 1ZBE1 3UETA 3VD4A 1JS9A 4KU7A 3LEMA 2E63A 1TMF3 1GQGA 4PF1A 5FREA 3LDRA 4LHLA 5C9AB 3TB0A 1RUC3 4QPIC 3I2OA 4A42A 3DEMA 5BNPA 1SACA 1EPZA 3ETQA 1HIXA 2YG0A 4C0HA 5F2WA 1RUJ1 2HWF2 5FIXA 4GB31 3VB9A 1LHVA 3MIEA 3NNGA 2H0BA 1KFXL 1EAH2 2MEV3 4YVSA 2VBPA 4JDNA 4TXWA 5GM0A 4NR1A 2VUDA 4HK9A 4BHPA 5FO7B 4ARXA 2C9KA 2P37A 1ODNA 3T2PA 1HXS3 3FBMA 1IS6A 4QX7A 4COVA 1RUG3 2A3XA 2WABA 1U12A 5JLVA 4ONUA 5HPOA 4XHXA 1ZRCA 4DUVA 1DQ0A 5LATA 2W1SA 2VCCA 3BOPA 3VBOB 1RUD3 1V6OA 2WN2A 5DZGA 1RUH1 1OH3A 2HWE2 3GZAA 4NRPA 1VALA 3RYPA 4CSWA 4AVSA 5FYMA 1IHMA 3ZFEB 4GWNA 3HD8B 1MVQA 3KF3A 3AYDA 2DURA 3WR0A 1XXNA 2HEWF 2Y6JA 3POBA 2GU9A 2VU9A 2FHRA 2B9VA 1W8HA 2X29A 1B35C 3I2HA 1JBCA 3H8OA 4IE4A 3ZSJA 3VKOA 5F3GA 4B8EA 2VXRA 5F37A 2WLQA 1T6GC 3RYRA 5F32A 4CDUB 1YFXA 4MGZE 5F5CA 3WVJA 2EALA 2ADDA 3Q8EA 4IV1A 2JE9A 5CKMA 2VCBA 4FPLA 4X6QB 1LHWA 2P3JA 4Y1YA 2B45X 4GMP3 3WP6A 3IBMA 4MLOA 4CDWA 5J37A 3M4FA 1DGRA 3I3QA 5H9RA 5EJZB 1RVF2 2JDKA 1AR62 2NYYA 2VVFA 4WVMB 3AL6A 2BVBA 5C3SA 4Z92B 1HB1A 2HBTA 4QX5A 4H3WA 4LBMA 3ON7A 2RJKA 5FMOL 5JR7B 1D0GA 2OKXA 4AGGA 1F5FA 1QJY3 3CU7A 5FP9A 5LY1A 5FYIA 1SLAA 1H2NA 5C8CC 3D0JA 4U2AA 3THDA 2QDRA 2XWBB 1NUKA 2FMDA 2W2IA 4Z82A 4AVVA 1ZZ8A 1WMDA 2IXHA 4LEJA 4DZGA 3DPRC 1MQTA 3ZFFC 4CTEA 2VOVA 4M0HA 2VUCA 1SEFA 1FPN3 2JD9A 2DF7A 3MIFA 1CESA 4LHKA 4AFDA 3ZYHA 3POGA 4JTNA 1CN1A 4QMAA 2HWB2 1GP4A 3MPPG 2B5HA 2WFF1 3VBRB 1ZBA1 3S5QA 1QJZA 1T6BX 2EIGA 1PZ7A 1RUG1 1BK0A 3OGSA 2Y0IA 2YC4A 4XUQA 1ND3B 2AH2A 4HKLA 4ZU4A 1WCSA 5C9AC 5LB6A 4AAPA 3AVSA 2P1BA 4QB2A 1W8NA 2C24A 4KWUA 1OF4A 2E53A 1DIWA 3KVAA 5JXIA 1OFSA 2PLV1 3B3QE 4QKDA 3VHNA 1ASJ2 1K42A 3N4MA 2QQMA 3B01A 4YVWB 2DCJA 2BERA 3KV9A 4LUMA 5E1RA 1I6XA 2DCTA 2R6QA 1PHMA 2NMNA 3O12A 4DY3A 1DFQA 5F6KA 1UD1A 1V6MA 4EN7B 4BU2A 1QOOA 3OEAA 5DABA 4NRMA 2IWGB 4L0PA 1MR5A 5A7WA 2HJIA 4LO8A 2DV9A 1PVC2 1ZBE2 2VCMA 4O65A 1HRI1 2Z79A 1LAJA 4DXZA 3PVEA 3OPZA 1Q8PA 1NCRB 4G9SB 3PUSA 4XXAA 5M0TA 4N90A 4GMP1 1R081 5BNOA 4QU2A 3RZHA 5C71A 1PGL1 2XB6C 3MPBA 1SPPA 3C8XA 4RFRB 4XFGA 1PIV3 4L99A 5LA1A 3N9LA 3LEKA 4XZPA 1IQAA 3MICA 4OHWA 3HN3A 1UZVA 2XHKA 1IGOA 2E51A 2XLAA 3QH7A 1Y9MA 3DXTA 4GB32 4K6BA 1E5HA 4FSJA 3ZYBA 4QPIA 1S0GA 5GALA 4FVVA 1HJFA 4XFHA 1QJY1 2ZX0A 2HWD3 1X7NA 5JZGB 3SH4A 1OLQA 5JXGA 1SLCA 2GMMA 4QHBA 4ISQA 1YQ2A 1PVXA 2D40A 2D6MA 2PA7A 2DBNA 3EQEA 1W6NA 1WCUA 2ZMNA 2CGNA 2QNKA 2QZ2A 1FPN1 2JKBA 2BUKA 1DGWX 1RYYA 4JRLA 4V2VA 2WBKA 3PVOA 1AR91 1LCLA 4YGEA 4JAAA 2HYXA 3UNPA 1Y43B 2J1UA 4LHNA 4E8DA 4XAEA 1RUH2 1AL23 2HLEA 2QCSB 4GXLA 1IKQA 3AMMA 5FBZA 2DUPA 1H4HA 2DFCA 3QD6A 4FP2A 3WG3A 1YUDA 1O3RA 3T2TA 4B1LA 2A71A 5L9BA 1MZFA 1W05A 1JZ2A 2DUQA 2BTVC 1XNCA 2PQQA 2NMOA 2YGLA 4FAGA 5T5JA 3K46A 5FAXA 1U5XA 4BOWA 5F9TA 4PT6A 2A6VA 3FC0A 1Q8OA 4R4ZA 5E8AA 2J1RA 4A44A 1WA6X 2RS11 4XFCA 3TNPB 1G8WA 3ACHA 1RHI1 2LTNA 1TG7A 3LFMA 2BEOA 3W58A 3WNXA 4NAMA 4FCAA 4Y5TA 2K0GA 2RS33 5K4LA 3VZOA 1H8TB 4E4SA 3LEIA 3X29B 2W91A 4LOSA 3PJQA 1H9WA 4KU8A 3T09A 1B35A 4GH4C 2FDHA 4BH9A 4E9KA 1HX6A 5CIRA 3BU7A 1K5MB 1YFWA 3I59A 4QM9A 1SDDB 2YUEA 2FDKA 3PU8A 1PNFA 2BW8A 2CYFA 1W8TA 3GHMA 5EJ1B 5JOYA 1MS8A 5IAXA 2BJSA 1QXPA 1SLLA 1W6OA 3KZ4C 2ERFA 4GKYA 2EICA 5FMOS 4CEWB 3F95A 4CDQB 5CAZA 3HAGA 3NV4A 4XQWA 1UYZA 3FN9A 4IEOA 1W6QB 2Y34A 4Q4W3 3FMGA 2IXLA 3WXPA 4ARYA 4NAOA 5JOWA 3I54A 1O5LA 2A70A 2OA2A 2VNOA 3T2OA 3J7LA 1AYM3 2GALA 5C33A 2RM23 1LGCA 2W5FA 2HWD1 3BTZA 1DG6A 2A1XA 3R4SA 5C8CA 1GZWB 3I97A 1MEC3 3FFZA 1PMHX 4HG6B 1W9TA 1CZSA 3H1YA 4GAZA 2OIIA 4D69A 3NJZA 3OEBA 3ACGA 1X36A 1ZBA2 1ENQA 1N3OA 2E31A 1NCRC 3DPRA 3RZJA 1WW7A 2PMWB 3ZFFA 1RUG2 4BIOA 4GQ7A 2OS2A 4QX3A 4Y26A 1MS1A 4QDRA 1QJFA 1GBGA 1RUD2 3BIWE 2PLV2 2RHPA 2VW2A 3KCYA 1LJ7A 3LFIA 4JKKA 1RUE1 2AR6A 2JG8C 3VZKA 1KJLA 4AEJA 5C9AA 3L2YA 4LORA 5GZFA 1N47A 2B8MA 4AF9A 3CBNA 5JZGC 1FXZA 4PBPA 5CISA 3OGGA 2P3KA 3ZM8A 2WDBA 4XAAA 5A32A 1JU4A 3WG2A 4YM3A 3CNAA 1BCXA 3R05A 3MFAA 3D6EA 4NPRA 1ZM1A 4LA2A 4HXCA 1RGSA 1W0NA 5J36A 1FI2A 4QPWA 5CKQA 1QJEA 2RS31 2XLGA 3VD7A 1QNWA 1ULGA 1V6LA 1WMEA 1UMZA 2FZ1A 3ZFGC 4DFSA 4D7SA 4MGIE 4EN8B 4Y22B 4D94A 2G4IA 4V1PA 1MZEA 2EIBA 4Y1UA 4EWEA 5FK7A 2NP0A 1PGL2 1NAEA 1WCKA 3FBYA 1L7RA 3AXDA 5K7PA 2K46A 2JJ6A 4OI4A 3WD5A 3THCA 4QKFA 2XL7A 3I2KA 4D6QA 4I3PA 2AEYA 2WINB 1V70A 1W8ZA 5E16A 1VBE3 2J22A 5H9QA 2Q8EA 2Z2SB 1PGSA 3PMSA 1CX4A 2QQUA 2R1BA 5C4WC 3W5NA 5A3PA 4D7YA 1W6PA 2UWBA 1IZ3A 1UMIA 5ABJB 1QJY2 2ZGSA 4UFHA 4GWMA 3SNMA 3AXEA 4O61A 4QB6A 2GMPA 3CJIB 4MG2A 4LKEA 4QX2A 2VZ1A 5T3NA 3BN6A 2Q5TA 3ZKUA 1D0HA 1KS5A 3GZEA 1KRIA 3A0NA 1QJX1 3ATGA 5IT6A 1EP0A 1Y4WA 2JKXA 2ZZQA 4TTGA 3T1MA 1R1A3 3MLLA 4JKMA 1NOVA 2XGXA 1FPN2 3GDBA 3KGZA 5ACA3 2D44A 1REFA 4FPGA 2BGCA 5FY5A 1F9KA 1AR92 1Y9GA 5KHHA 2WRAA 2GN3A 1GQPA 1W2OA 4XCBA 3PURA 5JI7A 1IPKA 1VLNA 3AK0A 4WM7C 2PHFA 1P8JA 1PX4A 2OQ6A 4ORFA 4P9XA 1POV0 4YFWA 5EJ3A 3LCPA 1C1LA 4AZZA 1ULOA 3T0DA 3V65A 4HLTA 3DF0A 1W0PA 4CU9A 2QZ3A 4Z2WA 2WO2A 2FDIA 4MVTA 3BB6A 3ZMOA 4CEWC 3KHCA 3LB9A 5IVCA 2Y33A 4QPGB 4AYUA 3SISA 3HNBM 5FY8A 1PMIA 3VZNA 4K20A 4WVMA 2BRTA 1A8DA 4D8MA 1RHI2 3SH5A 2VZTA 4AK3A 2Q1ZB 4ES8A 2XBO1 1Z78A 2BOIA 2VTXA 3ECQA 1AJKA 1YO8A 4JDMA 4CUAA 5KHGA 1MS9A 1RJ7A 2EAKA 2FQPA 2WWSA 3DECA 3LOIA 4FFHA 4XIKA 2WWJA 4NIAA 1DGWA 4LO4B 4QQ2A 1UKGA 1LHOA 3PVBB 1ZRRA 2PHDA 1AF9A 1J3PA 2KA3A 4M01A 4L11A 1WLCA 3K2OA 4YZ2A 2J1VA 3WHUA 5FWJA 3MFCA 1XYPA 4A2UA 4GH4A 5EWSA 3PIGA 4CPBA 4AQ6A 4H2AA 2V72A 5FPUA 5FXVA 3WNOA 2J1EA 1RMU3 3H8UA 1PIV2 4D7TA 5EYYA 3WG1A 1YEWA 1R093 4JHZA 1F31A 5E89A 4RN5A 3HOBA 4DXSA 1CJPA 1VR3A 1UPSA 2VZQA 2JX9A 5FZOA 4DINB 1VBD3 5IHRA 2VW1A 3LD8A 2F4PA 4OHVA 3O1UA 1AX2A 1ZVFA 4A45A 1VRH1 2OPKA 3RFRA 5A1AA 2HWD2 5GLTA 4D0QA 1GOHA 5E88A 4COYA 4BQWA 3AP5A 1UOGA 4AQSA 5BNNC 5C70A 3OJBA 2GZWA 1LU2A 3HVDA 1D4M3 3WX5A 3MW2A 3O14A 4XBQA 3MLJA 4P5YA 1CGPA 1KS4A 4IV1B 4AHYA 1RXFA 3NMBA 2NQYA 2QQJA 1A8MA 1SLTA 3FL7A 1AL22 3OPWA 1C3HA 1OVSA 3N9NA 1UXXX 4NPMA 1ZZ6A 4EZHA 1NCRA 1XSRA 4PLNA 4YZ4A 5I91A 1ZX5A 3ZXLA 2ZX3A 5BYNA 2QVSB 1VIWB 1W3VA 2ZGUA 5FZEA 4UW6A 3H0OA 1Q8VA 4XILA 1F2NA 5ABJC 3BKZA 3O5SA 2BDRA 4HT1T 2Q1FA 3D5OA 4HK8A 2AEZA 4FOQA 4Y4YA 5CBLA 1ULEA 4QQPA 2B7YA 4XFAA 2JG8A 3IIIA 3VN4A 4LBQA 3R6SA 3ZO0B 5JIAA 4A7YA 5DAVA 2A75A 2RS32 5JZGA 4EZ4A 1CWPA 2XWJB 1W9FA 3BPZA 1OKOA 3A0KA 1ALYA 1H1IA 4QXCA 3I49A 1MQTB 4QAWA 3E6BA 1XE8A 3AC0A 2X5IB 4L9BA 1ULPA 2NM1A 4SBVA 1JZ5A 4YRDA 2ZHLA 4R9BA 3RGBA 1AXKA 1RTVA 2X8KA 3IMNA 4N7UA 4C91A 5FZIA 3SEPA 3ZFGA 1G9CA 3WP4A 1S0EA 5C3RA 2BU9A 1LOEA 2D5FA 4LKDA 4UAPA 2EXJA 4QPGC 4XHBA 1JTZX 3JBG1 4NIDA 2OVUA 1RMU1 5IAVA 2W46A 2VMHA 5GKAC 2ZEWA 1LEDA 1JYTA 5H9PA 3ZYIB 3RZKA 4JQTA 1SBFA 2ZGKA 4NHKA 4ZHNA 3O1OA 2A73B 4Q4W2 4NIHA 3U1XA 1QGLA 1R091 1FV2A 1OFNA 4S2FA 4A3XA 3EJKA 5BV6A 5HCBA 4FTSA 2WA4A 5C4WA 2D6NA 1BLZA 4Y1XA 1QJX2 4MUVA 1M4WA 1OPOA 1TME3 3I3BA 1DZQA 5FPAA 1MEC2 4XF0A 2VBBA 3C7EA 3URFA 2JDAA 1FOD3 1IPJA 2CDOA 3AYEA 2B9UA 2RR13 4K8FA 4YG6A 1VB2A 2BNOA 4HOOA 2DVFA 2W52A 2OYZA 5A7WB 4OHZA 3WF1A 2IVIB 3AJZA 2JECA 1DP0A 4FT8A 5J3UA 4F83A 2J42A 2ZTNA 3O1SA 4WM7A 2N7GA 4AR2A 1HKDA 2JB8A 5BNOB 2CHHA 2ZGLA 4JRAA 3I3DA 3CZUA 4RYDA 1SPPB 3BYWA 3ABZA 3W9AA 3QLQA 3IM0A 4CDXC 3GHNA 5LEJA 4BLIA 1LHUA 1HW5A 1LENA 3B5LB 2WZR3 3N7KA 5FP4A 2VR4A 4CEWA 1QH6A 1DGLA 2GDFA 3CZJA 2JWPA 1OHFA 1UZZA 4LK6A 4QPIB 4ATFA 1SCSA 2WQ4A 4CCDA 5CG9A 2TBVA 3NAPC 4PLOA 4QGMA 5IFPA 1XU1A 3LA7A 3PUAA 1Z0HA 3AZXA 2QUOA
chains in the Genus database with same CATH topology
4BWOA 1WW6A 4RFT0 1I5ZA 1POV1 1BBT1 2GH2A 1W6NB 1GZWA 4M3CE 4PIZA 4SLIA 5CVRA 2BYVE 3ZN6B 1XNBA 3PLQA 5H9SA 1QU0A 1BJQA 1H30A 4IEWA 5J98B 2O1QA 5LK5A 3WOGA 2XG3A 1Q3EA 3RJ2X 1OQEA 3GALA 3CJXA 4YM1A 2ZABA 2R0FA 4Q26A 1WMFA 1VRH2 2YGMA 5AVPA 3NWKA 4LBNA 4MSVA 4QXKA 2D6KA 4KG0A 2EF6A 1BVVA 5I0RA 1Z7S3 2EAAA 1CAXB 4KQ7A 4JTOA 1QY4A 5AFEA 1YCIA 2X5IC 4EWAA 1R1A2 2XKOA 5ACA2 3GZUC 1GFF2 1GSLA 5BNNA 1UIJA 2RR11 3DGTA 4HSJA 3P3NA 4QQOA 1OQ1A 2XPJA 5GLUA 4MXWB 1HRV3 4UW5A 3AP4A 2XJRA 2HWB1 4P9WA 1WD3A 3AZZA 2F6BA 3TBDA 2PAEA 1ULCA 1C8M1 1YJKA 1W6OB 3AZWA 4YW2A 1FMD1 5BPXA 5CNAA 2PN5A 4EN9B 4FOYA 1J59A 1KQRA 3FZ3A 5LEKA 5ABJA 4AI8A 5AC91 4MGYE 1ASJ1 1OA2A 1KDKA 2OUHA 3FHIB 3OD4A 1Q56A 3FFQA 1LKNA 2D93A 2R063 3WDYA 2HEYF 1HLCA 3ELNA 4IETA 3R4UA 3DN7A 2GC1A 1XYNA 3DPRB 3ZFFB 3C2UA 2R32A 3E5XA 4F8AA 3JBG2 3MYXA 1RMU2 3DV8A 4NOTA 5D8AC 4FQZA 3WDWA 4KGQA 2VMIA 1LGBA 2DTWA 1COV3 4H14A 4LBOA 1R092 2AENA 1YFYA 4QPGA 5FO8B 4XFIA 1S0BA 3WP3A 4LNVA 2A5ZA 2B39A 4I2OA 1FATA 2UWAA 2EA7A 5A32B 3SITA 3WG4A 2AUYA 1QHDA 1QJU3 5FLHA 4FPHA 2E6VA 2UY9A 3PTYA 3RWNA 1G9FA 1D4M2 1VBB3 3FUQA 2ZGMA 2IFWA 4MH0E 2CAUA 2XJVA 2CY6A 4FPKA 4R9DA 2XLFA 4DNYA 1BMV1 1OI6A 3E97A 2DUOA 5T5OA 5JCTA 2AGSA 3RZZA 2WS91 4ISRA 1W6PB 4OLLA 4OZXA 1V6NA 4CDXA 4MYEA 2YY1A 2FMYA 3ZXAC 1BBT2 1PO13 1V9U3 4Y24A 3E6CC 2A6ZA 3UK9A 3ZVXA 3D8CA 2ZHKA 3NAPA 3NVCA 3UJQA 2VULA 3W59A 3D0SA 2PHWA 4LBKA 2R061 2D6LX 3HN1A 2XVGA 1G9DA 1PGW2 2WT1A 1O4ZA 2I2SA 1TNRA 2WSUA 1W2UA 2ZGPA 4FAHA 4HN1A 1GZCA 4U36A 3ES4A 3TOJA 5EZWA 3ZDSA 1TMF1 1AXZA 4IERA 1KITA 1CPMA 5TSWA 1DYPA 1U5ZA 1VP6A 1J58A 1A6CA 1RUC1 1YRZA 3AFGA 4BIFA 1S0FA 2ZOEB 1WCDJ 2PYTA 1YXWA 4B4RA 3MW4A 1TME2 1H4GA 3MGUA 5GZGA 1RUF3 3KM5A 4P9YA 3ILNA 4PDWC 3USSA 4Q4V3 2VUAA 2RR12 1BVP1 3KS7A 1NQDA 1AXYA 2X5IA 3SXWA 1APNA 3U0ZA 2MEV1 3WDXA 2CWSA 4GH4B 1TQ5A 1H2KA 3KT7A 4BLJA 2TUNA 1C8M2 1HXS1 1C5HA 3WW1A 4PIYA 1NLRA 1FMD2 1OLRA 4URTA 1TE1B 5IK5A 4XF9A 4B7KA 1RUD1 2VOWA 2WZR2 3KMHA 2BBVA 3HMYA 5AC92 4R4XA 1FYUA 1V00A 1Q8QA 1OOPC 2Q30A 3PHMA 3POSA 4YM0A 4YGBA 4W6YA 5DG1A 4YW5A 3SCHA 3VL8A 3IDCB 2XH6A 3MIBA 4ASMB 2H0VA 4E2QA 3P3PA 3ZXFA 4LUKA 4AQ2A 3D82A 2V5YA 1LEMA 2TNFA 2PHXA 3JB8A 1ENXA 2XJQA 3M7AA 1WBLA 1LULA 2Q0AA 3H3UA 5IK4A 1QDOA 4K21A 1XYOA 1VBC3 5CFCC 3AB0A 5C6CA 1CAVB 3RS6A 5D8AA 4HVRA 1DBNA 4YSFA 2B46X 5IUQA 2KXLA 2GMEA 1VAKA 2ZACA 1RUI3 3RI8A 1JHNA 2JG8B 1ZZ9A 1IS5A 4LBQB 3VBSC 1BEV3 4B29A 5BXXA 3ME2A 1YIPA 2D3SA 4R9CA 1ZREA 4XBNA 4LLOA 2A7AA 3ENRA 1QKQA 4Q4V1 1S1AA 1MZ5A 4XJ8A 1RIRA 3GYDA 1ULDA 3ZN6A 3ZFGB 1WUVA 4Z8BA 1NYWA 1HRV2 3QCWA 2UYAA 1BMV2 2DCYA 5FO9B 2WS92 5IK7A 3MDPA 2WQZC 5IK8A 2P3IA 2CWMA 2WC2A 4RQPC 5C4WB 3OGJA 4XPVA 3J26N 3VL9A 4XF1A 4G4FA 3ZYJB 1CAXA 2VECA 2R062 1AR73 2I45A 3AMPA 2UYBA 2ZGRA 4RSUA 4NVPA 4Q4X3 4N43B 3OCPA 2JE7A 3VBFC 2WT0A 5EXOA 4C90A 4Y20A 4N9IA 2PFWA 4CYDA 4GALA 1XE7A 2XJSA 1UL9A 1OD5A 4WM7B 4MXWA 1TMF2 4IEVA 2P2KA 1QDCA 1OSGA 2VOXA 1RUC2 1RUOA 4MZUA 3WW2A 1PIV1 3V0AB 1UX6A 3GBGA 4QGNA 4IEZA 1RUI1 4MXVA 1QJU2 1KFUL 4G3YC 1O3TA 1BEV1 2OZ6A 1LOGA 4EWDA 2Q4SA 3DKWA 4HKWA 2IZWA 4KG8A 4X8NA 1N1VA 1VBB2 2MEV2 3PJYA 3RPQA 1OA4A 2XJUA 1H1AA 2CTVA 2DVGA 4PDWA 4Q1PA 5DG2A 2BFUL 2I74A 3MZHA 1HXS2 5KBFA 4XJ9A 1WBFA 4AXOA 2V09A 1AYN3 1AR83 1AL21 1XRUA 5GLZA 1WLDA 4Q0UA 5J09A 1CAUA 3IN9A 4YGDA 2E9QA 2RMU3 1G6NA 4IESA 3EO6A 4DOUA 5DDJ3 3WUCA 2BWAA 2XUMA 2ZS6B 4AG4A 5A3LA 4Z1VA 1EV13 3ZMNA 2RS53 5LK7B 3VLBB 1OOPA 1UU5A 4N7IA 4INDA 5FTTC 4FBFA 5SV8A 1QWRA 3BOWA 3TRSB 4AFBA 3THTA 1LECA 1ENSA 2WL1A 3D4KA 5BNNB 2YV8A 1CPNA 1AX0A 3OY8A 3CO2A 4NHLA 4COUA 1RITA 1LGNA 1KD7A 4AVCA 5HXVA 3ZXDA 3T1LA 2C9AA 1LHNA 4X6RB 1LTEA 1G9BA 3A4UA 5CFCA 4DS0A 3UKNA 3KCXA 4B4QA 1GYKA 1BZWA 4XYXA 4DRVA 4ZU7A 4Q4W1 1C1FA 1JXNA 1NZCA 1RC6A 1RUF2 1SMVA 3ZXJA 2ETEA 4OHYA 1AYM1 2DTYA 2NLRA 4Q4V2 4N43C 2RM21 3VBSA 4E27A 4UXAA 2ZCWA 2JG9C 4YZ3A 4YLZA 1MEC1 4K9SA 2DCKA 1I3HA 2R0HA 1YFUA 1UKRA 1G7YA 1NCQB 1PM7A 5I8SA 3PNAA 4HETA 5F6LB 1KDMA 3BODA 3S7IA 1WD4A 4NWWA 4XF3A 3EXUA 4I0WB 4ITCA 2RMU1 2ZKLA 1LOFC 3VKNA 1U5IA 1H9PA 2GAUA 5KHIA 4XJZA 1GR3A 5DUWA 2VQAA 3KSCA 2VOKA 2WIIB 4AEMA 2RJLA 3B9IA 1EV11 4PCRA 2D3RA 4AI1A 3KGLA 4F3JA 1MS0A 1Y3TA 3FLPA 4CP2A 5HCFA 3JB4C 2H6CA 4I09A 2I07B 1QOTA 5CU1A 3FX3A 4X8PA 2B42B 4OUMA 3SHRA 3VBFA 3ZYGA 4ATEA 5JPNB 4QM8A 2UY8A 2CGOA 3OBRA 1CAWA 2Q8OA 2LALA 2A3YA 4OHXA 4AWDA 2PTMA 5LRRA 4WVZA 1VBE1 4K40A 3UKTA 1RUI2 2R30A 4CDXB 4AVAA 4AFAA 1BEV2 2XJPA 3M8LA 3MLKA 3AYCA 4I0AA 4Q4Y3 1DZTA 3NAPB 3RMYA 4HKOA 2C5DA 4EROA 1GNZA 2IXKA 3KT1A 3WHTA 5I0SA 1R1A1 1Q8SA 4QQHA 5ACA1 1GKBA 3WW4A 5L7OB 2R043 3SCGA 5JVVA 2UWCA 1LB2A 3ZSKA 1S0CA 1ZRFA 1CAVA 3NKTA 2HWF3 3KB5A 3WW3A 5CB7A 1NE6A 4PIXA 4M3CF 2K9ZA 1S0IA 5DZEA 4IV3C 3H50A 1EAH3 1IOAA 4XJWA 1PO23 4IEUA 3U4XA 4Z07A 4WM8C 1AR72 1GLHA 1Q43A 2PELA 3Q9OA 4H55A 4DB5A 3JUUA 1PNGA 3B69A 3TAYA 1S0DA 1ZYBA 3APBA 3IKWA 2UURA 5J7MA 2JD4A 2A6XA 4AGVA 3ZIWA 1RINA 4A7KA 1NCQC 5LRSA 3M3IA 4W6XA 3VHRA 4P9IA 1CIWA 3RSJA 5I0TA 1Y7BA 4AE2A 4PF5A 3AMHA 4AHXA 2QFEA 2VW0A 1ONAA 1CD3G 4NWVA 3WUDA 2ZMKA 3SMHA 3E5QA 4YW1A 2GC2A 2P34A 4HZFA 4LULA 1VBD1 5F5QA 1AYM2 3FLRA 3J4UH 2RM22 5GZDA 1XNKA 4FOWA 1HQLA 2BNMA 1N1YA 4XE9A 2ZHNA 3GBFA 3LKJA 5KXDA 3N7MA 4N43A 4XTMA 1D4M1 1NA1C 2JG9A 4IXLA 1AR63 5FOBB 4A7ZA 2R041 3U11A 1AYN2 1AR82 3WT3A 1LESA 5D8AB 3S30A 5L19A 2RMU2 4CRQA 2IXIA 4Q0VA 1X82A 3V0AA 3QOPA 4QPYA 4AHWA 2DU0A 3VDDC 2WFPA 1EV12 4IEXA 4RS5C 4TLFA 1LOFA 4QD2A 2WKKA 3VZJA 5JSPA 1XNDA 4N53B 3ZSMA 2JEMA 1QF3A 4FOVA 5EV7A 1AJOA 4LBLA 3V0BA 1LOAA 3B7MA 3WLUA 5L7OC 3E5UA 3ZPYA 2WZPP 1SFYA 1QQP3 4FTEA 4B4PA 5KXEA 4MV2A 1ZZ7A 3AKQA 4O9GA 1NXMA 4QT6A 2Z42A 1PGW1 1ENRA 2D98A 1O5UA 1VBE2 1W0OA 4AW7A 5J48A 2YHJA 3HWJA 1VBA3 4LE4A 4OI2A 1PK6C 4Q0SA 2LUWA 3G7DA 3M3OA 4JGYC 4JC1A 3ZIXA 3TNQA 2XVKA 3DL3A 2XKPA 2YDEA 2ZHMA 2DVDA 1YIFA 3AKRA 3FE5A 4DPNA 4LA3A 1UF2C 1TME1 1URXA 2D5HA 2BQPA 4K7JA 4Q29A 2EXHA 3H3ZA 4FP3A 4C0BA 3AJYA 1FOD1 4MGKE 4Y20B 4TZDA 2W08A 2WNUC 1Y9QA 1DDLA 3ZYPA 3B9CA 1ZRDA 4YYOA 1TNFA 1ULFA 1RUJ3 4XJUA 4L97A 4GB33 1QXJA 3OYWA 1NG0A 1HV1A 5A33A 1S0JA 2YXSA 3MIDA 5FLIA 2D97A 5DZFA 3RG0A 2AYHA 2ILMA 2VVEA 2W0XA 2WZR1 5F1RA 3WQ1A 2VH9A 2IC1A 2WNVC 1O3SA 5KC5A 3M70A 5CA6A 1S55A 1WLWA 3O0WA 4IV3A 5KHKA 1REDA 1BXHA 4WM8A 2IXCA 4S2DA 3AMNA 4WZFA 3VKMA 4AEDB 1RUH3 1ND2B 3BCWA 4BE3A 4Q8KA 4PDWB 2OZJA 1FX5A 1NXD1 3WDTA 3LSEA 5JMCA 4XBLA 4KWKA 3ST7A 4ASLA 1QQP1 1YI9A 3ROUA 3VBHB 1NCQA 1LRHA 2FBEA 3EHKA 5T5LA 1CAUB 4ES9A 2YMZA 5KXBA 2ZMLA 3AKPA 2ZX1A 1VBD2 1BYHA 2VG9A 4YG0A 1WA4A 1CVNA 4RHV3 3ZXEA 2WT2A 4N53C 2C0ZA 2GN7A 3AX4A 1Z7S1 5I8YA 1GV9A 4XF4A 5JOXA 1JYIA 1OOPB 1C8NA 2ET7A 1RL3A 3AKSA 1YLLA 1AUYA 3NV2A 5FCCA 3B94A 4E2SA 2C1FA 2Z5WA 4BMEA 3OY8B 1MVEA 1YWKA 1ZA4A 2R042 3FUOA 4YG3A 4DMIA 4FTBA 1NA1A 5JOZA 4M0NA 5JDBA 1HRV1 3MEPA 1MACA 4YW3A 4EN6B 4L8QA 3LOBA 1CONA 2ES3A 2MPFA 5BNQA 2YROA 5CFCB 3VV1A 5FDBA 1LU1A 1PO22 2EXIA 4P5HA 4BYYA 2WFF3 1ZBA3 4P9JA 3VDDA 3VBSB 3AM2A 4S2GA 2R073 4RS5A 4DQAA 2DVAA 3K51A 3R4DB 4QQLA 2QE3A 4WZCA 2PLV3 4XOGA 1WW4A 1V6KA 2GNDA 5L7OA 2ZGQA 3ACLA 1CQ9A 1NLSA 2BPA2 4JDOA 1O4YA 4FO9A 5KXCA 4AGRA 3ZSLA 1WLTA 2Y38A 5AVAA 3CEWA 2ZAAA 2CAVA 4JQRA 1COV1 3SCFA 5SV5A 3RNSA 4AI2A 2A6YA 1D2SA 1ZNPA 2VNRA 3C3VA 1VB4A 1N1SA 1UZYA 4WVWA 1HDKA 1F8VA 2RE9A 4WBBA 1EY2A 2CNAA 2CGPA 4BA6A 4RHV1 1HRI3 1PK6A 2ZZJA 1UU4A 4RQPB 4JGYA 1DZRA 4AEDC 4XMAA 1ND2C 5D1IA 4B7EA 1QJU1 1R083 5CADA 1FOD2 5J96B 2KM2A 4OVEA 2IFRA 1VAMA 1GANA 4XJAA 3N7LA 3M3QA 1VBB1 3VBHC 2NN8A 1GZ9A 3VBFB 2DWRA 1SDWA 4FPYA 4QGLA 4ZKTB 2WNUA 2ZBJA 4P9LA 4XIOA 5L73A 1QNYA 3ALQA 1CR7A 1CAWB 1JYCA 3I8TA 3NV1A 3V56A 4RA0A 2ENRA 3H1MA 4KBBA 4FXKB 3HBZA 2VPVA 3AMQA 3AZYA 2ZGNA 5JAXA 4HMZA 1X33A 4MX3A 2PAMA 2GC3A 1AR93 1LOCA 4LR4A 3VKFC 2HEVF 4R8HA 1W6MA 4M3CA 1PO11 1V9U1 2WNVA 3IWZA 2X53S 2ZX4A 4AVTA 5L36A 1DF0A 2GNMA 2R071 3IPVA 1CJDA 3VKLA 5A3MA 5FPXA 2D6PA 3AP7A 1QQP2 4K1YA 4LBJA 2GH8A 4DRRA 2K2SA 2BNNA 3GBWA 2MNGA 4OULA 3PVNA 2DVBA 2VUJA 3DUIA 1W39A 2RS13 2D43A 3RRDA 1RHI3 5FPZA 1C5IA 4NHMA 1VBA2 4XW3A 4Q27A 4E4DX 4UW4A 4YZ5A 2WNEA 2BVVA 3KT4A 2ZKNA 3TN93 5T5PA 4GIQA 2PHTA 1Z7S2 4HANA 5K0UB 4FQ4A 4Y1VA 3L9JT 3LGRA 4N53A 5JSRA 5DUVA 3H1WA 3VBOC 3WZ1A 1RUF1 1IKPA 1U5YA 2JENA 3ZFEC 4YNIA 2QKDA 1UAIA 4J1WA 2W68A 3WDVA 4Q0PA 1SFNA 3HQXA 5I0UA 1RUJ2 5KC6A 3UL2A 3OF1A 3TYJA 3WY6A 4GA9A 3J9SA 1VJ2A 1DQ2A 1RUNA 2HWC3 2YPJA 4P14A 1LODA 5GZCA 1H1MA 1OA3A 4R9AA 3O7OA 4CDUC 1H8VA 4AI3A 2GC0A 4AFCA 3QBQA 3POYA 3NKGA 3M2MA 1X50A 3WINE 3AKTA 3RDIA 3FWEA 3FLTA 2JXAA 2ZA9A 1FNYA 3V64A 2ZGTA 2ZGOA 3UKVA 4W6WA 5DXDA 1RUE3 4FPEA 2JG9B 1G86A 1XU2A 3JZVA 1EYBA 2QJVA 4META 1UW8A 1AZDA 3WQ7A 1SLBA 5KHJA 4I3GA 2ZPXA 4HPKB 2R1DA 1AHSA 3WCRA 1COV2 2Z69A 5HI0A 1VBC1 4BM8A 1X8MA 3NL1A 1REEA 4HL0A 2Y26A 1AL0G 1JH5A 4TSVA 2CV6A 4RHV2 3N3HA 2XVLA 3JCIA 5FFOC 5GLVA 3S0MA 4LO6B 4CEYB 3TN91 3VBRC 2LM3A 1YI7A 3KCCA 1ND3C 3ZN4A 2A6WA 2O0OA 3NW4A 3V0BB 3LA2A 1WW5A 4AEDA 5BY5A 1R1ZA 1ND2A 1I9RA 3OD0A 1J1LA 2VNGA 3WDUA 3RQ0A 4YVWC 4KGGA 4KH9A 1V6IA 2V73A 2DU1A 3VBHA 2YYOA 4IEYA 4Y1ZA 4LLFA 2JDZA 4GULA 5FQ0A 1QJX3 3B02A 4UBHA 2HWC1 5K0UC 4RR3B 2QQPA 1DQ4A 2GNBA 3KLSA 1V6JA 3AFKA 2E7AA 3IDBB 2WFF2 2WA3A 3UJOA 1PO12 1V9U2 4LO7A 3WCSA 1DQ1A 5K8SA 2DYCA 2ET1A 2R072 2YC0A 1ZZCA 2PHLA 3NO8A 1AR71 4RGAA 3SLIA 1DHKB 1H0BA 4UW3A 4Q4X1 3I4IA 5EYXA 4EJRA 3I2DA 1MS5A 4RGGA 4JCKA 2EXKA 2EVXA 4GKXA 5FRAA 3G6JB 2XBO3 4L92A 2UU8A 1F5JA 3OYWB 5EFUA 4BZ4A 4CZSA 5A33B 4E2GA 5FLJA 1JN2P 3U10A 3RYKA 3INAA 2W39A 4FPJA 3QACA 3ZX7A 1J3QA 5DUXA 4JGZB 2PHRA 1HRI2 3BTAA 1MS3A 3IDEA 1J3RA 4IV3B 4AFMA 1R082 4I0BA 3TWIA 5CFDB 4WM8B 3USUB 3K48A 1UIKA 4I30A 4EN0A 3MF6A 1NY71 1HQWA 3JD73 3VBOA 5I93A 4XFBA 3AP6A 2GSYA 1C57A 3ZFEA 1VRH3 3E6DA 1H2LA 4XFFA 2VVDA 2E7TA 3U07A 3VBUB 4TYSA 4IL7A 1SCRA 4BQ1A 2NPIA 1DU3D 1H8TC 2ZX2A 4EV0A 1AYN1 1AR81 2VY0A 1N1TA 4ZXKA 4HSLA 3IIAA 2D3PA 3POWA 1DQ6A 4CEYC 1O4TA 4K3UA 5HBAA 4Q8LA 5DDJ1 1SBDA 1KJRA 1K5MC 1LR5A 4C1XA 1FT9A 5GZEA 4CDUA 2R16A 2O8OA 4RQPA 4L2NA 3ZXGA 3HT2A 3KD4A 4XQ4A 1UPIA 2RS51 2ATFA 4LTAA 1I1EA 3ZSEA 4CDQC 4RD7A 5JI9A 4YFZA 4AVBA 1KXGA 5BNPB 4CP1A 2E7QA 3J8F3 3VHOA 3VZLA 3WV6A 1VBC2 2RS12 1NA1B 1A78A 4PBOA 4RR3C 2AREA 2D7FA 3H9AA 1AX1A 4KWLA 1H2MA 3TN92 2GNTA 1O91A 1YYNA 1DQ5A 4YVSB 2FZ2A 4XQDA 1QMJA 3H7YA 1DGRN 4UBGA 3VDDB 3N36A 4M00A 4RS5B 3VBRA 3WP5A 4COWA 3JBG3 4E4ZA 1BKZA 2BFUS