3BTZA

Crystal structure of human abh2 cross-linked to dsdna
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
202
structure length
202
Chain Sequence
WRHIRAEGLDSSYTVLFGKAEADEIFQELEKEVEYFTGALARVQVFGKWHSVPRKQATYGDAGLTYTFSGLTLSPKPWIPVLERIRDHVSGVTGQTFNFVLINRYKDGSDHIGEHRDDCRELAPGSPIASVSFGASRDFVFRHKDSRGKSPSRRVAVVRLPLAHGSLLMMNHPTNTHWYHSLPVRKKVLAPRVNLTFRKILL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/dna
molecule keywords Alpha-ketoglutarate-dependent dioxygenase alkB homolog 2
publication title Crystal structures of DNA/RNA repair enzymes AlkB and ABH2 bound to dsDNA.
pubmed doi rcsb
source organism Homo sapiens
total genus 51
structure length 202
sequence length 202
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2007-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13532 2OG-FeII_Oxy_2 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 3btzA00
3O1MA 3T4HB 4CXYA 3BI3A 4IE7A 3LFMA 3BTZA 4NRMA 4IE5A 4CXWA 3H8RA 3KHBA 4MG2A 3O1SA 3T4VA 4MGTA 4NIHA 3O1PA 4IE6A 3I3MA 3RZKA 2FDIA 4NPMA 4O61A 4NIIA 4QKFA 2FDJA 4NJ4A 3T3YA 4NROA 3H8XA 3BUCA 3O1VA 3BKZA 4NIDA 4NPLA 2FDFA 3BTXA 3S57A 4IDZA 4OCTA 3I2OA 3RZMA 3BTYA 4ZS2A 2FDKA 3O1RA 3KHCA 2FD8A 4QKBA 3I49A 4NRQA 4QKNA 4RFRB 2FDGA 3S5AA 4JHTA 3I3QA 4QHOA 3RZJA 3H8OA 4CXXA 4ZHNA 5F8PA 4IE0A 3RZLA 4O7XA 3RZGA 3O1OA 4ZS3A 3O1UA 4IE4A 2FDHA 3BIEA 2IUWA 4QKDA 4NIGA 4NRPA 3O1TA 3RZHA 3BU0A 5DABA
chains in the Genus database with same CATH superfamily
1PMJX 4FSJA 3T4HB 4BLJA 4E4ZA 2XUEA 1MEC2 3KZ4C 2XJTA 5A3TA 1SLLA 1QMJA 5I0TA 5JOYA 2D43A 4LITA 3LF7A 2C0ZA 1CESA 4XFAA 4DXSA 1B35C 1HB2A 1AR92 4QQOA 5FYUA 1J3RA 1AR63 4UXAA 5CEHA 4N9IA 4CPBA 1FOD2 1CVNA 1ZZCA 2HYXA 2VNVA 2CYFA 1S0JA 1W2UA 2W3JA 2YC2A 4CCKA 2GN3A 2LTNA 2YYOA 1QJU2 2JG8A 5DAVA 3SXWA 4A41A 1S0FA 1Z7S1 4ATEA 2UWCA 3Q8EA 3NO8A 2I45A 2B46X 3HQXA 3KM5A 2W91A 4XBNA 2Y64A 1PO21 5FZOB 3LD8A 4AWDA 2VGDA 3P3NA 1VAVA 4AI9A 5FR3A 3UV9A 1HX6A 2R061 1AL22 1SCSA 1TME3 4Q0VA 3PU8A 1ZA4A 1BKZA 1N3OA 2QBXA 1LEDA 1P8JA 2W1SA 1K5MA 4BQWA 4IGPA 1TVGA 2DDUA 1ZZBA 1OA3A 2KD7A 5A3WA 3ZR5A 1AYM2 3SHRA 1T2XA 1UKGA 1VRH2 1RUF1 2Q0AA 1C8M3 4HPKB 2IFWA 1RUI3 3JB8A 2R041 3AZVA 1FX5A 1PVC3 4WZCA 4YZ1A 4LO4B 5BPXA 4R4XA 2ES3A 1YFYA 2P1BA 2HEWF 4DXRA 4TN7A 5J1XA 3OYWA 2OKXA 3NVCA 4PDWB 4L11A 2RS53 1UIJA 4OULA 1OFSA 2W87A 1VJ2A 3ZYGA 3I3QA 4UW3A 2HEYF 3AFKA 4XUPA 5AC92 1O4TA 5FLIA 2ZHLA 4BQ3A 2BBVA 2PFWA 2YMZA 4GZ9A 5C4WC 2X53S 1PZ9A 2ZA9A 1NQJA 1MR5A 2BGCA 3DV8A 5B2GB 1V9U1 1DU3D 3PVNA 1VMHA 1G7YA 4O7XA 5APAA 1AJOA 3TEZA 5DDJ1 4BZ4A 3K77A 5FREA 1LHNA 1NX9A 2VVFA 5IUQA 4QU1A 4XCBA 3TEXA 5CFCA 1DIWA 5A3PA 4OUMA 2XBO3 1EAH2 1OQEA 1W8OA 4QX8A 4ISQA 4CP2A 3ACIA 1AUYA 3WF4A 4QPGA 1J59A 4MXWB 5F3GA 2V73A 4NO4A 1PGL2 4ASLA 3F95A 1V6IA 1ZZ7A 4KWJA 1ODNA 1W0NA 4Y5Z0 3H1YA 3H1MA 1A6CA 2CY6A 3VBOA 2YV8A 1JZ5A 3D4KA 2O8OA 5FYSA 1LOAA 2BFUL 3F2ZA 4M01A 3GBWA 1S4CA 3HT2A 5CISA 1A8DA 1JH5A 3TEWA 1V00A 3ZIWA 3GF6A 4NRMA 2A75A 2ZHKA 4IE5A 4AFAA 3WG2A 3NJZA 3DN7A 3TB0A 3WF2A 2HWB2 2GU9A 5FV3A 4EWEA 3WINE 4Z2WA 5J36A 5C8WA 2ZGLA 2NPIA 3QD6A 1DLLA 2VOTA 3POFA 4Q4X3 4SLIA 2MEV2 5I8TA 3I3MA 4AQSA 1SLBA 1POV1 2BGPA 4LO6B 1ND3C 4GULA 5T54A 1SCRA 2QZ2A 4KMQA 4Q4W1 1S2BA 2FZ1A 5FZEA 2OZ6A 5D2AA 2B39A 5GLTA 4OUEA 3AP4A 3AK0A 1VMJA 3V0BB 1ZRRA 3BOWA 4QHBA 3ELNA 3O0WA 4YVWC 2VW1A 3FMGA 4OYUA 3VN4A 1KDMA 1RUE3 2SBAA 4FFFA 4QXBA 4LR4A 4YLZA 3LA3A 2Q1MA 1WCSA 2D98A 1FNZA 2Y6LA 4CEWC 4EN0A 3T1MA 1W8TA 2WAOA 1PHMA 2WNEA 1BBT2 5F5AA 2CSGA 1YFXA 1ULDA 1WMXA 1LGCA 1W2NA 4B1MA 5BNNA 4GIQA 3GXUA 5ACA1 4Y24A 4N7IA 4MXVA 1LNSA 4R4ZA 4YG0A 2R073 4K9SA 1PIV3 4UBHA 4AEDA 4ES8A 4XHXA 4N43A 2D3PA 4FPYA 5CAZA 1HRI3 5CFDC 2PLV1 1RGSA 4FPFA 2VZRA 4OI1A 4CU8A 5JZGB 1WZXA 3JBG2 4PCRA 5HCBA 4CRQA 1BHGA 2WNVB 4V1PA 2D6KA 3KQ4B 3GZEA 5D8AB 4CDWA 4PBPA 4LO5B 1RUD3 5M0TA 2GMEA 2EIDA 3GALA 3WNPA 3D82A 4DUWA 1I6XA 3PIJA 1JOJA 2FDGA 4AOCA 1CAVB 1H1MA 3RGBA 1KEXA 4XF3A 5LY2A 2G4IA 1WLDA 5FP9A 2VMGA 4QHOA 4KWKA 4QAWA 3JCIA 4JQTA 1VLNA 3B9IA 4JTOA 5L36A 1PO12 1RVF1 1TMF1 2NLRA 3ZFFB 4JGZB 5LCWL 5EP9A 1H8VA 5F8PA 3PMEA 4QPIB 4UW4A 2QQNA 5FAXA 4QGLA 5LA1A 2EIEA 1LOFA 1VBD1 1NXMA 3M7AA 3TEYA 2RR11 4YM1A 3OG2A 3EJKA 4IEZA 1C5HA 1RUC1 2OYZA 4LBJA 4XFGA 2VR4A 2VUJA 2JDUA 4XMAA 2OPWA 1QF3A 4D6RA 4F8AA 3ZYIB 3AZXA 5A6QA 5LBEA 3WT3A 4JKKA 5J3UA 2OUHA 3P6BA 2HWF2 3UESA 3ZKYA 4IXLA 2FMYA 3WQ7A 1AYN2 3DF0A 4KWLA 1OLRA 4RL7A 5FWEA 5CKQA 2C24A 5IK7A 1QJU1 1IS6A 3UJOA 4HN0A 2DBNA 3BTZA 5C3OA 3PUQA 4A2UA 1STMA 1OA2A 4XF0A 1FMD2 1LTEA 5A33B 3NWKA 2JKBA 4HMZA 2PTMA 4RQPA 2X5IC 5IAVA 2ZX0A 4YG6A 4ARXA 1IQAA 2BW8A 3BALA 3OOXA 5HCHA 3O1PA 4TLFA 2D44A 4N9HA 1IPSA 3THDA 1KXGA 2BTVC 4XF9A 1LJ7A 1REDA 5FPLA 4C0HA 2A3XA 1NUKA 1WW7A 1H2LA 3BTAA 1OH3A 3ZFGB 1IS5A 2FQPA 2R30A 1Y7BA 2PYTA 5A6YA 3AFGA 2HWC3 4UFJA 2RVAA 1ENQA 1GOGA 2V4AA 3GZUC 4UFIA 3O1VA 3LZZA 3ZSJA 3C7OA 2CNAA 3ZYJB 3H7JA 3KLSA 3VBHA 1KGYA 2PA7A 2VMDA 4XXAA 4JC1A 3WDXA 4CCDA 3P1IA 1W8ZA 1VPHA 5JMCA 1BZWA 4GWJA 4Q4V1 2J1TA 3WG3A 4EYUA 4NVPA 4NHLA 1BXHA 2ET1A 2VZQA 2ZS6B 3ZPOA 3LSDA 4BE3A 4CDXC 2VQAA 4L97A 4LHLA 1XNTA 3QACA 4ZZ5A 1I3HA 5DXDA 5IFPA 1C1LA 1W9YA 4K8FA 4BXFA 1OOPC 3AMQA 2RMU3 3AMNA 1QQP3 3HBZA 4OHVA 3ZXAC 3HR9A 4QGMA 5GLUA 4D69A 3ZXEA 1AR62 3VD9A 5FMCA 3VDDC 3AX4A 3E97A 3ZKUA 1WW6A 2E6VA 2P37A 4Z92B 4BK4A 4CDUC 5A7NA 4BQ2A 2J1UA 2HH9A 3POJA 1DZRA 5FP7A 1N3PA 1NAEA 1M4WA 1EAH1 3T0AA 3VBRB 1CONA 2BNMA 1JZ7A 5FDBA 3AP9A 1SLTA 4IV1C 4MZUA 2LUWA 5JOXA 3HT1A 1PK6B 3CO2A 1V6LA 2VOXA 4FVVA 4RYDA 3RYKA 4C90A 1FYUA 1KD7A 3KGLA 3HJRA 3OGVA 3JD71 5T5LA 1VAKA 1OLQA 3D6EA 2B7YA 3ZMOA 2EXIA 2IZWA 2AENA 3H3UA 1MVEA 1M06G 1TME2 4W50A 5C71A 1R1A3 1PMIA 5FZFA 3ST7A 1UD1A 2ERFA 3SMHA 4AE2A 1XNCA 5EJZB 1GZWA 1QJX1 3BPSA 4ZXKA 1OHFA 1VE0A 5C9AC 4PQQA 3ZN6B 2FCVA 1C8M2 2JIJA 2JDHA 1RUI2 4LK7A 4C1XA 1PVC2 3B7MA 2GMMA 3K3NA 1J3QA 4YW5A 5HPOA 4BK5A 3N9MA 4H3WA 2VVDA 1W2TA 1W8UA 1AR81 1H8TC 3PUAA 3QH6A 4XTPA 5F3CA 5LK7B 1S0CA 3I59A 2RS52 3JUUA 5CG9A 1NXD1 3LAGA 2D5HA 4FQZA 3O1MA 4B3NA 1IQDC 1FPN1 1MS1A 2FZ2A 1KJRA 3AMMA 1LULA 3N9PA 1SG3A 3W20A 2GP3A 2ORXA 2W1UA 2F4PA 2VUAA 3ON7A 2H0BA 2WYSA 4I30A 3FZ3A 4LKSA 4QX2A 5FZIA 5FBJA 4P9LA 1R64A 2OX0A 2WINB 3FUOA 1V6KA 3NNFA 2JDNA 4CE8A 4Y22A 1OD3A 2Z42A 3VKMA 4DINB 4MOAA 1IPJA 1HIXA 1RITA 1CQ9A 4CEYA 2VOKA 2HBUA 4EWAA 5BNOA 1IPKA 2B42B 5FY5A 1GZTA 5FXZA 5FPXA 3RFRA 4UFKA 3SKJE 2QDNA 2XBO2 4NN0A 3ZXLA 1B35A 1KS5A 4FFHA 1NY71 4NIIA 1LAJA 2G9FA 2OW4A 1IKPA 3P5BA 2ENRA 2VUCA 4AHZA 1KDKA 3UKTA 2W92A 3ECQA 4D0QA 2OZJA 1QNYA 2W68A 2YGMA 4Q0PA 1XE8A 1E5RA 3MBWA 1UMHA 3CJIA 3LCPA 4HANA 5FZCA 1PNGA 3WDVA 4CP1A 1H6YA 5FZ7A 4FBFA 3AKTA 2ZX1A 1LESA 2Y34A 5CB7A 5IW0A 3VDAA 1VP6A 3ZFEC 4E4HA 3VD5A 1SLAA 3MDPA 4NPLA 2RDSA 1FATA 2RM23 1MZ5A 1O8SA 2VH9A 1RC6A 4D6SA 4GAZA 4Q4X2 2HWD1 2YHJA 3EBRA 4K3UA 3RPQA 5JXJA 4CCNA 3BCWA 3VBFC 4BIOA 3OPZA 3AM2A 2WWSA 4WVMA 3KQRA 1R093 1NZIA 4HG6B 1US3A 2RS31 4MGQA 2TEPA 1JODA 3SKVA 4CVUA 5BV6A 1RIRA 1RUE2 3K4AA 2YGLA 1UU5A 3S5AA 4XDPA 1Q43A 3ZXDA 3KF3A 2WA3A 2JG8B 2CGNA 3MGUA 5HBAA 5KHHA 1H9WA 4Z07A 3MF9A 5K7PA 4UT5A 3VD3A 5ANQA 3VBUC 4BXSV 1LENA 3KV4A 2YPJA 3TNPB 4M0NA 4V2WA 1U0AA 1VIWB 3CMGA 4DPNA 4I0AA 1LODA 1GZCA 3CL1A 1CPMA 2R072 3RZGA 4QM8A 3N3HA 3WDYA 3ZXGA 4ASKA 3I2KA 1K5MB 4HKOA 3K46A 5F5IA 1HRI2 4LEJA 3BIEA 2WN2A 4RGAA 4JGYC 1ASJ3 3OBRA 3J8F1 5T5JA 1LRHA 1YNAA 4MGYE 2BV4A 3NW4A 2IXLA 3O1TA 1RUD2 1DGRA 1W8WA 2IFRA 2ZGQA 4XAAA 2Y8KA 2WNUA 3IDBB 1V6JA 1S0EA 5EYYA 4WM8C 5EYXA 1TG7A 5IVEA 5IT6A 2WZPP 3ZN5A 5L19A 2DWRA 4XABA 3MEPA 1OC1A 1G9BA 3OYWB 5FZGA 3KF5A 2CL2A 2DTWA 3QH7A 3T09A 4Y1VA 1X33A 4DFSA 1HQWA 3LDRA 4U2AA 4BYYA 1EPZA 4XTMA 2Y60A 3OF1A 2BERA 5I93A 1UY3A 1HJFA 2VQUA 4NMIA 2ARBA 3AL6A 4AGVA 5I0RA 1S55A 2CV6A 1L3JA 2XG3A 4Q0UA 4HKLA 1BQPA 1K12A 4BU2A 1AHSA 2JJ6A 4JQRA 3AJYA 3DGTA 1QXPA 4E2QA 5K9YA 3MUZ1 2E7AA 4OZOA 5DPNA 4GKYA 5SV5A 4B8EA 4QQHA 1RUOA 1ZM1A 3WVJA 1LECA 2A6WA 2ZGMA 3IT8A 1WW5A 4RN5A 2DYCA 2QE3A 5F2SA 5J96B 4PI2A 4XQWA 5CFCB 3I97A 4EROA 3R4SA 1CAUA 4TXWA 1W90A 1PZ8A 3PHMA 2AYHA 5J37A 1QJFA 2KA3A 4HT1T 5CYYA 1IGOA 4QPGB 3ZYRA 1CGPA 1R1ZA 5DG1A 1YIFA 5FY0A 1MS5A 4OHZA 4M0HA 4GXLA 1LR5A 1JHJA 1PX3A 2WLQA 4Q2FA 3H3LA 1X9TA 1CIWA 4DXTA 3VBOB 4CDQC 1TE1B 2E33A 2Y6GA 2OQ6A 4DNYA 2PN5A 5FUIA 4AVSA 4Z2AA 2VW2A 5L9RA 3UGGA 3MO4A 4F83A 3K3OA 2YU2A 4OCTA 5FZ1A 1BYHA 1HB1A 1W04A 2QQPA 3THPA 3MLJA 4YW7A 4CYDA 3SQOA 1X8MA 2BZDA 4XDQA 3O12A 1RUG3 2XDVA 2NM1A 2PELA 1G8WA 2A6VA 2ZEXA 3A7QA 3ZDVA 3RI9A 4CCJA 4DUVA 2WC2A 2HWC2 4EJRA 2R16A 3I2JA 2YFUA 4GMP3 2W1WA 5FPAA 3ZX7A 4CU6A 3TOJA 2WAAA 1BCXA 5CFDA 2C9KA 4XBQA 1H4HA 4LUMA 1ZA7A 2QNKA 4AZZA 5T5PA 2PXJA 3QOPA 4FAGA 1I1EA 3RZJA 1LB2A 3DYOA 2O8QA 1DYKA 2G19A 5JSRA 2RS51 2XJQA 4DIQA 1ULGA 1D2QA 2DVGA 3A0KA 3ACHA 3MFAA 4B7EA 1QU0A 2WBKA 3HEIA 1HLCA 4G3YC 1JZ2A 5ABJA 5A1AA 2Y33A 1E5SA 3VHNA 5FZDA 3WDWA 5LZ6A 3T2QA 1RUJ1 2ORZA 2YROA 3QBQA 4XUTA 3NQHA 3I7DA 4E8CA 1UWWA 5BNNB 5A3LA 4BJ0A 4F7ZA 1VBB1 1ZBA1 1QQP2 2JDKA 2RMU2 1WCDJ 1DHKB 2A3WA 1MZEA 1MS4A 2OUJA 3LPGA 4AEDB 2FDHA 4N43B 1AL0G 4DOUA 2HBTA 1QGLA 1AZDA 2Y38A 1HQLA 4D7YA 1D4M1 3WY6A 1CJDA 2R6QA 4FAHA 1IS3A 2IC1A 3U4XA 4K1YA 1ULOA 1VBE3 2Y6FA 1XOYA 3FBYA 4MGZE 2VZ3A 5J7MA 1QWRA 3C8XA 2VZPA 2AGSA 3CKHA 4IV3A 1JMUB 3R4DB 4PLMA 5F32A 3I4IA 4Q0SA 4W6YA 3KT4A 2VC9A 1Q8SA 3N9LA 1W6OA 3ZXJA 4AI1A 3MW4A 4GD4A 4DMIA 4RD7A 3T4VA 1BJQA 1R1A2 3POEA 1IS4A 4AYUA 1UMZA 1DFQA 1CZSA 4BCUA 2VTXJ 1ND2A 4RSUA 3H0OA 5JR7B 1DQ1A 1JZ6A 3UNPA 3BIWE 1GOHA 4FQ4A 2DUPA 4UBGA 5JXIA 2J7MA 4XW3A 3D8CA 4FP3A 4HSLA 1QJY3 1H1AA 1TZOA 2XB6C 1LHWA 1SHWB 3MI8A 4EZHA 4Q4X1 4FXGB 1IG3A 2DCKA 3WDTA 1GP6A 1ENSA 3CZUA 4PJYA 3Q9OA 1VBC1 4LJHA 1DZTA 2WT2A 4A7YA 1V6NA 2ZKLA 3BUCA 5DQ0A 5KHIA 3AYAA 5K0UA 4DUXA 1JYWA 1KS4A 4GALA 4HSJA 2CGOA 1VB4A 4AI3A 1OUSA 1H2MA 1LHUA 2EAAA 4CCEA 2PMWB 4ISRA 4LBNA 1RMU3 1MQTC 4RGGA 4YW6A 5C7GA 4TZDA 2GMPA 5EZWA 3OUHA 4META 1EUUA 2BDRA 5FYMA 4BIFA 3AVRA 2Y26A 3USUA 3ZYPA 1UIKA 3L2YA 3O5SA 5C6CA 1DQ6A 2VTXA 5C3PA 2GH8A 4M00A 4RQPB 1UY4A 2W95A 1QKQA 1OF3A 4QQ2A 4AI0A 5FY4A 1Y9MA 4YM0A 2G9ZA 2XLGA 3ETQA 3PDQA 4LBOA 3SISA 1BK0A 1XNBA 1QH6A 5FPBA 4NRQA 2GNDA 2RV9A 3QCWA 5IYYA 2KXLA 1S2KA 1ZBE1 4Q4Y1 1OD5A 4XACA 1NT0A 3FUQA 4UFMA 3VDDA 2OQ7A 2WRAA 1RUD1 3T30A 4CDUA 4CU9A 4X8PA 4AGGA 1GV9A 3B3QE 4Q27A 4CXXA 3K48A 2JECA 4COYA 5GZCA 1WLCA 4RA0A 2BNOA 4LOSA 3VBHB 1OF4A 1ENXA 3C3VA 4ZHNA 2CDOA 3A4UA 4K21A 1HRV3 1QDCA 1URXA 4IE0A 5E89A 2ZKNA 5FPUA 1L7RA 2R7EB 3EMRA 3RZLA 2RM22 5EJ3A 1Y3TA 2WNVC 2XQRA 5EPAA 4A42A 5D8AC 5CBLA 2PHFA 5FY9A 2EIGA 1JYCA 1AXZA 3NAPC 1GWKA 1JUIA 4QX3A 4QX1A 5DAWA 4D7TA 5HI0A 2JKXA 1S1AA 5T55A 4HFSA 3RJ2X 3GBGA 3WX5A 4XFFA 3M3QA 3WNKA 2GDFA 2PQQA 2DTYA 5A70A 1VB2A 2J1RA 4QKDA 4XYXA 4B4RA 1R092 1XPWA 5LBBA 4FPKA 4BMEA 1EV13 3S0MA 1IG0A 1IKQA 2DCZA 1MS0A 1QY4A 3DXUA 1MVQA 1GQHA 2VZTA 1AJKA 4JGZC 4OFGA 1N47A 3PL0A 4PIZA 2W94A 5IVJA 1GWLA 1F9KA 1PGW2 1DLCA 3FHQA 1R081 5C9AA 2DUOA 5A3NA 1O3SA 3HBKA 2OS2A 5GLWA 5I0SA 4OMCA 2IVJA 1FI2A 2ZGOA 4CXYA 4J1XA 1SZBA 4XJUA 1TEIA 1HXS3 2FHRA 3AXDA 4TSVA 3POWA 5L7OB 1K42A 2UU8A 2UWBA 2EA7A 3M2MA 4LQRA 3OUJA 3VKNA 2BOJA 4FPJA 3GHNA 4O9GA 3TN93 5A3UA 1GZ9A 2XUMA 4Y1ZA 5FMDA 4MGTA 2WZ8A 2BGOA 4IE6A 3SEEA 1ZZ9A 4WBBA 3DCQA 1T6BX 2A6ZA 1RJ8A 2HKXA 2BWCA 4FO9A 3VZNA 4LO7A 3WQ0A 3E5XA 4RHV1 1YI7A 1COV3 3BVCA 1GZWB 1VR3A 2QQKA 1W6PA 3POSA 1RHI1 1ULPA 1ASJ2 2UY9A 2VQ0A 2WS91 3BB6A 3GM8A 3LPFA 1V70A 2Q8CA 2K0GA 1W6MA 2DF7A 3T3YA 2WIIB 4DO0A 3AJZA 4CSWA 5C3QA 5F7UA 3WEZA 1PGSA 1SACA 2BVBA 2GALA 2WO7A 5LB6A 2XHKA 1JZ8A 1AR71 3A21A 2JG9A 1UOBA 3IZOA 3OGJA 4AK3A 5FQ0A 2A6XA 3DUIA 4IUGA 1LHOA 1NLRA 3I59B 3AKSA 3PIGA 3JXSA 2WZR3 4FTEA 5BXXA 2PQSA 4FFIA 1VALA 2W0XA 2WFF3 5FK7A 1GNYA 4L99A 3ZFGC 5C5UA 2RS11 2ZZQA 2Z4FA 4P14A 5KC5A 2HWE3 4CUAA 1UYZA 4Y5SA 2B8MA 2YBPA 4UW5A 1US2A 4LHSA 5FLJA 2IXJA 2BP6A 2EAKA 2X29A 3FC0A 3POIA 4ZXEA 3I2HA 3KCXA 4P9WA 4Y22B 4AFMA 5FOJB 3AYDA 1OMIA 1C8NA 4GB33 3K75B 4XDOA 4CEYB 3L2HA 4RR3C 1UQXA 5GKAC 5BNOB 1D2SA 1KITA 4CCOA 4P9YA 4Q1RA 5E16A 2G1MA 3HN3A 1VBA2 2XKPA 4XQDA 4AFCA 1AX2A 1YQ2A 2MHFA 4JDMA 1B35B 4Y33A 1GQPA 3RQ0A 1NCRA 2JB4A 5T50A 3OPTA 3NNMA 5ISLA 5IAXA 1UZWA 4JV4A 4N53A 3I3EA 2D40A 2XWJB 2HLEA 3CJIB 1XBFA 5IFTA 4BQ1A 1JZ4A 3IKWA 4KI5M 4CUGA 5KR7A 4BHPA 1AX1A 1MACA 4JZRA 4TLGA 2JXAA 1HB3A 1O5UA 1PM4A 1OKOA 2O14A 2OPKA 5BNPC 4MGKE 2ATFA 4R8HA 3CZJA 1BEV1 3RG0A 1REEA 1K45A 4KBZA 3RJRA 2VAUA 4AAPA 4AXOA 3I2IA 1FV3A 1PK6C 1DGWA 1YQ5A 4IEUA 1RUH1 4H7LA 4PIYA 4V2VA 5FIXA 3WNMA 1UU4A 3IAQA 1YEWA 1WBFA 1RUG2 3K51A 5JIUA 2P5BA 2PHTA 5EXOA 4WM7A 5EV7A 4NRPA 5GZGA 1X50A 1NLQA 2CAUA 2VY0A 4WVMB 1ACCA 5FCCA 1Z7S3 2A7AA 3IBMA 4KH9A 2EVXA 3RZZA 3HNYM 4RGKA 3SH4A 4A7KA 1RUNA 1O4ZA 1PO23 1MEC1 3LFMA 4YGEA 4Q5OA 2D3RA 1NA1A 2R063 5C3SA 3UKVA 3ZOIA 3KGZA 2WLPA 3MZHA 1CZTA 3VL9A 4WM8A 5IJRA 4HVRA 4MG2A 3LB9A 2VM9A 2Q1FA 3EO6A 1AR91 2BU9A 1UOGA 1QEXA 1QDOA 4ONUA 2XMLA 3CEWA 1OURA 2ZEYA 3VHOA 4COVA 1SDDB 2XONA 4FPOB 3T08A 3VZOA 2B9VA 3LA2A 1ULCA 1FOD1 1RUF3 1DYOA 3S6PA 4QB1A 3OGGA 2NMOA 2R043 2VZOA 3ORJA 5GZDA 5A80A 2YZ4A 4Y4YA 4MHUA 4NJ4A 3R05A 1O8PA 3PTYA 3ZO0B 1VBE2 1DQ5A 5DZFA 1FNYA 1GP4A 3B94A 4KNCA 5EWSA 1L7QA 4AR2A 5IVFA 2XJRA 5CIRA 2XLAA 2WNUB 3EYPA 4ARYA 4CCLA 1RYYA 4MUVA 4AQ6A 4P08A 4KWUA 1J1LA 1AL21 1UW8A 2XJSA 3I8TA 3OGRA 3PURA 3IDCB 3M3OA 1LOCA 3QLQA 1Q8OA 1V9U3 4AGRA 2ZMLA 3V0AA 1O3RA 3ZN4A 2VZVA 5DDJ3 3RZMA 5FYZA 2WDBA 2DCYA 1AYM1 1VRH1 1UL9A 3U07A 3DPRA 2J42A 3IPVA 5CVRA 1O6UA 3WP6A 4CDQA 3U10A 3AZZA 3KVAA 3D0SA 1QJY2 4I02A 2QVSB 3I49A 1RL3A 2H0VA 5GJ6A 4XIOA 4LORA 2F17A 3RS6A 3M3IA 4KBBA 3WHUA 4A6OA 1PM7A 1GMMA 3ACFA 3MFCA 3FBMA 2NMNA 4AHWA 2DU1A 4KG0A 1YJLA 2GC3A 3SLIA 1DCSA 1A34A 4LIUA 4R9BA 5DN2A 5AC91 1CAUB 1YLLA 1MZ6A 4LIVA 4QPWA 1RMU2 4XFCA 4E2SA 2X09A 1A3KA 1ND3B 1SLIA 2AEYA 3TRSB 1B09A 2D6MA 2CU5A 2D93A 2R0HA 2VZSA 3OEAA 4XILA 4COUA 4Y26A 3CU7A 4IETA 1C57A 1JBCA 5FZ4A 2O1QA 2WWJA 3MLLA 3JU9A 5AFBA 2OA2A 3M3EA 3PUSA 1O91A 4Y20A 2ZGKA 3ROUA 4AVVA 2WN3A 4CCCA 5F9TA 3UYJA 1POV3 2KR2A 4CEWB 1C5IA 1QOOA 1SFPA 4FOYA 3WCSA 1S0BA 2VXJA 2W47A 3LDKA 4RS5A 5JOZA 2ARCA 4Q4W3 5A6ZA 3MUY1 4MO3M 2JX9A 5E6HA 4LXLA 2JG8C 2VULA 2HEVF 3KV5A 3PU3A 1UPSA 1L7LA 1I5PA 1XE7A 3O0XA 1K3IA 2LM3A 5AFEA 1ZVFA 3THTA 5IVYA 2VO5A 4A4AA 4CP9A 1PGL1 5C8CC 4ITCA 1G9CA 1JHNA 5FY1A 1DGLA 4IEPA 4EN8B 1XB9A 4HK9A 4BM8A 3DKQA 1WCQA 4XIKA 1NCQA 1OT5A 2A1XA 2VUDA 3Q8CA 4YFZA 2FCUA 4BH9A 1UY1A 5CFDB 1OH4A 2QUOA 4FPHA 3S7IA 4W4ZA 1JYNA 5DZGA 2GNMA 2HWB1 3K4ZA 4UI9L 2EALA 5CNAA 1HRV2 4QGNA 5ACA3 2ZX3A 1Q8VA 4LE4A 4A45A 4NIHA 3VBSA 2Q1ZB 1JN2P 3N9QA 2Q8OA 1MS8A 2MEV1 4K6BA 2WO3A 5ABJB 4IERA 2VTFA 4I2OA 4W6XA 2RJLA 2FDIA 1WLWA 3A23A 4OHWA 4FI9A 2PLV3 2Q30A 3H3ZA 4O61A 3LIGA 5FRAA 5FZ8A 5FZ0A 4NPRA 2JICA 3FJSA 2B4KA 4LBKA 2W9XA 4H55A 3M3CA 2ZAAA 3ME2A 4E8DA 2Z5WA 4B4PA 3LEIA 4I01A 4BMBA 2H6CA 1EV12 3HOBA 3A22A 2ZEZA 5FXXA 3GJBA 1PVXA 1UYXA 2A5ZA 4XEZA 5FLHA 4AI8A 3WHTA 4A3XA 1VBA1 2GH2A 3GZTB 4IEWA 4XZUG 4UWDA 1BBT1 1UX6A 2RDQA 2AREA 2RHPA 2TBVA 1RVF3 1TMF3 3J7NA 4IV3B 2VXRA 3WF3A 1DDLA 3BU7A 4QWNA 3WW3A 4AF9A 3HIFA 2FDFA 4BB3A 4OUSA 4DB5A 1GOFA 3J7HA 4NHKA 5AVPA 1GR3A 5IWFA 2E7TA 3TN92 3WD5A 4CA9A 5LA0A 2WSVA 1W6OB 2SLIA 3DYPA 2BJSA 4ORFA 3I2OA 3ZIXA 1KFXL 1MQTA 1VBD3 4S2GA 5CFCC 2RR13 3BTYA 1WCKA 4AL9A 3E5QA 4YWAA 1GICA 1RUC3 1W0PA 5JVVA 2ZJCA 3VKOA 4YSFA 1W03A 3OBTA 1O59A 5LW9A 3JBG1 4A7ZA 1ND2B 1COV2 2BEOA 5JLVA 1C3HA 1QJZA 3CF6E 4HBNA 1DF0A 1YUDA 4XPVA 4YFWA 3WCRA 5GALA 5LY1A 4OI4A 2DBIA 3VBOC 4BISA 2X5IB 1E57A 4AQ2A 2D7FA 4ET7A 1RUG1 2RG4A 3FLTA 5H9RA 3HQRA 5DUWA 3FE5A 5KXCA 2XGXA 1JYXA 2XOMA 2C1FA 2ZTNA 3VL8A 1PO11 2CTVA 5K0UB 1MPXA 2JIGA 3FLRA 5FJKA 3FHIB 3OTFA 3ITQA 3MW3A 2JE9A 4AEMA 4C8DA 4R9AA 1ZRDA 2B9UA 2WZR2 2QQJA 5IVBA 2YB7A 1I9RA 2DURA 5JPNB 3AYEA 2VCMA 2XH6A 3GBFA 4CCMA 3OBZA 1UY2A 3CBNA 1U5YA 2WFF2 5FP3A 4PQ9A 1JYVA 1F2NA 1NYWA 2A73B 2HWE2 3THCA 4W8JA 1BMV2 5AVAA 2QDRA 3USUB 1LHVA 5ANNA 4JTNA 2DV9A 5DAXA 3SH5A 4A3ZA 3RDIA 2BUKA 1HN0A 5ERLA 2WFPA 2IUWA 3E6BA 3J7LA 2WKKA 3LWCA 1UU6A 4GB32 4WZFA 1SPPA 3TWIA 2WZEA 4OI2A 1YI9A 2XHNA 4NIGA 2HWF1 4HXCA 3SEPA 4Q0QA 3NAPA 1YO8A 2W2IA 3M1HA 1RJ7A 1AYN1 1OQ1A 1NE6A 4YVSC 2YPDA 3C7GA 3WW4A 1H9PA 3GHMA 3T0DA 4QX5A 2E53A 5BNNC 2Y6KA 4Q4V3 3VDDB 5JI7A 1FMD1 4NHMA 3OBAA 4DS0A 4ATFA 2AACA 3ABZA 1X82A 1PIV2 2P34A 1VMFA 4CDUB 5T5OA 1F31A 3N35A 2BRTA 4AEDC 5C4WA 2J1EA 1ALYA 4YW2A 2YU1A 3HNMA 2PAMA 2QCSB 1KRIA 3WNXA 3FHAA 5C33A 1ODMA 1OI6A 2ZACA 1YRZA 3AP7A 3W58A 3AP6A 4CDWC 3D0JA 3MF6A 3O7OA 4GH4C 1QOSA 1W0OA 1UZVA 3AKPA 2PHLA 3LEMA 2E63A 4E9KA 5KWRA 2ARAA 4FPCA 4XUNA 1CWPA 3C2UA 3CLPA 3FL7A 4M4PA 3LKJA 4X6RB 4E27A 2W1QA 1Z7S2 2BBAA 3H7YA 5K4LA 4XETA 1HV0A 2TNFA 4XOGA 5IATA 3JD73 4XF1A 2GP5A 3WXPA 4N90A 2E7QA 1PO22 5C9AB 1QHDA 1ZNPA 3B9CA 3AZYA 3EXUA 1PNFA 5IHRA 2R062 2XWBB 5F1RA 1LOFC 2DVFA 1HN1A 4B4QA 1HV1A 3UL2A 2X10A 2XL7A 2VBDA 4COZA 1QJX3 4NHXA 1AR61 4O9EA 2WO2A 4BA6A 2VL4A 2FDKA 2XJUA 4UF0A 3SITA 2P2KA 1PMHX 3GYDA 1CIYA 5FZ3A 3DYMA 1RUF2 5JWPA 2FD8A 3GCXA 2JDPA 2R042 1ND3A 4W65A 1IOAA 1OSGA 1UOJA 2BQPA 3LEGA 1ZREA 4L9BA 4P9GA 1AR83 4WVWA 4XQ4A 1E5IA 1W6PB 2FMDA 1CX4A 2HYKA 4YVWA 5GZEA 3U78A 3KV9A 1ZRCA 1W6MB 3M70A 2EIBA 4RR3A 1FPN3 3WUDA 4BDVB 1XRUA 3PJYA 2MPFA 4RQPC 2ZHMA 4CEWA 2R32A 3LIHA 4C0BA 1TME1 1CPNA 2OVUA 2ZEWA 1WMDA 3VZLA 2JG9B 2VNGA 3VGIA 3BODA 1V9U2 1OKQA 3ASIA 4XFIA 2RDRA 5FQ0B 2D6PA 1WMFA 3V56A 3ZVXA 2ET7A 2B5HA 1RXGA 4LKFA 4C91A 5JAXA 3RWKX 3S5QA 2JDZA 5DDJ2 2N7GA 5E88A 5FY8A 5FYBA 4R52A 4K20A 5LEJA 1SBEA 1C8M1 3KB5A 4IEQA 5HV0A 3O1UA 5FO7B 1RUI1 1D0HA 5KXBA 1PVC1 2CAVA 3VZJA 2ZCWA 5BNPA 4O65A 3ALQA 4ZU7A 3BU0A 3ZSEA 4MGSA 2QQWA 3W59A 5J48A 2V5YA 4XURA 1F5FA 5SV8A 1X7NA 3WP5A 5A6XA 1NCRB 2GNTA 5L9BA 1HB4A 2CWSA 2VCBA 3AP5A 1YQCA 3KMHA 4XE9A 5TSWA 2YC4A 3H8RA 2AZ5A 4X8NA 4PDWC 5JPMB 2PHUA 4N53B 2IXKA 5LA9A 4B29A 2W52A 2ZZJA 3PMSA 4MYEA 1APNA 4Y3OA 5FKCA 2HWD3 1LEMA 2CHHA 3N36A 5LRRA 4LULA 5D21A 5FY7A 1W2AX 2PAEA 4NPMA 2XBO1 4J25A 1DBNA 4NR1A 4Q4W2 3TAYA 1UYPA 2VMIA 1W2OA 1YC61 4E2GA 2RS33 3VBUB 5JCTA 5L7OC 3H8XA 4P9IA 5FO8B 1YXWA 3LSEA 1LU1A 1GYKA 4WM7B 3J9SA 4HL0A 2WABA 3BKZA 4NIDA 4KGGA 1UXXX 2BYVE 5F5QA 1YWKA 1F5JA 1POQA 2JDAA 5FYTA 3W5MA 4DY3A 2O0OA 1LU2A 2VNRA 1QIQA 4LBLA 2P6CA 1X36A 3LEKA 5BYNA 1C28A 3NJVA 3OD4A 4FCAA 2PHDA 4HN1A 5GZFA 4AW7A 4EN9B 4CUBA 5ACA2 1NA1B 4QT6A 2ETEA 4EE2A 1SBDA 1UAIA 1U12A 2X5IA 4TYSA 4WM8B 2A6YA 5FZLA 1UPIA 4Y4RA 4ZS2A 2V72A 2BNNA 4LBQB 5J09A 2VBPA 2IWGB 2PLV2 1W6QA 5DUVA 3N7LA 3BPZA 4B7KA 3E5UA 3J8F3 1JYTA 5F6LB 4KU8A 2UURA 4MSVA 3IIAA 3ES4A 4NE9A 4PT6A 1G9DA 1RUE1 4GJYA 2VG9A 4TTGA 4D7SA 1ULEA 2DUQA 5FFOC 1GNZA 2VBBA 4OLLA 5G04L 4S2FA 3IWZA 2Y0IA 2A3YA 4L92A 3H8OA 1K5JA 3MV01 3P3PA 2VJXA 1RVF2 1TMF2 3POYA 1RXFA 5K8SA 4P02B 4ZONA 1ZZ8A 3D5OA 3KD4A 5KHKA 4AI2A 4CEYC 3FN9A 5BNOC 1QXRA 2R071 3AMPA 1PIV1 3JQXA 1W06A 4I3GA 5CZKA 3USSA 4GMP0 3ZMNA 2JB8A 1Q3EA 1VBD2 4Z82A 5FWJA 4CDXA 2RR12 1J84A 1MZFA 2QTWB 4GA9A 1RUC2 4YGBA 3U1XA 3ZM8A 3V0AB 4LBMA 1HRI1 1Z78A 4Q8LA 1OOPA 3RYPA 1XYPA 1N1TA 5LBFA 3M4FA 3DPRB 1XYOA 5KHGA 2I07B 3IPVB 4CDQB 2QZ3A 3WZ1A 2VOVA 3MIEA 1XSQA 4LO8A 4URTA 4M3CA 4AG4A 4YM2A 3R0RA 5B4NA 5JSOA 3KT7A 3CJIC 1GWMA 2DFBA 2XJPA 3RZHA 4UFLA 2C9AA 4JRLA 3HNBM 5LA2A 4H7MA 3FFQA 5FMOS 4I0WB 2QQIA 4MVTA 4IV1A 1AXYA 5CU1A 5DAPA 3M8LA 5JZGC 3N4MA 2QQVA 2BOIA 1O5LA 3D3AA 2YG0A 3GCWA 3MV11 5EJ1B 5A7OA 4AVCA 4EWDA 5C8CA 4LLOA 4UFHA 2GC2A 5I8YA 2E32A 2XL9A 1YQ8A 1S2EA 1WD4A 2JE7A 2PHRA 3RVHA 3SCFA 4FTBA 3WUCA 4GWIA 3PVBB 3RMYA 4BWOA 1W3XA 3AMHA 4IQPA 3U4SA 3OY8A 3G6JB 4S2HA 3RZKA 5FZBA 1OQDA 4Q8KA 4Y1XA 4Y20B 3Q8BA 1H30A 1SMVA 2EXJA 1ZYBA 2B45X 2ZXQA 2YXSA 5LASA 4QPIC 2C5DA 4ZU4A 1YYNA 3WG1A 4RS5B 4NIAA 4LHKA 4PHZA 2YY1A 1ZZ6A 1SQ4A 5F3IA 2ZHNA 3UT0A 3GDBA 3OJBA 1EYBA 5H9QA 4YZ4A 2GSYA 1H8TA 5T52A 2ADDA 3T2TA 4H2AA 4CP9B 4UAPA 3IN9A 1JU4A 1PX4A 3NRUA 1OFNA 5CA6A 3DKWA 4M3CE 3IAPA 3IMNA 4AQTA 3NV3A 4Q4V2 1F8VA 1OLMA 3J7MA 2PHWA 4Y1UA 4LKDA 1DZQA 1NCQB 2X05A 2EF6A 4XCAA 5KBFA 4HKWA 5GLZA 2RJ2A 1RUJ3 3MPPG 4HOOA 4LBQD 1ST8A 3S57A 1D0GA 1ULFA 4HETA 3WP4A 5DAQA 3UKNA 1YHFA 4K1ZA 2ILMA 5G05L 4QU2A 3VUOA 2DFCA 1VBB3 1ZBA3 4XFBA 1JUHA 3IIIA 3HQUA 3SH3A 1W8FA 3VBSB 1DQ0A 1JOPA 1LCLA 1UKRA 4A6SA 1XQNA 4JDOA 2WNUC 4MGIE 5LK5A 1D4M3 4UW6A 5JUVA 2UYAA 2HWC1 4G9SB 1W6NA 1WMEA 1REFA 2P3IA 2XJVA 3C7FA 4K7JA 1UMIA 1PZ7A 5CG8A 3Q8AA 2ZOEB 4MH0E 5F2WA 4IW3A 4DXZA 1W99A 3H42B 3JD72 2ZGRA 3LOIA 2VZUA 3ATGA 3WF1A 5C70A 3VDCA 4AVAA 4UOJA 3N7MA 5IK4A 4PLOA 2XVKA 5CKMA 4BOWA 1CAWA 2Y0OA 2F4LA 3E6CC 3KWVA 3ZFEA 1O3TA 3LFIA 5HXVA 4N8MA 2XR4A 1EUTA 3U0ZA 2GC0A 3ZFFC 4BQYA 3FLPA 3AB0A 1Q8PA 2Z69A 1UO9A 2QQOA 3NL1A 1OLME 1QJX2 2RMU1 1QQP1 1U5ZA 4OHXA 5FKBA 2QQMA 5L7OA 2AC1A 1UF2C 3FFZA 2WYFA 3AYCA 1HKDA 1MQTB 3K2OA 3WNNA 1YQ6A 2NZ9A 3K4DA 1IZ3A 2XVLA 3CQOA 4QB6A 4KU7A 3VBFA 4E4DX 3BGAA 4ASMB 1VBC3 4QQPA 5IVVA 4NOTA 1J83A 1AR82 3WG4A 2ID4A 4HK8A 1OUXA 1UZYA 3C7HA 2WUHA 3H50A 5A3OA 5A32A 1NE4A 3WOGA 4DRRA 5HCFA 4YARA 4QPYA 3NNGA 3BI3A 4IE7A 4LE3A 3BYWA 1FPN2 4HONA 3OD0A 4QXKA 3ACGA 4XBLA 4OHYA 1DP0A 3HMYA 5FZAA 4XUQA 2WO1A 3AXEA 3ES1A 3KHBA 2RDNA 5F39A 3VBRC 1BVVA 5C5TA 5LRSA 1R1A1 3LOBA 4YW1A 4YVSA 2AR6A 3KVBA 4QDSA 1ZRFA 3VBUA 3VZMA 5FYYA 5A1LA 1LOBA 2ZGUA 1Y9QA 2ZGPA 3CJXA 2BVVA 3OCPA 3NJYA 3R4UA 1XC6A 3WSOA 3KCCA 2R0FA 3DXTA 4FOQA 3RMXA 4NHYA 3OPWA 1OBNA 1QJEA 3I2GA 5FPZA 3T2PA 1JS9A 4P9JA 4AVTA 4OZXA 4YM3A 1NY72 3KCYA 2FDJA 3UGFA 2ZX4A 5I91A 3A0NA 4JGYA 4NROA 4AEJA 1ZBE3 4Q4Y3 1KJLA 2CGPA 4KL1A 4G4FA 5A7QA 1W8NA 1SPPB 4XC9A 1ZX5A 1XYNA 2ZGNA 4PBOA 4CP0A 4GH4A 4K40A 1GQGA 3NAPB 1UOFA 5FPVA 2NYYA 3MPBA 4J6GA 3B93A 2J1SA 3S30A 1LGNA 2NN8A 4KG8A 3PLQA 4LKEA 4LBQA 5FYCA 4CU7A 5ABJC 4FOWA 5FP8A 4JCKA 5FZKA 3VDBA 2D6OX 1LOEA 1JYIA 3RI8A 1V0AA 3LQCA 5FK8A 1CAXA 3ZYBA 3NV2A 1Y4WA 2V4VA 2AUYA 4IDZA 4XUOA 4D8MA 1CR7A 2P4EA 2UWAA 3ZLIA 4IESA 3IB3A 5C4WB 2D5FA 1LOGA 1RINA 2HWD2 4JRAA 4L8QA 4XAEA 1QXJA 2OT7A 1G6NA 5JSPA 4EQVA 4DQAA 2GNBA 5E8AA 4QDRA 4S2DA 1EY2A 1XJAA 5F3EA 3GJAA 3SCGA 1WA6X 1UYYA 2RS32 4IV3C 3WQBA 4Z8BA 3L9JT 4BQ5A 3T0BA 5A7SA 1R083 2P3JA 4JHTA 2QQUA 2WSUA 2WR9A 4LNVA 2JEMA 5LATA 5GM0A 4I3PA 3IDAA 4FT8A 1S0GA 2R1BA 2P3YA 1SFNA 4SBVA 4JKMA 3WLUA 3ZSMA 1UZ0A 1KFUL 3MIDA 1XU2A 1OPMA 3B00A 5EQUA 2DVDA 4YZ5A 4QQLA 2WT1A 3N9OA 4LT5A 1GUIA 1ND2C 2RM21 3WW1A 1NZCA 4AAXA 1W8HA 4L2NA 1WCUA 2ZMKA 4YZ3A 5CKNA 1MS3A 1XNAA 3AL5A 5FO9B 1JOBA 1LGBA 5FYVA 2ZAHA 2BFUS 2V09A 1A8MA 2QJVA 4IE4A 4RHV3 4FTSA 2VCAA 1R091 2X8KA 1KQRA 1GLHA 1RHI3 2WS93 4UF0B 4X6QB 5K0UC 3J8F2 5IK8A 3BOPA 5JXGA 3KS7A 1E5HA 4E4SA 5IK5A 5FZOA 1PGW1 2JE8A 5IVCA 4BQXA 5JXHA 4FFGA 3ZSLA 2VVEA 4P5YA 3TYJA 1BVP1 5JI9A 2C6SA 1AR73 1S0DA 3TNQA 2ZBJA 4D94A 2IXCA 3JZVA 3WR0A 3POGA 3UGHA 3O14A 4LA3A 2P6HA 5DG2A 4YVWB 4YRDA 1U5IA 3ZXKA 4R9DA 4RR3B 4DZGA 4MX3A 3O1SA 1UN1A 3WF0A 2YUEA 1AVBA 2RS13 2WNOA 3PVEA 4FPGA 5F37A 1UX7A 3INAA 4INDA 4JHZA 4HPKA 2D97A 1ONAA 4XJ8A 1XE0A 1GBGA 4CUCA 4OQ8A 2GN7A 5FXVA 4ZPIA 4HLTA 4FP2A 3S7EA 1GU3A 1I5ZA 4XJ9A 5EHDA 2YBKA 3AC0A 2ADEA 3VB9A 1EP0A 3KT1A 4PDWA 4Q29A 1ASJ1 2E51A 3CDZB 5KC6A 1MS9A 3DL3A 3H8UA 3OGSA 2ZABA 2RJKA 3LDBA 1JU3A 1OVPA 2DCJA 2IXIA 2QQLA 4KQ7A 4QD2A 4HZFA 5JR2A 5I0DA 1F35A 5LBCA 2D3SA 1K5MC 4LPLA 5BNPB 3VZKA 2GZWA 2ZX2A 3I54A 5DUXA 5HCAA 5D1IA 3VD4A 4EV0A 4JX0A 5E1RA 3NKGA 5A7WB 4CZSA 4QXHA 1V6OA 3BN6A 1JZ3A 3BTXA 1EPWA 4LA2A 1N3QA 2P17A 4LOTA 4QDQA 2OIIA 4D6QA 1SDWA 2Y6JA 2CWMA 2DCTA 4NAOA 5FBZA 5EFUA 1BEV3 3ILNA 3R6SA 2IXHA 1Y9GA 2YC0A 2JD4A 4IEXA 4YW4A 3ZSKA 3KHCA 3NMBA 4MXWA 4XF4A 1WWYA 1RUH3 4GJZA 2D6NA 5I8SA 3N9NA 4BLIA 1SEFA 4F3JA 3IMMA 4RFRB 2UYBA 4L0PA 1IHMA 2C4XA 2VMHA 5DZEA 4YGDA 1DYPA 1WKYA 4DY5A 1CZVA 1HXS2 4QB2A 5FYIA 2BPA2 1C4RA 1QNWA 4FOVA 3RWNA 2K9ZA 1J1TA 1MEC3 4ZY9A 4IL7A 1S0IA 2I2SA 3MICA 2YDEA 2WQZC 4ZZ8A 5KXEA 1V6MA 1ZRIA 5A7PA 3I2FA 4IEVA 4JKLA 2K46A 2WQ4A 1AR93 1G9AA 4MV2A 2LW8A 1W3VA 1RUJ2 3ZPYA 5BUVA 3H9AA 4QPGC 5DMYA 1G86A 1WGPA 4P00B 5FUNA 1VBB2 1ZBA2 4R9CA 1FOD3 3V0BA 2AEZA 5JOWA 3LE0A 1W9TA 2EXHA 1WUVA 1H2NA 1HDKA 1CX1A 1D4VB 2GC1A 4FPEA 1C1FA 2VZ1A 2UY8A 3U37A 4N7UA 4TWTA 1D4M2 1GKBA 1JTZX 2VW0A 3NV1A 1QJU3 4YPJA 1GANA 3APBA 4FPLA 1W6QB 1F4HA 3NNJA 3CNAA 4GMP1 4P9XA 2JG9C 3MIGA 1XU1A 1GSLA 5L73A 1UNBA 4LUKA 4C1WA 4YZ2A 2J22A 1NKGA 3O0VA 4YGCA 5LWBA 1POV0 2JENA 3PVOA 2WWUA 5CADA 4PF1A 1AL23 4I09A 4CXWA 1AXKA 1DQ4A 3B02A 2VMFA 5GLVA 3OB8A 3FX3A 3MYXA 3NJXA 2WL1A 3SC7X 3WNOA 1NOVA 1GFF2 3RSJA 2WT0A 5JZGA 1AYM3 1VRH3 3MHZA 2TUNA 2WNVA 2PHXA 1OPOA 2W08A 3JB4C 4RFT0 5D8AA 3WQ1A 1FAYA 3J4UH 3ZR6A 5L9VA 3OSDA 2NQYA 4XJZA 2Q8EA 4GQ7A 4MHRA 4CDXB 5BY5A 4AVBA 5JDBA 1CAVA 4QKFA 2FBEA 2JWPA 4PLNA 2VNOA 3DEMA 1NCRC 1J58A 1OOPB 1VBC2 1VBE1 3AZWA 4DEVA 5BNQA 1NQDA 1Q8QA 4HVOA 4H14A 4QX0A 1ENRA 1JW6A 5DUUA 3ZFFA 4FXKB 2VE1A 4JGZA 4N53C 5JMOA 1YFUA 1DGRN 1G9FA 4M3CB 1H4GA 1DGWX 1Z0HA 4GWMA 5AC93 4OI0A 1BLZA 4N43C 3VKFC 2JDYA 4QPIA 4EN7B 2D6LX 2E31A 2DU0A 3B01A 4GKXA 2Q8DA 4DEQA 4YW3A 3MIBA 1GP5A 1N1SA 1H0BA 1YFWA 3HWJA 2EXKA 1QOTA 5F5CA 3N7JA 4IV1B 2DVAA 5F6KA 4MADA 4Y5TA 2P3KA 2V5DA 3W21A 1TQ5A 2VPVA 3IM0A 5C8CB 3I2DA 5JIAA 3HVDA 3KSCA 3MLKA 5FZ6A 5KXDA 5A1FA 1BK1A 3AKQA 3POBA 1XXNA 4ES9A 1OVSA 1QJY1 5EIYB 1EAH3 1X9PA 2Z2SB 4WM7C 5FUPA 3AVSA 2LALA 2F6BA 1SBFA 3OY8B 2I74A 1WBLA 3G7DA 4NWWA 4OMDA 2E9QA 4QKNA 3WDUA 4YNIA 3JQWA 5LEKA 2YFZA 1ZBE2 4Q4Y2 1UZZA 4URAA 4LTAA 3ZYHA 4AEKA 1N1VA 5A33A 4LK6A 4WV8A 1RTVA 1NA1C 1OA4A 3UETA 1RMU1 1TNFA 3FWEA 5FJHA 2Q4SA 4MLOA 3ZXFA 1WA4A 2VD7A 2VMEA 2JDMA 2QFEA 3Q8FA 5FZMA 1H8TB 2WA4A 2ARXA 2XLFA 2HWB3 1NLSA 3RYRA 2VQTA 3I3DA 1SFYA 2R1DA 3VHPA 2VCCA 1F4AA 1T6GC 1D7PM 1H1IA 5KHJA 2RE9A 3OEBA 3VV1A 3O1OA 2MEV3 1W05A 4ZS3A 5T3NA 3ZFGA 3E1F1 1W39A 4AHYA 3VLBB 3KV6A 4Q1PA 4QMAA 5FZHA 3SCHA 1VRBA 5B4XA 3T1LA 2A70A 4QXCA 1FXZA 2H6BA 1UXZA 3UJQA 3AKRA 2FCTA 2W39A 2VOWA 4Q26A 3SNMA 1W9FA 3EB7A 4XJAA 2ZPXA 3N7KA 1R082 5DABA 3B69A 1VBA3 1W6NB 4M3CF 2DVBA 3EHKA 4LHNA 3HD8B 3V65A 1WLTA 4UYBA 3RRDA 1J3PA 5HV4A 1BBT3 5FOBB 3I3BA 1Q5OA 4NUBA 4K8RB 4DRVA 4PIXA 2L9LA 5C3RA 3NSTA 4A44A 1HRV1 4YYOA 1QH7A 2E26A 3UK9A 5J98B 3DPRC 4AFBA 2GAUA 3B5LB 1WD3A 1A78A 4OQ9A 1RB8G 1AF9A 1CAWB 3PNAA 3ZFEB 5FMOL 4ZU5A 5H9PA 3ILFA 4IEYA 4IGQA 2XPJA 3NV4A 1U5XA 1Y43B 1CD3G 4RHV2 5FZ9A 3JBG3 4J1WA 4XFHA 3PTRB 3VBHC 3VBRA 4D3WA 1O4YA 2LROA 4GWNA 3GNEA 3GGLA 3WP3A 4XVHA 1RHI2 3T2OA 1HW5A 1EV11 1PK6A 2WS92 2Y6HA 4IEOA 4CPBD 4JVAA 2ZGSA 4XJWA 1WW4A 3CIHA 5A7WA 2LS6A 4BQ4A 3ENRA 3J26N 4LMFA 5FTTC 3VBFB 4EZ4A 3MW2A 1YCIA 3EQEA 3E6DA 3WW2A 3WNLA 3LGRA 4ZKTB 2IVIB 2W5FA 1PO13 1AR72 1N1YA 3ACLA 3ILRA 5A32B 2KM2A 1OXCA 4W6WA 4WVVA 1HXS1 4BPZA 5FP4A 2MNGA 3LA7A 4B1LA 4KGQA 3W5NA 4XHBA 4XZPA 3TN91 4COWA 2ZMNA 2EICA 3VHRA 4QHZA 1DG6A 1O7FA 2RS12 4PI0A 5FMBA 2G9GA 3CHXA 2C26A 4JAAA 3X29B 2LRPA 3ZN6A 4PF5A 4RS5C 5FXWA 3U75A 3HN1A 1SLCA 3PUIA 1X8EA 4YVSB 3C7EA 3O1RA 2J1VA 2PAKA 2AH2A 3V64A 2JD9A 3MIHA 1COV1 2OXBA 3NKTA 4QKBA 3U14A 1W28A 3PUHA 3H1WA 4JDNA 4XXPA 2K2SA 2HWF3 2Z79A 4CTEA 2XVGA 3VKLA 4QM9A 4IGOA 3HPNA 1AYN3 1NCQC 5H9SA 3MIFA 2QKDA 4EN6B 4JGYB 1H2KA 2XKOA 3ZDSA 1UCXA 4Y1YA 2YBSA 1FMD3 1FV2A 2WJSA 4XMIA 4CDWB 1O3QA 2WZR1 1W9WA 2BWAA 4GH4B 2VMCA 1CJPA 4NAMA 1JXNA 1GNHA 1LKNA 2J1AA 1XNDA 3VBSC 3VD7A 2WFF1 1TNRA 2XQXA 3PJQA 3WV6A 1W9SA 1XNKA 1UY0A 1H6XA 2VU9A 3OUIA 1HQNA 1NG0A 2HWE1 1AX0A 3GZAA 4I0BA 1CN1A 1Q56A 1VAMA 2A71A 2W46A 1YJKA 3IDEA 4P5HA 5HXMA 1BMV1 3TBDA 5A3MA 1CAXB 4LLFA 1BEV2 4Z1VA 3W9AA 3URFA 2CDPA 2VECA 2ZGTA 4QX7A 3U11A 1XSRA 1HJGA 4YG3A 1RUH2 3DECA 4GB31 4HVQA 4WVZA 5FYHA 4NWVA 2HJIA 4OVEA 2Q5TA 1JI6A 3RNSA 1DQ2A 5I0UA 4M4RA 3ETPA 2NP0A 2XXZA 1YIPA 1F15A 1FT9A 2WQ8A 3HAGA 3ZYFA 4U36A 3NNLA 4AHXA 2R49A 4AFDA
chains in the Genus database with same CATH topology
3O1MA 3T4HB 4CXYA 3BI3A 4IE7A 3LFMA 3BTZA 4NRMA 4IE5A 4CXWA 3H8RA 3KHBA 4MG2A 3O1SA 3T4VA 4MGTA 4NIHA 3O1PA 4IE6A 3I3MA 3RZKA 2FDIA 4NPMA 4O61A 4NIIA 4QKFA 2FDJA 4NJ4A 3T3YA 4NROA 3H8XA 3BUCA 3O1VA 3BKZA 4NIDA 4NPLA 2FDFA 3BTXA 3S57A 4IDZA 4OCTA 3I2OA 3RZMA 3BTYA 4ZS2A 2FDKA 3O1RA 3KHCA 2FD8A 4QKBA 3I49A 4NRQA 4QKNA 4RFRB 2FDGA 3S5AA 4JHTA 3I3QA 4QHOA 3RZJA 3H8OA 4CXXA 4ZHNA 5F8PA 4IE0A 3RZLA 4O7XA 3RZGA 3O1OA 4ZS3A 3O1UA 4IE4A 2FDHA 3BIEA 2IUWA 4QKDA 4NIGA 4NRPA 3O1TA 3RZHA 3BU0A 5DABA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O1M A;  3T4H B;  4CXY A;  3BI3 A;  4IE7 A;  3LFM A;  3BTZ A;  4NRM A;  4IE5 A;  4CXW A;  3H8R A;  3KHB A;  4MG2 A;  3O1S A;  3T4V A;  4MGT A;  4NIH A;  3O1P A;  4IE6 A;  3I3M A;  3RZK A;  2FDI A;  4NPM A;  4O61 A;  4NII A;  4QKF A;  2FDJ A;  4NJ4 A;  3T3Y A;  4NRO A;  3H8X A;  3BUC A;  3O1V A;  3BKZ A;  4NID A;  4NPL A;  2FDF A;  3BTX A;  3S57 A;  4IDZ A;  4OCT A;  3I2O A;  3RZM A;  3BTY A;  4ZS2 A;  2FDK A;  3O1R A;  3KHC A;  2FD8 A;  4QKB A;  3I49 A;  4NRQ A;  4QKN A;  4RFR B;  2FDG A;  3S5A A;  4JHT A;  3I3Q A;  4QHO A;  3RZJ A;  3H8O A;  4CXX A;  4ZHN A;  5F8P A;  4IE0 A;  3RZL A;  4O7X A;  3RZG A;  3O1O A;  4ZS3 A;  3O1U A;  4IE4 A;  2FDH A;  3BIE A;  2IUW A;  4QKD A;  4NIG A;  4NRP A;  3O1T A;  3RZH A;  3BU0 A;  5DAB A; 
#chains in the Genus database with same CATH topology
 1PMJ X;  4FSJ A;  3T4H B;  4BLJ A;  4E4Z A;  2XUE A;  1MEC 2;  3KZ4 C;  2XJT A;  5A3T A;  1SLL A;  1QMJ A;  5I0T A;  5JOY A;  2D43 A;  4LIT A;  3LF7 A;  2C0Z A;  1CES A;  4XFA A;  4DXS A;  1B35 C;  1HB2 A;  1AR9 2;  4QQO A;  5FYU A;  1J3R A;  1AR6 3;  4UXA A;  5CEH A;  4N9I A;  4CPB A;  1FOD 2;  1CVN A;  1ZZC A;  2HYX A;  2VNV A;  2CYF A;  1S0J A;  1W2U A;  2W3J A;  2YC2 A;  4CCK A;  2GN3 A;  2LTN A;  2YYO A;  1QJU 2;  2JG8 A;  5DAV A;  3SXW A;  4A41 A;  1S0F A;  1Z7S 1;  4ATE A;  2UWC A;  3Q8E A;  3NO8 A;  2I45 A;  2B46 X;  3HQX A;  3KM5 A;  2W91 A;  4XBN A;  2Y64 A;  1PO2 1;  5FZO B;  3LD8 A;  4AWD A;  2VGD A;  3P3N A;  1VAV A;  4AI9 A;  5FR3 A;  3UV9 A;  1HX6 A;  2R06 1;  1AL2 2;  1SCS A;  1TME 3;  4Q0V A;  3PU8 A;  1ZA4 A;  1BKZ A;  1N3O A;  2QBX A;  1LED A;  1P8J A;  2W1S A;  1K5M A;  4BQW A;  4IGP A;  1TVG A;  2DDU A;  1ZZB A;  1OA3 A;  2KD7 A;  5A3W A;  3ZR5 A;  1AYM 2;  3SHR A;  1T2X A;  1UKG A;  1VRH 2;  1RUF 1;  2Q0A A;  1C8M 3;  4HPK B;  2IFW A;  1RUI 3;  3JB8 A;  2R04 1;  3AZV A;  1FX5 A;  1PVC 3;  4WZC A;  4YZ1 A;  4LO4 B;  5BPX A;  4R4X A;  2ES3 A;  1YFY A;  2P1B A;  2HEW F;  4DXR A;  4TN7 A;  5J1X A;  3OYW A;  2OKX A;  3NVC A;  4PDW B;  4L11 A;  2RS5 3;  1UIJ A;  4OUL A;  1OFS A;  2W87 A;  1VJ2 A;  3ZYG A;  3I3Q A;  4UW3 A;  2HEY F;  3AFK A;  4XUP A;  5AC9 2;  1O4T A;  5FLI A;  2ZHL A;  4BQ3 A;  2BBV A;  2PFW A;  2YMZ A;  4GZ9 A;  5C4W C;  2X53 S;  1PZ9 A;  2ZA9 A;  1NQJ A;  1MR5 A;  2BGC A;  3DV8 A;  5B2G B;  1V9U 1;  1DU3 D;  3PVN A;  1VMH A;  1G7Y A;  4O7X A;  5APA A;  1AJO A;  3TEZ A;  5DDJ 1;  4BZ4 A;  3K77 A;  5FRE A;  1LHN A;  1NX9 A;  2VVF A;  5IUQ A;  4QU1 A;  4XCB A;  3TEX A;  5CFC A;  1DIW A;  5A3P A;  4OUM A;  2XBO 3;  1EAH 2;  1OQE A;  1W8O A;  4QX8 A;  4ISQ A;  4CP2 A;  3ACI A;  1AUY A;  3WF4 A;  4QPG A;  1J59 A;  4MXW B;  5F3G A;  2V73 A;  4NO4 A;  1PGL 2;  4ASL A;  3F95 A;  1V6I A;  1ZZ7 A;  4KWJ A;  1ODN A;  1W0N A;  4Y5Z 0;  3H1Y A;  3H1M A;  1A6C A;  2CY6 A;  3VBO A;  2YV8 A;  1JZ5 A;  3D4K A;  2O8O A;  5FYS A;  1LOA A;  2BFU L;  3F2Z A;  4M01 A;  3GBW A;  1S4C A;  3HT2 A;  5CIS A;  1A8D A;  1JH5 A;  3TEW A;  1V00 A;  3ZIW A;  3GF6 A;  4NRM A;  2A75 A;  2ZHK A;  4IE5 A;  4AFA A;  3WG2 A;  3NJZ A;  3DN7 A;  3TB0 A;  3WF2 A;  2HWB 2;  2GU9 A;  5FV3 A;  4EWE A;  3WIN E;  4Z2W A;  5J36 A;  5C8W A;  2ZGL A;  2NPI A;  3QD6 A;  1DLL A;  2VOT A;  3POF A;  4Q4X 3;  4SLI A;  2MEV 2;  5I8T A;  3I3M A;  4AQS A;  1SLB A;  1POV 1;  2BGP A;  4LO6 B;  1ND3 C;  4GUL A;  5T54 A;  1SCR A;  2QZ2 A;  4KMQ A;  4Q4W 1;  1S2B A;  2FZ1 A;  5FZE A;  2OZ6 A;  5D2A A;  2B39 A;  5GLT A;  4OUE A;  3AP4 A;  3AK0 A;  1VMJ A;  3V0B B;  1ZRR A;  3BOW A;  4QHB A;  3ELN A;  3O0W A;  4YVW C;  2VW1 A;  3FMG A;  4OYU A;  3VN4 A;  1KDM A;  1RUE 3;  2SBA A;  4FFF A;  4QXB A;  4LR4 A;  4YLZ A;  3LA3 A;  2Q1M A;  1WCS A;  2D98 A;  1FNZ A;  2Y6L A;  4CEW C;  4EN0 A;  3T1M A;  1W8T A;  2WAO A;  1PHM A;  2WNE A;  1BBT 2;  5F5A A;  2CSG A;  1YFX A;  1ULD A;  1WMX A;  1LGC A;  1W2N A;  4B1M A;  5BNN A;  4GIQ A;  3GXU A;  5ACA 1;  4Y24 A;  4N7I A;  4MXV A;  1LNS A;  4R4Z A;  4YG0 A;  2R07 3;  4K9S A;  1PIV 3;  4UBH A;  4AED A;  4ES8 A;  4XHX A;  4N43 A;  2D3P A;  4FPY A;  5CAZ A;  1HRI 3;  5CFD C;  2PLV 1;  1RGS A;  4FPF A;  2VZR A;  4OI1 A;  4CU8 A;  5JZG B;  1WZX A;  3JBG 2;  4PCR A;  5HCB A;  4CRQ A;  1BHG A;  2WNV B;  4V1P A;  2D6K A;  3KQ4 B;  3GZE A;  5D8A B;  4CDW A;  4PBP A;  4LO5 B;  1RUD 3;  5M0T A;  2GME A;  2EID A;  3GAL A;  3WNP A;  3D82 A;  4DUW A;  1I6X A;  3PIJ A;  1JOJ A;  2FDG A;  4AOC A;  1CAV B;  1H1M A;  3RGB A;  1KEX A;  4XF3 A;  5LY2 A;  2G4I A;  1WLD A;  5FP9 A;  2VMG A;  4QHO A;  4KWK A;  4QAW A;  3JCI A;  4JQT A;  1VLN A;  3B9I A;  4JTO A;  5L36 A;  1PO1 2;  1RVF 1;  1TMF 1;  2NLR A;  3ZFF B;  4JGZ B;  5LCW L;  5EP9 A;  1H8V A;  5F8P A;  3PME A;  4QPI B;  4UW4 A;  2QQN A;  5FAX A;  4QGL A;  5LA1 A;  2EIE A;  1LOF A;  1VBD 1;  1NXM A;  3M7A A;  3TEY A;  2RR1 1;  4YM1 A;  3OG2 A;  3EJK A;  4IEZ A;  1C5H A;  1RUC 1;  2OYZ A;  4LBJ A;  4XFG A;  2VR4 A;  2VUJ A;  2JDU A;  4XMA A;  2OPW A;  1QF3 A;  4D6R A;  4F8A A;  3ZYI B;  3AZX A;  5A6Q A;  5LBE A;  3WT3 A;  4JKK A;  5J3U A;  2OUH A;  3P6B A;  2HWF 2;  3UES A;  3ZKY A;  4IXL A;  2FMY A;  3WQ7 A;  1AYN 2;  3DF0 A;  4KWL A;  1OLR A;  4RL7 A;  5FWE A;  5CKQ A;  2C24 A;  5IK7 A;  1QJU 1;  1IS6 A;  3UJO A;  4HN0 A;  2DBN A;  3BTZ A;  5C3O A;  3PUQ A;  4A2U A;  1STM A;  1OA2 A;  4XF0 A;  1FMD 2;  1LTE A;  5A33 B;  3NWK A;  2JKB A;  4HMZ A;  2PTM A;  4RQP A;  2X5I C;  5IAV A;  2ZX0 A;  4YG6 A;  4ARX A;  1IQA A;  2BW8 A;  3BAL A;  3OOX A;  5HCH A;  3O1P A;  4TLF A;  2D44 A;  4N9H A;  1IPS A;  3THD A;  1KXG A;  2BTV C;  4XF9 A;  1LJ7 A;  1RED A;  5FPL A;  4C0H A;  2A3X A;  1NUK A;  1WW7 A;  1H2L A;  3BTA A;  1OH3 A;  3ZFG B;  1IS5 A;  2FQP A;  2R30 A;  1Y7B A;  2PYT A;  5A6Y A;  3AFG A;  2HWC 3;  4UFJ A;  2RVA A;  1ENQ A;  1GOG A;  2V4A A;  3GZU C;  4UFI A;  3O1V A;  3LZZ A;  3ZSJ A;  3C7O A;  2CNA A;  3ZYJ B;  3H7J A;  3KLS A;  3VBH A;  1KGY A;  2PA7 A;  2VMD A;  4XXA A;  4JC1 A;  3WDX A;  4CCD A;  3P1I A;  1W8Z A;  1VPH A;  5JMC A;  1BZW A;  4GWJ A;  4Q4V 1;  2J1T A;  3WG3 A;  4EYU A;  4NVP A;  4NHL A;  1BXH A;  2ET1 A;  2VZQ A;  2ZS6 B;  3ZPO A;  3LSD A;  4BE3 A;  4CDX C;  2VQA A;  4L97 A;  4LHL A;  1XNT A;  3QAC A;  4ZZ5 A;  1I3H A;  5DXD A;  5IFP A;  1C1L A;  1W9Y A;  4K8F A;  4BXF A;  1OOP C;  3AMQ A;  2RMU 3;  3AMN A;  1QQP 3;  3HBZ A;  4OHV A;  3ZXA C;  3HR9 A;  4QGM A;  5GLU A;  4D69 A;  3ZXE A;  1AR6 2;  3VD9 A;  5FMC A;  3VDD C;  3AX4 A;  3E97 A;  3ZKU A;  1WW6 A;  2E6V A;  2P37 A;  4Z92 B;  4BK4 A;  4CDU C;  5A7N A;  4BQ2 A;  2J1U A;  2HH9 A;  3POJ A;  1DZR A;  5FP7 A;  1N3P A;  1NAE A;  1M4W A;  1EAH 1;  3T0A A;  3VBR B;  1CON A;  2BNM A;  1JZ7 A;  5FDB A;  3AP9 A;  1SLT A;  4IV1 C;  4MZU A;  2LUW A;  5JOX A;  3HT1 A;  1PK6 B;  3CO2 A;  1V6L A;  2VOX A;  4FVV A;  4RYD A;  3RYK A;  4C90 A;  1FYU A;  1KD7 A;  3KGL A;  3HJR A;  3OGV A;  3JD7 1;  5T5L A;  1VAK A;  1OLQ A;  3D6E A;  2B7Y A;  3ZMO A;  2EXI A;  2IZW A;  2AEN A;  3H3U A;  1MVE A;  1M06 G;  1TME 2;  4W50 A;  5C71 A;  1R1A 3;  1PMI A;  5FZF A;  3ST7 A;  1UD1 A;  2ERF A;  3SMH A;  4AE2 A;  1XNC A;  5EJZ B;  1GZW A;  1QJX 1;  3BPS A;  4ZXK A;  1OHF A;  1VE0 A;  5C9A C;  4PQQ A;  3ZN6 B;  2FCV A;  1C8M 2;  2JIJ A;  2JDH A;  1RUI 2;  4LK7 A;  4C1X A;  1PVC 2;  3B7M A;  2GMM A;  3K3N A;  1J3Q A;  4YW5 A;  5HPO A;  4BK5 A;  3N9M A;  4H3W A;  2VVD A;  1W2T A;  1W8U A;  1AR8 1;  1H8T C;  3PUA A;  3QH6 A;  4XTP A;  5F3C A;  5LK7 B;  1S0C A;  3I59 A;  2RS5 2;  3JUU A;  5CG9 A;  1NXD 1;  3LAG A;  2D5H A;  4FQZ A;  3O1M A;  4B3N A;  1IQD C;  1FPN 1;  1MS1 A;  2FZ2 A;  1KJR A;  3AMM A;  1LUL A;  3N9P A;  1SG3 A;  3W20 A;  2GP3 A;  2ORX A;  2W1U A;  2F4P A;  2VUA A;  3ON7 A;  2H0B A;  2WYS A;  4I30 A;  3FZ3 A;  4LKS A;  4QX2 A;  5FZI A;  5FBJ A;  4P9L A;  1R64 A;  2OX0 A;  2WIN B;  3FUO A;  1V6K A;  3NNF A;  2JDN A;  4CE8 A;  4Y22 A;  1OD3 A;  2Z42 A;  3VKM A;  4DIN B;  4MOA A;  1IPJ A;  1HIX A;  1RIT A;  1CQ9 A;  4CEY A;  2VOK A;  2HBU A;  4EWA A;  5BNO A;  1IPK A;  2B42 B;  5FY5 A;  1GZT A;  5FXZ A;  5FPX A;  3RFR A;  4UFK A;  3SKJ E;  2QDN A;  2XBO 2;  4NN0 A;  3ZXL A;  1B35 A;  1KS5 A;  4FFH A;  1NY7 1;  4NII A;  1LAJ A;  2G9F A;  2OW4 A;  1IKP A;  3P5B A;  2ENR A;  2VUC A;  4AHZ A;  1KDK A;  3UKT A;  2W92 A;  3ECQ A;  4D0Q A;  2OZJ A;  1QNY A;  2W68 A;  2YGM A;  4Q0P A;  1XE8 A;  1E5R A;  3MBW A;  1UMH A;  3CJI A;  3LCP A;  4HAN A;  5FZC A;  1PNG A;  3WDV A;  4CP1 A;  1H6Y A;  5FZ7 A;  4FBF A;  3AKT A;  2ZX1 A;  1LES A;  2Y34 A;  5CB7 A;  5IW0 A;  3VDA A;  1VP6 A;  3ZFE C;  4E4H A;  3VD5 A;  1SLA A;  3MDP A;  4NPL A;  2RDS A;  1FAT A;  2RM2 3;  1MZ5 A;  1O8S A;  2VH9 A;  1RC6 A;  4D6S A;  4GAZ A;  4Q4X 2;  2HWD 1;  2YHJ A;  3EBR A;  4K3U A;  3RPQ A;  5JXJ A;  4CCN A;  3BCW A;  3VBF C;  4BIO A;  3OPZ A;  3AM2 A;  2WWS A;  4WVM A;  3KQR A;  1R09 3;  1NZI A;  4HG6 B;  1US3 A;  2RS3 1;  4MGQ A;  2TEP A;  1JOD A;  3SKV A;  4CVU A;  5BV6 A;  1RIR A;  1RUE 2;  3K4A A;  2YGL A;  1UU5 A;  3S5A A;  4XDP A;  1Q43 A;  3ZXD A;  3KF3 A;  2WA3 A;  2JG8 B;  2CGN A;  3MGU A;  5HBA A;  5KHH A;  1H9W A;  4Z07 A;  3MF9 A;  5K7P A;  4UT5 A;  3VD3 A;  5ANQ A;  3VBU C;  4BXS V;  1LEN A;  3KV4 A;  2YPJ A;  3TNP B;  4M0N A;  4V2W A;  1U0A A;  1VIW B;  3CMG A;  4DPN A;  4I0A A;  1LOD A;  1GZC A;  3CL1 A;  1CPM A;  2R07 2;  3RZG A;  4QM8 A;  3N3H A;  3WDY A;  3ZXG A;  4ASK A;  3I2K A;  1K5M B;  4HKO A;  3K46 A;  5F5I A;  1HRI 2;  4LEJ A;  3BIE A;  2WN2 A;  4RGA A;  4JGY C;  1ASJ 3;  3OBR A;  3J8F 1;  5T5J A;  1LRH A;  1YNA A;  4MGY E;  2BV4 A;  3NW4 A;  2IXL A;  3O1T A;  1RUD 2;  1DGR A;  1W8W A;  2IFR A;  2ZGQ A;  4XAA A;  2Y8K A;  2WNU A;  3IDB B;  1V6J A;  1S0E A;  5EYY A;  4WM8 C;  5EYX A;  1TG7 A;  5IVE A;  5IT6 A;  2WZP P;  3ZN5 A;  5L19 A;  2DWR A;  4XAB A;  3MEP A;  1OC1 A;  1G9B A;  3OYW B;  5FZG A;  3KF5 A;  2CL2 A;  2DTW A;  3QH7 A;  3T09 A;  4Y1V A;  1X33 A;  4DFS A;  1HQW A;  3LDR A;  4U2A A;  4BYY A;  1EPZ A;  4XTM A;  2Y60 A;  3OF1 A;  2BER A;  5I93 A;  1UY3 A;  1HJF A;  2VQU A;  4NMI A;  2ARB A;  3AL6 A;  4AGV A;  5I0R A;  1S55 A;  2CV6 A;  1L3J A;  2XG3 A;  4Q0U A;  4HKL A;  1BQP A;  1K12 A;  4BU2 A;  1AHS A;  2JJ6 A;  4JQR A;  3AJY A;  3DGT A;  1QXP A;  4E2Q A;  5K9Y A;  3MUZ 1;  2E7A A;  4OZO A;  5DPN A;  4GKY A;  5SV5 A;  4B8E A;  4QQH A;  1RUO A;  1ZM1 A;  3WVJ A;  1LEC A;  2A6W A;  2ZGM A;  3IT8 A;  1WW5 A;  4RN5 A;  2DYC A;  2QE3 A;  5F2S A;  5J96 B;  4PI2 A;  4XQW A;  5CFC B;  3I97 A;  4ERO A;  3R4S A;  1CAU A;  4TXW A;  1W90 A;  1PZ8 A;  3PHM A;  2AYH A;  5J37 A;  1QJF A;  2KA3 A;  4HT1 T;  5CYY A;  1IGO A;  4QPG B;  3ZYR A;  1CGP A;  1R1Z A;  5DG1 A;  1YIF A;  5FY0 A;  1MS5 A;  4OHZ A;  4M0H A;  4GXL A;  1LR5 A;  1JHJ A;  1PX3 A;  2WLQ A;  4Q2F A;  3H3L A;  1X9T A;  1CIW A;  4DXT A;  3VBO B;  4CDQ C;  1TE1 B;  2E33 A;  2Y6G A;  2OQ6 A;  4DNY A;  2PN5 A;  5FUI A;  4AVS A;  4Z2A A;  2VW2 A;  5L9R A;  3UGG A;  3MO4 A;  4F83 A;  3K3O A;  2YU2 A;  4OCT A;  5FZ1 A;  1BYH A;  1HB1 A;  1W04 A;  2QQP A;  3THP A;  3MLJ A;  4YW7 A;  4CYD A;  3SQO A;  1X8M A;  2BZD A;  4XDQ A;  3O12 A;  1RUG 3;  2XDV A;  2NM1 A;  2PEL A;  1G8W A;  2A6V A;  2ZEX A;  3A7Q A;  3ZDV A;  3RI9 A;  4CCJ A;  4DUV A;  2WC2 A;  2HWC 2;  4EJR A;  2R16 A;  3I2J A;  2YFU A;  4GMP 3;  2W1W A;  5FPA A;  3ZX7 A;  4CU6 A;  3TOJ A;  2WAA A;  1BCX A;  5CFD A;  2C9K A;  4XBQ A;  1H4H A;  4LUM A;  1ZA7 A;  2QNK A;  4AZZ A;  5T5P A;  2PXJ A;  3QOP A;  4FAG A;  1I1E A;  3RZJ A;  1LB2 A;  3DYO A;  2O8Q A;  1DYK A;  2G19 A;  5JSR A;  2RS5 1;  2XJQ A;  4DIQ A;  1ULG A;  1D2Q A;  2DVG A;  3A0K A;  3ACH A;  3MFA A;  4B7E A;  1QU0 A;  2WBK A;  3HEI A;  1HLC A;  4G3Y C;  1JZ2 A;  5ABJ A;  5A1A A;  2Y33 A;  1E5S A;  3VHN A;  5FZD A;  3WDW A;  5LZ6 A;  3T2Q A;  1RUJ 1;  2ORZ A;  2YRO A;  3QBQ A;  4XUT A;  3NQH A;  3I7D A;  4E8C A;  1UWW A;  5BNN B;  5A3L A;  4BJ0 A;  4F7Z A;  1VBB 1;  1ZBA 1;  1QQP 2;  2JDK A;  2RMU 2;  1WCD J;  1DHK B;  2A3W A;  1MZE A;  1MS4 A;  2OUJ A;  3LPG A;  4AED B;  2FDH A;  4N43 B;  1AL0 G;  4DOU A;  2HBT A;  1QGL A;  1AZD A;  2Y38 A;  1HQL A;  4D7Y A;  1D4M 1;  3WY6 A;  1CJD A;  2R6Q A;  4FAH A;  1IS3 A;  2IC1 A;  3U4X A;  4K1Y A;  1ULO A;  1VBE 3;  2Y6F A;  1XOY A;  3FBY A;  4MGZ E;  2VZ3 A;  5J7M A;  1QWR A;  3C8X A;  2VZP A;  2AGS A;  3CKH A;  4IV3 A;  1JMU B;  3R4D B;  4PLM A;  5F32 A;  3I4I A;  4Q0S A;  4W6Y A;  3KT4 A;  2VC9 A;  1Q8S A;  3N9L A;  1W6O A;  3ZXJ A;  4AI1 A;  3MW4 A;  4GD4 A;  4DMI A;  4RD7 A;  3T4V A;  1BJQ A;  1R1A 2;  3POE A;  1IS4 A;  4AYU A;  1UMZ A;  1DFQ A;  1CZS A;  4BCU A;  2VTX J;  1ND2 A;  4RSU A;  3H0O A;  5JR7 B;  1DQ1 A;  1JZ6 A;  3UNP A;  3BIW E;  1GOH A;  4FQ4 A;  2DUP A;  4UBG A;  5JXI A;  2J7M A;  4XW3 A;  3D8C A;  4FP3 A;  4HSL A;  1QJY 3;  1H1A A;  1TZO A;  2XB6 C;  1LHW A;  1SHW B;  3MI8 A;  4EZH A;  4Q4X 1;  4FXG B;  1IG3 A;  2DCK A;  3WDT A;  1GP6 A;  1ENS A;  3CZU A;  4PJY A;  3Q9O A;  1VBC 1;  4LJH A;  1DZT A;  2WT2 A;  4A7Y A;  1V6N A;  2ZKL A;  3BUC A;  5DQ0 A;  5KHI A;  3AYA A;  5K0U A;  4DUX A;  1JYW A;  1KS4 A;  4GAL A;  4HSJ A;  2CGO A;  1VB4 A;  4AI3 A;  1OUS A;  1H2M A;  1LHU A;  2EAA A;  4CCE A;  2PMW B;  4ISR A;  4LBN A;  1RMU 3;  1MQT C;  4RGG A;  4YW6 A;  5C7G A;  4TZD A;  2GMP A;  5EZW A;  3OUH A;  4MET A;  1EUU A;  2BDR A;  5FYM A;  4BIF A;  3AVR A;  2Y26 A;  3USU A;  3ZYP A;  1UIK A;  3L2Y A;  3O5S A;  5C6C A;  1DQ6 A;  2VTX A;  5C3P A;  2GH8 A;  4M00 A;  4RQP B;  1UY4 A;  2W95 A;  1QKQ A;  1OF3 A;  4QQ2 A;  4AI0 A;  5FY4 A;  1Y9M A;  4YM0 A;  2G9Z A;  2XLG A;  3ETQ A;  3PDQ A;  4LBO A;  3SIS A;  1BK0 A;  1XNB A;  1QH6 A;  5FPB A;  4NRQ A;  2GND A;  2RV9 A;  3QCW A;  5IYY A;  2KXL A;  1S2K A;  1ZBE 1;  4Q4Y 1;  1OD5 A;  4XAC A;  1NT0 A;  3FUQ A;  4UFM A;  3VDD A;  2OQ7 A;  2WRA A;  1RUD 1;  3T30 A;  4CDU A;  4CU9 A;  4X8P A;  4AGG A;  1GV9 A;  3B3Q E;  4Q27 A;  4CXX A;  3K48 A;  2JEC A;  4COY A;  5GZC A;  1WLC A;  4RA0 A;  2BNO A;  4LOS A;  3VBH B;  1OF4 A;  1ENX A;  3C3V A;  4ZHN A;  2CDO A;  3A4U A;  4K21 A;  1HRV 3;  1QDC A;  1URX A;  4IE0 A;  5E89 A;  2ZKN A;  5FPU A;  1L7R A;  2R7E B;  3EMR A;  3RZL A;  2RM2 2;  5EJ3 A;  1Y3T A;  2WNV C;  2XQR A;  5EPA A;  4A42 A;  5D8A C;  5CBL A;  2PHF A;  5FY9 A;  2EIG A;  1JYC A;  1AXZ A;  3NAP C;  1GWK A;  1JUI A;  4QX3 A;  4QX1 A;  5DAW A;  4D7T A;  5HI0 A;  2JKX A;  1S1A A;  5T55 A;  4HFS A;  3RJ2 X;  3GBG A;  3WX5 A;  4XFF A;  3M3Q A;  3WNK A;  2GDF A;  2PQQ A;  2DTY A;  5A70 A;  1VB2 A;  2J1R A;  4QKD A;  4XYX A;  4B4R A;  1R09 2;  1XPW A;  5LBB A;  4FPK A;  4BME A;  1EV1 3;  3S0M A;  1IG0 A;  1IKQ A;  2DCZ A;  1MS0 A;  1QY4 A;  3DXU A;  1MVQ A;  1GQH A;  2VZT A;  1AJK A;  4JGZ C;  4OFG A;  1N47 A;  3PL0 A;  4PIZ A;  2W94 A;  5IVJ A;  1GWL A;  1F9K A;  1PGW 2;  1DLC A;  3FHQ A;  1R08 1;  5C9A A;  2DUO A;  5A3N A;  1O3S A;  3HBK A;  2OS2 A;  5GLW A;  5I0S A;  4OMC A;  2IVJ A;  1FI2 A;  2ZGO A;  4CXY A;  4J1X A;  1SZB A;  4XJU A;  1TEI A;  1HXS 3;  2FHR A;  3AXD A;  4TSV A;  3POW A;  5L7O B;  1K42 A;  2UU8 A;  2UWB A;  2EA7 A;  3M2M A;  4LQR A;  3OUJ A;  3VKN A;  2BOJ A;  4FPJ A;  3GHN A;  4O9G A;  3TN9 3;  5A3U A;  1GZ9 A;  2XUM A;  4Y1Z A;  5FMD A;  4MGT A;  2WZ8 A;  2BGO A;  4IE6 A;  3SEE A;  1ZZ9 A;  4WBB A;  3DCQ A;  1T6B X;  2A6Z A;  1RJ8 A;  2HKX A;  2BWC A;  4FO9 A;  3VZN A;  4LO7 A;  3WQ0 A;  3E5X A;  4RHV 1;  1YI7 A;  1COV 3;  3BVC A;  1GZW B;  1VR3 A;  2QQK A;  1W6P A;  3POS A;  1RHI 1;  1ULP A;  1ASJ 2;  2UY9 A;  2VQ0 A;  2WS9 1;  3BB6 A;  3GM8 A;  3LPF A;  1V70 A;  2Q8C A;  2K0G A;  1W6M A;  2DF7 A;  3T3Y A;  2WII B;  4DO0 A;  3AJZ A;  4CSW A;  5C3Q A;  5F7U A;  3WEZ A;  1PGS A;  1SAC A;  2BVB A;  2GAL A;  2WO7 A;  5LB6 A;  2XHK A;  1JZ8 A;  1AR7 1;  3A21 A;  2JG9 A;  1UOB A;  3IZO A;  3OGJ A;  4AK3 A;  5FQ0 A;  2A6X A;  3DUI A;  4IUG A;  1LHO A;  1NLR A;  3I59 B;  3AKS A;  3PIG A;  3JXS A;  2WZR 3;  4FTE A;  5BXX A;  2PQS A;  4FFI A;  1VAL A;  2W0X A;  2WFF 3;  5FK7 A;  1GNY A;  4L99 A;  3ZFG C;  5C5U A;  2RS1 1;  2ZZQ A;  2Z4F A;  4P14 A;  5KC5 A;  2HWE 3;  4CUA A;  1UYZ A;  4Y5S A;  2B8M A;  2YBP A;  4UW5 A;  1US2 A;  4LHS A;  5FLJ A;  2IXJ A;  2BP6 A;  2EAK A;  2X29 A;  3FC0 A;  3POI A;  4ZXE A;  3I2H A;  3KCX A;  4P9W A;  4Y22 B;  4AFM A;  5FOJ B;  3AYD A;  1OMI A;  1C8N A;  4GB3 3;  3K75 B;  4XDO A;  4CEY B;  3L2H A;  4RR3 C;  1UQX A;  5GKA C;  5BNO B;  1D2S A;  1KIT A;  4CCO A;  4P9Y A;  4Q1R A;  5E16 A;  2G1M A;  3HN3 A;  1VBA 2;  2XKP A;  4XQD A;  4AFC A;  1AX2 A;  1YQ2 A;  2MHF A;  4JDM A;  1B35 B;  4Y33 A;  1GQP A;  3RQ0 A;  1NCR A;  2JB4 A;  5T50 A;  3OPT A;  3NNM A;  5ISL A;  5IAX A;  1UZW A;  4JV4 A;  4N53 A;  3I3E A;  2D40 A;  2XWJ B;  2HLE A;  3CJI B;  1XBF A;  5IFT A;  4BQ1 A;  1JZ4 A;  3IKW A;  4KI5 M;  4CUG A;  5KR7 A;  4BHP A;  1AX1 A;  1MAC A;  4JZR A;  4TLG A;  2JXA A;  1HB3 A;  1O5U A;  1PM4 A;  1OKO A;  2O14 A;  2OPK A;  5BNP C;  4MGK E;  2ATF A;  4R8H A;  3CZJ A;  1BEV 1;  3RG0 A;  1REE A;  1K45 A;  4KBZ A;  3RJR A;  2VAU A;  4AAP A;  4AXO A;  3I2I A;  1FV3 A;  1PK6 C;  1DGW A;  1YQ5 A;  4IEU A;  1RUH 1;  4H7L A;  4PIY A;  4V2V A;  5FIX A;  3WNM A;  1UU4 A;  3IAQ A;  1YEW A;  1WBF A;  1RUG 2;  3K51 A;  5JIU A;  2P5B A;  2PHT A;  5EXO A;  4WM7 A;  5EV7 A;  4NRP A;  5GZG A;  1X50 A;  1NLQ A;  2CAU A;  2VY0 A;  4WVM B;  1ACC A;  5FCC A;  1Z7S 3;  2A7A A;  3IBM A;  4KH9 A;  2EVX A;  3RZZ A;  3HNY M;  4RGK A;  3SH4 A;  4A7K A;  1RUN A;  1O4Z A;  1PO2 3;  1MEC 1;  3LFM A;  4YGE A;  4Q5O A;  2D3R A;  1NA1 A;  2R06 3;  5C3S A;  3UKV A;  3ZOI A;  3KGZ A;  2WLP A;  3MZH A;  1CZT A;  3VL9 A;  4WM8 A;  5IJR A;  4HVR A;  4MG2 A;  3LB9 A;  2VM9 A;  2Q1F A;  3EO6 A;  1AR9 1;  2BU9 A;  1UOG A;  1QEX A;  1QDO A;  4ONU A;  2XML A;  3CEW A;  1OUR A;  2ZEY A;  3VHO A;  4COV A;  1SDD B;  2XON A;  4FPO B;  3T08 A;  3VZO A;  2B9V A;  3LA2 A;  1ULC A;  1FOD 1;  1RUF 3;  1DYO A;  3S6P A;  4QB1 A;  3OGG A;  2NMO A;  2R04 3;  2VZO A;  3ORJ A;  5GZD A;  5A80 A;  2YZ4 A;  4Y4Y A;  4MHU A;  4NJ4 A;  3R05 A;  1O8P A;  3PTY A;  3ZO0 B;  1VBE 2;  1DQ5 A;  5DZF A;  1FNY A;  1GP4 A;  3B94 A;  4KNC A;  5EWS A;  1L7Q A;  4AR2 A;  5IVF A;  2XJR A;  5CIR A;  2XLA A;  2WNU B;  3EYP A;  4ARY A;  4CCL A;  1RYY A;  4MUV A;  4AQ6 A;  4P08 A;  4KWU A;  1J1L A;  1AL2 1;  1UW8 A;  2XJS A;  3I8T A;  3OGR A;  3PUR A;  3IDC B;  3M3O A;  1LOC A;  3QLQ A;  1Q8O A;  1V9U 3;  4AGR A;  2ZML A;  3V0A A;  1O3R A;  3ZN4 A;  2VZV A;  5DDJ 3;  3RZM A;  5FYZ A;  2WDB A;  2DCY A;  1AYM 1;  1VRH 1;  1UL9 A;  3U07 A;  3DPR A;  2J42 A;  3IPV A;  5CVR A;  1O6U A;  3WP6 A;  4CDQ A;  3U10 A;  3AZZ A;  3KVA A;  3D0S A;  1QJY 2;  4I02 A;  2QVS B;  3I49 A;  1RL3 A;  2H0V A;  5GJ6 A;  4XIO A;  4LOR A;  2F17 A;  3RS6 A;  3M3I A;  4KBB A;  3WHU A;  4A6O A;  1PM7 A;  1GMM A;  3ACF A;  3MFC A;  3FBM A;  2NMN A;  4AHW A;  2DU1 A;  4KG0 A;  1YJL A;  2GC3 A;  3SLI A;  1DCS A;  1A34 A;  4LIU A;  4R9B A;  5DN2 A;  5AC9 1;  1CAU B;  1YLL A;  1MZ6 A;  4LIV A;  4QPW A;  1RMU 2;  4XFC A;  4E2S A;  2X09 A;  1A3K A;  1ND3 B;  1SLI A;  2AEY A;  3TRS B;  1B09 A;  2D6M A;  2CU5 A;  2D93 A;  2R0H A;  2VZS A;  3OEA A;  4XIL A;  4COU A;  4Y26 A;  3CU7 A;  4IET A;  1C57 A;  1JBC A;  5FZ4 A;  2O1Q A;  2WWJ A;  3MLL A;  3JU9 A;  5AFB A;  2OA2 A;  3M3E A;  3PUS A;  1O91 A;  4Y20 A;  2ZGK A;  3ROU A;  4AVV A;  2WN3 A;  4CCC A;  5F9T A;  3UYJ A;  1POV 3;  2KR2 A;  4CEW B;  1C5I A;  1QOO A;  1SFP A;  4FOY A;  3WCS A;  1S0B A;  2VXJ A;  2W47 A;  3LDK A;  4RS5 A;  5JOZ A;  2ARC A;  4Q4W 3;  5A6Z A;  3MUY 1;  4MO3 M;  2JX9 A;  5E6H A;  4LXL A;  2JG8 C;  2VUL A;  2HEV F;  3KV5 A;  3PU3 A;  1UPS A;  1L7L A;  1I5P A;  1XE7 A;  3O0X A;  1K3I A;  2LM3 A;  5AFE A;  1ZVF A;  3THT A;  5IVY A;  2VO5 A;  4A4A A;  4CP9 A;  1PGL 1;  5C8C C;  4ITC A;  1G9C A;  1JHN A;  5FY1 A;  1DGL A;  4IEP A;  4EN8 B;  1XB9 A;  4HK9 A;  4BM8 A;  3DKQ A;  1WCQ A;  4XIK A;  1NCQ A;  1OT5 A;  2A1X A;  2VUD A;  3Q8C A;  4YFZ A;  2FCU A;  4BH9 A;  1UY1 A;  5CFD B;  1OH4 A;  2QUO A;  4FPH A;  3S7I A;  4W4Z A;  1JYN A;  5DZG A;  2GNM A;  2HWB 1;  3K4Z A;  4UI9 L;  2EAL A;  5CNA A;  1HRV 2;  4QGN A;  5ACA 3;  2ZX3 A;  1Q8V A;  4LE4 A;  4A45 A;  4NIH A;  3VBS A;  2Q1Z B;  1JN2 P;  3N9Q A;  2Q8O A;  1MS8 A;  2MEV 1;  4K6B A;  2WO3 A;  5ABJ B;  4IER A;  2VTF A;  4I2O A;  4W6X A;  2RJL A;  2FDI A;  1WLW A;  3A23 A;  4OHW A;  4FI9 A;  2PLV 3;  2Q30 A;  3H3Z A;  4O61 A;  3LIG A;  5FRA A;  5FZ8 A;  5FZ0 A;  4NPR A;  2JIC A;  3FJS A;  2B4K A;  4LBK A;  2W9X A;  4H55 A;  3M3C A;  2ZAA A;  3ME2 A;  4E8D A;  2Z5W A;  4B4P A;  3LEI A;  4I01 A;  4BMB A;  2H6C A;  1EV1 2;  3HOB A;  3A22 A;  2ZEZ A;  5FXX A;  3GJB A;  1PVX A;  1UYX A;  2A5Z A;  4XEZ A;  5FLH A;  4AI8 A;  3WHT A;  4A3X A;  1VBA 1;  2GH2 A;  3GZT B;  4IEW A;  4XZU G;  4UWD A;  1BBT 1;  1UX6 A;  2RDQ A;  2ARE A;  2RHP A;  2TBV A;  1RVF 3;  1TMF 3;  3J7N A;  4IV3 B;  2VXR A;  3WF3 A;  1DDL A;  3BU7 A;  4QWN A;  3WW3 A;  4AF9 A;  3HIF A;  2FDF A;  4BB3 A;  4OUS A;  4DB5 A;  1GOF A;  3J7H A;  4NHK A;  5AVP A;  1GR3 A;  5IWF A;  2E7T A;  3TN9 2;  3WD5 A;  4CA9 A;  5LA0 A;  2WSV A;  1W6O B;  2SLI A;  3DYP A;  2BJS A;  4ORF A;  3I2O A;  3ZIX A;  1KFX L;  1MQT A;  1VBD 3;  4S2G A;  5CFC C;  2RR1 3;  3BTY A;  1WCK A;  4AL9 A;  3E5Q A;  4YWA A;  1GIC A;  1RUC 3;  1W0P A;  5JVV A;  2ZJC A;  3VKO A;  4YSF A;  1W03 A;  3OBT A;  1O59 A;  5LW9 A;  3JBG 1;  4A7Z A;  1ND2 B;  1COV 2;  2BEO A;  5JLV A;  1C3H A;  1QJZ A;  3CF6 E;  4HBN A;  1DF0 A;  1YUD A;  4XPV A;  4YFW A;  3WCR A;  5GAL A;  5LY1 A;  4OI4 A;  2DBI A;  3VBO C;  4BIS A;  2X5I B;  1E57 A;  4AQ2 A;  2D7F A;  4ET7 A;  1RUG 1;  2RG4 A;  3FLT A;  5H9R A;  3HQR A;  5DUW A;  3FE5 A;  5KXC A;  2XGX A;  1JYX A;  2XOM A;  2C1F A;  2ZTN A;  3VL8 A;  1PO1 1;  2CTV A;  5K0U B;  1MPX A;  2JIG A;  3FLR A;  5FJK A;  3FHI B;  3OTF A;  3ITQ A;  3MW3 A;  2JE9 A;  4AEM A;  4C8D A;  4R9A A;  1ZRD A;  2B9U A;  2WZR 2;  2QQJ A;  5IVB A;  2YB7 A;  1I9R A;  2DUR A;  5JPN B;  3AYE A;  2VCM A;  2XH6 A;  3GBF A;  4CCM A;  3OBZ A;  1UY2 A;  3CBN A;  1U5Y A;  2WFF 2;  5FP3 A;  4PQ9 A;  1JYV A;  1F2N A;  1NYW A;  2A73 B;  2HWE 2;  3THC A;  4W8J A;  1BMV 2;  5AVA A;  2QDR A;  3USU B;  1LHV A;  5ANN A;  4JTN A;  2DV9 A;  5DAX A;  3SH5 A;  4A3Z A;  3RDI A;  2BUK A;  1HN0 A;  5ERL A;  2WFP A;  2IUW A;  3E6B A;  3J7L A;  2WKK A;  3LWC A;  1UU6 A;  4GB3 2;  4WZF A;  1SPP A;  3TWI A;  2WZE A;  4OI2 A;  1YI9 A;  2XHN A;  4NIG A;  2HWF 1;  4HXC A;  3SEP A;  4Q0Q A;  3NAP A;  1YO8 A;  2W2I A;  3M1H A;  1RJ7 A;  1AYN 1;  1OQ1 A;  1NE6 A;  4YVS C;  2YPD A;  3C7G A;  3WW4 A;  1H9P A;  3GHM A;  3T0D A;  4QX5 A;  2E53 A;  5BNN C;  2Y6K A;  4Q4V 3;  3VDD B;  5JI7 A;  1FMD 1;  4NHM A;  3OBA A;  4DS0 A;  4ATF A;  2AAC A;  3ABZ A;  1X82 A;  1PIV 2;  2P34 A;  1VMF A;  4CDU B;  5T5O A;  1F31 A;  3N35 A;  2BRT A;  4AED C;  5C4W A;  2J1E A;  1ALY A;  4YW2 A;  2YU1 A;  3HNM A;  2PAM A;  2QCS B;  1KRI A;  3WNX A;  3FHA A;  5C33 A;  1ODM A;  1OI6 A;  2ZAC A;  1YRZ A;  3AP7 A;  3W58 A;  3AP6 A;  4CDW C;  3D0J A;  3MF6 A;  3O7O A;  4GH4 C;  1QOS A;  1W0O A;  1UZV A;  3AKP A;  2PHL A;  3LEM A;  2E63 A;  4E9K A;  5KWR A;  2ARA A;  4FPC A;  4XUN A;  1CWP A;  3C2U A;  3CLP A;  3FL7 A;  4M4P A;  3LKJ A;  4X6R B;  4E27 A;  2W1Q A;  1Z7S 2;  2BBA A;  3H7Y A;  5K4L A;  4XET A;  1HV0 A;  2TNF A;  4XOG A;  5IAT A;  3JD7 3;  4XF1 A;  2GP5 A;  3WXP A;  4N90 A;  2E7Q A;  1PO2 2;  5C9A B;  1QHD A;  1ZNP A;  3B9C A;  3AZY A;  3EXU A;  1PNF A;  5IHR A;  2R06 2;  2XWB B;  5F1R A;  1LOF C;  2DVF A;  1HN1 A;  4B4Q A;  1HV1 A;  3UL2 A;  2X10 A;  2XL7 A;  2VBD A;  4COZ A;  1QJX 3;  4NHX A;  1AR6 1;  4O9E A;  2WO2 A;  4BA6 A;  2VL4 A;  2FDK A;  2XJU A;  4UF0 A;  3SIT A;  2P2K A;  1PMH X;  3GYD A;  1CIY A;  5FZ3 A;  3DYM A;  1RUF 2;  5JWP A;  2FD8 A;  3GCX A;  2JDP A;  2R04 2;  1ND3 A;  4W65 A;  1IOA A;  1OSG A;  1UOJ A;  2BQP A;  3LEG A;  1ZRE A;  4L9B A;  4P9G A;  1AR8 3;  4WVW A;  4XQ4 A;  1E5I A;  1W6P B;  2FMD A;  1CX4 A;  2HYK A;  4YVW A;  5GZE A;  3U78 A;  3KV9 A;  1ZRC A;  1W6M B;  3M70 A;  2EIB A;  4RR3 A;  1FPN 3;  3WUD A;  4BDV B;  1XRU A;  3PJY A;  2MPF A;  4RQP C;  2ZHM A;  4CEW A;  2R32 A;  3LIH A;  4C0B A;  1TME 1;  1CPN A;  2OVU A;  2ZEW A;  1WMD A;  3VZL A;  2JG9 B;  2VNG A;  3VGI A;  3BOD A;  1V9U 2;  1OKQ A;  3ASI A;  4XFI A;  2RDR A;  5FQ0 B;  2D6P A;  1WMF A;  3V56 A;  3ZVX A;  2ET7 A;  2B5H A;  1RXG A;  4LKF A;  4C91 A;  5JAX A;  3RWK X;  3S5Q A;  2JDZ A;  5DDJ 2;  2N7G A;  5E88 A;  5FY8 A;  5FYB A;  4R52 A;  4K20 A;  5LEJ A;  1SBE A;  1C8M 1;  3KB5 A;  4IEQ A;  5HV0 A;  3O1U A;  5FO7 B;  1RUI 1;  1D0H A;  5KXB A;  1PVC 1;  2CAV A;  3VZJ A;  2ZCW A;  5BNP A;  4O65 A;  3ALQ A;  4ZU7 A;  3BU0 A;  3ZSE A;  4MGS A;  2QQW A;  3W59 A;  5J48 A;  2V5Y A;  4XUR A;  1F5F A;  5SV8 A;  1X7N A;  3WP5 A;  5A6X A;  1NCR B;  2GNT A;  5L9B A;  1HB4 A;  2CWS A;  2VCB A;  3AP5 A;  1YQC A;  3KMH A;  4XE9 A;  5TSW A;  2YC4 A;  3H8R A;  2AZ5 A;  4X8N A;  4PDW C;  5JPM B;  2PHU A;  4N53 B;  2IXK A;  5LA9 A;  4B29 A;  2W52 A;  2ZZJ A;  3PMS A;  4MYE A;  1APN A;  4Y3O A;  5FKC A;  2HWD 3;  1LEM A;  2CHH A;  3N36 A;  5LRR A;  4LUL A;  5D21 A;  5FY7 A;  1W2A X;  2PAE A;  4NPM A;  2XBO 1;  4J25 A;  1DBN A;  4NR1 A;  4Q4W 2;  3TAY A;  1UYP A;  2VMI A;  1W2O A;  1YC6 1;  4E2G A;  2RS3 3;  3VBU B;  5JCT A;  5L7O C;  3H8X A;  4P9I A;  5FO8 B;  1YXW A;  3LSE A;  1LU1 A;  1GYK A;  4WM7 B;  3J9S A;  4HL0 A;  2WAB A;  3BKZ A;  4NID A;  4KGG A;  1UXX X;  2BYV E;  5F5Q A;  1YWK A;  1F5J A;  1POQ A;  2JDA A;  5FYT A;  3W5M A;  4DY3 A;  2O0O A;  1LU2 A;  2VNR A;  1QIQ A;  4LBL A;  2P6C A;  1X36 A;  3LEK A;  5BYN A;  1C28 A;  3NJV A;  3OD4 A;  4FCA A;  2PHD A;  4HN1 A;  5GZF A;  4AW7 A;  4EN9 B;  4CUB A;  5ACA 2;  1NA1 B;  4QT6 A;  2ETE A;  4EE2 A;  1SBD A;  1UAI A;  1U12 A;  2X5I A;  4TYS A;  4WM8 B;  2A6Y A;  5FZL A;  1UPI A;  4Y4R A;  4ZS2 A;  2V72 A;  2BNN A;  4LBQ B;  5J09 A;  2VBP A;  2IWG B;  2PLV 2;  1W6Q A;  5DUV A;  3N7L A;  3BPZ A;  4B7K A;  3E5U A;  3J8F 3;  1JYT A;  5F6L B;  4KU8 A;  2UUR A;  4MSV A;  3IIA A;  3ES4 A;  4NE9 A;  4PT6 A;  1G9D A;  1RUE 1;  4GJY A;  2VG9 A;  4TTG A;  4D7S A;  1ULE A;  2DUQ A;  5FFO C;  1GNZ A;  2VBB A;  4OLL A;  5G04 L;  4S2F A;  3IWZ A;  2Y0I A;  2A3Y A;  4L92 A;  3H8O A;  1K5J A;  3MV0 1;  3P3P A;  2VJX A;  1RVF 2;  1TMF 2;  3POY A;  1RXF A;  5K8S A;  4P02 B;  4ZON A;  1ZZ8 A;  3D5O A;  3KD4 A;  5KHK A;  4AI2 A;  4CEY C;  3FN9 A;  5BNO C;  1QXR A;  2R07 1;  3AMP A;  1PIV 1;  3JQX A;  1W06 A;  4I3G A;  5CZK A;  3USS A;  4GMP 0;  3ZMN A;  2JB8 A;  1Q3E A;  1VBD 2;  4Z82 A;  5FWJ A;  4CDX A;  2RR1 2;  1J84 A;  1MZF A;  2QTW B;  4GA9 A;  1RUC 2;  4YGB A;  3U1X A;  3ZM8 A;  3V0A B;  4LBM A;  1HRI 1;  1Z78 A;  4Q8L A;  1OOP A;  3RYP A;  1XYP A;  1N1T A;  5LBF A;  3M4F A;  3DPR B;  1XYO A;  5KHG A;  2I07 B;  3IPV B;  4CDQ B;  2QZ3 A;  3WZ1 A;  2VOV A;  3MIE A;  1XSQ A;  4LO8 A;  4URT A;  4M3C A;  4AG4 A;  4YM2 A;  3R0R A;  5B4N A;  5JSO A;  3KT7 A;  3CJI C;  1GWM A;  2DFB A;  2XJP A;  3RZH A;  4UFL A;  2C9A A;  4JRL A;  3HNB M;  5LA2 A;  4H7M A;  3FFQ A;  5FMO S;  4I0W B;  2QQI A;  4MVT A;  4IV1 A;  1AXY A;  5CU1 A;  5DAP A;  3M8L A;  5JZG C;  3N4M A;  2QQV A;  2BOI A;  1O5L A;  3D3A A;  2YG0 A;  3GCW A;  3MV1 1;  5EJ1 B;  5A7O A;  4AVC A;  4EWD A;  5C8C A;  4LLO A;  4UFH A;  2GC2 A;  5I8Y A;  2E32 A;  2XL9 A;  1YQ8 A;  1S2E A;  1WD4 A;  2JE7 A;  2PHR A;  3RVH A;  3SCF A;  4FTB A;  3WUC A;  4GWI A;  3PVB B;  3RMY A;  4BWO A;  1W3X A;  3AMH A;  4IQP A;  3U4S A;  3OY8 A;  3G6J B;  4S2H A;  3RZK A;  5FZB A;  1OQD A;  4Q8K A;  4Y1X A;  4Y20 B;  3Q8B A;  1H30 A;  1SMV A;  2EXJ A;  1ZYB A;  2B45 X;  2ZXQ A;  2YXS A;  5LAS A;  4QPI C;  2C5D A;  4ZU4 A;  1YYN A;  3WG1 A;  4RS5 B;  4NIA A;  4LHK A;  4PHZ A;  2YY1 A;  1ZZ6 A;  1SQ4 A;  5F3I A;  2ZHN A;  3UT0 A;  3GDB A;  3OJB A;  1EYB A;  5H9Q A;  4YZ4 A;  2GSY A;  1H8T A;  5T52 A;  2ADD A;  3T2T A;  4H2A A;  4CP9 B;  4UAP A;  3IN9 A;  1JU4 A;  1PX4 A;  3NRU A;  1OFN A;  5CA6 A;  3DKW A;  4M3C E;  3IAP A;  3IMN A;  4AQT A;  3NV3 A;  4Q4V 2;  1F8V A;  1OLM A;  3J7M A;  2PHW A;  4Y1U A;  4LKD A;  1DZQ A;  1NCQ B;  2X05 A;  2EF6 A;  4XCA A;  5KBF A;  4HKW A;  5GLZ A;  2RJ2 A;  1RUJ 3;  3MPP G;  4HOO A;  4LBQ D;  1ST8 A;  3S57 A;  1D0G A;  1ULF A;  4HET A;  3WP4 A;  5DAQ A;  3UKN A;  1YHF A;  4K1Z A;  2ILM A;  5G05 L;  4QU2 A;  3VUO A;  2DFC A;  1VBB 3;  1ZBA 3;  4XFB A;  1JUH A;  3III A;  3HQU A;  3SH3 A;  1W8F A;  3VBS B;  1DQ0 A;  1JOP A;  1LCL A;  1UKR A;  4A6S A;  1XQN A;  4JDO A;  2WNU C;  4MGI E;  5LK5 A;  1D4M 3;  4UW6 A;  5JUV A;  2UYA A;  2HWC 1;  4G9S B;  1W6N A;  1WME A;  1REF A;  2P3I A;  2XJV A;  3C7F A;  4K7J A;  1UMI A;  1PZ7 A;  5CG8 A;  3Q8A A;  2ZOE B;  4MH0 E;  5F2W A;  4IW3 A;  4DXZ A;  1W99 A;  3H42 B;  3JD7 2;  2ZGR A;  3LOI A;  2VZU A;  3ATG A;  3WF1 A;  5C70 A;  3VDC A;  4AVA A;  4UOJ A;  3N7M A;  5IK4 A;  4PLO A;  2XVK A;  5CKM A;  4BOW A;  1CAW A;  2Y0O A;  2F4L A;  3E6C C;  3KWV A;  3ZFE A;  1O3T A;  3LFI A;  5HXV A;  4N8M A;  2XR4 A;  1EUT A;  3U0Z A;  2GC0 A;  3ZFF C;  4BQY A;  3FLP A;  3AB0 A;  1Q8P A;  2Z69 A;  1UO9 A;  2QQO A;  3NL1 A;  1OLM E;  1QJX 2;  2RMU 1;  1QQP 1;  1U5Z A;  4OHX A;  5FKB A;  2QQM A;  5L7O A;  2AC1 A;  1UF2 C;  3FFZ A;  2WYF A;  3AYC A;  1HKD A;  1MQT B;  3K2O A;  3WNN A;  1YQ6 A;  2NZ9 A;  3K4D A;  1IZ3 A;  2XVL A;  3CQO A;  4QB6 A;  4KU7 A;  3VBF A;  4E4D X;  3BGA A;  4ASM B;  1VBC 3;  4QQP A;  5IVV A;  4NOT A;  1J83 A;  1AR8 2;  3WG4 A;  2ID4 A;  4HK8 A;  1OUX A;  1UZY A;  3C7H A;  2WUH A;  3H50 A;  5A3O A;  5A32 A;  1NE4 A;  3WOG A;  4DRR A;  5HCF A;  4YAR A;  4QPY A;  3NNG A;  3BI3 A;  4IE7 A;  4LE3 A;  3BYW A;  1FPN 2;  4HON A;  3OD0 A;  4QXK A;  3ACG A;  4XBL A;  4OHY A;  1DP0 A;  3HMY A;  5FZA A;  4XUQ A;  2WO1 A;  3AXE A;  3ES1 A;  3KHB A;  2RDN A;  5F39 A;  3VBR C;  1BVV A;  5C5T A;  5LRS A;  1R1A 1;  3LOB A;  4YW1 A;  4YVS A;  2AR6 A;  3KVB A;  4QDS A;  1ZRF A;  3VBU A;  3VZM A;  5FYY A;  5A1L A;  1LOB A;  2ZGU A;  1Y9Q A;  2ZGP A;  3CJX A;  2BVV A;  3OCP A;  3NJY A;  3R4U A;  1XC6 A;  3WSO A;  3KCC A;  2R0F A;  3DXT A;  4FOQ A;  3RMX A;  4NHY A;  3OPW A;  1OBN A;  1QJE A;  3I2G A;  5FPZ A;  3T2P A;  1JS9 A;  4P9J A;  4AVT A;  4OZX A;  4YM3 A;  1NY7 2;  3KCY A;  2FDJ A;  3UGF A;  2ZX4 A;  5I91 A;  3A0N A;  4JGY A;  4NRO A;  4AEJ A;  1ZBE 3;  4Q4Y 3;  1KJL A;  2CGP A;  4KL1 A;  4G4F A;  5A7Q A;  1W8N A;  1SPP B;  4XC9 A;  1ZX5 A;  1XYN A;  2ZGN A;  4PBO A;  4CP0 A;  4GH4 A;  4K40 A;  1GQG A;  3NAP B;  1UOF A;  5FPV A;  2NYY A;  3MPB A;  4J6G A;  3B93 A;  2J1S A;  3S30 A;  1LGN A;  2NN8 A;  4KG8 A;  3PLQ A;  4LKE A;  4LBQ A;  5FYC A;  4CU7 A;  5ABJ C;  4FOW A;  5FP8 A;  4JCK A;  5FZK A;  3VDB A;  2D6O X;  1LOE A;  1JYI A;  3RI8 A;  1V0A A;  3LQC A;  5FK8 A;  1CAX A;  3ZYB A;  3NV2 A;  1Y4W A;  2V4V A;  2AUY A;  4IDZ A;  4XUO A;  4D8M A;  1CR7 A;  2P4E A;  2UWA A;  3ZLI A;  4IES A;  3IB3 A;  5C4W B;  2D5F A;  1LOG A;  1RIN A;  2HWD 2;  4JRA A;  4L8Q A;  4XAE A;  1QXJ A;  2OT7 A;  1G6N A;  5JSP A;  4EQV A;  4DQA A;  2GNB A;  5E8A A;  4QDR A;  4S2D A;  1EY2 A;  1XJA A;  5F3E A;  3GJA A;  3SCG A;  1WA6 X;  1UYY A;  2RS3 2;  4IV3 C;  3WQB A;  4Z8B A;  3L9J T;  4BQ5 A;  3T0B A;  5A7S A;  1R08 3;  2P3J A;  4JHT A;  2QQU A;  2WSU A;  2WR9 A;  4LNV A;  2JEM A;  5LAT A;  5GM0 A;  4I3P A;  3IDA A;  4FT8 A;  1S0G A;  2R1B A;  2P3Y A;  1SFN A;  4SBV A;  4JKM A;  3WLU A;  3ZSM A;  1UZ0 A;  1KFU L;  3MID A;  1XU2 A;  1OPM A;  3B00 A;  5EQU A;  2DVD A;  4YZ5 A;  4QQL A;  2WT1 A;  3N9O A;  4LT5 A;  1GUI A;  1ND2 C;  2RM2 1;  3WW1 A;  1NZC A;  4AAX A;  1W8H A;  4L2N A;  1WCU A;  2ZMK A;  4YZ3 A;  5CKN A;  1MS3 A;  1XNA A;  3AL5 A;  5FO9 B;  1JOB A;  1LGB A;  5FYV A;  2ZAH A;  2BFU S;  2V09 A;  1A8M A;  2QJV A;  4IE4 A;  4RHV 3;  4FTS A;  2VCA A;  1R09 1;  2X8K A;  1KQR A;  1GLH A;  1RHI 3;  2WS9 3;  4UF0 B;  4X6Q B;  5K0U C;  3J8F 2;  5IK8 A;  3BOP A;  5JXG A;  3KS7 A;  1E5H A;  4E4S A;  5IK5 A;  5FZO A;  1PGW 1;  2JE8 A;  5IVC A;  4BQX A;  5JXH A;  4FFG A;  3ZSL A;  2VVE A;  4P5Y A;  3TYJ A;  1BVP 1;  5JI9 A;  2C6S A;  1AR7 3;  1S0D A;  3TNQ A;  2ZBJ A;  4D94 A;  2IXC A;  3JZV A;  3WR0 A;  3POG A;  3UGH A;  3O14 A;  4LA3 A;  2P6H A;  5DG2 A;  4YVW B;  4YRD A;  1U5I A;  3ZXK A;  4R9D A;  4RR3 B;  4DZG A;  4MX3 A;  3O1S A;  1UN1 A;  3WF0 A;  2YUE A;  1AVB A;  2RS1 3;  2WNO A;  3PVE A;  4FPG A;  5F37 A;  1UX7 A;  3INA A;  4IND A;  4JHZ A;  4HPK A;  2D97 A;  1ONA A;  4XJ8 A;  1XE0 A;  1GBG A;  4CUC A;  4OQ8 A;  2GN7 A;  5FXV A;  4ZPI A;  4HLT A;  4FP2 A;  3S7E A;  1GU3 A;  1I5Z A;  4XJ9 A;  5EHD A;  2YBK A;  3AC0 A;  2ADE A;  3VB9 A;  1EP0 A;  3KT1 A;  4PDW A;  4Q29 A;  1ASJ 1;  2E51 A;  3CDZ B;  5KC6 A;  1MS9 A;  3DL3 A;  3H8U A;  3OGS A;  2ZAB A;  2RJK A;  3LDB A;  1JU3 A;  1OVP A;  2DCJ A;  2IXI A;  2QQL A;  4KQ7 A;  4QD2 A;  4HZF A;  5JR2 A;  5I0D A;  1F35 A;  5LBC A;  2D3S A;  1K5M C;  4LPL A;  5BNP B;  3VZK A;  2GZW A;  2ZX2 A;  3I54 A;  5DUX A;  5HCA A;  5D1I A;  3VD4 A;  4EV0 A;  4JX0 A;  5E1R A;  3NKG A;  5A7W B;  4CZS A;  4QXH A;  1V6O A;  3BN6 A;  1JZ3 A;  3BTX A;  1EPW A;  4LA2 A;  1N3Q A;  2P17 A;  4LOT A;  4QDQ A;  2OII A;  4D6Q A;  1SDW A;  2Y6J A;  2CWM A;  2DCT A;  4NAO A;  5FBZ A;  5EFU A;  1BEV 3;  3ILN A;  3R6S A;  2IXH A;  1Y9G A;  2YC0 A;  2JD4 A;  4IEX A;  4YW4 A;  3ZSK A;  3KHC A;  3NMB A;  4MXW A;  4XF4 A;  1WWY A;  1RUH 3;  4GJZ A;  2D6N A;  5I8S A;  3N9N A;  4BLI A;  1SEF A;  4F3J A;  3IMM A;  4RFR B;  2UYB A;  4L0P A;  1IHM A;  2C4X A;  2VMH A;  5DZE A;  4YGD A;  1DYP A;  1WKY A;  4DY5 A;  1CZV A;  1HXS 2;  4QB2 A;  5FYI A;  2BPA 2;  1C4R A;  1QNW A;  4FOV A;  3RWN A;  2K9Z A;  1J1T A;  1MEC 3;  4ZY9 A;  4IL7 A;  1S0I A;  2I2S A;  3MIC A;  2YDE A;  2WQZ C;  4ZZ8 A;  5KXE A;  1V6M A;  1ZRI A;  5A7P A;  3I2F A;  4IEV A;  4JKL A;  2K46 A;  2WQ4 A;  1AR9 3;  1G9A A;  4MV2 A;  2LW8 A;  1W3V A;  1RUJ 2;  3ZPY A;  5BUV A;  3H9A A;  4QPG C;  5DMY A;  1G86 A;  1WGP A;  4P00 B;  5FUN A;  1VBB 2;  1ZBA 2;  4R9C A;  1FOD 3;  3V0B A;  2AEZ A;  5JOW A;  3LE0 A;  1W9T A;  2EXH A;  1WUV A;  1H2N A;  1HDK A;  1CX1 A;  1D4V B;  2GC1 A;  4FPE A;  1C1F A;  2VZ1 A;  2UY8 A;  3U37 A;  4N7U A;  4TWT A;  1D4M 2;  1GKB A;  1JTZ X;  2VW0 A;  3NV1 A;  1QJU 3;  4YPJ A;  1GAN A;  3APB A;  4FPL A;  1W6Q B;  1F4H A;  3NNJ A;  3CNA A;  4GMP 1;  4P9X A;  2JG9 C;  3MIG A;  1XU1 A;  1GSL A;  5L73 A;  1UNB A;  4LUK A;  4C1W A;  4YZ2 A;  2J22 A;  1NKG A;  3O0V A;  4YGC A;  5LWB A;  1POV 0;  2JEN A;  3PVO A;  2WWU A;  5CAD A;  4PF1 A;  1AL2 3;  4I09 A;  4CXW A;  1AXK A;  1DQ4 A;  3B02 A;  2VMF A;  5GLV A;  3OB8 A;  3FX3 A;  3MYX A;  3NJX A;  2WL1 A;  3SC7 X;  3WNO A;  1NOV A;  1GFF 2;  3RSJ A;  2WT0 A;  5JZG A;  1AYM 3;  1VRH 3;  3MHZ A;  2TUN A;  2WNV A;  2PHX A;  1OPO A;  2W08 A;  3JB4 C;  4RFT 0;  5D8A A;  3WQ1 A;  1FAY A;  3J4U H;  3ZR6 A;  5L9V A;  3OSD A;  2NQY A;  4XJZ A;  2Q8E A;  4GQ7 A;  4MHR A;  4CDX B;  5BY5 A;  4AVB A;  5JDB A;  1CAV A;  4QKF A;  2FBE A;  2JWP A;  4PLN A;  2VNO A;  3DEM A;  1NCR C;  1J58 A;  1OOP B;  1VBC 2;  1VBE 1;  3AZW A;  4DEV A;  5BNQ A;  1NQD A;  1Q8Q A;  4HVO A;  4H14 A;  4QX0 A;  1ENR A;  1JW6 A;  5DUU A;  3ZFF A;  4FXK B;  2VE1 A;  4JGZ A;  4N53 C;  5JMO A;  1YFU A;  1DGR N;  1G9F A;  4M3C B;  1H4G A;  1DGW X;  1Z0H A;  4GWM A;  5AC9 3;  4OI0 A;  1BLZ A;  4N43 C;  3VKF C;  2JDY A;  4QPI A;  4EN7 B;  2D6L X;  2E31 A;  2DU0 A;  3B01 A;  4GKX A;  2Q8D A;  4DEQ A;  4YW3 A;  3MIB A;  1GP5 A;  1N1S A;  1H0B A;  1YFW A;  3HWJ A;  2EXK A;  1QOT A;  5F5C A;  3N7J A;  4IV1 B;  2DVA A;  5F6K A;  4MAD A;  4Y5T A;  2P3K A;  2V5D A;  3W21 A;  1TQ5 A;  2VPV A;  3IM0 A;  5C8C B;  3I2D A;  5JIA A;  3HVD A;  3KSC A;  3MLK A;  5FZ6 A;  5KXD A;  5A1F A;  1BK1 A;  3AKQ A;  3POB A;  1XXN A;  4ES9 A;  1OVS A;  1QJY 1;  5EIY B;  1EAH 3;  1X9P A;  2Z2S B;  4WM7 C;  5FUP A;  3AVS A;  2LAL A;  2F6B A;  1SBF A;  3OY8 B;  2I74 A;  1WBL A;  3G7D A;  4NWW A;  4OMD A;  2E9Q A;  4QKN A;  3WDU A;  4YNI A;  3JQW A;  5LEK A;  2YFZ A;  1ZBE 2;  4Q4Y 2;  1UZZ A;  4URA A;  4LTA A;  3ZYH A;  4AEK A;  1N1V A;  5A33 A;  4LK6 A;  4WV8 A;  1RTV A;  1NA1 C;  1OA4 A;  3UET A;  1RMU 1;  1TNF A;  3FWE A;  5FJH A;  2Q4S A;  4MLO A;  3ZXF A;  1WA4 A;  2VD7 A;  2VME A;  2JDM A;  2QFE A;  3Q8F A;  5FZM A;  1H8T B;  2WA4 A;  2ARX A;  2XLF A;  2HWB 3;  1NLS A;  3RYR A;  2VQT A;  3I3D A;  1SFY A;  2R1D A;  3VHP A;  2VCC A;  1F4A A;  1T6G C;  1D7P M;  1H1I A;  5KHJ A;  2RE9 A;  3OEB A;  3VV1 A;  3O1O A;  2MEV 3;  1W05 A;  4ZS3 A;  5T3N A;  3ZFG A;  3E1F 1;  1W39 A;  4AHY A;  3VLB B;  3KV6 A;  4Q1P A;  4QMA A;  5FZH A;  3SCH A;  1VRB A;  5B4X A;  3T1L A;  2A70 A;  4QXC A;  1FXZ A;  2H6B A;  1UXZ A;  3UJQ A;  3AKR A;  2FCT A;  2W39 A;  2VOW A;  4Q26 A;  3SNM A;  1W9F A;  3EB7 A;  4XJA A;  2ZPX A;  3N7K A;  1R08 2;  5DAB A;  3B69 A;  1VBA 3;  1W6N B;  4M3C F;  2DVB A;  3EHK A;  4LHN A;  3HD8 B;  3V65 A;  1WLT A;  4UYB A;  3RRD A;  1J3P A;  5HV4 A;  1BBT 3;  5FOB B;  3I3B A;  1Q5O A;  4NUB A;  4K8R B;  4DRV A;  4PIX A;  2L9L A;  5C3R A;  3NST A;  4A44 A;  1HRV 1;  4YYO A;  1QH7 A;  2E26 A;  3UK9 A;  5J98 B;  3DPR C;  4AFB A;  2GAU A;  3B5L B;  1WD3 A;  1A78 A;  4OQ9 A;  1RB8 G;  1AF9 A;  1CAW B;  3PNA A;  3ZFE B;  5FMO L;  4ZU5 A;  5H9P A;  3ILF A;  4IEY A;  4IGQ A;  2XPJ A;  3NV4 A;  1U5X A;  1Y43 B;  1CD3 G;  4RHV 2;  5FZ9 A;  3JBG 3;  4J1W A;  4XFH A;  3PTR B;  3VBH C;  3VBR A;  4D3W A;  1O4Y A;  2LRO A;  4GWN A;  3GNE A;  3GGL A;  3WP3 A;  4XVH A;  1RHI 2;  3T2O A;  1HW5 A;  1EV1 1;  1PK6 A;  2WS9 2;  2Y6H A;  4IEO A;  4CPB D;  4JVA A;  2ZGS A;  4XJW A;  1WW4 A;  3CIH A;  5A7W A;  2LS6 A;  4BQ4 A;  3ENR A;  3J26 N;  4LMF A;  5FTT C;  3VBF B;  4EZ4 A;  3MW2 A;  1YCI A;  3EQE A;  3E6D A;  3WW2 A;  3WNL A;  3LGR A;  4ZKT B;  2IVI B;  2W5F A;  1PO1 3;  1AR7 2;  1N1Y A;  3ACL A;  3ILR A;  5A32 B;  2KM2 A;  1OXC A;  4W6W A;  4WVV A;  1HXS 1;  4BPZ A;  5FP4 A;  2MNG A;  3LA7 A;  4B1L A;  4KGQ A;  3W5N A;  4XHB A;  4XZP A;  3TN9 1;  4COW A;  2ZMN A;  2EIC A;  3VHR A;  4QHZ A;  1DG6 A;  1O7F A;  2RS1 2;  4PI0 A;  5FMB A;  2G9G A;  3CHX A;  2C26 A;  4JAA A;  3X29 B;  2LRP A;  3ZN6 A;  4PF5 A;  4RS5 C;  5FXW A;  3U75 A;  3HN1 A;  1SLC A;  3PUI A;  1X8E A;  4YVS B;  3C7E A;  3O1R A;  2J1V A;  2PAK A;  2AH2 A;  3V64 A;  2JD9 A;  3MIH A;  1COV 1;  2OXB A;  3NKT A;  4QKB A;  3U14 A;  1W28 A;  3PUH A;  3H1W A;  4JDN A;  4XXP A;  2K2S A;  2HWF 3;  2Z79 A;  4CTE A;  2XVG A;  3VKL A;  4QM9 A;  4IGO A;  3HPN A;  1AYN 3;  1NCQ C;  5H9S A;  3MIF A;  2QKD A;  4EN6 B;  4JGY B;  1H2K A;  2XKO A;  3ZDS A;  1UCX A;  4Y1Y A;  2YBS A;  1FMD 3;  1FV2 A;  2WJS A;  4XMI A;  4CDW B;  1O3Q A;  2WZR 1;  1W9W A;  2BWA A;  4GH4 B;  2VMC A;  1CJP A;  4NAM A;  1JXN A;  1GNH A;  1LKN A;  2J1A A;  1XND A;  3VBS C;  3VD7 A;  2WFF 1;  1TNR A;  2XQX A;  3PJQ A;  3WV6 A;  1W9S A;  1XNK A;  1UY0 A;  1H6X A;  2VU9 A;  3OUI A;  1HQN A;  1NG0 A;  2HWE 1;  1AX0 A;  3GZA A;  4I0B A;  1CN1 A;  1Q56 A;  1VAM A;  2A71 A;  2W46 A;  1YJK A;  3IDE A;  4P5H A;  5HXM A;  1BMV 1;  3TBD A;  5A3M A;  1CAX B;  4LLF A;  1BEV 2;  4Z1V A;  3W9A A;  3URF A;  2CDP A;  2VEC A;  2ZGT A;  4QX7 A;  3U11 A;  1XSR A;  1HJG A;  4YG3 A;  1RUH 2;  3DEC A;  4GB3 1;  4HVQ A;  4WVZ A;  5FYH A;  4NWV A;  2HJI A;  4OVE A;  2Q5T A;  1JI6 A;  3RNS A;  1DQ2 A;  5I0U A;  4M4R A;  3ETP A;  2NP0 A;  2XXZ A;  1YIP A;  1F15 A;  1FT9 A;  2WQ8 A;  3HAG A;  3ZYF A;  4U36 A;  3NNL A;  4AHX A;  2R49 A;  4AFD A; 
#chains in the Genus database with same CATH homology
 3O1M A;  3T4H B;  4CXY A;  3BI3 A;  4IE7 A;  3LFM A;  3BTZ A;  4NRM A;  4IE5 A;  4CXW A;  3H8R A;  3KHB A;  4MG2 A;  3O1S A;  3T4V A;  4MGT A;  4NIH A;  3O1P A;  4IE6 A;  3I3M A;  3RZK A;  2FDI A;  4NPM A;  4O61 A;  4NII A;  4QKF A;  2FDJ A;  4NJ4 A;  3T3Y A;  4NRO A;  3H8X A;  3BUC A;  3O1V A;  3BKZ A;  4NID A;  4NPL A;  2FDF A;  3BTX A;  3S57 A;  4IDZ A;  4OCT A;  3I2O A;  3RZM A;  3BTY A;  4ZS2 A;  2FDK A;  3O1R A;  3KHC A;  2FD8 A;  4QKB A;  3I49 A;  4NRQ A;  4QKN A;  4RFR B;  2FDG A;  3S5A A;  4JHT A;  3I3Q A;  4QHO A;  3RZJ A;  3H8O A;  4CXX A;  4ZHN A;  5F8P A;  4IE0 A;  3RZL A;  4O7X A;  3RZG A;  3O1O A;  4ZS3 A;  3O1U A;  4IE4 A;  2FDH A;  3BIE A;  2IUW A;  4QKD A;  4NIG A;  4NRP A;  3O1T A;  3RZH A;  3BU0 A;  5DAB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...