3ORJA

Crystal structure of a sugar-binding protein (bacova_04391) from bacteroides ovatus at 2.16 a resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
429
structure length
429
Chain Sequence
DDNGGSSVMNITGIYLEDAKSNVPDRLVDFARLGQLIRIEGEGFNGLKKVYINGYNCYFNPVFVSNKSFLVSVNSKVPTTEADENVRNTIRLVKDGGEYVYDFQIRAAAPSITKISNCMPNVGEPIIVYGSGLTEIAKVVFPGNVVVTEGIISDLDGEYFMVDMPAGVSEEGGSIFVEGSNGGAYSPAYFNYKKGLLLNFDGVGAQGAWGDSESMIQTTELESASIGEGNVSQGAYCRLPLERQLPVAAAKNRCAEVWTAGNGTDPDWLTLGVPAETPVAECAIQFEIYVPEPWSESGFLKICGQNGFNGGEWERDCYNYVPWLVDGKIVPFQTTGWQTVTVPFSEFYKSKASSGAWTTFADVTATRASASYANFGFYFENSDITLDKITGASSDKETEFLSKATSVKIYIDNWRVVPLTKPEYTDFPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of a sugar-binding protein (BACOVA_04391) from Bacteroides ovatus at 2.16 A resolution
rcsb
source organism Bacteroides ovatus
molecule tags Sugar binding protein
molecule keywords sugar-binding protein
total genus 96
structure length 429
sequence length 429
ec nomenclature
pdb deposition date 2010-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18329 SGBP_B_XBD Surface glycan-binding protein B xyloglucan binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3orjA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3orjA02
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 3orjA03
1ND0B 1OARL 4PFEA 2GJ6B 3QCTL 1U3HD 4HXBH 1JWSB 3QFDB 1XF3B 2VERN 4NHCH 3T1WA 5BZDA 3MFFB 4LSTL 5CSGA 1BWMA 2IANB 1F97A 4PREA 4OJFH 1ZHBB 4YHNA 4K9EH 4EDWL 3MA9L 5BV7H 5DJDB 2PO6C 2A83A 1OKOA 4GRLC 4DTGL 3BP6B 3EHBC 5CINH 4NQDD 5DQJA 3IFNL 3G6DH 3JSSA 4HV8B 2W92A 2DTSA 4PRPD 5FDYA 2BZDA 5ENWA 5TPWH 2XA8H 4LSRL 4JFYB 4PRDB 4Q0XH 1V8HA 3LKSB 2VWEC 1U8PB 5E2WL 4YR6A 3U30B 5EUKA 3QEGH 1FCGA 4J23A 5E7BA 4KTDL 1NKRA 3NIGF 25C8H 3O8XA 5IUSA 2ERJB 1JHLH 1NGPH 4W4OC 5CJOH 3T8XB 3B5GA 1U36A 3MCKA 2CLRA 3L7FA 4F7EA 2XI9A 3S5LB 5IESL 4O02H 5FA3B 4XGZA 5INDB 2XN9E 1R3HA 5LJYH 4F7EB 1FNGB 2EO9A 3VXQB 3QXTA 4PRID 4NQTA 4OCYH 5JXEA 1GGIH 3GHBH 5MHSE 5I30L 3WS6C 2VL5A 2LABA 1VGEL 4Y5VC 2WWMD 5KVEH 4WJ5B 2VITB 1TETL 3LEXB 1PKOA 3W39B 2LV4A 5KAQG 4XPGL 3UTTE 1G9EA 2ERJC 4U1SA 5IJKC 1EHXA 4XP4H 4YWGL 4AL8L 2ZJSL 4IEFB 4YDLC 4JPWH 3ARQA 1HDMA 4S1SH 3MLZL 3QQ9D 4U1IB 3TN0B 4UQ3A 5DA4A 32C2A 3S96A 3TNNB 4YQXH 3O0RH 3QIWD 2XPGB 4ZFGH 4I0KA 2FB4L 1MLCA 5D8JL 1QBLH 1Q0XH 1CU4L 1H3PL 3KPPB 4LCCC 1WEJH 4PJBB 1RZIB 3QXAB 5F9WB 2DI9A 2O14A 1NCWL 1S7VB 3O9WB 1KJVB 2BVPB 4FXKA 2C24A 4V1DE 1UACL 5CJXC 4GS7B 4XBPA 4QHLA 2J4WL 3BQUD 4NKIL 4ZPTB 5JHLH 2PYEE 1RUQL 2UUDK 4KDTA 2ZCHL 5B22A 4YHKH 4X5XA 4M7JL 2X4NB 3QO0A 4JDZA 3DTXB 1E28A 1DLHB 1A5FL 3LSOA 4LPYA 4NNXA 5LXGL 1E28B 3KS0H 5JDSB 2NY2B 4K94L 1ADQH 1QG3A 1ZLUH 1HQRB 2VZOA 1KCRL 2ICWI 4NN7C 2DQTH 4TTDD 2HKHL 1N8ZA 2VIRA 4PP1C 3AXLB 5DVMA 3TZVD 3BP4A 5ABDE 5KSVA 2BOCA 3BAEH 4HDIB 3V6ZA 1L7LA 3IRZA 4G8EB 5ALBH 3FL7A 1OAKL 1X5HA 4PLOB 3MGOB 5E24E 3O2DA 5DJCA 3SDXB 1HN1A 3LOWA 4LL9A 4MD0A 1MQKL 4L3CA 4MCYB 4U3XA 1D7FA 1CD1A 1Q9LB 2CDFB 4NWUH 2AK4D 4X4MA 2XTJE 3VXPB 4BH8B 5C0BA 1PZUB 4JM4L 1D9KB 4DAGL 2NY7H 4G8GA 3BQUA 4R8WL 4WEUD 4NO0B 1J5OH 9CGTA 3ARUA 3G6AB 3MMEA 4Y16C 1DQQB 4JZNA 3X3GH 1BF2A 3OL2A 4MCZB 1NC2A 3BKML 4G8GE 2FATL 1TPXC 5D9SB 1CFNB 4MXWH 1EGJL 4I4WB 5E5MA 2KQNA 2DQUL 2VQ1A 3U6RA 5HHNA 4KVNL 2F8VA 2WMPA 3EIFA 5FO8A 5DK2B 1QFUH 2V2XB 5C0AE 1OGTA 1AY1H 3T0BA 4U33A 2J8UF 3TO2A 1KNOB 1G7IA 2P46B 1RUQH 2G5BB 1NANI 4Q7DA 4HQQL 4JQIL 5AUMA 4LLWA 4KV5F 3P77A 5D5ME 3RDTA 2ZP0T 4Z0XA 4YEFA 5IFAL 2XZQH 4FQ2H 3X3FH 4CMMB 2AGJH 4MD5B 1S9WB 2J5LB 1ZTXH 3FO9A 3PNWB 1G6RA 3G5ZA 2DM4A 3WO4B 2I9LB 3MOAL 3MUHL 3KYKH 1D5MA 1M7XA 3CC5A 4QRUA 3WNPA 4EUPG 3RWJB 1XF3A 1KIQA 2DQFB 4CP9A 4E41A 3DI2B 3V4VH 4QNPF 4GLRH 4MB5A 5B39B 3VCLB 1VESA 4KRLB 4V1DB 4J4PC 4OUOA 4YJZL 1AC6A 2VE6A 1IGYA 4JFDB 3BKCH 3P9MB 3M8OL 2YUZA 1Q0YL 3FQXA 5DQJB 4DFHA 2HFGL 5HHOD 4JG1H 4ZAKD 5SV3A 4MQXC 1CZ8H 4LPVA 1WV7T 1QHPA 5CP3A 1K85A 3C8HA 2WM0A 1Q9KB 3VXUD 1N6UA 4HWUA 4RISH 4LK4A 4N9OB 1S9YA 1LD9A 3L3GA 2CH8A 2ZSWB 4HS8L 4TULH 1NAMA 4I0PD 1UYWH 2OJEA 2Z91A 4NIKB 3EFFA 4JY6A 4WO4A 3WS3A 2R2EA 5KSAA 3MRMB 3B9AA 2F9BT 2CLRB 4JRYD 5DHVH 3B9DA 3TWCL 5HTSA 3ZZ1A 3I02A 4FQHB 4YIQA 4AEHL 1ZSDA 4RAVA 1MUJB 1IKNC 4MJ5B 3DGCR 5TPWL 4DUVA 4ONHB 5DXWA 4HHAB 4EI5A 1EFXD 2ID5A 3MXWL 3BGMB 4DEPC 1ZVSB 4NC2B 1GIGL 5JNYA 4DQOH 1CU4H 5K9OB 3WUWA 2NY2D 3AB0B 1M7IA 3WUWB 1MFNA 3MJ9L 3MLSH 4O2CB 5DHVB 2OTUA 4OV5B 1I1CA 4OJFL 1DFBH 1TVHB 5GS0C 2VQ1B 1F4XL 4RAHA 2EYSB 5E56A 5TE6L 4LCIL 2E5EA 4NZDA 4NZRH 2HWZL 2R39A 5ECJE 5F1IA 4LCCA 2J6EL 4ZAKB 4KTEL 5SWQB 2LU3A 3FN3A 3D0VB 4KY1H 3D85B 2DQUH 4P48A 2QTEA 5ESAB 4PJDE 1DN0B 4RCAA 3QDJD 4XC3H 5ESQB 3MLTB 2ZZUT 1M05A 4HGWB 4MNHA 5ALCH 4XBPB 4BYHA 2PXYA 2LTQC 4HQQH 4JQIH 1QBMH 2IANE 4P2RB 2WNGA 5EWIL 2EXWD 1NGPL 1D5MB 5F88A 1D5ZA 4YUEL 1NL0H 5I8CB 1MHHB 5F9OL 3RVTD 2XKUA 1DBBL 4PJFF 1D9KC 3MRRA 5KJRH 1QFOA 3LSOB 4TQEL 3STLA 5IK3B 1U8IB 3G5VB 3MBEB 1FNSH 5I1HH 3AM8A 1XGRA 3HFML 5HI3C 1MCIA 5EC2B 4GXUN 3EO9L 2UVFA 5HVGB 1Q1JH 5FUOH 2QQNL 2AERT 3JVGC 4NQSB 3UYPA 3LEYH 4LOUD 1GGTA 3P30H 4RMRA 2B2XH 4F3FA 1OGAD 5E8OB 3O9WD 4ORGA 4NQDA 5CIPA 1JZ7A 4JDVB 1T04B 2I24N 5FYJE 4F58H 3UTOA 5EORH 3VXMD 5EIIA 4G6KH 1Y0LA 4F33B 4CN1A 1R5VA 2NY1B 1CE6B 5GSRB 5AAMA 1ZHKB 4G8EA 5D7LB 5J06A 4PJGA 1E4XL 2X4PB 1CQYA 4WNQA 3NA4A 3W9EA 5JQ6H 1AO7E 4OCSH 4BH8A 4M7KL 3WFEH 5I8KH 4CDHA 3QH3B 4LSSH 3GSRA 1F58H 1TITA 4Y4FD 4AL8H 4R3SB 3L3OA 4LAQL 1HEZB 3W11D 2PF6A 3IDMA 4OV6F 4Y4KC 3U36A 1VKXA 2FX9L 2HN7A 4QTIL 5A16B 5CLTA 5HGGS 1X4YA 1INDL 4U2ZA 5DUMH 1K4CB 2BNQA 2W0PA 4YE4L 2DAVA 3TN0A 1AKJB 4NN5C 1PD6A 32C2B 4LARL 3DX6A 4M7KH 1JP5A 1OGTB 4LKXA 5BV7B 1IQDB 3FQWA 4XCFH 1F3DJ 2SEBA 2V5TA 4QHUA 4WUUD 2R9HD 3D85A 2GTZA 4P5TC 4XNUH 5I71C 2BRRH 3SCMB 4JFFA 4KGLA 1F4XH 1PLGH 2E6QA 1G6RL 1U3JA 1OAXL 2PYFA 1JYVA 5DEFA 4DUWA 1FZJB 5IFHL 1FORL 5IVXB 1L6ZA 1UH4A 1WJ3A 1Q72H 5KVMC 5IVXA 5EC1B 2IQAA 4YBLB 1V05A 5GS1C 3ULVH 1NGQH 4XNMA 4XHJC 2OJZL 5GRUH 4YH6A 1MCHA 2F15A 3GJFK 4JFEE 5FO7B 4D0CA 4L4VB 4PJIB 5E7FA 4OLUL 4FQIH 4ORZC 3Q1SL 4I77L 4Y5XB 2G75A 3EYFA 3RWJA 4F15B 1DQML 1MAKA 3UC0H 4ZUSB 3BN9D 3E3QC 1T2JA 3SKOB 1DE4B 1WFTA 2DN7A 3KPQB 1FVEB 3T2QA 3O6ML 1E6JL 3FOMA 3KPQA 5E9DA 4JO2H 4K3DH 3B6SB 1AO7D 3MXWH 2HFTA 5CSZB 3MRQB 3VFNA 3EZJB 1A1MB 5HI5D 1OW0A 3O2DL 5IMLB 2GT9A 3EFDL 4APQA 1V7MH 5FYLL 5HHME 2O61B 1BOYA 3VWKA 4ZFFB 1K6QL 1HYSC 2ZNWA 3OAYK 3EDKA 3QCUL 1AD9B 5BZWA 3VXRB 4Y1AA 4HS8H 5JHDD 4LLMB 1WZMA 5CGYC 4BQ6A 4LLVB 2P5EB 4GKSA 3WIHA 4LHUA 4LLVA 1R3HB 5JHDE 2EEBA 3VFMA 3CFIC 4N0FA 4NT6B 5DMIL 3E8UL 8FABB 2FECL 4Z7QF 1OD7A 3RWFA 1GIGH 3ILPB 4X98A 3SDDB 1FPTH 1IT9L 4PGZA 2F5AL 5JHDA 3JBG7 5FV2A 1FAKT 4MSWA 5D1ZD 5I1KL 4FQCL 4HD9A 1FO0A 5BOZG 2HTKC 1OAXH 4GAYA 4Y1AE 2HTLC 3D0VA 4XNUL 1MIEL 2R4SH 3RUGE 1RIVH 5F3BA 2XPGA 5EUOB 3ARXA 1TQCC 4YHLL 4WFFD 5IQ7H 4KJPD 3PWJB 3RVXD 3F7RA 5MERA 1E6OH 3HRZB 2FHBA 4PJ5E 5I73C 3AM8C 3STZB 3ARWA 3K46A 3VMNA 5C07A 2CXGA 1QFWI 5I1HL 4TNWK 4IRSD 4KMLB 1W72H 3QXVA 4QF1A 3SHSA 1M05B 1M7DB 1XGQB 3WL9B 4WHTB 1QRKA 5IW3A 3ABZA 1SJXA 4MQXD 4ODSL 5CINL 1DSFL 3SKUD 2C7UA 2RCSH 1NCDL 3K8LA 4LLDA 5BJTA 1E4WL 3CFKA 4QHNA 3IFLH 2YPLB 3ZHLA 3Q5YA 4XP9L 4PJ9A 4QXGL 1WBZB 3ARYA 4C56B 3W2DH 5IW1A 4Y4HD 1UVQB 5KVDH 2CK0L 1AGFA 2NNAB 5C2BH 4YFEA 5L88H 3MTRA 5CKAA 1ZEAH 3IJYB 5ACMA 4PJEB 4QRRA 4OF8A 3TBSA 1H9VA 2OSLA 4UAOB 4N0UE 4QRSA 3ZHKA 4S1RL 2NY7L 4P4KC 4ZNEA 1ZHKA 2RHEA 1TCRB 3QFJE 1DQJA 4PRNB 3AREB 3ARPA 3QO1B 1RZGA 4CVXB 1IFHL 3SJVB 3FQUA 3SPVA 2GI7A 2MHAA 3MCKB 5DMYA 4JY6B 3GI8H 5FHAL 1XT5A 4KVNH 3P4MA 4P3DB 2CDFA 3UX9B 1ZOXA 4QOKB 2AJSH 4X5WB 5CKGA 1CGVA 5H35A 5EPMB 4YW7A 1AHWA 3PP4L 4N0FB 1ZLVK 2VITA 5D7IA 3O4OB 5C08B 4HFUL 4D0BB 5DWUL 5F9JA 5CBEA 2CIKB 2DQTL 1R3LA 5EWIH 1QSFD 5I66B 3RWDA 4AM0A 1NFDA 5GS1A 1A6AA 1TVHA 3DYMA 2AAVA 2DYPA 5MP6H 3QQ3B 5F7UA 2RIKA 3QZWB 4UV4H 3QG6A 4XC3L 5DI8B 4BFIA 3TF7C 2Z31C 3OB0K 3KPNA 43C9B 1VA9A 4U1MB 4XMPL 1Y18B 3MLYL 1A1OB 4UU9A 3BW9B 2UWEF 4QHUB 5ICXB 4F7TA 4FXKB 5IHZA 4P5TA 5EOCL 3RU8L 4I5BA 1MRFL 4P2QB 3I3DA 4MXVF 3S8WA 4WCYH 3KXFD 3U2SB 4BQCA 4M1GL 2VXSH 3C5ZA 4MHHG 2BP3A 1KB5H 5CEZL 5I1GL 4QXUL 1KN4H 2NY4C 3N85L 5EC1A 2Q20A 4ZD3L 3VWJB 4GW1B 4RGNE 2X4OA 4OZGE 3V6OC 3P11L 1UWXH 2IFGA 1JF1A 1FE8H 1UWXK 1T80A 4HLZH 4K7PY 4AEFA 2PCPB 2DLFL 3RKDC 4YX2L 2YPKA 2XWTB 3RY4A 1XF1A 4B7IA 5JOEA 3T65A 3HC3L 2DWDB 1MCWW 4NPYB 5K9QG 3MFGB 4L5FL 3BSZL 1MVUB 3O81A 3QDJB 2DBLH 2Z35A 4O2EB 2W9LA 5FKPA 4Q6YA 1CF8H 3CVIL 5JXAH 3FONA 1AGFB 5D7KE 5CILH 4YXLH 1EFQA 3WFHB 4EI6B 2DJUA 5DQDL 3T1FA 4XPFL 2NY0D 4JFDA 2EH7L 1WZXA 4ZOAA 4BKLA 4FP8L 1YMMD 5IIEB 5KSVB 1UWGL 3VGHA 5AZ2H 5J9PA 8CGTA 2FX8L 4PJFB 4RBPH 5DRZA 5DQ9A 2R69L 2EYTB 4JB9L 2APVA 2E27H 2YWZA 5GRXG 4QRPA 4AEIH 1MFDL 1UCTA 2X9WA 5IMLA 4L9LC 3V4PH 3VA2C 4MJID 4OFDA 3GK8H 3REVB 1NFKA 5C3TA 3UXFA 5DLMH 1CICA 1SJEB 3BZ4A 5DYOA 2DQDL 3P4OA 2DQJH 4XP5L 1GOGA 4KI5E 1LO4H 2DWEA 1RJLA 5KW9H 3P4OB 1QBBA 3OKNB 1KACB 2WQ8A 1EO8H 5JLZB 5D7IB 1Q94A 5IBLC 3ZYHA 3SDCC 1WIOA 1TETH 4R26H 1HE7A 3HZVB 4CADA 4TTGA 5FK9A 4XWGL 4HBCL 3ZL4L 1HHKB 4V2CB 1QR1B 5I1AA 4YDVA 4XNQA 5DJ8A 1S7XA 3VMOA 3BKJL 4W68A 4BFIB 2ARWA 4J1UA 4K9EL 2A9MH 1CGTA 1PLGL 3UPRA 3DOSA 4Y2DB 4KJQD 3CIQA 4OKDA 1NCUA 1JGLL 3O2VL 2AK4E 3BUYA 1QQDA 3PWVB 4Y2OA 3SCMA 3F7YB 3ULVF 3RGVB 5TDNA 1MREL 3LN4B 3U2SA 2V5MA 3NA9H 4XPHH 4QRTB 1MNUH 4ZO6A 4WHYH 1B0GA 1AP2B 4RQQB 4AEEA 4L3EE 4DJMA 3PGFH 4X6BB 1VPOL 1FIEA 5L7XH 3VI3E 3PWPB 1CVSC 3FMGH 1U6AH 3CSGA 2A9NL 2EDTA 3GSVA 4TSBH 3GMPB 3LPWA 1U2HA 3SGDH 4KVCL 4L3ED 5DGQA 4U1GB 4X6EB 1XAUA 3OXSB 4Y2DD 4HJ0C 2A77L 4JFXB 4HPYL 3HPLB 1LP9E 5MEQB 1AH1A 5DD0L 1ITBB 4N0RA 5FYKD 2BNRB 3L7EA 1HHGA 5KS9A 3M1BA 5B4MC 4BSWB 4FFZL 5DTFB 4MA8L 4XBGA 3OKLA 3ES6A 5FUCE 1ZT1B 4YHPB 2UUDH 1BX2A 1U3ZA 2V2WA 5JQ6L 2XWJB 4B0MM 2QSTA 1FGNH 5C07E 2PYEA 4PD4K 5AZEH 4XPAL 1NC4A 3GSQA 2EDLA 1QLRB 5FOJA 1IBGL 3W82A 2Z4QB 3HE7D 1IAOA 3L5WA 3SGJA 2XXMB 1KPUA 3O45B 5GJSL 1FFNB 1CLYL 3VFRB 3QWRD 3LHPL 3VH8A 4OTXH 4TPRL 3PDOB 3VFRA 4WI8A 1F90L 5D1ZC 4G6AC 4FFYH 4FTVB 4NZUL 4JDTH 2A38A 3MRMA 2IC2A 3SDDC 1A7PH 5IEHB 1NLDH 4WRLA 1AHWB 3SE3A 1XZ0B 5D1XB 3FB6A 1VFAA 2X9XA 2P8PB 2JCCB 3GJEB 4MHHI 4ODUB 4OFYA 2QR0B 3QUMB 4M5YL 5HHVL 3WDJA 3T0ED 2V6HA 3C5ZC 1VERA 3DHJA 4Z7WF 4G6FD 5IOPA 4B50A 4JQXC 2CDEA 1PVHA 3B9KD 3MLUL 3RWDB 2YPVL 4NP4L 4M7JH 3IDMB 1T83A 2DYPB 3RAJH 1WAAE 2W38A 4UQ3B 3FHQA 2HT3C 3GI8L 1CFTB 4GAJH 4I2XE 4XTRD 1F45A 2E7BA 1IVLA 4KPHL 1ONQA 4JKLA 4XNXH 3TBWA 5KZCD 3KWWA 4EQ3A 4J3OC 1ZXQA 4GAGL 4LRIA 1LDPH 2DM7A 5LGJA 1E4XI 1RU9L 3B9KA 5F6IC 3ME0A 4QY8A 3CDGA 3E0GA 3G6JB 5ESAA 1FH5L 3WE6B 3DO3A 2AJ3A 1BJ8A 3WMSA 3FZUC 4JR9H 4GLRI 1B0RA 3MLZH 1FGNL 5E6ZA 3IS0X 1YECL 3HAEB 3FFCD 5ILTH 3U4EB 2NXZD 1AXSB 2IBZX 1ADQA 3PQYB 4FQPA 4Q74A 2N7BA 1RVFH 2EDWA 4LPXA 3ULVE 1D5ZB 5HYQA 1QRNB 5DSCA 3V0VA 2H26B 1RUPH 4ZO7A 3ILQD 2W9DH 3ESUF 4QRUB 3PWNB 4TVPL 4DW2H 2X4UB 4NUGH 1G9NH 2EDYA 3UJIL 1I9RL 2DJSA 4U7KA 2OI9B 1V7ML 5FYLH 4WUKL 1MFDH 1YPZB 2XZZA 1S7TA 2IEPA 3U48A 1X5XA 2I5YL 2HG5B 1KPRB 4KJYA 3QIWB 2IPKA 4LMQE 3ULUE 4NRZB 4HUVB 3C60A 5GGUA 3TZVC 3DBXA 4QRSB 3SQOH 5F7KC 2D7QA 4K23H 4FP8H 4QO1A 1KG0B 4D9QE 3RAJL 2X1PA 2DKSA 4NKMA 5C92A 4NGHH 5E2TL 1JGUL 3VD4A 1Q9WA 3D3VB 5K33A 3I84A 4KROC 3UAJC 2K1MA 3DPBA 4M5YH 1OF2A 4YAQA 1CD1B 1Q9LA 2P5WE 3BMVA 5FUZL 1YEEH 2VXUL 1GGYA 3MCG1 4FQXB 3NBNA 3O41B 5BV7L 1IAKA 4PRAB 5F7EL 3MRBB 4IMLA 4GKSB 1S78C 2NXYB 1F90H 1KJ3L 1SJHA 4TSCH 1D6VH 5T3XD 3QPXL 3IVKA 5K59F 5IOPB 1U3HB 1EO8L 4O9HL 4IM8A 3N1MC 1BBJB 3VGEA 4U1SB 3EJZD 4H25A 4U0QB 3TZVB 2VC2H 2CKBL 2VUYA 2UZYB 4JFPA 2KH2B 2AP2A 1GSMA 3UCRA 3QRGL 3QDME 1JI2A 1OSZA 1G9NC 1CD0A 3A6CL 1QQDB 4TOYH 2ENYA 3IXAB 1OL0A 2XOTA 4KHXL 3MXVL 1S9XB 3L9RB 3IETA 1AXTH 3MRCB 5IJVB 2VXJA 4L8DA 5EO0A 2A77H 3VFGL 1FDLL 4RMQA 5CS7A 1SYSB 4YX2H 4NO2A 1HNFA 1LE9A 3F7VA 1XH3B 1KCUL 4Q9RL 3NOIA 5DC4B 2IAMB 3NTCL 1OAYH 1JWSA 1F58L 1MCRA 3OKYA 5J1SC 5DFWH 2BVQA 4PLKC 4JR9L 1P4LA 4OGXL 5KN5B 3AREC 2OK0H 4PJXA 4RMWA 5HVFB 3SGEH 4X6FB 3CFKB 2BHUA 4NUJA 3LCYA 5BO1L 3CFCH 2ICEA 3ULSB 4HSQA 3ARBB 5LCVH 1NGXA 5IB1A 3NCYP 2DMCA 5I8EA 1MCOL 1YNLH 1YN7B 3WLWC 4KPHH 2P49B 5I1EH 3O6KH 5BXFB 4ZOBA 3GKWL 4OZIB 3JUYA 3MACL 4L9LB 3SE9L 4LNVA 1ETZA 4POZC 1LE5A 5IM7A 1J1PL 3MRQA 4Z7VB 2W0FA 3O4LA 1J0HA 1G7JB 5SWSE 3STBA 3U7AA 5E1AB 4FTVA 5L2JB 5GSRA 4JG0L 4KFZC 1YJDH 1FCCA 4I3GA 2VN7A 3QIBC 1RD6A 5GIRA 5DD3H 4BZ2H 2CK2A 2XWBB 3QHFH 2W0KA 4HMEA 4DFIA 1BJMA 4LCWB 1FAIL 2YD4A 1NCCH 1L0YA 3QI9A 4TUJA 4D8PA 4KRPB 4NQCB 4KKBD 4KV5E 3O4LD 5D5MF 5DLML 1LP9F 1JWUB 3CVHH 4G8IA 5I16B 3VI3F 4IDJL 4PB0L 5JPNB 8FABA 3SKMA 1ZKAA 2X5PA 1BWWA 3UJTL 3CVHB 1I3RA 4OLWH 4JRWA 4U6HB 4AG4L 3GB7A 2FIKB 5D2NE 5GSVB 3RTQB 2C1PB 1MFCH 4ZS6D 3QUXC 4N1HB 4NQVA 3S96B 3TNNA 4C56D 4K07A 3MRKA 1LO5B 5BCAA 5K59E 2CK0H 1S8DA 5ID0B 4KK6C 2YS4A 3CDGB 2ATPA 4U31A 5DHYB 2NXYD 4OCXL 3MRLA 3TCLA 1CF8L 2WUCL 2YN5A 3MJ9H 4BA8A 1J05B 5EBMA 1QFWM 4OZ4B 1XF5B 2AABH 1Z9MA 5D4QA 2YD7A 3ZHDA 2J3SA 2PYED 4KI5D 3D3VD 3I9GL 3DTXA 1MRCH 1RURL 4MDIA 1DP0A 1L0XA 1VPOH 1MHHA 2ZCKL 2F54B 5BRZB 3W0WD 2R23B 3AROA 3ZDXF 4G6ML 3BWAA 1HHJB 5HYJB 2DQFA 2H1PH 1VGEH 2DICA 4X80H 4KKCD 3V7AG 1KUMA 5JXEC 5ACZA 1AKJD 2GTWB 4QHMA 2JIXB 5B3JF 2QEJA 4OQTL 3FQTB 5T33H 1VGKB 2ADIB 3SDDD 3UZQA 4NRZA 4W70A 1HH9A 1QRNE 4LCWD 3FQXB 3QI9D 4XP6H 3KNBB 2DS4A 4NQXB 4LDLB 4K3DL 5B8CA 1X5FA 1T1ZA 1UWGH 4U1JA 2Z8VC 3KHOA 3QNYA 43CAB 3P9LA 5L0QC 3RL2A 3BPNB 2ICCA 2IH3B 4ERSH 3H9SA 5T3ZL 3DGGB 4ZDHB 1T7YA 3WNNA 4HG4K 3MLVL 5I1KH 1BD2E 1YC8A 3ARGA 4FQIL 4M1DL 4DTGH 4D0DA 5D2NB 1YEEL 2VXUH 1MEXH 3LN5B 2CKBA 5DD5L 4I2XB 5A2KH 3QUYA 5GGQL 4JZNB 1W0WA 3CH1B 4F2MB 1NMAH 3OX8B 3P4NA 2ADJB 2XYCA 4JREB 3FB8B 2FWOA 1CE1H 4ZYKA 4LF3B 5IW6A 3OKEB 4H25B 5CD5C 1OAUL 5IW6B 4LSDA 2XFXB 4GXVH 1H3VA 4UT9H 1I1AD 2AK1H 1A1NA 4JLRA 4AMKH 4YO0A 1EO5A 1QKZL 4JFFB 4G9FD 4BK5A 1KLUB 5FYLD 4JLRB 1A8JH 1UXWB 1FZJA 3H6JA 2I07B 1BFVH 3TVMC 5D6CB 2OX5A 4UB0H 1AGDB 3OHXB 3ZKND 4HGWA 4MNHB 2YKLH 2XN9D 1ZLSH 3BVNB 5ETUB 1JYNA 1OAQL 1OP9A 1IGCH 1RZFH 3ORJA 3WN5B 1U42A 4I3RH 2MOVA 3BUTA 4MAUH 4PGCA 1IBGH 3V0WL 1JPTL 3ZDYE 2OI9C 4KMTH 1EUTA 2BVOB 4AZ8A 2AJSL 5FHBH 5LGHH 2NY1C 2VL4A 5E70A 3FN0H 2YPLA 5JOPE 1U58A 3D1MC 4QXTA 4LGSB 2E8YA 4PJCE 1I1AA 5TFSH 2XTJD 5JO5A 3P9MA 4FOMA 5E0QA 1H5BC 1OTUC 5FFLA 5AWNH 5DUML 4K2UH 3BRDA 2EDEA 5BXFA 1G7LB 3MNVB 4OB5L 5EUOF 1KCSH 1LK3L 3HCVA 4FQCH 5EU6A 4UMGA 4G42A 2NY3C 5D70H 2BRRL 4L3EB 5DDHA 3S4SG 3CFBA 1S7SA 4PJ7B 1Y0LB 4F33A 5C8JB 5GIRB 1X9QA 2BNUB 3RHWF 2V17L 3MGOA 4AT6B 2CKNA 3AU1B 2NY5H 4M43H 3I6LE 2YZ8A 1KTRL 3QBTB 3RIAK 4HUMB 2NY5L 4OZHA 3MV9D 4OLZL 2Q87A 4NKQB 4DN4L 3RY6C 5ANME 1I8MA 1NLDL 2QBWA 4HPYH 3VGFA 3SO3C 3EBAA 1F11A 1ZT7A 2OMNA 5J13B 3MV9E 1U3HA 4JZOB 3GNML 3R0MA 3VXNB 1JGVH 1EMTH 4Z7UA 1FBIH 3SE4A 3RNKA 1OCWL 5I66A 4CBPA 1P4IL 4XCCH 4XPAH 1DLFL 2HT4C 4KZDH 4JAMA 4IRJA 2J8OA 1QBLL 1IILE 1MHEB 1TCMA 4I1NB 1PKQB 2JF1A 4GRWF 3FFDB 3NN8B 4NN7B 3MC0A 1AGCB 1I4FB 4P2RD 4NRYB 3MLTA 4LVHC 2V5YA 4QRTA 1QVOB 1UCBL 4JVPA 3QNXA 4H26A 1DQTA 1U93A 1RK0B 1OP3K 4OF3A 4MVBD 5F88B 2NTFA 2HVKB 5BW7A 2APWA 2XNAA 3VI4F 1OSPH 5FGRA 4WO4C 4WU7B 2E3VA 3RKPA 1AFVL 3GJFH 4LIQL 2CJUH 2AJXL 1T89A 4JGUA 2EE2A 3PWNA 4UTBL 2NR6D 5F7DA 3NACL 1MJ7L 4Z95H 5DD1L 4EI5C 3QDGD 2MQ3A 3KR3H 2BY2A 1MQ8A 1XGPB 3EYUL 5FIEA 1MH5B 1QACA 3BDBA 4PY7B 4EUPA 3T4AB 5LG1A 4G9DA 1JZ6A 3Q1SH 1NJ9A 3BKJH 3JWDL 4KZEL 4D3CH 4G9DB 4XVSL 3QIUD 3TA3B 3ALXA 1WFUA 5AZ2L 1CXFA 4P4KD 5B38B 1WBYB 1HQ4B 3RGVC 2A73A 2AKRA 2MNUA 2C4FT 3M8OH 1HN0A 1KULA 5GHWL 4HZAA 1AR1C 1A7QL 4LKFA 1FE8L 2ATKA 3FT2A 5INCA 2P43B 5LKNA 3VWJD 4X4XB 4ZFZB 3FT2B 5INCB 4P2OD 2XA3A 3HUJB 4M1GH 4PD4J 1BREA 4I77H 4KUZH 3U9UA 1MLBB 5FYJL 1JPSH 3DXAA 3MRBA 4IMLB 3HUJE 4JZJB 3KLHD 4MCZA 4X8XA 2CIKA 1U41A 7FABL 2ZOLB 3NZ8B 2GFBB 3GMRB 4Z0BH 4ZXBC 2R2BB 4WI6A 4D9RD 4AEHH 5C0JB 1BIHA 3L3JA 4MXVE 2HKFL 3TZVA 3EYSL 4A6YL 2E7CA 4ISVA 3FQWB 4NFBA 6CGTA 4Y16B 4M03A 2OR8A 1NBVH 3TN0D 3HR6A 3ZKXB 3WXVH 4MX7B 1BZ7A 1CFQA 5E9DD 1TPXB 4ZSOA 3SKJL 2GCYA 4PJGE 4RDQF 3QXDB 3EOTL 4BZ1H 3IDJB 3IETB 2ZCKH 1EGJH 5E2JA 1YEJL 4ZOEA 3U4AA 4IRSC 3K4DA 3QFJB 3BGFC 5AD0B 1KEMH 3L5XH 4PRBB 3DVGB 3D6GA 1KB9K 2P24A 3QEUA 4XI5D 5EOCJ 1KYOK 4JO1H 5D71H 4HJGA 4NZUH 2X4QA 1ZA6B 2N1KA 1J8HB 5D2LF 4ELME 3OZ9H 1FZKA 2NLJB 3QB7C 1QYGH 5KSUB 3QEUB 1QFPA 1H3UA 3VRIB 4PJEE 1HK6A 4DZBB 1I7TB 2H2SD 5EBLB 5D7IF 3RVUC 4PJCA 2VLME 3GNMH 4TUOB 4LU5H 1BGXH 2ESVE 1U8IA 1KC5L 3AMLA 1BF8A 4C56A 2HAZA 1FZOA 3SKOA 2VLKB 1TVBA 3RVVC 5TFSL 5EU7E 5KBNC 1MCSA 4MA8H 2YD3A 3ARDC 3BAEL 2Y06L 2XWJA 4F3FB 5EUKB 4H0GA 4WWKA 3MOBH 4LHQB 1AE6H 2JELL 1D9KD 1AJ7H 1KN2H 5GQBA 1KG0A 3AAZA 5MEND 5DQ9B 4Y4KB 5B38A 2EC9U 4JJ5A 1T66D 5C0GA 3DMMC 1CE6A 1MJJA 3AREA 4JGJA 3FRUB 5KG9A 1KELL 2X4PA 1XIWB 4RZCB 1LEGA 3MV9B 5DD3L 1QP1A 3DARA 4OCRH 4TNVK 3T8XA 4BZ2L 1I3VA 3HRPA 2OJEB 2Z91B 2A0LD 1UXSA 1UZ6E 1YQVH 5E8DL 3QH3A 3MRNA 4KTEH 4QOKA 3F5WA 4YGVA 3GJEA 1FG2B 5TQ2H 2DKMA 5DT1L 1W0VB 5HY9A 1HHIB 4TYUA 3VRJB 2CGRH 3QAZC 5DJ6B 2AXFA 2YRLA 5B21A 1WSST 3LRSB 3RWGB 5A16A 4LCWE 4D9QD 4J3UA 3LKNA 4R90L 3SGKA 4L3AA 4CJ0A 1GGCH 5L9DL 4FQLL 3DIFB 3DRTB 2B1HL 3DSNA 3WXWH 1EHNA 2VXVH 3PGCA 4J3XA 2AXGA 5D1QD 1WEJL 1RIHH 4BUHA 2VAJA 4OZGF 2XQBH 4YNYA 1U8LB 3E8UH 1R3JB 5DO2D 1TNNA 4OCWL 1KIRB 3VXRE 2YR3A 1TTFA 5C0RL 1VFBA 3HS0B 1A3LH 4Z7VE 1QSVA 3RX8A 2C5DC 3MLRH 1AI1L 3VD7A 1CDUA 2E9IA 4UT9L 5CZVL 3H7LA 3V0WH 2A6DB 1WQVT 4OZIE 1FYHB 3MJGX 1T20A 3QPQD 3EO1B 3K4ZA 4UDTB 4ONFL 2AJVH 3PNWA 2AEIT 2A0LC 4E41E 3DUSB 2C3VA 4KKNA 4XPTH 2GITB 3HMXH 3F62A 3D25A 4H8WC 3TA3C 3V6OE 5EBLA 3D9AL 4H1LA 4KHTL 2CMRL 4CGTA 4YHNB 4JG1L 4DVBB 4M9OA 2V7HA 3VFSB 1LILA 1CIDA 4X7SH 4Q9BA 4LVNC 4F7MB 4LSQH 4QOKD 4XWOC 1Z5LB 4N90E 2R8SH 4YHPA 4U1NA 2VH5H 1G9MC 4JFEB 4Q2ZA 3T0DA 1LO2H 1CICC 3MV8E 3F95A 2W60A 2LTQB 1JWMA 4LLAA 1HI6A 1FO0L 1XR8B 2IPKB 3IU4L 2CRZA 4KTYA 3L1OL 1GPOL 1JE6A 4J7RA 4JKPH 5CLWA 1TCRA 4L3EA 4PRHB 3O2WH 3D9AH 4ZXBA 3A6OA 4GFTB 5IVXE 1B4JL 2B1AL 4LLQB 1WLHA 1LD9B 2DIAA 2VKXA 1GGIL 3CX5K 3GHBL 5BOPA 4ZFFA 2R1YB 3ESVF 5FDWA 2B1HH 4LEOA 3WXWL 2DLFH 3TJHD 5SX5H 2D7TL 1ZV5A 3TBVA 3C6LA 3K80A 4PJXF 1EPFA 1DQLL 3TV3H 5I74C 4EJ1C 1K9TA 2HJFB 1TJGL 2DQEL 1W8WA 4OM1L 1KCVH 5FYKH 1T3FA 2A6JB 4F37K 1JHLL 1N64L 3LS4L 2IBBA 1WCBB 5TJWK 3RWIA 4D0BA 2HN7B 3HE6D 4OD1L 1UB5B 1RIHL 3QSKB 3VXNA 3D39A 4J3TA 2X09A 4RGMC 3CX2A 1I8LC 1IEAB 3TEUA 4Z0BL 4CN4A 1IL1A 2MFNA 3U0TB 4P46A 2IFFH 3WFCL 3GMMB 5FCUL 5IVZB 5DK2A 1M71B 4WDIB 1TENA 4JFHD 4MA3B 5HYSG 2CGRL 3LKQB 5DJYA 3SN6N 4HH9B 3EYUH 1YQ2A 5SWQA 4GMTL 4U2YA 4PB9H 5HGAB 3FJTA 2VAAA 3D39D 3UC0L 5DEFB 5FGSA 4MD5A 1UWEH 2P1YA 2X70A 2G5BA 5DD6B 1J10A 3WIIL 5I1CH 1CDIA 4BFGA 5LXGH 1IAII 4LLWB 1B90A 1YMMA 4W6XB 1NBYA 3OKOA 5HYJE 3NPZB 4BELD 4P2RA 3QFDA 3I75A 2NY5C 3OR6B 4R2GB 3OKOB 3FB7B 3BVNA 1BVKA 1RFDL 1VADB 5J4MA 2RR3A 2ADGB 3T77A 1F8TL 4R7NB 4YHKL 3QQNA 3U82B 4RRPA 3RVXC 5MI0C 1A9BA 1T21A 1T2QL 3SGJC 2BSSB 2D2OA 4JFXA 4K3EH 2HKHH 4X6FA 3IAPA 1UKTA 1A9BB 1IGYB 2BNQD 1D5IH 1DE4A 2AXJA 5IGXL 4UTBH 1MCQA 4JFEA 1O7VA 2P7TA 4JY4B 1IE5A 1MFCL 3V5DA 1CL7I 4QRRB 3TYFB 4HUWB 1FNSL 3BE1H 4JN2A 2A6KB 3TH3T 1EGJA 4NFDA 1IEHA 1BQLL 2AJUH 2D9QB 4HUWA 5D7SH 1SVCP 3LH2L 2BFVL 3QDMA 5DA0B 4PRDA 1MIML 1ZGLP 5KVFL 4R9HA 2V5SA 2P5WD 1G7MB 4IBLT 4ZUWA 4RZCA 1YUHB 4A6YH 1RZGB 3A67H 4CVXA 1DSFH 3SDXA 3DO7A 4UTAH 1R3IH 4QGTA 4LAQH 3NH7L 4PG9B 4ALAH 5IKCB 2R0WH 2ORBH 4KUCF 1RZJC 1TJIH 4PV8A 4WFGD 5IF0B 2R2EB 1NGYA 3GSUB 4OBSA 1XZ0A 5D1XA 5L6YL 4NQCE 2ARJQ 2FJGB 1YDPA 3UDWC 3PP3K 1JL8A 4PJDF 4LQFH 2EDJA 4H20L 4XVJL 4G8IB 2NTSP 1U0QA 1YDPB 3HZVA 4QTHA 3QWRA 5JHDB 4PLJD 4WJ5A 3SDAD 4FZEL 3QDMD 4LDOB 4AYFA 4GKZB 3FFCB 4UOW1 5FECA 4L8CB 1QBML 5ISZD 1OOAA 3EAKA 4UILH 2AW2A 3QDGA 3S37H 1XR9A 2IAMC 1QZ1A 4RWHA 1QLFA 4M48L 4FXGA 3FQNB 5ICZA 4LSVL 5LCVL 3NFSL 1NCBL 1HCFX 2EIZA 3C5JA 4NCC2 4HH9A 4CDGC 4M5ZL 3RVWD 4RFNC 5DUBA 3H3PL 2UZIH 3TO2B 2XRAH 1X6LA 4PJBF 5EOQL 1I4FA 1NUFA 2GYSA 5I0DA 5HDBE 1DDHA 3KJ4B 2ZJSH 2H2PC 3QRGH 1P7KB 4ODXB 5CEYA 2X4OB 2R8SL 5HDLA 1G6VK 3CFJB 3CNKA 3V5KA 4KTDH 5DUPH 1BEYL 5GISL 4X99B 1LP9B 3MRGA 5D6DC 1I9JL 3C60C 3OXSA 4HWBH 2ZUWA 2UYLA 4O9HH 4RGOH 5C7XH 4UDUA 1EZVX 4F7MA 4TSCL 1CZ8L 3TIDB 2Q76A 1MJ8L 2AV7A 5IESH 3F7QA 4DVBA 1SY6A 1TIUA 3S34H 2BK8A 3O6MH 1PBYA 3PGDB 1EFXB 1N0XH 3PWPE 2VMFA 4K7FB 1FFQA 5CMAA 1IM9A 4FQXC 1MI5E 2NNAA 1B3JA 3WLWD 3WFDL 1JNHB 1SY6H 1L7IH 1GJIA 1QTYT 4E5XA 3ZYJA 4JPWL 2Q6WA 1FRGH 3OGOE 4PJ8C 4F9LA 1J9CT 2CLVB 2Z4QA 4E5XB 5TH2B 3BESR 2G2RA 4IOIB 3UTTD 2CRIA 2VZVA 3I9GH 4PV9A 3LS5L 3TJEL 2NW2A 2XY2A 3TO4C 4JZJC 2ZG3A 3CSYA 4RFOL 5T1LA 3OKKB 3P4MB 4E0RA 3CSYB 5T1LB 3NIFE 1JGVL 4WFHD 5IF0A 4DVRL 1IAIH 2WQRA 5SWZA 1T1XA 1VACB 3UP1A 1D5BB 2FX7H 4I2XA 3X17A 1FGVH 4UV7L 1MPAL 3IKKA 3NIFF 4R0LB 2OMBA 5IEKA 3U0TA 2B5IB 3OSKA 2AV1B 1U8JB 5DJZA 4LARH 5CD3A 4MSWB 3ZSSA 4ZS6C 4KHTH 4ZPVA 4YDKH 1KEGH 2CUHA 5DRNB 4WEBH 1X4ZA 1IL1B 4ZUTA 4M93B 4JRXD 5DI8A 1CLOL 1OP5K 3KPLB 5J1AB 1WZLA 3PWUA 2D4FA 4UIMA 1KJ2L 3QXAA 1IQWH 1CL7H 1S7VA 3H9YA 3UT0A 2FR4B 4M8QB 4Z0XB 3CDYA 1YPZE 1FV1A 5T3ZH 2EDQA 1PZ5A 3O11A 1BZ9A 2D03L 4GBXB 1J0YA 1AQKH 5BQ7B 4DKDC 4KI5F 4L8SA 5D93B 3EO1A 2DI7A 1MI5D 5SX5K 1T7VA 5KANG 5J6HA 3BP7B 4MXWL 4Z5RA 1VADA 1XGYH 3U7WH 2VLRA 1T7WA 3ZYBA 1MHCB 3DVGA 1T4KA 4MS8C 1YJDC 4D0CB 5ALBL 4KJQC 1FZKB 2RBLA 2GJ6A 1BVKB 2PCPA 4U1GC 3V8CA 4MJ2A 1MY7A 5IQ9A 1CTNA 2XG4A 4Z18A 1RAMA 3RWHB 2WUCH 4J3WA 3VFUB 3V2AR 5HHVH 4B7LA 1WBZA 4JM4H 3MYZA 3NCMA 1AGEB 3E2HC 1PDKA 2G9HA 4JY5H 1GOFA 4UT7H 5FYLE 3RJQB 4H88L 2FSEA 1A7RL 5F7YC 2AK4A 5DK0A 4ZUUA 4LCUB 1JNHA 4AIZB 2ZG2A 1H8SA 2F53E 4H8WH 5HGBA 4G6MH 1OAKH 3HFMH 2DYPD 4NNYA 2F19L 2R15A 4NKMB 1WIPA 4KQ3L 5H94A 1HSBA 3LH2H 5CEXB 2Q7NA 2DOCA 4O58L 1OD9A 4I18B 4WNQB 5L2JA 3KLAB 3FQUB 1I3UA 3U83A 3WIFB 4AT6A 1F6AB 1N0LA 2WLZA 5HHOB 2MCPL 4PJBE 4P4KB 1GYAA 3VXRA 4PJHF 3LD8B 5D2NA 1YEGH 3BHBA 5I8OL 2H6PA 5SWZB 3KPMB 2YSSA 1ACYH 1WC7A 4MAYC 5GJTH 2PTTB 4R96A 5C08E 5J1TC 3RVTC 3LQZA 5CUSL 4ODUA 4OM0H 4O4YL 1VB9A 5E6YA 1L7TL 2WANA 4GG8B 4QOKE 4PJHE 1DEEA 1W8UA 4LP5A 4PGEA 4LMQI 4FXGB 1WBXB 3U1SH 3QP3A 1HINH 1IM3B 3LRSA 1HILB 1HOCA 5T3XL 1QD0A 1Z9OA 1ORQA 2YA2A 3U79A 3SJVE 3NCCB 4IDJH 4LLUA 1QLFB 3CDFA 2O5YH 2MPAL 1KJ3H 1JV5B 4JO4H 5J1AA 4WFEE 3KPSE 2H2SC 1MF2L 5F7EH 1NCCL 1H3PH 3IKCA 4OQ1A 4EN3C 3SJVD 3WN5C 3TNMB 2F58H 1LE9B 4QF1B 1W8ZA 1BP3B 5AD0A 4KKAC 5IV2A 4F8TA 2HT3D 4HF5H 1IMHC 2PKDA 4LLYA 5T1MB 4Z78B 3V6FB 1A7NH 3VD5A 1NBVL 3QUZC 5DGRA 3UTZB 4X6EA 25C8L 4NNPL 2AQ3A 1EIBA 5IQ9B 4TUOA 1WCQA 4LEXL 4Z76B 1A4KB 2E9WA 4UT6L 2A2QT 3HZMB 5EBGA 2XA8L 1EEYA 3QPXH 3O6LL 4K7PL 5AAWA 2Q76B 4OLYH 3ES6B 4S2SB 1HXYB 2H8PA 2AV7B 2NXZC 1TTGA 2FEDD 2FJFA 3MOQA 2K9UA 5ESVB 4GRWH 2AK4B 4ZUUB 5T3XE 1KBGL 4QRPD 3OR7A 4RX4D 4OF0A 1T1YB 1A14L 4PJ5B 1RIUH 5EIIB 1NJ9B 1RUAL 4NJAL 3GRWL 2B7DT 4HPOL 4QYOB 4JKPL 4PR5A 1DCLA 1QLRA 4UT6H 1K8DB 2QQKL 2MKWA 4QHKI 3HMXA 1Q9WB 3DHMA 5IMKA 3WJLC 4G8FA 1P4BH 1LEIA 4NHUB 4HWEH 2DQDH 4LPUA 3EYOA 5H37G 3GO1H 2EDRA 3OKKA 2EKJA 4RX4A 3IU3B 1J18A 4PPTA 1NGYB 5FXCH 2ILLA 2X1WL 4I3SL 1CLOH 1OWWA 1TZHB 3KPMA 1SVZA 3MRNB 4LHUB 1NSNH 3VA6A 2EDKA 5I17A 4JHZA 4PB0H 1I9RH 1I8LA 4C58B 3ZE1F 3QUYB 1D5BA 1YY8B 3CXDH 3GSNA 4P9HL 2IPUK 4LSTH 3AGVA 4OI8A 1WCBA 3SY0B 5HBBA 2YWYA 3N1PC 4O2FB 1A6UH 4Y5VB 3V4UL 1UQSA 3LAFA 2CJUL 5T5NG 2MPAH 2JJSA 3GSNH 2EECA 5C0JA 3B83A 4XCYA 4NFCA 4WWKC 4H1LG 5CD3B 1Y18A 4XP1H 1PKQA 3BPCA 5I18L 1R3JA 5DUBB 3CCHA 5GRJL 1EEZB 1U8HB 3KGRA 1EUUA 3ETBF 2OYPA 5I75B 5ICYB 4NUGL 5HVWA 1FLRH 4XXCC 1DUYA 4NO3B 5HI4C 4M8QA 4IJ3B 3ZKSD 5KSBF 4J8RB 4UDTA 1IAIM 4C83B 4WWID 3QDJE 4JY5L 12E8H 1NEZG 2KUTA 5EA0L 1WTGT 5BS0E 5HJ3B 4X7TA 2DIJA 1KTDA 4XCEA 1IRAY 2WBJB 3C6SB 4BH7B 1F42A 2DWDA 2GK0B 3OR6A 5GGTH 1CD9B 4HKBB 3WNLA 5IR1B 3QDJA 2EYRA 4PP2A 3E1F1 3L3DA 4OZGB 4RGNB 5E6IB 3AS2A 4X8JA 4ZTPL 2FO4A 1W9FA 4IHOB 4NC1C 2YEZA 1K3ZA 4JFED 4X8JB 3PUCA 1OH3A 3QNZA 2G9HB 5DJAA 1LO3L 2YEZB 3GBML 2BC4A 2OQJA 4Y88A 4P0DA 4BSJA 4PJDA 1JWMB 5AG8A 3IFLL 3WHXB 2HTKD 4GAJL 1X5AA 2DQIH 4OUUA 2MCPH 4IMKC 4CN6A 2EDDA 5IBUB 3SDYH 3QG7L 1HSBB 4XRCA 4GKNA 4M7ZB 4Y2DC 1U3YA 5FM4A 5HYJD 3UYRH 2OR9L 3OAZK 4HGMA 2YD5A 3PHQA 3SCMD 4YDKL 1H5BA 3EYVA 3U1SL 1OAYL 3IDXH 4N5EC 3VG9B 3EKCA 2YD1A 5D2LA 3KAAA 2ITCB 2CKBH 3AU1A 3KLAA 1BOGB 4M8VA 1MOEA 5D2LB 3H9HB 4OLXL 2F74A 4P2OC 2CKBB 4P9ML 3HC0A 1CICB 2H41A 4LGRB 3X13B 5ITFB 5H35B 5IP4A 4GG8A 3L3OB 2FHCA 1RK1A 4CVUA 1X44A 2DMBA 4HC1A 3IAGC 1A3RL 1F11B 2IMNA 1W0VA 3LQAL 4BZYA 5HY9B 5LBSL 2OL3B 2APTA 3MPCA 5M7QA 2IAND 3DURB 4Q6IC 1KJ2H 1BVLA 4MXQC 4JFQB 3QWQB 1QFHA 3DSFH 2J8UE 4HT1H 3TYGL 2C9AA 3O3EA 1NAKL 5EUOA 3DRTA 2ZG1A 3QCVL 2EYSA 1N3NB 1P6AB 4Q9QH 4Y0GA 1S9XA 1MCBA 3ULUD 3VW3H 4GAYB 5GGSB 1AQKL 1NMBL 2R1XB 5EU6D 3VXSB 4K23L 4OZHE 3IJSB 4I5BB 1U8OB 3T2PA 3PHOB 4XVTH 4OCYL 3D87B 4X9HA 1DN0A 1EHLL 1NBQA 3FCTB 2X44D 3S34L 5FCUH 4GG6B 3EFDH 4DVRH 2BFVH 1JF1B 2Y4SA 4XI5C 2VLMD 4ZAKC 4FFVD 3H8NA 3Q5TA 4MDIB 2ZUQB 1K4DB 3CFJA 2V7NB 4JO3L 4OKVB 1JMZA 5MENB 1I9JH 3RWHA 5MI0B 3M07A 3ARGC 4XBEL 4S2SA 4H5SB 5F7DB 4H0IA 1OW0C 1FNFA 15C8L 2YK1H 4XP5H 1ES0A 5DZLA 2P7TB 4JY4A 3A6BL 4AIZA 3MREB 1NGXB 5K9QI 4DGYL 1AIFA 1UKQA 1ZHLA 1H15B 2W59A 3R06B 1K6QH 4NRXA 4OIIL 1S7RB 3WUZA 1T1YA 1DQJB 1VEMA 4PRNA 3C8KB 4GG6E 3UTSA 1CDGA 1GWMA 2VDRL 4ERSL 4LSVH 4X7DC 4OD2A 3HNTL 1H5BB 2VISB 3BPOC 1UADC 3GSNL 2I9TA 3BWUC 1ZLUK 2HP4A 35C8H 4WW1A 3FB6B 3CFDA 2B4CL 5C0CB 1PY4A 3O2VH 1J11A 1UGNA 2FEEL 4ODWA 3UEZA 2PTTA 3GSWB 4R4FL 2PO6A 3LRHA 5F9DC 3DRQB 4BJLA 2NQCA 3UJTH 1NSNL 4XMPH 4HG4J 5A40E 4U6HA 5GS0H 2X7LB 4Z7UB 5SX4I 3H3PH 4Y19A 2IG2L 2ORBL 2CDGA 3V5HA 5HHMB 5JIPA 3G5XA 4LEXH 4LHUD 4ODVH 3WEXA 4HAGA 3ROOB 4DZ8B 4U1IA 4YBLC 4XNQB 4NNPH 1T0MA 3VDBA 2Q86A 3BW9A 5JOPD 2OZ4L 4LKXB 4W4OA 2A74A 1XGTB 5D2LE 4ELMF 3TBWB 1DANT 5MERB 4PRIA 4G80A 4XXCA 4HUKB 4OCSL 4CW1B 2V2TA 3QIBB 4HJJH 4FN0A 1FV1B 2WP3O 5C71A 1DUYB 4NO3A 4HIHB 4CMHC 4H0HB 3RDTB 3QIBA 2BCKA 3BI9X 1B4JH 2B1AH 2KL6A 1JUFA 4JM2D 1OCWH 4PJIE 4YHIA 3MNWB 3THMH 4LKEA 3P11H 1J8HA 2NY6C 3CFCL 4PP2B 2W9EH 4HBQA 4MA1B 4MB3A 2FH6A 1U8QB 4WW2F 1QRNA 4O58H 1MRFH 5KVFH 1H0DB 1PG7W 3BT2L 2FECI 3OKMB 2A9NH 1K5NA 2BNRA 3L7EB 2YXMA 5F97E 1LMKA 3DV6A 1CXLA 2D7PA 4OCMC 1KPRA 3NIGE 4KJYB 2AJYL 3ZYIA 3QIWA 3BPNC 4K3JL 3TM6A 1ACYL 5GJTL 3P0YL 3VXMB 4P5MB 4WV1A 1I7ZB 3V4UH 5IM7B 5L8LB 4JE4B 1Q8MA 2IPTH 4QLRA 1D5XA 3WNKA 4CU7A 5EU6B 4Z7OE 3NFSH 4LIQE 4X6DF 5BS0B 5EU3A 1U8PA 4QRPB 1J8HD 4OBRA 1H8NA 4Y4KD 2P44B 1I3GH 4OD2B 1RMFL 1KCSL 1ZT4B 4AH2A 5D1ZA 3SJVA 3Q6FA 5C0AA 3RPIA 4K2UL 1EAPB 3W9EB 2Y06H 3QA3B 4FZEH 4WI5A 3NABH 1IAKB 4HC1H 4LFHD 3DUUA 3HR5B 4X9BA 1MCEA 4NBYB 4PRIE 1YEIL 5KSAB 1T3FB 4XMLH 4G8GB 4DEPB 4ZDHA 5FHAH 5IQ7L 5HGHA 3O3BA 3F5WB 5C86A 4Y19E 1I1YA 3BJLA 4NN6B 5C0EA 4UT7L 2YBRB 4Y7MA 5DD0H 3K81A 5MP6L 4OGYH 3W39A 1HYRC 1HHKA 5GGVY 4ONGL 1IEAA 4K55A 3LKPB 4U6TA 3RWFB 4UBDD 5E8PB 3SDDA 5JOFB 5DJZB 3W81A 5DWUH 4ODSH 3KDMB 3ZL4H 4RGMB 3C87A 3SDXE 1XR9B 4RWYL 2WIIA 4LP4A 2VO5A 4HH8A 3IFPB 2PR4L 1A1NB 4C57C 3TBTA 1VFMA 1Z9LA 4WFGE 1M1SA 1WZKA 1X4XA 3W2DL 4XVUD 5KJRL 3VFGH 2CRYA 2Q8BH 4XH2A 4X6BA 4MNQE 1J1OL 5T1KA 2JKXA 3T3PE 2ADFH 5J6HB 5EB9A 4M61A 3IYLW 1AXSA 4JRYA 3BO8B 3JWNC 5KVGL 4OKVA 3RZCC 1A02N 3MLSL 3WLBB 2GITA 2CLZA 3E6FB 4JB9H 4YPGB 2WYFA 1UACH 1G9NL 3O3DB 4YBQC 1ZLWH 1QHOA 2ZUQC 4X6CE 3QUYC 5GGQH 1QBAA 4JFZH 4X9IA 2R1WB 3DETD 1YNTB 2FB4H 3K8KA 3VXUA 3QUKA 2OM5A 3IDIB 5CP3H 3FT4A 3O0RL 2W1NA 3GMNB 4A2MA 5F8RC 5KSBB 1U8NB 3RZWA 4DKEL 5IVXF 3S3PA 2HMID 4U0RC 4L9LA 4ZFOA 3OJDB 5CZVH 4YDIL 4N8VA 1TJGH 4IRJC 5C0ND 1I1RA 3WFDH 1G1CA 3D0LA 3TPKA 3DBXB 1IQWL 1CL7L 3EZ8A 1GC1C 5J9PB 1A7QH 5K9JL 4WW2A 3R06A 1Q9OA 4NRXB 2R29L 5AYUL 1S7RA 4UNUA 3RFZC 1ZGLA 5DRXB 3QXWA 4JFDD 1IAOB 3L5WB 4KXZI 3L3KB 3QULB 4G9FE 2DRUA 4XCNA 4PJAE 2MCG1 2EH8H 3BZEA 5F93C 4G6AD 3QISA 3TBVB 4C4KT 1MCWM 4X4XA 4ZFZA 3KPSB 5J3HD 3PWPD 1OTTD 1CLCA 3D2UA 3PJSA 2KPNA 2BY3A 4LCWA 5TQ2L 5EOCH 3RU8H 3C5SB 4H20H 4XVJH 4E9LA 5JLZA 4TUKH 3B3IA 3CH1A 3FB5B 1YY8A 3GB7B 3U7YL 1NGZB 3UJIH 2HFFA 4P5KB 2BY0A 1DUZB 3BGAA 2QHRL 5KTEH 3BKYL 5C09E 1I3RB 1T03H 4Z7NF 3HI5L 5E8EA 1IM3A 4XNZC 3EJYD 2HFGH 4LVHB 3WO4C 4HS6B 3PABB 3WJLA 4ZUVA 5C0NC 2XQYG 3O2WL 4BFBD 5DRNA 4PJAB 2X1XR 4HIXL 4JHAL 4ZUVB 5IBTL 4HKXA 2EE9A 1MAJA 3IRPX 1JPGA 5SX4H 2R1XA 4U1KA 1CD8A 3HE7C 3CXHJ 2QKIB 3NCYS 1AI1H 1SY6L 1MCCA 3RGVA 4JPIB 1N59A 5CP7B 4BQ4A 2Y5TA 2VXTH 1NUDA 3O11B 1FH5H 3ZYZA 5TE7L 1UG9A 3MODH 3UAJD 3UYOD 1RK0A 4S0TD 1XIWC 1QVOA 5D7JB 5T1MA 4XNZB 3U4BL 4Z78A 1MJUL 4CU6A 2VNCA 1HKLL 4OZ4A 2G60L 1XF5A 2PUQT 3QNXB 4Z6AT 5KSBE 4OLEA 5I1LB 2ED7A 4LU5L 4C55A 4UIKH 3T77B 2FATH 3R0NA 1JCKA 1YMME 3O6FB 3T65B 3DMMB 1RZ7H 1EEYB 2JJSC 3KR3L 4EIGB 2BVTA 2HVJA 4WUUA 2KBGA 1TVBB 1F5WA 4HGKC 4V1DA 5I1JH 1C5DB 3CK0H 1W72A 1YJDL 3JV6A 3QT2A 4QCIB 3UBXG 5I0ZA 1A6ZB 1INDH 4Z7VA 1BVZA 3ZDZE 4PJ8D 1UZ8A 4YHYB 5IWLC 4M5ZH 4FFYL 1B6DA 2IADA 5BS0A 1HIMH 1J1PH 2EYTA 3FZUD 3L3KA 3QULA 3RVVD 4WFHE 5D72H 4LSUH 4L3CB 4MCYA 3DWTA 4OGYL 3FN9A 4NYLA 4MQTB 2XWBA 2Z31A 1HSAA 2HFEB 3MV9A 4IIQB 1CWVA 4JM2B 2F5BH 1BOGA 5EO9A 3PF2A 3DUUB 3S3JA 4NO0A 3VFTA 2XTJB 4KK8C 5FYJD 3QR2A 3FKUS 3U46A 2NY3D 1ED3B 2EDHA 2IALB 3RIAF 4U7SA 4J12A 3NCBB 4TQEH 4LF3A 1EDQA 3N9GL 1ZANH 2X6MA 3Q6GL 4X4ME 3BXNA 3ROOA 3ZT5A 2QV2A 2CRMA 2GFBA 4OZFH 4NQVB 4XB7A 5I9QB 3QUMH 4EQ2A 1BIIB 2YHGA 3IFPA 2OZ4A 3MZTA 1AQDA 1YEDA 3GSOB 4KVCH 1T5XB 3X11B 4ODVL 1UA6L 4DQOL 4CVWA 2Z92B 1YEDB 1FL3B 4W4NA 3QXDA 1SJVA 1U8HA 4U1KB 5C6PB 4G6JL 4OLZH 5E5UB 3WKNA 3SEPA 3GM0A 4F57H 1EBPA 1GPOH 4RGOL 4X9FA 2AJYH 5DZOA 1HKLH 4H1LH 1E6OL 1J88A 1W8OA 2EXYD 5DF0A 2VLJB 1ODAA 5TF1L 2OXHA 4XH2B 4Z5RB 4NZRL 1B0GB 1QLEL 1ZA6A 2NY0C 2X4QB 3GEWB 1SYSA 4KQ4L 4L1DA 2QQLH 5HJ3A 4LVOB 1BJ1J 4YHIB 1N5AA 4WVRA 2P5ED 2P45B 2GSGA 4IOFD 4OM1H 4NKIH 3WNOA 3TPUA 5HHXL 1JF5A 3MA7A 1QR4A 2XICA 3OGCB 4PJ8A 3U9PH 3WKML 2CLZB 3E6FA 2Y25A 1BECA 4YPGA 4PG2C 5A3IC 5BJTB 5HSFA 1MCLA 5D6DA 2ZUSA 2G60H 1DVFD 1UB6A 5DJXA 3PDDA 3HI5H 2BRQA 1Q72L 4FFWC 1YEJH 1BHGA 3B8SA 1LE5B 1UCBH 2J88L 1S9KC 2ZCLL 1FSKB 4RSVA 5J0BA 1KJMA 3DVNA 2WAHA 5HGBB 3LZFL 4K71B 1JGUH 1Q9OB 3INUL 2ED9A 4OZIF 1KLGA 3QHTC 4OIAA 4HIIA 5E08L 5JW5B 1N0XL 3TO4D 1YY9C 4WW2B 1G7JA 2FJHA 3LQMA 3EYVB 4J6RL 3WJJC 3Q6FB 1LNUB 2NR6C 3RPIB 2WIMA 1AFVH 2ITCA 2IH3A 3OPZL 4IRSA 4K3HA 5CEZD 1OF2B 5L9DH 3JWDH 3D69B 2GJZB 5FA4B 2E7MA 2GY5A 5D72L 4QHKJ 3D39E 3F58H 3S36H 1UEMA 3RNQB 2BHZA 1N5YH 2FIRT 1L6XA 1Q94B 3P73B 3ARBC 1JGEA 1KTLA 3BPLC 4XVUC 4JZJA 4Z7WA 1DVFC 3OG4B 5DURD 1YEFL 3CVIH 5JXAL 3BDXA 2WBWB 2DQEH 3I6LD 3JV4B 3FFCA 5KS9F 4L8CA 4GH7B 3L95A 5E1HB 3LKNB 5SV4A 4OCRL 4L8SC 4HIEA 3EDFA 1BIIA 3DV4A 3PG2A 5IGXH 3BKMH 4DWHA 4HKXB 1JN6A 3PIQA 3HN3A 3VFOB 1ROWA 1B88A 2R2HA 1DLFH 3GMQB 4K9EC 1JZ3A 3MRLB 2BSRA 3PIQB 3VFOA 3QUML 5B3JE 4G5ZH 1LDPL 1CFSB 3G04B 1KLUA 4EN3D 4PGBA 2Y36H 4NWUL 3QUXB 2XT1B 2P42B 3MLWL 1AY1L 5DVNA 4Y4HC 4EEEA 4N8CH 2Y5TB 3BISA 4HK3N 4DK6A 1OLLA 3DROB 5JMOC 1B0RB 4P9HC 1J7VR 1KT2A 1T20B 3QO0B 3VFWB 4IRJD 1E4XH 2P47B 4JANA 2RFXB 1VFUA 1BBDH 3WIIH 5IMMB 5CJQH 4P57A 2CMRH 5SWSD 4RMSA 2VZSA 5GGRA 1A4KA 3ZE0E 1C5CH 3VMPA 2NY4B 5FO7A 2R23A 1SEQH 5C0IA 3TIDA 1T22A 5JW3L 5F96H 4C4KO 1IGIH 1N6VA 5HHPB 2VZUA 4MQ7A 5IB5B 2ICEB 3ARFA 4ONFH 4WU5B 1KCRH 1BLNA 3MSPA 1QSEB 3LIZH 4WU5A 2R0KL 5GS0D 1F4WL 3PP4H 4RRPG 1YPZA 1XR8A 2VZ3A 3T1FB 1VGKA 2ADIA 3VW3L 4HIJB 4Q2ZB 2BOCB 2AEPL 1PEZA 2UV3A 2NXYC 4M43L 3O9WC 5IWLA 1I7RA 4F7PB 5D1QA 3RY5A 4XRCB 4LPCA 5ADPH 4UUJB 3TESA 3B2VH 5F7HA 1Z9SA 4F37F 3RUGA 1MSPA 2H32B 4XXDA 5A43C 1A7OL 4LSUL 3TVMB 3ZKNC 5HHOA 5F21B 3H3BC 1OPGL 2Z31B 2NZ9C 4Z7WE 2C3HA 1T1XB 3VU2A 3QIWC 4P59L 3LEYL 3ARGB 3CGTA 3G6AA 3C5SA 3JWDC 1MJUH 4MNGA 1HEZA 3P73A 2V9TA 3K2MC 1HHIA 3IDNA 3MV7A 1GZQA 3D2UD 3N1FC 1HXMB 4J3SA 5E4IA 1NPUA 5D96B 1U9KA 3K3QA 4DGIL 2ADJA 4QEGA 5FM5M 3DX6B 4HS6A 5TDPB 3QG6B 1LO5A 3PGFL 1BQSA 4N90D 5F89B 1KCUH 4WY7L 1Z6JT 4Z7NE 5JZ7D 3LKOA 2XIDA 1TJHH 5JHLL 2IBZY 5HDQL 4JFZL 2FR4A 1URLA 3MGTA 5AG9A 2P8MB 3QHZH 2KZ1B 1JGLH 3G6JA 1LO3H 4JPIA 4QWWD 1RJYB 3GI9H 4P5TD 4AK1A 5CJQL 4K3JH 1CK0L 2NMSA 2JTDA 3AUVA 3HNVL 5D21A 4LVEA 4XMLL 2OXGA 2LRPA 3S35L 2VLRB 1YEHH 2VXTL 5TE4H 1PY9A 2YUWA 1T1WA 3HB3C 3INUH 1OAUH 4OT1H 4RIRA 5GGVL 2ZOKA 3OGCA 4PJ8B 1I9EA 2GAZB 2XNAB 3MNZA 1R5WA 3CSBA 1MFEL 2AI0H 2GSGB 3MV8B 2GAZA 2BSSA 5E6IA 2VXQL 1YMHA 5I19H 4N9GB 5I15L 2A83B 2FO4B 2XQBL 3RWCA 1OGAE 3CUPA 3BN9C 5AYQA 2LFGA 5CWSA 4RMVA 2BVEA 2OLDA 3S88L 4NQSA 4APQC 1UFUA 4L8BA 1MCDA 5JZ7C 4ONGH 4TRPH 1G9MH 4QCIA 4KK8D 5GS3A 3VJ6A 4OCXH 4UAOC 3F12B 2CLVA 3KYOA 4QYOA 2GUOB 4ZUWB 2VDNH 4HLZG 5D7JD 2LU4A 4ZS7L 2H9GB 1EEQA 1RUKL 4ZQKB 4DCQB 3REVA 4S1QH 4XT1C 4HWZB 2EH8L 2PTUA 1YPZF 1F3DH 3RNQA 2BXYA 1XEDA 3MXVH 3IB4A 4NDMA 2X42A 3IU3A 4RAUB 4MVBC 1NH6A 5E00B 2WBJC 1FG2A 3KJ6H 5E03A 2J12B 5JNYB 4BUGA 4E42B 3U46B 1WICA 4NN6C 5EZJA 2FGWH 3SO3B 2R4RL 4ONHA 3GSNB 1C08A 1KXVC 4NQEE 4GRMB 2EXYC 3FB5A 3OJMB 3PWLB 4AIOA 1DQMH 5D9SA 3W9DB 5DZNA 3K74B 4GRMA 1S7XB 1DJSA 5LAXB 1MRCL 1RURH 5I73B 4QGYA 3REWB 4OV5A 3L6FA 4X4ZA 1M71A 3T09A 3NN8A 1I8KA 3BOVA 3C9NA 1DQDH 4PJAA 4K8RH 5C2UB 2H45A 4GW5A 1KBGH 5DEGA 3HI1A 5DHYA 5DJ2A 1TZGL 4DAGH 2Y6SD 3GUTA 3SDCA 3LDBB 3JXAA 3MRDB 3NFPB 3MYJB 3CXHK 1GGBL 5HYFA 1JYWA 2C3GA 5A2IH 4HXBL 4NO0D 4XMKH 5DD1H 4JRYB 1RY7B 3WIHL 2VLJD 4MJ6A 3I6GB 4YHML 3QEGL 1GVIA 1XCQB 5I1DB 3MJ8B 5IB4A 2DI8A 4WO4D 4NP4H 2EDFA 4P57B 3WFZA 1IKNA 5TQ0L 2DQCH 4R2GC 1A5FH 1ZA3A 3IDUA 3LN9A 1D6EA 3VXUB 4P23D 3IDIA 3NIDF 4KKLC 3BZFA 3QWOB 2EDBA 3AS1A 3PL6D 3JWOL 4H8WL 1KPVB 4PJEF 1PYWA 1J8KA 2JK5B 3QNZB 4EDWH 1HHHB 4EI6A 3BZDA 1SYVA 4IS6B 3WCYA 3OR7B 1TNMA 5E2UL 1B2WL 4LSSL 4ORGB 2VKWA 1RULH 4MNQD 4PY7A 5EU4A 4V1DD 3F6LA 2V5RA 3HCVB 1B6UA 4ELMB 3AAZB 3QCVH 1E27B 4KJPC 4U3HA 5H94B 1U92A 3T0EC 1YECH 2C3XA 4DN3H 1S9YB 5D1QB 1OB1A 4N5ED 1OM3H 3BD4A 4KZDL 4MD0B 3E6HA 1IGML 4KDTC 2PO6D 6FABH 35C8L 4IMKA 4PJGB 1ACZA 4LJHA 4LKDA 4FQJH 2O5ZL 4Q9RH 1SJEA 3BZ4B 5DYOB 1I9IL 4YIQB 1KCLA 3C08H 1NAMH 3MMEB 2FEEI 4HW6A 2QR0A 3CMOL 3UBXI 1A4JA 3BQUB 4JZOA 1JNNH 5DS8A 3MJ7B 5TE7H 3T04D 5EZLB 4GQPH 3L3JB 4MXQD 1WIUA 1JZ8A 2OK0L 5DS8B 5SWZE 3OX8A 1ZE3C 1MWAH 4W6WB 4LK7A 5GRYA 3FB8A 3CPLA 4WEBL 1OP3H 3N1GC 3KPNB 1K4CA 3H2WA 5D70L 3N1QC 5EU5B 4PJBA 3WHE1 4CPBA 4Q6IA 3TH2T 3U0WH 1R24A 3KPLA 4XHQA 4UIMB 1FGVL 1A6WH 3JTTA 4FG6C 1J05A 4P3CL 4GKOA 5EFIB 3IGAA 5HI3D 1A6TB 2F53B 2M26A 3LHPH 4F7CA 4X4YA 1P7QA 4ACPA 1TZGH 3I75B 1Q0XL 4KJWD 2JB5H 5D6CA 1T4KB 1J87A 3E3QE 2RFXA 2ICES 1XCQA 4X7FC 4XAWH 5GRJH 4YHZH 4WI9A 2I9LA 1NDMB 3RVWC 3MJ9A 3V4VL 5H2BB 3DYOA 4JRYE 1R5WB 4M6NH 3VWKC 4M00A 5ACZB 4M9PA 2FYYB 5F6HI 3ARFB 3ARSA 3K7UA 1X3DA 1Z5LA 4NWTL 4XX1E 4L8BB 2VTFA 1ZTXL 1ZT1A 4WWKB 1NCNA 3O8XC 4GMSH 3NAAL 3VFNB 1C1EL 2VR5A 4MB4A 1F3JA 3UZVB 3TA3A 3C60D 2Q7YB 3UJJL 4UINL 4R4FH 5E9DB 2APFA 5I75C 1IEBA 3IDGA 4QT5A 2XZCL 4M6AA 3NFNB 3MRFA 3O45A 2GUOA 1XIWA 3R4DA 4KGJA 1C12A 5CSBA 5E1AA 3WIFA 3E2HB 4XXDB 1X5YA 4YZFF 5C8JA 3WS3B 4LLMA 2ICWJ 4OFYD 2FEDC 2Z8RA 4RAUA 5CD5D 1MPAH 2ZSWA 1RVFL 3UTQB 5GPRA 1SEBA 3W5MA 2FJGA 4CJ1A 3GSRB 1RK1B 3RHWK 3LEXA 4NQEA 1C1EH 4AY0A 4YXHH 1A4JB 2FLBT 3RWIB 4DGYH 1UB5A 2JB5L 4R8WH 2MQCA 4XWGH 5J7CC 1FL6B 3BP5A 5ID1A 1R3LB 4P2OB 1QSFB 4UBDC 3TJEH 2A1WH 3NCJL 4M6OL 3RNKB 5J8OA 2J8HA 3T4YA 3O3AB 5KW9L 4PGJA 1NLBH 1Z0MA 3MRPA 1MCPL 2FHFA 1VFBB 3GGWA 3HS0A 1MI5A 1AGBB 4GJTB 4JHWH 5AEAA 5IT2H 2X10A 3VRLE 5EU6E 1SMAA 1S5HB 4XCFL 2I07A 2FL5A 5DJ0A 5GRVK 3GI9L 4FFWD 4YGAB 2FL5B 2FGZA 3CVHL 2DM3A 3V5KB 4N0UA 1P1ZB 4APQD 5I6XC 3U4EA 1II4E 2DQHH 3U0WL 4QTIH 1A2YA 1VCAA 1XGQA 3CMOH 4JDTL 3ARFC 3T2OA 2EO1A 2O5YL 4HKBA 1QKZH 1FN4A 5C08D 4PIRF 4PJ9C 3FT4B 1X5GA 4GBXD 2C1OA 4M7LT 2FH8A 3VH8G 2CO6B 4XNYL 4MDJA 4BSWA 4Y4HB 1FYTB 2VE6B 4ETQB 5JA9A 1P9MA 2DBLL 1MNUL 2BC4B 1BLNB 4TVPD 4Y4HA 4JRXB 3O6FC 3LKRB 4PJAF 2HG5A 4XHJD 4WTWA 4MS8D 4NQDB 5CIPB 1KYOJ 4JDVA 4YDJA 5JW4R 1F3JB 3AXLA 2DTML 1AXTL 4G6KL 5GGRY 5JW4M 4MA7L 5EU3B 4U6XB 1CLYH 5JTWA 2E9BA 4NZJA 3D5OF 2JIXD 4NHUA 4IRSB 1W8NA 2HJKA 2APXA 3WYRA 5FDWB 2GJ6D 5C0BD 5IEHA 4WI3A 1FJ1B 3QJFB 1EEUA 5FA3A 2MHAB 5I2IB 2E7HA 2HJLA 2X4RB 4MAUL 1FNHA 4JM2A 1A47A 3LY6A 5EO9B 2HTLD 4MJ5A 5KOVC 1U3HC 2F54D 4XPGH 5BRZD 2HRPL 4PRAA 3T0VA 3BH8B 4I18C 4Z7WB 1S7WA 2EDNA 5GRWA 3HAEG 2BVUA 1LWRA 3L5JA 3F65A 4MNGE 2OL3A 3BH9B 4JO4L 2WINB 4Y5XC 4MGXA 2EE6A 1BM3H 3QHFL 1BD2A 4XP6L 4NZTH 2R2BA 1JNJA 3IF1B 5IHLB 5BW7C 1U8JA 1ONQB 1I8IA 4YC2B 3T4YB 5GS1B 2G5RA 4JVUA 2X41A 1T5XA 5FGCE 2VAAB 5ICYA 1FL3A 2RB8A 3G6JF 2OS7A 3WJJA 4G80B 4MX7A 5ISZE 1RHHB 1CFQB 4HUXA 4YHMH 4PTUB 2AJ3B 3PV6A 5FF6A 2VRAA 2HWZH 4DUXA 4UV7H 1RZJH 3HG1E 3VXRD 2XQYK 4P5TB 4H88H 4RNRB 3HNTH 4L1HA 2ICWA 1BAFL 3BIKA 4MD4B 3W0WA 4BQ9A 3F7VB 4X4YB 2ICWB 4XNMB 2PW1A 4PRBA 2Y72A 1A2YB 4LQ1A 2D7TH 3D25B 1ND0A 1E4KA 1K4DA 4YXHL 1PG7H 4GRWB 1DVFB 4OLYL 3MV8A 4OLVL 1AGEA 3C5ZD 15C8H 1G0DA 5L88L 4FNLL 1K5NB 4XP4L 4YWGH 3FAWA 2Q8AH 1P6FA 3QUZB 1XGPA 3EHBD 3H9ZA 1D6VL 3WUWG 3MRJB 3IFOB 2VIRB 1I7ZA 2V2WB 5CWSB 4O00A 3BD5A 4JN1L 1CLZL 5BRZE 3MBED 4OFKA 4XC1L 4I9WE 5ENWB 5DRZB 4PRHA 1WAAA 3IJHA 3C8KA 1NGWB 4I3SH 4OF6A 4ZXBD 5JW5A 2H3NB 3BSZH 3IJHB 1M4KA 4HKJB 4JJ5B 1FNLA 5KG9B 3S6CA 3HUJA 2MSPA 1JHTA 2YMXL 2QQKH 1G7PA 4A6YA 3D2UB 2I26N 1FNAA 1FL5A 4EXKA 4NT6A 1EAJA 3CMGA 4LAJH 2YD6A 3HC0B 3H0TA 3ILQC 2J8UA 2F19H 5EN2A 1F6FB 2N56A 1NBZB 4QWWC 3TFKC 3SDAC 1L7TH 4WTXA 3TT1H 2B8OT 3UTSE 3TVMD 3CPLB 1JTPA 3RTQA 1BD2D 1BVLB 1DBMH 5FECB 1CGSL 4J1UB 4NM8H 1P5VA 2OTUB 5F89A 5I71B 1GGCL 4U1LB 4G9FA 1FORH 1V0AA 1LO0L 3GMQA 4ZD3H 3IKCB 1QEWB 5DUPL 3UO1H 1RV6X 3EJJX 3FFDA 4OT1L 5GGVH 3OV6A 1KGCD 4XAWL 1UXWA 3PV6B 1QFUL 3X14B 2X70B 5DD6A 2P8LB 1NDGA 2E7LC 1FC1A 4KROD 4UINH 1T0NB 3WSQH 5D7LD 1S9WA 1WUNT 5F7NC 3NFPA 3MYJA 3B4NA 3K2UH 5LQBL 5E4EB 3EDJA 2EKSA 1X5LA 2AEQH 2L7JA 3R8QA 5FYKU 2DD8L 1P4LB 1E4WH 4U0RB 2NX5A 1C5BH 3LS5H 2R9HC 1LGVA 3ZKQD 4G7VH 3DMMD 3VE0A 1HKFA 4YBHA 1HHGB 5KS9B 1U8MA 3SOBH 2X05A 2V7HB 2BJMH 4AENB 4KQ3H 3LKRA 5F3HA 4JM2C 4UNVA 3ECBA 1RJCA 4KRNA 2N4IA 2VC2L 4ETQA 4KAQH 4TSAL 1PGRB 2DLGA 5MHSD 3DUHA 3ZE2F 3TBYA 1P53A 4PY8I 4JGMA 2Q7YA 3U30C 4PBWD 1MAMH 5HHQB 5J11C 3MLWH 5F70A 3QEQD 3BIBX 3C08L 4Q58C 1H3TA 1IC1A 4MNQA 3ARRA 4P3CH 3DX8B 1S9VA 1I7UA 3P9LB 2L0DA 4K8RD 3EYOB 4HEPG 1TDQA 3GKZA 3MX0A 4XPBH 4U1HB 4ENEC 4HWZA 1CG9A 5J13C 3PE9A 4P3DA 6FABL 1U95B 4NN5B 5F96L 2E9JA 4P23A 3P2TA 3JVGA 1KJ2B 1U6AL 4D0DB 2FBOJ 3JUZA 1KJ2A 3QDGE 1RUMH 3H0TB 3VRJA 4OZFB 3RZCA 3SDYL 3T0EB 1CI5A 1JNNL 3GBNL 1QO3B 1U8KB 3SQOL 3WIHH 3DURA 1KELH 3EW3B 5FK9B 4DOHB 2DQHL 3T0EA 1A7RH 1NCBH 1P5UA 2MMXA 3FTGA 2WINA 3PABA 5D1XD 5F44A 3MV7E 3S36L 4I4WA 3V5HB 3REWA 2HKFH 3PGCB 3V4PL 5F7LB 4WGWB 3UBXA 5D7SL 3TO4B 4QRQB 2EEDA 1NCTA 1C16B 3KPPA 1T6WA 3LKOB 5JMRA 3UPRB 3B2VL 4M6MH 3MRIA 4GBXA 4ZSOB 1P7HL 1RI8A 4NKDA 1EEZA 3C5ZB 1G7IB 2X4TB 5E08H 1R5IB 2GTZB 4LVOC 1KSRA 3CLFL 4JHBA 3OJ2C 5DQDH 1JRHL 1FRGL 1XH3A 4QXGH 2WBJA 1P84J 1YMMB 2QJDA 2YC1B 5IBUG 1RUAH 4NJAH 3BIKB 2ED8A 3O3UN 2J88H 2VLKE 1V3KA 3G5ZB 4ESKA 1RZKH 3V0VB 2FGWL 3AY4A 1HZHH 4H1LB 4MAYD 4ONOA 3ULUC 3Q3GB 3KJ6L 2JWPA 4GOSA 3RDTC 1MCJA 3FMGL 3BN3B 1C7SA 3VFUA 4AENA 1S7TB 4PTTB 1RUKH 4HWNA 3EOTH 4BZ1L 5A2JH 3LD8C 4JFOA 1UH3A 2JB6B 2D0FA 4QXUH 4ZFOB 2ITDB 4PJEA 3ZYOA 4MZ3A 2VOTA 4YXKL 3IFOA 3IXTB 1GHFL 4R97C 2R56H 4PG2A 3V5DB 5J6GA 4KDVA 3WD5H 2W65B 5LWYH 3CZFA 5TH2A 3EYSH 1YY9D 3C60B 5GGUB 1IAIL 3KYOB 4R4BB 4A2LA 3RTQC 3EUUA 4UV4L 2HMIC 2DL9A 4OI9A 2GQHA 3G6JE 1ZT4A 4D9LL 1IT9H 1MRDL 3B5HA 3QJFA 3FT3B 3NH7H 3GJFA 4XPTL 3NZHL 3QXUA 1Y6MR 3UTTA 5C0BB 1W90A 1EVUA 1GH7A 2F8OA 4M48H 5BVJA 4X5WA 4PJHB 5C0EB 1T7ZA 1ED3A 4F2MA 1S7WB 3X13A 1KIUA 3IDNB 1Z3GH 3MV11 3TCXA 4L4TB 3GMRA 5C0RH 2NW3A 5JORA 1CFNA 1IJ9A 5EOQH 1JZ5A 2IQ9L 1HILA 1HOCB 1V3JA 1A6VL 3PWLA 2W07A 2FIKA 5GSVA 4G8GD 2OJZH 2YXFA 5GRUL 2JLLA 4OIBA 5FKAA 4OI7A 3GSOA 1I8IB 1OTTC 5C07D 3OTTA 4M6ML 4IRZL 2EZ0D 3CX5J 1OAZH 4MA3A 3BKYH 1FO0B 4UQ2B 4L29B 2Q86B 5D93C 5I8OH 5C7XL 3VFPB 4LKCA 2ZUXA 3GGWB 1XF2A 1KB5L 2FD6L 3PHOA 1OTSC 4UTAL 5I1GH 3JTTB 4PRPE 1CTOA 4U6VH 1INEH 1MY5A 3VXSA 1R5IA 4XPFH 2BMKB 3HZKB 2LU7A 4KKAD 3S35H 2RAMA 1OVZA 4GW1A 1KCVL 4FA8A 3H7BA 2Y07L 3HAEA 4CAGA 2BVQB 5FO9A 1CBVH 4Z77B 2YD2A 4DZBA 4LASH 1OHQA 1NUGA 5IR1A 4YUEH 1R3IL 4N1CA 2ZSVB 1HZHL 3SDXF 3ARVA 1F2QA 4F58L 3O4OC 4ODHH 2YRPA 5IB1B 3BQUC 1MIMH 4H5SA 3PDGA 3Q6GH 5EC2A 1A7OH 5DJAB 3ZE1E 5AWNL 2NZIA 1W72L 5D96C 1ZHLB 4KQ4H 2HH0L 1KLGB 4HUUA 4L4TD 3RI5F 1DBJH 5E94A 4OAWB 5DDHB 5I1IL 3FN0L 1JNLH 2VXVL 3LS4H 2K3TA 3B9EA 1UWEL 4F57L 2O61A 1RJZB 1PKQE 3VWKB 5IFAH 1YEGL 4ZTOL 2NCMA 3SOBL 3D69A 3ULUL 1UM5H 1FIGH 2ADFL 3HR5A 1IGIL 1PQZB 4EIZC 4HAFA 1FNGA 2NY3B 3VXQA 2BOBB 4XZUA 1MUJA 5E95B 5ALCL 1PEWA 3LN5A 2X40A 3SY0A 3P0YH 3GIZH 4I0PA 4ZO9A 2AEQL 1KTKE 1JIBA 5EN2B 3W11C 2PO6B 3MGAA 1EVTC 4TNVF 4R3SA 4L4TA 1JNLL 3BEVB 3FTGB 2Y07H 1IARB 3M45A 2PR4H 4OD1H 3P9WB 2XTJC 2QSVA 4RWYH 5DHVA 5EU7C 3RI5K 3DV4B 4GXVL 5I1AB 1BMGA 5SWSA 5D7IE 1TQBB 5I74B 5J11B 1FC2D 1I85A 43C9A 4PJCF 5DR5H 4LLUB 2I60H 2R0LH 4TVSa 1F6LL 1MCKA 2ARJA 3ALWA 1PSKH 1YN6A 3VDCA 5L2KD 5F3BB 4G5ZL 5EO1A 5DFVD 4QRQA 5EU5A 3VGGA 3ARED 3P30L 2B5IC 2APBA 1MQKH 3HC3H 3C09C 5F72S 4YWAA 4HUNB 2BY1A 3EJZC 3I6KA 4R0LC 2IWGA 4AQOA 2WV3A 2YC1A 5T1KB 4RGNC 4XWOD 5KTEL 2AJVL 2DLIA 2RQ8A 5I1CL 4UNTA 3MNWA 5EBMB 1H3GA 5TE6H 2IGFH 4KMTL 5ETUA 1KIPB 4XP9H 4Q97A 2IBGA 4WU7A 2IPUG 2R4RH 1J0ZA 4NNXB 4RMTA 5MENA 2YPKB 2XKNB 3EYQC 5KN5A 4LGPB 4KK5D 1OT2A 1YMHB 4AJ0A 4PJIF 5BVPH 1HCVA 3OB8A 1T21B 2OP4L 4ODTL 5E6IC