3ORJA

Crystal structure of a sugar-binding protein (bacova_04391) from bacteroides ovatus at 2.16 a resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
429
structure length
429
Chain Sequence
DDNGGSSVMNITGIYLEDAKSNVPDRLVDFARLGQLIRIEGEGFNGLKKVYINGYNCYFNPVFVSNKSFLVSVNSKVPTTEADENVRNTIRLVKDGGEYVYDFQIRAAAPSITKISNCMPNVGEPIIVYGSGLTEIAKVVFPGNVVVTEGIISDLDGEYFMVDMPAGVSEEGGSIFVEGSNGGAYSPAYFNYKKGLLLNFDGVGAQGAWGDSESMIQTTELESASIGEGNVSQGAYCRLPLERQLPVAAAKNRCAEVWTAGNGTDPDWLTLGVPAETPVAECAIQFEIYVPEPWSESGFLKICGQNGFNGGEWERDCYNYVPWLVDGKIVPFQTTGWQTVTVPFSEFYKSKASSGAWTTFADVTATRASASYANFGFYFENSDITLDKITGASSDKETEFLSKATSVKIYIDNWRVVPLTKPEYTDFPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of a sugar-binding protein (BACOVA_04391) from Bacteroides ovatus at 2.16 A resolution
rcsb
source organism Bacteroides ovatus
molecule tags Sugar binding protein
molecule keywords sugar-binding protein
total genus 96
structure length 429
sequence length 429
ec nomenclature
pdb deposition date 2010-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18329 SGBP_B_XBD Surface glycan-binding protein B xyloglucan binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3orjA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3orjA02
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 3orjA03
5BV7C 3N9GH 1F58H 3WIHA 5EZOL 4RGNB 1VSCA 2R1WB 1FL5B 5CCKL 2D9QB 1A7RH 3CLFL 2VDQL 4LRNL 4EQ3A 5I1CL 3OKNB 3FFCB 3F8UB 4M7LL 4ZFFA 3V95A 2XN9A 4OLUL 1E4XH 3L7EB 4L4TD 4XBEH 3QH3B 1DE4A 5GS2D 1J8HA 1A5FH 1FNFA 3P4MB 4YXKH 3A6OA 1XF5A 4NZTH 2P8MB 4OM1H 2XZZA 2VLMD 4GAGH 1D6VL 4XBGB 2H2SD 4XPFH 1EFQA 2ATPB 4Q9CA 5FKPB 1YEIH 4G9FE 3B3IB 1BP3B 3E8UH 2EKJA 1I3RB 1IM9A 1T5WA 4P5MA 2ADFH 4U6HA 4KZEH 1TQBC 4F7PB 1FHGA 4P2QA 1P9MA 3UYOD 3FT4A 1NBQA 3SJVD 3TCLA 4F7CA 4PJDA 1ZLUK 1UCBL 5EUOA 4HS3B 5C0GB 3PWLB 4XX1G 1RJYB 4OAWB 4FFZH 4WJ5B 4YBQD 5FOBA 5LG1A 5I1AB 1A64A 4HUMB 2LROA 3WFEH 1JPGB 2Z91B 4LRNH 2FIKA 4O51A 3GIZH 2BVQA 5FGSA 4NHCH 2ORBL 4ORZC 4UZGA 1KB9K 4NNPL 4PJXA 4QXWA 2G75A 3MUGB 5DD6A 5IB3A 1D5MA 2ZG3A 1R5VA 3LV3B 1RV6X 4G6AD 2PYED 2H2SC 3ROOA 5C07E 1N8ZB 1CVRA 1RD6A 4YXLL 2AABH 3MV8D 3X12A 4LHJB 4M6OH 4QRTA 2W9EL 3GBML 3RWIB 4LHUA 4UILH 5IW3A 4XVUC 4DUWA 3ET9F 1EFXB 1MRDH 3GNMH 3DX7B 1FYHB 4S1SH 3N1QC 4CMMA 3L3KA 3QEUA 5T5FH 3QUYA 3RVXD 3X3GH 1J05B 2Q6WA 3QUKB 4DTGL 1QLFA 1JI1A 2VDNL 5DDHA 1XR9A 3BE1L 4D8PB 5FGBC 2IWGA 4LVOB 5EFIB 4HKBB 3HC4H 5C09D 1H8NA 2B5IC 2NY2D 2JJWA 4HLJA 1WCBB 4Z95L 5HDBF 3TBVB 4MAYC 3BGMB 4KRNA 1I9IH 2HT4D 4ELME 5D5ME 3QUZA 3QIBD 3P0VH 2H32H 4XPHH 4OKVB 5IM7B 3SDYH 2CDFA 2Z31D 3EJZD 3OXRB 2FRGP 5IEHB 1E4KC 3C8DA 3C09C 2IALA 5FYKE 4H1LB 4XC3H 1VA9A 3IETB 4M93C 4PGJA 4NNXB 1FGVL 2B4CC 3W0WD 4IDJL 3U36A 2XXCB 4LQ1A 4C57C 5KS9E 3ARBB 2ESVA 4Z7WA 3MNWB 4G43B 5DF0A 2LAGB 4P23B 4X9GA 5L9DH 4JREB 2VDNH 2N56A 3BGMA 2I07A 3GIVB 3QUXB 4PJXF 1HIMH 2HP4A 1I1CA 3FOLB 1LNUA 4Y7MA 3RY4A 1JL8A 4M62L 1U8IB 3H42L 5C07A 5EZIL 3RY6C 1WK0A 4H25A 4OZIA 3NMEA 4HLZH 3TT1L 5T3ZE 1RHFA 1I1FA 2LU3A 1KJMB 4JFFD 5HTSA 2O5XH 1QFUH 5GJSL 4NKDB 3ZHDA 2VH5H 4I2XB 1U36A 3PG2A 4RZCA 4ELKB 5D2NE 2VLJA 4XP5H 2I24N 1MHHA 4G7YL 2HLFC 1FBIL 4M5ZL 4OF3A 3BN9C 1HQRB 3M8OH 3RA7L 4NN7C 5IJKC 3ARED 1RPQA 4J8RB 5IMMA 5KSAB 4M61B 1LNUB 2Q87A 1DUYB 3TNMA 3RWHB 4JJ5B 1TTFA 4GG6B 1F8TH 4K94L 1DCLA 3ARGD 5L2KD 5FOBB 3RWDA 5EPMA 3ZE1F 1T7YA 4DGVL 3NCBB 1UOJA 5CILL 2NY5L 1P4BL 5D5MF 3S35X 3V0VB 1R3LA 3MRPA 1N3NB 2Y23A 4JM2F 2HLAA 3IGAA 5DXWA 1INQB 2CKBA 3SCMD 4P0DA 4IOIB 3VGHA 5J13C 3SDDD 3BN3B 1FJ1B 2VNCA 3U83A 3OKYA 3ESVF 4JCLA 2GK0B 1FN4B 5DVLA 4U2ZA 2DQDL 3O4OB 2H9GA 4OLUH 1FAIL 3QEQA 5DD3L 2CPCA 4WDIA 2GSIA 1QSEB 2CLRA 5IQ7L 2V5SA 1NGWB 3OPZL 3IFOB 2V2WA 2ZSWB 4JY4A 3RTQB 1ZK9A 4ZUSA 1HCFX 1SEBA 3PP3H 4UIKL 2XKNA 3BKYH 1EVUA 4IIQB 2BC4A 3ULVE 4QRPE 5GZNC 5JA8B 3QDJD 1CXFA 1J86A 2R8SH 4HZAA 1BBDH 3BVNA 3HMXL 1B0RA 4RFNB 2J5LC 5C70A 3ULVC 1OAYL 3PABB 4PP1D 3BEWB 1WGOA 1UA6H 1KLGB 1ZS8B 1FFPB 1P4IL 2D4FA 4FG6D 1HHHA 3KNBA 2NTFA 3RWIA 5KSVB 1IMHC 3L5XL 4G6FD 4Z18A 3QXAA 4R3SB 5EO1A 5DMYA 4HDIB 3BKJH 2E9BA 3MLRH 3PNWB 3U82B 4LLVA 1QA9A 2IH3A 4C83A 1Z0MA 1S5HB 4LPWA 3N1MC 4KDVA 4PJ5A 4QT5A 5HGDA 1ZHKA 1Z0NA 5IB3B 3SGKA 3HS0B 2A74B 2GTWA 4JHAL 1JYWA 4KI5E 2J6EL 2NXZB 3VFMB 2NY0D 1IGCH 2AKRA 5CEXA 2C4FT 3T1WA 1GSMA 4DVRL 1QEWA 1KCSL 3WBDA 3RY5A 4IMKA 3HAEB 5GZND 8CGTA 2FZ3A 1ES0B 5EOCJ 4E41A 4LSDA 4UUJA 3ULVD 4XBGA 1JN6B 3QNYB 4JY6A 2ADJA 1HQ4B 3GMNB 1NKRA 1K8DA 5F97E 4MJ4A 4PJ7E 5MP6L 4EXPX 1T5XB 4PJBF 4LDEB 4ZFOA 1MREL 1YJDL 3VFNB 1RK1A 1JMXA 3QDHA 2YR3A 5DEFA 2VE6A 3IDGA 3C6LB 4LIQE 1QO3A 4KRPB 3SDXE 1OF2A 1EAPB 4M7ZC 5ENWA 1IQDA 5D70H 5CKAA 5IBTH 3T0VA 2HLFD 1PYWA 2JCCB 1ZLVK 1AKJB 3ZSTA 2AV7A 4UTAH 2CLZA 3QZWG 2SEBA 1FSKC 5KVFH 1JNLH 4W4OA 5A40E 3NCJH 4OGYH 2NNAB 4H0IA 4PTUB 4OV5A 1J0KA 3RZCA 1I7ZB 5JDSA 5C8JB 4K8RC 3QNYA 4CVZA 2OSLB 4KQ4L 4HIIA 4KHTL 3F12A 1M7IA 2FZ3B 4PJEB 3O4LE 3SO3C 3KR3L 4X99B 3C60C 4L5FH 3QHZH 2JK5A 1C08A 4XNZC 5SV4A 3DX8B 4WO4D 1WCUA 4Q9RL 5FYKD 1T83A 2F5AL 3LPFA 2HFFA 2HFGL 4LCIL 1KEGL 5I15H 3AVEA 4PLJC 3WEXB 4ENEC 1O7SA 3N50A 1TTGA 3H9YA 2J3SA 4GRWB 4LLUB 4HBCL 5DQ9B 3V79C 1IARB 1GOGA 4DKEL 3CFKA 4OGXL 5DMKA 3BEWA 1OH3A 4UB0L 1YYLH 1EX0A 4KPHH 3BT2L 2NR6C 3A67L 4LPUA 1U2CA 3MXWH 4R8WH 4CKVX 1G9MC 4M43H 1T0MB 5I1JL 2VWEE 3ULUD 1EAJA 1KPRB 2GJ6E 3HNTH 1Z5LB 3D39E 3ARZA 2R2BB 3TT3H 1B0WA 2R0KL 1A6WL 1AGCA 4P59L 1GHFH 1ZA3B 5CJ8A 1WJ3A 3ESUF 1A3LH 2AK1H 5LCVL 4XNQB 4BYHA 1JE6A 1QSEA 2CLRB 3WUWA 1BOYA 3TM6A 1P84K 3OG6B 4UB0H 2HLAB 3BQUA 3U46A 4P3DB 3TO4A 1EEYA 3KVQA 1A7QH 1ED3A 2J8OA 5IHZA 1ROWA 4E41E 2RFXA 4Y19E 5H94B 5T1LA 1CS6A 3O6MH 3BUYB 5DHVH 1ADQA 4OF5A 3ZTJG 2HG5A 1IGMH 3S3JA 1J11A 3OAZH 5EIVA 6FABL 5AZ2L 4PRDB 4J3SA 5KVDH 2BRQA 2ZZUT 5M94B 1LK3L 1YPZF 3VXRE 3CFDB 3MBEA 4P9MH 4WFFD 5BRZA 1ZVHA 2Q86A 1BVKA 1T66D 5DRZA 1UJ3B 5IBUB 5SX5H 5CHNA 1IGYB 3S5LA 3RTQC 4NM8L 1CXLA 2B39A 2C7UA 5JZ7D 1EBAA 1I3VA 1NEUA 4ZXBA 3HHRB 5B3JE 1RUMH 1X5HA 2KKQA 4UV7H 1YEGH 4NO5A 1KSRA 1AFVH 1XIWC 4XP1L 5J9PA 2F8OA 2VXSH 3PWPA 3N85L 1Z2KA 4U1HA 3H8NA 4LLDA 1JNNH 4WEBL 4WV1B 1MUJA 3VFUA 3VFGH 1UM4H 1X5XA 5D1XB 1N64L 4RSVA 4UTAL 4QRPA 1R5IB 1H9VA 4BFEA 1U58A 5C08B 3GSRB 2CUMA 1A6VL 3IXTA 1G7MB 4Y16D 4E41D 4KK6D 4U1JA 1OY3B 4N0UE 3GKWL 3GEWB 5EBLA 1M6OB 2OJZL 1G6RL 3T3MF 4YHKH 5J9PB 3EO0B 4FP8H 5A2FA 2PUQT 1MCPL 5D1ZA 4WFFE 5EC1A 3VFTA 5JHLH 3M17B 3DXAA 5HVGB 4KZDH 5FYKH 3TCLB 1OT1A 4F7CB 1V3KA 1LE5B 4XHJD 3QQ3A 3T2PA 2VAAB 2R23A 5L7XH 4ZMAT 2A1WH 1EXUA 2LQRA 5HXMA 4D0DA 4Z7UE 3QHFL 1NL0L 4JQIH 1BEYL 1JGEB 1OW0C 4M1GL 2JIXB 4LCWB 4K2UL 4JPKL 4YPGA 4EDWL 3BH9A 3VWJA 3QG7H 5EN2B 3MV9A 3M45A 3TP4A 4IMLA 1AQDB 4JN2B 2Q8BH 2AV1B 4OCWH 5C0BA 5DDHB 2CDGB 4TTDC 1GWMA 3FT3A 2I26N 5FCUH 1A1OB 4N1CA 4XTRC 5DJZB 3VGBA 1TENA 1UB5A 4TULL 2EDRA 4NM4H 1TJIL 4JN1H 4P48A 4ZOCA 3VMOA 3AS0A 5TQ2L 1BM3L 1JWUB 1NAKL 4WHTA 4BKLA 2C4FU 5J1AB 4PJBB 4WU7B 3HE7D 2IADA 3NCEB 1NCAL 1T7ZA 3L3KB 4ZFOL 1MRFL 3VI4F 4IRSB 4P5TA 3T77B 3VD3A 4O2CA 4XRCA 3HPJA 2UVEA 3O9WB 4OSUL 5L2KE 1Z6JT 3L3GA 1FZMA 4MD0B 4UIKH 5D6DC 4ODWA 3IDJA 4OD2A 4U1MA 3EYVB 3BSZH 3MCKB 5HJ3B 4LU5H 4XNZB 1OT2A 5FB8A 1N2RB 1FDLH 3CC5A 3LV3A 4PS4L 3IFLH 1G0YR 2HKFL 5CGYC 1NUGA 3WEXA 5HY9A 3UTQA 4HH9B 5DJAA 2Q1EA 4GG6F 2A6JA 1IGIL 3G08B 1MCHA 1I8LA 3RL2A 3H0TB 2WWKO 2QEJA 4U0RB 3EOAB 4JDVB 1U8LA 1CFSA 1RU9H 2P42B 4UIMB 1QTYT 5KG9B 1U8HA 8FABA 3OZ9L 4K9EC 5ISZA 3MBED 3HNSL 1T7XA 3GRWH 4QHUB 3VRJA 1QHPA 1OP5H 1LEGA 4Y5XA 4W70A 2WUCL 2PR4L 2R0WL 4KKLC 2IQAB 4O2CB 1YC7A 4XRCB 1L9NA 1WUNT 2VXTL 4X98A 4LSRL 5FYJL 1VEMA 1RUKH 3CJJA 5C7XL 2QSCL 5E5MB 1NEZB 1KBGL 4M8QA 4X8XA 4DW2H 5E24E 3JUZA 1BJ1J 1MFDH 1NCNA 4HF5L 4LPVA 5DJ6B 3PQYA 1BJMA 3MUZ1 1BFSA 1SEBB 5CJQH 3Q0HA 3I2CL 4Z7VF 3ZKNC 1RIHH 3QR2A 3RKDD 5FM5M 4I0PA 3MRCB 5FEBA 1NGWA 5C0CB 1AI1L 2PYEE 3TF7C 3TZVA 5KVGL 3PV6B 5E8EB 3TNNA 4R90H 4UTBL 1XGQB 5JOFA 1TCRA 1BEYH 4N9OB 2OLDA 1HDMA 4OZ4B 5DQJB 4Q9QL 4NKIH 1JGDA 1C5CL 1S7SB 5AWNL 2W60A 3WKML 4LCCA 1CBVH 5EIIB 4G3YL 4D0BB 1HIML 4N1EA 3RRQA 1FNEA 1R5WB 4F7TB 1NUDA 3DWTA 1NEZA 4GG6A 1NDGA 2DI7A 3S36X 4LPYA 1DQLL 4L8SC 3HS0A 4GO6B 2RIKA 1W8WA 3A6BL 2W9LA 4NOFA 2O5YL 3HNSH 3VFOB 4NKMB 1A4JB 4KRMB 1H0DA 4HW6A 4OZIF 4FFVD 3SDYL 4WEBH 3VFGL 1EVTC 2HT2C 4P2YA 3SE9H 4Z0XA 4RRPA 4HWNA 2VXSL 4HEPG 4N0YH 5JW4R 3BWUC 4TVPE 1VFUA 3ORJA 4PG2A 1OAKL 3HE6C 2ED8A 3BYTA 3KLDA 1TZHA 1JFQL 3UTOA 1GC1C 5C6WH 3QUYD 1AD0A 2DAVA 1OSZB 2G9HA 4GOSA 4LMQE 4DK3A 1HZHH 3BP5B 2FD6L 1E4JA 4PJIF 4TNWK 4AH2B 4R26H 4BSWB 1X4XA 1PLGL 3R06B 3IKCA 3ZYZA 1NLDH 4HUUA 3MRBA 1MFEH 3FB5B 1J1PH 1P1ZB 5SWSD 1VKXA 2BSSB 5GGRY 3TN0D 5HYJB 1GYAA 3T08A 3OJVC 5GGSB 1NCWL 1NMBL 2X1XR 2HT2D 1KB5L 1I8KA 2BRRH 1YEJL 3O2VH 5DGQA 1QHOA 4NQCD 4OBSA 4M00A 5F71A 3H6JA 3OHXB 3QG7L 3T2NL 4JRYD 5C2BL 4LHQB 1HXMA 1WF5A 3CXDL 4GKNA 3AS2A 2ZG2A 2OL3B 3HAEG 4A6YB 2XZQH 2WSKA 3ULVH 3QPXL 4WI7A 2XWTA 4U1KA 1DL7H 2EO9A 5GRUL 5DR5H 5D6DA 4LEXH 5ADPH 3O41A 1SM3L 3MUJA 1HXYB 1GGYA 2UZIH 4DKFL 1OP3H 3ZMRA 3DTXA 3U0WH 4I0PD 3D2UA 1LO0L 2P7TB 3DYPA 1EFXA 5D7IE 1DBBL 2XQYK 4YBLC 4UINL 2O61B 1VFAA 3PQYD 1J8KA 3C08L 4L4JA 1Q0YL 2ITCA 5HPOA 4QHNA 5ITBL 2I9TA 4XMLH 1A6VH 1MVUB 1QSZA 3CZJA 3QDJA 1KPRA 3MRMA 1B6DA 1QG3A 2AJZA 4HGWA 4B7LA 1KEML 4X6BB 4CNIB 3B8SA 3WNPA 4M93B 5KW9H 4YDVA 2EIEA 1RZGA 3ZE1E 4WWKC 5BCAA 5DD5L 3MA9H 4OI9A 1LEIA 4YX2H 3D39B 5K9OB 4TSAL 5EZJA 3ARYA 4OF7A 4PTTB 5J89A 1NGZA 1CICA 4I0PC 2DLFL 4LSVL 4P2QB 1VFBB 4NRZB 4NO2B 5I66B 4K23L 3ZYOA 4LKCA 2E8ZA 3SCMA 3W0WB 3GSUB 1M71B 1IGTB 3VGAB 1BFOA 1K9TA 3BKML 1QBLL 5D9SB 1MCEA 4ZO6A 2AV7B 4X6CB 5GRUH 2IBZY 3TVMD 1XIWA 3P9LA 4LCUA 3BEVA 2XXMB 4HJJH 1I7RA 4PRID 5TDPA 5L2KA 4H0GA 5L88L 3D0VA 3RGVB 5I8CB 5EU3A 4NFDA 1GAFL 3DROA 5DK2B 1VACB 3GI8H 3TEUA 1KB5H 2BRRL 3OR7A 3UJTH 1IC5H 2BVOB 1CU4L 4FQLH 4P23C 2BCKA 3I75A 4UT7L 4XB8A 1I4FA 1K2DB 4QHKI 2BOCB 4Z7NE 4ODSL 2MHAA 3OV6A 5LGJA 3WFCL 2RCSL 2FSEB 2H1PL 5JNYA 1XR9B 5J8OA 1EHXA 4LVEA 2X42A 3VFMA 4APQC 1WAAA 2FLRT 3E0GA 3GJEA 4MJIE 5GS0C 2PYFA 1E4WH 4KK8C 4QGTA 3I6GA 3RVXC 3O2VL 3EOBA 5HYSG 2FIKB 3HAEA 4IMKC 5JXEA 2MPAL 5IJVB 5BVPH 1L7IH 2DQCL 4HIJB 5E8PB 2AS5M 3IDNA 1KTKE 5JMRA 3KPSE 2AKRB 1U95B 5I76B 2DQUH 5C0NC 3GBNL 3MGTB 4D9LL 1MI5E 4PJDB 1LD9B 4XVTL 5KSAC 3UPRA 1R0AL 4AQOA 2AEQH 2XKUA 3ULUC 2QQLH 1MCWM 3L5WB 3LRHA 2ARJB 3RAJL 3VCLB 1MFAL 4AM0A 4K3DL 4K3EH 3TBSA 2B5IB 4LPXA 5CMAB 5DWUH 4QRPD 5LXGH 4N8VA 3GM8A 2DM2A 3TVMB 3RJDA 4ODWB 3U4BH 1K6QH 3BZFA 3IXAA 3U1SH 3MACL 3T04D 2W60B 1L0YA 1J8HB 1FO0B 4M7KH 4JR9H 4KK5D 2KQNA 4YZFF 3FAWA 3O45B 2IADB 4P3WA 3QEQB 4E0RA 1IZKA 4OIAA 4M5YL 4X7DC 4BFIB 4UAOB 2YUVA 1PX3A 4DCQA 3O8XC 2DWDB 2CLZB 1WWCA 2E6QA 3RKPA 4BQCA 4F57H 32C2B 1SVCP 4JFED 4RFEB 4N0FA 4QY8B 3BISA 4Z7VB 1CL7L 1MJUL 4M1CC 1DE4B 4PJHA 1T7WA 4YDJB 4BH8B 4WWKD 5T5NG 4OCYL 4FQCH 2LE9A 1FGNL 1L0QA 2FB4H 3VG0L 3NACL 4P2OB 4MD4B 4IOFC 3FFCA 3RX7A 4ZFFB 4GLRH 1FCCA 3SO5A 4KI5F 3GHEL 4R6UA 3BX7C 1A4KB 3FB8A 3GMOB 3MRGB 4AEHL 1P2CA 3U9UB 1BFOB 4KK5C 4NZUL 3REVA 1WC7B 3V5KA 2OXHA 3VFTB 1NCBL 4O2EB 3VH8G 1JK8B 1T0NB 3RPIA 2HN7B 5DLML 5DJCB 1QBAA 3WS6C 3QQ3B 2GTZB 1PAMA 4XC1H 2FYYA 3T2QA 3EYSL 3QIWA 5GJSH 4JJ5A 1JGLH 2DJUA 4HKJA 4JLRB 4UQ3B 4O58L 5D7JB 2WUCH 2V17H 5DEZA 4G42B 1FC1A 5ILTH 2Y5TA 4XCYA 3DI2B 1PX4A 3IFNL 2N1KA 2XQBL 4JZNB 5C08A 2NY3D 3G6AA 3TLRA 2IPKB 5JA9A 5I1DA 1MNUL 1WZKA 1MCDA 2DBJA 1X5JA 2VLJB 3EDDA 3NVQA 4J3XA 2P48B 4ZD3H 5KZCB 1UGNA 3C6SB 4XZUA 5D7KD 5FM4A 4M8VA 3HA0A 2F58H 4LSTH 1HILA 2ZCLL 5GSRB 1EHNA 1EO7A 1A14H 2CXGA 1UACL 4APQD 3GJFH 4HKJB 2PR4H 3ARQA 1ZSDA 1BMGA 4QYOA 1MJ7L 4RGOL 2ZCLH 1CQYA 1KB9J 5H37G 4XNXL 1A22B 1CF8L 3NTCL 1DN0A 1X5FA 4N0UA 3F7QA 2MCPH 1IKFH 4R96B 4WEMB 3CFDA 4OQTL 1WBZB 5J06A 5JXAL 2AGJH 3NFNA 1T0PB 3S88H 2CIIB 1KGCD 3P0VL 4XPHL 3S5LB 1J7VR 5H2BB 3IDYC 1TXKA 4Y4HB 3EDKA 4P2QE 5LWYL 2LAAA 1WCBA 4IOIA 4IRJD 2P5EE 5D1XC 1XF3A 5C71A 4MS8D 1IKNC 1AC0A 4GAJH 4NZRL 5CILH 3WUWG 3DURB 2D7PA 3DYMA 1I7TB 2IAND 4ZUWA 4G9FD 2YN5A 5TQ2H 3ILQC 3O11B 3FB5A 2CSPA 1T83C 3BP5A 1DEDA 2X4TA 2E7MA 4V1DA 3GBMH 5CSBA 1MNUH 2LABA 1FVCA 3MNVA 1U8JA 1G7MA 5F7FA 2F54B 2VXQL 4G6KH 4JG1L 4I77L 4JO1L 5FGBA 1BF8A 4PG2C 3NCYP 1P6AB 3KYKH 4Z7UB 2IBBA 3KLAB 3HG1D 5TQ0L 3FN3A 1FORL 2OMBA 2VLRA 5GS3A 1E4XI 3O0RH 2PW2B 4HKXA 2KL6A 1ZKAA 4NO0D 4WVRA 2VAJA 2CH8A 2ZUUA 5FDWB 3MV9D 3UPRB 5FYJU 1HNGA 1G7IA 2B0SL 2EH8L 2BNUB 3BJ91 1V7NH 2FYYB 1MVFA 2NMSA 1RQ5A 4AEHH 1U92A 3B43A 4PJIA 4XP1H 4QWWD 3D25B 2JIXD 5DUBA 3MV01 1G6RH 1S9XA 2WBJC 4K3JH 1R5WA 1ACYH 3NCYS 3KPRA 1CK0H 1MLCB 3EYOB 3I84A 1K6QL 3H9SE 3HZKA 4H5SB 4FQCL 3WHE0 3VFPA 2GJ6A 1S7XB 2B1AL 3FFCD 2JJUA 2FH6A 5JW4M 4Z7VA 1ZAGA 4GMSL 1NBYA 2R15A 2FNBA 2PTTA 3HUJB 4EI6A 5A1AA 3E3QC 5F9DC 3KPSD 2ATKA 3GM0A 5F7HA 3FQWA 3PDOB 3DMMC 2BVUA 5DYOB 3VWKD 2YC1A 2X09A 3ALPA 3TNNB 1UXWB 4MLSA 4IRSD 4NZJA 1XR8A 4PJAF 3R06A 3RBGA 1NH6A 3S36L 2ZNXA 1J87A 4TSCL 1BFTA 1QUNA 1SYSB 3QUXC 2J8UF 4GG8A 2AEIT 2Y9RT 1J0JA 4POZC 5DK0A 5IMKA 5F6IB 4N8VB 3CSGA 3WHXA 3VI3E 4ODUB 3KGRA 5SWSB 4LPCA 2VDLL 3HG1B 1SEQH 4HGKC 1JPSH 3OR6A 2AK1L 3CFJA 5EIQA 3KDMB 1CR9H 2YWYA 4K71C 3SDAC 4YC2C 4Z0BH 1NFDB 1R0AH 1GGCL 3PL6C 4WFHD 5AZ2H 4QTIH 4KQ3H 2W65B 3KYMB 5CMAA 1YUHA 5ICYB 3QRGL 2P8PA 3GMPB 1YJDC 2ARJA 2ZCKL 1YN6B 5H35A 1VFBA 3TH4T 1F11B 5TE4L 1IC5L 3RDTB 4ZNEA 1CFSB 2BVEA 4X4MA 3ZDZE 4JY5H 4EN3A 3QWOB 4KTDL 3T0EE 5HHNB 3CZFA 5E7FA 3IDXL 1LEGB 3L5HA 2HFFB 3E6HB 1CN4A 1CXHA 2L7JA 4N5EC 4HBCH 1DBKH 4PV8A 3VE0A 2JK5B 5IBUG 4N8VG 3PNWA 4PJEF 5F88A 4HC1H 2FO1A 3WJLC 1OD9A 1Q94A 5JO5A 2ZUSA 1QVOA 3TT3L 5HGDB 5FIEA 2VLJE 2BOCA 2YZ1A 4ESKA 2IFGA 1HI6B 2WIMA 3KPLA 1YN6A 4G6ML 2WQRA 4J1UA 4PJ9B 1TCRB 1A6PA 2AK4A 2AJYH 3GUTB 3FQUB 4MXWL 4XPGL 4OJFH 4PBVC 4BZ1H 4PG9B 4XX1E 1DBAH 3WYRA 4HG4J 4LASH 4Q6YA 2ZOKB 1LK2A 3I3EA 2J7LA 4NZTL 5JLZA 2DD8L 5C0JB 1TVDA 2EIBA 3F6IA 3RWFB 1EAPA 4F9LC 4ALAH 3SKJH 4JPIA 3G6JA 4P4KC 4H1LH 1JWSB 2BSED 2X7LA 2XKNB 2OI9C 3P9MA 5C0FB 3D87B 3VFNA 1XIWD 3Q6FA 3HZYB 2NYYC 5FA4B 3W0WA 1UEMA 4CU7A 5TDPB 3RVTD 1T1XA 1DQTA 3TO2B 3KPMA 5HD8D 1RZJL 1DBAL 2OX5A 3QCTH 3TCXA 1FIGH 1SJEB 1CXEA 1W8OA 4G9DA 4I77H 1P9MC 3MA9L 4JO1H 5MP6H 3T3PE 5SWQA 5KW9L 2H32B 1JF1B 2XWBB 4NNYA 3MRIA 3MCLL 5GSRA 2W0PA 4Q7DA 1KULA 1DN2A 5IBTL 4X8JB 4IRSC 1F45A 5SWZD 5CEZH 4LVOC 5GGTH 2MKWA 4Y5XC 3MFFB 1MCOH 1HHKA 1JZ2A 1MUJB 1YY8A 4MXWH 5GS1A 4HCRA 1LO4L 5DJDA 3VXNA 3LDBC 3M1BA 5F8RC 3RIFK 1Q1JH 3CNKA 1ZA6B 4R4BB 4WV1A 2XY1A 4O02L 4F33B 5HHMD 2VYRE 5DZOA 2R8SL 3C8HA 4NN6B 2EKSB 4KDTC 3L6FB 2A77H 5HYSB 1MCSA 2ID5A 3Q6GL 3MV9B 4L1HA 5GHWH 1W72A 3RI5F 5MEPA 4TNVK 5LBSL 1Z3GL 4JY5L 3PWNB 5FO8A 1JGEA 5F9JB 1UJ3A 3MRHB 4N5ED 3HPLB 3F7YA 1X7QA 3QRGH 5C0CE 4YUEL 1CGVA 4JRXA 3OXRA 3EOTH 1XF4B 4X5XB 2H6PA 1E27B 3OKKB 3CVHB 1CDGA 4KK9C 2EIDA 4NNXA 1KCRH 1PKOA 3FFCE 3IF1A 5D7LA 5JOFB 1U8PA 2YRPA 3O2DA 3A6BH 1JHKH 2CDFB 1BF2A 2XN9D 4PJ7F 4XC1L 3U4EA 1W72B 2R56L 4JREC 1BBJA 4GT7A 3CCHB 3KJ4C 3IVKB 4NZUH 4FFWC 4RA3A 2DMBA 1FC2D 4M4PA 1JUFA 1QPXA 2HJKB 1UENA 3KXFD 4P4KD 3RIFF 4FQ2H 4CVXB 4QNPE 4LGSB 4NC2B 5IEKB 3STBA 3K74B 3D85B 3NFPB 3SE8L 2WZPD 3TWCL 4L8SB 3WE6B 3A6CH 1JHKL 4JVUA 3QIWB 2RQ8A 4KHXH 4WI9A 2HT3D 4P46D 4WUUD 1I1AC 2ADGA 2YUWA 4TVPH 3RPIB 4Y8AA 4KMQA 2R2HA 2H2PC 2V5YA 5DFVC 3SHSA 5IBLD 3RY6A 4MZ2A 5JW4N 5I1GH 5DQDL 1ZLVH 2Q7YB 5AD0A 1QFHA 4MJID 3I9GL 3NZ8A 4JG1H 5C0RH 5K9QI 3S98A 1T20A 1WZ1L 2APXA 3V6FB 1IVLA 5DSCA 1AH1A 4PRIB 4X7CC 4Z5RB 2C1OB 1MFDL 1KT2B 2KBGA 2FLBT 3WNOA 4I5BA 4HC1A 3CD4A 1FFQA 2DQTL 1KBGH 4ODUA 3B9DA 3H9HB 5ICXB 3U1SL 2CRMA 2YD8A 5IHUH 1IC7L 4D0BA 4FQPA 2J12B 4W4OC 4PJHB 1JF5A 3DETC 4IDJH 1JGDB 2IG2L 4A6SA 5IQ9A 4GXVL 4F7PA 4I0PB 5JORA 4AEIH 1NJ9A 2AK4D 4S0SD 5EDXA 3UTSE 5T3ZD 5E95B 3W9DA 5CD5D 3C6LA 3PL6A 2YKLH 4MA7L 1F2QA 1HHJB 4ODTL 1ZT1A 3PQYB 5KBNC 3WDIA 5BV7H 1D5BA 3T0DA 1Y6NR 4ODHL 2DRUA 5FUOL 4C56E 2DMCA 4IRZH 5FYJE 4E5XA 1BJ1H 25C8L 4NQCE 5JMOC 1DLHA 5TH2B 4S11A 4FXKA 5CUSL 1MCOL 3Q1SL 4H5SA 4MQXC 1S9VB 4EDXA 5EUOE 2P8LA 4OLXL 5FUCE 4CP9A 1T7VA 2F9BT 1T20B 4HT1H 3H9SD 3MNZA 4X5WA 1MCLA 3OX8B 3FN0H 4YAQB 3E3QE 3KPPA 4QRTB 2GJZB 3FCTB 1OGAA 5KG9A 4N8CL 4CN1A 1TPXB 1OPGL 4X4ME 1UM6L 2AJUL 1KIRA 3K4ZA 3RL2B 4XGZB 3P77B 1N5YH 3FFDA 1OSPH 4NQSA 2GJ6D 2PETA 3U48A 5I16A 4G6JH 2FDBP 1TCMA 2O5ZL 4PUBH 2QQNH 1CF8H 3NTCH 3QCVH 2GSGB 4UBDC 2B2XH 5F7UA 4I13B 3QXAB 3B6SA 5D2LA 4QHLA 4EDWH 3HC4L 3QIBA 5TFSH 3LN4A 1CWVA 1NMAH 1XFPA 5EBWA 1VDGA 3W39A 1G7HA 5EBMA 5IHUL 3CX5J 2C4XA 4LSPH 3WD5L 3FCTA 4DVBA 4H8WH 1NAKH 1BM3H 5C09A 3OB8A 5EZLA 5IESH 5BS0E 1B0GB 4KZDL 3LKQB 4UILL 5DJYA 5IVNA 4TNWF 3BH8B 3QXTA 4Y5VB 3DTXB 3NIGF 3QDJE 4YWGL 3VFWA 5IGXH 4HJGA 3QA3A 5E2TH 3T0EC 2APWA 3QNXB 4QTHB 4U1SA 4MB3A 1T4KA 3E8UL 5DMIL 2C26A 1T1WB 1IZJA 4ZNCD 1HSBA 3AREB 4OCYH 5DC4B 3ZE2E 3RZCC 2WP3T 2J8UE 2W07A 3EYSH 2L0DA 3T2OA 4Z8FL 4V1DD 4K8RH 3WFEL 1K8DB 1IGJA 4JPWL 3ECBB 5DLMH 1KENL 4PIRF 4MHHG 1WTLA 2H41A 3O6FA 4FQHA 5EOCH 1LE5A 1PGRB 1E27A 4NPYA 1EEZB 2B8OT 2R0ZL 4FTVE 3OTTA 1BZ7A 4RNRA 3FQNA 4F7MA 3VXUD 1XF1A 4M48H 5FAAA 3UZQA 4NUJB 4YEFA 3EO1B 3OWEA 3HI1A 5EZOH 1XMWA 2BHUA 2R69L 3PQYE 3KPSB 5D2NB 1IEBB 4XAWL 4CADB 4NO0A 5LKNA 4JFOA 4ZFZB 4XXCA 5I17B 2G5BA 1MLCA 1RK0B 1HQRA 2XA3A 5DWUL 4C4KT 3GSUA 3DETD 4MNQA 5DA0B 4GRMA 2PF6A 4LLVB 4QTIL 3TYGL 1IM9D 3LEVL 1J12A 4U6VL 4HGWB 3RGVD 5E8DL 1A6ZA 1R3HB 4Z0BL 3QUML 3DUUA 2DBLH 2ICWI 4YGVB 5D21A 4O4YH 3N85H 5GGVH 1ZWIA 1J8HD 4V1DE 5J3HC 5GRVK 4NWTL 1TNNA 3ETBF 1I9RL 3P73A 3T3ME 3WFBL 2YD7A 2OQJA 4AL8L 4Y4HC 5FOJA 2GAZB 4Q2ZB 4S1RL 2AJZB 4E42A 4L9LA 1MHPH 5AAWA 4K7FB 1U6AL 3LH2L 5GGVL 4FQJL 1IL1B 5DHVA 3KG5A 1TIUA 3QQ9C 4GAYB 2VITB 4H20H 5CJBA 4F7EA 5EUKA 5IW6A 4P9ML 1U8IA 2QQLL 4MAUL 5B39A 3UEZA 1TJHH 1QSFE 4Y1AE 1Z9MA 1NFDF 3OKDB 4LCWD 4ZYKB 4P46B 2IMMA 2YBRB 4DZBB 4I4WB 3RGVC 1HEZB 1EA9C 2FECL 5D1QC 2XZCH 2FJFB 3UDWC 2NY5C 4Y5VC 4LCCB 5ESQB 2R69H 3QEQE 5D6CA 5SWZE 5IB1B 2I25N 2P5WA 5CSZA 4BJLA 5E6ID 4LBEA 3QUXD 1ONQB 2VQ1B 3O6FD 4X9FA 1W90A 3LIZH 2NLJB 4X6CF 4ONFL 2XTJD 3BGAA 5B39B 4HUVB 1WIPA 2XG4A 3P9MB 4L9DA 5F7LB 5F7DA 4JKPH 2X4UA 3O9WD 5F44A 2EKSA 4OFVA 1U9KA 4OT1H 5EA0H 5FHAH 4ZUUA 3VFWB 4BSJA 3Q2CA 5IFJA 4LSVH 1PKQE 2RB8A 3AFLA 3D0LA 1MCCA 4HIEA 1WVZA 4MCZB 4B41A 1QRNA 4LLUA 5EBMB 1RZ8A 4JO4H 1QSFD 2EE3A 4Y1AD 3QQ4A 1KPUB 4HSQA 1NC4B 5ACZA 5K9KB 3NZHH 3MGOB 4U1IA 5GGRB 3D18B 3MV7D 4K3GA 5TDNB 2Y72A 3LQAC 5AG8A 4U1GB 5H8DA 1F13A 3ES6B 4RFOL 5DJ2A 4WO4A 1G7PB 3GSXA 4HMCA 5FUCC 4FABH 1DBBH 2VDKH 4LNRB 5F21B 4YX2L 1BZ9A 3O3AA 2DOCA 4L3ED 1EK3A 4HK0A 4YK4C 4XCCL 1NC2D 3ARVA 1MPAL 1VPOL 5AG9A 3TBTA 3LOWA 4H0HB 4OZGB 2QKIB 3STZA 2NXYD 5FM5O 5ADPL 4WWID 4BQ2A 4LSPL 3MSPA 3G6DH 4JFDA 3L3JA 3VGGA 1DEEB 1CFTA 4S1DD 4KKBD 4YAQA 2IANE 3QIBC 1K5NA 4JZJC 1UZ6E 1EZVY 5K59E 4KUZH 4AG4H 5KZCD 1NGXB 4HXAL 3D6GA 3BN9D 5C0CA 25C8H 2YPVL 4RX4A 3AAZB 3PE9A 3HZMB 1YMMB 5DZLA 2ADJB 32C2A 3ZZ1A 3S88L 1NMCC 1OSPL 4QF1B 5I75B 1KELH 2JELL 2N7BA 1YC8A 4M4RA 2QKIA 3AMKA 1DUZB 1KN2H 1HINH 3QXUA 2F8XC 1UWEH 3HMXH 2XIDA 4EEEA 3ROOB 3FHQA 1MJ7H 2EDTA 4KU1A 5EBWB 1A7PH 5ANMB 5I6XC 1A1NB 1JGLL 1OM3H 1HHGB 1G84A 2EDHA 3D39A 4TVPD 3V6FA 2HJLA 2I9LB 5JXED 2PTUA 3LRSA 5F88B 5TDOB 4ZNEE 3MRLB 1YN7A 5I73C 2DWEA 1MJ8L 4AM0B 4PJBE 3TIEB 4TUKL 4MJIA 4G8IA 4N0YL 1J8HE 3PGCB 3DPBA 2WIIB 5EO1B 1U92B 5E94B 1BOGB 2Q20A 5HPMB 2EDLA 1CTOA 3BMVA 5A2IH 1UCTA 3UTSD 3CC5B 2WWMC 3IU3A 1U58B 3KYOB 1O0VA 4ZDHB 2OR8A 2GAZA 3OX8A 3L95B 3ULUF 4CVXA 4HK3J 2PXYD 3HFML 1KJMA 3UX9B 3BIAX 4PRBB 1H15B 1DQLH 3SE8H 1X3DA 1G7JB 5BVJB 5T33L 1KTDA 2EH7H 3OKOA 2ZSVB 4K3JL 4DOHB 2WP3O 1EIBA 1U8QA 4XH2A 3CVHL 3FO0L 5IF0A 5JHLL 5IMKB 3CPLB 3HC0B 3PL6B 4ZTOL 3ZSSA 4HAGA 3C5SA 2X4RA 1HKFA 1WFUA 1C5CH 3SCMC 4PV9A 3AU1A 2AV1A 3GKWH 3L3IB 3MBEB 1OQXA 4BSVA 1XT5A 5HHPB 3NOIA 3IGAB 4HUVA 2P24B 1C16B 3W2DL 3HFMH 4YPGB 4ODXA 5CWSB 5LVEA 5T1DL 2I27N 3ULVF 3SN6N 1CL7H 4LK7A 3HNVH 3RAJH 5GGSA 3PJSB 1ZT7B 3H9HA 1YEDA 2AEQL 1N64H 3RNQA 1I8MB 1ZVSB 4Y2OA 3VXPB 4RWYL 3BQUB 5HDQL 3T0EB 4QEGA 2HFTA 2DLHA 1FNAA 1M71A 4JR9L 4JRYB 2VRAA 3OAUH 5CJOL 2YUZA 4I48B 2PKDA 2BOBB 1MWAA 4NKIL 3MACH 5ECJE 1EEQA 2ILLA 3TBWB 1OQOA 4GFTB 1EGJH 1OTUC 1VADA 3LN9A 4FG6C 3V7AE 4TUJB 4YXHH 4F7EB 1TNMA 3VXQB 5IB4A 4R4BA 3F6LA 1KXVC 1I9EA 2ICWJ 3GRWL 2JB6A 3OZ9H 1CXKA 3G9AB 5IFAL 5IEKA 2YD6A 2N4IA 3QEGL 4F33A 5GS1B 1BIIB 1W0VB 5ICZB 1MEXL 1RIHL 2CRIA 3QEHB 4NQDD 1IAOA 5DUMH 5I1DB 4OLWH 4FQLL 1A4JA 3BHBA 5EO9B 4NO5B 4I3SL 1CFVL 3CXHK 3E6FA 5C2UB 2G5BB 4DGYL 4KDWA 4ZG1A 5CJXC 2A77L 1H3PL 3BP6B 4JRYA 3VXMD 1ETZA 5DHYA 1XH3B 3ALWA 5T5FL 1N59A 4KJQC 3BKMH 5INDB 1JYVA 2OBGA 3ZKXB 3H9SB 2CRYA 1P2CB 4OCRH 3F7YB 4RFEA 4CN4A 2EEBA 4YWAA 3T4YB 3ZKSD 4XCCH 4KPHL 1F4XL 2VDRL 1UJTA 4BZ2H 3GI8L 2XNAB 1EEYB 2AXHA 4F37K 3BSZL 4XP9H 2HYMA 3DRQB 1F42A 3OHXA 1T2JA 4WFGE 1S9VA 4O58H 5MEQB 5EFIA 3HZMA 4G8GB 4L1DA 2JCCF 3VXMA 3U0TA 2QQQA 2FATL 3FHAA 1RJZB 5E0QA 2XG5A 5IUSA 3L7EA 5AZEL 1AXSA 3GMQA 1WV7T 3KPTA 3QJFA 3TA3B 2CUIA 4EVNB 2LTQC 4Y5YC 3SPVA 5F1NA 4ALAL 1YQVL 1W0YT 1EZVX 4M02A 4YFDB 4HULB 5L0QB 2JF1A 4KUCF 1S8DA 3JXAA 3ISWA 3ZKQD 2NY6B 3ZDXE 2DTML 4WCYH 1YY8B 4FABL 2ADFL 2YD9A 1DQML 4MWFB 4LKXB 5C6TL 5FYLE 2AJYL 5BOZG 4X0KA 2AI0L 1L7TH 1RZJH 3K8MA 1QRKA 3KYAA 1OCWL 4L3CA 5I9QC 5MENB 3QHFH 1D6EA 5HVHB 4JKPL 5E6IA 3GZKA 1K4CB 4PRAB 4GG6E 1DVFC 2A38A 2XOTA 2VXVL 4JQVA 3IU4L 4EN3B 4EKXA 1U3HB 3CSYA 4IHOB 5DC0A 2EDDA 3CDGB 3V52H 5CBAB 1B90A 1BLNA 4KZEL 2AI0H 1FZMB 2CIKA 3GHBL 5HGAA 4WRLA 2X44D 3F12B 1J9CT 4PGEB 4PJAE 1QRNB 4M6NH 4LEOA 1LP9A 3QRFM 1BJ8A 5LXGL 2DTSA 3MA7A 4OT1L 5EA0L 4JO2L 3IFPB 4KQ3L 4P5MB 5TF0A 1D5BB 3MJ9L 4DK6A 3WFDH 1OLZA 1I8LC 1JMZA 1OHQA 1WEJL 4LSSL 4MAUH 2XN9B 5AZEH 5CS7A 2WANA 1G9EA 3VD4A 3FOMA 3JTTA 4FXKB 3ULVL 3IS0X 2AP2A 1I7RB 4L4TA 4M7JL 1MY7A 4MAYA 5I6XB 4GLRI 5JLZB 4P5TD 2FHFA 5DVKA 5D9SA 4DCQB 3HG1E 3OGOE 1PFCA 1YY9D 4P3CL 3FQUA 3KXFB 1DBJH 1CTNA 1A2YB 1V5JA 4RISH 4MNQD 5HI5D 1QZ1A 1BD2D 1UXWA 1G9NL 2H6PB 3GSOA 3DXAB 3HCVA 1GHFL 5DSCB 1CFQB 2ADIB 4XMKL 2Q7YA 3MJ8B 4PV8B 3VE0B 4LNRA 4M1DL 4NHUA 4DZBA 4ZYKA 4UT7H 4PJCA 5EORH 3F58H 3O3UN 3FO2A 1U8KB 1U42A 2ADGB 3T65B 3VWJC 1JRHL 4OCMC 1MCWW 1DLFH 4XCFH 1Z9SA 1JGVL 5D7JC 1S7TA 2FX9H 3SJVB 2X4OA 5IWLA 2UYLB 3JWOL 4QHNB 2I9TB 4QOKB 3GI9L 4HIEB 3VXUE 3UYRH 1EHLL 4PY7B 1R3KA 3DSNA 3I6GB 4OKDA 2AVGA 4LLDB 1P7KB 1MQKL 2AXJA 5I15L 1LP9F 4PJ9D 2RAMA 3S34L 3QCUL 4OZIB 4UV4H 3SDDB 5FECB 3BPNB 2O5YH 4K8RL 5MEOB 4Z8FH 3ULSA 4R4NC 3FZUD 2F54A 2NY5H 2Y5EA 5GGSY 3IDYB 1R24A 3MLVL 4D9RE 1VFAB 5HHVL 2YD3A 3UBXG 4OGXH 2I60L 3RGHA 4LKXA 4U1KB 4FQXD 4KK9D 4EXKA 3I50H 5ALCH 3WUZA 5IT2H 3NA4A 1LWRA 4EJ1C 3GJFA 3OAUL 2AAVA 4LSUH 3VRLF 3V9FA 3F5WB 4G9FA 2IANA 3FRPA 3PWPD 5KSBF 1HXYA 1H3VA 1ZVSA 5CEZD 4NQDE 1IAIM 4QGYA 5IESL 1Q0XH 4PP1C 4NJ9L 2C9AA 5C0EA 1JPFA 2F5AH 4OFKA 3HPLA 5C0IA 2M8XA 4WFGD 2EE2A 3BAEL 4JFDD 5I2IB 1LP9E 3WSQH 2MSPA 4F7MB 1QSFB 4Y1AB 5FYLH 1UWGH 4JN2A 3VFPB 4PLKD 5TQ0H 3W2DH 1AP2B 2BY2A 3BH9B 4FFYL 4G6FB 2WW8A 4OLZH 5EPMB 5TE7H 1BD2A 4NGHL 2D03H 3WFHB 4GRLA 3ZHKA 1DANT 3BP6A 4BM7A 3OGCA 3V0WH 4A2MA 2FGWL 5T1LD 3F7VA 4IIQC 3WXVH 1IKFL 2R39A 5L8JB 3JWDL 1F4YH 5INDA 3S9DB 1S7RA 4WY7H 4JFEB 4KROC 1P84J 5LGKA 4MAYD 1PG7W 1REIA 1RUKL 3QUYB 4E42B 3TPKA 2XZQL 4LSRH 4V2CB 2ZUQB 2OR9H 2J6EH 3P73B 4QRRA 3AY4A 1LO3H 4DVBB 4LSTL 3W0WE 5D2NC 1T1ZA 4HPYH 1QP1A 2YPLD 5LWYH 4PUBL 2HMIC 1CGSL 3D1MC 3V4PH 2WM0A 2YXMA 2H3NA 1FYTB 4R0LA 2D7OA 4Y4KA 3ARPA 1P4IH 1SJHB 3HZVA 2VWEC 4DN4L 4F7TA 3D2UB 3QIWD 1XGTB 2EDQA 4H1LG 2NY3C 4NKMA 4RGOH 3MOQA 1HYSD 2G2RB 2D7MA 4JDTL 3G6JF 1WBYA 2HAZA 1IRAY 4K8RD 4OSUH 1SYVA 5I1KH 3DSFH 1A6UL 1T04B 1ZLSH 5LGHL 4KKBC 2VZOA 2A1WL 4UDTB 3TO4D 3PJSA 3QUXA 4K7PL 4MNHA 4I1NB 4JZOB 3CVIL 1CLZH 5EO0A 1RI8A 3SQOH 1LQSR 5FHBL 1MCPH 1RZKC 4YH6A 2KZWA 2BNRB 3NFNB 3L5XH 2QLVB 1X5KA 3C6LC 5D7IB 5IIEB 2PXYB 5F96H 3B2UD 4QTHA 2WMPA 3QO1A 1DLHB 5CLWA 3QB7C 3QG6B 4GKSA 4Q0XL 3VG0H 5SX4H 3KLSA 2JJSA 3HC0A 4JFXB 5IMOA 2V9QA 3BJLA 1DSFL 5CLTA 1FNGB 3KS0J 1INDL 3U46B 3GB7B 4HS8L 3UBXB 3GJFB 2R9HC 5I30L 1F4YL 4X4YA 2X1QA 2NW3B 4LLQA 4YC2B 3FQRA 3HRZA 5GGQH 1MPAH 1QEWB 2DLTA 3G5ZA 5A16A 2K9UA 2OP4H 3CDGA 4IS6A 2R1XA 3QWRD 4OFDA 3MREB 5CEXB 3TFKD 2VL4A 1GJIA 1FBIH 3FTGB 3RWGB 3QFJD 4LEOB 1VGEH 2GTWB 3IAPA 2WWMD 4NM8H 4JLRA 1B2WL 1FNSH 3CDFA 1KCRL 3IB4A 3FKUS 4DGVH 3UMTA 3RUGA 2FJGB 4WJ5A 5I16B 5HHOD 3QUMA 1GH7A 5D96C 1YMME 3O8XA 1DVFD 3MR9B 3CZFB 2W65A 3KYMA 4M7LH 5FGRA 3RVVD 3GBNH 4D9LH 1F97A 4JPVH 5JW5B 1U95A 4PJXB 5EC2B 2PYFB 2Z93A 1S8DB 1RZIA 2F5BL 2NY7L 2ZUWA 1WT5C 4WHTB 4BKLB 4WNQA 3D9AL 4UV7L 2WBKA 2R1XB 4OLYL 2C3XA 5HJ3A 2CJUL 4U3CA 4LLWB 4PJ5D 1NAMA 2VISB 4RMQA 5J11B 4JFYB 1G0XA 3NPZB 3ZTJH 3GSOB 4ZS7L 4NN5B 1A7PL 4HIIB 5JZ7C 3I6KA 4IS6B 3NIDE 1I7ZA 5C8JA 1UWEL 3JV4A 1DZBA 1U3HC 5BW7C 3LKSB 5EZIH 3V5DA 1KCLA 4PJ7A 3MLUL 4ODSH 3DVNA 1NJ9B 3SY0B 4NC1C 5E2JA 1EHLH 4QF1A 2LVEA 1CCZA 1LO4H 1V3LA 2NY0C 2FO4B 1T2QH 3LDBB 1YYLL 2H45A 5L9DL 4XCFL 5DYOA 5DJXA 1NC4D 3PDOA 1QSVA 3CAFA 5EN2A 3EO0A 4U33A 1XGRB 5ESVA 2D7QA 2YHGA 1T5XA 1BZ9B 3O3BA 2XNAA 2VXJA 2IAMA 4XPAL 3WN5B 3RWHA 1CLOL 3TVMC 2BHZA 3THMH 4PJ5E 3X3GL 4PGEA 1FL3A 4LQFL 4POZD 4E41B 1J0IA 5E7BA 4Q9RH 3DRTB 1CICD 1VGKA 5JIHA 2DF3A 3UO1H 2AABL 2R2HB 5FK9A 4XHJC 3DO7A 4MSWB 1CD1A 4LVNC 2VABA 4TSBL 3MRNB 4MQSB 5E99L 1HH9A 3U7WH 4LLYA 2XV6B 3VGDA 5E03A 3PWJA 1MVUA 5EO9A 4KY1H 2HJKA 1KLFA 4AEEA 2IQ9L 2ZPKH 1UADC 1NBZA 3ARDC 2Y7QB 5CHNB 4HIXH 4U1HB 4JGMA 3TYFB 3EOYG 3BD5A 3TBYA 2GFBA 1Q0YH 3DUHA 2Z8WC 2I5YH 2DLFH 3UTSA 5E2WH 4ELMB 3CH1B 1F6AB 2ESVB 4UINH 4HXBL 5GQBA 3UT0A 4OJFL 4TQEH 5LAXB 1FYTD 5C07D 4M6ML 1DQDL 4GAFB 3B4NA 4YFLF 1KB5B 3MROA 4DKFH 3AGVA 3OF6A 1S7RB 5JQHC 2XTJE 5EWIL 4G8GA 3FRPG 2VDOL 3V4UH 1SM3H 2R0ZH 1PZUB 1H5BB 4PJHE 4M3JA 4QXUL 3CU1A 1FN4A 1NCDL 2VDOH 5FA4A 2YBRA 4XMLL 2DD8H 4EI5D 4G7VH 2X4NB 3AREA 3K46A 5E5UB 1JWSA 3K2MC 3TN0A 1MFBL 2NXYB 1WBZA 4TNVF 4HWEH 5F1IA 5J12B 3CH1A 1JP5A 4MS8C 3ZDXF 2Q76A 3TZVC 5E2TL 3VWKB 1JHLL 2YOCA 2ITDA 5BVJA 3TBYB 2XT1B 1P1ZA 1VKXB 4BSWA 2A6DB 2IJ0C 4LFHD 2HVJB 1VCAA 1N7ML 4HWZA 4ELMA 4Q6IB 3CMOL 1OAYH 5ANME 4U1GC 1N8ZA 2IC2A 1BQUA 4GUPB 1MCIA 3QUZC 1FRGH 4Y8DC 3ARWA 4HD9A 4Y4FB 3RKDC 1Q72H 4EZMA 5DVOA 4QHLB 4APQB 4OCXL 2K7QA 1CFNA 1R24B 2QR0A 2YK1L 2DS4A 4MJIB 4TSCH 4R9HA 1BX2A 5E2VH 1XCTA 3DNKA 2HTKC 3H2WA 3WO4C 2Y5TB 5KS9A 5L8KB 3BZ4B 1CDHA 4HJ0C 1IQWL 3FFDB 2EDEA 5FXCH 4LAJH 1C8PA 1NPUA 3TN0B 5BZDB 4YW6A 1H0DB 2FEEL 3MUY1 3DGGA 4HV8A 4Y16B 3IYLW 4N8CH 2WYFA 2UWEF 4JRXE 3DX8A 2AQ1A 4Y19A 1WZLA 1VFOA 2X1PA 1HYSC 3F65A 5HDOA 4X7SH 3QP3A 3OB0K 5IOPA 5MI0C 1I7UB 3BT2H 4NFCA 5GRWA 2X10A 4W6WB 3GSQA 3UPCA 1X5IA 3ECBA 1FFNA 4V2BA 5F9WC 1S3KH 4KC3B 2W1NA 5I8EB 2X5PA 3ARSA 4F3FA 1NGXA 4FMKA 4J7RA 3BPOC 4ODBD 3SY0A 3W11D 5GJTL 1U8NA 3QAZC 4JPIB 3FN9A 3HE7C 3MV9E 5ELIA 3B2UC 4JHBA 4XP4H 3JV0A 4HUUB 4GXVH 3IKCB 2E6PA 5EU6B 4Q9QH 5ENWB 2VH5L 3C5JA 4YPJA 3UZEA 3BD3A 4JM2B 1ZA3A 4FZEL 5KVGH 4NQXA 4HKBA 2WLZA 1UYWH 3K0WA 3NABL 4PRNB 1UT9A 5GGTA 3SBWA 5KAQG 3D9AH 4P9HH 3BEVB 2P5WE 1RZIB 1H15A 5C3TA 4MB5A 4B5EA 4RA0C 1ZE3C 2CIKB 3NA9L 1BLNB 4MSWA 4NWUH 3LS4L 2LTQB 4MNQE 4XP6H 2WINA 3ELAT 2D31A 2P5ED 3NIFE 2DL9A 3ARFB 5KSUA 1KJ3L 4OM0H 3MUGA 4P2QD 1NFDA 3B6SB 2V7HA 5CSGA 5E94A 1JPTH 1PW3A 1V7MH 5EULV 1RHHA 3KYKL 3NFPA 2MQ3A 4LOUD 4XC3L 2FJHB 1F00I 2VERN 1WICA 1SQ2N 1DQQB 5ICYA 4PRNA 3S4SB 2X70B 1EO5A 2QJDA 2VXUH 4P4RA 4APQA 3IAQA 4DGIH 1FCGA 5AUMB 3BESR 3IFOA 1W8UA 2B1HL 4ODVH 4WFHE 5DFVD 5IBLC 3OKLB 4DWHA 2X4UB 2FSEA 2O14A 3UBXA 4UOJA 1E28A 4NQEA 2Y6SC 2IPTH 4MD0A 4DQOH 2Z9TA 1IFHH 4MWFA 4EBQH 1FLRH 3R1GH 4K7PX 4N9GA 5FKPA 4PJFA 1CT8B 4JHAH 4NRXB 1T2QL 5CUSH 1GZQB 5FA3A 3RTQA 2CGRL 2GYSA 1C12A 3QI9C 2GCYB 4F80A 4XPBH 4YDKL 1X4YA 5GS1C 1U91B 3PDDA 5F1IB 2FX8H 5B39G 1ZT1B 4MA7H 3QFDA 2HA1A 3EW3B 4NYLA 4CJ1A 1O7VA 3CVIH 3DARA 1S9XB 3MXVH 1L7LA 4PJFE 3SDAA 2YK1H 3OKDA 3V8OA 2W38A 5MEQA 2BNRA 3DSFL 1JTOA 2KDGA 3B9KA 5IOPB 1KPVB 5IW1B 2CJUH 1WBYB 4WI8A 4Q74A 4JVPA 1XH3A 3K4AA 5DGRA 2YPKA 3DMMD 3O3AB 3MLYL 4O02H 4Y2DA 4CAGA 7FABL 5JPNA 4AJ0A 5GS0L 1DUYA 4I18C 1KFAH 3EJJX 3KHQA 2H3NB 5GPRA 1BHGA 4Y4FA 1M05B 1OGAE 3C09B 2Z92B 5E9DD 5BZWB 2DYPA 4TVPL 1T03H 5ILTL 4YJZL 5HHXH 4XPTH 3U2SA 1VGEL 1ORQA 4OM1L 3CFEB 4G7VL 1UZ6F 2OR9L 1G6RA 4JGUA 1F4WH 2P7TA 3MRDA 4JKWA 3KPOB 4YFLI 1TQCB 2Q76B 3EDFA 2NY1B 3C8KB 5JPNB 2VN4A 5D1ZC 3QDGA 4QRUB 1UH2A 1KLUB 2AJ3B 3P4OA 4Z9KB 3RA7H 1AFVL 4WUKL 1NGQL 5M95B 4XI5C 4JAMA 4XP5L 2C7UB 1JNJA 5T1KD 3WIIH 3U4BL 2LU4A 3K1DA 1NGPH 1AGBA 2PYEB 1A5FL 1KJ2B 3UTTD 3PXJA 3O3BB 4OFIA 3PWNA 1OGAD 3BAEH 4A2LA 5CD3B 4I0KA 5DURB 3CDYA 4CL7A 3L3HB 1AHWA 3MJ7A 5KVDL 4YDLB 5HYSA 5C9KA 2BX5A 4OUUB 3O4OC 1MAKA 4KY1L 4YUEH 7FABH 2P47B 3GMLB 3QXWA 4M62H 1JYXA 4P99A 1P7QA 4K7PH 3B9KD 3ARDA 1KLUA 2AJ3A 5KTEL 4WGVB 3MRHA 4LASL 1FH5H 3SE4A 1NQBA 5D1QB 4RCAA 4ZPTA 3SDAD 3D3VB 4TSBH 1C5BL 3VFRB 4NBXB 3LEXB 1GVIA 5BJTA 1UEYA 3IXTB 4XI5D 1CGUA 2R0LH 1K3ZA 2X6MA 1VERA 1FQ9C 5ID0A 4DN4H 3UDWA 3ARRA 4Q58C 1ZLUH 4AK1A 1J05A 4QRPB 2Q6WB 1NLBL 2ICEA 4URTB 4ZFGL 3QT2A 3RTQD 4JZJA 1WZMA 5IKCA 3NBNA 4LHUB 4HFWB 2Y07H 4ZDHA 2OL3H 3MBXL 1G6VK 4IBLT 1RUQL 4AYFA 3I02B 1XGPB 1ZT4B 2KR2A 3DRTA 3SGDH 1HE7A 2FWOB 4Y2DB 4DQOL 2ZNWA 2GTZA 1GL4B 2MKLC 2HT4C 5E2UH 4WHYG 2AJVL 3PP4H 3BE1H 4P5TC 5DMJB 4ORGB 1FAKT 4HJJL 2P5WD 1WC7A 3V5KB 1IM9B 3MLSL 3EOBB 2H2PD 5TDOA 2F19L 4XBPB 4GKZA 2FGWH 5CGTA 1GGCH 1IAKA 4Y4HD 2DLEA 3P77A 4S1SL 5ITFA 5F8QC 1I8MA 1NDGB 3ARBA 4IRJA 1CDJA 1KN4L 3ZDYF 2AJXL 2OSLA 4NYLB 4F58L 3MXWL 4JDZA 4H1LA 5C0FA 5EU5A 5IVXA 3KPPB 3B2VH 1BREA 3FQXB 3KXFA 4Y88A 1MCKA 4P3CH 4UT9L 1J1OH 4PJ7B 4NPYB 4YHPB 3TPUA 2IANB 2XWJB 4MD5B 5FUZL 3QUZB 5D1QD 1TITA 1ZEAL 2ZOKA 1IGJB 4Z6AT 3MRCA 4M7JH 1Q0XL 1JGUH 4WHDA 3RVTC 4FQ1L 1D9KC 5T3XH 4FFZL 3HE7B 5INCA 3QO0A 5DI8B 2OYPA 3PV6A 1RMFH 3P30H 1WEJH 3MRFB 4FQXB 4B7IA 3TBSB 3N06B 3TYGH 5A3ID 4P9HL 3F7PC 3QA3B 5ITBH 3I50L 5ALCL 4L5FL 3X13A 2XFXB 1MRCL 2DDQH 2DQGH 2ZWLT 2Z8RA 1CICC 4NQDB 1X5YA 5C3LD 4W68A 4GKZB 5MEND 5JIPA 4Z7WF 3BKCH 1SBSH 1YEIL 4F9PC 3O8XB 3BPOB 3PDGA 3SCMB 1ZMYA 2FECI 3VRJB 1CGXA 4MYWB 3ZTNH 3DGGB 1I3GL 4NCC1 3W39B 1KNOB 5KSAD 5JHDD 4YR6B 3C87A 1IGFL 4QXUH 1NGYB 2OJEA 1BOGA 1S7VA 4NJAH 5EOCL 1K4CA 4P2RB 2CDEB 1D5ZB 3U7YL 4N0CC 1JPGA 2Z91A 1S3KL 4BQ3A 1YECL 1IGCL 3NIFF 3VXUA 4OF0A 4RGNE 5GZOD 3QULA 1FFOB 5HYEA 1INEL 4ZUTB 1Z9OA 3ZE2F 2XPGB 2GK2A 2I9LA 4Y19D 3U0PB 5GSVB 5LGJB 4WO4B 1JUFB 1F58L 3H7BB 1M7IB 4IRJC 4Z7UA 1W8TA 4YHZH 1IKNA 3G9VA 1ZHLA 5CIPB 4RAVB 1I85C 3C60B 4U6YA 4LKDA 1FVCB 4D3CL 4NQXB 4ZSOA 1I1AB 4LLQB 1DBML 4ZPVB 2GW5A 3QJFB 3TA3A 3SDXB 1NLDL 1NDMA 1CR9L 5EU6A 2XY2A 1YQ2A 4WWKB 4TVSa 1PBYA 3U0TB 4L8CA 4NN6C 2EO1A 2CRZA 3DECA 2BXZA 3U9PH 2VDMH 4IOFD 4ZXBB 4XVSL 4X6EB 3TA3C 4ZUSB 1QFWM 1YEEH 2NY0B 4KROD 3S96A 4EI5C 1ZTXL 4X4ZA 1MAJA 4GMTH 2D7NA 5HHMB 3IF1B 4NRYB 2YRLA 3ZKND 1BPVA 5DD3H 3JTSA 3MV7E 3CVHA 4F37F 1Y18B 1NGZB 2FL5A 4GBXB 3FQXA 2ATKB 4OF6A 4NO2A 1OPGH 4HPOH 4X6FB 5MERB 5C0IB 3VXSB 4XPAH 3ABZA 1LO5A 3VGFA 5F7EL 3BKYL 5FDWA 3TGXA 1HILB 1I7UA 4CVWA 2XTJB 2DI9A 4OZFB 3O6KL 4OFPA 3QIWC 5KSBB 1ACYL 5GRXG 4AH2A 5T3ZH 2B1HH 4ODVL 4AT6B 1A0QH 5C9JB 5FUOH 4XWOD 3RVWD 4PJIB 3ARGC 3S3SA 1NANI 4OLVH 4ODTH 1GOHA 3SE9L 4J8RA 3T0XA 3V0WL 1EJOH 3M8OL 2AK4E 3V4UL 1Q9WB 1PDKA 2D03L 3QEGH 1UFUA 1OTTC 4XWGL 3NGBC 5I1LA 2ITCB 4ZS6C 1XCTB 4TN9A 1ZWIB 1N5AB 5KS9F 5DS8A 3SKUD 1OWWA 4ZS7H 3C6LD 4KMLB 1A6ZB 1ORSB 2EDWA 4P2OC 4ETQB 4L8BB 4YNYB 4G9DB 3IJHB 5F9OH 5MHSD 4OZFG 2GSIB 3SEPA 3Q5OA 3ULUL 2VXQH 2BY1A 3MNVB 1U8JB 2PNDA 5FF6B 1X6LA 1SBBA 3L7FA 4N1HB 3V7AG 2ZCHH 4OUOA 4NNYB 2NPLX 3D3VA 1I1YB 3WN5A 2Z4QA 5DVNA 5HHVH 1JPFB 1EV2E 3T0WA 4G8GD 5EIIA 2AJSL 1MF2H 5GRVL 1QFUL 4YHML 3HCVB 4L4VB 5T1DH 1C1EH 5BV7B 1AGFA 3GMRA 1MJUH 3MLTB 3SKMB 2OTWB 5L2JB 5DZNA 1ZANH 3PHOA 1GZQA 5FA3B 2ZKHL 1HEZA 15C8H 2R29H 4PLJD 4ODXB 5CWSA 1GGBH 1CYGA 3BQUC 3L7FB 2C1PA 4OQTA 4XMPH 3X3FH 1CLOH 1JTTA 2YD2A 3RIAK 3RHWF 2JCCE 1KCUL 2V6HA 2IMNA 1DLFL 1H3PH 2Y1VA 3JTTB 3T09A 4LDLB 5DK3A 5DJ6A 3GFUA 2R0WH 1UACH 2OTUA 1XAUA 1KCUH 3PWJB 3TA3D 4I3SH 1MRFH 5BQ7A 4HHAB 5E5MA 1PVHA 1FO0L 4Q0XH 3IU3B 1RU9L 1QBBA 1FL6A 5C0BD 2OJEB 1MRDL 4NQEE 3WNLA 1E4KA 4MQTB 1TJIH 4JN1L 4TUJA 1ZHNB 4CVUA 5J6GB 5BMFH 3AY4C 4PGCB 1IQWH 2E9JA 5EUOF 3KPRE 5D7LD 1L6ZA 3BYYA 1FFOA 5ETUA 3SQOL 2ZUVA 2MPAH 4BH7A 4XNYL 2NX5B 1M7DA 3MC0A 1FZKA 4HG4K 1MELA 4FN0A 1HH9B 5LBSH 2VZSA 4U4BA 4K2UH 5D71H 1HH6A 4HS3A 4PJCB 5HGHB 5BXFA 3OR6B 2XWBA 2IAMB 1NL0H 4JQIL 5ESAA 3BP7A 4HQQL 4UMGA 4EI5B 5L8LB 3MRJA 5INCB 1FNHA 1YUHB 3RVWC 1YNLH 2VLRD 5FO9B 3T8XB 4D9QE 1RZ7H 3S6CA 1T66C 1YPZE 4FP8L 1BD2E 4YXLH 3BZDA 4DOHE 3GJFK 5IB5A 4WTXA 5J1AA 2DWDA 2FHCA 5SWSA 5TF1L 4OCWL 1X5ZA 1VACA 4JFQA 3WMSA 4U6HB 1FNSL 3LB6C 3O4LB 4HPYL 1GAFH 2ED7A 5JQ6L 1T1WA 1FNLA 4KUZL 4AG4L 4X6DF 4EUPB 4JY4B 4MAYB 3DVGB 3UXFA 4OGAD 5GGVY 3U7YH 3OKOB 3L3JB 1EJOL 2KPNA 4ZTOH 2ICWA 5GGQL 2HJFA 2E7BA 3DRQA 1SMOA 3FO0H 3CVHH 2F53E 4RMWA 5I74C 1DR9A 3ZDYE 4K23H 2CXKA 4LK4A 4YBQC 5HYJD 2JWPA 1NCTA 5BS0D 2HFEA 1DVFA 2W0FA 5BZDA 1INDH 1D5MB 1FIGL 1DFBH 4IRJB 4PRHE 5HHOA 4X9HA 5E2WL 4YDIH 1FFRA 2A6JB 4I9WD 3SOBL 3X17A 4HPOL 1RZGB 1ZHKB 2JJVA 4L3CB 5MENA 3QIUD 4C56D 3C2AH 1PEWA 3D18A 2EICA 5IWLC 1RIVL 5JW5A 1HHHB 3KNBB 4KVCH 2J2ZA 4E9LA 3S8WA 5F7WC 1A1NA 1RZJC 1YEFH 1JGUL 1YNLL 4KK8D 5B8CA 3GSRA 3U7WL 1QA9B 5BVPL 5GGRA 4RMVA 2O26U 1MJJA 3BPCA 4UQ2B 4R2GD 1FYTE 3WCYA 4QXTB 1NCCL 4GQPH 4YE4L 2P8LB 3KDMA 5FO7B 2QSQA 4NT6B 3GB7A 2P45B 3CSPA 4X6DB 3WNMA 1J10A 3V4VH 3ZO0A 2RCSH 4LHUG 5EU3B 4LP5A 3WFCH 3S34H 1HOCB 5IMLA 3MJ9A 1WIUA 1GRWA 2MQCA 3G5XA 2BSRB 2FX8L 6FABH 1YA5A 4FS0A 2XKSA 4EUPH 1I4FB 1AGBB 2FBOJ 4WW2A 5HGBB 4KKNA 1CLYL 5D7SH 3NCFB 4W6XB 2P5WB 3VWJB 1OL0A 3DUSA 4MX7A 4DKEH 2VQUA 2NY2C 5DEGB 2GK0A 1CI5A 3CX5K 1HSAB 5D5MA 3U7AA 1KIPA 5L88H 1NMBH 2DKUA 5I2IA 5TE4H 4YO0A 1X9QA 5H94A 5T1LB 3RPKA 2PTVA 2OL3L 2UY7A 43C9B 5EU6E 1A6TB 5HI3D 2C24A 3ARFD 4PJGE 4NC0B 1PY4A 3UTTA 3HZKB 1C16A 3O2WH 4S1DC 2DIAA 2YMXH 1IAMA 4Y16C 1BECA 3C5ZC 2R29L 4L3EE 4I4WA 2BERA 3G6JE 5DHVB 4FQJH 4GBXD 4HJ0D 5ETUB 3BHBB 3CFEA 5FM8A 1J5OH 5HYQA 4IDLA 1AD0B 4RFOH 4Z77A 4LCCC 2GY7B 5BZWA 1RIUH 3G6AB 4QRRD 2V5MA 3S36H 4U1NA 5KJRH 2AEPH 4U7MA 4WFEE 5FYJD 3IDMA 3LPWA 4JM2D 1VENA 5K33A 4LCIH 1QFWH 1BIIA 1W0VA 3SQBA 1CFNB 4U6XB 1GGIL 3C2AL 3OKEA 4ZS6D 3RWCB 1QRNE 5C07B 2DYPD 3JZ7A 5E9DA 4PGBB 4TUOA 1OAZL 1VADB 2A6IB 4PJDE 4TTDD 4U6TA 3UTTB 4CADA 2ZUQC 2O61A 3KPSA 4GBXC 4P2OD 3L5JA 1U8PB 2HKHL 3U36B 2H32A 12E8H 1OD7A 4KTEL 1L9MA 4U0QB 3NPSB 2YPKB 3FZUC 4G43A 3U30C 1C7TA 3REVB 1AO7D 3VGAC 1JIBA 4P3DA 5C6PB 2C3HA 3MJ7B 5DR5L 2AJVH 4RGNC 4DVRH 4CVZB 1ITCA 1N4XH 2PO6A 4DEPB 1Y0LB 1F4HA 5AEAA 1CIUA 4XXDA 1NFIB 2X4RB 4GQ9H 5IEHA 1NC2B 5JIIA 4LJHA 4GKNB 1A02N 5JQ6H 1ULVA 3J8F7 1CLYH 1T4KB 5C6TH 4FFWD 1CGYA 2UWEB 5TF1H 2Y07L 1TZGL 4LRIA 4P4KB 5DRNB 1TZIB 1UG9A 2FGZA 2NY1C 1J0YA 4KI1A 4Y4FD 1BQLL 3UTZB 4OZHB 4NQVB 4J1UB 4PJ9A 4HUNB 3KPQA 4KKLD 2FEDD 3M07A 3QUYC 2X1WL 2DQEH 5LGHH 2G60L 1ZLSL 1C5BH 4KJWD 3OG4B 1G6RB 3CFKB 5AUMA 5D71L 3BZFB 3IXAB 5JW3H 2NY4D 5GSVA 4OZGF 1IT9H 4QCIA 3SGKC 2WINB 3KYOA 4O51B 2UYLA 2QQNL 2EYTB 4BZ2L 3HMXA 4F15C 1QFOA 3SDDA 2DBLL 4H8WC 2NW2B 3GO1L 4LARH 2YD1A 4O5LL 1CDUA 1RIVH 4ZXBD 1OP9A 3MRIB 3U0PA 3ARFC 1G7QA 3QFJB 5C0AB 4PJ5B 1N7MH 4QT5B 1OARH 2EYRA 5FB8B 3QI9D 3U4AA 3NPSC 5JDSB 1UWXH 4M6NL 3WIIL 2H8PB 4O2EA 4RBPH 5GIRA 4PP2A 3ZE0F 4EBQL 5IW1A 4PRPE 1GWLA 3BIBX 1KPUA 3UTPD 1DVFB 2IPTL 2W0FB 1NAMH 1OTSC 4FQHB 2YS4A 2DKMA 2VJXA 5I73B 3EFFA 4J6RL 3LQAL 4OZ4A 4X80H 3KPQB 4M48L 3P4MA 2OTUB 3WXVL 1FNEB 3RL1B 1A7OL 2ATPA 4N0RA 3D0VB 3FQTA 1U3JA 2VXUL 1YNKL 3WKMH 4ZFOB 3CFJB 4LIQH 1SYSA 1FE8L 1NEZG 3LD8B 4MQXD 1Y6KR 3RP1A 4N0FB 4QY8A 2XQBH 2ZKHH 2BCKB 3I75B 2Y4SA 2CKNA 4OLZL 5ID1A 3ZTNL 5IHLB 2EYSB 1L7TL 4RGMC 4ELMF 2JJTA 2IPUG 1T03L 4OM0L 2YPLE 4QRQB 4Y5YB 4YHMH 2ZUXA 1DQMH 4NC1E 4R90L 3P4NA 4GRLC 2VIRA 3V7MA 1E6OH 3EAKA 1RSFA 4RFNC 4WO4C 4L4TB 2W59A 5CSZB 2P5EA 2R4SL 5FO9A 5K93A 4C4KO 5BXFB 1QLRB 3FOMB 4PP2B 3RUGE 3MLYH 1MY5A 2HVKA 2NZIA 4RWYH 4YHNA 2XPGA 5CP3A 2DIBA 3DLQR 3QJHA 1WAAF 2Q7NA 1D5XA 4L8DB 4NRZA 4FMFA 5ITFB 1H5BC 1X5AA 4LVNB 4RQQB 5CAYB 3UTQB 2A6IA 3FL7A 3PXHA 5CD5C 3TH3T 5DD0L 2Q1FA 5K9OA 2XTLA 1S5HA 4ZO7A 1E6JL 1MHEB 3NIGE 3VJ6B 1IAII 5I74B 1PEZA 4OCRL 1XZ0B 5K9KA 2VC2H 4FQ2L 5IK3A 3T1FB 1QKZH 4OLVL 2GJJA 1RZ8B 3SGJC 1QACA 3OXSB 3OB0H 4JFEA 3CCHA 1JVKA 1G9ML 4R97B 3DV6B 4DZ8B 1PQZB 5C08E 5AAMA 3MRFA 3GMMA 1Q9LB 5DK0B 5ERWA 4OLXH 4X0KB 2BFVL 4V1DB 2COQA 4X7SL 1I9JH 3SE3A 2FR4B 5ID0B 4PJIE 2BJMH 5E00A 2OL3A 2X41A 4CU6A 3B9AA 1W8NA 3PWUA 3AM8C 3VFRA 4RMRA 2ENYA 3NH7L 5D2NA 3MLUH 3O41B 2W9DL 5B3JF 3QSKB 4MA1C 3T4YA 2F74B 3OKKA 1I8IA 1MJ8H 3BP4A 5D6CB 5KN5A 2D7TH 1YEEL 3GSQB 3KS0H 2VSCA 4X7TA 4CUCA 1X7QB 4UNTA 3S37X 4TUOB 2CLVA 5DRXA 2VITA 1TVBA 3OBAA 5EBLB 5E00B 1AQKL 2FR4A 2GUOA 5L7XL 1MIEL 4L9LB 4PJDF 1FVEA 1HSBB 4U3XA 3L3DB 3CMOH 5IF0B 5DQDH 2FBJH 1N5AA 4D3CH 4WW1B 4H25B 5I18L 2VLKB 2G5RA 3B8YA 1CU4H 3QZWB 4J3UA 3V6OE 2YD5A 3QDME 4HWBL 1S7WB 2VLRB 1AR1C 3GHBH 2WBJB 5DC9B 2ORBH 1T22A 4F2MB 3RNKA 4XCEB 2QSTA 1UKTA 1MFCH 2JB5H 1BAFL 4OGZA 5K9JH 2VKWA 5E8OB 1S9WA 4HUKB 5DO2C 2Z0BA 3C6SA 1R5IA 4XBEL 4XZUB 1KGCE 5I17A 1UQSB 3MOAL 3T65A 5JR1L 4M03A 1ZHBB 3BO8A 4G8IB 5DA4A 4S10A 2EC9U 5DRZB 4L29A 4JEGB 3HKFA 2R56H 3LRSB 3G5VB 2YEZB 2BNQD 1XF4A 2V5RA 4G80B 1GWKA 2VDKL 3MODH 5E6IC 4MX7B 1T89C 4TSAH 4M9PA 4QO1A 4TYUA 4RBPK 3VXSA 3FT2B 1MRCH 2DDQL 4WENB 5C0AD 1T1XB 5IGXL 5SWQB 3WLWC 3GKZA 1Q9OB 2X89A 5D7LE 5JXEC 4X9BA 3DJ9A 3VXSD 3AMLA 2CIIA 1W8ZA 1RMFL 4LPTA 3VH8B 3MPCA 4OGAC 1KCKA 1A4KA 3FB8B 4PR5B 3P40A 3SDAB 2FATH 5E4EB 2A6KB 2J8HA 3K8KA 3ARUA 1TTUA 4FXLA 2XZAL 1EMTL 5DQJA 4CMMB 2P4AB 3N9GL 2EDYA 2B2XL 1PQZA 5F6HI 2BZDA 1MHCB 2EXWC 3DBXB 3VW3H 1NBVL 4FQIH 4UQ2A 3RU8L 4D8PA 5F3BA 2AK4B 2P24A 1F4XH 2VDRH 5JUEH 1UM5H 4HJGB 3ARXA 3ZYFA 5LCVH 2VLJD 4ZPVA 1R3JA 1JF6A 5HGAB 3GUTA 3VWJD 2VR9A 4LEXL 4MJ5A 3U2SB 1EFXD 1BQHA 4HUWA 1KXQE 4PREB 1T6WA 1UKSA 1MHEA 4LP4A 4JG0H 3VXUB 1VEPA 4XPBL 1FV1A 1RUAL 3VCLA 1HH6B 3CXHJ 5C2BH 5DJ2B 2IAMD 3IDXH 3DXAD 2VLME 2GSGA 4YR6A 1FZKB 1OP5K 4PJ9C 4Z7WE 4JG0L 4PRIE 5AYUH 5A16B 5SWSE 3IDJB 4U1MB 1XGUB 4PRHD 4WY7L 1CE1H 3LKNB 3JUYA 2R1YB 1MEXH 3FO9A 4DGIL 3D5OF 5JHDE 2R4RL 3I02A 1P6FA 3PABA 4POUB 2E7HA 2ZP0T 4EUPG 3PGCA 3O4LD 4HX1A 4P46C 2VDLH 2E9WA 3MJ8A 3P4NB 4TQEL 1DUZA 5ESVB 2VLLA 2OCFD 5E1AA 2SEBB 2YSSB 1TZIA 3OKMA 2HMID 1E0OB 1AR1D 3V6OA 1UWGL 3BZEA 3GSWB 4OQ1A 3T77A 1JNHB 4KQ4H 5D7IA 1RURL 1MSPA 2MQ0A 5DFWH 3SBWC 4HBQA 4MXVE 1MLBB 2UZYB 5I8CA 5EO0B 2J1KA 4PJAA 2CO6B 5EU5B 4U6VH 5DJZA 4JQVC 2E27L 2VAAA 3D85D 4G8GE 5L2KB 4IEFB 4QNPF 3I6KB 3TPUB 3NABH 3QO1B 3STZB 3AC0A 4IMLB 4A6YH 1JZ3A 1YEKL 5F9WB 2VE6B 3IDGB 4FTVB 1UKQA 4MXQC 1FPTH 2AJXH 2NX5A 1NSNL 4H26B 1Q9OA 1LP9B 4JY6B 2R4RH 2WUBH 3INUH 1N26A 5D8JL 2VTFA 2PN5A 2F19H 4FFVC 4XBPA 1CBVL 4U0RC 1ZGLA 2EH8H 1VFMA 1G7IB 4OZGA 5GJTH 5IV2A 5F7MC 3IJHA 1H3WM 5KSBE 1B9ZA 1BAFH 2M2DA 4MGXA 2EIZB 3V6OC 1PZ5B 3ZKMC 4JM2C 4Z76A 5IJVA 2K7PA 2AXFB 3O0RL 3VXRB 1R6VA 1TETH 4JRYE 1S78C 1RULL 3MLXL 4NO3B 3TT1H 1LEIB 3S7GA 5EH1A 5I18H 5EORL 1S9WB 1R3IL 2OMNA 4KGLA 5HVFB 4LCYB 4GRWF 4UOW1 4NQUA 1U8MA 3D69B 3H42H 1ORQB 2C1PB 2YPLA 2OZ4A 1A7NH 3HC3H 2PCPB 1R3JB 1CD8A 5T5NF 3O81A 1AGEB 2R0LL 3DX6A 3W5NA 3H3KA 1WWWX 2YXFA 4NKOB 5E2VL 3JV6A 5CP7A 4YE4H 4RAUA 4X7TB 3OSKA 5GHWL 1CE6B 2GY5A 1WMXA 5A2JH 4Z78A 3F7VB 43C9A 2IAMC 4NBZB 3BXNB 4I3RH 2A6DA 3VDAA 5IROA 3HI1B 3VXOA 3VG9C 3HR5A 3QIUA 4C56A 3B5HA 4X6FA 3HUJA 4JB9H 4YHOH 5MERA 2A0LC 3FT3B 1H8OA 3PIQB 3FQNB 1T3FB 4HK3N 4PRPA 2APFA 3L3HA 1IGIH 2IH1A 2AGJL 4U7KA 2EZ0D 4LCWA 5ISZD 3CUPB 3LKRB 3HI6H 1DN0B 1I9IL 4UI2A 3FRUB 3RZCD 3K1KC 1WFOA 2E7LC 4LBEB 1KB5A 1JHLH 4KKAC 3O2DL 3QFDB 5LAXA 3OAYK 3R1GL 5ADOL 5GGTL 4PTTA 3TV3L 3GSNL 1CE6A 1MFBH 4MB4A 4AEFA 3QXDA 1JWMA 3BRDA 4JRWA 1F5WA 1U3HD 2C3GA 4DTGH 4K7FA 1MAML 3IS1X 2PW2A 1XGTA 4U6XA 3U6RA 3JVGA 3LKQA 1AKJD 4QRSA 2IGFL 4NM4L 4TPRL 5C92A 1I1AA 1Q9LA 4C58B 4XVJH 1AE6H 4PGBA 3TIDA 5EUKB 5IW6B 2Z92A 3WFZA 2ZJSH 5E08L 2B20A 1YYML 4X6DE 4OZFA 1V7ML 3H7BA 2J4WH 2EEAA 2GEEA 5B38A 1MIMH 1CL7I 3P2TA 4KFZC 2VLKD 4M3KB 3ZL4L 4HXBH 5BO1H 1M05A 5ALBH 2FJHA 3AS1A 3MJ6A 5FK9B 4OZHF 3VFOA 2VN7A 3LS4H 4X99A 1HWHB 2X4OB 4PJEA 1MCJA 3AS3A 4BQ6A 4Z0XB 1S7TB 2C3VA 4HIXL 1ZGLP 5KOMC 3LS5H 2P5EB 2GITA 3RI5K 4H8WL 3KPMB 3I85A 4NUJA 2X4QA 1TPXC 1MWAB 2PO6D 1W72H 5SWZB 3EHBC 4NRYA 4MA8L 1SJEA 1DDHA 3GSNH 1YDPB 3STLB 1OAXH 2R2EB 3NACH 1P7HL 5E99H 1OGTB 1Q9KB 5D1ZD 1XEDA 3O3DA 5IR1A 5J1TC 2BHYA 2XYCA 4YDJA 4BH8A 5FHAL 1I8KB 4KI5D 3W9EA 2P1YA 4LF3A 1T1YA 1CQKA 1C7SA 1NFDE 4P2OA 3G5XB 5TGBB 2X7LB 5J1SC 1WIOA 2W0KA 3FB6A 1WSST 4IJ3C 3OKNA 2JJTC 1CGSH 4L8CB 3HB3C 4CU8A 1A9BB 4MDJA 5B4MD 3AROA 4QXTA 2NQCA 3V6ZB 1B4JH 4HT1L 1HKLL 5J0BA 4DGYH 3H7LA 2VLLB 3UJIL 1CFVH 2OK0H 1U3HA 3CSYB 5D96B 1OARL 1U3YA 5C0AA 1S7UA 3O9WC 4HH8A 3X3FL 3EZ8A 2QHRH 4DN3H 1LK3H 3KJ6L 3MLWL 3UZVB 1L0XA 1XZ0A 2VABB 1PSKL 4H88L 2UVFA 4HX1B 2IG2H 5BRZD 3UPAA 1DBJL 3EYFB 1NGYA 1G7LA 5LQBL 4YXHL 5F9AC 1A7BA 3DO3A 4RDQF 3GMOA 3MRGA 1BVLB 4S0TD 3SO3B 3GJEB 5KS9B 4CPBD 1GGUA 2KUTA 1MCBA 3SGJA 3NAAL 1NCBH 1F3DH 1FRGL 3FB7B 5F1NB 3PHQA 3EYVA 4NBYB 4PREA 4NQTA 3RDTC 3PWLA 4CBPA 3KPNA 4MDIA 3VRLE 2NW3A 2R4SH 4GMSH 4JM4L 1Q1JL 1B0RB 2Z31C 4ZQKB 1OOAA 4MVBC 3EBAA 4HUWB 1X4ZA 5JDJA 4X7FC 1YEHH 4KHXL 3W9DB 4JFQB 5J6HA 4WUUB 5HI5C 4E0RB 4F3FB 2ZG1A 4P4KA 5DRNA 3QXVA 2XWJA 4MD5A 1LEKB 3DVFA 1XR8B 3O6LH 4E5XB 4JE4B 3DVGA 5DK2A 2EDOA 3MYZA 1KJVB 1A7OH 2ESVE 3FONB 1YDPA 1TVHA 3STLA