3ORJA

Crystal structure of a sugar-binding protein (bacova_04391) from bacteroides ovatus at 2.16 a resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
429
structure length
429
Chain Sequence
b'DDNGGSSVMNITGIYLEDAKSNVPDRLVDFARLGQLIRIEGEGFNGLKKVYINGYNCYFNPVFVSNKSFLVSVNSKVPTTEADENVRNTIRLVKDGGEYVYDFQIRAAAPSITKISNCMPNVGEPIIVYGSGLTEIAKVVFPGNVVVTEGIISDLDGEYFMVDMPAGVSEEGGSIFVEGSNGGAYSPAYFNYKKGLLLNFDGVGAQGAWGDSESMIQTTELESASIGEGNVSQGAYCRLPLERQLPVAAAKNRCAEVWTAGNGTDPDWLTLGVPAETPVAECAIQFEIYVPEPWSESGFLKICGQNGFNGGEWERDCYNYVPWLVDGKIVPFQTTGWQTVTVPFSEFYKSKASSGAWTTFADVTATRASASYANFGFYFENSDITLDKITGASSDKETEFLSKATSVKIYIDNWRVVPLTKPEYTDFPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords sugar-binding protein
publication title Crystal structure of a sugar-binding protein (BACOVA_04391) from Bacteroides ovatus at 2.16 A resolution
rcsb
source organism Bacteroides ovatus
molecule tags Sugar binding protein
total genus 96
structure length 429
sequence length 429
ec nomenclature
pdb deposition date 2010-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18329 SGBP_B_XBD Surface glycan-binding protein B xyloglucan binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3orjA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3orjA02
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 3orjA03
5EBWA 3O6FB 2OR9L 2HRPH 4L29A 5L6YH 4RZCB 5I66A 3F7VB 3S35X 5CP7B 4M03A 4QHNA 1N3NB 2IPUG 5F93C 4NYLB 2BNQD 3MRPA 4N5ED 4PY7B 2IALB 3C6LA 5BZDA 1QSFE 4HMEA 4IMLB 4CJ1A 3ARDB 4AEEA 4NHUA 3KPSA 2NY5L 3UTQA 5HGAA 5IR1B 1F3JA 1CWVA 5I30H 5DJ6B 2Y5EA 3L3JA 2XRAH 3MO1A 4JEGB 4GXUN 3EBAA 4L9LA 5BV7H 3V5DB 4RDQG 3ZL4H 3IAGC 2FZ3A 4X7DC 3B3IB 3L5JA 3MCLH 3LEVL 4TRPH 1J11A 1O5DT 2WAHA 4EIZC 5E9DA 2RAMA 1TTGA 4B41A 1TENA 1NBYB 5F88A 1OSZB 4E5XA 6CGTA 4MJ5A 2VDPH 1WCBA 4OIAA 4AIZA 4YWAA 1U8QA 5IFHH 1G9ML 1P4LB 3L3DA 3HLAA 4XC3H 4RNRB 3D18A 5FO8B 5GS1B 5EWIL 4KK6D 4DW2H 3JBG7 1IARB 1ZS8B 3BP5A 3MA7A 1UKTA 1P7QA 1X5FA 3T0BA 1KIUA 5IBLC 4ODHH 1UWGL 1KB9K 4YXKH 1SBSH 4TYUA 1CG9B 4BQ5A 4PRPE 1T6WA 3F58L 3PGCB 2OJZL 1OSPH 4X6DB 5F7LB 3HFML 3S4SB 4ZD3L 3VFVB 2CDEA 4BQ8A 4QGTA 2PW1A 5D71L 5CINH 2DQUH 4W68A 2XKSA 3VXPB 2HKFH 2X10A 5HPOA 1G9NC 2VXUL 5IFAH 5EBLA 3FO0H 4KMQA 2R9HC 4JGUA 4PLKC 2K7QA 1NCCL 1U8JB 2HP4A 4QF1B 5I1CH 5FCUL 4NOBA 2FDBP 3CX5J 5EC2A 1RPQA 4X9BA 2Z9TA 5FDWB 3OR7A 3PP3K 3VGAB 2VZOA 2BMKA 5F96L 4XCCL 1Q1JH 1K4DA 2QHRH 1S9YA 2OSLB 3P9MA 4TVPL 3QIBB 5LCVL 3SKJL 3QZWG 4OCLC 4Q97A 2C1PA 2E27L 5F7YC 2P48B 4NZTL 2EDOA 3E0GA 1EAJA 1YPZF 5HSFA 3BN9C 4QY8B 1A6PA 1UYWL 5C0EB 4LMQI 4G8GD 1HH6B 1IZKA 3HMWH 1JHTB 1BQHG 2CKBH 4AZ8A 1JGUL 3KPOA 2ZOKB 4GW1A 1IM9D 4YHPA 5L2KB 1BFVL 32C2B 5AWNL 4O58H 1XIWA 3H0TB 4MJIE 3U36A 3TBWB 1MCPL 3GRWA 3NTCH 3OX8A 3QRGL 2JIXD 2AP2A 3V95A 1V7NL 1JYVA 5GGVL 2VDMH 4GQPH 4UOW1 5T1KD 4CU7A 1TQCB 3P2TA 3I75B 2X09A 4RDQF 4LKCB 5DD1L 2AW2A 1P84J 4I3SL 3V0WL 4NM4L 1I7RA 5C07B 4JHAL 5H37G 4G8GB 2WUBL 1IM9B 1N5AA 1BQUA 1KIPB 5E70A 1I8KB 4WI3A 1CD1A 4Y5XC 1J8HD 3VFGH 1A6TB 3Q5OA 4MB5A 4UQ3A 1PGRB 2JIXB 4PJXE 1DANT 3MRGB 2GTZA 5DHVA 3FB6A 3L5XL 5GHWH 1IC5L 5L2JA 5EZLA 5DC9B 5I1KL 3ARWA 3BD3A 3G5VB 4GW4B 3TN0C 5GIRA 4L4TE 5E4EC 3DECA 3ZDZE 5CD5D 5IVXA 3MMEB 4CW1A 5IJKC 4H1LA 2P5EA 1N0XL 5HI3D 3CLFL 4X9FA 3U4BL 1AGFA 2CQVA 3AREC 1P7HL 5J12C 1DN2A 4JO2L 4XVTL 1IGTA 4LPVA 4YDLB 1IEAB 2VJXA 1AP2B 35C8L 4JRWA 4MD0A 1RZJC 3O9WB 2Q7NA 5JIKA 3J8F7 3D39E 4LF3B 4PUBH 1GGIH 1MFCL 2WIIB 4RISL 2VE6B 4MXVF 1LO5B 1HILB 1J5OL 1MHEA 2ZCHL 2QEJA 4IRJD 3P0YH 3DXAA 4NFDA 4JY4B 1UH2A 4OZFA 4R96A 4UILL 2V5YA 3L1OL 1BVKA 3TZVB 4P9HH 5C08B 4N0YL 5DFVC 3RX8A 5BOPA 4AENA 5C2BH 1RUKL 2OP4H 3VFWA 3WN5B 3NPZB 4YLQT 5TDPB 8CGTA 5I75C 1NPUA 2CKNA 2VZ3A 3BEVA 1CLOL 3WDJA 3I02B 3ZDXE 1Z5LB 2FATL 3MCKB 2CMRH 5DC0A 1P4IL 3HI5H 3WS3B 3K8MA 3VCLB 3EDEA 1M7DA 4LDLB 4GUPA 5C0JA 3P4NA 1CXFA 1E4WH 1RZ8B 4BJLA 5ID0B 3IDXL 1U9KA 2Y36L 2VKXA 3H2WA 3T1FA 4OZHB 5MI0C 4GG8B 4O2CA 1CR9L 5E8DH 1S5IH 1LEIA 2R2BA 2Z8WC 4MD5A 2YUVA 5I1JH 1WZ1H 3TYGL 3VXUE 2OM5A 1AC0A 5C6TH 5BQ7A 3P77B 1AQDA 5EU6D 3MNWA 1YJDC 2C3WA 4WWKD 4FNLL 4NQED 2B8OT 5IHUL 4Z8FL 3N1MC 2XZAH 1PY9A 5DJDA 2YD7A 4QRPB 5JHDA 4LCWD 3RIFK 1VCAA 3P11H 2PR4L 3V4PH 1T1ZB 2HLAA 4KRPD 3CIQA 1ZT4B 4LJHA 3BP7A 5B4MC 3GNMH 2X40A 3VMPA 2I25N 3JSSA 2X1XR 3MJ8A 4K23H 4PJBB 3OV6A 3CK0L 5EU6B 4POZD 1QR1A 5I71B 1JTPA 3RWJB 1ITCA 5GGUB 2R2EA 1OB1B 2NXZD 4LEXL 1AE6L 1WAAF 1NC2A 3AFLA 4DAGL 2N7AA 4I18C 4LCWB 3GFUA 5F6HI 4YXLL 4GAFB 4XPFL 2HVJB 3QXWA 2JJWA 2B5IC 4POUB 1CDUA 1CFQA 4P5KA 5KW9H 2YN3A 4ELKB 3EO1B 5KZCD 3MRMB 1A7RL 4TTDC 2NY6B 2XWBB 4ZUVB 2Y9RT 3QO1B 1PJ9A 3JV6A 3CSGA 5D96B 3KYMA 4CP9A 3ARFB 4NQXB 5D2LE 2AJUL 1NFDF 1FL3B 3P4OB 1XGRB 1OGTA 5HHOB 4DJMA 5KVDH 3MYZA 3QHTC 4HIXH 4PV9A 3S37X 4ZOAA 4C56B 3MXVH 1CDJA 3V4VL 2FX8L 4PRHD 3HMXH 4EOWH 3BZDA 4ERSL 3RVXD 4R90L 1J0JA 3MRNB 4LVNC 3UTPD 5CJ8A 1HYSC 2OTUA 3DO7B 1JHLL 3TT1L 5CILH 1FZJB 1QQDA 2G5BA 1P53A 3D3VD 3MRBA 1Q0XH 4ODSL 5KZCB 3WNLA 3D0LB 2FX9H 4L3ED 5GJSL 4UINL 2OI9B 1HHJA 5KS9F 3FT2A 4HJ0C 4XVUC 1FPTL 4IJ3B 5D1XB 2W07A 1A3LL 2KZWA 4ZFFB 4ODXB 4PREB 5DEGB 4F7TA 4ALAL 5C07E 4IOSD 4I5BB 4KU1A 1RIVH 5KJRH 3OXRA 4PRHB 4Y5YB 2WINB 2NY7L 2Y72A 3V6BR 4X7SH 2NZIA 5DDHB 1VADB 4YGAB 1BBJB 2XTJE 4L3CA 3SKMB 3T4YB 1LEGA 5HHXL 4G42A 2X2YA 4JM4L 4Y89A 3S97C 4ELMB 3W39A 4HJJL 4HKXA 3W9DB 2ITCA 1CYGA 4S1RH 4MJIA 3T2NH 2A73A 4JFZH 2F58L 4L3EB 4HPYL 1LNUA 3ZYOA 1B0RA 3B8SA 4U6HA 4F33A 2ICWB 3FRUA 1PZ5A 2XA8H 4GXVL 4EN3D 4JKWA 5J6HA 4FTVD 3QDHA 3C9NA 3UPCA 4BZ2L 4MYWB 1PKQE 4R8WL 2YXMA 4XNQB 5IBUG 4X4ME 2VABA 4K94C 1F3DJ 3SCMC 3IDGB 1RUQL 4OKVA 1NCWL 2DAVA 2NXYC 1GGBH 1OAXL 2VDRL 1OP5K 3JWOL 1JL8A 3NIGE 4D0DA 5FKPA 4KMTH 1RK1A 5FF6A 3NFPB 3P4MA 5FYJH 4EN3B 1EX0A 1W0VA 1MJUL 2W60B 2WP3O 4WO4C 4KFZC 5ID1A 3ARYA 3MV8D 2F54D 2YPVL 1YYML 2IQAB 2AKRB 4L4TA 1PG7X 4OAWA 1DBAL 3PGFH 5EPMB 3ZYFA 4Z95H 4JDZB 3K1DA 3EYQC 5SWSE 2DF3A 2RFXB 4OZIF 4GKNB 1I3RA 2ZG3A 2D4DA 2OS7A 3K4DA 4NQVA 4DZBA 1IILE 2A6JA 2GYSA 4NZRH 3GJFK 1WV7T 1BJ1H 3OTTA 2BVUA 3KHOA 5ACZA 3LPWA 4JZJA 4PRID 4S1QL 4BQBA 3HI1A 4NCC1 1W8UA 3MV8B 1BX2A 1MHHA 4ONHB 4OZHE 5FYKH 1V7ML 5FUZL 4QT5A 1T0MB 2JELH 4FFYL 4NKIH 1IJ9A 4FXKA 3TJEH 5BZWA 1UZ8A 2V2XB 1WZMA 3FFCE 4FZEL 2QR0B 1HN1A 3CVHH 3WIFA 5K9JL 1YNKL 1DEEB 4X9GA 4X5XA 4ZAKC 1UOJA 1ZMYA 1E28B 1LO4H 3EJJX 2NTFB 2Z92A 4ORGB 4YBLC 3BPNB 4GW5B 1JPGB 3KNBB 3TM6A 5C0GB 1ZXQA 3X11A 4WHDA 5T1LB 3NA4A 4PRBA 2FSEA 3HZYA 1FC1A 1FIEA 3EFDH 1ORSB 3C6LD 4N0UB 3SHSA 3OJDA 5IBTH 4YE4L 4UNTA 4MA1B 4JM2C 4Y5XA 1I1AB 1JWSB 4OLZH 1CDGA 5F70A 4GG6B 3TV3H 3KPSD 3VXUA 4M00A 3AAZA 4TNWF 3X12B 4OCNC 1OLZA 5JXAL 1GZQA 4M7KH 4L8DA 4G9FB 3ULUE 2F15A 4ZOBA 3RI5F 4AL8L 4OFDA 3FQUA 3TN0A 1HXYA 4H26A 1YNLL 4LEOA 3E6FA 5FGBC 1M7XA 2AJSH 4N1EA 3MRPB 3U0WH 1C7TA 5IJKA 4OSUL 2D3VA 3VDCA 2D7QA 3GJEB 4TULH 4AQ1B 1ZHNA 2VLKB 4XB7A 1D5BB 2DQTL 3KPSB 4ORZC 5LKNA 4LSVH 5HGAB 3H3KA 4ZFGL 1KEGH 2I60H 3L3JB 2AEPH 1P7QD 1RZFL 4C56E 5HGGS 1FDLL 3DVGA 4KDWA 3U2SA 2EYTA 4JHBA 3VG9C 5LJYH 1S9WB 3CPLB 3QUXC 3DURB 5F88B 3LY6A 2DOCA 3U7YH 1U8QB 5T1MA 4KZDL 3L3DB 4NP4L 3LZFH 5C0DB 1WBXB 43CAA 5JO5A 1MUJA 4HLZH 1G6RL 2BNRA 3WNKA 5TF1H 1EH9A 4Q58C 3QUKA 5D2LA 1FBIL 4NKDA 1JF6A 4TSAL 4GAJL 3S36L 1TFHA 3SQOL 5E24E 2BDNH 1DL7H 4M1GL 2VLJA 1ODAA 4U1IA 5LVEA 5F7NC 3C09C 4G6AC 3X3FL 5AYUH 3BSZL 5E6IC 1J10A 2W0KA 2ZKHH 3PWPB 4FXLA 4JN1L 4P59H 4ETQA 5DVKA 1R3LA 3IKCA 4FQ2H 4H0HB 3UJJH 3V52L 4LLUB 5I1LA 1MH5B 3RGVB 5CWSB 5DT1L 2VITB 4S0SD 4K8RL 2AS5M 4RGOL 2A6DA 1EUTA 5IKCB 4OD2A 3WUWB 1XIWD 2NW2B 3WFBH 1CXHA 3O6LL 3BOVA 1FVEB 1TJHH 2DLGA 2HTLC 2J5LB 1SHMA 4WW2F 3SDAB 2A6IA 2WSKA 1AD9A 1U8OA 5AUMA 1Z3GL 2Z8SA 2GSIB 4WUKL 1WUNT 3ZSTA 3NGBC 5D1QC 3NCMA 1U8NB 4ZO8A 3K2MC 3ZDYF 2CO7B 2FEEL 5CJBA 1M7IA 3LPFA 4J3TA 4PGDA 1YEJH 1CIDA 1IAKA 1ZHLA 3U36B 3UEZA 4QOKB 1G7HB 1QPXA 1CT8B 4O51A 4QCIA 3QWQB 4GKZA 4FA8A 4X4MA 3GHEH 2DJ4A 2EDQA 3G04A 5DK0B 3ZKSD 1M1SA 5DSCB 5F7EL 1I9IL 4P4RA 4BFEA 5E7BA 4WWID 1K8IA 3NVQA 4Q9QH 3GZKA 1IC7H 2CLRA 3HZKB 4DVBA 4X4YA 2AJZB 5IV2A 4JPWH 5SWQA 1KPUA 5D4QA 5CEZE 4XAKE 1WBYA 3QNZB 5INCB 4XBEL 3BP6A 1MIMH 1MJJA 1X5IA 2P5ED 4OCWL 5FHAL 3I6KA 5D7LE 4XNUH 1SEQH 2H1PH 2YUXA 5DMKB 4L8BA 1T83C 4IS6A 4HF5H 3NPSB 3PGDA 1BM3H 2OZ4L 5JMOC 1W9FA 3GO1L 4N8VA 4UQ3B 3FFDB 5DMYA 5JOPE 5L2JB 1P6FA 5EZLB 3UPAA 2XIDA 4HMDA 4KRMB 4QRUA 2LRPA 1KN2L 2VUOA 3O2VH 4JFEE 2YKLH 2K46A 5GIRB 5JUEL 1CBVH 3DXAD 1MRCH 4RFEA 2A0LC 4UB0L 1EA9C 1KEML 2XZQL 3LD8C 4KI5D 1X5YA 3C08H 1QEWA 1HKLL 4M1DL 3GKWH 3DRQA 4AH2B 2Q8AH 1HIMH 4X6CB 4MD0B 5A3ID 5DQDL 3FQTB 1HWHB 1JHKL 5FHBL 1CU4L 5D2NC 3GMMA 3WUZA 1LVEA 4KK9C 1FGVL 3FFCA 3C8HA 1E4XH 2XG5A 3KYOB 2P8LB 2ADFH 5KOMC 1CLYH 4G9FE 2IC2A 1MHEB 3CDGB 2NY0C 3JV4B 4G5ZL 4OZFB 2EDNA 1U93A 4O4YH 4R96B 4M6OL 3BO8B 4J23A 2LVEA 4JHWH 4FHBD 1RIUH 4L8SB 3TLRA 3BRGC 1HHGB 1KJ2L 4AENB 4AG4L 1I1CA 4R4NC 4YC2C 1NLDL 5GZND 3RIFF 3SCMA 1IKFL 2GJZB 4WFED 2C3VB 4GH7B 1C5BL 2NY1C 3FOMB 5FB8B 1IEBA 4HQQL 1CQYA 1WEJH 1FO0L 3MNZA 1CGUA 5FV2A 5FECA 5JHDD 4IDJH 2XN9A 5C0JB 1FE8H 5I19L 3OJ2C 3CUPB 3LIZL 3TESA 1P1ZA 4MB3A 5HYQB 3KR3H 3BT2H 5K93A 1RZGB 3FQNA 3NCJH 4O2CB 4H8WL 1PBYA 1MVUB 5F3BB 4WO4A 1OAZL 2VC2L 4OGZA 5DUMH 4JDTH 4Y4FB 2A9MH 1XGYH 1U92A 2E9JA 2ADJA 4X0KA 4CU6A 4YPGA 5FA4B 3MNWB 3RWHA 1YEHH 2F19H 3E6HA 1Q9LB 2DDQH 1AIFB 4X80L 5EUKA 4YHZH 5HDBE 3UJTL 1KPRA 1HHIB 1RMFL 1RVFH 3FCTA 1NC2D 4HGWA 1DQQA 3Q1SH 3QH3A 5JHDB 4UBDD 3D2UA 4P5MA 4KJPC 4UT9L 1X5AA 2CPCA 2XWTA 4NQCE 1JPSH 4CNIA 2Z31C 5INDA 3MLWL 1UC6A 4CKVX 4N8CL 4YXHH 4R7NA 4QNPE 3GSNA 1H15A 2IFGA 3MJ8B 1K9TA 4N0FB 2YUZA 1RJYB 1ROWA 3B2VH 4PJEF 4G7VH 5HYJE 3PWPE 5KTEL 4Z7UA 1A1OB 1QSZA 5BOZG 1W8NA 2I27N 3VG0L 4XHQA 2R2EB 4XWOC 5D7SH 3TWCH 4OLXH 3O11A 1EMTH 3BPOB 5KVMC 4BFIB 4ZAKA 2X4OA 3STLA 2X4RB 5E08H 3H42H 1T7YA 1L0QA 5IT2H 1TZHB 3CXDH 2GSGB 4QHKJ 5EZJB 4GKSB 4K3HA 4NKMB 3SKNA 5EUOF 2HT2C 2HJFA 4CVXA 3KDMB 1BFSA 2YBRA 1RUML 1XEDA 1AR1C 1Q72L 1RZIA 3DX6A 4KJYA 5ALBL 2JLLA 2EH7H 5ICYA 3LKOA 4WNQA 1G7IA 3B9AA 4HIIB 2OK0H 5BXFB 2FO4B 1JIBA 5DZLA 3NCCB 5DMGC 4PV9B 4JM2A 4R7DA 1NUGA 3MUY1 5B38B 3KJ4B 5C0BE 1MVFA 3P30L 1R6VA 2FR4B 5C0IB 4YZFE 1N26A 1HHKA 1TLKA 3S3PA 3QEHA 1CGVA 1JGLL 4QOKE 1HZHL 3VW3L 1RIHH 4PJGE 4XCFL 4J12A 1WGOA 1TVHB 1NKRA 2DMCA 4MJID 2VMFA 3GMOA 3BKMH 3A6CL 2EDJA 4R0LC 2IGFH 3DVFA 3O45B 3WLBA 5FGBA 3FT2B 4G8IA 2JK5A 1ZGLA 1U8PA 2AJVL 4NCDA 3QUML 4ENED 2Q87A 2BSED 4TSCH 1J1PH 3RVTC 5EOQL 1HINH 3FQRA 4NNPL 5F1NA 3LDBB 4MNHA 1HH9A 3I3EA 1UZ6E 1XR8B 3QJHB 5C2UB 3VMNA 2BY1A 1BD2A 2GW5A 5IBLD 2VKWA 4M93C 4Q9BA 4W4OC 3W39B 1QR4A 3ZT5A 1XT5A 2A73B 4L1HA 3SOBL 1CICC 3SGDH 3QUXA 1B0RB 4NRXB 5TPWH 3WHXA 5JW5A 1MCBA 1JE6A 1F4XL 1MPAH 1X5HA 3IAPA 4Q6YA 4U6HB 3OXSA 3T1WA 1C08A 2D7OA 3KJ6H 2I5YH 5J6HB 2BHUA 2MCPH 3EO9H 5A43C 3FO2B 3GK8H 5E6ZA 5T3XE 1CGTA 2QBWA 1GJIA 5L0QB 4L4TD 1Y18A 4QEGA 3ZZ1A 3WMSA 2AI0H 5B39A 4XAWH 2D7TL 2NLJA 1NCBH 1QP1A 2R9HD 1RZKH 4PLKD 2QJDA 3MYJA 1TDQA 3LQAL 5CCKH 4GMTH 2ERJC 5D7LA 3ULVF 3GSXB 4X6CE 4S10A 5LBSH 1DSFH 5GGVY 5L6YL 2OYPA 1UWEH 4J3VA 3X3GH 4P48A 4DN3H 1JF1A 2NY2B 2PW2A 2OR8A 2WBJC 4E42A 3QXDB 1MREL 4PFEA 1VSCA 5E6IA 3OR6A 2P43B 3O0RH 2FD6H 5CJOH 3HRZB 2NTSP 5ID1B 3KPLA 5JW3L 5D7JC 3SO3C 3K2UH 2ICES 3RA7L 1FNSL 4Z7WE 1TVBA 3BN9D 1NGPH 3CH1A 3MRDB 1AGEB 3QXUA 3G5XA 4XZUB 5F9WC 2E7CA 4G6KH 5BV7L 1AHWB 4FG6C 3KPMB 3TPUB 1I3RB 2VL4A 1MNUH 1K8DB 3LQAC 5TDNB 3H9SB 3ILPB 3U0PA 2BVOA 3VGGA 4YO0B 3HKFA 5ACZB 3E2HC 2EC9T 3MFFA 4M8QB 3NAAL 1BPVA 1GIGH 4LFHG 3SPVA 1U58B 4FQJH 3PJSA 3DLQR 4LVHC 1NL0H 1EHLL 2JCCF 4FQCL 5D1QA 1VFOA 2A9NL 4FXKB 4GRWH 4UUJB 5AAWA 1UZ8B 1NBQA 4JZOA 3UO1L 2MQCA 5DI8B 4ODHL 5JMRA 1MCRA 4GBXB 4BFBD 2VR9A 1FZKA 4IDLA 3VXUD 1UA6L 5IF0A 1H8OA 2B0SL 5E2WH 1WZXA 5D9SB 1V3JA 4MZ3A 4YEEA 5DMIH 1SBBA 4KQ3H 4NNYB 3BWAB 3MGTB 1CGYA 2IBGA 5E5RB 3QHFH 1IT9L 1U8KA 4B53A 2HVKB 4DVRH 4XCYA 2IH3B 3D0VA 4Q7DA 4PRBB 2I9LB 1GHFL 4OQTA 4OCXH 4Y5XB 3KPRA 4NO2A 2HKHH 3RWIB 1T83A 4DKEL 5F9OH 4TQEL 4JPVH 1E6OH 3ARED 4X5WA 4MXQD 4K3JL 1A2YA 1BF8A 2H6PA 5C0FA 3BN3B 1L6ZA 3AMKA 4OKDA 2HT4C 5MP6L 1DQLL 1CL7H 1Q1JL 5JIPA 4OZGA 4UU9B 3VWJB 4NT6A 1S7WB 3RUGA 1RZ7L 3OHXB 5E4EB 4HUXA 3BXNB 1NAMA 3DUUB 2XYCA 4LMQE 5IMLB 1I1RA 2CJUL 3CLEH 2XFXB 4P5TC 2CKBL 3NIFE 1EK3A 4PYHA 4YW7A 2FJFA 1FJ1B 1HQRA 3L7EB 1PYWA 1UWXH 3BJLA 1JRHI 4O58L 4WTZA 4M5YH 3AREB 3T8XA 2ZJSL 5J12B 3GM8A 2BNRD 1ONQB 5HYJA 5IGXL 2EXYC 4NCC2 3DRTB 1Q0YL 3ZKNC 5MEPA 2VLRA 5D2NA 2BSTB 2ED7A 2DM2A 2HH0L 4JG0L 4XCEB 1CQKA 3VGEA 2G9HB 2VLJD 4KXZI 4OLUL 1GPOH 2AV1A 1KXTB 2Q1FA 3BH8B 2YA1A 2PO6B 3T0EC 4RA3A 1IL1A 4P23C 2OL3A 5I1AB 2FCBA 1TQBB 1T0NA 4TTGA 4ONGH 5DRXB 4JG1H 4G6FB 5JO5B 4NGHL 1MUJB 1DBJH 1LP9B 3HUJF 3QUKB 3FQWA 1CFSB 4NM8H 1QA9A 1HHHA 4OGXL 3R0NA 1OGAA 5BVPL 3SDDC 1KNOA 1A5FL 3BZFA 4HDIB 4I4WA 1FNHA 2VLJB 4HKBB 1HSAB 4M62H 1XFPA 1X5ZA 5EU3A 1ZT1A 1L9NA 1LDPH 2E3VA 4UAOC 3S9DB 3PG2A 5CBAB 3ESVF 1K85A 4NC0B 5DQJA 3RL1A 5J4MA 5MEQA 2GI7A 5B4MD 3T08A 2R4SH 2VQ1A 3ESUF 3PL6B 4PJ9C 5EC1A 2VH5H 1IAIM 3QULB 4RFOH 1YY8A 5GGTA 1JVKA 4LKXB 3LKRA 3IFOB 1J0HA 4P2RE 2NX5A 4ONFH 5EB9A 3KXFE 3DHJA 4OD2B 1GC1H 4OD3L 3STZB 4H88H 1G7PA 5GRWA 4XPBH 1LILA 4MDJA 1NGYB 2PF6A 2WP3T 4QTIH 2AABH 2QQLH 5JZ7C 1MQ8A 2O93L 4HD9A 2Z31A 4NQSA 1INQA 4ODVL 5TQ2H 3U46B 3PE9A 2BOCA 4TTDD 5IW6B 3OF6A 1GAFL 5D7KD 3FO9B 1W8WA 3UZVB 3W9EB 3ZTNL 5DS8B 4KV5F 1X5JA 1CGXA 3NCYP 1BAFL 1MRFL 4PGDB 1U42A 3MRCB 4YQXL 1RJLB 1D6EA 1C5DA 1CGSL 4K2UL 3TFKC 2DQEL 3UTOA 4I18B 4PTTA 1KACB 2R0ZH 1TVDA 5TE7L 1LWRA 2ATKA 4U6TA 1PLGL 1HYSD 3T0EE 2PCPA 5ILTH 2GCYB 3TBYB 3VXMB 3U7WH 4D9QD 4X4YB 3X13B 1WZ1L 2B4CH 2P45B 1A9BA 1JK8A 1IZJA 3M17B 2YPLE 4Z7QF 5I17B 1WBYB 1YPZE 4HJ0D 4XVUD 1A6UL 1MCSA 3BP6B 3FOLA 1MJJB 4M9OA 4MX7A 4I0CC 4IOIB 5AZEH 2X70A 4KHXL 4YW6A 1S3KL 3O3EA 2AERT 2VDOL 1YEEL 1UCTA 4XNZC 1A14H 4Z7WA 3TBSB 4PGBA 2AJYL 2FHBA 3DSFL 5ADOL 3V4PL 4E0RB 2CLZB 4LVNB 1BIIB 3BHBA 3S5LA 1JI2A 1MAKA 5F6IB 3FFCD 2QSQA 4OLYL 3OSKA 4X98A 5I73C 4JZNB 4AJ0A 3PV6A 4P4KA 4XT1C 3MLSH 1JNNH 4R0LA 1BZ7A 1HQ4B 1NGXA 3BIKA 3DO3A 3VJ6A 1FSKB 1KCUL 1KTRL 2YD2A 3BPCA 5ISZE 1F90H 3Q6GL 3SKUD 1QEWB 1IAOB 4X6FB 4JFQB 5F9JA 4TVPE 4NRYB 5B22A 1GXEA 1NFIB 4MJ2A 2Q3ZA 2DIJA 1NJ9A 4OLWL 3MLYH 1HEZA 3B9KB 3SCMD 4EUPG 1MCOH 4UIMB 4UTBH 3BW9A 3GMMB 1XZ0B 3CSYA 4W4OA 3EO0B 1ORQB 4D9RD 5J1SC 1OM3L 1CICA 2XN9D 4XP1L 2QKIA 2APWA 1HI6B 3VRJA 4RGMB 4PD4J 4M7LH 3GI9L 5D7IB 5KVDL 2J4WL 4Q6IC 1VFBA 2JB5H 2UWEB 3Q0HA 4HIXL 4WO4D 1ADQA 2A1WH 4WEUD 1YEIL 1QFWH 3IFNH 2BY2A 1PQZB 1WTLA 5D93B 4M7JL 1GL4B 1P5VA 3EYQD 3O41B 2DIBA 4X7FC 1Q0XL 3KLAA 5AEAA 3IDUA 3THML 3EYSL 3HI6H 5I8CB 1ES0B 1FL5B 3VFNA 4MXVE 4BH7A 1KFAH 5DRNB 3D2UD 3CFDA 2FBOJ 1C16A 2FJHB 5IB4B 2WBJA 1T04B 3DYPA 3MC0A 5GQBA 1WQVT 3KLSA 4WRLA 1BQLL 3MACL 1MIEL 3FAXA 4A6SA 5D7JA 1GOGA 2BVQA 2OBGA 4J8RA 4X0KB 1TPXB 3L7FA 5DYOA 1V8HA 3AS0A 1T5XB 4M48H 4CDGC 3UTTE 1VKXA 3H9HB 4CPBA 1IRAY 4X9HA 5FM5M 5FO7A 3FCTB 3DPBA 1CFVH 5H2BA 4XP4L 1QFOA 3RAJH 2Z91B 3GRWH 4ZAKD 3D69B 3VGHA 1IGYB 4MA3B 5A2KH 3HNSH 2XA8L 2W65B 4HCRA 4CNIB 3WDHA 4UI2A 5HHQA 4MXWL 4XP5H 4W70A 4Z7UB 2C4FU 4PIRF 2F53E 2X4QA 4JB9H 4M43H 2Z0BA 5F1IB 1OAKL 3GSWA 5KVGL 5EO0B 2EYRB 4GMSH 3TVMC 3IVKA 4TUJA 4ZAKB 2A77L 4ZUSA 4TVSa 1INEL 1DVFD 5CZVH 5FYJL 1XGPA 3SKNB 4FQQB 3MUZ1 4D0CB 3VFPB 3UBXB 5HYFA 1SJVA 3OKLB 1KGCE 5IW3A 5I1HH 5CFHA 5EA0H 2BOBA 4WNQB 5GGSA 3GSQB 3SDXB 4JVPA 1R3KA 2EIZA 4WFFD 1T7XA 5MEOB 5AZ2L 1W8ZA 1L9MA 4MJ6A 1WAAE 5DQ9B 1LD9B 2J1KA 4FFZL 5KN5A 4OZ4A 5ADPH 2AXFA 1DVFB 4UNUA 1BD2D 2R2HB 4P2RA 3UROR 3KXFA 1PSKL 1EVTC 2Q8BH 5IMOA 3GMOB 4P99A 4CDHA 4LGRB 4HIHB 3QUXD 3S96B 2AJ3B 4U0RB 4G6JH 1G6VK 2YK1H 2JELL 3RWCB 3VXME 5C09B 5BO1H 4OZFH 4P5TA 4Z5RA 1NFDE 4WTXA 1A6ZB 4FQLH 1QRNE 4WI7A 3B6SB 1MCKA 4H0IA 2W9EH 3ARGC 5F1NB 4MNHB 1HH9B 5KSBB 5CEZD 2IBZY 2RCSL 2EEDA 4NN5C 2YPKA 4PR5A 1U8HA 2YSSA 3CFEB 2XA3A 3FRPG 1KJ3H 1A9EA 1KG0B 5IEKB 5JW5B 1HSBA 3MRKA 4WTWA 1KIQB 3VDAA 5HDOA 1C08B 3T0EA 3EFDL 4P23A 5E6ID 3EGSA 3KPTA 3CZJA 4HG4J 1AGCA 2R29H 5EU7E 3TV3L 4M61B 5ELIA 3IXAA 3FKUS 2YPLA 2Q6WA 3NFSL 1YPZA 2FGZA 3QISA 3BISA 3AGVA 3BUTA 4WHYH 3VGFA 4NKQB 2XKUA 3OBAA 2D31B 4XBGA 5J11C 1FG2B 1I7UB 2MMXA 5EOCL 1TXKA 1J05A 2X4TB 3C09B 4U6YA 1CK0H 3INUL 4M6NH 1O7VA 2HTLD 4HIEA 5IOPA 2O5XH 3PP4H 4CADB 5J9PA 3OR6B 5C0AA 4XPHH 1R3IH 3U0WL 1NCAH 4WCYL 3GSOB 4LLWA 3EYUH 5D7IE 4MAYC 4U1GB 1CDHA 2CR6A 5D72H 1E4JA 3EUUA 3CH1B 5D1QD 4WEBH 5HDQH 2GITB 1S9VA 3V0VA 5ICXB 5ISZA 3ZKXC 2RIKA 5JIHA 4HKZB 2EYSB 1AY1H 1G6RB 3OKKA 4NJAH 5JPNA 4LLMB 4K7PL 3I6LE 1QSEB 4O2EB 4Y4HD 3CFIC 4BQ3A 2W0LA 4NFBA 1VACA 3BKJH 4DK6A 3CX5K 2NZ9C 2XZZA 2VLLA 3U7YL 5BRZA 3VXRE 1H3GA 2YWYA 2YD1A 4JRYB 4LHUA 3PJSB 1GZPA 1QBLL 5GRJL 5T3ZE 3KYNA 4A6YA 3MUJA 5GISL 1UQSB 1JGVH 4G43B 4BH8A 3HC3L 2PYFB 1JNLH 5CLTA 2JWPA 1WISA 4GQ9H 2IANA 2ZNWA 1GGCL 4UZGA 3DMMD 2VSDA 3MLXH 3WIHH 3EYOB 3KPRD 3RWDB 4IRZL 3OKEA 2FYYA 3QUZC 3WD5H 1FZKB 3RY6C 4NKOA 1GOFA 4Y4HB 5ITFA 4YDKH 4OZIE 3O6KL 3OAUH 4RMUA 4HGMA 2UYLA 5FCSH 3K7UA 5BVJA 5EORH 5DJ0B 2ESVB 3O3BA 3W81A 1L7IH 1NKOA 4P9MH 4JREC 1AO7A 5C9JB 4P59L 3DVNA 2P8PB 1P84K 3RVVC 3UJJL 2YC1A 4JO4H 1I75A 1OAQH 2A0LD 3MRLA 4XVJH 4XMKL 3RRQA 2VOTA 1W0YT 1MFEL 3DMMB 4NRZB 3AB0C 4FQIL 4XPGL 1FNEA 3MUGB 5HHPA 3LRHA 4RAUA 1KIRB 2O5YH 3BAEH 4LPXA 2IJ0C 3LN5A 3UTSE 4NHCL 4PS4H 3QZWA 2AV7A 3HC4H 4WU5B 3D85A 3DYMA 2VLRD 1AKJB 2C7UA 2UV3A 1U0QA 4OZGB 4DTGL 5TQ0H 1BQHA 4NT6B 2J8UF 4E9LA 2V2WB 2NY0D 1J86A 5HGDA 1MRDH 3QP3A 3TBVA 3IF1A 5D5MF 5AD0B 5HI4C 1T2XA 1G1YA 1S7UB 5C0CE 1QLRA 3WO4C 1D7FA 1IGIL 4U6VL 4LVOC 1FP5A 1YEJL 3TH4T 5L88L 3F7YB 5FA3A 5DJ8A 2Z4QA 1NUNB 4U1MA 5L8JB 3SE9L 3DUSB 1HKFA 3GSRA 4R4ND 4X4XB 4IBLT 3SDXE 1BOGA 4DEPB 4ODWB 4H0GA 1EAPB 2F53A 4N1HB 1OGAD 2NY1D 1ZLVH 1X5GA 1BHGA 2NY5H 4Q9QL 4PJXF 1XH3B 5E56A 2H32A 3S4SG 4JPWL 1LQSR 5SV3A 2W9DL 5E8OB 1J87A 1IL1B 4K55A 4LLDA 3ZLQC 3LEVH 5IMKA 5CLWA 3WEXA 1R5IA 4MA8L 3ZDZF 4Q6IA 5A16A 2RR3A 3S35L 1ITBB 3MBEB 2R1XB 5GGRA 1G9NH 3L3OA 4Q9RL 2QSTA 2DD8L 4WU7A 1HHHB 4XP9L 3HPLA 4QHMB 2NX5D 3H7LA 5EFIB 1ZLSL 3QDJE 5EWIH 4M9PA 3RHWF 5GRVL 3BIAX 3N1QC 4PJAB 4Y2DC 5IIEB 1WAAA 1ZT1B 2OTWA 3DX8A 4PGEB 3VWKB 4KJPD 1UWGH 4B50A 2B1AH 1CLZL 3QDGA 3LMJL 3F58H 4JY6A 2OJZH 1AC6A 3JUZA 1TZIB 2VZTA 3GKWL 3HFMH 5EOTA 4ZD3H 4F37K 4P46C 3OF6D 5FIEA 3LEXA 3S6CA 5HYSB 3CDCA 3QEGL 1IGCH 4NWTL 4KRLB 1I8LC 1KJ2B 4S1DC 4H5SB 3MRJA 4XWOD 3RDTB 4I0PB 3PHQA 1NFDA 1E4XL 3U0TB 2VXUH 1WIPA 3HZMA 4EI5B 3VXTB 4EVNB 1G7PB 3PWNB 2J6EL 2ADFL 3RQ3A 4UDUB 1MQKL 1TNNA 3RNQA 2X1OA 4LSQL 4MDJB 2A74A 1NCCH 3RWGA 3MLVL 4KY1H 1FO0B 1G1CA 4X6BA 4F9LC 2PUQT 5D8JL 5FCUH 3U48A 5HI5C 1JZ3A 1VFAA 2HT2D 2YD9A 4L4VD 5C9KA 3MXWL 4KUZL 5F96H 4XCCH 4OV6F 3SKJH 2F74B 2G60H 1S7SB 5KS9A 2E27H 2RB8A 4NZTH 3GIVA 4G80A 5DMGD 3W11C 3T65B 3NBNA 4O9HL 1UYWH 3VXNB 1K4CB 1KPVA 3TVMA 2ZUQB 1JGUH 1OWRM 1YN7A 1MHCB 2OXGA 3CMOL 3DI2B 1BFVH 3PWUA 4QO1A 3VFUB 5AWNH 1QSEE 5DJYB 3VXSD 5C6PB 2R69L 1XF3A 5CHNA 1MCPH 4EJ1C 4AY0A 3H9YA 3B5TA 3PWVA 3OGCB 4JDTL 4L4VB 2V17L 3QRGH 2EKSA 1JK8B 1JZ8A 1V7NH 4X6DF 2Q7YA 1A7OL 1IAIL 4GLRH 2DWDB 2QSCL 5DD1H 3ZDYE 4I3SH 1ZWIB 4IOFC 3O3EB 2IEPA 4NM4H 4OGYL 5FK9B 4YHZL 5C3LD 3RVTD 1RVFL 3WHE1 1QHOA 5K9QI 4I3GA 4JHAH 3EIFA 4X99B 2WUBH 4LGSB 5CEXA 3ZYJA 2DYPA 1H3PL 1S7VB 3QUYB 4DOHE 2XQBL 3VXSB 3BHBB 3RTQC 2EE2A 1B0GA 7FABL 2O26U 1Y6MR 4HKJB 3PV6B 5A2IH 1YMMA 2XNAA 3RWEB 1CICD 1T1XA 2ZUUA 1G0YR 1NGXB 3BIKB 4FFVC 5I1KH 3KLDA 1OAUL 4N8VG 4LNVA 1FLRL 4AIXA 3VXRA 1VGKB 3TWCL 3UC0L 3SGEI 5SWZB 3ARGA 3R8BB 1WC7A 4WFGE 4YHLL 2QADC 1N0XH 5IHZA 3CLFH 5GS0C 3W0WE 3U4BH 3A6BH 2ZSVA 3NH7H 3MV11 4JO2H 4XVTH 4Y8AA 5I1GH 35C8H 1CICB 1FN4A 4OZIA 4KVCL 1TJGL 1MY7A 1G7QA 2WBJD 5J89A 1FORL 4RISH 3GBLA 2CDGA 1J5OH 3KS0J 1ZAGA 2MPAL 2ZCHH 1MCLA 5F6HJ 2BC4B 3CXHJ 4UILH 5MHSE 1SJEA 3TH3T 3MROA 3GJFB 3L1OH 1DEDA 4EZMA 3AMLA 4NDMA 4FMKA 4CPBD 1V0AA 1YJDH 2ZSWB 4N0YH 4FG6D 3L95B 3TIEB 1WCUA 3VRIB 5TDOA 4YGVB 1RUKH 1F00I 3BEWA 1BF2A 4MSWA 3UTSA 1CLOH 3BYYA 3DV6B 3FZUC 2ORBH 4RWYL 5K9KA 4FQ1L 4JVUA 1R24B 2FATH 5DXWA 1P4IH 2RQ8A 4HH9A 4TSCL 2BVQB 3SO3B 5DYOB 4YK4B 4MAYA 4EBQH 15C8H 3X14B 1K6QL 4LCUA 1VKXB 5F9WB 1N8ZA 3C6SA 1YMHB 5C0CA 3V5HA 3G6JB 2Z93A 5FO7B 3TYGH 1RHHA 4Y19A 2CRIA 5H2BB 3T2OA 4XNMA 4JQVC 4D94A 3ARUA 5ETUB 4X6EB 1XCQB 4FNLH 2HN7B 4YDVA 1MPAL 4XNYL 3WNPA 5IHUH 4F2MB 4PJAE 3QQ9C 3NIGF 4UV7L 1I1FB 5HHQB 1KLGA 2VISA 4IIQB 4U6XA 5CGTA 2PR4H 4LVHB 4QHLA 2AI0L 4EKXA 1JRHL 3AU1B 4I2XE 1F4WL 4R4BB 4QHKI 1P9MC 4Z76A 3VE0A 3RZWA 3L6FB 1F6FB 5CCKL 3QUZA 5LBSL 4UT7H 3GSWB 4WJ5B 3RY6A 5E5MA 4Z78B 2FL5A 4KRNA 5H35B 1RJZB 4ZUSB 4AM0B 1JYNA 1I4FB 4LEXH 2MKLC 3O3UN 1U3JA 2HT4D 1IBGL 1AE6H 5TH2A 4DAGH 5IB5A 2GTWA 3DTXA 1WFNA 2WIMA 4PJDB 3DROB 4ZUTA 4XPFH 4P57B 1ZLWH 1OKOA 5GGSB 3MODL 1V3KA 4PJEE 3GKZA 5EU4B 1VB9A 4G6KL 1KCSH 4P5TD 1A7RH 4OZHF 1R3KB 1F6AB 4MDIB 3B5HA 1MNUL 1I1YA 1XF4A 2AJUH 2UZXB 5K9OA 4HK3N 3BVNB 4OZ4B 4XTRC 1JZ5A 1A3QA 2RJMA 3IU3A 5ACMA 3ZKND 3CCHA 3SDYL 5C0ND 2CRMA 3V4VH 1WTGT 1JNHA 3CVIL 1KB5L 1GIGL 2OCFD 1SM3L 1IGML 5ANME 3ULVC 2P8MA 5EUOE 1MLBA 3SE8L 3F95A 1NGZA 1CFTA 1JHLH 3TT1H 5F44A 2EO1A 3CFBA 3T0ED 4PRAB 5GSRA 4P23D 1OT1A 3QEQE 4Z5RB 3SJVB 5GJSH 2V5RA 4UINH 2QSVA 4NQDB 2DJUA 1Z9OA 2DM7A 1FV1A 2YPLD 2V5TA 4PJBF 4ALAH 4RAHA 1S7TA 2YPKB 5F7MC 1INDL 5DMIL 2C3XA 1HDMB 4KQ3L 3QG6A 1U8HB 3SDDD 1WIOA 3WL9A 2OR7A 4PLJC 3MNVB 2X9WA 1DDHB 1A6WH 3ULUF 2DICA 3MRKB 4DVRL 2DJSA 3L3KA 1I7TB 2BY3A 4JM4H 4HJJH 5CJ5A 1U95B 5C0AD 4PP1C 4FFWC 2F58H 3EYFA 4KTYA 3BZEA 4PJ9D 3LRSA 1Q9OA 2CKBB 3IXAB 3V0AC 1I3UA 2ICEA 4GXVH 1H3TA 5SWZE 5ISZD 3DV4B 4F7CB 2R56L 3SDDB 1LO3L 3FN3A 1NDGA 4BZ2H 4R8WH 3N1GC 4XX1E 1FG9C 2DM4A 1BVZA 4Y2DA 4U6YB 1RUQH 2XV6B 4LLYA 1NCWH 2WWKT 3PNWA 4FQHA 5J9PB 5JZ7D 3CLEL 3ARVA 5E5UB 5B39G 3REVA 4LCIL 5BRZD 4MWFA 1OAXH 4MNQB 2VDRH 4UQ2A 3QRFM 3IDIA 3QIWC 5LGJA 5FOBA 4WW1B 4LHUD 2FIKA 4LIQL 1YEKH 2NY3C 5DD6A 4PJ9B 1CD8A 1UM4L 4P46A 3GSNH 2Z35B 4J3OC 4WIQA 1R5VB 1F2QA 2WWMC 4HHAA 1I8LA 1WBZA 1XR9B 2IAND 4ZPVB 2AXGB 1F45A 5DA4A 1CDYA 2P49B 2YA2A 2YPVH 1YYMH 5C7XL 5JPNB 3MREB 3CFCL 1N0LA 4JCLA 1MOEA 3BDXA 2Z8RA 3TFKD 3ORJA 4OM0L 3LKNA 1KT2A 2VQUA 1EGJL 2VXVL 5A1AA 2VLLB 1JI1A 3QA3A 3RBGA 4F9LA 4PJIB 3W0WA 5BRZB 5FO9A 4ELMF 1AO7D 1AD0A 3DGCR 4L8CB 2AXJA 5ESVB 4JG1L 4U4BA 3IJSA 2DQHH 3KYNB 1D5MA 4WY7L 3F6LA 4NC1C 3IB4A 5DJCA 3KPPA 1LHZA 3SGDI 3PDDA 3VH8A 5I18L 1Z9MA 2IANB 4S1QH 1UJ3B 5DHYA 1JN6B 1PG7L 4JDVA 3K81A 2FYYB 2EDFA 5FUZH 4CN4A 1N2RA 4FFYH 3O2DL 4M5ZL 4HIJA 3D85D 2UYLB 4PLNC 4FRWA 3TNNB 3A6OA 3BX7C 4XC1L 1UB6A 4FZEH 5DRZA 2J6EA 1HXMA 3WCYA 2GJ6D 5K9JH 1YNKH 3DGGB 4R4FL 3QAZB 4F7EB 5EU5B 1D5ZB 4YHNA 3ULSB 5J1TC 2HYMA 1JPTL 2JCCE 4YIQA 1REIA 3W5MA 4OF0A 1YYLL 2BCKB 5JW4R 3CFJB 3LN5B 4HK0B 5KSAC 2B1HL 5E94B 3D85B 1EUUA 1QLEL 3EOBA 4YE4H 2AABL 4KH2A 3RTQA 2GJ6B 3SKOA 1P2CB 2ZOLA 3PF2A 4HUMB 5LXGL 4LLVB 5TQ2L 3KVQA 1U91B 1T21A 5JXAH 1W0WA 1MEXL 5IFJA 3PABB 4XCNB 5LG1A 1MFAL 1VENA 1A4KA 2VIRA 3U9PH 3IF1B 1ZLVK 4PJDE 3ZO0A 2EZ0C 3CZFA 5HGBB 2PTTA 5C8JB 1YNLH 3TEUA 4LNRA 1EFXA 1BOGB 1KGCD 3PP3H 1QPPA 4I48B 2VDLL 4OSUH 4XGZA 5IB3A 1OF2B 4OFPA 2DQTH 4PGJA 1MHPL 1SYVB 4ZFGH 3CH8A 1Q94A 3M8OL 1LK3L 3K1KC 2NY4C 2ENSA 3QDGD 5J57B 3GMPA 4JPIA 5AZEL 1R5IB 2ZCKL 1U3ZA 1X5LA 4Q6IB 5A16B 5CBEB 3SY0B 1DQDL 1KULA 4N8PA 3IETA 4JAMA 3SJVE 4PJEA 4KZDH 4NP4H 2H9GB 5EO1A 4UOJA 1TZGL 5IVOA 1DCLA 4Z7OF 5TF0A 3DIFA 3WUWG 4GS7C 1G6RH 4GG6F 4YAQB 4UMGA 4PJ5B 4LLQA 1KC5L 1FBIH 2FB4L 5M7QA 4TSAH 4GAJH 3S36H 2DLHA 3SQOH 1I9RL 1QO3B 4JHZA 5I6XC 4PGCA 25C8L 1KB9J 3RVUC 4HBCL 3X3FH 5EUOA 1KN4H 3BSZH 3RIAF 4Z7VB 4HSQA 1F11A 3PHOB 2DTML 2JB6B 4UTBL 3D48R 2UUDH 1NANH 1CIUA 3QEQA 3UPRA 2ICWI 3PHQB 2BSRA 1A6AB 3T3ME 4ZTOL 5ESQB 3V52H 2K1MA 4V1DA 3RZCD 1H3UA 2HWZL 2ZNXA 4JLRB 3RNQB 1NC4A 5DT1H 3TVMD 5FKAB 1T7ZA 2GIYA 3NCYS 5EO9B 5B8CC 2CXGA 4RGOH 2E7BA 1F8TL 2NNAA 4S2SA 1OH3A 3PWLA 3DSNA 5FYLL 3UYOD 4ZQKA 4PG2C 3O6LH 2XXMB 5F3HA 5LAXB 2X1PA 1NDMA 1U41A 5FGCB 3VFMB 3HE6C 5DJZA 2D9QB 2VDKL 4ZODA 4H25B 4IHOA 1P9MA 1Z3GH 3IS1X 2P5WE 1YZZA 4JFXA 4OQTH 4P49A 3IFPB 4WUKH 4RBPH 4OBSA 3RZCB 5IVZA 1KPVB 1KCKA 3LKQA 1BJMA 2DYPD 1FVCA 1EJOL 3MV9A 2CD0A 1MF2L 1QLFA 2MFNA 4K9EL 3GMNA 4YUEL 4QXTB 3PQYA 3V7AE 1WZLA 1FH5L 4JE4B 4HX1A 4UDTB 4C57C 1YMMD 4PJCE 2JJTC 3I6LD 3PWVB 1S7RA 4YNYA 3VFOB 1DLFL 1ZA6B 4PJIE 4G9DA 1S7XA 2GT9A 5F7EH 1I9IH 4CU8A 3K46A 2DWEA 1A7QL 4K71B 3VXRD 4E41E 4KV5E 3DWTA 3F7PC 1XGQB 3MJ9A 5T3ZD 5BS0B 1WK0A 3ARGD 2HFEA 2VYRE 4GJTB 1S7QB 1FHGA 3QQ3B 3GRWL 4OCWH 3Q6FA 5FHAH 3IJHA 3BDYH 4F80A 2VZSA 3MGOB 4RSVA 5FXCH 3V6FA 2FWOA 1UCBH 4ZO7A 3QIUC 5IJVA 2OZ4H 4F15B 2EEAA 2XNAB 3GO1H 4GRLC 4N5UA 1TCRB 3GGWA 4K9EC 1T1XB 3VFSB 1G7JB 3RKDC 1T4KA 1YUHB 5JOFA 4Z7QE 2XACC 2BJML 1E27A 4F57L 1D5XA 4FQXB 1EERB 1JCKA 1N5YL 5E4IA 1JNJA 4IMKC 3TIDA 4GMSL 4UB0H 1KEMH 4W4NA 5ACLA 3FN0L 4K7PY 3TA3C 2VXTL 4KGLA 4ZXBC 4YPJA 4HS3A 4MNGB 1HKLH 5CZVL 2YEZA 2VAAB 2APVA 3BGFB 4JGJA 5CZXC 4C58B 4FMFA 1FN4B 1CE6A 1UM5L 5DQDH 4PJGF 1JHKH 1OHQA 1CU4H 2DBLL 5FHBH 2DQFA 5I1HL 1FVDA 4ODBD 4ZFZB 1YN6A 2D7PA 5JDSA 1MLCA 3ARQA 4NO0A 3JTSB 3VI3F 2CO6B 3QCTL 5L7XL 3KWWB 4G5ZH 4MAYD 4M7ZC 5DZOA 4M6OH 1T5WA 5DJXB 3STBA 4KTEL 4NDMB 4KQ4H 4RFNB 4LVEA 4RGNB 3TO2B 8FABA 4LQFL 5DJ2A 2JCCA 2D4FA 2VTFA 1KJ2H 3VXQA 5DUBB 4ZUWA 5C0CD 3B2UC 4AG4H 3OKDB 4ISVA 5HVHC 4Y19D 4YDIL 4BUHA 1NLDH 4HT1L 1IKFH 4Y4KB 3PDOB 4UOW0 1ZEAH 1CCZA 3I3BA 2NZ9D 2YK1L 5I2IA 3IDJA 3MA9L 4HQQH 1U3HC 3L5WA 5J56B 3QIWA 2M26A 1BBDL 5I19H 3LSOA 3OKNA 2MWCA 4H8WH 4WV1C 3T77B 4P2QB 5DRWA 1OAZH 2VC2H 1O7SA 3V5HB 1NUDA 2Z93B 1KJ3L 3QUZD 3BQUB 4ZS7H 2X9XA 3QR2A 2BSSA 1EO5A 1Q9KB 3HB3C 2D2OA 1S5HB 4X6CF 4X80H 4GRMB 4PG9A 1MFBL 3WBDA 3NFNB 4LCYB 5KSVA 1HOCB 1RMFH 4XXDA 2HJKA 4GO6B 3VMOA 4HPOL 1IMHC 2VISB 3ZYIA 2Y6SC 4CJ0A 1I3GL 4UT9H 3RVVD 2YXFA 5HPMA 5I8EB 3TNMB 3BUYA 2EKJA 1EXUB 1U8MA 2Y07L 3WE6B 1WFTA 1F3RB 4HWZB 4N8CH 2ENYA 4PV8B 4URTB 2P24A 3AY4C 5B38G 1ZLWK 5KTEH 3P73A 2OLDA 2YMXL 1QFWI 4QXUL 3REWA 4NUJA 4N1CA 2CGRL 5F72S 1FYHB 2X05A 4AMKH 5TH2B 5IB5B 5EBGA 2GK0A 1EGJA 3RBSA 4QRTA 4M3JA 2C4FT 2FLBT 3MBXH 1ZGLM 4JKLA 3MV7E 1WZKA 5C86A 2Q76A 2FGWL 3ES6A 5HI4D 5FGCE 3RVWC 1A0QL 4NN6C 4PP2B 3MJ7B 2V7NB 4EDWH 1RUMH 2GFBA 2F5AH 2PXYC 1Q72H 5ALBH 1A1NA 1OP9A 2E9IA 1ED3A 4U1KA 5EIVA 5KSAA 2DBJA 2P44B 3ARBC 5DURD 2YHGA 5E99L 4BYHA 1V05A 1H0DB 3HUJA 4OCSL 4U1SA 4M1CC 4JRXD 3O2DA 2ATPB 1NEUA 2DKSA 1S9KC 3P30H 2QQQA 1MLBB 1X4XA 2Q86A 3DBXB 4KROC 1NGZB 1CFTB 1JGLH 1FYTA 1BFOA 3CFBB 1T1WB 3VW3H 1MJ7L 1SVZA 4XCFH 2EO9A 3VFRA 4LDEB 1GGYA 4AEHL 3MLXL 3A6CH 1MAML 4LVOB 1VEPA 4P2OB 5IESH 4ZSOA 4DUWA 4Y88A 1FV1B 4NPYB 3IJYB 2HFGH 4J6RL 2AJVH 3NZ8A 3GJFH 3OKOA 5DTFA 4PGZA 1DQJA 5EOQH 4AT6A 4JJ5B 3WL9B 4JRXB 2P5WA 4NNPH 1F4YL 1WIUA 1V3MA 3UYRL 3E1F1 4X8XA 1OPGL 4Y2DD 3WXVL 3N50A 3WV0A 5GPRA 2MHAB 5BJTB 2MJWA 1KELL 1ACZA 1B6DA 5E6YA 4XVJL 4CMMB 1ETZA 2V5SA 2PYEB 4HAFA 3SOBH 2X4PB 4HUUB 4L3AA 5FYJE 4HFWA 1JUFB 5KOVC 2LTQC 2E5EA 3O4LE 4P46D 1F4XH 3CFKA 4WFHD 3BWUC 2WM0A 4X9IA 1NEZA 2ICEB 5CSGA 2WNGA 1PX3A 5I1EL 2FH6A 5IK3A 3UJIH 4CGTA 1AXSB 2D7TH 4YDJB 1AXIB 1NGWA 4LLYB 3LQAH 5DFTA 5E8NA 3KHQA 4EDXB 1LO2L 3W0WD 4MWFB 4PRDA 4HCRH 2IBZX 1QD0A 2EDEA 3DOSA 5LGJB 5HI5D 5HVWA 1LEKA 1IM3B 4DCQA 1MREH 5CGYC 4L9DA 5F89B 4OT1L 2P42B 5FYKE 5E8PA 1WBZB 3NCFB 1NBZA 4R2GC 5JW3H 4FN0A 3W11D 3RA7H 1FNSH 4RGNE 1M71B 1N6QL 3QCVL 2LROA 2EDTA 4QHUB 5IMMA 4TNVK 5EN2A 5JPMA 1GGUA 1EO8L 2ADGA 5B8CA 1F13A 5ERWA 1RULH 1KOAA 1NLBL 1G7LB 1XGTA 4PG2A 1AD0B 2ICCA 3RPIA 3WFEH 2I07B 1U8IB 4M6ML 2DKMA 5CSZA 1RUPL 1N64L 5J1AA 4KTDL 4C83B 4MAUL 4BSVA 3QFJE 1EHNA 3HE6A 3BP4B 1G9NL 2BNQB 2IAMC 3MLZL 3G5YA 4HJGB 4KPHH 1P69B 4BUGA 3NAAH 1KTDA 2K9UA 2IFFL 4FABL 1GGTA 3EDFA 2V9RA 4IOFD 2VXQL 4ZYKA 1XF2A 1MCFA 1EHLH 5JW4N 4FQCH 4DUXA 2A9NH 3RX5A 4U1HA 1ZHBA 2A6KA 2X4SA 3QDAA 1I9EA 3MTRA 4LHUG 4HFUL 3UO1H 4JANA 4NWUH 2BERA 5IB1A 2B1AL 4MJ4A 4F7PB 1SJHA 3RTQD 1UA6H 1R0AH 2ZUXA 2AQ3A 3HS0B 5HJ3A 3W2DL 1Q38A 2JJTA 2B0SH 3WSQL 4HUVA 1IGCL 1OARL 5DK2A 1YEGL 2V7HB 3C5SA 4YBQC 1U3YA 1IT9H 5E7FA 3TO4D 4BQCA 1K2DA 4PJHA 3VI4F 4WI6A 5E8EA 3SQBA 2D03H 2P7TA 4M4RA 5MENA 1GHFH 5IM7B 2C5DC 1I7ZB 4KY1L 2QADD 2MSPA 4IEFB 4NZJA 1FC2D 5GS0D 1JYXA 4JY5L 1HN0A 4DKEH 4TQEH 3QT2A 3QIUA 3ARZA 1IFHL 1BWMA 4K3JH 1T21B 1OD7A 4GRLA 3ROLB 3MRFA 4KDVA 5IFJB 3EFFA 4JFDA 1Z0NA 2AQ1A 5DEFA 2VIRB 5MP6H 4HBQA 1AGDA 1DQLH 1F02I 3W82A 3B9VA 1W72L 3QQ4A 4JZJC 4YHIB 1ZT7A 2G60L 3CZFB 2H3NB 2PTTB 3TO4B 1RZ7H 4OF3A 4KDTC 5E00A 43C9B 5I8OL 2B2XL 2EE9A 4IMKA 3O6FC 1YC8A 2CJUH 4LPTA 1RK0A 3TA3A 3GMLB 4ZXBA 4XGZB 3FB7B 3QFDA 5LWYL 2GY7B 2ZJSH 3D25A 3HZVB 4HGKC 1J0IA 1DLHA 3M1BA 3QNXA 4WUUE 3V6ZB 5J6GA 5IGXH 1VPOL 4QRRE 2J8UE 1MELA 1Q0YH 2AK1H 2X4UA 3ARDC 3HMXA 3FZUD 2P1YA 2HH0H 4JG0H 1FQ9C 2FBJL 4XH2B 4JFYB 1KTLB 2I26N 1IGJB 1W8OA 3GMRA 5D5ME 4OLUH 5CJXC 1R3JA 4ACPA 3ZT7A 5DJAA 5C71A 1ZA3B 3CD4A 4LU5L 3IRPX 2X4NB 3MV7A 5I1IL 5IG7A 2R1YA 1QG3A 1T80A 3K4ZA 3MR9A 1RZJL 3QEQD 3ZSSA 2CUIA 3DX7A 1JPFA 3AS2A 5HHMD 4Y5VC 4NGHH 1EHAA 3F5WA 3MRHB 2OQJA 1FZMB 4V1DD 2YD6A 1MCWW 1NC4D 4LLQB 4D8PA 4OGXH 5GS1C 2YRPA 4Y1AE 2EDWA 2LU4A 4XI5C 2UUDK 5T1KB 4G8FA 5HHNA 5BVPH 1A5FH 2C26A 1DE4A 1QFHA 5EBMA 3QQ9D 1U3HA 4EUPA 4JFFE 4G6ML 2C3GA 3QXAA 4QRSA 4MCZA 2JKXA 1EZVX 3ET9F 1AQKL 3HC0B 4ZUUA 1SMOA 4WGWB 3LH2L 3QDMD 1J8HB 4WV1A 4D0BA 4JFPA 1UKQA 3OKMA 3A6BL 2BSRB 5HHMB 5DR5H 1LE5A 3NH7L 2C9AA 4JCMA 4IM8A 4XXCC 4Z0XB 5I1GL 5CD3B 4ZDHA 1FRGH 1QKZL 3IDNB 4KK6C 4Z0BL 3MV9D 2ED9A 2NNAB 3PQYD 2AK4D 5IQ9A 1UB5A 4OD3H 4ZQKB 4RBPK 1I8IA 1Q9WB 5F3HB 3V6OE 1KUMA 1NDMB 3UTZB 4OLVL 4PJ7B 3DYOA 3ETBF 2VL5A 5DJZB 3QDMB 4WHTB 3WIIL 3MRIB 4RQQA 4ODVH 1YJDL 3G5ZA 3I3DA 3O3DB 1BMGA 1SYSB 2DI8A 1I8MB 1GAFH 2E6QA 4XVSL 1YEDA 3AY4A 3O4LA 3ZTNH 1NH6A 3QIBC 2V2TA 2IMMA 1FVCB 5GS2D 1H8SA 1BAFH 1LP9F 2ORBL 2ZG1A 1MRFH 3MV9B 4XTRD 1QLFB 4YQXH 3PQYB 2AK4B 1XCTA 2OX5A 1CGSH 4K2UH 3HG1D 3RNKA 2DQEH 3UYPA 1RURL 3FT3A 3OJMB 5TE7H 3ULVD 4IRJB 3ME0A 1PLGH 1S7XB 2GT9B 4EBQL 15C8L 5B3JF 2HMIC 5F1OB 4CVUA 4F3FA 3DX9A 1TIUA 2WZPD 2BNQE 5E1AB 1TQCC 1ZVSB 2PXYA 4NNXA 2HFEB 1A6UH 2VXJA 3ARBA 1UH4A 5CEYB 4KHXH 1S3KH 3R06B 1QSFA 4GSDH 2VDOH 1YEEH 4KHTH 3HG1B 2XQYK 3GSVA 4PJFB 3WKMH 5H37H 1JGDA 4PLJD 2AJYH 3DSFH 5ADOH 2G2RA 2XTJC 3ELAT 3E8UL 1T4KB 1MCIA 1J9CT 1ZTXL 5JOFB 4OLYH 4X6DE 3WFHA 3L3HA 4EI6A 2C1OA 2BFVH 4NO0D 4PP1D 1E27B 5BMFH 1X7QB 3FB8B 1FFNA 4UT7L 4MCYB 2H8PB 3UZQA 1J1XL 2A38A 3HCVA 5I0DA 2KQMA 1DBML 1KCUH 4WWKB 4NQEB 3LKSA 3Q6GH 2CDFA 2NYYC 2HFFA 3VXOB 1YY9C 1FL6A 2YEZB 4I77L 4I8DA 4LLAA 4OLWH 1UXWB 2BVEA 2OMBA 5D6CB 4MQ7B 1FVDB 4KRPB 1KB5B 5ENWB 1ZHKB 4YDLC 1KCSL 2JJSC 4PRPA 3O9WC 1OM3H 3QIWD 4XP1H 1G7MB 2NY3D 2R0LL 2A2QT 5MERB 4GRWB 4OUOA 3GUTA 1T5WB 4NQTA 2QHLA 3GI9H 3AUVA 4HZLA 2WWMD 2NXZB 2J4WH 5DJ2B 1SQ2N 5HGHB 1N4XL 2A83A 4P0DA 5DO2C 1A4JB 4GLRI 1YEIH 1GWKA 4GXUM 1T89C 4OI7A 4OGAC 3TZVC 4QTHB 5L2KE 3LAFA 3DETC 4M7JH 1L0XA 5I2IB 2I9TA 4RAVB 1LK2B 3WN5C 1B4RA 4OV5B 3L5WB 3MPCA 3MLUH 3THMH 3O4OB 3EYSH 3QIWB 1OW0C 4KK8C 3I6GB 2E7HA 3FHQA 3CC5B 4XMPH 3FRPA 1MCJA 5E95B 2COQA 5DVMA 5HTSA 4K94L 1BQLH 3MACH 1MIEH 5DRWB 1FNAA 2HG5B 1KJMA 4G7YL 4G8GE 5IW1A 2R23B 2CIIB 1T22A 4BA8A 1A6WL 5D1ZC 1BVLA 2WBKA 2Q3AA 3QI9C 1ACYL 4U1JA 4QRQA 1YNTB 5CP3H 2W0FA 1KLFA 3D3VB 4YHOL 1RZKC 3HN3A 3H7BA 2HJKB 3QYCA 3ULUL 3FB5A 5H94A 4BKLA 4NO3A 1M05B 4XP4H 1T3FB 4LSTH 4ETYA 2F5BH 3QPQC 3UBXG 1T20B 3KAAA 5TFSL 4QRRA 2J8UA 1J12A 1AGBB 2IAMA 2IPTH 3AXLA 4RIRA 3BDBA 3L3IA 3SDCC 5D7IF 3WXWL 4MXWH 3BH9A 5D5MA 2L4OA 3T2QA 2UWEF 3C60D 4YHKL 4DQOL 3PV7A 1CGWA 4LFHD 2GUOA 1EEYA 2ARJB 3REWB 1H9VA 4U1LA 1OAKH 3P0VL 3VFTA 1A1MB 5KVGH 3O3AA 5I71C 3UAJD 2Y7QB 3TT3L 1CXLA 4HUNB 1BZ9A 2XI9A 1YEKL 2A77H 3KPQA 1UACL 4PJXA 3GSNL 1INEH 1U36A 3PIQA 5IEHA 3ULUC 1EEQA 4NSKB 1FYTD 4Y1AA 1JWUA 1QOKA 3BE1L 4FTVB 4PJ7E 3WYRA 2EZ0D 5I74B 1A02N 3MUHL 4JFFA 5IQ7L 1UADC 3Q5TA 3C60B 2GAZB 4DZ8A 1DBKL 3RWFB 4QYOA 2NY6C 5C08E 5D96C 2P5WD 3LPGA 3ARFC 4KJQC 5AZ2H 4TUOA 2F8OA 4LBEB 4FFZH 3UCRA 2DQHL 4PBVC 1BFOB 3D39A 2CLVB 5DFWH 2GY5A 1PSKH 2NY4D 4ZFOA 4DUVA 1T66C 5CJQH 5I16B 2F54B 1DUYA 4OCYL 4KDTA 5M94B 2APBA 1E6JL 4APQD 3ROOA 3O6FA 3QPXL 5E0QA 4RZCA 4Z7UF 3F7VA 2OI9C 3VD3A 1DQJB 5CP7A 1N3NA 4IJ3C 1X3DA 4NYLA 5D1XC 4PY7A 4JFOA 1MI5D 2IALA 4BQ4A 2YOCA 2G75A 3BKCL 4ZO6A 2RCSH 4IMLA 4YX2L 4JO3L 3ARDA 4QRPE 4Y5YC 1H3XA 1KJVA 5IR1A 3RU8L 2NY4B 4PRIB 3FQXB 4U1NB 5DJ6A 3UT0A 5CJXA 2BXZA 3RVUD 3V5DA 4APQB 1W72A 6FABL 3B3IA 1J0KA 1EV2E 4P2YA 4TNVF 3R0MA 4JO1L 1B4JH 3KPNB 5DD5L 1RJCA 4PJBE 1NBYA 5EU6E 1OSZA 1CE1L 3SDXF 1RU9L 4Y5VA 1MI5B 3QNYA 1C12B 2R8SL 3NFSH 3QCUL 4RNRA 5T5FL 4KWUA 2X6MA 5FO8A 5GS1A 1BZQK 1CXKA 4LCWE 3U9PL 5EBWB 1ZS8A 1NMCB 5I6XB 4L29B 4R97B 3ZT6A 5I66B 5EOCH 5E9DD 1T1YA 2BK8A 3IFLL 3INUH 4DCQB 4QHNB 3FMGH 1SY6L 3HE6D 3PGCA 5F8QC 3C6LB 5CEZL 5BZDB 4X6DA 5TE4L 3S4SA 3VFVA 4WCYH 3EKCA 3IGAA 4GRWE 4HWNA 3KG5A 1KV3A 4NHUB 3UTQB 5HHOE 1F3JB 4R9HA 4UV4L 4XXCA 3VXPA 3MO1B 4L9LB 5KSBF 4ODTL 5J0BA 1BJ1J 4DGYL 1T2QH 2FZ3B 4U05A 4K7PH 3E3QC 4HC1L 4ONOA 1IGFL 3U6RA 3F7QA 3BMWA 5CSZB 2R0WL 5E9DB 1U8JA 4QF1A 5FYLD 4E5XB 1RY7B 5I15L 3G5YB 4MJ5B 3C87A 1WCBB 4AIZB 1EVUA 1T0PB 5HDLA 3HLAB 1A47A 3D18B 5IROC 5FDWA 3GHBH 1QBLH 5GRJH 1MWAL 2CK2A 2DI9A 2ZUTA 5GISH 1QFUL 2MOVA 3BP5B 3MA7B 2OSLA 3HC3H 3QIBA 4U1HB 1P7QB 3I9GL 5MEND 2H2SC 1JYWA 4PRHE 1GGCH 3QG7L 4IRZH 2ITDA 4OCRL 3UTPE 3VH8G 1HH6A 3QIUD 1JHTA 3WFCL 2J7LA 3GDBA 3O6KH 4GRLD 1DBBL 2CDEB 3T0AA 4ELME 1GC1C 5IUSA 4JFDD 5JW4Q 5L2KA 1KN4L 4DGIL 2M1KA 32C2A 3RKDD 3H0TA 2PW1B 2QQNL 5DK2B 4L3EE 3TBWA 3C5SB 3EHBC 4PJHB 1A8JH 1G9EA 2VR4A 5EBLB 3I75A 3BPNC 5MENB 4XMKH 3BMVA 3TA3D 1MFEH 4ZXBD 3IT8D 4FQIH 5C07A 4XPGH 5A2FA 2IG2L 1NSNL 1FIGL 5CZXD 4NHCH 5EC2B 1KIPA 2RBLA 1I8KA 3OR7B 4JFDB 4MA1C 1I1AC 2BMKB 5DEFB 1A6TA 3CSBA 4N9GA 1AGDB 1K4DB 1RUAH 3I85A 4I3RL 1S9YB 4DTGH 3P9MB 3SBWA 2C1PB 2IPUK 3CU7A 3MRGA 4OQTL 4J3SA 4LPYA 4MQXD 5DD0L 4FTVE 4K3GA 5CUSL 2GJJA 2D0GA 3CNKA 2B4CC 3G5VA 3MV7D 4GW4A 3KPOB 4GW1B 3UBXI 4YHPB 4ZXBB 3KLHD 1IGIH 4J7RA 4U6VH 1IQWL 3O6ML 3HE7C 3V7MA 5L88H 1XIWB 1Z9SA 3HAEG 3B2UD 3E3QE 3MMEA 3SE9H 3QNXB 1PKQA 3OX8B 4ZOEA 2X4UB 2D7MA 1NAML 4X83A 3W5NA 4S1SL 2VUYA 1IEAA 2JJSA 4YEFA 4A2MA 1U3HD 5SX5H 3O9WA 1I7RB 1C1EH 4LF3A 3PXJA 2WIIA 2W9DH 4OB5H 3MV8E 4CVWA 2F54E 1N5AB 5HVFB 1HILA 1OVZA 1CD1B 4MA8H 5IWLC 3BDYL 3S35H 4XB8A 3DX7B 4JY4A 3MZTA 1UCBL 2ZUYA 2YD8A 1JZ6A 3F5WB 5CSBA 2OQJB 5HVHB 2DQDL 1T89A 5EZIL 4Q9RH 3TZVA 3RY4A 2DD8H 2BVTA 2GTZB 5DHVB 3FB6B 4XP9H 5C08A 3HB3D 5J13B 4YWGL 2AVGA 1ZLSH 1DE4B 4KAQL 5SWSA 2O61A 5HHVL 3WN5A 5E2VL 5TDPA 2OL3L 4EUPB 3I02A 1L6XA 1OW0A 3ZTJG 2Y6SD 2APXA 5IVXB 4TUKL 3ZYHA 1CLZH 4CW1B 3LMJH 3VCLA 3LS4L 4H1LB 2P5EB 4XWGL 4D0BB 4HS6A 4F7MA 1AGFB 3S8WA 4Z7OE 3AC0A 1IGTB 4OZHA 3QEGH 3O4LD 4GG8A 4N0UE 4JFHD 4NWTH 5D1ZA 2DQJL 4GG6E 2FO1A 3QI9A 4CUCA 1AI1L 3B5GA 3P77A 3RGVC 5DVOA 2J6EH 1MQKH 1CI5A 4LSQH 3DXAB 2EDKA 2W9LA 3MLVH 1URLA 4QRPA 2K7PA 1BVKB 5GGTL 1W8TA 4KQ4L 4K3EL 3SDCA 5D8JH 3RVWD 1KCRL 12E8L 3F7RA 3SDAC 2P4AB 5C0RL 1T1ZA 4RCAA 3MXWH 1RFDL 3CJJA 4KUZH 1ZT4A 3VFWB 5HBBA 3BEVB 4RRPG 1S78C 3EJZC 2VLKE 3ARBD 4KI1A 1ZEAL 3KPSE 3IDMA 1QSFD 1QUNA 4M1CD 4O9HH 1M7DB 3RWJA 4U33A 4GUPB 3P4NB 5GGUA 4F8TA 2LABA 1ZLUK 3U7AA 1OB1A 3Q3GA 4PJAF 1UM6L 3CMOH 3T1FB 1W90A 2R69H 5KVEL 4LCWA 3DX9B 1LEIB 2R2BB 2VWEC 3UXFA 2HVJA 4MD5B 2C3HA 2V17H 2AGJL 3G08A 5BQ7B 3QWRA 4ZS7L 1AQDB 5T3XL 4ELKA 3EO1A 4Y16C 1A7OH 1IAIH 2XWBA 4XX1G 4ZUVA 1VGEH 2QSCH 2WLZA 1QSFB 3QO1A 3B8YA 4JPKH 4OGYH 4S0TD 5L8KB 1JJUA 5DJDB 2E9BA 3ARFA 4NQXA 4CN1A 5GS0H 3P4OA 1XGRA 5HHOA 3VD5A 1H3PH 2Y23A 5GJTL 2G2RB 5HYEA 2XQBH 1PVHA 4C56A 5B21A 2HLAB 2XOTA 3L3HB 1C5CL 3BP7B 5H8DA 7FABH 1BQSA 2WQRA 4PRPD 3MRNA 3DO7A 1A3RL 3PWJA 4FOMA 1FZJA 3I2CL 3HCVB 1L0YA 2WYFA 1QR1B 3D0LA 1OAUH 3LKSB 3WLWC 1FLRH 4OJFL 3UC0H 2YR3A 2V6HA 1FL6B 4AMKL 1NC2B 5D1XA 1LO0H 4ZFFA 5DEGA 1B2WL 4EXKA 4YHLH 3WFDL 4I5BA 3MBXL 4PRHA 2FEEI 4P5KB 1CFQB 2EIDA 2QV2A 2WINA 4Y5YA 2H45A 1VESA 4OFYA 4PRPB 4Z18A 4LRNL 2X42A 2EECA 5DDHA 1VADA 1BBJA 3T4YA 4EDWL 4M02A 3JV6B 4KVCH 1TJGH 2F5AL 4PYGA 4ELMA 1PFCA 3KYMB 2W38A 4CP9B 3W9DA 5CGYD 1FORH 1OGTB 1AH1A 4L3EA 3LHPL 3FJTA 4R2GD 2MPAH 2ICWA 5DUPL 4L8SC 3EOTL 4U49A 1CZ8H 2OTUB 3EDJA 3GIZL 1QQDB 2G5BB 4P3WA 3AVEA 2I9TB 3MRBB 2EH8H 4JQXC 3ZYBA 2VWEE 3P3YA 4P4KC 3VI3E 3IDGA 5IESL 1HHJB 1ADQL 4RWYH 4FQ1H 2IAMD 2HFGL 4F7TB 3DHMA 1TCMA 5TE6H 1LE9A 2ADIA 4Y0GA 4BQ6A 3OXRB 3U30C 3NFPA 3TH2T 1NAKL 3CMGA 1T22B 1K6QH 4NO5A 2W60A 2ZUWA 1BVLB 3H3BC 4KKAC 4U1JB 4L3CB 4Y4FC 1LEGB 4G42B 5DLML 3R1GH 2AKRA 4DN4L 5DF0A 5K33A 3SGJC 4HKXB 3IAQA 5AAMA 2VN4A 1E4KC 2BXYA 2ITCB 4MJIB 3JWDL 3FB5B 5CIPA 3JV5A 5EPMA 1LNUB 4JDZA 4O5LL 4XNYH 4F33B 2IAMB 3FRUB 4GKNA 1PZ5B 2VDNL 5F21B 4LHQB 4UV7H 1I9JL 4GOSA 5C3TA 5JOEA 4LCCC 3P9WB 4YBQD 1L4IA 3RJDA 3C9NB 5IVXE 5IROA 1B6UA 1AFVL 4JFFD 4JN2A 1SY6A 1FGNL 3UJIL 2P5EE 2VABB 2J3SA 1JRHH 1F4WH 3MV8A 4J3WA 4OKVB 2AEIT 5GS2H 2BHZA 2Z8VC 3AM8C 3N9GL 4LASL 5K59E 1T0MA 3D87B 4HCRL 4WGVB 4D0DB 2V2XA 5FKPB 2VSCA 1BEYH 4PJ8C 1RK1B 4PJXB 5FF6B 3ULVH 3PIQB 3T3PE 1X6NA 2J88H 2QR0A 3JWDC 1U2HA 1JWUB 3D39D 3P4MB 1IBGH 2LVCA 3BPOC 4HC1A 1W0VB 4CMHC 3DXAE 2GK2A 4JFEA 4L4TB 4DWHA 5SX4H 4OAWB 4BFGA 4WI8A 4ORGA 3O6FD 3MODH 3EW3B 4GW5A 1JPGA 3KNBA 5T1LA 1M6OA 1MWAA 1RULL 2CK0L 2FIRT 4D9LL 3WFEL 2IQ9L 2R4RL 3G6JF 4NQVB 1ORSA 4DZBB 4N0UA 2A6JB 4HMCA 3ALPA 2DLIA 3CDFA 1I1AA 1JWSA 4GG6A 3ARDD 3D39B 3SDYH 3KJ4C 1OWWA 1A7PL 4KPHL 3CVIH 4LK4A 4JZJB 1CTNA 1KB5H 3X12A 3HI1B 1SM3H 2X5PA 3MJGX 1IGMH 1J1OL 5F7DA 1II4E 4HK3J 4Z9KB 3BFOA 1BX2B 1P6AB 1JBJA 3SE8H 1MHHB 3T0DA 4G9FA 4OTXH 4QT5B 3ROOB 2LU3A 3F65A 5BZWB 4ZOCA 5DVLA 3OZ9L 4NJ9L 4NWUL 1QYGL 3HE7A 3B83A 1C8PA 2WK2A 5BW7C 3WIFB 1WSST 4WFEE 4X5XB 4JFOB 1R0AL 2G75B 5FAAA 5D70L 3GJEA 3S37H 1X5XA 1V5JA 2NCMA 1INDH 2VLKA 1D5BA 1OTTC 1KJVB 4XI5D 5JHDE 2Z92B 3LDBC 2IPKA 5E03A 2AEWA 3NA9L 3X11B 3TN0D 1AXTH 3H3PL 1W72B 4PJDF 3RJQB 1EBAA 2D03L 2FSEB 3HZYB 3AS1A 3QB7C 4TNWK 2ZCLL 5T5NF 1S9WA 3CPLA 3OJDB 3OPZL 5LQBL 5IWLA 4DFHA 3DURA 1OAYH 2FLRT 2IF7A 5DGRA 2UY7A 4Y5VB 3VXUB 2EXWC 3AAZB 3QNYB 1MSPA 4RWHA 1F4AA 3RI5K 1GZQB 3V7AG 4ENEC 5C0DA 4L8DB 1K5NA 5L0QC 2R56H 1WBXA 2L0DA 1CN4A 1LO3H 3EDDA 1ZANL 5T1DL 1NEZG 1T03L 1FFRA 3FQUB 3TN0B 3VD9A 1KYOK 1HXYB 4KKCC 4H26B 4LEOB 2DQIL 2NY5C 1T1YB 3E6FB 2N56A 4UNVA 3X17A 1CDIA 3TJHC 4LCIH 4NQCA 3IGAB 2ZUVA 2DLFL 2NY2C 4LIQH 1ZHNB 4HS8L 2UZYB 5DFVD 2ED8A 1UM4H 3WS6C 4P3CL 3PWPA 3QIBD 4QLRA 2AK1L 5I76A 2H2PC 3DVGB 5JR1L 4OFIA 5C7XH 4LLUA 1G9MC 2AEQL 1MH5A 2APTA 3CFCH 3RGVA 2BRRL 2EYTB 5CWSA 3U2SB 1H5BC 2VITA 3TGXA 3U6RB 3NIDE 4OM0H 1AHWC 1EGJH 5L2KD 5IKCA 1H3VA 2VXVH 5EH1A 3WUWA 2NW2A 3FT4A 1XAUA 2HMID 5T1MB 2D9CA 4HEME 3C8DA 1FVEA 1F4HA 4WY7H 3SDAA 1EBPA 1QSVA 43CAB 2BNRB 3BJ91 1J88A 1X4YA 5I18H 5I75B 5D2LB 2X7LA 4NKDB 4HWBA 3T3MF 1PG7H 5HY9A 2GSIA 5C07D 2ITDB 2DN7A 1U8NA 4U1IB 4LP4A 3O2DH 5C0BA 4M5ZH 1LMKA 4GBXC 4U7SA 3WNMA 2XTJD 4XC1H 4FS0A 4QOKA 4A6YL 1G7HA 2X89A 5MI0B 4PJGA 1CT8A 2KR2A 4R4FH 5DK0A 4JQIL 4ETQB 5DR5L 5DSCA 1R3LB 3IKCB 5D6DC 1OY3B 5I1LB 1C7SA 3BZ4A 1FRGL 3HZKA 4Y16A 1JPTH 2AJZA 2A6DB 2NYYD 2WUCH 1YYLH 4LPUA 1YY9D 3QNZA 5INCA 5LGHL 2B1HH 3N1PC 4B7IA 4I0KA 2MQ0A 4WI2A 2AJXL 4XNXL 1QLEH 5DMKA 2XTJB 2A6IB 3G6AA 3LB6C 4N9GB 4Z6AT 4PJCF 2ZZUT 1AD9B 1U8OB 2ICWJ 5LXGH 5AUMB 1CXIA 4PJIF 3O9WD 1TETL 5DEZA 1MEXH 3FFDA 5FUOL 1MFAH 3VWJC 1RSFA 1S8DA 2BNUA 3VI4E 2VDQL 1M7IB 2FH8A 1OP3H 5SX5K 4D3CL 1IAKB 1ZHLB 5DO2D 3H8NA 1NBVL 1UT9A 2VZUA 1PKQB 4O51B 4QCIB 4GKZB 2Y06H 4OGAD 3TZVD 3G04B 3GMQA 2VDLH 5C08D 3DETD 4P4RB 4AH2A 2B5IB 4MXQC 1N7ML 3Q48A 5ICZA 1K8IB 5SWSD 4X6CA 3MQIA 2CLRB 1MHPH 2BY0A 4DVBB 3FQTA 3H9SE 5IV2B 1DUZA 4KK8D 5SWQB 1KPUB 3M8OH 3GBML 5JQ6L 3KYOA 3RL2A 1LK3H 2P8LA 4DGVL 4LPCA 5GRVK 3AS3A 3CDGA 2ZCKH 3I6KB 4GSDL 1DQDH 3JV4A 4L8BB 2PO6C 4IS6B 5JA8B 4KHTL 3CU1A 3PUCA 3BO8A 3PGDB 3WKML 1MCEA 3ZYZA 4N8VB 1TQBC 4L8SA 3SE3C 3MV01 3BI9X 5D1ZD 5F71A 3QI9D 1HHGA 1IAMA 1TZGH 2XY2A 2O14A 3OB0H 5ECJE 5SWSB 2O61B 4QRUB 2BFVL 4JQXA 2GJZA 2JF1A 5BMFL 2C3VA 3FOMA 1KC5H 5FB8A 5JXEC 2FB4H 3QPQD 4RFEB 5I8KH 4QRPD 1I9RH 3SDCD 3CUPA 2L7UA 25C8H 4HS6B 4F7MB 3DRQB 3LEYL 4HBCH 1F42A 5HYQA 1RZGA 5D1ZB 1MVUA 5F3BA 2DTMH 3PL6C 3QI9B 2Y5TA 4Y4FA 3CX2A 3NN8A 3N85L 1HCFX 3FFCB 2NXYD 3LN9A 4LSSH 4RMRA 3SGJA 4ZTOH 3EOAA 1E4KA 5FA4A 2HWZH 4PPTA 3U4EA 1Q9LA 1AIFA 2N7BA 1D6VH 1U93B 4K7FA 1HHIA 4PY8I 1F8TH 3ULUD 5FYLH 2VLME 3JZ7A 3SDCB 4U0QB 4LCCA 4K3DL 1IKNC 2HJLA 3QWRD 3WNOA 2VDKH 3SCMB 3RKPA 5C6WH 1XF1A 1YDPA 2NY6D 3IDMB 4N0FA 1IEBB 2NXYB 1RJYA 3AM8A 4LARL 3MNZB 3MLUL 3ARFD 1A1OA 4KJQD 3ILQC 5FECB 2XN9B 5HHOD 3V8OA 3Q3GB 4KZEL 1EJOH 1P1ZB 4PJ8A 4K9EH 1MF2H 4XMPL 4C56D 3NZHH 4QGYA 3C8KA 4YUEH 4F9PA 4NIKB 3FQNB 1FH5H 1F3DH 4BFIA 4WO4B 1T66D 2X4RA 4KKLC 2YD3A 4AK1A 1TZHA 1U92B 2ADJB 1DLFH 2QQKL 3G08B 4YPGB 4OF6A 2E8ZA 2GSGA 2R15A 5EZJA 4GKSA 4NKMA 3NMEA 1KTKE 2GQHA 4KKBC 3RWHB 1K3IA 1A7QH 3E6HB 3WJLC 1QNZH 3KDMA 4Z7VF 3N1FC 5EUKB 1KPRB 3TP4A 1QRKA 1LP9E 2BNRE 4CL7A 4HGWB 5L8LB 4HIIA 1DQQB 4LRIC 3QH3B 5D1XD 5BXFA 2FO4A 3WIHA 3D2UB 4LSTL 4P5MB 5C70A 2F5BL 3MOAL 4M3KB 4R3SA 4YBHA 2XWTB 2VLJE 2IPTL 4HWUA 5B38A 5INDB 2GKIA 4OFYD 5B3JE 1OQXA 2FR4A 2E9WA 5C0IA 4R7NB 4XPAL 3GSNB 4AL9A 1H15B 3PWJB 3FL7A 4HULB 5F6IC 4BM7A 2SEBA 1TVHA 1GH7A 4I1NB 1QBBA 2BJMH 2NQCA 4F57H 2YRZA 3LS5L 3O81A 4JM2D 4WI4A 3O11B 3O45A 5BW7A 1FSKC 4I13B 5EU7C 1N5YH 5ALCH 2X4OB 3STLB 1J0ZA 3FN0H 4Z7NE 1TJIL 2VXTH 2DIAA 2FHCA 5ESAA 5DHVH 2BVPA 2YD4A 4YBLB 4MHHG 4KJWC 2Y4SA 1IEHA 3QJHA 1XR8A 3A67L 3B9KC