3ORJA

Crystal structure of a sugar-binding protein (bacova_04391) from bacteroides ovatus at 2.16 a resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
429
structure length
429
Chain Sequence
DDNGGSSVMNITGIYLEDAKSNVPDRLVDFARLGQLIRIEGEGFNGLKKVYINGYNCYFNPVFVSNKSFLVSVNSKVPTTEADENVRNTIRLVKDGGEYVYDFQIRAAAPSITKISNCMPNVGEPIIVYGSGLTEIAKVVFPGNVVVTEGIISDLDGEYFMVDMPAGVSEEGGSIFVEGSNGGAYSPAYFNYKKGLLLNFDGVGAQGAWGDSESMIQTTELESASIGEGNVSQGAYCRLPLERQLPVAAAKNRCAEVWTAGNGTDPDWLTLGVPAETPVAECAIQFEIYVPEPWSESGFLKICGQNGFNGGEWERDCYNYVPWLVDGKIVPFQTTGWQTVTVPFSEFYKSKASSGAWTTFADVTATRASASYANFGFYFENSDITLDKITGASSDKETEFLSKATSVKIYIDNWRVVPLTKPEYTDFPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Sugar binding protein
molecule keywords sugar-binding protein
publication title Crystal structure of a sugar-binding protein (BACOVA_04391) from Bacteroides ovatus at 2.16 A resolution
rcsb
source organism Bacteroides ovatus
total genus 96
structure length 429
sequence length 429
ec nomenclature
pdb deposition date 2010-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18329 SGBP_B_XBD Surface glycan-binding protein B xyloglucan binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3orjA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3orjA02
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 3orjA03
5F71A 3WL9A 1H3XA 3T77B 2CRIA 4QF1B 3T2OA 1MRCH 5K9KA 3WJLA 2DF3A 4W4NA 1ZLUK 4NQXA 1QA9B 1S9VA 5C08A 4ZS7L 3JBG7 4FN0A 1S9YA 3QHTC 2AJXL 5D5MA 5H94B 1RZ8B 2Q86B 5DA4A 3BMVA 2R0KL 1HI6B 1D5XA 2I5YH 1VPOH 4JPVL 2OTWA 3VGAB 4IDJH 2EDBA 3KPLA 5DUBA 2Z8WC 3ZDYE 4QRRA 1ZLSH 3UJTH 1CDBA 1AR1D 1MCOH 3LKPB 4CGTA 2J2ZA 5GSVB 2K9UA 3LKOA 3ZYIA 3CPLB 4NUJA 3BHBA 1CGXA 1AR1C 2OZ4L 4XPBL 1CR9L 4FQCH 1I9RH 5L2KA 1KB9J 4DTGH 2W60B 5DZOA 4PR5A 3VFOB 2A9ML 4FG6D 4PP2B 1R5VB 3H8NA 3RGVA 1FNSL 4FG6C 1Y18A 1O5DT 3QEQE 3L5HA 4PLOB 1HHGB 1S7UB 1GIGH 1I3GL 3ES6A 3NACL 2GSGA 3QXWA 4RZCB 4AIZB 1QUNA 1KJ3L 4IIQB 5HYJB 3BW9B 2B39A 4PJDB 1ZHKA 4JFZL 5IT2L 1A3LH 3ZE2E 3WIHA 5F7HA 4LPUA 5I8KL 1JMXA 5T5NF 5I1JL 1FYTD 5E5UB 1YEKH 4MDJA 1OTUC 4WU5B 2AKRB 1WBXB 2YSSB 3QIWB 4X5LA 2HN7A 1UXSB 1AI1H 2R1WB 2VABA 3D5OF 1MLCB 4QHLA 4HIXH 4DK3A 1CQYA 4XCCL 1WFTA 2OLDA 3CFBA 4FFVC 2AXGA 4OF8A 2XZQH 2Z35B 4X8JB 3CMOH 2BHUA 2RCSL 3PIQA 1WV7T 1CDCA 2XA8H 2VDML 4UQ3B 5D7LA 1WBZA 2LFGA 1EHLL 1KCUL 4AIXA 5CD5D 4TSBH 5KG9A 3MLYL 5EIVA 1I1FA 5MENA 3ZT6A 3DHJA 4JG1H 4M9OA 5CD5C 1VACA 5IHBA 4PJCA 3SKNB 2WLZA 2MHAA 3BGFB 3QZWB 1ED3A 1A5FL 5BQ7B 3OKMA 5T3XH 4LNRB 4NC1C 1XR9A 5HGHA 5C8JB 4KQ4L 2BOBA 1ERNA 3IDJA 5GXBB 4HZLA 3B6SB 4OAWB 1ADQL 3NZHL 3SGKC 4K94C 1EGJL 5A1AA 3HE6D 3Q5OA 2H41A 3PABA 1KXQE 5BRZE 2LAAA 3HE6C 2EIEA 4UIKL 2YPVH 1JL8A 1NBYB 4LDLB 2HJLA 1PG7H 1CFNB 1A1OA 3MNZB 3FFCE 2EO9A 3C6LC 2X89D 4YFDB 5I2IB 1A9BB 5D7JD 1J0KA 1LK2B 2DQEH 4GLRH 4AEIL 4Y4KD 1BAFH 2AW2A 5D7JC 3TH2T 3VGFA 1J8HA 3AXLA 4P2OD 4X5WA 4P0DA 4JFQB 4J3OC 4Y4KC 3UZEA 4WO4B 1BECA 2R4RH 3KGRA 3LEYL 4P2OC 4M6ML 2PO6D 3QI9A 2VITA 5I0ZA 1I8KB 2VR5A 3T3PF 4QOKA 5DMIH 4HUVB 2X1OA 3AMLA 2X42A 4PTUA 1DQLL 4EXPX 2E7CA 1DBBH 4MX7A 1BBDL 3ROLB 3KLHD 4CBPA 2B2XH 2BOCA 1HKLH 4LK4A 1JPTL 5EU7E 4NRZB 4EQ2A 2ZOLA 4R4FH 4ACPA 1I3VA 4JGJA 4K2UH 5KBNC 5DGRA 2IG2H 2VWEE 4MJ4A 3T0WA 1SVZA 1UJTA 3DV4A 4Z7UF 2Y06L 4GT7A 5D7SH 2MPAH 4KKAD 2G75A 4DFHA 4HK0A 3B9VA 1BVLB 5JR1L 1G9ML 2Y6SD 5EZOL 3C5SA 4KKAC 2I07A 3OG6B 2R0WH 4NO2A 3IGAA 2JCCE 1YMHB 3QNXA 1LE5B 1U8QA 1SJEB 2Y6SC 4IMLB 4P57B 4Y5YB 4L4JA 3U4BH 5KVEL 5CCKH 4NZRH 4X7SL 2R56H 5TE6L 5I1HL 4JRXB 5B4MD 4Z7NF 3WE6A 3GMOB 4X4YB 3U46A 4G8EA 3T08A 4PGDA 1NFIA 5B4MC 1ZGLB 1BBJA 2X1QA 1OAXH 1D5MB 5ISZE 5C6TH 4HBQA 5J1SC 4JO2H 1HILA 4OZGA 3AROA 1P7QB 5L2JA 4P2YA 3W5MA 3D39E 3FB5A 3GMRA 4JKPH 1EV2E 4O9HH 3OJVC 2P7TB 4XMPH 3SKUD 3DRTB 4DEPB 4X4XB 1T5XB 1DLHA 1N0LA 3KPQB 1WBYB 2Y36H 4XHJC 3HCVB 3L3JB 2XRAH 4WTXA 1UADC 2YD4A 2VDNL 1SYSB 4ZOBA 3OR6B 5CAYB 5KVMC 1OTTD 1ZGLP 5GRJL 4MJ5B 1OQXA 4BQCA 4O2CA 4IRZL 3ESVF 43C9A 1XMWA 4G6KL 1RFDH 2VXVL 1CIUA 3STLA 3D18B 4GRWB 5EBMB 5GRYA 2CIKB 1A1NB 4YIQA 1ORQA 3IYLW 3C5ZD 2KL6A 3L3HB 2O61A 1U8LA 3O9WD 4PJFB 1NGWA 3C5ZC 5D71L 1XF3B 4H1LG 1NCDL 1MF2H 3O6FA 1LP9E 4BZ2L 2N7AA 2VN4A 3RUGF 5GS1B 5I73C 4HUXA 4N8VB 5I71C 4YXLH 4LHUB 5KAQF 4X7TA 4NKQB 4NBYB 1RY7B 3O3EB 1UVQA 4RDQG 2ZSVA 2AJUH 2OK0L 2M8XA 4JPKH 4Y16D 2NY6D 4H8WH 3W11C 3MXVH 5CZXC 3MV8B 4Y16C 4X6DF 1FBIL 2NY6C 5IK3B 4HT1L 2OM5A 3VCLB 1OP5H 2KZWA 2VLRE 2BCKA 4KK8C 1QNZL 4Y8DC 4CUCA 2YWYA 5E8PA 1A6PA 5LGJA 5JDSA 2XXMB 1CU4L 5BW7A 5F8QC 1S5IL 1XAUA 4ALAH 4XAKD 1MVUA 1YPZA 2DM2A 1EFXA 5LQBL 1AQKL 1JGEB 3ZHLA 4LBEA 4P2QE 1JPSH 3MOBH 5J6HA 1FYHB 4KPHL 4MXVF 1O7SA 3KPSD 5D8JL 1F8TL 1ACYH 4JN2B 4LIQE 1SEQH 2YZ8A 3C2SA 3WXWH 2PW1A 5CIPA 1CFQB 1ZLVK 3ZL4H 4JM4H 4TTDD 4FQHB 2XXCB 4M7KH 3PWPD 4RNRB 2XTJE 4QTIL 4TTDC 3KG5A 3HI5L 1II4E 4Z7VB 5ERWA 2DQCL 1NCAL 4M6NH 5HYFA 1KIRB 3T65A 1IGIL 1KACB 3FQXB 1S9KC 5C9KA 4J3VA 2XYCA 4AL8L 3TA3A 1ZS8B 3UC0L 2EIBA 3BPOB 4HX1A 1CICD 4CJ0A 3L5XH 3QO1B 5TH2B 4K7FA 1CICC 4FS0A 4FZEL 4N0UB 1KPRA 1HK6A 2QLVB 2XY1A 4L3CB 1QFWL 2AJZA 4PJAA 2B0SL 4ZFZA 5C0CD 4HMEA 4Z8FL 4XCNB 4WHYH 4GW5B 1FG2A 1QQDA 1QO3B 1UZ8B 4YHYB 4JFEA 4AK1A 3NIGF 5HHQA 2HFGL 1KNOA 3S3SA 4LOUC 3EDKA 4LSSH 5F9DC 4LHJB 2R29H 4M93C 1IFHL 3OF6D 4M62L 5DWUH 2R23B 4C83B 5GRVK 2YD9A 4HBCL 1T20B 3KXFB 4UNUA 2NCMA 4HWZA 4OCYH 5IFHL 4TUJB 1X6LA 4AL9A 3Q3GB 4LKEA 1NFDF 4ODSH 4R0LA 4NGHH 5IKCA 5C0IB 2XFXA 4M5ZH 4GG6F 4JPWL 1QSED 2VERN 2Z31D 3GSRA 3MRMB 3SGDH 1HWHB 1I9IL 1ZT4B 2Z31C 4FFYL 4LKCA 4MNQE 4NN5C 3RWFB 1KC5H 4NQEB 3GJFH 5CGMA 1FVEB 5C0GB 1TJHH 3V5DA 5D72H 4L8DA 4PRNA 2UUDK 5B39A 1WCQA 2YMXL 4OM0H 2KZ1B 4PJEA 1YUHA 2IMNA 1S7QB 1KTDB 1XH3A 4LSRH 2Y5TA 4GO6B 1RZJL 1EJ6A 1SBSH 1MUJA 1CT8B 1PAMA 3BO8A 4M6OH 3WN5A 3CUPA 5TGBB 1FL3B 3WNNA 3W0WB 1LDSA 2GKIA 1JHTB 2DI7A 4F37F 3FO0L 3LRGA 3P30H 5ICXA 1FO0A 3B9EA 4FQLL 1NAMA 1W8NA 3QUXB 1RIVL 3ZSSA 1X6NA 5FA4B 4LASL 5T3XD 1EAPA 3KYKL 4JFDD 1PSKL 1CE1H 3CZJA 3VXSD 2VXUL 4JJ5A 3GIZH 4FZ8L 5T1KB 5DQJA 1ZT1B 2MSPA 3T0ED 4Q9QH 1JGDA 2CK0L 1HDMA 2IBBA 5GGSY 3ZT7A 3T0EC 3MRDA 4P46B 4PRPB 3FOLA 2D2OA 4K55A 3VWJD 1TQCB 4XVTH 5B39G 3JV4A 2YZ1A 4HULB 3VWJC 3LIZL 3RWDA 5JMRA 2X4PB 4Z0XA 3HC3L 4DGIH 1RZIB 3BRDA 2WQRA 3S98A 1JZ6A 1RULL 1HYSD 3JWDH 1J5OL 4LARH 1E28B 2O5YL 1NGYA 1AO7A 2EH7H 1S9XA 3VFRA 1HYSC 4CAGA 4ZTOL 3FB6B 3NTCH 2FEDD 4B7LA 3FQUA 3VXUD 2AI0L 2FEDC 5GGVL 5TQ0L 3RA7L 3EDJA 5CGTA 4ZXBB 1ZEAL 4X7FC 1T2QH 2LE9A 4HGWB 2W9EL 3O45B 4UOJA 4NN6B 3MR9B 3M17A 2D4FA 3BEVA 1JFQH 4Y4HA 5D1QA 3RL1B 4AMKL 4RRPA 1H3PL 1U3JA 1JYXA 4EN3D 5ID0A 2UZYB 3Q5TA 4NOBA 1NJ9A 1WTGT 2CH8A 4YBLB 4ESKA 1NLBH 3LY6A 5C08E 1MCBA 3V52L 3STZA 1WICA 2A83A 1LHZA 5D5ME 3ARVA 4DKFL 2RR3A 3AB0B 4L3ED 4LF3A 3GB7B 5DD5L 5L6YH 5I1GL 4PJGB 4FFZL 4KAQL 5H37G 4P5MA 4OKVA 4UAOC 4KTDH 5DK0A 4CDGC 1JNLL 4GSDL 3B5HA 3DVIA 1E4JA 4EOWH 2H8PB 1CK0L 2C4XA 3R06B 3VWKA 5KW9H 4EXKA 4ZD3H 3MGOA 4PJ5E 3RNKB 2CGRL 2OTUA 3BQUD 3T2PA 5J06A 2A77L 3MGAA 5F88B 4MS8C 3UTSD 1HHIA 4OKDA 4UNTA 2GK0B 4JDZA 4XHQA 4NZUH 1T1ZA 3BQUC 1CGWA 1UWXH 1R3JA 3CXDL 4Y1AE 3V0AC 2HRPL 5E2WH 3CD4A 5DHVA 4OZIA 3TYGL 4HWUA 2DQDL 5C09B 1OLZA 3UBXI 4XBPA 4D0DB 5GISH 2VZTA 1W0VA 3QDJA 4KV5F 1I1YB 4LVOC 4DAGH 1YECL 4LLVA 3ZTJG 5CBEB 4F3FA 2ADFL 5IJKC 3EOYG 1KPVA 3RIFF 4G7VH 3GI9H 5F7MC 1YDPA 4HH8A 2BVOB 4ZUUA 4EBQH 4KJYA 1DSFH 1MWAH 3F7YB 4U1LA 3QDMA 3UBXB 1BZ9A 5MEQB 4UU9B 4WJ5B 1IGTB 2F8OA 2A6JA 1UZ6F 4NHCH 1UYWH 3MLSL 3IF1A 3HE7D 2EDRA 4OCWL 4GXUN 1IT9H 1CZ8L 4AT6B 1B3JA 2HT3C 3HE7C 3JWOH 3ZDZF 3QQ4A 5JA9A 3MX0A 4P4RB 4WTZA 3WD5L 4GKSB 1FORH 2NY0D 3KDMB 3RX7A 1RUQL 1S5HA 2NY0C 4OLVH 5GS3A 5HGDB 2A6KB 1LO3L 1KEGH 4KMTL 3SE8L 3MCKA 3ARDA 2CUMA 2VQTA 1XIWA 3GZKA 3QHZL 3CC5B 2DYPA 3CVHB 3OKLA 3CLFL 3PWUB 5DK2B 3V6OC 1F02I 4H8WC 4PRHB 2DQUL 4HKBA 3T0BA 2YC1B 3VI4E 4KROD 3D69A 3KJ4B 1HHHA 3MJ9L 4HHAA 4TVPH 4NO0D 3ZT5A 2YEZB 3SOBL 3OXRB 3GI8L 4PJCE 4KROC 2MWCA 1AGCB 3IRZA 5HPMB 2CMRL 5CKAA 5LBSL 3FN9A 4S0TD 1FL5A 2OL3A 5EUOB 1G6RB 4DGVL 1HINL 3MRBB 4XXCC 2VISB 4N8CH 2HJFA 2O5XL 3DVGB 1HN1A 2H26B 5INDA 4IMKC 4WI6A 4FP8L 1QYGH 3FN0L 3WFEL 2HH0L 4CU6A 4YLQT 1ETZA 3SQOL 3FQNA 4JHAH 2A6DA 1NANI 3GK8H 3R0NA 1L9NA 1AP2B 4I48A 5EFIB 5IR1A 5F93C 2FJFB 2M1KA 4HLZG 5HY9A 1IKFH 5DXWA 2VDOH 2G9HB 1S3KH 4JZJA 1TZHB 1WWBX 1JNHA 2E6JA 3OR7A 1WZMA 3V8CA 5JUEH 2VDLH 4PV8B 1IGCH 1P1ZA 4ZTPH 3OV6A 5E1AA 4Y5XB 2FB4L 2PW2A 3NCYP 4I9WE 5CEZE 4UTBH 1W90A 2A0LD 1J8HE 1IAII 5GGUB 4JZNB 4OF0A 3FO2A 4JFHD 5EC1A 2C7UB 2ZNWA 1QKZL 5C7XH 2A0LC 4OLXL 2F58H 4KKNA 4WHTA 2P8PA 2F53B 5FCUH 3NFNA 3X3FL 4P5TD 4QOKE 1R24A 3F12B 4JKKA 5TPWL 4FQIH 5ESAB 4YPGA 1OSZA 4MCZA 4NQCB 2I25N 3ZKQD 2ESVA 4MQTB 3G08A 4P4KD 3VXNA 4YNYB 3WYRA 12E8H 4NT6B 3TBSA 3HMWH 1PYWB 2ZG1A 3TCLB 1JTTA 2FYYB 1P84K 1Y6NR 1X5IA 4X80H 5T1MA 5L9DL 4JO4H 1KLGA 4XBEL 4PGZA 3BDYH 1SJHB 2ORBL 3MNVB 3I6GB 3DPBA 7CGTA 2D31B 3P0VL 2C3WA 4S1RH 4PJ9B 3RRQA 3HI6L 1XGPA 4JG0L 2ID5A 3QDAA 3RL2A 1P4LA 3WO4B 3LAFA 1CFSB 4UV4L 4JFOB 4KUZL 2OQJB 4XNMA 1A7RH 4M1DH 4X6CE 3VXRB 1CFTB 5KVDL 3REWB 2BVQA 5IESL 3M1BB 3FO1A 1LILA 5K93A 3ZKND 3OJDB 2PTTB 1P5UA 3A6BH 5DZLA 4LCWA 4MQ7B 3AM8A 2XZCH 3ZKNC 5I30H 5HYQA 4Z77A 5ACZA 4DFIA 3D0VA 2VZOA 5DJ6B 1B0RB 2IQ9H 3BXNA 4KFZC 3IDIA 1H5BC 1BZ7A 1MHCA 3IFLH 4W4OC 3L6FA 4PD4K 1QPXA 2MTPA 5JNYB 4NM8L 2VDPH 4MD5A 4R7DB 3HPLA 1RIUH 3R4DA 2YXFA 2EEDA 1EEZA 5IGXH 3OAYK 4Y5VC 4D9RD 1VFAB 3EOTL 3VD7A 3D0LB 1U8IA 1I3RA 4EDXA 5D2NB 4J3TA 2IPUG 3DNKA 4OIAA 5L8LB 3Q48A 5JPNA 1VA9A 4R90H 1IAKA 1LK3H 2LAGB 3JV6A 2QKIB 1TDQA 2NZ9D 4HJJL 4WFHE 4YBQD 5J11C 3EYQD 1B4JH 1XF2A 4GKOA 4P23B 3QG6A 1A7OL 1HE7A 2NZ9C 4YBQC 3EYOA 3EYQC 1ORSA 4X7DC 1RK1A 4NDMB 3IXAB 4LU5L 2ZWLT 1NH6A 1TVHB 4M03A 1K6QL 3WFZA 3P77B 2FX9H 1R3IH 5EU4A 4ZPTA 1YN7A 2GITA 1YEJL 3BRGC 2AABH 3TT3L 5EORL 1S7SB 4HUNB 3FT3B 3ZTNL 3E2HB 5I1CL 1AXSB 1RJZB 3LVEA 5DD6A 3QFJD 2Q7YA 3C87A 1Q9WA 3HG1B 1CLCA 4MYWB 3QNYB 4JPIB 4ODTL 5D9SB 5EBWB 3JWDC 1KCSL 3MA9L 1LD9A 2XOTA 3N1QC 3IDNA 5ITBH 5I8OL 2IPTL 4YDVB 4YHLL 2GJZA 2E6QA 3QXUA 4U1SA 2APFA 4LKXA 5F7LB 1HSAA 4EI6A 1S7WB 4PJ7B 1HKFA 5MEPB 1T0NB 1NKRA 1RHHA 4NJ9H 4KVCH 2WP3T 2GJJA 1BLNA 3KR3H 5GZOC 3DI2B 4GXVH 1MH5A 2X4QB 4O4YL 1YMMA 3VFUA 5B8CA 4F9PC 2Y1VA 4S2SA 1R3KA 2FO4B 1KN2L 2YD7A 1G7LA 4NYLA 2BY0A 3VFMB 1VGKB 5FKAB 2QQNH 1A21A 5GRZA 4LLMB 1NMBH 5JHLH 3P73A 3L7FA 1T3FB 4H88H 4J3UA 2KUTA 2WUBL 2Y5EA 3C8HA 5FYKH 4EZMA 5J9PA 1I1AD 3ULUL 4M4PA 4JFXB 4LSPH 4QCIB 3CNKA 4O58H 4PJAE 2AS5M 1XGUA 3DO7B 1PEWA 4LEXH 2J88L 2LV4A 4LCYB 3UJIL 1UM5H 4PGCA 4PJ8A 3BIKB 5C0AA 4POUB 2BSSB 5F9OL 2V17H 3F7VB 4FXGA 4JFEE 4KJQD 1ZA3A 2YHGA 4PREB 3BEWA 2C3VB 1IGML 3HZVA 5IHUL 1P9MA 4KJQC 1FJ1B 4JKMA 1KEMH 5HJ3B 3UTQB 4MA3A 2BNUA 3RY4A 2PXYA 3ZYOA 5TF1H 3QULA 5HXMA 1CCZA 3ARPA 1CN4A 1YEFL 4MAUH 3LKNB 3QUZD 4EIZC 2UV3A 1ZOXA 4LLYB 2VDRL 3QUZC 2CKBA 1NCBL 4I3RH 3BGMA 5E2JA 4Z76B 4JRYA 4RISH 4XNXH 4LMQI 3QEGL 1DLFH 3QQ3A 4IM8A 5FYJU 1CFVL 3TNMA 4I0PA 4XCEB 1AY1H 1OT2A 3O3UN 3JWOC 2IGFL 3SE3C 2V2WA 1PFCA 4GBXA 5I1DB 2NW2B 1B0GB 4AEEA 2X4TB 2NPLX 5D7JB 2QQKH 1U93A 5I15H 1IEAA 3T4YB 4PJEE 1FVDB 4Y4KB 4Y2DD 3TBYB 2R9HC 1U8OB 5DLML 3ARGD 4UIMB 4XPFH 1CE6B 4XZUB 4Y2DC 5LWYL 4G43A 4A6YB 4PY8I 1QR1B 2A2QT 3ARGC 2PO6B 3TZVD 3PWJA 1ZVSA 4HW6A 3THML 5AZEL 1MLBB 3TZVC 2FH8A 3A6CL 5C0BA 4ISVB 4TVPD 5EUKA 3SDDD 3HAEH 3WEXA 4N8VG 2A1WL 3VE0A 5IB2B 3HZYB 4LHUG 2VLLA 1G7QB 2W0KA 3DWTA 3SDDC 4H5SB 5DGQA 3O2DL 3D1MC 1IZJA 5DFWH 4HIHA 1T03L 4XP9L 2HYMA 2YPKA 4BH7A 3G5XB 1CD9B 1UACH 2GFBB 1ZT7A 2B4CL 2XKSA 3DSFH 3QPXL 3SGEH 1C12A 2FD6L 4YDKL 5GGVY 2A74B 1HHJB 4XB7A 2ZUSA 2ICEA 2FATH 3RAJH 1PLGL 4U05A 1OAZH 4J6RH 1RVFL 1U3HA 3MMEA 1RIHH 3W9EB 4NZTL 4PJBF 4LSUH 1TZIB 1ZE3C 5J3HD 3P9WB 3O0RH 4PJHF 4KKBD 1FRGH 1Z0MA 1DQJA 5J3HC 1ND0A 4MZ3A 1AO7E 4AENB 5ALCH 1R3HA 4QO1A 3K2UL 4KKBC 3LS5H 5HGBB 2DM4A 5IJVB 1JPGB 5AYQA 5SWQB 3H2WA 1PVHA 2FJGB 4U6HB 5IUSA 5E7FA 3ZKXB 4IRSD 2A6IA 3MLWH 1KJ2A 3BT2H 1MI5E 4AEHL 2IC2A 3EW3B 4IRSC 3L3GA 1YY8B 3EZJB 3ULVL 4UBDD 3ISWA 5B38B 1MFCL 1WFUA 1KTRL 4LPVA 4MMZC 2FHBA 5F1IA 4F2MB 1R0AL 1GGCH 1X5GA 4UBDC 1N2RB 1TJGH 3C8DA 1U8JA 3CDFA 3HLAA 3TEUA 4R3SB 2VN7A 1OSPL 2DL9A 4M43L 5ACMA 3SY0A 3X12A 5IB5B 1ZV5A 4P2RA 4WU7A 4APQA 5I76B 4DQOH 2H9GB 5KSVA 3C2AL 4O5LL 4YHZH 3S36H 1KLUB 2XNAB 2V5TA 3HFMH 1DN0B 3C5ZB 4GRLA 5DVMA 5EO1A 3UPAA 4Z7WF 3R8QA 3CGTA 4KH2A 3O9WB 4U1HA 2JIXD 5I71B 1OPGL 4NUGH 3TJEL 3A0OA 3G5ZA 3LD8C 1H15A 1FGNH 5TDOA 1T1WB 2WZPD 5KSAA 4P5KB 2ZPKH 3G6JB 1QLEL 4PRIE 3FT4B 2R1XB 2I9LB 1JP5A 3U83A 4XMKL 3ZE1F 4Z5RA 2NY6B 5FO8B 3ARED 1W9FA 5D2LB 1RU9H 4L9LC 3LCYA 1D6VL 1AJ7H 3AS2A 2VLJE 4P9MH 3AREC 5CIPH 2BNRB 4QYOB 5IFAH 1KT2B 2CIIA 4GMSH 4J1UB 1W72B 1F6FB 4EUPA 3BN9D 4OZIE 3U2SB 3TV3H 1KENH 5E9DD 3TNNA 4K3GA 3BOVA 3MRGB 4OJFL 4FMKA 2X6MA 3QDJE 4WHDA 2DD8H 3SJVB 5EU5A 5C08D 4HCRL 3WJLC 4ORGB 4QXWA 2GJ6D 4JY4A 1VEOA 1RHFA 4N5ED 4YHMH 2AJVH 3VMOA 3QDME 2AEQL 1ZHBB 3KPSB 4N5EC 3VFVA 5DUPH 1PY9A 3DGGB 4HQQL 4I4WA 3R1GL 4J12A 4F7EA 4QRRD 4G8FB 4QRPA 4X6BB 4OFPA 1UEMA 4WENB 3U36A 4F8TA 2W0LA 1A6ZB 1QPPA 5H35B 3VFPA 3QG7L 3SDXA 3H3BC 3PWPB 4ZSOA 5C0ND 3P11H 1IGFH 4ZAKB 4Q0XL 4WWKB 5L2KD 1RI8A 2QR0B 4MJIB 1ZHNB 1JWMA 3TYFB 3X11B 1LO2L 1L6ZA 1L7IH 4PRAA 3H9SB 5BZWB 5KSBA 5EOTB 3GMQA 3CVHL 4XH2A 5CP3A 2VSDA 5DURB 1RURH 3CK0H 1F4XL 1CICB 3ARWA 5DJXB 3GSNA 3RGVD 2B1AH 3WV0A 1U91A 1GGBL 1OW0C 5LCVH 4KRLB 4F33B 1AXTH 4H25B 3RGVC 1P6FA 3C5JB 2VXQL 3IS1X 1IARB 2I27N 5TQ2H 2IWGA 5EWIL 3IU4H 3VW3H 2RFXA 1G6RL 4NP4L 4BKLA 4PBVC 3BIAX 1MCJA 4DZBA 3RIFK 4X7EC 4U49A 2D7TH 5C0CB 4PGBB 1BQHB 1EJOH 1K3ZA 4I18C 1XCQB 5HHOE 1T83A 3RY6C 3ALPA 3HMXL 3BDXA 5TF0A 3MZGB 4ODVL 5GSRA 4K3HA 3NH7H 1QLRA 1AGFA 2D0HA 1DVFA 4YHOH 1E4WL 3I6LD 3P0GB 5M7QA 3VI3E 5FOJA 2PYFA 4BA8A 3KPRA 1GZPB 3WFCH 5GJTH 1HIML 3WCYA 1LNUB 1OCWL 3QXVA 2L7UA 4YAQB 1V7NL 2J6EL 5D7LD 3MLZL 1BJ1J 2FX8L 3KPNA 1QVOA 2X2YA 4MCYA 1MHEA 4I3GA 3S35X 5MEND 1NAMH 1DFBH 1JF1A 4X4ME 2C4FT 1I4FB 5FK9B 3BKML 2FL5B 4ETYA 1JGLH 2ED7A 4NC2B 5SWZA 3CSYA 1DJSA 1J05B 1IAIL 2J8OA 4F7PB 1A7PL 5LXGL 5FYKD 3TO2A 2GUOA 4G42A 4MB5A 1WVZA 2ESVE 3GSOB 4D2NA 2H1PH 4R4BA 4K3JH 2ADIA 2QSCL 3EOAA 3P4MB 1JN6A 2LTQB 3B2VL 4PJDE 5FHAH 3U4EB 4NNXB 1P69B 1N59B 1CGUA 4DVBA 5IQ9A 4KZEL 2X4NA 4BFIB 4P3CH 4D0BB 3I02B 3QJFB 2CPCA 2XPGA 2CLRB 4YE4L 3FHQA 4LVHB 5CLWA 2NTSP 3EO1B 1E4XI 1TZGH 4HPOH 4UT7L 1NBZB 4I9WD 4L8SA 4LK6A 2YN5A 2DLEA 3VXSB 1TFHA 1JZ3A 5E8NB 5FUCE 4HKJB 4BSJA 4X0KA 15C8L 3K80A 5F96L 3PHSA 4LL9A 5TE7H 5JOFA 1N64H 3VXQA 4QGTA 3QI9D 3WKML 3PL6B 5HDBF 2NLJA 2YD3A 1A4KB 3FO9A 3QI9C 3NCJH 2F54A 1F90H 4L8CA 3BPNC 4OCSL 4PRDA 1O7VA 4GLRI 4NO5B 4E42A 1UENA 1CDJA 2E9BA 4P3WA 1X5XA 3VFSA 3N9GL 1WT5A 5DJDA 3HUJF 2R0LL 1W0WB 3QAZB 1KTKE 3E3QC 4QHMB 4XPTL 4OIIL 4I0KA 4HH9A 1HOCA 5EC2B 2CJUH 3OKDB 2JB5L 3NIDF 1RUAL 1Q9OB 2UWEA 3UBXG 3UX9B 2P8MB 1XT5A 1V5JA 3MV9A 4OZ4A 3DUSA 4FQXB 4Y89A 1OAYH 4MSWB 5JW4Q 4GKNB 4O2FB 4RFEA 3UO1H 5DYOB 4XC1H 3PGFL 1YNTB 5T1DL 2DJUA 1R5IA 5ENWB 1LEGA 3MYJA 2A73B 2ZOKA 1JUFB 2PYEA 4ONHB 1QEWA 3S7GA 1CF8L 3VGGA 3QIUC 4M7ZC 3VRIB 3HNSL 4P99A 4EN3B 3QPQD 3KPPB 1BM3L 3B3IA 2ADGA 4XNYL 3QPQC 1UXWA 4XI5D 2J8UF 3WNPA 1R6VA 2VE6A 1ZMYA 3G6AA 4OD2A 2JELH 3GJFK 4XI5C 5GGRA 2APBA 3V4PH 1G0YR 4ZMAT 3GBML 3O8XD 4C4KO 4MXWL 2VH5L 3I6KA 3X3GL 3S37H 4LSVH 3W9DB 2VQ1B 3O8XC 5ICYB 3HTLX 1JV5A 4UDTB 2X4SA 4G5ZL 3AMKA 5HVWA 3NCEB 4KI5E 4FNLH 2QBWA 2ZCKL 3BQUB 4HC1L 5DJ8A 2Q6WB 5I1EH 4F7CB 3FZUD 1U8HB 5A3ID 1Q0XH 1P4IH 2XZZA 4XX1G 1MJJB 3K4AA 3S35L 2J1KA 4UOW1 4ZDHB 3MRLA 5A3IC 3HNVH 4LVOB 3RTQC 4NKIL 4BSWB 1G1YA 2ARJQ 2IF7A 3GRWH 1T04B 3DECA 1L9MA 3MACH 1YNLH 5JW3H 32C2B 3D2UD 2DQGL 3QDGD 4LAJH 3HR5A 1YMME 3PV6A 3NZ8B 3T3MF 2ZCLH 4F7TB 1UGNA 3HE7B 4HKXB 3G5YA 3SDYL 3QA3A 4BUGA 4NRXB 2AJSL 1B6UA 4WCYL 2IH1B 2HT4D 4JN1H 5J89A 2HJKB 1AFVL 1JGVH 1I8MB 1Q94A 1GPOH 5FHBL 5EO0B 5CINH 3K46A 3K2MC 2OL3H 4K3EH 3T2NH 3AS0A 2EECA 2IQAA 5I6XC 4GG8B 1JVKA 5I74B 3PUCA 2EEAA 3MLTA 5DD3L 2A9NH 4YWGL 3VXTB 1G0XA 1FGVL 1IC7H 2V5YA 3VDAA 4R2GD 1F4WH 4QT5B 5E00A 1MRFL 3MV11 2R69H 4Q7DA 4R2GC 4GKZB 3OX8B 4ETQB 5C0AE 4HFWB 3VG9B 4OTXL 1AD0A 2HFTA 4GRWE 2Q20A 3O6MH 3G6DL 1G7IA 3QXDB 2FIKA 5ADOL 1G7JA 1MQKH 3RWEB 5DSCB 3O4LA 1JPFA 3MRCA 4BQ4A 4PGEB 1FHGA 1OF2B 1YZZA 1E27A 4PBWD 1N7ML 1F4YH 4PS4L 1C5CL 3D9AH 1J12A 4OGAC 5EZLB 1NBVL 1KIQA 3TA3D 4K94L 2ZCHH 4LLQB 3IFNH 2OX5A 4UI2A 3BGAA 5F1KC 3TA3C 1PZ5B 2ZKHL 4Z7OF 3MBXL 3KHQA 4L4VD 1GRWA 1SVCP 5HDQH 5KS9F 3EFDH 1PX4A 2V7HB 5I1LB 1T1XB 2E9JA 3MV8E 4JRYE 4B50A 4RQQB 1RZKH 4LFHD 1F6LL 2HRLA 1LO4L 3SGJC 2QSQA 4U7MA 4ZYKB 3IJHA 1FL6A 1KB5H 2EZ0D 3I85A 3L3DA 1A2YB 5C07D 1YN6B 2M2DA 4DN4L 4D3CH 3LKQA 4JFED 2EZ0C 2NNAB 3H7LA 1WSST 2MQ0A 4A6YL 4X6FB 5HI3C 1T4KB 1EXUB 5CEXB 2XI9A 1K4DB 2H32H 3DYMA 4JO1L 2IADB 4DCQB 3P4OB 3D87B 1HEZA 3PHQB 1UWXK 3UTOA 4LDOB 1I8IA 2XZAH 3MPCA 5EIIA 2AGJL 4P5TB 3O3DB 2KPNA 1I7RB 3IU3A 5C0BE 4ODHL 2ZSWB 4GH7B 3QXAA 2R2HA 4P4KB 5I17A 3PGCB 1T7VA 4GMTH 1INEH 4M02A 3QIBA 5C0EA 4U1KB 1R3LA 5F6IB 3DTXB 4IS6B 1JWUB 4R0LC 5DRWA 1AQDA 5DDHA 3MRFB 4BK4A 5BRZB 1AD9A 3DURA 3AAZA 1JWSA 4OD1H 4JQXC 1FYTA 1GOGA 2ADJA 3BZ4B 3QUMA 2MCPH 5D7IF 5ELIA 5FO9B 5EOQL 1WFOA 1DL7H 5EO9B 3VFGH 1F3DH 4JGMA 4OQTH 2VLMD 3SGDI 1NAKL 3E8UL 4PJXF 3NN8B 1W8WA 1YA5A 3ULUE 2X7LA 2FR4A 3H9HB 2J4WH 4M7JH 4KVNH 1GAFH 1JCKA 5C0DA 4HUUB 1YQVH 4H0IA 4M7LH 4LSTL 5DJZA 4EI5B 1LEKA 3NFPA 1UQSB 2FDBP 2YUXA 3ZDXE 9CGTA 4RMVA 1QBML 2D7PA 4KKLD 3L95A 7FABH 3BH9B 2F19H 1FPTL 2QHLA 3MLRL 4RSVA 4XCYB 5I1KH 2D7QA 2Y7QA 2NTFB 4BZ1H 2I9TB 3PGDB 4ZG1A 5D1ZB 1KIPB 2JCCB 4RAVA 3MRJB 3Q1SH 3SGKA 5BMFL 2DLIA 4HWBA 1A3RL 5DJ2B 4Y5VB 2K7PA 4CVUA 4GAGL 3F7RA 4X9IA 3BUYB 1U6AL 3HE6A 2PR4L 3WDHA 1DQQA 4M1GH 5JW5A 1CXLA 3C6LA 5ISZB 5SV4A 3LSOB 1U8MB 1V0AA 1AO7D 3RZWA 4KMLB 1JF6A 2NY5L 1SY6A 3D39B 5LJYH 4M1CD 1NEZA 1EVUA 3P2TA 4TUOA 3BD5A 4M1CC 5H8DA 2X44D 2WBKA 4P2OA 1XGRB 2ZNXA 3V5KA 3QEHB 2EDTA 1EZVX 4WW2B 5SWSD 3W0WE 4MA7L 3ARQA 2BY3A 1BGXH 2UVFA 1W72L 5DHXB 3OAUH 5C71A 1LO5A 1N3NB 3TBVB 1I75A 4Y4HD 5F7FA 3QFJB 3V5HA 1K4CA 2VZSA 4Y4HC 4M48H 2HFEB 4Y19D 4ZUTB 1VFBA 4QKXB 3SQBA 1VKXA 3CXHJ 4Z7UA 4DWHA 2K46A 4OB5H 2P42B 1U8KB 2ITDB 1AGDA 4N0YH 1RUPH 3AUVA 4UT6L 3JV5A 3ZE2F 4ZUVB 1C5BL 1T6WA 3VJ6B 3Q6FA 4RGMC 3N85H 2IH3A 5D93C 4JO3L 2AV7B 2CUHA 3SDXE 4M6AA 4ZSOE 3F58H 1AIFB 3RIAF 1VADB 2X4RA 3LEVH 5ESVB 2W59A 5I8EA 4NBXB 3DV6A 5KSBE 1K8DB 1RJYA 1VGEH 5FF6B 3UYRH 1A6AB 4JB9H 2DOCA 5AWNH 5HHPB 1EEYB 1NBQA 1HXYA 3QUKA 1OB1B 2I5YL 4ZOAA 1VPOL 5ETUB 1RZ7L 2DN7A 4V2BA 5DMKB 1W0YT 1UM4H 1I1AB 4WW1B 1OM3H 4ZS6D 4QTHA 1FZMA 3UXFA 3GSXB 4YH6A 1A1MB 3U9PH 3UJTL 1MCOL 2NZIA 4ZS6C 4P2QB 2CKNA 2CKBH 1T21B 1ONQA 1N4XH 3O3AB 2BMKA 3V4UH 4FQCL 1I9RL 5INCB 5KJRH 2QSVA 3L3KA 5E2TH 2WBJD 1M1SA 1WZLA 1AHWB 5BZDB 3RU8H 3GSVA 4L8BA 2H2PD 2WBJC 5HYSB 3MRIA 3OXSA 1Q1JH 1B2WL 3B9KA 4JZOA 2H2PC 4XP1H 2DQTL 3CX5K 3LZFH 3U7WL 5GRWA 4PJGE 4R4ND 3KLAA 3RUGA 3KPRE 4WHCA 3ARDD 3QUZB 4AM0B 4R4NC 1J0ZA 2DYPD 1WC7A 1JTOA 3ARDC 3S4SA 2HFFA 5F6HJ 4P9HH 4Y16A 4LRIC 2E7MA 5D7KE 2RIKA 3FQWB 1F4HA 3EYUH 2NY2C 1DE4B 3N0PB 3MRRA 4X6DA 2V2TA 4FQ1L 3RWCA 2WK2A 3CMGA 3EYSH 3MRQB 1YNKH 3VFNB 1CL7I 1OAKH 3F95A 1AI1L 1FDLH 5B38G 4HIXL 1Z3GH 1XGQA 1KN4H 1NFKA 1FZJB 3VRJB 2YRLA 5HDLA 2SEBA 3FAWA 4G6AC 3QQ9D 3UTZB 3CMOL 3WIIH 3TO4D 1FVCA 5CJBA 2XA8L 1ZAGA 3QQ9C 4YO0B 4KZDH 3TO4C 1RUKH 1A22B 2YRZA 2XKNA 1EK3A 3TZVB 2X4UB 3IXTA 3J7HA 5BVPL 4G9DA 3RWGB 1TNNA 5BQ7A 1OD7A 1X44A 4JG1L 3RPKA 1BD2A 5FO7B 2HVKB 3LV3B 4I3SH 2JE8A 5T3XL 3SDDB 3MRNA 3S96A 5KAQG 5IVXF 1HQRA 3CFCH 4HIJA 5E5MA 3IDGA 5IB3B 4ZFOB 3RVTD 4Y4FA 4UILL 2YBRB 2AXFA 4H26A 1E4XL 3MTRA 2CQVA 2ATPA 3RVTC 3EHBD 3MODL 4M61B 1OT1A 4WI8A 3IDMB 5BOZG 5E6YA 3PF2A 1IAOA 3I3EA 2XACC 3OZ9L 1TCRA 1ZVYA 1PDKA 3EHBC 3KPOB 4RFNC 2F54E 5E4EB 4K8RH 5FECA 2YPVL 1O0VA 3I50H 4XP4H 3KS0J 3SKOB 4XVJL 5KVGH 1PG7L 4ODUA 4FXKA 1RZKC 2DLHA 1FFPA 2P46B 5IBUB 5A2IH 2NW3B 5D6CA 5IBTH 1C1EH 1F6AA 1BAFL 3K4DA 4HS3B 5K33A 4OZFH 5HYIA 3PXJA 5IM7A 1MFAH 2UWEE 3D25A 3T1FA 3CFDB 3MV9E 1FNGA 3PE9A 1JJUA 4QY8B 2EYSA 1ZSDB 4IRSB 5EZJB 4B5EA 3C08L 3CFEA 1FN4A 4XP6H 1A0QH 1WUNT 5ICZB 3H7BB 1I7ZA 4DN3H 4OT1L 3OF6A 4TNVF 1IC5L 2D03L 4XX1E 1HKLL 5IB4B 4WDIA 4R4FL 1NMAL 2VRAA 1KTLB 4OM1H 5IIEB 1LP9F 2PYEE 5GJSH 1NGQH 4GUPA 1DEDA 5ESQA 1NFDA 1SM3H 4OF6A 3D85D 1I85C 5EN2B 1KXVC 1MHHA 2ICWA 4P57A 3ZHDA 3K1KC 4NPYA 4GG6A 1QSEA 2R0WL 2Z31A 4LSQH 1M71B 3CDGB 2PCPB 4CMMB 4EUPH 4LCWD 1JK8B 2AJ3B 1A9EA 5GGQL 1TJIH 4JFYA 2IBGA 4G9FD 3VG0H 1FNLA 1KGCD 4WUUA 3U4BL 5BS0D 5CCKL 4NZRL 2JIXB 3GSUA 4PB0H 5IVZA 4XNUH 2R56L 3ZE0F 3LKRB 4F57L 1XF4B 3MLUH 4PRBA 1DEEA 4TPRH 1WWCA 1QG3A 2Z92A 2GCYB 4N9OB 1A6TA 4F8QA 1MQ8A 3F62A 4L9LB 1XF5A 3MREB 4JO2L 2NX5D 3RHWF 2HAZA 4ODXB 2VXTH 4JKPL 4K07A 5F44A 4W6YB 2V9RA 3WUWA 1A7NH 2P24A 4XMPL 2APWA 3LS4H 2J5LB 3ZZ1A 3OJ2C 2B1HH 3KLSA 3PP3K 3GMPB 1CFBA 5C3TA 4ONGL 4LPWA 3HI1A 2XRAL 2EC9U 3FB8A 2JWPA 5E9DB 1MY5A 1F97A 4ZS7H 3WL9B 5K9KB 2O93L 2AJXH 1ITCA 4NQXB 4JFDA 1S9VB 2DLGA 5C08B 5J12C 1J18A 3TBWA 1RFDL 3FONA 3OB8A 1S9YB 2R0KH 3KYOA 5D5MB 3T0EA 4DJMA 3TESA 2VB5A 1D5XB 1WCBA 2OTWB 3EO0A 3KPLB 5DUBB 4HXBH 2IFFL 4QRRB 3MUZ1 3VWJA 4G6JL 1CR9H 3LKOB 4NUJB 3BHBB 3VU2A 1HNFA 2WQ8A 3DX9A 4YXLL 4O51A 3AY4A 1UKSA 5L2KB 3ETBF 4WFGD 2A9MH 4JPKL 3QHFL 3MGTA 4C56A 4Y1AB 3WNOA 3MRHA 1IILE 4PR5B 1YEDA 4ORZC 4AJ0A 4PJIF 3NACH 3RGVB 4HLJA 3MJGX 3P9MA 5CUSH 1Y18B 3VXUA 4OLUH 3ES6B 4QXTA 5J1AA 3OHXA 3V6BR 5I8KH 5I18H 3EIFA 5K9OA 5I1JH 1ZHKB 4U6VL 3EJYD 4ALAL 5B8CC 1BOYA 1E4KA 3CZFA 3MV7D 3EJYC 1NMCB 4MDJB 5SX4H 5FAAA 1JPSL 3BSZH 3DMMA 3MOBL 5KN5A 1OGTA 2ZUUA 1FFNA 3ALXA 1A6VH 1ACYL 3ARBD 4XCCH 1CFQA 2HN7B 3BP4A 4UUJA 3HN3A 4ZOEA 2VABB 2CLZA 2D7NA 3BKJH 4QHLB 3Q0HA 3QCTL 5DFTA 4FQJL 3ARBC 1EERB 3P4NA 1T80A 4Q6IC 4YX2L 3IKKA 4YDJA 2IANA 4L3EA 3ZL4L 3CFBB 2R8SH 2AXGB 4NKDB 2VDMH 4OD3L 1LO0H 1VESA 1H3TA 1RMFH 4M5YH 2DL2A 2GT9B 3PIQB 1KCUH 1DZBA 4S1QH 5D7LB 5IMKA 1WBZB 5C0AD 5GGTL 1K85A 4NQVA 5KG9B 3QO1A 1I1FB 5MENB 2AV1A 1X7QA 1X5ZA 4WI9A 1VACB 4PJCB 3UTSA 4TNWK 3L5XL 4K23H 2MHAB 1P9MC 1ED3B 3OKMB 4O2EA 3JTTA 3VA2C 1XR9B 2PXYD 4G80A 3NGBC 2MQ3A 5HGHB 4XMLL 5JORB 3MJ8A 1ADQH 1FV1A 2PXYC 3IDJB 2VAAA 3NZHH 5DS8A 4HZLB 4EDWL 1J8KA 1EGJH 3FT2A 4PJ7E 1NDMB 5DEFA 4Z0BL 5IJKA 5B3NA 2VIRA 4YPJA 3EDEA 2R2BA 2FWOA 1RV6X 4PY7A 4UIKH 3PABB 4JRYD 2DQIH 2MQCA 4I5BA 5FUZL 5LGHL 5DC9B 1N5YH 1FYTE 1UFUA 2HJLB 2JJTC 3KLDA 3H3PH 1A1OB 1U0QA 4KY1L 5HI4D 3NCFB 2W0FA 5DWUL 4JCMA 2JK5A 5MEOA 1KFAH 4JQVA 5HI4C 2Z4QA 3QQNA 2YUVA 1YEEH 3H6JA 1JHLH 2F5AL 3LEYH 5C0IA 1J8HB 3AXLB 4M6MH 2AK1L 1MEXL 2D7MA 4X5WB 1QSFD 4XNQA 2C1PA 3GM8A 3ET9F 1LGVA 4ODSL 2Q3AA 4ELMF 3OGCA 2DMCA 3QI9B 2VITB 4M5ZL 1DQLH 2WP3O 3BPNB 2J12B 4QOKB 2AK4D 1Z9OA 3V6OA 4XP5L 4PTUB 2JF1A 4P9HC 1JPTH 4MX7B 5JQ6H 5FM4A 2BOCB 5D72L 4I8DA 1ES0B 2DMBA 2ZOLB 4NO0A 4NZJA 1LDPL 1QTYT 3RJQB 4GAYA 4OM0L 4NC1E 5JR1H 3DV4B 5EZOH 2L7JA 3P9LA 3MO1A 2G75B 1UH2A 4LSRL 3K8KA 4HK0B 3MC0A 5DMYA 3C5SB 2I07B 4NO2B 4PUBL 3IGAB 3WSQL 1U8QB 2Q8BL 4XPHH 3VDCA 2H45A 4YDLC 1G9NL 2OS7A 1DQTA 4ODWA 4CN6A 1NUGA 1NCTA 3WE6B 1U3HD 3U46B 3ABZA 4G8EB 4PGDB 1NFIB 2Y07L 1BBJB 1U3HC 1A6UH 2Y9RT 2EDDA 1RJLA 3G5VA 3MCLL 5FB8A 1FFQA 1HILB 2WV3A 4OZGB 2DQJH 5L2JB 1DBKH 3FB5B 3GMRB 4HMDA 2CDGB 2YD2A 1GGTA 2EXYC 4C55A 4LJHA 1NEUA 3IETA 1DLHB 2VDNH 4N68A 3KNBA 5KOVC 5SX5H 2W92A 3S34L 1NCNA 1QHOA 2CLVA 4K8RD 5DD0L 4IRZH 5I0DA 2AERT 4G6KH 4Z7QE 2VKWA 4K8RC 4DGIL 4O2CB 1D3CA 43C9B 3FRPA 4LP4A 3VGHA 1KCKA 4P2RD 3JWDL 3STLB 5HDOA 2EE3A 2VXSH 5E0QA 2DWDB 1QLFA 4YIQB 4P49A 1ORQB 2P5WA 5D71H 4GRLD 4UT9H 3F8UB 4LPXA 2O61B 4Z7UE 1U8LB 4XAWH 1NGWB 4ERSH 4E41A 5ADPH 4I0CC 3O6FB 1N5AA 3U30C 3BZFA 1T2QL 4NKMA 3TCXA 2OK0H 4HUXB 1VFOA 3FFDA 4RIRA 5KSAD 4WTWA 3C6SA 4X7TB 4MA8L 1UVQB 2FLRT 2H6PA 2ZSVB 2XWBA 4FFWD 5KSAC 1JF5A 1K2DA 4HT1H 4FFWC 5CILH 5EOCJ 5KOMC 4LCUA 3RPIA 5AD0A 5L88H 4U3XA 4DOHB 1NLBL 1FAIH 1AH1A 3UYOD 2BCKB 5CZVL 4XBGA 4QLRA 5IBLD 1S5IH 5E8PB 3TFKD 5LGJB 5I6XB 2B5IB 5L6YL 5JDSB 1P4BH 2Q3ZA 3O6KL 5B3JE 3GJFA 3FRPG 2HTKD 1MVUB 1H5BA 1EFXB 5D8JH 2HTKC 4W4OA 3ZYZA 1F8TH 2NY1B 1CQKA 4LBEB 3BKYH 4LIQL 5J6HB 4WHYG 5JA8B 4TVSa 4HPYH 5GHWL 4NHUA 1J7VR 2GSIA 5C70A 3X13A 5ACLA 4HD9A 2OTPA 2HMID 3V95A 3BRFA 2PW1B 4M8VA 4QRPD 2AJYL 2W9DL 5CIPB 1EX0A 3RNQA 2HMIC 4F9LA 3HI5H 2DQCH 1NCAH 2DTSA 3CCHA 3WIFA 1CGTA 1IGIH 5MHSD 5DQ9A 2CDEA 5ERWB 4TSCL 4AL8H 1B90A 1Z5LA 3T65B 3RIAK 4H20H 3TA3B 4HX1B 3TPUA 4LPTA 1DSFL 4KQ3L 3G6JE 1P5VA 4NHCL 4K71C 1UYWL 4K7FB 3GM0A 1B6DA 4HV8B 4FQ2L 5D6DC 1QFWH 3VDBA 5D2LE 4NQDD 1KPRB 4X6DE 2C3HA 3QCVH 2VXJA 1DBJL 4XPAH 2P8LA 2AJZB 4Z8FH 4PJAB 1H0DA 3ZHKA 4ZFZB 1FORL 4GS7B 4LGPB 5DRXA 2HFGH 2DTML 1FG2B 1QQDB 4WFFD 1CL7L 4OLVL 2VL5A 4JFEB 3RX5A 1KEGL 4JANA 5HHQB 2FZ3A 1KNOB 4YR6A 3S3JA 1IFHH 3DX7A 3QUMH 1T83C 4XVUD 4XAKE 4M62H 4XVUC 1T0MA 3KHOA 4YHKH 1XZ0A 5J0BA 4CNIA 5IFHH 3KPSE 5DRZA 5E2UH 4TVPL 4OFVA 1YEGL 5FDYA 4HWZB 3DOSA 5I9QC 4YW7A 4JPWH 5DJ0A 4GW1A 5IKCB 3OAZH 3WJJA 4ZFOL 3QFDA 1DR9A 2XFXB 2JKXA 4OLYL 4JM2B 3GSRB 3PWPE 4Z95L 3EO9H 4F9PA 1MCWM 1ZXQA 4LKCB 4X6EA 2P5ED 3T0XA 3OKYA 5SWZD 4JHAL 3V5DB 1BVKA 2YMXH 3V0VA 3LN5A 4L8DB 4PRNB 1TZHA 1A6WH 5B39B 4MNHA 4X6CF 4OBSA 4PV9A 4NFDA 4PJEB 2F74A 1YUHB 5FA3A 1M6OA 1XH3B 2LVEA 2Y5TB 1MUJB 2G5RA 1IGCL 3BO8B 1FH5L 3WN5B 3CUPB 5GGUA 4HWBH 3FO0H 3WNLA 2EIZA 4FQLH 1GZQA 1CIDA 5MERA 1J1XH 5C0CE 4N9GA 5ICXB 1FO0B 3NVQA 1NAMB 4LASH 1IKNA 5EA0H 5GZND 1J88A 1PSKH 2N4IA 3NIGE 4FZ8H 2FO1A 5GZNC 4LLDA 1EAPB 4YNYA 2CK0H 3FMGH 1FP5A 4JJ5B 4G7YH 1W8UA 5HHVL 5DQJB 2F8XC 1XGTA 1MIEH 4N0FA 4HUWA 12E8L 3HMWL 1JGDB 5ALBL 1HDMB 1KXTB 2X41A 1PG7W 4TRPL 1BFOA 3MRDB 1S7VA 4L29A 3FOLB 1U3YA 5BCAA 1NFDE 4JO4L 4WI2A 3HC3H 1MWAA 2EE2A 3BDYL 1QSEE 3JV4B 4FABH 3RWDB 4Z0XB 3UTTA 3K8LA 4CP9A 2O5YH 1KULA 3SE3A 1TTUA 1FIEA 4OBRA 1WT5C 1EBAA 4QEGA 1NGYB 1AO7B 3ALWA 5IMMA 1U8NA 5K59E 1S9XB 4L4TA 3VFRB 2AI0H 2LVCA 3V2AR 3RA7H 5TQ0H 4MWFA 4KKCD 3FQUB 4Y2DA 1A7RL 4M1DL 2W9EH 3ARGA 4LPCA 5FOBA 4KKCC 3S5LA 4L3AA 5HYSG 1IC4L 1OWWA 1D9KA 4JFFD 1TCMA 1CDGA 4UNVA 3M17B 4TNVK 2XZCL 4LSDA 2B20A 4MVBD 2HLAA 3BEVB 4Y4HB 5D1QB 1K8IA 3GMLA 4W6WB 1N6QL 1PD6A 3EYFA 4G8IA 5ID0B 4MVBC 1ACZA 3V52H 1NJ9B 1CS6A 4HJ0D 4JFDE 4UQ2A 1P53A 3N1MC 3VXSE 1MCFA 1NC4D 3STZB 5I1GH 1FCGA 2VLKA 2A83B 5T3ZH 4HJ0C 3T0EE 4FFZH 4LF3B 4J3WA 5D2NA 2LU4A 4RGMB 5IGXL 5A16A 4I2XA 2NY7L 5D93B 4P5MB 1CK0H 4OKVB 5DK0B 5DUML 4U4BA 2R0ZL 1LK3L 2CGRH 2GTWB 3VWKB 4QRQA 4XRCA 3RDTC 1UH3A 3MGOB 1T2XA 3GIVA 4LVNC 4ZFFA 2F9BT 4RMSA 4PJBA 2OTUB 3CXDH 1GVIA 4X4ZA 2HRPH 1HHIB 3ECBA 3K0WA 3D3VD 4JDZB 4OZHF 4PJHA 3HR6A 4WEUD 1T1ZB 1HXMA 4C56E 1R3JB 5DO2D 3TYGH 3RZCA 2DQDH 3U1SL 1GOHA 1UJ3C 3NOIA 5DHVB 5DO2C 4OZIB 4JQIL 4XBPB 3VH8A 1W0VB 3QDJB 2ADFH 3VXUE 2AABL 4NWUH 1D5ZA 4LLVB 3PP4H 4F3FB 1DUYA 1KPVB 1TENA 2BERA 3WIHL 3MLSH 5KVFL 3IKCA 4ZUUB 4KJYB 4OCWH 4U1LB 1CZ8H 3NA9L 3QDMB 1BZ9B 3Q2CA 1NL0H 2A6JB 1GWKA 2WAHA 3IF1B 4XVSL 5CHNA 2DLFL 3DARA 3DX8A 3G9AB 3IDYC 3CFJA 3WD5H 5JZ7D 2I26N 3QQ4B 1RZFL 1C5DA 3MNWA 1P84J 3U48A 1RUQH 1JI2A 4Z7WA 5DI8A 4JM2F 5IEHA 2HP4A 1S5HB 4KMTH 3SE8H 3GKZA 4L3EE 3MLVL 2AQ3A 1SYVA 2EDXA 1IE5A 4GXVL 3MCKB 3ARDB 1XIWB 1JIBA 2DQUH 2DWEB 2DYPB 3OKLB 3WMSA 3MBEB 3RVXD 3GI8H 4HKBB 3V4VH 1Z2KA 3U0PA 5IMLA 3AREA 3D69B 2J7LA 2QQNL 3VH8G 1NMBL 1HHHB 3RVXC 4HHAB 3O4LD 5JHLL 5HHMD 5LBSH 4G8GA 3MROA 3UTSE 1NQBA 4IJ3C 4JJHA 4DGVH 1HINH 4NM4L 4XXDA 4U1MA 3WHE1 1FL5B 2OL3B 2O5XH 2D0GA 2VC2H 2WLYA 1EHAA 2L0DA 4LCYA 4LSPL 3FN0H 2HJFB 4O58L 5F1NA 3S36X 4KV5E 2NY3D 1RK0A 5INDB 5E03A 4LEXL 3RI5F 2W65A 4OLEA 4JE4B 4PY8J 1ETZB 3FQNB 3BUTA 2A6DB 2NY3C 1PBYA 2DIJA 2GJ6A 4I48B 5IR1B 2V17L 3REVA 4RMUA 5HY9B 2Q76A 4PD4J 3UTQA 1UZ6E 4PP1D 4JZJB 4YUEH 4R8WH 1JNHB 1NSNH 3OR7B 2BNQD 5CSGA 3RQ3A 4PP1C 1LVEA 3ZDZE 4M7LT 1P1ZB 4V1DA 4OCXL 1DUZA 5E1AB 3SE4C 4MJ2A 5CEZL 5IQ7H 5TF1L 3IB4A 2PW2B 1QKZH 1LEIA 4OLXH 3SN6N 3MXWL 2CRMA 3FO2B 4RWYH 5EC1B 5I1IH 3X3FH 1EO8L 1M7IA 4WHTB 4AY0A 5FV2A 5D1XD 2P8PB 3CU1A 2FLBT 3EKCA 3NFNB 4I3RL 4M00A 1R24B 4RISL 4JDTH 3V6OE 1OW0A 5D1XC 1WWAX 4HJGB 1OSZB 4MCZB 3OMZA 4X99A 4YPGB 4X5XA 1J10A 2ESVB 3G08B 1B88A 3VXNB 1AY1L 1TNMA 3TBSB 3QIBD 2BP3A 3OL2A 1WEJH 3WS6C 1F58H 3DGCR 3QIBC 2YOCA 1MPAL 1VENA 3QRGH 5T1MB 4I18A 5E8EA 3FOMA 1OTUD 3CAFA 4MJ6A 3RY6A 1KLGB 4XPFL 4U1JA 3SO3C 3EJJX 2Q8AL 1J1PH 4ZUWA 1IM9D 3IAPA 4Q97A 4JG0H 3GJEA 2GTZA 2DIBA 2LABA 2Q7NA 5IB2A 2FIRT 4FFVD 4UV4H 1XGPB 3RL2B 1P4LB 2R2EA 5GS0H 2C24A 3EGSA 4TULL 5KVDH 1ZWIA 4LQ1A 1FSKC 2HG5A 1CBVH 1G1CA 5JXAH 4XNMB 4KRMB 5IESH 5IG7A 5T1LA 4XCFH 2X9YA 3QEUA 1H8SA 1T5WA 2BVQB 2FEEI 4HS8L 3DSFL 1CLZL 3FO1B 2EDYA 4D9LH 5DTFA 1G7HA 4LCWB 4HS6A 1IBGL 4JFHE 4CMHB 2R1YA 1NCWL 5AAWA 5HYQB 3DROA 1BJMA 4Z77B 5ACZB 3RAJL 3D0VB 4AEFA 3UJJH 1XFPA 1OAZL 4J6RL 3IDIB 4I77H 2WINA 1JNNH 1BZ7B 1MHCB 3GGWA 4NM8H 3L6FB 2E5EA 1MELA 4LSUL 5C0FA 3O0RL 1OWRM 1JPGA 3B8SA 4U3HA 3HPLB 3CH1A 4OIBA 5ALCL 1YYML 3O2WH 1IJ9A 5A43C 1EEZB 5F6HI 5F3BA 5J57B 1F11A 4C4KT 3HZMA 1U8IB 3C60C 4JREC 1I3RB 3BT2L 4EDXB 3TN0C 2EYTA 1QRNA 4QWWD 4G6ML 1B9ZA 5JPNB 3C6LD 1IAKB 2FNBA 4QWWC 3JV6B 1J1OL 3Q6GH 5IOPA 1W8OA 3IJYA 4LU5H 1XF2B 3GSQA 3QG6B 4LQFL 5CJ5A 1K6QH 3EYOB 2NXZD 1ORSB 1RK1B 3DYPA 2NXZC 3LN9A 4YK4B 4FRWA 5HTSA 5EU4B 5E6IB 4ZPTB 2XT1B 4DQOL 1MHPL 3TT3H 2ZUQC 1CI5A 5I66A 1YN7B 2GITB 3S36L 3IFOA 3VA6A 5I1CH 2EIDA 3HFML 5F7EL 3JZ7A 3BD3A 1P7HL 5IV2A 5DD6B 2WIIA 4NUGL 3GBNL 4ODTH 2Q7YB 4LNVA 1KCSH 1INQA 1IGJA 1Q9WB 5DJAA 3HUJA 1HQ4A 3I2CH 1CD1A 1KBGL 1YJDH 4U1GB 2XQBH 2OJEA 1LD9B 3IDNB 2GJZB 1QHPA 1RU9L 5AUMA 2HTLD 3QH3A 4U1SB 2Z8VC 4LKXB 4E5XA 5HSFA 5IW6A 1HSAB 1S7TA 1BVZA 4EI6B 2HTLC 5FYLH 2EDLA 4QRTA 5J13C 2DQHL 4EJ1C 2VO5A 4GMSL 1RHHB 4O4YH 5F9AC 1BLNB 1IGYA 4D9RE 1DTUA 1BEYH 5CJQH 3SJVA 3TV3L 1MH5B 2EDNA 3C09B 2XIDA 1YMMB 3VFUB 5B8CB 2GQHA 1U58A 2DD8L 3HAEA 4S2SB 1R3KB 4YQXH 4KDVA 3QIUA 1G7LB 4NYLB 3OKOA 4RCAA 3PNWB 4YHML 2WUBH 1NGXA 1WQVT 3P73B 3L7FB 2OYPA 2XN9A 3WS3A 5T3ZD 3WFBH 5DD1H 4YXKH 4XHJD 5J9PB 3R8BB 2J8UA 2ICWJ 2XV6B 2DQFA 1W8TA 1HWGB 2J88H 2WIMA 2RHEA 4HFUH 2C9AA 2Y23A 2RBLA 1XGUB 3P11L 1IGFL 2P47B 3CJJA 5F9OH 3O8XA 5EIQA 1TLKA 5JOPE 3O2VH 3SBWC 4PGCB 4POZD 4PJ8B 5C0AB 3ULSB 5IHUH 3QFJE 4JLRA 4FXGB 2DICA 4POZC 1JGUL 5JW4N 1ZA3B 3DJ9A 4YFLI 4D9QE 1RURL 3LPFA 3BEWB 3HZVB 3B9KD 4Q2ZA 4U0QB 2B1AL 3GDBA 1EMTL 3HC0A 3LN4A 3PJSA 4DW2L 5FGCB 3NGBB 1TPXC 3B9KC 3H42L 5HYJD 4PJDF 1AXTL 4MA3B 3BN3B 2BNUB 1GH7A 2PXYB 3RTQA 1ZA6B 2ED8A 3CSPA 3QULB 4IIQC 3PQYA 1JHKH 3HAEG 2DBLH 4XT1C 1NCBH 3IU4L 4PGBA 3VW3L 1K5NA 3W11D 4OI7A 5MI0C 5GPRA 5CZXD 2CKBB 2DDQL 3UTPD 1GJIA 4AG4H 3BGMB 3D2UA 3QDGA 4WI5A 1MJUH 2Y25A 4JRYB 4KK8D 1MAML 3QQ3B 4OV5A 5HVFB 4XWOD 3TNMB 4CVWA 4I0PB 5JHDA 5K9JL 5LVEA 1CXEA 1U8PA 3S37X 3BP5A 4XWOC 2V2WB 4YHOL 4GBXB 4BELD 1U93B 2CK2A 3IVKA 1IEAB 3T0AA 5LWYH 1UEYA 3GBLA 4IHOA 2FHFA 3L5JA 3WUZA 2BHZA 3GHBH 5ID1A 2ZUVA 1JZ2A 4G43B 5JLZA 2NR6D 1DN2A 3A6CH 3NCMA 3PWJB 1ZVSB 1FO0L 3L1OH 2NR6C 2PNDA 4B7IA 1V7ML 1BD2D 5HVHB 5C0BB 3BGFC 1JGLL 4BQ3A 2G60L 3UCRA 1U92A 4DKEL 2VR4A 5EUKB 3WEXB 2ZUTA 3VE0B 3O2DH 4MQXC 4JVPA 3GSOA 3WKNA 4MD0A 1WIOA 3BX7C 1T03H 4XP9H 1WZ1L 2YPLA 4QGYA 5T5FH 3SCMA 1FZKA 5C9JA 4Y4FD 2B4CH 4TYUA 3QPXH 3RJDA 4HIHB 4WV1A 1NCCL 2H1PL 4Q9RL 3IFPA 4BH7B 4Y4FC 1ZT7B 4BM7A 5C0JA 4ZNCD 1C12B 4KU1A 1PLGH 3JVGC 4CW1A 1YYLL 1QACA 5EU6A 1RVFH 3UDWC 2ICEB 4L4VA 2NXYB 5KS9A 3MOAL 4ZUSA 4R9HA 1U3HB 3MMEB 3SGJA 4RX4A 1TZGL 2UY7A 4HPOL 4ZPVA 3E6HA 3GNMH 2QADD 1DQJB 1ND0B 4BYHA 4TSAL 3SKJH 1R3HB 4L4TE 2QADC 4WO4C 4AEHH 5C07A 5JIPA 1N64L 4LOUD 2A6IB 1GGYA 1KJ2B 3V6ZA 1KOAA 3ULVH 2Z8RA 1R0AH 1F90L 3L3GB 1NCUA 3SKMA 1DANT 1I8LC 5EZIH 3H9YA 4K7PX 4KI5F 2IEPA 5F1IB 1OSPH 2EDFA 3LQAL 1U8JB 3HLAB 4KMQA 1JBJA 3C2AH 3SY0B 3X12B 4TVPE 4P2RB 4WU7B 4APQB 5KSVB 2CJUL 5IFJA 3ORJA 4PB9H 4DZ8A 4JQXA 5BV7B 3LPWA 5E4IA 4GRLB 5EO1B 4OFYA 1S8DA 1OPGH 3X17A 1UM6H 4U1HB 4WUUD 3W39A 1VDGA 3BPLC 1FIGH 2C5DC 4LFHG 1QLEH 3ARTA 3G5ZB 5KTEL 5FYJH 1H15B 2K7QA 5E2VH 5D7IA 5TDOB 2C26A 5KSAB 1CDHA 4XMKH 2P48B 4M3JA 4XWGL 5GS0D 4M3KB 1GC1H 1D6VH 2BHYA 5D96C 5AZ2L 4Z5RB 5GS0C 1MFDL 4PJXA 3OPZH 4PJBE 4YXHL 2CO7B 4BK5A 1XGYL 4UZGA 1ROWA 2F5BH 4DEPC 2CIIB 2V9QA 1E6JL 2ICCA 4CPBA 4OJFH 2KR2A 1YEIL 4RGOH 3QR2A 4EUPB 2JELL 1OAUH 2G5BA 3CDYA 2GAZA 3TNNB 4YHIA 3V4PL 3TIEA 2BZDA 5ICYA 4GRWF 3TT1L 5DQDH 4NQSA 5EU5B 3S37L 4LSVL 5LAXA 1TMCB 4JY4B 1NUDA 2YA0A 3OKEA 4HQQH 3VD5A 4PJFF 1A64A 1U8HA 4FNLL 3VFVB 2FSEA 3ZKSD 4HXAL 4I4WB 3LRSB 3KWWA 3QG7H 4R26H 4QRPB 3U36B 3GSWA 1Q0XL 1BIIA 5GS1C 3VFPB 3SDXB 1TQBB 4ZSOB 4Z7WE 3MRPA 2MJWA 1Q38A 4KRPD 4UB0L 1JWMB 1P2CA 3MJ6A 4MGXA 3AY4C 1F4XH 4PRAB 5KSBB 4C56D 4KRPC 3MACL 3GMQB 4XH2B 1YNLL 3CDCA 3ROOA 4NKOA 1A14H 1SEBA 1NUFA 3NAAH 4YGVA 3GSNB 1I9EA 1N0XH 2ZCLL 4PTTA 2R4SL 3HZKA 1U91B 4WUKH 1EEUA 1C16B 5EWIH 1FNHA 4JN1L 3NBNA 5SX5K 5FKPA 2EXWC 5DJCA 2OL3L 4K3EL 5SWSA 3T2NL 2RFXB 4BKLB 5CWSA 1CTNA 1CGVA 4DZBB 5F7KC 3HMXH 3BPCA 3W5NA 4ODVH 3BJLA 3WFDL 3H0TA 3OKNA 5E9DE 1F4WL 3DMMD 1E4KC 3TIDA 4Y19A 2R69L 1AKJA 4H0GA 1GXEA 5GSRB 3QEQA 4YC2B 4XPGL 3DMMC 1YJDC 1BQLH 1QLRB 1AGFB 2BY2A 3BE1L 2GJ6E 5E1HB 4IOIA 1DVFB 3O6ML 4NWTH 2IAND 5EPMA 5FYLD 4Z7VF 2Z9TA 3L5WA 5I9QB 8FABA 1V7NH 2J6EH 2PYFB 3KPRB 4N90D 2FX8H 3SDCA 4QRRE 3RVUD 4PBXA 1FG9C 4K7PL 2BSTA 3D9AL 3KPNB 1QVOB 4FOMA 3BKMH 4MCYB 1BOGA 1MHEB 3RVUC 4MS8D 3O4OB 4UINH 1NGZA 3IFNL 1JF1B 5L2KE 3RWHA 1IAIH 3TVMA 1A7PH 5SWZB 2Z0BA 2MMXA 4K9EL 3J8F7 3ULUF 3CSYB 3DXAA 1OQOA 3BKCL 3X14A 5GS2H 2E8ZA 1WLHA 1Z9MA 3QXTA 3TO2B 5J1TC 1DBML 2GUOB 1RZKL 4G42B 2CXKA 5KSUA 3PDOA 1FC2D 2APTA 3B2VH 1QRKA 3AC0A 3GO1L 4R4BB 4RRPG 3HHRB 3L5IA 2ADIB 1S9WA 3ZDXF 3EOAB 2V5RA 1JN6B 3RI5K 1MCHA 5HGGS 4BSVA 4FTVA 2YRPA 5EG6C 4DVBB 5F3HA 4YE4H 5IQ9B 1CLOH 2X4NB 2HT3D 3VXMA 5CSZA 2XPGB 3MA7A 2WBJA 5HHXH 3HNTL 5F9JA 2XZAL 1CYGA 3L3OA 1T89A 4OFDA 2EDHA 4L8SB 1Q8MA 1BMGA 1UA6H 4JQVC 1QSZA 3I6LE 3SDAA 3EOBA 1DQDL 5IHZA 4X0KB 3H9ZA 1VSCA 3FTGA 5JOFB 3VXQB 2BX5A 5CSBA 5JW4R 4OCSH 2NLJB 2EICA 3GRWA 4NQED 4LCIH 3AS3A 3FO9B 3DX6A 2F54B 4LRIA 4L8CB 3PHOA 5D7LE 3IDXL 4HIIA 3FFCA 4PRDB 3N9GH 3PDGA 4QHUA 3U6RB 4HAFA 4K3DH 4E42B 1IEBA 1J0IA 2R0LH 1BX2A 5MENE 2AXHA 2MCPL 1M05A 3VFSB 1R5WA 3VRLF 4OIIH 5A2LH 5DJDB 3MUJA 2B7DT 5F72S 5T33H 1SJVA 2JB5H 2DI8A 1RUAH 1AGEA 2FEEL 3GMMA 3QO0A 4HH9B 3P4LA 4WI4A 2UWEB 5FYKE 3MV9B 4OZ4B 4UMGA 3I3DA 1ZANH 2GEEA 3DUSB 4M7JL 4KVNL 3PGFH 5HVGB 5T1DH 4RFEB 5E08H 3TO4A 2Z93A 3QUXD 5GRUL 3L7EA 4ZO7A 3TGXA 1SHMA 4EVNA 4QHNB 3QUXC 4WTZG 4NCC1 1R5IB 4KDWA 2XWTA 3WLBA 5T1KD 5ITFA 3MYJB 2DAVA 1CF8H 2IPKA 4YBHA 3I84A 2ZOKB 5FM5M 2PYEB 2F19L 2LROA 3VD4A 1QEWB 5I1KL 4HZAA 3OAZK 4XNYH 1WK0A 4RGND 5IVXA 3LQMA 2VSCA 2V2XA 3B3IB 3CIQA 2ADGB 2B4CC 1W2KT 1UXWB 4RGNC 3DHMA 2WBWB 5FGBC 2VE6B 4PG2C 1G7PA 3G6AB 1TQCC 4OD2B 2I60H 4MXWH 5GGRB 2LU7A 3LH2L 2VH5H 3B5GA 4F15B 4GFTB 2H3NA 1KYOK 4MLIA 1PKQA 3I6KB 3V6FA 4LVNB 5F7NC 1JV5B 4CL7A 2X4SB 3E3QE 4HK3N 4KTEH 3TWCL 2P5WD 2WYFA 5DJ8B 3HUJE 3QWRA 1V3LA 4ZQKA 1KB5A 3ESUF 4ZXBD 3S35H 1FE8H 2Y4SA 3ME0A 4E41D 4MB4A 5IVNA 4N1EA 1INDL 1KJVA 4NKIH 1LQSR 4ZXBC 1D5IH 3ULVF 3QCUL 2VDKL 3FB7A 3MRLB 4NSKA 2H32A 2CR3A 2VTFA 2YD6A 4O02L 3ULVC 1BGXL 4NN6C 3KPMA 2DQGH 2NQCA 1TITA 5J8OA 3ILPA 1IQWL 2OSLA 3PV6B 4JDVA 2AJSH 4M48L 4YBLC 2FECI 1YEHL 1MJ7L 4X9HA 3C8KA 3G5YB 1LP9A 3QA3B 1I85A 4PJGF 4OZGE 3HRZA 3V8OA 4KXZI 3AB0C 1RZGA 1NDGA 1Q94B 4YGAB 3D85A 5I8CA 3VJ6A 3BP6B 1RUPL 4N0YL 5DD3H 1KJMA 4J3XA 1F2QA 2HVJA 2IALA 1FGVH 2VAJA 3OB0H 4XGZA 4G9FA 3MLTB 1OAQH 5FYJD 4ZFGL 3N85L 1MRFH 5BS0A 3O41A 5I1AA 5DT1L 3PWNA 2WW8A 5CBAA 4HEME 5E00B 3FHAA 3DETD 3F58L 1KG0A 4QRUA 4OTXH 1HSBB 2M26A 3ARFB 2VLRA 3G6DH 1FLTX 4OQTA 5F9WB 4MMXC 1J0JA 3DETC 2DKSA 5D70H 3LEVL 5DJYA 2WM0A 2APXA 1GC1C 1AD0B 1VGEL 2NX5A 1G7IB 4X7CC 2OR9H 4JB9L 1WF5A 2FIKB 1G7JB 1JNJA 1L0QA 3O4LB 1JPFB 3IDUA 3MRCB 1N7MH 4QXUL 4KUCF 4F9LC 1A8JH 2EE9A 1NBVH 1E27B 1MFEL 3U9PL 4ONOA 1KIQB 3MBXH 1EFQA 4GRMA 4BJLA 2COQA 2CKBL 5EBGA 1LE9A 4Q58C 1DDHA 2X70A 4WNQA 4BFBD 1Q9LA 1BQUA 1LO4H 3QDGE 1FC1A 3RU8L 3T3ME 1BFVH 3KYAA 2ZZUT 4DOHE 1Q1JL 2QQLL 2YN3A 1QBBA 5C92A 4DN4H 5JOPD 4XP1L 4WEBH 3IJHB 3UMTA 1FL6B 3GHEH 1KCRL 4CN1A 3L3DB 5FUOH 3K81A 5FXCH 4WY7L 3LKQB 3WFHA 4RBPH 4RMQA 4D9QD 1MIML 1YPZE 2HWZL 3MOQA 3DVNA 4LLWA 4U2YA 1JYVA 1HEZB 2PF6A 4P9HL 2ATKA 4ODHH 5EIIB 3EYUL 4PJIA 3M8OH 3IU3B 4MHHI 3D48R 5EUOF 1YNKL 3VGEA 3QXAB 2R2HB 5I17B 1MNUH 1SQ2N 4Z6AT 1FDLL 5ILTL 5GZOD 3VXOA 2ITCA 1UKTA 1Z3GL 3QIBB 1KN4L 5C0EB 3LB6D 1GGIL 5HBBA 3NPSC 1OP3H 1JMZA 5DRWB 4E0RA 2YPLE 1AQDB 3WJJC 5DDHB 1A02N 1GWMA 2YA2A 3LB6C 1AD9B 3DBXA 3DURB 1Q9KA 3AAZB 1JWSB 1N8ZA 3ZYHA 2KQNA 3OKKA 3T0DA 1FYTB 2ADJB 3QUMB 4KZDL 3MV7A 1RUKL 4I1NB 2HVKA 35C8L 1NAKH 3E8UH 4L4VE 3ARBA 4Q6IA 5BJTA 1CLYL 5KS9E 2VZVA 4NJAL 2GY5A 6FABL 4Y5XC 5AEAA 2FR4B 2X7LB 2CRYA 3SEPA 3CFCL 4MNQA 1TTGA 3F7QA 1NKOA 3JUZA 1M7XA 4M61A 5C0DB 3U0WH 3UZVB 1KJ2L 1QBMH 5DJZB 1LWRA 5C07E 5J6GA 1LEKB 3GMNA 5BVJA 3NFPB 3HPJA 3V0WL 5H2BA 1IMHC 2Z91A 1IKNC 5FDWA 1J87A 4QHKJ 1AE6L 3L95B 4K8RL 4PG9A 5HGAB 2G2RA 3I50L 4XP4L 2AEPL 2Y7QB 3CFIC 5CP7A 1NLDH 3BD4A 1D6EA 2JJUA 4RAVB 1XEDA 4GAGH 2AQ2A 2OBGA 1U6AH 2UZIL 2PR4H 5BV7L 5ANMA 4JREB 4D0CA 3G04A 3HE6B 4JHWL 3UTTD 1DQQB 1U2HA 3RBGA 2JJTA 5A40E 1A0QL 2NY5H 1P7KA 5JW5B 3C6LB 4CVZA 4L4TD 5D7IE 3KYMA 4FQPA 5FGSA 1NEZB 2NXZB 3VXRD 2R9HD 4KI1A 4TUOB 5CGYD 2K1MA 1PGRB 4OM1L 2VLME 4P2OB 1NGQL 1QSFA 4MA7H 2V5MA 3CX5J 5CGYC 3V5KB 3KJ6L 4ELMA 4JKLA 4LEOA 5IW1B 1D9KD 4LSQL 3BWUC 4P3DA 3PP3H 2AK4A 1TJIL 1D9KC 3LKRA 3N50A 1KELH 2DMKA 1LO5B 4LLUA 2VL4A 4PB0L 3BIBX 1UCBH 1VB9A 3V5HB 1K4CB 3N1FC 1TVBA 2APVA 1VFBB 3SPVA 2YKLL 4TPRL 4LRNH 2YWZA 1VKXB 4UT6H 2VLKD 4Z7UB 2JJVA 1C5BH 1AGDB 4TUKH 1M7DA 3FJTA 2VXTL 4JO3H 5D2NC 5C0RH 3Q6FB 2AXJA 2DS4A 5GIRA 2HKFL 4RAUA 2IH3B 4N1HB 3ARYA 1Z9LA 4WFED 5DFVC 4P59H 4P23C 5I75C 2OXGA 4EQ3A 3BVNA 2X4RB 4WEMB 1DBAH 2XG5A 2W9LA 3TC9A 5I8EB 1F3JA 3DV6B 2P4AB 1CGYA 1RJYB 4YHNA 5E8DL 2ARJA 3RZCD 1MJ8H 3GSNL 3MRKB 4OCRH 3RZCC 1RZ7H 1HXYB 2FBOJ 3QUKB 4F37K 1WAAF 3VFTA 3E2HC 1NPUA 1PEZA 4HXBL 4QTHB 1FZMB 1T7XA 1JRHH 2EDQA 4PJ5A 3HG1D 5F7DA 1KSRA 2YUWA 5SWSE 2WUCH 1ONQB 2CR6A 2BMKB 4K7PY 3LKSB 4Y1AA 2B8OT 3ARUA 1CTOA 3O11A 3L3KB 1B2WH 2CDFB 3C9NA 1RAMA 3GSVB 3QNZA 4L8BB 4Y19E 2DQTH 1X5YA 3MRIB 3OXSB 4PJ7F 3QISA 1TPXB 3B9KB 4OZFA 4JZOB 1HN0A 3U7WH 2CUIA 5CUSL 2HT2D 4GQ9H 5I73B 3W82A 4OLUL 2HT2C 4NOFA 3KLAB 3RUGB 5I18L 4FA8A 5MI0B 2FGWL 5DRNA 3CLEH 1WC7B 3S4SB 3GUTA 2HFFB 4Y16B 4FQ1H 4YDIL 1XCTA 3ZYBA 2QV2A 2V2TB 3MRRB 4X6DB 3BSZL 4G8GD 3RWCB 5F21B 5EU3A 1A6VL 3PWVA 3I75B 2BVPA 4OSUH 3DXAE 3BKJL 4JR9H 1XGQB 4NKDA 4OUUA 1KUMA 1URLA 1A3QA 5IF0A 2GT9A 1X5JA 2YK1L 3DSNA 1BZQK 2SEBB 2R8SL 1X3DA 4OCLC 1LO0L 5IEKA 1RMFL 1Z9SA 4M5YL 1FVCB 4S1QL 5GGSA 1WFNA 5EBLA 5BVPH 2YA1A 2XKNB 4FTVE 4OZFG 4P48A 5DMJB 3IXTB 4G9DB 5BO1L 3VXME 2EYRA 1BD2B 1XR8A 5IWLA 1GHFH 4K23L 5JO5A 5JORA 5EOCL 3GKWL 4V1DD 3MRNB 3S96B 4UILH 1KF9B 1X5LA 1HQRB 4HIJB 5E5MB 1E4XH 1NDMA 3IDGB 4MNGA 5GRVL 1C7TA 3MODH 3UT0A 1SBBA 1F13A 2A38A 2ZJSL 4Y4FB 3S8WA 5AYUH 2AXFB 4H26B 4OLZL 3OZ9H 2UY6A 4KRNA 3CVIL 2ATPB 2OJZL 1G84A 4NC0B 4UTAL 5F97E 1IAOB 1TCRB 1T7YA 2DQIL 8CGTA 1FZOA 2I24N 3L9RA 4XVJH 2JJSA 5D6DA 5FECB 4OGXL 1N5YL 4EUPG 2KH2B 3VFWA 3H3PL 4NQDA 4ODUB 4JAMA 1T22A 4FXKB 4KHTH 3A67L 1FFPB 2BXZA 1Q0YL 1KIUA 5D6CB 1KFAL 1F6AB 3BMWA 3N1GC 1MCEA 2QADB 1YEEL 2OZ4A 2FBJL 1JHLL 4UOW0 4YHPA 1AR2A 1G6VK 3C08H 5IM7B 3D25B 3T1FB 1A7BA 3BP7A 3T2QA 2P43B 1FNGB 1L0YA 3DUHA 2PO6C 4Z7QF 2EYSB 3BWAA 3DO3A 1KCVH 1QFUL 3DLQR 2C1OA 3CFEB 1FN4B 4JRWA 4OT1H 3MCG1 5DEGA 4M93B 1I7ZB 1F45A 1IC5H 2D03H 4CADA 3KLHC 3U0TA 1ES0A 5JQ6L 1NMAH 2BRRL 2ICWI 3JTSA 3JXAA 3F5WA 4WDIB 1RPQA 1C08A 3MUHL 3NFSL 1BHGA 3AVEA 2EC8A 4GUPB 2DB8A 4NNPL 5ESQB 4OGYL 5T1LD 1NFDB 2E7LA 5GGQH 1IQDA 1MHHB 2ICWB 5IVXE 4NPYB 4GG6B 1QSEB 2BSRA 1ZHLA 2Z31B 4NN5B 1PQZB 1A9EB 3BPLB 4XPHL 4JFYB 4XTRD 5EB9A 4F57H 2EDWA 4WUUB 2P5EA 4H1LA 3GSUB 5IVZB 3WLWD 4PIRF 4XTRC 2BDNH 1WJ3A 4PLKD 1H3VA 4FQQA 3WLWC 5DMGD 4PRBB 4PLKC 1DEEB 1PKQE 3H3KA 4X6CA 1A4JA 1A6UL 5D96B 5DMGC 2Z92B 2XY2A 1A6TB 5IVOA 3ILQD 2CDGA 1WIPA 1XF5B 4YZFE 1EHNA 1GGUA 5B3JF 2DQJL 4HAGA 3ILQC 1DBKL 5JIKA 1UB6A 3ZKXC 4GAFB 3WUWB 4ONGH 2P24B 5CJOL 3U82B 4HF5H 1QRND 1FLRL 3DUUA 1ITBB 2O5ZL 3O3BA 4ELKA 4MQSB 1EUTA 3HI1B 1I7UA 5L7XH 3FB8B 1WWWX 4BH8A 1OTTC 2JB6A 4R96A 4G3YL 2IAMA 2E3VA 1OVZA 4JFDB 2DWDA 3TBWB 4C58B 5JPMA 4PYGA 1A7QH 3FONB 2DJ4A 1D5BB 3KYOB 1ADQA 3S3PA 2VXSL 3T0EB 5DR5L 2GK2A 1EGJA 2EKSB 3E6FA 4XB8A 2IFFH 4NCC2 1WCBB 4G6JH 4UT9L 2D9CA 3EO0B 4U6XA 3O9WC 4CVXA 4XAWL 4LKDA 4ERSL 5ADPL 3VWJB 4JHZA 2FECL 3CFKA 3LEXA 1FNEA 3G6JF 4GJTB 4LCWE 3QHFH 3DX9B 4LAQH 4O51B 4Z18A 3MFFA 4G9FE 1KGCE 2NY5C 5BS0E 4KRPB 2E27H 5D2LF 1I1RA 3ZE0E 5I16A 3MGTB 4C56B 1JZ4A 1IRAY 2BNRD 2VDQL 3MRHB 5CILL 3UZQA 3CU7A 3CSGA 1YEDB 2QQQA 2BVEA 5L88L 3AGVA 5TDNA 2YD5A 1MREH 3P9MB 1FAIL 3VXUB 3DRQA 4D8PA 1UH4A 2NX5E 3WBDA 4U6VH 4QXTB 5J1AB 3OHXB 3SJVD 3EBAA 5K9OB 1P4BL 3B4NA 4JFFA 5L0QC 1S7XA 4S1SH 1EDQA 3QIUD 5DHYA 3CZFB 1C7SA 3BKYL 3DMMB 5KN5B 1OGTB 3VXPA 1HHKA 2XN9D 3QCTH 1FFNB 4FQJH 3V7AG 4HPYL 4DVRL 4YX2H 3RWJA 1MRDH 1OGAA 3BP4B 4JEGB 4UUJB 2ILLA 1KPUA 1NC4A 2CLZB 3T8XA 2RJMA 3P4NB 4OD3H 1CG9B 1PY4A 4ZAKD 4NO3A 4YDJB 2IANB 4L3EB 5TDPA 2X4OA 4WWKD 3L3IA 5FIEA 4QXGL 1IL1A 4JVUA 4UAOB 4MJID 3OSKA 1HH9A 4ZAKC 5GGTH 4WWKC 3H9SD 1BF8A 3RDTA 1EBPA 5IMKB 5DURD 4X98A 5E8OA 4HDIA 3B9DA 5E94A 4NQVB 4H20L 1DQML 4GOSA 2AV1B 1X7QB 5CLTA 4HV8A 3UTSB 4WFGE 3D3VA 4OZHA 4XMLH 1UJ3A 4O2EB 3JTTB 1OKOA 4G80B 3RTQD 4EDWH