3ORJA

Crystal structure of a sugar-binding protein (bacova_04391) from bacteroides ovatus at 2.16 a resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
429
structure length
429
Chain Sequence
DDNGGSSVMNITGIYLEDAKSNVPDRLVDFARLGQLIRIEGEGFNGLKKVYINGYNCYFNPVFVSNKSFLVSVNSKVPTTEADENVRNTIRLVKDGGEYVYDFQIRAAAPSITKISNCMPNVGEPIIVYGSGLTEIAKVVFPGNVVVTEGIISDLDGEYFMVDMPAGVSEEGGSIFVEGSNGGAYSPAYFNYKKGLLLNFDGVGAQGAWGDSESMIQTTELESASIGEGNVSQGAYCRLPLERQLPVAAAKNRCAEVWTAGNGTDPDWLTLGVPAETPVAECAIQFEIYVPEPWSESGFLKICGQNGFNGGEWERDCYNYVPWLVDGKIVPFQTTGWQTVTVPFSEFYKSKASSGAWTTFADVTATRASASYANFGFYFENSDITLDKITGASSDKETEFLSKATSVKIYIDNWRVVPLTKPEYTDFPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords sugar-binding protein
publication title Crystal structure of a sugar-binding protein (BACOVA_04391) from Bacteroides ovatus at 2.16 A resolution
rcsb
source organism Bacteroides ovatus
molecule tags Sugar binding protein
total genus 96
structure length 429
sequence length 429
ec nomenclature
pdb deposition date 2010-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18329 SGBP_B_XBD Surface glycan-binding protein B xyloglucan binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3orjA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3orjA02
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 3orjA03
2GJ6E 3D5OF 3NIFF 4E5XB 4L4VA 1GGIL 5DDHB 2X9YA 1X9QA 3MLXL 1X5YA 3OB0H 2WIIB 3OMZA 3MODL 4EOWL 3VH8G 2JJTC 3THMH 4AZ8A 1DUZB 5DDHA 3R4DA 1H15B 5I1DB 2WIIA 3CXDL 1NPUA 4Z78A 43C9A 4KKLC 2KPNA 4TPRL 5CEZD 4MD5B 1H15A 5I1DA 1MRFH 2H26A 4FZEH 3VG9B 2DLEA 3IS0X 5DUPL 5J12B 4I2XB 3MLUL 1NFKA 1A7PL 5DMKB 4EI6B 3O6KH 5D1QA 1MWAL 4HIJB 1NGZB 4PBWD 4XPFH 3GHEH 3WN5A 1M7DB 1NL0H 4JHWL 4EN3B 4A6YB 5D71L 1S7VB 3S34L 5DMKA 5DRWA 4BFBD 1NGZA 3C09B 1C5CH 1KB9K 1M7DA 4U1IB 2EXYC 4EN3A 2FL5B 2MTPA 5IESH 1WBZA 3D3VE 5K9KB 4KTYA 1WWWX 4HHAA 4M5YH 5I6XC 1RFDH 4OZHA 4JKLA 4YR6A 4FRWA 1BOGB 2YEZB 2W9EH 5C6WH 4PY8I 1OARH 2ARWA 4Z7UE 2V17L 4XT1C 5L8JB 1FG9C 3FN0H 1BOGA 5HXMA 4RFNB 4XNZC 1FYTB 1CL7L 3DX9A 2WBJD 4PJGF 4JDTH 5JR1L 3U4AA 3F8UB 3NAAL 1FYTA 2BERA 3UZVB 4NQVB 3DARA 3D6GA 12E8H 4OCWH 5AG8A 3EJZC 4D9LL 4LLDB 4NQVA 3FT3B 5IB1B 2V2XB 4I18B 2VXVL 1YNLL 3MRLB 4HWEL 1A4JA 2Y5TB 3T0WA 2R1XB 3PHOA 1OPGH 2ESVB 1N6VA 3QJFB 3N1MC 3FT3A 5IB1A 2V2XA 4I18A 5IVXE 4LRNH 3RP1A 3MRLA 4NJAL 4ZS7L 2Y5TA 1LHZA 3TIEB 2ESVA 3QJFA 5HHMD 4PPTA 4Z7VE 2HLAA 4PTUA 4AEEA 4DKEL 5HHQB 4FFVD 3PDOB 4GW4B 4GAYB 1PG7H 4NPYB 5E24E 5I73C 3TIEA 4RGNB 4QF1A 3UPAA 4OI7A 4BQ2A 1MAMH 1E4KC 5F6IB 4GRWH 3KYKH 4PJ8C 3PDOA 1TENA 4P49A 3O41B 1Q72L 1WF5A 2IANA 2A9NL 3R06A 3V4PL 2IBGA 1A6VL 1YQVH 2K3TA 3GSNH 1XF2B 1CFSB 4K71B 1I9JH 2BMKB 5GZOC 3O41A 1LE9B 3SE8H 2IALA 5I1EL 1F02I 1VB9A 3GSVA 5CJ5A 1JGVH 1BGXH 1TVDA 3U0PB 4NFBA 3ZTJG 5I75B 4OGYL 2BMKA 3D85D 5CJOH 1LE9A 3MRGB 5IB2B 2EKJA 4NGHH 3IAQA 3MPCA 1XIWC 2DI9A 2WUBL 4K07A 1L9MA 3RGVD 1A6PA 3VXRE 3C9NB 3IDUA 5F7EH 9CGTA 4XMKL 5B39G 4YXKH 5MP6H 5IB2A 4DAGL 3RWIA 1RUMH 4P23D 4IOFC 3C9NA 1CXEA 4DGIH 5C6PB 4AM0A 5ISZB 2CQVA 4R4FL 2XYCA 2XZZA 4PRDA 2G2RA 4JREC 5E5RB 2C1OB 4JRXE 4KGLA 5HGDA 1JHLL 4F7EB 3DECA 5T1KB 2V2WB 4P2QB 5D2LB 3IAPA 1QRND 1WZ1L 5AWNL 2C1OA 3WL9B 5KVEL 5EPMB 4BZ1H 1MPAH 1VHPA 5T1KA 1O5DT 4P2QA 2VQTA 4U1LB 1A3QA 5D2LA 1I7ZA 2VXQL 3ILQD 1UM6H 3VXRD 3NZHL 4M93C 1KXQE 2FBJL 4OD1H 4U1LA 3SGEI 5EZLB 2AJXL 3PP3K 2JIXB 1H8NA 4POZD 4U1KA 4F9PC 1QFUH 5EZLA 3NOIA 1QBML 4D0CB 3DV6A 4QXGL 1JN6B 1X7QA 1UT9A 2JIXA 2VDOH 4JRXD 5FUOH 1EJ6A 4BYHA 3PABA 1JPST 1JN6A 2VLJA 4U2ZA 2P43B 4P2OC 3VG0L 4WNQA 1WT5A 3BKCH 3PNWB 1CD1A 2IAMB 4KY1H 2A9MH 2RR3A 4L9DA 5DVOA 4YWGH 2Y25A 4IDJL 2NMSA 3W11C 1JP5A 2DKUA 3PNWA 3UZQA 1I8LC 1BIIA 3PGFL 4ACPA 3D39D 3QCTL 1EFXD 2ICWJ 2VXSL 3VFSB 3P0YL 5D7SH 4QRRD 4XHJC 2BY2A 3H6JA 4JM2F 5IW6B 5IMLB 2GK2A 3S88H 4LFHD 1OGTB 3L3GA 4XPHH 5JOFB 3OF6D 4OFKA 1OAKH 2I9LB 2VZTA 2X89D 1AD9B 1OGTA 2AI0H 4HKXA 4XAKD 3BZEB 2PXYC 1B0GB 1SHMA 4NCC1 4PJ8B 2XICA 2J8UE 2P49B 5BV7C 5JOFA 4QNPF 5E5UB 2VWEC 1AD9A 3BZEA 2IEPA 1TMCB 5C0AA 1GRWA 2X4RA 4PJ8A 1CR9L 4R2GB 1JPTH 4JQIL 3S36L 3U0WL 3WIHA 1QPXA 1QYGL 3MV9A 4BQ9A 4BSWA 3VD5A 1ZLSH 3S3SA 1HKLL 2EIBA 2F5AH 4Z9KB 2DQFB 3INUL 2VDML 4GAFB 3MV01 3WXWL 5FCUH 5HHOE 5IHZA 4U2YA 2VC2H 3RVWD 4PJAE 2WQ8A 2VLRB 1LEGB 1QKZH 4WHYG 2HT3D 4LASH 4JZOB 1CFBA 2NX5E 1JNLL 3BP7A 4YEFA 5IEHA 2FWOB 1R3HB 3PXJA 5FECA 1NANI 4X4MA 5J11B 2AXFB 3GSRB 4JZOA 3L3HB 4ENED 2FWOA 1YPZE 1R3HA 4G7YH 4PJEB 3DROB 2HTKC 5GGQH 3OR7B 3MUGB 1YEJL 3T2OA 2AXFA 3GSRA 4ZSOB 3TJEL 1RUKH 3L3HA 1FJ1B 1G7HA 4XBEL 3WDIA 4ZODA 4MJ4A 5DR5L 4XNUL 3JWOC 4PJEA 1ES0B 3MUGA 1CGSH 3UPRB 5F88A 4IBLT 2YC1B 5KG9B 2UZIL 4ZSOA 1ZAGA 1MREH 2YPVH 4MQ7B 5F7WC 5HHOD 4NM4H 3QIUC 4QYOB 1ES0A 3MOQA 3ARBC 4LCCC 3UPRA 1RUAH 5EU4B 5J8OA 1LO4L 5KG9A 3FB5B 1JGUL 3KPMB 4MQTB 2NX5D 1PBYA 3BKYL 3GHBH 4MQ7A 1K8IB 2D9CA 4DW2L 3H8NA 2YRZA 4LGRB 4LHUB 1A7OL 4WI5A 5EU4A 1I9RL 2M2DA 4K7PY 3FB5A 3KPMA 2X4OB 4WCYL 1YMHB 1K8IA 2NXYB 3RVTD 2EYSB 3DMMD 4KK6C 5KS9F 1MI5D 3QFJE 1F4YH 4LHUA 1UB6B 4G8IB 2X4OA 3SJVB 1H3UA 1FZMB 3BWAB 3FO1B 3S36X 1MFEL 2P46B 4HLZG 1F8TH 5K9QI 4OLVL 5DWUH 1UB6A 4WU7A 1UWGH 4G8IA 1YEEL 5E6IB 4Y4FB 4WTZG 1ZEAL 1CG9B 2KZWA 5TF1H 3SJVA 1FZMA 3FO1A 4V1DD 4RMWA 3KXFB 4LSQL 4G6JH 3BESR 4M4PA 4IS6B 5CZKA 1CXFA 5E6IA 4Y4FA 1QSFB 1TQCC 5T1DL 2IF7A 2HH0L 5IJVA 4PTTA 5BV7L 3RL1A 3BDYH 1KF9B 3WXVL 4WWKC 3RWDB 4QHKJ 4I3SH 4F15C 5DD0H 5D2NC 1YEDB 3FAWA 3IKKA 4HKZB 1I3RB 3ARZA 3ES6B 1I8LA 1WFOA 1X5GA 1DBJH 2UV3A 4OFIA 2APFA 3WUWB 2W0PA 3RWDA 5JXAH 4FP8L 3O6LH 3Q0HA 4XNXH 4KKAD 3MO1A 1YEDA 1I3RA 4CW1B 4O2CB 3ULUC 4KJPC 1MHEB 4ZG1A 4G6FD 3WUWA 3ORJA 1DBBH 1J10A 1JHKL 3U2SA 5EULV 2VDQL 4CW1A 4O2CA 3EYFB 5GRJL 1BJ8A 1XMWA 5JUEL 1MHEA 1KLGB 1WVZA 5IJKC 1DSFL 2PXYA 4MXQC 2DI7A 1MCPL 3EO1B 3Q5TA 1QFWM 4M5ZH 3H0TB 3JWDH 1KPUB 1MIML 4HJJH 5GS1B 1R3IH 3FQWA 3H0TA 4RBPH 1PSKH 4UOW0 5D7IE 1WZXA 4GT7A 5DJAB 4U33A 5F96H 3UJIL 5GS1A 1B2WL 5CEXB 4JVWA 2JJSC 4S1RH 3D18A 3PUCA 1DVFC 2DOCA 3QJHB 5EOCL 1RUPL 3SDXF 4BH8B 5DJAA 1ED3B 4MQXC 3JVGC 5CEXA 5JTWA 4LARL 2YOCA 4Y19E 2V5YA 3FFDB 7FABH 2D4FA 3AMLA 1EFQA 1ZGLM 1CS6A 4EJ1C 2GTZA 4DVRH 1OGAB 3IDYC 4YBQC 3HN3A 1ED3A 1WMXA 3CNKA 4U6TA 1FDLL 4Q97A 5IB3B 3W5MA 4FHBD 1HHJB 1OGAA 5EU6B 4MNHB 3VI3F 5K9OB 3STLA 1C16B 1KPVB 4Z0XB 5IB3A 2DBLH 3KR3L 1HHJA 3TVMB 5EU6A 1I75A 4QY8B 4MNHA 3SDCB 2VLJE 5K9OA 3V4VH 3ZSTA 5AZ2L 1QSVA 3K3QA 3MLSL 3V4UH 1U93B 4P48A 2XFXA 2XRAH 3AROA 5JHLH 3QIUA 3V5DB 1DBAL 5FGCB 5DO2C 4YXHL 3ARBA 3DSFL 4O58L 4PJIB 4Y19D 4FQCH 4JHZA 1BQHB 3QEQD 3V5DA 3FQRB 3FRPA 1CXLA 1IEAB 3CFBB 4HX1B 4MXWH 1AFVL 4PJIA 4M7LH 3HLAB 3MLVL 5CLTA 4DKFH 1CGXA 1HINL 3P4MB 4ODVL 4N0CD 3PJSB 2DMKA 1IEAA 1ZHNB 5FHBH 4R8WH 4HX1A 1RQ5A 5E4EC 1C1EH 1R3LB 1VCAA 3HLAA 1R0AL 1CD0A 5INDB 4KZDH 4OUUA 4M02A 3ULUL 4XP4H 3IFPB 2W60B 5CINL 1CXHA 2NZIA 4JFFE 3CLEL 3MREB 2PTVA 5DEZA 1R3LA 4PJ7B 3NA4A 2G9HA 3IFPA 3QWRA 5GPRA 1Z2KA 2W60A 1IGFL 2VZSA 3MREA 3MRIA 1WQVT 1IFHH 3B9AA 4I77L 4WWKB 4ZOAA 2JELH 3WHXA 3VWKD 2X4NB 1KXTB 3W2DH 4PJ5A 1OTSD 3LRGA 2H2SD 5EUKB 5T3XL 1XF4A 4CPBA 1PFCA 1U92B 3FOMB 2D7TH 4WWKA 1IM9D 3MV9E 4L1HA 4L3CB 2BNUB 4LGSB 2X4NA 2R4SH 4HUXB 5D2NA 4PGBB 4WFGE 2P8MB 4OCSH 1U92A 4QEGA 2XXMB 1HILA 3FOMA 4G80B 2H9GA 3WJJC 3OXRB 4L3CA 5DD3H 3FO9A 4PGBA 1IVLA 3C6LC 4X6DB 2P8MA 4JFFD 2VZ3A 5HD8D 5C0BD 4UB0H 2HWZH 2PYFB 5TFSL 3W9DB 1KB5B 3HAEA 5BRZE 4S1SL 4DTGL 3AB0B 3IGAA 4ZO8A 1IJ9A 1T2QL 4QCIB 1X3DA 1Y18B 2PYFA 3W9DA 1KB5A 5IJKA 2AJ3A 1GGUA 3H3PL 2OXHA 3D2UB 4U7SA 2NY2D 4HC1H 4QTIH 3JXAA 4QCIA 3QWQB 4ZO7A 4LSUH 4RFOL 1M05B 3KPNB 4WFGD 4D9QE 4MA1B 2V5RA 2QSQA 3PDDA 1M05A 2AV1B 5IFAL 1G84A 3KPNA 2Z31B 4XP1L 5A16B 3G6JE 2R2BA 1OOAA 1AGCA 2EDYA 2H32B 5IV2A 2IQ9H 1SEBB 3B3IA 4TVPH 1XIWD 3IDYB 1EDQA 5BRZD 5SWZA 5HTSA 4CADB 1A5FH 3JVGA 3RQ3A 1DQDH 1ZSDA 5FF6B 3DO3A 1SEBA 1KCSL 2WNGA 1XCQB 3SDDB 2VXUL 4IMLB 3O2DL 5GGRY 2E27H 2Z8SA 1Q9LB 1HEZB 5FF6A 4KV5E 2LFGA 2FGWH 5C2BL 1FH5H 4XP6H 4PBVC 2MQ3A 4YBLB 5ITBL 3HZMB 1Q9LA 1HEZA 3OL2A 3V5KB 4LLQB 1HIML 5DMIL 2DQTH 4M6ML 4NQED 5I74B 4X5LA 5HJ3B 4AMKL 1M7IB 4ZYKA 3IDXH 3V5KA 1KEGH 3TA3B 4ZOEA 2XWTB 4JFEA 3H9ZA 4LLQA 5BMFH 2Q20A 1CE1H 1E4XI 2NW3A 4JR9L 5L6YL 4BQ4A 5FYLL 5HJ3A 3ROOB 1YJDC 3Q6GH 3VWJD 1PDKA 4NT6B 3TA3A 2XWTA 1F4XL 2P42B 2DTMH 3TO2B 5HYJD 1IGMH 2ATKB 1WEJH 3EGSB 3ROOA 1C8PA 5JDSA 4RRPA 4ALAL 3FFCD 4FQ2L 2OTWA 1BP3B 3TO2A 3SQBA 2HVKA 2PCPA 3SKJH 3EGSA 4JO1H 4P2CG 4Q2ZA 3KPRE 2PO6C 4LKDA 2EE2A 3RX8A 4Y5XC 1JPGB 4RIRB 3H9YA 4J4PD 2J8UF 2BJML 4LSVL 5GGVY 3TN0C 3CZFA 3QR2A 1ACZA 5CZVH 1D9KD 5J1AB 5C2UB 2C3VA 4K8RH 4OCYL 5TQ0L 4JGUA 4TULL 2VWEE 1U6AL 2AJYL 3EYUL 1MFAH 4JM4H 1G0DA 4LSTH 5CILL 3MV7E 4BUHA 4AEIL 4AH2A 3UO1L 2EKSB 5J1AA 3ZZ1A 1P5UA 4X80H 2BSRB 4KI5C 4HGWA 4NBYB 1ERNA 4NZTL 4U1HB 3HNTH 4U1JB 1TZIA 4PJAF 2EKSA 1AXIB 2MJWA 3FONB 2V9RA 2NXZC 5A40E 1H3WM 2BSRA 4PJBB 3TT1L 3WJJA 3EO9H 4U1HA 3KPRD 1O7VA 2CJUH 5H37H 4JRYA 4ZAKB 3V0VB 3QP3A 2VLME 5AYQA 2H8PB 3FONA 1KCKA 3C6LA 2APWA 4OZHF 4H26B 35C8L 4GQ9L 1MLBA 4AG4L 2VIRB 1T7YA 1YPZF 1A6TB 1INEL 1JGLH 3IU4H 4P5MA 4ZAKA 3V0VA 1HXMB 4TNVK 2H8PA 5L2KB 2VDRH 2PN5A 4H26A 3D69B 1Y6KR 5CSZB 1K4CB 3MV7D 1W8TA 2ENYA 3L1OL 4IRZH 2YPLB 3EHBC 5L2KA 4KKBC 3GMRA 1L7TL 1OT2A 3D69A 5CSZA 1K4CA 3GKWH 3G04B 4OLZH 3DUUB 4LLAA 4UNUA 3T3PE 1KNOA 2YPLA 4NKQB 1UOJA 3IT8D 4IHOB 4HS6B 1LEKB 1GIGH 2KDGA 4LHUG 3EJYD 2A1WL 3G04A 4HXBH 3DUUA 2VXJA 2VR5A 2EH7L 2BVOB 3MXVH 4XPBH 1KBGH 3RVUD 3P0GB 4LNVA 3W0WB 4MS8C 3RA7H 1QR4A 4P9MH 4IHOA 2FD6L 5C86A 4HS6A 1LEKA 2NY3B 4W6WB 1G7MB 4RNRB 4I5BB 5DUBA 3GSQB 3W0WA 3NACH 4K7PH 2MPAL 5I8CB 2NY7H 2YN5A 1IC7H 1S78C 1G7MA 1OTTD 2Y72A 1MQKL 3RZCB 3FT2B 5I1AA 2A0LC 4CDHA 1HHIB 3QHFL 3SPVB 3GI9H 1FO0H 1MOEA 1CLOH 4HUWB 2GIYA 2OP4H 2Y07H 4PB0H 1LDPL 4GSDH 2HFEB 4TTDC 4G3YL 1HHIA 4OD2B 4M7JH 3SPVA 2KH2B 4BSVB 4HUWA 3CFCL 1EV2E 4OFYD 3VFRB 5I1LB 3HUJB 2ADJB 2HFEA 4YIQA 1MHHB 2A6JA 1J8HE 4FQIH 4OD2A 5C08E 3OKMA 3WUWG 3VFRA 3HUJA 5ID1B 4W6XB 5E2WL 4PUBH 5F9OH 1MHHA 4F7CA 3V2AR 4OAWA 1YC7A 3QCUL 4MDIB 6FABL 2ZCHH 1INDL 4FQPA 3S37H 5ID1A 5FGRA 3MLWH 2QADC 3VGEA 4HIXL 1T0MA 4EIZC 4YPGB 1BAFH 4KFZC 1G7IA 4MDIA 4IIQC 4X7EC 4HUNB 3ULUE 5E95B 3GMPB 3LAFA 3NCCB 1IGTA 2RFXA 3QXTA 3STZB 4YPGA 4MCZB 3BQUC 5ACMA 1BBDL 3GMPA 3K8LA 1J8HD 3STZA 4DN3H 1PX3A 4D3CL 5C08D 1G7LA 5HDQL 1JZ2A 1XT5A 2QQKL 2J7LA 4WUUE 4JHAL 4XWOD 4JFDE 3D1MC 1F11B 2D0GA 3ULSA 2DL2A 4G9DA 1S8DB 4LPWA 5HVFB 3ULUD 4KJPD 4Z7WE 4OM1L 5K9QG 3FT4B 1S8DA 1CGWA 5F1IB 3N1GC 3KJ4B 5F71A 4UT7H 3NIGE 5KOMC 1CT8B 4WW1B 4CKVX 1CDUA 2IWGA 2HG5A 3CH8A 1VGEH 2XPGA 1CLYL 4QRTA 2JJUA 1I9EA 3DVFA 4Q0XL 5SV4A 5ANME 4MJIE 3EO0B 5A2JH 4WUUD 4BQCA 1A2YB 4JFDD 1UXWB 2FX7L 5DUMH 4MD0A 3CPLB 2FO4B 3LKQB 25C8H 4FQXB 3EO0A 3ALXA 4CVZA 3FRPG 4CU8A 4KHTH 3C2SA 2FO4A 4HZAA 5J9PB 5E9DE 4ZPVB 4PGJA 1OD7A 2X2YA 3X11A 1BQHG 4GRLD 4HT1L 1R3KB 1MF2L 5GS0C 4ODWB 5F9JA 1DVFD 1D5BB 1AC6A 4KAQH 1Y0LB 1JV5B 2X40A 4UTAL 4M48H 1R3KA 4ODWA 1HCVA 4TRPH 1D5BA 1BM3H 1Y0LA 3D0LB 1TIUA 4JO3H 4MJID 2DLIA 1ZXQA 4PS4H 1JV5A 4ESKA 1JYWA 3LKRA 1IBGL 4WVRA 3ZKND 4ZOBA 1N0XL 3QUKA 3D0LA 1TVHB 3TO4C 1Z9OA 3WDJA 5ICYB 4XX1G 2NY1B 4HV8B 4GRMB 4B0MM 4YH6A 1KN4H 5EIIB 3TT3H 4NKOA 4HS3B 2DQUL 1MHPL 3CMOH 2J88L 5ICYA 1D5IH 4GRMA 3FQNB 4HWUA 4JG0H 5EIIA 5T1LD 3FB6B 4HS3A 3HPLB 2FEEI 4RAUA 5IT2L 4G8FB 1KIRA 4OCLC 1U91B 3FQNA 3T3ME 5FYLE 3A6CL 1NBVL 5IFHL 2W07A 1W0WB 3GK8L 4HPOL 3FB6A 1N6QL 3T4YB 3RU8H 3SN6N 3X17A 3PGDA 2KQNA 4JFYB 5DGRA 4G8FA 1A6AB 1U91A 4LK4A 3UYPA 5BS0A 1MIEL 3SOBH 4GBXD 4PJHE 1YUHA 1W0WA 4IIQB 3T4YA 4JE4B 4AEHH 2V7NB 1IGYA 1FC1A 3W5NA 1AO7B 3QI9B 4UQ2A 2IMMA 4IIQA 1DANU 5C71A 3EYQC 3EBAA 4U6VH 3QUYD 1HH9B 3JV6B 5CAYB 1AO7A 3QI9A 2OM5A 2ADFH 1IGCH 2CLVB 5DJXB 1CDGA 4GW5A 4I4WB 1CTOA 1IAIH 1HH9A 2HMIC 3O0RH 2Z9TA 4PJEF 3HCVB 4MXVE 5GQBA 1YECL 5ESVB 2CLVA 1F2XK 5DJXA 3ELAT 4I4WA 3MUHL 3HCVA 5GGSA 5ESVA 4NOFA 1GWMA 4OJFH 3O2WL 1AR2A 1MJ7L 1J5OL 1J1XL 4YGAB 3AM8C 4XI5D 3QG7H 1YY8B 4PY7B 1SYSB 5SWSB 5J89A 4O4YH 1FLRL 2X6MA 5GS0L 1EEYA 3V6BR 4YZFE 1CDJA 3CVHL 2F53A 1YY8A 1VACB 1SYSA 4KUZH 5SWSA 1KJ3L 3PHQB 2F19H 5CUSH 5DFVC 4C56B 1WWAX 4KV5F 4DZ8B 1VACA 3IVKA 4Y4HD 4IOIA 1GGCL 1UKTA 5MHSD 3PHQA 4KHXH 5D93B 3WD5H 2AEPL 1JPFA 3TJHC 3U9PH 2CXKA 5TE6L 1JNNH 5EC2B 2I5YH 5DJYB 5A3IC 2HFGL 1T6VN 5GJTL 4G6AC 4X4XB 5EC2A 4HGKC 5I30H 5AZEH 5F1KC 1XGTB 1HDMA 5I17B 4X4XA 4HMEA 4Y2DB 1A47A 2NY0D 2X5PA 3IXTB 3UC0L 2AABL 4R0LC 3QUXC 2LABA 2XOTA 4B50A 5HI3C 2XKUA 4NQDE 2IPUK 4DKAA 4RMTA 2BVQA 2BVEA 4RMRA 4BFGA 3IXTA 1ZT1A 1BD2B 2ZSWB 3ROLB 4RDQF 2W0FB 3TO4A 3V9FA 3MLYH 1A6WL 3PWJB 4PLKD 4H8WH 1I7TA 4NQCE 2ZSWA 1XGUB 3ROLA 1IGJA 5L7XH 1CXIA 1QLRB 5GGVH 2W0FA 3T08A 1OH3A 3RI5K 5DHVH 3PWJA 4ZNEE 5D6DC 3MJ9H 4XPTH 3GSXA 4HCRL 4TNWK 3UDWC 1XGUA 3PF2A 1QLRA 1QLEL 1NMAH 4LOUD 4KDTA 4L3EE 3IDJB 4LK7A 3GEWB 2RQ8A 1KPRB 2NZ9D 2W9DL 2YMXH 4LPYA 4MJ6B 1NGWA 2AEIT 1UEYA 3RAJH 2VQ1B 3MRKB 1FFNA 1PKQB 4NQDD 3KYNA 4FXKB 4MDJB 2VQ1A 3MRKA 1Q9WB 2HFFB 4Z7OE 2LRPA 5CCKL 4WI6A 1QPPA 2OTUB 5K9JH 4MDJA 4ZUVB 3NCMA 3G6DH 4Z8FL 2DLGA 1Q9WA 2HFFA 2OTUA 3QIWD 3KPPB 1I9IH 2G60H 3TPKA 3V6FB 4P2RB 4EBQH 4KQ3L 4JPKL 2VDPH 5D7LD 2AJVL 3QDAA 3JZ7A 4LDLB 4M62L 4UTBH 3V6FA 2ERJC 4XBGB 4U1GC 1G9NL 5F9AC 3OBAA 4WY7H 1LO2L 4KJQD 2NXZD 4XBGA 4GRWB 4O51A 3ARGC 4YQXH 3BUTA 3AM8A 4AIOA 1KN2L 3RY6A 1G7PB 2EC8A 4PJIF 1SJHB 5GZNC 1ZVSA 3MJ7B 3GSNB 1F3JA 1VGKA 4QO1A 1AI1L 2F8VA 4LCYA 4IRJC 3CZJA 2APBA 4P2YA 3AREC 5I19L 2VERN 3PQYA 1G7PA 4HUMB 1SJHA 3MJ7A 1KEMH 1S5IH 15C8H 1A7QH 2J5LC 5FOBA 4F33B 3MACH 5CEZH 2FECL 1TITA 1SJVA 3EHBD 2D2OA 3TBYA 3MOBH 5E99H 4GUPB 1ADQH 2ARJQ 4OV5A 4F33A 5A2FA 4NZRH 1KJ2H 1BMGA 5FYJU 4J23A 2B39A 4GH7B 1FFRA 2UWEB 2AERT 5ADPL 4XPAH 4KQ4H 2J6EA 3C08H 5F72S 3O6MH 4X4YB 2LE9A 2YUZA 4O02L 2DQDH 2BDNH 1P7QB 1G7QB 4TN9A 3L5JA 5T3ZL 2AXGB 5MEND 3DVGB 4OCXH 2FGZA 4UMGA 4WHCA 4X4YA 2X1PA 1QEWB 5C3TA 3OKEB 4KKCD 1OAZL 1P7QA 5T5FH 1G7QA 5DTFB 2AXGA 1FRGL 3ZTJH 1S78D 3DVGA 4WFEE 3PG2A 3O4OC 1QEWA 2ZPKH 3OKEA 5CEYA 4XCYA 2ICCA 3QUXA 3SY0B 4RCAA 5DTFA 2ADGB 4HPYH 5JNYB 4KK8D 3IFNL 1ZT4B 4LEXH 5DQJB 1AXSA 4ODBD 2FX8L 4PY8J 2XWJB 5ADOL 4CP9B 4K3GA 2HKHL 4TTDD 3EYSL 3LV3B 3Q1SL 2R9HD 5IMMB 5B4MD 1YN6B 1ZT4A 3TH4T 2W0LA 5DQJA 4L8CB 4CP9A 2APTA 3VXMA 1ZLWK 1GC1H 3O8XC 4CAGA 2F9BT 4K94C 3MLZH 5DGQA 5IMMA 4BQ8A 1F13A 3WSQH 4G5ZH 5D6DA 4I0PB 1NC4A 3UDWA 4L8CA 1UB5B 1YY9D 1X5KA 1HSAB 1X5HA 4WDIB 1UM5H 5EBGA 1CDCA 2CSPA 1MCCA 4WFED 4YDKL 3LQZB 2R56H 3QIBC 4I0PA 5HDBE 1FPTL 5IQ7L 1UB5A 3U46B 5I15H 1RVFL 1RZKH 2P5EB 1HXYB 4ZOCA 5LQBL 2PR4H 5ITFB 1S9WB 3NH7L 5I1HH 1FVDA 1H5BC 3U46A 3MRPB 2R29L 3N1FC 1D5MB 4PGEB 3KJ6L 2P5EA 5KZCB 5ITFA 1S9WA 5I1JL 4L4VD 1TTGA 4OCRL 5KJRL 4UT9H 1PEWA 3MRPA 1D5MA 4PGEA 3QHTC 4I2XE 3N1QC 2JWPA 2J8OA 5E70A 1AKJB 3BSZL 5D5ME 3C87A 3B8SA 4TUOA 4LVHC 1HYSC 5I18L 2MKWA 3R1GH 4ORGB 1AKJA 2PYEB 1BJ1J 1DLFH 4UU9B 5FXCH 2V5MA 2B5IB 5D1XC 1MFDH 5CP7A 1A0QL 4MWFA 2PYEA 5E2VL 1MRCH 5GGTL 3NFPB 1NKRA 3ARGA 3MRNB 4UU9A 3VXSA 5JIIA 2BY0A 4IRJB 1T7WA 3QRGH 2LU3A 3D9AL 3AREB 4P3WA 1NAML 1FNEB 5DMYA 4ELMB 3MRNA 4R7DA 4IRJA 3TZVC 3AREA 3NVQA 3RWEA 2OL3H 4ZDHA 4ELMA 3IAGC 3C5SB 2OS7A 3RRQA 4LKCB 2XZAL 4XVJH 1MVUB 4PRPE 4OLUH 4IM8A 3BPLC 1IRAY 2A2QT 3F6LA 4YLQT 3C5SA 4Q9QH 5C0CE 3EOBB 5LBSL 4P46C 5DEFB 1MVUA 4DEPC 5MEQB 1TJHH 1JBJA 3S97C 5IKCB 1NAMB 4FMFA 1RUQH 3H9SA 1BX2B 4M1GH 4YHKL 3EOBA 3SE3C 5DEFA 3OZ9H 4HDIB 5MEQA 2V9TA 5LWYL 4QWWC 4K94L 5IKCA 4R90L 4XRCB 1NAMA 2E6PA 4X5XB 4TNVF 1DJSA 1BX2A 4PJHF 1FYTD 2CXGA 4LVOC 1FVCA 4HDIA 3O4OB 5JXED 5GIRA 2AJSL 2PW2B 1YZZA 1RY7B 3PXHA 1X5LA 1JZ4A 4W70A 1DEEB 3WFEL 4LCUB 3BIAX 1Q8MA 5HPOA 4PRPD 4PG2A 2I60L 1IQWL 3F12B 1Z3GH 5DVKA 3BGFC 3AS3A 1W72H 3HE7C 4M3JA 1DEEA 3HNSH 5C0CD 3BE1L 4NNPH 1FZKB 2DYPA 4GKSB 3F12A 1ZT7B 3KPSE 2OZ4L 3HI5L 4ODTL 1U3ZA 1FZKA 4Y1AA 3VRJB 5C7XL 5DLMH 4GKSA 3MYZA 1ZT7A 3FZUD 1FFQA 4RQQB 2XV6B 5CSBA 1R5VB 2OR8A 3ULVC 5CZXD 2WV3A 3SKMB 1RJCA 1U8JB 5IR1B 4PB9H 1WTLA 4PREA 3IJSA 1CK0H 4HJGB 3BP6A 1FGVH 2CR3A 4OLYH 3BOVA 4XVUD 3U83A 4RQQA 2FEDC 1R5VA 2YXFA 3SKMA 1HNFA 1U8JA 1KCRL 3QIBA 2EO1A 2HN7B 5IR1A 5EWIL 3U4BH 2YPKA 4HJGA 2ZUSA 4Z7QE 3NMEA 3LEVH 4I0KA 1FVEB 3QUMH 1S7SB 3M8OL 5CJXC 2HN7A 2QTEA 1W0VB 3G5XB 4QRPB 1EK3A 1GVIA 2FATL 5MEOA 4BH7B 3U6RA 3WJLA 3QDJB 1S7SA 2OZ4A 5C0JB 2IQAB 3DXAE 4X6FB 2Y4SA 1NSNH 3QXAB 4ODSH 1W0VA 4Z18A 3G5XA 1D5XB 4HLZH 3EOAB 4BH7A 2B8OT 3A67L 4LPCA 3QDJA 2CLRA 4N5ED 1HQRA 5H94B 5C0JA 4X6FA 4E42B 1E6OH 1D5XA 3EOAA 2X1OA 3TBSB 4B7IA 4XAWH 5H94A 3KGRA 4EDWL 2NY4B 3P0VH 3QH3B 2EDXA 3TBSA 5D1XA 1VFOA 4YK4C 4OM0L 2I27N 4NBXB 4YHZH 3OXSB 1HZHL 5ISZD 2MCPL 3GMQB 1G6VK 3QH3A 1CCZA 2VKXA 1CQYA 1RJYB 5T1KD 3OXSA 1BFVH 2OR7A 5DFVD 3NFSL 1XGQA 5KSAC 1J8KA 2AK1L 4I3RL 2GSGB 5C0IA 1RJYA 1BQLL 4PGCB 1WIPA 3Q5YA 2YHGA 3B43A 1U3JA 3MNZA 4DEPB 1UWEL 2GSGA 2B20A 4X8JB 5HI4D 4PBXA 3DI3B 5J6HA 4P46A 1GGIH 3QNYB 4HKBB 1X44A 4ONHB 4OZ4A 4X8JA 3MLXH 1DCLA 4RA0C 5E1AA 4UIMB 1QFWL 3UJTL 4EOWH 5E2UL 3SE3A 4LVOB 4HKBA 3D87B 5CKAA 4KI5F 5I1CL 1IILE 1KTDB 3ULVL 4APQB 4EI5C 3CXDH 3UTSA 4Z7OF 3VD3A 3G5ZB 3SDAC 4GG6B 3GBNL 2IAMD 3MYJB 1KTDA 5IGXL 4APQA 4UNTA 1T2JA 1FNLA 2CRIA 2KBGA 3GIZH 4MYWB 3RWGB 5DUPH 2VITA 1RIVL 3MYJA 1NCNA 5IIEB 3MLUH 2ZG3A 2VRAA 1A7PH 4Y4KD 2XNAA 1MWAH 2FB4L 5DMGC 7CGTA 1AH1A 1G9MC 3VXUB 3ZYHA 3T2QA 3RWGA 3LH2L 3GGWB 3IB4A 3ARDB 5FKPB 2HTLD 5D71H 3S34H 1UKSA 3VI4E 3SKNB 3VXUA 4C55A 5KN5B 3GGWA 3QEGL 3T1WA 4NKMB 3CXHJ 4LGPB 4AENB 5F7YC 2IPTL 3MNVB 1UVQB 2JKXA 3SKNA 5J56B 1MCRA 2XN9B 3H3KA 4PRNB 5KN5A 5F7UA 4PRHB 4AENA 4ZTPL 2R1WB 4JO2L 2V17H 4WEMB 3MNVA 5DJ0A 1JI2A 4PRNA 4ONFL 1ZGLB 5DK0A 1JTOA 4PRHA 4UQ3B 5FUCC 5L2JB 1CL7H 4R2GD 1Q0YL 3HRPA 5CJXA 1PQZB 4HIIA 5JR1H 1ZGLA 3JTSB 3NAAH 4UQ3A 4FA8A 3MV8B 2YRLA 3RL2B 1PQZA 3RVXD 3G5YA 3GIVB 3JTSA 1MH5B 3RNKB 4D94A 3MV8A 2VLRD 3UTZB 4D9LH 2JCCE 2EXWC 3UP1A 1OAQL 5DHYB 4MAUL 2VXVH 1MY7A 4HWEH 1T80A 3GIVA 3H9HB 4IRSC 2P5WA 3UTZA 3H42L 3U4EB 5I8OL 1BFOA 4XZUA 4PRIB 4NJAH 2SEBB 4ZS7H 3GMNB 1W90A 1OAXL 4HBQA 1CGVA 3U4EA 4WEBL 4R6UA 3IYLW 3GMNA 3EFFB 5FAAA 1JYNA 1U36A 4HUVA 2UUDK 1ORSA 1YNKL 3UXFA 4YPJA 1KG0A 2LVCA 3O11B 3KXFE 3C5ZC 2OR9L 3SKOB 3EFFA 1Q72H 1F5WA 2D7MA 5AAMA 2A9NH 1QSFE 3V4PH 2IFGA 3O11A 4IDLA 4FTVE 4FG6D 4NQSA 3OAUH 3WV0A 3SKOA 1E4JA 1OSZB 3PP3H 5I1EH 1UCBH 4JY4B 3L9RB 3QZWB 2OBGA 2VH5L 2NXYD 3I3BA 4LLMB 5DZLA 1O7SA 4OGYH 4PV8A 1NFDE 1WICA 2AVGA 1G9ML 4JY4A 3FKUS 3L9RA 3DOSA 4J3OC 1IC1A 2WUBH 2QQQA 2L7JA 1OTUD 3L7EB 4NQXA 4XMKH 5E6ID 2X7LB 4Y4FD 4ZFOL 5CJQL 3LN4B 3P30L 4DAGH 4WW2C 1JWUB 3T0BA 1RZ7L 3T0EC 4C4KT 2BVTA 3KXFD 4LCWB 4PJFE 3IETB 1OB1B 1T89C 3QXUA 2X7LA 3LN4A 1QSFD 3C8KB 1JWUA 1JRHL 2R69H 4HAGA 3QPQC 4WJ5B 3SDAA 3ZTNL 4FTVD 2VUOA 5ID0A 5DSCB 3VA6A 2X70A 4NM8L 4BZYA 4EKXA 3WHE1 4WI4A 1OB1A 1JHLH 5I8KL 3BRDA 4LCIH 3REVA 2VISB 2F15A 3C8KA 4JY5L 8CGTA 1GZPB 1WZ1H 2V7HA 3F7VB 5AWNH 4GMSL 2P45B 3SKUD 4DGVL 2JJWA 5KVEH 5D5MF 4MD4A 2VISA 1BJ1H 2VXQH 1MCOH 5E8DL 1GZPA 3ZT7A 3F7VA 2YUXA 1E4XL 3BJ91 3TYGL 3LSOB 3NZHH 2CO6B 1A3LL 2UY6A 2FBJH 3DUSB 1DLHA 3FTGB 2YK1L 2AJXH 2BOCB 4KRNA 1N64H 1JMZA 2E9JA 3LSOA 4AL9A 5HHNB 5GJSH 1RK0B 3DUSA 3F7RA 3FTGA 3MLTB 1QBMH 2BOCA 2MSPA 3MJGX 4R4BB 4FFYL 3NGBB 4JKWA 3WNOA 5HHNA 2XTJC 5TDPA 2W59A 2RCSL 3KWWB 1ONQB 4QHKI 3BO8B 4HF5L 4MJ5B 1D6VL 1UH4A 4R4BA 1XF3A 4OLWL 3VG0H 5FHAL 5JQHC 3KWWA 5H2BB 2C26A 1ONQA 3BO8A 1RZFL 4MJ5A 1V5JA 4KTDL 1I1AB 4TSCL 4IDJH 4CN4A 1WSST 5H2BA 5EUOA 5GS2D 3PWLB 3PGFH 1A1MB 5BCAA 1I1AA 3QCTH 4D0BB 2VXSH 3CDCA 4PJCB 3L7FB 3LIZL 5CMAB 1HWHB 3PWLA 4P4KC 3TNMB 4OT1L 4WFFE 2X44D 4U1SB 1V3KA 1FAKT 1NUNB 4AIZA 5E94B 4HK3J 4PJCA 3L7FA 5C09A 5CMAA 3RPIA 3TNMA 1A9BB 5EU6D 5FB8A 5FUZL 2IBBA 4U1SA 4A6SA 3FRUB 4QHMB 4KJYB 5E94A 5FYKD 3CSYB 5L88L 2O93L 3TVMD 3I50L 1RV6X 1A9BA 2CRMA 3SDCD 1TZHA 4UUJB 5FM5O 1N5YH 4QHMA 1BOYA 4FXGB 4PJ7E 4KRPC 1CR9H 3T0VA 3ALWA 4UUJA 5JW5B 4JQIH 1U2HA 3S36H 4MNGE 3U0WH 1S7RB 3GJEB 1QYGH 4JDVB 1UJ3C 1HKLH 4FXGA 4X4ZA 5JQ6L 4U6XB 3W9EB 3INUH 4WFFD 4OZIB 2VDMH 3WXWH 5JW5A 4R96B 5CFHA 1S7RA 3GJEA 5D1ZB 4F9LC 1P4LA 4K2UL 4JDVA 1P1ZB 2VN4A 4U6XA 5JW4N 3W9EA 4KROC 4OZIA 2NPLX 1Z9LA 1AC0A 1DEDA 1FO0B 1D3CA 1ZLVK 2VZUA 1P1ZA 3GI8L 3ZE1E 4X6DE 4GMTL 3ULVE 1ZS8A 3G9AB 2Z35B 1KV3A 4GS7B 5EIVA 3M45A 1FO0A 4WW2A 4Z7QF 5IK3B 5EN2A 1MSPA 1YEJH 2C4FU 4QHUB 3TJEH 5EU3B 1FNHA 4Y5YB 4N0YH 1T89A 4QRQA 4LKEA 4K3DH 3GMOA 5DR5H 4XNUH 2ITDB 5JO5B 1W9FA 3HI1B 5IK3A 3TBVA 2BOBB 3RVVC 4HZLB 4QHUA 1DBKL 1U3HC 5EU3A 1M71B 3OQ3B 4CMHC 5JO5A 2ITDA 5E6ZA 2UY7A 3HI1A 2BOBA 2K46A 1LO4H 1JGUH 3LN5B 4DW2H 4NO0B 1Q9OB 3BIBX 1Z5LA 5BO1L 1A7OH 1X4YA 1I9RH 1UWXH 4M1CC 2QLVB 4WCYH 3V5HB 4HS8L 5ETUB 3BGMB 4X6CE 1PW3A 5JHDB 5EO0B 4NO0A 3TFKD 3MRQB 4Z7NE 2Q7NA 3ARFB 1TCRB 3RDTC 5ETUA 1MFEH 3BGMA 5D7JC 1C5BL 5JHDA 5EO0A 1TQBC 3MRQA 4OLVH 3S3PA 1X6LA 3RZWA 3D2UD 1YEEH 3BH8B 3SGKA 3ARFA 5E8OB 5BOPA 1ZEAH 3VU2A 1TCRA 4MX7B 4S1DC 4NN6C 1D7FA 4LSQH 4NHCL 1T0NB 3CH1B 3BH8A 2VXTL 1I1FB 3VGFA 3E8UL 4XMPL 2H2PD 5T1DH 2HH0H 4JGJA 5BV7H 1T0NA 4YHYC 3CH1A 2Z31D 3V8CA 3WXVH 4DQOL 3O6FC 4FQ1H 3RHWK 3P4NB 3HNVL 4V2CB 3VFMB 4NKDB 3RTQB 2AK4B 2BNQB 4GFTB 4P4KB 2R2CA 4M6OL 3UTTB 4ZFGL 3S35L 3DYOA 3P4NA 4FP8H 2AKRB 3VFMA 1PYWA 4FFZL 4NKDA 2R23B 3MR9B 2AK4A 3U48A 4PP1D 4P4KA 1T4KB 3SDDD 4LF3B 4BA8A 2GYSA 1JHKH 1EJOH 4FFWD 2R23A 4F8QA 3MR9A 3WNNA 2VDQH 1AQDB 5GRJH 5C9KA 5JUEH 4DN4L 4LF3A 3B5GA 2F5BH 1IAII 1URLA 4YDLC 3SE9L 1DSFH 4RX4D 3VXPA 3T0XA 1XR9B 1K9TA 5DJZB 3MRBB 4MAYC 1AQDA 1MCPH 2EEAA 5IQ9B 5KSAD 5TQ2H 4N0UE 1MCIA 1MIMH 3MRBA 3TA3D 4EUPA 1UZ6F 3GRWL 4KGJA 4IJ3B 1MCDA 4XGZB 1D5ZB 3JWOH 1FN4A 2VZOA 5C07B 2J12B 4ZD3L 1UJ3A 2BHZA 3GSOA 1B2WH 2VQUA 1UYWL 3C60C 1ZK9A 3ALPA 4XGZA 3IDMB 5EOCH 5C07A 1RUPH 2GY7B 4ZUSA 4NC1C 1H0DB 1NAKL 3QA3B 2GY5A 4LARH 4F7MA 3HZKA 2Y06L 4I48A 2C4XA 5D9SB 3IDMA 5EZIL 2X4UA 5CIPA 2I24N 1FV1B 4EI5D 1H0DA 5F1OB 1FDLH 3QA3A 1MRDL 2EC9U 1D6EB 4W4OA 1FL5B 4L4TB 2HFTA 4QOKE 3SO3C 1S3KH 1QSEB 5D9SA 4KUCD 5LAXB 5I1IL 1T0PB 4NNXB 3KR3H 3S35X 3GRWA 1FL5A 5FYJH 3WE6A 3FO2A 4L4TA 3MRFB 2ZUQC 1NDMB 2WW8A 4UBDD 3LRSB 5LAXA 1A7RL 1MHCB 2A83B 4KXZH 3WFCH 5AZ2H 1NLDL 3MLSH 2C9AA 5FUCE 3P2TA 1U3HA 1UFUA 5FK9A 4M7ZC 2P8LA 4LLVB 1DBAH 3THML 1JF1B 3LS5L 4YXHH 3DSFH 3WFBL 4O58H 1U8IB 2D31B 3B5HA 1DN0B 2FYYB 3LPWA 4HJ0D 1KJMA 1U8IA 2NTSP 4Y16C 1EHAA 1PLGL 1E27B 3RDTB 3IF1B 5D7JB 2D31A 4ODVH 1DN0A 1TQBB 3BD4A 3NCYS 3P9LA 5L2KD 2YA0A 1R5WB 3HE6B 1S9XA 2BSSB 2KZ1B 3AC0A 5T33L 1R0AH 2NTFB 3RDTA 3MZGB 5D7JA 3DX8B 4ZXBC 3GJFK 1NGXB 3O4LE 4X98B 3SO5A 5J3HC 3GHEL 5CINH 3HE6A 3CLEH 3NFNA 3HAEH 4NO2B 3RGHA 2NTFA 4NUGL 4ODXA 1NGXA 3QNXB 3QDGB 1VA9A 1EZVX 4NO2A 4G8GE 4I77H 3BKJL 3NCBB 1RFDL 4S2SB 4UV7L 3QNXA 5T3XH 1U8KA 3O6FA 5GGSY 1V7MH 3HR5B 3OKNA 3B9KB 2NY3D 4YC2C 3X13B 3HPJB 3OB0K 1VFAB 1A6UL 1NFDF 2EIZB 3IFLL 4IRSD 3DGCR 3QYCA 3VXQB 3HR5A 3UAJD 1F42A 4CUCA 3B9KA 5KAQG 4HIHA 4OI9A 3O4LD 3HPJA 3ZDXF 3LDBC 2EIZA 3RZCD 5GGRB 3OV6A 5FDWB 2Q86A 3VXQA 5TFSH 4XHQA 1YA5A 4PJFF 3BD3A 4S1SH 4F57L 1MFBH 4DTGH 5DC4B 1T2QH 3HZVB 3QFDA 2UZYB 5BW7C 5FDWA 2Z91A 2DM7A 3ZHDA 2B1HL 3T0EE 4M9PA 3H3PH 4MAYA 4KZEL 2EZ0D 3C5ZD 2HT4D 3EIFA 5GRVL 3HZVA 4JM2B 1MCKA 4RFOH 4KVCH 4PJ9C 5I2IB 1OPGL 1JK8B 5L0QC 3CCHB 3WKML 2DQEH 5J0BA 1T7XA 2DDQH 3RJDA 4M9OA 3C60B 4I9WD 4JM2A 4NRZB 5J13C 2LROA 5I2IA 2FSEB 5IFAH 1JK8A 2D3VA 3CCHA 1MCBA 1S5HA 3BN9D 4XP1H 4K3JL 1DQTA 1XF5B 1DQJA 3OPZL 2VYRE 2F54E 3C60A 1PG7L 4MVBC 3AY4A 2W1NA 4C54A 2FSEA 4DUWA 4F7TB 1U8OB 3VXTB 4PJDE 3QRFM 1XF5A 1LDSA 4X6BB 3MX0A 2F8XC 3ESVF 1GHFL 1KCSH 4F7TA 1U8OA 1MQ8A 2VXUH 1CVSC 3VXTA 4JQXC 5DHVB 5KVGL 3MRJB 2MKLC 4KK9D 4MSWB 3J8F7 2VAAB 4G43B 4LRIC 2WBJC 1NC2B 1UACL 5C2BH 4WENB 1IEBA 5FGSA 1FZJB 4OBSA 5ITBH 2XTJE 3MRRA 3MRJA 4N90E 1ZA6B 4MSWA 1C7TA 3MJ9A 3RWHB 1QBAA 2VAAA 4G43A 4NDMB 4ODUB 1NC2A 1AQKL 1HIMH 5DMIH 4XCNA 4FQLL 4M6MH 2DAVA 1YYLL 3IDIB 3MA9L 3MRDA 2F54D 1OP3K 4AMKH 4CVUA 4KMQA 4W4NA 4WIQA 1ZA6A 1DFBL 4NFCA 3RWHA 4NDMA 4G9FA 4HMDA 1RUML 4YUEL 3MBEB 4JR9H 1H3XA 4YAQB 3IDIA 5L6YH 5FYLH 4DOHE 4Y16B 2FIKA 1JNHB 1F4XH 4JEGB 3MUY1 5IOPB 3SBWA 1AJ7H 1CICB 2BNRB 3MBEA 3PGCB 4YAQA 3CIQA 1SQ2N 4Y16A 4F37K 4FQ2H 3RWCA 1XH3B 3KLDA 4NHUB 5IOPA 4P4RB 1A6ZA 2CUHA 4HQQH 3K1KC 2XTJD 3C2AL 1N5AB 4N90D 1II4E 4XC3L 1CTNA 1T1YB 4ZXBA 2LU7A 4FQXD 4X9HA 3W82A 5HPMB 1N5AA 2R0LL 1PG7X 5FEBA 1RZGB 1B9ZA 1T1YA 2NY5C 1W8UA 1T2XA 2CO7B 5TQ0H 5IBLD 5KS9B 1I3GL 1U6AH 3EYUH 5CILH 5KVDL 4AEIH 1JFQH 1RZGA 2XZCL 4M7LT 4RGMB 3VFOB 4NZTH 2VDOL 3JWNC 2GJZA 2A6KB 3LDBB 3RGVC 2K7PA 3TT1H 3VFOA 2ZG1A 5C9JA 1Q9KA 4E41B 5MI0C 1NKOA 5FA4B 3U7YL 4P23C 4WHTB 3ULVF 4RGOL 35C8H 4AG4H 5IB5B 2NY1D 4R97B 4E41A 3WS6C 3BXNA 1INEH 1TVBB 5FA4A 3TBTA 3DIFB 2OMNA 3DHJA 1GZQA 4L8BA 2XWBA 2GJ6B 5FKAB 3UZEA 5IB5A 3QEHB 5BW7A 2XKNB 2YZ8A 2YZ1A 1ADQA 1NCWH 2MHAB 1TVBA 2ZKHL 2ENSA 3DIFA 3HC0A 5I9QC 2GJ6A 4P57B 2HA1A 5FKAA 3QEHA 5I66B 1NCAL 1GWKA 4DJMA 3TC9A 2MHAA 4P59L 3DBXA 1OAYH 3ILQC 3OSKA 4BKLB 2FO1A 5EO1B 2XTLA 2BP3A 2EH7H 1QO3B 3S3JA 2AI0L 1MJJB 1EGJL 2FD6H 4BKLA 3RUGE 5EO1A 1JUFB 3BYYA 2ZUWA 1VFBB 4X6CF 4POZC 3MRCB 3L3IB 3BAEL 1EBAA 4M43L 4P5KB 2E6QA 1MJJA 5IVOA 1AY1L 1YJDH 1YMME 2MPAH 1SEQL 1JUFA 4PFEA 1VFBA 3O3BB 3L3IA 3HG1E 1MQKH 2LAAA 4P5KA 1T20B 1ZLSL 3PWUA 3CLFH 3QHFH 4C56E 3O3BA 4LLYB 1IARB 3PHSA 3T65B 2WBJA 1LDPH 1H8SA 5HDLA 4I13B 3SDXB 4G3YH 3O3AB 3D3VB 3I9GL 2V5SA 2OJEB 4PGDB 1QKZL 3UBXI 4LLYA 4H5SB 2EDWA 3ZO0A 3CFCH 3T65A 1YDPB 3TCLA 4AQ1B 1ZA3B 1RI8A 2NY6C 3CAFA 1PZ5B 3D3VA 2GKIA 2OJEA 1EGJA 2BVUA 4PGDA 4LKXB 4Z7UB 2NY5L 4Y8DC 1ZA3A 5SWSD 1XZ0B 2ZSVB 5E2WH 1YMMD 3N85L 4X5WA 2EDKA 2DF3A 4LKXA 3B2UC 4Z7UA 4ZTOL 3QCUH 3HG1D 5DK2B 2VR4A 6FABH 1INDH 1M6OB 1XZ0A 2ZSVA 4YHNB 4HIXH 2VJXA 1NGYB 4C56D 3QQ4B 3LKOB 5DK2A 4NZJA 4NM4L 1JYVA 1ZHLA 3ZMRA 3N50A 3LEYL 4WWID 4P0DA 1NGYA 2E7HA 4S1DD 2VUYA 1ND0B 3LKOA 3GHBL 4XCCL 1BD2E 4GKOA 1BBDH 3P4LA 2GJJA 3S5LB 2EE3A 5ESAB 4D3CH 4XP5L 3RKDD 3OG6B 1ND0A 5HDQH 5DA4A 3TNNB 5IVXB 2QQKH 2QR0A 3V95A 1QHOA 4JHAH 1GOGA 1CLCA 2GSIB 3S5LA 3D85B 1I7UB 5CD5D 4M61A 5HGGS 3TNNA 3ZHKA 5IVXA 3RVWC 5E5MB 3FQTB 2GSIA 4YFLF 2H3NB 4GLRH 2HT3C 5FDYA 4EQ3A 1GL4B 1LGVA 3D85A 4Y2DD 3EYOB 4Z7VA 4LSPL 1FFOA 4OM1H 2OL3B 4OKVA 1NEUA 3FQTA 4G6JL 1PKQE 2H3NA 3LCYA 5D70L 1DN2A 1UENA 2YD4A 1BD2D 4UOJA 4P23A 3U9UB 2PETA 3EYVA 2D7PA 5I71B 3BMVA 3WS6A 4R26L 1H3TA 4Q0XH 3FN3A 1I1CA 1CGYA 1EHNA 1ZHBB 2QQNL 5C70A 3U9UA 4HSQA 3MGAA 1UH3A 3UBXB 2FX7H 2YBRB 3BP5A 1PAMA 1U42A 5FA3B 3AU1B 2LV4A 1ZHBA 4HIEB 3PWPE 4P2RE 4QGTA 1F3RB 3UBXA 4F7PA 3AU1A 3O9WB 1UA6L 3GSUB 1MCJA 4HT1H 1MF2H 5EDXA 5EUOF 3VXRA 2CPCA 4NNYB 3RVTC 5DZNA 3DMMC 1CBVL 3GNML 4W6YB 3GSUA 4U0RC 1ZE3C 3QXVA 4GRWE 2W65B 5ESQB 1W72B 4KRLB 3MGTB 4X9BA 4NNYA 5JLZB 3K8KA 3CX5J 1MJ8L 1J0JA 5TE4L 2W65A 3D25B 1IBGH 4JRXA 2ZG2A 3KHOA 1N0XH 2FJGB 3PWPD 4UILH 4P2RD 3MRMA 1Q0XH 1RIHH 4HK0B 3WLBB 3L5WB 2O5YL 4YBHA 2FJGA 2J88H 1OP5K 2I26N 1EFXB 4HG4J 2P24B 5BQ7B 2VLKE 4E0RB 3WLBA 4WGVB 1IQDB 3L5WA 5IT2H 2UWEE 1T21B 4NFDA 3D39A 3LHPH 1EFXA 5BQ7A 2P24A 1LD9B 4N0RA 4N8PA 2VDNL 3A6CH 1NBVH 3QUMB 1IQDA 3GK8H 4HPOH 4KKAC 5JPMB 5CGTA 1N6QH 2WANA 2EECA 1DBML 4NKIL 2EDJA 4QXTB 2DWDB 1MIEH 4J6RL 3QUMA 2R0KL 5JPMA 3DRTA 2WWMD 4X7CC 1R6VA 3OF6A 4WV1C 2X89A 3ARPA 4QXTA 2DWDA 1JZ7A 3S96B 4YFEA 4J3UA 2EDLA 3L95B 3M1BB 4WW2F 1L0XA 3VFVB 1BQSA 1E0OB 3O2VL 3I2CL 3S96A 2WMPA 1IC5H 1TLKA 3EUUA 3OJVC 2YD9A 4RBPK 3AMKA 4Y5VC 3BEWB 4G6ML 1BREA 1B6DA 2BSED 1ITBB 1P7QD 4MLSA 3B4NA 3BEWA 3O2WH 2B0SL 1MJ7H 1J5OH 1J1XH 2J8UB 3L5XL 4Z78B 43C9B 4NC0B 4QT5B 3OHXB 1CL7I 1FLRH 2ZWLT 1C08B 4MA7L 4NN7C 5GS0H 2J8UA 2H26B 3IS1X 5DVLA 4QT5A 3OHXA 2LTQB 2JELL 4P5TD 1KJ3H 1C08A 3CMGA 1LP9E 2CKNA 5F7HA 2VNCA 5D8JL 4O5LL 5D1QB 1OAUL 1QA9A 4AT6B 5HHOB 1GGCH 3WN5B 4PJAB 2I07B 5DRWB 3ZKMD 2NX5B 4PJ9D 2R0WL 4AT6A 3OJDB 5HHOA 4U3HA 4I0PD 5TE6H 1G7JA 1WBZB 2F8OA 2HVJB 2I07A 4PJAA 4RFEA 4HHAB 1IKNC 4OZHB 4YR6B 1V3MA 5GHWH 2NX5A 2HFGH 3OJDA 2IPKB 1YPZB 3LVEA 1DQML 1MUJB 4N1EA 4RAHA 5GJTH 2HVJA 2G5RA 5C6TL 4TTGA 1TNNA 4J12A 4KMLB 4MVBD 5JIPA 1KENL 3WFHB 2K1MA 3VGAB 2IPKA 5FM5M 1YPZA 4N0CC 1MUJA 3KLAB 4GAGL 4PYHA 3DETD 4HC1L 4KK5D 3WFHA 4AJ0A 3DX9B 3I84A 3UC0H 2AABH 3AS0A 1MWAB 3E2HB 3KLAA 5HBBA 1P2CA 5HHME 1FBIL 3JUYA 1MWAA 4ONGL 3DX7B 1A6WH 1KXVC 5JW3L 3VWKC 2PYED 1OTSC 2IQ9L 1HQ4B 1A4JB 2H2SC 3QFJB 4YGVB 1J1OL 4UOW1 1P9MA 3DX7A 3PHOB 1ZVHA 1YNTB 5EU7C 2FHCA 1K4DB 1HQ4A 3QFJA 2O5ZL 4YGVA 3TH3T 1AIFA 2A6IA 2HLAB 1YNTA 2W9DH 4PTUB 4Q6IC 4CDGC 4ZNCD 4ELKB 5B3NA 5K59F 1K4DA 3B5TA 4QF1B 5HD8C 2P48B 4DWHA 4ELKA 3S8WA 2VDKH 5CCKH 2IANB 2WQRA 3VRLE 5DJDA 3R06B 1SBBA 3DLQR 4Z8FH 2VOTA 2NY2C 3S4SB 2IALB 3WO4B 5JW4Q 5CGYD 4JY6B 3OKLB 3GSVB 3MTRA 2ED7A 3Q6GL 2CIKB 3WEXA 2B1AL 4KQ3H 3PIQB 4JPKH 1S9YB 1IGML 3S4SA 4GJTB 2GITA 1J0IA 2AJVH 1U8PA 4JFHD 3LZFL 4JY6A 3OKLA 2CIKA 4M62H 4PLJD 1QRNE 3PIQA 4WFHE 2CK2A 3T0AA 1AD0A 1S9YA 5E8NB 1LO2H 3RWIB 3ZE2E 3RUGF 2XG4A 2J6EH 5F1NB 1KN2H 1WAAE 3A0OA 2F58L 2JJTA 1J7VR 5E8NA 4AM0B 4Z76B 2VZVA 4YW6A 4PRDB 2G2RB 5F1NA 2ICWA 1AI1H 1XCTB 5HGDB 1GPOH 4PP2B 5DQ9B 4F3FB 5I19H 1YQ2A 3ZKXC 4Z76A 4WO4D 1UG9A 1WZKA 1AR1C 1I8KA 3ARXA 1W8ZA 3QDHA 1SYVA 4QRPE 1XCTA 4PP2A 1ZLWH 1NFIB 5DQ9A 4F3FA 1KYOK 5D7IA 1I7ZB 1PD6A 1IC4L 4WFHD 2GFBA 2CGRL 1NFIA 3QAZC 4LP4A 3EO9L 1NBZB 3PDGA 1KLFA 2ZCKL 5C8JB 3P9MB 5J4MA 2EEBA 5I6XB 1IKNA 3VWJC 4Y19A 4U1KB 2E8ZA 3BPNC 5DI8A 1SY6L 3ARUA 2KUTA 1NBZA 4O02H 3DV6B 1WIUA 3IU4L 1X7QB 3ECBA 1TPXC 2YUWA 4X0KB 3D39E 5T3ZH 3HR6A 5C8JA 3P9MA 3ARSA 3PABB 1N4XL 4HFWB 1U8QB 1G6RL 4QRRE 2QSVA 4I1NB 4XNZB 1OAZH 2VLJB 4X0KA 5B38A 4QRPD 2C1PA 2EYRB 3BP4B 3BPOC 4WNQB 4HFWA 1U8QA 5F93C 1CD1B 4J4PC 4LMQI 3IFNH 2EYRA 3BP4A 3HC3L 3Q2CA 4XAKE 2W91A 3S5LG 3VWKB 2FX8H 1D9KC 5ADOH 1YEFL 2QSCL 1FG2A 1BIIB 4HKJA 2HKHH 2O61B 5K33A 3EYSH 4M7KL 3Q1SH 2YD3A 2Z92B 4MCYA 1KYOJ 3VWKA 2NY6D 3V7AG 2O61A 5BVPH 5KBNC 4PG9B 2Z92A 4UDUB 2HRLA 1F90L 2NY4D 4XTRC 5HHVL 1IM9A 3L3GB 1A8JH 1G6RA 1MVFA 1RJLB 4PG9A 1M4KA 1RURH 2N4IA 4UDUA 3B2UD 3CSBA 4HKXB 4FS0A 2CR6A 5F44A 3I85A 3QB7C 1FPTH 3QUZD 5IQ7H 5EO9B 4ZS6D 1RVFH 3VFUB 4PB0L 1RJLA 4GSDL 4JFFA 3WIIH 5I73B 5LQBH 2DQGL 4RWYL 1GSMA 3NH7H 2Q8BL 4M7JL 5C0AB 5EO9A 2X4RB 1GAFL 3VFUA 1AGFA 3KJ6H 3U30C 1OD9A 3MCLL 2K9UA 4OIIL 5I1JH 4FQIL 3MV9B 1E4KA 4OCRH 4BSWB 5KJRH 3UBXG 4NRXA 4K23L 2J4WL 1BZ9B 4O2EB 4BUGA 1OM3L 1OT1A 1EAPB 5IHZB 3VGHA 2M26A 3BSZH 4RMVA 3L6FA 1DUYA 4WGWB 1JIBA 1FAIL 5JMOC 1H9VA 1BZ9A 4O2EA 5I18H 1EAPA 3BP7B 1EEQA 5IEHB 3EJYC 4JN1L 1KC5L 1R3JA 3IKCB 4D0DB 2HT2D 3RVUC 4F37F 5FECB 4LP5A 1XIWB 1NMBL 5EH1A 4M1DL 1H3GA 3IKCA 1A0QH 4D0DA 3QT2A 5E2VH 4X7FC 1XIWA 2GHWB 5GGTH 5BRZA 2OMBA 1AHWC 1X5JA 5EORL 1G7HB 3D9AH 2Q76B 5E8EA 1OTTC 2JK5B 3NCYP 1NAMH 1MI5E 2XQYG 5A2KH 3VMNA 4JREB 5F88B 2HRPL 3ZSSA 2WLZA 3DUHA 2Q76A 4NQTA 2JK5A 4ZQKB 3ZKQD 1WCBA 1XR8A 3VXUD 1QTYT 4DK6A 4FMKA 3OX8A 3G6JB 3MSPA 4MGXA 1F58L 3ARDD 2XZAH 1AGDB 1FQ9C 2DB8A 3TP4A 1EO5A 4V1DE 3NCJL 5E7BA 4ZQKA 5IFJB 4U6HA 2ICEB 4HFUL 3G6JA 2Y7QB 5HI5D 4M93B 1AGDA 2XG5A 5IFJA 2ICEA 2XN9D 4LFHG 1TPXB 3MBXL 2Y7QA 4YHKH 5IM7A 3VWJA 1ACYL 4X99B 1DDHA 4LBEB 3BMWA 5LWYH 4K94H 1XF1A 4R90H 4WU7B 1WCQA 4PRIE 4XH2A 4X99A 1IL1B 4LBEA 4F9PA 1N0LA 2AJSH 1EIBA 1ZLUH 2DWEB 3MV8D 3WFEH 1S7QB 4P2OB 1FNFA 4Z95H 1UQSA 5IJVB 4U31A 4Q9CA 1IL1A 4PTTB 2I60H 3RL1B 4J4PA 1IQWH 3DJ9A 3CFKB 2R0ZL 3U1SL 5DURB 4OTXL 2DWEA 3QXDB 1S7QA 3BE1H 4P2OA 2O14A 4ONOA 3ISWA 3G6AA 3SHSA 3CFKA 4XWOC 4WI9A 4TVPE 5IG7B 5T1MA 2R8SL 3QXDA 2OZ4H 3HI5H 1NGQL 4ODTH 3HS0A 4OGXH 3MO1B 2ARJA 5C7XH 4LNRB 4Q58C 5D96C 2LVEA 1U8HA 2O26U 3P11H 4HEPG 1U8NB 1FNAA 4PRID 5IG7A 3KPRB 5DJ2A 3K2MC 3U2SB 4NO5B 4LNRA 4XBPA 4X9IA 4NYLB 1RJZA 1U8NA 4YHLL 4GAJH 1BJMA 2X4QB 3KPRA 1NJ9A 2PXYB 1KCRH 4NO5A 5EWIH 4MQSB 4UDTB 1FIGH 3L5HA 4NYLA 5BV7B 5JA9A 2H45A 4KXZI 1EXUB 2X4QA 3M8OH 4X7TA 1LP9F 4LQFL 1MFCL 4UDTA 5DRNA 4XWGH 5F3HA 3UX9B 2BRRL 4TVPD 3FQWB 1EXUA 2FATH 2YSSB 2P4AB 1MNUL 3MV7A 2YA2A 2IG2L 5M95B 2XZQL 2YSSA 1ZWIA 3A67H 3D18B 4ETQB 4Y7MA 2DBJA 3KNBB 1J05A 4J3TA 4OSUL 1S9KC 2E9IA 4GRLC 5CBAB 4ETQA 1CZ8L 2UVFA 2BXYA 1T5WA 2GTZB 3KNBA 2VLLB 2KR2A 2Y36H 2YUVA 4LCWD 1U3YA 5CBAA 4OF5A 4U6VL 4OM0H 3T8XB 2OTPA 1DQQA 3QEQE 2C3HA 1YYML 4JDZA 3BZ4A 2VLLA 1JTTA 4YX2L 1HZHH 3STLB 2AW2A 4Z7UF 2MCPH 2ADFL 3HC4L 4LSRL 5F8RC 4O2FB 5KSBE 3ZKNC 3T8XA 4UZGA 1WBYB 3O0RL 3RY5A 5IEKB 2N7BA 2QBWA 4LVNC 1R24B 4CVXB 3AAZA 5J06A 3NFSH 4KDVA 4JFQB 1YEIL 3SCMC 2XFXB 3OB8A 4O2FA 5GSRA 2PF6A 3NN8B 2AK1H 3QIUB 1WBYA 4I3RH 1JE6A 5IEKA 3HMXL 1BQLH 1R24A 2R4RL 3ARBB 4CVXA 4LCCB 4OJFL 4JFQA 4LHQB 3DO7B 4POUB 3NN8A 1UWEH 1L6ZA 4OFYA 2IFFL 4LCCA 2OK0L 3C6SB 5IF0B 3KS0J 3DO7A 4GW1B 3GDBA 4JPWH 1NMCC 3MUJA 3F5WB 3C6SA 5IF0A 1IT9L 3UJTH 5IVXF 1KIPB 1QFWH 4GW1A 4K8RD 2JB5L 4KVNL 5E2UH 4GBXC 5EU7E 4OUUB 4ZPTB 3I6KB 1JPSL 2CDFB 5I1CH 3ULVH 3F5WA 4EXKA 1UEMA 2NR6D 4P9HC 4Z7VF 1KIPA 3WD5L 1J11A 3I75B 1OQXA 4ZPTA 1EO8L 2G9HB 3I6KA 3GBNH 2CDFA 4GXVH 5IGXH 4GQPH 3ZT5A 1JNNL 3MRIB 3HMXA 3QUYC 5C0BE 2VL4A 3WHXB 1I1AD 5K93A 1TQCB 4JFZL 5C08B 3FO0L 3I75A 3S4SG 4PJ5B 5ENWB 1G1CA 2BX5A 3WLWD 5EG6C 1RIVH 1XF4B 1Z6JT 1XGPB 1J8HA 4C58B 4F15B 1IAKA 3LB6D 5C08A 2FB4H 5D2NB 5ENWA 5CJ8A 5IMOB 1QVOA 3LH2H 5D96B 1EZVY 1HILB 1XGPA 1FFPB 2H9GB 2D0FA 2EDNA 3R0NA 3FO9B 1N26A 1S7TB 5IMOA 4MMZC 5KVFL 1FFPA 1WK0A 4XI5C 2IPTH 4F58L 3HAEB 4Q6YA 4XXCC 3ZE2F 5SX4H 4D8PB 5C0FA 1S7TA 5F7LB 3IGAB 5DMJB 1WAAF 2K7QA 4JO2H 2AJ3B 4D8PA 2CLZA 1QBLL 1XGRB 3WS3B 4ONFH 4UIKL 4JFDB 5LGJB 4RISL 1Q0YH 4N0FA 4Y4HC 1XGRA 4XPTL 5F6HI 2PTTB 3WS3A 3NIFE 1Q38A 1JWSB 4WUUA 4JFDA 5LGJA 3B9DA 2LAGB 1P4IL 3QDME 1EPFA 2A74A 3Q48A 2PTTA 5D1ZD 2I25N 1JWSA 5BVJB 1RD6A 2R2BB 1AGCB 5IV2B 1DVFB 1L6XA 3B3IB 2R15A 4MAUH 3ARTA 5SWZB 3VMPA 5BVJA 4DUVA 1B4RA 1TJIL 4L9LC 4NQEE 4Z7WA 1ZSDB 5HYQB 4GRLA 4S10A 2JJSA 4R3SB 4OV6F 5JZ7D 1DVFA 3H42H 5I8OH 1U2CA 4NIKB 4X8XA 2DTSA 5HYQA 1OAXH 4M6AA 4K9EC 4R3SA 2NY0C 4MZ2A 3HI6L 5HYJE 5ANMA 2VKWA 4MJIA 4CJ1A 4WEBH 5J7CC 1L0YA 4MB3A 3DV4A 1V8HA 4ZFZB 1YNKH 4LQ1A 3FFCE 5FO7B 3QDMD 2RGSA 5DC0A 5E9DB 1AR1D 4P9HL 2E6JA 4ZFZA 3GUTB 4MMXC 4ZYKB 4PLKC 5FO7A 5FCSH 2ORBL 4JFEB 4PRBA 2DQCL 5E9DA 4K7FB 4NO0D 2NW3B 4LPTA 3HMWL 3GUTA 4OZGE 1NCBL 4OF0A 4AK1A 2VH5H 5T1LA 5JHDD 4K7FA 3RKPA 4LOUC 1F6LL 3PL6C 1X5IA 5C92A 5JDSB 2O5XL 1G9MH 3ARFD 2NZ9C 4O9HL 2OTWB 2HVKB 2PCPB 5E4EB 4Q2ZB 3O2DA 5D7KD 1BEYL 2Q3AA 5HHPB 15C8L 4PJGE 2AAVA 2X41A 5DC9B 5CJQH 3P30H 4JZJC 4XNYL 1VKXA 4NUJB 2YA1A 3CZFB 3T1FB 3LD8C 5HHPA 5E99L 1AGBA 4OFVA 1KJVA 1KJ2L 4CMMB 1JRHH 2C5DC 2ZOKA 2C3VB 4NUJA 3ZTNH 2CMRL 3T1FA 4QHLA 4NM8H 1FNSL 2DIJA 5I8KH 4XPAL 4AH2B 3QIWC 4XCFL 2VAJA 4UV4L 4CMMA 3RTQD 2AK4D 1QOKA 4GMSH 2BNQD 4HGWB 4DGVH 3UTTD 1W8NA 1L4IA 2C7UB 1TZIB 5KTEH 4PJHB 2BVYA 4C83B 5E8DH 4N9OB 4LDEB 2R39A 1QNZL 4LIQL 4QLRA 4XTRD 2C7UA 1A3LH 4CJ0A 4JRYB 3MNWA 4KJQC 4PJHA 4C83A 3C6LB 3X3FL 1VPOH 2ATPB 5LGHL 1MLBB 3GBML 5LG1A 4EQ2A 4P5MB 4XXCA 2DQIL 1N59B 2N56A 3NPSC 2VDLL 2ATPA 3LMJL 4FFYH 1YC8A 5JW4M 1Q94A 4G6KL 4WU5A 3G08B 1CDHA 5HVHC 2CKBL 3NTCL 4R7NA 2RCSH 1N59A 1QSEE 1X4XA 4HF5H 3RFZC 3GMRB 3UTOA 4K9EL 1D6VH 1GJIA 4GXUN 3G08A 3BRFA 5GISH 2HLFD 4Y4HA 5FHAH 1KNOB 5C07D 4TSAH 4KTDH 4TQEH 1BZ7B 4TSCH 1BF8A 1UH2A 1UM5L 2DD8L 4R9HA 4OD3H 2D7QA 2R56L 3E3QE 3QQ3B 3JTTA 1EEZB 3MCKB 4NP4L 5E8PB 4OZFB 5I15L 1J12A 1BZ7A 4KJWD 3WKNA 4CU7A 5DUBB 5DT1L 2CKBB 3OJ2C 4JRWA 3QQ3A 5IHUH 1EEZA 3MCKA 4OT1H 5E8PA 4MZ3A 4OZFA 1NCTA 3FMGL 1IGIL 1W8WA 1IM3B 5ERWB 5GS3A 5HVWA 1EHLL 3MROA 4L4TD 1QSED 1P84J 2CKBA 5I1AB 1FSKC 4KKCC 3LEXB 2GT9A 5FUZH 4MNQE 3CU1A 1IM3A 5ERWA 4YO0B 3I50H 1T5XB 5IVZB 1OWWA 3LEXA 1E6JL 2ADIB 1QRKA 4DK3A 4KK8C 3QHZL 3CVIL 4PYGA 1A02N 1KIQA 1I1RA 4YO0A 5IVZA 1T5XA 4YIQB 3EOTH 3QPXL 2ADIA 3QDGE 2A6JB 4XVTL 2R9HC 4GLRI 5B4MC 4H20L 2VL5A 3OKMB 3VFGL 4YHPA 3X3GL 4KTEL 4AQOA 4F7CB 1LILA 2FR4A 1CN4A 1DE4B 4OAWB 5EBMB 2OI9C 5HSFA 1J0ZA 4K2UH 5IBUB 1YY9C 1CLZL 1KULA 3A6BL 5GRUL 4MNQD 1E4WL 1T0MB 4NQDB 3HE6D 1DE4A 1T1XA 5EBMA 5DVNA 2WWKT 5DJCB 3SDYL 1G7IB 4RDQG 4YHOL 4BFIA 3GI8H 3BHBA 1IGTB 2RFXB 4GMTH 4NQDA 2PO6B 2P1YA 3VW3H 4Y5XB 5DJCA 4CU6A 1MCLA 1HH6B 4NQCB 3TN0B 3QDGD 1VFUA 5FO8A 1REIA 1G7LB 2PO6A 5DJ8B 4Q9QL 4Y5XA 5IWLC 4NQCA 1HH6A 1FLTX 4D2NA 3TN0A 4A2MA 4L3EB 3MMEB 4ZNEA 2OLDA 5DJ8A 4DCQA 3DVIA 4M1GL 4YNYA 1J18A 2Q6WA 3QIWA 2P8PB 3B9KD 3ULSB 1A7BA 3AGVA 2ZJSL 4L3EA 3MMEA 5D7IF 4G9DB 4OI8A 4X7DC 2P8PA 3LS4L 1RZ8B 2NXZB 5BO1H 3VXOA 4PJXE 4HS8H 1BQUA 3FB8B 2HP4A 4QNPE 1RZ8A 1YEKH 3NPSB 1T6WA 2EYTA 1K6QL 1CDIA 3MZTA 5C0GA 2HG5B 2XPGB 4QRTB 1RIUL 5HVHB 1ZV5A 3E1F1 3FB8A 4Q7DA 4EIGB 2J3SA 3OAYK 3GO1L 4M8VA 4RZCB 1IAOB 1ZTXL 4JM2D 5ALBL 4MD0B 2E7CA 4NHCH 4H1LH 2ZOLA 4CVZB 4WI8A 3CK0L 1MELA 3E8UH 1IAOA 4RZCA 4XMPH 3VD4A 2Q1EA 3BW9B 3M07A 5ELIA 3C09C 3X11B 1T22B 4DQOH 4OLYL 5F9JB 4PD4J 2FH8A 3KS0H 3HNVH 1Z9MA 1U41A 4EUPH 1I7RA 2DLTA 2IBZX 3BW9A 3MUZ1 4M6OH 1T22A 4ZFGH 2FIRT 2FH6A 3FOLB 1PEZA 4FFZH 4RFNC 3WBDA 5F89B 1TZGL 3LKRB 2BNRE 2GCYB 3FOLA 5EBLA 3QUKB 5DRZB 4EXPX 5JXEC 4JKPH 1NDGB 1NC2D 1TJGH 5F89A 4DN4H 3ZDZE 5EFIA 2GCYA 5CIPH 4NKOB 5DRZA 1L7LA 1RU9L 3L5IA 4UINH 1NDGA 2C3WA 5KW9L 3SCMD 1NLBL 2JB6A 2EICA 4RAUB 1KIRB 2FX9L 1U58B 2XQYK 3GRWH 3K2UL 5KS9E 3MBED 3MJ6A 2Q7YB 2XI9A 4ZD3H 3PGDB 3UYRL 4N1HB 1UGNA 1U58A 3FZUC 1CI5A 1A3RL 1UYWH 1CICD 2BNRD 5SV3A 5CZXC 5BS0B 1OSPL 4NO3B 1YUHB 1DANT 1QQDB 2Q7YA 4MHHG 3WDHA 2VSDA 3HAEG 3QWOB 4XVUC 5EZJB 2QADB 1DR9A 1NCUA 1NUFA 2ZCLL 2QKIB 1NAKH 1M7XA 2Y06H 3RWJB 1IGYB 2MMXA 4JO4L 4NO3A 3TESA 4UQ2B 1QQDA 5EZIH 3QWOA 5EZJA 1T03L 2A77H 2QKIA 1MRDH 3RWJA 3MA7A 3VCLA 1KCUH 2B2XL 1FGNL 4XVSL 3BQUB 4GW5B 5TDOB 4K71C 4WUKL 4G7VL 4X7SL 5IWLA 4YDJB 3BQUA 2X42A 1A7RH 3BVNB 5TDOA 1NLDH 5I75C 3T09A 1BF2A 5GGSB 1CDBA 4N5EC 4YDJA 4E5XA 1HNGA 5MHSE 3LS5H 4A6YL 3BVNA 1ZANL 1WFTA 5F70A 3T2NL 3WFBH 1GH7A 4LIQE 5DEGB 2AQ1A 4E41D 3RX5A 2BXZA 3G6JF 5EOQL 1EEYB 1DUZA 2F53B 2Z0BA 1BFSA 5DEGA 1PLGH 3EDFA 5DA0B 3GIZL 4MD5A 1DQLL 2GJ6D 3IVKB 5T33H 4IOIB 3LQMA 4JKMA 5D5MB 3SGJC 4U0QB 5JDJA 5E08L 4U3CA 3HB3D 1EO7A 1H3PL 4I2XA 1JPFB 4NUGH 4EI6A 2ID5A 5D5MA 4HIJA 1A14L 1G9NC 2WP3T 3SDXE 4A6YA 1L7IL 4YJZL 3BKJH 1S7VA 3WMSA 4UV7H 5HI4C 1WV7T 1MCEA 1AE6L 4OZGF 4U1IA 1HK6A 2FL5A 1JGDB 5EA0L 2Q87A 5K9KA 3CVHB 4JCMA 5GRWA 1YEHH 1HDMB 3GB7B 3O3EB 4RRPG 4HUUB 1A6UH 2YEZA 3IFLH 5ABDE 2DLFH 1JGDA 1KCVL 3VI3E 3CVHA 3GB7A 3O3EA 1WT5C 1LWRA 4HUUA 3F7PC 4NWUL 2ILLA 2BVQB 2PW1B 3M17B 4JPIB 1ZT1B 2YD6A 5CHNB 4PRPB 5JXEA 3TO4B 2EH8L 4F57H 2IAMC 2GI7A 2PW1A 3D3VD 1I7TB 5C0CB 2BCKB 2P47B 3M17A 4JPIA 5CHNA 1OP3H 4PRPA 1IGJB 2B1HH 4KZEH 1GYAA 1P7HL 1K3ZA 4Y4KC 4Q9RL 3GSXB 5C0CA 2BCKA 1NCDL 1CYGA 2FNBA 2XACC 3O3UN 4LLDA 2I9TB 4L5FL 3WKMH 1KB9J 2HTLC 5F97E 2AGJL 3AS1A 2R1XA 1NGWB 4OB5L 3JBG7 1JL8A 3V7AE 2I9TA 4HXAL 1FFNB 3KYNB 3PL6D 4K3JH 1G9EA 5D7LE 3ZYIA 1F3DH 3OPZH 3BEVB 3P77B 4HW6A 5HHQA 2ICES 4GW4A 1W0YT 4GAYA 4NPYA 2HKFL 1KT2B 1U95B 3A6OA 1GHFH 2WK2A 3BEVA 2FECI 4JB9L 3PWVB 2HYMA 3P77A 4NN5C 1X5XA 3OAUL 3KPSB 1VESA 5KVGH 4R2GC 1KT2A 1YEGL 4TVSa 1U95A 2FBOJ 1NGPL 1UACH 1UCBL 3WFZA 4K3EL 3PWVA 1KACB 1XF2A 1CFSA 1V7NL 3KPSA 1IEHA 4MA3B 3RVXC 1MCFA 4HCRA 1AQKH 4X9FA 4FQLH 3U0PA 3MC0A 1YYLH 3MA9H 3T3PF 4OZFG 5MEPB 1DFBH 3MRGA 4MA3A 2VTFA 3JV4B 2VB5A 2Y6SD 4O51B 2NYYD 5EZOL 4YUEH 1IZJA 4B53A 4NWTL 5J11C 1MCHA 4J8RB 5MEPA 3EDKA 1ZVSB 3JV4A 1X5ZA 4FQJL 4AIXA 1F3JB 1VGKB 1ORQB 2R69L 3HZYB 4LCYB 2ZUUA 3T77B 4U1NB 2IMNA 4J8RA 3PQYB 4LCIL 3DXAB 5AYUL 5ISZA 1ORQA 3HZYA 3BWUC 5MENE 3EZJB 3T77A 5FOBB 3UT0A 4U1NA 3C2AH 3CDGB 1G0YR 1RK1B 1U8MB 3V0WL 4F7EA 4XC3H 3WIFB 3AUVA 3SGJA 3DXAA 3TBYB 2V2WA 2HJLB 3K8MA 2AEQL 1MCOL 4CNIB 4OV5B 4URTB 3MFFB 4QKXB 3CDGA 3U7WL 1RK1A 1U8MA 2R0LH 3F65A 3WL9A 4YDVB 5EPMA 3WIFA 3O9WD 5F9WC 4FG6C 2HJLA 2L4OA 4CNIA 1I3GH 5KVDH 3MFFA 1N64L 1B4JH 3QO0B 5DD6B 4YDVA 5JORB 1NBQA 5GJSL 2NXYC 2XZCH 1UC6A 3F7QA 5IBUG 3L3OB 3QO0A 1FE8H 5DD6A 3V6OE 1RZJC 5JORA 3VD7A 1T7ZA 4H0IA 4D0CA 3L3OA 1U9KA 1Q1JL 1OTUC 5E6IC 4Y4FC 2CK0L 2DS4A 3QQNA 4YE4L 5CEYB 4R0LB 4XCYB 3QUXB 3U7YH 5GRZA 4RGOH 5M7QA 3VFTB 2VN7A 5D72L 3HTLX 3ULUF 1AXSB 1SBSL 4R0LA 2IAMA 4YHIB 5EB9A 2J1KA 4Z0BL 4Y4KB 3VFTA 3WIHL 4HLJA 3K0WA 1OKOA 2ZKHH 3VXMB 1CF8H 4MA8L 4YHIA 1G1YA 3UTPE 1NCAH 4Y4KA 4L4VE 1NC4B 4P59H 4M00A 3VFSA 3WFDL 1MFNA 1GGBH 5IW6A 4S0TD 5IMLA 1VERA 3GBLA 1X4ZA 1EGJH 1B6UA 5FGBC 4PJXF 2YKLL 1FVDB 2I9LA 4LLWB 3BAEH 4Z7WF 1N5YL 4M43H 3EAKA 2X9XA 1B0GA 1AY1H 4NN5B 1SEQH 3NIGF 4LLWA 1KIUA 3FJTA 4S1QL 1GCFA 3UTPD 5GS1C 4HWBL 2Y9RT 4B41A 4OQ1A 5E00B 1RAMA 1F6FB 4TUOB 3NBNA 4DUXA 3I9GH 4YEEA 2DQFA 1XGYL 3P3YA 4ODHL 2D9QB 5BJTB 3UEZA 5E00A 2ERJB 4U1GB 2VLRA 1LEGA 5CP7B 4MWFB 3VGDA 4OZHE 5BJTA 5LCVL 2NY5H 1OLZA 3N9GL 3VXSB 3ARGB 3N85H 5I1GL 1MCSA 1IMHC 4ZTOH 5GGUB 4N0YL 4K3DL 3ESUF 2WAHA 3DROA 3FN9A 2BY1A 4R7DB 2DJSA 3OR7A 5EIQA 4NC2B 1RZJL 5D1QD 3RWEB 4E9LA 5GGUA 4W81A 4HWBA 2E5EA 1FJ1A 3TVMC 1K5NB 4ZDHB 4OGAD 5JIHA 5LXGL 1I85C 3SDCC 1WC7B 3ZDZF 3LEYH 1W2KT 2ZP0T 1FYTE 2J5LB 2JCCB 2YC1A 3DX6B 1Z0MA 3R8BB 4XCCH 1N7ML 1K5NA 2NW2B 4QYOA 5F9WB 5JW4R 1WC7A 4EN3D 3GM0A 4S0SD 3ARRA 3UCRA 2RAMA 4UT6L 4XP5H 2JCCA 5C0ND 3TWCL 1F97A 3DX6A 3RIFK 4TUKH 4OF3A 2NW2A 3H9SB 2G75B 2L7UA 1A7NL 3ZYJA 1VSCA 3DPBA 4CRPA 1JYXA 3HA0A 1YMHA 3FQXB 2EYSA 3LN9A 4G42B 3T3MF 2JLLA 5GGTA 3IJHB 2G75A 1FVCB 2ESVE 3OGOE 5GIRB 3KDMB 4LSPH 1AXTL 1FNGB 3BWAA 3FQXA 4G42A 3IJHA 1HN1A 5D70H 1B3JA 1KELH 5TE7L 1CG9A 3KDMA 2VO5A 3CFIC 1FNGA 3X12B 2RJMA 4FTVB 2FJFB 3KXFA 5I0DA 4IS6A 4XPGH 4RGNE 1OP5H 2IANE 3JUZA 4FQ1L 2DYPB 4R26H 4LSDA 1QSFA 4ZMAT 3BISA 5HGBB 2QQNH 3X12A 3KHQA 2OJZL 4FTVA 2FJFA 3QFJD 1LO0L 3H7BB 1NFDB 2DLHA 2Q8AL 4Y1AB