4AFMA

Structural and biochemical characterization of a novel carbohydrate binding module of endoglucanase cel5a from eubacterium cellulosolvens.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
127
structure length
127
Chain Sequence
GDIVLFSGSKHVEFTDWGGTDWPSAYELQPPYQTMPFDLNKNFEIKVDYSGADIVLIFARWEHGSKPQIWAQISPYYVVDGTAVFTKEQIAKAYGSDDFSDLDYIGVKPLPSADGMTVTKIVASYTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ENDOGLUCANASE CEL5A
publication title Understanding How Non-Catalytic Carbohydrate Binding Modules Can Display Specificity for Xyloglucan.
pubmed doi rcsb
source organism Eubacterium cellulosolvens
total genus 24
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18259 CBM65_1 Carbohydrate binding module 65 domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1070 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4afmA00
2YPJA 4AEMA 4AFMA 4AFDA 5AFEA 4AEKA 4BA6A
chains in the Genus database with same CATH superfamily
5DAPA 4XEZA 4PDWB 4UT5A 1VBD2 4BOWA 4META 5FOBB 2DU0A 5E89A 2V5DA 3E1F1 1RMU1 2WS92 1DQ6A 1E5HA 4IEYA 5CU1A 4R9DA 4XFIA 3FUQA 3AXDA 1H8TC 1T6GC 2WLQA 3N9MA 5FPZA 4C0HA 4AFBA 5FIXA 4MHUA 4MXVA 4QPIC 5FMCA 4ZHNA 3H0OA 4PQ9A 1CIWA 5KC5A 3LF7A 3AP5A 1XC6A 3THDA 3ZXLA 2R30A 2D6MA 1SACA 3MW2A 3WNOA 1VE0A 4FPEA 4QPYA 4XDOA 1S0DA 3T1LA 1D4VB 1PK6B 1UWWA 5J98B 1PIV3 4ASMB 1OFSA 3O0WA 4CDXB 1E57A 1AR93 3EO6A 1DGLA 4PIXA 3K4AA 3BTXA 4XUOA 2X5IC 2BEOA 2RS13 4YW6A 2RM22 2YBKA 4H7MA 2H0VA 4I3GA 1RC6A 4OHZA 2D5FA 2YC4A 4NIDA 3VHNA 1IPKA 1X82A 3T4HB 4DINB 4DEQA 2RS33 4OCTA 1PVXA 5FZ0A 3K77A 3I3MA 5CG8A 4PCRA 2W1QA 2KA3A 3IIIA 1QQP1 4I0WB 1NA1C 1FNZA 1UW8A 4GALA 4O65A 4PBOA 3N35A 4WM8A 4PJYA 2HYKA 4LULA 5F5CA 3RWNA 4D8MA 5JR7B 3LPFA 3PNAA 1UQXA 4FFFA 3SXWA 3ES4A 4AAXA 4HPKB 2R042 4NUBA 4NPRA 4OQ9A 3C8XA 1EPZA 1OI6A 4COYA 5KHIA 4XJ9A 5H9SA 4BZ4A 1BMV1 4I2OA 1WMFA 2I07B 2WJSA 5C4WC 1BBT3 1D2SA 4GQ7A 1LODA 4UFLA 5I0TA 5LW9A 1NKGA 1YFXA 4AGVA 5FP7A 1OHFA 4XW3A 3CJIB 3PVBB 4NPLA 1ULPA 2ZABA 2OXBA 2Y0IA 1A34A 2AREA 3E97A 4CVUA 3D3AA 3C7EA 1PIV1 3H9AA 4OHYA 2VCAA 1SBDA 3DPRB 3GZAA 5H9PA 4MXWA 3RWKX 3TWIA 3V64A 4EJRA 4CEYA 3OF1A 1LENA 2DVAA 1AR91 4XUNA 5GZCA 1AJOA 5K0UA 5FY7A 1QJY2 1RUC3 2RS11 2I45A 2VZ3A 2ARCA 3ME2A 2Z42A 3OPTA 5F32A 2RDRA 3EB7A 3ZKYA 1D4M3 1OKQA 3A22A 3AC0A 4MYEA 2ZX3A 1MS9A 4CCMA 1J58A 4NIAA 3WX5A 3BIEA 2RS31 4CCNA 3V65A 1OA2A 2Q1MA 3LEMA 5FPAA 5L73A 3SQOA 5HCHA 3IBMA 2J1AA 2RJKA 1C1LA 5FY1A 1GZ9A 4HN0A 5GZGA 1FATA 4QKNA 3OGRA 3MV11 2VE1A 1XRUA 4AQSA 3WP3A 4Q4W2 2E7QA 2Y33A 5FKCA 4XFHA 4MVTA 5FZKA 4XJWA 3B00A 2JICA 1KXGA 4CCDA 5JIAA 2AH2A 5L9BA 2YUEA 4QQ2A 2DCYA 5FMBA 5IWFA 2QQWA 1KDKA 1Q8PA 4LKSA 3QH6A 1BBT1 3SMHA 1BKZA 1HJFA 1OOPB 4P9YA 2PTMA 3UT0A 1BK0A 4ATEA 3V0BB 1PNGA 4P9JA 3KD4A 4YGEA 4XBQA 1MZ5A 5I8TA 1COV3 4LOSA 3VDAA 3MF9A 3M7AA 3WQ0A 3H1YA 2VD7A 1OVPA 3LEIA 4GWIA 4UWDA 3PDQA 4RHV3 4XAAA 2XLFA 5EIYB 5DQ0A 4XUTA 3AKQA 4HSLA 1D2QA 1RUC1 4XFGA 1D4M1 3MICA 4LIVA 5E1RA 1WW5A 1K5MA 2NN8A 5FP8A 3H50A 3M3QA 5J36A 1FPN2 4QM9A 4QPWA 2RG4A 1UO9A 5A7PA 4E9KA 3W5NA 4BE3A 5L19A 2VOVA 5CG9A 4QB6A 4WVVA 1PO23 1C1FA 4YG6A 5LBBA 3MZHA 5FZ7A 2YY1A 4OI1A 2W87A 3ZFEB 4A6SA 4GWMA 4BQ4A 4DXTA 1MEC3 4Z82A 5FPUA 3VLBB 4EROA 3OCPA 2X09A 1RL3A 2PQQA 1DQ4A 4ISRA 5K8SA 4NHLA 3C7FA 3ZXKA 3T4VA 4M3CF 1QKQA 4FPFA 5HXMA 3M3IA 1ZZBA 4FOWA 2PELA 3WG3A 3BCWA 1C5IA 5JZGC 1BJQA 1ZZ6A 3DYMA 2Y0OA 3DV8A 5T52A 5DABA 3VHPA 2BPA2 1HB1A 1RITA 1JOPA 2IC1A 4NROA 1QXRA 2EIDA 4ZS3A 3AMMA 2XONA 1OQEA 4FPKA 4JHTA 5F39A 1COV1 1K12A 5FMDA 3M3EA 2GC2A 4OFGA 1KEXA 5I0DA 4A3ZA 4AI9A 3LA7A 5T5JA 2WSUA 1XE7A 2QQIA 2WA3A 4RHV1 5FYVA 2WT2A 4HN1A 1SLBA 3PVOA 5A3OA 2P37A 2SBAA 4KBBA 1EP0A 3MW3A 4FQ4A 2P3YA 2Y26A 2NLRA 5EFUA 4AQ2A 2XL7A 1QMJA 4A3XA 1G7YA 5I8YA 4HBNA 2W68A 1MS5A 3RNSA 2ZGLA 4CU9A 4D7YA 4RR3C 1WA4A 2PFWA 2G19A 2C0ZA 1MS4A 4N9HA 3JXSA 2O1QA 3BYWA 2GMPA 1HQLA 1PO21 4N43C 2PHXA 1LKNA 3B9IA 2C5DA 1NY72 2A75A 1UAIA 3MFAA 2HYXA 4KGQA 2JIGA 2XGXA 2OPKA 4RQPB 1MEC1 1W6MB 2ZJCA 1X8EA 2D5HA 1UOGA 1AL22 4XQ4A 2ZGNA 3KHCA 5IW0A 5L9RA 3VBFB 3A0NA 1N3PA 2EIGA 2R072 4UF0A 3O1RA 1ULDA 2ETEA 2ZMNA 1FV2A 3L2HA 1JYWA 3VBUC 2GH2A 3QCWA 4QQLA 2JB4A 2VCMA 2JDYA 3MIDA 5B4XA 1S2BA 1H1AA 2JKXA 1O4ZA 1QHDA 4RS5A 4CCJA 2AEYA 4Y4RA 3U37A 3C7GA 4IE6A 5CFCA 4COUA 3QOPA 4BM8A 1R1A2 3AK0A 3IZOA 5FWJA 1F35A 1CZVA 1LOFC 2IXKA 3GHNA 4QT6A 1ZZ7A 2VY0A 3WNMA 3AXEA 2PHTA 4NWWA 1HQWA 3OYWB 5FLHA 4CEWA 3MHZA 5EV7A 1M06G 3WHUA 1L7LA 3ACLA 4HK8A 4PDWA 4QWNA 1GOGA 2WC2A 3VDCA 3ZPYA 1B35C 2IUWA 4HZFA 4F8AA 2YYOA 3VBOC 5H9RA 3JQWA 5ACA2 2XBO3 2VQ0A 5JOYA 1OH3A 5CNAA 4JCKA 5FMOL 2Y60A 3D5OA 4XAEA 1UY4A 2V4VA 2R7EB 3ACGA 1C8M2 1DFQA 4D94A 4FFHA 4AI8A 4MH0E 3O0VA 1PNFA 3WNXA 1RUF2 1DIWA 1MS3A 2D3RA 3KCYA 4OYUA 2WNVB 4YGDA 4L8QA 5IAVA 2ADDA 5FFOC 1SFNA 1LOEA 1YUDA 2XR4A 1W8HA 5FJKA 2VMCA 4NOTA 3T09A 3VD4A 1PK6A 3ETPA 1PZ9A 1HQNA 1QJU3 1CX4A 5CFDC 2WO2A 4JGYB 5FZ8A 1UU6A 4CDUC 4XDQA 3WZ1A 3POJA 4CDXA 4CUAA 2VUCA 2JD4A 5EPAA 3F2ZA 4F3JA 1RGSA 5K7PA 2Y6KA 4YWAA 1OXCA 5IFPA 3AMHA 2YB7A 1ZVFA 5F8PA 5LEJA 2ORXA 5EXOA 5KHKA 2VL4A 1AYM3 2HEWF 4WZCA 3VDBA 4XF3A 4EZ4A 2EAAA 2X10A 1H9WA 2GDFA 5EP9A 1OUXA 1HN0A 5CZKA 1NCQC 2PLV2 1VBC2 4NHYA 1GP6A 4M01A 2VG9A 1RTVA 1XYNA 1CVNA 4XJZA 3VD7A 2E9QA 3OBTA 3ZFGB 1RYYA 1ULEA 4CCKA 2AUYA 1UY2A 4HPKA 2E6VA 3LKJA 3I2HA 2XBO1 2W1UA 1MACA 3DL3A 3K51A 3W21A 2E7AA 3WDYA 1QXPA 2WT1A 1W9WA 1RHI2 1UZ0A 5E16A 4YSFA 1DQ1A 5DG1A 4EN8B 1UCXA 1W6OA 2D6PA 4QKBA 5JMCA 3JQXA 4IV3B 3THCA 3P3NA 1LRHA 1GSLA 5FY9A 1C8NA 5JR2A 4P9XA 3MBWA 1H0BA 2L9LA 3CJIA 1RMU2 2LROA 2VU9A 4LJHA 4XQDA 3WNNA 2XHKA 4XZUG 1QJU1 3LA2A 1AF9A 3ELNA 1CIYA 3OUHA 4Q0UA 3BTZA 2WO1A 1ZRCA 4FSJA 3WG4A 5IT6A 1U5ZA 2WKKA 1Y9GA 3MGUA 5A3MA 1UL9A 1XYPA 2WZ8A 4CCCA 3P5BA 3AX4A 3DKQA 4LO6B 3USSA 3AZYA 3T0DA 2JXAA 5SV8A 1AYM1 3KV6A 1VBB3 1OUSA 3RYPA 4IE7A 1HB4A 1RUD3 1W06A 5FWEA 2WO3A 1IPSA 2HWC3 3K3NA 5A7NA 1DGWX 2YBPA 1S2EA 5E8AA 3OEBA 1G9BA 3ACFA 1NG0A 3H3ZA 1XE8A 5JOZA 4LBNA 1W0PA 1XQNA 1TNFA 3PUAA 3PLQA 4XTMA 3ENRA 1O8PA 2QTWB 4CP1A 4YFWA 3LOBA 2YDEA 5C70A 4XBNA 4AEKA 5F3IA 4DRRA 4HVOA 1O3QA 3HNMA 3FX3A 3POIA 1VRH2 1W99A 1OOPA 4KI5M 2K46A 4YZ1A 5C9AC 2H6CA 4Y26A 2WZEA 2JX9A 2ES3A 3E5UA 2WR9A 4MV2A 1CAWB 4Y3OA 2EXKA 5EJ3A 3ZSLA 5GLWA 2XDVA 1ZRDA 4BK4A 3W58A 5L7OA 1DF0A 5A70A 3U11A 2WINB 1QJX2 5DN2A 1RUJ2 2GALA 3OBRA 1XSRA 4FOVA 4FP2A 1LCLA 4X8NA 3UKNA 5IJRA 4AVVA 4ES9A 5GLZA 2GC3A 3RZGA 2QCSB 5FPBA 1HJGA 3VZJA 3CF6E 3KGZA 2OKXA 5HV4A 3CMGA 1IQDC 1SDWA 1VBA3 3PU3A 4WM7C 3W20A 2W1SA 2QFEA 5GALA 1KGYA 5GZDA 2VCBA 1VBB1 2IXIA 1W8OA 3RZZA 1RUD1 4GH4C 5LY1A 2HWC1 3ALQA 4XFBA 4XPVA 2YHJA 4K1YA 4LHLA 1XPWA 2J7MA 4IE4A 2BWCA 2ZGSA 4BCUA 5FYYA 3ZFEA 3LDRA 4JDOA 4LO5B 3ILNA 1FMD3 3OGSA 5KC6A 1AXKA 2YPDA 3KM5A 4QPGA 1HDKA 3AM2A 2ZGRA 2PA7A 3B9CA 4HANA 2RS32 3M3CA 1C4RA 1LEDA 4XCAA 3ZFFC 1AR83 2WAOA 3DYPA 2WZR2 1V6IA 4N8MA 5DDJ1 2WWSA 1BCXA 5AC92 5BPXA 5I0RA 3KT7A 3VZOA 5EHDA 1URXA 3ASIA 1PMIA 1S1AA 5F6KA 1JZ7A 5KXEA 1BEV2 5A80A 3WXPA 3EXUA 1VBE3 4CP9B 1W6PB 1SCRA 2AZ5A 3AKPA 1MVEA 2EXIA 4ASLA 5BV6A 5FXVA 2I2SA 1AR62 1XNCA 4GA9A 4PIZA 1HXS3 1XNDA 5FZ9A 1JU3A 4TZDA 1AX1A 2XL9A 5HCFA 1SBFA 1X8MA 1FOD2 4LKDA 4YG3A 2IFRA 4YVSC 1RUH2 1CZTA 1U12A 2HWE3 1AXYA 4HONA 5DZGA 1VBA1 2BTVC 5LA9A 2XJRA 3HPNA 4PI0A 4QU2A 4IW3A 2D40A 4XXAA 5CVRA 5GM0A 3O1VA 1MQTC 4XQWA 5LZ6A 3C3VA 3TAYA 4E8DA 3HN1A 2YMZA 3RQ0A 3R4DB 1QIQA 2C9KA 5JIUA 4OMCA 4FPHA 4Q29A 2J1RA 3IDBB 3W5MA 3ZOIA 1Y9QA 2VZSA 2QQOA 1FMD1 2R063 5T50A 1W6MA 4YVWB 1OSGA 1OC1A 3KLSA 4GB32 4Q26A 4AVSA 2YPJA 3HNYM 2DU1A 1ENQA 3PMSA 3VBFA 5J37A 4X8PA 3QLQA 1NLSA 1EPWA 5FKBA 3NJYA 5C6CA 1AR81 4ZONA 1SLTA 3R05A 3ECQA 4GWNA 4YRDA 4QHBA 2P4EA 4OVEA 5FXZA 1W28A 1H2KA 2E26A 1S0GA 4XJAA 2JDHA 1XNBA 3IM0A 4CDQC 5C8CC 2MEV3 1VBE1 2VUAA 2XB6C 3BPZA 3PMEA 4XUQA 3RMYA 4AAPA 1WW6A 4M0HA 3RRDA 2ORZA 3ILRA 1BVVA 1VAMA 2WA4A 2XKOA 4QGNA 1ZBA3 2VZUA 1UY3A 1VP6A 1E5IA 2GC0A 3ZXFA 4AW7A 2ZBJA 3O5SA 4UFMA 1O4YA 4XABA 1S0EA 1PZ8A 1F31A 4RGKA 5FR3A 1YC61 3OYWA 5IVVA 4AFMA 5F1RA 3H42B 4XIKA 2DVBA 2RMU2 2RDQA 1H1MA 1OMIA 3GGLA 4ZXEA 3DGTA 2QZ2A 5I8SA 1ZYBA 1CAVB 4NAMA 4UFKA 5FTTC 1JYVA 1S0CA 3S7EA 5JZGB 4MADA 2JDNA 4XMIA 3BKZA 3M4FA 4Q1RA 2BUKA 1YQ8A 2VMFA 3DUIA 1XNAA 4JQRA 3T08A 1O3SA 2EXJA 1A8DA 4TYSA 4PLOA 4YZ2A 2R061 5DAXA 1W3VA 2FCVA 2QZ3A 1A3KA 3NAPC 2WNVA 4JGZB 4FPCA 4LHNA 1JYNA 5JSRA 1I6XA 2QQMA 2WABA 2OZ6A 4BPZA 4QX8A 5C8WA 4WVZA 3PUQA 3RZLA 3VZNA 1IHMA 4LBQD 4AHXA 4AOCA 3FMGA 1GLHA 4AVAA 4JGYA 2JDZA 3OY8A 1PGL1 2MEV1 4Q4X2 4FO9A 2WFF2 2OYZA 2JWPA 3KV5A 4IGQA 5FY0A 2WQ8A 1W90A 1QDOA 4W6YA 1W8TA 5D8AB 5BYNA 1CPMA 1KFXL 1ZBA1 4LUKA 4N43B 2QQUA 3NV4A 5DZEA 2XJQA 1DYKA 2ZX4A 2BNOA 2LRPA 3WR0A 4CDWB 1F2NA 1WMEA 1RUG1 4FOQA 4HETA 5DXDA 2FBEA 4OZXA 3AMNA 2OQ7A 1ULFA 4LO8A 2HWD2 1RUI2 2ZXQA 3EYPA 5FO8B 4IEXA 2LS6A 4XOGA 3ZFGA 4FAHA 3NL1A 3FJSA 5TSWA 1S4CA 3KV4A 2XH6A 1XOYA 4KL1A 4DUVA 2BRTA 2VAUA 5FOJB 1YJLA 5FO9B 5IK4A 3GALA 3WHTA 2BU9A 2VTXJ 5DAWA 4XF4A 3O1SA 4YZ5A 2CSGA 2ENRA 2PHRA 4YNIA 1NE6A 3ZMOA 2FZ2A 4Z2WA 3U10A 3UK9A 3PJYA 5IK8A 2JG9B 4GMP3 4D6SA 4MGTA 3FHAA 3IKWA 1SPPB 3UKTA 4IE5A 3Q8EA 3AKSA 3V0AB 3SITA 1QOTA 1I5ZA 4BQ3A 5FXWA 1TMF1 1WKYA 2VVEA 4UFIA 3OGGA 2C6SA 1PX4A 2ZGTA 3GJAA 2XVGA 3VBOB 4AVBA 3VD9A 4LA3A 3LFIA 3THTA 3I2IA 3VDDB 3I54A 3LWCA 2PHWA 1QEXA 5AVAA 2VOWA 3MIGA 4B4PA 4DO0A 4Q4V1 4HK9A 1ZBE3 4GMP0 3NNLA 2QQNA 2OA2A 1Z7S2 2YC2A 1F4AA 1AYN2 1NCRC 5JPMB 1G6NA 2NYYA 3PUIA 2FDJA 5JOXA 2N7GA 3J9SA 2GZWA 3JCIA 3J7HA 1OURA 4E27A 2HWB3 2PN5A 3KCXA 4JTOA 1IS4A 4IDZA 5FMOS 3SEEA 5CFDB 2D6LX 4CDUB 4IV1A 1ZM1A 2XXZA 5JOWA 3KT4A 1AR72 4AHWA 3MIFA 4CU6A 3WNLA 2BGPA 2A71A 3AYCA 3WDUA 1IS3A 5A7QA 4E4HA 5IVJA 3WUDA 5IVBA 3ZN6A 4GMP1 3S5AA 1CAWA 4QQPA 3E6BA 3KQRA 3SISA 2XMLA 1QJEA 2KM2A 4K6BA 1IGOA 4K1ZA 1J3RA 3GZEA 5KR7A 4AL9A 3POBA 5KBFA 4NPMA 3VD3A 4NRMA 4L92A 3TOJA 2FMYA 1H30A 1UPSA 1YIFA 1GZWB 5EJ1B 2WUHA 1SFYA 2EICA 1R1ZA 4QKFA 3TN93 3T0BA 1JTZX 1REEA 5LY2A 1J3QA 4P9GA 2RS53 2E33A 3DCQA 5F5AA 2JG8B 3N7LA 3BU7A 3I3BA 2DBIA 3JD72 4JRLA 1DG6A 1WCQA 3ZYPA 2GU9A 2WNUC 2W0XA 4OMDA 2Z79A 5A3UA 4XFFA 1O91A 3K4DA 3NV3A 5A7WA 3ZO0B 3VBRC 4E4SA 3DN7A 2HWB1 1JYTA 1V6JA 2NM1A 2P6HA 3FBYA 3HEIA 1G9AA 1EAH3 2UYBA 2VZTA 4DY3A 1LGBA 2GMMA 2QE3A 3N9LA 2CV6A 1WMXA 1EV13 4AZZA 2VMGA 5FUPA 2VQAA 1GICA 1UMHA 2Y6HA 2CGPA 1XNTA 1VMHA 4CP9A 1ZRRA 1W6PA 2Y6LA 1NOVA 3O0XA 2SLIA 1ZZCA 3AYAA 1V70A 3IPVB 2WQ4A 4TSVA 1UY0A 2W2IA 1NYWA 2QDNA 2VM9A 2FD8A 3WNKA 4DXZA 5FZ4A 2OW4A 3I2DA 3M8LA 1E5RA 5D2AA 4CXYA 3ETQA 1JYIA 4FFIA 2GNMA 2WN3A 3ZIWA 1H6YA 4DY5A 3RZKA 2QUOA 5FK7A 4ZY9A 4A7KA 5IYYA 1LNSA 3TN91 1ODNA 4D3WA 1LULA 1W9TA 3GDBA 4FPGA 3NNGA 1AXZA 1NXD1 1HRV3 2RS51 5CEHA 2LTNA 2QQKA 4GZ9A 5FZDA 5D21A 2WBKA 4WV8A 3ZSJA 2JDKA 3PHMA 1GMMA 1VR3A 3AL6A 4OHXA 4PF5A 1JOBA 5G05L 3IDEA 1FT9A 5FUNA 4FVVA 5FLJA 4YVWA 1XU2A 2RDNA 5FYZA 1DYOA 4LO7A 5CKMA 4FBFA 2P17A 1IPJA 1HRI3 1W6QB 2PHUA 2VW0A 1EAH1 3B7MA 4NAOA 4PF1A 4JKLA 4WM8C 5C3RA 3IDAA 3SH3A 4IEOA 2WNEA 3OD0A 4N53B 1G9CA 1EV11 5JMOA 1F8VA 1GU3A 1EY2A 1H2MA 4IEQA 2MHFA 3CJXA 3FLPA 4G9SB 4WM7B 4L11A 4EN7B 2HWF3 4XF9A 1HB3A 1R093 1WUVA 4GIQA 2YFZA 5CB7A 3OD4A 3WSOA 3D6EA 4P14A 2WAAA 1O6UA 1MZEA 1TME2 3AJZA 1F4HA 3RI8A 3B93A 1LAJA 4JVAA 3BOWA 5DDJ2 5L9VA 4A42A 2FZ1A 4P9LA 4S2GA 3V56A 3VBHB 4CXXA 1BHGA 5FK8A 1WGPA 4TTGA 1DCSA 2WYSA 4QGLA 2A6YA 5FYIA 1CAVA 3ZFFB 5A3NA 1H2LA 1OFNA 4CEYC 4D7SA 1HRV1 1Q8VA 2AC1A 2J1VA 1X7NA 4NRQA 1R64A 1WCDJ 5DUXA 5K0UC 1H8VA 2JE7A 4QXKA 3ZSEA 2IVIB 4GD4A 4BHPA 2YC0A 1VALA 3JU9A 3UYJA 3N3HA 2RDSA 4GXLA 2XOMA 3NKGA 2D98A 1XE0A 2ZEWA 4MGZE 4Q4Y2 2C4XA 4XUPA 3AZXA 4EQVA 1B09A 1VPHA 4JGZA 5FAXA 2Q30A 1RVF3 1H6XA 4E8CA 1RIRA 4R4ZA 2JKBA 2AGSA 3Q8CA 1OA3A 2RVAA 3H1MA 5FCCA 5A32B 1XJAA 5FRAA 1PHMA 2HWF1 4KWUA 5J7MA 1MQTB 1R091 1UOBA 4QD2A 1OF4A 1GZTA 1Q8OA 2ZGUA 4ZZ8A 2P3JA 4FPYA 3BVCA 5D8AA 3UJOA 2V4AA 5IVEA 1NQJA 1UF2C 1WLTA 4FTSA 4N43A 2J1UA 3N9OA 1RJ8A 3G7DA 4MGKE 3N9QA 5FQ0A 3HVDA 1PVC3 4KG0A 4CDWA 5C3QA 1MZFA 3BU0A 3FBMA 3LGRA 1Q3EA 1PGW1 4A2UA 1ASJ2 5F5IA 3WT3A 1WBFA 3FLTA 2X53S 2Q1ZB 2D3PA 2WYFA 1S0JA 3A23A 2DCKA 1ENXA 3ITQA 4WZFA 3R4SA 3L9JT 4J6GA 4CEWB 3GBGA 3OGJA 4AFAA 1W6NB 3ES1A 5CKQA 1DZQA 4FTBA 2WNOA 2O14A 3POSA 1BLZA 5JSOA 4RA0A 4XF1A 1K5MC 4Q5OA 1UMZA 3WW2A 5J48A 5FLIA 2A73B 1CR7A 1GBGA 2P3KA 4YG0A 1TE1B 2FDHA 1FYUA 3FWEA 1OH4A 1SBEA 1QOOA 3JBG2 5FY5A 3OUIA 1D0HA 2JG9A 1OBNA 5FZIA 1WLWA 1RVF1 1FXZA 1SPPA 2H0BA 2W46A 1CWPA 5L36A 3ZSKA 3HBKA 2W52A 3GXUA 4UBGA 4I02A 4BWOA 3V0AA 1S0FA 1W39A 2OVUA 3ZXDA 1MVQA 3C7HA 1IQAA 2ILMA 4EE2A 3RFRA 1QOSA 4M4PA 5FY4A 4N7UA 5GZFA 2A70A 1M4WA 3LIHA 3Q8BA 4JQTA 5J09A 3O1MA 4X6RB 2CU5A 4XF0A 5FP3A 5FZ3A 1VAVA 3VDDA 3I2GA 3RDIA 5AFBA 5IATA 4NIHA 5BNNB 2FQPA 2D6OX 1W05A 2BBAA 2G9ZA 3I8TA 5GJ6A 2WL1A 3U07A 1K42A 1PVC1 3AVSA 4IEVA 2VUJA 1UN1A 2Q5TA 4KMQA 5FYHA 5KWRA 2GMEA 3NAPB 2TUNA 2YROA 2Q8CA 1O7FA 5F3EA 1BYHA 4KWJA 4MGSA 5I0UA 5DG2A 3ZYJB 1YO8A 2ZZJA 2Z69A 4JDMA 4JHZA 3WV6A 1ZBA2 3T0AA 1GFF2 2G9FA 2RV9A 2VBPA 5F2SA 5DMYA 3UGFA 5FPVA 3RJRA 1DZRA 4CDUA 3CKHA 4MLOA 3SKJE 3ABZA 3I2FA 3IMMA 1GQGA 5BXXA 1W8WA 2A3XA 3POGA 3ZYIB 1RUG2 1WD4A 1JMUB 3JB4C 3J8F3 1ND2B 4ZU7A 2B42B 3U4SA 1F15A 1XXNA 4GJYA 4NHKA 4ZZ5A 2XLAA 1VIWB 1CESA 2XJPA 4PBPA 5FP4A 3LAGA 4Z8BA 2VZRA 3SCHA 5KHHA 1A78A 2BYVE 4QB1A 3MPBA 5KHGA 3UNPA 1RUE2 1VBD3 4A7YA 3A21A 4B1MA 1PO12 3TEWA 2UYAA 1TQ5A 2WS93 4P08A 2D6NA 1O5LA 3B01A 4AHYA 2AEZA 1I5PA 1V00A 3AYDA 2I74A 4QAWA 4PIYA 1ZREA 2PYTA 4AG4A 4DQAA 2VMEA 4AGRA 2D97A 1OPOA 1VRBA 2B45X 2G4IA 3E5XA 4RS5C 3LE0A 5HI0A 1GV9A 2B9VA 3N7MA 3VHRA 2RR12 2E32A 2JG8A 4DIQA 3BALA 4XCBA 1QNWA 1TMF2 4LBMA 5CFCC 2VMDA 4OUEA 3OBAA 2HJIA 1PZ7A 2R16A 2V72A 3BPSA 2X8KA 1POV3 1WCUA 3GZTB 3O14A 3NV2A 1YFWA 3W9AA 4BA6A 3DXTA 1ND3B 1UOFA 2CAUA 4Y24A 4UYBA 4AI1A 4LBOA 5BNQA 3DECA 1W2NA 2H6BA 4P5YA 5ANNA 1JU4A 2GC1A 3KHBA 5LATA 3TNPB 3ZX7A 4DPNA 3AB0A 1DLLA 2QDRA 4B29A 2RM23 1WWYA 4XHXA 4Q4V2 4Y1VA 1Y3TA 4PDWC 5FZFA 1L7RA 4WBBA 2ZPXA 3MPPG 4AWDA 2R0FA 4YM3A 4C1WA 3J8F1 3ZMNA 3RMXA 4LR4A 2WDBA 4R9BA 5CIRA 2BGOA 1R082 4XIOA 5BNPB 1SLLA 3SEPA 4BLIA 5F37A 1V9U2 4AEDC 3DXUA 2AENA 4BXFA 2BZDA 1TVGA 5T55A 1POV0 1V6MA 4LIUA 4TN7A 1LHWA 3GCWA 2E51A 3WVJA 1VBD1 2BWAA 4HFSA 4YW2A 2R043 1NQDA 5JUVA 3Q8AA 1C28A 2WS91 4XJUA 2BW8A 1W8NA 3VKOA 4HVQA 1UY1A 5DUUA 2VNGA 2J42A 4B3NA 5CISA 4DRVA 4LKEA 1PK6C 3DPRA 2ZX1A 2JDAA 3ZYRA 1K45A 2VNRA 2D3SA 4XVHA 3KS7A 4CDXC 1ENRA 3MF6A 1NUKA 2PHFA 1N3OA 3UKVA 1TZOA 3SCGA 2X05A 3URFA 3AKRA 4QHZA 1H8TB 1LU2A 2VULA 1OLRA 2XKPA 4W8JA 2D7FA 2XJSA 2WWJA 4QPIB 3SC7X 5FZHA 1QJY3 3HJRA 1W6QA 4J1XA 1L3JA 2O8OA 2RM21 3LCPA 5LB6A 4AE2A 5JLVA 2NP0A 4H3WA 1CGPA 3T2TA 3A0KA 1LOBA 5ERLA 5IVFA 4N53A 3UESA 3NQHA 5K4LA 4Y5TA 4IUGA 2GP3A 1VMJA 5A33B 3PVNA 3LA3A 5DAVA 5FREA 2EA7A 3PURA 2O0OA 1QQP2 2ZCWA 3T30A 2X5IB 4L0PA 4C1XA 1YXWA 3OSDA 1MPXA 4Y5SA 2IZWA 1Q8QA 4FOYA 2E63A 4Q8KA 1UPIA 3IWZA 4JRAA 2R041 4Q4W3 4BQ5A 4M3CE 3V0BA 2A6XA 3VBHA 2ZOEB 4XBLA 4L97A 3IIAA 4XFAA 3VBRB 2DUOA 1J59A 1NA1B 3MEPA 3LPGA 2A6ZA 4DXSA 2IXCA 4DUWA 2J1SA 2WO7A 3GM8A 1RJ7A 3IMNA 4HMZA 1X9PA 1N1TA 2VW1A 1OQ1A 3PIJA 1BMV2 1LEMA 1VJ2A 3R4UA 1AVBA 3ZFFA 4IE0A 3U75A 4DNYA 1GWLA 2W39A 3FZ3A 3WCSA 3O1OA 2ZACA 4LK6A 2QBXA 4K20A 3VL9A 1W0NA 4ASKA 4ZU5A 3J7LA 4R9AA 2OUHA 4ORFA 2OS2A 4KQ7A 4Z07A 4DB5A 1PIV2 4K7JA 4I09A 5C4WB 1V0AA 3NW4A 4Y1ZA 5FUIA 2VZVA 3RPQA 3TN92 5LK5A 4AK3A 3JB8A 1AR92 5I93A 1QJY1 3UGHA 1QGLA 2RS12 1ACCA 4QM8A 3NNJA 4I3PA 1JZ2A 3NV1A 5ABJC 1FPN3 3VGIA 4YGCA 3WW4A 3FE5A 3J7MA 1UU5A 2ZMKA 4M00A 3IB3A 2CAVA 4MUVA 4BIFA 3Q8FA 2YXSA 3VBSC 1FAYA 3FN9A 1KJRA 2ZZQA 5A3PA 3I3DA 4OUSA 5C3PA 2Q8DA 2HH9A 3RYRA 3POWA 1OOPC 1CPNA 1PMHX 4M0NA 1GP4A 4Q4W1 4DMIA 1EV12 5ANQA 5AVPA 3S5QA 1F5FA 1X36A 4K40A 3I2JA 5IUQA 2D44A 5A6QA 5HPOA 4AI0A 5L7OC 2WN2A 4P9WA 4A7ZA 3AP7A 3NKTA 3O12A 4E4DX 2VNOA 4WM8B 1S0IA 2VMIA 2ZS6B 3H1WA 1BBT2 5FZAA 3KSCA 4EN0A 3WDXA 4IGPA 5LEKA 4YW5A 4A4AA 3MFCA 3GJBA 1W6NA 4BXSV 1I9RA 4HKOA 3WG2A 4BMEA 1HV1A 1D0GA 2OX0A 5FPXA 1JZ5A 1LOGA 2DCJA 2DVFA 3OTFA 1UKGA 2VTFA 3VHOA 4PLMA 1LU1A 1SDDB 1WA6X 4OHVA 4IERA 4WVMB 2A3YA 3MW4A 1KFUL 1RUC2 4RQPA 2WFPA 2YGLA 3D0SA 3PUHA 4CCOA 2OPWA 1D4M2 1YYNA 3KZ4C 2ET1A 1FPN1 1U5XA 4QPGC 4PI2A 4YPJA 2XVKA 4CEYB 1J83A 1FX5A 4P5HA 4UW6A 4XHBA 5CYYA 5C5UA 1CZSA 1SLIA 1GNHA 4LBKA 1XSQA 5IAXA 2CDPA 4Y1UA 4QX7A 1A8MA 5BNNA 3ZDSA 1AL23 2FMDA 2OZJA 2VC9A 1OQDA 2R073 1IS5A 2PAKA 4W6XA 4DS0A 4LLOA 3ACHA 1SLAA 4AYUA 3A4UA 2YV8A 4HSJA 1HXS1 4XC9A 1JYXA 2OT7A 1QF3A 4IESA 3O1TA 2DDUA 3I49A 1N1SA 3WP5A 2RHPA 4OHWA 5EYYA 1JN2P 4J25A 4P02B 1ZA7A 2HWE1 5T5PA 2E31A 4AQTA 4C0BA 4PT6A 3ZN5A 2G9GA 3BI3A 1G8WA 2C24A 4NWVA 4NR1A 1COV2 1R1A3 5E88A 4K3UA 3VZMA 4LHKA 1YI7A 2WLPA 3THPA 1JOJA 1ND2A 1EUUA 3N7KA 4O9EA 4RHV2 4Y33A 1SEFA 3ZXAC 1QH7A 1K3IA 1LTEA 1ST8A 2UWCA 3KQ4B 4M3CB 4N9IA 3UETA 2DCZA 5GLTA 4Q27A 4URTA 5LBCA 4MO3M 1KITA 4CTEA 3KMHA 2FHRA 4E2GA 3TBDA 1GKBA 4RFT0 1Y7BA 3DYOA 3MDPA 4QDRA 4NIIA 3T1MA 3VBFC 3ZLIA 3KF5A 5ACA3 5FYUA 3HAGA 3OB8A 3CO2A 4XE9A 2DYCA 3RVHA 4HL0A 2CY6A 1NY71 1PO22 2A6WA 4I30A 4INDA 4COVA 1NXMA 4UFHA 3TNQA 3WQBA 1K5JA 1C8M3 1US3A 4EYUA 3F95A 5IFTA 1MEC2 1H2NA 4BLJA 4FTEA 1IOAA 1AL21 1RINA 1K5MB 1REFA 1RUF3 2MPFA 4RR3B 3TEXA 1QDCA 2IXLA 2R071 2O8QA 2K9ZA 1V6LA 4K21A 2QQLA 3HT1A 3WDVA 3USUB 1F9KA 3RYKA 4ZPIA 4LTAA 4LT5A 2D6KA 2EVXA 4GJZA 4UW4A 1YRZA 2JEMA 1ND3A 4A6OA 2YU1A 3CIHA 4B4RA 1S0BA 3I7DA 3PTYA 3SH4A 2DV9A 3GZUC 3VKNA 3UJQA 1RXGA 1Q43A 2LUWA 3HT2A 3D8CA 4ZS2A 1R1A1 3VBUB 4YARA 4KG8A 5FY8A 4YLZA 2AACA 5FDBA 1Q8SA 2D93A 4KH9A 5BNPA 1W8ZA 1YLLA 4R8HA 2K2SA 3POEA 1I3HA 4ONUA 1VBC3 2NMNA 2XQXA 4C90A 1BXHA 1U0AA 3NNFA 3BUCA 3LQCA 1PGSA 5FZEA 1ALYA 5DZFA 4IV3A 2XHNA 3J26N 5KHJA 5IK5A 1AX0A 4BB3A 5JWPA 5ACA1 5IVYA 4QDSA 2WNVC 5K9YA 3CBNA 4DUXA 1CX1A 1GOHA 1TG7A 4F83A 1AZDA 1KDMA 4XILA 5DUWA 1IZ3A 5BNOC 5JXIA 2CGNA 1JZ4A 1RHI3 5FZGA 2P3IA 4ARYA 4F7ZA 1C8M1 5CBLA 4JGYC 1NE4A 3H7YA 1B35B 3BOPA 2DUQA 2B5HA 3S6PA 1CAXB 4QX0A 3CHXA 4H14A 4MHRA 4KNCA 4A41A 5A3WA 3UGGA 3ORJA 4BQXA 2XWBB 2IVJA 5LWBA 2E53A 4IETA 4LXLA 4XZPA 4RSUA 1H8TA 2QJVA 3P6BA 4NIGA 4C8DA 1ZRFA 4G4FA 4NO4A 4AEJA 1LOCA 1UIKA 2BFUS 4GWJA 3RI9A 4QPIA 3QBQA 1DDLA 3KWVA 5AFEA 4XMAA 3HBZA 1XBFA 1UXXX 3ZFGC 3KF3A 4WVWA 2C26A 4FPOB 3AFGA 4BQWA 3B02A 4FPLA 5A33A 2A5ZA 5C71A 2CGOA 2VGDA 4TXWA 4ZU4A 3S7IA 1VBC1 1NZIA 3WINE 1W8FA 3TEYA 4OI4A 5FXXA 2ZGKA 4DEVA 2X5IA 4TWTA 3WP4A 4LE4A 5F3CA 5IVCA 2DF7A 3VKLA 3RG0A 4PQQA 5CFCB 5JVVA 1H1IA 5FBZA 5LCWL 1N1YA 4DOUA 4CU8A 4NE9A 3K3OA 1JZ3A 2XBO2 4FFGA 3LEKA 2BOJA 3RZMA 1LGCA 1NCQB 1ODMA 1YQ6A 1NA1A 4H2AA 4Z92B 2BGCA 1RHI1 1UYYA 2VOKA 2Z4FA 2ZGPA 1N3QA 2GH8A 3H7JA 3J7NA 2B39A 1VRH3 1XNKA 2PHDA 2XWJB 1W03A 3N7JA 3SCFA 4CUCA 5C3OA 2ARAA 1APNA 1PM7A 2W9XA 4QQOA 3N9PA 5GKAC 2W5FA 3O1UA 2ZX0A 2OUJA 4AEDB 1QJX3 1RUJ3 5F5QA 1OLME 4RGAA 4XJ8A 3S0MA 1JHNA 1ZBE1 3T2PA 1QJU2 2JDPA 4COWA 5C4WA 4Q0SA 1SMVA 3DF0A 1GWMA 1W9SA 1H4GA 2QNKA 3LOIA 4YM2A 2FDFA 1MZ6A 2PHLA 4COZA 2Y8KA 3ST7A 3ZR6A 1PX3A 4A45A 1GUIA 4P9IA 5C9AA 3VN4A 4LLFA 3VKFC 1AYM2 3BODA 4ISQA 4LBQB 4AXOA 4BMBA 4IL7A 2DUPA 3L2YA 3VZLA 4FXKB 1Z78A 3WDWA 3HR9A 4IV1C 2ZHKA 1GP5A 2WWUA 4KWLA 3HMYA 3CNAA 4R4XA 3LFMA 1CAUB 4XDPA 1EYBA 1OA4A 2UURA 5JXHA 2FDIA 1AL0G 4XYXA 3OPWA 3ZDVA 3RSJA 4JV4A 2UY9A 2BVBA 2WZR3 4AQ6A 5AC93 2JB8A 4UXAA 4I01A 2OIIA 4KU8A 4UW5A 2J22A 3FFZA 4LHSA 2DFCA 1VRH1 3KV9A 5A6XA 3K46A 2Y6FA 1BEV3 3WLUA 5JSPA 3EJKA 1YFUA 5F9TA 3TB0A 1LB2A 4GKXA 5A3LA 3ATGA 1S55A 4HVRA 2R0HA 1KD7A 3INAA 1BVP1 1AR63 3KB5A 3WUCA 1GZCA 1DGRN 1QJX1 2B46X 1RUJ1 2XJTA 4YZ4A 2EIEA 2VMHA 3HNBM 4QKDA 1FV3A 1YQCA 4KWKA 4LQRA 4W65A 1E5SA 2EAKA 2J1EA 2VPVA 1G9DA 1GQHA 4Q0VA 1FOD3 1W6OB 3VZKA 4L2NA 4WVMA 5C9AB 1RUH3 1YQ2A 4CXWA 5FPLA 1N47A 4BK5A 4YM1A 3AMQA 1WZXA 3C2UA 3NJZA 5GZEA 3AJYA 2V5YA 3S57A 4XXPA 1FNYA 1VBB2 3WP6A 3VV1A 2FCTA 2G1MA 1YWKA 1RUD2 3FLRA 2HWC2 3E6DA 3VKMA 4V1PA 3P3PA 3RZJA 4LMFA 3O7OA 3FUOA 1WLDA 1AUYA 3AVRA 1LESA 3AKTA 3CZJA 1BZWA 3OJBA 1XU1A 5CA6A 4GB33 2F6BA 3HQXA 2XVLA 4Y4YA 1IG3A 2IWGB 1D7PM 4NHMA 3WQ1A 4GH4B 4N7IA 4GAZA 4Q0PA 2WZR1 4CP2A 3ZIXA 5AC91 5CAZA 5I0SA 1WW7A 4A44A 3EMRA 2PAEA 2QQPA 4IXLA 1LGNA 3PUSA 1BEV1 1LHVA 5A3TA 1CQ9A 3T3YA 2DVDA 2VW2A 4YM0A 5ABJB 3W59A 4CCEA 1Y9MA 1JZ6A 3UL2A 2MNGA 1RB8G 2QQJA 4YW4A 1AR61 4ATFA 3VBSB 2XPJA 2XLGA 2VBDA 2FDGA 4QDQA 5A6ZA 4MG2A 1UKRA 4IEUA 1O59A 5JZGA 1GQPA 3M1HA 4H7LA 4OI2A 2VJXA 2A3WA 2W92A 1ZZ8A 1FOD1 2LW8A 4M3CA 4BYYA 1RUH1 2XJUA 2RMU3 3M70A 1VBA2 2GN7A 5FYTA 4YVWC 5L7OB 3ON7A 5FYBA 1HRI1 1OD3A 2VZQA 5FJHA 4SBVA 4CSWA 1SHWB 2HEYF 2B7YA 2LM3A 4Q1PA 4YVSB 4O61A 3Q9OA 2Y38A 4LKFA 1OVSA 2X29A 3K2OA 2BVVA 1MS1A 4GB31 1FMD2 4YW3A 4D6RA 5FZ6A 1U5IA 1VLNA 3MUY1 4RR3A 4LNVA 3QD6A 3VUOA 3ZXGA 4QX5A 2W08A 3USUA 3WF2A 4UOJA 5T5LA 4QX1A 1YHFA 1AR82 2UWBA 3BIWE 4L9BA 4PHZA 5SV5A 2F4LA 1GNYA 1GWKA 4LPLA 2ZEXA 3AP6A 4EV0A 1ZZ9A 5C5TA 3GNEA 2VZ1A 4Q4X3 2WFF3 5M0TA 1UX6A 1UOJA 2Q8OA 1VBE2 1Q5OA 2IXHA 4I0AA 4QPGB 1DU3D 5FBJA 1DBNA 2P1BA 5A6YA 2DVGA 1O4TA 2GN3A 5A1FA 3VBUA 4EZHA 1HXS2 3GBWA 4I0BA 4YZ3A 5C8CB 2C9AA 5JXGA 4CDQB 2HLEA 2P5BA 3MUZ1 4CPBD 1J84A 3VB9A 4TLFA 1O3RA 2Y34A 2HWD3 1RUI3 3MI8A 2RMU1 2HWE2 1DZTA 5LRSA 2ADEA 4OI0A 1YFYA 4OLLA 1LHOA 5A7SA 5C33A 2TEPA 1LOFA 3WF0A 4BISA 4JGZC 4BQYA 3KVAA 4N90A 4W4ZA 5GLUA 1JHJA 2VUDA 2VTXA 4YFZA 2BP6A 3E6CC 2KR2A 2TBVA 3WW3A 5KXCA 5LBEA 1JZ8A 4BQ1A 2R062 4UI9L 4FAGA 2PQSA 2ZHLA 3I97A 3WF1A 1B35A 1WCSA 3VBOA 1SG3A 3HQRA 5FYSA 5J1XA 4V2WA 1CAXA 4EN6B 2EIBA 2GNTA 5D8AC 3TRSB 4IEZA 4AI2A 4Q2FA 5F3GA 4Y20B 1QJFA 5F7UA 4Q4X1 4CDWC 1PGL2 4LOTA 2MEV2 2P6CA 1YEWA 2WFF1 3PVEA 4XFCA 1RUNA 3CLPA 4Q8LA 3MO4A 2KXLA 1QXJA 2J1TA 5JAXA 3AZWA 2W95A 3LSDA 3POFA 2PXJA 3PU8A 5A7OA 5HCAA 1DHKB 1EUTA 1GYKA 1UZYA 4E4ZA 2BFUL 3B3QE 4KGGA 4S2HA 5CFDA 5HXVA 4QX3A 5EJZB 3HIFA 1DQ0A 3WQ7A 1Z7S3 3DKWA 2YU2A 1AYN3 2VBBA 4AF9A 1OD5A 1RUI1 1J1LA 1V6NA 2HWD1 3WDTA 4DZGA 1VAKA 4J1WA 3I4IA 2GNBA 1HV0A 1A6CA 4AR2A 3P1IA 4LA2A 4U36A 2JD9A 4CUGA 1LOAA 3WD5A 1BQPA 3G6JB 2JG9C 2Q1FA 1ENSA 2VOTA 3I2KA 3ZKUA 4D6QA 3U1XA 1NCQA 2VCCA 4Y1YA 2A7AA 1AR73 4UFJA 2D43A 5A1LA 2XG3A 2XQRA 4CA9A 5FZMA 1GZWA 5FZ1A 5JCTA 3AZZA 2Q8EA 1P8JA 2R1DA 4TLGA 2VXRA 3IAQA 5T54A 3MV01 3VDDC 4AEDA 1W2TA 2JE9A 5F6LB 1ZRIA 2UWAA 3AZVA 2WIIB 1DP0A 2AR6A 2FCUA 4CUBA 5LA1A 3AP4A 3D82A 3D0JA 3MIEA 3MYXA 5FZCA 4ET7A 2DTWA 3BN6A 4K8RB 2BQPA 1JYCA 2Y6GA 3UV9A 3ZSMA 4L99A 5C3SA 4Y22B 1XYOA 2YFUA 3LDKA 3R0RA 2B4KA 2ZGMA 3AL5A 2ZGQA 5BNOB 2B9UA 4LBQA 1ULCA 4CEWC 3CU7A 3RZHA 2R49A 2IFWA 5GLVA 4IGOA 1JUIA 3OY8B 4LBJA 1Z7S1 2ZKNA 3JD73 5T3NA 1AYN1 1JS9A 4W50A 4RYDA 4HOOA 5FO7B 5FZOB 1O5UA 2CWSA 4OULA 2VR4A 4U2AA 2B8MA 3H8RA 1CAUA 5B2GB 1UYZA 1H4HA 4W6WA 5J3UA 4SLIA 1POQA 3IPVA 3ZR5A 2VVFA 3ZYFA 2JJ6A 2YGMA 3I59B 5JPNB 3H8UA 4YW1A 4LITA 4FCAA 5FYCA 1AR71 1NCRB 3N36A 4DFSA 1IKQA 2VQUA 1WLCA 3FL7A 3NWKA 4MOAA 3VD5A 2VZOA 1C5HA 4ARXA 1Y43B 3PTRB 4R9CA 5JDBA 1LJ7A 1REDA 1WD3A 3GF6A 4QB2A 2BV4A 2QKDA 1CN1A 4C91A 4AGGA 4CP0A 3HN3A 2JENA 3I2OA 1STMA 4YW7A 2HBTA 2JDUA 2JG8C 4PLNA 4HT1T 3KT1A 1ZNPA 2UY8A 4Q0QA 1YNAA 1POV1 1HN1A 1N1VA 3GHMA 2TNFA 4JZRA 2VOXA 3SHRA 4E2QA 2ET7A 3M3OA 2VECA 5E6HA 4EN9B 4QGMA 1NLQA 4GULA 4MGQA 5HV0A 4BQ2A 1UZZA 4NVPA 1W8UA 2JDMA 3GYDA 1W3XA 2BJSA 4IEWA 2ZX2A 1ZBE2 1GANA 4YGBA 3JD71 1US2A 4V2VA 2KD7A 3D4KA 4QX2A 1C57A 4ES8A 1F5JA 3H3LA 4AVCA 2CDOA 2VQTA 4QU1A 4WM7A 2Y64A 3KVBA 5T5OA 1UX7A 2VVDA 2BOIA 4AEMA 1QWRA 4LORA 2HWB2 2DWRA 4RL7A 5FZBA 3U4XA 4MSVA 3WG1A 2F17A 2ZGOA 4GH4A 2ZAAA 1YI9A 1KRIA 1KS4A 1OT5A 2WNUB 5JXJA 4JKMA 5BY5A 4OQ8A 1KJLA 1JODA 1KS5A 3MLLA 4Y1XA 3NRUA 3OGVA 1VMFA 1MS8A 3CJIC 3I3EA 5ABJA 5EQUA 1TME3 3ACIA 1CJDA 3DPRC 3IN9A 2Q4SA 1LECA 3VBSA 1UMIA 3N9NA 4JAAA 4IV1B 1ZX5A 4FXGB 5DDJ3 4XURA 3WCRA 3BB6A 2AYHA 2P2KA 4H55A 4HXCA 2EALA 1PM4A 2GP5A 3TYJA 2BERA 4O7XA 2NZ9A 4UW3A 4Y5Z0 1JUHA 3RS6A 3OUJA 4B8EA 3ZN6B 1W04A 1YCIA 2VXJA 1NX9A 1YIPA 5A1AA 4QQHA 1OPMA 1S2KA 2W94A 4XACA 1GOFA 1UIJA 5EZWA 4X6QB 3KGLA 2WZPP 2W47A 5C7GA 2RS52 2K0GA 1UD1A 4XTPA 2W91A 3ZN4A 1MR5A 3EHKA 4NJ4A 3H3UA 2V73A 1SQ4A 4K8FA 4N53C 2PAMA 3HQUA 4G3YC 4YVSA 5A32A 2BNNA 1UZVA 3WF3A 4CZSA 4URAA 4Q4Y3 2CYFA 2R32A 1Q56A 1OLMA 1MQTA 1DLCA 1PMJX 4NHXA 1UZWA 1Y4WA 1KQRA 1LHNA 2WSVA 2QVSB 3FC0A 1O3TA 3RJ2X 1EAH2 3JUUA 5DAQA 1OLQA 2HBUA 3PL0A 2R6QA 2VO5A 3NNMA 5G04L 2W1WA 5HCBA 2FDKA 3VBHC 3OPZA 1JXNA 5LA0A 2QQVA 1X33A 3CQOA 5A7WB 4E2SA 4FPJA 1ULGA 2Y6JA 3LB9A 3TEZA 3N4MA 1TME1 3LIGA 1UXZA 4R52A 2BDRA 2VZPA 3DEMA 2PMWB 1AX2A 5C8CA 3K4ZA 5J96B 4B7EA 4CDQA 3APBA 2ZEZA 5HBAA 3ZPOA 3H8XA 1ZA4A 2CL2A 4M4RA 1YQ5A 4GKYA 4HLTA 3C7OA 5LASA 2WQZC 3SH5A 3U14A 1GR3A 4JKKA 4ITCA 1ASJ3 2GAUA 1AJKA 3T2QA 2XJVA 3M2MA 2ZKLA 3WY6A 1HRV2 4EWDA 1CJPA 3NO8A 1QJZA 3ZFEC 2JIJA 2DURA 2W3JA 4LBLA 2ZHNA 5F2WA 4KU7A 1Z0HA 4AFDA 1HB2A 4CCLA 3EQEA 4UAPA 3WF4A 1LHUA 4B4QA 4MZUA 2DFBA 1MS0A 4S2DA 4Q4Y1 4MXWB 5DPNA 1SLCA 2EF6A 3GCXA 4S2FA 3JBG3 5IK7A 2P34A 4RFRB 4Z1VA 3LEGA 4QMAA 5K0UB 1HRI2 3QH7A 1T2XA 5LK7B 5KXDA 1H9PA 3BTAA 3X29B 1X50A 5ISLA 4AVTA 2HEVF 5FYMA 4Y20A 2DBNA 4NRPA 4B7KA 5CADA 2DTYA 1W2OA 1W9FA 2HWF2 4LUMA 1X9TA 5JI9A 2WT0A 1R092 3NAPA 4FQZA 5FV3A 3CEWA 1QU0A 4QXBA 4DXRA 4IQPA 3ZYGA 1W2AX 4FI9A 1G9FA 1SFPA 4BDVB 3MIBA 5IHRA 2ZEYA 5JI7A 5FZLA 4P00B 3MIHA 4O9GA 3A7QA 3ZYBA 5KXBA 1HLCA 1I1EA 5B4NA 4FT8A 3BGAA 1ASJ1 1PGW2 1DYPA 2ZAHA 1FI2A 3HOBA 1CONA 2ID4A 1JW6A 2CNAA 1DQ2A 2EXHA 1SZBA 3NVCA 4RQPC 4D7TA 3JZVA 1J1TA 3LD8A 1HIXA 4QHOA 3U0ZA 1RUG3 1WW4A 1WMDA 1HKDA 1NAEA 4LE3A 1XB9A 3AYEA 1V6OA 2LALA 3JBG1 3U78A 3CDZB 1NLRA 3IDCB 5H9QA 4QXCA 2ATFA 1O8SA 4AFCA 3CL1A 3I3QA 2HKXA 1RVF2 2GNDA 1VB2A 3NMBA 3ZYHA 1RUE3 2JE8A 3NJVA 2VNVA 4CYDA 2A6VA 2OQ6A 5EYXA 5BNNC 1DQ5A 2NMOA 1PO13 3H8OA 3K75B 1RXFA 1ONAA 3SNMA 2XUMA 4MX3A 1W9YA 2ERFA 3VL8A 2YBSA 5FP9A 2RJLA 2ZA9A 4Y22A 1C3HA 5BNOA 2ZHMA 3B5LB 3EBRA 3FHIB 5EWSA 5I91A 1GNZA 1OF3A 1CD3G 2ARBA 1TNRA 3T2OA 4BH9A 2R1BA 1UNBA 2RR13 1PVC2 4LK7A 3S30A 3WEZA 1TMF3 1UYXA 2ZTNA 2IXJA 4LEJA 5APAA 5FZOA 2RJ2A 4QXHA 4OUMA 2JECA 3KCCA 1ND2C 3FFQA 5LRRA 2GSYA 1DGRA 3WNPA 2PLV3 1L7QA 1W2UA 4YYOA 4ZXKA 2DCTA 3CZUA 3R6SA 3MLKA 5FQ0B 4Q4V3 3AMPA 3I59A 4Z2AA 3BTYA 2A1XA 1SCSA 1NCRA 1VB4A 1NT0A 1IS6A 4BJ0A 1ULOA 2XUEA 1DGWA 1NZCA 1W0OA 2NQYA 3ILFA 3K48A 2WRAA 3ZM8A 4JC1A 2NPIA 1R083 3MLJA 4OZOA 3QACA 4MGYE 3NJXA 1OKOA 3WOGA 1V9U3 4CRQA 1J3PA 3AFKA 3OOXA 4MGIE 5CKNA 1V6KA 1RUOA 1U5YA 1JBCA 1UYPA 4ZKTB 1QY4A 3WW1A 1YJKA 2V09A 1RUE1 3B94A 4CU7A 3ZVXA 4CPBA 1RUF1 3PIGA 2CWMA 1WBLA 1PO11 2Q0AA 5LBFA 4AI3A 1RMU3 3RGBA 1LR5A 4D69A 4AHZA 4EWEA 2E7TA 4BU2A 2VH9A 4FP3A 1WCKA 1ND3C 2CHHA 3IAPA 3LSEA 3GBFA 3OEAA 4EWAA 4RN5A 5D1IA 3SKVA 1BK1A 3B69A 4K9SA 4HKWA 1HW5A 1QNYA 3OG2A 2F4PA 2RR11 3HD8B 4LO4B 3SLIA 3O1PA 2Z5WA 4JTNA 4NMIA 3OBZA 4UF0B 4HG6B 1JH5A 3J4UH 4JDNA 1UU4A 2ZMLA 5DUVA 3ZXEA 5LA2A 3AP9A 4KBZA 2BNMA 4D0QA 2Z2SB 2PLV1 2UU8A 2YG0A 4HKLA 4RD7A 4RS5B 4CE8A 5BNPC 2RE9A 4IEPA 2BBVA 1JI6A 1T6BX 1IG0A 1QH6A 3HWJA 1AHSA 4XETA 2ARXA 1G86A 4UBHA 4B1LA 2C1FA 3FHQA 4JX0A 2WNUA 4IV3C 1IKPA 3NSTA 4RGGA 3PJQA 3J8F2 4NN0A 4BIOA 1HX6A 1R081 3LDBA 3ROUA 1TEIA 3VBRA 1V9U1 3LZZA 2YZ4A 5BUVA 1QQP3 3POYA 3E5QA 3IT8A 2CTVA 3ZXJA
chains in the Genus database with same CATH topology
4XEZA 4PDWB 1VBD2 4BOWA 4META 5FOBB 2DU0A 5E89A 1RMU1 2WS92 1DQ6A 4IEYA 5CU1A 4R9DA 4XFIA 3FUQA 3AXDA 1H8TC 1T6GC 2WLQA 5FPZA 4C0HA 4AFBA 4MXVA 4QPIC 3H0OA 4PQ9A 1CIWA 5KC5A 3AP5A 3ZXLA 2R30A 2D6MA 1SACA 3MW2A 4FPEA 4QPYA 3T1LA 1S0DA 1D4VB 1PK6B 5J98B 4ASMB 1PIV3 1OFSA 3O0WA 4CDXB 1E57A 1AR93 3EO6A 1DGLA 4PIXA 2X5IC 2BEOA 2RS13 2RM22 4H7MA 2H0VA 4I3GA 1RC6A 4OHZA 2D5FA 3VHNA 1IPKA 1X82A 4DINB 2RS33 1PVXA 5CG8A 4PCRA 2KA3A 1QQP1 4I0WB 1NA1C 1FNZA 1UW8A 4GALA 4PBOA 3N35A 4WM8A 4PJYA 2HYKA 4LULA 3RWNA 5JR7B 3PNAA 3SXWA 3ES4A 4HPKB 2R042 4NPRA 1EPZA 1OI6A 4COYA 5KHIA 4XJ9A 5H9SA 4BZ4A 1BMV1 4I2OA 1WMFA 2I07B 2WJSA 5C4WC 1BBT3 1D2SA 4GQ7A 1LODA 5I0TA 1YFXA 4AGVA 1OHFA 4XW3A 3CJIB 3PVBB 2ZABA 2Y0IA 2AREA 3E97A 1PIV1 3H9AA 4OHYA 1SBDA 3DPRB 3GZAA 5H9PA 4MXWA 3TWIA 3V64A 4EJRA 4CEYA 3OF1A 1LENA 2DVAA 1AR91 5GZCA 1AJOA 5K0UA 1QJY2 1RUC3 2RS11 2I45A 3ME2A 2Z42A 1D4M3 1OKQA 4MYEA 2ZX3A 1MS9A 1J58A 3WX5A 2RS31 3V65A 1OA2A 2Q1MA 5L73A 3IBMA 2RJKA 1C1LA 1GZ9A 4HN0A 5GZGA 1FATA 1XRUA 4AQSA 3WP3A 4Q4W2 2E7QA 4XFHA 4MVTA 4XJWA 3B00A 2JICA 1KXGA 5JIAA 2AH2A 2YUEA 4QQ2A 2DCYA 1KDKA 1Q8PA 3QH6A 1BBT1 3SMHA 1BKZA 1OOPB 4P9YA 2PTMA 4ATEA 3V0BB 1PNGA 4P9JA 3KD4A 4YGEA 4XBQA 1MZ5A 5I8TA 1COV3 3MF9A 3M7AA 3WQ0A 3H1YA 4RHV3 2XLFA 3AKQA 4HSLA 1D2QA 1RUC1 4XFGA 1D4M1 3MICA 5E1RA 1WW5A 1K5MA 2NN8A 3H50A 3M3QA 5J36A 1FPN2 4QM9A 4E9KA 4BE3A 5L19A 2VOVA 4WVVA 4YG6A 1PO23 1C1FA 3MZHA 2YY1A 4OI1A 3ZFEB 4GWMA 1MEC3 4Z82A 3VLBB 4EROA 3OCPA 1RL3A 2PQQA 1DQ4A 4ISRA 5K8SA 4NHLA 3ZXKA 4M3CF 1QKQA 4FPFA 3M3IA 1ZZBA 4FOWA 2PELA 3WG3A 3BCWA 1C5IA 5JZGC 1BJQA 1ZZ6A 2Y0OA 3DV8A 5T52A 3VHPA 2BPA2 1RITA 2IC1A 1QXRA 3AMMA 1OQEA 4FPKA 1COV1 3M3EA 2GC2A 4OFGA 3LA7A 5T5JA 2WSUA 1XE7A 2WA3A 4RHV1 2WT2A 4HN1A 1SLBA 3PVOA 2P37A 2SBAA 4KBBA 1EP0A 3MW3A 4FQ4A 5EFUA 2Y26A 2NLRA 4AQ2A 2XL7A 1QMJA 4A3XA 1G7YA 5I8YA 4HBNA 2W68A 1MS5A 3RNSA 2ZGLA 4D7YA 4RR3C 1WA4A 2PFWA 2C0ZA 1MS4A 4N9HA 2O1QA 2GMPA 1HQLA 1PO21 4N43C 2PHXA 1LKNA 3B9IA 2C5DA 1NY72 2A75A 1UAIA 3MFAA 4KGQA 2XGXA 2OPKA 4RQPB 1MEC1 1W6MB 2ZJCA 1X8EA 2D5HA 1AL22 4XQ4A 2ZGNA 3VBFB 3A0NA 1N3PA 2EIGA 2R072 1ULDA 2ETEA 2ZMNA 1FV2A 3L2HA 3VBUC 2GH2A 3QCWA 4QQLA 3MIDA 1S2BA 1H1AA 1O4ZA 1QHDA 4RS5A 5CFCA 4COUA 3QOPA 4BM8A 1R1A2 3AK0A 1LOFC 2IXKA 3GHNA 4QT6A 1ZZ7A 2VY0A 3AXEA 2PHTA 4NWWA 1HQWA 3OYWB 5FLHA 4CEWA 5EV7A 1M06G 3WHUA 3ACLA 4HK8A 4PDWA 2WC2A 3ZPYA 1B35C 4HZFA 4F8AA 2YYOA 3VBOC 5H9RA 3JQWA 5ACA2 2XBO3 2VQ0A 5JOYA 5CNAA 4JCKA 5FMOL 3D5OA 1C8M2 1DFQA 4D94A 4AI8A 4MH0E 3O0VA 1PNFA 3WNXA 1RUF2 1DIWA 1MS3A 2D3RA 3KCYA 2WNVB 4YGDA 4L8QA 5FFOC 1SFNA 1LOEA 1YUDA 4NOTA 1PK6A 1PZ9A 1HQNA 1QJU3 1CX4A 5CFDC 4JGYB 4CDUC 1UU6A 4XDQA 3WZ1A 4CDXA 2JD4A 4F3JA 5K7PA 1RGSA 3AMHA 5LEJA 1ZVFA 5EXOA 5KHKA 1AYM3 2HEWF 4WZCA 4XF3A 2EAAA 1H9WA 2GDFA 1NCQC 2PLV2 1VBC2 4M01A 2VG9A 1RTVA 1XYNA 1CVNA 4XJZA 2E9QA 3OBTA 3ZFGB 1ULEA 2AUYA 4HPKA 2E6VA 3LKJA 2XBO1 1MACA 3DL3A 3K51A 2E7AA 3WDYA 1QXPA 2WT1A 1RHI2 5E16A 1DQ1A 5DG1A 4EN8B 1UCXA 1W6OA 2D6PA 5JMCA 3JQXA 4IV3B 3P3NA 1LRHA 1GSLA 1C8NA 4P9XA 1H0BA 3CJIA 1RMU2 2VU9A 4XQDA 2XHKA 1QJU1 3LA2A 1AF9A 3ELNA 4Q0UA 1ZRCA 4FSJA 3WG4A 5IT6A 1U5ZA 2WKKA 3MGUA 5A3MA 1UL9A 1XYPA 3AX4A 4LO6B 3USSA 3AZYA 2JXAA 5SV8A 1AYM1 1VBB3 3RYPA 1RUD3 2HWC3 1DGWX 5E8AA 1G9BA 1NG0A 3H3ZA 1XE8A 5JOZA 4LBNA 1W0PA 1XQNA 1TNFA 3PLQA 4XTMA 3ENRA 4CP1A 4YFWA 3LOBA 2YDEA 4XBNA 4AEKA 4DRRA 4HVOA 1O3QA 3FX3A 1VRH2 1OOPA 4YZ1A 5C9AC 2H6CA 4Y26A 2JX9A 2ES3A 3E5UA 4MV2A 1CAWB 5EJ3A 2EXKA 3ZSLA 5GLWA 1ZRDA 3W58A 5L7OA 1DF0A 3U11A 2WINB 1QJX2 1RUJ2 2GALA 3OBRA 4FOVA 4FP2A 1LCLA 4X8NA 3UKNA 4AVVA 4ES9A 5GLZA 2GC3A 2QCSB 3VZJA 3CF6E 3KGZA 1SDWA 1VBA3 4WM7C 2QFEA 5GALA 5GZDA 1VBB1 2IXIA 3RZZA 1RUD1 4GH4C 2HWC1 3ALQA 4XFBA 4XPVA 2YHJA 4K1YA 4LHLA 2BWCA 2ZGSA 4BCUA 3ZFEA 4JDOA 4LO5B 3ILNA 1FMD3 5KC6A 1AXKA 3KM5A 4QPGA 1HDKA 3AM2A 2ZGRA 2PA7A 3B9CA 4HANA 2RS32 3M3CA 1C4RA 1LEDA 3ZFFC 5KXDA 1AR83 2WZR2 1V6IA 5DDJ1 5AC92 2WWSA 1BCXA 5BPXA 5I0RA 3KT7A 3VZOA 1URXA 3ASIA 1PMIA 1S1AA 5F6KA 5KXEA 1BEV2 3WXPA 3EXUA 1VBE3 1W6PB 1SCRA 2AZ5A 3AKPA 1MVEA 2EXIA 4ASLA 5BV6A 2I2SA 1AR62 1XNCA 4GA9A 4PIZA 1HXS3 1XNDA 4TZDA 1AX1A 2XL9A 5HCFA 1SBFA 1X8MA 1FOD2 4YG3A 2IFRA 4YVSC 1RUH2 5DZGA 1U12A 2HWE3 1AXYA 5CG9A 1VBA1 2BTVC 4B4RA 2XJRA 4QU2A 4XXAA 2D40A 5GM0A 1MQTC 4XQWA 3C3VA 3TAYA 3HN1A 2YMZA 3RQ0A 3R4DB 5JIUA 4Q29A 4FPHA 3IDBB 1Y9QA 1FMD1 2R063 5T50A 1W6MA 4YVWB 1OSGA 3KLSA 4GB32 4AVSA 4Q26A 2YPJA 2DU1A 1ENQA 3PMSA 3VBFA 5J37A 4X8PA 3QLQA 1NLSA 1EPWA 5C6CA 1AR81 1SLTA 3R05A 3ECQA 4GWNA 4YRDA 4QHBA 4OVEA 1H2KA 4XJAA 1S0GA 5C8CC 1XNBA 3IM0A 4CDQC 2MEV3 1VBE1 2VUAA 2XB6C 3BPZA 3PMEA 3RMYA 1WW6A 4M0HA 3RRDA 3ILRA 1BVVA 1VAMA 2WA4A 2XKOA 4QGNA 1ZBA3 1VP6A 2GC0A 3ZXFA 4AW7A 2ZBJA 3O5SA 1O4YA 1S0EA 1PZ8A 1F31A 3OYWA 4AFMA 5F1RA 4XIKA 2DVBA 2RMU2 1H1MA 1OMIA 3DGTA 2QZ2A 5I8SA 1ZYBA 1CAVB 5FTTC 1S0CA 3S7EA 5JZGB 4XMIA 3M4FA 4Q1RA 2BUKA 3DUIA 4JQRA 1O3SA 2EXJA 1A8DA 4TYSA 4PLOA 4YZ2A 2R061 2QZ3A 1A3KA 3NAPC 2WNVA 4JGZB 4FPCA 4LHNA 5JSRA 1I6XA 2OZ6A 4BPZA 5C8WA 4WVZA 3VZNA 1IHMA 4LBQD 4AHXA 3FMGA 1GLHA 4AVAA 4JGYA 2JDZA 3OY8A 1PGL1 2MEV1 4Q4X2 4FO9A 2WFF2 2OYZA 1QDOA 4W6YA 5D8AB 5BYNA 1CPMA 1KFXL 1ZBA1 4LUKA 4N43B 5DZEA 3NV4A 2XJQA 1DYKA 2ZX4A 2BNOA 3WR0A 4CDWB 1F2NA 1WMEA 1RUG1 4FOQA 4HETA 5DXDA 2FBEA 4OZXA 3AMNA 4LO8A 1ULFA 2HWD2 1RUI2 5FO8B 4IEXA 4XOGA 3ZFGA 4FAHA 3NL1A 3FJSA 5TSWA 4KL1A 2XH6A 5FO9B 5FOJB 1YJLA 5IK4A 3GALA 3WHTA 4XF4A 4YZ5A 2ENRA 2PHRA 4YNIA 1NE6A 3ZMOA 2FZ2A 4Z2WA 3U10A 3UK9A 3PJYA 5IK8A 2JG9B 4GMP3 3IKWA 3UKTA 3AKSA 3V0AB 3SITA 1QOTA 1I5ZA 1TMF1 2VVEA 3OGGA 2ZGTA 3VBOB 2XVGA 4AVBA 4LA3A 3THTA 3VDDB 3I54A 3LWCA 2PHWA 5AVAA 2VOWA 3MIGA 4B4PA 4Q4V1 4HK9A 1ZBE3 4GMP0 2OA2A 1Z7S2 1AYN2 1NCRC 5JPMB 1G6NA 2NYYA 5JOXA 2N7GA 3J9SA 2GZWA 3JCIA 4E27A 2HWB3 2PN5A 3KCXA 4JTOA 1IS4A 5FMOS 5CFDB 2D6LX 4CDUB 4IV1A 1ZM1A 5JOWA 3KT4A 1AR72 4AHWA 3MIFA 2A71A 3AYCA 3WDUA 1IS3A 3WUDA 3ZN6A 4GMP1 1CAWA 4QQPA 3E6BA 3KQRA 3SISA 2KM2A 4K6BA 1IGOA 4K1ZA 1J3RA 5KBFA 4L92A 3TOJA 2FMYA 1H30A 1UPSA 1YIFA 1GZWB 1SFYA 1R1ZA 3TN93 1JTZX 1REEA 1J3QA 4P9GA 2RS53 2JG8B 3N7LA 3BU7A 4JRLA 3JD72 3ZYPA 1DG6A 2GU9A 2WNUC 2W0XA 2Z79A 4XFFA 1O91A 3NV3A 3ZO0B 3VBRC 4E4SA 3DN7A 2HWB1 1V6JA 2NM1A 3FBYA 1G9AA 1EAH3 2UYBA 4DY3A 1LGBA 2GMMA 2QE3A 2CV6A 1EV13 2VMGA 2VQAA 1GICA 2CGPA 1ZRRA 1W6PA 3O0XA 1NOVA 2SLIA 1ZZCA 3AYAA 1V70A 3IPVB 2WQ4A 4TSVA 1NYWA 2QDNA 4DXZA 2OW4A 3I2DA 3M8LA 3ETQA 1JYIA 2GNMA 3ZIWA 4DY5A 2QUOA 4A7KA 3TN91 4D3WA 1LULA 4FPGA 1AXZA 1NXD1 1HRV3 2RS51 2LTNA 4WV8A 3ZSJA 3PHMA 1VR3A 4OHXA 4PF5A 3IDEA 1FT9A 4FVVA 5FLJA 4YVWA 1XU2A 4LO7A 4FBFA 2P17A 1IPJA 1HRI3 1W6QB 2PHUA 2VW0A 1EAH1 3B7MA 4WM8C 3SH3A 4IEOA 2WNEA 3OD0A 4N53B 1G9CA 1EV11 1F8VA 1EY2A 1H2MA 4IEQA 2MHFA 3CJXA 3FLPA 4G9SB 4WM7B 4L11A 4EN7B 2HWF3 4XF9A 4GIQA 1R093 1WUVA 5CB7A 3OD4A 3D6EA 4P14A 1MZEA 1TME2 3AJZA 3RI8A 3B93A 4JVAA 3BOWA 5DDJ2 2FZ1A 4P9LA 4S2GA 3V56A 3VBHB 1WGPA 4QGLA 2A6YA 1CAVA 3ZFFB 1H2LA 1OFNA 4CEYC 4D7SA 1HRV1 1Q8VA 1X7NA 1WCDJ 5DUXA 5K0UC 1H8VA 2JE7A 4QXKA 3ZSEA 4BHPA 2YC0A 1VALA 3JU9A 3N3HA 4GXLA 3NKGA 2D98A 4MGZE 4Q4Y2 3AZXA 1B09A 4JGZA 5FAXA 2Q30A 1RVF3 1RIRA 4R4ZA 2JKBA 2AGSA 1OA3A 3H1MA 5FCCA 5A32B 5FRAA 1PHMA 2HWF1 5J7MA 1MQTB 1R091 4QD2A 1Q8OA 2ZGUA 2P3JA 4FPYA 3UJOA 5D8AA 1NQJA 1UF2C 1WLTA 4FTSA 4N43A 1RJ8A 3G7DA 4MGKE 5FQ0A 1PVC3 4KG0A 4CDWA 1MZFA 3FBMA 3LGRA 1Q3EA 1PGW1 1ASJ2 3WT3A 1WBFA 3FLTA 2X53S 2Q1ZB 2D3PA 4WZFA 1S0JA 2DCKA 1ENXA 3R4SA 3L9JT 4J6GA 4CEWB 3GBGA 3OGJA 4AFAA 1W6NB 3ES1A 1DZQA 4FTBA 3POSA 5JSOA 4RA0A 4XF1A 1K5MC 5J48A 1UMZA 3WW2A 5FLIA 2A73B 1CR7A 1GBGA 2P3KA 4YG0A 1TE1B 1FYUA 3FWEA 1SBEA 3JBG2 1QOOA 1D0HA 2JG9A 1WLWA 1RVF1 1FXZA 2H0BA 5L36A 3ZSKA 2W52A 4UBGA 4BWOA 3V0AA 1S0FA 1W39A 2OVUA 3ZXDA 1MVQA 1IQAA 2ILMA 1QOSA 4N7UA 5GZFA 2A70A 1M4WA 5J09A 4X6RB 4XF0A 3VDDA 1VAVA 5AFBA 3RDIA 5BNNB 2FQPA 2D6OX 3I8TA 5GJ6A 3U07A 2WL1A 1PVC1 4IEVA 2VUJA 1UN1A 2Q5TA 5KWRA 2GMEA 3NAPB 2TUNA 2YROA 1O7FA 1BYHA 4KWJA 5I0UA 3ZYJB 5DG2A 1YO8A 2ZZJA 2Z69A 4JDMA 3WV6A 1ZBA2 1GFF2 2G9FA 3RJRA 1DZRA 4CDUA 4A2UA 4MLOA 1GQGA 5BXXA 2A3XA 3ZYIB 1RUG2 1WD4A 3JB4C 3J8F3 1ND2B 4ZU7A 2B42B 4NHKA 1XXNA 2XLAA 1VIWB 1CESA 2XJPA 4PBPA 3LAGA 4Z8BA 3SCHA 5KHHA 1A78A 2BYVE 3MPBA 5KHGA 1RUE2 1VBD3 4A7YA 1PO12 2UYAA 1TQ5A 2WS93 2D6NA 1O5LA 3B01A 4AHYA 1V00A 3AYDA 2I74A 4PIYA 1ZREA 2PYTA 4AG4A 4DQAA 4AGRA 2D97A 1OPOA 2B45X 3E5XA 2G4IA 4RS5C 5HI0A 1GV9A 3N7MA 3VHRA 2RR12 2JG8A 3BALA 1QNWA 1TMF2 4LBMA 5CFCC 4I02A 2HJIA 1PZ7A 2R16A 3GZTB 3O14A 2X8KA 1POV3 3W9AA 3NV2A 1YFWA 4BA6A 4Y24A 1ND3B 2CAUA 4AI1A 5BNQA 4LBOA 2H6BA 2GC1A 3TNPB 3ZX7A 3AB0A 1DLLA 2QDRA 4B29A 2RM23 4XHXA 4Q4V2 4Y1VA 1Y3TA 4PDWC 4YM3A 4WBBA 4AWDA 2ZPXA 3MPPG 2R0FA 4C1WA 3J8F1 3ZMNA 3RMXA 4LR4A 4R9BA 5CIRA 1R082 4XIOA 5BNPB 1SLLA 4BLIA 1V9U2 4AEDC 2AENA 5T55A 1POV0 1V6MA 1LHWA 2E51A 3WVJA 1VBD1 2BWAA 4HFSA 4YW2A 2R043 1NQDA 1C28A 2WS91 4XJUA 2BW8A 4HVQA 3VKOA 5DUUA 2VNGA 4B3NA 4DRVA 1PK6C 3DPRA 2ZX1A 3ZYRA 2VNRA 2D3SA 4CDXC 3KS7A 1ENRA 3MF6A 2PHFA 1N3OA 3UKVA 3SCGA 3URFA 3AKRA 1H8TB 1LU2A 2VULA 1OLRA 2XKPA 2D7FA 2XJSA 4QPIB 1QJY3 4J1XA 1W6QA 5JLVA 1L3JA 2O8OA 2RM21 3LCPA 4AE2A 2NP0A 1CGPA 4H3WA 3T2TA 3A0KA 1LOBA 4N53A 5A33B 3PVNA 3LA3A 5FREA 2EA7A 2O0OA 1QQP2 2ZCWA 2X5IB 4C1XA 1YXWA 2IZWA 1Q8QA 4FOYA 2E63A 4Q8KA 1UPIA 3IWZA 4JRAA 2R041 4Q4W3 4M3CE 3V0BA 2A6XA 3VBHA 2ZOEB 4XBLA 4L97A 3IIAA 4XFAA 3VBRB 2DUOA 1J59A 1NA1B 3MEPA 2A6ZA 2IXCA 4HMZA 3IMNA 1RJ7A 4YSFA 1BMV2 1N1TA 2VW1A 1OQ1A 1LEMA 1VJ2A 3R4UA 1AVBA 3ZFFA 4DNYA 2W39A 3FZ3A 3WCSA 2ZACA 3VL9A 4K20A 4ZU5A 4R9AA 2OUHA 4ORFA 4Z07A 4KQ7A 4DB5A 1PIV2 4K7JA 4I09A 5C4WB 3NW4A 4Y1ZA 3RPQA 3TN92 4AK3A 5LK5A 5I93A 3JB8A 1AR92 1QJY1 1QGLA 2RS12 4QM8A 4I3PA 3NV1A 5ABJC 1FPN3 3VGIA 4YGCA 3WW4A 3FE5A 1UU5A 2ZMKA 4M00A 4MUVA 2CAVA 4BIFA 2YXSA 3VBSC 1FAYA 1KJRA 2ZZQA 4OUSA 3RYRA 3POWA 1OOPC 1CPNA 4M0NA 4Q4W1 4DMIA 1EV12 5AVPA 1F5FA 1X36A 4K40A 5IUQA 2D44A 4AI0A 5L7OC 4P9WA 4A7ZA 3AP7A 3NKTA 3O12A 4E4DX 2VNOA 4WM8B 1S0IA 2VMIA 2ZS6B 3H1WA 1BBT2 3KSCA 4EN0A 3WDXA 5LEKA 4YW5A 3MFCA 1W6NA 1I9RA 4HKOA 3WG2A 4BMEA 1HV1A 1D0GA 5FPXA 1LOGA 2DCJA 2DVFA 3OTFA 1UKGA 3VHOA 4PLMA 1LU1A 4OHVA 4IERA 4WVMB 2A3YA 3MW4A 1KFUL 1RUC2 4RQPA 2WFPA 2YGLA 3D0SA 3KZ4C 1D4M2 1YYNA 2ET1A 1FPN1 1U5XA 4QPGC 2XVKA 4CEYB 4P5HA 1FX5A 4UW6A 4XHBA 1SLIA 1GNHA 4LBKA 4Y1UA 5BNNA 1A8MA 3ZDSA 1AL23 2FMDA 2OZJA 1OQDA 2R073 1IS5A 2PAKA 4W6XA 4DS0A 4LLOA 4AYUA 1SLAA 3A4UA 2YV8A 4HSJA 1HXS1 1QF3A 4IESA 1N1SA 3WP5A 2RHPA 4OHWA 5EYYA 1JN2P 5T5PA 2HWE1 4C0BA 4AQTA 3ZN5A 2G9GA 1G8WA 4NWVA 4NR1A 1COV2 1R1A3 5E88A 4K3UA 3VZMA 4LHKA 1YI7A 2WLPA 3THPA 1JOJA 1ND2A 3N7KA 4O9EA 4RHV2 1SEFA 3ZXAC 1QH7A 2UWCA 1LTEA 4M3CB 4N9IA 2DCZA 5GLTA 4Q27A 4URTA 4CTEA 1KITA 3KMHA 2FHRA 4E2GA 3TBDA 1GKBA 4RFT0 1Y7BA 3MDPA 3T1MA 5ACA3 3VBFC 3HAGA 3CO2A 4XE9A 2DYCA 4HL0A 2CY6A 1NY71 1PO22 2A6WA 4I30A 4INDA 4COVA 1NXMA 3TNQA 1C8M3 1MEC2 1H2NA 4BLJA 4FTEA 1IOAA 1AL21 1RINA 1K5MB 1REFA 1RUF3 2MPFA 4RR3B 1QDCA 2IXLA 2R071 2O8QA 2K9ZA 1V6LA 4K21A 3WDVA 3HT1A 3USUB 1F9KA 3RYKA 4LTAA 4LT5A 2D6KA 2EVXA 4UW4A 1YRZA 2JEMA 1ND3A 1S0BA 3I7DA 3PTYA 3SH4A 2DV9A 3GZUC 3VKNA 3UJQA 1Q43A 2LUWA 3HT2A 3D8CA 1R1A1 3VBUB 4YARA 4KG8A 4YLZA 5FDBA 1Q8SA 2D93A 4KH9A 5BNPA 1YLLA 4R8HA 2K2SA 1I3HA 4ONUA 1VBC3 2NMNA 4C90A 1BXHA 1U0AA 1PGSA 1ALYA 5DZFA 4IV3A 3J26N 5KHJA 5IK5A 1AX0A 5JWPA 5ACA1 2WNVC 5K9YA 4F83A 1KDMA 1AZDA 4XILA 5DUWA 1IZ3A 5BNOC 2CGNA 1RHI3 2P3IA 5CBLA 4F7ZA 1C8M1 4JGYC 1NE4A 3H7YA 1B35B 3BOPA 2DUQA 2B5HA 3S6PA 1CAXB 4H14A 4KNCA 2XWBB 2E53A 4IETA 4XZPA 4RSUA 1H8TA 2QJVA 1ZRFA 4G4FA 4NO4A 4AEJA 1LOCA 1UIKA 2BFUS 3RI9A 1DDLA 4QPIA 3QBQA 5AFEA 4XMAA 3HBZA 3ZFGC 4WVWA 4FPOB 3AFGA 3B02A 4FPLA 5A33A 2A5ZA 2CGOA 2VGDA 4ZU4A 3S7IA 3WINE 1VBC1 4OI4A 2ZGKA 2X5IA 4TWTA 3WP4A 4LE4A 2DF7A 3VKLA 3RG0A 5CFCB 5JVVA 1H1IA 5FBZA 1N1YA 4DOUA 2XBO2 1LGCA 1NCQB 1NA1A 4Z92B 1RHI1 2BGCA 2ZGPA 2VOKA 1N3QA 2GH8A 3H7JA 3SCFA 1VRH3 2B39A 1XNKA 2PHDA 2XWJB 3N7JA 1APNA 1PM7A 4QQOA 5GKAC 2ZX0A 2OUJA 4AEDB 1QJX3 1RUJ3 5F5QA 4RGAA 4XJ8A 3S0MA 1JHNA 1ZBE1 1QJU2 4COWA 5C4WA 4Q0SA 1SMVA 3DF0A 2QNKA 1H4GA 3LOIA 4YM2A 1MZ6A 2PHLA 4COZA 3ST7A 4P9IA 3VN4A 4LLFA 3VKFC 1AYM2 3BODA 4ISQA 4LBQB 4AXOA 4BMBA 4IL7A 2DUPA 3L2YA 3VZLA 4FXKB 1Z78A 3WDWA 3HR9A 4IV1C 2ZHKA 4KWLA 3HMYA 3CNAA 4R4XA 1CAUB 1EYBA 1OA4A 2UURA 1AL0G 4XYXA 3RSJA 4JV4A 2UY9A 2BVBA 2WZR3 4AQ6A 5AC93 4UXAA 4I01A 2OIIA 4KU8A 4UW5A 3FFZA 2DFCA 1VRH1 1BEV3 3WLUA 5JSPA 3EJKA 1YFUA 5F9TA 3TB0A 1LB2A 4GKXA 5A3LA 3ATGA 1S55A 4HVRA 2R0HA 1KD7A 3INAA 1BVP1 1AR63 3KB5A 3WUCA 1GZCA 1DGRN 1QJX1 2XJTA 1RUJ1 2B46X 4YZ4A 2VMHA 4DPNA 4W65A 1FV3A 4KWKA 2EAKA 2VPVA 1G9DA 1GQHA 4Q0VA 1FOD3 1W6OB 3VZKA 4L2NA 4WVMA 5C9AB 1RUH3 1N47A 4YM1A 3AMQA 3C2UA 3NJZA 5GZEA 3AJYA 2V5YA 4XXPA 1FNYA 1VBB2 3WP6A 3VV1A 1RUD2 1YWKA 3FLRA 2HWC2 3E6DA 3VKMA 4V1PA 3P3PA 3O7OA 3FUOA 1WLDA 1AUYA 1LESA 3AKTA 1BZWA 3OJBA 1XU1A 5CA6A 4GB33 2F6BA 3HQXA 2XVLA 4Y4YA 2IWGB 4NHMA 3WQ1A 4GH4B 4N7IA 4Q0PA 4CP2A 2WZR1 5CAZA 3ZIXA 5AC91 5I0SA 1WW7A 2PAEA 2QQPA 4IXLA 1LGNA 1BEV1 1LHVA 1CQ9A 2DVDA 2VW2A 4YM0A 5ABJB 3W59A 3UL2A 2MNGA 1RB8G 4ATFA 4YW4A 1AR61 3VBSB 2XPJA 2XLGA 1UKRA 4IEUA 5JZGA 3M1HA 4H7LA 4OI2A 2A3WA 1ZZ8A 1FOD1 4M3CA 4BYYA 1RUH1 2XJUA 2RMU3 3M70A 1VBA2 2GN7A 4YVWC 5L7OB 1HRI1 4SBVA 2HEYF 2B7YA 2LM3A 4Q1PA 4YVSB 3Q9OA 2Y38A 2X29A 2BVVA 1MS1A 4GB31 1FMD2 4YW3A 1U5IA 1VLNA 4RR3A 4LNVA 3QD6A 3VUOA 3ZXGA 4QX5A 2W08A 3USUA 5T5LA 1YHFA 1AR82 2UWBA 3BIWE 4L9BA 5SV5A 4EV0A 3AP6A 1ZZ9A 3GNEA 4Q4X3 2WFF3 1UX6A 2Q8OA 1VBE2 1Q5OA 2IXHA 4I0AA 4QPGB 1DU3D 1DBNA 2DVGA 1O4TA 2GN3A 3VBUA 1HXS2 3GBWA 4I0BA 4YZ3A 5C8CB 2C9AA 4CDQB 1O3RA 4TLFA 2HWD3 1RUI3 3MI8A 2RMU1 2HWE2 1DZTA 5LRSA 4OI0A 1YFYA 4OLLA 1LHOA 5C33A 2TEPA 1LOFA 4JGZC 4N90A 5GLUA 4YFZA 3E6CC