4AFMA

Structural and biochemical characterization of a novel carbohydrate binding module of endoglucanase cel5a from eubacterium cellulosolvens.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
127
structure length
127
Chain Sequence
GDIVLFSGSKHVEFTDWGGTDWPSAYELQPPYQTMPFDLNKNFEIKVDYSGADIVLIFARWEHGSKPQIWAQISPYYVVDGTAVFTKEQIAKAYGSDDFSDLDYIGVKPLPSADGMTVTKIVASYTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE CEL5A
publication title Understanding How Non-Catalytic Carbohydrate Binding Modules Can Display Specificity for Xyloglucan.
pubmed doi rcsb
source organism Eubacterium cellulosolvens
molecule tags Hydrolase
total genus 24
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18259 CBM65_1 Carbohydrate binding module 65 domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1070 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4afmA00
4BA6A 4AEKA 4AFMA 4AFDA 2YPJA 4AEMA 5AFEA
chains in the Genus database with same CATH superfamily
1BEV1 1JOBA 4ORFA 4W6XA 5DDJ2 3U4SA 3VBRB 2C24A 3MIBA 4NRPA 1DG6A 2WWSA 3DCQA 3V65A 2B9UA 3PL0A 2HH9A 3AJZA 3BB6A 5FY9A 3ZMNA 3K4ZA 5IUQA 1OLME 3D0JA 3ST7A 4XFFA 4ZXKA 1LOFA 5A32B 3WF4A 1UCXA 3T2PA 2VMEA 2BRTA 3HOBA 4GAZA 5CBLA 1HDKA 2QQJA 4NO4A 1JU4A 3B5LB 3VBSA 4R9CA 4QPGB 1AYN3 1QH6A 2V73A 3ILFA 4FQZA 4AEMA 1MEC1 5A1FA 3TB0A 1ZYBA 3GJAA 2E53A 2QQMA 3VB9A 4FQ4A 4ZKTB 1GNHA 1QQP2 4W6YA 5ISLA 4Y20B 2X09A 3OGRA 4QB2A 5C3OA 2ES3A 3Q8CA 5EXOA 4IE6A 1ZA4A 2WS92 1LEDA 3DV8A 1Q56A 2GC2A 1FMD3 4G9SB 2C6SA 3U11A 4WZCA 5IVVA 3OGGA 1DCSA 1MQTA 3VD9A 2FDJA 4LBNA 2Z4FA 3BODA 3K4DA 3UGGA 5IFPA 4GH4A 4JGZB 3LQCA 5FZ6A 2ZOEB 3T2TA 3VUOA 3BALA 2V72A 4CUGA 4L99A 1BBT3 1L7LA 1OFNA 1F4AA 1RUC3 5GLWA 1UMHA 1PO23 2HEWF 1W6QB 4I2OA 1NE4A 3N7JA 5FBZA 5LA0A 4UW6A 4N7UA 3OD4A 3OBZA 5FREA 4ARXA 4J25A 3V0AA 3LPFA 4NRQA 5C70A 4ONUA 5C8CC 1QJX3 1WD4A 4BA6A 5FXWA 1HRV2 2DFCA 3OPWA 2IFWA 2XJVA 3RGBA 3S30A 2Y33A 2GP3A 5HCHA 2QKDA 3ACGA 4N53C 3VBRA 5EZWA 3N35A 4HSJA 2DVGA 1IPKA 1TMF1 4NIAA 2OPKA 3NNJA 2Q8EA 4DXRA 1RMU1 3LEGA 4NVPA 1PVXA 1WW6A 1RYYA 3GZUC 1UZZA 4YM2A 4DRRA 1VRH3 4FCAA 2ZACA 4HONA 4IDZA 3UK9A 1O5UA 3H8UA 3WZ1A 2VCAA 1FI2A 3AB0A 3LSEA 4FPGA 5IW0A 4OHVA 4Y5Z0 1FV2A 2Q4SA 4ZPIA 2LTNA 2PHFA 2BNNA 4IEQA 4Q0PA 4F83A 4IE0A 2XLAA 3WT3A 4Q0SA 3VBOC 2A6YA 3T0DA 1UX6A 2R071 2W87A 2CAVA 4OCTA 1JTZX 3J4UH 1DQ1A 4UFHA 5FLIA 3LEMA 4Y20A 3ZKYA 4BQ2A 1ZNPA 2QNKA 4XFCA 1XE0A 2I07B 2K0GA 5FYMA 4UW4A 4XTPA 2ZABA 2VOKA 4QDRA 1AVBA 2PMWB 3U75A 4MXVA 2VBPA 4M3CE 3WHTA 3VDDA 2Z2SB 4EZHA 3RJRA 4JGZA 3OSDA 4FOWA 3ITQA 4QX5A 5JMOA 1WUVA 1FYUA 3E97A 5ERLA 3ZXEA 2ZXQA 1HKDA 2GNBA 3G6JB 4LO5B 1W3XA 3R6SA 2O1QA 1W6QA 3PTYA 1R092 3I2GA 1SFPA 4AFCA 3POSA 2UY8A 4XABA 3QCWA 2WKKA 3SH5A 3O1VA 2B46X 4QHOA 2DURA 3POJA 3BIWE 4Z8BA 2VCMA 2Q8OA 4CCLA 1J83A 2RR12 2BGOA 2XVLA 1L7RA 3PNAA 2RVAA 2D93A 2IVJA 2PQQA 2X10A 2D6LX 1ULPA 4N9IA 1IS4A 1D4M3 1CPMA 1RVF1 4QKNA 5GJ6A 1LRHA 1EV12 3CO2A 4RGGA 4M4PA 3BVCA 1FX5A 5JR7B 3WW4A 2FBEA 2VNGA 1GLHA 4CUCA 5JVVA 1I5PA 2JIGA 2ZMNA 2B42B 1I3HA 2BBAA 2PHTA 4MGYE 4XZUG 1H2LA 3VBUC 3H8XA 2WFF3 4ZS3A 2JG8C 3RDIA 1A8DA 5AC91 4GWNA 3MLLA 4QD2A 2ARCA 1O8PA 2IXHA 4AEKA 2Y6KA 4IXLA 4CDUB 1N1TA 2AH2A 3NSTA 2D5HA 3A23A 3KGLA 3OTFA 3WQBA 3FUOA 4HOOA 1ZZCA 1HV1A 1OLQA 4QX1A 5FP8A 3VD7A 3O0VA 3POYA 4TYSA 5FZMA 3UESA 2IVIB 2VMGA 1XB9A 3WHUA 3PU8A 2IC1A 2XBO3 3DEMA 2P4EA 1YFXA 4EV0A 2CU5A 2B45X 2XHKA 5BNNC 4Q0VA 1HX6A 1OLRA 2GC0A 2RMU1 5JXHA 2AENA 2VOTA 1BHGA 3LZZA 4MADA 4ET7A 5FZLA 4AI9A 4KWLA 1F15A 2VZPA 1JUHA 4JDOA 3LEIA 3U78A 4LORA 5I8SA 1BBT2 4XBQA 3WUCA 1PO12 2WIIB 1J3PA 4W4ZA 3RNSA 4BLIA 1F35A 2VW0A 4Q4W1 2Y0OA 4XEZA 3ZFEC 2VZOA 2CL2A 3VDBA 4EN7B 3RZZA 2ADEA 3NO8A 1MS8A 3KV9A 4XZPA 1Q8QA 2Y6FA 1RHI3 4RFRB 4AFMA 5GLUA 2Y64A 4LOSA 4ES8A 1DGLA 3WNXA 3UNPA 4IV1C 4U36A 2QDRA 1SDDB 3TAYA 4O65A 2P37A 2ZS6B 2XWJB 1EUUA 2D6PA 4AI8A 1T6BX 2FZ1A 5KHJA 1Z0HA 2UWCA 3QH6A 1RUF1 1UYPA 4FAGA 1ND3A 1VBD1 3BYWA 1WMXA 1GZCA 5JXJA 2WYSA 2HWF1 3FE5A 3W9AA 4QKDA 3OUIA 1ULDA 4CCMA 3WR0A 2ERFA 4GMP3 2NM1A 1REDA 4UOJA 4I0BA 1OBNA 5EYXA 2BVVA 2ILMA 1PMJX 3APBA 3MLKA 4JGYB 4Z82A 4XQ4A 1VRH2 3THPA 2PHRA 1JOJA 3EBRA 4JRAA 4CP2A 1MS3A 1RUE2 4NIIA 2HWD3 1TME1 3W21A 3ZIWA 4CDUA 5HCFA 3UKTA 5FUPA 2ET1A 5DG2A 1IPJA 4KG8A 4YARA 2ZJCA 3I8TA 4CEYA 1Z7S2 1ZBA1 2WAAA 2WO2A 4Q4Y3 4WZFA 2JE9A 2VNVA 5A6QA 5FLHA 1MVQA 2BP6A 1UIKA 1H1IA 2RJLA 1AX2A 2AGSA 1PVC3 2PAKA 4NR1A 3ECQA 3ZSLA 5A7WB 4AQ6A 2ZGLA 4QX0A 4CPBD 2DWRA 4XVHA 5BNOC 3SMHA 4H14A 4UXAA 3ZYIB 3NV1A 3RMYA 4FAHA 5K0UC 1ZZ7A 2BFUS 1UIJA 1FPN2 3DKWA 4LO6B 4OMDA 4TN7A 2DUQA 2BGCA 4I09A 5T5JA 4LKSA 3PUSA 3TEWA 3WEZA 4FP2A 1JODA 4IEZA 5J1XA 5L7OC 1DGWA 4M00A 4P00B 4WVMA 5DAQA 1JUIA 1GBGA 1MZFA 1XE7A 4RL7A 4OYUA 3ZYHA 2WZR3 4HKLA 3SEEA 3ME2A 3I2IA 1U5YA 2RS31 2XVKA 1CGPA 2AEZA 2KA3A 4OHXA 4BJ0A 2EIBA 3O1PA 4RQPA 1QJU3 4FTEA 1O3QA 4K6BA 1OI6A 4FOVA 3NJVA 2DTYA 4Q8LA 5CFDB 2QQVA 1BVVA 2ZGSA 3N7MA 3PIJA 5A3UA 3SHRA 4IEWA 3SCFA 2W1UA 2YFUA 4GKXA 4LNVA 2D3SA 4YZ5A 2YDEA 4ZS2A 4UBGA 4B7EA 3ZYRA 1D7PM 4GWMA 2DU0A 2VECA 3SISA 5KR7A 4JGYA 4PIXA 3M3EA 4LULA 3AYAA 1AR93 5A6XA 1HJFA 1HQNA 1OPMA 1Y43B 4XFHA 1V6IA 5D8AB 5FK7A 3BCWA 2ZX4A 5L9VA 2E7TA 1BEV3 5DXDA 5HXVA 1NQDA 5BY5A 1SLIA 1JZ4A 1W28A 4OI1A 1J3QA 4AVAA 2P34A 3RMXA 1SPPB 1KXGA 1VAKA 4FPCA 2EVXA 2JB8A 1UAIA 1W6MA 4QX7A 3MPPG 3WQ7A 4AFDA 2Y8KA 2WA4A 1O4YA 3N9LA 2JICA 2KD7A 3NNMA 1ASJ1 3ZXFA 1A78A 2VUJA 1QIQA 2BBVA 3K3OA 3JXSA 4M0NA 3W58A 4XJ8A 5DUXA 4YM3A 3D8CA 5IVBA 1W39A 2XBO2 1UKGA 2RDQA 4UWDA 1VBA3 1PZ8A 1MEC3 3DECA 4DINB 3S7EA 4X8PA 2D6KA 4YFWA 4ISQA 5GLTA 4O9EA 1NYWA 5I0SA 1NY72 1V00A 4J1WA 2XJRA 4AVTA 3EMRA 2UURA 3N9NA 5A80A 5L9RA 5FXZA 4Z2AA 2UY9A 2DYCA 1SQ4A 1ZZ9A 1O7FA 2R49A 2OYZA 5L9BA 5KXEA 3FHQA 2XVGA 4FO9A 2VBBA 4COVA 2VC9A 2D5FA 3T4HB 4DY5A 5FR3A 3POWA 5LY2A 4KH9A 5FZOA 5CFDA 1OMIA 2FCUA 4LUMA 4LBLA 2Q8DA 4BQ1A 4I30A 5LWBA 2EXJA 3WNLA 3U0ZA 3T09A 5LA1A 1RL3A 5JIUA 1POQA 4Q26A 4PDWB 2ATFA 1BQPA 2BTVC 4CPBA 5CKQA 5D8AA 3NQHA 1CX4A 4ZU7A 3WV6A 4HN0A 2VVEA 1DZQA 1VBE1 3FLTA 1W2UA 2MNGA 3SH4A 4CU7A 2WJSA 3IIIA 4Q4V2 3NNLA 1YJKA 1L3JA 4HL0A 5D1IA 3ZFFA 1RINA 4ARYA 3O1TA 5F7UA 3H1MA 2OS2A 3I49A 1GANA 1VMHA 1NLRA 1TMF3 4RS5A 5FYZA 3AKSA 4HK8A 3ILRA 2FMYA 4JKMA 1RMU3 3TN91 4YZ2A 1NXMA 3MZHA 2FD8A 2DV9A 2G9ZA 4AZZA 2PHLA 3KWVA 4R8HA 1QY4A 5ABJC 4YVWB 5LBEA 1VIWB 5IWFA 3C7FA 2BNOA 1H2KA 2W08A 3D82A 4JV4A 3E5QA 4EWDA 3VHNA 2VAUA 4CSWA 1S0BA 1GMMA 4FFIA 4XXPA 4MXWB 1O3TA 1CN1A 2HWC2 4YM0A 3BTAA 2V5DA 3KB5A 2KXLA 1SCRA 5DZEA 4E4ZA 4EN8B 4HFSA 1UMZA 2R073 1UOFA 3HQRA 5IK7A 4UFKA 5EJZB 3O1OA 4RHV2 4YW4A 2C9KA 2QUOA 2Q1FA 1NCQB 3KHCA 1O4ZA 1ULGA 3LIHA 3MW4A 1W8TA 2O14A 3CNAA 2WNVB 4LHKA 1US2A 1W6PB 2BU9A 1SFYA 3S57A 5FJKA 1WW4A 4FXGB 4TWTA 3MO4A 1COV1 5K7PA 1GQGA 1H1MA 4Z07A 2DBNA 3KT1A 2VMHA 1CD3G 1DYKA 3AMHA 5LK7B 1KJLA 3KZ4C 5SV8A 4A42A 1GOFA 5LRSA 1CIYA 3NV3A 1IKPA 4IGQA 1US3A 4UT5A 1RUH1 5BXXA 3VKNA 1MR5A 4OUEA 4B29A 1YIPA 2HEYF 2K2SA 3PMEA 1W2TA 2R042 5I0UA 3ZSJA 1ND2C 4K40A 5A3MA 5FYUA 1OC1A 3B01A 3GBGA 1HV0A 1QJZA 1ZZBA 4BQ3A 3B3QE 1LJ7A 1S0EA 4BQYA 2FDKA 2PYTA 3UJOA 3UL2A 4QX3A 4INDA 3FBYA 2A73B 2JE8A 4LBJA 1OUXA 4QMAA 2WT0A 4UFMA 5DMYA 2WO3A 1E5RA 4IERA 5FP4A 5A3PA 1RVF3 4K1ZA 3USSA 5FJHA 4OI2A 5FV3A 4EE2A 1B35A 2P3JA 5JIAA 1CQ9A 3ASIA 2CY6A 5A7QA 3NNFA 4CCKA 5A3LA 3OOXA 3A7QA 4Z2WA 3HVDA 3H3UA 4A41A 1WCUA 3NAPC 3AFGA 4AAXA 3ACIA 2HBUA 3WD5A 3OUHA 1TVGA 4JHTA 5AC93 4DB5A 3T2OA 4BH9A 2JDYA 2CWSA 3CJIC 2IFRA 4HSLA 1QJY2 3BN6A 3WVJA 2XQXA 4XCBA 4CUBA 1DP0A 3UKNA 4XUNA 4LTAA 4BQWA 1VBA2 3POBA 3AP5A 4GB32 4TSVA 2UYBA 3I2JA 2WABA 1PGL1 5GZCA 5IK4A 1UU6A 1XU1A 4Y5TA 3WSOA 5EWSA 3BPSA 3FL7A 2ZGNA 3FX3A 4PI2A 4PQQA 4EWAA 4AEDC 5JDBA 3O1MA 4XILA 4XYXA 4MV2A 2VVDA 1CZTA 1E5HA 2RMU3 3DYPA 5FZ8A 2TNFA 3ZYGA 5ACA3 1MACA 1O6UA 3TEZA 1YHFA 4C8DA 5I0DA 2QQPA 3ENRA 1N3PA 3R05A 4XF0A 2E51A 1PK6A 2YC2A 4XE9A 1V6KA 1OVPA 1JYWA 3O1UA 1WCQA 3I2HA 3I54A 2W52A 2BW8A 4FPJA 4K9SA 4NPMA 3RYRA 3ON7A 4PDWC 4LO8A 4PJYA 1OD5A 3Q8BA 1QKQA 4RA0A 2XWBB 2XGXA 3EYPA 3M1HA 5FPVA 4Q4W3 4UYBA 4QPIC 1AHSA 5DN2A 2MEV1 3LF7A 1CAVB 4OI4A 2BPA2 4XJWA 1DQ6A 1W6OB 3JUUA 2B4KA 5GLZA 4C0HA 1AZDA 2VNOA 4MZUA 1V9U2 2BJSA 2W46A 2H0BA 4GWJA 4QQHA 5DABA 1SACA 4HK9A 5FPZA 1LESA 4LPLA 3ROUA 1RUF3 4NIHA 1Y9QA 4LIVA 1VBD3 5CKMA 3U14A 4YVWC 2R061 1DLLA 2HWF3 4GULA 4Y1VA 3SXWA 1T6GC 3V56A 4CCOA 1YQ8A 3Q9OA 3HBKA 2WNOA 1DQ5A 1W8NA 3IZOA 2FZ2A 1GP5A 1C5IA 2ZAAA 3N9MA 4IQPA 2YBSA 2VUAA 4AI0A 1REFA 1TME3 3BGAA 4CCCA 1ENXA 4E2GA 4XXAA 1I1EA 3UV9A 2Y0IA 3VD4A 4DUXA 3SCHA 1U12A 1NCQC 3LDKA 1X9TA 3K75B 3VBSB 2XJUA 1RTVA 3PUIA 3RI9A 4AI1A 1UY3A 2WNVC 3CLPA 4YGBA 1JZ7A 2PAMA 5LEJA 1GZTA 1ZBA3 3GZTB 2WSVA 4AI3A 1FOD1 4AHZA 3CIHA 1Y3TA 2VZRA 1RUD2 3FC0A 4AFBA 4LE3A 1EPWA 3FUQA 1XJAA 4QHBA 2L9LA 5LBCA 1VPHA 3AP9A 1PIV1 2ZPXA 2P2KA 5FP3A 4BMBA 4D3WA 4HN1A 2YPJA 1PGW2 3ZYBA 1VRBA 5CKNA 1NA1B 2DF7A 4NPRA 4LE4A 1C3HA 2LS6A 1W8ZA 1JYIA 1AXKA 5T5LA 4AEJA 2LM3A 3DF0A 2ZHMA 1MQTB 2RS52 2HWE2 5I8TA 3IAPA 5HPOA 2JG9C 1JYVA 3R4DB 1MZ5A 1GOGA 5BNPA 4GH4B 1URXA 1RIRA 2ZGMA 5F3GA 2ENRA 5F3IA 4GWIA 3WLUA 3OJBA 5JOZA 4OFGA 2C0ZA 2J1EA 5F32A 1CESA 2RDRA 2XXZA 2JX9A 3JQWA 2Z42A 5FK8A 3BTYA 1EPZA 3J26N 2R7EB 4MSVA 5A7PA 4FTSA 1CJDA 1HXS2 2RS33 2XJQA 3MHZA 2B8MA 2CNAA 4KWJA 5BYNA 1O4TA 2WFPA 5T50A 4XIKA 4N8MA 3RQ0A 5FZ0A 5C3RA 2E63A 1RUI1 3OYWB 4YW2A 3IDCB 1VBC2 4BHPA 3VD3A 4XFBA 3ZDVA 1W9FA 4HKOA 4YVSC 4RYDA 5JOWA 3FHAA 3JD71 4V1PA 2D6NA 2OXBA 1NQJA 2OVUA 3C8XA 4W50A 1UOBA 5JSRA 2E7AA 2B39A 1AR71 1SEFA 3CBNA 2JD9A 2QE3A 5FO8B 2RM21 3TBDA 5C9AA 1G7YA 2Y60A 1DQ2A 2E6VA 2QQWA 4DPNA 3C2UA 2BEOA 3E5XA 2OUHA 2VCBA 3VV1A 3M7AA 3PUHA 4RN5A 4LIUA 5F9TA 1AXZA 3PVEA 4FTBA 1JH5A 2A3XA 1H2MA 3GXUA 4ASMB 4C90A 3IPVA 2R32A 4CEWC 3WG4A 4BISA 4XW3A 3GDBA 3LB9A 4K21A 5CA6A 1LGNA 1W2OA 3WQ0A 1NCRC 3JBG1 5FIXA 5JZGC 4NROA 3I97A 3T3YA 3HNBM 1AYM1 1AR82 2C9AA 5HCBA 3IDBB 4HT1T 4JQTA 1DZRA 2DTWA 2ZEWA 3IB3A 1XYPA 1NA1A 4P5HA 1AJKA 5F8PA 4BE3A 3W59A 1JHJA 3SNMA 5IVFA 3MF9A 1DGWX 2YROA 2B9VA 2BUKA 3P5BA 5A3OA 3RPQA 1HN1A 2VQUA 4XMAA 3VDDB 5ACA2 5AFBA 4LITA 1OPOA 2A6ZA 2RS11 4MGSA 4QB1A 1KS5A 4O9GA 4LEJA 1E5IA 4FOQA 3SLIA 3ZN4A 1XPWA 1YWKA 4LA2A 1W9SA 1Q8PA 1SLTA 3KMHA 3KD4A 4A6OA 2EALA 5FKBA 3SH3A 1QXJA 3EB7A 4YGDA 1J1TA 3PHMA 2VW1A 2XLGA 3ZOIA 4D7YA 2CAUA 3AXEA 3RZKA 1QMJA 4FPEA 3RZMA 4BQ5A 4B4PA 3SKJE 4CCDA 1EAH2 4OZXA 3AZYA 3OYWA 2DBIA 4NHMA 4Q8KA 1CIWA 2IXLA 3K3NA 4LA3A 1PMHX 1RUF2 2W47A 2YGLA 4QKFA 4CXWA 2E26A 4QQPA 2JJ6A 2HWF2 4WM7A 3H42B 1LOFC 1VBB1 1X82A 1QNWA 4I0WB 2AREA 3LD8A 4YZ4A 3KGZA 4C0BA 1W04A 2EAAA 4MHUA 5J98B 1I6XA 1VBE3 4Y26A 1YQCA 4CDQA 5JSOA 3AMQA 4YG0A 1W8FA 1LENA 1SHWB 1H2NA 2P17A 2P5BA 3MUY1 5CAZA 2GH2A 2YPDA 3TN93 3L2HA 4A7ZA 3UYJA 1NX9A 2VZTA 4H7MA 3VKMA 2RJKA 2NYYA 3ES4A 3Q8FA 4Q0UA 1S2BA 2ZKNA 3ORJA 4CP1A 2QTWB 3R4UA 4EYUA 4QT6A 1ZBE2 2EXIA 4TLGA 2D7FA 1MQTC 1R1A2 3VBHB 1GSLA 2PLV1 3N9PA 2W94A 4GH4C 3LEKA 3J8F2 2DCTA 3A21A 3LDBA 2Z79A 5HI0A 4BLJA 2FDFA 2XB6C 3QOPA 5FUIA 4AQTA 3LDRA 1NXD1 4QM8A 1W0PA 1VR3A 1YEWA 5T52A 1QJFA 4CYDA 5JAXA 5JOXA 1QH7A 1Y9MA 1QDCA 4BPZA 4FPHA 1GNYA 1O8SA 5FZ9A 1YCIA 3THDA 1UYZA 5F2WA 1HN0A 3N3HA 3ZFGA 4BIFA 4COUA 1VB2A 1CZVA 1COV3 2DVFA 4JHZA 2MPFA 2X29A 3TNQA 4CP0A 4EN6B 3VGIA 3FJSA 2D98A 5DZGA 1JOPA 1H4GA 2WNUA 3VZJA 1W9YA 2VUDA 3OUJA 4LBQD 2HKXA 5IATA 2XUEA 3VBRC 1RUJ2 1W6NA 1W8OA 2CGNA 1RUH3 2UYAA 1G6NA 5LBBA 3RSJA 4ISRA 4YG6A 1AR61 1IGOA 2GDFA 2WYFA 3EXUA 1W05A 3IMMA 1TEIA 3LA7A 4PHZA 5FYYA 4I3PA 5FY1A 1ND3B 3SC7X 2WDBA 3ZX7A 2SBAA 2VOXA 5DUUA 3WNOA 5BUVA 5JPNB 1ZRCA 3H9AA 1XXNA 5IT6A 1TE1B 1WLCA 2VR4A 4OUSA 4R9DA 1JN2P 4QPGC 1L7QA 3H1WA 1XYOA 1UNBA 4ZY9A 3ZFEA 1HB4A 5A1AA 4B7KA 3BU0A 4CU6A 4FFFA 1P8JA 3ZXKA 3OBTA 1HQWA 4OUMA 5FQ0B 1MZ6A 1DGRN 1GQPA 3VDAA 1EY2A 1UY2A 4E4HA 4NAMA 4XJZA 3RZGA 4L97A 1OH4A 4HPKB 3E6DA 5LZ6A 1AYN2 1QHDA 4I0AA 4RSUA 5J96B 3H0OA 5DDJ1 5BNPB 3A0NA 3FLRA 2BOIA 4B3NA 3PUAA 4CEYB 4LO4B 1ACCA 5L73A 2XUMA 3VBHA 5TSWA 4XC9A 2PHWA 5C71A 3VDDC 4LBQB 1E57A 3AL5A 3NV4A 4JGZC 1OLMA 4ES9A 1FMD2 4UFIA 4A3ZA 2W39A 4WBBA 3I4IA 3CMGA 3VZLA 2VCCA 2PHDA 1H0BA 1TG7A 3MIHA 3ACFA 3LAGA 4KMQA 2D97A 2NLRA 1J84A 1OVSA 4R52A 4F8AA 2GN3A 1U5ZA 1JXNA 1KGYA 3I3DA 3KQ4B 1QQP1 4AW7A 1RUC2 3H50A 4YFZA 1AX0A 2VMCA 3VHOA 4V2VA 5FYBA 3VL9A 5LEKA 1ULFA 4CRQA 1PO22 1QOSA 3I59A 3K2OA 3KHBA 4WVMB 4S2DA 4Y22A 3BKZA 4YG3A 2ZX3A 5A70A 1C8NA 3WW1A 1ODNA 4L0PA 2DCKA 2VNRA 2R1DA 3ACHA 3LWCA 1QJX2 4FBFA 4RQPB 2W1WA 3JU9A 1QWRA 5F6LB 3RFRA 2VMFA 2IZWA 4M3CB 5BNOA 2A71A 2MEV3 2RJ2A 4MGTA 3FWEA 5K0UA 4AWDA 2WN3A 1OHFA 2A6VA 4LKFA 5A33A 2DCYA 3UGFA 3AC0A 4A6SA 1DQ0A 1N1VA 4NE9A 4AE2A 5GKAC 1R64A 3PVNA 3ZM8A 4AK3A 4P5YA 2F6BA 1XQNA 3SQOA 5L36A 3LIGA 2BWAA 4CUAA 2ZGKA 4NIDA 1VBE2 2NPIA 2JKXA 2WNEA 3AZXA 1GR3A 1HRV1 1JZ6A 5FQ0A 2R063 1RGSA 3USUA 1UL9A 2D43A 3H8RA 5E1RA 1LR5A 2ZMLA 4HPKA 4BDVB 3QLQA 2EIEA 1JHNA 3PU3A 2VU9A 4WVWA 1CVNA 1XRUA 3H3LA 1W6MB 4GZ9A 3AVRA 5LATA 3N7KA 1K42A 1S0FA 3KV6A 2HYXA 4XOGA 4GJYA 3BI3A 4LBQA 3ILNA 4Q0QA 3TOJA 1WLDA 2YUEA 1UOGA 1W9TA 3VD5A 4K8RB 1A8MA 3P3NA 5C4WB 4AGVA 3OEBA 4DMIA 2VTXJ 2E7QA 1LOGA 4AVVA 1GOHA 2QCSB 1ENQA 2J7MA 3IWZA 3N7LA 5FZAA 1HRI1 2DUOA 2IXIA 2PXJA 3A22A 5SV5A 5CISA 4DXZA 2Y38A 2PFWA 5FZIA 2OQ6A 3ACLA 3NW4A 2BWCA 5HV0A 1KDMA 3DPRA 4LKDA 1PIV3 1WCSA 1X36A 3O5SA 4HG6B 2ZEXA 3T4VA 5JSPA 1ONAA 1KD7A 4JQRA 4HKWA 3JZVA 2RDNA 1UF2C 1X8MA 2VBDA 1F5JA 4V2WA 4E8DA 4XCAA 1MZEA 3WW3A 5KXDA 3LCPA 1ND3C 2CDOA 4L9BA 4UF0A 2B7YA 2XL9A 4MO3M 4M3CA 2JDHA 1PGSA 5FZOB 4EN0A 3H8OA 1H6XA 3GCWA 4JX0A 5E8AA 3WDXA 2VOVA 4GD4A 3S6PA 1D4M2 1BLZA 3GHNA 3MDPA 3I2DA 2VW2A 1OF3A 3LFMA 1IG3A 1LEMA 3KF5A 2AUYA 5KWRA 2VUCA 1UO9A 1LTEA 3OY8A 1CZSA 4OHWA 4DO0A 3UJQA 4CDUC 2PHXA 4HXCA 1OOPA 1ENRA 1RUI3 2RR11 4AVCA 2VTXA 2WFF2 4NHXA 1C8M1 3ZFFB 2VQTA 2BNMA 2ZBJA 4CEYC 2QJVA 4TLFA 3WF0A 3RYKA 3AZWA 4PQ9A 1Y7BA 2P6HA 3NV2A 4RS5B 4LLFA 3JD73 3MUZ1 2XL7A 5F6KA 4NWVA 1DLCA 3T30A 1EV11 4DQAA 1AR73 1F5FA 4HETA 4O61A 2RM23 3J9SA 3U10A 3AYCA 3WNMA 2J42A 4FOYA 5JLVA 4IETA 3ZXGA 4Y1UA 4L2NA 4BQXA 2VXJA 1K5JA 1XNBA 1HIXA 3CF6E 4IV3B 5H9PA 3VBFA 1UY1A 2XKPA 5C4WA 5LASA 5J36A 3FFZA 3PDQA 2XLFA 4ZU5A 1BXHA 5L19A 2ZAHA 1XSRA 3IAQA 5B4NA 1SLAA 2VZ1A 3JBG3 3I3EA 1BKZA 4KBBA 1PGL2 3PVBB 5F3EA 3JQXA 1W0NA 3H3ZA 5CFCB 1GICA 2WINB 3HBZA 5CEHA 3M4FA 4UI9L 3HAGA 1VALA 3THCA 4HVQA 5FMOL 1O91A 1QEXA 1XOYA 2MHFA 4RR3A 4OQ9A 1LAJA 4BXFA 4CDXA 3WP4A 4FFGA 5C5TA 2GMMA 1UU4A 3D6EA 1G9AA 4P9YA 2IXKA 5CB7A 1IZ3A 3RWNA 4AOCA 2RS13 3OG2A 1RHI2 3GNEA 3ELNA 1V6LA 3OGSA 5KXBA 1HB2A 5GZFA 4QDQA 2YYOA 1I5ZA 4COYA 3VKFC 4MGQA 4LR4A 1GKBA 4COWA 5BV6A 1W03A 4JZRA 1H8TA 1PO11 4JGYC 5FZBA 4ZXEA 4BOWA 2MEV2 2GP5A 3DXTA 2A5ZA 1GWLA 5DPNA 1QF3A 1V6MA 3NMBA 4R9AA 2JDUA 3P3PA 2J1RA 2YHJA 1A6CA 4DUWA 3MYXA 2AC1A 4CTEA 1LOEA 2GNMA 3BOWA 4NAOA 5KHKA 2ZA9A 4HZFA 4IESA 1WCDJ 1H9PA 4SBVA 5A6YA 4M0HA 2R062 5HV4A 2YU1A 2HWD2 4LK6A 1B35B 2OX0A 3PMSA 3MEPA 3SCGA 1VBB3 4H3WA 4QWNA 3SEPA 4KU7A 4BMEA 4LBOA 2GU9A 1CAWA 1X33A 2EIDA 4N90A 1K5MB 3I3QA 4AHXA 3T0BA 4DNYA 4PLOA 1OA3A 5KXCA 4XMIA 4COZA 1OH3A 3K51A 3B69A 5A7SA 3WDWA 2E31A 4IV3A 2YC4A 4KG0A 4Q4Y2 3U4XA 2XOMA 1GZ9A 2OIIA 3N9OA 4W65A 1DZTA 4BIOA 1NLSA 3RZJA 1XNDA 4YGCA 1PVC2 1UZ0A 4XFGA 1RUE1 5DAWA 1UYXA 4L92A 2G9GA 5CZKA 2WUHA 4MGIE 1PNGA 1JZ8A 3K4AA 2RDSA 5FZ3A 5CFCA 2XMLA 3ZPOA 1W8UA 2FHRA 4A7KA 1LHUA 1Z7S1 1N3QA 5AVAA 4Y1ZA 1W2AX 2LUWA 3VZNA 2D44A 2IXCA 2NN8A 2PLV3 3AYEA 4XAEA 5EV7A 3C7HA 5T5OA 5FBJA 3UETA 4E2SA 5DQ0A 1G9BA 1DDLA 3VDCA 4YYOA 5CFDC 3U07A 4H7LA 4N9HA 3CL1A 2AZ5A 5FXXA 4P9JA 4WV8A 4OQ8A 1U5IA 2WZR2 1OA4A 2PA7A 2JECA 2NMNA 4WM8B 1XC6A 1STMA 2ARAA 2YXSA 5JXGA 2V4AA 3CJIA 4EZ4A 1QJU2 1PK6B 4KWKA 4ZONA 3H7YA 3SKVA 4BXSV 1FPN1 3OD0A 4S2HA 1W90A 2A3YA 2EA7A 5T5PA 3I3BA 2EIGA 5D8AC 2TBVA 4CDWB 2PTMA 5A3NA 1GWMA 3KSCA 4META 4QU1A 1U5XA 2WRAA 4MH0E 3I7DA 5AVPA 4HBNA 4EJRA 1QDOA 3ZYFA 3F95A 3KVAA 1K12A 3WCSA 1AR92 1K45A 1XNCA 1AR63 2X8KA 3E6CC 1EUTA 4HLTA 3WDVA 2ZGPA 1JW6A 1RUI2 3AKPA 1IQAA 1OUSA 1BEV2 2WZ8A 5FZFA 5J48A 5FOJB 3IT8A 2GMPA 2WT1A 3ZPYA 1YLLA 5LCWL 2ZEZA 4XFAA 4Y4RA 1DQ4A 1K5MA 1VE0A 3CJXA 4M4RA 4AYUA 2VZSA 1SLCA 4FT8A 4RD7A 4A7YA 4FSJA 4Q1RA 1AR72 3JB4C 2CWMA 3KS7A 5FPBA 4D7SA 1RUOA 5GZDA 4CXXA 4XPVA 1YC61 1Q43A 4DOUA 3M3CA 4K3UA 3DUIA 5E16A 1J1LA 2WO1A 3N36A 2OQ7A 5I0RA 2WSUA 1SBDA 2PAEA 1IG0A 3NJZA 1SBFA 5FYTA 2CSGA 1MEC2 1AXYA 3FBMA 3WCRA 1WKYA 2K9ZA 1OF4A 1YYNA 4H2AA 2O8QA 3MPBA 3VKLA 1Z78A 3ZXDA 1M06G 3I2OA 4CCEA 1CX1A 3KVBA 4PIZA 1ENSA 1GU3A 2ORZA 5DAXA 1SG3A 4E27A 5FTTC 5FPUA 3M2MA 1ST8A 3CDZB 4BM8A 4B1LA 4JAAA 4N43A 2XBO1 4GALA 4WM8A 1OQ1A 2C26A 4MVTA 4A4AA 1KJRA 1NUKA 3D5OA 4A3XA 2D6MA 1J59A 3IN9A 5EFUA 1FT9A 2W95A 4JKLA 4NHLA 5C3PA 1QQP3 4FPYA 3OCPA 3WP6A 4CDWA 2I2SA 2I45A 2WZEA 3D3AA 3TYJA 2WQ8A 1QNYA 2LW8A 4G3YC 2E9QA 5GALA 5JR2A 2XQRA 1JYXA 4UAPA 1D2SA 4R4ZA 3A4UA 1ULEA 4TZDA 4JTOA 4KGQA 4QQOA 4P02B 3EQEA 4XIOA 4MUVA 4LBKA 4IE5A 3SITA 2ZGTA 5HXMA 2JD4A 4NN0A 5A3WA 2KR2A 1UWWA 3ZR5A 2GC1A 5FLJA 2OT7A 2X5IA 3H1YA 3G7DA 2BOJA 3AKTA 2JG9A 2WWJA 1TMF2 5DUWA 2D6OX 2WL1A 3M3OA 3TWIA 4EWEA 3AZVA 1JZ2A 1RMU2 1ALYA 3FN9A 1OD3A 1C1FA 4ZHNA 2JKBA 3B9IA 2VZ3A 2YY1A 1NZCA 1NOVA 4L11A 5FYHA 4YGEA 4GMP1 2FDGA 1GV9A 1HRV3 4QPWA 3ZSMA 2F4LA 5FYIA 2GC3A 5C9AB 2SLIA 1S2EA 4AR2A 4YW5A 3OGVA 5FYCA 5IVJA 4Q4V1 3RWKX 1XYNA 3X29B 3ZR6A 3D4KA 1R081 4U2AA 4X6QB 5C8CB 3P6BA 3PJYA 3OGJA 3ZXLA 5FUNA 2A7AA 2R072 4YPJA 4P9GA 3INAA 3IPVB 3LFIA 2HWB1 1ULCA 3POEA 4KNCA 1UPIA 3N9QA 1UY0A 1RXFA 1WBFA 1TQ5A 4IEYA 2AYHA 2YB7A 1FAYA 4N53B 2XJTA 3RRDA 4YVSA 1FXZA 4IL7A 2JWPA 1RUG1 2EF6A 2ZMKA 4KU8A 4ZU4A 4OHZA 1LKNA 1WLWA 4JC1A 1AL0G 3KCCA 1PK6C 2HWC1 4JDMA 3VN4A 5KHGA 3GZEA 1HRI3 1OKQA 2EAKA 2W0XA 4MYEA 5FPLA 2E33A 4RHV1 4PBOA 2HYKA 3S7IA 1W9WA 3VBOB 1UW8A 5C6CA 3ES1A 5E6HA 1NCRA 4YW3A 1HJGA 1VJ2A 1CAXB 4K7JA 3C3VA 1ZA7A 2FCVA 4Q2FA 5FPAA 4QPYA 5DUVA 1F4HA 1R1ZA 3POGA 4QU2A 1RB8G 1JYNA 3ABZA 4LBMA 4P9WA 5F5AA 3GGLA 2WLQA 1RVF2 2GSYA 2PHUA 4Y5SA 2DCZA 3I2KA 1IKQA 4E9KA 3WNPA 2J1UA 5KHIA 4IW3A 2QZ2A 1RJ7A 1X50A 2R041 5ANQA 2XKOA 3AX4A 3E6BA 4QGMA 2C4XA 4WM7B 4P08A 4LHSA 3TNPB 1LU1A 3CHXA 4MOAA 1ZX5A 1C5HA 4C91A 3GHMA 2XONA 4XETA 2RR13 4E4SA 1NLQA 4IEVA 4CDQB 1MS1A 1C8M3 1YJLA 5AC92 1POV0 3GALA 2VO5A 5T3NA 5JMCA 5C8CA 2ET7A 1O3RA 1G9CA 2ZKLA 3EO6A 1DBNA 4QX8A 3POIA 1EV13 2VL4A 5KC5A 3V64A 2ZGRA 1ASJ3 1Q5OA 1SBEA 2XR4A 4CP9A 2GMEA 4S2GA 4N53A 1F8VA 1LHNA 3MIFA 2J1SA 5FXVA 1IQDC 4Y1XA 4ASKA 5A3TA 3AKQA 5FDBA 1KEXA 5J3UA 2Y26A 2VQ0A 3NWKA 5BNQA 3RVHA 3HJRA 4LHNA 1J3RA 2J1TA 3HPNA 5BNPC 2YMZA 1D2QA 1SDWA 1RXGA 2RMU2 4Q4X1 2Y6LA 5EIYB 1MS0A 1QJY1 3NKTA 3PIGA 4NWWA 4XTMA 3RJ2X 2WBKA 3S5QA 3VBUB 1U0AA 3AP4A 3DL3A 2JG8B 2XHNA 5EHDA 1VBA1 1FV3A 2DCJA 2V5YA 4GB31 5FY0A 1ZZ6A 4N7IA 1CR7A 1YQ6A 1TNRA 1S4CA 2JIJA 5FWEA 1OQDA 1WD3A 3MI8A 4FP3A 4Q1PA 3VBOA 4P9LA 1S0DA 5FZCA 2YG0A 4X8NA 5K8SA 3GYDA 3WG3A 3ZFGB 1IHMA 5M0TA 5FY7A 4Q4W2 4ITCA 1CAXA 1VB4A 4DY3A 2DVBA 2ADDA 5LW9A 4GJZA 5FYSA 1QJEA 2WNUB 2WWUA 3R4SA 5G05L 5CYYA 5FKCA 1UZWA 1W6NB 3MGUA 1POV1 2Y6JA 5C33A 1RJ8A 5A6ZA 1KDKA 5BNNB 1PO13 1VBD2 2ZHNA 3U37A 2W1QA 2ZGOA 4JCKA 2QQUA 1YO8A 2VG9A 4PBPA 2W9XA 4ASLA 4PCRA 5C9AC 1OXCA 4IEOA 2JDNA 3B02A 3K46A 2F4PA 3ZN6B 4Y4YA 5EP9A 5T54A 3VBSC 5BPXA 4E2QA 1CAUB 2P1BA 3GM8A 5J37A 5EJ1B 2IUWA 5C3QA 4XHBA 1V9U1 3KM5A 3ZFEB 4PI0A 1TME2 3HNMA 4GQ7A 4K1YA 2YFZA 4NRMA 4QHZA 1XE8A 2FQPA 4QDSA 4IEUA 4X6RB 5KBFA 3EHKA 3M70A 4XUOA 5IJRA 3LGRA 5JI9A 4IV1B 3AK0A 1ZBA2 2G4IA 2Q1ZB 4Q29A 4AHYA 1IPSA 1NA1C 1DIWA 4KQ7A 2R30A 5A32A 4DXSA 3MFAA 4IGOA 3RZHA 3LOBA 1WGPA 3C7GA 5F2SA 3B93A 5F5CA 1RUE3 2WQZC 4D8MA 4FPLA 3LA3A 1YFYA 4D6SA 1D4VB 3CEWA 4QPGA 5GLVA 2LRPA 3MIEA 1UZVA 3VBUA 1AX1A 1SMVA 2JG8A 2JENA 1HRI2 2RHPA 1UOJA 3MF6A 1Z7S3 4HVOA 3J7HA 5FZDA 3WW2A 3RS6A 1S0JA 5LY1A 4FPFA 2O8OA 1Q3EA 5FMDA 1M4WA 1RUD1 3AFKA 3IDEA 4YM1A 1ODMA 2VMDA 1W0OA 5AFEA 2F17A 2VMIA 2DDUA 3BPZA 1WLTA 4YWAA 3I59B 5FY8A 1PGW1 3MLJA 4XFIA 1Q8SA 4Y22B 4GA9A 3AMNA 2RS32 3GCXA 3QD6A 2XPJA 2DU1A 2RS51 3R0RA 2HWE1 1FPN3 2WO7A 4B1MA 5FZKA 2QVSB 2IWGB 1LU2A 4WM7C 1O59A 2OKXA 5BNNA 2ZX0A 3DXUA 3FHIB 4MGZE 1YQ5A 5IHRA 1BMV1 5BNOB 3HR9A 2Z69A 2QQOA 1AL21 2VZQA 1E5SA 5K0UB 4CDQC 5A33B 5GZGA 2TEPA 3ZN6A 4JKKA 4OLLA 3HT1A 4MX3A 5FMBA 3S0MA 1CAUA 4ATFA 4XF1A 1AF9A 1HXS1 4KL1A 2R16A 3VZKA 1LOCA 3AVSA 3NJXA 3EJKA 5L7OB 1F31A 2OW4A 2D3PA 1C8M2 4I02A 4ZZ8A 3OF1A 3KT4A 4FFHA 2OA2A 3IIAA 3USUB 3A0KA 4D7TA 3LOIA 4ATEA 4WVZA 3IM0A 1VBC1 3HN3A 4IV1A 4XAAA 4P9IA 3HEIA 2CV6A 5FO7B 5D2AA 1BVP1 3BTZA 2NQYA 1ASJ2 3WDTA 1QGLA 3GZAA 1GP4A 4FPKA 4LK7A 2C5DA 4URTA 1SLLA 5K4LA 4PT6A 1JBCA 3NL1A 3ZXJA 2BGPA 3ETPA 4LXLA 5E88A 1LGCA 4B8EA 4BYYA 2BDRA 3W5NA 4QXKA 2YU2A 3HD8B 4K8FA 1B09A 1QOTA 2ZHLA 1DYPA 1QOOA 3P1IA 2EICA 4QGNA 4YNIA 3ZFGC 4O7XA 3FFQA 3V0BB 2P3YA 2VZUA 1VAMA 4XF9A 1HW5A 5FMCA 3LSDA 3B00A 3QH7A 1N3OA 3PTRB 3DPRB 4Y33A 2H6BA 1AR81 1RUNA 1H6YA 1WCKA 1LHVA 2WNUC 2YC0A 3WOGA 4IEXA 5EJ3A 2G19A 2WS91 1N47A 3NVCA 4YW6A 1W3VA 4KWUA 5F3CA 2UWAA 3PVOA 4NMIA 3ZVXA 4DXTA 3AJYA 4B4QA 5ACA1 3IDAA 4EROA 1LB2A 2ARXA 4UF0B 3ZXAC 3LA2A 1UX7A 4Q5OA 2E32A 3ZLIA 3FMGA 1GNZA 1S0IA 3PJQA 3KCXA 1C1LA 3KV4A 4HANA 2YGMA 1JYTA 3KF3A 2BVBA 2R6QA 1C4RA 4BK5A 3AP6A 3OB8A 1F9KA 1OSGA 3OY8B 1S55A 5H9QA 1SZBA 2CGPA 5L7OA 3QACA 5K9YA 3BIEA 4FXKB 2BV4A 1OKOA 1OOPB 1SFNA 2DVAA 3GJBA 1UN1A 1YNAA 4NOTA 4EN9B 1EAH1 2JEMA 4YSFA 5JWPA 2Y34A 1HB1A 4S2FA 3ZKUA 1Y9GA 3O1RA 3TN92 1ZVFA 1GUIA 1ZM1A 2C1FA 3VBHC 2WT2A 3LKJA 1PZ7A 3IKWA 3VZOA 3HQUA 1WMEA 3AMPA 3WG1A 4AG4A 2Q1MA 5JOYA 1Q8OA 4FPOB 4LUKA 2VULA 2VY0A 3ZMOA 3M8LA 4XDPA 5IVYA 4DZGA 3N4MA 2VH9A 1NE6A 1UY4A 4YLZA 4Q4V3 3C7OA 1KFUL 5JI7A 3VBFB 2QFEA 5F1RA 1R083 1LODA 1XNKA 2R0FA 5FMOS 1G8WA 2VE1A 1W99A 2WN2A 5IAXA 2QQIA 1D0HA 3WY6A 1MS9A 5FZEA 4LKEA 5C5UA 5IYYA 1FOD3 3ALQA 5LK5A 1WW7A 2HWB3 1OA2A 3IBMA 4DUVA 3V0BA 1J58A 4CE8A 3AYDA 4QKBA 3O0WA 4GXLA 1V6OA 4Y1YA 2H0VA 4CCJA 3CU7A 2AR6A 1IOAA 1FNYA 4XBNA 1RUG3 1WA4A 3VHRA 3WP3A 3FLPA 2D3RA 1ZBE1 4XBLA 3AP7A 5ANNA 1R1A1 2HWC3 1EYBA 4RR3B 2W2IA 1COV2 2W92A 4CDXB 3HNYM 5ABJB 1W2NA 1GZWB 3J8F1 2QZ3A 5G04L 3BTXA 3MV01 1YIFA 2VPVA 4MGKE 2GH8A 5CG9A 3O1SA 4R9BA 1QXPA 1REEA 3WUDA 3W5MA 2NZ9A 2HLEA 2RG4A 4RHV3 3VZMA 5C8WA 1F2NA 4OVEA 1RUH2 1IS3A 1ZZ8A 4OHYA 3HIFA 4H55A 2JDZA 3DN7A 4NHYA 1JU3A 4NIGA 4AF9A 2VTFA 3FZ3A 4RFT0 3ZDSA 1R091 4BQ4A 1H8TB 1N1SA 1UXXX 5GZEA 4CVUA 3WQ1A 3S5AA 5DAVA 1NKGA 3J7MA 4FI9A 4C1WA 1LCLA 3GBFA 1NZIA 2Q0AA 1PX3A 2G1MA 1OFSA 5FYVA 4JDNA 1RUJ1 3NKGA 2LALA 1Y4WA 4IE7A 1WMFA 4NJ4A 3WX5A 3T08A 1S1AA 5FZGA 2R043 2GALA 3OBAA 4J1XA 3JB8A 4PLNA 1XNTA 3B94A 2WC2A 2P3KA 3CQOA 1AUYA 4RGAA 4BZ4A 1MS4A 1FNZA 1CAWB 2QBXA 2XJPA 2YZ4A 3O7OA 4P14A 2ARBA 3D0SA 4P9XA 4OMCA 3ETQA 5CIRA 1CWPA 3DGTA 1A3KA 1KITA 4IGPA 5FCCA 2N7GA 2VJXA 1ND2B 1APNA 5LA2A 4NPLA 4E4DX 5FRAA 2WQ4A 1W8HA 2Y6GA 3KQRA 4M3CF 4J6GA 2TUNA 4UFJA 4YW1A 5C3SA 5C7GA 5IK5A 3VKOA 4LHLA 2ZZQA 3DPRC 3UGHA 1JYCA 3GF6A 3HQXA 3E1F1 5F5QA 1AYN1 2FDIA 3AKRA 3E5UA 5JXIA 1AYM3 1GYKA 2RV9A 4LMFA 1LOBA 1UYYA 2GN7A 2WAOA 1BCXA 5IAVA 4QB6A 3W20A 3NNGA 2OZ6A 3AMMA 4QXHA 4PF1A 2V09A 5EQUA 5JPMB 1W8WA 5ABJA 1O3SA 1DFQA 2P6CA 3LPGA 1GZWA 4Q4X3 1QJY3 1SCSA 4G4FA 2W5FA 4RQPC 5CU1A 5A7WA 3NAPB 5FAXA 1QU0A 2A3WA 4Q27A 5DZFA 1DU3D 1FMD1 3THTA 4ZZ5A 4QXBA 5APAA 3MW2A 4AVSA 4XJAA 4GB33 4YZ1A 1UMIA 4PF5A 5HCAA 2VXRA 1V70A 3CJIB 2PQSA 2DVDA 2D40A 2JDAA 1ULOA 2FCTA 3ZYJB 1BBT1 1GP6A 1RC6A 3WF1A 5LRRA 1RUC1 4C1XA 2CGOA 3KV5A 3MV11 1O5LA 5FPXA 4LT5A 3DYOA 4OI0A 1OOPC 4QAWA 4IUGA 1PO21 3VL8A 4JRLA 1BJQA 2Q8CA 3TEYA 5J09A 3NRUA 2WLPA 1X9PA 3OPTA 1POV3 2BFUL 5D21A 2WZPP 3UT0A 3MFCA 4XF3A 2ZEYA 1QJX1 4AEDB 2P3IA 4AGRA 3M3IA 4JVAA 3I3MA 5H9RA 2DFBA 3MIDA 2HEVF 3KT7A 2NP0A 4MHRA 2RE9A 1JZ5A 1GQHA 1LGBA 2OUJA 2KM2A 1UD1A 3QBQA 5T55A 5FZ7A 1BK1A 4HVRA 3VBFC 5KC6A 5C4WC 3WG2A 1VMFA 3WP5A 4XJ9A 1LHOA 4PLMA 1ND2A 1V9U3 1C28A 4QX2A 4QPIB 4IEPA 1DF0A 1VMJA 1VRH1 4MG2A 4D6QA 1WWYA 3GBWA 3MW3A 2Z5WA 3ZN5A 4UBHA 4WVVA 3H7JA 1R082 1VP6A 4CCNA 2VQAA 1UKRA 4Z1VA 1SPPA 4FVVA 3AM2A 3WINE 1FOD2 2BZDA 1UXZA 2HWB2 3O12A 2ORXA 1T2XA 5CADA 4QGLA 3POFA 4RR3C 5IVEA 4AQSA 4CDXC 3AL6A 3WXPA 1NAEA 4I01A 4CU9A 1PHMA 4QQLA 4L8QA 5F39A 1PIV2 4BB3A 1RUG2 3MBWA 4XJUA 1GWKA 3BOPA 5A7NA 5LB6A 2VOWA 4DEQA 3NAPA 1X8EA 2G9FA 2QDNA 1PMIA 4XUQA 4AFAA 3RYPA 2W3JA 5FP7A 5FFOC 4KGGA 4K20A 4PIYA 5CNAA 4N43B 3C7EA 4XDOA 1YUDA 1G9DA 1IS5A 3WDYA 1YQ2A 4F7ZA 4LQRA 4M01A 3O0XA 1H8TC 4LLOA 1RUD3 5FY5A 4DEVA 1Q8VA 3L2YA 5J7MA 1HB3A 4D0QA 2YBPA 2CDPA 2CYFA 5I93A 5JCTA 1YXWA 1TNFA 3B7MA 4DIQA 3JCIA 3T2QA 1LNSA 4CXYA 4D94A 3TRSB 3ZFFC 2UWBA 1PM4A 1YRZA 3BU7A 1I9RA 2RS53 2HWE3 3DYMA 2ZHKA 4RS5C 4AEDA 2K46A 2BYVE 3RZLA 1DHKB 3RG0A 1OQEA 5FWJA 4XUPA 2ID4A 2IXJA 2W68A 4AQ2A 4D6RA 1AL23 2A6XA 2ZCWA 3CZUA 3ZSEA 2JXAA 2X5IB 4AVBA 3ZSKA 1LHWA 1D4M1 5E89A 2JG9B 2A6WA 2PELA 1LOAA 1WMDA 2JDMA 1KQRA 4IV3C 1YI9A 3JD72 4F3JA 4PDWA 5H9SA 2A70A 1HXS3 3KLSA 3RI8A 1SLBA 1MPXA 1V6NA 5EPAA 2RM22 2ZTNA 2GNTA 4QPIA 4AAPA 1W06A 1JMUB 1MVEA 2XH6A 3BUCA 1UQXA 5I91A 1H30A 4CU8A 3I2FA 4YW7A 2QQLA 2QQKA 2WFF1 5CFCC 1VBC3 1YFWA 2Q30A 5DDJ3 4R4XA 1XSQA 4OZOA 5F5IA 4DRVA 1S2KA 1C57A 2VZVA 3JBG2 3PLQA 3K77A 4YVWA 3K48A 5IK8A 1AYM2 3T0AA 4GMP0 2X53S 1G9FA 3AZZA 4JTNA 1D0GA 1H4HA 3NJYA 3WNNA 2ZGUA 4YVSB 5FP9A 1ZRIA 5A7OA 4DS0A 1BZWA 4MXWA 1QXRA 3MICA 1MS5A 5I0TA 3URFA 2Y6HA 2B5HA 5FZ4A 4KI5M 5B2GB 4Q4X2 1WW5A 4XURA 2EXHA 4IE4A 5DAPA 2DUPA 5JUVA 2XG3A 3WNKA 1JI6A 3PURA 2RS12 4NUBA 2CTVA 1YI7A 3DKQA 4NHKA 1XBFA 4BWOA 4DFSA 2J1VA 1NCQA 5IVCA 1LECA 3Q8EA 4Y24A 1AR83 5LBFA 2A1XA 1PNFA 4A45A 2WNVA 1NY71 5FZHA 1W6PA 2WS93 5A1LA 3J7LA 4CEWB 5LA9A 1OT5A 1ZRRA 2JB4A 2XJSA 1LULA 4SLIA 1ZREA 1K3IA 1ZRFA 3F2ZA 1S0GA 1EP0A 1NCRB 2XDVA 3IMNA 4QQ2A 5JZGB 2JE7A 5FY4A 4CZSA 1B35C 1N1YA 4LO7A 2A75A 2GNDA 3TEXA 2O0OA 2HBTA 2QQNA 4CA9A 4OULA 1XU2A 2J22A 1RHI1 1K5MC 1VAVA 3MIGA 4LOTA 1CONA 3KCYA 4XQDA 1XNAA 4A2UA 4AXOA 1ZRDA 4GKYA 2W91A 3VLBB 1WBLA 1VBB2 2ZX2A 1V0AA 1A34A 2WR9A 2VVFA 1YFUA 2ZX1A 1FATA 1UZYA 1IS6A 2LROA 1H9WA 2PN5A 3L9JT 5HBAA 3M3QA 4XQWA 1OURA 4AL9A 1EAH3 5EYYA 3T1LA 2H6CA 2BQPA 4XACA 3ZYPA 5I8YA 2NMOA 2GZWA 4XUTA 1AJOA 1DYOA 4W8JA 5KHHA 2JDPA 5FZ1A 2OPWA 4URAA 2HWD1 2Q5TA 4TTGA 3CZJA 1KFXL 1G86A 2FMDA 4GIQA 4UFLA 3Q8AA 4YRDA 3ZIXA 4CP9B 1TZOA 4LJHA 2OZJA 4XHXA 4UW3A 1S0CA 4XDQA 5FO9B 1UU5A 4N43C 4Q4Y1 1RITA 4WM8C 2ZZJA 2I74A 2PLV2 1KRIA 3OBRA 1KS4A 2J1AA 2VGDA 3HT2A 3HWJA 5B4XA 3ATGA 1BYHA 1PVC1 4BK4A 2W1SA 3HMYA 2AACA 3WDUA 3OEAA 1JS9A 2R1BA 4BCUA 4CDWC 5F37A 1NT0A 2VD7A 4KBZA 2X05A 4AGGA 1ZBE3 4CEWA 3ZO0B 1X7NA 1R1A3 4B4RA 1V6JA 2R0HA 1H1AA 3HN1A 3J8F3 5JZGA 1CJPA 3OPZA 3PUQA 1PX4A 1HQLA 1HLCA 5GM0A 4AI2A 1GFF2 5FOBB 2X5IC 4BU2A 1NG0A 2VM9A 2WZR1 2ETEA 1WZXA 4AHWA 4Y3OA 1PZ9A 1UPSA 3WF3A 4A44A 1AR62 1WA6X 1QJU1 4HMZA 3U1XA 4XF4A 4YZ3A 1BMV2 2FDHA 4RGKA 2YBKA 2HJIA 4Z92B 1R093 1AL22 2YV8A 4E8CA 3T1MA 1H8VA 2GAUA 2BERA 1BK0A 2WA3A 2EXKA 4UW5A 5CG8A 1CAVA 5DG1A 1PM7A 4TXWA 2UU8A 3B9CA 3J7NA 3LE0A 5CVRA 3UKVA 1CPNA 1W6OA 4D69A 2ZGQA 4EQVA 1VLNA 3V0AB 1DGRA 3O14A 2AEYA 3VHPA 5IFTA 1RUJ3 1JZ3A 2V4VA 4MLOA 2CHHA 4QM9A 4W6WA 1AR91 3CKHA 4QXCA 4I3GA 3WF2A 3AXDA 2JDKA
chains in the Genus database with same CATH topology
1BEV1 4ORFA 4W6XA 5DDJ2 3VBRB 3MIBA 1DG6A 2WWSA 3V65A 2B9UA 3AJZA 3BB6A 3ZMNA 5IUQA 3D0JA 3ST7A 4XFFA 4ZXKA 1LOFA 5A32B 5JSOA 1UCXA 5CBLA 1HDKA 4NO4A 3B5LB 3VBSA 4R9CA 4QPGB 1AYN3 1QH6A 2V73A 3ILFA 4FQZA 4AEMA 1MEC1 3TB0A 1ZYBA 2E53A 4FQ4A 4ZKTB 1GNHA 1QQP2 4W6YA 4Y20B 2ES3A 5EXOA 1ZA4A 2WS92 1LEDA 3DV8A 1Q56A 2GC2A 1FMD3 4G9SB 3U11A 4WZCA 3OGGA 1MQTA 4LBNA 3BODA 4GH4A 4JGZB 3T2TA 3VUOA 2ZOEB 3BALA 4L99A 1BBT3 1OFNA 1RUC3 5GLWA 1PO23 2HEWF 1W6QB 4I2OA 1NE4A 3N7JA 5FBZA 4UW6A 4N7UA 3OD4A 5FREA 3V0AA 4ONUA 5C8CC 1QJX3 1WD4A 4BA6A 1HRV2 2DFCA 2IFWA 2XJVA 3S30A 2QKDA 4N53C 3VBRA 5EZWA 3N35A 4HSJA 2DVGA 1IPKA 1TMF1 2OPKA 1RMU1 4NVPA 1PVXA 1WW6A 3GZUC 1UZZA 4YM2A 4DRRA 1VRH3 4FCAA 2ZACA 3UK9A 1O5UA 3H8UA 3WZ1A 3AB0A 1FI2A 3LSEA 4FPGA 4OHVA 4Y5Z0 1FV2A 2Q4SA 2LTNA 2PHFA 2BNNA 4IEQA 4Q0PA 4F83A 2XLAA 3WT3A 4Q0SA 3VBOC 2A6YA 1UX6A 2R071 2CAVA 1JTZX 3J4UH 1DQ1A 5FLIA 4Y20A 1ZNPA 2QNKA 4XFCA 2I07B 2K0GA 4UW4A 4XTPA 2ZABA 2VOKA 1AVBA 4MXVA 4M3CE 3WHTA 3VDDA 2Z2SB 3RJRA 4JGZA 4FOWA 4QX5A 1WUVA 1FYUA 3E97A 3ZXEA 1HKDA 2GNBA 3G6JB 4LO5B 3R6SA 2O1QA 1W6QA 3PTYA 1R092 4AFCA 3POSA 2UY8A 3QCWA 2WKKA 3SH5A 2B46X 2DURA 3BIWE 4Z8BA 2Q8OA 2RR12 2XVLA 3PNAA 2D93A 4N9IA 2PQQA 2D6LX 1IS4A 1D4M3 1CPMA 1RVF1 5GJ6A 1LRHA 1EV12 3CO2A 4RGGA 5JR7B 1FX5A 3WW4A 2FBEA 2VNGA 1GLHA 5JVVA 2ZMNA 2B42B 1I3HA 2PHTA 4MGYE 3LOBA 3VBUC 1H2LA 2WFF3 2JG8C 3RDIA 1A8DA 5AC91 4GWNA 3MLLA 4QD2A 2IXHA 4AEKA 4CDUB 1N1TA 2AH2A 3NSTA 2D5HA 3KGLA 3OTFA 3FUOA 1ZZCA 1HV1A 1OLQA 3O0VA 3POYA 4TYSA 2VMGA 3WHUA 2IC1A 2XBO3 1YFXA 4EV0A 2B45X 2XHKA 5BNNC 4Q0VA 1HX6A 1OLRA 2GC0A 2RMU1 2AENA 3LZZA 4KWLA 1JUHA 4JDOA 5I8SA 1BBT2 4XBQA 3WUCA 1PO12 2WIIB 1J3PA 3RNSA 4BLIA 2VW0A 4Q4W1 3ZFEC 2Y0OA 4XEZA 2CL2A 3RZZA 3NO8A 1MS8A 4XZPA 1Q8QA 4AFMA 1RHI3 5GLUA 4ES8A 1DGLA 3WNXA 4IV1C 4U36A 2QDRA 3TAYA 2P37A 2ZS6B 2XWJB 2D6PA 4AI8A 2FZ1A 5KHJA 1Z0HA 2UWCA 3QH6A 1RUF1 4FAGA 1ND3A 1VBD1 1GZCA 2HWF1 3FE5A 3W9AA 1ULDA 3WR0A 2ERFA 4GMP3 2NM1A 1REDA 4I0BA 5EYXA 2BVVA 2ILMA 3APBA 3MLKA 4JGYB 4Z82A 4XQ4A 1VRH2 3THPA 2PHRA 1JOJA 3EBRA 4JRAA 4CP2A 1MS3A 1RUE2 4YZ2A 2HWD3 1TME1 3ZIWA 4CDUA 5HCFA 3UKTA 2ET1A 5DG2A 1IPJA 4KG8A 4YARA 2ZJCA 3I8TA 4CEYA 1Z7S2 1ZBA1 4Q4Y3 4WZFA 2JE9A 5FLHA 1MVQA 1UIKA 1H1IA 2RJLA 1AX2A 2AGSA 1PVC3 2PAKA 4NR1A 3ECQA 3ZSLA 4AQ6A 2ZGLA 2DWRA 5BNOC 3SMHA 4H14A 4UXAA 3ZYIB 3NV1A 3RMYA 4FAHA 5K0UC 1ZZ7A 2BFUS 1UIJA 1FPN2 3DKWA 4LO6B 2DUQA 2BGCA 4I09A 5T5JA 4FP2A 4IEZA 5L7OC 1DGWA 4M00A 4WVMA 1JUIA 1GBGA 1MZFA 1XE7A 4RL7A 2WZR3 4HKLA 3ME2A 1U5YA 2RS31 2XVKA 1CGPA 2KA3A 4FTEA 4OHXA 4RQPA 1QJU3 1O3QA 4K6BA 1OI6A 4FOVA 2DTYA 4Q8LA 5CFDB 1BVVA 2ZGSA 3N7MA 3SHRA 4IEWA 3SCFA 4GKXA 4LNVA 2D3SA 4YZ5A 2YDEA 4UBGA 4B7EA 3ZYRA 4GWMA 2DU0A 2VECA 3SISA 4JGYA 4PIXA 3M3EA 4LULA 3AYAA 1AR93 5D8AB 1HQNA 1OPMA 1Y43B 4XFHA 1V6IA 3BCWA 2ZX4A 2E7TA 1BEV3 5DXDA 5HXVA 1NQDA 5BY5A 1SLIA 4OI1A 1J3QA 4AVAA 2P34A 3RMXA 1KXGA 1VAKA 4FPCA 2EVXA 1UAIA 1W6MA 3WQ7A 3MPPG 4AFDA 2WA4A 1O4YA 2JICA 3ZXFA 1ASJ1 1A78A 2VUJA 2BBVA 4M0NA 3W58A 4XJ8A 5DUXA 4YM3A 3D8CA 1W39A 2XBO2 1UKGA 1VBA3 1PZ8A 1MEC3 4DINB 3S7EA 4X8PA 2D6KA 4YFWA 4ISQA 5GLTA 4O9EA 1NYWA 5I0SA 1NY72 1V00A 4J1WA 2XJRA 4AVTA 2UURA 2UY9A 2DYCA 1SQ4A 1ZZ9A 1O7FA 2R49A 2OYZA 5KXEA 2XVGA 4FO9A 4COVA 2D5FA 4DY5A 3POWA 4KH9A 5CFDA 1OMIA 4LUMA 4LBLA 4BQ1A 4I30A 2EXJA 3U0ZA 1RL3A 5JIUA 4Q26A 4PDWB 2ATFA 1BQPA 2BTVC 5D8AA 1CX4A 4ZU7A 3WV6A 4HN0A 2VVEA 1DZQA 1VBE1 3FLTA 1W2UA 2MNGA 3SH4A 2WJSA 4Q4V2 1YJKA 1L3JA 4HL0A 5D1IA 3ZFFA 1RINA 3H1MA 1GANA 1NLRA 1TMF3 4RS5A 3AKSA 4HK8A 3ILRA 2FMYA 3TN91 1RMU3 3MZHA 1NXMA 2DV9A 2PHLA 4R8HA 1QY4A 5ABJC 4YVWB 1VIWB 2BNOA 1H2KA 2W08A 3D82A 4JV4A 3E5QA 4EWDA 3VHNA 1S0BA 4XXPA 4MXWB 1O3TA 1CN1A 2HWC2 4YM0A 3BTAA 3KB5A 2KXLA 1SCRA 5DZEA 4E4ZA 4EN8B 4HFSA 1UMZA 2R073 5IK7A 4RHV2 4YW4A 2QUOA 1NCQB 1O4ZA 1ULGA 3MW4A 3CNAA 2WNVB 4LHKA 1W6PB 1SFYA 1WW4A 4FXGB 4TWTA 1COV1 5K7PA 1GQGA 1H1MA 4Z07A 3KT1A 2VMHA 1CD3G 1DYKA 3AMHA 5LK7B 1KJLA 3KZ4C 5SV8A 5LRSA 3NV3A 1IKPA 5BXXA 1RUH1 3VKNA 1MR5A 4B29A 1YIPA 2HEYF 2K2SA 3PMEA 3ZSJA 2R042 5I0UA 5A3MA 1ND2C 4K40A 3B01A 3GBGA 1HV0A 1QJZA 1ZZBA 3B3QE 1LJ7A 1S0EA 2PYTA 3UJOA 3UL2A 4INDA 3FBYA 2A73B 4QMAA 4LBJA 2WT0A 4IERA 1RVF3 4K1ZA 3USSA 4OI2A 2P3JA 1B35A 5JIAA 1CQ9A 3ASIA 2CY6A 5A3LA 4Z2WA 3H3UA 3NAPC 3AFGA 3WD5A 5AC93 4DB5A 4BH9A 2CWSA 3CJIC 2IFRA 4HSLA 1QJY2 3WVJA 3UKNA 4LTAA 1VBA2 4TSVA 3AP5A 4GB32 2UYBA 1PGL1 5GZCA 5IK4A 1UU6A 1XU1A 5EWSA 3FX3A 2ZGNA 5JDBA 4EWAA 4AEDC 4XILA 4XYXA 4MV2A 2VVDA 2RMU3 2TNFA 3ZYGA 5ACA3 1MACA 1YHFA 2QQPA 3ENRA 1N3PA 3R05A 4XF0A 2E51A 1PK6A 4XE9A 1V6KA 5BNPB 4K9SA 3I54A 2W52A 2BW8A 4FPJA 3RYRA 4PDWC 4LO8A 4PJYA 1OD5A 4RA0A 1QKQA 2XWBB 2XGXA 3M1HA 4Q4W3 4QPIC 1AHSA 2MEV1 1CAVB 4OI4A 2BPA2 4XJWA 1DQ6A 1W6OB 3JUUA 5GLZA 4C0HA 1AZDA 2VNOA 4MZUA 1V9U2 4QQHA 2H0BA 1SACA 4HK9A 5FPZA 1LESA 3ROUA 1RUF3 1Y9QA 1VBD3 4YVWC 2R061 1DLLA 2HWF3 4GULA 4Y1VA 3SXWA 1T6GC 3V56A 3Q9OA 1DQ5A 2FZ2A 1C5IA 2ZAAA 4IQPA 4AI0A 2VUAA 1REFA 1TME3 4E2GA 1ENXA 4XXAA 1I1EA 3UV9A 2Y0IA 3SCHA 1U12A 1NCQC 3VBSB 2XJUA 1RTVA 3RI9A 4AI1A 5LEJA 2WNVC 3CLPA 4YGBA 2PAMA 3GZTB 1ZBA3 2WSVA 1FOD1 4AHZA 1Y3TA 1RUD2 3FC0A 4AFBA 4LE3A 1EPWA 3FUQA 4QHBA 3AP9A 1PIV1 2ZPXA 2P2KA 4BMBA 4D3WA 4HN1A 2YPJA 1PGW2 1NA1B 2DF7A 4NPRA 4LE4A 1C3HA 1JYIA 1AXKA 5T5LA 4AEJA 2LM3A 3DF0A 2ZHMA 1MQTB 2RS52 2HWE2 5I8TA 2JG9C 3R4DB 1MZ5A 5BNPA 4GH4B 1URXA 1RIRA 2ZGMA 2ENRA 3WLUA 3OJBA 5JOZA 4OFGA 2C0ZA 1CESA 2JX9A 3JQWA 2Z42A 1EPZA 3J26N 4MSVA 4FTSA 1CJDA 1HXS2 2RS33 2XJQA 4KWJA 2B8MA 2CNAA 5BYNA 1O4TA 2WFPA 5T50A 4XIKA 3RQ0A 2E63A 1RUI1 3OYWB 4YW2A 3IDCB 1VBC2 4BHPA 4XFBA 4YVSC 4HKOA 5JOWA 3JD71 4V1PA 2D6NA 1NQJA 2OVUA 5JSRA 2E7AA 2B39A 1AR71 1SEFA 2QE3A 5FO8B 2RM21 3TBDA 5C9AA 1G7YA 1DQ2A 2E6VA 4DPNA 3C2UA 2BEOA 3E5XA 2OUHA 3VV1A 3M7AA 5F9TA 1AXZA 3PVEA 4FTBA 1JH5A 2A3XA 1H2MA 4ASMB 4C90A 3IPVA 2R32A 4CEWC 3WG4A 5CA6A 4XW3A 3LB9A 4K21A 1LGNA 3WQ0A 1NCRC 3JBG1 5JZGC 1AYM1 1AR82 2C9AA 5HCBA 3IDBB 4HT1T 1DZRA 2DTWA 1XYPA 1NA1A 4P5HA 1AJKA 4BE3A 3W59A 3SNMA 3MF9A 1DGWX 2YROA 2BUKA 3RPQA 4XMAA 3VDDB 5ACA2 5AFBA 1OPOA 2A6ZA 2RS11 1KS5A 4O9GA 4LEJA 3ZN4A 4FOQA 3SLIA 1YWKA 4LA2A 1Q8PA 1SLTA 3KMHA 3KD4A 2EALA 3SH3A 1QXJA 4YGDA 1J1TA 3PHMA 2VW1A 2XLGA 4D7YA 2CAUA 3AXEA 1QMJA 4FPEA 4B4PA 1EAH2 4OZXA 3AZYA 3OYWA 4NHMA 4Q8KA 1CIWA 2IXLA 4LA3A 1RUF2 2YGLA 4QQPA 2JJ6A 2HWF2 4WM7A 1LOFC 1VBB1 1X82A 1QNWA 4I0WB 2AREA 4YZ4A 4C0BA 3KGZA 2EAAA 5J98B 1I6XA 1VBE3 4Y26A 4CDQA 3AMQA 4YG0A 1LENA 1H2NA 2P17A 5CAZA 2GH2A 3TN93 3L2HA 4A7ZA 4H7MA 3VKMA 2RJKA 2NYYA 3ES4A 4Q0UA 1S2BA 2ZKNA 4CP1A 3R4UA 4QT6A 1ZBE2 2EXIA 2D7FA 1MQTC 1R1A2 3VBHB 1GSLA 2PLV1 4GH4C 3J8F2 2DCTA 2Z79A 5HI0A 4BLJA 2XB6C 3QOPA 4AQTA 1NXD1 4QM8A 1W0PA 1VR3A 5T52A 4CYDA 5JAXA 5JOXA 1QH7A 1QDCA 4BPZA 4FPHA 1YCIA 3N3HA 3ZFGA 4COUA 4BIFA 1VB2A 1COV3 2DVFA 3TNQA 2MPFA 2X29A 4CP0A 4EN6B 3VGIA 3FJSA 2D98A 5DZGA 1H4GA 2WNUA 3VZJA 4LBQD 2HKXA 3VBRC 1RUJ2 1W6NA 2UYAA 2CGNA 1RUH3 3RSJA 1G6NA 4ISRA 4YG6A 1AR61 1IGOA 2GDFA 3EXUA 1TEIA 3LA7A 4I3PA 1ND3B 3ZX7A 2SBAA 2VOXA 5DUUA 5BUVA 5JPNB 1ZRCA 3H9AA 1XXNA 5IT6A 1TE1B 1WLCA 4OUSA 4R9DA 1JN2P 4QPGC 3H1WA 1XYOA 3ZFEA 4B7KA 3ZXKA 3OBTA 1HQWA 4OUMA 5FQ0B 1MZ6A 1DGRN 1EY2A 4XJZA 4L97A 4HPKB 3E6DA 1AYN2 1QHDA 4I0AA 4RSUA 5J96B 3H0OA 5DDJ1 3A0NA 3FLRA 4B3NA 4CEYB 4LO4B 5L73A 2XUMA 3VBHA 5TSWA 2PHWA 3VDDC 4LBQB 1E57A 3NV4A 4JGZC 4ES9A 1FMD2 2W39A 4WBBA 3I4IA 3VZLA 2PHDA 1H0BA 3MIHA 3LAGA 2D97A 2NLRA 4R52A 4F8AA 2GN3A 1U5ZA 1JXNA 1QQP1 4AW7A 1RUC2 3H50A 4YFZA 1AX0A 3VHOA 3VL9A 5LEKA 1ULFA 4CRQA 1PO22 1QOSA 3I59A 4WVMB 4S2DA 4Y22A 4YG3A 2ZX3A 1C8NA 3WW1A 2DCKA 2VNRA 2R1DA 3LWCA 1QJX2 4FBFA 4RQPB 3JU9A 1QWRA 5F6LB 2IZWA 4M3CB 5BNOA 2A71A 2MEV3 3FWEA 5K0UA 4AWDA 1OHFA 2A6VA 5A33A 2DCYA 1DQ0A 1N1VA 4AE2A 5GKAC 3PVNA 4AK3A 2F6BA 1XQNA 5L36A 2BWAA 2ZGKA 1VBE2 2NPIA 2WNEA 3AZXA 1GR3A 1HRV1 5FQ0A 2R063 1RGSA 3USUA 1UL9A 2D43A 5E1RA 1LR5A 2ZMLA 4HPKA 3QLQA 1JHNA 4WVWA 2VU9A 1CVNA 1XRUA 1W6MB 3N7KA 1S0FA 4XOGA 4LBQA 3ILNA 4Q0QA 3TOJA 1WLDA 2YUEA 1A8MA 3P3NA 5C4WB 4AGVA 4DMIA 2E7QA 1LOGA 4AVVA 2QCSB 1ENQA 3IWZA 3N7LA 1HRI1 2DUOA 2IXIA 5SV5A 4DXZA 2Y38A 2PFWA 3NW4A 3ACLA 2BWCA 1KDMA 3DPRA 1PIV3 1WCSA 1X36A 3O5SA 5JSPA 1ONAA 1KD7A 4JQRA 4HKWA 3JZVA 1UF2C 1X8MA 1F5JA 1MZEA 3WW3A 5KXDA 3LCPA 1ND3C 4L9BA 2B7YA 2XL9A 4M3CA 1PGSA 4EN0A 5E8AA 3WDXA 2VOVA 3S6PA 1D4M2 3GHNA 3MDPA 3I2DA 2VW2A 1LEMA 2AUYA 5KWRA 1LTEA 3OY8A 4OHWA 3UJQA 4CDUC 2PHXA 1OOPA 1ENRA 1RUI3 2RR11 4AVCA 2WFF2 1C8M1 3ZFFB 2BNMA 2ZBJA 4CEYC 2QJVA 4TLFA 3RYKA 3AZWA 4PQ9A 1Y7BA 3NV2A 4RS5B 4LLFA 3JD73 5F6KA 2XL7A 4NWVA 1EV11 4DQAA 1AR73 1F5FA 4HETA 2RM23 3J9SA 3U10A 3AYCA 4FOYA 5JLVA 4IETA 3ZXGA 4Y1UA 4L2NA 3VBFA 3CF6E 1XNBA 1HIXA 4IV3B 5H9PA 2XKPA 5C4WA 5J36A 3FFZA 2XLFA 4ZU5A 1BXHA 5L19A 2ZAHA 1SLAA 3JBG3 1BKZA 4KBBA 1PGL2 3PVBB 3JQXA 3H3ZA 5CFCB 1GICA 2WINB 3HBZA 3M4FA 3HAGA 1VALA 4HVQA 5FMOL 1O91A 2MHFA 4RR3A 4CDXA 3WP4A 2GMMA 1UU4A 3D6EA 1G9AA 4P9YA 2IXKA 5CB7A 1IZ3A 3RWNA 2RS13 1RHI2 3GNEA 3ELNA 1V6LA 5KXBA 5GZFA 2YYOA 1I5ZA 4COYA 3VKFC 4LR4A 1GKBA 4COWA 5BV6A 1H8TA 1PO11 4JGYC 4BOWA 2MEV2 2A5ZA 1QF3A 1V6MA 4R9AA 3P3PA 2YHJA 1A6CA 3MYXA 4CTEA 1LOEA 2GNMA 3BOWA 5KHKA 2ZA9A 4HZFA 4IESA 1WCDJ 1H9PA 4SBVA 4M0HA 2R062 2HWD2 3SCGA 1B35B 3PMSA 3MEPA 1VBB3 4H3WA 4KU7A 4BMEA 4LBOA 2GU9A 1CAWA 1X33A 4N90A 4DNYA 1K5MB 4AHXA 4PLOA 1OA3A 5KXCA 4XMIA 4COZA 3K51A 3B69A 3WDWA 4KG0A 4IV3A 4Q4Y2 3U4XA 1GZ9A 2OIIA 4W65A 1DZTA 4BIOA 1NLSA 1XNDA 4YGCA 1PVC2 4XFGA 1RUE1 4L92A 2G9GA 4MGIE 1PNGA 5CFCA 4A7KA 2FHRA 1LHUA 1Z7S1 1N3QA 5AVAA 4Y1ZA 2LUWA 3VZNA 2D44A 2IXCA 2NN8A 2PLV3 3AYEA 5EV7A 5T5OA 4E2SA 1DDLA 1G9BA 5CFDC 4YYOA 3U07A 4H7LA 4N9HA 3CL1A 2AZ5A 4P9JA 4WV8A 1U5IA 2WZR2 1OA4A 2PA7A 2JECA 2NMNA 4WM8B 2YXSA 3CJIA 1QJU2 1PK6B 4KWKA 3H7YA 1FPN1 3OD0A 4S2HA 2A3YA 2EA7A 5T5PA 2EIGA 5D8AC 2TBVA 4CDWB 2PTMA 4META 3KSCA 1U5XA 4MH0E 3I7DA 5AVPA 4HBNA 4EJRA 1QDOA 3WCSA 1AR92 2X8KA 1XNCA 1AR63 3E6CC 4HLTA 3WDVA 2ZGPA 1JW6A 1RUI2 3AKPA 1IQAA 1BEV2 5J48A 5FOJB 3IT8A 2GMPA 2WT1A 3ZPYA 1YLLA 4XFAA 1DQ4A 1K5MA 3CJXA 4AYUA 1SLCA 4FT8A 4RD7A 4A7YA 4FSJA 4Q1RA 1AR72 3JB4C 2CWMA 3KS7A 4D7SA 1RUOA 5GZDA 4XPVA 1Q43A 4DOUA 3M3CA 4K3UA 3DUIA 5E16A 1J1LA 3N36A 5I0RA 2WSUA 1SBDA 2PAEA 3NJZA 1SBFA 1MEC2 1AXYA 3FBMA 3WCRA 2K9ZA 1YYNA 2O8QA 3MPBA 3VKLA 1Z78A 3ZXDA 1M06G 4PIZA 1ENSA 4E27A 5FTTC 3M2MA 4BM8A 4JAAA 4N43A 2XBO1 4GALA 4WM8A 1OQ1A 4MVTA 1KJRA 4A3XA 3D5OA 2D6MA 1J59A 3IN9A 5EFUA 1FT9A 4NHLA 1QQP3 4FPYA 3OCPA 3WP6A 4CDWA 2I2SA 2I45A 3TYJA 1QNYA 4G3YC 2E9QA 5GALA 1D2SA 4R4ZA 3A4UA 1ULEA 4TZDA 4JTOA 4KGQA 4QQOA 3EQEA 4XIOA 4MUVA 4LBKA 3SITA 2ZGTA 2JD4A 4NN0A 2GC1A 5FLJA 3H1YA 2X5IA 3G7DA 3AKTA 2JG9A 1TMF2 5DUWA 2D6OX 2WL1A 3M3OA 3TWIA 4EWEA 3AZVA 1RMU2 1ALYA 1C1FA 2JKBA 3B9IA 4L11A 2YY1A 1NZCA 1NOVA 4YGEA 4GMP1 1GV9A 1HRV3 3ZSMA 5C9AB 2GC3A 2SLIA 4YW5A 4Q4V1 1XYNA 3X29B 3D4KA 1R081 4U2AA 4X6QB 5C8CB 3ZXLA 3PJYA 3OGJA 2A7AA 2R072 4P9GA 3INAA 3IPVB 2HWB1 1ULCA 4KNCA 1UPIA 1WBFA 1TQ5A 4IEYA 2AYHA 1FAYA 4N53B 2XJTA 3RRDA 4YVSA 1FXZA 4IL7A 1RUG1 2EF6A 2ZMKA 4KU8A 4ZU4A 4OHZA 1LKNA 1WLWA 4JC1A 1AL0G 3KCCA 1PK6C 2HWC1 4JDMA 3VN4A 5KHGA 1HRI3 1OKQA 2EAKA 2W0XA 4MYEA 4RHV1 4PBOA 2HYKA 3S7IA 3VBOB 1UW8A 5C6CA 3ES1A 1NCRA 4YW3A 1VJ2A 4K7JA 1CAXB 3C3VA 4Q2FA 4QPYA 5DUVA 1R1ZA 4QU2A 1RB8G 4LBMA 4P9WA 2WLQA 1RVF2 2GSYA 2PHUA 2DCZA 1IKQA 4E9KA 5KHIA 2QZ2A 1RJ7A 1X50A 2R041 2XKOA 3AX4A 3E6BA 4QGMA 4WM7B 3TNPB 4EN7B 1LU1A 1ZX5A 1C5HA 4C91A 3GHMA 4XETA 2RR13 4E4SA 4IEVA 4CDQB 1MS1A 1C8M3 1YJLA 5AC92 1POV0 3GALA 5T3NA 5JMCA 5C8CA 2ET7A 1O3RA 1G9CA 2ZKLA 3EO6A 1DBNA 1EV13 5KC5A 3V64A 2ZGRA 1ASJ3 1Q5OA 1SBEA 2GMEA 4S2GA 4N53A 1F8VA 1LHNA 3MIFA 4Y1XA 5J3UA 3AKQA 5FDBA 2Y26A 2VQ0A 3NWKA 5BNQA 4LHNA 1J3RA 5BNPC 2YMZA 1D2QA 1SDWA 2RMU2 4Q4X1 1MS0A 1QJY1 3NKTA 4NWWA 4XTMA 3RJ2X 3VBUB 1U0AA 3AP4A 3DL3A 2JG8B 1VBA1 1FV3A 2DCJA 2V5YA 4GB31 1ZZ6A 4N7IA 1CR7A 1TNRA 1OQDA 1WD3A 3MI8A 4FP3A 4Q1PA 3VBOA 4P9LA 1S0DA 4X8NA 5K8SA 3GYDA 3WG3A 3ZFGB 1IHMA 4Q4W2 4ITCA 1CAXA 1VB4A 4DY3A 2DVBA 2WNUB 3R4SA 1W6NB 3MGUA 1POV1 5C33A 1RJ8A 1KDKA 5BNNB 1PO13 1VBD2 2ZHNA 2ZGOA 4JCKA 1YO8A 2VG9A 4PBPA 4ASLA 4PCRA 5C9AC 4IEOA 3B02A 2F4PA 3ZN6B 4Y4YA 5T54A 3VBSC 5BPXA 4E2QA 1CAUB 5J37A 4XHBA 1V9U1 3KM5A 3ZFEB 1TME2 4GQ7A 4K1YA 1XE8A 2FQPA 4IEUA 4X6RB 5KBFA 3EHKA 3M70A 3LGRA 5JI9A 4IV1B 3AK0A 1ZBA2 2G4IA 2Q1ZB 4Q29A 4AHYA 1NA1C 1DIWA 4KQ7A 2R30A 5A32A 3MFAA 1WGPA 3B93A 1RUE3 2WQZC 4FPLA 3LA3A 1YFYA 1D4VB 3CEWA 4QPGA 5GLVA 3MIEA 3VBUA 1AX1A 1SMVA 2JG8A 2JENA 1HRI2 2RHPA 3MF6A 1Z7S3 4HVOA 3WW2A 3RS6A 1S0JA 4FPFA 2O8OA 1Q3EA 1M4WA 1RUD1 3AFKA 3IDEA 4YM1A 1W0OA 5AFEA 2VMIA 3BPZA 1WLTA 3I59B 1PGW1 3MLJA 4XFIA 1Q8SA 4Y22B 4GA9A 3AMNA 2RS32 3QD6A 2XPJA 2DU1A 2RS51 3R0RA 2HWE1 1FPN3 2QVSB 2IWGB 1LU2A 4WM7C 5BNNA 2ZX0A 3FHIB 4MGZE 1BMV1 5BNOB 3HR9A 2Z69A 1AL21 5K0UB 4CDQC 5A33B 5GZGA 2TEPA 3ZN6A 4OLLA 3HT1A 4MX3A 3S0MA 1CAUA 4ATFA 4XF1A 1AF9A 1HXS1 4KL1A 2R16A 3VZKA 1LOCA 5L7OB 3EJKA 1F31A 2OW4A 2D3PA 1C8M2 4I02A 3OF1A 3KT4A 3USUB 2OA2A 3IIAA 3A0KA 4D7TA 3LOIA 4ATEA 4WVZA 3IM0A 1VBC1 4IV1A 4P9IA 2CV6A 5FO7B 1BVP1 2NQYA 1ASJ2 3WDTA 1QGLA 3GZAA 4FPKA 2C5DA 4URTA 1SLLA 1JBCA 3NL1A 3ZXJA 5E88A 1LGCA 4B8EA 4BYYA 4QXKA 3HD8B 4K8FA 1B09A 1QOTA 2ZHLA 1DYPA 1QOOA 4QGNA 4YNIA 3ZFGC 3FFQA 3V0BB 1VAMA 4XF9A 1HW5A 3LSDA 3B00A 3QH7A 1N3OA 3DPRB 2H6BA 1AR81 1RUNA 1WCKA 2WNUC 1LHVA 2YC0A 3WOGA 4IEXA 5EJ3A 2WS91 1N47A 3NVCA 2UWAA 3PVOA 3ZVXA 3AJYA 4B4QA 5ACA1 4EROA 1LB2A 2ARXA 3ZXAC 3LA2A 3FMGA 1GNZA 1S0IA 3PJQA 3KCXA 1C1LA 4HANA 2YGMA 2BVBA 2R6QA 1C4RA 3AP6A 1F9KA 1OSGA 3OY8B 1S55A 5H9QA 2CGPA 5L7OA 3QACA 5K9YA 4FXKB 1OOPB 1SFNA 2DVAA 4NOTA 1UN1A 1YNAA 4EN9B 5JWPA 1EAH1 2JEMA 4YSFA 4S2FA 3TN92 1ZVFA 1ZM1A 2C1FA 3VBHC 2WT2A 3LKJA 1PZ7A 3IKWA 3VZOA 1WMEA 3AMPA