4AFMA

Structural and biochemical characterization of a novel carbohydrate binding module of endoglucanase cel5a from eubacterium cellulosolvens.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
127
structure length
127
Chain Sequence
GDIVLFSGSKHVEFTDWGGTDWPSAYELQPPYQTMPFDLNKNFEIKVDYSGADIVLIFARWEHGSKPQIWAQISPYYVVDGTAVFTKEQIAKAYGSDDFSDLDYIGVKPLPSADGMTVTKIVASYTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Understanding How Non-Catalytic Carbohydrate Binding Modules Can Display Specificity for Xyloglucan.
pubmed doi rcsb
source organism Eubacterium cellulosolvens
molecule tags Hydrolase
molecule keywords ENDOGLUCANASE CEL5A
total genus 24
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18259 CBM65_1 Carbohydrate binding module 65 domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1070 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4afmA00
5AFEA 4AEMA 4BA6A 4AFDA 4AFMA 2YPJA 4AEKA
chains in the Genus database with same CATH superfamily
2E7AA 4LE4A 4BE3A 1LODA 1ZVFA 4D6RA 3HOBA 1R081 1PX4A 3VB9A 2OZ6A 5AFEA 2IXKA 3R4SA 4HZFA 4AVBA 2TEPA 1HRV3 2A7AA 3KT7A 5FZKA 4TLGA 1FPN3 2WS93 4XF3A 5BUVA 4UI9L 1ULOA 5KC5A 1VBE1 1V6LA 4UW4A 3ZKYA 3KVBA 4X8PA 1DZRA 3RGBA 1EAH1 3PJYA 5FZLA 4AK3A 2X5IB 3PHMA 4BLIA 1DLCA 1HQLA 1MR5A 3CJIC 3THPA 2HKXA 2FDIA 4W6XA 4TTGA 2BRTA 5E89A 5APAA 3KM5A 3N7MA 4AEDC 1XU2A 3ZXLA 2YGMA 2VTFA 4IE7A 3DPRB 1QGLA 3BOPA 2JDPA 2WQ4A 2YMZA 4JGYC 3ZX7A 3H1WA 4M01A 3WW3A 1XB9A 2OQ6A 4A42A 2RS52 5F8PA 3D3AA 4RQPC 4R9BA 3SEEA 2D7FA 3IWZA 3NNGA 2CWSA 5L9RA 1CPMA 4LITA 3RYPA 4HKLA 1RUH3 4ASKA 4D6QA 1SEFA 3CKHA 1GICA 4XJ9A 2ZHLA 4LO6B 4FFHA 4RFT0 1XNAA 2XUEA 3OPZA 3RJRA 3S57A 1EUTA 1NG0A 1HXS3 1GOFA 1AJOA 3H42B 3DXUA 5EJ1B 2XJRA 3ZM8A 5GLZA 5A6QA 4COUA 4XXPA 3SH4A 2QJVA 2HWB3 1BBT2 3MO4A 2ADEA 3H8OA 1GZ9A 4K40A 3UV9A 1I9RA 4S2GA 2G9GA 3EO6A 3IAQA 4OHXA 5CFCC 2RHPA 2VOTA 2ZA9A 1Z7S1 2L9LA 4M3CB 4YW7A 4YM3A 3HQUA 3PMSA 1CJPA 1UO9A 2CL2A 4Q4W3 1Q8VA 1W9WA 1ULDA 3GZEA 2Y0IA 5D8AB 3POSA 1GNHA 1R64A 1W05A 2E32A 2VG9A 4FFFA 4LBLA 1XE0A 5AVAA 4A2UA 1R082 1CVNA 4LR4A 4AGGA 1ZRFA 1LULA 2B45X 2XJPA 2RM22 4CDQC 1VRH2 2GN3A 2YU2A 5BYNA 5JAXA 2FDKA 1RUI2 1RUG3 4LA2A 2AEZA 1J84A 4E2QA 2D5HA 1HIXA 3THDA 4BU2A 4JDOA 3VBRC 2VO5A 4JHTA 1OA3A 3ZSLA 1GSLA 3CJXA 5T55A 1RHI1 4IUGA 4IV3B 1XOYA 3P6BA 3KMHA 5FQ0B 4QQPA 1W6OA 4YW1A 3ES4A 1GOGA 2ORZA 2VZOA 4NO4A 4XABA 2W9XA 5F39A 4GWNA 3AVRA 1PVC1 4OHWA 1RUG2 5FBJA 1O8PA 1SDWA 4B4QA 3WUDA 4XBLA 1Q8PA 1TME3 1REEA 5BV6A 2DV9A 4HKWA 1W9SA 3DKWA 5FMBA 2ZGQA 4S2DA 3AYDA 5BNOC 1NCRA 3A0KA 2QNKA 2VOXA 4YG0A 1JU4A 1NCRB 4GH4C 4Q0PA 5FP3A 3UGFA 1QQP3 2B39A 5A80A 2P3YA 3ZYIB 4DB5A 3RZJA 4JVAA 1AYN2 2E6VA 1S0EA 4CDWA 4DFSA 2W87A 3J7LA 4IGOA 1SG3A 4CE8A 1Q8QA 2CAVA 1S0IA 5G04L 2JJ6A 4DUWA 4K8FA 4QX7A 3FHQA 2W68A 3BVCA 2R061 3E1F1 4ZS3A 4CEYC 3BTZA 3GM8A 3VHNA 1TG7A 5JSRA 3BIWE 1COV3 4RR3A 5FZ6A 4V2VA 1VAMA 3WNKA 4GB32 1RUJ2 4ARXA 2BEOA 2W47A 3GHNA 2CGNA 4L2NA 3LOBA 5BNQA 3FLPA 1V9U3 4WZCA 5AC92 3LEKA 4IEOA 4IGQA 5T5JA 4A44A 3CO2A 3WX5A 1BHGA 1QNYA 5FLHA 3GJBA 2OUHA 1T6GC 1VRH1 2ZMNA 2Q0AA 3MIGA 5FO9B 1JZ7A 2WFF2 2JIGA 4JGZC 5FREA 2R6QA 2I74A 4AEKA 4CDXA 4QPGB 2J1VA 2DTWA 3LF7A 3I49A 1H6XA 4IV1C 2P6CA 4MX3A 1XNBA 1QDOA 2YPJA 1VBC2 3FLRA 3J7HA 2HWF2 2OUJA 2R042 1CAVA 3VD5A 4AEMA 4AW7A 1SBEA 1GMMA 4XUNA 2BFUL 2X05A 1RUE3 3VBOA 1NKGA 1JZ8A 5ABJC 4FPEA 2HWE1 3I2FA 3SMHA 2W94A 4G4FA 4BPZA 2JD4A 4RR3C 4XF0A 4XTMA 2Y6JA 1QIQA 4BCUA 4D7YA 2QQPA 1DYPA 4GAZA 2BV4A 2QZ2A 2JEMA 1SPPB 5IW0A 3ZFEA 4QDSA 5LASA 1JZ4A 4GKXA 5IK5A 4G3YC 5DDJ2 4A41A 2VECA 5A7SA 5FXZA 1DU3D 1YXWA 3B02A 1W0NA 3POGA 1VBB3 3CEWA 1AR72 4ZZ8A 3ZFGB 1VBD3 4ZXKA 1UMHA 3UESA 1VMHA 1APNA 1C4RA 1UPSA 4Z82A 5FZFA 1UU6A 3TEXA 3ZXAC 2BPA2 1DCSA 4V1PA 3WOGA 5EIYB 3WHTA 2BWAA 2JWPA 4JDNA 2KXLA 2QBXA 1ND2A 1NE6A 1CZSA 1MS8A 3VHOA 5JMOA 1XBFA 4CUBA 3ZN4A 3RDIA 3LOIA 3T3YA 3H8UA 2YFZA 3O0WA 2GSYA 5LB6A 2X09A 1JHNA 1S0FA 1BK1A 1LOCA 2CAUA 2Y38A 4INDA 4N9HA 4QB1A 2VXRA 4MGKE 4CSWA 3O1RA 4OUMA 2QFEA 5FPXA 4A6SA 1CAUB 1RUH1 4FOQA 1JOJA 5FY1A 2OIIA 3ZFGA 4YRDA 1ENRA 1NQJA 2Y8KA 4Y26A 3WCSA 5K0UC 2Z2SB 4CRQA 2VCCA 4GKYA 5FMCA 5DG1A 4GB33 3D4KA 3POEA 3B5LB 1QH6A 4MOAA 5FPZA 1H9WA 4GD4A 1QOSA 2D3PA 2JG9B 4YVSB 1PGL2 5C3RA 1OKOA 3QD6A 2ZX2A 2JE9A 2HWD1 1V6MA 1RUD2 3VBSA 1YFWA 2GNMA 3IB3A 2D98A 5C8CB 2WN3A 4G9SB 2ZX1A 2GC2A 1HRV2 1QNWA 1W90A 2VD7A 3CJIA 3OGJA 4PBOA 1SFPA 2WS92 2OYZA 1AR63 4B4RA 5FK8A 4BXSV 5LATA 3ZSEA 4XUQA 4LHSA 1ND2C 2ZJCA 4RYDA 1MEC3 5F6KA 5EZWA 1OOPA 3E5UA 1CAVB 3JBG3 3LAGA 2FDGA 4TYSA 4P9JA 4XFGA 4MGSA 3FHIB 5JR7B 1UY1A 4GMP0 1UYYA 3SITA 2R32A 5GLUA 4P9WA 1BMV1 4LK7A 3ZPYA 2UY8A 1AXKA 5D21A 1OLQA 3BKZA 1F35A 4LLOA 1T6BX 2Y6FA 2ZMKA 5C9AC 2O1QA 4IGPA 5FYHA 3PUIA 2DCZA 1XXNA 2ES3A 1YI7A 1ZREA 1DG6A 2JB8A 1JODA 3MLKA 4QPYA 4MO3M 4XXAA 3U14A 3WSOA 4XUOA 2DDUA 2PHTA 3A22A 5JLVA 4MUVA 1VB4A 3LWCA 2W39A 3T08A 1LEMA 4EWDA 2YPDA 3ACLA 2YYOA 3ZFFC 4BDVB 5A6ZA 1PM7A 1FOD3 1VBB2 4GWIA 3VKLA 3KQRA 1FV3A 2AC1A 1YFXA 2VVFA 4O65A 4XJZA 3VBHA 5LK5A 2ARCA 1GKBA 4K1YA 1RMU1 2Q8CA 4AF9A 4DZGA 3U11A 3ZYFA 1HB2A 1X33A 4Q4Y2 4N7IA 4YM1A 4DIQA 1W0PA 3PIJA 2DUPA 3OOXA 1NX9A 5C9AB 4FPJA 2G19A 4XHBA 5GKAC 5CVRA 4XZUG 1QXJA 1NY71 4AXOA 4NHKA 5DABA 2WNVA 3Q8AA 3I3BA 2WNOA 1HV0A 1LR5A 3LEIA 5GZDA 3OCPA 3RG0A 2JECA 5L7OA 5LEKA 3K51A 2G1MA 1ULGA 3FFQA 3GALA 1NXD1 3W9AA 4DEQA 2IZWA 1UYXA 1QY4A 4IXLA 1W6OB 2JE8A 4BWOA 3KHBA 5LCWL 1WCKA 3M3CA 1IPJA 4EN8B 1YO8A 1VBA3 2GC1A 3ZXKA 4YZ2A 5K0UB 4U2AA 1XSRA 5E8AA 1HLCA 1JYNA 4HXCA 5FP4A 4NR1A 2ERFA 3KWVA 2UURA 1OQ1A 3MW2A 3WF4A 2RR13 3ASIA 1O4YA 2OX0A 4IQPA 4NIIA 4KGQA 4ZHNA 3MICA 1IPSA 2UWCA 4YGCA 4CDWC 1GP6A 4AQ6A 1WCSA 4XCBA 3H3UA 1S0CA 1J3RA 2ZGOA 4BK4A 3VBUA 1RIRA 4AVTA 4QQLA 2KD7A 5KHKA 3MV11 2QQUA 2EIEA 3WHUA 5F5CA 3ZSJA 2BYVE 5IYYA 3G7DA 4Q26A 1SBDA 3GYDA 5C4WB 4B4PA 3V0AA 2BNMA 2E53A 1W3VA 5KXEA 5KXDA 5KHHA 3F95A 1CJDA 3ALQA 3KZ4C 1UOFA 2RM21 2RDRA 4W8JA 1H4HA 4OUEA 4XJAA 2OXBA 1QJZA 3AP6A 3CHXA 1ASJ2 4EQVA 3RQ0A 1QF3A 4FCAA 2IXCA 3WVJA 1QJY2 2DVGA 3WF1A 3NV4A 3UNPA 1LENA 2X53S 1UZ0A 4HT1T 3IAPA 3OEBA 1ZBE3 4Y5SA 1C1FA 2PAKA 3E6DA 4IEPA 4IE0A 4CPBA 2ZHKA 3LEGA 4AFMA 2Y6GA 4GWJA 2HH9A 5DXDA 3B9IA 4CU6A 1DYKA 1MVQA 4N90A 1RJ7A 2OW4A 3HNYM 1UZZA 2R49A 4BH9A 3SLIA 4DY5A 2LM3A 1JYIA 4D7TA 3V56A 2ZOEB 5CYYA 2C6SA 3C7EA 4HVRA 1C28A 4NHXA 3UKTA 5LBBA 3VZLA 3CQOA 3PUQA 1UMIA 5FP7A 2VH9A 4LIUA 3KGZA 4LK6A 5D1IA 2ZTNA 1PVC3 4COYA 5C71A 5IVCA 1OA4A 2UYBA 2WLPA 1VBE3 3J7NA 3I3EA 3FE5A 4XEZA 4QM9A 4WM7C 1OLME 4YPJA 1HN1A 3EMRA 2X10A 5IUQA 4NRPA 1SHWB 5FDBA 1ZNPA 4Q5OA 1X36A 4RN5A 5K4LA 3N35A 4CTEA 1CIYA 4HPKA 2VR4A 1HQWA 2I07B 4J1XA 2NP0A 2FDJA 2XHKA 2GZWA 3C8XA 4M4PA 4NAMA 3PVEA 1U5ZA 4QWNA 1BK0A 3CLPA 5AC91 5C5TA 3LGRA 1Z78A 1AX0A 5CKMA 2V4AA 5FZOA 2FQPA 4QAWA 5GZFA 3SKVA 1O59A 4DINB 1TEIA 3USSA 4IESA 3B9CA 2HWE3 2IVJA 4IE4A 2IVIB 3FWEA 3O1PA 2W3JA 3D82A 5FY7A 2Y6KA 4ORFA 1V6IA 2HWB1 3NAPB 3EB7A 3WEZA 1W9FA 1STMA 4CP2A 3H3LA 2VTXJ 1W8WA 3N3HA 4D7SA 3B94A 2C9KA 1V6JA 4Q4Y3 1S0BA 1WLCA 2GP5A 3GGLA 1POV0 1S0JA 2C0ZA 1NCQA 1PX3A 4MXWA 1KDMA 2F4PA 3PTYA 1HXS2 2WABA 4QD2A 5IAVA 1AX1A 2EXHA 3TN92 3GBGA 5KHJA 1B09A 5B2GB 3U10A 4OQ8A 2MHFA 1C5IA 4YZ4A 5EXOA 3D0JA 3M4FA 3K48A 4AZZA 5BNPC 4Y3OA 3MUY1 3N7JA 1Y9QA 2ZGTA 1I6XA 4XFBA 5GLTA 5IT6A 4XDOA 1D0GA 4UOJA 2IXHA 5G05L 5D8AC 4PHZA 5GZCA 5JSOA 1V9U2 2A6YA 1W06A 3MF6A 4W6WA 5CKQA 1RHI3 3AP5A 5DAXA 4R8HA 3UETA 2K2SA 1EAH3 1RJ8A 4XFAA 1R083 4R4XA 3LFMA 3E5QA 5FTTC 4C90A 1NOVA 1OF4A 2WFF3 2WNEA 1S2KA 1HV1A 1G7YA 3GXUA 3IDAA 4N43C 1PMHX 3S7EA 2QCSB 5GLWA 1HB3A 1XU1A 3PJQA 4NE9A 5FZDA 1LOFA 2YROA 4ASMB 1KITA 4FPHA 1DP0A 3OYWA 4CYDA 5CEHA 5HV0A 3HAGA 4RSUA 4ASLA 4XFIA 1JYTA 4HOOA 3LE0A 4LUKA 1DZQA 5CKNA 1YQ2A 3KD4A 5FWEA 2HWD3 4ISRA 5A70A 3J4UH 1LGCA 4LUMA 4KWUA 1JBCA 2VOVA 3AJZA 4JX0A 3BI3A 1XYNA 1NCRC 2XJTA 1RUD3 3PLQA 1QOOA 5A7OA 1J58A 4R52A 4RGKA 4JGYB 1A8MA 5C3OA 2VZRA 2EAKA 4LORA 4PQ9A 2X29A 4X6QB 4CP1A 5KHIA 4HVOA 1QH7A 3ZN6B 2FCUA 3BN6A 3K4DA 4LT5A 3NWKA 1NT0A 4AVCA 3SCHA 2XVKA 2OT7A 4YARA 5FJHA 3IIAA 4QGMA 2O0OA 3HQRA 4C1XA 4F83A 5DUWA 4JCKA 4NOTA 4XOGA 1ZBA2 2WN2A 3KCYA 4IEQA 1F5FA 2WT2A 1NZIA 2EXJA 1GWKA 4ZY9A 1S2EA 1LOFC 3SISA 4QXKA 4AI2A 4EN0A 5DAVA 2KA3A 2DU0A 1UD1A 4YW3A 4XUPA 3VDDC 2FDHA 5FLIA 4M3CA 3PUHA 2V09A 1TMF3 4CDQB 2R7EB 1MS1A 1XJAA 1MQTA 4AQTA 2FCVA 2QDRA 4OZXA 5IK8A 3B00A 3Q8EA 1SFNA 3LPGA 3TNQA 3GDBA 2QTWB 1ZZ6A 1VE0A 3OTFA 2ZZJA 1VBA2 2VGDA 4QU1A 2DCKA 3VDDB 3IBMA 3AFGA 1LU1A 2V5YA 3OG2A 4AVVA 5HPOA 5J7MA 5GLVA 4ES8A 1YYNA 1FMD3 1ND3B 4TSVA 1UY4A 4LBOA 1PK6C 1WMDA 3A4UA 2F17A 3M3EA 4J25A 4LO5B 2IXIA 2ZX3A 4TN7A 5ACA3 1ZZBA 2BGCA 4L99A 1RVF2 1OMIA 3O12A 1DBNA 1JU3A 3WDUA 1OURA 4FP2A 1RITA 1K5JA 4K6BA 2P37A 2RDNA 2JE7A 3D6EA 3I97A 4LJHA 1BCXA 5L36A 1RMU2 2LS6A 3KV5A 2GMEA 3I3DA 2V73A 4YW4A 3T2TA 2CNAA 4Q0QA 2B46X 1GR3A 3B01A 1W0OA 3EYPA 4XE9A 4W65A 3SH5A 4K20A 2BVVA 3AB0A 3LSEA 4E2GA 4DUVA 1SLAA 2X5IA 3NL1A 4PQQA 4Q4V1 4META 4B1LA 1F9KA 3AMPA 3BGAA 3JD72 4LQRA 4BYYA 1JYXA 1RUC1 2HJIA 4QX1A 2YHJA 3V0BA 5KXBA 3CF6E 1VMJA 1SMVA 2CV6A 4IL7A 1ENSA 3W59A 2EIDA 3HNMA 4LPLA 1PVC2 2NQYA 2QQOA 2MEV2 4P5HA 1TE1B 1J83A 2HLEA 4NHLA 2JKBA 4PBPA 2RJKA 4QXBA 3VBFA 2WNUA 5ERLA 3WNXA 4AFCA 1WD4A 4UXAA 1UY0A 3GF6A 4NROA 5IK4A 3C7HA 4N43B 3VBRA 2A70A 5H9RA 1W6QB 3OBZA 5FZ3A 1VBC1 1W6QA 2R063 3JD73 4OYUA 5FLJA 4UW3A 4FSJA 4LKEA 3OPWA 2GDFA 4AAPA 5B4NA 3VBFB 1VR3A 1ONAA 2E31A 1O6UA 2PHFA 1HN0A 5JXHA 4QB2A 4CXWA 1Z7S3 1YQ6A 1YEWA 5JZGC 4ITCA 3VBSB 4HANA 4DXTA 1V9U1 1W2OA 1VBA1 4R9AA 3M3IA 1LOAA 1UQXA 1P8JA 1KEXA 1HRI2 2JKXA 2PHWA 3FBMA 1RGSA 3QBQA 3V65A 3VHRA 4P5YA 4COWA 5ABJB 2EALA 5FUIA 5A7QA 4C1WA 1YQ5A 2JB4A 4FFIA 1D2SA 1WUVA 4XDPA 5DUUA 1F4HA 5CFCA 4PF5A 2EA7A 1XE7A 2A6ZA 3VBSC 1ZM1A 3BODA 1RVF1 3D5OA 4XF4A 4LBNA 3JBG1 4OMDA 1CONA 1ZBE1 2NN8A 2XBO1 3VBFC 3WNLA 1LOEA 2BOJA 1L7LA 4Q0UA 3JUUA 1WW4A 1US3A 1H9PA 4IEZA 2HWC2 5IJRA 1SQ4A 2Q8DA 5A3MA 2WAAA 4S2FA 4HSLA 4YW5A 1HB1A 4RGGA 2ZACA 2YFUA 3J8F2 2WL1A 4N53A 2AR6A 2CGPA 3FX3A 4YZ5A 1WBLA 2BOIA 1TME1 1UYZA 2R041 1FOD1 4FO9A 4X8NA 4MLOA 3FHAA 4SLIA 2GMPA 2WJSA 1DQ0A 4OLLA 1EP0A 1H8TB 1OUSA 2RMU1 3J7MA 1U5IA 3ME2A 5FZMA 1ST8A 4H7MA 1JN2P 2DVAA 3ZXEA 1HJGA 3TOJA 3OEAA 1AXZA 4EROA 5I0TA 5LBFA 4JTOA 5J1XA 5EJZB 2VUDA 3TYJA 3AZZA 3ZN5A 2RS11 2WO7A 4XFHA 1ZRIA 1FNYA 2RR11 1JW6A 3PL0A 4QXCA 3UK9A 1OVSA 3WT3A 5F2WA 1AR71 4OHYA 1MS9A 4DY3A 5FR3A 1WW5A 4XBNA 4Q4W2 3WY6A 2HEVF 1QOTA 3PURA 4E9KA 1AVBA 2VNRA 3ZFEC 4P9YA 1EUUA 1UOJA 2EAAA 2RS51 1YQCA 1MS5A 1YC61 5A33B 5A7PA 4QPGA 2RDQA 5FRAA 1W2TA 2PQSA 1KGYA 2BGOA 1W8TA 1K5MC 3ZSKA 1JZ5A 4N43A 1AL23 3VBRB 3MIDA 2NLRA 5C3PA 2MPFA 2VCBA 5JVVA 2XBO2 3WW1A 2BDRA 1W8UA 4KG8A 1MEC1 1YRZA 1V70A 2Y6LA 4LBKA 2JG8C 2Q4SA 2ZHMA 1S1AA 1ZZCA 3OYWB 2ATFA 1F15A 3O14A 4R9CA 3LDBA 4BQXA 1UKGA 2RDSA 2XJVA 4ARYA 1WLDA 2FCTA 5CFDC 2DURA 4Q0SA 4RS5C 1DF0A 1YCIA 5GZGA 1UN1A 4AI9A 4QPIA 2D40A 3POFA 5F5QA 4Q4V2 3N9QA 1ZRCA 1TME2 5CZKA 5DQ0A 3USUA 4YM2A 1ULPA 2VBBA 3AKPA 2FMYA 2J7MA 3C7OA 4TWTA 2H0BA 3W58A 5T3NA 4NRMA 2RS31 2PN5A 2XHNA 4JKMA 4QU2A 4Q4X2 1OI6A 2RMU2 1HX6A 3LB9A 3NJVA 4KWJA 4LEJA 4S2HA 2WAOA 1VAVA 2XPJA 2WFPA 2ZS6B 1JUIA 4IW3A 1US2A 3RS6A 2VMHA 4PI2A 4A7KA 4ATEA 2VNVA 2Q5TA 2D6PA 5JOXA 2WR9A 3RYRA 3ZR5A 2G9FA 2ZGRA 5ANNA 2W92A 3S5QA 2Y6HA 4KI5M 4PJYA 1QQP1 3HBZA 3S30A 4P00B 4BB3A 1UF2C 1ZZ8A 2D6NA 2ZEYA 1ZBA3 4HKOA 5F3GA 4URTA 1A3KA 3EBRA 3V0AB 1W28A 4Q27A 2RE9A 2HBUA 1BQPA 2WZR2 1KDKA 3I2KA 1S55A 1N1VA 3DECA 4I02A 3AMNA 4CDUC 1EYBA 3IDEA 2P2KA 3IM0A 1JOBA 3FZ3A 3IPVA 2TUNA 3OBTA 1ALYA 3VZJA 5T54A 4BZ4A 4CP0A 5LA1A 3RZGA 5DMYA 4DEVA 3KSCA 5C6CA 3K75B 1LHUA 1O4TA 1PK6A 4W50A 4QDQA 3VKOA 1N3OA 2AEYA 1NLSA 1ZBE2 2XLGA 3NKTA 3WQ7A 2PA7A 1H4GA 5BNPB 3I59B 2B42B 3OUHA 4YNIA 2IWGB 2P34A 1IGOA 1DIWA 4AVAA 1UZWA 4ZU5A 5JOWA 4FAGA 2JX9A 4JQTA 1LRHA 2B4KA 3IPVB 4KQ7A 4D69A 1AYM3 1A34A 2PLV3 3DKQA 3O1VA 3HN3A 4XTPA 1BYHA 4WM7A 4XACA 3VBHC 2J42A 1FOD2 3R4DB 1CWPA 4H55A 1MZ5A 3LA7A 1KXGA 3OBRA 4I3GA 2D44A 5DZFA 1NLRA 4YYOA 5CB7A 3BPZA 2Q8EA 4AOCA 4IEYA 5L73A 2P5BA 1OQDA 4J6GA 2OS2A 4QMAA 2CYFA 3MW3A 1HQNA 1H2NA 2YV8A 2VMDA 1PGW1 3ST7A 5FO8B 3GJAA 3LIHA 4CEYA 2WNVC 1YJLA 2JDNA 4YW6A 3E6CC 3T0DA 4UBGA 3NJXA 4FQ4A 3A0NA 5E1RA 5A3OA 3DPRA 1QJEA 1V6OA 4Y33A 4BQ2A 2J1SA 1AR83 4CUGA 2D93A 2DFBA 3U75A 4RL7A 3BPSA 2WQZC 3JCIA 2YDEA 2IUWA 2UWBA 1WLTA 2V4VA 3ILFA 3IMNA 3WDXA 1RC6A 2QQVA 3RZHA 3ORJA 1AR61 1CN1A 1M4WA 1GZWB 3SC7X 2O8QA 2WZR1 2K9ZA 1DQ4A 4E27A 1H8VA 3J26N 3T0AA 4D0QA 2XB6C 5A1AA 4QX3A 2J1EA 3LDKA 4UBHA 3I2OA 4PLNA 1ACCA 4OQ9A 2W2IA 1AX2A 1GYKA 1WA4A 1ND3A 1OD3A 1RMU3 1U0AA 3AC0A 5KHGA 2HYKA 3MFCA 4X6RB 3KB5A 3KCCA 4AFAA 2WZPP 1NA1C 3HR9A 2DCJA 2VQUA 4OHVA 4BIFA 4C91A 5C8CC 1R091 3KV6A 2JDUA 5FXVA 1X8EA 3PMEA 2QQJA 3WDTA 1X9PA 1YQ8A 1WW7A 2WO1A 5GALA 4PDWB 3ZVXA 3VBOC 1XRUA 2WSVA 4CCOA 4YG6A 3MLLA 4WM7B 1PNFA 2QQWA 1ODMA 3FUQA 4Q8LA 5E88A 2VOWA 5H9SA 5FQ0A 4MYEA 2DUQA 2Z4FA 3KLSA 4H7LA 2CTVA 5F1RA 1QJY1 2WWUA 2P1BA 4YWAA 2EXIA 5IVJA 5K9YA 4XF1A 2B9UA 2W52A 5FY0A 3JD71 4AEDA 3EJKA 4CEWC 3HEIA 3ZXGA 1QJFA 3MFAA 3PVOA 2LRPA 1WMEA 1NA1B 2O14A 3I59A 1RUNA 1OC1A 2ILMA 1RUH2 1CX1A 2ZGLA 3PUSA 4QPWA 1EPZA 4WM8C 3LEMA 2SLIA 5FUPA 1PIV2 2WDBA 4EN6B 3I8TA 2BZDA 4LBJA 2E9QA 4CUCA 1XNDA 3I2GA 5IVEA 2KM2A 3S5AA 2PHXA 2YBPA 2W1SA 5T50A 4K21A 1H2KA 1WCUA 2WSUA 4CCJA 5ISLA 3PNAA 1JHJA 3WQ0A 1AHSA 1RUD1 3OGSA 4HL0A 1R1A3 4IE6A 4PDWA 3B93A 4XMIA 5EWSA 3FMGA 3O1OA 4JKKA 3AL6A 1UKRA 2VAUA 3AZVA 3ES1A 4QKDA 5ANQA 4AFDA 1W6NB 3AX4A 4LULA 3N9NA 3RZKA 1IQAA 3MPPG 3QCWA 2QE3A 1UPIA 3TN91 4AGVA 5FAXA 4CU9A 1MS0A 2Q1FA 2VU9A 3MGUA 4N53B 2A71A 3KT4A 4GULA 4YM0A 4EZ4A 2Z69A 3I2DA 1BMV2 3UGHA 4XIKA 2FMDA 5A7WB 1BEV1 5CADA 1GZWA 2XGXA 3PUAA 4FOYA 1NUKA 2HYXA 2WZR3 1UY3A 4I0AA 1K5MA 2P4EA 3MF9A 5JMCA 5LK7B 3WXPA 4DXZA 5F3IA 5LY1A 3F2ZA 1JI6A 4M00A 4MADA 1EV13 4Z2WA 2JXAA 1UAIA 1SLCA 4AHZA 4C0HA 3MYXA 3NNMA 4GZ9A 5TSWA 1PO12 5IFPA 4YVWB 5IK7A 5IVFA 1I1EA 1AL0G 3T1LA 4MSVA 2ZKNA 1RUF3 5FJKA 3WF3A 1C8M2 1VIWB 2J1TA 1GQPA 3Q8CA 3O1UA 3OY8B 3MEPA 2GNBA 4MXWB 1W8HA 1OSGA 2XH6A 1W04A 1O4ZA 1AZDA 2VMIA 3OGVA 4FI9A 2ZXQA 3AL5A 5I8YA 1V0AA 1OLMA 2RM23 1G9AA 2D97A 3O1MA 1X50A 1Y7BA 1D7PM 1QJY3 3PU3A 3DCQA 2AUYA 4AAXA 5IFTA 1CZTA 3VD3A 1SZBA 4TXWA 3WINE 3MIBA 1GWMA 2VCMA 4XURA 3RI9A 1XNTA 5EV7A 1UX7A 3M7AA 4YVWC 5FY5A 3ZDSA 4ONUA 3U4SA 2VZSA 3OUJA 2A3WA 1CD3G 2PHDA 1UX6A 4ISQA 2TNFA 4UFLA 4BQ4A 3I54A 4P9GA 3EQEA 3ETPA 5DPNA 3LPFA 2DTYA 2BBVA 1W3XA 5I0DA 4JHZA 1RB8G 2I45A 3WUCA 1O3RA 1UU4A 1K42A 5K8SA 5JI9A 4I3PA 5FBZA 2JIJA 1IKPA 1LEDA 1H2LA 2V5DA 4MH0E 2YY1A 3GHMA 3FUOA 4RHV1 5C5UA 3VHPA 1O3QA 4CZSA 3RMYA 1QXRA 2XJQA 3H7YA 4O7XA 4BLJA 2ARBA 1A78A 2FHRA 4EJRA 3LDRA 4NPRA 2WBKA 1N3PA 3AM2A 4IDZA 3AJYA 3TBDA 4NN0A 4UFHA 3P3PA 4Z1VA 1J59A 2W1WA 2FZ1A 4XQWA 3WV6A 4NMIA 4CVUA 4YW2A 3H50A 2A1XA 2DF7A 4AGRA 3HT2A 3P1IA 2IC1A 5FZ4A 2W5FA 5FKCA 2FBEA 3NO8A 4NIAA 1O3TA 1CAWA 1SLBA 1C8M1 3RPQA 3IMMA 2ZX4A 5BY5A 3VL8A 2E33A 1RVF3 3MW4A 2OKXA 2VY0A 4CU8A 5BPXA 5HV4A 4GIQA 3R05A 4MV2A 4AEJA 3A23A 1K5MB 3HN1A 4LHNA 4DO0A 4EN7B 2VJXA 3OD4A 1PZ8A 3LSDA 5FYCA 1FATA 1LECA 1E5SA 2CU5A 5T52A 2H0VA 2D6KA 2E7TA 2Z42A 1OD5A 1PIV1 5A32B 1SACA 5FXXA 1L3JA 3J9SA 1PGL1 2E26A 5CFCB 5H9QA 5EFUA 2ZEWA 1R1ZA 3OUIA 2R043 3WP3A 4P02B 2EF6A 5ABJA 2K46A 1PO23 1UNBA 1DLLA 1HRV1 3BU7A 1S0GA 5FYMA 5L9BA 1B35B 2B8MA 4Y20A 3VBOB 1G9BA 2BNOA 4QQOA 4F3JA 4ZPIA 2D3SA 2IXJA 3BCWA 4WVVA 3O0VA 3AYEA 4MG2A 3APBA 1LGBA 2WWJA 1LCLA 1L7RA 3T09A 2RS53 1QJX1 2WIIB 3VN4A 3U4XA 2YC4A 3CIHA 4JGYA 2BGPA 4DRVA 3ZXFA 1H8TC 1AJKA 5D2AA 4UW6A 3GZAA 2H6BA 5DDJ1 2VBDA 2ARXA 3AKTA 4RQPA 1ODNA 1LOBA 2NMOA 1IS5A 5I93A 3W5NA 4HK8A 1ASJ3 4CCEA 5HBAA 3IIIA 5DG2A 4R4ZA 5EPAA 5F6LB 3W20A 3CJIB 5HCFA 1ZA7A 1PNGA 1E5IA 3D8CA 2ZAAA 1W8OA 2BW8A 3MV01 2AYHA 3ACHA 4L97A 3DYPA 1H1IA 1KS5A 3TAYA 3AP4A 1MACA 4UYBA 3N4MA 3N9MA 3AMQA 4C8DA 4RR3B 1WCQA 5EHDA 1Q43A 1VLNA 5EP9A 4UAPA 2VVDA 1SCRA 2VW2A 2VULA 4E8DA 1N1TA 1Q3EA 2PQQA 4XAEA 1AR92 1W9YA 4ZONA 5SV8A 2R0HA 1V00A 2JDHA 5LA0A 4CXXA 1D4M3 3AP7A 3AVSA 4LHKA 1GP4A 4CDWB 5FZ8A 3CMGA 1TMF1 4NWVA 1RUI1 4LOTA 2MEV1 5FZEA 1IZ3A 3WP4A 5C3QA 3GBWA 2C26A 3U1XA 4NPLA 3RVHA 1IKQA 1O3SA 1E5RA 2ADDA 1VBE2 1UXZA 1UL9A 3KV9A 1NY72 1Q8SA 1FYUA 4MHUA 2PFWA 5JOYA 1IG3A 2R1BA 3CZUA 3C2UA 3VDDA 1FMD1 2VQAA 1X82A 5L19A 1OH4A 1N1SA 3M8LA 4YFZA 4QKFA 5J96B 5FCCA 1W2NA 2PHRA 1SLLA 3OF1A 4CCCA 4CCNA 1AR62 3B3QE 1FX5A 4FAHA 5CBLA 3AKRA 1AF9A 2E51A 5CU1A 3VDBA 4Y4YA 4DPNA 1UYPA 4PF1A 4CEYB 4BOWA 5IATA 4URAA 5FWJA 3X29B 2JDAA 4NIHA 1PO13 2MNGA 1YFYA 3EHKA 5DZEA 1R092 4Y1UA 3QACA 1JOPA 2DCTA 4BA6A 3OPTA 4DMIA 1LAJA 3CNAA 4K9SA 4CPBD 1O5UA 1SCSA 5F37A 5JXGA 4AYUA 1OVPA 4MGQA 5LW9A 1UOGA 4L9BA 2BJSA 3WG1A 1UIJA 5BNOB 3TWIA 3L2YA 2XUMA 4XVHA 2ZGNA 3T0BA 3NV2A 1NE4A 2WZ8A 1RUJ1 2Z79A 1IOAA 4HPKB 4AHXA 2QDNA 3IDCB 1REDA 4XW3A 1LJ7A 2ZGPA 3J8F1 1AYM1 2Q8OA 2IFRA 3GCWA 4A6OA 3MPBA 4HMZA 4LKDA 4Y1YA 4BK5A 5F7UA 3SXWA 5BNOA 1ENQA 2HBTA 2UWAA 4JTNA 4MGYE 2C9AA 3VZOA 3ZLIA 3BTXA 2C24A 3VUOA 4CP9B 2CDOA 4XMAA 4E4ZA 4F7ZA 1HKDA 5IVBA 3WF2A 1TMF2 1QJU2 2J1AA 2WFF1 1PK6B 3OY8A 5FXWA 2XR4A 2CGOA 2LW8A 4XPVA 5FPLA 2JG9A 5EYXA 4JGZA 2WNUC 3VKMA 3NNJA 4Q4V3 4HK9A 3PTRB 4Y1XA 5A7NA 3RZZA 1D4M1 4LBQD 3ELNA 2XQRA 2Y64A 1FMD2 2D6MA 3AXEA 3K3OA 5EJ3A 3T4VA 5I0UA 3WCRA 4O9GA 2CSGA 1LB2A 2BUKA 2Y33A 2VBPA 4FPKA 4Q4X3 3RFRA 3B69A 2VW1A 4BM8A 2JG8B 5FOBB 2PLV1 4Q1RA 1M06G 5JZGA 2XWBB 5A3NA 2VZVA 1U5XA 4GMP1 1LOGA 1VP6A 4AI8A 1EY2A 5AVPA 1KS4A 2ZGUA 4CCMA 2ORXA 3RJ2X 4BIOA 2Q30A 4RGAA 4CDXC 1GP5A 4KU8A 4XAAA 3RZMA 1W03A 3AKSA 4FXGB 4CUAA 4OI4A 5K7PA 3IKWA 1AR81 5IHRA 1NLQA 3WF0A 1VJ2A 1YJKA 2UU8A 2H6CA 4FP3A 4E8CA 5L9VA 4JRLA 5C4WA 3PIGA 1MQTB 5A3TA 4PLOA 2VZTA 3AK0A 4I2OA 2QQKA 1H1MA 4OUSA 3ZXJA 2PHUA 3LCPA 3DF0A 4XZPA 2GU9A 1NAEA 3VDAA 1RXGA 3O5SA 4YG3A 4O61A 1W2UA 5A33A 3TEWA 3ZYBA 1O91A 3I2HA 1XE8A 4PIYA 2A75A 3A7QA 3U0ZA 3BTAA 5C3SA 3HD8B 1G9DA 2XONA 5J98B 3NNFA 1L7QA 3FC0A 2YU1A 1MVEA 1GFF2 5E16A 4RD7A 4N53C 1AR91 4JKLA 1OFNA 4LLFA 3ROUA 4BMBA 3IDBB 1XSQA 1PGSA 1XYPA 3AYCA 4LBMA 1QJU1 1CIWA 1UZYA 4DXRA 4CU7A 5JIUA 1MQTC 4NVPA 5C70A 3ITQA 4DXSA 1ASJ1 3NSTA 4B7EA 1ND3C 5C8WA 1AR73 4I09A 1AYN3 1YWKA 1EAH2 2LROA 2P6HA 5LBEA 2WT1A 2ZKLA 4CDXB 4QGLA 1H6YA 4EYUA 3R6SA 1POV3 2RS13 1VMFA 4K7JA 5C33A 3WW4A 3ATGA 2PYTA 2W1UA 4FOWA 1VPHA 1KFUL 2R072 2WS91 3HWJA 2VVEA 2Y26A 5CNAA 5FMDA 4AL9A 3WDVA 4E4HA 5CAZA 2QQNA 2X8KA 3UJOA 3AKQA 3N9PA 3L2HA 4DQAA 1EV12 4CEWB 1U5YA 2YZ4A 4GWMA 3VD7A 5FPUA 2VNOA 3S0MA 3LA2A 4P14A 4B1MA 1Z0HA 1S2BA 4LBQA 3H1YA 4QT6A 3BIEA 2YC2A 3S7IA 4BHPA 3BALA 2GC0A 3K4ZA 1H8TA 2VUAA 1IS4A 2OA2A 2QVSB 3BOWA 1G86A 4MHRA 4PI0A 4BQWA 4FPYA 5FZIA 1G9CA 4RA0A 1D0HA 2RVAA 3SKJE 1N3QA 3WLUA 1K12A 2O8OA 5A3WA 1ZZ7A 3WZ1A 2Q1ZB 1R1A1 3BUCA 5M0TA 3ZPOA 3KS7A 1ZX5A 2P17A 4Q0VA 3EXUA 4DUXA 1MS4A 1S4CA 2J1RA 3NMBA 4J1WA 4RS5A 1AL21 1NCQC 5FZ9A 1PMIA 5I91A 4FPCA 1IG0A 1XNCA 3JQXA 2BWCA 4LIVA 2HWC1 3K2OA 3IZOA 4Q4Y1 1XPWA 4GJYA 5CA6A 1QMJA 1G6NA 3WQBA 5HXMA 1VBD1 4U36A 2ZEXA 4SBVA 3UKNA 4KMQA 4CCKA 2J22A 3GZUC 4D3WA 1J1LA 3JU9A 2ID4A 2VPVA 4LKSA 3PDQA 3RRDA 1DQ2A 1RUF1 2DVFA 3NQHA 1HDKA 4GH4B 4Q29A 3VBUB 4Z92B 4P08A 2W91A 5GZEA 4B8EA 3E5XA 1D4M2 3ABZA 3A21A 2XL9A 2R30A 5FZCA 3LQCA 2ET1A 2R071 2XJSA 3WDWA 2WZEA 3POJA 3ETQA 3ZFFA 4EZHA 1MZ6A 2DYCA 3MIFA 3S6PA 4CP9A 4Z8BA 4DNYA 1OPOA 1C3HA 4FPOB 4KWKA 2YXSA 3BB6A 4HLTA 5JUVA 2GAUA 3ZYHA 4NIGA 1O5LA 3TNPB 1I3HA 2QQMA 3LKJA 4FVVA 3AYAA 5BNNA 3MHZA 2RS12 3KF5A 2IXLA 5A3UA 2GC3A 3WQ1A 1ULEA 4WVWA 5JIAA 5T5LA 1QU0A 5FPAA 4I0BA 4NHYA 2FD8A 1AR82 2B5HA 4UFMA 2QZ3A 2TBVA 4XQ4A 4XQDA 2GH2A 5FZHA 5L7OB 1NXMA 1SLTA 4I30A 4LO8A 2WO3A 4AVSA 1JXNA 3CDZB 2VMFA 2NPIA 1C8NA 1BBT3 1RUE2 3POIA 2EXKA 3DL3A 2NM1A 1CAXB 4OMCA 4UWDA 1MPXA 1RINA 5FYBA 2A6VA 4A4AA 5IAXA 2DFCA 5FP8A 2VCAA 3VBUC 2EICA 3O0XA 1UOBA 5JWPA 3C7FA 4EWEA 3OGGA 2VZ1A 4QXHA 3I2IA 5A3LA 4JRAA 2EIBA 3FBYA 3KF3A 1OBNA 4MZUA 5FOJB 5LWBA 3THTA 5FYYA 1JTZX 1WGPA 3ACGA 1W2AX 3CZJA 1YFUA 2A6XA 2VZQA 3NV3A 1SBFA 3WP5A 2VZ3A 2XKPA 4QX5A 1DGWA 4UW5A 4XF9A 2ZHNA 3POBA 3LZZA 1HRI3 2D43A 2DCYA 4UFKA 4YZ1A 4FTBA 2HWF1 4KU7A 2YC0A 4AG4A 4HFSA 4ATFA 2ENRA 4HVQA 1BKZA 4JZRA 2A3XA 4R9DA 4LOSA 2PELA 3FLTA 2F4LA 2Y0OA 2RS32 1ZRRA 1IHMA 3WNPA 5JOZA 1VB2A 3O1TA 2VNGA 1LGNA 4IEUA 2WUHA 2DVDA 2VM9A 2VQTA 5FY9A 1KJLA 3ZN6A 5LRRA 1MS3A 3DUIA 4MGZE 1PIV3 4CDQA 1F2NA 1GANA 1R093 4M3CF 4QKBA 3FL7A 5BNNB 2GN7A 1UIKA 4M3CE 2XBO3 4HBNA 2LUWA 3KGLA 1EV11 3SCGA 4LTAA 4KBBA 3TB0A 1UWWA 4PDWC 2R073 3ZMOA 5CFDA 5JPNB 2RS33 1BJQA 1OOPB 3J8F3 4Y1ZA 1EPWA 1Q56A 5SV5A 4UF0B 1CGPA 1W8NA 4XBQA 4Y20B 1FPN1 1W8FA 1E57A 1SLIA 1XC6A 1XYOA 1NA1A 1OPMA 5ACA1 5AFBA 3VD4A 2YUEA 4OI1A 3ZIXA 4BXFA 2YBSA 5C8CA 5DAQA 3CBNA 3P3NA 1UZVA 3ACIA 3U07A 4F8AA 1COV1 2VZUA 3E97A 3KVAA 4FQZA 5T5OA 4TZDA 4YGDA 3RNSA 1GV9A 3VV1A 4OI2A 1PO11 2CHHA 2HEYF 3IT8A 3RZLA 4FT8A 3H0OA 5F3CA 4RHV2 1ZZ9A 2RMU3 3ZYJB 2B7YA 2VQ0A 4E4SA 4GALA 1YLLA 3NW4A 1W9TA 1T2XA 3AP9A 4WVZA 4OHZA 3H9AA 2GH8A 5IVVA 1QJX3 1GWLA 4GQ7A 3RYKA 1O7FA 1X9TA 2WINB 3KV4A 1BBT1 4M4RA 4XILA 3ZIWA 1VRH3 4NJ4A 1PM4A 3G6JB 1CX4A 1WMXA 1LNSA 2JDMA 3WG3A 1Q8OA 1WA6X 2WNVB 4W4ZA 2QKDA 1J3QA 5LA9A 5FO7B 2VUJA 2W1QA 1F8VA 3SHRA 1Z7S2 2IFWA 1CAWB 1HJFA 4IETA 4WM8A 1VBD2 3PVBB 5E6HA 4QM8A 1NYWA 5JXJA 2XDVA 5A1FA 5C9AA 1GOHA 3SQOA 4YSFA 4CDUA 2WT0A 1DGWX 4AI1A 1CQ9A 3N9OA 5FUNA 4I0WB 4EWAA 1GZTA 2J1UA 4AI3A 2HEWF 4AQSA 3OSDA 3UKVA 4ZZ5A 2D3RA 1F5JA 4YGEA 4BISA 1DQ1A 4D6SA 3ZYRA 4JAAA 5FYIA 4DS0A 1JYWA 1WD3A 3WNNA 4PCRA 2MEV3 4XJUA 1HXS1 1X8MA 1G9FA 2WO2A 4IV3A 3NAPA 1LESA 3OBAA 5FY8A 4C0BA 5FZ7A 1IS6A 4UFIA 1PGW2 4KL1A 4ZS2A 1W6PB 3N7KA 2XLFA 2XQXA 2A3YA 4OZOA 1OKQA 4I01A 4HETA 3LIGA 3T4HB 2NZ9A 4OVEA 3POYA 3E6BA 3LFIA 4ET7A 5FPBA 1Y43B 1DHKB 3ACFA 3QLQA 2WRAA 1COV2 3FJSA 1RUE1 3UYJA 1A8DA 5FP9A 3SNMA 4KGGA 5FPVA 1PZ9A 2BTVC 4XETA 4W6YA 3GZTB 5C7GA 2WNUB 3T1MA 1JUHA 2A73B 4Q8KA 5FZ1A 1TNRA 4CCDA 1QHDA 3JBG2 4WVMB 5BNPA 4QKNA 4LNVA 5FZOB 2CWMA 2Y60A 3NAPC 1TZOA 3VKFC 4D8MA 3ZXDA 4DOUA 4FPFA 3V0BB 1OT5A 5F9TA 4QDRA 5F3EA 4BQ1A 1RL3A 1WWYA 1GQGA 3W21A 3VD9A 4OI0A 3M70A 4GA9A 4GB31 2DVBA 1YIFA 5J36A 2AREA 3H8RA 1SDDB 1W6PA 4QHZA 5CISA 1O8SA 1RHI2 3GNEA 3ZO0B 2AGSA 3LA3A 3ZFGC 5DUXA 4E2SA 2YB7A 1NQDA 5F2SA 5FY4A 3TRSB 2GNTA 1MZFA 3NKGA 4H3WA 2P3JA 4COVA 2ARAA 3LD8A 1Q5OA 2PAMA 4NWWA 4RS5B 2G4IA 2BU9A 1JZ6A 2GP3A 4BMEA 3ZDVA 2XOMA 2JD9A 4WM8B 1BXHA 4M0NA 3MLJA 4Y4RA 3AZWA 1DDLA 2XLAA 2JG8A 3HT1A 4NAOA 1F4AA 2Y34A 1RXFA 3M3OA 2HWE2 4UFJA 1WCDJ 5LRSA 5J09A 1FPN2 3KT1A 2F6BA 1C8M3 4Q4W1 1CPNA 4XCAA 4ES9A 1FAYA 2DBIA 2JG9C 2OPWA 1B35C 2WQ8A 1VAKA 1W6MA 5EYYA 4QPGC 5FZAA 3VZNA 2W0XA 4Y22B 4Z07A 2ETEA 4N7UA 5A7WA 5KWRA 3IN9A 4JGZB 3HMYA 1WW6A 4QPIB 3DYMA 4A3ZA 2A5ZA 2VMCA 1FV2A 4IEVA 3CL1A 4A7ZA 3KCXA 5DUVA 5FK7A 1BEV2 3U78A 1GZCA 1X7NA 1Y3TA 4XHXA 5HI0A 3NJZA 1AL22 1UW8A 2W08A 3ECQA 5IVYA 2E7QA 2AACA 5HCBA 5JDBA 3I2JA 2N7GA 3AZYA 3TN93 1AUYA 4B7KA 4Y24A 3T2OA 5A1LA 5I0RA 5GM0A 1V6NA 4UF0A 3ZR6A 4NHMA 5LY2A 2AENA 5K0UA 1VRBA 2KR2A 1PZ7A 1MZEA 4FXKB 2QUOA 4N9IA 4QX8A 1GLHA 4GJZA 4H2AA 3GCXA 1W39A 3SEPA 5T5PA 3H1MA 4NUBA 4AQ2A 4QHBA 4CA9A 1H1AA 3NNLA 4A7YA 2UY9A 3K77A 5A3PA 2XG3A 4HG6B 3V64A 4L92A 2ZZQA 4BQ3A 5A6XA 3ILRA 2D6LX 1D4VB 1B35A 1QJU3 2PAEA 4OCTA 4XJWA 4AI0A 1OHFA 3U37A 4QX2A 1KJRA 1UXXX 1ZBA1 4NRQA 2JDKA 2QQLA 4QQHA 1DGLA 4RFRB 1OQEA 1IS3A 5LZ6A 1LTEA 3WDYA 4EN9B 1K45A 3R4UA 2OQ7A 5I0SA 3KQ4B 1OLRA 5KXCA 5IWFA 2HWD2 5DDJ3 5L7OC 5BXXA 3K4AA 5KBFA 2QQIA 3VKNA 3OJBA 1UY2A 2W46A 1N1YA 1W6MB 4LKFA 4KBZA 2VMGA 5FYZA 5J48A 3QOPA 5FZBA 3VBHB 4AWDA 3RWNA 4FOVA 4RHV3 4YZ3A 1H0BA 2PLV2 3JB4C 1YI9A 3GBFA 2D6OX 1POV1 4IV1B 4L8QA 2ZPXA 3RWKX 1A6CA 3AMMA 1LHOA 3QH6A 4KH9A 3N7LA 4A3XA 4OFGA 3VZMA 1UCXA 1XNKA 2R1DA 1W99A 4LXLA 2ZCWA 4FTSA 2BVBA 3DGTA 3DV8A 1ENXA 2I2SA 1H2MA 1HW5A 4B29A 4E4DX 4CXYA 1GUIA 1KQRA 4FPGA 4IV1A 1WBFA 2Q1MA 1F31A 2VUCA 3I3QA 5FYUA 4LA3A 3ZSMA 4PT6A 2VOKA 3VL9A 3BYWA 4IEWA 1CR7A 2A6WA 2HWC3 5FMOL 2WA3A 4JC1A 4WBBA 4WZFA 2ZEZA 1PO22 1C1LA 2GNDA 1UU5A 1WLWA 2R16A 1DQ5A 5F5AA 1J1TA 1LHWA 1OFSA 4L11A 4MGTA 3MIEA 5CG8A 4Y1VA 2AZ5A 5FV3A 2HWB2 4JDMA 1I5ZA 1YUDA 3B7MA 4LE3A 5HXVA 1YHFA 3DN7A 1OXCA 1BVVA 4QQ2A 1JS9A 2WYFA 2YBKA 3ENRA 2BNNA 3ZFFB 2EVXA 4JV4A 1JZ2A 4IERA 3BTYA 4WVMA 2D5FA 4K3UA 2V72A 1BLZA 4RQPB 5FFOC 4YVSA 2P3KA 1JYCA 4OULA 1ZYBA 3URFA 2NMNA 1Y9GA 3JB8A 2VTXA 4MXVA 1YIPA 1LHVA 2VZPA 1DFQA 3CU7A 3AMHA 3HQXA 2WYSA 2ZABA 3JZVA 4PIZA 4XIOA 5GJ6A 4D94A 2PTMA 4BQ5A 1RYYA 3JQWA 5JR2A 5FIXA 2RR12 1UMZA 4Y5TA 2NYYA 5EQUA 1H30A 3WNOA 4AFBA 2XWJB 1RUG1 2ZGMA 2XXZA 1ULCA 4QB6A 1CESA 4BQYA 3POWA 2RJLA 3FFZA 1GNYA 4XFCA 3W5MA 4K8RB 2RV9A 2Z5WA 2RG4A 1QJX2 4BJ0A 4IEXA 4XYXA 1GQHA 5FZ0A 1ND2B 4L0PA 5A32A 1XQNA 2BERA 3NV1A 5DN2A 4Y22A 3TEYA 2VW0A 2AH2A 3I3MA 1AYN1 1PHMA 3M1HA 4FPLA 4P9LA 5DAWA 5HCHA 3AXDA 2EIGA 4QHOA 1VBB1 4KG0A 4KNCA 1CAUA 1Y4WA 2JDYA 3HJRA 3ILNA 4K1ZA 1RUOA 3UL2A 1HB4A 2OZJA 5HCAA 2BFUS 3Q9OA 3WG2A 1KRIA 4YFWA 5JSPA 4YVSC 5FKBA 2R062 5DAPA 3KHCA 1GBGA 2ZBJA 1SFYA 1R1A2 5I8TA 3O7OA 4TLFA 3ON7A 1FNZA 5BNNC 1GU3A 1RUI3 3C7GA 3INAA 3NVCA 3ZFEB 1U12A 3UGGA 1OOPC 4WV8A 1IQDC 1C57A 1CAXA 2DWRA 3ZOIA 4CDUB 1JZ3A 1GNZA 3Q8FA 4CEWA 2WWSA 4YLZA 4IE5A 1BVP1 3VZKA 3N9LA 4LMFA 3L9JT 4QPIC 1QDCA 2P3IA 1S0DA 5KR7A 5JCTA 4Y5Z0 1TVGA 1ZRDA 1V6KA 3OGRA 1W6NA 2JDZA 1N47A 1URXA 3K46A 4Q4X1 3R0RA 5LBCA 2ZMLA 1J3PA 4ZXEA 3RMXA 2RJ2A 1D2QA 3M3QA 2OVUA 1YNAA 1PVXA 1KD7A 1QWRA 2C5DA 3H8XA 3USUB 5AC93 2FDFA 1QXPA 3HNBM 1LHNA 1K3IA 4QGNA 4FBFA 5LEJA 2GALA 5J37A 1SPPA 1WZXA 4KWLA 2YG0A 3PU8A 4PIXA 3TEZA 4AE2A 4XC9A 4AR2A 2XJUA 1REFA 3C3VA 2LTNA 1BZWA 5JI7A 3WNMA 3SCFA 1JYVA 1QQP2 4FFGA 4XJ8A 2ZGSA 2ZX0A 4ZU4A 3HPNA 1POQA 4HSJA 3WG4A 1BEV3 2XMLA 4O9EA 1JH5A 4ZU7A 2X5IC 2HWF3 3VDCA 4GH4A 3MBWA 2VXJA 5C4WC 5CFDB 1AR93 4QX0A 1FI2A 1G8WA 2OPKA 3DEMA 2WC2A 2B9VA 3ZMNA 1WMFA 3VLBB 1RUJ3 2BQPA 3AFKA 3Q8BA 3O1SA 2R0FA 5DZGA 4XUTA 1OF3A 2WA4A 2WLQA 5FYVA 5FMOS 4Q1PA 1RUC3 3D0SA 4PLMA 4XFFA 3ZYGA 1MEC2 2ZAHA 4MVTA 5FYSA 3K3NA 1PMJX 5JPMB 2DU1A 3WW2A 1DGRN 3HBKA 1DGRA 2PMWB 1C5HA 1PO21 4V2WA 4XDQA 4YVWA 5H9PA 2JICA 2C4XA 4Z2AA 5KC6A 1AYM2 2UYAA 2ZGKA 3AZXA 2CDPA 3DYOA 4LHLA 4AHYA 1JMUB 2VE1A 1RTVA 3DXTA 1W8ZA 4HN0A 1RUF2 4FTEA 5FYTA 3H7JA 1RUC2 2YGLA 5JZGB 1AXYA 2C1FA 2WKKA 3RSJA 3UT0A 4NPMA 1QEXA 4AHWA 2VMEA 1LKNA 4YGBA 3WP6A 3MUZ1 2FZ2A 3UJQA 4HONA 5A6YA 1WKYA 1DZTA 4HN1A 4P9XA 4LO4B 4LBQB 5F5IA 3SH3A 2E63A 3PVNA 4CCLA 2XVLA 3HIFA 3T30A 2VC9A 4Q2FA 4ZKTB 3OB8A 1KFXL 2XVGA 5FZGA 5B4XA 1I5PA 3T2QA 3MDPA 1QKQA 3BU0A 1E5HA 4MGIE 4P9IA 3THCA 1ZA4A 4EV0A 5CG9A 2VL4A 5F32A 2PXJA 5LA2A 3NRUA 2PHLA 1NCQB 3NJYA 1TNFA 3MI8A 3OD0A 2GMMA 1FXZA 2CY6A 2XKOA 5D8AA 4GXLA 1OH3A 5I8SA 1VBC3 1HRI1 2BP6A 2K0GA 2JENA 1CZVA 3I4IA 4M0HA 1NZCA 2SBAA 4LO7A 4DRRA 3P5BA 2DBNA 3I7DA 3VGIA 1TQ5A 3FN9A 1IPKA 3WR0A 1Y9MA 3ZYPA 4A45A 2DUOA 4UT5A 3M2MA 4N8MA 5ACA2 1DQ6A 3JXSA 3MZHA 4H14A 3MIHA 4IV3C 1LU2A 3RI8A 2BBAA 3DPRC 5JXIA 3ZKUA 4GMP3 4NIDA 3H3ZA 4AEDB 1OUXA 1OA2A 1FT9A 4COZA 3N36A 3WD5A 2XL7A 2W95A 5J3UA 3HVDA 2G9ZA 2LALA 4JQRA 1DYOA 1ULFA 1VALA 3QH7A 4B3NA 5CIRA 3T2PA 2ET7A 4EE2A
chains in the Genus database with same CATH topology
2E7AA 4LE4A 4BE3A 1LODA 1ZVFA 1R081 2OZ6A 5AFEA 2IXKA 3R4SA 4HZFA 4AVBA 2TEPA 1HRV3 2A7AA 3KT7A 1FPN3 2WS93 4XF3A 5BUVA 5KC5A 1VBE1 1V6LA 4UW4A 4X8PA 1DZRA 1EAH1 3PJYA 4AK3A 2X5IB 3PHMA 4BLIA 1HQLA 1MR5A 3CJIC 3THPA 2HKXA 4W6XA 5E89A 3KM5A 3N7MA 4AEDC 1XU2A 3ZXLA 2YGMA 3DPRB 1QGLA 3BOPA 2WQ4A 2YMZA 4JGYC 3ZX7A 3H1WA 4M01A 3WW3A 2RS52 4RQPC 4R9BA 2D7FA 3IWZA 3RYPA 2CWSA 1CPMA 4HKLA 1RUH3 1SEFA 1GICA 4XJ9A 2ZHLA 4LO6B 4RFT0 3OPZA 3RJRA 1NG0A 1HXS3 1AJOA 2XJRA 5GLZA 4COUA 4XXPA 3SH4A 2QJVA 2HWB3 1BBT2 1GZ9A 4K40A 3UV9A 1I9RA 4S2GA 2G9GA 3EO6A 4OHXA 5CFCC 2RHPA 2ZA9A 1Z7S1 4M3CB 4YM3A 3PMSA 1CJPA 2CL2A 4Q4W3 1Q8VA 1ULDA 5D8AB 2Y0IA 3POSA 1GNHA 4LBLA 2VG9A 5AVAA 4A2UA 1R082 1CVNA 4LR4A 4AGGA 1ZRFA 1LULA 2B45X 2XJPA 2RM22 4CDQC 1VRH2 2GN3A 5BYNA 5JAXA 1RUI2 1RUG3 4LA2A 4E2QA 2D5HA 1HIXA 4JDOA 3VBRC 3ZSLA 1OA3A 1GSLA 3CJXA 5T55A 1RHI1 4IV3B 5FQ0B 3KMHA 4QQPA 1W6OA 4YW1A 3ES4A 4NO4A 4GWNA 1PVC1 4OHWA 1RUG2 1SDWA 4B4QA 3WUDA 4XBLA 1Q8PA 1TME3 1REEA 5BV6A 2DV9A 4HKWA 3DKWA 2ZGQA 4S2DA 3AYDA 5BNOC 1NCRA 3A0KA 2QNKA 2VOXA 4YG0A 1NCRB 4GH4C 4Q0PA 1QQP3 2B39A 3ZYIB 4DB5A 4JVAA 1AYN2 2E6VA 1S0EA 4CDWA 4DFSA 1Q8QA 2CAVA 1S0IA 2JJ6A 4K8FA 2W68A 4CEYC 2R061 3VHNA 5JSRA 3BIWE 1COV3 4RR3A 1VAMA 4GB32 1RUJ2 2BEOA 3GHNA 2CGNA 4L2NA 3LOBA 5BNQA 3FLPA 1V9U3 4WZCA 5AC92 4IEOA 5T5JA 3CO2A 3WX5A 1QNYA 5FLHA 2OUHA 1T6GC 1VRH1 2ZMNA 2Q0AA 3MIGA 5FO9B 2WFF2 4JGZC 5FREA 2R6QA 2I74A 4AEKA 4CDXA 4QPGB 2DTWA 4IV1C 4MX3A 1XNBA 1QDOA 2YPJA 1VBC2 3FLRA 2HWF2 2OUJA 2R042 1CAVA 4AEMA 4AW7A 1SBEA 3VBOA 2BFUL 1RUE3 5ABJC 4FPEA 2HWE1 4BPZA 3SMHA 4G4FA 2JD4A 4RR3C 4XF0A 4XTMA 4BCUA 4D7YA 2QQPA 1DYPA 2QZ2A 3ZFEA 2JEMA 4GKXA 5IK5A 4G3YC 5DDJ2 2VECA 1DU3D 1YXWA 3B02A 1VBB3 3CEWA 1AR72 3ZFGB 1VBD3 4ZXKA 4Z82A 1APNA 1C4RA 1UPSA 2BPA2 3ZXAC 1UU6A 4V1PA 3WOGA 3WHTA 2BWAA 4JDNA 2KXLA 1ND2A 1NE6A 1MS8A 3VHOA 3ZN4A 3RDIA 3LOIA 3H8UA 3O0WA 2GSYA 4N9HA 1JHNA 1S0FA 1BK1A 1LOCA 2CAUA 2Y38A 4INDA 2VXRA 4MGKE 4OUMA 2QFEA 5FPXA 1CAUB 1RUH1 4FOQA 1JOJA 3ZFGA 2OIIA 4YRDA 1ENRA 1NQJA 4Y26A 3WCSA 5K0UC 2Z2SB 4CRQA 4GKYA 5DG1A 4GB33 3D4KA 3B5LB 1QH6A 5FPZA 1H9WA 1QOSA 2D3PA 2JG9B 4YVSB 1PGL2 3QD6A 2ZX2A 2JE9A 2HWD1 1V6MA 1RUD2 3VBSA 1YFWA 2GNMA 5C8CB 2D98A 4G9SB 2ZX1A 2GC2A 1HRV2 1QNWA 4PBOA 3CJIA 2OYZA 3OGJA 2WS92 4B4RA 1AR63 3ZSEA 1ND2C 2ZJCA 1MEC3 5F6KA 5EZWA 1OOPA 3E5UA 1CAVB 3JBG3 3LAGA 4TYSA 4P9JA 4XFGA 3FHIB 5JR7B 4GMP0 3SITA 2R32A 5GLUA 4P9WA 1BMV1 3ZPYA 2UY8A 1AXKA 1OLQA 4LLOA 2ZMKA 5C9AC 2O1QA 2DCZA 1XXNA 2ES3A 1YI7A 1ZREA 1DG6A 3MLKA 4QPYA 4XXAA 5JLVA 2PHTA 4MUVA 1VB4A 3LWCA 2W39A 4EWDA 1LEMA 3ACLA 2YYOA 3ZFFC 1PM7A 1FOD3 1VBB2 3VKLA 3KQRA 1FV3A 1YFXA 2VVFA 4XJZA 3VBHA 5LK5A 1GKBA 4K1YA 1RMU1 4AF9A 4DZGA 3U11A 1X33A 4Q4Y2 4N7IA 4YM1A 1W0PA 2DUPA 5C9AB 4FPJA 4XHBA 5GKAC 5CVRA 1QXJA 1NY71 4AXOA 4NHKA 2WNVA 1HV0A 1LR5A 5GZDA 3OCPA 3RG0A 2JECA 5L7OA 5LEKA 3K51A 1ULGA 3FFQA 3GALA 1NXD1 3W9AA 2IZWA 1QY4A 4IXLA 1W6OB 4BWOA 1WCKA 3M3CA 1IPJA 4EN8B 1YO8A 1VBA3 2GC1A 3ZXKA 4YZ2A 5K0UB 4U2AA 5E8AA 1HLCA 4NR1A 2ERFA 2UURA 1OQ1A 3MW2A 2RR13 3ASIA 1O4YA 4IQPA 4KGQA 3MICA 2UWCA 4YGCA 4CDWC 4AQ6A 1WCSA 3H3UA 1S0CA 1J3RA 2ZGOA 3VBUA 1RIRA 4AVTA 4QQLA 5KHKA 3WHUA 3ZSJA 2BYVE 3G7DA 4Q26A 1SBDA 3GYDA 5C4WB 4B4PA 3V0AA 2BNMA 2E53A 5KXEA 5KXDA 5KHHA 1CJDA 3ALQA 3KZ4C 2RM21 1H4HA 4XJAA 1QJZA 3AP6A 1ASJ2 3RQ0A 1QF3A 4FCAA 2IXCA 3WVJA 1QJY2 2DVGA 3NV4A 1LENA 2X53S 4HT1T 1ZBE3 1C1FA 2PAKA 3E6DA 4IEPA 2ZHKA 4AFMA 5DXDA 3B9IA 1DYKA 1MVQA 4N90A 1RJ7A 2OW4A 1UZZA 2R49A 4BH9A 3SLIA 4DY5A 2LM3A 1JYIA 4D7TA 3V56A 2ZOEB 4HVRA 3UKTA 3VZLA 1C28A 2VH9A 3KGZA 5D1IA 2ZTNA 1PVC3 4COYA 1OA4A 2UYBA 2WLPA 1VBE3 3FE5A 4XEZA 4QM9A 4WM7C 5IUQA 5FDBA 1ZNPA 1X36A 3N35A 4CTEA 4HPKA 1HQWA 2I07B 4J1XA 2NP0A 2XHKA 2GZWA 3PVEA 1U5ZA 3CLPA 5AC91 3LGRA 1Z78A 1AX0A 2FQPA 5GZFA 4DINB 1TEIA 3USSA 4IESA 3B9CA 2HWE3 3FWEA 3D82A 4ORFA 1V6IA 2HWB1 3NAPB 4CP2A 3N3HA 4D7SA 3B94A 1V6JA 4Q4Y3 1S0BA 1WLCA 1POV0 1S0JA 2C0ZA 1NCQA 4MXWA 1KDMA 2F4PA 3PTYA 1HXS2 4QD2A 1AX1A 2EXHA 3TN92 3GBGA 5KHJA 1B09A 5B2GB 3U10A 2MHFA 1C5IA 4YZ4A 5EXOA 3D0JA 3M4FA 3K48A 5BNPC 3N7JA 1Y9QA 2ZGTA 1I6XA 4XFBA 5GLTA 5IT6A 1D0GA 2IXHA 5D8AC 5GZCA 5JSOA 1V9U2 2A6YA 3MF6A 4W6WA 1RHI3 3AP5A 4R8HA 2K2SA 1EAH3 1RJ8A 4XFAA 1R083 4R4XA 4C90A 3E5QA 5FTTC 1NOVA 2WFF3 2WNEA 1S2KA 1HV1A 1G7YA 4N43C 3S7EA 2QCSB 5GLWA 1XU1A 3PJQA 4ASMB 1LOFA 2YROA 1KITA 4FPHA 3OYWA 4CYDA 3HAGA 4RSUA 4ASLA 4XFIA 4LUKA 1DZQA 3KD4A 2HWD3 4ISRA 3J4UH 1LGCA 4LUMA 1JBCA 2VOVA 3AJZA 1XYNA 1NCRC 2XJTA 1RUD3 3PLQA 1QOOA 1J58A 4R52A 4JGYB 1A8MA 4PQ9A 2EAKA 2X29A 4X6QB 4CP1A 4HVOA 1QH7A 3ZN6B 4LT5A 3NWKA 4AVCA 3SCHA 2XVKA 4YARA 3IIAA 4QGMA 2O0OA 4C1XA 4F83A 5DUWA 4JCKA 4NOTA 4XOGA 1ZBA2 3KCYA 4IEQA 1F5FA 2WT2A 2EXJA 1LOFC 3SISA 4QXKA 4AI2A 4EN0A 2KA3A 2DU0A 1UD1A 4YW3A 3VDDC 5FLIA 4M3CA 2V09A 1TMF3 4CDQB 1MS1A 1MQTA 4AQTA 2QDRA 4OZXA 5IK8A 3B00A 1SFNA 3TNQA 3OTFA 1ZZ6A 2ZZJA 1VBA2 2VGDA 2DCKA 3VDDB 3IBMA 3AFGA 1LU1A 2V5YA 4AVVA 5J7MA 5GLVA 4ES8A 1YYNA 1FMD3 1ND3B 4TSVA 4LBOA 1PK6C 1WMDA 3A4UA 3M3EA 4LO5B 2IXIA 2ZX3A 5ACA3 1ZZBA 2BGCA 4L99A 1RVF2 1OMIA 3O12A 1DBNA 3WDUA 4FP2A 1RITA 4K6BA 2P37A 3D6EA 2JE7A 5L36A 1BCXA 1RMU2 2GMEA 2V73A 4YW4A 3T2TA 2CNAA 4Q0QA 2B46X 1GR3A 3B01A 1W0OA 4XE9A 4W65A 3SH5A 4K20A 2BVVA 3AB0A 3LSEA 4E2GA 1SLAA 2X5IA 3NL1A 4Q4V1 4META 1F9KA 3AMPA 3JD72 4BYYA 1RUC1 2HJIA 2YHJA 3V0BA 5KXBA 3CF6E 1SMVA 2CV6A 4IL7A 1ENSA 3W59A 1PVC2 2NQYA 2MEV2 4P5HA 1TE1B 4PBPA 3VBFA 4NHLA 2JKBA 2RJKA 4AFCA 3WNXA 2WNUA 1WD4A 4UXAA 3GF6A 5IK4A 4N43B 3VBRA 2A70A 5H9RA 1W6QB 1VBC1 1W6QA 2R063 3JD73 5FLJA 4UW3A 4FSJA 2GDFA 3VBFB 1VR3A 1ONAA 2PHFA 1Z7S3 5JZGC 4ITCA 3VBSB 4HANA 1V9U1 1VBA1 4R9AA 3M3IA 1LOAA 2PHWA 3VHRA 1HRI2 4COWA 3FBMA 1RGSA 3QBQA 3V65A 5ABJB 2EALA 4C1WA 1D2SA 1WUVA 5DUUA 5CFCA 4PF5A 2EA7A 1XE7A 2A6ZA 3VBSC 1ZM1A 3BODA 1RVF1 3D5OA 4XF4A 4LBNA 3JBG1 1CONA 1ZBE1 2NN8A 2XBO1 3VBFC 1LOEA 4Q0UA 3JUUA 1WW4A 1H9PA 4IEZA 2HWC2 1SQ4A 5A3MA 4S2FA 4HSLA 4YW5A 4RGGA 2ZACA 3J8F2 2WL1A 4N53A 2AR6A 2CGPA 3FX3A 4YZ5A 1WBLA 1TME1 2R041 1FOD1 4FO9A 4X8NA 4MLOA 4SLIA 2GMPA 2WJSA 1DQ0A 4OLLA 1EP0A 1H8TB 2RMU1 1U5IA 3ME2A 4H7MA 1JN2P 2DVAA 3ZXEA 3TOJA 4EROA 1AXZA 5I0TA 4JTOA 3TYJA 3AZZA 3ZN5A 2RS11 4XFHA 1FNYA 2RR11 1JW6A 3UK9A 3WT3A 1AR71 4OHYA 1MS9A 4DY3A 1WW5A 4XBNA 4Q4W2 3WY6A 2HEVF 1QOTA 4E9KA 1AVBA 2VNRA 3ZFEC 4P9YA 2EAAA 2RS51 1MS5A 5A33B 4QPGA 5FRAA 3ZSKA 1K5MC 4N43A 1AL23 3VBRB 3MIDA 2NLRA 2MPFA 5JVVA 2XBO2 3WW1A 4KG8A 1MEC1 1YRZA 1V70A 4LBKA 2JG8C 2Q4SA 2ZHMA 1S1AA 1ZZCA 3OYWB 2ATFA 3O14A 4R9CA 1UKGA 2XJVA 1WLDA 5CFDC 2DURA 4Q0SA 4RS5C 1DF0A 1YCIA 5GZGA 1UN1A 4QPIA 2D40A 1ZRCA 5F5QA 4Q4V2 1TME2 3USUA 4YM2A 3AKPA 2FMYA 4TWTA 2H0BA 3W58A 5T3NA 2RS31 2PN5A 4QU2A 4Q4X2 1OI6A 2RMU2 1HX6A 3LB9A 4KWJA 4S2HA 4LEJA 2XPJA 1VAVA 2WFPA 2ZS6B 1JUIA 3RS6A 2VMHA 4A7KA 2Q5TA 2D6PA 5JOXA 2G9FA 2ZGRA 4PJYA 1QQP1 3HBZA 3S30A 1UF2C 1ZZ8A 2D6NA 1ZBA3 4HKOA 4URTA 1A3KA 3EBRA 3V0AB 4Q27A 2RE9A 1BQPA 2WZR2 1KDKA 1S55A 1N1VA 4I02A 3AMNA 4CDUC 1EYBA 3IDEA 2P2KA 3IM0A 3FZ3A 3IPVA 3OBTA 2TUNA 3VZJA 1ALYA 4BZ4A 5T54A 4CP0A 3KSCA 5C6CA 1LHUA 1O4TA 1PK6A 3VKOA 1N3OA 1NLSA 1ZBE2 2XLGA 3NKTA 3WQ7A 2PA7A 1H4GA 5BNPB 3I59B 2B42B 4YNIA 2IWGB 2P34A 1IGOA 1DIWA 4AVAA 4ZU5A 5JOWA 4FAGA 2JX9A 1LRHA 3IPVB 4KQ7A 4D69A 1AYM3 2PLV3 4XTPA 1BYHA 4WM7A 3VBHC 1FOD2 3R4DB 4H55A 1MZ5A 3LA7A 1KXGA 3OBRA 4I3GA 2D44A 5DZFA 1NLRA 4YYOA 5CB7A 3BPZA 4ATEA 4IEYA 5L73A 1OQDA 4J6GA 4QMAA 2CYFA 3MW3A 1HQNA 1H2NA 2YV8A 1PGW1 3ST7A 5FO8B 4CEYA 2WNVC 1YJLA 3E6CC 4UBGA 4FQ4A 3A0NA 5E1RA 3DPRA 1V6OA 1AR83 2D93A 2DFBA 4RL7A 3JCIA 2WQZC 2YDEA 3IMNA 2UWBA 1WLTA 3ILFA 3WDXA 1RC6A 4BOWA 1AR61 1CN1A 1M4WA 1GZWB 2O8QA 2WZR1 2K9ZA 1DQ4A 4E27A 1H8VA 3J26N 2XB6C 4UBHA 4PLNA 1AX2A 1GYKA 1WA4A 1ND3A 1RMU3 5KHGA 1U0AA 2HYKA 3MFCA 4X6RB 3KB5A 3KCCA 4AFAA 2WZPP 1NA1C 3HR9A 2DCJA 4OHVA 4BIFA 4C91A 5C8CC 1R091 1X8EA 3PMEA 3WDTA 1WW7A 5GALA 4PDWB 3ZVXA 3VBOC 1XRUA 2WSVA 4YG6A 3MLLA 4WM7B 1PNFA 5FQ0A 3FUQA 4Q8LA 5E88A 2VOWA 5H9SA 4MYEA 2DUQA 3KLSA 4H7LA 2CTVA 5F1RA 1QJY1 2EXIA 5K9YA 4XF1A 2B9UA 2W52A 4AEDA 3JD71 3EJKA 4CEWC 3ZXGA 3MFAA 3PVOA 1WMEA 1NA1B 3I59A 1RUNA 2ILMA 1RUH2 2ZGLA 1EPZA 4WM8C 2SLIA 1PIV2 4EN6B 3I8TA 4LBJA 2E9QA 1XNDA 2KM2A 2PHXA 5T50A 4K21A 1H2KA 2WSUA 3PNAA 3WQ0A 1AHSA 1RUD1 4HL0A 1R1A3 4PDWA 4XMIA 3B93A 5EWSA 3FMGA 1UKRA 3AZVA 3ES1A 4AFDA 1W6NB 3AX4A 4LULA 1IQAA 3MPPG 3QCWA 2QE3A 1UPIA 3TN91 4AGVA 5FAXA 1MS0A 2VU9A 3MGUA 4N53B 2A71A 3KT4A 4GULA 4YM0A 2Z69A 3I2DA 1BMV2 4XIKA 2FMDA 1BEV1 5CADA 1GZWA 2XGXA 4FOYA 2WZR3 4I0AA 1K5MA 3MF9A 5JMCA 5LK7B 3WXPA 4DXZA 4M00A 1EV13 4Z2WA 2JXAA 1UAIA 1SLCA 4AHZA 4C0HA 3MYXA 5IK7A 5TSWA 1PO12 4YVWB 1I1EA 1AL0G 3T1LA 4MSVA 2ZKNA 1RUF3 1C8M2 1VIWB 3OY8B 3MEPA 2GNBA 4MXWB 1OSGA 2XH6A 1O4ZA 1AZDA 2VMIA 5I8YA 2RM23 1G9AA 2D97A 1X50A 1Y7BA 1QJY3 2AUYA 3WINE 3MIBA 3RI9A 5EV7A 3M7AA 4YVWC 3ZDSA 4ONUA 2A3WA 1CD3G 2PHDA 1UX6A 4ISQA 2TNFA 3I54A 4P9GA 3EQEA 2DTYA 2BBVA 1RB8G 2I45A 3WUCA 1O3RA 1UU4A 5K8SA 5JI9A 4I3PA 5FBZA 1IKPA 1LEDA 1H2LA 4MH0E 2YY1A 3GHMA 3FUOA 4RHV1 3VHPA 1O3QA 4CZSA 3RMYA 1QXRA 2XJQA 3H7YA 4BLJA 2ARBA 1A78A 2FHRA 4EJRA 4NPRA 1N3PA 3AM2A 3TBDA 3AJYA 4NN0A 3P3PA 4Z1VA 1J59A 2FZ1A 4XQWA 3WV6A 4YW2A 3H50A 2DF7A 4AGRA 3HT2A 2IC1A 2FBEA 3NO8A 1O3TA 1CAWA 1SLBA 1C8M1 3RPQA 2ZX4A 5BY5A 3VL8A 1RVF3 3MW4A 2VY0A 5BPXA 4GIQA 3R05A 4MV2A 4AEJA 1K5MB 3HN1A 4LHNA 4EN7B 3OD4A 1PZ8A 3LSDA 1FATA 1LECA 5T52A 2H0VA 2D6KA 2E7TA 2Z42A 1OD5A 1PIV1 5A32B 1SACA 1PGL1 1L3JA 3J9SA 5CFCB 5H9QA 5EFUA 1R1ZA 2R043 3WP3A 2EF6A 5ABJA 1PO23 1DLLA 1HRV1 3BU7A 1S0GA 1B35B 2B8MA 4Y20A 3VBOB 1G9BA 2BNOA 4QQOA 4F3JA 2D3SA 2IXJA 3BCWA 4WVVA 3O0VA 3AYEA 3APBA 1LGBA 1LCLA 2RS53 1QJX1 2WIIB 3VN4A 3U4XA 4JGYA 4DRVA 3ZXFA 1H8TC 1AJKA 4UW6A 3GZAA 2H6BA 5DDJ1 3AKTA 2ARXA 4RQPA 1LOBA 2NMOA 1IS5A 5I93A 4HK8A 1ASJ3 5HBAA 5DG2A 4R4ZA 5F6LB 3CJIB 5HCFA 1PNGA 3D8CA 2ZAAA 2BW8A 2AYHA 4L97A 1H1IA 1KS5A 3TAYA 3AP4A 1MACA 3N4MA 3AMQA 4RR3B 1Q43A 1VLNA 2VVDA 1SCRA 2VW2A 2VULA 1N1TA 1Q3EA 2PQQA 1AR92 5SV8A 2R0HA 1V00A 1D4M3 3AP7A 4CDWB 4LHKA 1TMF1 4NWVA 1RUI1 2MEV1 3WP4A 1IZ3A 3GBWA 1O3SA 1IKQA 1VBE2 1UL9A 1NY72 1Q8SA 1FYUA 2PFWA 5JOYA 2R1BA 3C2UA 3VDDA 1FMD1 2VQAA 1X82A 5L19A 3M8LA 1N1SA 4YFZA 5J96B 5FCCA 2PHRA 1SLLA 3OF1A 1AR62 3B3QE 1FX5A 4FAHA 5CBLA 3AKRA 1AF9A 2E51A 5CU1A 4Y4YA 4DPNA 4CEYB 3X29B 1PO13 2MNGA 1YFYA 3EHKA 5DZEA 1R092 4Y1UA 3QACA 2DCTA 4BA6A 4DMIA 3CNAA 4K9SA 1O5UA 1SCSA 4AYUA 4L9BA 3WG1A 1UIJA 5BNOB 3TWIA 3L2YA 2XUMA 2ZGNA 3NV2A 1NE4A 1RUJ1 2Z79A 1IOAA 4HPKB 4AHXA 2QDNA 3IDCB 1REDA 4XW3A 1LJ7A 2ZGPA 3J8F1 1AYM1 2Q8OA 2IFRA 5I91A 3MPBA 4HMZA 4Y1YA 3SXWA 5BNOA 1ENQA 2UWAA 4JTNA 4MGYE 2C9AA 3VZOA 3VUOA 4E4ZA 4XMAA 4F7ZA 1HKDA 1TMF2 1QJU2 2WFF1 1PK6B 3OY8A 2CGOA 4XPVA 2JG9A 5EYXA 4JGZA 2WNUC 3VKMA 4Q4V3 4HK9A 4Y1XA 3RZZA 1D4M1 4LBQD 3ELNA 1FMD2 2D6MA 3AXEA 5EJ3A 5I0UA 3WCRA 4O9GA 1LB2A 2BUKA 4FPKA 4Q4X3 3B69A 2VW1A 4BM8A 2JG8B 5FOBB 2PLV1 4Q1RA 1M06G 5JZGA 2XWBB 1U5XA 4GMP1 1LOGA 1VP6A 4AI8A 1EY2A 5AVPA 1KS4A 2ZGUA 3RJ2X 4BIOA 2Q30A 4RGAA 4CDXC 4KU8A 3AKSA 4FXGB 4OI4A 5K7PA 3IKWA 1AR81 1VJ2A 1YJKA 2UU8A 2H6CA 4FP3A 4JRLA 5C4WA 1MQTB 4PLOA 3AK0A 4I2OA 4OUSA 1H1MA 3ZXJA 2PHUA 3LCPA 3DF0A 4XZPA 2GU9A 3O5SA 4YG3A 5A33A 1W2UA 1O91A 4PIYA 1XE8A 2A75A 3U0ZA 3BTAA 3HD8B 1G9DA 5J98B 3FC0A 1MVEA 1GFF2 5E16A 4RD7A 4N53C 1AR91 1OFNA 4LLFA 3ROUA 4BMBA 3IDBB 1XYPA 1PGSA 3AYCA 4LBMA 1QJU1 1CIWA 1UZYA 5JIUA 1MQTC 4NVPA 1ASJ1 3NSTA 4B7EA 1ND3C 5C8WA 1AR73 4I09A 1AYN3 1YWKA 1EAH2 2WT1A 2ZKLA 4CDXB 4QGLA 3R6SA 1POV3 2RS13 4K7JA 5C33A 3WW4A 3ATGA 2PYTA 4FOWA 1KFUL 2R072 2WS91 3HWJA 2VVEA 2Y26A 5CNAA 5CAZA 3WDVA 2X8KA 3UJOA 3AKQA 3L2HA 4DQAA 1EV12 4CEWB 1U5YA 2YZ4A 4GWMA 2VNOA 3S0MA 3LA2A 4P14A 1Z0HA 1S2BA 4LBQA 3H1YA 4QT6A 3S7IA 4BHPA 3BALA 2GC0A 1H8TA 2VUAA 1IS4A 2OA2A 3BOWA 2QVSB 1G86A 4FPYA 1G9CA 4RA0A 1D0HA 1N3QA 3WLUA 2O8OA 1ZZ7A 3WZ1A 2Q1ZB 1R1A1 3KS7A 1ZX5A 2P17A 4Q0VA 3EXUA 1MS4A 4J1WA 4RS5A 1AL21 1NCQC 1PMIA 4FPCA 1XNCA 3JQXA 2BWCA 2HWC1 4Q4Y1 5CA6A 1QMJA 1G6NA 1VBD1 4U36A 4SBVA 3UKNA 4D3WA 3GZUC 1J1LA 3JU9A 2VPVA 3RRDA 1DQ2A 1RUF1 2DVFA 4GH4B 1HDKA 4Q29A 3VBUB 4Z92B 5GZEA 4B8EA 3E5XA 1D4M2 2XL9A 2R30A 2ET1A 2R071 2XJSA 3WDWA 3ZFFA 3ETQA 1MZ6A 2DYCA 3MIFA 3S6PA 4Z8BA 4DNYA 1OPOA 1C3HA 4FPOB 4KWKA 2YXSA 3BB6A 4HLTA 2GAUA 1O5LA 3TNPB 1I3HA 3LKJA 4FVVA 3AYAA 5BNNA 2RS12 2IXLA 2GC3A 3WQ1A 1ULEA 4WVWA 5JIAA 5T5LA 1QU0A 4I0BA 1AR82 2B5HA 2QZ3A 2TBVA 4XQ4A 4XQDA 2GH2A 5L7OB 1NXMA 1SLTA 4I30A 4LO8A 4AVSA 1JXNA 2NPIA 1C8NA 1BBT3 1RUE2 2EXKA 3DL3A 2NM1A 1CAXB 1RINA 2A6VA 2DFCA 3VBUC 3O0XA 5JWPA 4EWEA 3OGGA 5A3LA 4JRAA 3FBYA 4MZUA 5FOJB 3THTA 1JTZX 1WGPA 1YFUA 2A6XA 3NV3A 1SBFA 3WP5A 2XKPA 4QX5A 1DGWA 4UW5A 4XF9A 2ZHNA 3LZZA 1HRI3 2D43A 2DCYA 4YZ1A 4FTBA 2HWF1 4KU7A 2YC0A 4AG4A 4HFSA 4ATFA 2ENRA 4HVQA 1BKZA 2A3XA 4R9DA 2PELA 3FLTA 2Y0OA 2RS32 1ZRRA 1IHMA 5JOZA 1VB2A 2VNGA 1LGNA 4IEUA 2DVDA 3ZN6A 1KJLA 5LRRA 1MS3A 3DUIA 4MGZE 1PIV3 5BNNB 1F2NA 1GANA 1R093 4M3CF 2GN7A 1UIKA 4M3CE 2XBO3 4HBNA 2LUWA 3KGLA 1EV11 3SCGA 4LTAA 4KBBA 3TB0A 4PDWC 2R073 3ZMOA 5CFDA 5JPNB 2RS33 1BJQA 1OOPB 3J8F3 4Y1ZA 1EPWA 1Q56A 5SV5A 1CGPA 4XBQA 4Y20B 1FPN1 1E57A 1SLIA 1XYOA 1NA1A 1OPMA 5ACA1 5AFBA 2YUEA 4OI1A 3ZIXA 5C8CA 3P3NA 4F8AA 3U07A 1COV1 3E97A 5T5OA 4FQZA 4TZDA 4YGDA 3RNSA 1GV9A 3VV1A 4OI2A 1PO11 2HEYF 3IT8A 4FT8A 3H0OA 4RHV2 1ZZ9A 2RMU3 3ZYJB 2B7YA 2VQ0A 4E4SA 4GALA 1YLLA 3NW4A 4WVZA 4OHZA 3AP9A 3RYRA 3H9AA 2GH8A 1QJX3 3RYKA 4GQ7A 1O7FA 2WINB 1BBT1 4XILA 3ZIWA 1VRH3 3G6JB 1CX4A 3WG3A 1Q8OA 2WNVB 2QKDA 1J3QA 5FO7B 2VUJA 1F8VA 3SHRA 1Z7S2 2IFWA 1CAWB 4IETA 4WM8A 1VBD2 3PVBB 4QM8A 1NYWA 5C9AA 4YSFA 4CDUA 2WT0A 1DGWX 4AI1A 1CQ9A 4EWAA 4I0WB 4AI3A 2HEWF 4AQSA 3UKVA 2D3RA 1F5JA 4YGEA 1DQ1A 4DS0A 3ZYRA 4JAAA 1WD3A 4PCRA 2MEV3 4XJUA 1HXS1