4AFMA

Structural and biochemical characterization of a novel carbohydrate binding module of endoglucanase cel5a from eubacterium cellulosolvens.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
127
structure length
127
Chain Sequence
GDIVLFSGSKHVEFTDWGGTDWPSAYELQPPYQTMPFDLNKNFEIKVDYSGADIVLIFARWEHGSKPQIWAQISPYYVVDGTAVFTKEQIAKAYGSDDFSDLDYIGVKPLPSADGMTVTKIVASYTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE CEL5A
publication title Understanding How Non-Catalytic Carbohydrate Binding Modules Can Display Specificity for Xyloglucan.
pubmed doi rcsb
source organism Eubacterium cellulosolvens
molecule tags Hydrolase
total genus 24
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18259 CBM65_1 Carbohydrate binding module 65 domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1070 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4afmA00
4AEMA 4BA6A 5AFEA 2YPJA 4AEKA 4AFDA 4AFMA
chains in the Genus database with same CATH superfamily
3H1YA 4EYUA 3AVRA 2WLQA 3QD6A 4CDWA 2Y60A 4XF1A 2B7YA 4OI0A 5CADA 3K4AA 5KHIA 4K8FA 4D94A 5IK5A 1QOOA 1RHI2 2DWRA 5G05L 4QPYA 4PIXA 2GH2A 4PDWA 3LGRA 2Q8EA 3ASIA 2OZ6A 1MEC3 4IEUA 4WM7B 2E33A 1Q8OA 2XJUA 4FP3A 4PLOA 1ZM1A 4R9CA 5I0DA 3IMMA 3UKTA 4PIZA 4AGGA 2IFRA 4BYYA 3V65A 4E4HA 1UKGA 2RMU2 5GZDA 1VBC3 4FPEA 5CIRA 1PNFA 1SLCA 1PZ9A 1SG3A 4A7KA 1NG0A 4EN0A 3UNPA 2C26A 1O91A 2HWF3 2Y6LA 4LUMA 2RS52 3S7EA 3POGA 4JRLA 5T55A 2WNVB 3LAGA 2XGXA 3C7OA 2F17A 1DCSA 3RVHA 4NHMA 4Q4Y2 3T0DA 2RM22 2BU9A 2BZDA 5LBFA 4XXPA 3DL3A 2GNBA 2A3YA 2YG0A 3F2ZA 3MV01 4HT1T 2VZPA 2YXSA 3S30A 5L7OA 4NRQA 3ZLIA 4FFGA 3GZUC 3DN7A 4AFDA 2RS51 3KS7A 3RG0A 3B9CA 3ZXAC 4AGVA 4XACA 4XF0A 5C4WB 3O0WA 3GHMA 4RGKA 5A6YA 4XQ4A 3VBFA 2HH9A 2WN3A 3O1UA 4XOGA 2RM21 1UPSA 2D5HA 3JXSA 2WINB 1ZA4A 3UYJA 2KM2A 4GWMA 4QPGA 5J98B 3WF4A 3U0ZA 1HN1A 4IW3A 4Q8LA 2VNOA 3NNGA 4Q0VA 2WNUB 3D6EA 3PIGA 1VE0A 2I45A 3ME2A 1AR71 4QKFA 4XYXA 1YC61 2FDJA 1OSGA 2LUWA 4W50A 4LKFA 2GNDA 3WVJA 2XB6C 5A33A 1C3HA 4CRQA 1CAVA 3ZDSA 2ORZA 3MYXA 2Y6GA 2Y6HA 5IFPA 2HYXA 2R0HA 1RUD1 3SQOA 5KXEA 4WVMA 1QJU1 3LEGA 4LITA 3WHTA 1NYWA 5LA1A 2V4VA 4QGLA 4MADA 1QJY3 4NIGA 5F32A 5LA2A 2JDPA 3O1TA 2JG9B 2GALA 3POSA 4C91A 4MHUA 4UW6A 3RMXA 5FFOC 3T2OA 5C70A 4OZXA 5LWBA 2VOKA 3WNNA 5FZ4A 4XFGA 3ZO0B 4NAMA 1C57A 3PVBB 5FZAA 4EZHA 4WM8A 4EROA 3A4UA 4ET7A 3WUDA 4HVQA 4L9BA 4Y4RA 4AI0A 4YW2A 4AFMA 1AF9A 3MW4A 3WP6A 5FXXA 3GJAA 1C1LA 1BQPA 3PU3A 3ZMOA 3ZX7A 4BU2A 2JD9A 4ISQA 3IIIA 1MZ6A 4M4RA 4CDUC 5IAVA 1AX2A 2NYYA 3PL0A 4JGZC 5IVEA 4HXCA 5J7MA 2BBVA 3FBMA 2YBKA 1ZRFA 5AC93 4KBZA 3SEPA 3GF6A 2VUCA 2PXJA 2ZGNA 2XJPA 1XU1A 1U0AA 1D4M3 2E51A 4LBKA 2LTNA 4CDQC 5GJ6A 4I01A 1LJ7A 1X8MA 5EPAA 3MHZA 1RUG2 5FK8A 2Q30A 2YC2A 3NAPC 4XTPA 1Q8VA 4FAHA 1QIQA 5LW9A 3S5AA 2VQTA 1H1IA 1MS8A 4GB32 4OHYA 2E31A 4HL0A 1AR91 1AXZA 3S5QA 4MXWA 4K3UA 2P3JA 3ORJA 3N9OA 1DYOA 4MOAA 2KA3A 2EXHA 2BWCA 4G3YC 1UY2A 3I3EA 2HKXA 4B1MA 4D7YA 1N3PA 2QCSB 1GZ9A 2ZX2A 1RJ7A 1G6NA 3GGLA 3LKJA 1SCRA 4L99A 4UI9L 1LHOA 5T5JA 5HPOA 4A44A 3KHCA 1DGWA 2PHLA 1GZTA 2ZTNA 4S2DA 5F5CA 5FY1A 5BPXA 1STMA 1R083 2DVFA 2RHPA 3OBAA 4FOVA 2LRPA 5KHKA 3G6JB 3E1F1 1C8M3 3C7EA 3LD8A 5A7SA 1OLRA 4FOQA 3ROUA 5JMOA 2OT7A 3H8UA 1QNYA 4DY3A 2W68A 5BNOA 1BZWA 1NX9A 3PVEA 4AHZA 1U12A 1I1EA 1OD3A 4P14A 2GU9A 1SLBA 4PI2A 1XC6A 3VD5A 2HWB1 2DDUA 4P9IA 4Y33A 4BLJA 4COVA 4I2OA 3K3NA 2ZHKA 1OOPA 1PMHX 1SPPB 4ITCA 3VD3A 4Y20B 3IMNA 1AX0A 4YW7A 4CDQB 4MGTA 4GALA 2EXKA 3UV9A 2EAKA 3ZFFC 1JYCA 4LBOA 5IATA 3GHNA 2VTXA 3NAPB 3RYKA 1CAWA 2XG3A 3HBKA 1W6PA 4IV1A 4LTAA 5CKQA 1SBFA 4Y24A 2FDIA 4BXFA 4GIQA 1OA3A 3J7MA 2VBPA 2BNMA 5FKCA 5J48A 4A3ZA 5F1RA 1QNWA 2GMEA 4O61A 2IUWA 1GV9A 2YPJA 3H8RA 4LPLA 1LHVA 2RG4A 4IV3A 5E6HA 3MUY1 1Q8QA 4C1XA 3ZFGC 1CPNA 5FY5A 3DUIA 2JEMA 1MQTA 4FPFA 1VPHA 4XDQA 4PBOA 5FZFA 2G9FA 1ZZCA 5F3IA 5CFCA 4M3CB 4YPJA 2ZGTA 4GMP1 2W0XA 3DPRA 3WQ0A 5JSPA 4ES9A 3CNAA 1V0AA 3ZYRA 4CEWA 4M3CE 2LS6A 1I5ZA 2D6MA 2WABA 5DUWA 2ZX4A 3MIDA 4QM8A 2MNGA 1VBE1 2L9LA 1VMJA 3PUIA 3P3NA 1G9BA 1ND3C 2OPKA 1WLTA 4JQTA 3ZN4A 1PVC2 2RS33 2XKPA 3B69A 3WQ1A 3I2OA 1HJGA 1G7YA 5F37A 3GBFA 4DB5A 2UURA 4FPYA 3EJKA 3ZYBA 1HN0A 3H8XA 3I2JA 1AYM2 3ZFFB 4QGNA 2XJVA 2EAAA 3IDBB 4B4QA 4UBGA 4EWAA 2IVIB 3H3ZA 2YBSA 3N9NA 1EPWA 1OMIA 1OT5A 3I7DA 4R9BA 4XMIA 3VDDA 3AM2A 2PLV3 2VAUA 4IEPA 2I2SA 2BW8A 4L11A 1WW7A 5IVYA 3TOJA 1Q5OA 4BMBA 3KCYA 3BIEA 1AYM1 1OF4A 3U10A 1W8FA 4G9SB 2VW0A 2XHKA 4R4XA 5DDJ1 5LZ6A 4CU9A 2XWJB 5A3NA 2HWD3 4CDXC 4XFIA 4GH4A 5EJ3A 3MIFA 4DNYA 4AFAA 3WCRA 5A6QA 1IZ3A 3V0BA 3WDYA 1XNAA 1QXRA 1W05A 4OMCA 2Y6KA 4NRPA 2WQZC 3HOBA 5FUNA 4YM3A 3DGTA 4FTEA 2JG8B 2VPVA 1RUE1 3AP4A 2VE1A 2WO1A 1ND3B 2P4EA 1HB3A 3MUZ1 1NCRC 2A7AA 4XBLA 1K5MA 1N3QA 4HOOA 3RI9A 4C0BA 1MEC2 1OD5A 2Y6FA 3M7AA 5B2GB 3NJVA 1W6NB 3POIA 4LK7A 3UJOA 2PA7A 3SCFA 4Q1PA 3THTA 1VBC2 2ZMLA 5EJ1B 2Y34A 2AGSA 2ZKLA 4WV8A 1PVXA 1Q56A 1CAUB 2HWF2 2TBVA 2XKOA 3LWCA 4L8QA 5T5OA 5ANQA 4MVTA 3ZYGA 5ABJA 4D3WA 5I0UA 4O7XA 2SBAA 2DFBA 4I3GA 5JXIA 1QMJA 3ZN6B 2FZ2A 2WFF1 3MZHA 4QB6A 3VBSB 1ZVFA 5CNAA 3UK9A 2UY9A 5I0SA 2CYFA 4N7IA 1QJX3 2HWF1 2JX9A 1ZBA3 4N7UA 4E4DX 4JGYB 4BA6A 1DDLA 4HONA 3ZPOA 1PK6B 5IW0A 2X5IA 1VAKA 3NV3A 4TYSA 4AHYA 1ZRDA 2FDKA 2Y8KA 5K4LA 3WNPA 5HXMA 1WCKA 2V72A 1Y3TA 2HWC3 3FUQA 3SITA 1JZ5A 1LOFC 1RUC3 5JZGC 1DIWA 1WLWA 3LSEA 4F83A 4FCAA 3PVNA 3VBOC 5C9AA 3RZMA 2Y26A 5BNPC 2ID4A 1NCRB 3ZFEA 3HNMA 5FZOB 5F6LB 3R4SA 1O8PA 4N43A 4RS5A 4CCLA 5KHHA 1F5FA 3MFCA 5FRAA 5J3UA 4W4ZA 1GZWA 1YO8A 3AKRA 2P37A 4KWLA 1A34A 5HV4A 1Q3EA 5FPXA 3O1SA 1QJY2 3GZTB 1M4WA 2XUMA 5BNNA 4A3XA 1C5HA 4D8MA 2JIJA 4JKMA 2B42B 3FMGA 4Y4YA 4YZ3A 3O1MA 3QCWA 4YGEA 1FOD1 4XAEA 4IE4A 4XUTA 4HPKB 4IL7A 1H4GA 2VUAA 3PURA 3RZLA 1CZSA 2BDRA 2ZGOA 4UT5A 4CPBA 1JBCA 1MVQA 4XABA 1QWRA 3WW2A 2XQRA 3LFMA 1EPZA 3AKQA 4LO7A 2P2KA 3TBDA 3KSCA 3MDPA 2Q8DA 1K12A 2W46A 1QDOA 2H0BA 2Z4FA 2QFEA 5FAXA 4N53A 1ACCA 3OSDA 1S0FA 2E7QA 4LA3A 3OGSA 4UFMA 3PUSA 2Z69A 4Q1RA 4A4AA 3JQWA 3WDVA 5FWEA 4QX5A 5FYVA 3VD7A 1LTEA 2WT2A 1LGCA 2VBDA 3D0SA 1O5UA 5CISA 3VBOB 2CTVA 3HQUA 2VMGA 1LCLA 3POYA 4Q0PA 4XQWA 4CP9B 3CJXA 5AC92 4UAPA 4P5HA 1XSRA 4HKWA 1NA1B 3IKWA 1D4M2 2OX0A 4QU2A 1XNCA 4XXAA 4CTEA 4QDQA 4Y1UA 3W58A 1LAJA 5LK7B 2CDOA 2ZGSA 4BB3A 3IDEA 1Y4WA 2BBAA 2VNGA 4YWAA 4IEWA 2C6SA 3L9JT 1PGSA 4UW4A 5AC91 1AR73 3EMRA 5J36A 4YW1A 4DY5A 3FC0A 5DUXA 1D0HA 1ONAA 4LHNA 4PLMA 3U75A 5IAXA 2WNEA 4QHZA 1FYUA 2OPWA 3VB9A 5FWJA 2DUPA 3AMQA 5C7GA 1S55A 1RUD3 1R64A 1WCUA 3DEMA 1QJU3 2YPDA 4META 2B39A 3DKWA 3OOXA 4WVWA 4PF5A 4WM7A 3WP4A 2NQYA 5KHJA 4XVHA 4S2HA 2QDRA 2J1VA 1TE1B 4Y1ZA 4LR4A 1B35C 3OUJA 4QMAA 3D4KA 4QX0A 4FPLA 4Y26A 3BYWA 1R082 2CAUA 3O0XA 2V4AA 2NLRA 4JZRA 3RRDA 2VGDA 1C8M2 1C28A 1SFNA 4OMDA 1YYNA 2WNVA 4JKKA 3ZSMA 3AL6A 4CCJA 4CXXA 5H9QA 4E2QA 2Y33A 3E97A 3TAYA 1PNGA 3WF0A 2XHNA 3PJQA 1GOHA 4D6QA 4EN9B 4BK5A 1UYPA 3Q8EA 4AAXA 3WNLA 3A22A 1FMD1 2BYVE 4GXLA 1C8M1 1X9PA 3IBMA 4R9AA 5D2AA 5C4WA 3BPSA 3HQXA 4GKXA 5F3CA 1SDWA 5IVCA 2VUDA 4XJ8A 4NPRA 3MF6A 2QBXA 4AGRA 2D5FA 4ASMB 1PM4A 4DPNA 1H9PA 3MICA 3GBGA 3KB5A 4BOWA 3VGIA 2EIEA 4YFZA 1JZ6A 1AX1A 3OF1A 2QTWB 4DEQA 1DG6A 5FYTA 1H4HA 4YVWB 5FZLA 5BNQA 3NJZA 5KBFA 3FFQA 2WNUA 3I2FA 4R4ZA 2FDHA 4CA9A 4XJ9A 5A3TA 1NLSA 3MIBA 2AYHA 1AJOA 3AYDA 1X82A 3C3VA 2VZ3A 3D82A 3Q8AA 2W39A 2WUHA 4CYDA 1E5RA 4F7ZA 2ET1A 1V6KA 2ZX3A 1W90A 4P9JA 2ZEYA 2B5HA 1BHGA 2CV6A 2FHRA 1X8EA 1AR93 4LLOA 2BFUL 2J7MA 1PZ7A 4BLIA 2JG9A 5FZHA 5HBAA 3I2KA 4IETA 3CMGA 2QQKA 5K0UC 1W8UA 1FI2A 1D4VB 3NL1A 1QH6A 4HFSA 1C1FA 1H6XA 1Q8PA 2UYAA 2W92A 2OVUA 4LOSA 4CUGA 1GYKA 2CGPA 1FATA 2RS32 2VU9A 1LHUA 3OGJA 2VVDA 2JDAA 1RTVA 3V64A 4AEMA 4YZ2A 1O5LA 1W2TA 2IZWA 3LDKA 5FDBA 1Y9GA 3IM0A 4FI9A 1POQA 2LM3A 3I59B 1MS5A 1V6NA 1FXZA 2DTYA 1QH7A 1HRV1 1G9FA 4IERA 4LE4A 4AF9A 1JYIA 5FP8A 1V6IA 1LOGA 1C8NA 4GAZA 4MX3A 1HB1A 3ZMNA 5CBLA 1S0EA 2PLV2 4GMP0 4I3PA 2VVEA 2DFCA 2HWB3 3I3DA 4HKLA 1QXPA 1UNBA 2Z79A 4JV4A 3LIHA 3WDTA 5FY8A 4CU6A 3WCSA 2HWD2 4CP1A 1ZZ8A 2DCTA 4UFKA 5A70A 4AVCA 4AAPA 5CG9A 1H1AA 4COUA 1S1AA 2G19A 5I0RA 3BALA 5FUIA 4GWNA 3FUOA 4XFCA 3WP5A 3ACLA 1X7NA 1IQAA 1R091 1UU4A 2E32A 2G9ZA 4J1WA 4MGIE 3NMBA 5E8AA 3RJ2X 2WQ8A 2HWD1 4QGMA 4X6QB 4W6YA 4XE9A 1OQDA 2BNOA 3H7JA 2YU1A 2RJ2A 5CEHA 4K9SA 2YFZA 3WY6A 3T1LA 2Q8CA 4KGGA 3RYPA 4YW4A 5IWFA 2J1RA 4AG4A 2FD8A 3B01A 2ZMNA 3LZZA 2B9UA 2WFPA 4NIIA 4BQXA 4D6SA 3P5BA 4XJZA 1LOEA 5JDBA 2PHRA 2FMYA 1C5IA 2DYCA 1ULGA 2HEVF 2X8KA 1HDKA 4CP2A 4MGSA 4CCOA 1OLME 2F6BA 4NROA 1VBE3 4LBLA 3WINE 5EIYB 4LK6A 1SZBA 2VMIA 3AKPA 2HLEA 3ZYIB 1FNYA 2Q1ZB 2W52A 1HB2A 1RMU1 4KWJA 5L73A 1YFUA 3RZZA 2CDPA 3GNEA 4J6GA 3QACA 1BCXA 5DAPA 2WZ8A 3VDBA 1FV3A 4QAWA 4AHXA 3AMNA 1PGW2 2VZQA 2BVVA 3MW3A 1QJX2 2E7TA 3M70A 1ZBA2 3I54A 5HCBA 4IEXA 4YFWA 4EWDA 4QQLA 1SPPA 2VZ1A 4CDQA 1EUUA 5JPNB 4Y20A 4RR3C 5FYZA 5IUQA 2WSVA 5BUVA 4OUEA 3O1VA 1CESA 4OFGA 1JYXA 4UBHA 4X8PA 2ZBJA 5JI9A 1LODA 5GALA 4B3NA 4J1XA 1OKQA 1SACA 4BDVB 2HWC2 2R062 5I8SA 4AR2A 1RUC2 1URXA 5DDJ3 2RS13 1ND2C 4RYDA 1LEDA 5D1IA 3AB0A 4QKBA 4IEOA 2HEWF 3T0BA 4MHRA 3MLLA 4XJAA 3B93A 1TEIA 4A45A 2HWC1 3LB9A 2BJSA 3NNLA 1UU5A 2BQPA 2VOVA 1XRUA 3WHUA 3U14A 4LJHA 4MH0E 2R30A 3GJBA 1QU0A 5FMOL 2UWAA 2J22A 4M3CA 1FX5A 4FFIA 4XHBA 1H8TC 4TXWA 1A8MA 4RHV1 3ZKYA 4TZDA 1RUE3 2R7EB 3BN6A 1SDDB 4LO4B 4AXOA 4QXHA 4CSWA 4QT6A 4Z2WA 5AFEA 4NJ4A 4OUMA 1AR83 3NWKA 4I0BA 2E6VA 1QF3A 1RC6A 2A71A 4QB1A 2R32A 5A3WA 4YRDA 2WQ4A 1H8VA 5DAVA 5C9AC 2ZA9A 3VHOA 4JCKA 2R0FA 2ZEXA 2HWE1 3VBUC 3ZXKA 4RQPB 1XYPA 2K2SA 2VO5A 3CZJA 4BQYA 3ATGA 4RR3B 5CA6A 2ZOEB 5E1RA 5LK5A 4EQVA 1GQHA 3EBRA 5FZKA 3RPQA 1MS3A 1CWPA 2EA7A 1OPOA 4OLLA 2RVAA 4YYOA 3M1HA 1XXNA 2WFF3 2VECA 5A1LA 2C0ZA 2XUEA 3AX4A 4ZHNA 2VMEA 1NCQC 2B4KA 2VZOA 3M2MA 2ZAHA 4YGCA 2VOXA 3K46A 1W6MB 3I2DA 2WRAA 4PT6A 4AL9A 5I93A 1KS4A 5DZFA 1F9KA 2C4XA 4ZU5A 4E8DA 4XURA 1UZWA 4ATEA 4ZZ5A 2AUYA 2IVJA 4OZOA 5D8AA 2ZX1A 5LBEA 2WS91 1UOJA 4MO3M 5J1XA 1JYVA 3HAGA 2YV8A 2JE9A 3W59A 3IDAA 4XW3A 4CVUA 3U4XA 4ZU7A 2ARCA 5F2WA 4HN1A 3O0VA 4EV0A 4FSJA 3PUHA 1AR72 3T08A 2XVKA 4QPIC 1H6YA 1RITA 1ZRIA 1VAMA 2JECA 4RGAA 1JU3A 2JG8A 4FOYA 3PDQA 1YIFA 5LASA 5FXWA 2EIGA 5F9TA 5FMDA 3NRUA 2AREA 2DUOA 4CEYC 1DU3D 5C9AB 5JOXA 1RUD2 3CQOA 1XOYA 5HCAA 1HRI1 1QJU2 3FLTA 1W2AX 3GBWA 3OGRA 2WIIB 4UYBA 4BE3A 4W6XA 2VJXA 4HSLA 3QH6A 3WW3A 3ZVXA 1KJRA 1W8HA 1O7FA 4YNIA 2KXLA 1BMV2 1DBNA 1UZVA 1XBFA 3M3CA 3ZXEA 2WL1A 5C3OA 2XBO3 5C3SA 5DXDA 1ULPA 4RGGA 3V0AA 3WF3A 1FOD3 1JTZX 2A73B 3J26N 4OUSA 4QU1A 2DCJA 5JCTA 3I8TA 4ZONA 5A3PA 4KMQA 5IK4A 2WDBA 4D7TA 1ULCA 3G7DA 4DUXA 3ZN6A 5HI0A 1KGYA 3MW2A 4K1ZA 3ZKUA 1BMV1 1CD3G 3VBSA 3BB6A 1WUVA 5EP9A 2IFWA 3OJBA 1LESA 4IDZA 3KV5A 1PO23 1DQ1A 5FZIA 4JGYA 3U07A 3HMYA 1TG7A 1YHFA 2NN8A 3FHAA 5CKMA 5FZ0A 1PK6A 1Y9QA 2H6BA 1ZBE1 3AMHA 3CJIC 3FZ3A 1A6CA 5FY9A 2H0VA 3AZWA 1S2EA 2ZGLA 4LQRA 4NUBA 5CKNA 2PQQA 4OQ9A 4H7MA 1N3OA 4UFJA 4P00B 5FOJB 4CEYB 4C90A 1OQEA 1VBD1 4QQ2A 4OI1A 3ETQA 4YVSC 1CAXB 5FZOA 4Y22B 4INDA 4JRAA 3THDA 4YARA 4WZCA 2ADEA 1W99A 3W5MA 2QUOA 3HNYM 5C8CC 3KCCA 1NXMA 1AR92 2P3IA 4HK9A 4A7ZA 4ZU4A 3A21A 4OCTA 5FPUA 4CU7A 5JOZA 3WG3A 2D3SA 3P1IA 1SHWB 5FO8B 1S0CA 3LCPA 1L7RA 2WWJA 2B46X 1VBB1 1NQJA 4IGPA 5DAXA 2FCVA 2OUHA 1AHSA 2WJSA 2Y0IA 2JE8A 1O3TA 5GLTA 2EXIA 4FTSA 4OQ8A 4M0NA 1HB4A 5DG2A 3VHPA 3CF6E 1J1LA 2ORXA 3FX3A 2RDQA 5F3EA 2DU0A 2PFWA 5H9SA 4DO0A 5FO9B 5C3RA 5LCWL 1UW8A 5EWSA 1K45A 2R071 4KH9A 4IQPA 3I3MA 2HWB2 3JU9A 1FMD3 1HX6A 4HANA 3X29B 4CDUB 2D6OX 4IGOA 4B7KA 3TEWA 4GA9A 2R49A 1IKQA 4WVVA 5GZGA 1ZRRA 1JOPA 1OVSA 1NA1A 3D0JA 4JGZB 4QDSA 5FXVA 4AI2A 1XNTA 1XNBA 2ARAA 3MGUA 2HBTA 1W04A 3HN3A 4TLGA 4KG0A 4DUWA 2Y6JA 3AFKA 2P6CA 1HQNA 2GMMA 2Y38A 3AYAA 5C8CB 3HPNA 5DUUA 1VR3A 4YLZA 3UGFA 3BPZA 3VBRC 3J8F1 2DVGA 3CDZB 2P3YA 3CHXA 4NAOA 5EQUA 1DYKA 5LA9A 4Q4V3 5A3UA 2JENA 2WZEA 1OKOA 1UX7A 3LSDA 3MIGA 4K20A 4ASLA 5JUVA 3E5XA 1IS3A 2VVFA 1DGRN 4P9WA 4Y3OA 4ZS3A 5A32B 3T0AA 4KG8A 1NY72 3VD9A 1R1A3 4FXKB 1NE6A 5DUVA 4DIQA 1FAYA 1SLIA 2BERA 5AVAA 2X05A 1XU2A 4BWOA 2IXJA 3UT0A 1Y7BA 4KI5M 3OYWB 4AK3A 3H50A 3VDAA 4AFCA 2C24A 4O65A 4UXAA 1NY71 3AMPA 5KWRA 4PDWC 1RJ8A 3UJQA 4W8JA 3UKNA 1VBE2 1GICA 3WT3A 2PHWA 2Q4SA 2W1WA 3POJA 5LBBA 4RD7A 2YDEA 1E5SA 1AL21 2QQMA 4YW6A 2OW4A 2VY0A 5HXVA 5IK7A 3T2TA 2XLGA 2MEV3 1HRV3 1P8JA 2A6VA 3ES1A 2C1FA 4MXVA 2C9AA 3MFAA 3VKOA 2VMFA 3B5LB 5F6KA 4QHBA 1CVNA 1ODNA 5CZKA 3Q8FA 4HZFA 5I8YA 1YFWA 3VBRB 1L7LA 1IG3A 5CYYA 3I2HA 3VBHA 1PX4A 2C9KA 4YVWA 1YCIA 4HVOA 5DDJ2 1OC1A 2RS12 3VBFC 2EF6A 5KC6A 1Z7S1 2J42A 3BCWA 4PIYA 1PGL2 1XYOA 2O1QA 4N90A 3BIWE 4QPGC 2ZGRA 4P02B 1YJKA 3LA2A 4HMZA 3FLRA 2JB4A 2BNNA 2ZGQA 1R093 4RFT0 2RS11 3CKHA 1ST8A 3AZXA 2G4IA 1UMHA 4PF1A 3ZFGB 1LEMA 5J96B 3TEZA 4XBQA 1OA2A 1PGL1 1RUE2 2ET7A 1WMXA 3B3QE 5E89A 1GWMA 1Z78A 3KQRA 1TMF3 2JWPA 1AR82 3K4ZA 3KV9A 1AL0G 5SV5A 1DQ5A 3ZXLA 5FYMA 2VZRA 4IXLA 1VJ2A 1WW5A 4H55A 3EHKA 1XE8A 5JMCA 5KR7A 2BRTA 1DGWX 1AR81 1VBA3 4EJRA 3KGLA 3I59A 1ENXA 3PVOA 1MZFA 3USUB 4M00A 2AEZA 2XMLA 3JD71 1RMU3 5EV7A 4Y5Z0 4P9LA 4PLNA 4AE2A 2MHFA 5I8TA 5BXXA 4EN8B 4WM8C 1EV13 1DQ0A 1YEWA 2K46A 2W5FA 1W0OA 2WFF2 3WNOA 1W9FA 2DURA 2XJTA 3H3UA 3BTZA 4RL7A 5FQ0B 3ZYJB 1AYN3 1U5IA 2GN3A 3IIAA 2DCZA 5DPNA 4QPGB 1YXWA 2RE9A 3AFGA 4FPKA 3VL9A 2ATFA 1GR3A 3OGGA 1WD4A 2D98A 2VTXJ 1RVF3 2Y64A 5FP7A 5FZ8A 5GLVA 4CDXB 2VOTA 3S6PA 1AR63 2R043 2OXBA 3LDRA 2AC1A 3P6BA 4HK8A 4XFBA 3Q8BA 2Q8OA 4D7SA 1OI6A 1ASJ3 4Z1VA 5HCFA 3FLPA 1UIKA 1KXGA 1RINA 3VN4A 2BGOA 2IC1A 4I02A 3WP3A 4K7JA 4BHPA 3AJYA 3LPGA 4L92A 4NIHA 4NIAA 4M0HA 5ERLA 3SKJE 1NUKA 5HCHA 5EYYA 3NNFA 2FQPA 4QX7A 2P1BA 3HQRA 4FP2A 4XFAA 3NV1A 2DVAA 3EXUA 4RHV3 3WUCA 1QHDA 1UU6A 3LPFA 5FZ1A 4KU8A 2OYZA 4URAA 2XL9A 1HQLA 3KGZA 3N4MA 3OEBA 2X29A 2GP5A 2P5BA 2XBO2 1H9WA 5JVVA 4WM8B 1ULFA 1FOD2 1OH4A 5L19A 3ENRA 3SNMA 3T4VA 1OPMA 3B00A 5FO7B 3HT1A 2DF7A 2HWE3 1FPN3 1W03A 2OQ7A 2P3KA 2VW2A 3KV6A 4CCDA 4AOCA 1G9DA 2NMNA 1C4RA 1OXCA 3JB4C 2ILMA 2WYSA 1RUI1 3U78A 2XBO1 1WA4A 2I07B 1WCDJ 2RDSA 1PO22 3T2QA 5FBZA 3DV8A 5BNOC 4LE3A 5LA0A 1CX1A 3ZSKA 4FQZA 4QXBA 2MPFA 2DVDA 1CIYA 4GD4A 2VQUA 3PLQA 4LUKA 1O3RA 1YQ8A 2OKXA 4ARXA 1F4HA 4ZXEA 5K9YA 3T4HB 1PO21 4NWVA 3A0KA 2D43A 3UGHA 3OBRA 4Q0UA 2WZR1 3VZLA 1YWKA 1FNZA 1CJDA 1QQP3 1RUH1 2WS93 3D5OA 4IV1C 5EFUA 5LEJA 2FDFA 2BP6A 5FPVA 4DINB 5FPBA 1NXD1 3BVCA 4E4ZA 5JZGB 2W1QA 4XFHA 2D6PA 5FZBA 4LXLA 3INAA 5C3QA 2CWMA 5GLZA 5BNPB 3DYOA 4MXWB 1QJFA 1TME1 3TYJA 2ZCWA 3ILRA 4IV3C 3FN9A 3TEXA 2VNRA 4AFBA 3WDUA 4X6RB 4Z07A 4UFIA 5K8SA 5IVJA 3PJYA 4H3WA 4Q29A 1MQTC 2DU1A 5F7UA 4Y1XA 4URTA 1AXKA 1H2NA 1UOGA 3U4SA 1EUTA 1JUIA 5F2SA 5CFCC 1HRI3 1NLRA 1LU1A 2QQOA 1A8DA 3DPRC 3NVCA 2BWAA 1KJLA 4UW3A 4NOTA 2GC0A 1LB2A 1D7PM 4XDOA 4CEWC 4ZY9A 5FZMA 3S57A 2CHHA 2JDUA 1XPWA 1JW6A 3K2OA 3CZUA 4RQPA 3T3YA 2GZWA 3AMMA 4XILA 3WDXA 4YM2A 3C7GA 4HBNA 4RR3A 2XVGA 4IE5A 4FBFA 3NNJA 4CE8A 2VG9A 2EIBA 4I09A 4BZ4A 5L9BA 3TWIA 2UY8A 2ZEWA 1BBT3 2ZMKA 1U5ZA 5FY4A 4AQ2A 1LR5A 2G1MA 2PHDA 3VKNA 2CL2A 1UAIA 1W6MA 1FMD2 4FTBA 2D3PA 5FZ6A 4NR1A 5A6XA 4XCAA 3VDDC 4Q4X3 2QQUA 5KHGA 1VB4A 3H1WA 1UKRA 1F5JA 3SEEA 3IT8A 4ZKTB 1RGSA 1ZBE3 3JQXA 3NSTA 5A1FA 1ZA7A 3CU7A 1O3QA 4KQ7A 3WW4A 2VCCA 2VUJA 5FZEA 2ZHNA 2W87A 4WZFA 2GC3A 4P9XA 1G8WA 1REDA 4IV3B 4LO6B 4ZPIA 4GH4C 3B02A 1OF3A 5FIXA 1JOJA 4MUVA 3HT2A 4V1PA 4BXSV 3ZSLA 1QEXA 1RUF1 3HIFA 4Q4V2 1VBD3 3DYPA 5D21A 4MGKE 1WBLA 2A70A 2WO2A 4FPHA 3VD4A 3BTXA 1W6OB 4A41A 3QLQA 2RDRA 1R1A2 4LBQB 4PCRA 2LROA 4FFHA 1G9AA 2PHFA 1US3A 4Q4W3 3WQ7A 1GQPA 1V00A 1W9TA 3RQ0A 3ST7A 4Q4V1 2BUKA 3KM5A 1G9CA 5L9VA 1IOAA 5DZEA 1CR7A 3OY8B 2PHTA 4JDMA 1KDMA 1R1A1 1V70A 4Q2FA 3K51A 3NNMA 5JWPA 2RDNA 1K5MC 5ANNA 1VBB3 1GLHA 4WBBA 3FHQA 3M8LA 4YM1A 1B35B 2DCKA 3VZKA 1GMMA 1KRIA 2VZVA 3RWNA 3ZXDA 3J9SA 2N7GA 1T6BX 4M3CF 3EO6A 5DQ0A 1Q43A 2XJSA 3UKVA 1CJPA 5A7QA 4F8AA 1EP0A 1RUJ1 3VDDB 2AH2A 5M0TA 3FL7A 3N35A 1IQDC 2JICA 1HRV2 2MEV2 2WA4A 5ABJC 1JYTA 2ZZQA 5JPMB 4JTOA 1A3KA 5FPLA 3OD4A 4XDPA 4NVPA 4V2VA 5J37A 2R073 2YC0A 3Q8CA 2XDVA 4LEJA 4GH4B 4NHYA 3IN9A 4YZ1A 2V5YA 5A7OA 1YJLA 2MEV1 3I3QA 4HLTA 3SXWA 1N1SA 2JDYA 5F5IA 4HN0A 3AYCA 3N9PA 1SMVA 2ZABA 3VKLA 4Q26A 3H1MA 3T2PA 5FYSA 3WD5A 4EE2A 4LKDA 1QXJA 1X36A 2V5DA 3OGVA 1PMIA 1CAXA 2TEPA 1S4CA 2EALA 1WMDA 4Y22A 1YLLA 4IE7A 1MS9A 1R092 1RIRA 1J3RA 1POV3 2QDNA 3FJSA 3N3HA 3BU7A 5LY2A 3J8F3 2D40A 4JX0A 1W2NA 3W20A 1GQGA 3KWVA 1FT9A 4CUBA 2GN7A 3LQCA 4GQ7A 2A6YA 2I74A 4N43C 4COYA 5FKBA 3T30A 1FV2A 1TMF2 4XAAA 3RWKX 2W91A 1CQ9A 3C8XA 4CUAA 4AI9A 3ON7A 4FPCA 4NRMA 4L0PA 2IXIA 5K0UB 5H9RA 5BNNC 3ZYHA 4AW7A 3BTYA 2VMHA 1QKQA 3NKTA 1UY0A 3MEPA 5FY7A 1TMF1 4PQ9A 3O12A 4AQ6A 1AJKA 3SMHA 3ACHA 5FREA 4TWTA 4B7EA 2XQXA 1W6QB 4BQ5A 3GYDA 2Z2SB 4OHZA 4ZZ8A 4LHSA 2D6LX 1XJAA 1RMU2 5FTTC 2E53A 1S2BA 1COV3 5FBJA 3ZM8A 1BK1A 1QGLA 4ES8A 5CG8A 3R0RA 1EV12 1YRZA 4ISRA 4AVAA 1AL23 1OUXA 3PIJA 3VL8A 2ZX0A 3LEKA 1EAH1 1VBA1 3PU8A 3ZR6A 2QE3A 5I0TA 4AEDC 4AQTA 3J7NA 1AYN2 4D0QA 1US2A 4N53C 3HWJA 4S2FA 4CDUA 5FPAA 5T5PA 4A7YA 4AWDA 4NWWA 5A7NA 4JGZA 1JHNA 1EV11 2BEOA 1K5JA 2Q1FA 1H2KA 5DZGA 3WF1A 5CFDC 3ZIWA 5KXCA 2YMZA 4LHKA 1RVF2 3UETA 2LALA 1AYN1 2QQIA 3O7OA 4HG6B 1JMUB 2R042 1AR62 5C8CA 2AZ5A 1GNHA 2R6QA 1GU3A 1JU4A 1Z7S3 4MZUA 5BYNA 5EJZB 4GULA 5EYXA 1LRHA 3HD8B 1GP5A 1NE4A 2BOIA 1ASJ2 1GZWB 1GP4A 1RYYA 1VIWB 3NAPA 4LKEA 2AEYA 1UCXA 1RUNA 4A6OA 1NZCA 3THPA 4AEJA 4MYEA 4NIDA 4FPJA 3R6SA 1RVF1 4FFFA 5A32A 3AP6A 1OURA 3TEYA 1AR61 2J1SA 2R041 2JDMA 1VLNA 2VW1A 2JXAA 4XTMA 5T3NA 5BNNB 1BYHA 1UF2C 1UN1A 4YG3A 5ACA1 4DEVA 2B9VA 4DQAA 2ES3A 2RV9A 1ASJ1 2OQ6A 2YGMA 3N7LA 3OYWA 2ZXQA 4K21A 4RHV2 4GWIA 3RMYA 3SC7X 4AEKA 1EYBA 2WT0A 1I5PA 2VCMA 2WA3A 1XNKA 4DFSA 1DZRA 3S0MA 3HN1A 1JN2P 1XE7A 3DF0A 3POBA 3TRSB 4WM7C 1XNDA 4U2AA 2UWCA 4ONUA 3VHNA 3IB3A 5FOBB 3BGAA 2HWE2 2WO7A 1FPN2 1UMIA 2CWSA 1Y43B 2P6HA 2YC4A 3O14A 2J1TA 4UW5A 4AEDB 1NT0A 3POEA 4IE0A 5FYHA 4BQ3A 4H2AA 2R16A 2QJVA 2XLFA 3VZJA 4PHZA 2TUNA 3PUAA 4MGZE 3JD73 1GKBA 1ZX5A 2VZSA 3OPWA 1UX6A 5CFDB 1JODA 1UIJA 1J58A 2BTVC 3AZZA 4LHLA 4OI4A 5LBCA 2CGOA 2BGCA 1FPN1 4C0HA 1Q8SA 3PUQA 3RZGA 3E6BA 3H3LA 3M3IA 5C4WC 3DKQA 3ZFFA 4NPLA 4O9EA 4I30A 1KQRA 5T5LA 2FCTA 4BQ4A 4COZA 2OS2A 3ZYPA 2VXRA 1LOBA 3LF7A 5K7PA 4PI0A 1QQP2 4I0AA 1OFSA 2WS92 5FMCA 3NV4A 1O8SA 4NO4A 4XF4A 5LATA 1PM7A 4YZ4A 5F3GA 1OFNA 3HJRA 1ND2B 5FZGA 1V6MA 1LOAA 2WNUC 3BOPA 3KVAA 2OZJA 4LLFA 1MS0A 5F5QA 3NV2A 3RZKA 2GNMA 1NLQA 3LOBA 1UYZA 3HR9A 2VC9A 2YUEA 1QQP1 4XBNA 3SH3A 3ZFGA 3NO8A 1F15A 5T50A 1DF0A 5A3OA 1DZQA 5IJRA 4BCUA 5JIUA 1BK0A 4LNVA 4HKOA 1H0BA 4LBMA 2XLAA 4C1WA 1H8TB 2GNTA 1CZTA 5FV3A 4JC1A 1Y9MA 1HRI2 2JDHA 4IEQA 3EB7A 1LGNA 1GBGA 3BTAA 4XHXA 1UPIA 2AENA 2QKDA 1RHI1 3S7IA 1ENRA 4GWJA 2JG9C 2XOMA 4PBPA 3ZOIA 5C33A 2W1SA 1VMHA 5FPZA 1J3QA 5IVBA 3K75B 4Q5OA 4S2GA 3W5NA 1ND3A 1UY1A 1VRBA 2J1EA 4R9DA 4SLIA 5C71A 3PMSA 1WCSA 4SBVA 4FT8A 2XL7A 3VBUB 3USUA 2OA2A 4J25A 1JOBA 1MZ5A 2RMU1 3D3AA 3DECA 4Y5TA 5FYIA 2BV4A 5A7PA 4C8DA 1BJQA 2GAUA 1JYNA 1W6NA 1BBT2 5A80A 3I97A 3UESA 4DRRA 3EYPA 5C5UA 1OLQA 3AZYA 1E5IA 3CO2A 3BODA 1RUI3 2P34A 3KF5A 4Q4Y1 1SCSA 1HJFA 2YROA 1CAUA 5FQ0A 3OD0A 4Q4X2 4LORA 1NCQB 3I2GA 3RZJA 5GLWA 1UD1A 3DCQA 1ZBE2 4NN0A 5GZCA 1BBT1 3VKFC 4CXWA 5KXBA 4MG2A 1AVBA 2DBNA 4QB2A 2WN2A 4A42A 4JQRA 1BXHA 4K40A 2W2IA 2ZGPA 4P9YA 2VXJA 1OH3A 3VLBB 4CDXA 2D6NA 4UF0B 2WKKA 2H6CA 1PO13 3J7LA 5SV8A 4YW3A 1WWYA 2BPA2 2WZR3 4Q4X1 4QDRA 1MPXA 1RUH3 3I49A 4GJZA 4Z82A 1WW6A 3CL1A 1IG0A 1KEXA 5H9PA 2PHUA 5B4NA 1VBD2 4JAAA 3WNKA 3AC0A 2K0GA 1W39A 1KITA 2W95A 3FE5A 2YU2A 4QPIB 4B8EA 1W28A 2QZ3A 2RJKA 4E27A 4YSFA 1TME3 1LU2A 3IPVB 3K48A 2Z5WA 2EXJA 2XJRA 4Q4W2 3TB0A 3GCXA 1ZREA 3M4FA 2QQJA 1NCRA 1LNSA 2YBPA 4PQQA 4A2UA 1WBFA 2DTWA 2XH6A 3SLIA 3AKSA 3KLSA 2VCAA 4Y1VA 3MIEA 2QVSB 1HV0A 4AVSA 4QXKA 1VBB2 3SHRA 1ZZ9A 4AVVA 4XEZA 1VMFA 1GFF2 2D44A 4Q4W1 1O3SA 4KL1A 1ULOA 1WZXA 2E63A 3B9IA 1G86A 4CZSA 2R1DA 2Q0AA 2WAAA 2WR9A 4XPVA 4ORFA 4UOJA 2Y0OA 1UXZA 4QPWA 5AVPA 2YZ4A 3N7JA 1ZZ6A 2D97A 3ACIA 1JZ2A 3JZVA 4FPOB 3WW1A 3H42B 4HPKA 2A1XA 3TN93 2JDNA 3AYEA 4YG6A 1SFPA 2YYOA 4UFHA 2R072 2ZS6B 1LGBA 1GSLA 1OVPA 4GJYA 4BJ0A 4DUVA 3J7HA 3C7HA 3CJIB 2V73A 4DXTA 2D3RA 1UZYA 4FVVA 4QX3A 2X10A 2VR4A 2O0OA 1E57A 3PTRB 4ASKA 1IS5A 4BH9A 5DMYA 4Y1YA 1BVVA 4CP0A 3OB8A 1LOFA 1GZCA 4LBNA 4OYUA 2B8MA 1QOTA 2GC1A 4LBQD 5JZGA 4QQOA 4IEYA 2Z42A 2VQ0A 3PNAA 3VBOA 3AP5A 2JKBA 1SLTA 5BNPA 2LW8A 4CP9A 1NOVA 2WZPP 3J8F2 5FLHA 4YVSB 1RUG1 1YQ2A 3KD4A 1VRH3 3WX5A 1JXNA 4DOUA 3C7FA 3I4IA 1QOSA 1XB9A 3WG4A 1MVEA 1RUF3 4B1LA 3ELNA 3K4DA 3RSJA 3TNQA 4LMFA 4B29A 1T2XA 4GB31 5A7WB 1KDKA 4HSJA 3FWEA 5FZ7A 5IVFA 1HXS3 3UGGA 1POV1 1S0DA 1L7QA 1GOGA 4XF9A 3O1RA 4XC9A 1JI6A 1D2QA 2W47A 3ETPA 2JDKA 1HLCA 3PMEA 4LBJA 4B4RA 1YI7A 2D6KA 3OUHA 3POWA 5E16A 4DZGA 1LOCA 2FMDA 1JZ8A 4M4PA 2KD7A 5B4XA 2NP0A 3FBYA 5FJKA 1F31A 3MV11 3KT4A 4KWUA 5A3MA 1J3PA 1W2UA 5DG1A 3WXPA 3AVSA 5FLJA 1RXGA 5GZFA 4CCEA 4QKDA 4NE9A 1COV2 4CDWC 2O14A 5JLVA 2JE7A 3MPBA 2CAVA 1RB8G 1AL22 2RR13 3SH5A 4MSVA 1VAVA 1RUJ3 3K77A 3MF9A 4WVZA 5G04L 2HYKA 1SEFA 3HNBM 3WLUA 3ZSEA 3N7MA 3M3EA 1COV1 1KS5A 2BGPA 2HEYF 4XJWA 1CZVA 5T54A 1S0BA 1I6XA 1A78A 5LEKA 1W3XA 5FZ3A 1OHFA 2UYBA 2NZ9A 4K6BA 3LEMA 1JUHA 2WT1A 1JZ7A 1UZZA 4YW5A 2DUQA 3N9LA 4COWA 4LA2A 5DAWA 1BEV3 3NW4A 2WNOA 5D8AC 1AUYA 1Z7S2 4IESA 1HV1A 1ZYBA 3WQBA 1GWLA 4BMEA 3AK0A 5L7OC 2YGLA 2BFUS 1ENQA 3QOPA 3MPPG 1OBNA 5A3LA 1N1TA 4NPMA 1W6OA 3A0NA 3VZMA 1UL9A 4JVAA 3SH4A 4QWNA 5JI7A 4LBQA 1GNZA 3W21A 1W0PA 3FHIB 1DQ4A 3N9QA 4RA0A 3SCHA 3ZYFA 3KVBA 2JG8C 5FZDA 1XQNA 3IAPA 2CY6A 4O9GA 2Q1MA 1S0JA 1UY3A 2VBBA 5FR3A 4B4PA 5CAZA 3OY8A 1TQ5A 4HVRA 4L97A 1O59A 3KT7A 2PTMA 4R8HA 2UU8A 4AZZA 1M06G 3M3OA 2FZ1A 2JJ6A 4AI1A 1O4TA 2D93A 4CDWB 4QKNA 1B35A 4LULA 3WOGA 4CCNA 4BK4A 1YFXA 4PDWB 3N36A 2EVXA 5LRSA 5JSOA 2DBIA 1V6LA 1CONA 2ARBA 1J59A 1PVC1 4XUPA 1BKZA 4H14A 1IS4A 2FCUA 1V9U3 2DV9A 3LA7A 3JD72 4CU8A 1TZOA 2CGNA 3OUIA 1HW5A 4LIUA 1BLZA 4BIFA 1VALA 3BUCA 4E4SA 4XUQA 3BKZA 4E2SA 1I3HA 4MV2A 3VBSC 1DZTA 2GSYA 3BU0A 1EAH3 3AKTA 3E5UA 1MS1A 3JBG3 5CU1A 5D8AB 3O1PA 3SCGA 1W8OA 4JGYC 2JDZA 2QNKA 3SKVA 3RNSA 1V6JA 1I9RA 2VNVA 4AI3A 1PK6C 2JKXA 2ARXA 1ALYA 5L7OB 1JH5A 1O4YA 5T52A 3CIHA 4CXYA 1N1VA 1TNRA 3ZXGA 1HKDA 4N9IA 3VBFB 4FQ4A 1IKPA 3OBTA 1SLAA 4Q0QA 2J1AA 4QM9A 4DXRA 4OVEA 5FYUA 2ERFA 3T1MA 1IPKA 4XJUA 3ZR5A 3V56A 2VMCA 2P17A 4JKLA 2PAMA 1JZ3A 3IDCB 4JHTA 2ZGKA 3APBA 1CPMA 4OI2A 1DQ2A 4RN5A 3DXUA 4CPBD 3C2UA 3TNPB 3JUUA 1XSQA 3EQEA 1VP6A 3B94A 5C6CA 1PIV3 1IPSA 3T09A 2GP3A 3LE0A 1MR5A 3KCXA 5A33B 5ACA3 1CAVB 2PMWB 3PHMA 4U36A 5IHRA 5C3PA 4V2WA 4EZ4A 3QBQA 5K0UA 4AQSA 4DRVA 3V0AB 4WVMB 4PJYA 5FP4A 4IE6A 1MEC1 4FXGB 3ZIXA 2VL4A 1YQ6A 4N9HA 5ISLA 1F8VA 5GKAC 1H1MA 1T6GC 3RZHA 5GM0A 2E7AA 2B45X 2W94A 1W6QA 1WCQA 4NHLA 1J83A 1WLDA 1EY2A 2A75A 1VBC1 4YG0A 3HVDA 2FBEA 5EZWA 5FCCA 5BY5A 1YUDA 5JXGA 1OLMA 1WA6X 2PYTA 1O6UA 1UYXA 1DLLA 1YI9A 2WBKA 2AACA 3IAQA 1SQ4A 4RFRB 1RUI2 3U1XA 4P5YA 4EWEA 1H2MA 5HV0A 2ADDA 5J09A 3ITQA 2ZEZA 4AVBA 2VOWA 4P9GA 2R063 4AHWA 1ZZBA 4Q8KA 3GXUA 4Z92B 4OHVA 1LECA 1JS9A 2QQLA 3KT1A 3Q9OA 4Q0SA 3LIGA 2K9ZA 1LHNA 1D2SA 1PO12 1H30A 2ETEA 2WLPA 4DXZA 3MLKA 2WZR2 3AP9A 5FMOS 5JAXA 1NA1C 2A3XA 1YFYA 2FDGA 5JOWA 1RUH2 1W8TA 4HETA 5FLIA 3OBZA 5FK7A 3VUOA 3A7QA 2IXHA 5IYYA 3BOWA 5FP3A 1LKNA 5FZ9A 1WLCA 1QJEA 2VMDA 5F8PA 1DFQA 1OOPC 2C5DA 5CB7A 1SBEA 1PO11 4UFLA 4JHZA 1TME2 1SLLA 2ENRA 5JOYA 3ZDVA 3ACGA 4LOTA 3LFIA 2JD4A 4GZ9A 3NQHA 4QX2A 3AXDA 2PQSA 5IK8A 1W9SA 2PN5A 1PZ8A 3KMHA 5I91A 5IVVA 1PMJX 4XETA 3PTYA 4KWKA 1JHJA 1UXXX 1QJY1 4KU7A 3BI3A 1MACA 1LENA 1DP0A 2HJIA 1MS4A 4N8MA 1RHI3 2GDFA 4H7LA 5LRRA 2RJLA 3KQ4B 5JR2A 3H0OA 1E5HA 1W9YA 4A6SA 4AEDA 2F4PA 3NJYA 1NKGA 2DVBA 4XIOA 5F39A 4E2GA 1UY4A 5EXOA 3H8OA 2IXKA 2QQVA 4D6RA 2RMU3 2VZUA 2VTFA 1LHWA 2A5ZA 3N9MA 4NMIA 5CFDA 1ZZ7A 4BPZA 2RS53 4QX8A 3TN92 3KZ4C 2AR6A 4K8RB 1PX3A 1ULDA 5BNOB 2O8QA 1PHMA 4Q4Y3 2ZPXA 2RM23 3H7YA 4X8NA 2JIGA 4JTNA 1DGRA 5A6ZA 1H2LA 1W8WA 5APAA 1QDCA 3RS6A 2D7FA 3VKMA 5FXZA 4BM8A 1OOPB 3TN91 4QD2A 4W6WA 3M3QA 1DYPA 2CSGA 3LA3A 1UZ0A 5FP9A 4XQDA 4DMIA 3VBHC 1TVGA 2PHXA 1ND2A 1UMZA 4YVWC 1D4M1 1UOBA 2X09A 5FJHA 1CAWB 1K3IA 4IV1B 1W6PB 3RI8A 2ZGMA 1DQ6A 2O8OA 1CGPA 1SFYA 1OUSA 3OG2A 1VRH2 4LO8A 3AP7A 4YGDA 2YB7A 3I2IA 1RUF2 1S2KA 4IEZA 3WF2A 3MIHA 2NM1A 3WDWA 4G4FA 3HBZA 5A1AA 2YY1A 2IWGB 4I0WB 2ZHMA 1H8TA 1U5XA 1HXS2 1W0NA 1J84A 2WWUA 3GDBA 4DS0A 1W8NA 5FYCA 1W06A 3JCIA 3RFRA 3VV1A 1GUIA 4AVTA 1IS6A 1MQTB 1VRH1 5JSRA 4BQ2A 1UYYA 2V09A 5C5TA 3AJZA 5CFCB 1RUOA 1WD3A 3MI8A 1WMFA 2SLIA 3DPRB 3DXTA 2QQPA 3GZAA 5GZEA 3HEIA 1HXS1 3THCA 3WR0A 3ZXJA 3VHRA 4CEWB 4XZPA 3VBUA 5L9RA 3O5SA 4QHOA 1X33A 2VQAA 1ENSA 1R081 5FUPA 2E26A 4OHXA 1QJZA 2GC2A 2EIDA 2RR12 1L3JA 1RUJ2 1UOFA 2QZ2A 2WO3A 3ZN5A 2G9GA 1IPJA 2A3WA 3N7KA 4DXSA 1WGPA 4IGQA 1POV0 1NCQA 3I3BA 4BQWA 5L36A 4TTGA 3VBHB 3D8CA 1DGLA 4E9KA 4CUCA 2RR11 4YZ5A 3WNMA 3CBNA 4FO9A 4ZXKA 1W2OA 2VULA 1LULA 4UF0A 1X9TA 2VZTA 1R1ZA 2A6ZA 2GH8A 2F4LA 2W08A 1BEV2 2WYFA 1D0GA 2PAKA 3DYMA 4M01A 3W9AA 1BVP1 4MGYE 5JXJA 2YFUA 5IT6A 5JIAA 1KFUL 3ILFA 1IHMA 2Q5TA 4MGQA 1KFXL 4LIVA 4F3JA 3IWZA 3J4UH 1AXYA 4KNCA 4QXCA 3V0BB 1DHKB 4QPIA 1F2NA 4CCMA 4YM0A 2VM9A 2CU5A 4LO5B 2W1UA 1BEV1 1NAEA 2DCYA 2X5IC 1RUG3 5FY0A 2UWBA 3B7MA 3IPVA 4BQ1A 2ZZJA 4AYUA 4XFFA 3WSOA 1CIWA 4KGQA 1TNFA 1XE0A 4CEYA 3A23A 4BIOA 3VZOA 5IFTA 1ZNPA 4GB33 4UWDA 1GANA 4D69A 4FAGA 4ZS2A 3USSA 5EHDA 2ZJCA 2WAOA 1S0GA 3WG1A 1WMEA 2WWSA 1KD7A 3LOIA 3KF3A 3ZFEC 2QQWA 3R4DB 4QX1A 1K5MB 2KR2A 2TNFA 2ZHLA 3ALQA 4RS5C 5DAQA 3RJRA 4LKSA 4R52A 2JB8A 2RS31 3ZPYA 2XXZA 2A6XA 2QQNA 4KBBA 5CVRA 1V9U2 4IUGA 1UO9A 5FMBA 3VDCA 1SBDA 2ZAAA 3FFZA 1QY4A 3NJXA 4BISA 3KV4A 4Z8BA 3P3PA 3F95A 5ABJB 3ZSJA 1EAH2 1VBA2 2PAEA 4K1YA 3JBG2 3WG2A 4NHKA 4CCKA 2CNAA 1V9U1 2PLV1 3CJIA 2XVLA 4L2NA 2XWBB 4MLOA 3RDIA 3MBWA 1GNYA 2IXCA 4XUNA 2GMPA 1OA4A 2ZKNA 1JYWA 2YHJA 5LB6A 1F4AA 5FYYA 3POFA 3AXEA 3WZ1A 3NKGA 2WSUA 3OEAA 5F5AA 3VZNA 2X5IB 3JBG1 3WNXA 4TLFA 2ZACA 5FZCA 5DN2A 1IGOA 3JB8A 4TN7A 1GOFA 1X50A 5GLUA 4XCBA 4FPGA 2PELA 4YVSA 4CCCA 1VB2A 4TSVA 1YNAA 1REFA 4EN7B 1JZ4A 5AFBA 3OPZA 2NMOA 5E88A 2VCBA 4GMP3 5A7WA 1HQWA 1B09A 1WW4A 3E6DA 3KHBA 4YGBA 2OIIA 1PIV2 2XR4A 1ULEA 5FYBA 1RL3A 2NPIA 4Q27A 3WV6A 1WKYA 2ZGUA 3ZFEB 4N43B 4RS5B 5ACA2 3LEIA 1S0IA 1Z0HA 4P08A 1J1TA 2HBUA 4IEVA 3OTFA 3H9AA 3E5QA 3URFA 3R4UA 1ODMA 5KC5A 3RGBA 3ILNA 4EN6B 3RYRA 1MZEA 1RXFA 1APNA 1PIV1 1UWWA 2EICA 1CX4A 3L2YA 4XF3A 5JXHA 5DABA 2OUJA 1AZDA 4W65A 2J1UA 4RQPC 1W8ZA 4GKYA 1PVC3 4XIKA 1XYNA 2BOJA 1V6OA 3AL5A 3SISA 4ATFA 3ECQA 5C8WA 4QQHA 3O1OA 3UL2A 3CEWA 4E8CA 5BV6A 4OHWA 4XMAA 1DLCA 3MLJA 1PGW1 1AYM3 1CN1A 3CLPA 1QJX1 1ZBA1 1N47A 3GALA 4AI8A 1OQ1A 3R05A 4JDNA 4N53B 3U37A 1U5YA 1YQ5A 2BVBA 1YQCA 2VH9A 3IZOA 4QQPA 3QH7A 2WNVC 2W3JA 3OCPA 1N1YA 5LY1A 3ACFA 5KXDA 2R061 4FOWA 2IXLA 4OULA 4Z2AA 2XPJA 2XJQA 3ABZA 1RUC1 2WC2A 2XONA 1O4ZA 2A6WA 1W3VA 2VD7A 2X53S 3GZEA 1YIPA 3MO4A 1REEA 4XUOA 1ZRCA 4LT5A 3GCWA 3VBRA 3U11A 2E9QA 1NZIA 3OPTA 3GM8A 2W9XA 1GP6A 4JDOA 3LDBA 4RSUA 3K3OA 1K42A 2R1BA 4XZUG 1GWKA 3E6CC 4ARYA 1HIXA 3ZXFA 3L2HA 5TSWA 1F35A 1UQXA 1NQDA 3ES4A 4NHXA 4Y5SA 3AZVA 5JR7B 1W9WA 3WEZA
chains in the Genus database with same CATH topology
3H1YA 2WLQA 3QD6A 4CDWA 4XF1A 2B7YA 4OI0A 5CADA 5KHIA 4K8FA 4D94A 5IK5A 1QOOA 1RHI2 2DWRA 4QPYA 4PIXA 2GH2A 4PDWA 3LGRA 3ASIA 2OZ6A 1MEC3 4IEUA 4WM7B 2XJUA 1Q8OA 4R9CA 4FP3A 4PLOA 1ZM1A 3UKTA 4PIZA 4AGGA 2IFRA 4BYYA 3V65A 1UKGA 2RMU2 5GZDA 1VBC3 4FPEA 5CIRA 1PNFA 1SLCA 1PZ9A 4A7KA 4EN0A 1NG0A 4LUMA 1O91A 2HWF3 3S7EA 2RS52 4JRLA 5T55A 2WNVB 3LAGA 2XGXA 4NHMA 4Q4Y2 2RM22 4XXPA 3DL3A 2GNBA 2A3YA 4HT1T 3S30A 5L7OA 2YXSA 4AFDA 3GZUC 3DN7A 4AGVA 2RS51 3KS7A 3RG0A 3B9CA 3ZXAC 5C4WB 4XF0A 3O0WA 3GHMA 4XQ4A 3VBFA 4XOGA 2RM21 1UPSA 2D5HA 2WINB 1ZA4A 2KM2A 4GWMA 4QPGA 5J98B 3U0ZA 4Q8LA 2VNOA 4Q0VA 2WNUB 3D6EA 2I45A 3ME2A 1AR71 4XYXA 1OSGA 2LUWA 2GNDA 3WVJA 2XB6C 5A33A 1C3HA 4CRQA 1CAVA 3ZDSA 3MYXA 2R0HA 1RUD1 5KXEA 4WVMA 1QJU1 3WHTA 1NYWA 4QGLA 1QJY3 2JG9B 2GALA 3POSA 4C91A 4UW6A 3RMXA 5FFOC 4OZXA 2VOKA 4XFGA 3ZO0B 1C57A 3PVBB 4WM8A 4EROA 3A4UA 3WUDA 4HVQA 4L9BA 4AI0A 4YW2A 4AFMA 1AF9A 3MW4A 3WP6A 1C1LA 1BQPA 3ZMOA 3ZX7A 4ISQA 1MZ6A 4CDUC 1AX2A 2NYYA 4JGZC 5J7MA 2BBVA 3FBMA 1ZRFA 5AC93 3GF6A 2ZGNA 2XJPA 1XU1A 1U0AA 1D4M3 2E51A 4LBKA 2LTNA 4CDQC 5GJ6A 4I01A 1LJ7A 1X8MA 1RUG2 2Q30A 4XTPA 3NAPC 4FAHA 1Q8VA 1H1IA 1MS8A 4GB32 4OHYA 4HL0A 1AR91 1AXZA 4MXWA 4K3UA 2P3JA 2KA3A 2EXHA 2BWCA 4G3YC 2HKXA 4D7YA 1N3PA 2QCSB 1GZ9A 2ZX2A 1RJ7A 1G6NA 3LKJA 4L99A 1SCRA 4XIKA 5T5JA 1LHOA 1DGWA 2PHLA 2ZTNA 4S2DA 5BPXA 2RHPA 1R083 2DVFA 4FOVA 5KHKA 3G6JB 1C8M3 1OLRA 4FOQA 3ROUA 3H8UA 1QNYA 4DY3A 2W68A 5BNOA 1BZWA 3PVEA 1I1EA 4AHZA 1U12A 4P14A 2GU9A 1SLBA 2HWB1 4BLJA 4P9IA 4COVA 4I2OA 2ZHKA 1OOPA 4ITCA 4CDQB 4Y20B 3IMNA 1AX0A 4GALA 2EXKA 3UV9A 2EAKA 3ZFFC 1JYCA 4LBOA 3GHNA 3NAPB 3RYKA 1CAWA 2XG3A 4IV1A 1W6PA 4LTAA 1SBFA 4Y24A 4GIQA 1OA3A 2BNMA 5J48A 5F1RA 1QNWA 2GMEA 1GV9A 2YPJA 1LHVA 4IV3A 1Q8QA 4C1XA 3ZFGC 1CPNA 3DUIA 2JEMA 1MQTA 4FPFA 4XDQA 4PBOA 2G9FA 1ZZCA 5CFCA 4M3CB 2ZGTA 4GMP1 2W0XA 3DPRA 3WQ0A 5JSPA 4ES9A 3CNAA 3ZYRA 4CEWA 4M3CE 1I5ZA 2D6MA 5DUWA 2ZX4A 3MIDA 4QM8A 2MNGA 1VBE1 3P3NA 1G9BA 1ND3C 2OPKA 1WLTA 3ZN4A 1PVC2 2RS33 2XKPA 3B69A 3WQ1A 1G7YA 3GBFA 4DB5A 2UURA 4FPYA 3EJKA 1AYM2 3ZFFB 4QGNA 2XJVA 2EAAA 3IDBB 4B4QA 4UBGA 4EWAA 3H3ZA 1EPWA 1OMIA 3I7DA 4R9BA 4XMIA 3VDDA 3AM2A 2PLV3 4IEPA 2I2SA 2BW8A 4L11A 1WW7A 3TOJA 1Q5OA 4BMBA 3KCYA 1AYM1 3U10A 5DDJ1 4G9SB 2VW0A 2XHKA 4R4XA 2XWJB 2HWD3 4CDXC 4XFIA 4GH4A 5EJ3A 3MIFA 4DNYA 4AFAA 3WCRA 1IZ3A 3V0BA 3WDYA 1QXRA 2WQZC 4YM3A 3DGTA 4FTEA 2JG8B 2VPVA 1RUE1 3AP4A 1ND3B 1NCRC 2A7AA 4XBLA 1K5MA 1N3QA 3RI9A 4C0BA 1MEC2 1OD5A 3M7AA 5B2GB 1W6NB 3UJOA 2PA7A 3SCFA 4Q1PA 3THTA 1VBC2 2ZMLA 2ZKLA 2AGSA 4WV8A 1PVXA 1Q56A 1CAUB 2HWF2 2TBVA 2XKOA 3LWCA 4L8QA 5T5OA 4MVTA 3ZYGA 5ABJA 4D3WA 5I0UA 2SBAA 2DFBA 4I3GA 1QMJA 3ZN6B 2FZ2A 2WFF1 3MZHA 3VBSB 1ZVFA 5CNAA 3UK9A 2UY9A 5I0SA 2CYFA 4N7IA 1QJX3 2HWF1 2JX9A 1ZBA3 4N7UA 4E4DX 4JGYB 4BA6A 1DDLA 1PK6B 2X5IA 1VAKA 3NV3A 4TYSA 4AHYA 1ZRDA 1WCKA 3FUQA 1Y3TA 2HWC3 3SITA 1LOFC 1RUC3 5JZGC 1DIWA 1WLWA 3LSEA 4F83A 4FCAA 3PVNA 3VBOC 2Y26A 5BNPC 1NCRB 3ZFEA 5F6LB 3R4SA 4N43A 4RS5A 5KHHA 1F5FA 3MFCA 5FRAA 5J3UA 1GZWA 1YO8A 3AKRA 2P37A 4KWLA 1Q3EA 5FPXA 1QJY2 3GZTB 1M4WA 2XUMA 5BNNA 4A3XA 1C5HA 2B42B 3FMGA 4Y4YA 4YZ3A 3QCWA 4YGEA 1FOD1 4HPKB 4IL7A 1H4GA 2VUAA 2ZGOA 1JBCA 1MVQA 1QWRA 3WW2A 1EPZA 3AKQA 4LO7A 2P2KA 3TBDA 3KSCA 3MDPA 5FAXA 1QDOA 2H0BA 2QFEA 4N53A 1S0FA 2E7QA 4LA3A 4Q1RA 2Z69A 3JQWA 3WDVA 4QX5A 1LTEA 2WT2A 1LGCA 3D0SA 1O5UA 3VBOB 2CTVA 2VMGA 1LCLA 3POYA 4Q0PA 4XQWA 3CJXA 5AC92 4P5HA 4HKWA 1NA1B 3IKWA 1D4M2 4QU2A 1XNCA 4XXAA 4CTEA 3W58A 4Y1UA 5LK7B 2ZGSA 3IDEA 2VNGA 4IEWA 3L9JT 5AC91 1PGSA 4UW4A 1AR73 5J36A 4YW1A 4DY5A 3FC0A 5DUXA 1D0HA 1ONAA 4LHNA 4PLMA 2WNEA 1FYUA 2DUPA 3AMQA 1S55A 1RUD3 1QJU3 4META 2B39A 3DKWA 4WVWA 4PF5A 4WM7A 3WP4A 2NQYA 5KHJA 4S2HA 2QDRA 4Y1ZA 1TE1B 4LR4A 1B35C 4QMAA 3D4KA 4FPLA 4Y26A 1R082 2CAUA 3O0XA 2NLRA 3RRDA 2VGDA 1C8M2 1C28A 1SFNA 3ZSMA 1YYNA 2WNVA 5H9QA 4E2QA 3E97A 3TAYA 1PNGA 3PJQA 4EN9B 1FMD1 2BYVE 4GXLA 1C8M1 3IBMA 4R9AA 5C4WA 4AG4A 3HQXA 4GKXA 1SDWA 4XJ8A 4NPRA 3MF6A 4AGRA 4ASMB 2D5FA 4DPNA 1H9PA 3MICA 3GBGA 3KB5A 4BOWA 3VGIA 4YFZA 1AX1A 3OF1A 1DG6A 1H4HA 4YVWB 5BNQA 3NJZA 5KBFA 3FFQA 2WNUA 4R4ZA 4XJ9A 1NLSA 3MIBA 2AYHA 1AJOA 3AYDA 1X82A 3C3VA 3D82A 2W39A 4CYDA 4F7ZA 2ET1A 1V6KA 2ZX3A 4P9JA 2B5HA 2CV6A 2FHRA 1X8EA 1AR93 4LLOA 2BFUL 1PZ7A 4BLIA 2JG9A 5HBAA 4IETA 5K0UC 1FI2A 1D4VB 3NL1A 1QH6A 4HFSA 1C1FA 2UYAA 1Q8PA 2CGPA 2OVUA 1GYKA 1FATA 2RS32 2VU9A 1LHUA 3OGJA 2VVDA 3V64A 1RTVA 4AEMA 4YZ2A 1O5LA 2IZWA 5FDBA 3IM0A 2LM3A 3I59B 1MS5A 1V6NA 1FXZA 2DTYA 1QH7A 1HRV1 1G9FA 4IERA 4LE4A 4AF9A 1JYIA 1V6IA 1LOGA 1C8NA 4MX3A 3ZMNA 5CBLA 1S0EA 2PLV2 4GMP0 4I3PA 2VVEA 2DFCA 2HWB3 4HKLA 1QXPA 2Z79A 4JV4A 3WDTA 3WCSA 2HWD2 4CP1A 1ZZ8A 2DCTA 4AVCA 5CG9A 1H1AA 4COUA 1S1AA 5I0RA 3BALA 4GWNA 3FUOA 4XFCA 3WP5A 3ACLA 1X7NA 1IQAA 1R091 1UU4A 4J1WA 4MGIE 5E8AA 3RJ2X 2HWD1 4QGMA 4X6QB 4W6YA 4XE9A 1OQDA 2BNOA 3H7JA 4K9SA 3WY6A 3T1LA 4KGGA 3RYPA 4YW4A 3B01A 2ZMNA 3LZZA 2B9UA 2WFPA 5JDBA 4XJZA 1LOEA 2PHRA 2FMYA 1C5IA 2DYCA 1ULGA 2HEVF 2X8KA 1HDKA 4CP2A 2F6BA 1VBE3 4LBLA 3WINE 3AKPA 2VMIA 3ZYIB 1FNYA 2Q1ZB 2W52A 4KWJA 1RMU1 5L73A 1YFUA 3RZZA 3GNEA 4J6GA 3QACA 1BCXA 1FV3A 4AHXA 3AMNA 1PGW2 2BVVA 3MW3A 1QJX2 2E7TA 3M70A 1ZBA2 3I54A 5HCBA 4IEXA 4YFWA 4EWDA 4QQLA 4CDQA 5JPNB 4Y20A 4RR3C 5IUQA 2WSVA 5BUVA 1CESA 4OFGA 4UBHA 4X8PA 2ZBJA 5JI9A 1LODA 5GALA 4B3NA 4J1XA 1OKQA 1SACA 2HWC2 2R062 5I8SA 1RUC2 1URXA 5DDJ3 2RS13 1ND2C 1LEDA 5D1IA 3AB0A 4IEOA 2HEWF 3MLLA 4XJAA 3B93A 1TEIA 2HWC1 3LB9A 1UU5A 2BQPA 2VOVA 1XRUA 3WHUA 4MH0E 2R30A 5FMOL 1QU0A 2UWAA 4M3CA 1FX5A 4XHBA 4TZDA 1H8TC 1A8MA 4RHV1 1RUE3 4LO4B 4AXOA 4Z2WA 4QT6A 5AFEA 4OUMA 1AR83 3NWKA 4I0BA 2E6VA 1QF3A 1RC6A 2A71A 2R32A 4YRDA 2WQ4A 1H8VA 5C9AC 2ZA9A 3VHOA 4JCKA 2R0FA 3VBUC 2HWE1 3ZXKA 4RQPB 1XYPA 2K2SA 3ATGA 4RR3B 5CA6A 2ZOEB 5E1RA 5LK5A 1GQHA 3EBRA 3RPQA 1MS3A 2EA7A 1OPOA 4OLLA 4YYOA 3M1HA 1XXNA 2WFF3 2VECA 2C0ZA 3AX4A 1NCQC 4YGCA 1O3RA 3M2MA 2ZAHA 5I93A 2VOXA 1W6MB 3I2DA 1KS4A 5DZFA 1F9KA 4ZU5A 4ATEA 2AUYA 5D8AA 2ZX1A 2WS91 3HAGA 2YV8A 2JE9A 3W59A 4XW3A 3U4XA 4ZU7A 4HN1A 3O0VA 4EV0A 4FSJA 1AR72 2XVKA 4QPIC 2JECA 1RITA 1VAMA 4RGAA 4FOYA 2JG8A 1YIFA 2EIGA 5F9TA 2AREA 2DUOA 4CEYC 1DU3D 5C9AB 5JOXA 1RUD2 5HCAA 1HRI1 1QJU2 3FLTA 3GBWA 2WIIB 4BE3A 4W6XA 4HSLA 3QH6A 3WW3A 3ZVXA 1KJRA 1O7FA 4YNIA 2KXLA 1BMV2 1DBNA 3M3CA 3ZXEA 2WL1A 2XBO3 3V0AA 5DXDA 4RGGA 1FOD3 1JTZX 2A73B 3J26N 4OUSA 2DCJA 5JCTA 3I8TA 5IK4A 4D7TA 1ULCA 3G7DA 3ZN6A 5HI0A 3MW2A 4K1ZA 1BMV1 1CD3G 3VBSA 3BB6A 1WUVA 2IFWA 3OJBA 1LESA 1PO23 1DQ1A 4JGYA 3U07A 3HMYA 1YHFA 2NN8A 1PK6A 1Y9QA 2H6BA 1ZBE1 3AMHA 3CJIC 3FZ3A 1A6CA 2H0VA 3AZWA 2ZGLA 2PQQA 4H7MA 1N3OA 5FOJB 4CEYB 4C90A 1OQEA 1VBD1 4QQ2A 4OI1A 3ETQA 4YVSC 1CAXB 4Y22B 4INDA 4JRAA 4YARA 4WZCA 2QUOA 5C8CC 3KCCA 1NXMA 1AR92 2P3IA 4HK9A 4A7ZA 4ZU4A 5JOZA 3WG3A 2D3SA 5FO8B 1S0CA 3LCPA 2B46X 1VBB1 1NQJA 2OUHA 2Y0IA 1AHSA 2WJSA 1O3TA 5GLTA 2EXIA 4FTSA 4M0NA 5DG2A 3VHPA 3CF6E 1J1LA 3FX3A 2DU0A 2PFWA 5H9SA 5FO9B 1UW8A 5EWSA 2R071 4KH9A 4IQPA 2HWB2 3JU9A 1FMD3 1HX6A 4HANA 3X29B 4CDUB 2D6OX 4B7KA 4GA9A 2R49A 1IKQA 4WVVA 5GZGA 1ZRRA 3D0JA 4JGZB 1NA1A 4AI2A 1XNBA 3MGUA 4KG0A 3AFKA 1HQNA 2Y38A 2GMMA 3AYAA 5C8CB 5DUUA 1VR3A 4YLZA 3BPZA 3VBRC 3J8F1 2DVGA 1DYKA 4Q4V3 2JENA 3LSDA 3MIGA 4ASLA 4K20A 3E5XA 1IS3A 2VVFA 1DGRN 4P9WA 5A32B 4KG8A 1NY72 1R1A3 4FXKB 1NE6A 5DUVA 1FAYA 1SLIA 5AVAA 1XU2A 4BWOA 2IXJA 1Y7BA 3OYWB 4AK3A 3H50A 4AFCA 4UXAA 1NY71 3AMPA 5KWRA 4PDWC 1RJ8A 3UJQA 3UKNA 1VBE2 1GICA 3WT3A 2PHWA 2Q4SA 4RD7A 2YDEA 1AL21 2OW4A 2VY0A 5HXVA 5IK7A 3T2TA 2XLGA 2MEV3 1HRV3 2A6VA 3ES1A 2C1FA 4MXVA 2C9AA 3MFAA 3VKOA 3B5LB 5F6KA 4QHBA 1CVNA 4HZFA 5I8YA 1YFWA 3VBRB 3VBHA 4YVWA 1YCIA 4HVOA 5DDJ2 3VBFC 2RS12 2EF6A 5KC6A 1Z7S1 3BCWA 4PIYA 1PGL2 1XYOA 2O1QA 4N90A 3BIWE 4QPGC 2ZGRA 1YJKA 3LA2A 4HMZA 3FLRA 2BNNA 2ZGQA 1R093 4RFT0 2RS11 3AZXA 2G4IA 3ZFGB 1LEMA 5J96B 1PGL1 4XBQA 1OA2A 1RUE2 2ET7A 3B3QE 5E89A 1Z78A 3KQRA 1TMF3 1AR82 5SV5A 1AL0G 1DQ5A 3ZXLA 4IXLA 1VJ2A 1WW5A 4H55A 3EHKA 1XE8A 5JMCA 1DGWX 1AR81 1VBA3 4EJRA 3KGLA 3I59A 1ENXA 3PVOA 1MZFA 3USUB 4M00A 3JD71 1RMU3 5EV7A 4Y5Z0 4P9LA 4PLNA 4AE2A 2MHFA 5I8TA 5BXXA 4EN8B 4WM8C 1EV13 1DQ0A 2WFF2 1W0OA 2DURA 2XJTA 3H3UA 4RL7A 5FQ0B 3ZYJB 1AYN3 1U5IA 2GN3A 3IIAA 2DCZA 4QPGB 1YXWA 2RE9A 3AFGA 4FPKA 3VL9A 2ATFA 1GR3A 3OGGA 1WD4A 2D98A 4CDXB 1RVF3 5GLVA 3S6PA 1AR63 2R043 4XFBA 4HK8A 2Q8OA 4D7SA 1OI6A 1ASJ3 4Z1VA 5HCFA 3FLPA 1UIKA 1KXGA 1RINA 3VN4A 2IC1A 4I02A 3WP3A 4K7JA 4BHPA 3AJYA 4L92A 4M0HA 5EYYA 2FQPA 4FP2A 4XFAA 3NV1A 2DVAA 3EXUA 4RHV3 3WUCA 1QHDA 1UU6A 2OYZA 4KU8A 2XL9A 1HQLA 3KGZA 3N4MA 2X29A 2XBO2 1H9WA 5JVVA 4WM8B 1ULFA 1FOD2 5L19A 3ENRA 3SNMA 1OPMA 3B00A 5FO7B 3HT1A 2DF7A 2HWE3 1FPN3 2VW2A 1G9DA 2P3KA 2NMNA 1C4RA 3JB4C 2ILMA 1RUI1 2XBO1 1WA4A 2I07B 1WCDJ 1PO22 5FBZA 3DV8A 5BNOC 4LE3A 3ZSKA 4FQZA 2MPFA 2DVDA 3PLQA 4LUKA 5K9YA 1PO21 4NWVA 3A0KA 2D43A 3OBRA 4Q0UA 2WZR1 3VZLA 1YWKA 1FNZA 1CJDA 1QQP3 1RUH1 2WS93 3D5OA 4IV1C 5EFUA 5LEJA 4DINB 4E4ZA 5JZGB 1NXD1 4XFHA 2D6PA 3INAA 2CWMA 5GLZA 5BNPB 4MXWB 1TME1 3TYJA 2ZCWA 3ILRA 4IV3C 4AFBA 2VNRA 3WDUA 4X6RB 4Z07A 5K8SA 3PJYA 4H3WA 4Q29A 1MQTC 2DU1A 4Y1XA 4URTA 1AXKA 1H2NA 1JUIA 5CFCC 1HRI3 1NLRA 1LU1A 1A8DA 3DPRC 3NVCA 2BWAA 1KJLA 4UW3A 4NOTA 2GC0A 1LB2A 4CEWC 1JW6A 4RQPA 2GZWA 3AMMA 4XILA 3WDXA 4YM2A 4HBNA 4RR3A 2XVGA 4FBFA 2VG9A 4I09A 4BZ4A 3TWIA 2UY8A 1BBT3 2ZMKA 1U5ZA 4AQ2A 1LR5A 2PHDA 3VKNA 2CL2A 1UAIA 1W6MA 1FMD2 4FTBA 2D3PA 4NR1A 3VDDC 4Q4X3 5KHGA 1VB4A 3H1WA 1UKRA 1F5JA 3IT8A 4ZKTB 1RGSA 1ZBE3 3JQXA 3NSTA 1O3QA 3CU7A 4KQ7A 3WW4A 2VUJA 2ZHNA 4WZFA 2GC3A 4P9XA 1G8WA 1REDA 4IV3B 4LO6B 4GH4C 3B02A 1JOJA 4MUVA 3HT2A 4V1PA 3ZSLA 1RUF1 3HIFA 4Q4V2 1VBD3 4MGKE 1WBLA 2A70A 4FPHA 1W6OB 3QLQA 1R1A2 4LBQB 4PCRA 1G9AA 2PHFA 4Q4W3 3WQ7A 1V00A 3RQ0A 3ST7A 4Q4V1 2BUKA 3KM5A 1G9CA 1IOAA 5DZEA 1CR7A 3OY8B 2PHTA 4JDMA 1KDMA 1R1A1 1V70A 4Q2FA 3K51A 5JWPA 1K5MC 1VBB3 1GLHA 4WBBA 3M8LA 4YM1A 1B35B 2DCKA 1KRIA 3RWNA 3ZXDA 3J9SA 2N7GA 4M3CF 3EO6A 1Q43A 2XJSA 3UKVA 1CJPA 4F8AA 1EP0A 1RUJ1 3VDDB 2AH2A 3N35A 2MEV2 2JICA 1HRV2 2WA4A 5ABJC 2ZZQA 5JPMB 4JTOA 1A3KA 3OD4A 4NVPA 5J37A 2R073 2YC0A 4LEJA 4GH4B 3IN9A 4YZ1A 2V5YA 1YJLA 2MEV1 4HLTA 3SXWA 1N1SA 4HN0A 3AYCA 1SMVA 2ZABA 3VKLA 4Q26A 3H1MA 3WD5A 1QXJA 1X36A 1PMIA 1CAXA 2TEPA 2EALA 1WMDA 4Y22A 1YLLA 1MS9A 1R092 1RIRA 1J3RA 1POV3 2QDNA 3FJSA 3N3HA 3BU7A 3J8F3 2D40A 1GQGA 1FT9A 2GN7A 4GQ7A 2A6YA 2I74A 4N43C 4COYA 1FV2A 1TMF2 1CQ9A 4FPCA 2IXIA 5K0UB 5H9RA 5BNNC 4AW7A 2VMHA 1QKQA 3NKTA 3MEPA 1TMF1 4PQ9A 3O12A 4AQ6A 1AJKA 3SMHA 5FREA 4TWTA 4B7EA 1W6QB 3GYDA 2Z2SB 4OHZA 2D6LX 1RMU2 5FTTC 2E53A 1S2BA 1COV3 4ES8A 5CG8A 1BK1A 1QGLA 3R0RA 1EV12 1YRZA 4ISRA 4AVAA 1AL23 3VL8A 2ZX0A 1EAH1 1VBA1 2QE3A 5I0TA 4AEDC 4AQTA 1AYN2 4N53C 3HWJA 4S2FA 4CDUA 5T5PA 4A7YA 4AWDA 4NWWA 4JGZA 1JHNA 1EV11 2BEOA 5DZGA 1H2KA 5CFDC 5KXCA 3ZIWA 2YMZA 4LHKA 1RVF2 2LALA 1AYN1 3O7OA 2R042 1AR62 5C8CA 2AZ5A 1GNHA 2R6QA 4MZUA 5BYNA 1Z7S3 4GULA 5EYXA 1LRHA 3HD8B 1NE4A 1ASJ2 1GZWB 1VIWB 3NAPA 1RUNA 1UCXA 1NZCA 3THPA 4AEJA 4MYEA 4FPJA 3R6SA 1RVF1 5A32A 3AP6A 1AR61 2R041 1VLNA 2VW1A 2JXAA 4XTMA 5T3NA 5BNNB 1BYHA 1UF2C 1UN1A 4YG3A 5ACA1 4DQAA 2ES3A 3N7LA 1ASJ1 2YGMA 4K21A 3OYWA 4RHV2 3RMYA 4AEKA 1EYBA 2WT0A 2WA3A 4DFSA 1XNKA 1DZRA 3S0MA 3HN1A 1JN2P 1XE7A 3DF0A 3TRSB 4WM7C 1XNDA 4U2AA 2UWCA 4ONUA 3VHNA 5FOBB 2HWE2 1FPN2 2CWSA 4AEDB 1Y43B 4UW5A 3O14A 2QJVA 2XLFA 3VZJA 2TUNA 4MGZE 3JD73 1GKBA 1ZX5A 1UX6A 5CFDB 1UIJA 2BTVC 1J58A 3AZZA 4OI4A 4LHLA 2CGOA 2BGCA 1FPN1 4C0HA 1Q8SA 3E6BA 3M3IA 5C4WC 3ZFFA 4O9EA 4I30A 1KQRA 5T5LA 4COZA 3ZYPA 2VXRA 1LOBA 5K7PA 1QQP2 4I0AA 1OFSA 2WS92 3NV4A 4NO4A 4XF4A 1PM7A 4YZ4A 1OFNA 1ND2B 1V6MA 1LOAA 2WNUC 3BOPA 2OZJA 4LLFA 1MS0A 5F5QA 3NV2A 2GNMA 3LOBA 3HR9A 2YUEA 1QQP1 4XBNA 3SH3A 3ZFGA 3NO8A 5T50A 1DF0A 1DZQA 4BCUA 5JIUA 4LNVA 4HKOA 1H0BA 4LBMA 2XLAA 4C1WA 1H8TB 2GNTA 4JC1A 1HRI2 4IEQA 1LGNA 1GBGA 3BTAA 4XHXA 1UPIA 2AENA 2QKDA 1RHI1 3S7IA 1ENRA 2JG9C 4PBPA 5C33A 5FPZA 1J3QA 4S2GA 1ND3A 4R9DA 4SLIA 3PMSA 1WCSA 4SBVA 4FT8A 2XL7A 3VBUB 3USUA 2OA2A 1MZ5A 2RMU1 4YSFA 1BJQA 2GAUA 1W6NA 1BBT2 4DRRA 1OLQA 3AZYA 3CO2A 3BODA 1RUI3 2P34A 4Q4Y1 1SCSA 5FQ0A 2YROA 1CAUA 3OD0A 4Q4X2 1NCQB 5GLWA 1UD1A 5KXBA 1ZBE2 4NN0A 5GZCA 1BBT1 3VKFC 1AVBA 4JQRA 1BXHA 4K40A 2ZGPA 4P9YA 3VLBB 4CDXA 2D6NA 2WKKA 2H6CA 1PO13 5SV8A 4YW3A 2BPA2 2WZR3 4Q4X1 1RUH3 4Z82A 1WW6A 3CL1A 5H9PA 2PHUA 1VBD2 4JAAA 2K0GA 1W39A 1KITA 3FE5A 4QPIB 4B8EA 2QZ3A 2RJKA 4E27A 1TME3 1LU2A 3IPVB 3K48A 2Z5WA 2EXJA 2XJRA 4Q4W2 3TB0A 1ZREA 3M4FA 1NCRA 4A2UA 1WBFA 2DTWA 2XH6A 3SLIA 3AKSA 3KLSA 4Y1VA 3MIEA 2QVSB 1HV0A 4AVSA 4QXKA 1VBB2 3SHRA 1ZZ9A 4AVVA 4XEZA 1GFF2 2D44A 4Q4W1 1O3SA 4KL1A 2E63A 3B9IA 1G86A 4CZSA 2R1DA 2Q0AA 4XPVA 4ORFA 2Y0OA 5AVPA 2YZ4A 3N7JA 1ZZ6A 2D97A 3JZVA 4FPOB 3WW1A 4HPKA 3TN93 4YG6A 3AYEA 2YYOA 2R072 2ZS6B 1LGBA 1GSLA 3CJIB 2V73A 2D3RA 1UZYA 4FVVA 2O0OA 1E57A 4BH9A 1IS5A 4Y1YA 1BVVA 4CP0A 1LOFA 1GZCA 4LBNA 2B8MA 1QOTA 2GC1A 4LBQD 5JZGA 4QQOA 4IEYA 2Z42A 2VQ0A 3PNAA 3VBOA 3AP5A 2JKBA 1SLTA 5BNPA 1NOVA 2WZPP 3J8F2 5FLHA 4YVSB 1RUG1 3KD4A 1VRH3 3WX5A 1JXNA 4DOUA 3I4IA 3WG4A 1QOSA 1MVEA 1RUF3 3ELNA 3RSJA 3TNQA 4B29A 4GB31 1KDKA 4HSJA 3FWEA 1HXS3 1POV1 1S0DA 4XF9A 1D2QA 3PMEA 1HLCA 4B4RA 4LBJA 1YI7A 2D6KA 3POWA 5E16A 4DZGA 1LOCA 2FMDA 2NP0A 3FBYA 1F31A 3KT4A 5A3MA 1J3PA 1W2UA 5DG1A 3WXPA 5FLJA 5GZFA 5JLVA 1COV2 4CDWC 2JE7A 3MPBA 2CAVA 1RB8G 1AL22 2RR13 3SH5A 4MSVA 1VAVA 1RUJ3 3MF9A 4WVZA 2HYKA 1SEFA 3WLUA 3ZSEA 3N7MA 3M3EA 1COV1 1KS5A 4XJWA 2HEYF 5T54A 1S0BA 1I6XA 1A78A 5LEKA 1OHFA 2UYBA 2NZ9A 4K6BA 1JUHA 2WT1A 1UZZA 4YW5A 2DUQA 4COWA 4LA2A 1BEV3 3NW4A 5D8AC 1AUYA 1Z7S2 4IESA 1HV1A 1ZYBA 4BMEA 3AK0A 5L7OC 2YGLA 2BFUS 1ENQA 3QOPA 3MPPG 5A3LA 1N1TA 1W6OA 3A0NA 3VZMA 1UL9A 4JVAA 3SH4A 5JI7A