5C5UA

The crystal structure of viral collagen prolyl hydroxylase vcph from paramecium bursaria chlorella virus-1 - truncated construct
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
208
structure length
187
Chain Sequence
b'HMEGFETSDRPGVCDGKYYEKIDGFLSDIECDVLINAAIKKGLIKEQTWFMPGEHEVIDKIQKKTREFLNSKKHCIDKYNFEDVQVARYKPGQYYYHHYDGDDCDDACPKDQRLATLMVYLKAPEEGGGGETDFPTLKTKIKPKKGTSIFFWVADPVTRKLYKETLHAGLPVKSGEKIIANQWIRAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prolyl 4-hydroxylase
molecule tags Hydrolase
source organism Paramecium bursaria chlorella virus 1
publication title Structure and Mechanism of a Viral Collagen Prolyl Hydroxylase.
pubmed doi rcsb
total genus 51
structure length 187
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 5c5uA00
5L9RA 2G1MA 5LB6A 4BQXA 3OUHA 3GZEA 4NHYA 4ZONA 4UWDA 2JIJA 5C5TA 3KT4A 4Y5SA 5L9VA 5EPAA 4NHXA 5L9BA 4MHRA 5IATA 4NMIA 2Y33A 5C5UA 4XCBA 5DAXA 5M0TA 5LBBA 3NNLA 3NNJA 5LASA 4XCAA 3HQRA 5EQUA 5LA9A 3HQUA 2RDNA 5LBEA 5EP9A 2RDQA 4BQYA 2JIGA 4Y5TA 4XABA 3EMRA 2FCTA 3MGUA 2FCUA 5IAXA 5DAQA 5ERLA 5HV0A 5LBFA 2A1XA 2G19A 3BVCA 2Y34A 3W20A 3NNFA 5DAVA 4JZRA 5DAWA 3W21A 3KT1A 4J25A 3PL0A 3OBZA 2FCVA 4NHKA 4BQWA 3ITQA 4NHLA 2RDSA 3OUJA 3DKQA 4KBZA 5A3UA 5LATA 4MHUA 4ZPIA 3NNMA 5LBCA 2HBTA 5DAPA 3KT7A 3GJAA 3OUIA 3GJBA 2OPWA 2RDRA 4NAOA 2HBUA 4XC9A 2V4AA 5IAVA 5HV4A 4XACA 4IW3A 4Q5OA 2RG4A 4NHMA 4XAAA
chains in the Genus database with same CATH superfamily
4FPLA 1UWWA 3KGZA 5FBZA 1H8VA 1QHDA 3WNKA 3AKPA 3AYCA 1EUTA 4DUWA 3GALA 4WM8B 4M3CE 4QX0A 1EAH1 3RS6A 1U5ZA 4AHZA 4CEYA 1LJ7A 1SBDA 1IHMA 1QY4A 2HKXA 4R52A 4DIQA 5JZGA 1PO12 3MBWA 4UW4A 5FMBA 2WQ8A 3M70A 1GKBA 1K12A 1BQPA 2ZGSA 3DPRB 5FKBA 4L92A 1SFPA 4LOTA 4AGVA 4A7YA 1AR83 3B01A 3NV3A 3GNEA 3K51A 2IXIA 5DAXA 4BE3A 5I8TA 3I2DA 1NYWA 2WA3A 4P5HA 5BXXA 3KF3A 3ZO0B 3MHZA 1YQ5A 4XURA 1DBNA 3B02A 3HQRA 4WVZA 5F5IA 3MIEA 4RS5A 3ELNA 5HXVA 3VV1A 2WS91 3H0OA 1W2AX 3K77A 3ZFFA 1JZ7A 2WNUB 4XFFA 1YFXA 1PGL1 4MOAA 1QQP1 2JKBA 3V65A 4KWLA 2UY9A 5EP9A 3KVBA 1XU2A 1O8PA 1Q8SA 2WZ8A 5DZFA 3IIAA 1UAIA 1V6JA 2JDHA 3VD5A 2YC2A 1XJAA 4XMIA 4LBNA 4EJRA 1TMF3 5LRSA 2VVDA 2ERFA 2UWBA 4E8CA 1JYIA 3ZMNA 3BU0A 1ZA7A 4YVWC 1ZBA2 5C8CB 5EJZB 5I0UA 1ZZCA 5JXHA 2AACA 2OPKA 2PN5A 3WSOA 1LOFA 5FPZA 1RUH1 2NN8A 1AJKA 3CHXA 5FXZA 4ISRA 5APAA 3A0KA 5I0SA 2VUJA 2TBVA 1PMHX 3JB8A 5JVVA 5A7PA 3FUQA 3RI8A 3HMYA 1HV0A 3PIGA 3ON7A 4FXGB 4BLIA 3SEEA 4N53B 5E6HA 5IYYA 4KL1A 4YGBA 5CFCC 2W2IA 4N7UA 5FPUA 1D4M2 3WCSA 2VZQA 4IESA 5E88A 4BMEA 4E9KA 1VBA1 1W8HA 2PLV1 1MS1A 2X5IA 2W46A 2VMGA 4AZZA 1V9U2 2YHJA 3MIBA 5DXDA 5C8CA 5KC5A 4OUMA 4YM1A 4M3CF 3DECA 2DBNA 1AR73 1NY72 4JDMA 2GMEA 1OOPC 3LIHA 2HJIA 2I07B 3I59A 3GHMA 4INDA 4XIOA 1O4YA 1UQXA 1ZZBA 1GR3A 3JUUA 4GB33 5FYYA 2G9FA 2XJUA 1FT9A 3A7QA 5CFDB 4FP2A 2HH9A 5FLJA 2QBXA 3HVDA 1Y9GA 1ULOA 3CJXA 5DABA 4AGRA 2P4EA 4CCMA 4Z8BA 1J3RA 2ORXA 3ZXEA 1TEIA 4FPGA 1OFSA 2P3KA 4DEVA 5F37A 4RHV2 1WCQA 1GNYA 2QDNA 5BYNA 2Y64A 4LHSA 5FY0A 5D21A 2A6ZA 2EIDA 3NV2A 4FI9A 2YV8A 1WKYA 4OCTA 2NM1A 2HWD1 2P5BA 4CCEA 3AKRA 2DBIA 5FO9B 1AZDA 2WC2A 2D6LX 1XQNA 4IV1B 5FYSA 1XE7A 5FIXA 4Q4X3 4XF1A 1ODMA 3GZEA 1LESA 1FMD3 1Y4WA 2XBO3 2RE9A 2ZGTA 5L19A 1MEC2 2J1RA 1EUUA 4BWOA 4FOVA 5LY1A 3N36A 3U0ZA 4DY3A 2Y6JA 1XSRA 2RHPA 5SV5A 1V6MA 1VP6A 2CY6A 1LTEA 2HYXA 1FPN2 1NCQA 2H6BA 4HBNA 4QPIC 4TXWA 2C5DA 5FPVA 1DF0A 5F3IA 1OUXA 4QX5A 2XVKA 3KWVA 5IVYA 5L9VA 3VDCA 4G4FA 4QB6A 2BNNA 3OSDA 3DCQA 4QU2A 5D8AB 2OUHA 4AAPA 3JQXA 4KBBA 1R093 3CL1A 4NMIA 2Y33A 2WQZC 4UFHA 3M3IA 4CCJA 5C5UA 5CEHA 2ZGMA 3DYMA 3AKSA 1S0EA 4XCBA 4N43B 3ZSMA 2RMU3 1IOAA 2IXLA 4K1ZA 3VL8A 4Y4RA 1PVXA 1WBFA 4S2GA 4GMP1 3LDRA 4IEQA 3FFQA 1U5XA 3VDDB 3OD4A 4YW6A 4CRQA 1MZEA 4DNYA 5BY5A 4A4AA 1VBC2 3MF9A 4B1MA 4ISQA 5L73A 1W6QB 3UKTA 1F15A 2J1UA 2JIGA 3R4DB 5LEJA 2JB4A 4IERA 3WW3A 2B9UA 2UY8A 3EMRA 1QWRA 5I8SA 2DVGA 2PXJA 1OQDA 1F8VA 2JG8B 3OPZA 5LCWL 2JECA 3ILNA 1M4WA 4QXCA 4MH0E 2ZGNA 5GLWA 3ZFFB 4RS5C 2A73B 3CQOA 3W9AA 2CNAA 2J1VA 1Q8PA 1GMMA 4XF4A 5TSWA 3VBFC 1UKGA 2G19A 3WHUA 1D0GA 4QQOA 1STMA 1X50A 2C9AA 4JTOA 4BQ3A 1WZXA 4XUQA 5C70A 1SCRA 2KR2A 5A6XA 1SLLA 1WMEA 2WUHA 1DDLA 4Q0PA 3EYPA 5DN2A 4UW3A 5A1FA 3MZHA 4JV4A 2PAEA 2PYTA 1WA6X 4DUXA 1YJKA 5A3OA 2NMNA 3VZJA 1UX6A 3QD6A 2JG8A 4IE6A 5AFBA 2Z5WA 4LUMA 3K2OA 4GD4A 4Y26A 3I7DA 5J36A 4JX0A 2ORZA 1US2A 5LATA 2YGLA 3U07A 1B09A 4OFGA 3AK0A 4AQSA 2Q0AA 4GJZA 2ZX3A 3O0XA 1PK6A 1O8SA 1SLTA 2JICA 3KT7A 4NIGA 4XDPA 1H2LA 3KSCA 1AXZA 5BNNA 2QQMA 1W90A 1LKNA 3GBWA 4KNCA 1GANA 1HRV3 1JYXA 2AGSA 3R0RA 4AVAA 2CSGA 4QQLA 4HK9A 1SCSA 4QD2A 3JD71 4OMDA 3AL6A 4XUOA 5C3QA 3N4MA 1PMJX 4OHXA 4XAAA 1YRZA 3RZLA 4LK7A 5FYHA 5EJ3A 3WQBA 1RUH2 3E6DA 1GOHA 2MPFA 1PHMA 1R083 1KD7A 3AP9A 5FZ4A 2AEZA 4IEVA 2XLFA 1LHWA 3AMMA 4ZONA 4CP2A 2BGCA 3IM0A 1UZ0A 3O0WA 1ASJ2 5IK5A 1ND3C 1W04A 2ZMNA 3AB0A 5L7OA 3BTXA 4A3XA 1DYKA 3TYJA 1OPMA 4HSJA 4IV3C 1V9U3 3TNQA 3KHBA 3SHRA 5FYUA 1FOD2 4XDOA 2Q1FA 2GH2A 3QH7A 1B35C 3FHQA 2RS12 3TEYA 5IATA 2YDEA 3VKNA 3ZFGA 3DF0A 1SG3A 2WO7A 5FY1A 5IK4A 2FMDA 3MICA 1AX0A 1H1MA 2UWAA 3C7OA 4JGZB 5LK5A 2GC2A 1OD3A 2NPIA 4MXVA 3FJSA 1Z7S2 3CLPA 2FD8A 3ZN6B 3VHNA 3WG1A 1A8DA 1HB4A 2HWF2 2CL2A 2VUAA 4XZPA 1PGSA 1FMD2 2R062 2Y60A 2D6KA 4QGNA 1Z0HA 4M0HA 3QACA 4PJYA 3RG0A 2RDNA 4P9YA 2DVDA 3I3EA 2VNVA 4LA2A 3HJRA 1VBA3 1DYPA 1F31A 1PX4A 4LUKA 3RYPA 3T2QA 3H8XA 3SCHA 4CSWA 3JZVA 1PO13 3CF6E 2B46X 1CWPA 1W8NA 3LDBA 4CCOA 1YFUA 4FPEA 1LOGA 4QB1A 3WG4A 2C1FA 4FFFA 1X82A 2WLQA 3WUDA 3NJYA 4UI9L 3S7IA 5B2GB 4LR4A 4IDZA 4JGZA 4PCRA 1TNRA 4MSVA 4PDWB 4PT6A 3VKLA 4AEMA 1C1LA 3KCCA 5IHRA 1XOYA 4GMP3 3MFAA 3WG2A 5FPLA 3KD4A 2D5FA 2WKKA 2B8MA 4FAHA 4RHV1 5A1AA 3AXEA 3CO2A 1MEC1 3OPTA 1QIQA 3GZAA 5GZFA 1HRI3 1SMVA 4XXAA 5JSRA 3NMBA 3O12A 3DXTA 2YXSA 2JE8A 5DAVA 3ACFA 2BW8A 2DWRA 5DG2A 2QQOA 1UPSA 3SH5A 2O14A 4Z1VA 3MIDA 3L2YA 2HWB2 2F17A 2H6CA 1VBC3 2AYHA 3RYRA 2OX0A 3K48A 4QQHA 3O1TA 4NHLA 1H30A 5KHJA 1V70A 4QKBA 3OUJA 4QKFA 3FX3A 1DZQA 3NAPA 3S30A 4SBVA 1YI7A 2VAUA 4F3JA 3LE0A 3UGGA 1Y9QA 2A3WA 5BNOA 2RS51 4FPCA 1DGWX 3ZFEC 5C3OA 3ZX7A 5C3SA 2B39A 2AEYA 1BJQA 2DTWA 4M4PA 2R073 4Y1VA 3UETA 4D7TA 4ES8A 2VBDA 1KRIA 4XBNA 3VDAA 4XHBA 3IDAA 3G6JB 2DUQA 3ZN6A 1AX1A 5L7OC 4PF1A 3H7JA 4QGLA 5FO8B 2YUEA 2HBUA 4XC9A 5HI0A 1SBFA 2VECA 3O14A 1YUDA 1RJ8A 1UY3A 3PNAA 3PU3A 4H3WA 4CXYA 3Q8CA 2DYCA 2QQUA 4Q4Y2 4ASLA 2BRTA 1JU4A 3C8XA 2C9KA 2PHRA 3NAPB 4Q0QA 1F4AA 1F9KA 2AZ5A 3ILFA 3U11A 1PZ7A 4JGYC 4UBGA 4BQ5A 1SDDB 2ZABA 2XB6C 3ZSEA 5FYIA 4EZ4A 3POSA 1QOTA 1RUF1 4I3GA 4NHYA 4Q4V1 4XAEA 3D0SA 2GNBA 2FDIA 1C5IA 1ZZ7A 3ZYBA 3A4UA 1XNCA 3ZSKA 5C5TA 1HN1A 3U37A 4P9XA 2CGNA 4URTA 5BNPB 3VHPA 1YFWA 2JB8A 3O1VA 3CBNA 4D0QA 3MV01 2QVSB 4FP3A 5T55A 2JE9A 1ZX5A 2IZWA 3SCGA 2KM2A 4WZFA 3NJXA 1HRV1 4H7MA 4RQPA 5IVCA 1HRI1 1AR63 1U0AA 2XJPA 3KV9A 4AXOA 4I0AA 1Q43A 3VBOA 3IAQA 3FC0A 1A6CA 1ODNA 2NMOA 1FPN1 3WQ0A 5LW9A 4NIHA 1GOGA 1U5YA 4XCAA 3VD7A 5F7UA 2DCTA 1AJOA 5E16A 3N9MA 4XILA 2GNTA 5EQUA 2DDUA 5KC6A 2VCBA 4MADA 2JG9B 5HCAA 3BUCA 1V0AA 3ASIA 1XC6A 1T2XA 5ACA2 4L99A 1VRH1 1OF3A 1GWKA 2HWF1 1PO23 3CJIC 3UNPA 2PQQA 4Y1UA 3ST7A 2MNGA 1QMJA 3WP4A 1L7LA 1LU1A 2IC1A 3FLPA 3PLQA 1W6PA 3JQWA 4CDXA 3WINE 1VR3A 2WWUA 4IE5A 3NKTA 4JGZC 5IAXA 4Z92B 3DKWA 3O1UA 1AYM1 1H9PA 2DURA 5FLIA 1XE0A 2BBAA 1R082 3E5XA 4J6GA 5H9PA 4AI8A 2ET7A 2CGOA 2VQ0A 3M4FA 4Y20A 5FZOB 5FZHA 5ISLA 1I9RA 1NXD1 2P17A 1WGPA 4XFBA 5C4WB 1W6OA 1SZBA 2E6VA 1NOVA 1BHGA 4HZFA 4LEJA 1N3PA 1C57A 2R063 1GZWB 4AFMA 3EB7A 4LO4B 4CDXB 1UYYA 1SLAA 4BQWA 3DGTA 5EJ1B 4QHZA 1W8UA 4AI1A 3ZOIA 1U12A 4WV8A 1FNYA 2K2SA 1ASJ1 1OKOA 1N1SA 1UX7A 4Y20B 1OT5A 5CVRA 4KG0A 2WYSA 1XE8A 4CDQC 5C33A 1G9AA 5E1RA 4LE3A 1U5IA 3AMHA 3HNBM 2VMIA 4IEZA 4EE2A 1ND3A 2D3PA 3VD3A 3OUIA 3GJBA 5A3WA 1AR61 1YWKA 3PUQA 5JZGB 1XNBA 1K5MC 2AUYA 4XUTA 2G9GA 2AREA 4A44A 5BNOB 1H2NA 4JVAA 4LKFA 1S55A 3I3QA 4GMP0 4LKDA 4LIVA 2YB7A 3CZJA 3RJRA 4N9IA 2X05A 1IS4A 4D7YA 3BTYA 3KM5A 3BPSA 1POV3 3AFGA 3FFZA 4L9BA 3FUOA 4NPMA 4PI2A 5L9RA 2W39A 1F5JA 2VY0A 1FX5A 2V09A 5J98B 1QQP2 1UYPA 2VVFA 2VZ3A 3OBTA 4LPLA 1DCSA 1PX3A 4LO5B 4XZUG 4DINB 2P3JA 5T3NA 2WIIB 4CP1A 1ND3B 3MEPA 4KU7A 3J7NA 1C8M3 4Q4Y3 2MEV2 1FYUA 1CPMA 4NVPA 2SLIA 1H6YA 4RYDA 5FZFA 3ORJA 4CUBA 2AR6A 4COUA 4OI2A 4DXZA 3I3BA 3RYKA 2ZEYA 3PU8A 4AEDA 5BUVA 4S2DA 3IN9A 3PVOA 5D8AC 5LK7B 2CAVA 3HR9A 1ULGA 1W2TA 2PHXA 4QDRA 4LOSA 3KV6A 4QKDA 4F83A 2P6HA 2ZZQA 4F8AA 5FOJB 5HPOA 2IUWA 1KITA 3BODA 1GSLA 4UW6A 5IW0A 3ACIA 1UMIA 5KHHA 2R043 1X7NA 2W1WA 1Y9MA 3WDTA 4IL7A 3K4DA 5FZ3A 3ZIXA 1UU5A 3ZVXA 3T08A 3OPWA 4MYEA 3J7LA 2PAMA 4N53A 2W1QA 3OGSA 1W2NA 2R6QA 4AEDB 1BEV1 2A71A 2GNDA 3WDYA 4E4DX 2BWCA 1RMU3 1LOFC 4HPKB 3PVBB 3E5QA 2FDFA 4MXWA 1HDKA 4Q0VA 5IVVA 1DGRN 4WVMA 3RMXA 5CYYA 3KZ4C 3ETPA 4UYBA 3LD8A 4XFHA 4Y33A 1SLBA 1RUH3 5FZLA 3VKFC 2D98A 1ZBE3 2A1XA 2Q8DA 4HVQA 2RS11 3O1OA 1W6NA 2R0FA 2VUDA 2WDBA 2IFWA 3K46A 4OZXA 1IPJA 4Q4V2 5A3PA 4JQTA 5CFDA 3RGBA 1BCXA 4FPYA 4HANA 4EYUA 4Q4W2 1JU3A 3BB6A 4B7KA 3WVJA 1RUJ1 1RTVA 1LOEA 3BU7A 2A6VA 2VW1A 1RVF3 5A6YA 2V72A 3U75A 2ES3A 4RR3B 5ACA3 4XF3A 1QJZA 1TG7A 2GZWA 1AYM3 2ZHNA 3E5UA 2QFEA 2XDVA 2VQAA 5C4WA 2IVJA 3OJBA 4H14A 4BQ1A 1WD4A 2D6MA 1AR71 3B7MA 5FO7B 2LROA 2W87A 2XKPA 3WP3A 1RUNA 1W6NB 5EXOA 5BV6A 3IDBB 3NNMA 3T09A 2BQPA 4HK8A 1SLIA 5DPNA 5FK8A 4LTAA 3SH3A 3WF0A 2WT2A 4ET7A 3V56A 4N9HA 3MLLA 4NPLA 4P00B 3SITA 1H2MA 3AZYA 3I8TA 2LUWA 1K5JA 1O91A 1W99A 4IGOA 4OUEA 1OA2A 5FYTA 4JKMA 5A7SA 4K40A 3I3DA 1OLRA 4AOCA 3HQXA 1GWMA 4GWNA 4EROA 3D5OA 2DF7A 1RL3A 3N7JA 3PUSA 2XH6A 2RM23 4RSUA 4JGYB 3FLTA 3T4VA 5B4NA 1OOPB 1SQ4A 4HVOA 4K6BA 1HXS1 3PMEA 1O3QA 1NA1B 1UOBA 2RJ2A 4NE9A 2B9VA 2VOWA 3OEAA 5LA2A 3POGA 2K9ZA 4RD7A 3C7EA 4BLJA 3G7DA 1O59A 2QE3A 3SXWA 3H3UA 2WNVA 1QOSA 4HL0A 1RHI1 5EPAA 3WNNA 3POFA 4FPHA 4UFLA 1QDOA 3ZYGA 2LALA 1REEA 3LDKA 1N1VA 3ENRA 1KDMA 1R1A1 4QX8A 2Z69A 4AQ2A 4GQ7A 1LU2A 3P3NA 1DQ5A 2BPA2 4GH4A 4RGAA 5FZ7A 4WM7A 3MW2A 2PA7A 3ZMOA 1W8TA 3O7OA 4MXWB 2HEYF 4GA9A 2XPJA 1RUF2 2GNMA 2HWE2 2JE7A 4CA9A 2C0ZA 3HQUA 3TB0A 1DQ4A 1PNFA 2W92A 1MS4A 2WNVB 5F8PA 4YZ1A 1BEV2 4GZ9A 4QHOA 2WSUA 1DQ6A 2E31A 2PQSA 4Q4Y1 1E5IA 3VBHA 3ZXGA 4A45A 1CAUA 3AMPA 5F3CA 2UYAA 3I2HA 4LK6A 4U2AA 3H1MA 4DO0A 1K42A 2ZHMA 1HJGA 2UURA 4QWNA 4ZS3A 2E7AA 5F3EA 5FYBA 1AHSA 1WWYA 5EIYB 3VUOA 2DU1A 1X8MA 4QAWA 1UL9A 4KWJA 1GQHA 1X33A 5C4WC 2EALA 1QKQA 4HMZA 4FO9A 4WM7B 1VMJA 1FAYA 1MS3A 1WBLA 1W8OA 2OA2A 5J96B 1LNSA 1UF2C 2OQ6A 2ZGOA 5BNNC 1A78A 1WMDA 4NIAA 4GIQA 1D4M3 1KJRA 4B8EA 4BIFA 4BZ4A 1WA4A 3VBHC 3VHRA 5A1LA 3CNAA 4IEPA 4I3PA 3WNXA 1SEFA 2GAUA 2VM9A 2VCCA 4LO8A 1AXKA 2DCJA 2X10A 2YBPA 4YZ4A 5JCTA 1LR5A 1NAEA 4RL7A 4AW7A 1TVGA 4K9SA 3RZGA 1RUE3 2ZEZA 3IPVA 3N7LA 4JDNA 3WT3A 1YLLA 1VBE2 1QEXA 2ADDA 5IVFA 1UYZA 1UYXA 3DKQA 4KBZA 1BKZA 4A6OA 4RFT0 1SPPB 1W6MB 1GP6A 2ZS6B 4W65A 3DN7A 4BMBA 5KBFA 1ULCA 4LITA 4LORA 1VMHA 1R64A 3UGHA 5JZGC 3WP5A 2C6SA 2Y6FA 2YROA 3FLRA 1JYVA 4FPKA 1UY1A 2ZKLA 1XNDA 3AP6A 1V6OA 5GZDA 5L7OB 1R1A3 4QXBA 4RR3C 3VBFA 2D40A 3LFMA 3VZNA 2PFWA 4Q4W3 2A75A 3OGGA 1M06G 1AF9A 1J3PA 4AVBA 3HNMA 3WXPA 4AFAA 1RVF1 4I02A 1R092 5GZGA 1RUC2 4A6SA 1KS5A 1WCKA 1NCQB 3FHIB 2W9XA 1NQDA 3OBAA 2PMWB 3PMSA 3HPNA 4NRPA 1V9U1 1HQNA 2ARCA 1OKQA 3PVEA 5D8AA 1HV1A 2Z4FA 3V64A 1UOFA 4WM8C 2JIJA 4KG8A 5A7NA 2Y6HA 4DUVA 1W8FA 4AR2A 5ANQA 1ZZ9A 4XOGA 2DCKA 5E8AA 5FBJA 2HWE1 1VBD1 2VMDA 1TQ5A 3ACHA 4JCKA 4Q8LA 4XJ8A 1EP0A 1EPZA 1PZ8A 2ZACA 2Q8OA 1ZYBA 1QH7A 1COV1 3ZN5A 2ILMA 4ATFA 5CG8A 2X8KA 4QPGB 4AF9A 3WCRA 4HT1T 3ZKUA 4X8PA 4MUVA 4PDWC 5AFEA 3WY6A 4DY5A 2Y6GA 5C7GA 4PLOA 1MVQA 1YXWA 3O1PA 3DXUA 5CKQA 3NJZA 3I2KA 4PI0A 2I74A 3IAPA 1CESA 1HX6A 1VALA 1MZ5A 3V0AB 3ZKYA 5JPNB 1DHKB 4L2NA 3SEPA 4A42A 1S4CA 1BVVA 2XUMA 4GAZA 5FUPA 1UNBA 3RZJA 1HW5A 3GBFA 4XQ4A 2FQPA 1OHFA 4NIDA 4XABA 4HKOA 4XQWA 3BCWA 3JD72 3M3CA 2QQLA 4K7JA 1ZA4A 3MGUA 5DQ0A 1HRI2 4HOOA 1QXRA 1VB2A 4QPGA 4XE9A 5HXMA 5LEKA 3E6CC 4AI9A 1UU6A 1S2BA 5D2AA 2Z2SB 2OW4A 4DXTA 2W5FA 4JAAA 2EIGA 2IFRA 2DCZA 5J3UA 5FY7A 1S0CA 1YNAA 1UXZA 3ZFEB 4D3WA 3I2IA 5AC91 4IXLA 4AVTA 1UKRA 2WNVC 4YM0A 4EZHA 1SPPA 5K0UC 3W58A 3KT1A 4XBQA 3VBUA 3AP7A 3LIGA 4YVSC 2FCVA 4N53C 4HKWA 1E5SA 4QPWA 1CZTA 1RUD1 2QNKA 4YARA 2UU8A 1QJEA 1RUG3 4MG2A 2P2KA 3T2OA 4X8NA 4QT6A 4GB31 4IEXA 3C7HA 3KLSA 5FZ9A 2VOXA 3KHCA 5C71A 5JMCA 1ULFA 3USSA 3A22A 1YIFA 2YYOA 4Y1ZA 4ZU4A 1VBD2 4AQ6A 4FTEA 1JOBA 4U36A 4GJYA 3WP6A 3W5MA 4NUBA 1ZBE2 1QJY3 1RINA 2D7FA 4IE0A 4UBHA 2Y6KA 5SV8A 3VD9A 5CB7A 2RS31 3O5SA 4C90A 1AR72 1ENSA 3MIFA 2V4AA 4BU2A 1W3VA 4YW4A 1JZ4A 1K3IA 4NROA 2Q4SA 1W6MA 2BBVA 1PGW1 2VE1A 2A6XA 3U1XA 2E51A 3T0DA 1JODA 1YIPA 1QXJA 2BTVC 4NHMA 2VMHA 2XHNA 5IWFA 4YW7A 3NQHA 1BZWA 4BYYA 2ZXQA 3WDVA 3PUHA 4HVRA 4ITCA 5I8YA 1MS8A 2WA4A 2ZGKA 1HQWA 4UWDA 4FCAA 2OZ6A 2PLV3 4NRQA 3AMNA 1IPSA 5AC92 3PTRB 3UV9A 1WW6A 4CUCA 1FOD3 2HWC2 3T3YA 3TN93 3NRUA 2JD4A 3J7HA 3R05A 1MPXA 1QJX2 5JUVA 2O1QA 3HN3A 1ZRCA 4HKLA 1FV3A 3AP5A 1NQJA 3N35A 5A3TA 3RQ0A 5BPXA 2XUEA 4MHRA 2JDNA 3LA7A 2GC3A 4PIXA 3ZSJA 3HBKA 4O9EA 4LBLA 2H0BA 2GC0A 1PO21 1W0PA 2HWF3 1PNGA 2YFUA 4OQ9A 1ZM1A 4BK5A 1DYOA 1DFQA 3B9CA 2WWJA 4YVWB 1ZREA 1C5HA 4EN6B 1OI6A 3OEBA 4IGQA 4CU6A 4D94A 2GP3A 3GZTB 3B9IA 5FMDA 4BM8A 3C3VA 2D3RA 2Q8CA 5JR7B 4XFIA 1YHFA 3SKVA 2F4PA 1RITA 1YQ6A 1UMZA 4YRDA 5LBEA 1JW6A 3EJKA 1G9DA 4CVUA 1UY2A 1S1AA 1D2QA 1WCSA 4Q0SA 1OH3A 4RN5A 2ZAHA 4BQYA 2ZOEB 1S0FA 3KCXA 1DZTA 4GH4C 4IV3A 5FUNA 2I2SA 5DG1A 2OKXA 2CAUA 1O7FA 4A41A 4R9DA 5JXJA 1JZ2A 2ZEXA 1GUIA 4IEUA 1TNFA 1O5UA 1SDWA 2BVVA 2D44A 5HV0A 4QX3A 1UXXX 5LBFA 4Q1PA 4RGGA 3PIJA 5FKCA 1F35A 3ZXAC 1LENA 4QQ2A 5CBLA 2YBSA 1AR82 2EF6A 4W6XA 5F1RA 2WZR1 1I1EA 1VBC1 5JOWA 1RIRA 2WT1A 3I2GA 3LQCA 4R4ZA 3NNFA 2HEVF 1SFNA 3KV4A 1CAVA 4MLOA 3NWKA 4O61A 4UOJA 3BI3A 5IK8A 3LSDA 3E97A 2W47A 5FK7A 2DVBA 1W05A 1BMV1 1REFA 4UAPA 4YG3A 3IWZA 2V5YA 3ZDSA 4AGGA 4JKLA 4XJWA 2R49A 2WBKA 3I2FA 4TWTA 3MUZ1 3Q8AA 4E4SA 1D7PM 4XETA 4YFZA 2BVBA 2GH8A 4AFCA 1SBEA 1J58A 5C3PA 1G7YA 2EA7A 2A6YA 2Y8KA 3H50A 4QPYA 1US3A 1LGCA 4P14A 3MO4A 4HFSA 4ZPIA 3NW4A 5F5CA 3WDWA 3VB9A 2W95A 5A7WA 2ZGPA 2VW0A 3IDCB 2WO1A 1OH4A 1GZCA 1QOOA 4DOUA 4ZHNA 3J8F2 3RJ2X 2IVIB 3MUY1 4KWKA 5CAZA 2WT0A 2X29A 2BWAA 2D43A 4H7LA 3H8UA 2JDKA 3GM8A 4LLFA 3WUCA 2DTYA 3BKZA 2JDYA 2VCAA 2IXHA 2FBEA 1C8M2 4LO6B 1AX2A 5KR7A 4OHYA 1W0NA 4QB2A 1DG6A 1RUG1 4KMQA 3ROUA 2SBAA 2VMCA 3A23A 3WLUA 3MI8A 2OT7A 3OCPA 4XIKA 4BPZA 5KHGA 4MGIE 2R042 3ZYPA 1UMHA 2Y0OA 1B35A 1URXA 1ONAA 1QNWA 1RUE1 4LJHA 5DUWA 5A7WB 2W68A 1PM7A 4XVHA 1W9WA 3KQ4B 3VHOA 2W08A 5LWBA 2WFF2 1VRH2 3TOJA 1JOPA 1N47A 4YVWA 2JENA 3GCXA 1POQA 3LOIA 5EYYA 3MW4A 4YGEA 4CDWC 3VBSB 4F7ZA 1HKDA 1WW5A 4UFIA 4NAMA 4PLNA 5AVAA 4E2SA 3NNGA 5I0RA 1H4HA 1W03A 1J84A 5JR2A 5A3NA 4CU9A 1JTZX 5IFPA 2ATFA 1MS5A 4DXSA 5FZ0A 3U78A 2CWSA 5LZ6A 1KEXA 4NJ4A 3B5LB 1RXFA 2I45A 3KV5A 4ZXEA 5JIUA 4GWIA 3JBG2 3UKNA 4AVCA 4C1XA 1NKGA 4RA0A 3BALA 1GP4A 1NX9A 4BXSV 1CX4A 1Q8VA 3INAA 3POIA 2XONA 5FFOC 3WQ7A 4WVVA 5GZEA 3URFA 3LPFA 3RWNA 2QUOA 3C7FA 3WDXA 3SKJE 4CU7A 1JUIA 2AH2A 2J1TA 2OQ7A 1IQAA 5A33A 5LRRA 4YM3A 5HBAA 1RUD3 2B42B 2LM3A 2W91A 1FOD1 3CMGA 4P9GA 4TN7A 4ZKTB 5KHKA 4PIZA 1RUOA 2ENRA 1ZRDA 1V6LA 1G9BA 3PUAA 4QX2A 4JRAA 4UFKA 4LBMA 1ZRRA 4C8DA 1OPOA 3U4SA 4V2VA 2WO2A 3AM2A 3S6PA 4CTEA 3VBOC 1O4ZA 2A70A 3KQRA 4CEYC 2VBBA 2EICA 4XJAA 2A5ZA 4XBLA 5FYVA 5FY4A 4LBKA 1PGW2 1UW8A 3E6BA 2WYFA 4WM7C 4FTSA 2DFCA 4SLIA 4Q26A 4B29A 1R1ZA 1O3RA 5FP8A 5FZ1A 1Q5OA 3KCYA 3LGRA 1C8NA 4ZU7A 2QQJA 3FBMA 1MZ6A 4FAGA 5A7QA 1XNAA 4MX3A 3OGJA 2KXLA 2RS33 1TME1 3PL0A 4QU1A 2EXJA 4CXXA 4ES9A 4JKKA 2LS6A 4E2QA 2QKDA 1D0HA 2O0OA 5FY5A 1W39A 1F4HA 3SCFA 3FBYA 3CDZB 1MQTA 1JUHA 1ULEA 1XPWA 3AJYA 1OOPA 2P6CA 4AL9A 4CDQB 2ZMKA 3MLKA 3AMQA 5J48A 4YSFA 1DGRA 4CDUA 3BGAA 3DEMA 2WS93 4DEQA 1NCRC 3C7GA 2RM21 3HOBA 4MGYE 4QM8A 4JHZA 3ZFGC 3EBRA 1WW4A 2BEOA 4L11A 1ZRFA 1Q8OA 3NKGA 1S0JA 1YEWA 2D3SA 1UZWA 2OS2A 2XKOA 4W6WA 1UCXA 3WQ1A 3X29B 4CXWA 3ATGA 3J4UH 3RVHA 3JCIA 1OLQA 4YZ5A 5LA1A 2WFPA 5FR3A 5HV4A 5J7MA 5JLVA 1TZOA 1SACA 2RJKA 1UOGA 3LZZA 1MS9A 3D3AA 3K3NA 1RXGA 1J1LA 2G1MA 3MFCA 3HAGA 3NAPC 3ECQA 1DZRA 5DUUA 5LB6A 3MF6A 4MV2A 3OUHA 2JDPA 5FYMA 1DQ1A 1H8TB 2VZOA 2XJVA 5FYZA 1GLHA 4K3UA 1VPHA 4QXKA 1S0IA 3OOXA 4YG0A 3THDA 1AYN1 1Q56A 1C28A 1RC6A 4OHWA 3T1MA 1JHNA 1ACCA 2QJVA 1E5HA 1HB3A 3AL5A 2ZTNA 3K4AA 3KT4A 3N3HA 4EWAA 1YQ8A 1W8WA 5BNPC 3CU7A 3BOPA 1FMD1 3NO8A 3H3ZA 2ZGRA 4FPFA 3HN1A 2XLAA 3Q8FA 5JDBA 1L3JA 1CVNA 3FL7A 4LXLA 5DZGA 2V4VA 2YPJA 5A80A 4FOWA 4IQPA 3PJQA 3SQOA 2VGDA 2ZX2A 5FJHA 5C9AA 3P6BA 3WF2A 1LHNA 1S0DA 2FZ1A 4NN0A 4ATEA 1FNZA 1LB2A 4JHTA 1VAKA 2YU2A 2CU5A 2BFUS 4AEKA 2HLEA 4D7SA 5LA9A 1RMU1 2XVLA 4YW3A 1IPKA 1UO9A 2JKXA 1HJFA 4YWAA 3BIEA 1EYBA 1DLLA 3JBG3 3ZYJB 3J26N 3RFRA 1OMIA 1N1YA 4KWUA 3VGIA 2JDAA 1S2EA 4JQRA 4GKXA 4N8MA 4XTMA 2ZJCA 3J7MA 4Q2FA 3H42B 5CIRA 2FCTA 3AKQA 1AYM2 1VAVA 4AAXA 5IVBA 1KFXL 4ASMB 3QCWA 5F9TA 2XL9A 3AFKA 1GICA 4XJZA 1OVPA 2PHDA 5ANNA 3ZLIA 3M2MA 4CE8A 3B00A 5GM0A 5CFCB 2XG3A 2EIBA 2KD7A 2EAAA 1PZ9A 2XBO1 1H0BA 1NT0A 2YU1A 4FPOB 4BK4A 2WNOA 2VR4A 1S0GA 2BNMA 4C91A 1UZZA 5ACA1 2MEV1 2PHWA 3K75B 1HB1A 5F5AA 4ARYA 2VUCA 4DPNA 4XQDA 3EHKA 4JZRA 5DAWA 3ZXFA 3GBGA 3RRDA 2GDFA 1VB4A 5T5OA 4Y3OA 1RB8G 4CDUB 4XW3A 3LA2A 5FPAA 5JI7A 5F2SA 4YVSA 4OHZA 1DQ2A 2GN7A 4YGCA 5K0UA 1A8MA 1CQ9A 2J42A 4Y22B 5CNAA 5FPXA 1W3XA 4PF5A 1J83A 5KXCA 2TNFA 4NRMA 4DXRA 3RZKA 1PVC2 3VN4A 2VW2A 3TWIA 5FZOA 4BA6A 4D6RA 4P9IA 5CADA 3OBRA 1UN1A 2A6WA 3EQEA 4CUGA 3EO6A 1OF4A 1YCIA 1ZRIA 2RMU2 1H2KA 2RMU1 2YC0A 4HN0A 3SC7X 1H9WA 1K45A 1ENQA 4IEYA 5A70A 5I0DA 2A3XA 2FDJA 3CIHA 2WABA 1W2OA 2LW8A 4Y4YA 1XU1A 2B45X 2GALA 1VBA2 2WR9A 4Y1YA 1LCLA 2RM22 1QU0A 2R30A 3VZOA 4CEWC 3PUIA 5CKNA 1H8TA 1PK6C 1CAXA 1VE0A 1VBB3 2H0VA 5BNOC 3PVNA 5LA0A 3TN91 3DPRA 1V6IA 4TSVA 2BFUL 4LO7A 2HWB3 4COWA 5FLHA 3MYXA 1SLCA 4DRVA 1CAWB 4UF0A 1JZ6A 3AYEA 1BMV2 2JXAA 1O5LA 5D1IA 5DZEA 2WN3A 4AVVA 1NLRA 1BBT1 4AE2A 5ABJB 3I2JA 5JWPA 5DDJ3 3THTA 5CKMA 1IQDC 4H2AA 1ZBE1 2BDRA 3OY8A 1MVEA 1RUF3 4L8QA 3QBQA 4QKNA 4CDWB 1P8JA 1IZ3A 1Z7S1 1JMUB 2DV9A 2R072 2DVAA 1LEDA 2XLGA 4OYUA 3GXUA 3KS7A 1KDKA 2ZHLA 3OYWB 3RZHA 4W4ZA 2ZPXA 4I2OA 3TBDA 1VBB1 1AL22 1W9FA 5GKAC 4XTPA 1CAWA 2WS92 4UF0B 1ZBA1 5EHDA 2HWB1 2R071 4TTGA 1BEV3 3POBA 3RWKX 1ST8A 3TEXA 4K1YA 4YNIA 1XRUA 4CCNA 4A7ZA 4OVEA 5DUXA 4QDSA 1PGL2 2VNGA 3GHNA 5FOBB 5C9AB 4A2UA 4FTBA 1W0OA 1VRH3 4FSJA 2KA3A 2Y6LA 4RR3A 2ARAA 2AENA 3AVRA 4GH4B 2WN2A 2WZPP 3ZN4A 4CDXC 3LSEA 4J1XA 4N43C 2X5IB 3NV1A 3VD4A 4LHKA 1VBD3 2TEPA 3ETQA 4IUGA 3ES1A 5IK7A 4BIOA 1WCDJ 1QH6A 3WR0A 5F6LB 3IMMA 2RJLA 1XYOA 2RR13 2VVEA 3VBRB 2PHLA 2VG9A 4P5YA 1RUG2 2P1BA 3OG2A 4LBQB 4YGDA 3VBHB 5FZBA 1GFF2 1ZNPA 1ZZ8A 3FMGA 3WNPA 3BYWA 1BYHA 2QQWA 2P34A 5FZMA 3FE5A 2TUNA 1FI2A 4YW2A 3VKMA 1RUE2 4TLGA 4AHYA 5G04L 2J22A 3ABZA 4CP9A 2J1EA 4HPKA 4NO4A 1Y3TA 3LOBA 2BYVE 3ZFFC 4HLTA 1COV2 2XR4A 4BHPA 1AR62 2LTNA 5H9SA 3K4ZA 3VBFB 4B4QA 1NXMA 4R8HA 4EN8B 2PLV2 2NLRA 3HT1A 5IUQA 5I91A 5CFDC 4B3NA 3IT8A 3H9AA 4AWDA 4AVSA 4CU8A 1EPWA 4LBQA 2YC4A 1NLQA 3T0BA 2XJRA 1MZFA 3CEWA 2WZEA 5K0UB 2VJXA 1IKQA 1QDCA 1OXCA 3LF7A 2OPWA 2A7AA 3ZXLA 2WNEA 1FV2A 4LBJA 4X6QB 2DUPA 3W59A 3POYA 3RPQA 1POV0 3B3QE 3D4KA 3KF5A 1OFNA 2VD7A 3MIHA 1UU4A 2ZGQA 4XACA 2VULA 4WZCA 5GZCA 4E4ZA 5BNQA 1CX1A 2RG4A 1GP5A 1A3KA 1UIJA 2E7QA 4YZ2A 1VAMA 3POEA 5AVPA 4RQPC 4FVVA 3WF4A 2BGPA 4AQTA 2B4KA 3IDEA 4AHWA 4BQ2A 1J1TA 2ZAAA 3IIIA 4FFHA 1CONA 1H8TC 1KJLA 1VRBA 5HCBA 2RS52 5J37A 4UFJA 4CP0A 3VDDA 5FMOL 1V6NA 4P9LA 1CAXB 1ZZ6A 2J1SA 3MPBA 5FYCA 5IJRA 4BOWA 5CFCA 4QMAA 1TE1B 1YYNA 2W52A 4Q4X1 3D82A 3S7EA 2NP0A 3VZMA 4I09A 1LECA 4MGZE 1W6QA 3ALQA 3PTYA 1FXZA 2DUOA 1GV9A 4MVTA 4LT5A 1ALYA 3T1LA 2A3YA 3VBSC 3VBUC 3GCWA 2ARXA 1APNA 3IZOA 1AR91 3V0AA 1CAUB 4JGYA 3KGLA 3ME2A 2ZEWA 2CTVA 1YQ2A 3QH6A 2W94A 2D97A 2VNOA 5CU1A 4CPBD 3TNPB 2QQIA 4OI1A 2FDKA 1NZCA 4QHBA 4IV1A 2VZRA 3ZYIB 4QX7A 5CISA 5M0TA 3QLQA 1OD5A 2D6PA 5T5JA 4A7KA 1L7QA 1NA1A 4Z82A 3T2TA 1DIWA 4KGGA 1UZYA 1GBGA 2OVUA 3LB9A 3O0VA 4YM2A 3M3EA 1NE6A 4COZA 1XYNA 5JMOA 3DV8A 4QQPA 3HT2A 1PO11 1GOFA 4BXFA 1JS9A 4FOQA 1C1FA 2GSYA 4ARXA 4E2GA 3GGLA 3O1MA 2IWGB 1RUI2 1VLNA 1WMXA 3ZFEA 1O3TA 4S2FA 4LKSA 4YZ3A 3MPPG 3FHAA 2F4LA 4LNVA 4Y5Z0 2WJSA 2O8OA 2CGPA 4NR1A 4RS5B 4ZZ8A 4N43A 5FDBA 3IKWA 4OHVA 1E5RA 1LODA 5C3RA 2FHRA 2QQKA 4AI3A 5FY8A 4BQ4A 2R061 4N7IA 4CP9B 3EXUA 1G9FA 1RHI3 1ZBA3 3OF1A 5F32A 3BIWE 4BH9A 4KI5M 4C0BA 4UXAA 2JWPA 4NWVA 2IXCA 3OTFA 1RUJ3 3OD0A 5F3GA 5BNNB 3W21A 3KB5A 1I3HA 1BLZA 1YJLA 2CHHA 4DS0A 1MR5A 4PQ9A 3SNMA 5A6ZA 1AL23 2Q5TA 1Y7BA 5FP3A 1V6KA 4UW5A 4AFDA 4WVWA 4E4HA 1D4VB 1ENXA 1QJY2 4QX1A 4COVA 1EAH3 5FMOS 3MV11 3IMNA 4C1WA 1XNTA 3POWA 4Z2AA 3O1SA 1BBT3 1WMFA 2EAKA 2XJQA 3OGRA 4YYOA 1Q8QA 3ZSLA 2XWJB 3MLJA 4N90A 4PBOA 4XFCA 2R1DA 2XOMA 3UJOA 3TEZA 2HBTA 3MIGA 4GULA 5DAPA 3N9QA 3H3LA 5GLZA 4GB32 2CWMA 4D6SA 2Y38A 3S0MA 5A3MA 3WEZA 2PHUA 1GNZA 2DFBA 3NV4A 4OMCA 2NZ9A 2VTFA 5F6KA 3WNOA 5K9YA 4LHNA 1BVP1 1VBE1 3H1WA 4FOYA 3PHMA 1MS0A 3WV6A 3LAGA 3IPVB 4R9BA 5J09A 1JHJA 2JDMA 3DPRC 2W1UA 1UZVA 1QJX3 4MGKE 1HB2A 3UK9A 1AXYA 1EV13 2VCMA 2PELA 2VBPA 1AYN3 2XHKA 3P1IA 2QTWB 4XDQA 1COV3 1TME3 5DUVA 4NOTA 3WD5A 5AC93 5FZEA 4AHXA 4TLFA 2GC1A 2R16A 3T2PA 2RS13 1VMFA 2YGMA 4Q4V3 1OQEA 4XF0A 5JIAA 1YQCA 1YI9A 1D2SA 5H9QA 3ACLA 4HETA 3S5AA 2WINB 1UY4A 3AYAA 1NE4A 4NHXA 5L9BA 2PAKA 2JX9A 4Q29A 4JRLA 4QDQA 5A6QA 2VTXJ 1OBNA 4LIUA 2E32A 5CA6A 1EV11 2VQUA 1WLTA 1OA4A 4K20A 1QJFA 4YLZA 5JPMB 2CV6A 2QQVA 1KQRA 4PIYA 3AKTA 2XMLA 4EV0A 1AR92 2E33A 4LHLA 3PJYA 4MO3M 4O7XA 5LASA 2WL1A 4EN0A 5G05L 4Q4W1 4CEYB 3T30A 1OVSA 5T5LA 1IG3A 2VZUA 5FZKA 5K7PA 4Q0UA 4UFMA 4B4RA 5DDJ2 4XF9A 2RS53 2BNOA 3QOPA 5KXEA 2ZX4A 3SH4A 5FWJA 2BP6A 2IXKA 3V0BA 1X36A 4LBOA 3VBUB 1OC1A 3LFIA 2ET1A 1CR7A 4HXCA 3BN6A 3F95A 1DGLA 1OLMA 2FCUA 4EWEA 1LOCA 1NUKA 4HONA 3KMHA 3LEMA 4M3CA 4CCDA 3BPZA 1QXPA 2GU9A 2JG8C 2ZCWA 3VZLA 3ZYRA 1QJU2 3SMHA 4XYXA 1AL21 2XQXA 3I4IA 1GQGA 4CDQA 4KU8A 2FDGA 4ZY9A 3NVCA 2W1SA 2VZTA 3IBMA 4C0HA 3WDUA 3GF6A 4Z2WA 3M8LA 4WBBA 2BV4A 3W20A 2XXZA 5IVJA 1HXS2 2EXHA 2E9QA 3VLBB 1RUI3 5FWEA 4CCLA 1IS6A 1PIV3 4CCKA 1JYCA 1QJY1 4Q1RA 1W28A 3ZXDA 1J59A 2E63A 5F5QA 1AVBA 1WW7A 4META 4M3CB 5A7OA 1X8EA 4QGMA 4XMAA 1CAVB 2JDZA 1NG0A 4TYSA 1NCQC 3J8F3 5F39A 1JYTA 3WX5A 1LRHA 1GQPA 3ZPYA 3ZDVA 3AXDA 1DLCA 4JTNA 5LBCA 4AI0A 4GWJA 4XEZA 1AR81 3ZM8A 2ADEA 2C24A 4LKEA 3UYJA 4NPRA 5A32B 1ZVFA 4V1PA 1XBFA 4Q8KA 5J1XA 4X6RB 4OULA 2WAOA 4M4RA 5FZDA 3RI9A 1WLDA 5IAVA 3THPA 3THCA 4PHZA 3RDIA 1FATA 5GALA 3N9PA 4DMIA 4IW3A 4CEWB 3VDBA 2DVFA 4W6YA 1PK6B 4H55A 1CJPA 4PLMA 2Y26A 1H4GA 2EVXA 2G9ZA 4JDOA 4OUSA 4XHXA 1PVC1 4B4PA 1ENRA 4EWDA 5FMCA 3USUB 4QPGC 4BB3A 1D4M1 2J7MA 3ZR5A 1KFUL 3J8F1 1RUJ2 2C4XA 4FBFA 1VIWB 4MGSA 2ZBJA 3ZFGB 1TMF1 1G6NA 1RGSA 3J9SA 4IEWA 4B7EA 4LE4A 4Q27A 1OLME 5B4XA 4QPIA 1K5MB 3KVAA 3N7KA 3AVSA 3UT0A 5C8WA 2N7GA 3WOGA 3AJZA 1KS4A 3LKJA 4CPBA 1IS3A 2BZDA 2QZ2A 2BOJA 2WFF3 1XXNA 4IV3B 1W6PB 1GZ9A 1ULDA 2QCSB 2XBO2 1ULPA 2QDRA 3I54A 5FTTC 4XJ9A 4CEWA 4URAA 5GLVA 5HCFA 1B35B 4AI2A 1KXGA 4GALA 2VMFA 3M1HA 1W2UA 3A21A 2V73A 1JN2P 1UD1A 3R4SA 5ABJC 4LA3A 3UL2A 3R6SA 1IKPA 1RJ7A 4HN1A 1ND2C 4P9WA 2K0GA 1WLWA 5T5PA 4QPIB 1ASJ3 4MGQA 1G9CA 3GDBA 1S0BA 2VMEA 5FUIA 4B1LA 2XJTA 2UWCA 3FWEA 1W06A 4I30A 4E8DA 1Z7S3 4Y5TA 1FPN3 2WAAA 4JC1A 4R9AA 3H7YA 4YVSB 3WZ1A 3T4HB 5FV3A 5DDJ1 5FAXA 3T0AA 1G86A 1JOJA 5DAQA 5C8CC 1RUC3 2QQNA 2E7TA 3VBOB 3H8RA 1SHWB 5EFUA 2XVGA 1T6BX 2RS32 4EN7B 5A33B 1YC61 2HEWF 3VDDC 4FFGA 5FREA 3NSTA 2K46A 3V0BB 1UOJA 4FFIA 1QGLA 2ARBA 2UYBA 2JG9A 1EY2A 2R1BA 2Y0IA 4AG4A 3VKOA 3E1F1 5FZ6A 1PVC3 4DB5A 1QJU3 4J25A 1IGOA 5E89A 4AEDC 3HBZA 2WLPA 4AEJA 2FMYA 1W9TA 4NHKA 1RUC1 3TRSB 3B93A 4COYA 3DYPA 3JU9A 3GYDA 1X9TA 2G4IA 1H1IA 1CZSA 3ZR6A 3DL3A 5I0TA 1CIWA 3N9LA 4S2HA 3Q9OA 5JAXA 1JBCA 4LLOA 2YMZA 4M01A 3ILRA 3RZZA 1LHUA 1QJX1 2WSVA 1A34A 1NY71 3WHTA 1W8ZA 5ABJA 3UKVA 1W6OB 3L9JT 3RNSA 1X9PA 4TZDA 3RZMA 1Z78A 2Q1MA 1DP0A 2YBKA 2C26A 4XUPA 1YO8A 4XUNA 3UJQA 2VNRA 1CPNA 1MQTB 2XQRA 3RMYA 1IS5A 3TAYA 5IVEA 5KWRA 5A3LA 1I5ZA 5KXDA 4NIIA 3ZYHA 4GXLA 1CJDA 4ZS2A 1K5MA 4MZUA 2VL4A 1DQ0A 3DYOA 2ZX0A 4AK3A 1LULA 3AZXA 5FP7A 1LOAA 5FJKA 5A32A 5KXBA 3TEWA 2HWE3 5F2WA 4BQXA 2L9LA 3JXSA 1HN0A 3JB4C 4J1WA 4OI4A 4RQPB 1XB9A 5FZ8A 5T50A 4K8RB 4QXHA 4DFSA 4Q4X2 1W9YA 3FZ3A 2ZZJA 1C3HA 3WNLA 2VH9A 1PIV2 1WUVA 5GLTA 2PHFA 1QNYA 2OIIA 1NLSA 3M7AA 2V5DA 2ETEA 3ZPOA 5HCHA 1UPIA 5JI9A 3USUA 2HWD3 4Y5SA 2D93A 1GZTA 5C9AC 2Q1ZB 1R081 2YPDA 5FZAA 5FP4A 3WF3A 2ZMLA 1C4RA 2Z42A 5CZKA 4DZGA 4IGPA 4Y24A 1GYKA 4CYDA 1NZIA 5EZWA 2VOTA 1H1AA 2JEMA 3NNLA 1NA1C 4R4XA 5FXXA 4KH9A 5BNPA 3NNJA 3I49A 1Q3EA 5JOZA 4EN9B 1E57A 2BERA 2WWSA 2ZA9A 1VBE3 3B94A 4FPJA 1CGPA 1JI6A 2W0XA 2VZSA 2X53S 1L7RA 3C2UA 3F2ZA 1JZ3A 1GNHA 4IETA 1JZ5A 5K4LA 1DU3D 1DGWA 5JXIA 5DMYA 3S57A 2WNUC 3D6EA 1R1A2 4KGQA 3VBSA 2FZ2A 4FXKB 2P3IA 2OXBA 5FZGA 1RUI1 4ASKA 5H9RA 1ND2A 2HWC3 3TN92 2ZHKA 1H6XA 3CJIA 3CZUA 2CDPA 1WD3A 4OI0A 5ERLA 3H8OA 3ACGA 4P08A 2PTMA 5L36A 4I0WB 1GZWA 3K3OA 4D69A 5T52A 2GN3A 4DRRA 3WW4A 1PM4A 1EV12 2JD9A 2YY1A 2WO3A 3B69A 1AYN2 1LHVA 2VPVA 2ZX1A 5FZCA 1KGYA 3LA3A 2DCYA 3AZZA 3WNMA 4W50A 4R9CA 5IFTA 1O3SA 1LGNA 2LRPA 3BOWA 2VC9A 3ZXKA 2R0HA 3ES4A 4CUAA 2Y34A 2E53A 1MEC3 1AR93 3AYDA 5EWSA 2XL7A 1UIKA 1OUSA 1C8M1 1NCRA 2WZR3 4CDUC 2F6BA 3LEGA 3AC0A 4ZXKA 3UESA 2QQPA 5CG9A 2EXKA 5I93A 2XJSA 3HD8B 2YZ4A 3SLIA 2X5IC 2RV9A 1O4TA 3ITQA 1VBB2 2ID4A 2HWC1 4PDWA 2J1AA 3NJVA 2CYFA 2RDSA 4CCCA 1XSQA 4XFAA 4V2WA 5JOYA 5FXVA 5A3UA 1PMIA 4O9GA 3P5BA 3I3MA 2VQTA 2CDOA 4MHUA 3VBRC 2Q30A 3P3PA 2R32A 1XYPA 5C6CA 2X09A 1HQLA 3WW2A 3GJAA 3Q8EA 4FT8A 4XXPA 1UY0A 1NCRB 4I01A 5LY2A 4OZOA 3LEKA 2RDRA 4BJ0A 3WG3A 5T54A 2B7YA 1RYYA 3M3QA 4WM8A 1IG0A 1XNKA 4YPJA 2GMPA 3MW3A 1YFYA 4K21A 4W8JA 3I97A 4I0BA 4XPVA 3UGFA 5JSOA 4Q5OA 4CDWA 2RR11 1CN1A 3HIFA 1QJU1 1WLCA 5IT6A 1W9SA 3O1RA 2D6OX 2YG0A 2VZPA 1MACA 1HLCA 3DUIA 3LPGA 4KQ7A 3ZYFA 3VL9A 4MGTA 1G8WA 3FN9A 4A3ZA 2MEV3 4LBQD 2P37A 3U14A 1LHOA 4FQ4A 3GZUC 3HEIA 1WCUA 3ZIWA 1POV1 2VZVA 4BCUA 3AZVA 1GU3A 1N3QA 4RGKA 3JD73 2JG9C 1HXS3 4HSLA 4YFWA 3ZXJA 3S5QA 1I5PA 1QQP3 4OQ8A 4LQRA 2GP5A 3Q8BA 4D6QA 1AUYA 4AYUA 4NWWA 2BU9A 2BOIA 3N9OA 5KHIA 3VZKA 4L97A 4FQZA 1VJ2A 4D8MA 2ZGUA 3JBG1 4XJUA 1RHI2 2VOKA 4XFGA 2RVAA 4AFBA 3WW1A 3N9NA 4YW5A 2JDUA 5LBBA 2NQYA 2XGXA 5K8SA 2ZKNA 1Y43B 2OUJA 1ND2B 1OQ1A 4GKYA 1LEMA 3U4XA 2OZJA 1F2NA 3POJA 2R7EB 1BK1A 1TMF2 3OYWA 4HG6B 3PURA 2BGOA 5JSPA 1OA3A 1N1TA 4GWMA 2HYKA 5FY9A 2OYZA 2DU0A 2D6NA 1HRV2 2RDQA 2HWD2 4Y1XA 5JOXA 3HNYM 4P9JA 1EAH2 3HWJA 3VBRA 4ONUA 2R041 3AX4A 4YW1A 1JYWA 5GJ6A 4EQVA 3U10A 2O8QA 4Y22A 1LAJA 2EXIA 3D0JA 1PO22 2WNUA 1JH5A 4OLLA 2JJ6A 1SFYA 2VZ1A 2WFF1 2P3YA 4BISA 1GWLA 2VU9A 3BVCA 5FXWA 3LWCA 3R4UA 1OURA 4P02B 4DQAA 1PIV1 1BK0A 1RMU2 3LCPA 4PQQA 2GMMA 3AZWA 3CJIB 4K8FA 2EIEA 4QM9A 1CD3G 2RR12 1HIXA 3BTAA 2BJSA 3NL1A 1CIYA 1V00A 3OGVA 3N7MA 1BBT2 4WVMB 3MDPA 5FP9A 4RFRB 5FZIA 4ORFA 5FRAA 3CKHA 2VOVA 3A0NA 3I59B 1T6GC 3OBZA 4YG6A 5FQ0B 3M3OA 3W5NA 1JZ8A 4BDVB 4M0NA 2VTXA 1AL0G 4IEOA 4RHV3 4G3YC 1O6UA 1RVF2 3AP4A 3D8CA 1LGBA 1F5FA 1JXNA 4M00A 1TME2 2QZ3A 2BUKA 2NYYA 2VXRA 2W3JA 2VXJA 2VO5A 1S2KA 3LEIA 4IE7A 2IXJA 4Z07A 2PHTA 3WF1A 4E27A 2AC1A 3SISA 5EYXA 2FDHA 4L0PA 2B5HA 4IV1C 2YFZA 4IE4A 2WQ4A 4CZSA 1OSGA 3IB3A 3L2HA 2ZGLA 2XWBB 5JXGA 4ZU5A 3OY8B 5EV7A 3PDQA 1MQTC 4LULA 1R091 3APBA 1I6XA 2D5HA 1J3QA 5GLUA 2WRAA 4NAOA 4UT5A 5FQ0A 1RUD2 1JYNA 2E26A 5FCCA 1BXHA 3BTZA 2WZR2 4G9SB 3RSJA 4ZZ5A 4O65A 3I2OA 2MHFA 3H1YA 4LMFA 1LOBA 1QF3A 5FPBA 1N3OA 1REDA 1CZVA 4PBPA 2Q8EA 2Z79A 3OB8A
chains in the Genus database with same CATH topology
5L9RA 2G1MA 5LB6A 4BQXA 3OUHA 3GZEA 4NHYA 4ZONA 4UWDA 2JIJA 5C5TA 3KT4A 4Y5SA 5L9VA 5EPAA 4NHXA 5L9BA 4MHRA 5IATA 4NMIA 2Y33A 5C5UA 4XCBA 5DAXA 5M0TA 5LBBA 3NNLA 3NNJA 5LASA 4XCAA 3HQRA 5EQUA 5LA9A 3HQUA 2RDNA 5LBEA 5EP9A 2RDQA 4BQYA 2JIGA 4Y5TA 4XABA 3EMRA 2FCTA 3MGUA 2FCUA 5IAXA 5DAQA 5ERLA 5HV0A 5LBFA 2A1XA 2G19A 3BVCA 2Y34A 3W20A 3NNFA 5DAVA 4JZRA 5DAWA 3W21A 3KT1A 4J25A 3PL0A 3OBZA 2FCVA 4NHKA 4BQWA 3ITQA 4NHLA 2RDSA 3OUJA 3DKQA 4KBZA 5A3UA 5LATA 4MHUA 4ZPIA 3NNMA 5LBCA 2HBTA 5DAPA 3KT7A 3GJAA 3OUIA 3GJBA 2OPWA 2RDRA 4NAOA 2HBUA 4XC9A 2V4AA 5IAVA 5HV4A 4XACA 4IW3A 4Q5OA 2RG4A 4NHMA 4XAAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L9R A;  2G1M A;  5LB6 A;  4BQX A;  3OUH A;  3GZE A;  4NHY A;  4ZON A;  4UWD A;  2JIJ A;  5C5T A;  3KT4 A;  4Y5S A;  5L9V A;  5EPA A;  4NHX A;  5L9B A;  4MHR A;  5IAT A;  4NMI A;  2Y33 A;  5C5U A;  4XCB A;  5DAX A;  5M0T A;  5LBB A;  3NNL A;  3NNJ A;  5LAS A;  4XCA A;  3HQR A;  5EQU A;  5LA9 A;  3HQU A;  2RDN A;  5LBE A;  5EP9 A;  2RDQ A;  4BQY A;  2JIG A;  4Y5T A;  4XAB A;  3EMR A;  2FCT A;  3MGU A;  2FCU A;  5IAX A;  5DAQ A;  5ERL A;  5HV0 A;  5LBF A;  2A1X A;  2G19 A;  3BVC A;  2Y34 A;  3W20 A;  3NNF A;  5DAV A;  4JZR A;  5DAW A;  3W21 A;  3KT1 A;  4J25 A;  3PL0 A;  3OBZ A;  2FCV A;  4NHK A;  4BQW A;  3ITQ A;  4NHL A;  2RDS A;  3OUJ A;  3DKQ A;  4KBZ A;  5A3U A;  5LAT A;  4MHU A;  4ZPI A;  3NNM A;  5LBC A;  2HBT A;  5DAP A;  3KT7 A;  3GJA A;  3OUI A;  3GJB A;  2OPW A;  2RDR A;  4NAO A;  2HBU A;  4XC9 A;  2V4A A;  5IAV A;  5HV4 A;  4XAC A;  4IW3 A;  4Q5O A;  2RG4 A;  4NHM A;  4XAA A; 
#chains in the Genus database with same CATH topology
 4FPL A;  1UWW A;  3KGZ A;  5FBZ A;  1H8V A;  1QHD A;  3WNK A;  3AKP A;  3AYC A;  1EUT A;  4DUW A;  3GAL A;  4WM8 B;  4M3C E;  4QX0 A;  1EAH 1;  3RS6 A;  1U5Z A;  4AHZ A;  4CEY A;  1LJ7 A;  1SBD A;  1IHM A;  1QY4 A;  2HKX A;  4R52 A;  4DIQ A;  5JZG A;  1PO1 2;  3MBW A;  4UW4 A;  5FMB A;  2WQ8 A;  3M70 A;  1GKB A;  1K12 A;  1BQP A;  2ZGS A;  3DPR B;  5FKB A;  4L92 A;  1SFP A;  4LOT A;  4AGV A;  4A7Y A;  1AR8 3;  3B01 A;  3NV3 A;  3GNE A;  3K51 A;  2IXI A;  5DAX A;  4BE3 A;  5I8T A;  3I2D A;  1NYW A;  2WA3 A;  4P5H A;  5BXX A;  3KF3 A;  3ZO0 B;  3MHZ A;  1YQ5 A;  4XUR A;  1DBN A;  3B02 A;  3HQR A;  4WVZ A;  5F5I A;  3MIE A;  4RS5 A;  3ELN A;  5HXV A;  3VV1 A;  2WS9 1;  3H0O A;  1W2A X;  3K77 A;  3ZFF A;  1JZ7 A;  2WNU B;  4XFF A;  1YFX A;  1PGL 1;  4MOA A;  1QQP 1;  2JKB A;  3V65 A;  4KWL A;  2UY9 A;  5EP9 A;  3KVB A;  1XU2 A;  1O8P A;  1Q8S A;  2WZ8 A;  5DZF A;  3IIA A;  1UAI A;  1V6J A;  2JDH A;  3VD5 A;  2YC2 A;  1XJA A;  4XMI A;  4LBN A;  4EJR A;  1TMF 3;  5LRS A;  2VVD A;  2ERF A;  2UWB A;  4E8C A;  1JYI A;  3ZMN A;  3BU0 A;  1ZA7 A;  4YVW C;  1ZBA 2;  5C8C B;  5EJZ B;  5I0U A;  1ZZC A;  5JXH A;  2AAC A;  2OPK A;  2PN5 A;  3WSO A;  1LOF A;  5FPZ A;  1RUH 1;  2NN8 A;  1AJK A;  3CHX A;  5FXZ A;  4ISR A;  5APA A;  3A0K A;  5I0S A;  2VUJ A;  2TBV A;  1PMH X;  3JB8 A;  5JVV A;  5A7P A;  3FUQ A;  3RI8 A;  3HMY A;  1HV0 A;  3PIG A;  3ON7 A;  4FXG B;  4BLI A;  3SEE A;  4N53 B;  5E6H A;  5IYY A;  4KL1 A;  4YGB A;  5CFC C;  2W2I A;  4N7U A;  5FPU A;  1D4M 2;  3WCS A;  2VZQ A;  4IES A;  5E88 A;  4BME A;  4E9K A;  1VBA 1;  1W8H A;  2PLV 1;  1MS1 A;  2X5I A;  2W46 A;  2VMG A;  4AZZ A;  1V9U 2;  2YHJ A;  3MIB A;  5DXD A;  5C8C A;  5KC5 A;  4OUM A;  4YM1 A;  4M3C F;  3DEC A;  2DBN A;  1AR7 3;  1NY7 2;  4JDM A;  2GME A;  1OOP C;  3LIH A;  2HJI A;  2I07 B;  3I59 A;  3GHM A;  4IND A;  4XIO A;  1O4Y A;  1UQX A;  1ZZB A;  1GR3 A;  3JUU A;  4GB3 3;  5FYY A;  2G9F A;  2XJU A;  1FT9 A;  3A7Q A;  5CFD B;  4FP2 A;  2HH9 A;  5FLJ A;  2QBX A;  3HVD A;  1Y9G A;  1ULO A;  3CJX A;  5DAB A;  4AGR A;  2P4E A;  4CCM A;  4Z8B A;  1J3R A;  2ORX A;  3ZXE A;  1TEI A;  4FPG A;  1OFS A;  2P3K A;  4DEV A;  5F37 A;  4RHV 2;  1WCQ A;  1GNY A;  2QDN A;  5BYN A;  2Y64 A;  4LHS A;  5FY0 A;  5D21 A;  2A6Z A;  2EID A;  3NV2 A;  4FI9 A;  2YV8 A;  1WKY A;  4OCT A;  2NM1 A;  2HWD 1;  2P5B A;  4CCE A;  3AKR A;  2DBI A;  5FO9 B;  1AZD A;  2WC2 A;  2D6L X;  1XQN A;  4IV1 B;  5FYS A;  1XE7 A;  5FIX A;  4Q4X 3;  4XF1 A;  1ODM A;  3GZE A;  1LES A;  1FMD 3;  1Y4W A;  2XBO 3;  2RE9 A;  2ZGT A;  5L19 A;  1MEC 2;  2J1R A;  1EUU A;  4BWO A;  4FOV A;  5LY1 A;  3N36 A;  3U0Z A;  4DY3 A;  2Y6J A;  1XSR A;  2RHP A;  5SV5 A;  1V6M A;  1VP6 A;  2CY6 A;  1LTE A;  2HYX A;  1FPN 2;  1NCQ A;  2H6B A;  4HBN A;  4QPI C;  4TXW A;  2C5D A;  5FPV A;  1DF0 A;  5F3I A;  1OUX A;  4QX5 A;  2XVK A;  3KWV A;  5IVY A;  5L9V A;  3VDC A;  4G4F A;  4QB6 A;  2BNN A;  3OSD A;  3DCQ A;  4QU2 A;  5D8A B;  2OUH A;  4AAP A;  3JQX A;  4KBB A;  1R09 3;  3CL1 A;  4NMI A;  2Y33 A;  2WQZ C;  4UFH A;  3M3I A;  4CCJ A;  5C5U A;  5CEH A;  2ZGM A;  3DYM A;  3AKS A;  1S0E A;  4XCB A;  4N43 B;  3ZSM A;  2RMU 3;  1IOA A;  2IXL A;  4K1Z A;  3VL8 A;  4Y4R A;  1PVX A;  1WBF A;  4S2G A;  4GMP 1;  3LDR A;  4IEQ A;  3FFQ A;  1U5X A;  3VDD B;  3OD4 A;  4YW6 A;  4CRQ A;  1MZE A;  4DNY A;  5BY5 A;  4A4A A;  1VBC 2;  3MF9 A;  4B1M A;  4ISQ A;  5L73 A;  1W6Q B;  3UKT A;  1F15 A;  2J1U A;  2JIG A;  3R4D B;  5LEJ A;  2JB4 A;  4IER A;  3WW3 A;  2B9U A;  2UY8 A;  3EMR A;  1QWR A;  5I8S A;  2DVG A;  2PXJ A;  1OQD A;  1F8V A;  2JG8 B;  3OPZ A;  5LCW L;  2JEC A;  3ILN A;  1M4W A;  4QXC A;  4MH0 E;  2ZGN A;  5GLW A;  3ZFF B;  4RS5 C;  2A73 B;  3CQO A;  3W9A A;  2CNA A;  2J1V A;  1Q8P A;  1GMM A;  4XF4 A;  5TSW A;  3VBF C;  1UKG A;  2G19 A;  3WHU A;  1D0G A;  4QQO A;  1STM A;  1X50 A;  2C9A A;  4JTO A;  4BQ3 A;  1WZX A;  4XUQ A;  5C70 A;  1SCR A;  2KR2 A;  5A6X A;  1SLL A;  1WME A;  2WUH A;  1DDL A;  4Q0P A;  3EYP A;  5DN2 A;  4UW3 A;  5A1F A;  3MZH A;  4JV4 A;  2PAE A;  2PYT A;  1WA6 X;  4DUX A;  1YJK A;  5A3O A;  2NMN A;  3VZJ A;  1UX6 A;  3QD6 A;  2JG8 A;  4IE6 A;  5AFB A;  2Z5W A;  4LUM A;  3K2O A;  4GD4 A;  4Y26 A;  3I7D A;  5J36 A;  4JX0 A;  2ORZ A;  1US2 A;  5LAT A;  2YGL A;  3U07 A;  1B09 A;  4OFG A;  3AK0 A;  4AQS A;  2Q0A A;  4GJZ A;  2ZX3 A;  3O0X A;  1PK6 A;  1O8S A;  1SLT A;  2JIC A;  3KT7 A;  4NIG A;  4XDP A;  1H2L A;  3KSC A;  1AXZ A;  5BNN A;  2QQM A;  1W90 A;  1LKN A;  3GBW A;  4KNC A;  1GAN A;  1HRV 3;  1JYX A;  2AGS A;  3R0R A;  4AVA A;  2CSG A;  4QQL A;  4HK9 A;  1SCS A;  4QD2 A;  3JD7 1;  4OMD A;  3AL6 A;  4XUO A;  5C3Q A;  3N4M A;  1PMJ X;  4OHX A;  4XAA A;  1YRZ A;  3RZL A;  4LK7 A;  5FYH A;  5EJ3 A;  3WQB A;  1RUH 2;  3E6D A;  1GOH A;  2MPF A;  1PHM A;  1R08 3;  1KD7 A;  3AP9 A;  5FZ4 A;  2AEZ A;  4IEV A;  2XLF A;  1LHW A;  3AMM A;  4ZON A;  4CP2 A;  2BGC A;  3IM0 A;  1UZ0 A;  3O0W A;  1ASJ 2;  5IK5 A;  1ND3 C;  1W04 A;  2ZMN A;  3AB0 A;  5L7O A;  3BTX A;  4A3X A;  1DYK A;  3TYJ A;  1OPM A;  4HSJ A;  4IV3 C;  1V9U 3;  3TNQ A;  3KHB A;  3SHR A;  5FYU A;  1FOD 2;  4XDO A;  2Q1F A;  2GH2 A;  3QH7 A;  1B35 C;  3FHQ A;  2RS1 2;  3TEY A;  5IAT A;  2YDE A;  3VKN A;  3ZFG A;  3DF0 A;  1SG3 A;  2WO7 A;  5FY1 A;  5IK4 A;  2FMD A;  3MIC A;  1AX0 A;  1H1M A;  2UWA A;  3C7O A;  4JGZ B;  5LK5 A;  2GC2 A;  1OD3 A;  2NPI A;  4MXV A;  3FJS A;  1Z7S 2;  3CLP A;  2FD8 A;  3ZN6 B;  3VHN A;  3WG1 A;  1A8D A;  1HB4 A;  2HWF 2;  2CL2 A;  2VUA A;  4XZP A;  1PGS A;  1FMD 2;  2R06 2;  2Y60 A;  2D6K A;  4QGN A;  1Z0H A;  4M0H A;  3QAC A;  4PJY A;  3RG0 A;  2RDN A;  4P9Y A;  2DVD A;  3I3E A;  2VNV A;  4LA2 A;  3HJR A;  1VBA 3;  1DYP A;  1F31 A;  1PX4 A;  4LUK A;  3RYP A;  3T2Q A;  3H8X A;  3SCH A;  4CSW A;  3JZV A;  1PO1 3;  3CF6 E;  2B46 X;  1CWP A;  1W8N A;  3LDB A;  4CCO A;  1YFU A;  4FPE A;  1LOG A;  4QB1 A;  3WG4 A;  2C1F A;  4FFF A;  1X82 A;  2WLQ A;  3WUD A;  3NJY A;  4UI9 L;  3S7I A;  5B2G B;  4LR4 A;  4IDZ A;  4JGZ A;  4PCR A;  1TNR A;  4MSV A;  4PDW B;  4PT6 A;  3VKL A;  4AEM A;  1C1L A;  3KCC A;  5IHR A;  1XOY A;  4GMP 3;  3MFA A;  3WG2 A;  5FPL A;  3KD4 A;  2D5F A;  2WKK A;  2B8M A;  4FAH A;  4RHV 1;  5A1A A;  3AXE A;  3CO2 A;  1MEC 1;  3OPT A;  1QIQ A;  3GZA A;  5GZF A;  1HRI 3;  1SMV A;  4XXA A;  5JSR A;  3NMB A;  3O12 A;  3DXT A;  2YXS A;  2JE8 A;  5DAV A;  3ACF A;  2BW8 A;  2DWR A;  5DG2 A;  2QQO A;  1UPS A;  3SH5 A;  2O14 A;  4Z1V A;  3MID A;  3L2Y A;  2HWB 2;  2F17 A;  2H6C A;  1VBC 3;  2AYH A;  3RYR A;  2OX0 A;  3K48 A;  4QQH A;  3O1T A;  4NHL A;  1H30 A;  5KHJ A;  1V70 A;  4QKB A;  3OUJ A;  4QKF A;  3FX3 A;  1DZQ A;  3NAP A;  3S30 A;  4SBV A;  1YI7 A;  2VAU A;  4F3J A;  3LE0 A;  3UGG A;  1Y9Q A;  2A3W A;  5BNO A;  2RS5 1;  4FPC A;  1DGW X;  3ZFE C;  5C3O A;  3ZX7 A;  5C3S A;  2B39 A;  2AEY A;  1BJQ A;  2DTW A;  4M4P A;  2R07 3;  4Y1V A;  3UET A;  4D7T A;  4ES8 A;  2VBD A;  1KRI A;  4XBN A;  3VDA A;  4XHB A;  3IDA A;  3G6J B;  2DUQ A;  3ZN6 A;  1AX1 A;  5L7O C;  4PF1 A;  3H7J A;  4QGL A;  5FO8 B;  2YUE A;  2HBU A;  4XC9 A;  5HI0 A;  1SBF A;  2VEC A;  3O14 A;  1YUD A;  1RJ8 A;  1UY3 A;  3PNA A;  3PU3 A;  4H3W A;  4CXY A;  3Q8C A;  2DYC A;  2QQU A;  4Q4Y 2;  4ASL A;  2BRT A;  1JU4 A;  3C8X A;  2C9K A;  2PHR A;  3NAP B;  4Q0Q A;  1F4A A;  1F9K A;  2AZ5 A;  3ILF A;  3U11 A;  1PZ7 A;  4JGY C;  4UBG A;  4BQ5 A;  1SDD B;  2ZAB A;  2XB6 C;  3ZSE A;  5FYI A;  4EZ4 A;  3POS A;  1QOT A;  1RUF 1;  4I3G A;  4NHY A;  4Q4V 1;  4XAE A;  3D0S A;  2GNB A;  2FDI A;  1C5I A;  1ZZ7 A;  3ZYB A;  3A4U A;  1XNC A;  3ZSK A;  5C5T A;  1HN1 A;  3U37 A;  4P9X A;  2CGN A;  4URT A;  5BNP B;  3VHP A;  1YFW A;  2JB8 A;  3O1V A;  3CBN A;  4D0Q A;  3MV0 1;  2QVS B;  4FP3 A;  5T55 A;  2JE9 A;  1ZX5 A;  2IZW A;  3SCG A;  2KM2 A;  4WZF A;  3NJX A;  1HRV 1;  4H7M A;  4RQP A;  5IVC A;  1HRI 1;  1AR6 3;  1U0A A;  2XJP A;  3KV9 A;  4AXO A;  4I0A A;  1Q43 A;  3VBO A;  3IAQ A;  3FC0 A;  1A6C A;  1ODN A;  2NMO A;  1FPN 1;  3WQ0 A;  5LW9 A;  4NIH A;  1GOG A;  1U5Y A;  4XCA A;  3VD7 A;  5F7U A;  2DCT A;  1AJO A;  5E16 A;  3N9M A;  4XIL A;  2GNT A;  5EQU A;  2DDU A;  5KC6 A;  2VCB A;  4MAD A;  2JG9 B;  5HCA A;  3BUC A;  1V0A A;  3ASI A;  1XC6 A;  1T2X A;  5ACA 2;  4L99 A;  1VRH 1;  1OF3 A;  1GWK A;  2HWF 1;  1PO2 3;  3CJI C;  3UNP A;  2PQQ A;  4Y1U A;  3ST7 A;  2MNG A;  1QMJ A;  3WP4 A;  1L7L A;  1LU1 A;  2IC1 A;  3FLP A;  3PLQ A;  1W6P A;  3JQW A;  4CDX A;  3WIN E;  1VR3 A;  2WWU A;  4IE5 A;  3NKT A;  4JGZ C;  5IAX A;  4Z92 B;  3DKW A;  3O1U A;  1AYM 1;  1H9P A;  2DUR A;  5FLI A;  1XE0 A;  2BBA A;  1R08 2;  3E5X A;  4J6G A;  5H9P A;  4AI8 A;  2ET7 A;  2CGO A;  2VQ0 A;  3M4F A;  4Y20 A;  5FZO B;  5FZH A;  5ISL A;  1I9R A;  1NXD 1;  2P17 A;  1WGP A;  4XFB A;  5C4W B;  1W6O A;  1SZB A;  2E6V A;  1NOV A;  1BHG A;  4HZF A;  4LEJ A;  1N3P A;  1C57 A;  2R06 3;  1GZW B;  4AFM A;  3EB7 A;  4LO4 B;  4CDX B;  1UYY A;  1SLA A;  4BQW A;  3DGT A;  5EJ1 B;  4QHZ A;  1W8U A;  4AI1 A;  3ZOI A;  1U12 A;  4WV8 A;  1FNY A;  2K2S A;  1ASJ 1;  1OKO A;  1N1S A;  1UX7 A;  4Y20 B;  1OT5 A;  5CVR A;  4KG0 A;  2WYS A;  1XE8 A;  4CDQ C;  5C33 A;  1G9A A;  5E1R A;  4LE3 A;  1U5I A;  3AMH A;  3HNB M;  2VMI A;  4IEZ A;  4EE2 A;  1ND3 A;  2D3P A;  3VD3 A;  3OUI A;  3GJB A;  5A3W A;  1AR6 1;  1YWK A;  3PUQ A;  5JZG B;  1XNB A;  1K5M C;  2AUY A;  4XUT A;  2G9G A;  2ARE A;  4A44 A;  5BNO B;  1H2N A;  4JVA A;  4LKF A;  1S55 A;  3I3Q A;  4GMP 0;  4LKD A;  4LIV A;  2YB7 A;  3CZJ A;  3RJR A;  4N9I A;  2X05 A;  1IS4 A;  4D7Y A;  3BTY A;  3KM5 A;  3BPS A;  1POV 3;  3AFG A;  3FFZ A;  4L9B A;  3FUO A;  4NPM A;  4PI2 A;  5L9R A;  2W39 A;  1F5J A;  2VY0 A;  1FX5 A;  2V09 A;  5J98 B;  1QQP 2;  1UYP A;  2VVF A;  2VZ3 A;  3OBT A;  4LPL A;  1DCS A;  1PX3 A;  4LO5 B;  4XZU G;  4DIN B;  2P3J A;  5T3N A;  2WII B;  4CP1 A;  1ND3 B;  3MEP A;  4KU7 A;  3J7N A;  1C8M 3;  4Q4Y 3;  2MEV 2;  1FYU A;  1CPM A;  4NVP A;  2SLI A;  1H6Y A;  4RYD A;  5FZF A;  3ORJ A;  4CUB A;  2AR6 A;  4COU A;  4OI2 A;  4DXZ A;  3I3B A;  3RYK A;  2ZEY A;  3PU8 A;  4AED A;  5BUV A;  4S2D A;  3IN9 A;  3PVO A;  5D8A C;  5LK7 B;  2CAV A;  3HR9 A;  1ULG A;  1W2T A;  2PHX A;  4QDR A;  4LOS A;  3KV6 A;  4QKD A;  4F83 A;  2P6H A;  2ZZQ A;  4F8A A;  5FOJ B;  5HPO A;  2IUW A;  1KIT A;  3BOD A;  1GSL A;  4UW6 A;  5IW0 A;  3ACI A;  1UMI A;  5KHH A;  2R04 3;  1X7N A;  2W1W A;  1Y9M A;  3WDT A;  4IL7 A;  3K4D A;  5FZ3 A;  3ZIX A;  1UU5 A;  3ZVX A;  3T08 A;  3OPW A;  4MYE A;  3J7L A;  2PAM A;  4N53 A;  2W1Q A;  3OGS A;  1W2N A;  2R6Q A;  4AED B;  1BEV 1;  2A71 A;  2GND A;  3WDY A;  4E4D X;  2BWC A;  1RMU 3;  1LOF C;  4HPK B;  3PVB B;  3E5Q A;  2FDF A;  4MXW A;  1HDK A;  4Q0V A;  5IVV A;  1DGR N;  4WVM A;  3RMX A;  5CYY A;  3KZ4 C;  3ETP A;  4UYB A;  3LD8 A;  4XFH A;  4Y33 A;  1SLB A;  1RUH 3;  5FZL A;  3VKF C;  2D98 A;  1ZBE 3;  2A1X A;  2Q8D A;  4HVQ A;  2RS1 1;  3O1O A;  1W6N A;  2R0F A;  2VUD A;  2WDB A;  2IFW A;  3K46 A;  4OZX A;  1IPJ A;  4Q4V 2;  5A3P A;  4JQT A;  5CFD A;  3RGB A;  1BCX A;  4FPY A;  4HAN A;  4EYU A;  4Q4W 2;  1JU3 A;  3BB6 A;  4B7K A;  3WVJ A;  1RUJ 1;  1RTV A;  1LOE A;  3BU7 A;  2A6V A;  2VW1 A;  1RVF 3;  5A6Y A;  2V72 A;  3U75 A;  2ES3 A;  4RR3 B;  5ACA 3;  4XF3 A;  1QJZ A;  1TG7 A;  2GZW A;  1AYM 3;  2ZHN A;  3E5U A;  2QFE A;  2XDV A;  2VQA A;  5C4W A;  2IVJ A;  3OJB A;  4H14 A;  4BQ1 A;  1WD4 A;  2D6M A;  1AR7 1;  3B7M A;  5FO7 B;  2LRO A;  2W87 A;  2XKP A;  3WP3 A;  1RUN A;  1W6N B;  5EXO A;  5BV6 A;  3IDB B;  3NNM A;  3T09 A;  2BQP A;  4HK8 A;  1SLI A;  5DPN A;  5FK8 A;  4LTA A;  3SH3 A;  3WF0 A;  2WT2 A;  4ET7 A;  3V56 A;  4N9H A;  3MLL A;  4NPL A;  4P00 B;  3SIT A;  1H2M A;  3AZY A;  3I8T A;  2LUW A;  1K5J A;  1O91 A;  1W99 A;  4IGO A;  4OUE A;  1OA2 A;  5FYT A;  4JKM A;  5A7S A;  4K40 A;  3I3D A;  1OLR A;  4AOC A;  3HQX A;  1GWM A;  4GWN A;  4ERO A;  3D5O A;  2DF7 A;  1RL3 A;  3N7J A;  3PUS A;  2XH6 A;  2RM2 3;  4RSU A;  4JGY B;  3FLT A;  3T4V A;  5B4N A;  1OOP B;  1SQ4 A;  4HVO A;  4K6B A;  1HXS 1;  3PME A;  1O3Q A;  1NA1 B;  1UOB A;  2RJ2 A;  4NE9 A;  2B9V A;  2VOW A;  3OEA A;  5LA2 A;  3POG A;  2K9Z A;  4RD7 A;  3C7E A;  4BLJ A;  3G7D A;  1O59 A;  2QE3 A;  3SXW A;  3H3U A;  2WNV A;  1QOS A;  4HL0 A;  1RHI 1;  5EPA A;  3WNN A;  3POF A;  4FPH A;  4UFL A;  1QDO A;  3ZYG A;  2LAL A;  1REE A;  3LDK A;  1N1V A;  3ENR A;  1KDM A;  1R1A 1;  4QX8 A;  2Z69 A;  4AQ2 A;  4GQ7 A;  1LU2 A;  3P3N A;  1DQ5 A;  2BPA 2;  4GH4 A;  4RGA A;  5FZ7 A;  4WM7 A;  3MW2 A;  2PA7 A;  3ZMO A;  1W8T A;  3O7O A;  4MXW B;  2HEY F;  4GA9 A;  2XPJ A;  1RUF 2;  2GNM A;  2HWE 2;  2JE7 A;  4CA9 A;  2C0Z A;  3HQU A;  3TB0 A;  1DQ4 A;  1PNF A;  2W92 A;  1MS4 A;  2WNV B;  5F8P A;  4YZ1 A;  1BEV 2;  4GZ9 A;  4QHO A;  2WSU A;  1DQ6 A;  2E31 A;  2PQS A;  4Q4Y 1;  1E5I A;  3VBH A;  3ZXG A;  4A45 A;  1CAU A;  3AMP A;  5F3C A;  2UYA A;  3I2H A;  4LK6 A;  4U2A A;  3H1M A;  4DO0 A;  1K42 A;  2ZHM A;  1HJG A;  2UUR A;  4QWN A;  4ZS3 A;  2E7A A;  5F3E A;  5FYB A;  1AHS A;  1WWY A;  5EIY B;  3VUO A;  2DU1 A;  1X8M A;  4QAW A;  1UL9 A;  4KWJ A;  1GQH A;  1X33 A;  5C4W C;  2EAL A;  1QKQ A;  4HMZ A;  4FO9 A;  4WM7 B;  1VMJ A;  1FAY A;  1MS3 A;  1WBL A;  1W8O A;  2OA2 A;  5J96 B;  1LNS A;  1UF2 C;  2OQ6 A;  2ZGO A;  5BNN C;  1A78 A;  1WMD A;  4NIA A;  4GIQ A;  1D4M 3;  1KJR A;  4B8E A;  4BIF A;  4BZ4 A;  1WA4 A;  3VBH C;  3VHR A;  5A1L A;  3CNA A;  4IEP A;  4I3P A;  3WNX A;  1SEF A;  2GAU A;  2VM9 A;  2VCC A;  4LO8 A;  1AXK A;  2DCJ A;  2X10 A;  2YBP A;  4YZ4 A;  5JCT A;  1LR5 A;  1NAE A;  4RL7 A;  4AW7 A;  1TVG A;  4K9S A;  3RZG A;  1RUE 3;  2ZEZ A;  3IPV A;  3N7L A;  4JDN A;  3WT3 A;  1YLL A;  1VBE 2;  1QEX A;  2ADD A;  5IVF A;  1UYZ A;  1UYX A;  3DKQ A;  4KBZ A;  1BKZ A;  4A6O A;  4RFT 0;  1SPP B;  1W6M B;  1GP6 A;  2ZS6 B;  4W65 A;  3DN7 A;  4BMB A;  5KBF A;  1ULC A;  4LIT A;  4LOR A;  1VMH A;  1R64 A;  3UGH A;  5JZG C;  3WP5 A;  2C6S A;  2Y6F A;  2YRO A;  3FLR A;  1JYV A;  4FPK A;  1UY1 A;  2ZKL A;  1XND A;  3AP6 A;  1V6O A;  5GZD A;  5L7O B;  1R1A 3;  4QXB A;  4RR3 C;  3VBF A;  2D40 A;  3LFM A;  3VZN A;  2PFW A;  4Q4W 3;  2A75 A;  3OGG A;  1M06 G;  1AF9 A;  1J3P A;  4AVB A;  3HNM A;  3WXP A;  4AFA A;  1RVF 1;  4I02 A;  1R09 2;  5GZG A;  1RUC 2;  4A6S A;  1KS5 A;  1WCK A;  1NCQ B;  3FHI B;  2W9X A;  1NQD A;  3OBA A;  2PMW B;  3PMS A;  3HPN A;  4NRP A;  1V9U 1;  1HQN A;  2ARC A;  1OKQ A;  3PVE A;  5D8A A;  1HV1 A;  2Z4F A;  3V64 A;  1UOF A;  4WM8 C;  2JIJ A;  4KG8 A;  5A7N A;  2Y6H A;  4DUV A;  1W8F A;  4AR2 A;  5ANQ A;  1ZZ9 A;  4XOG A;  2DCK A;  5E8A A;  5FBJ A;  2HWE 1;  1VBD 1;  2VMD A;  1TQ5 A;  3ACH A;  4JCK A;  4Q8L A;  4XJ8 A;  1EP0 A;  1EPZ A;  1PZ8 A;  2ZAC A;  2Q8O A;  1ZYB A;  1QH7 A;  1COV 1;  3ZN5 A;  2ILM A;  4ATF A;  5CG8 A;  2X8K A;  4QPG B;  4AF9 A;  3WCR A;  4HT1 T;  3ZKU A;  4X8P A;  4MUV A;  4PDW C;  5AFE A;  3WY6 A;  4DY5 A;  2Y6G A;  5C7G A;  4PLO A;  1MVQ A;  1YXW A;  3O1P A;  3DXU A;  5CKQ A;  3NJZ A;  3I2K A;  4PI0 A;  2I74 A;  3IAP A;  1CES A;  1HX6 A;  1VAL A;  1MZ5 A;  3V0A B;  3ZKY A;  5JPN B;  1DHK B;  4L2N A;  3SEP A;  4A42 A;  1S4C A;  1BVV A;  2XUM A;  4GAZ A;  5FUP A;  1UNB A;  3RZJ A;  1HW5 A;  3GBF A;  4XQ4 A;  2FQP A;  1OHF A;  4NID A;  4XAB A;  4HKO A;  4XQW A;  3BCW A;  3JD7 2;  3M3C A;  2QQL A;  4K7J A;  1ZA4 A;  3MGU A;  5DQ0 A;  1HRI 2;  4HOO A;  1QXR A;  1VB2 A;  4QPG A;  4XE9 A;  5HXM A;  5LEK A;  3E6C C;  4AI9 A;  1UU6 A;  1S2B A;  5D2A A;  2Z2S B;  2OW4 A;  4DXT A;  2W5F A;  4JAA A;  2EIG A;  2IFR A;  2DCZ A;  5J3U A;  5FY7 A;  1S0C A;  1YNA A;  1UXZ A;  3ZFE B;  4D3W A;  3I2I A;  5AC9 1;  4IXL A;  4AVT A;  1UKR A;  2WNV C;  4YM0 A;  4EZH A;  1SPP A;  5K0U C;  3W58 A;  3KT1 A;  4XBQ A;  3VBU A;  3AP7 A;  3LIG A;  4YVS C;  2FCV A;  4N53 C;  4HKW A;  1E5S A;  4QPW A;  1CZT A;  1RUD 1;  2QNK A;  4YAR A;  2UU8 A;  1QJE A;  1RUG 3;  4MG2 A;  2P2K A;  3T2O A;  4X8N A;  4QT6 A;  4GB3 1;  4IEX A;  3C7H A;  3KLS A;  5FZ9 A;  2VOX A;  3KHC A;  5C71 A;  5JMC A;  1ULF A;  3USS A;  3A22 A;  1YIF A;  2YYO A;  4Y1Z A;  4ZU4 A;  1VBD 2;  4AQ6 A;  4FTE A;  1JOB A;  4U36 A;  4GJY A;  3WP6 A;  3W5M A;  4NUB A;  1ZBE 2;  1QJY 3;  1RIN A;  2D7F A;  4IE0 A;  4UBH A;  2Y6K A;  5SV8 A;  3VD9 A;  5CB7 A;  2RS3 1;  3O5S A;  4C90 A;  1AR7 2;  1ENS A;  3MIF A;  2V4A A;  4BU2 A;  1W3V A;  4YW4 A;  1JZ4 A;  1K3I A;  4NRO A;  2Q4S A;  1W6M A;  2BBV A;  1PGW 1;  2VE1 A;  2A6X A;  3U1X A;  2E51 A;  3T0D A;  1JOD A;  1YIP A;  1QXJ A;  2BTV C;  4NHM A;  2VMH A;  2XHN A;  5IWF A;  4YW7 A;  3NQH A;  1BZW A;  4BYY A;  2ZXQ A;  3WDV A;  3PUH A;  4HVR A;  4ITC A;  5I8Y A;  1MS8 A;  2WA4 A;  2ZGK A;  1HQW A;  4UWD A;  4FCA A;  2OZ6 A;  2PLV 3;  4NRQ A;  3AMN A;  1IPS A;  5AC9 2;  3PTR B;  3UV9 A;  1WW6 A;  4CUC A;  1FOD 3;  2HWC 2;  3T3Y A;  3TN9 3;  3NRU A;  2JD4 A;  3J7H A;  3R05 A;  1MPX A;  1QJX 2;  5JUV A;  2O1Q A;  3HN3 A;  1ZRC A;  4HKL A;  1FV3 A;  3AP5 A;  1NQJ A;  3N35 A;  5A3T A;  3RQ0 A;  5BPX A;  2XUE A;  4MHR A;  2JDN A;  3LA7 A;  2GC3 A;  4PIX A;  3ZSJ A;  3HBK A;  4O9E A;  4LBL A;  2H0B A;  2GC0 A;  1PO2 1;  1W0P A;  2HWF 3;  1PNG A;  2YFU A;  4OQ9 A;  1ZM1 A;  4BK5 A;  1DYO A;  1DFQ A;  3B9C A;  2WWJ A;  4YVW B;  1ZRE A;  1C5H A;  4EN6 B;  1OI6 A;  3OEB A;  4IGQ A;  4CU6 A;  4D94 A;  2GP3 A;  3GZT B;  3B9I A;  5FMD A;  4BM8 A;  3C3V A;  2D3R A;  2Q8C A;  5JR7 B;  4XFI A;  1YHF A;  3SKV A;  2F4P A;  1RIT A;  1YQ6 A;  1UMZ A;  4YRD A;  5LBE A;  1JW6 A;  3EJK A;  1G9D A;  4CVU A;  1UY2 A;  1S1A A;  1D2Q A;  1WCS A;  4Q0S A;  1OH3 A;  4RN5 A;  2ZAH A;  4BQY A;  2ZOE B;  1S0F A;  3KCX A;  1DZT A;  4GH4 C;  4IV3 A;  5FUN A;  2I2S A;  5DG1 A;  2OKX A;  2CAU A;  1O7F A;  4A41 A;  4R9D A;  5JXJ A;  1JZ2 A;  2ZEX A;  1GUI A;  4IEU A;  1TNF A;  1O5U A;  1SDW A;  2BVV A;  2D44 A;  5HV0 A;  4QX3 A;  1UXX X;  5LBF A;  4Q1P A;  4RGG A;  3PIJ A;  5FKC A;  1F35 A;  3ZXA C;  1LEN A;  4QQ2 A;  5CBL A;  2YBS A;  1AR8 2;  2EF6 A;  4W6X A;  5F1R A;  2WZR 1;  1I1E A;  1VBC 1;  5JOW A;  1RIR A;  2WT1 A;  3I2G A;  3LQC A;  4R4Z A;  3NNF A;  2HEV F;  1SFN A;  3KV4 A;  1CAV A;  4MLO A;  3NWK A;  4O61 A;  4UOJ A;  3BI3 A;  5IK8 A;  3LSD A;  3E97 A;  2W47 A;  5FK7 A;  2DVB A;  1W05 A;  1BMV 1;  1REF A;  4UAP A;  4YG3 A;  3IWZ A;  2V5Y A;  3ZDS A;  4AGG A;  4JKL A;  4XJW A;  2R49 A;  2WBK A;  3I2F A;  4TWT A;  3MUZ 1;  3Q8A A;  4E4S A;  1D7P M;  4XET A;  4YFZ A;  2BVB A;  2GH8 A;  4AFC A;  1SBE A;  1J58 A;  5C3P A;  1G7Y A;  2EA7 A;  2A6Y A;  2Y8K A;  3H50 A;  4QPY A;  1US3 A;  1LGC A;  4P14 A;  3MO4 A;  4HFS A;  4ZPI A;  3NW4 A;  5F5C A;  3WDW A;  3VB9 A;  2W95 A;  5A7W A;  2ZGP A;  2VW0 A;  3IDC B;  2WO1 A;  1OH4 A;  1GZC A;  1QOO A;  4DOU A;  4ZHN A;  3J8F 2;  3RJ2 X;  2IVI B;  3MUY 1;  4KWK A;  5CAZ A;  2WT0 A;  2X29 A;  2BWA A;  2D43 A;  4H7L A;  3H8U A;  2JDK A;  3GM8 A;  4LLF A;  3WUC A;  2DTY A;  3BKZ A;  2JDY A;  2VCA A;  2IXH A;  2FBE A;  1C8M 2;  4LO6 B;  1AX2 A;  5KR7 A;  4OHY A;  1W0N A;  4QB2 A;  1DG6 A;  1RUG 1;  4KMQ A;  3ROU A;  2SBA A;  2VMC A;  3A23 A;  3WLU A;  3MI8 A;  2OT7 A;  3OCP A;  4XIK A;  4BPZ A;  5KHG A;  4MGI E;  2R04 2;  3ZYP A;  1UMH A;  2Y0O A;  1B35 A;  1URX A;  1ONA A;  1QNW A;  1RUE 1;  4LJH A;  5DUW A;  5A7W B;  2W68 A;  1PM7 A;  4XVH A;  1W9W A;  3KQ4 B;  3VHO A;  2W08 A;  5LWB A;  2WFF 2;  1VRH 2;  3TOJ A;  1JOP A;  1N47 A;  4YVW A;  2JEN A;  3GCX A;  1POQ A;  3LOI A;  5EYY A;  3MW4 A;  4YGE A;  4CDW C;  3VBS B;  4F7Z A;  1HKD A;  1WW5 A;  4UFI A;  4NAM A;  4PLN A;  5AVA A;  4E2S A;  3NNG A;  5I0R A;  1H4H A;  1W03 A;  1J84 A;  5JR2 A;  5A3N A;  4CU9 A;  1JTZ X;  5IFP A;  2ATF A;  1MS5 A;  4DXS A;  5FZ0 A;  3U78 A;  2CWS A;  5LZ6 A;  1KEX A;  4NJ4 A;  3B5L B;  1RXF A;  2I45 A;  3KV5 A;  4ZXE A;  5JIU A;  4GWI A;  3JBG 2;  3UKN A;  4AVC A;  4C1X A;  1NKG A;  4RA0 A;  3BAL A;  1GP4 A;  1NX9 A;  4BXS V;  1CX4 A;  1Q8V A;  3INA A;  3POI A;  2XON A;  5FFO C;  3WQ7 A;  4WVV A;  5GZE A;  3URF A;  3LPF A;  3RWN A;  2QUO A;  3C7F A;  3WDX A;  3SKJ E;  4CU7 A;  1JUI A;  2AH2 A;  2J1T A;  2OQ7 A;  1IQA A;  5A33 A;  5LRR A;  4YM3 A;  5HBA A;  1RUD 3;  2B42 B;  2LM3 A;  2W91 A;  1FOD 1;  3CMG A;  4P9G A;  4TN7 A;  4ZKT B;  5KHK A;  4PIZ A;  1RUO A;  2ENR A;  1ZRD A;  1V6L A;  1G9B A;  3PUA A;  4QX2 A;  4JRA A;  4UFK A;  4LBM A;  1ZRR A;  4C8D A;  1OPO A;  3U4S A;  4V2V A;  2WO2 A;  3AM2 A;  3S6P A;  4CTE A;  3VBO C;  1O4Z A;  2A70 A;  3KQR A;  4CEY C;  2VBB A;  2EIC A;  4XJA A;  2A5Z A;  4XBL A;  5FYV A;  5FY4 A;  4LBK A;  1PGW 2;  1UW8 A;  3E6B A;  2WYF A;  4WM7 C;  4FTS A;  2DFC A;  4SLI A;  4Q26 A;  4B29 A;  1R1Z A;  1O3R A;  5FP8 A;  5FZ1 A;  1Q5O A;  3KCY A;  3LGR A;  1C8N A;  4ZU7 A;  2QQJ A;  3FBM A;  1MZ6 A;  4FAG A;  5A7Q A;  1XNA A;  4MX3 A;  3OGJ A;  2KXL A;  2RS3 3;  1TME 1;  3PL0 A;  4QU1 A;  2EXJ A;  4CXX A;  4ES9 A;  4JKK A;  2LS6 A;  4E2Q A;  2QKD A;  1D0H A;  2O0O A;  5FY5 A;  1W39 A;  1F4H A;  3SCF A;  3FBY A;  3CDZ B;  1MQT A;  1JUH A;  1ULE A;  1XPW A;  3AJY A;  1OOP A;  2P6C A;  4AL9 A;  4CDQ B;  2ZMK A;  3MLK A;  3AMQ A;  5J48 A;  4YSF A;  1DGR A;  4CDU A;  3BGA A;  3DEM A;  2WS9 3;  4DEQ A;  1NCR C;  3C7G A;  2RM2 1;  3HOB A;  4MGY E;  4QM8 A;  4JHZ A;  3ZFG C;  3EBR A;  1WW4 A;  2BEO A;  4L11 A;  1ZRF A;  1Q8O A;  3NKG A;  1S0J A;  1YEW A;  2D3S A;  1UZW A;  2OS2 A;  2XKO A;  4W6W A;  1UCX A;  3WQ1 A;  3X29 B;  4CXW A;  3ATG A;  3J4U H;  3RVH A;  3JCI A;  1OLQ A;  4YZ5 A;  5LA1 A;  2WFP A;  5FR3 A;  5HV4 A;  5J7M A;  5JLV A;  1TZO A;  1SAC A;  2RJK A;  1UOG A;  3LZZ A;  1MS9 A;  3D3A A;  3K3N A;  1RXG A;  1J1L A;  2G1M A;  3MFC A;  3HAG A;  3NAP C;  3ECQ A;  1DZR A;  5DUU A;  5LB6 A;  3MF6 A;  4MV2 A;  3OUH A;  2JDP A;  5FYM A;  1DQ1 A;  1H8T B;  2VZO A;  2XJV A;  5FYZ A;  1GLH A;  4K3U A;  1VPH A;  4QXK A;  1S0I A;  3OOX A;  4YG0 A;  3THD A;  1AYN 1;  1Q56 A;  1C28 A;  1RC6 A;  4OHW A;  3T1M A;  1JHN A;  1ACC A;  2QJV A;  1E5H A;  1HB3 A;  3AL5 A;  2ZTN A;  3K4A A;  3KT4 A;  3N3H A;  4EWA A;  1YQ8 A;  1W8W A;  5BNP C;  3CU7 A;  3BOP A;  1FMD 1;  3NO8 A;  3H3Z A;  2ZGR A;  4FPF A;  3HN1 A;  2XLA A;  3Q8F A;  5JDB A;  1L3J A;  1CVN A;  3FL7 A;  4LXL A;  5DZG A;  2V4V A;  2YPJ A;  5A80 A;  4FOW A;  4IQP A;  3PJQ A;  3SQO A;  2VGD A;  2ZX2 A;  5FJH A;  5C9A A;  3P6B A;  3WF2 A;  1LHN A;  1S0D A;  2FZ1 A;  4NN0 A;  4ATE A;  1FNZ A;  1LB2 A;  4JHT A;  1VAK A;  2YU2 A;  2CU5 A;  2BFU S;  4AEK A;  2HLE A;  4D7S A;  5LA9 A;  1RMU 1;  2XVL A;  4YW3 A;  1IPK A;  1UO9 A;  2JKX A;  1HJF A;  4YWA A;  3BIE A;  1EYB A;  1DLL A;  3JBG 3;  3ZYJ B;  3J26 N;  3RFR A;  1OMI A;  1N1Y A;  4KWU A;  3VGI A;  2JDA A;  1S2E A;  4JQR A;  4GKX A;  4N8M A;  4XTM A;  2ZJC A;  3J7M A;  4Q2F A;  3H42 B;  5CIR A;  2FCT A;  3AKQ A;  1AYM 2;  1VAV A;  4AAX A;  5IVB A;  1KFX L;  4ASM B;  3QCW A;  5F9T A;  2XL9 A;  3AFK A;  1GIC A;  4XJZ A;  1OVP A;  2PHD A;  5ANN A;  3ZLI A;  3M2M A;  4CE8 A;  3B00 A;  5GM0 A;  5CFC B;  2XG3 A;  2EIB A;  2KD7 A;  2EAA A;  1PZ9 A;  2XBO 1;  1H0B A;  1NT0 A;  2YU1 A;  4FPO B;  4BK4 A;  2WNO A;  2VR4 A;  1S0G A;  2BNM A;  4C91 A;  1UZZ A;  5ACA 1;  2MEV 1;  2PHW A;  3K75 B;  1HB1 A;  5F5A A;  4ARY A;  2VUC A;  4DPN A;  4XQD A;  3EHK A;  4JZR A;  5DAW A;  3ZXF A;  3GBG A;  3RRD A;  2GDF A;  1VB4 A;  5T5O A;  4Y3O A;  1RB8 G;  4CDU B;  4XW3 A;  3LA2 A;  5FPA A;  5JI7 A;  5F2S A;  4YVS A;  4OHZ A;  1DQ2 A;  2GN7 A;  4YGC A;  5K0U A;  1A8M A;  1CQ9 A;  2J42 A;  4Y22 B;  5CNA A;  5FPX A;  1W3X A;  4PF5 A;  1J83 A;  5KXC A;  2TNF A;  4NRM A;  4DXR A;  3RZK A;  1PVC 2;  3VN4 A;  2VW2 A;  3TWI A;  5FZO A;  4BA6 A;  4D6R A;  4P9I A;  5CAD A;  3OBR A;  1UN1 A;  2A6W A;  3EQE A;  4CUG A;  3EO6 A;  1OF4 A;  1YCI A;  1ZRI A;  2RMU 2;  1H2K A;  2RMU 1;  2YC0 A;  4HN0 A;  3SC7 X;  1H9W A;  1K45 A;  1ENQ A;  4IEY A;  5A70 A;  5I0D A;  2A3X A;  2FDJ A;  3CIH A;  2WAB A;  1W2O A;  2LW8 A;  4Y4Y A;  1XU1 A;  2B45 X;  2GAL A;  1VBA 2;  2WR9 A;  4Y1Y A;  1LCL A;  2RM2 2;  1QU0 A;  2R30 A;  3VZO A;  4CEW C;  3PUI A;  5CKN A;  1H8T A;  1PK6 C;  1CAX A;  1VE0 A;  1VBB 3;  2H0V A;  5BNO C;  3PVN A;  5LA0 A;  3TN9 1;  3DPR A;  1V6I A;  4TSV A;  2BFU L;  4LO7 A;  2HWB 3;  4COW A;  5FLH A;  3MYX A;  1SLC A;  4DRV A;  1CAW B;  4UF0 A;  1JZ6 A;  3AYE A;  1BMV 2;  2JXA A;  1O5L A;  5D1I A;  5DZE A;  2WN3 A;  4AVV A;  1NLR A;  1BBT 1;  4AE2 A;  5ABJ B;  3I2J A;  5JWP A;  5DDJ 3;  3THT A;  5CKM A;  1IQD C;  4H2A A;  1ZBE 1;  2BDR A;  3OY8 A;  1MVE A;  1RUF 3;  4L8Q A;  3QBQ A;  4QKN A;  4CDW B;  1P8J A;  1IZ3 A;  1Z7S 1;  1JMU B;  2DV9 A;  2R07 2;  2DVA A;  1LED A;  2XLG A;  4OYU A;  3GXU A;  3KS7 A;  1KDK A;  2ZHL A;  3OYW B;  3RZH A;  4W4Z A;  2ZPX A;  4I2O A;  3TBD A;  1VBB 1;  1AL2 2;  1W9F A;  5GKA C;  4XTP A;  1CAW A;  2WS9 2;  4UF0 B;  1ZBA 1;  5EHD A;  2HWB 1;  2R07 1;  4TTG A;  1BEV 3;  3POB A;  3RWK X;  1ST8 A;  3TEX A;  4K1Y A;  4YNI A;  1XRU A;  4CCN A;  4A7Z A;  4OVE A;  5DUX A;  4QDS A;  1PGL 2;  2VNG A;  3GHN A;  5FOB B;  5C9A B;  4A2U A;  4FTB A;  1W0O A;  1VRH 3;  4FSJ A;  2KA3 A;  2Y6L A;  4RR3 A;  2ARA A;  2AEN A;  3AVR A;  4GH4 B;  2WN2 A;  2WZP P;  3ZN4 A;  4CDX C;  3LSE A;  4J1X A;  4N43 C;  2X5I B;  3NV1 A;  3VD4 A;  4LHK A;  1VBD 3;  2TEP A;  3ETQ A;  4IUG A;  3ES1 A;  5IK7 A;  4BIO A;  1WCD J;  1QH6 A;  3WR0 A;  5F6L B;  3IMM A;  2RJL A;  1XYO A;  2RR1 3;  2VVE A;  3VBR B;  2PHL A;  2VG9 A;  4P5Y A;  1RUG 2;  2P1B A;  3OG2 A;  4LBQ B;  4YGD A;  3VBH B;  5FZB A;  1GFF 2;  1ZNP A;  1ZZ8 A;  3FMG A;  3WNP A;  3BYW A;  1BYH A;  2QQW A;  2P34 A;  5FZM A;  3FE5 A;  2TUN A;  1FI2 A;  4YW2 A;  3VKM A;  1RUE 2;  4TLG A;  4AHY A;  5G04 L;  2J22 A;  3ABZ A;  4CP9 A;  2J1E A;  4HPK A;  4NO4 A;  1Y3T A;  3LOB A;  2BYV E;  3ZFF C;  4HLT A;  1COV 2;  2XR4 A;  4BHP A;  1AR6 2;  2LTN A;  5H9S A;  3K4Z A;  3VBF B;  4B4Q A;  1NXM A;  4R8H A;  4EN8 B;  2PLV 2;  2NLR A;  3HT1 A;  5IUQ A;  5I91 A;  5CFD C;  4B3N A;  3IT8 A;  3H9A A;  4AWD A;  4AVS A;  4CU8 A;  1EPW A;  4LBQ A;  2YC4 A;  1NLQ A;  3T0B A;  2XJR A;  1MZF A;  3CEW A;  2WZE A;  5K0U B;  2VJX A;  1IKQ A;  1QDC A;  1OXC A;  3LF7 A;  2OPW A;  2A7A A;  3ZXL A;  2WNE A;  1FV2 A;  4LBJ A;  4X6Q B;  2DUP A;  3W59 A;  3POY A;  3RPQ A;  1POV 0;  3B3Q E;  3D4K A;  3KF5 A;  1OFN A;  2VD7 A;  3MIH A;  1UU4 A;  2ZGQ A;  4XAC A;  2VUL A;  4WZC A;  5GZC A;  4E4Z A;  5BNQ A;  1CX1 A;  2RG4 A;  1GP5 A;  1A3K A;  1UIJ A;  2E7Q A;  4YZ2 A;  1VAM A;  3POE A;  5AVP A;  4RQP C;  4FVV A;  3WF4 A;  2BGP A;  4AQT A;  2B4K A;  3IDE A;  4AHW A;  4BQ2 A;  1J1T A;  2ZAA A;  3III A;  4FFH A;  1CON A;  1H8T C;  1KJL A;  1VRB A;  5HCB A;  2RS5 2;  5J37 A;  4UFJ A;  4CP0 A;  3VDD A;  5FMO L;  1V6N A;  4P9L A;  1CAX B;  1ZZ6 A;  2J1S A;  3MPB A;  5FYC A;  5IJR A;  4BOW A;  5CFC A;  4QMA A;  1TE1 B;  1YYN A;  2W52 A;  4Q4X 1;  3D82 A;  3S7E A;  2NP0 A;  3VZM A;  4I09 A;  1LEC A;  4MGZ E;  1W6Q A;  3ALQ A;  3PTY A;  1FXZ A;  2DUO A;  1GV9 A;  4MVT A;  4LT5 A;  1ALY A;  3T1L A;  2A3Y A;  3VBS C;  3VBU C;  3GCW A;  2ARX A;  1APN A;  3IZO A;  1AR9 1;  3V0A A;  1CAU B;  4JGY A;  3KGL A;  3ME2 A;  2ZEW A;  2CTV A;  1YQ2 A;  3QH6 A;  2W94 A;  2D97 A;  2VNO A;  5CU1 A;  4CPB D;  3TNP B;  2QQI A;  4OI1 A;  2FDK A;  1NZC A;  4QHB A;  4IV1 A;  2VZR A;  3ZYI B;  4QX7 A;  5CIS A;  5M0T A;  3QLQ A;  1OD5 A;  2D6P A;  5T5J A;  4A7K A;  1L7Q A;  1NA1 A;  4Z82 A;  3T2T A;  1DIW A;  4KGG A;  1UZY A;  1GBG A;  2OVU A;  3LB9 A;  3O0V A;  4YM2 A;  3M3E A;  1NE6 A;  4COZ A;  1XYN A;  5JMO A;  3DV8 A;  4QQP A;  3HT2 A;  1PO1 1;  1GOF A;  4BXF A;  1JS9 A;  4FOQ A;  1C1F A;  2GSY A;  4ARX A;  4E2G A;  3GGL A;  3O1M A;  2IWG B;  1RUI 2;  1VLN A;  1WMX A;  3ZFE A;  1O3T A;  4S2F A;  4LKS A;  4YZ3 A;  3MPP G;  3FHA A;  2F4L A;  4LNV A;  4Y5Z 0;  2WJS A;  2O8O A;  2CGP A;  4NR1 A;  4RS5 B;  4ZZ8 A;  4N43 A;  5FDB A;  3IKW A;  4OHV A;  1E5R A;  1LOD A;  5C3R A;  2FHR A;  2QQK A;  4AI3 A;  5FY8 A;  4BQ4 A;  2R06 1;  4N7I A;  4CP9 B;  3EXU A;  1G9F A;  1RHI 3;  1ZBA 3;  3OF1 A;  5F32 A;  3BIW E;  4BH9 A;  4KI5 M;  4C0B A;  4UXA A;  2JWP A;  4NWV A;  2IXC A;  3OTF A;  1RUJ 3;  3OD0 A;  5F3G A;  5BNN B;  3W21 A;  3KB5 A;  1I3H A;  1BLZ A;  1YJL A;  2CHH A;  4DS0 A;  1MR5 A;  4PQ9 A;  3SNM A;  5A6Z A;  1AL2 3;  2Q5T A;  1Y7B A;  5FP3 A;  1V6K A;  4UW5 A;  4AFD A;  4WVW A;  4E4H A;  1D4V B;  1ENX A;  1QJY 2;  4QX1 A;  4COV A;  1EAH 3;  5FMO S;  3MV1 1;  3IMN A;  4C1W A;  1XNT A;  3POW A;  4Z2A A;  3O1S A;  1BBT 3;  1WMF A;  2EAK A;  2XJQ A;  3OGR A;  4YYO A;  1Q8Q A;  3ZSL A;  2XWJ B;  3MLJ A;  4N90 A;  4PBO A;  4XFC A;  2R1D A;  2XOM A;  3UJO A;  3TEZ A;  2HBT A;  3MIG A;  4GUL A;  5DAP A;  3N9Q A;  3H3L A;  5GLZ A;  4GB3 2;  2CWM A;  4D6S A;  2Y38 A;  3S0M A;  5A3M A;  3WEZ A;  2PHU A;  1GNZ A;  2DFB A;  3NV4 A;  4OMC A;  2NZ9 A;  2VTF A;  5F6K A;  3WNO A;  5K9Y A;  4LHN A;  1BVP 1;  1VBE 1;  3H1W A;  4FOY A;  3PHM A;  1MS0 A;  3WV6 A;  3LAG A;  3IPV B;  4R9B A;  5J09 A;  1JHJ A;  2JDM A;  3DPR C;  2W1U A;  1UZV A;  1QJX 3;  4MGK E;  1HB2 A;  3UK9 A;  1AXY A;  1EV1 3;  2VCM A;  2PEL A;  2VBP A;  1AYN 3;  2XHK A;  3P1I A;  2QTW B;  4XDQ A;  1COV 3;  1TME 3;  5DUV A;  4NOT A;  3WD5 A;  5AC9 3;  5FZE A;  4AHX A;  4TLF A;  2GC1 A;  2R16 A;  3T2P A;  2RS1 3;  1VMF A;  2YGM A;  4Q4V 3;  1OQE A;  4XF0 A;  5JIA A;  1YQC A;  1YI9 A;  1D2S A;  5H9Q A;  3ACL A;  4HET A;  3S5A A;  2WIN B;  1UY4 A;  3AYA A;  1NE4 A;  4NHX A;  5L9B A;  2PAK A;  2JX9 A;  4Q29 A;  4JRL A;  4QDQ A;  5A6Q A;  2VTX J;  1OBN A;  4LIU A;  2E32 A;  5CA6 A;  1EV1 1;  2VQU A;  1WLT A;  1OA4 A;  4K20 A;  1QJF A;  4YLZ A;  5JPM B;  2CV6 A;  2QQV A;  1KQR A;  4PIY A;  3AKT A;  2XML A;  4EV0 A;  1AR9 2;  2E33 A;  4LHL A;  3PJY A;  4MO3 M;  4O7X A;  5LAS A;  2WL1 A;  4EN0 A;  5G05 L;  4Q4W 1;  4CEY B;  3T30 A;  1OVS A;  5T5L A;  1IG3 A;  2VZU A;  5FZK A;  5K7P A;  4Q0U A;  4UFM A;  4B4R A;  5DDJ 2;  4XF9 A;  2RS5 3;  2BNO A;  3QOP A;  5KXE A;  2ZX4 A;  3SH4 A;  5FWJ A;  2BP6 A;  2IXK A;  3V0B A;  1X36 A;  4LBO A;  3VBU B;  1OC1 A;  3LFI A;  2ET1 A;  1CR7 A;  4HXC A;  3BN6 A;  3F95 A;  1DGL A;  1OLM A;  2FCU A;  4EWE A;  1LOC A;  1NUK A;  4HON A;  3KMH A;  3LEM A;  4M3C A;  4CCD A;  3BPZ A;  1QXP A;  2GU9 A;  2JG8 C;  2ZCW A;  3VZL A;  3ZYR A;  1QJU 2;  3SMH A;  4XYX A;  1AL2 1;  2XQX A;  3I4I A;  1GQG A;  4CDQ A;  4KU8 A;  2FDG A;  4ZY9 A;  3NVC A;  2W1S A;  2VZT A;  3IBM A;  4C0H A;  3WDU A;  3GF6 A;  4Z2W A;  3M8L A;  4WBB A;  2BV4 A;  3W20 A;  2XXZ A;  5IVJ A;  1HXS 2;  2EXH A;  2E9Q A;  3VLB B;  1RUI 3;  5FWE A;  4CCL A;  1IS6 A;  1PIV 3;  4CCK A;  1JYC A;  1QJY 1;  4Q1R A;  1W28 A;  3ZXD A;  1J59 A;  2E63 A;  5F5Q A;  1AVB A;  1WW7 A;  4MET A;  4M3C B;  5A7O A;  1X8E A;  4QGM A;  4XMA A;  1CAV B;  2JDZ A;  1NG0 A;  4TYS A;  1NCQ C;  3J8F 3;  5F39 A;  1JYT A;  3WX5 A;  1LRH A;  1GQP A;  3ZPY A;  3ZDV A;  3AXD A;  1DLC A;  4JTN A;  5LBC A;  4AI0 A;  4GWJ A;  4XEZ A;  1AR8 1;  3ZM8 A;  2ADE A;  2C24 A;  4LKE A;  3UYJ A;  4NPR A;  5A32 B;  1ZVF A;  4V1P A;  1XBF A;  4Q8K A;  5J1X A;  4X6R B;  4OUL A;  2WAO A;  4M4R A;  5FZD A;  3RI9 A;  1WLD A;  5IAV A;  3THP A;  3THC A;  4PHZ A;  3RDI A;  1FAT A;  5GAL A;  3N9P A;  4DMI A;  4IW3 A;  4CEW B;  3VDB A;  2DVF A;  4W6Y A;  1PK6 B;  4H55 A;  1CJP A;  4PLM A;  2Y26 A;  1H4G A;  2EVX A;  2G9Z A;  4JDO A;  4OUS A;  4XHX A;  1PVC 1;  4B4P A;  1ENR A;  4EWD A;  5FMC A;  3USU B;  4QPG C;  4BB3 A;  1D4M 1;  2J7M A;  3ZR5 A;  1KFU L;  3J8F 1;  1RUJ 2;  2C4X A;  4FBF A;  1VIW B;  4MGS A;  2ZBJ A;  3ZFG B;  1TMF 1;  1G6N A;  1RGS A;  3J9S A;  4IEW A;  4B7E A;  4LE4 A;  4Q27 A;  1OLM E;  5B4X A;  4QPI A;  1K5M B;  3KVA A;  3N7K A;  3AVS A;  3UT0 A;  5C8W A;  2N7G A;  3WOG A;  3AJZ A;  1KS4 A;  3LKJ A;  4CPB A;  1IS3 A;  2BZD A;  2QZ2 A;  2BOJ A;  2WFF 3;  1XXN A;  4IV3 B;  1W6P B;  1GZ9 A;  1ULD A;  2QCS B;  2XBO 2;  1ULP A;  2QDR A;  3I54 A;  5FTT C;  4XJ9 A;  4CEW A;  4URA A;  5GLV A;  5HCF A;  1B35 B;  4AI2 A;  1KXG A;  4GAL A;  2VMF A;  3M1H A;  1W2U A;  3A21 A;  2V73 A;  1JN2 P;  1UD1 A;  3R4S A;  5ABJ C;  4LA3 A;  3UL2 A;  3R6S A;  1IKP A;  1RJ7 A;  4HN1 A;  1ND2 C;  4P9W A;  2K0G A;  1WLW A;  5T5P A;  4QPI B;  1ASJ 3;  4MGQ A;  1G9C A;  3GDB A;  1S0B A;  2VME A;  5FUI A;  4B1L A;  2XJT A;  2UWC A;  3FWE A;  1W06 A;  4I30 A;  4E8D A;  1Z7S 3;  4Y5T A;  1FPN 3;  2WAA A;  4JC1 A;  4R9A A;  3H7Y A;  4YVS B;  3WZ1 A;  3T4H B;  5FV3 A;  5DDJ 1;  5FAX A;  3T0A A;  1G86 A;  1JOJ A;  5DAQ A;  5C8C C;  1RUC 3;  2QQN A;  2E7T A;  3VBO B;  3H8R A;  1SHW B;  5EFU A;  2XVG A;  1T6B X;  2RS3 2;  4EN7 B;  5A33 B;  1YC6 1;  2HEW F;  3VDD C;  4FFG A;  5FRE A;  3NST A;  2K46 A;  3V0B B;  1UOJ A;  4FFI A;  1QGL A;  2ARB A;  2UYB A;  2JG9 A;  1EY2 A;  2R1B A;  2Y0I A;  4AG4 A;  3VKO A;  3E1F 1;  5FZ6 A;  1PVC 3;  4DB5 A;  1QJU 3;  4J25 A;  1IGO A;  5E89 A;  4AED C;  3HBZ A;  2WLP A;  4AEJ A;  2FMY A;  1W9T A;  4NHK A;  1RUC 1;  3TRS B;  3B93 A;  4COY A;  3DYP A;  3JU9 A;  3GYD A;  1X9T A;  2G4I A;  1H1I A;  1CZS A;  3ZR6 A;  3DL3 A;  5I0T A;  1CIW A;  3N9L A;  4S2H A;  3Q9O A;  5JAX A;  1JBC A;  4LLO A;  2YMZ A;  4M01 A;  3ILR A;  3RZZ A;  1LHU A;  1QJX 1;  2WSV A;  1A34 A;  1NY7 1;  3WHT A;  1W8Z A;  5ABJ A;  3UKV A;  1W6O B;  3L9J T;  3RNS A;  1X9P A;  4TZD A;  3RZM A;  1Z78 A;  2Q1M A;  1DP0 A;  2YBK A;  2C26 A;  4XUP A;  1YO8 A;  4XUN A;  3UJQ A;  2VNR A;  1CPN A;  1MQT B;  2XQR A;  3RMY A;  1IS5 A;  3TAY A;  5IVE A;  5KWR A;  5A3L A;  1I5Z A;  5KXD A;  4NII A;  3ZYH A;  4GXL A;  1CJD A;  4ZS2 A;  1K5M A;  4MZU A;  2VL4 A;  1DQ0 A;  3DYO A;  2ZX0 A;  4AK3 A;  1LUL A;  3AZX A;  5FP7 A;  1LOA A;  5FJK A;  5A32 A;  5KXB A;  3TEW A;  2HWE 3;  5F2W A;  4BQX A;  2L9L A;  3JXS A;  1HN0 A;  3JB4 C;  4J1W A;  4OI4 A;  4RQP B;  1XB9 A;  5FZ8 A;  5T50 A;  4K8R B;  4QXH A;  4DFS A;  4Q4X 2;  1W9Y A;  3FZ3 A;  2ZZJ A;  1C3H A;  3WNL A;  2VH9 A;  1PIV 2;  1WUV A;  5GLT A;  2PHF A;  1QNY A;  2OII A;  1NLS A;  3M7A A;  2V5D A;  2ETE A;  3ZPO A;  5HCH A;  1UPI A;  5JI9 A;  3USU A;  2HWD 3;  4Y5S A;  2D93 A;  1GZT A;  5C9A C;  2Q1Z B;  1R08 1;  2YPD A;  5FZA A;  5FP4 A;  3WF3 A;  2ZML A;  1C4R A;  2Z42 A;  5CZK A;  4DZG A;  4IGP A;  4Y24 A;  1GYK A;  4CYD A;  1NZI A;  5EZW A;  2VOT A;  1H1A A;  2JEM A;  3NNL A;  1NA1 C;  4R4X A;  5FXX A;  4KH9 A;  5BNP A;  3NNJ A;  3I49 A;  1Q3E A;  5JOZ A;  4EN9 B;  1E57 A;  2BER A;  2WWS A;  2ZA9 A;  1VBE 3;  3B94 A;  4FPJ A;  1CGP A;  1JI6 A;  2W0X A;  2VZS A;  2X53 S;  1L7R A;  3C2U A;  3F2Z A;  1JZ3 A;  1GNH A;  4IET A;  1JZ5 A;  5K4L A;  1DU3 D;  1DGW A;  5JXI A;  5DMY A;  3S57 A;  2WNU C;  3D6E A;  1R1A 2;  4KGQ A;  3VBS A;  2FZ2 A;  4FXK B;  2P3I A;  2OXB A;  5FZG A;  1RUI 1;  4ASK A;  5H9R A;  1ND2 A;  2HWC 3;  3TN9 2;  2ZHK A;  1H6X A;  3CJI A;  3CZU A;  2CDP A;  1WD3 A;  4OI0 A;  5ERL A;  3H8O A;  3ACG A;  4P08 A;  2PTM A;  5L36 A;  4I0W B;  1GZW A;  3K3O A;  4D69 A;  5T52 A;  2GN3 A;  4DRR A;  3WW4 A;  1PM4 A;  1EV1 2;  2JD9 A;  2YY1 A;  2WO3 A;  3B69 A;  1AYN 2;  1LHV A;  2VPV A;  2ZX1 A;  5FZC A;  1KGY A;  3LA3 A;  2DCY A;  3AZZ A;  3WNM A;  4W50 A;  4R9C A;  5IFT A;  1O3S A;  1LGN A;  2LRP A;  3BOW A;  2VC9 A;  3ZXK A;  2R0H A;  3ES4 A;  4CUA A;  2Y34 A;  2E53 A;  1MEC 3;  1AR9 3;  3AYD A;  5EWS A;  2XL7 A;  1UIK A;  1OUS A;  1C8M 1;  1NCR A;  2WZR 3;  4CDU C;  2F6B A;  3LEG A;  3AC0 A;  4ZXK A;  3UES A;  2QQP A;  5CG9 A;  2EXK A;  5I93 A;  2XJS A;  3HD8 B;  2YZ4 A;  3SLI A;  2X5I C;  2RV9 A;  1O4T A;  3ITQ A;  1VBB 2;  2ID4 A;  2HWC 1;  4PDW A;  2J1A A;  3NJV A;  2CYF A;  2RDS A;  4CCC A;  1XSQ A;  4XFA A;  4V2W A;  5JOY A;  5FXV A;  5A3U A;  1PMI A;  4O9G A;  3P5B A;  3I3M A;  2VQT A;  2CDO A;  4MHU A;  3VBR C;  2Q30 A;  3P3P A;  2R32 A;  1XYP A;  5C6C A;  2X09 A;  1HQL A;  3WW2 A;  3GJA A;  3Q8E A;  4FT8 A;  4XXP A;  1UY0 A;  1NCR B;  4I01 A;  5LY2 A;  4OZO A;  3LEK A;  2RDR A;  4BJ0 A;  3WG3 A;  5T54 A;  2B7Y A;  1RYY A;  3M3Q A;  4WM8 A;  1IG0 A;  1XNK A;  4YPJ A;  2GMP A;  3MW3 A;  1YFY A;  4K21 A;  4W8J A;  3I97 A;  4I0B A;  4XPV A;  3UGF A;  5JSO A;  4Q5O A;  4CDW A;  2RR1 1;  1CN1 A;  3HIF A;  1QJU 1;  1WLC A;  5IT6 A;  1W9S A;  3O1R A;  2D6O X;  2YG0 A;  2VZP A;  1MAC A;  1HLC A;  3DUI A;  3LPG A;  4KQ7 A;  3ZYF A;  3VL9 A;  4MGT A;  1G8W A;  3FN9 A;  4A3Z A;  2MEV 3;  4LBQ D;  2P37 A;  3U14 A;  1LHO A;  4FQ4 A;  3GZU C;  3HEI A;  1WCU A;  3ZIW A;  1POV 1;  2VZV A;  4BCU A;  3AZV A;  1GU3 A;  1N3Q A;  4RGK A;  3JD7 3;  2JG9 C;  1HXS 3;  4HSL A;  4YFW A;  3ZXJ A;  3S5Q A;  1I5P A;  1QQP 3;  4OQ8 A;  4LQR A;  2GP5 A;  3Q8B A;  4D6Q A;  1AUY A;  4AYU A;  4NWW A;  2BU9 A;  2BOI A;  3N9O A;  5KHI A;  3VZK A;  4L97 A;  4FQZ A;  1VJ2 A;  4D8M A;  2ZGU A;  3JBG 1;  4XJU A;  1RHI 2;  2VOK A;  4XFG A;  2RVA A;  4AFB A;  3WW1 A;  3N9N A;  4YW5 A;  2JDU A;  5LBB A;  2NQY A;  2XGX A;  5K8S A;  2ZKN A;  1Y43 B;  2OUJ A;  1ND2 B;  1OQ1 A;  4GKY A;  1LEM A;  3U4X A;  2OZJ A;  1F2N A;  3POJ A;  2R7E B;  1BK1 A;  1TMF 2;  3OYW A;  4HG6 B;  3PUR A;  2BGO A;  5JSP A;  1OA3 A;  1N1T A;  4GWM A;  2HYK A;  5FY9 A;  2OYZ A;  2DU0 A;  2D6N A;  1HRV 2;  2RDQ A;  2HWD 2;  4Y1X A;  5JOX A;  3HNY M;  4P9J A;  1EAH 2;  3HWJ A;  3VBR A;  4ONU A;  2R04 1;  3AX4 A;  4YW1 A;  1JYW A;  5GJ6 A;  4EQV A;  3U10 A;  2O8Q A;  4Y22 A;  1LAJ A;  2EXI A;  3D0J A;  1PO2 2;  2WNU A;  1JH5 A;  4OLL A;  2JJ6 A;  1SFY A;  2VZ1 A;  2WFF 1;  2P3Y A;  4BIS A;  1GWL A;  2VU9 A;  3BVC A;  5FXW A;  3LWC A;  3R4U A;  1OUR A;  4P02 B;  4DQA A;  1PIV 1;  1BK0 A;  1RMU 2;  3LCP A;  4PQQ A;  2GMM A;  3AZW A;  3CJI B;  4K8F A;  2EIE A;  4QM9 A;  1CD3 G;  2RR1 2;  1HIX A;  3BTA A;  2BJS A;  3NL1 A;  1CIY A;  1V00 A;  3OGV A;  3N7M A;  1BBT 2;  4WVM B;  3MDP A;  5FP9 A;  4RFR B;  5FZI A;  4ORF A;  5FRA A;  3CKH A;  2VOV A;  3A0N A;  3I59 B;  1T6G C;  3OBZ A;  4YG6 A;  5FQ0 B;  3M3O A;  3W5N A;  1JZ8 A;  4BDV B;  4M0N A;  2VTX A;  1AL0 G;  4IEO A;  4RHV 3;  4G3Y C;  1O6U A;  1RVF 2;  3AP4 A;  3D8C A;  1LGB A;  1F5F A;  1JXN A;  4M00 A;  1TME 2;  2QZ3 A;  2BUK A;  2NYY A;  2VXR A;  2W3J A;  2VXJ A;  2VO5 A;  1S2K A;  3LEI A;  4IE7 A;  2IXJ A;  4Z07 A;  2PHT A;  3WF1 A;  4E27 A;  2AC1 A;  3SIS A;  5EYX A;  2FDH A;  4L0P A;  2B5H A;  4IV1 C;  2YFZ A;  4IE4 A;  2WQ4 A;  4CZS A;  1OSG A;  3IB3 A;  3L2H A;  2ZGL A;  2XWB B;  5JXG A;  4ZU5 A;  3OY8 B;  5EV7 A;  3PDQ A;  1MQT C;  4LUL A;  1R09 1;  3APB A;  1I6X A;  2D5H A;  1J3Q A;  5GLU A;  2WRA A;  4NAO A;  4UT5 A;  5FQ0 A;  1RUD 2;  1JYN A;  2E26 A;  5FCC A;  1BXH A;  3BTZ A;  2WZR 2;  4G9S B;  3RSJ A;  4ZZ5 A;  4O65 A;  3I2O A;  2MHF A;  3H1Y A;  4LMF A;  1LOB A;  1QF3 A;  5FPB A;  1N3O A;  1RED A;  1CZV A;  4PBP A;  2Q8E A;  2Z79 A;  3OB8 A; 
#chains in the Genus database with same CATH homology
 5L9R A;  2G1M A;  5LB6 A;  4BQX A;  3OUH A;  3GZE A;  4NHY A;  4ZON A;  4UWD A;  2JIJ A;  5C5T A;  3KT4 A;  4Y5S A;  5L9V A;  5EPA A;  4NHX A;  5L9B A;  4MHR A;  5IAT A;  4NMI A;  2Y33 A;  5C5U A;  4XCB A;  5DAX A;  5M0T A;  5LBB A;  3NNL A;  3NNJ A;  5LAS A;  4XCA A;  3HQR A;  5EQU A;  5LA9 A;  3HQU A;  2RDN A;  5LBE A;  5EP9 A;  2RDQ A;  4BQY A;  2JIG A;  4Y5T A;  4XAB A;  3EMR A;  2FCT A;  3MGU A;  2FCU A;  5IAX A;  5DAQ A;  5ERL A;  5HV0 A;  5LBF A;  2A1X A;  2G19 A;  3BVC A;  2Y34 A;  3W20 A;  3NNF A;  5DAV A;  4JZR A;  5DAW A;  3W21 A;  3KT1 A;  4J25 A;  3PL0 A;  3OBZ A;  2FCV A;  4NHK A;  4BQW A;  3ITQ A;  4NHL A;  2RDS A;  3OUJ A;  3DKQ A;  4KBZ A;  5A3U A;  5LAT A;  4MHU A;  4ZPI A;  3NNM A;  5LBC A;  2HBT A;  5DAP A;  3KT7 A;  3GJA A;  3OUI A;  3GJB A;  2OPW A;  2RDR A;  4NAO A;  2HBU A;  4XC9 A;  2V4A A;  5IAV A;  5HV4 A;  4XAC A;  4IW3 A;  4Q5O A;  2RG4 A;  4NHM A;  4XAA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...