5C5UA

The crystal structure of viral collagen prolyl hydroxylase vcph from paramecium bursaria chlorella virus-1 - truncated construct
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
208
structure length
187
Chain Sequence
HMEGFETSDRPGVCDGKYYEKIDGFLSDIECDVLINAAIKKGLIKEQTWFMPGEHEVIDKIQKKTREFLNSKKHCIDKYNFEDVQVARYKPGQYYYHHYDGDDCDDACPKDQRLATLMVYLKAPEEGGGGETDFPTLKTKIKPKKGTSIFFWVADPVTRKLYKETLHAGLPVKSGEKIIANQWIRAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prolyl 4-hydroxylase
publication title Structure and Mechanism of a Viral Collagen Prolyl Hydroxylase.
pubmed doi rcsb
source organism Paramecium bursaria chlorella virus 1
molecule tags Hydrolase
total genus 51
structure length 187
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 5c5uA00
3W20A 5DAPA 5C5UA 3NNLA 2JIJA 3DKQA 5LATA 2FCUA 5DAXA 2G19A 5DAWA 4NHLA 2RDNA 2HBTA 3KT1A 4BQYA 3GZEA 3GJAA 4XACA 4ZPIA 3GJBA 5IATA 2A1XA 5IAVA 3BVCA 4MHUA 5LBFA 2Y34A 5A3UA 5ERLA 2JIGA 5LBCA 4KBZA 5HV4A 3W21A 2G1MA 4JZRA 4XCBA 4Y5SA 3OUJA 3NNMA 3HQRA 2Y33A 4MHRA 3NNFA 3OUHA 4NHYA 4Y5TA 2RG4A 3OUIA 5L9BA 4NHMA 4Q5OA 4BQWA 5EP9A 5M0TA 4NAOA 4NHKA 4BQXA 3KT7A 4XC9A 3NNJA 2V4AA 2HBUA 3HQUA 2FCTA 5HV0A 5LASA 5L9RA 3OBZA 5L9VA 5LBEA 4XCAA 2OPWA 5IAXA 2FCVA 4UWDA 3PL0A 4ZONA 5EQUA 3ITQA 4XAAA 3MGUA 3KT4A 5C5TA 4J25A 3EMRA 5EPAA 2RDRA 4NHXA 4XABA 2RDSA 5DAQA 4NMIA 4IW3A 5LBBA 5DAVA 5LA9A 2RDQA 5LB6A
chains in the Genus database with same CATH superfamily
3PUAA 3UKTA 5FLIA 1BXHA 5CFDC 3O1MA 4QPGA 1ZZBA 3LEGA 4XJAA 4IEZA 5A1LA 5F5CA 4QX2A 4S2DA 4BQ5A 1YFWA 1HRI3 1RJ7A 3VHNA 1BEV2 1CIYA 1DZQA 4UFKA 3HT1A 5B4XA 1IKQA 3AM2A 1O8PA 2YGLA 2GC2A 1IPJA 2D43A 2ZAHA 4JGYB 5H9SA 3T0AA 2NN8A 3ES4A 3R05A 1CAWB 4EZHA 2VXRA 3M3IA 3NMBA 3AZZA 5JOXA 4P9WA 5F3IA 2A6WA 4RQPA 4QGNA 3U0ZA 1GKBA 2HYKA 3OPZA 2XOMA 5C9AC 4UW5A 4BYYA 3MIHA 1LHVA 4YW7A 4CCOA 2WDBA 3J7HA 5FQ0A 1GNHA 4JGZA 2WKKA 5FYUA 2JX9A 2WN3A 4GA9A 4NJ4A 4Q26A 2DVDA 1HRV1 2YZ4A 3BOWA 3ZMOA 2VMCA 3N9NA 2Q5TA 2VCCA 5JWPA 1N1YA 4XZUG 3ZFFC 3L2HA 2GC1A 4LO8A 4AVVA 2FD8A 2FMDA 4TLGA 5A7QA 1PO21 1F9KA 5DUVA 3VBUC 3RYRA 2V72A 1NCQC 1SFNA 1OLQA 3VL8A 1QMJA 2G9ZA 2GALA 2P3YA 2R043 4YLZA 5FZCA 1UN1A 3EQEA 5L9BA 3KZ4C 4BH9A 4QB1A 3TRSB 4X6RB 2OS2A 1ZBA1 2DTWA 4LA3A 4XJ8A 2MHFA 1W6OB 2R063 2RMU2 1AJKA 3L9JT 3WNNA 1D4VB 1ZYBA 3EO6A 3AZYA 3FL7A 3CEWA 1RXGA 4DPNA 4Z8BA 1H8TC 1O4YA 1OFNA 3FBYA 4HOOA 4BLIA 5FZ9A 1V0AA 2JXAA 4AWDA 5KXCA 1B35A 4NIDA 4AXOA 1YCIA 4GMP0 2W9XA 4HVRA 5DXDA 4OHZA 3RSJA 3TN91 2WNEA 4LA2A 2JKXA 1QQP2 2BRTA 3R4UA 5GM0A 1LESA 4QWNA 1W2OA 2PA7A 2WT2A 3ZSJA 5FMOS 1V9U3 1XXNA 1J3RA 4HLTA 4LTAA 3TEWA 1WKYA 3JD72 3AB0A 1W8HA 5GZEA 3B9CA 3MIDA 1VB2A 4A3ZA 2YY1A 3E5UA 3NNGA 1UZYA 1H2LA 1KFUL 3OJBA 1NT0A 4FFIA 5BNNC 3BPSA 3KSCA 1RIRA 3MV01 4NWVA 5A7NA 3W5NA 2PHDA 3I49A 5C33A 3WG3A 4H14A 4IESA 3KM5A 3IM0A 3WQ7A 4ASLA 2XWBB 5J48A 3NL1A 4N7IA 3WF0A 3ZFEC 3VBFA 1BQPA 5A7PA 4LE4A 3N9QA 1H30A 1HN1A 1GOGA 3ILRA 5FTTC 2BGOA 1KXGA 5FUIA 4YM2A 4ZU4A 4UF0A 2RS11 3V65A 1GFF2 3ES1A 1IOAA 3AMNA 2JEMA 4N90A 4BIFA 5DZGA 2WRAA 4IUGA 1REEA 4NMIA 4AHYA 2OUJA 3IZOA 4ZU7A 4P08A 3ZFGB 3CZJA 5LA9A 1TME2 2O14A 2QQVA 1OF3A 3D82A 2QDNA 3GBFA 2JG9C 4LBMA 1FV2A 1GWLA 4YVWC 4AI1A 4KG0A 4CEYA 3WG1A 1MZEA 1O8SA 4A3XA 4BIOA 5HCAA 1R093 3LD8A 4CDWB 3T3YA 3DKQA 4LLOA 2BNOA 3BYWA 5CNAA 5FZFA 4TN7A 1B09A 1J84A 1SBDA 4C1XA 3OGGA 4AK3A 2X53S 4WM8B 1DU3D 4D6SA 4LLFA 4KGQA 4CRQA 1US3A 3NKGA 2ZMKA 2RM23 2ZX4A 4YG0A 1EP0A 1ULOA 3FN9A 1VP6A 3BCWA 2XG3A 3GJAA 5JXGA 2RS33 4FPJA 4XACA 3IPVA 2JG8B 3LA3A 5E8AA 1HIXA 4YZ3A 4RR3C 1F31A 5L7OB 2WZEA 4K8RB 4A6OA 4ZZ5A 1Y9MA 4Q4V2 3VZKA 1V6MA 1RMU2 2W1QA 1FOD1 1LOBA 2GU9A 3RWNA 4GWMA 3CJIA 3CU7A 4LHLA 4LUMA 4GD4A 2W1WA 1DYPA 4LKFA 5ERLA 1ND3B 2V5DA 2VTXJ 3MF9A 2EAKA 2D5HA 4QQHA 2MPFA 3PU3A 3P3NA 3U1XA 2RJ2A 4AQ2A 2WAAA 1DQ5A 3DYMA 4JTOA 2WO3A 5HV4A 5DMYA 1RHI1 2BDRA 2JB8A 1BCXA 1BLZA 4CU6A 5AC92 1KQRA 5IUQA 2OIIA 1J1LA 1ZRIA 3BODA 4ZKTB 3BALA 1YO8A 2B9VA 2WNVB 3HQRA 4K3UA 4MHRA 5E89A 4YM3A 3W58A 1T2XA 2R073 2Z69A 3WZ1A 5KC5A 1X8EA 3OUHA 1OHFA 4FO9A 4NHYA 5EZWA 3NQHA 4CP0A 3U07A 5CEHA 4FPKA 3POIA 3O1UA 2ETEA 4B4QA 4NIGA 1OVPA 3T1LA 4CDQC 2W3JA 3Q8AA 1JYNA 2PXJA 2WR9A 1MS0A 2P37A 1C8NA 4UAPA 5ABJB 4XFAA 4QM8A 4YGBA 5H9PA 2DCYA 2EXIA 5FZ3A 1X7NA 2RS53 4K8FA 1XB9A 1I5PA 5C3PA 3DL3A 4RS5A 4AHWA 1AJOA 1SBFA 3AVRA 3OEAA 1FI2A 1BK1A 2DCKA 3LOIA 1JYTA 5KXBA 3ZN4A 1FNYA 1ULDA 2YU2A 3J7LA 3PJQA 4QPYA 4B4PA 5FZAA 2ZOEB 2XGXA 2B9UA 5IT6A 2LM3A 3OBRA 4GAZA 1MEC2 1MVQA 4NO4A 3OCPA 1POV3 4MGZE 3WDWA 4YVSB 2CWMA 4JAAA 1F15A 4BK5A 1ENRA 2QDRA 3O0VA 1S55A 2C0ZA 3BN6A 2AGSA 3N7LA 5J96B 2E63A 5FZ6A 5C8CB 4KL1A 1UKGA 4LO7A 4YZ4A 3BUCA 1U5XA 1X50A 1RUH1 2PYTA 3FBMA 4Q4X1 5T5PA 4XF3A 1Y9QA 3C7GA 4NRPA 4QU1A 4XVHA 4B3NA 5LEKA 1ACCA 2TNFA 1UWWA 2E31A 3J8F3 5FZGA 4YM0A 2C9KA 4LMFA 5FYTA 1AL0G 2D98A 3HMYA 1ODNA 4IERA 3O1PA 4NR1A 4W6WA 4CCLA 1K45A 3KQRA 3LWCA 2BVBA 4MXWA 1DQ4A 3VD7A 4E2SA 1R082 4B1MA 1TMF2 3CJXA 1UY0A 4AI2A 1PZ8A 4XJUA 5KHGA 4DINB 1CAUA 2HWB3 4Q4W2 1UMZA 4O9EA 5FMCA 5T50A 1WCDJ 4Y26A 3S30A 4CP9A 1UY4A 3ZN6A 2R6QA 1S0FA 2AZ5A 2PMWB 3FLTA 2YFZA 2ZKNA 2G9GA 4AFMA 2XUMA 5F3CA 1SLLA 4AVBA 4KWLA 3ZSLA 1PK6C 3SH3A 1SFPA 1PO13 1NCRC 2VGDA 2JDPA 2W46A 2X5IC 1F4HA 3O5SA 3PMEA 3T2TA 3RZJA 4WZFA 1ZRDA 4PDWA 4J1XA 3BTZA 1OI6A 2ZMLA 1RTVA 3GJBA 3SMHA 1WLDA 5D8AC 3D8CA 4RHV1 1ZNPA 1DQ6A 3GZAA 2P3JA 5FO7B 2NZ9A 1ND2A 3SEEA 1COV2 2A6XA 3WG2A 2W1SA 2XVGA 2IXHA 1HB2A 4LULA 2OXBA 1ULEA 4W8JA 5SV8A 5AVPA 1AVBA 2ADEA 1GZWB 1AYN3 5I8YA 3HR9A 4WVWA 5GZGA 4CTEA 1EAH1 2GMMA 5IJRA 4N9IA 2NQYA 3WF1A 4BK4A 2B42B 2DWRA 2P2KA 4HN0A 1CAVA 5JSOA 1V6KA 3WCRA 1UY1A 4KU8A 3T4HB 3NJYA 1H6YA 2WL1A 3OUJA 4KWJA 4BHPA 1OLMA 4LT5A 3E6BA 2EVXA 2D6LX 1EV11 3ENRA 4BMBA 5T54A 1FYUA 4QB2A 1RUD1 3LSDA 3THDA 4H7LA 4HPKA 2ILMA 4P9XA 3OUIA 2ID4A 4KWUA 4JQRA 2AR6A 3IMNA 2YBKA 3OOXA 3ZXFA 1AR83 3RS6A 2J22A 1DGLA 2PAEA 2PQQA 4AR2A 5ACA3 2AACA 1LCLA 2XJUA 4WM7A 4IEVA 4QX1A 3B01A 4JKMA 4Q4Y1 1ULFA 5BNPC 4G4FA 3ASIA 5BY5A 3ACHA 1MACA 3THTA 3WP4A 2JICA 1OOPA 3KT7A 5IYYA 1MQTB 2HBUA 1A8DA 4ET7A 1L7RA 4LITA 1PGW2 1ASJ1 2OX0A 4M4PA 5FXZA 4EN8B 2W94A 5LA0A 1C5IA 3DECA 1SG3A 1FT9A 3OYWA 2GNMA 5CFDB 1NKGA 3TB0A 4OHYA 4CDUA 3ACGA 4S2FA 3WDVA 1VBE2 2J1TA 3HNBM 3EBRA 1PGL1 3MW2A 1AR91 1OMIA 2F17A 2RS12 1RUF3 4IE5A 3JUUA 3AYAA 3Q8EA 5LRRA 4GWNA 3SCFA 2OPKA 5C71A 2YGMA 2HJIA 3N36A 1RUC1 3CQOA 5GLVA 1I5ZA 3MGUA 4M3CB 3JBG3 4CPBD 1C3HA 4PQ9A 1X36A 5JMCA 5A80A 2EXJA 4QPIA 2PAMA 3UJOA 4S2HA 5DZFA 1UIKA 1OBNA 2W47A 4LBQD 4N8MA 3I4IA 3SEPA 5FPUA 5C9AB 2PHWA 3SITA 4DS0A 2WO7A 1NQJA 1LR5A 1RUJ2 2Y6JA 1HV1A 2W5FA 4I2OA 3MYXA 5FY0A 3K77A 1KD7A 2P17A 1XU1A 2AUYA 1AXYA 2B46X 5CU1A 2ZXQA 3B9IA 1W3XA 4PLNA 4R4XA 1XE8A 2A70A 3I3BA 3ZFFB 4BXFA 2VMGA 5JSRA 4L11A 4G3YC 4RSUA 2XBO2 3RYPA 4TTGA 4LBNA 3J26N 4QKDA 3S5AA 2P6HA 3VBUB 2JIJA 2DVAA 1CD3G 1NCQB 2GC0A 1CWPA 1FOD2 2EIDA 4GH4C 4XF0A 2HH9A 1IQDC 2VW2A 3ETPA 2XLGA 4A2UA 1UCXA 3S57A 5JOZA 4ZXKA 1ULPA 1K5MB 1NE6A 1H1IA 2DVBA 1L7QA 1GR3A 1PIV2 2JDHA 1RHI2 2HYXA 3M3EA 5EJ1B 4I3GA 2A1XA 5IAVA 2C6SA 3BVCA 1PX3A 4WVVA 1H8TB 3GM8A 4Z2AA 2YBSA 3CKHA 1UOGA 5F2WA 5CFCC 1Z7S2 3POYA 4E9KA 2W39A 2R0FA 4JV4A 1IS6A 4XJ9A 2E6VA 4L97A 1J3QA 2JDMA 3VZOA 1GZCA 2OVUA 3CF6E 1E5HA 2ZGOA 2WZR2 4LR4A 2FDGA 1JXNA 5L36A 1O91A 2PHUA 4QDSA 5A7SA 2VVDA 2V09A 2W08A 4MGTA 4FPLA 2D97A 4META 5KXEA 2ZEWA 5FWEA 3AFGA 4BB3A 4E27A 3I8TA 1H4GA 1ALYA 1UIJA 2X8KA 5FZMA 3LKJA 1RUI1 2V5YA 5LEJA 3FWEA 1UZZA 2OZJA 3VKFC 1AUYA 3ZFEB 3TEYA 1LAJA 2XJTA 3BI3A 3K2OA 2HEWF 4AEDA 1XQNA 1YYNA 2ZHKA 3PTYA 4XURA 4QX7A 4CXWA 1AYM3 4NHKA 1XNDA 4WVMB 2IFWA 2UY8A 1LECA 3KV5A 3P6BA 4CUGA 3VZLA 3ZFGC 3GCWA 3DEMA 2DURA 5EYXA 2OW4A 5KXDA 1EUUA 2ZJCA 4Q4X2 2J1RA 3VBHA 3V56A 5FMOL 4NIIA 2JG9B 3I3MA 4GKYA 3WVJA 3MIBA 4YVWB 4LO5B 5BUVA 1S0BA 1LOGA 2HLEA 1HB3A 4JDOA 5LBEA 4URAA 2XKOA 1CQ9A 3AZXA 1AL23 3IKWA 4WM8C 1XNTA 2GH2A 4DZGA 4V2WA 2EICA 2JENA 3PL0A 2WSUA 1FAYA 2BNNA 1AR73 5ISLA 5LK7B 4J6GA 1WW6A 2B39A 5HI0A 3CIHA 1PVC3 1C8M2 2XJPA 4JGYA 4ATEA 5FJHA 2QKDA 4MOAA 3RZLA 1YFXA 1CAWA 4A45A 2Y0IA 2UYBA 4RR3B 1VBB2 2QNKA 4N9HA 5C5TA 4XIKA 2JE8A 3CLPA 3KF5A 4AI3A 1W06A 4OZXA 1BEV3 4QHOA 1GQPA 5CISA 4YG3A 5FXWA 1CAXB 4J1WA 1WWYA 4W65A 3B00A 3U75A 3WV6A 3I59B 2D40A 1JZ4A 2ZHNA 3Q8BA 4IQPA 4RHV2 3N7KA 4I01A 4MX3A 5FZHA 5DAPA 1U12A 1GUIA 3D0JA 2WNVC 1LGNA 4QMAA 4BQ1A 2Y6LA 4ZY9A 1FMD1 4FP2A 3INAA 4YARA 3ACLA 2WLQA 1WCSA 4HSLA 1GZTA 5H9QA 4UFJA 4Y24A 3EB7A 4CDQB 5ANNA 1UYXA 2DTYA 5F39A 1JZ5A 1GBGA 2IVJA 2D3RA 3LFIA 1W6OA 4GMP3 2VQTA 5FY7A 5HCBA 4A7YA 4FCAA 4GWIA 4QX3A 2VZVA 4P5YA 4Q0UA 2G9FA 3LB9A 3B7MA 1URXA 1D7PM 4E8DA 3H3LA 4ASKA 4TSVA 2JKBA 1KS5A 4PF5A 1X9TA 2K9ZA 2X05A 2XQRA 1MZFA 3LAGA 3VBOB 2VTFA 1W9YA 3QCWA 5EYYA 4BXSV 3WX5A 1JH5A 3H8XA 4XFHA 3WD5A 3RI9A 3NV2A 5FOJB 3MLKA 1LHOA 1DGRN 2ADDA 1BYHA 2WFF1 3N35A 4RD7A 2RMU3 2OA2A 4FTSA 5C8CC 3WSOA 1ZREA 2XMLA 2RR13 1LOFA 2Z79A 3THCA 2CWSA 1Q43A 2ZBJA 5JI7A 4L99A 5I91A 3RDIA 1YEWA 4NIHA 2Q8EA 2AH2A 1E57A 3HJRA 4QQPA 2MEV1 5JUVA 3LEKA 4M3CF 4XFBA 1QQP3 2QTWB 3LCPA 2K0GA 5DDJ1 2JE9A 2LROA 2QQNA 1PGL2 1AR92 4O9GA 3M4FA 4OHVA 2EALA 3FZ3A 4Q0SA 3E6CC 5JPNB 4PIYA 4B1LA 5A70A 3JD73 4XC9A 2XONA 1XU2A 3LDRA 1X33A 4HK8A 2PAKA 4OZOA 1VLNA 5F9TA 2VNRA 1MS4A 2BEOA 2D6NA 1W6NA 2IFRA 5CAZA 1BMV1 1GP4A 2VQ0A 3JCIA 3I7DA 2R16A 2XHKA 4CDWA 2OT7A 1PK6B 1W9SA 1BZWA 3OGVA 1NCRB 3WCSA 5FY1A 2HWE1 4AEMA 2X5IB 1UU5A 3LF7A 1GQHA 1W3VA 1VBD1 1DQ2A 2IWGB 4K6BA 5D8AB 2RV9A 4UFIA 5FRAA 4CEWA 1TME3 3KV9A 5A3NA 1ZRCA 2JG8A 4LKSA 3VBSA 4COUA 4CUAA 4YW5A 5L7OA 5BV6A 3M3QA 4XAEA 1QJY1 2ENRA 4XUOA 3K4AA 2RDRA 4E4ZA 5IW0A 4D3WA 4DOUA 2WC2A 4P02B 4XHXA 2A3WA 4JDNA 4Z07A 1ND3A 5FY8A 5H9RA 5D1IA 3UJQA 1G9FA 2ATFA 3VKLA 2XPJA 1QOSA 4NOTA 3VKOA 2Y38A 4W4ZA 5A7WB 4KBBA 3ZDSA 4QKFA 3D6EA 1UZ0A 1Q56A 4FAGA 2WNUC 1HJGA 2WLPA 3D5OA 4PI2A 4Q4V3 3RFRA 4CCEA 1RUE2 2YV8A 3PLQA 4OFGA 1VBC1 5HCFA 2ZABA 1HJFA 4QD2A 1OUSA 5CBLA 4HK9A 1UY2A 3NSTA 4C1WA 3AP5A 1PZ7A 1Q8OA 4WZCA 5F8PA 3GZEA 5FYMA 4IV1C 1QNYA 1DLLA 4ZPIA 1HRI1 2GZWA 3RQ0A 2OUHA 3OTFA 3UV9A 2WWUA 5FPXA 4A42A 4EJRA 3GZUC 5EWSA 5BNPB 1NZIA 5ABJA 3ZSEA 2UWAA 3H1MA 4XFFA 5AC93 3AL5A 1UD1A 1LHUA 1WZXA 1Y9GA 3PUIA 4Q2FA 4S2GA 2VL4A 5C4WB 4AE2A 1QWRA 1QOTA 1PMJX 1QNWA 1GICA 1V70A 2WO2A 5GZDA 5FZOB 3QACA 1STMA 2D3PA 5CA6A 3OBAA 4NIAA 1DIWA 3FJSA 1REFA 1UL9A 2E7TA 4PQQA 1DHKB 4FVVA 5T5JA 3QOPA 1IGOA 1OVSA 5LW9A 1S2EA 2CGPA 4YVSA 3ZXLA 2VQUA 4JKKA 1E5SA 1Z0HA 3LEMA 3C2UA 3K3NA 2P3IA 1Y7BA 2ZGNA 2VUCA 4COZA 5FO8B 2KD7A 4UXAA 3VN4A 3MIGA 1HLCA 1OURA 2QQMA 4P9JA 5FXXA 3N7MA 4LNVA 3DGTA 4R9CA 5FLJA 5A33A 5JVVA 5D2AA 1F4AA 5FZIA 4OI1A 4CUBA 2XKPA 4XPVA 2O8OA 4JVAA 4BQWA 4B29A 3C7HA 3AZWA 2OZ6A 1MEC3 1QKQA 3AKPA 3G7DA 1KJLA 2R041 1O3QA 1S0EA 2HWD3 3NV4A 4HL0A 4XUQA 2Y8KA 5FLHA 4ES8A 4EN7B 3DYOA 4P5HA 1QIQA 2I45A 5BNQA 4CP2A 2R061 2MNGA 2ZGMA 2PHTA 1FPN2 2EIEA 3H9AA 1CZVA 3K75B 1CGPA 1NY72 2ZEXA 4AFDA 4Q29A 2R32A 4YGCA 2G4IA 3M3OA 1QXJA 2VD7A 3F2ZA 4EZ4A 2FCVA 4GH4B 2DU0A 3E5XA 1W2NA 4LXLA 4QKNA 5F2SA 4ZHNA 1O5UA 3ELNA 2GN3A 3ILNA 5IHRA 1R083 2CV6A 1K5MC 4I02A 2CAUA 1TMF3 3HNYM 1V9U1 4IV3B 3O1SA 4Q4W3 3I97A 5CADA 4KH9A 3N4MA 2Y64A 2ARBA 1RVF2 2I07B 4OYUA 4OVEA 1SZBA 1DZTA 3UNPA 2A73B 1DP0A 2V4VA 4YZ5A 2D6PA 3RVHA 3GHNA 5CFCB 4ZZ8A 3POBA 4LHKA 4GALA 1LOCA 1QXRA 4DIQA 1CJDA 1XBFA 1QEXA 1RITA 3DPRC 3F95A 2FHRA 4LEJA 2SBAA 4YW6A 2VVFA 4P00B 4Q8KA 5KC6A 4UI9L 1APNA 3NJZA 2ZMNA 3C7OA 4AAXA 1COV3 4QXHA 4XUNA 4XUTA 1D4M2 3N9MA 2KM2A 2BPA2 4MGSA 4OULA 1VRH2 1R091 5SV5A 1UAIA 2DBIA 4GKXA 5FCCA 1HXS2 3A21A 1ZRFA 1W9TA 4XFCA 1S2KA 1PZ9A 2CL2A 2J7MA 3C8XA 4FQ4A 4CCNA 4IEQA 2WFF2 3IDEA 5FBZA 3N9OA 3R6SA 3FHAA 2OQ7A 2CDPA 4OHXA 5FUNA 1XNBA 1PGSA 1XRUA 3FFQA 1NLQA 2BOIA 2YYOA 1DGWA 1W90A 2A6ZA 2WABA 3OF1A 2IXLA 2RS31 4IGPA 2NM1A 2BERA 1WW7A 5JCTA 2QQJA 3GALA 1MQTA 3FUQA 1LU1A 1PM4A 3DF0A 2QJVA 1HKDA 1W6PB 4L9BA 1K12A 5IK4A 5A3LA 5FZKA 3RPQA 2WS92 5C7GA 1U5ZA 5CFDA 1MR5A 5DDJ2 3MBWA 4WBBA 2J42A 1NXD1 2BP6A 1Q8PA 4DRVA 2WAOA 2DF7A 4QDQA 1W8WA 3PIJA 4MADA 2F6BA 4DXSA 2Y33A 1SDWA 1AXZA 1SACA 1DFQA 1UYPA 1YXWA 3VBRC 5A3TA 4CCDA 4CXXA 1U5YA 4I0WB 2Y6HA 1VPHA 2XJRA 4NN0A 3WP3A 2WINB 3JQWA 5JLVA 1UX6A 1BMV2 3C7FA 4Q1PA 3GZTB 5FP3A 2Y6FA 3SKJE 1G9CA 1AR63 2R071 2ZX2A 1F35A 3V64A 2VU9A 4FQZA 5I0DA 5C9AA 1W6QB 2VZUA 1VBE3 1FNZA 1L7LA 1CESA 3MUZ1 2RS13 1OF4A 3O1TA 1XJAA 1NZCA 5AVAA 3AYDA 2VZOA 5L19A 5BXXA 2VZSA 3C7EA 1OXCA 4GB32 2JDAA 5FAXA 3ZFFA 2RS51 3V0AA 2QUOA 5FBJA 2FCTA 5HV0A 5J37A 3PIGA 1F2NA 2D6MA 5L9RA 1TQ5A 2BBAA 2DVGA 5FIXA 5G05L 1I9RA 3POFA 3GF6A 4ISQA 4FT8A 4R9BA 3VBUA 1NCQA 1NX9A 5KWRA 3N9PA 1BKZA 5GLZA 2P34A 3A0NA 1RUJ3 4H55A 1POV1 2XDVA 1LOAA 1W05A 5IK8A 4XAAA 2WBKA 4Z2WA 4C91A 1VMJA 4UBGA 5FJKA 1C5HA 3KGZA 4IXLA 2DUPA 4QQLA 3JXSA 2XBO3 4BA6A 2A75A 5LCWL 2ZZJA 3ZXDA 1VBA3 1LOEA 1H8TA 1R1A1 3VBOC 3B69A 3J8F1 2YROA 4NAMA 5A32A 3IBMA 1S0IA 3LDKA 1HQWA 3M7AA 5FPBA 5A3OA 2BWAA 2YC4A 1WLTA 2YPJA 1Q3EA 3DXTA 4RL7A 2VMHA 2A5ZA 4Q1RA 3JB8A 1QJU2 5DAVA 4E4DX 1NUKA 3AMHA 2CNAA 3MI8A 3H3UA 4XF1A 4AL9A 4CZSA 5AFBA 1PIV3 3A23A 3W20A 3B3QE 3PVNA 2ZX0A 1OLRA 1ZM1A 4MGYE 2DUQA 2HWB1 3DN7A 3T4VA 4E4HA 5JR7B 4H2AA 1W8FA 4IDZA 3UT0A 1SHWB 2IXJA 5BNNA 2FCUA 1T6BX 4KU7A 4P9GA 1Z7S3 1JUIA 1BVVA 2B7YA 3AJZA 3BTXA 3TOJA 3KCCA 1PHMA 2OKXA 2JDYA 2WJSA 3LA7A 4CE8A 3I2OA 1SCSA 5FYYA 3ME2A 2VZQA 3ZFEA 3V0BA 3ATGA 2PLV3 5IATA 1O6UA 3ILFA 3NV1A 3GXUA 3FMGA 5A3MA 2WZR3 2VR4A 4FI9A 4WVMA 1M4WA 4CU7A 1XE0A 4OI0A 1WLWA 4QX5A 4FTEA 2VOKA 4YYOA 3PJYA 4NWWA 3ZR6A 4RA0A 3AKTA 3UETA 3H8UA 1RB8G 4ATFA 2JG9A 4RQPB 2VMIA 4E4SA 4YVWA 1ZBE3 3CO2A 3J9SA 4BM8A 5FY9A 5FP9A 4X8NA 1VMHA 3RGBA 3VDDC 3SLIA 1DYOA 5FQ0B 4EV0A 3NJVA 4JZRA 4R52A 5CG9A 1AYN1 5GLTA 4H3WA 3AJYA 1HRV2 1GOHA 3BTAA 4MUVA 5C3RA 1YQ5A 2K2SA 3SXWA 4DNYA 4CSWA 5GZCA 2XJSA 4QPWA 1YFYA 4HXCA 4O7XA 4Q4X3 3ZN5A 2JD9A 2ZX1A 2WUHA 2BVVA 3QH7A 2FBEA 1PO22 2VCBA 4HZFA 1CZSA 4RR3A 2XB6C 4OI4A 4HKLA 1PVXA 4BE3A 3E6DA 1SPPB 3L2YA 4ZS2A 4YPJA 1V6IA 2VOVA 2Y60A 2ZKLA 3DYPA 1AR81 2FDJA 3S7IA 3ZPOA 4UT5A 2EXKA 4OUEA 4TYSA 2CYFA 5IK7A 1ZBA2 1CAXA 2KA3A 4SLIA 3HBKA 4URTA 5FUPA 5ACA1 1V9U2 5CIRA 2J1EA 3I59A 1ZA4A 3MFCA 1BVP1 3W9AA 1C8M3 2CTVA 2Q4SA 4XDQA 3ECQA 4FPHA 5LASA 4WV8A 4MGIE 3SC7X 3ZX7A 4OI2A 2WNUB 1VBB3 1N1VA 3VGIA 5F6KA 3PNAA 3MIFA 3OPTA 3TN92 3VHOA 3B5LB 3UGHA 3KVBA 1UOFA 2EIGA 4IV1B 4CDQA 2LALA 1NQDA 4DXZA 4CYDA 3POEA 4UFHA 5T5LA 1RUF1 3TNPB 2Q8DA 5A1FA 2DU1A 5FY5A 4B7KA 4Q0VA 3K4ZA 5FZ8A 3JBG1 3WQ0A 3I3EA 4XBLA 5C4WC 3KHBA 2C24A 2BJSA 2NMOA 2UURA 4A41A 4QQOA 2XUEA 1EYBA 3IN9A 4IEOA 2E53A 4YM1A 3VBFB 3MLLA 4COVA 2BW8A 3GDBA 1WLCA 2YUEA 4GWJA 4UF0B 2DDUA 5EIYB 4BQ3A 1MVEA 1YLLA 2ZPXA 4N53C 5ANQA 3HQXA 1N3OA 2EA7A 1QH7A 5I93A 4UFLA 4K21A 4IGOA 4FSJA 4LBKA 1NA1A 5DAXA 4CEYB 4D7TA 2G19A 4NHLA 4HFSA 1G9DA 4Z82A 1W0NA 2YG0A 3SQOA 3O1VA 5HPOA 2P1BA 2I2SA 1QJX1 1FXZA 3ZYRA 5JOYA 2B4KA 2HWF3 4XUPA 3K51A 2YB7A 4HVOA 1G9BA 4OUSA 3WF2A 2VBPA 4NROA 3WT3A 3ZYGA 2D5FA 4D69A 5FYIA 5T3NA 1IPSA 4EQVA 2AC1A 1LHWA 3RYKA 2R072 3UGFA 1GU3A 4DQAA 5CZKA 3VD4A 1ZZ8A 1PK6A 2GNBA 4Y5SA 4B7EA 5IK5A 5F6LB 1YQ8A 3M3CA 4IL7A 4IV3C 3JB4C 5A7OA 2X5IA 2ZGUA 3RI8A 1YFUA 3RZMA 3KS7A 1DLCA 3PMSA 4MV2A 2E33A 3VD5A 4LHSA 1WCQA 1VRBA 2VNGA 5D8AA 1W0PA 1LNSA 1UF2C 1CX1A 2BV4A 1XSQA 4CU8A 1JZ2A 1DCSA 2P3KA 3B02A 2VMEA 2RJLA 4LIUA 4L2NA 4CVUA 1G6NA 3WEZA 1Q8SA 5FP7A 4TWTA 3VZMA 4QKBA 2QCSB 2V4AA 3WW3A 4W6YA 3DPRB 1SLAA 1AYM1 5F32A 3ZIXA 4BWOA 1O5LA 5A7WA 4AZZA 3RZHA 3PVOA 2K46A 3IIAA 1CPNA 1IHMA 4ZXEA 3TEXA 4QXKA 1R1A2 3I54A 3LFMA 3WW4A 3VUOA 1TVGA 5BNOC 5HBAA 3PVEA 4K7JA 3BU7A 4AGVA 4EROA 3PHMA 5LA1A 2D6KA 3NJXA 1L3JA 5FPZA 1J83A 1AL21 2FDFA 2Y26A 4OCTA 3VV1A 1RUG3 1QU0A 2P5BA 3ON7A 1AR71 1ENQA 3DV8A 5BNPA 4RN5A 1O4ZA 3UESA 1OPOA 1RUH2 2JECA 1PVC1 3ACFA 3WW1A 2XJVA 5CKQA 4CDXC 5K0UC 4OUMA 1A6CA 1HDKA 1RUE3 2W87A 2VZPA 4A4AA 4F3JA 3SHRA 4YG6A 4CXYA 1YC61 2WZPP 3BPZA 5DAQA 5I0UA 4LBOA 4AVCA 4IW3A 5FZOA 1GZ9A 4KQ7A 3IDCB 5C70A 2NMNA 4NRQA 3VB9A 4FPGA 1BEV1 4HKOA 1CIWA 4QQ2A 2Z5WA 1GYKA 1OA4A 3T2QA 1CAUB 4PBPA 3ZXGA 1VIWB 4MYEA 4HMZA 2VM9A 3VLBB 3ZN6B 4D8MA 3AYEA 4GIQA 3VBRB 1HV0A 2BGPA 4BQ4A 1AX2A 1CPMA 4LKEA 5J98B 1JODA 1J3PA 2W2IA 5J7MA 1S0JA 1YI7A 5JPMB 1VB4A 3AP9A 3I2KA 4BZ4A 3TNQA 1IS3A 3N9LA 4AG4A 1IS5A 2P4EA 4N43C 1A34A 2BNMA 1CONA 1RC6A 2D7FA 4MGQA 4HKWA 2ZTNA 2R49A 3AZVA 2XVKA 2CU5A 4MXVA 2W52A 3HT2A 2PHLA 4CEWC 3FLPA 4GMP1 2IXCA 3WQ1A 5JZGC 4AQ6A 1H1AA 2VZRA 2Q8CA 1XNCA 2BU9A 5F5QA 5LZ6A 3BIEA 3FLRA 4KMQA 2TEPA 1EUTA 4IE7A 3FUOA 4Z1VA 4ORFA 1G8WA 1UY3A 4Y20B 4Y5Z0 5F1RA 3MV11 3LPGA 3Q8FA 2FQPA 2EIBA 1CX4A 1LJ7A 3GNEA 4FPOB 3H42B 4GH4A 2WWSA 2NP0A 1PM7A 4CCCA 1D2QA 4LUKA 1A78A 2WFPA 1JHNA 4I09A 3RG0A 4R9AA 1JYVA 2VBBA 1EAH2 3U78A 1DGRA 5J1XA 4JHZA 4UBHA 4F83A 1C28A 2RMU1 4IE6A 1CAVB 1FPN3 3WLUA 4DUVA 1R1ZA 2RR11 2YFUA 1RYYA 1S4CA 4QHZA 5A3WA 1EV12 1NXMA 3NV3A 3UKVA 1RUD2 1LODA 2PHXA 4MLOA 4UW6A 5G04L 5CFCA 1NE4A 3T1MA 1KEXA 1OH4A 4CUCA 2GNDA 1RJ8A 1QQP1 1JHJA 4IEWA 4ES9A 3IT8A 4WM7B 4Q4Y2 4LBLA 2DBNA 4JCKA 3ZYIB 4EN0A 1OLME 3NAPC 1KS4A 2XL9A 1OOPB 3JD71 3ZM8A 3UL2A 1BBT1 1WCKA 1RVF3 5GLWA 2CGNA 3GGLA 5IFTA 3JBG2 1ASJ2 5IAXA 1GWMA 3OY8B 3IMMA 2VUAA 4QPGC 3B94A 2JD4A 1KJRA 1O3TA 3OPWA 1SQ4A 1RUNA 2XL7A 2Q1ZB 1DQ0A 3MLJA 4CDUB 4PJYA 5FMBA 3ITQA 2Z2SB 3OBTA 2R1BA 2W95A 2YC0A 4XETA 3KD4A 3KT4A 1H9WA 5DN2A 2VOTA 4HSJA 1BK0A 4MG2A 4FOVA 4BPZA 1UXXX 1XNKA 5T52A 1RUC2 5EJ3A 1WMEA 2VMFA 1W2UA 3WP6A 5GKAC 3EJKA 3ZFGA 1TME1 2R30A 4FTBA 2XVLA 4RQPC 2VUDA 1D4M3 1G7YA 2A6YA 4V2VA 2RDSA 1W6PA 4Y1XA 1OPMA 1VRH3 2C9AA 5DABA 1S0CA 2BWCA 2ES3A 1LGCA 1HXS3 4DEVA 2D93A 5C6CA 1OKOA 4JGZC 3VDDB 1YWKA 2E7AA 1LU2A 3OEBA 1AXKA 2VUJA 1QJX2 4WM8A 1RXFA 4XJZA 4XIOA 2YBPA 4AGRA 3NW4A 4JC1A 3NNLA 1MZ6A 4KI5M 1J59A 1IZ3A 5B2GB 5GZFA 2QZ2A 2VJXA 2W0XA 4M4RA 2Q0AA 4AEKA 4YZ2A 4LK7A 3KB5A 2ZGRA 4EN6B 2WS93 3AL6A 3VL9A 2QQLA 5DPNA 1Q8VA 4XF4A 5DDJ3 3USSA 3ZYBA 2BFUS 1W6QA 1ZX5A 1MS3A 3OD0A 2HWC1 4YW1A 2OQ6A 4TZDA 3UGGA 2NYYA 4DY5A 3AYCA 5CG8A 1U5IA 4DUXA 3I3QA 1Q5OA 5FYSA 2Q8OA 1JZ7A 4QX8A 3EXUA 1WCUA 1ONAA 4Y4RA 3ZIWA 1O4TA 5AC91 5LBCA 2XLAA 2TBVA 3H8OA 2ZAAA 2WNVA 1B35C 5FZDA 4CCMA 1RMU3 5A6QA 4U36A 1LHNA 3FC0A 1US2A 2VZ3A 1UZWA 4FPYA 4XFIA 1LENA 3SISA 1G9AA 1W8UA 3CBNA 1O7FA 2WSVA 4HVQA 1XYOA 2PELA 4LOSA 4BOWA 2VBDA 1YRZA 3GHMA 4HN1A 5FPAA 4GB33 5FYBA 3WDTA 2A6VA 3T30A 3GCXA 4NHMA 4DEQA 4DY3A 2YMZA 1MS9A 4Y4YA 3ZPYA 2VOWA 4Y22B 1GLHA 3N7JA 2DUOA 4AI0A 4RGKA 5CB7A 1RUI2 4XF9A 3VBFC 1JUHA 3M70A 2IC1A 2QFEA 1J1TA 1MEC1 3QBQA 5LY2A 5A1AA 1UNBA 1WD4A 3WQBA 1YQ6A 1LTEA 2HWD1 1QJEA 3O14A 1LULA 3ZXJA 3AXEA 3FFZA 1NLSA 1OA3A 4QXCA 4N53B 2ZGTA 3LA2A 4U2AA 4CP1A 2R1DA 5C8CA 4C90A 1POQA 4XCAA 5L9VA 1PVC2 2GMEA 1YQ2A 3ETQA 2OPWA 1OC1A 5F5IA 2CDOA 4B8EA 2ERFA 4CEYC 5APAA 1UXZA 2ZGKA 1ST8A 3TAYA 3I2DA 4FOQA 1W8OA 3M1HA 1I1EA 4LORA 1QJFA 4XQ4A 2VPVA 1JU3A 5EHDA 3HAGA 4PI0A 4YW4A 5JR2A 2LRPA 3RZZA 1TNFA 1QJU3 4DB5A 1O59A 2VNOA 1VJ2A 2WZ8A 1R081 1OA2A 3E1F1 2ET7A 4FOYA 3HWJA 1HB4A 1EPWA 1TMF1 4GZ9A 4J25A 4QXBA 5FZ4A 3RJRA 1JYCA 3ZXEA 3H1WA 4AFBA 1SLBA 4Q4W1 1W9WA 3WHTA 3LOBA 2XJQA 4LOTA 4K1ZA 4AFCA 1W6MB 4AI8A 5IVFA 3ZMNA 1JU4A 2X09A 4KGGA 4FXKB 1GNYA 1QJZA 3CJIC 2BOJA 3N3HA 1XPWA 5LBBA 4YSFA 5C3OA 5FPLA 1DGWX 2N7GA 1I6XA 2DFBA 1C4RA 3HNMA 3E5QA 1CZTA 2GNTA 5EXOA 4AQTA 3MW4A 2DVFA 2BYVE 3UKNA 5CYYA 1AX0A 3OD4A 2ZHMA 4HONA 4INDA 4XFGA 4GXLA 1KITA 5FXVA 2FDIA 4A7KA 4IEPA 3KT1A 1HQNA 1K3IA 1UU6A 1COV1 1FMD2 4AHXA 3QH6A 5K9YA 5KHHA 3KMHA 3KHCA 2WT1A 2F4LA 3IWZA 5A6YA 1LGBA 1OKQA 1SPPA 5EV7A 2B45X 1GZWA 4AVTA 3W59A 3VZNA 2HEYF 2PFWA 3M2MA 5DUXA 4FPCA 1HRV3 1TZOA 3LPFA 1OFSA 1IKPA 2E51A 3R0RA 4MHUA 1OQEA 3VZJA 3W5MA 4TXWA 2Y34A 5HXMA 4PF1A 2Q1FA 4RS5C 3WF3A 1JMUB 4H7MA 2RR12 2CAVA 2NPIA 1PNGA 1PO23 3ALQA 1NOVA 5JAXA 2Z42A 5HXVA 2WNUA 3U11A 3VDBA 2LW8A 4I0BA 5FYZA 4NVPA 5FYHA 4KNCA 4PLOA 5BNOB 2G1MA 2J1AA 2A71A 2HEVF 5FMDA 1S1AA 2IXIA 4FAHA 3D4KA 4BMEA 3K46A 3POSA 1ZBA3 3BTYA 4OQ9A 3TWIA 4IV1A 1SBEA 4C0HA 1X82A 2AEYA 1DYKA 1WA4A 2W68A 2RM21 3J7MA 4AVAA 3A0KA 4C8DA 1NAEA 2AYHA 4GJZA 4Q8LA 1BBT2 1GWKA 4MGKE 1ZZ7A 2WA3A 4CDXB 2B5HA 1IG3A 5K0UB 3HD8B 1PGW1 1UPIA 4JDMA 4RGGA 3WDXA 2WA4A 4QT6A 1O3SA 1C1FA 1MPXA 4EN9B 3TN93 4O61A 2QQKA 2YC2A 4LHNA 2MEV2 4BU2A 1AR61 2Z4FA 2Q1MA 3KVAA 5FYCA 3RJ2X 2BTVC 4DO0A 1A8MA 2XLFA 1U0AA 2XH6A 1OSGA 2ZHLA 4XBQA 4LK6A 1ZZ6A 3WNMA 1VBE1 3ZVXA 1C57A 3WNPA 4ISRA 1JOJA 2C26A 4XW3A 1Y43B 3OSDA 5E88A 5T55A 3MW3A 2VNVA 2W1UA 2CSGA 3DUIA 4NPLA 4A6SA 4JKLA 5K7PA 5CKMA 2WYSA 4M3CA 4N7UA 4RFRB 4KG8A 2O1QA 3K4DA 3T0BA 3IB3A 1JYWA 1W6NB 4XQWA 4Q0QA 5K8SA 3AMPA 3EHKA 4XZPA 3WNOA 1K42A 4JRAA 1ENSA 4KWKA 2VCAA 3I2GA 1TNRA 5AFEA 2E7QA 1DQ1A 3A22A 4PIZA 2WIIB 1RUJ1 2EAAA 2O0OA 3BB6A 1YNAA 3KV6A 1UMIA 3LIGA 2HWE2 4N43B 4PDWC 4ONUA 4FBFA 5J09A 3MFAA 3WR0A 2PHFA 4E8CA 1VBD2 4LBQB 3H8RA 3SCGA 3USUB 2VMDA 4B4RA 3CNAA 4CEWB 4CU9A 4DMIA 3PVBB 4NHXA 3KCYA 5FREA 5J3UA 3VBSB 1SEFA 5JZGB 1WW4A 4XTMA 2A3YA 1ND2C 3POJA 4EE2A 2BBVA 2XBO1 3THPA 5FZLA 1G86A 2VC9A 1VBA1 1QF3A 3NO8A 1QJY2 1SCRA 2XR4A 2WNOA 5BYNA 5LY1A 3WNXA 5LB6A 3E97A 1QXPA 1H0BA 4LKDA 5FZEA 5FDBA 3A4UA 2EXHA 3ZKYA 2HWC2 4K20A 4O65A 3RMYA 4ZS3A 3URFA 5FP8A 3VHPA 4XBNA 5LATA 2W91A 2WWJA 3FX3A 3H0OA 3IDBB 1K5MA 4XXAA 5JIAA 1XYPA 2H6BA 3SH5A 1PIV1 4JQTA 2VOXA 1YHFA 1GMMA 3HN1A 1UMHA 2FZ2A 1W99A 5DAWA 2VULA 1ZZ9A 4MVTA 2HBTA 1JZ6A 4QAWA 4P14A 5DUWA 1VBC2 1FOD3 3C3VA 1V6JA 4DRRA 3J4UH 4CCJA 2ZGQA 1Z7S1 4LBJA 4YFWA 4DFSA 3HEIA 1N1SA 4D0QA 1Y4WA 4WM7C 1PX4A 1HRI2 4FFGA 1KGYA 2PLV1 2ZGSA 1V00A 3Q9OA 1W8TA 3EYPA 4HBNA 3ZYFA 2GN7A 3DPRA 2WZR1 1RHI3 1AX1A 4R4ZA 3VDAA 1OOPC 2LUWA 4BDVB 3NAPB 2XHNA 4DUWA 2AREA 2Y6KA 3MDPA 5IVYA 1YJLA 1QHDA 3MPPG 4XMAA 3WDYA 1WD3A 2QQWA 1VE0A 3KWVA 5JIUA 2ET1A 4QPGB 4XCBA 1A3KA 1JYXA 3PU8A 4CDUC 1JZ3A 4K1YA 3FE5A 1KDKA 1SFYA 1SLCA 1ZBE1 1W04A 2DCJA 3POGA 1F8VA 4RFT0 5DG2A 2HWD2 4Y5TA 3D3AA 1Y3TA 5A3PA 5KHKA 1PO11 3R4DB 3ZDVA 3KF3A 4QHBA 3QLQA 3PUQA 2CGOA 1OD3A 3VDCA 1XOYA 5EP9A 4XHBA 1NA1C 3H7YA 2R7EB 5A33B 1ENXA 4QPIC 5FZ7A 4XJWA 1P8JA 1R1A3 1UOJA 2WQ4A 3O0XA 1UU4A 1H1MA 2C4XA 3APBA 4HETA 4WVZA 5J36A 1J58A 3NVCA 3DKWA 1UKRA 3NNJA 3AK0A 4AQSA 2R042 1JS9A 4ITCA 4JGZB 4XEZA 1AHSA 4XDPA 4Y1ZA 2UY9A 2X10A 4CA9A 1W0OA 2ZGLA 4NPMA 4AVSA 2BGCA 2J1UA 1D0GA 2R062 1SMVA 1GANA 1RL3A 2Y0OA 1WW5A 4LO6B 1RUH3 1BHGA 1C8M1 1LB2A 5FKCA 3FHQA 4UW4A 5LK5A 1ULCA 3VBRA 3TEZA 5C3SA 2VH9A 4Y33A 1VBB1 1ZVFA 5DG1A 1OQDA 1JYIA 1UW8A 4QB6A 2PHRA 4FPEA 3BKZA 1W39A 1SLIA 2D3SA 1PMIA 2NLRA 1GOFA 2YDEA 1W2AX 3ZXKA 4OHWA 2P6CA 2ZACA 5FZ1A 1UO9A 5GALA 2YU1A 2WQ8A 3WP5A 2QQOA 2H0BA 5EPAA 2IVIB 3ZR5A 4UOJA 1W03A 3MF6A 1KFXL 4XABA 5JI9A 1X9PA 3BGAA 3WUDA 2ZGPA 2D44A 1B35B 4Y20A 5IVEA 1WA6X 1LKNA 1SDDB 1PNFA 3AP7A 3CMGA 1I3HA 1ZA7A 2GSYA 2WQZC 3JZVA 4JTNA 5DUUA 1IG0A 5JXIA 5C5UA 3U14A 1QH6A 5E6HA 4FP3A 3S5QA 2QQUA 2ARAA 2JE7A 2FDHA 4A44A 1C1LA 2RVAA 4RHV3 2BFUL 2VAUA 2J1SA 4L8QA 4UYBA 5FPVA 5FK8A 1QDCA 5JOWA 1VALA 4BQYA 4NUBA 3T2PA 2ARXA 3PDQA 4M0HA 4DXRA 2PQSA 4L92A 3WXPA 1F5JA 3NWKA 1WGPA 1V6NA 3WINE 3VBOA 4V1PA 2BQPA 3GYDA 1R092 2VY0A 3MO4A 4ARYA 2IUWA 4AEDC 2XWJB 3LE0A 4ZU5A 1E5IA 2DV9A 1EAH3 5IVCA 3O1OA 5A3UA 3HPNA 5D21A 3WOGA 3A7QA 5FKBA 2HWF1 2RM22 4XE9A 3PUSA 1H8VA 5L73A 4ARXA 2WN2A 4G9SB 3VBHC 2RS32 3I2HA 4Y1UA 2CY6A 4LJHA 3S7EA 4KBZA 2C5DA 4EYUA 1EV13 4IE4A 1RUD3 2J1VA 3KQ4B 1W9FA 5JXHA 2VO5A 2L9LA 2Q30A 3MEPA 3OY8A 5IVBA 3O12A 5F5AA 4CCKA 3AC0A 5KR7A 4D7SA 1AR62 3R4SA 4LQRA 3AMMA 4EWDA 1UYYA 4NPRA 2ORZA 1F5FA 1EPZA 4F7ZA 5IFPA 3U4SA 5HCHA 1FATA 4Q4Y3 2R0HA 3O1RA 4AHZA 3MICA 5LRSA 1DF0A 4Q5OA 1H2NA 1W8NA 2TUNA 4FPFA 5A6XA 2ZZQA 1OUXA 3IPVB 4JGYC 2BZDA 4D94A 2IXKA 5M0TA 1DG6A 3IAPA 1HX6A 3VD9A 2FZ1A 3K48A 1ASJ3 1OD5A 4NAOA 4AF9A 4BQXA 4AEJA 1LEDA 3S0MA 1GP5A 3WF4A 2LTNA 3CJIB 3ZSKA 2A3XA 2DCTA 1UX7A 1Q8QA 3NRUA 2ZA9A 3RMXA 1AR93 3HQUA 2KR2A 1WBLA 3VDDA 1FX5A 1HB1A 1REDA 1JTZX 1NYWA 1NCRA 2O8QA 3KGLA 4LPLA 4D6QA 5LWBA 2Y6GA 1RUC3 4M3CE 4NE9A 4YNIA 2A7AA 1GV9A 1YUDA 2ARCA 4E2GA 3V0AB 2RS52 2EF6A 5FR3A 4XQDA 1RUOA 1W2TA 2H0VA 2JJ6A 4GJYA 4ZONA 3VHRA 5EQUA 2VW1A 2W92A 4FFFA 4ASMB 1DDLA 1VBA2 3ABZA 1XYNA 5FO9B 3RNSA 5K4LA 2ORXA 1PMHX 1IS4A 1LEMA 1QJX3 1H2MA 2YXSA 3MIEA 3SNMA 3Q8CA 4COYA 4AYUA 2VZ1A 3EMRA 4PHZA 3ZYJB 1IPKA 1RUG1 1VAMA 5DZEA 2WYFA 3P5BA 1H4HA 3MHZA 2PTMA 4X8PA 5FY4A 5FZBA 4RS5B 3O0WA 3ZYHA 2GAUA 4BCUA 1JI6A 4BQ2A 4LE3A 4HG6B 1VR3A 1RUE1 3AFKA 3GBGA 5E1RA 1Z78A 3AP4A 3I2IA 3J8F2 4OMCA 5I0RA 5A32B 4YZ1A 1AZDA 5JDBA 1DBNA 1TE1B 2QBXA 3SH4A 1DZRA 2DYCA 2UYAA 1WBFA 3T08A 1LRHA 2PLV2 1V6OA 3J7NA 1UPSA 2VZTA 4PT6A 5GJ6A 1KDMA 3U37A 3IDAA 4Y1VA 4IEYA 3PTRB 3WW2A 1LOFC 3X29B 1HQLA 4FXGB 1OT5A 1IQAA 1S0GA 2HWB2 2V73A 1D2SA 1EY2A 1JN2P 1SLTA 1POV0 4XOGA 2BUKA 3LQCA 4BISA 3BU0A 3JU9A 2GP5A 1YIPA 2ZS6B 2RJKA 4IGQA 4Q0PA 4Y22A 3IAQA 5C4WA 1CJPA 5BNNB 1W8ZA 3KLSA 2VTXA 3RRDA 4A7ZA 3POWA 2ZX3A 3VKMA 1ZBE2 1HW5A 4MXWB 4AAPA 2VQAA 2VVEA 3B93A 3V0BB 3WDUA 1S2BA 4RYDA 4P9LA 5FK7A 1PO12 1V6LA 3NKTA 4R9DA 1K5JA 5FV3A 2H6CA 4QX0A 5F3GA 3DXUA 1UQXA 3K3OA 4GQ7A 4N53A 3ZYPA 4CP9B 2DCZA 4AFAA 2E9QA 3WY6A 4UFMA 5KHIA 1TEIA 5FP4A 4X6QB 1VAVA 4XYXA 3LZZA 2GDFA 4UW3A 2FDKA 5JSPA 2E26A 4AOCA 1RUI3 3LIHA 3AKRA 4CDWC 1W28A 3AKSA 3BIWE 4LIVA 4QU2A 3MUY1 3NNFA 1KRIA 4MSVA 2QQPA 4IETA 1AYN2 3WG4A 5I0SA 1UYZA 1VMFA 5KHJA 3GBWA 4PDWB 3T09A 2GP3A 2YHJA 1JOBA 3D0SA 2JDUA 3G6JB 3UK9A 3I2JA 1UZVA 3OG2A 1QY4A 3WNLA 5FWJA 2JG8C 3ZSMA 3VBSC 1FPN1 2VECA 1NY71 5FFOC 4XMIA 1NLRA 3CL1A 4I0AA 1W6MA 5DQ0A 5L7OC 1ND2B 2GC3A 3TYJA 1H6XA 1MS5A 1XNAA 2F4PA 4MO3M 5CVRA 4YWAA 1QDOA 1T6GC 3FHIB 3P1IA 1VAKA 4YGEA 3O7OA 2VE1A 4YGDA 1AR82 5I8TA 1ND3C 1TG7A 3OGSA 4Y1YA 1MZ5A 3HOBA 3OBZA 4MZUA 2QVSB 5ACA2 4OQ8A 5B4NA 5EJZB 4IV3A 2DFCA 4UWDA 3RZKA 2CHHA 3U10A 4IEUA 3ORJA 3PURA 1RVF1 5T5OA 5CKNA 5KBFA 2RHPA 4HANA 4HPKB 5JMOA 1MS1A 3U4XA 1OH3A 3ZO0B 1O3RA 1GQGA 4HT1T 1CVNA 4QGMA 4I3PA 5I8SA 3VD3A 4YFZA 3ZKUA 5ABJC 1RUF2 1JZ8A 3ZOIA 4OLLA 4EWEA 1N3PA 2RE9A 1RINA 2UWBA 5GLUA 4E2QA 5C8WA 3DCQA 3KCXA 1FMD3 2RDQA 3BOPA 3ST7A 5C3QA 3OYWB 1D4M1 2PN5A 3AX4A 5BNOA 1RGSA 1VRH1 4PCRA 4I30A 4PLMA 4XXPA 4LO4B 4BLJA 1UOBA 3OGRA 1HXS1 1MS8A 3CDZB 3I2FA 1JOPA 4YVSC 1E5RA 2QE3A 3LEIA 5EFUA 3MPBA 5IWFA 4C0BA 2FMYA 2XQXA 4XDOA 4QDRA 2HWF2 5BPXA 3WHUA 3RWKX 2RDNA 4M00A 4L0PA 4D7YA 4JHTA 1N47A 1M06G 1NA1B 1ODMA 1QOOA 5IVJA 2E32A 2JDNA 4NRMA 4QPIB 2WT0A 5K0UA 2KXLA 4CDXA 3H1YA 1JBCA 4W50A 1NG0A 3SCHA 2XXZA 2YPDA 1S0DA 2WS91 3AKQA 2AENA 3H3ZA 4YW3A 5LBFA 2I74A 2WFF3 4EWAA 2JB4A 2VCMA 4W6XA 1ZZCA 2JIGA 4JRLA 3P3PA 1GNZA 4JX0A 5FZ0A 3VKNA 5FOBB 4QM9A 1BBT3 5F37A 2D6OX 3W21A 5I0TA 4P9YA 1X8MA 3HIFA 4TLFA 1XC6A 5IVVA 1WUVA 1N3QA 4GULA 2X29A 4Q4V1 4M01A 3NNMA 4OMDA 4PBOA 5E16A 2MEV3 1RMU1 4IE0A 3ZLIA 4FFHA 4YW2A 1QGLA 2RG4A 1XE7A 2ZEZA 3ROUA 5F7UA 2B8MA 2SLIA 3JQXA 1GSLA 4CPBA 1HN0A 2QQIA 3AP6A 4N43A 3KV4A 1AF9A 4RGAA 3WUCA 4AI9A 3AVSA 2JDKA 4IEXA 1CR7A 1YI9A 4SBVA 4COWA 4LBQA 3T0DA 3USUA 4GB31 3CZUA 5JZGA 3HN3A 4YRDA 1R64A 1H9PA 1YIFA 4XILA 4BJ0A 2OYZA 5A6ZA 1JW6A 3SKVA 4F8AA 1GP6A 3M8LA 1WMDA 2JDZA 3AXDA 2ZEYA 1ULGA 4Z92B 1FV3A 3RZGA 3LGRA 3LDBA 2VG9A 3OGJA 2UWCA 2HWE3 4XTPA 2LS6A 4P9IA 3PUHA 4R8HA 1RUG2 1VBD3 1AYM2 2C1FA 3TBDA 2IZWA 3ACIA 2AEZA 2GH8A 3OB8A 4K40A 1OQ1A 2HKXA 3H7JA 4PIXA 2VXJA 4QGLA 3LSEA 3MZHA 4D6RA 1WMFA 2JWPA 3HBZA 4AW7A 2GMPA 4DXTA 2WO1A 2VW0A 1QJY3 1D0HA 5F3EA 5LA2A 1YJKA 3IIIA 1YQCA 3S6PA 1XSRA 3UYJA 4Y3OA 4K9SA 3ZXAC 2HWC3 3AMQA 2ZCWA 1N1TA 1H2KA 4AEDB 1CN1A 1AL22 3H50A 3WNKA 5FYVA 3T2OA 1QJU1 4M0NA 1AR72 2QZ3A 3HVDA 4MH0E 1BJQA 4AGGA 3I3DA 4Q27A 4FOWA 3VBHB 3NAPA 5JXJA 1ZRRA 1MQTC 5TSWA 3QD6A 2UU8A 3CHXA 1VBC3 1WMXA
chains in the Genus database with same CATH topology
3W20A 5DAPA 5C5UA 3NNLA 2JIJA 3DKQA 5LATA 2FCUA 5DAXA 2G19A 5DAWA 4NHLA 2RDNA 2HBTA 3KT1A 4BQYA 3GZEA 3GJAA 4XACA 4ZPIA 3GJBA 5IATA 2A1XA 5IAVA 3BVCA 4MHUA 5LBFA 2Y34A 5A3UA 5ERLA 2JIGA 5LBCA 4KBZA 5HV4A 3W21A 2G1MA 4JZRA 4XCBA 4Y5SA 3OUJA 3NNMA 3HQRA 2Y33A 4MHRA 3NNFA 3OUHA 4NHYA 4Y5TA 2RG4A 3OUIA 5L9BA 4NHMA 4Q5OA 4BQWA 5EP9A 5M0TA 4NAOA 4NHKA 4BQXA 3KT7A 4XC9A 3NNJA 2V4AA 2HBUA 3HQUA 2FCTA 5HV0A 5LASA 5L9RA 3OBZA 5L9VA 5LBEA 4XCAA 2OPWA 5IAXA 2FCVA 4UWDA 3PL0A 4ZONA 5EQUA 3ITQA 4XAAA 3MGUA 3KT4A 5C5TA 4J25A 3EMRA 5EPAA 2RDRA 4NHXA 4XABA 2RDSA 5DAQA 4NMIA 4IW3A 5LBBA 5DAVA 5LA9A 2RDQA 5LB6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W20 A;  5DAP A;  5C5U A;  3NNL A;  2JIJ A;  3DKQ A;  5LAT A;  2FCU A;  5DAX A;  2G19 A;  5DAW A;  4NHL A;  2RDN A;  2HBT A;  3KT1 A;  4BQY A;  3GZE A;  3GJA A;  4XAC A;  4ZPI A;  3GJB A;  5IAT A;  2A1X A;  5IAV A;  3BVC A;  4MHU A;  5LBF A;  2Y34 A;  5A3U A;  5ERL A;  2JIG A;  5LBC A;  4KBZ A;  5HV4 A;  3W21 A;  2G1M A;  4JZR A;  4XCB A;  4Y5S A;  3OUJ A;  3NNM A;  3HQR A;  2Y33 A;  4MHR A;  3NNF A;  3OUH A;  4NHY A;  4Y5T A;  2RG4 A;  3OUI A;  5L9B A;  4NHM A;  4Q5O A;  4BQW A;  5EP9 A;  5M0T A;  4NAO A;  4NHK A;  4BQX A;  3KT7 A;  4XC9 A;  3NNJ A;  2V4A A;  2HBU A;  3HQU A;  2FCT A;  5HV0 A;  5LAS A;  5L9R A;  3OBZ A;  5L9V A;  5LBE A;  4XCA A;  2OPW A;  5IAX A;  2FCV A;  4UWD A;  3PL0 A;  4ZON A;  5EQU A;  3ITQ A;  4XAA A;  3MGU A;  3KT4 A;  5C5T A;  4J25 A;  3EMR A;  5EPA A;  2RDR A;  4NHX A;  4XAB A;  2RDS A;  5DAQ A;  4NMI A;  4IW3 A;  5LBB A;  5DAV A;  5LA9 A;  2RDQ A;  5LB6 A; 
#chains in the Genus database with same CATH topology
 3PUA A;  3UKT A;  5FLI A;  1BXH A;  5CFD C;  3O1M A;  4QPG A;  1ZZB A;  3LEG A;  4XJA A;  4IEZ A;  5A1L A;  5F5C A;  4QX2 A;  4S2D A;  4BQ5 A;  1YFW A;  1HRI 3;  1RJ7 A;  3VHN A;  1BEV 2;  1CIY A;  1DZQ A;  4UFK A;  3HT1 A;  5B4X A;  1IKQ A;  3AM2 A;  1O8P A;  2YGL A;  2GC2 A;  1IPJ A;  2D43 A;  2ZAH A;  4JGY B;  5H9S A;  3T0A A;  2NN8 A;  3ES4 A;  3R05 A;  1CAW B;  4EZH A;  2VXR A;  3M3I A;  3NMB A;  3AZZ A;  5JOX A;  4P9W A;  5F3I A;  2A6W A;  4RQP A;  4QGN A;  3U0Z A;  1GKB A;  2HYK A;  3OPZ A;  2XOM A;  5C9A C;  4UW5 A;  4BYY A;  3MIH A;  1LHV A;  4YW7 A;  4CCO A;  2WDB A;  3J7H A;  5FQ0 A;  1GNH A;  4JGZ A;  2WKK A;  5FYU A;  2JX9 A;  2WN3 A;  4GA9 A;  4NJ4 A;  4Q26 A;  2DVD A;  1HRV 1;  2YZ4 A;  3BOW A;  3ZMO A;  2VMC A;  3N9N A;  2Q5T A;  2VCC A;  5JWP A;  1N1Y A;  4XZU G;  3ZFF C;  3L2H A;  2GC1 A;  4LO8 A;  4AVV A;  2FD8 A;  2FMD A;  4TLG A;  5A7Q A;  1PO2 1;  1F9K A;  5DUV A;  3VBU C;  3RYR A;  2V72 A;  1NCQ C;  1SFN A;  1OLQ A;  3VL8 A;  1QMJ A;  2G9Z A;  2GAL A;  2P3Y A;  2R04 3;  4YLZ A;  5FZC A;  1UN1 A;  3EQE A;  5L9B A;  3KZ4 C;  4BH9 A;  4QB1 A;  3TRS B;  4X6R B;  2OS2 A;  1ZBA 1;  2DTW A;  4LA3 A;  4XJ8 A;  2MHF A;  1W6O B;  2R06 3;  2RMU 2;  1AJK A;  3L9J T;  3WNN A;  1D4V B;  1ZYB A;  3EO6 A;  3AZY A;  3FL7 A;  3CEW A;  1RXG A;  4DPN A;  4Z8B A;  1H8T C;  1O4Y A;  1OFN A;  3FBY A;  4HOO A;  4BLI A;  5FZ9 A;  1V0A A;  2JXA A;  4AWD A;  5KXC A;  1B35 A;  4NID A;  4AXO A;  1YCI A;  4GMP 0;  2W9X A;  4HVR A;  5DXD A;  4OHZ A;  3RSJ A;  3TN9 1;  2WNE A;  4LA2 A;  2JKX A;  1QQP 2;  2BRT A;  3R4U A;  5GM0 A;  1LES A;  4QWN A;  1W2O A;  2PA7 A;  2WT2 A;  3ZSJ A;  5FMO S;  1V9U 3;  1XXN A;  1J3R A;  4HLT A;  4LTA A;  3TEW A;  1WKY A;  3JD7 2;  3AB0 A;  1W8H A;  5GZE A;  3B9C A;  3MID A;  1VB2 A;  4A3Z A;  2YY1 A;  3E5U A;  3NNG A;  1UZY A;  1H2L A;  1KFU L;  3OJB A;  1NT0 A;  4FFI A;  5BNN C;  3BPS A;  3KSC A;  1RIR A;  3MV0 1;  4NWV A;  5A7N A;  3W5N A;  2PHD A;  3I49 A;  5C33 A;  3WG3 A;  4H14 A;  4IES A;  3KM5 A;  3IM0 A;  3WQ7 A;  4ASL A;  2XWB B;  5J48 A;  3NL1 A;  4N7I A;  3WF0 A;  3ZFE C;  3VBF A;  1BQP A;  5A7P A;  4LE4 A;  3N9Q A;  1H30 A;  1HN1 A;  1GOG A;  3ILR A;  5FTT C;  2BGO A;  1KXG A;  5FUI A;  4YM2 A;  4ZU4 A;  4UF0 A;  2RS1 1;  3V65 A;  1GFF 2;  3ES1 A;  1IOA A;  3AMN A;  2JEM A;  4N90 A;  4BIF A;  5DZG A;  2WRA A;  4IUG A;  1REE A;  4NMI A;  4AHY A;  2OUJ A;  3IZO A;  4ZU7 A;  4P08 A;  3ZFG B;  3CZJ A;  5LA9 A;  1TME 2;  2O14 A;  2QQV A;  1OF3 A;  3D82 A;  2QDN A;  3GBF A;  2JG9 C;  4LBM A;  1FV2 A;  1GWL A;  4YVW C;  4AI1 A;  4KG0 A;  4CEY A;  3WG1 A;  1MZE A;  1O8S A;  4A3X A;  4BIO A;  5HCA A;  1R09 3;  3LD8 A;  4CDW B;  3T3Y A;  3DKQ A;  4LLO A;  2BNO A;  3BYW A;  5CNA A;  5FZF A;  4TN7 A;  1B09 A;  1J84 A;  1SBD A;  4C1X A;  3OGG A;  4AK3 A;  2X53 S;  4WM8 B;  1DU3 D;  4D6S A;  4LLF A;  4KGQ A;  4CRQ A;  1US3 A;  3NKG A;  2ZMK A;  2RM2 3;  2ZX4 A;  4YG0 A;  1EP0 A;  1ULO A;  3FN9 A;  1VP6 A;  3BCW A;  2XG3 A;  3GJA A;  5JXG A;  2RS3 3;  4FPJ A;  4XAC A;  3IPV A;  2JG8 B;  3LA3 A;  5E8A A;  1HIX A;  4YZ3 A;  4RR3 C;  1F31 A;  5L7O B;  2WZE A;  4K8R B;  4A6O A;  4ZZ5 A;  1Y9M A;  4Q4V 2;  3VZK A;  1V6M A;  1RMU 2;  2W1Q A;  1FOD 1;  1LOB A;  2GU9 A;  3RWN A;  4GWM A;  3CJI A;  3CU7 A;  4LHL A;  4LUM A;  4GD4 A;  2W1W A;  1DYP A;  4LKF A;  5ERL A;  1ND3 B;  2V5D A;  2VTX J;  3MF9 A;  2EAK A;  2D5H A;  4QQH A;  2MPF A;  3PU3 A;  3P3N A;  3U1X A;  2RJ2 A;  4AQ2 A;  2WAA A;  1DQ5 A;  3DYM A;  4JTO A;  2WO3 A;  5HV4 A;  5DMY A;  1RHI 1;  2BDR A;  2JB8 A;  1BCX A;  1BLZ A;  4CU6 A;  5AC9 2;  1KQR A;  5IUQ A;  2OII A;  1J1L A;  1ZRI A;  3BOD A;  4ZKT B;  3BAL A;  1YO8 A;  2B9V A;  2WNV B;  3HQR A;  4K3U A;  4MHR A;  5E89 A;  4YM3 A;  3W58 A;  1T2X A;  2R07 3;  2Z69 A;  3WZ1 A;  5KC5 A;  1X8E A;  3OUH A;  1OHF A;  4FO9 A;  4NHY A;  5EZW A;  3NQH A;  4CP0 A;  3U07 A;  5CEH A;  4FPK A;  3POI A;  3O1U A;  2ETE A;  4B4Q A;  4NIG A;  1OVP A;  3T1L A;  4CDQ C;  2W3J A;  3Q8A A;  1JYN A;  2PXJ A;  2WR9 A;  1MS0 A;  2P37 A;  1C8N A;  4UAP A;  5ABJ B;  4XFA A;  4QM8 A;  4YGB A;  5H9P A;  2DCY A;  2EXI A;  5FZ3 A;  1X7N A;  2RS5 3;  4K8F A;  1XB9 A;  1I5P A;  5C3P A;  3DL3 A;  4RS5 A;  4AHW A;  1AJO A;  1SBF A;  3AVR A;  3OEA A;  1FI2 A;  1BK1 A;  2DCK A;  3LOI A;  1JYT A;  5KXB A;  3ZN4 A;  1FNY A;  1ULD A;  2YU2 A;  3J7L A;  3PJQ A;  4QPY A;  4B4P A;  5FZA A;  2ZOE B;  2XGX A;  2B9U A;  5IT6 A;  2LM3 A;  3OBR A;  4GAZ A;  1MEC 2;  1MVQ A;  4NO4 A;  3OCP A;  1POV 3;  4MGZ E;  3WDW A;  4YVS B;  2CWM A;  4JAA A;  1F15 A;  4BK5 A;  1ENR A;  2QDR A;  3O0V A;  1S55 A;  2C0Z A;  3BN6 A;  2AGS A;  3N7L A;  5J96 B;  2E63 A;  5FZ6 A;  5C8C B;  4KL1 A;  1UKG A;  4LO7 A;  4YZ4 A;  3BUC A;  1U5X A;  1X50 A;  1RUH 1;  2PYT A;  3FBM A;  4Q4X 1;  5T5P A;  4XF3 A;  1Y9Q A;  3C7G A;  4NRP A;  4QU1 A;  4XVH A;  4B3N A;  5LEK A;  1ACC A;  2TNF A;  1UWW A;  2E31 A;  3J8F 3;  5FZG A;  4YM0 A;  2C9K A;  4LMF A;  5FYT A;  1AL0 G;  2D98 A;  3HMY A;  1ODN A;  4IER A;  3O1P A;  4NR1 A;  4W6W A;  4CCL A;  1K45 A;  3KQR A;  3LWC A;  2BVB A;  4MXW A;  1DQ4 A;  3VD7 A;  4E2S A;  1R08 2;  4B1M A;  1TMF 2;  3CJX A;  1UY0 A;  4AI2 A;  1PZ8 A;  4XJU A;  5KHG A;  4DIN B;  1CAU A;  2HWB 3;  4Q4W 2;  1UMZ A;  4O9E A;  5FMC A;  5T50 A;  1WCD J;  4Y26 A;  3S30 A;  4CP9 A;  1UY4 A;  3ZN6 A;  2R6Q A;  1S0F A;  2AZ5 A;  2PMW B;  3FLT A;  2YFZ A;  2ZKN A;  2G9G A;  4AFM A;  2XUM A;  5F3C A;  1SLL A;  4AVB A;  4KWL A;  3ZSL A;  1PK6 C;  3SH3 A;  1SFP A;  1PO1 3;  1NCR C;  2VGD A;  2JDP A;  2W46 A;  2X5I C;  1F4H A;  3O5S A;  3PME A;  3T2T A;  3RZJ A;  4WZF A;  1ZRD A;  4PDW A;  4J1X A;  3BTZ A;  1OI6 A;  2ZML A;  1RTV A;  3GJB A;  3SMH A;  1WLD A;  5D8A C;  3D8C A;  4RHV 1;  1ZNP A;  1DQ6 A;  3GZA A;  2P3J A;  5FO7 B;  2NZ9 A;  1ND2 A;  3SEE A;  1COV 2;  2A6X A;  3WG2 A;  2W1S A;  2XVG A;  2IXH A;  1HB2 A;  4LUL A;  2OXB A;  1ULE A;  4W8J A;  5SV8 A;  5AVP A;  1AVB A;  2ADE A;  1GZW B;  1AYN 3;  5I8Y A;  3HR9 A;  4WVW A;  5GZG A;  4CTE A;  1EAH 1;  2GMM A;  5IJR A;  4N9I A;  2NQY A;  3WF1 A;  4BK4 A;  2B42 B;  2DWR A;  2P2K A;  4HN0 A;  1CAV A;  5JSO A;  1V6K A;  3WCR A;  1UY1 A;  4KU8 A;  3T4H B;  3NJY A;  1H6Y A;  2WL1 A;  3OUJ A;  4KWJ A;  4BHP A;  1OLM A;  4LT5 A;  3E6B A;  2EVX A;  2D6L X;  1EV1 1;  3ENR A;  4BMB A;  5T54 A;  1FYU A;  4QB2 A;  1RUD 1;  3LSD A;  3THD A;  4H7L A;  4HPK A;  2ILM A;  4P9X A;  3OUI A;  2ID4 A;  4KWU A;  4JQR A;  2AR6 A;  3IMN A;  2YBK A;  3OOX A;  3ZXF A;  1AR8 3;  3RS6 A;  2J22 A;  1DGL A;  2PAE A;  2PQQ A;  4AR2 A;  5ACA 3;  2AAC A;  1LCL A;  2XJU A;  4WM7 A;  4IEV A;  4QX1 A;  3B01 A;  4JKM A;  4Q4Y 1;  1ULF A;  5BNP C;  4G4F A;  3ASI A;  5BY5 A;  3ACH A;  1MAC A;  3THT A;  3WP4 A;  2JIC A;  1OOP A;  3KT7 A;  5IYY A;  1MQT B;  2HBU A;  1A8D A;  4ET7 A;  1L7R A;  4LIT A;  1PGW 2;  1ASJ 1;  2OX0 A;  4M4P A;  5FXZ A;  4EN8 B;  2W94 A;  5LA0 A;  1C5I A;  3DEC A;  1SG3 A;  1FT9 A;  3OYW A;  2GNM A;  5CFD B;  1NKG A;  3TB0 A;  4OHY A;  4CDU A;  3ACG A;  4S2F A;  3WDV A;  1VBE 2;  2J1T A;  3HNB M;  3EBR A;  1PGL 1;  3MW2 A;  1AR9 1;  1OMI A;  2F17 A;  2RS1 2;  1RUF 3;  4IE5 A;  3JUU A;  3AYA A;  3Q8E A;  5LRR A;  4GWN A;  3SCF A;  2OPK A;  5C71 A;  2YGM A;  2HJI A;  3N36 A;  1RUC 1;  3CQO A;  5GLV A;  1I5Z A;  3MGU A;  4M3C B;  3JBG 3;  4CPB D;  1C3H A;  4PQ9 A;  1X36 A;  5JMC A;  5A80 A;  2EXJ A;  4QPI A;  2PAM A;  3UJO A;  4S2H A;  5DZF A;  1UIK A;  1OBN A;  2W47 A;  4LBQ D;  4N8M A;  3I4I A;  3SEP A;  5FPU A;  5C9A B;  2PHW A;  3SIT A;  4DS0 A;  2WO7 A;  1NQJ A;  1LR5 A;  1RUJ 2;  2Y6J A;  1HV1 A;  2W5F A;  4I2O A;  3MYX A;  5FY0 A;  3K77 A;  1KD7 A;  2P17 A;  1XU1 A;  2AUY A;  1AXY A;  2B46 X;  5CU1 A;  2ZXQ A;  3B9I A;  1W3X A;  4PLN A;  4R4X A;  1XE8 A;  2A70 A;  3I3B A;  3ZFF B;  4BXF A;  2VMG A;  5JSR A;  4L11 A;  4G3Y C;  4RSU A;  2XBO 2;  3RYP A;  4TTG A;  4LBN A;  3J26 N;  4QKD A;  3S5A A;  2P6H A;  3VBU B;  2JIJ A;  2DVA A;  1CD3 G;  1NCQ B;  2GC0 A;  1CWP A;  1FOD 2;  2EID A;  4GH4 C;  4XF0 A;  2HH9 A;  1IQD C;  2VW2 A;  3ETP A;  2XLG A;  4A2U A;  1UCX A;  3S57 A;  5JOZ A;  4ZXK A;  1ULP A;  1K5M B;  1NE6 A;  1H1I A;  2DVB A;  1L7Q A;  1GR3 A;  1PIV 2;  2JDH A;  1RHI 2;  2HYX A;  3M3E A;  5EJ1 B;  4I3G A;  2A1X A;  5IAV A;  2C6S A;  3BVC A;  1PX3 A;  4WVV A;  1H8T B;  3GM8 A;  4Z2A A;  2YBS A;  3CKH A;  1UOG A;  5F2W A;  5CFC C;  1Z7S 2;  3POY A;  4E9K A;  2W39 A;  2R0F A;  4JV4 A;  1IS6 A;  4XJ9 A;  2E6V A;  4L97 A;  1J3Q A;  2JDM A;  3VZO A;  1GZC A;  2OVU A;  3CF6 E;  1E5H A;  2ZGO A;  2WZR 2;  4LR4 A;  2FDG A;  1JXN A;  5L36 A;  1O91 A;  2PHU A;  4QDS A;  5A7S A;  2VVD A;  2V09 A;  2W08 A;  4MGT A;  4FPL A;  2D97 A;  4MET A;  5KXE A;  2ZEW A;  5FWE A;  3AFG A;  4BB3 A;  4E27 A;  3I8T A;  1H4G A;  1ALY A;  1UIJ A;  2X8K A;  5FZM A;  3LKJ A;  1RUI 1;  2V5Y A;  5LEJ A;  3FWE A;  1UZZ A;  2OZJ A;  3VKF C;  1AUY A;  3ZFE B;  3TEY A;  1LAJ A;  2XJT A;  3BI3 A;  3K2O A;  2HEW F;  4AED A;  1XQN A;  1YYN A;  2ZHK A;  3PTY A;  4XUR A;  4QX7 A;  4CXW A;  1AYM 3;  4NHK A;  1XND A;  4WVM B;  2IFW A;  2UY8 A;  1LEC A;  3KV5 A;  3P6B A;  4CUG A;  3VZL A;  3ZFG C;  3GCW A;  3DEM A;  2DUR A;  5EYX A;  2OW4 A;  5KXD A;  1EUU A;  2ZJC A;  4Q4X 2;  2J1R A;  3VBH A;  3V56 A;  5FMO L;  4NII A;  2JG9 B;  3I3M A;  4GKY A;  3WVJ A;  3MIB A;  4YVW B;  4LO5 B;  5BUV A;  1S0B A;  1LOG A;  2HLE A;  1HB3 A;  4JDO A;  5LBE A;  4URA A;  2XKO A;  1CQ9 A;  3AZX A;  1AL2 3;  3IKW A;  4WM8 C;  1XNT A;  2GH2 A;  4DZG A;  4V2W A;  2EIC A;  2JEN A;  3PL0 A;  2WSU A;  1FAY A;  2BNN A;  1AR7 3;  5ISL A;  5LK7 B;  4J6G A;  1WW6 A;  2B39 A;  5HI0 A;  3CIH A;  1PVC 3;  1C8M 2;  2XJP A;  4JGY A;  4ATE A;  5FJH A;  2QKD A;  4MOA A;  3RZL A;  1YFX A;  1CAW A;  4A45 A;  2Y0I A;  2UYB A;  4RR3 B;  1VBB 2;  2QNK A;  4N9H A;  5C5T A;  4XIK A;  2JE8 A;  3CLP A;  3KF5 A;  4AI3 A;  1W06 A;  4OZX A;  1BEV 3;  4QHO A;  1GQP A;  5CIS A;  4YG3 A;  5FXW A;  1CAX B;  4J1W A;  1WWY A;  4W65 A;  3B00 A;  3U75 A;  3WV6 A;  3I59 B;  2D40 A;  1JZ4 A;  2ZHN A;  3Q8B A;  4IQP A;  4RHV 2;  3N7K A;  4I01 A;  4MX3 A;  5FZH A;  5DAP A;  1U12 A;  1GUI A;  3D0J A;  2WNV C;  1LGN A;  4QMA A;  4BQ1 A;  2Y6L A;  4ZY9 A;  1FMD 1;  4FP2 A;  3INA A;  4YAR A;  3ACL A;  2WLQ A;  1WCS A;  4HSL A;  1GZT A;  5H9Q A;  4UFJ A;  4Y24 A;  3EB7 A;  4CDQ B;  5ANN A;  1UYX A;  2DTY A;  5F39 A;  1JZ5 A;  1GBG A;  2IVJ A;  2D3R A;  3LFI A;  1W6O A;  4GMP 3;  2VQT A;  5FY7 A;  5HCB A;  4A7Y A;  4FCA A;  4GWI A;  4QX3 A;  2VZV A;  4P5Y A;  4Q0U A;  2G9F A;  3LB9 A;  3B7M A;  1URX A;  1D7P M;  4E8D A;  3H3L A;  4ASK A;  4TSV A;  2JKB A;  1KS5 A;  4PF5 A;  1X9T A;  2K9Z A;  2X05 A;  2XQR A;  1MZF A;  3LAG A;  3VBO B;  2VTF A;  1W9Y A;  3QCW A;  5EYY A;  4BXS V;  3WX5 A;  1JH5 A;  3H8X A;  4XFH A;  3WD5 A;  3RI9 A;  3NV2 A;  5FOJ B;  3MLK A;  1LHO A;  1DGR N;  2ADD A;  1BYH A;  2WFF 1;  3N35 A;  4RD7 A;  2RMU 3;  2OA2 A;  4FTS A;  5C8C C;  3WSO A;  1ZRE A;  2XML A;  2RR1 3;  1LOF A;  2Z79 A;  3THC A;  2CWS A;  1Q43 A;  2ZBJ A;  5JI7 A;  4L99 A;  5I91 A;  3RDI A;  1YEW A;  4NIH A;  2Q8E A;  2AH2 A;  1E57 A;  3HJR A;  4QQP A;  2MEV 1;  5JUV A;  3LEK A;  4M3C F;  4XFB A;  1QQP 3;  2QTW B;  3LCP A;  2K0G A;  5DDJ 1;  2JE9 A;  2LRO A;  2QQN A;  1PGL 2;  1AR9 2;  4O9G A;  3M4F A;  4OHV A;  2EAL A;  3FZ3 A;  4Q0S A;  3E6C C;  5JPN B;  4PIY A;  4B1L A;  5A70 A;  3JD7 3;  4XC9 A;  2XON A;  1XU2 A;  3LDR A;  1X33 A;  4HK8 A;  2PAK A;  4OZO A;  1VLN A;  5F9T A;  2VNR A;  1MS4 A;  2BEO A;  2D6N A;  1W6N A;  2IFR A;  5CAZ A;  1BMV 1;  1GP4 A;  2VQ0 A;  3JCI A;  3I7D A;  2R16 A;  2XHK A;  4CDW A;  2OT7 A;  1PK6 B;  1W9S A;  1BZW A;  3OGV A;  1NCR B;  3WCS A;  5FY1 A;  2HWE 1;  4AEM A;  2X5I B;  1UU5 A;  3LF7 A;  1GQH A;  1W3V A;  1VBD 1;  1DQ2 A;  2IWG B;  4K6B A;  5D8A B;  2RV9 A;  4UFI A;  5FRA A;  4CEW A;  1TME 3;  3KV9 A;  5A3N A;  1ZRC A;  2JG8 A;  4LKS A;  3VBS A;  4COU A;  4CUA A;  4YW5 A;  5L7O A;  5BV6 A;  3M3Q A;  4XAE A;  1QJY 1;  2ENR A;  4XUO A;  3K4A A;  2RDR A;  4E4Z A;  5IW0 A;  4D3W A;  4DOU A;  2WC2 A;  4P02 B;  4XHX A;  2A3W A;  4JDN A;  4Z07 A;  1ND3 A;  5FY8 A;  5H9R A;  5D1I A;  3UJQ A;  1G9F A;  2ATF A;  3VKL A;  2XPJ A;  1QOS A;  4NOT A;  3VKO A;  2Y38 A;  4W4Z A;  5A7W B;  4KBB A;  3ZDS A;  4QKF A;  3D6E A;  1UZ0 A;  1Q56 A;  4FAG A;  2WNU C;  1HJG A;  2WLP A;  3D5O A;  4PI2 A;  4Q4V 3;  3RFR A;  4CCE A;  1RUE 2;  2YV8 A;  3PLQ A;  4OFG A;  1VBC 1;  5HCF A;  2ZAB A;  1HJF A;  4QD2 A;  1OUS A;  5CBL A;  4HK9 A;  1UY2 A;  3NST A;  4C1W A;  3AP5 A;  1PZ7 A;  1Q8O A;  4WZC A;  5F8P A;  3GZE A;  5FYM A;  4IV1 C;  1QNY A;  1DLL A;  4ZPI A;  1HRI 1;  2GZW A;  3RQ0 A;  2OUH A;  3OTF A;  3UV9 A;  2WWU A;  5FPX A;  4A42 A;  4EJR A;  3GZU C;  5EWS A;  5BNP B;  1NZI A;  5ABJ A;  3ZSE A;  2UWA A;  3H1M A;  4XFF A;  5AC9 3;  3AL5 A;  1UD1 A;  1LHU A;  1WZX A;  1Y9G A;  3PUI A;  4Q2F A;  4S2G A;  2VL4 A;  5C4W B;  4AE2 A;  1QWR A;  1QOT A;  1PMJ X;  1QNW A;  1GIC A;  1V70 A;  2WO2 A;  5GZD A;  5FZO B;  3QAC A;  1STM A;  2D3P A;  5CA6 A;  3OBA A;  4NIA A;  1DIW A;  3FJS A;  1REF A;  1UL9 A;  2E7T A;  4PQQ A;  1DHK B;  4FVV A;  5T5J A;  3QOP A;  1IGO A;  1OVS A;  5LW9 A;  1S2E A;  2CGP A;  4YVS A;  3ZXL A;  2VQU A;  4JKK A;  1E5S A;  1Z0H A;  3LEM A;  3C2U A;  3K3N A;  2P3I A;  1Y7B A;  2ZGN A;  2VUC A;  4COZ A;  5FO8 B;  2KD7 A;  4UXA A;  3VN4 A;  3MIG A;  1HLC A;  1OUR A;  2QQM A;  4P9J A;  5FXX A;  3N7M A;  4LNV A;  3DGT A;  4R9C A;  5FLJ A;  5A33 A;  5JVV A;  5D2A A;  1F4A A;  5FZI A;  4OI1 A;  4CUB A;  2XKP A;  4XPV A;  2O8O A;  4JVA A;  4BQW A;  4B29 A;  3C7H A;  3AZW A;  2OZ6 A;  1MEC 3;  1QKQ A;  3AKP A;  3G7D A;  1KJL A;  2R04 1;  1O3Q A;  1S0E A;  2HWD 3;  3NV4 A;  4HL0 A;  4XUQ A;  2Y8K A;  5FLH A;  4ES8 A;  4EN7 B;  3DYO A;  4P5H A;  1QIQ A;  2I45 A;  5BNQ A;  4CP2 A;  2R06 1;  2MNG A;  2ZGM A;  2PHT A;  1FPN 2;  2EIE A;  3H9A A;  1CZV A;  3K75 B;  1CGP A;  1NY7 2;  2ZEX A;  4AFD A;  4Q29 A;  2R32 A;  4YGC A;  2G4I A;  3M3O A;  1QXJ A;  2VD7 A;  3F2Z A;  4EZ4 A;  2FCV A;  4GH4 B;  2DU0 A;  3E5X A;  1W2N A;  4LXL A;  4QKN A;  5F2S A;  4ZHN A;  1O5U A;  3ELN A;  2GN3 A;  3ILN A;  5IHR A;  1R08 3;  2CV6 A;  1K5M C;  4I02 A;  2CAU A;  1TMF 3;  3HNY M;  1V9U 1;  4IV3 B;  3O1S A;  4Q4W 3;  3I97 A;  5CAD A;  4KH9 A;  3N4M A;  2Y64 A;  2ARB A;  1RVF 2;  2I07 B;  4OYU A;  4OVE A;  1SZB A;  1DZT A;  3UNP A;  2A73 B;  1DP0 A;  2V4V A;  4YZ5 A;  2D6P A;  3RVH A;  3GHN A;  5CFC B;  4ZZ8 A;  3POB A;  4LHK A;  4GAL A;  1LOC A;  1QXR A;  4DIQ A;  1CJD A;  1XBF A;  1QEX A;  1RIT A;  3DPR C;  3F95 A;  2FHR A;  4LEJ A;  2SBA A;  4YW6 A;  2VVF A;  4P00 B;  4Q8K A;  5KC6 A;  4UI9 L;  1APN A;  3NJZ A;  2ZMN A;  3C7O A;  4AAX A;  1COV 3;  4QXH A;  4XUN A;  4XUT A;  1D4M 2;  3N9M A;  2KM2 A;  2BPA 2;  4MGS A;  4OUL A;  1VRH 2;  1R09 1;  5SV5 A;  1UAI A;  2DBI A;  4GKX A;  5FCC A;  1HXS 2;  3A21 A;  1ZRF A;  1W9T A;  4XFC A;  1S2K A;  1PZ9 A;  2CL2 A;  2J7M A;  3C8X A;  4FQ4 A;  4CCN A;  4IEQ A;  2WFF 2;  3IDE A;  5FBZ A;  3N9O A;  3R6S A;  3FHA A;  2OQ7 A;  2CDP A;  4OHX A;  5FUN A;  1XNB A;  1PGS A;  1XRU A;  3FFQ A;  1NLQ A;  2BOI A;  2YYO A;  1DGW A;  1W90 A;  2A6Z A;  2WAB A;  3OF1 A;  2IXL A;  2RS3 1;  4IGP A;  2NM1 A;  2BER A;  1WW7 A;  5JCT A;  2QQJ A;  3GAL A;  1MQT A;  3FUQ A;  1LU1 A;  1PM4 A;  3DF0 A;  2QJV A;  1HKD A;  1W6P B;  4L9B A;  1K12 A;  5IK4 A;  5A3L A;  5FZK A;  3RPQ A;  2WS9 2;  5C7G A;  1U5Z A;  5CFD A;  1MR5 A;  5DDJ 2;  3MBW A;  4WBB A;  2J42 A;  1NXD 1;  2BP6 A;  1Q8P A;  4DRV A;  2WAO A;  2DF7 A;  4QDQ A;  1W8W A;  3PIJ A;  4MAD A;  2F6B A;  4DXS A;  2Y33 A;  1SDW A;  1AXZ A;  1SAC A;  1DFQ A;  1UYP A;  1YXW A;  3VBR C;  5A3T A;  4CCD A;  4CXX A;  1U5Y A;  4I0W B;  2Y6H A;  1VPH A;  2XJR A;  4NN0 A;  3WP3 A;  2WIN B;  3JQW A;  5JLV A;  1UX6 A;  1BMV 2;  3C7F A;  4Q1P A;  3GZT B;  5FP3 A;  2Y6F A;  3SKJ E;  1G9C A;  1AR6 3;  2R07 1;  2ZX2 A;  1F35 A;  3V64 A;  2VU9 A;  4FQZ A;  5I0D A;  5C9A A;  1W6Q B;  2VZU A;  1VBE 3;  1FNZ A;  1L7L A;  1CES A;  3MUZ 1;  2RS1 3;  1OF4 A;  3O1T A;  1XJA A;  1NZC A;  5AVA A;  3AYD A;  2VZO A;  5L19 A;  5BXX A;  2VZS A;  3C7E A;  1OXC A;  4GB3 2;  2JDA A;  5FAX A;  3ZFF A;  2RS5 1;  3V0A A;  2QUO A;  5FBJ A;  2FCT A;  5HV0 A;  5J37 A;  3PIG A;  1F2N A;  2D6M A;  5L9R A;  1TQ5 A;  2BBA A;  2DVG A;  5FIX A;  5G05 L;  1I9R A;  3POF A;  3GF6 A;  4ISQ A;  4FT8 A;  4R9B A;  3VBU A;  1NCQ A;  1NX9 A;  5KWR A;  3N9P A;  1BKZ A;  5GLZ A;  2P34 A;  3A0N A;  1RUJ 3;  4H55 A;  1POV 1;  2XDV A;  1LOA A;  1W05 A;  5IK8 A;  4XAA A;  2WBK A;  4Z2W A;  4C91 A;  1VMJ A;  4UBG A;  5FJK A;  1C5H A;  3KGZ A;  4IXL A;  2DUP A;  4QQL A;  3JXS A;  2XBO 3;  4BA6 A;  2A75 A;  5LCW L;  2ZZJ A;  3ZXD A;  1VBA 3;  1LOE A;  1H8T A;  1R1A 1;  3VBO C;  3B69 A;  3J8F 1;  2YRO A;  4NAM A;  5A32 A;  3IBM A;  1S0I A;  3LDK A;  1HQW A;  3M7A A;  5FPB A;  5A3O A;  2BWA A;  2YC4 A;  1WLT A;  2YPJ A;  1Q3E A;  3DXT A;  4RL7 A;  2VMH A;  2A5Z A;  4Q1R A;  3JB8 A;  1QJU 2;  5DAV A;  4E4D X;  1NUK A;  3AMH A;  2CNA A;  3MI8 A;  3H3U A;  4XF1 A;  4AL9 A;  4CZS A;  5AFB A;  1PIV 3;  3A23 A;  3W20 A;  3B3Q E;  3PVN A;  2ZX0 A;  1OLR A;  1ZM1 A;  4MGY E;  2DUQ A;  2HWB 1;  3DN7 A;  3T4V A;  4E4H A;  5JR7 B;  4H2A A;  1W8F A;  4IDZ A;  3UT0 A;  1SHW B;  2IXJ A;  5BNN A;  2FCU A;  1T6B X;  4KU7 A;  4P9G A;  1Z7S 3;  1JUI A;  1BVV A;  2B7Y A;  3AJZ A;  3BTX A;  3TOJ A;  3KCC A;  1PHM A;  2OKX A;  2JDY A;  2WJS A;  3LA7 A;  4CE8 A;  3I2O A;  1SCS A;  5FYY A;  3ME2 A;  2VZQ A;  3ZFE A;  3V0B A;  3ATG A;  2PLV 3;  5IAT A;  1O6U A;  3ILF A;  3NV1 A;  3GXU A;  3FMG A;  5A3M A;  2WZR 3;  2VR4 A;  4FI9 A;  4WVM A;  1M4W A;  4CU7 A;  1XE0 A;  4OI0 A;  1WLW A;  4QX5 A;  4FTE A;  2VOK A;  4YYO A;  3PJY A;  4NWW A;  3ZR6 A;  4RA0 A;  3AKT A;  3UET A;  3H8U A;  1RB8 G;  4ATF A;  2JG9 A;  4RQP B;  2VMI A;  4E4S A;  4YVW A;  1ZBE 3;  3CO2 A;  3J9S A;  4BM8 A;  5FY9 A;  5FP9 A;  4X8N A;  1VMH A;  3RGB A;  3VDD C;  3SLI A;  1DYO A;  5FQ0 B;  4EV0 A;  3NJV A;  4JZR A;  4R52 A;  5CG9 A;  1AYN 1;  5GLT A;  4H3W A;  3AJY A;  1HRV 2;  1GOH A;  3BTA A;  4MUV A;  5C3R A;  1YQ5 A;  2K2S A;  3SXW A;  4DNY A;  4CSW A;  5GZC A;  2XJS A;  4QPW A;  1YFY A;  4HXC A;  4O7X A;  4Q4X 3;  3ZN5 A;  2JD9 A;  2ZX1 A;  2WUH A;  2BVV A;  3QH7 A;  2FBE A;  1PO2 2;  2VCB A;  4HZF A;  1CZS A;  4RR3 A;  2XB6 C;  4OI4 A;  4HKL A;  1PVX A;  4BE3 A;  3E6D A;  1SPP B;  3L2Y A;  4ZS2 A;  4YPJ A;  1V6I A;  2VOV A;  2Y60 A;  2ZKL A;  3DYP A;  1AR8 1;  2FDJ A;  3S7I A;  3ZPO A;  4UT5 A;  2EXK A;  4OUE A;  4TYS A;  2CYF A;  5IK7 A;  1ZBA 2;  1CAX A;  2KA3 A;  4SLI A;  3HBK A;  4URT A;  5FUP A;  5ACA 1;  1V9U 2;  5CIR A;  2J1E A;  3I59 A;  1ZA4 A;  3MFC A;  1BVP 1;  3W9A A;  1C8M 3;  2CTV A;  2Q4S A;  4XDQ A;  3ECQ A;  4FPH A;  5LAS A;  4WV8 A;  4MGI E;  3SC7 X;  3ZX7 A;  4OI2 A;  2WNU B;  1VBB 3;  1N1V A;  3VGI A;  5F6K A;  3PNA A;  3MIF A;  3OPT A;  3TN9 2;  3VHO A;  3B5L B;  3UGH A;  3KVB A;  1UOF A;  2EIG A;  4IV1 B;  4CDQ A;  2LAL A;  1NQD A;  4DXZ A;  4CYD A;  3POE A;  4UFH A;  5T5L A;  1RUF 1;  3TNP B;  2Q8D A;  5A1F A;  2DU1 A;  5FY5 A;  4B7K A;  4Q0V A;  3K4Z A;  5FZ8 A;  3JBG 1;  3WQ0 A;  3I3E A;  4XBL A;  5C4W C;  3KHB A;  2C24 A;  2BJS A;  2NMO A;  2UUR A;  4A41 A;  4QQO A;  2XUE A;  1EYB A;  3IN9 A;  4IEO A;  2E53 A;  4YM1 A;  3VBF B;  3MLL A;  4COV A;  2BW8 A;  3GDB A;  1WLC A;  2YUE A;  4GWJ A;  4UF0 B;  2DDU A;  5EIY B;  4BQ3 A;  1MVE A;  1YLL A;  2ZPX A;  4N53 C;  5ANQ A;  3HQX A;  1N3O A;  2EA7 A;  1QH7 A;  5I93 A;  4UFL A;  4K21 A;  4IGO A;  4FSJ A;  4LBK A;  1NA1 A;  5DAX A;  4CEY B;  4D7T A;  2G19 A;  4NHL A;  4HFS A;  1G9D A;  4Z82 A;  1W0N A;  2YG0 A;  3SQO A;  3O1V A;  5HPO A;  2P1B A;  2I2S A;  1QJX 1;  1FXZ A;  3ZYR A;  5JOY A;  2B4K A;  2HWF 3;  4XUP A;  3K51 A;  2YB7 A;  4HVO A;  1G9B A;  4OUS A;  3WF2 A;  2VBP A;  4NRO A;  3WT3 A;  3ZYG A;  2D5F A;  4D69 A;  5FYI A;  5T3N A;  1IPS A;  4EQV A;  2AC1 A;  1LHW A;  3RYK A;  2R07 2;  3UGF A;  1GU3 A;  4DQA A;  5CZK A;  3VD4 A;  1ZZ8 A;  1PK6 A;  2GNB A;  4Y5S A;  4B7E A;  5IK5 A;  5F6L B;  1YQ8 A;  3M3C A;  4IL7 A;  4IV3 C;  3JB4 C;  5A7O A;  2X5I A;  2ZGU A;  3RI8 A;  1YFU A;  3RZM A;  3KS7 A;  1DLC A;  3PMS A;  4MV2 A;  2E33 A;  3VD5 A;  4LHS A;  1WCQ A;  1VRB A;  2VNG A;  5D8A A;  1W0P A;  1LNS A;  1UF2 C;  1CX1 A;  2BV4 A;  1XSQ A;  4CU8 A;  1JZ2 A;  1DCS A;  2P3K A;  3B02 A;  2VME A;  2RJL A;  4LIU A;  4L2N A;  4CVU A;  1G6N A;  3WEZ A;  1Q8S A;  5FP7 A;  4TWT A;  3VZM A;  4QKB A;  2QCS B;  2V4A A;  3WW3 A;  4W6Y A;  3DPR B;  1SLA A;  1AYM 1;  5F32 A;  3ZIX A;  4BWO A;  1O5L A;  5A7W A;  4AZZ A;  3RZH A;  3PVO A;  2K46 A;  3IIA A;  1CPN A;  1IHM A;  4ZXE A;  3TEX A;  4QXK A;  1R1A 2;  3I54 A;  3LFM A;  3WW4 A;  3VUO A;  1TVG A;  5BNO C;  5HBA A;  3PVE A;  4K7J A;  3BU7 A;  4AGV A;  4ERO A;  3PHM A;  5LA1 A;  2D6K A;  3NJX A;  1L3J A;  5FPZ A;  1J83 A;  1AL2 1;  2FDF A;  2Y26 A;  4OCT A;  3VV1 A;  1RUG 3;  1QU0 A;  2P5B A;  3ON7 A;  1AR7 1;  1ENQ A;  3DV8 A;  5BNP A;  4RN5 A;  1O4Z A;  3UES A;  1OPO A;  1RUH 2;  2JEC A;  1PVC 1;  3ACF A;  3WW1 A;  2XJV A;  5CKQ A;  4CDX C;  5K0U C;  4OUM A;  1A6C A;  1HDK A;  1RUE 3;  2W87 A;  2VZP A;  4A4A A;  4F3J A;  3SHR A;  4YG6 A;  4CXY A;  1YC6 1;  2WZP P;  3BPZ A;  5DAQ A;  5I0U A;  4LBO A;  4AVC A;  4IW3 A;  5FZO A;  1GZ9 A;  4KQ7 A;  3IDC B;  5C70 A;  2NMN A;  4NRQ A;  3VB9 A;  4FPG A;  1BEV 1;  4HKO A;  1CIW A;  4QQ2 A;  2Z5W A;  1GYK A;  1OA4 A;  3T2Q A;  1CAU B;  4PBP A;  3ZXG A;  1VIW B;  4MYE A;  4HMZ A;  2VM9 A;  3VLB B;  3ZN6 B;  4D8M A;  3AYE A;  4GIQ A;  3VBR B;  1HV0 A;  2BGP A;  4BQ4 A;  1AX2 A;  1CPM A;  4LKE A;  5J98 B;  1JOD A;  1J3P A;  2W2I A;  5J7M A;  1S0J A;  1YI7 A;  5JPM B;  1VB4 A;  3AP9 A;  3I2K A;  4BZ4 A;  3TNQ A;  1IS3 A;  3N9L A;  4AG4 A;  1IS5 A;  2P4E A;  4N43 C;  1A34 A;  2BNM A;  1CON A;  1RC6 A;  2D7F A;  4MGQ A;  4HKW A;  2ZTN A;  2R49 A;  3AZV A;  2XVK A;  2CU5 A;  4MXV A;  2W52 A;  3HT2 A;  2PHL A;  4CEW C;  3FLP A;  4GMP 1;  2IXC A;  3WQ1 A;  5JZG C;  4AQ6 A;  1H1A A;  2VZR A;  2Q8C A;  1XNC A;  2BU9 A;  5F5Q A;  5LZ6 A;  3BIE A;  3FLR A;  4KMQ A;  2TEP A;  1EUT A;  4IE7 A;  3FUO A;  4Z1V A;  4ORF A;  1G8W A;  1UY3 A;  4Y20 B;  4Y5Z 0;  5F1R A;  3MV1 1;  3LPG A;  3Q8F A;  2FQP A;  2EIB A;  1CX4 A;  1LJ7 A;  3GNE A;  4FPO B;  3H42 B;  4GH4 A;  2WWS A;  2NP0 A;  1PM7 A;  4CCC A;  1D2Q A;  4LUK A;  1A78 A;  2WFP A;  1JHN A;  4I09 A;  3RG0 A;  4R9A A;  1JYV A;  2VBB A;  1EAH 2;  3U78 A;  1DGR A;  5J1X A;  4JHZ A;  4UBH A;  4F83 A;  1C28 A;  2RMU 1;  4IE6 A;  1CAV B;  1FPN 3;  3WLU A;  4DUV A;  1R1Z A;  2RR1 1;  2YFU A;  1RYY A;  1S4C A;  4QHZ A;  5A3W A;  1EV1 2;  1NXM A;  3NV3 A;  3UKV A;  1RUD 2;  1LOD A;  2PHX A;  4MLO A;  4UW6 A;  5G04 L;  5CFC A;  1NE4 A;  3T1M A;  1KEX A;  1OH4 A;  4CUC A;  2GND A;  1RJ8 A;  1QQP 1;  1JHJ A;  4IEW A;  4ES9 A;  3IT8 A;  4WM7 B;  4Q4Y 2;  4LBL A;  2DBN A;  4JCK A;  3ZYI B;  4EN0 A;  1OLM E;  3NAP C;  1KS4 A;  2XL9 A;  1OOP B;  3JD7 1;  3ZM8 A;  3UL2 A;  1BBT 1;  1WCK A;  1RVF 3;  5GLW A;  2CGN A;  3GGL A;  5IFT A;  3JBG 2;  1ASJ 2;  5IAX A;  1GWM A;  3OY8 B;  3IMM A;  2VUA A;  4QPG C;  3B94 A;  2JD4 A;  1KJR A;  1O3T A;  3OPW A;  1SQ4 A;  1RUN A;  2XL7 A;  2Q1Z B;  1DQ0 A;  3MLJ A;  4CDU B;  4PJY A;  5FMB A;  3ITQ A;  2Z2S B;  3OBT A;  2R1B A;  2W95 A;  2YC0 A;  4XET A;  3KD4 A;  3KT4 A;  1H9W A;  5DN2 A;  2VOT A;  4HSJ A;  1BK0 A;  4MG2 A;  4FOV A;  4BPZ A;  1UXX X;  1XNK A;  5T52 A;  1RUC 2;  5EJ3 A;  1WME A;  2VMF A;  1W2U A;  3WP6 A;  5GKA C;  3EJK A;  3ZFG A;  1TME 1;  2R30 A;  4FTB A;  2XVL A;  4RQP C;  2VUD A;  1D4M 3;  1G7Y A;  2A6Y A;  4V2V A;  2RDS A;  1W6P A;  4Y1X A;  1OPM A;  1VRH 3;  2C9A A;  5DAB A;  1S0C A;  2BWC A;  2ES3 A;  1LGC A;  1HXS 3;  4DEV A;  2D93 A;  5C6C A;  1OKO A;  4JGZ C;  3VDD B;  1YWK A;  2E7A A;  1LU2 A;  3OEB A;  1AXK A;  2VUJ A;  1QJX 2;  4WM8 A;  1RXF A;  4XJZ A;  4XIO A;  2YBP A;  4AGR A;  3NW4 A;  4JC1 A;  3NNL A;  1MZ6 A;  4KI5 M;  1J59 A;  1IZ3 A;  5B2G B;  5GZF A;  2QZ2 A;  2VJX A;  2W0X A;  4M4R A;  2Q0A A;  4AEK A;  4YZ2 A;  4LK7 A;  3KB5 A;  2ZGR A;  4EN6 B;  2WS9 3;  3AL6 A;  3VL9 A;  2QQL A;  5DPN A;  1Q8V A;  4XF4 A;  5DDJ 3;  3USS A;  3ZYB A;  2BFU S;  1W6Q A;  1ZX5 A;  1MS3 A;  3OD0 A;  2HWC 1;  4YW1 A;  2OQ6 A;  4TZD A;  3UGG A;  2NYY A;  4DY5 A;  3AYC A;  5CG8 A;  1U5I A;  4DUX A;  3I3Q A;  1Q5O A;  5FYS A;  2Q8O A;  1JZ7 A;  4QX8 A;  3EXU A;  1WCU A;  1ONA A;  4Y4R A;  3ZIW A;  1O4T A;  5AC9 1;  5LBC A;  2XLA A;  2TBV A;  3H8O A;  2ZAA A;  2WNV A;  1B35 C;  5FZD A;  4CCM A;  1RMU 3;  5A6Q A;  4U36 A;  1LHN A;  3FC0 A;  1US2 A;  2VZ3 A;  1UZW A;  4FPY A;  4XFI A;  1LEN A;  3SIS A;  1G9A A;  1W8U A;  3CBN A;  1O7F A;  2WSV A;  4HVQ A;  1XYO A;  2PEL A;  4LOS A;  4BOW A;  2VBD A;  1YRZ A;  3GHM A;  4HN1 A;  5FPA A;  4GB3 3;  5FYB A;  3WDT A;  2A6V A;  3T30 A;  3GCX A;  4NHM A;  4DEQ A;  4DY3 A;  2YMZ A;  1MS9 A;  4Y4Y A;  3ZPY A;  2VOW A;  4Y22 B;  1GLH A;  3N7J A;  2DUO A;  4AI0 A;  4RGK A;  5CB7 A;  1RUI 2;  4XF9 A;  3VBF C;  1JUH A;  3M70 A;  2IC1 A;  2QFE A;  1J1T A;  1MEC 1;  3QBQ A;  5LY2 A;  5A1A A;  1UNB A;  1WD4 A;  3WQB A;  1YQ6 A;  1LTE A;  2HWD 1;  1QJE A;  3O14 A;  1LUL A;  3ZXJ A;  3AXE A;  3FFZ A;  1NLS A;  1OA3 A;  4QXC A;  4N53 B;  2ZGT A;  3LA2 A;  4U2A A;  4CP1 A;  2R1D A;  5C8C A;  4C90 A;  1POQ A;  4XCA A;  5L9V A;  1PVC 2;  2GME A;  1YQ2 A;  3ETQ A;  2OPW A;  1OC1 A;  5F5I A;  2CDO A;  4B8E A;  2ERF A;  4CEY C;  5APA A;  1UXZ A;  2ZGK A;  1ST8 A;  3TAY A;  3I2D A;  4FOQ A;  1W8O A;  3M1H A;  1I1E A;  4LOR A;  1QJF A;  4XQ4 A;  2VPV A;  1JU3 A;  5EHD A;  3HAG A;  4PI0 A;  4YW4 A;  5JR2 A;  2LRP A;  3RZZ A;  1TNF A;  1QJU 3;  4DB5 A;  1O59 A;  2VNO A;  1VJ2 A;  2WZ8 A;  1R08 1;  1OA2 A;  3E1F 1;  2ET7 A;  4FOY A;  3HWJ A;  1HB4 A;  1EPW A;  1TMF 1;  4GZ9 A;  4J25 A;  4QXB A;  5FZ4 A;  3RJR A;  1JYC A;  3ZXE A;  3H1W A;  4AFB A;  1SLB A;  4Q4W 1;  1W9W A;  3WHT A;  3LOB A;  2XJQ A;  4LOT A;  4K1Z A;  4AFC A;  1W6M B;  4AI8 A;  5IVF A;  3ZMN A;  1JU4 A;  2X09 A;  4KGG A;  4FXK B;  1GNY A;  1QJZ A;  3CJI C;  2BOJ A;  3N3H A;  1XPW A;  5LBB A;  4YSF A;  5C3O A;  5FPL A;  1DGW X;  2N7G A;  1I6X A;  2DFB A;  1C4R A;  3HNM A;  3E5Q A;  1CZT A;  2GNT A;  5EXO A;  4AQT A;  3MW4 A;  2DVF A;  2BYV E;  3UKN A;  5CYY A;  1AX0 A;  3OD4 A;  2ZHM A;  4HON A;  4IND A;  4XFG A;  4GXL A;  1KIT A;  5FXV A;  2FDI A;  4A7K A;  4IEP A;  3KT1 A;  1HQN A;  1K3I A;  1UU6 A;  1COV 1;  1FMD 2;  4AHX A;  3QH6 A;  5K9Y A;  5KHH A;  3KMH A;  3KHC A;  2WT1 A;  2F4L A;  3IWZ A;  5A6Y A;  1LGB A;  1OKQ A;  1SPP A;  5EV7 A;  2B45 X;  1GZW A;  4AVT A;  3W59 A;  3VZN A;  2HEY F;  2PFW A;  3M2M A;  5DUX A;  4FPC A;  1HRV 3;  1TZO A;  3LPF A;  1OFS A;  1IKP A;  2E51 A;  3R0R A;  4MHU A;  1OQE A;  3VZJ A;  3W5M A;  4TXW A;  2Y34 A;  5HXM A;  4PF1 A;  2Q1F A;  4RS5 C;  3WF3 A;  1JMU B;  4H7M A;  2RR1 2;  2CAV A;  2NPI A;  1PNG A;  1PO2 3;  3ALQ A;  1NOV A;  5JAX A;  2Z42 A;  5HXV A;  2WNU A;  3U11 A;  3VDB A;  2LW8 A;  4I0B A;  5FYZ A;  4NVP A;  5FYH A;  4KNC A;  4PLO A;  5BNO B;  2G1M A;  2J1A A;  2A71 A;  2HEV F;  5FMD A;  1S1A A;  2IXI A;  4FAH A;  3D4K A;  4BME A;  3K46 A;  3POS A;  1ZBA 3;  3BTY A;  4OQ9 A;  3TWI A;  4IV1 A;  1SBE A;  4C0H A;  1X82 A;  2AEY A;  1DYK A;  1WA4 A;  2W68 A;  2RM2 1;  3J7M A;  4AVA A;  3A0K A;  4C8D A;  1NAE A;  2AYH A;  4GJZ A;  4Q8L A;  1BBT 2;  1GWK A;  4MGK E;  1ZZ7 A;  2WA3 A;  4CDX B;  2B5H A;  1IG3 A;  5K0U B;  3HD8 B;  1PGW 1;  1UPI A;  4JDM A;  4RGG A;  3WDX A;  2WA4 A;  4QT6 A;  1O3S A;  1C1F A;  1MPX A;  4EN9 B;  3TN9 3;  4O61 A;  2QQK A;  2YC2 A;  4LHN A;  2MEV 2;  4BU2 A;  1AR6 1;  2Z4F A;  2Q1M A;  3KVA A;  5FYC A;  3RJ2 X;  2BTV C;  4DO0 A;  1A8M A;  2XLF A;  1U0A A;  2XH6 A;  1OSG A;  2ZHL A;  4XBQ A;  4LK6 A;  1ZZ6 A;  3WNM A;  1VBE 1;  3ZVX A;  1C57 A;  3WNP A;  4ISR A;  1JOJ A;  2C26 A;  4XW3 A;  1Y43 B;  3OSD A;  5E88 A;  5T55 A;  3MW3 A;  2VNV A;  2W1U A;  2CSG A;  3DUI A;  4NPL A;  4A6S A;  4JKL A;  5K7P A;  5CKM A;  2WYS A;  4M3C A;  4N7U A;  4RFR B;  4KG8 A;  2O1Q A;  3K4D A;  3T0B A;  3IB3 A;  1JYW A;  1W6N B;  4XQW A;  4Q0Q A;  5K8S A;  3AMP A;  3EHK A;  4XZP A;  3WNO A;  1K42 A;  4JRA A;  1ENS A;  4KWK A;  2VCA A;  3I2G A;  1TNR A;  5AFE A;  2E7Q A;  1DQ1 A;  3A22 A;  4PIZ A;  2WII B;  1RUJ 1;  2EAA A;  2O0O A;  3BB6 A;  1YNA A;  3KV6 A;  1UMI A;  3LIG A;  2HWE 2;  4N43 B;  4PDW C;  4ONU A;  4FBF A;  5J09 A;  3MFA A;  3WR0 A;  2PHF A;  4E8C A;  1VBD 2;  4LBQ B;  3H8R A;  3SCG A;  3USU B;  2VMD A;  4B4R A;  3CNA A;  4CEW B;  4CU9 A;  4DMI A;  3PVB B;  4NHX A;  3KCY A;  5FRE A;  5J3U A;  3VBS B;  1SEF A;  5JZG B;  1WW4 A;  4XTM A;  2A3Y A;  1ND2 C;  3POJ A;  4EE2 A;  2BBV A;  2XBO 1;  3THP A;  5FZL A;  1G86 A;  2VC9 A;  1VBA 1;  1QF3 A;  3NO8 A;  1QJY 2;  1SCR A;  2XR4 A;  2WNO A;  5BYN A;  5LY1 A;  3WNX A;  5LB6 A;  3E97 A;  1QXP A;  1H0B A;  4LKD A;  5FZE A;  5FDB A;  3A4U A;  2EXH A;  3ZKY A;  2HWC 2;  4K20 A;  4O65 A;  3RMY A;  4ZS3 A;  3URF A;  5FP8 A;  3VHP A;  4XBN A;  5LAT A;  2W91 A;  2WWJ A;  3FX3 A;  3H0O A;  3IDB B;  1K5M A;  4XXA A;  5JIA A;  1XYP A;  2H6B A;  3SH5 A;  1PIV 1;  4JQT A;  2VOX A;  1YHF A;  1GMM A;  3HN1 A;  1UMH A;  2FZ2 A;  1W99 A;  5DAW A;  2VUL A;  1ZZ9 A;  4MVT A;  2HBT A;  1JZ6 A;  4QAW A;  4P14 A;  5DUW A;  1VBC 2;  1FOD 3;  3C3V A;  1V6J A;  4DRR A;  3J4U H;  4CCJ A;  2ZGQ A;  1Z7S 1;  4LBJ A;  4YFW A;  4DFS A;  3HEI A;  1N1S A;  4D0Q A;  1Y4W A;  4WM7 C;  1PX4 A;  1HRI 2;  4FFG A;  1KGY A;  2PLV 1;  2ZGS A;  1V00 A;  3Q9O A;  1W8T A;  3EYP A;  4HBN A;  3ZYF A;  2GN7 A;  3DPR A;  2WZR 1;  1RHI 3;  1AX1 A;  4R4Z A;  3VDA A;  1OOP C;  2LUW A;  4BDV B;  3NAP B;  2XHN A;  4DUW A;  2ARE A;  2Y6K A;  3MDP A;  5IVY A;  1YJL A;  1QHD A;  3MPP G;  4XMA A;  3WDY A;  1WD3 A;  2QQW A;  1VE0 A;  3KWV A;  5JIU A;  2ET1 A;  4QPG B;  4XCB A;  1A3K A;  1JYX A;  3PU8 A;  4CDU C;  1JZ3 A;  4K1Y A;  3FE5 A;  1KDK A;  1SFY A;  1SLC A;  1ZBE 1;  1W04 A;  2DCJ A;  3POG A;  1F8V A;  4RFT 0;  5DG2 A;  2HWD 2;  4Y5T A;  3D3A A;  1Y3T A;  5A3P A;  5KHK A;  1PO1 1;  3R4D B;  3ZDV A;  3KF3 A;  4QHB A;  3QLQ A;  3PUQ A;  2CGO A;  1OD3 A;  3VDC A;  1XOY A;  5EP9 A;  4XHB A;  1NA1 C;  3H7Y A;  2R7E B;  5A33 B;  1ENX A;  4QPI C;  5FZ7 A;  4XJW A;  1P8J A;  1R1A 3;  1UOJ A;  2WQ4 A;  3O0X A;  1UU4 A;  1H1M A;  2C4X A;  3APB A;  4HET A;  4WVZ A;  5J36 A;  1J58 A;  3NVC A;  3DKW A;  1UKR A;  3NNJ A;  3AK0 A;  4AQS A;  2R04 2;  1JS9 A;  4ITC A;  4JGZ B;  4XEZ A;  1AHS A;  4XDP A;  4Y1Z A;  2UY9 A;  2X10 A;  4CA9 A;  1W0O A;  2ZGL A;  4NPM A;  4AVS A;  2BGC A;  2J1U A;  1D0G A;  2R06 2;  1SMV A;  1GAN A;  1RL3 A;  2Y0O A;  1WW5 A;  4LO6 B;  1RUH 3;  1BHG A;  1C8M 1;  1LB2 A;  5FKC A;  3FHQ A;  4UW4 A;  5LK5 A;  1ULC A;  3VBR A;  3TEZ A;  5C3S A;  2VH9 A;  4Y33 A;  1VBB 1;  1ZVF A;  5DG1 A;  1OQD A;  1JYI A;  1UW8 A;  4QB6 A;  2PHR A;  4FPE A;  3BKZ A;  1W39 A;  1SLI A;  2D3S A;  1PMI A;  2NLR A;  1GOF A;  2YDE A;  1W2A X;  3ZXK A;  4OHW A;  2P6C A;  2ZAC A;  5FZ1 A;  1UO9 A;  5GAL A;  2YU1 A;  2WQ8 A;  3WP5 A;  2QQO A;  2H0B A;  5EPA A;  2IVI B;  3ZR5 A;  4UOJ A;  1W03 A;  3MF6 A;  1KFX L;  4XAB A;  5JI9 A;  1X9P A;  3BGA A;  3WUD A;  2ZGP A;  2D44 A;  1B35 B;  4Y20 A;  5IVE A;  1WA6 X;  1LKN A;  1SDD B;  1PNF A;  3AP7 A;  3CMG A;  1I3H A;  1ZA7 A;  2GSY A;  2WQZ C;  3JZV A;  4JTN A;  5DUU A;  1IG0 A;  5JXI A;  5C5U A;  3U14 A;  1QH6 A;  5E6H A;  4FP3 A;  3S5Q A;  2QQU A;  2ARA A;  2JE7 A;  2FDH A;  4A44 A;  1C1L A;  2RVA A;  4RHV 3;  2BFU L;  2VAU A;  2J1S A;  4L8Q A;  4UYB A;  5FPV A;  5FK8 A;  1QDC A;  5JOW A;  1VAL A;  4BQY A;  4NUB A;  3T2P A;  2ARX A;  3PDQ A;  4M0H A;  4DXR A;  2PQS A;  4L92 A;  3WXP A;  1F5J A;  3NWK A;  1WGP A;  1V6N A;  3WIN E;  3VBO A;  4V1P A;  2BQP A;  3GYD A;  1R09 2;  2VY0 A;  3MO4 A;  4ARY A;  2IUW A;  4AED C;  2XWJ B;  3LE0 A;  4ZU5 A;  1E5I A;  2DV9 A;  1EAH 3;  5IVC A;  3O1O A;  5A3U A;  3HPN A;  5D21 A;  3WOG A;  3A7Q A;  5FKB A;  2HWF 1;  2RM2 2;  4XE9 A;  3PUS A;  1H8V A;  5L73 A;  4ARX A;  2WN2 A;  4G9S B;  3VBH C;  2RS3 2;  3I2H A;  4Y1U A;  2CY6 A;  4LJH A;  3S7E A;  4KBZ A;  2C5D A;  4EYU A;  1EV1 3;  4IE4 A;  1RUD 3;  2J1V A;  3KQ4 B;  1W9F A;  5JXH A;  2VO5 A;  2L9L A;  2Q30 A;  3MEP A;  3OY8 A;  5IVB A;  3O12 A;  5F5A A;  4CCK A;  3AC0 A;  5KR7 A;  4D7S A;  1AR6 2;  3R4S A;  4LQR A;  3AMM A;  4EWD A;  1UYY A;  4NPR A;  2ORZ A;  1F5F A;  1EPZ A;  4F7Z A;  5IFP A;  3U4S A;  5HCH A;  1FAT A;  4Q4Y 3;  2R0H A;  3O1R A;  4AHZ A;  3MIC A;  5LRS A;  1DF0 A;  4Q5O A;  1H2N A;  1W8N A;  2TUN A;  4FPF A;  5A6X A;  2ZZQ A;  1OUX A;  3IPV B;  4JGY C;  2BZD A;  4D94 A;  2IXK A;  5M0T A;  1DG6 A;  3IAP A;  1HX6 A;  3VD9 A;  2FZ1 A;  3K48 A;  1ASJ 3;  1OD5 A;  4NAO A;  4AF9 A;  4BQX A;  4AEJ A;  1LED A;  3S0M A;  1GP5 A;  3WF4 A;  2LTN A;  3CJI B;  3ZSK A;  2A3X A;  2DCT A;  1UX7 A;  1Q8Q A;  3NRU A;  2ZA9 A;  3RMX A;  1AR9 3;  3HQU A;  2KR2 A;  1WBL A;  3VDD A;  1FX5 A;  1HB1 A;  1RED A;  1JTZ X;  1NYW A;  1NCR A;  2O8Q A;  3KGL A;  4LPL A;  4D6Q A;  5LWB A;  2Y6G A;  1RUC 3;  4M3C E;  4NE9 A;  4YNI A;  2A7A A;  1GV9 A;  1YUD A;  2ARC A;  4E2G A;  3V0A B;  2RS5 2;  2EF6 A;  5FR3 A;  4XQD A;  1RUO A;  1W2T A;  2H0V A;  2JJ6 A;  4GJY A;  4ZON A;  3VHR A;  5EQU A;  2VW1 A;  2W92 A;  4FFF A;  4ASM B;  1DDL A;  1VBA 2;  3ABZ A;  1XYN A;  5FO9 B;  3RNS A;  5K4L A;  2ORX A;  1PMH X;  1IS4 A;  1LEM A;  1QJX 3;  1H2M A;  2YXS A;  3MIE A;  3SNM A;  3Q8C A;  4COY A;  4AYU A;  2VZ1 A;  3EMR A;  4PHZ A;  3ZYJ B;  1IPK A;  1RUG 1;  1VAM A;  5DZE A;  2WYF A;  3P5B A;  1H4H A;  3MHZ A;  2PTM A;  4X8P A;  5FY4 A;  5FZB A;  4RS5 B;  3O0W A;  3ZYH A;  2GAU A;  4BCU A;  1JI6 A;  4BQ2 A;  4LE3 A;  4HG6 B;  1VR3 A;  1RUE 1;  3AFK A;  3GBG A;  5E1R A;  1Z78 A;  3AP4 A;  3I2I A;  3J8F 2;  4OMC A;  5I0R A;  5A32 B;  4YZ1 A;  1AZD A;  5JDB A;  1DBN A;  1TE1 B;  2QBX A;  3SH4 A;  1DZR A;  2DYC A;  2UYA A;  1WBF A;  3T08 A;  1LRH A;  2PLV 2;  1V6O A;  3J7N A;  1UPS A;  2VZT A;  4PT6 A;  5GJ6 A;  1KDM A;  3U37 A;  3IDA A;  4Y1V A;  4IEY A;  3PTR B;  3WW2 A;  1LOF C;  3X29 B;  1HQL A;  4FXG B;  1OT5 A;  1IQA A;  1S0G A;  2HWB 2;  2V73 A;  1D2S A;  1EY2 A;  1JN2 P;  1SLT A;  1POV 0;  4XOG A;  2BUK A;  3LQC A;  4BIS A;  3BU0 A;  3JU9 A;  2GP5 A;  1YIP A;  2ZS6 B;  2RJK A;  4IGQ A;  4Q0P A;  4Y22 A;  3IAQ A;  5C4W A;  1CJP A;  5BNN B;  1W8Z A;  3KLS A;  2VTX A;  3RRD A;  4A7Z A;  3POW A;  2ZX3 A;  3VKM A;  1ZBE 2;  1HW5 A;  4MXW B;  4AAP A;  2VQA A;  2VVE A;  3B93 A;  3V0B B;  3WDU A;  1S2B A;  4RYD A;  4P9L A;  5FK7 A;  1PO1 2;  1V6L A;  3NKT A;  4R9D A;  1K5J A;  5FV3 A;  2H6C A;  4QX0 A;  5F3G A;  3DXU A;  1UQX A;  3K3O A;  4GQ7 A;  4N53 A;  3ZYP A;  4CP9 B;  2DCZ A;  4AFA A;  2E9Q A;  3WY6 A;  4UFM A;  5KHI A;  1TEI A;  5FP4 A;  4X6Q B;  1VAV A;  4XYX A;  3LZZ A;  2GDF A;  4UW3 A;  2FDK A;  5JSP A;  2E26 A;  4AOC A;  1RUI 3;  3LIH A;  3AKR A;  4CDW C;  1W28 A;  3AKS A;  3BIW E;  4LIV A;  4QU2 A;  3MUY 1;  3NNF A;  1KRI A;  4MSV A;  2QQP A;  4IET A;  1AYN 2;  3WG4 A;  5I0S A;  1UYZ A;  1VMF A;  5KHJ A;  3GBW A;  4PDW B;  3T09 A;  2GP3 A;  2YHJ A;  1JOB A;  3D0S A;  2JDU A;  3G6J B;  3UK9 A;  3I2J A;  1UZV A;  3OG2 A;  1QY4 A;  3WNL A;  5FWJ A;  2JG8 C;  3ZSM A;  3VBS C;  1FPN 1;  2VEC A;  1NY7 1;  5FFO C;  4XMI A;  1NLR A;  3CL1 A;  4I0A A;  1W6M A;  5DQ0 A;  5L7O C;  1ND2 B;  2GC3 A;  3TYJ A;  1H6X A;  1MS5 A;  1XNA A;  2F4P A;  4MO3 M;  5CVR A;  4YWA A;  1QDO A;  1T6G C;  3FHI B;  3P1I A;  1VAK A;  4YGE A;  3O7O A;  2VE1 A;  4YGD A;  1AR8 2;  5I8T A;  1ND3 C;  1TG7 A;  3OGS A;  4Y1Y A;  1MZ5 A;  3HOB A;  3OBZ A;  4MZU A;  2QVS B;  5ACA 2;  4OQ8 A;  5B4N A;  5EJZ B;  4IV3 A;  2DFC A;  4UWD A;  3RZK A;  2CHH A;  3U10 A;  4IEU A;  3ORJ A;  3PUR A;  1RVF 1;  5T5O A;  5CKN A;  5KBF A;  2RHP A;  4HAN A;  4HPK B;  5JMO A;  1MS1 A;  3U4X A;  1OH3 A;  3ZO0 B;  1O3R A;  1GQG A;  4HT1 T;  1CVN A;  4QGM A;  4I3P A;  5I8S A;  3VD3 A;  4YFZ A;  3ZKU A;  5ABJ C;  1RUF 2;  1JZ8 A;  3ZOI A;  4OLL A;  4EWE A;  1N3P A;  2RE9 A;  1RIN A;  2UWB A;  5GLU A;  4E2Q A;  5C8W A;  3DCQ A;  3KCX A;  1FMD 3;  2RDQ A;  3BOP A;  3ST7 A;  5C3Q A;  3OYW B;  1D4M 1;  2PN5 A;  3AX4 A;  5BNO A;  1RGS A;  1VRH 1;  4PCR A;  4I30 A;  4PLM A;  4XXP A;  4LO4 B;  4BLJ A;  1UOB A;  3OGR A;  1HXS 1;  1MS8 A;  3CDZ B;  3I2F A;  1JOP A;  4YVS C;  1E5R A;  2QE3 A;  3LEI A;  5EFU A;  3MPB A;  5IWF A;  4C0B A;  2FMY A;  2XQX A;  4XDO A;  4QDR A;  2HWF 2;  5BPX A;  3WHU A;  3RWK X;  2RDN A;  4M00 A;  4L0P A;  4D7Y A;  4JHT A;  1N47 A;  1M06 G;  1NA1 B;  1ODM A;  1QOO A;  5IVJ A;  2E32 A;  2JDN A;  4NRM A;  4QPI B;  2WT0 A;  5K0U A;  2KXL A;  4CDX A;  3H1Y A;  1JBC A;  4W50 A;  1NG0 A;  3SCH A;  2XXZ A;  2YPD A;  1S0D A;  2WS9 1;  3AKQ A;  2AEN A;  3H3Z A;  4YW3 A;  5LBF A;  2I74 A;  2WFF 3;  4EWA A;  2JB4 A;  2VCM A;  4W6X A;  1ZZC A;  2JIG A;  4JRL A;  3P3P A;  1GNZ A;  4JX0 A;  5FZ0 A;  3VKN A;  5FOB B;  4QM9 A;  1BBT 3;  5F37 A;  2D6O X;  3W21 A;  5I0T A;  4P9Y A;  1X8M A;  3HIF A;  4TLF A;  1XC6 A;  5IVV A;  1WUV A;  1N3Q A;  4GUL A;  2X29 A;  4Q4V 1;  4M01 A;  3NNM A;  4OMD A;  4PBO A;  5E16 A;  2MEV 3;  1RMU 1;  4IE0 A;  3ZLI A;  4FFH A;  4YW2 A;  1QGL A;  2RG4 A;  1XE7 A;  2ZEZ A;  3ROU A;  5F7U A;  2B8M A;  2SLI A;  3JQX A;  1GSL A;  4CPB A;  1HN0 A;  2QQI A;  3AP6 A;  4N43 A;  3KV4 A;  1AF9 A;  4RGA A;  3WUC A;  4AI9 A;  3AVS A;  2JDK A;  4IEX A;  1CR7 A;  1YI9 A;  4SBV A;  4COW A;  4LBQ A;  3T0D A;  3USU A;  4GB3 1;  3CZU A;  5JZG A;  3HN3 A;  4YRD A;  1R64 A;  1H9P A;  1YIF A;  4XIL A;  4BJ0 A;  2OYZ A;  5A6Z A;  1JW6 A;  3SKV A;  4F8A A;  1GP6 A;  3M8L A;  1WMD A;  2JDZ A;  3AXD A;  2ZEY A;  1ULG A;  4Z92 B;  1FV3 A;  3RZG A;  3LGR A;  3LDB A;  2VG9 A;  3OGJ A;  2UWC A;  2HWE 3;  4XTP A;  2LS6 A;  4P9I A;  3PUH A;  4R8H A;  1RUG 2;  1VBD 3;  1AYM 2;  2C1F A;  3TBD A;  2IZW A;  3ACI A;  2AEZ A;  2GH8 A;  3OB8 A;  4K40 A;  1OQ1 A;  2HKX A;  3H7J A;  4PIX A;  2VXJ A;  4QGL A;  3LSE A;  3MZH A;  4D6R A;  1WMF A;  2JWP A;  3HBZ A;  4AW7 A;  2GMP A;  4DXT A;  2WO1 A;  2VW0 A;  1QJY 3;  1D0H A;  5F3E A;  5LA2 A;  1YJK A;  3III A;  1YQC A;  3S6P A;  1XSR A;  3UYJ A;  4Y3O A;  4K9S A;  3ZXA C;  2HWC 3;  3AMQ A;  2ZCW A;  1N1T A;  1H2K A;  4AED B;  1CN1 A;  1AL2 2;  3H50 A;  3WNK A;  5FYV A;  3T2O A;  1QJU 1;  4M0N A;  1AR7 2;  2QZ3 A;  3HVD A;  4MH0 E;  1BJQ A;  4AGG A;  3I3D A;  4Q27 A;  4FOW A;  3VBH B;  3NAP A;  5JXJ A;  1ZRR A;  1MQT C;  5TSW A;  3QD6 A;  2UU8 A;  3CHX A;  1VBC 3;  1WMX A; 
#chains in the Genus database with same CATH homology
 3W20 A;  5DAP A;  5C5U A;  3NNL A;  2JIJ A;  3DKQ A;  5LAT A;  2FCU A;  5DAX A;  2G19 A;  5DAW A;  4NHL A;  2RDN A;  2HBT A;  3KT1 A;  4BQY A;  3GZE A;  3GJA A;  4XAC A;  4ZPI A;  3GJB A;  5IAT A;  2A1X A;  5IAV A;  3BVC A;  4MHU A;  5LBF A;  2Y34 A;  5A3U A;  5ERL A;  2JIG A;  5LBC A;  4KBZ A;  5HV4 A;  3W21 A;  2G1M A;  4JZR A;  4XCB A;  4Y5S A;  3OUJ A;  3NNM A;  3HQR A;  2Y33 A;  4MHR A;  3NNF A;  3OUH A;  4NHY A;  4Y5T A;  2RG4 A;  3OUI A;  5L9B A;  4NHM A;  4Q5O A;  4BQW A;  5EP9 A;  5M0T A;  4NAO A;  4NHK A;  4BQX A;  3KT7 A;  4XC9 A;  3NNJ A;  2V4A A;  2HBU A;  3HQU A;  2FCT A;  5HV0 A;  5LAS A;  5L9R A;  3OBZ A;  5L9V A;  5LBE A;  4XCA A;  2OPW A;  5IAX A;  2FCV A;  4UWD A;  3PL0 A;  4ZON A;  5EQU A;  3ITQ A;  4XAA A;  3MGU A;  3KT4 A;  5C5T A;  4J25 A;  3EMR A;  5EPA A;  2RDR A;  4NHX A;  4XAB A;  2RDS A;  5DAQ A;  4NMI A;  4IW3 A;  5LBB A;  5DAV A;  5LA9 A;  2RDQ A;  5LB6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...