5C5UA

The crystal structure of viral collagen prolyl hydroxylase vcph from paramecium bursaria chlorella virus-1 - truncated construct
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
208
structure length
187
Chain Sequence
HMEGFETSDRPGVCDGKYYEKIDGFLSDIECDVLINAAIKKGLIKEQTWFMPGEHEVIDKIQKKTREFLNSKKHCIDKYNFEDVQVARYKPGQYYYHHYDGDDCDDACPKDQRLATLMVYLKAPEEGGGGETDFPTLKTKIKPKKGTSIFFWVADPVTRKLYKETLHAGLPVKSGEKIIANQWIRAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Prolyl 4-hydroxylase
publication title Structure and Mechanism of a Viral Collagen Prolyl Hydroxylase.
pubmed doi rcsb
source organism Paramecium bursaria chlorella virus 1
total genus 51
structure length 187
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 5c5uA00
4ZONA 5EP9A 4BQYA 4Y5SA 5DAXA 3NNMA 4ZPIA 5LBEA 5C5UA 3NNLA 4KBZA 4NHMA 4XACA 4J25A 5LBCA 5M0TA 3KT4A 5ERLA 2RDNA 4MHUA 5L9VA 4XABA 5A3UA 4NHXA 5LASA 3NNFA 5IATA 2FCTA 2HBUA 3MGUA 4NHYA 2FCVA 3W21A 2G1MA 5DAQA 4NHKA 3NNJA 4BQXA 3GZEA 4NMIA 2RDSA 3EMRA 2FCUA 5LBFA 4JZRA 2OPWA 2RDRA 5DAVA 5LATA 5DAPA 2V4AA 4Q5OA 4XCAA 4BQWA 4XCBA 4IW3A 5C5TA 5EQUA 4Y5TA 3KT7A 4NHLA 5L9BA 4UWDA 2RG4A 5HV0A 2A1XA 3PL0A 3ITQA 5L9RA 4XC9A 2G19A 2JIGA 2HBTA 3OUHA 5EPAA 3W20A 5IAVA 2JIJA 3HQRA 4NAOA 3DKQA 5LBBA 5LA9A 3GJAA 5IAXA 3BVCA 3OBZA 5LB6A 5DAWA 4MHRA 2Y34A 3OUJA 3OUIA 3KT1A 4XAAA 2Y33A 2RDQA 3GJBA 3HQUA 5HV4A
chains in the Genus database with same CATH superfamily
5FZOB 3P3NA 3D8CA 2NMOA 3WP5A 1IOAA 2ZGPA 4BQ5A 4CDWB 3LKJA 2OPKA 2D6MA 3I7DA 1OF3A 1RUI1 5FK8A 1W6NB 1GZCA 3BPSA 1RUG3 4HANA 4S2HA 4OI4A 1XQNA 1RHI2 4LO8A 2WLPA 3ZM8A 3BOPA 5E16A 3HOBA 1VALA 2ZAAA 3V65A 3ZFGB 1W8ZA 3I3DA 3J4UH 5EWSA 1Q8VA 2BV4A 3H8UA 3CO2A 2HWD1 2D97A 3ZN6A 1ONAA 4X6QB 1UCXA 1FYUA 4AAXA 5A1AA 4LT5A 4E2GA 2FHRA 2C9KA 5C8CA 5LW9A 3CIHA 1W8FA 1UU5A 2F4LA 1D2QA 1RUE1 3WDYA 1KDKA 1U0AA 3L2HA 2DDUA 4DPNA 2D40A 1PZ9A 4QQHA 2DBNA 3A23A 1EUTA 3QH7A 1T6BX 4Q4Y3 4XAEA 4CDUC 1PM7A 3MIFA 4DINB 2FCVA 4YVSC 1UU4A 1D4VB 1H4GA 5LK5A 5FY4A 3BTYA 1YJKA 1LJ7A 4AI9A 3N4MA 1IKQA 4XYXA 5A7WB 5LZ6A 1SQ4A 1WKYA 4QPGA 2W5FA 4A42A 4DXTA 4ET7A 4YW6A 4DZGA 4MX3A 1OKOA 4K7JA 4NMIA 1NCRB 3KMHA 1N1TA 1BQPA 4MOAA 3RPQA 1JHNA 5EV7A 4URAA 2K46A 5JR7B 1KDMA 5A3MA 1EV11 3ZSJA 3JD72 4XURA 4C8DA 1KQRA 1I1EA 5DAPA 5GM0A 2IC1A 1KS4A 2V4AA 4L99A 3T2PA 4BIFA 2DF7A 4UFHA 1RUG2 4M4RA 2ADEA 5L7OB 1UL9A 3M3EA 4IEQA 1CAVA 5GLZA 3AP7A 4A44A 2W0XA 1GOGA 4Y4YA 1BXHA 2PFWA 1VBA3 2Q8DA 2NP0A 2R1BA 1TQ5A 1YI9A 4LA3A 4FI9A 3TRSB 1JZ4A 1HRI3 1YFUA 3FE5A 4MZUA 1MEC1 1PO11 2W1UA 4QAWA 4B4QA 4IEPA 3G6JB 3B02A 1RUJ3 1RUC1 1YFXA 3GZAA 4I3PA 4Y20B 2A3XA 4HXCA 1S0EA 1QJY3 1QQP3 5K4LA 3GM8A 4Q4Y2 3VLBB 4O61A 4LHKA 1HN1A 3LA2A 4YPJA 1LOCA 2AC1A 5DUXA 5GKAC 1Z78A 1LR5A 4PI0A 4JGZB 4GJZA 3ZPOA 3RYKA 1O8PA 3BIWE 2LW8A 3M4FA 2WQ8A 3NV2A 4UFMA 4B4PA 4ZZ5A 2OUHA 1RVF3 1YRZA 1DHKB 4RL7A 5FBZA 4HLTA 5K8SA 4P9YA 1XYPA 4Q0QA 3K4AA 2YBPA 2DVFA 1ULFA 3EQEA 2BVVA 4L9BA 1W2UA 2ID4A 2QTWB 1W6OB 4CYDA 1ENQA 4LIUA 5C7GA 4ES8A 2FDHA 5JR2A 2JE7A 2UYBA 3VN4A 1R1A3 1VBA2 4XUNA 4EN7B 1SBDA 4CXYA 1HRI2 4J1WA 1RHI1 1BJQA 1U5ZA 2EIDA 3WDTA 3FHIB 1K5MC 1RXGA 2J22A 1EY2A 2X29A 4ZPIA 1RUJ2 4HBNA 3O12A 4L0PA 2OQ7A 4RQPA 4BISA 1CQ9A 1RGSA 1N1SA 1RJ7A 4MXWB 1H4HA 5C3RA 3IDBB 4P9LA 4S2GA 5LEJA 3E6CC 3T2QA 3UT0A 2GNTA 1QJY2 1QQP2 1UX6A 4Q27A 1VE0A 2XOMA 2QQLA 3MLKA 4CUAA 3H8OA 2WT2A 2OXBA 4P00B 1ENSA 5ACA3 3GF6A 2B5HA 2E7TA 1W8UA 3R4SA 2AREA 1LCLA 2E26A 3G7DA 3WDXA 1JMUB 1ZREA 2D6PA 4R9BA 3OB8A 1RVF2 1PNFA 2WC2A 4LO7A 4HMZA 1YEWA 3VZMA 1QMJA 2OQ6A 5CFDC 4H7LA 1GV9A 2A7AA 2HBUA 5FPXA 1VBC3 2UWCA 2ILMA 3KS7A 1PO21 3MUZ1 1N3PA 2ZHLA 3HNMA 1W6PA 3WSOA 3ZIXA 3VBHC 3RSJA 3V56A 5GZCA 3MIHA 5HPOA 3RMXA 1UU6A 1OKQA 2BNNA 3HT2A 5GALA 2Z4FA 4AGRA 2EAAA 1F4HA 1DQ4A 2XBO3 3T08A 4QMAA 2P3YA 4WVMA 5HXVA 1AL23 2VMHA 1H9WA 1G6NA 4FPLA 4JZRA 3GZUC 1BZWA 2PMWB 4CP0A 3V0BB 3CKHA 4Q5OA 2IZWA 5BNNB 4Z2WA 2X09A 3AKRA 2Y0IA 5I8TA 3J8F3 2OZ6A 3VDCA 4GULA 3ZYRA 4CCNA 4I0AA 5FO8B 2VOXA 1JZ3A 3ST7A 5ACA2 4LKDA 1CIYA 4NRQA 5KWRA 4QPIA 5EJ3A 3NV1A 3URFA 4Y24A 2C9AA 4QB1A 1WLCA 4PQ9A 4N9HA 2G9GA 2RMU1 2WNEA 2BRTA 4OZOA 5C3PA 2J1TA 3KCYA 1NX9A 2PHFA 3AMHA 4IGPA 4M4PA 3S5QA 1XU2A 3FX3A 3A0KA 4OUMA 4AEMA 3DGTA 2VBBA 1VBC2 2IXLA 4XF3A 4OUSA 2FBEA 2FMYA 5FK7A 5FZ8A 2OVUA 1W06A 1JBCA 4K3UA 2B42B 3KWVA 3HBZA 1UYYA 2LM3A 2HKXA 3MW3A 5FTTC 2PHLA 1QHDA 1UIKA 4LLOA 2O14A 2VZSA 4YW1A 1TME3 1W8HA 2W52A 4YFZA 3CJIA 2WNUC 2XBO2 4MGYE 2XJPA 1FOD1 2BOIA 4HSJA 2B9UA 1L7QA 2E33A 4IETA 4N53C 4NWWA 4YLZA 4OHXA 1VB2A 2MHFA 3AZZA 2ZGMA 1WCKA 4IE5A 1AL22 2EXHA 2VW1A 1OFSA 2Q1ZB 4JAAA 2WDBA 2OA2A 5FYVA 4LBLA 3U14A 3BTAA 4CDUB 1HRI1 4YVSB 1GZ9A 1UY4A 3J8F2 4CUGA 3RZZA 1CESA 3SHRA 3WHTA 2ZEWA 3ZYJB 3GALA 4AEDA 2ZX0A 3BPZA 3WVJA 1SHWB 4Q1RA 3K51A 4QXBA 1NE6A 1OQ1A 2WNVA 5EP9A 1QQP1 3JB8A 4IV3C 1HLCA 3WCSA 4DEVA 4UW5A 1W8TA 2VNRA 1WW7A 3LOIA 1NXMA 1UAIA 3SCFA 4CP2A 1RITA 1BVP1 1EAH3 1UY2A 3DPRC 2ZACA 2XVLA 4LJHA 4QX1A 4AQ6A 5JLVA 1E5RA 1UXXX 3I2DA 1RVF1 3WP6A 1ZYBA 2VBDA 1CPNA 1DQ0A 1V6JA 3PMEA 4GJYA 4MLOA 5DZEA 3VHNA 1I9RA 2JG9C 4XHXA 5F7UA 4NJ4A 1CVNA 3OTFA 1W9TA 1OVSA 1TME2 1SEFA 3LAGA 4DQAA 2JD4A 2FMDA 1ASJ3 4I30A 5CADA 1VJ2A 4BQ3A 5FOJB 2FCTA 2RS13 4UXAA 5FP3A 3RRDA 3RYRA 3GBWA 2XJRA 3JU9A 3WF0A 4XQ4A 2CGOA 1R1A1 4FAGA 1NLSA 2OS2A 1H8TC 2ZGUA 3LIHA 1SLLA 3RVHA 1TE1B 3Q8FA 3T3YA 1WCUA 1COV3 4Y33A 4A6SA 3NKTA 2VZUA 3B3QE 1TZOA 3R4UA 4M0NA 3RZMA 3USSA 1F5FA 3BU7A 5A33B 2QCSB 3IB3A 5F5CA 4Z1VA 3V0AB 1AR91 3WT3A 1Q8SA 3H7YA 5IFPA 1HQWA 2WS92 3H3ZA 4ZY9A 2VQ0A 5T52A 5A3TA 1YQ8A 5JOWA 4FFIA 1PVXA 1NLRA 5JZGB 3QACA 2JG8C 1KFUL 3FJSA 4XFHA 5C9AC 2V09A 3FC0A 4LEJA 1EAH2 1ULDA 4QX7A 1MS9A 3WOGA 5FUNA 3VBRA 1XXNA 1DQ2A 1QF3A 2IXKA 1AXZA 1ENXA 1RINA 2A5ZA 4F3JA 5A3NA 5ABJC 3O1OA 1W8OA 1LRHA 1VBC1 2DWRA 2ZZJA 4LORA 2Y60A 3OOXA 2UY8A 4QU1A 5FXWA 5JXHA 3N7MA 1VB4A 1K5MB 1ASJ2 2RS12 4D94A 1OXCA 3PIJA 4KGGA 5KHJA 2G19A 1W0PA 3AFGA 5LRRA 2O0OA 1AJOA 3POYA 4I0BA 5I91A 1UZYA 5CB7A 2GNMA 4GD4A 4HK8A 4QX3A 4IV1A 5ANNA 1W3XA 5FZ7A 2CU5A 2YYOA 3OBAA 3VDDC 1COV2 1YYNA 4WZCA 5D8AA 5LA9A 5K9YA 3N9NA 2DCZA 5DQ0A 2ZPXA 3VZLA 4AEJA 5JCTA 4S2DA 1W9FA 2GC3A 2PHTA 1REFA 3LEKA 3T1LA 5I0TA 4HPKB 3SMHA 3J8F1 1HXS3 2ES3A 5CFDB 1IS6A 2WA3A 3O1MA 4LULA 4JC1A 3FN9A 2BGCA 5A7SA 4I02A 3VBSA 4AQTA 4NRMA 2FDFA 2GH8A 3VBHB 4AHYA 5AC93 5FV3A 4Z8BA 2CL2A 3HQUA 2XJQA 2JEMA 4BQYA 4CDQC 4C1XA 1LOGA 2BQPA 1SFPA 4KBZA 1VPHA 4M3CA 2QJVA 1R083 2QQIA 3H9AA 1CX4A 4ASMB 4AVTA 2BBAA 3CF6E 2KD7A 4QXCA 1HV0A 1S1AA 2VZ1A 3MIGA 3P3PA 4PDWC 5HCBA 4CXWA 2RJKA 4P14A 4R52A 5FY8A 4Y3OA 4MHUA 2VECA 5AVPA 3OF1A 4CP9A 4M0HA 2VNGA 1GWMA 4FO9A 5BNQA 4I0WB 1O8SA 2R7EB 2JX9A 3PVBB 4BJ0A 1X8EA 3OY8A 1HDKA 5JVVA 4PIZA 3RDIA 1UZZA 4YM3A 2DYCA 1O91A 3ILNA 4PQQA 4MGTA 4TXWA 3W21A 3O1RA 1HXS2 1CAXA 1LGBA 2R063 3K2OA 3M3QA 3O7OA 2QVSB 5CZKA 5EXOA 5LA0A 3WF2A 1QXRA 4B8EA 4W8JA 3TNPB 1UZWA 1UOBA 4ISRA 5I0SA 1Z7S3 3K46A 1LGCA 5AC92 4ONUA 1ND3B 4N43A 4YGBA 3ZFFB 4JGYC 4OCTA 3ZR6A 4MGQA 2P3IA 1EAH1 1OPMA 3C7OA 4XF9A 4TN7A 5DAVA 1RC6A 4MUVA 4N53B 4AK3A 1LULA 1POV0 4W6YA 1Q3EA 1R082 3JB4C 4JKLA 3IZOA 2VULA 3RFRA 3CBNA 2ERFA 1OPOA 4JX0A 4XHBA 5FREA 4ES9A 1FAYA 4MGKE 4Q2FA 4YWAA 5EIYB 3FFZA 5FO9B 1JYWA 2JDPA 3VD7A 5KHKA 3DKWA 4DXZA 1ASJ1 4ARXA 1XC6A 1MR5A 1MVQA 3LEIA 4XOGA 5FBJA 2W1WA 4CSWA 3NV3A 4UWDA 3UL2A 5K0UC 4MV2A 4FTBA 4IV3B 3USUA 5E6HA 5APAA 4AHWA 2P34A 3RZHA 3ITQA 1W6NA 1VR3A 1WLWA 2A6YA 4PJYA 4BOWA 2VC9A 1JS9A 2Z79A 5GJ6A 5A3UA 3NO8A 3ZYHA 2WLQA 2HBTA 4OI2A 2R062 3ZFGA 5DZGA 3CDZB 5IAVA 4BIOA 1GFF2 1UPSA 1J3QA 1IS4A 2JDHA 5FYUA 5T55A 3ZFEA 2D43A 1Z7S2 4F7ZA 3NVCA 1GZTA 1MQTC 1MVEA 4FFHA 4IQPA 4AR2A 3TBDA 2Q4SA 1QJZA 4LR4A 1BYHA 3ROUA 4XZPA 4Z82A 3TN93 2NM1A 3PJQA 3VB9A 4AAPA 3WNMA 4QKBA 2HWC3 1XB9A 3OGSA 3VZNA 4L2NA 1J3RA 2CNAA 4FPFA 1JXNA 4YZ4A 3T2TA 4CEYA 2KXLA 4WVZA 3ZMOA 4YVWA 4JHTA 2X5IA 4CTEA 4ZONA 5GZDA 2BW8A 4JKMA 3RZJA 2P17A 3ZYGA 4NWVA 4IXLA 4XMIA 4LNVA 3VBFC 3IDEA 4XW3A 2VNOA 1JYCA 2PELA 4AQ2A 4GH4C 5FO7B 3I2FA 2B7YA 3ACIA 1SLIA 5LBCA 1AR63 1LESA 3WG3A 1XSQA 3NAPA 1FMD3 1S0BA 1PGW1 2WSUA 4XJZA 4LK6A 4Q8LA 2JG8B 3P1IA 1VBD3 5C9AB 4Y1UA 5BNPA 5E88A 4CU8A 3KGLA 1B35C 2R041 3KV9A 5D1IA 1XBFA 3AP9A 5FKBA 4E4ZA 2QQPA 3F95A 5ABJB 1FPN3 1OOPC 4B1MA 1DGRN 3J7HA 4KU7A 4AFDA 2JDNA 4AF9A 3LCPA 1JW6A 4I3GA 3W5MA 3TN92 1PIV3 2R1DA 5AC91 3KGZA 1RB8G 3OD0A 3PVEA 2BGPA 2HWC2 5A70A 2VG9A 2W95A 4QGNA 4UT5A 5DAQA 4X8PA 2J1EA 3WD5A 1LOFA 2BOJA 4Y22B 1R081 3CU7A 5KXBA 4DOUA 1KGYA 3VDDB 4PI2A 3WY6A 2DBIA 2IXIA 5J98B 4JDNA 3MLLA 2VUJA 4RA0A 3VBUC 4K1YA 4CPBA 3JQWA 4KWUA 2BDRA 5CA6A 4BM8A 1VIWB 4D6QA 5IVYA 1DYKA 1QJEA 3TYJA 1AR62 1IPJA 3GBGA 5C5TA 1ENRA 1FMD2 3OYWB 2ZEZA 4V1PA 3H1WA 4NVPA 1AR81 3JXSA 4LTAA 1VBD2 4NIIA 3MBWA 3WDUA 1UPIA 3VKMA 1LHWA 4XQWA 1F5JA 1JZ8A 3ZYPA 4DY5A 5A1FA 1DYOA 5KXEA 4R9DA 4YARA 1PK6C 1SLAA 1MS3A 3NL1A 3O14A 2D93A 2R061 1FPN2 1WMDA 2GSYA 3AZXA 4CDQB 5J09A 3PL0A 4LIVA 2AEZA 4OVEA 1V6IA 4MXWA 1UNBA 4KGQA 3I3MA 1NG0A 1QDOA 3SXWA 4OQ9A 3RWNA 1PIV2 5FPZA 4UBHA 1N1VA 5HCHA 4PHZA 2W94A 1GNYA 1VAKA 4GMP0 1CGPA 4PDWB 4QX0A 4QKDA 2VW0A 4QXHA 3FBYA 3VBOA 1QWRA 2PN5A 2W1QA 4RN5A 1H1AA 4BHPA 1EYBA 4CDXB 1C5HA 1W6MA 2Q5TA 5FJKA 1QJU3 1UQXA 3LFIA 2CY6A 3R4DB 2JDMA 1V6MA 2Y34A 1VBB3 1N47A 3E5UA 3HNYM 1IS5A 3PTRB 2GDFA 3H0OA 3RG0A 4QX2A 5FY0A 2XL7A 4MO3M 4A4AA 3WW3A 5BNOC 4QXKA 1W0NA 1HQLA 4DXSA 4WZFA 1OF4A 3BTXA 1AYN1 2LALA 1UMIA 1TG7A 4BMEA 1RUF1 3VKNA 1JTZX 3NNLA 4JGYB 2AR6A 2DCYA 3AJZA 4KL1A 3J7MA 4PIYA 4DEQA 1BEV3 2RS33 3JBG3 2AYHA 1AZDA 4DRVA 1WMXA 3V0BA 1JH5A 3LIGA 3DUIA 4L8QA 3NNGA 1C1LA 1PGL2 1D7PM 3VZKA 1F35A 1UIJA 2HJIA 3H42B 1V0AA 3IIAA 3IT8A 1T2XA 4PLOA 4UBGA 1OMIA 4XUQA 2RJ2A 4XF0A 1SFYA 2DTYA 1OI6A 4XJAA 1XNBA 4H3WA 5J3UA 4ZU5A 4NIGA 4DUXA 2JKBA 5LY1A 4CEWA 4XBNA 4Y1YA 4QKNA 3SNMA 4JRLA 5IATA 1YIFA 1RUNA 3LSEA 4BXFA 3VKOA 5DZFA 2LROA 5G05L 1QJU2 2R6QA 3JD73 3O0WA 2EALA 4GQ7A 5DABA 5FY9A 1QH7A 4BQ1A 3RNSA 1QKQA 4FPGA 1GYKA 1VBB2 2PAKA 3AYEA 2H0VA 2D3RA 3MPPG 2DCTA 3I3EA 2IVJA 2OX0A 5FMBA 2W39A 1CJDA 4RR3B 4RS5C 3ZYIB 2HWF3 3MIEA 2YROA 2YV8A 4U2AA 3FUOA 1S2BA 2PLV3 2UWBA 2XJSA 1ND2C 3J7NA 3Q8EA 4XVHA 4B7KA 1A8MA 5LCWL 2RDSA 1KXGA 1T6GC 2UWAA 1X7NA 2ZMKA 1AR61 2OYZA 3AB0A 4N7IA 3HPNA 4YG0A 1MQTB 4XXAA 4AWDA 1CWPA 1OLME 4FPHA 4NAMA 3U37A 1VBD1 1BEV2 1DIWA 1NQDA 1RMU3 1SPPB 2RS32 3JBG2 3PVOA 3RMYA 4GKXA 3O1SA 4P9WA 4Y1VA 5CISA 4XJ9A 1A6CA 3ZXJA 5LWBA 4PBPA 4QWNA 2L9LA 4OUEA 2MPFA 2EIBA 3AMQA 3MIDA 3AKPA 2JWPA 3MEPA 4E2QA 1UOGA 5IT6A 2HH9A 2E63A 1EPWA 2UU8A 2ZKNA 2BNOA 1DZRA 2AH2A 2WA4A 5C8CC 1X33A 3GZTB 3NW4A 5JIAA 4XPVA 3A0NA 4B3NA 5BYNA 3VBFB 4YZ3A 1LU1A 3ACLA 4FQZA 4GH4B 3PUSA 2Q8CA 3LEGA 2WSVA 1QJFA 1TNFA 3KQ4B 4NPLA 5KHGA 3N36A 1KRIA 4NAOA 3S6PA 1ZZ9A 4YRDA 4YW3A 5LA2A 3ZKUA 3IIIA 1NA1C 2C4XA 2HWF2 2VW2A 3AZYA 3MFAA 2ET1A 5HCFA 1SG3A 2PLV2 2Z2SB 4QPGC 3AL5A 4XMAA 4A7YA 5LB6A 1Y3TA 5DAWA 3D0JA 2GP3A 1XSRA 4IESA 3IAPA 5JPNB 4ZU4A 5FPUA 4XJUA 4OHVA 1RMU2 1NLQA 2J7MA 3WNXA 2P6HA 1K45A 4V2WA 4LUKA 2VVFA 5C8WA 4DFSA 3CZJA 4H14A 3BUCA 2AACA 4LO6B 4UW4A 5K7PA 4FFFA 3ZXLA 4QHBA 2XLFA 4UFIA 3TAYA 1DGRA 3ACFA 3AL6A 3GXUA 5B4NA 2JDUA 3SKJE 4CCCA 5LA1A 3IPVA 3VBUB 3KV5A 3PJYA 5JZGA 2C0ZA 3IAQA 3ZMNA 1O5LA 1IPKA 3ACGA 1ZRRA 1FX5A 4OZXA 4P5HA 5ERLA 2BWCA 1LHOA 1OD5A 2XGXA 4QD2A 2E51A 3HN3A 4XQDA 5FZ3A 4XUPA 1BLZA 1UY0A 3K3NA 4TWTA 1W39A 4D7SA 3FLRA 4GALA 2ENRA 3WF1A 1XE8A 1XOYA 3N9LA 3BALA 3MUY1 5LY2A 2NZ9A 5F6KA 3A7QA 3H50A 2XR4A 4MVTA 1JI6A 2DUQA 1D2SA 3K4DA 1WBFA 2FDKA 4WM7A 1GZWA 3HAGA 4GKYA 4NHKA 3I2IA 2BGOA 3NNJA 1C3HA 3GDBA 3AX4A 2W3JA 4EWEA 3GHMA 5CEHA 3AK0A 4JDMA 1BEV1 5JAXA 2CSGA 1BHGA 2OPWA 2GZWA 1PX4A 2GC1A 3S7IA 2BWAA 4XETA 2DCKA 5CKQA 1DLCA 3SCGA 4KNCA 1LEDA 2VCAA 4RQPC 1JOBA 3C7HA 5C3QA 4CCLA 2XH6A 3WINE 2B46X 2VGDA 4HZFA 3U0ZA 4Q0SA 5TSWA 3WDVA 1UKGA 4AFBA 4E9KA 2DVAA 3JZVA 1X36A 5BNOB 5JXGA 4ARYA 1YHFA 1TVGA 1LHVA 3B00A 3JD71 3ME2A 4R4XA 3GBFA 4EJRA 3I54A 3VHOA 2A1XA 5CAZA 1C28A 1RUG1 4KU8A 5C6CA 4ZZ8A 4IUGA 3PIGA 5CG8A 2HWF1 4JTOA 5SV8A 2QFEA 3PVNA 3AC0A 4KH9A 4A3ZA 2PLV1 2NPIA 2ZGKA 2EXIA 4PF1A 1LU2A 1S0IA 4FAHA 3OD4A 1GOFA 1F4AA 2WFF3 3IDAA 1G8WA 4AW7A 3GJAA 5HBAA 2TBVA 2LTNA 2VUAA 3B5LB 1OQEA 2R49A 3OGGA 2WO7A 3MIBA 3B69A 1R093 4LHSA 4Q4Y1 3T09A 5B4XA 3SH4A 2PAMA 5FPBA 2D3PA 1ZM1A 5FP7A 1C8M3 4IL7A 3ZN5A 4A7KA 2D98A 2NLRA 1JUHA 3AXDA 4QQPA 3LB9A 1LEMA 3WNKA 3VD4A 2Y0OA 4WM8A 2QQUA 2DCJA 4AOCA 1OBNA 2RM23 1UN1A 2D6KA 4HK9A 2FDJA 4UF0B 5HXMA 3ZYFA 2DVBA 1IPSA 4EZ4A 3E6BA 4RS5B 4CU6A 4OHYA 4LMFA 5KHHA 4COYA 4CCOA 1ND3A 4XJWA 3ZFFA 3AMMA 3HWJA 1MACA 4QPIC 1ND2B 1WLDA 1J59A 4PBOA 5E1RA 3KVAA 3N7KA 3RWKX 1DBNA 1UZVA 4BZ4A 3SKVA 3C2UA 1GBGA 1QNWA 2VMFA 2XHKA 1L7RA 1J83A 1ZBE3 2EA7A 3ECQA 4MADA 5FIXA 1VBA1 3NV4A 1OD3A 3KD4A 2Y6LA 4N9IA 1KITA 2FZ1A 2VAUA 2YXSA 4LHLA 5CVRA 5FZMA 3I3BA 1ZA4A 3ON7A 4GAZA 4P9JA 4BH9A 2WFF2 2ZGOA 5JXIA 1RUJ1 1MZ5A 4E4HA 2K0GA 3O0VA 4WV8A 3I59A 5C4WA 3ETPA 4WVWA 4NN0A 3T2OA 3ZN6B 3CJIC 3WR0A 1QJY1 2OKXA 1O6UA 2LS6A 2IUWA 1R092 3FMGA 5J48A 5C8CB 2WS93 1C8M2 5G04L 4K8FA 4YM0A 3HD8B 3AXEA 2Y8KA 3IDCB 1O4ZA 4FXGB 3KHCA 1ZRFA 2GP5A 2JE9A 2Q30A 3Q8BA 5H9QA 1V6OA 5I0DA 3KV4A 2J1UA 2RM22 3GZEA 4IGQA 1WW5A 2O8QA 1D4M3 3BYWA 5FXXA 1WMFA 5JIUA 2FCUA 5IJRA 4AEDC 1NA1B 1FV3A 1DG6A 1WBLA 2RDRA 1FV2A 2PYTA 5F5AA 2Y6GA 3RZLA 1Y7BA 2WNVC 3WP4A 2W87A 2XG3A 4QPGB 4AVAA 2PXJA 1RUOA 5GLTA 1AXYA 1UYPA 4J1XA 2BUKA 3HEIA 5EQUA 1TEIA 1DLLA 1W05A 2VJXA 1ZBE2 2MEV3 2N7GA 3OSDA 4LXLA 1XPWA 1V6NA 1CAVB 3I2JA 2IXJA 5I0UA 4GWIA 1WD3A 5FMOS 1YI7A 2P6CA 2UY9A 3VHRA 4EYUA 1K5JA 4R9AA 4D6SA 1S0DA 5F39A 2XHNA 2YB7A 4IE4A 4U36A 5DN2A 4DRRA 1SLTA 5FY7A 1YIPA 3J7LA 2W91A 1K3IA 3OUHA 4M00A 3U11A 5ACA1 2WAAA 1S4CA 1POQA 4LKSA 4I2OA 5LK7B 2JG8A 1CR7A 1A78A 1O3SA 1JU3A 5A32A 3KB5A 3TEWA 2A6XA 2WWSA 2GMEA 1KFXL 2Y64A 1D4M2 1NYWA 5IK4A 1EUUA 1QU0A 5EFUA 5I8SA 4DS0A 4AFMA 3WDWA 2B9VA 3U10A 3AMPA 1HB2A 4LBJA 1FNZA 4CP1A 4NR1A 5F32A 2AGSA 3ALQA 1APNA 1VRH3 3X29B 1G9CA 1W2TA 3VD5A 5IVEA 4NPRA 1NAEA 2QQJA 4Q4V3 2XBO1 3JCIA 2F17A 1PNGA 2OT7A 1D0HA 1O7FA 2MEV2 4QM8A 3VBRC 4Y5SA 4LA2A 3ZSLA 1AL21 1AX2A 2P3JA 1O59A 3ABZA 1YO8A 5IFTA 3WUDA 3MYXA 4YW7A 5FWJA 2HEYF 2BPA2 4HONA 4SLIA 1W8NA 1Y4WA 4CZSA 4AZZA 5IVFA 5FPVA 4CCKA 2A73B 1TNRA 5L19A 2R073 4RQPB 3VHPA 3AKQA 4HOOA 4PF5A 3OYWA 1SBFA 4C1WA 2PHWA 4AVBA 3LA7A 1IQDC 4PT6A 3WUCA 1GNZA 1R091 2C5DA 1ODNA 2ARAA 1Y43B 4IV1C 1AXKA 1C8M1 5D8AC 3SEEA 1NUKA 1DF0A 3QD6A 4BLIA 3H8RA 1DQ1A 2CAVA 3MGUA 2WUHA 4WVVA 3BODA 1NCQA 2QDRA 5T5JA 2RM21 4CE8A 4M01A 3VZJA 2JJ6A 2R0HA 2Q1MA 2WO1A 4AVVA 1IHMA 3IMMA 1NY72 1VRH2 4GWMA 4BE3A 2JICA 3ZXAC 1JYNA 3DCQA 3TOJA 2XQRA 1H6YA 3UV9A 2ZGRA 3INAA 4QQOA 5CYYA 4META 1SZBA 1TME1 3UETA 3VBSC 1W6PB 1GWLA 1KJLA 4Q4V2 4K40A 2JD9A 2XDVA 4W65A 3OPWA 5LBFA 1KEXA 5C70A 2X8KA 4AI8A 5FJHA 3FL7A 4CDXA 1ZA7A 1Q8PA 5HCAA 2R16A 1ZBE1 3DL3A 4XUTA 4JRAA 2V4VA 2D6LX 4Y1ZA 2I45A 3WQ7A 2YC0A 2Y38A 3NJVA 4KWJA 4WVMB 3GYDA 4Y26A 4HN1A 2GC2A 1IS3A 4NO4A 1GQPA 1LECA 4KMQA 2WINB 5A6QA 3LSDA 1AYM3 1JYXA 4RHV3 2QE3A 2XLGA 3WNPA 2R072 3K48A 2DURA 2H0BA 5JPMB 4RD7A 1HKDA 1OVPA 5L9BA 3WXPA 2PHUA 3GCXA 4XF4A 1ZZ8A 4JCKA 4XF1A 1GOHA 3AYAA 1RXFA 5DG1A 2XL9A 2WS91 5DUUA 5FP4A 2GMMA 3EXUA 4QPIB 5FXZA 5F6LB 4H2AA 2WNUB 3OEBA 1SBEA 1LOEA 2ZAHA 4HL0A 1JN2P 3RQ0A 5CFCA 2RE9A 3MF9A 1Q8OA 1A3KA 4FTEA 1D4M1 1OLRA 4A2UA 4QM9A 5J36A 5F8PA 5LBBA 1C1FA 4NROA 4W50A 3RZKA 5DPNA 2VZTA 4E2SA 2V72A 4IGOA 2W1SA 3WNOA 2BBVA 2AENA 2C24A 4IE7A 4DNYA 3TEYA 4B7EA 5FQ0A 4N43C 2IXCA 5GLVA 5EYYA 1U5XA 1AHSA 2RS11 2ZHMA 3BOWA 3OUJA 1ULPA 3OUIA 4AVSA 1WW4A 5FZOA 2XVGA 3U1XA 1B09A 4YM2A 4CDWA 1WD4A 4COUA 1I3HA 2ZGNA 1COV1 1AYM2 1KD7A 4RHV2 1J1LA 4RR3A 1S0CA 1YWKA 5FZ6A 5HV4A 3S0MA 4KG0A 3S5AA 2QKDA 1M06G 3DPRB 3DECA 1N3OA 3LWCA 5F5IA 5FWEA 3WNLA 4BA6A 2Z69A 2VOKA 3S30A 3FLTA 3ZYBA 3N9PA 3RI8A 1LKNA 2WZPP 4AEDB 2JG9B 3CJXA 4LUMA 3M3CA 5FYMA 1Q56A 2WQ4A 3HIFA 4Q4W3 5CKMA 2WNVB 4MGZE 4B1LA 1H9PA 2E6VA 3ZPYA 5AVAA 1YQ5A 1F9KA 2YBKA 1OHFA 5IVBA 4YZ1A 4XTPA 3IBMA 5ANQA 4L11A 3T1MA 5KHIA 2ZA9A 3BI3A 4XABA 2BERA 2MNGA 3D4KA 3KF5A 4P02B 4QGLA 4Z07A 1MS1A 3ZFGC 2YC4A 3AFKA 2YDEA 4ZU7A 2RV9A 1H8TB 3NNFA 4NIHA 4XFAA 3ZFEC 2UURA 5A7WA 1W3VA 3B9CA 1NY71 1NZCA 2EICA 1NCRA 5DDJ3 1E57A 2WL1A 4C0BA 4P9XA 4Q4V1 3T0BA 3T0AA 1RUH3 2PHXA 2VOTA 3Q9OA 5L7OA 2A6ZA 2WT0A 4UYBA 2BNMA 2WFPA 4CEYC 1VMHA 4P08A 4QB2A 3UESA 1POV3 3AVRA 1RUI3 4YVWC 4Q0PA 1AL0G 4OI0A 3OJBA 3AM2A 2X5IC 2YGLA 4TLFA 2HWE3 4Q0VA 1HB1A 1HXS1 2DUOA 3POEA 5C33A 1HB3A 3I2GA 1JZ7A 4ZKTB 1Q5OA 2ZMNA 3KCXA 1WA4A 4Q4W2 3C7EA 2HWD3 3OGVA 4Y20A 3WG1A 2AEYA 1QEXA 3J26N 4XFFA 4E8DA 1JZ2A 3POFA 2DTWA 2RJLA 1GLHA 3D6EA 1I6XA 1QGLA 3NAPC 1Y9MA 3LDRA 4K9SA 2SLIA 3O1PA 4OHZA 2XWBB 1RUE3 1CIWA 1QJX3 2VQUA 3RS6A 3ZSEA 5JUVA 1ZRIA 2NN8A 1RL3A 5BNPC 4JGZA 3D0SA 1FNYA 2RG4A 2HLEA 2RR13 5T3NA 3HR9A 3VBRB 2DVGA 1H1IA 2K9ZA 5IVVA 1ST8A 3I2HA 2EXKA 4XFBA 5L9RA 4BDVB 2WZ8A 5J96B 3DYOA 2R32A 4CU9A 3WW2A 3N35A 4MYEA 4AE2A 5DDJ2 1YFYA 5FZHA 2ETEA 2DFCA 4F8AA 1HX6A 2ZEXA 2ORXA 3HQRA 3ZXGA 2ZJCA 3PLQA 1RUH2 2CHHA 4UFJA 4CCEA 2EXJA 2JB8A 3DKQA 4LHNA 2P3KA 5BUVA 1UMZA 3CHXA 1W6OA 1W99A 1WLTA 3I8TA 3NJZA 1EV13 1VAMA 1ZZBA 1LOFC 5H9RA 1LODA 3T4HB 4D69A 1RUI2 3MW4A 4MHRA 1DYPA 3FBMA 4IV1B 4ATEA 4RYDA 2P1BA 3HVDA 5IWFA 4AQSA 5FPAA 2HWE2 3ES1A 4LBQB 1AYM1 4OHWA 4RHV1 3K75B 1QXPA 2Y33A 2J1VA 5FOBB 2YU2A 2CGNA 2HWD2 2IVIB 2ZEYA 4H55A 1MEC3 4LOSA 1HN0A 1JHJA 3UGHA 5J1XA 3BB6A 1Z7S1 3HMYA 5HI0A 5IYYA 2B4KA 4RGKA 1RUC3 1UD1A 1RUE2 1KJRA 2BTVC 1IKPA 1QJX2 1S2EA 3NNMA 3RGBA 3ZOIA 4C91A 2WJSA 5C5UA 5A1LA 1DGWX 1W04A 3KZ4C 4XUOA 2CDPA 4EN8B 1W9YA 3WLUA 2RR12 1I5PA 2ET7A 2XUMA 4Q8KA 1N3QA 3NWKA 4O7XA 1DGWA 4MH0E 1SCSA 2JE8A 5L73A 5EZWA 1XU1A 5E89A 3ELNA 1LHNA 2WWJA 3LPFA 4M3CB 5FRAA 3BCWA 4NRPA 1ALYA 3UJQA 5IVCA 2JDYA 3FLPA 4XILA 1WCQA 3QBQA 4H7MA 4ZXEA 2NQYA 4N7UA 2QDNA 1MZ6A 3UJOA 1F15A 3KVBA 4PIXA 1EV12 2Q1FA 2VZVA 4MSVA 2UYAA 3N9OA 3U75A 3CQOA 3VBOC 4CP9B 4YZ2A 4GB33 3EYPA 4M3CF 3MZHA 5D2AA 3JQXA 3OBTA 1PX3A 1H2KA 3U78A 3OY8B 2G1MA 5DUWA 1CONA 2BEOA 2VTXA 3GNEA 4G3YC 4MXVA 2FQPA 3UKNA 5BNNA 1OUXA 4NUBA 1BMV2 5F9TA 2WT1A 1MEC2 3ZSKA 2Y6JA 3PU3A 2G9ZA 1CAXB 4IEWA 4QX5A 2XMLA 5FUPA 2VD7A 3HQXA 1RUC2 4N90A 5KC5A 4J6GA 4JQRA 4Q4W1 3THCA 4KI5M 1ZRCA 1O3TA 1UOFA 4LQRA 3TN91 5IUQA 1Y9QA 5A7QA 2E7AA 3WW4A 1OH3A 4N43B 4XCBA 4AI3A 3O1UA 4S2FA 1VBE3 1HV1A 1XE0A 3CEWA 2AUYA 2HWC1 3PUAA 5JOZA 1CJPA 2F6BA 3E5QA 2KM2A 4HT1T 1UYXA 4TLGA 3PUIA 3OCPA 5F3CA 2GN3A 2O1QA 5KC6A 1W9SA 3RJRA 1CAUB 2WRAA 4MGIE 1V00A 1SDDB 1JODA 2AZ5A 3EJKA 4DXRA 3WF3A 2DFBA 1BK0A 5I8YA 5DDJ1 2WZR3 3ETQA 4CEWC 2IFWA 1PO23 2QNKA 4Q4X3 1RUH1 2W08A 2YZ4A 1X8MA 3N9MA 4O65A 4GB32 4LITA 2JIGA 1RYYA 1FMD1 2SBAA 4GMP3 5EPAA 2XJVA 1ULEA 4CU7A 3MFCA 1MS4A 2JIJA 3B01A 3LQCA 4ISQA 2GN7A 3USUB 1Z0HA 1BKZA 1POV1 1W28A 3ILFA 4W6WA 5FZCA 3SLIA 4Y1XA 4CDUA 5FYZA 2HWE1 2VZQA 4YVSA 2YPJA 3BU0A 2WZEA 3BVCA 3ZX7A 1FPN1 3PTYA 4FBFA 3L9JT 4AG4A 3JUUA 5SV5A 5D21A 3EB7A 5FYBA 5I0RA 2JDKA 4A45A 3SITA 2D3SA 1FI2A 4WBBA 4XIOA 3ZFEB 2XJUA 3CLPA 4FP3A 2ADDA 1PIV1 1WGPA 2QQWA 1CZTA 2WN3A 3NMBA 5JDBA 1AJKA 3GJBA 1VBE2 3D3AA 5FXVA 4E8CA 3U4SA 4AHXA 4HKOA 1QJX1 1OUSA 4YFWA 1YCIA 4FFGA 4HVRA 3FUQA 4QDRA 1AUYA 2VMCA 4IE0A 2VM9A 3PDQA 3I2KA 2RMU3 2RR11 3OPTA 5F5QA 3O5SA 4AI0A 2V5YA 4P5YA 2VMGA 2ZX3A 4A6OA 3GHNA 4CEYB 4EWDA 4URTA 3NSTA 1NA1A 2VO5A 1JUIA 4M3CE 2VOVA 4YVWB 1B35B 3O0XA 2VZ3A 5FP8A 4B4RA 2NMNA 2WZR2 4D7TA 4KQ7A 2X5IB 5A6YA 1P8JA 3DXUA 1PO22 4Q4X2 4IEYA 3AKTA 1LTEA 4GZ9A 2Q8OA 1SACA 3O1VA 1OOPB 3N7JA 2A6WA 3QOPA 1MZEA 3TEXA 3B9IA 1G7YA 2VE1A 2E7QA 2YFZA 4FPYA 5GLUA 1W6QB 2BP6A 2QQMA 4KWKA 1REEA 3MPBA 4JHZA 4YW4A 1FOD3 4QPYA 5FZKA 3NAPB 1LHUA 3PHMA 4K20A 3ZIWA 1OSGA 1X82A 3C7GA 1G86A 3IWZA 1PMJX 5BNPB 1AVBA 1OA4A 1GMMA 2VVDA 1UF2C 2CWMA 4NHYA 4YG3A 3ZDVA 2I07B 1JU4A 1QIQA 3C8XA 3AVSA 1M4WA 3CMGA 4LBNA 4XDOA 5A33A 1BMV1 1PGL1 3V0AA 2G9FA 3MHZA 3LOBA 1DCSA 1S2KA 3K4ZA 3ATGA 5FFOC 1YLLA 4HFSA 2DVDA 2BFUS 4FVVA 1EPZA 1W90A 3BIEA 2YHJA 4Q26A 4XEZA 1CAWB 1WUVA 1U5YA 1G9FA 2PTMA 1YQ6A 1ZZ7A 2BYVE 2RMU2 3HN1A 5KR7A 4D3WA 2R0FA 5LATA 4ATFA 1TMF3 4YZ5A 1PGSA 1QJU1 1ULGA 2JECA 3KV6A 4FPEA 3SH3A 3FWEA 5T50A 1W9WA 3NJXA 4R4ZA 3MICA 3AKSA 4UFKA 3U4XA 1VBB1 2QQOA 2VH9A 3HNBM 4CA9A 1PK6B 4ASLA 4G9SB 3POJA 4UFLA 1K5MA 4Y5TA 3VKLA 3ZN4A 4QHOA 5FZBA 5BY5A 3WNNA 5F2WA 4AYUA 5JZGC 2VZPA 1V70A 3VDAA 3UNPA 3OGRA 4XZUG 5K0UB 2GU9A 3W5NA 1LENA 1K12A 3BGAA 1FOD2 2ZX2A 3BKZA 4GB31 1W03A 3UKTA 5HV0A 4FP2A 2WIIB 3EO6A 1AX0A 3FZ3A 2GNDA 1S0FA 3TB0A 1WWYA 1F8VA 2RS31 3JBG1 3KLSA 3HJRA 1VLNA 4HG6B 4RFT0 1ULOA 4CCDA 1NKGA 2W9XA 3LA3A 3K3OA 4HPKA 3UGFA 5T5OA 3AYDA 1GSLA 3DEMA 1LGNA 4X8NA 5JI7A 5CFDA 1GICA 4C90A 5JSOA 2ORZA 4OFGA 1V9U3 3IM0A 4WM7C 1AR93 1ZZ6A 3DF0A 1SDWA 4LKEA 4LBKA 3VBHA 2BU9A 2F4PA 1VBE1 2YBSA 3OBZA 4BK5A 4DIQA 5FZDA 5A6ZA 2B39A 5J37A 1YQ2A 1TMF2 5FZLA 5A7NA 3VL8A 1GKBA 2G4IA 2GH2A 3KT1A 1BBT3 3VBOB 3C7FA 3TNQA 4D8MA 4QQLA 4EROA 5FZFA 2VXRA 5FP9A 1JYIA 3AP6A 1QY4A 1XE7A 1W6MB 1J58A 2OW4A 4HKLA 4K6BA 1FT9A 3N3HA 4BMBA 1LOAA 2ZKLA 1SMVA 3ZVXA 3ACHA 3IMNA 2DU1A 3I2OA 2WZR1 3MDPA 3B93A 2ATFA 3LDKA 2H6CA 2Y6KA 2BVBA 4Q4X1 3SC7X 4E27A 3UKVA 4BPZA 5FLIA 3CNAA 4IEVA 2CV6A 3O1TA 4FOYA 3LE0A 4AI1A 4IEZA 4GMP1 4XACA 1QXJA 1QNYA 3MW2A 4YW2A 2KR2A 5M0TA 4DUWA 1OLQA 4BLJA 1SLCA 5FMOL 5LEKA 3KT4A 1RMU1 1R1A2 3MV11 2GC0A 2VZRA 1ZBA3 5C71A 3EHKA 3THPA 5JOXA 1G9BA 4IEUA 3BN6A 3MF6A 4RGGA 1X50A 4YW5A 1XJAA 3I4IA 3THDA 3AYCA 4QX8A 3SH5A 4AVCA 2WO3A 2XQXA 2Z42A 2YPDA 5FZEA 5IHRA 1ZRDA 5FPLA 2WABA 1V9U2 3PNAA 1IG0A 4DUVA 1AR92 2C6SA 3AMNA 4DY3A 2XJTA 2VQTA 2IFRA 5AFBA 4Z92B 5GZEA 5FDBA 2X53S 4FOQA 1HJFA 1S55A 2X05A 4CEWB 4UW3A 5JSRA 2X10A 1KS5A 1BBT2 2QUOA 2WNUA 4ZS3A 4N53A 1DU3D 1VMFA 2E31A 1Q8QA 5FCCA 3POGA 4WM8C 1W2NA 3WQBA 3VZOA 5EHDA 3E6DA 2JB4A 5DMYA 4LO5B 2XUEA 2VTXJ 4LK7A 2VVEA 1ND3C 3ZFFC 1DGLA 4AGGA 1US3A 1YXWA 4DB5A 2RHPA 2CAUA 4XJ8A 1ZX5A 1UWWA 4IV3A 4HVQA 3T0DA 3KT7A 2OIIA 1H2LA 1ZBA2 2WN2A 4PLMA 4AEKA 2ZHNA 5FLJA 4QGMA 4XIKA 1FATA 2Y6FA 5FMCA 1O3QA 1H2NA 4AFCA 2YC2A 4RSUA 1MS8A 4OMDA 2BZDA 3DPRA 4XBLA 4ZHNA 3ZXFA 5JXJA 1AF9A 1H8VA 3LF7A 5EYXA 2VU9A 4KG8A 5JSPA 4IDZA 3VD9A 4K8RB 1DZTA 1VMJA 1OC1A 3ZXDA 4OQ8A 4NIDA 2ZCWA 4R9CA 2JG9A 5C4WC 3M70A 4GWJA 3VD3A 4Q1PA 4Z2AA 2PQQA 5DUVA 5FYSA 4ASKA 3APBA 1DQ6A 1PZ8A 1W8WA 2VCMA 2A3WA 3Q8CA 4LBOA 4YSFA 1GUIA 3ZLIA 2I2SA 2V5DA 2XONA 1LOBA 2C1FA 1TMF1 2WWUA 3EBRA 5FZ0A 5GZGA 5IAXA 4V2VA 1Q43A 4EN0A 5FUIA 4BWOA 1H8TA 1E5SA 5E8AA 2XKPA 1GU3A 1H2MA 1ZVFA 1UMHA 2C26A 3KHBA 4ITCA 3A21A 5F3IA 4EN6B 5H9PA 1C4RA 4I01A 3RYPA 1XRUA 1MZFA 2KA3A 2RDQA 2WO2A 3POIA 3T30A 1XNCA 2VTFA 2EVXA 1L7LA 1J3PA 4Q29A 1FXZA 4CVUA 3AZVA 3E1F1 3OEAA 1DFQA 4W4ZA 5CKNA 5FR3A 5T5PA 3WV6A 4N8MA 5C9AA 5JMOA 5CG9A 1QH6A 4NHMA 2WYSA 1R1ZA 1V6LA 4LBMA 3WCRA 4E4SA 4BU2A 4J25A 3IN9A 1PM4A 5CU1A 2A6VA 1OH4A 3QCWA 4IE6A 4AFAA 2VUDA 5ABJA 3ENRA 1GNHA 5CIRA 2WKKA 5BPXA 2YG0A 4COWA 1HRV3 2BJSA 1F31A 1MS0A 1V9U1 1GP6A 2PHDA 1OQDA 1BVVA 2TEPA 3MI8A 4NPMA 1E5HA 5L9VA 3TWIA 4QKFA 3IPVB 1PVC3 3VV1A 1S0GA 1ZZCA 5LASA 5A7OA 3ASIA 1JYTA 3LFMA 2CGPA 1NQJA 1BBT1 1C57A 2VMDA 4FSJA 1E5IA 1UOJA 3WQ0A 3OG2A 5FYCA 5T5LA 1O5UA 4Y22A 3AZWA 2TNFA 2FDIA 2JDZA 4QT6A 3VDDA 5A80A 2XKOA 4FQ4A 3U07A 1UYZA 3C3VA 3DYPA 4HKWA 3GGLA 5B2GB 1CZVA 1IZ3A 5FAXA 1ULCA 3SQOA 3I3QA 2J1RA 3SISA 1A8DA 4OLLA 2FZ2A 3OBRA 4G4FA 3VKFC 4FOVA 4BQXA 1WA6X 4XFGA 2WFF1 1MS5A 4CXXA 4OMCA 3SEPA 2XPJA 3GCWA 3EMRA 5FZAA 4TSVA 3WX5A 3E97A 4COZA 1PMIA 3I49A 4D0QA 4I09A 2ZXQA 1GZWB 1OLMA 4WM7B 4XE9A 4LOTA 2LUWA 1YJLA 4FPOB 4O9GA 5IK5A 1WCSA 1ZBA1 5T54A 5JWPA 2RS53 3R05A 5FY5A 4LLFA 4LBQA 5EJZB 1STMA 4AL9A 1UKRA 3DV8A 1GQHA 4CDQA 5A6XA 2JDAA 1N1YA 4DO0A 3L2YA 3RJ2X 2CTVA 1DQ5A 1HRV2 2R043 2TUNA 3POSA 5FZ4A 2J42A 2YUEA 2ZGLA 4UW6A 4XDPA 4INDA 3S7EA 4E4DX 3QH6A 4A7ZA 2ZOEB 4BYYA 1OA2A 3VDBA 2WNOA 1PVC2 1AR73 1LNSA 1IG3A 3D5OA 2HYKA 3HT1A 2W46A 2VZOA 4FPKA 4PDWA 5FZ9A 1YUDA 2ARCA 4A3XA 2VQAA 3M7AA 1RTVA 4XC9A 4GA9A 2CYFA 3N7LA 1W2OA 4QDQA 3ZKYA 4KBBA 1IGOA 2GAUA 1HB4A 4BQ2A 1HQNA 4FT8A 3SCHA 2W68A 2E9QA 3UYJA 3HBKA 2ZX4A 2OUJA 1NCQC 2GMPA 4K21A 2FD8A 3KCCA 5DXDA 1VRBA 4ZXKA 3WHUA 4HETA 3LZZA 5CNAA 4HSLA 2QQVA 4Q0UA 3PURA 1G9DA 1NXD1 2HYXA 1QOTA 2P5BA 1SCRA 2ZABA 4EN9B 2RS52 4LO4B 1PMHX 1GANA 1PGW2 4FCAA 4Y5Z0 4JGYA 4CDXC 4IERA 1AR83 5F37A 2VY0A 2JENA 4KWLA 4XBQA 3ILRA 2R042 3M3IA 3ES4A 3KQRA 4LBQD 5A3OA 1DZQA 5DAXA 5LBEA 4WM8B 4DMIA 2D5FA 1C5IA 4BB3A 5C3SA 4GIQA 1AR72 2YY1A 2A71A 1VAVA 1RUD3 3E5XA 1REDA 3H7JA 2XB6C 2ZGQA 5F3EA 3T4VA 1CX1A 1QDCA 2D5HA 3P6BA 3NKGA 4AI2A 1US2A 2OZJA 3WG2A 4EZHA 5LRSA 4BQ4A 3THTA 3WF4A 5CBLA 4A41A 5EJ1B 2B45X 3CJIB 3J9SA 5K0UA 4HN0A 1GWKA 4OYUA 5FYTA 2MEV1 5CFCC 3P5BA 4NHXA 3KSCA 1UXZA 2RVAA 5FZIA 1CAUA 5F1RA 2XXZA 4CCJA 4CUCA 1U12A 3MV01 1NZIA 3W59A 2D6OX 5A3PA 4RFRB 1DP0A 2QQKA 1L3JA 1WW6A 2JXAA 2V73A 2VCBA 3LGRA 4FPJA 4HVOA 5C3OA 3AJYA 3RZGA 1JYVA 1S0JA 3WEZA 4L97A 4EV0A 4D6RA 2YMZA 5IVJA 1OFNA 5JI9A 5KXDA 3POBA 1AX1A 1MQTA 3I59B 5C4WB 1K42A 1OA3A 4W6XA 1ODMA 4F83A 1AYN3 1AR82 4B29A 1G9AA 4CDWC 1URXA 2HWB3 4MGSA 1SPPA 5IW0A 1XYNA 1RUF3 5BV6A 1U5IA 1XNAA 1GP4A 3MO4A 2VL4A 2ZS6B 3PMSA 4RR3C 3FFQA 3W9AA 3ZXEA 2ZMLA 3POWA 4CUBA 2B8MA 4MG2A 4COVA 1HRV1 2I74A 2W2IA 1RUD2 4ZS2A 1I5ZA 1YQCA 4L92A 4NE9A 2VPVA 2QZ2A 4AHZA 1JZ5A 1CD3G 1VRH1 1PVC1 4AXOA 1J84A 2YFUA 3LD8A 4YM1A 4XTMA 3CL1A 3VBFA 2WAOA 1H6XA 2YGMA 4NHLA 5A7PA 2Q0AA 2ZX1A 2ZGSA 4GH4A 1HJGA 3LDBA 3PU8A 3AP4A 1BK1A 3MLJA 4YYOA 1HIXA 2GNBA 5KXCA 1SFNA 4QDSA 5FY1A 1W2AX 2HEVF 2WBKA 1UY1A 4LE4A 2PA7A 4NOTA 2DU0A 5F3GA 5IK8A 2PQSA 3DXTA 3WW1A 1X9TA 5IK7A 1B35A 4JKKA 4CRQA 4UAPA 4YGCA 4QQ2A 5BXXA 3W20A 3Q8AA 1XYOA 1ACCA 3S57A 2R071 1V6KA 2EF6A 1NCRC 1OOPA 2P4EA 3M1HA 4IEXA 4EQVA 4YGEA 1YNAA 4C0HA 4BCUA 1QOSA 1AYN2 1W6QA 2HWB2 4XDQA 3DN7A 3H1YA 1RIRA 1RUF2 2R30A 1XNTA 2VMEA 2RS51 5L7OC 3H1MA 2A75A 2J1AA 1J1TA 1X9PA 3NQHA 5AFEA 5A32B 4JQTA 4OI1A 1D0GA 1SLBA 4XAAA 3F2ZA 4CCMA 5FMDA 2K2SA 4LE3A 1UW8A 3K77A 1LAJA 2E53A 5DG2A 2ZBJA 1H30A 1AR71 3VBUA 4BK4A 4QB6A 2W47A 3WG4A 2EIEA 4QPWA 2GALA 3QLQA 1CAWA 1UZ0A 1R64A 1H0BA 3B7MA 3M8LA 3FHQA 1O4YA 4P9GA 3RI9A 3WP3A 3PUHA 1YC61 1PHMA 5FKCA 1WCDJ 2QZ3A 5JOYA 4FOWA 4JGZC 1NOVA 1RJ8A 2VNVA 5FLHA 3WZ1A 2E32A 2VUCA 1JZ6A 1LB2A 2VMIA 1GP5A 1QOOA 2D44A 2EAKA 2RDNA 5D8AB 1HW5A 1PK6A 1ZNPA 4XFIA 4UOJA 4YGDA 4GXLA 3IKWA 3ZO0B 1DDLA 1C8NA 2PAEA 4EWAA 1PO13 2NYYA 2ZZQA 4JTNA 5GLWA 2P37A 4ORFA 2XWJB 2XVKA 1OURA 4PCRA 5I93A 3LEMA 2ZTNA 1XNDA 3I97A 4IEOA 3VBSB 2CWSA 1CZSA 4JVAA 2WYFA 4TTGA 4XFCA 3ZDSA 4SBVA 3WQ1A 3NJYA 2D7FA 2DUPA 4FXKB 3DYMA 4LPLA 1F2NA 1H1MA 2P2KA 2Z5WA 4GWNA 1NCQB 4PLNA 4R8HA 2A3YA 4K1ZA 4QU2A 1RUD1 3BTZA 2VXJA 1O3RA 2XLAA 3A4UA 3R6SA 4JDOA 2FDGA 3VL9A 5FYHA 2O8OA 2WR9A 1UX7A 4XCAA 5FYYA 4X6RB 3B94A 2CDOA 4BQWA 2VOWA 1A34A 5BNOA 4EE2A 5GZFA 4IW3A 2QBXA 1YFWA 2YU1A 3UK9A 3FHAA 2A70A 4QHZA 1CPMA 2J1SA 5KBFA 3H3LA 4YNIA 3ZR5A 2ARXA 1MPXA 3D82A 3OGJA 2ZHKA 4TZDA 2Y6HA 5FZGA 2QQNA 2Y26A 4AGVA 2VR4A 5A3LA 1WMEA 1UY3A 3R0RA 2EIGA 3PUQA 1JOJA 1PO12 1RHI3 4O9EA 2ARBA 2JKXA 1EP0A 1VP6A 2VCCA 2IWGB 1OT5A 4CPBD 5J7MA 3VUOA 3V64A 5JMCA 4P9IA 4BXSV 3H3UA 3M2MA 4OULA 3KM5A 3ZXKA 3N9QA 1IQAA 4FTSA 2HWB1 1BCXA 1UO9A 4RGAA 3W58A 4FPCA 1CN1A 2WQZC 3VGIA 4Y4RA 4D7YA 2LRPA 5ISLA 1XNKA 4XXPA 2DV9A 2PHRA 3M3OA 1JOPA 4JV4A 5L36A 2Q8EA 3ORJA 2W92A 2BFUL 4YG6A 1PZ7A 3KF3A 5F2SA 3OPZA 3UGGA 1GQGA 5BNNC 5CFCB 3NRUA 3TEZA 5H9SA 4UF0A 2VBPA 1W0OA 3LPGA 5FZ1A 1O4TA 3CZUA 4TYSA 4LKFA 4RS5A 5A3WA 4UI9L 1GR3A 1NE4A 3AP5A 3H8XA 2IXHA 3A22A 1WZXA 1ND2A 2HEWF 2D6NA 2H6BA 5FQ0B 3ZSMA 2ZGTA 1NT0A 4NIAA 5FYIA 1Y9GA
chains in the Genus database with same CATH topology
4ZONA 5EP9A 4BQYA 4Y5SA 5DAXA 3NNMA 4ZPIA 5LBEA 5C5UA 3NNLA 4KBZA 4NHMA 4XACA 4J25A 5LBCA 5M0TA 3KT4A 5ERLA 2RDNA 4MHUA 5L9VA 4XABA 5A3UA 4NHXA 5LASA 3NNFA 5IATA 2FCTA 2HBUA 3MGUA 4NHYA 2FCVA 3W21A 2G1MA 5DAQA 4NHKA 3NNJA 4BQXA 3GZEA 4NMIA 2RDSA 3EMRA 2FCUA 5LBFA 4JZRA 2OPWA 2RDRA 5DAVA 5LATA 5DAPA 2V4AA 4Q5OA 4XCAA 4BQWA 4XCBA 4IW3A 5C5TA 5EQUA 4Y5TA 3KT7A 4NHLA 5L9BA 4UWDA 2RG4A 5HV0A 2A1XA 3PL0A 3ITQA 5L9RA 4XC9A 2G19A 2JIGA 2HBTA 3OUHA 5EPAA 3W20A 5IAVA 2JIJA 3HQRA 4NAOA 3DKQA 5LBBA 5LA9A 3GJAA 5IAXA 3BVCA 3OBZA 5LB6A 5DAWA 4MHRA 2Y34A 3OUJA 3OUIA 3KT1A 4XAAA 2Y33A 2RDQA 3GJBA 3HQUA 5HV4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZON A;  5EP9 A;  4BQY A;  4Y5S A;  5DAX A;  3NNM A;  4ZPI A;  5LBE A;  5C5U A;  3NNL A;  4KBZ A;  4NHM A;  4XAC A;  4J25 A;  5LBC A;  5M0T A;  3KT4 A;  5ERL A;  2RDN A;  4MHU A;  5L9V A;  4XAB A;  5A3U A;  4NHX A;  5LAS A;  3NNF A;  5IAT A;  2FCT A;  2HBU A;  3MGU A;  4NHY A;  2FCV A;  3W21 A;  2G1M A;  5DAQ A;  4NHK A;  3NNJ A;  4BQX A;  3GZE A;  4NMI A;  2RDS A;  3EMR A;  2FCU A;  5LBF A;  4JZR A;  2OPW A;  2RDR A;  5DAV A;  5LAT A;  5DAP A;  2V4A A;  4Q5O A;  4XCA A;  4BQW A;  4XCB A;  4IW3 A;  5C5T A;  5EQU A;  4Y5T A;  3KT7 A;  4NHL A;  5L9B A;  4UWD A;  2RG4 A;  5HV0 A;  2A1X A;  3PL0 A;  3ITQ A;  5L9R A;  4XC9 A;  2G19 A;  2JIG A;  2HBT A;  3OUH A;  5EPA A;  3W20 A;  5IAV A;  2JIJ A;  3HQR A;  4NAO A;  3DKQ A;  5LBB A;  5LA9 A;  3GJA A;  5IAX A;  3BVC A;  3OBZ A;  5LB6 A;  5DAW A;  4MHR A;  2Y34 A;  3OUJ A;  3OUI A;  3KT1 A;  4XAA A;  2Y33 A;  2RDQ A;  3GJB A;  3HQU A;  5HV4 A; 
#chains in the Genus database with same CATH topology
 5FZO B;  3P3N A;  3D8C A;  2NMO A;  3WP5 A;  1IOA A;  2ZGP A;  4BQ5 A;  4CDW B;  3LKJ A;  2OPK A;  2D6M A;  3I7D A;  1OF3 A;  1RUI 1;  5FK8 A;  1W6N B;  1GZC A;  3BPS A;  1RUG 3;  4HAN A;  4S2H A;  4OI4 A;  1XQN A;  1RHI 2;  4LO8 A;  2WLP A;  3ZM8 A;  3BOP A;  5E16 A;  3HOB A;  1VAL A;  2ZAA A;  3V65 A;  3ZFG B;  1W8Z A;  3I3D A;  3J4U H;  5EWS A;  1Q8V A;  2BV4 A;  3H8U A;  3CO2 A;  2HWD 1;  2D97 A;  3ZN6 A;  1ONA A;  4X6Q B;  1UCX A;  1FYU A;  4AAX A;  5A1A A;  4LT5 A;  4E2G A;  2FHR A;  2C9K A;  5C8C A;  5LW9 A;  3CIH A;  1W8F A;  1UU5 A;  2F4L A;  1D2Q A;  1RUE 1;  3WDY A;  1KDK A;  1U0A A;  3L2H A;  2DDU A;  4DPN A;  2D40 A;  1PZ9 A;  4QQH A;  2DBN A;  3A23 A;  1EUT A;  3QH7 A;  1T6B X;  4Q4Y 3;  4XAE A;  4CDU C;  1PM7 A;  3MIF A;  4DIN B;  2FCV A;  4YVS C;  1UU4 A;  1D4V B;  1H4G A;  5LK5 A;  5FY4 A;  3BTY A;  1YJK A;  1LJ7 A;  4AI9 A;  3N4M A;  1IKQ A;  4XYX A;  5A7W B;  5LZ6 A;  1SQ4 A;  1WKY A;  4QPG A;  2W5F A;  4A42 A;  4DXT A;  4ET7 A;  4YW6 A;  4DZG A;  4MX3 A;  1OKO A;  4K7J A;  4NMI A;  1NCR B;  3KMH A;  1N1T A;  1BQP A;  4MOA A;  3RPQ A;  1JHN A;  5EV7 A;  4URA A;  2K46 A;  5JR7 B;  1KDM A;  5A3M A;  1EV1 1;  3ZSJ A;  3JD7 2;  4XUR A;  4C8D A;  1KQR A;  1I1E A;  5DAP A;  5GM0 A;  2IC1 A;  1KS4 A;  2V4A A;  4L99 A;  3T2P A;  4BIF A;  2DF7 A;  4UFH A;  1RUG 2;  4M4R A;  2ADE A;  5L7O B;  1UL9 A;  3M3E A;  4IEQ A;  1CAV A;  5GLZ A;  3AP7 A;  4A44 A;  2W0X A;  1GOG A;  4Y4Y A;  1BXH A;  2PFW A;  1VBA 3;  2Q8D A;  2NP0 A;  2R1B A;  1TQ5 A;  1YI9 A;  4LA3 A;  4FI9 A;  3TRS B;  1JZ4 A;  1HRI 3;  1YFU A;  3FE5 A;  4MZU A;  1MEC 1;  1PO1 1;  2W1U A;  4QAW A;  4B4Q A;  4IEP A;  3G6J B;  3B02 A;  1RUJ 3;  1RUC 1;  1YFX A;  3GZA A;  4I3P A;  4Y20 B;  2A3X A;  4HXC A;  1S0E A;  1QJY 3;  1QQP 3;  5K4L A;  3GM8 A;  4Q4Y 2;  3VLB B;  4O61 A;  4LHK A;  1HN1 A;  3LA2 A;  4YPJ A;  1LOC A;  2AC1 A;  5DUX A;  5GKA C;  1Z78 A;  1LR5 A;  4PI0 A;  4JGZ B;  4GJZ A;  3ZPO A;  3RYK A;  1O8P A;  3BIW E;  2LW8 A;  3M4F A;  2WQ8 A;  3NV2 A;  4UFM A;  4B4P A;  4ZZ5 A;  2OUH A;  1RVF 3;  1YRZ A;  1DHK B;  4RL7 A;  5FBZ A;  4HLT A;  5K8S A;  4P9Y A;  1XYP A;  4Q0Q A;  3K4A A;  2YBP A;  2DVF A;  1ULF A;  3EQE A;  2BVV A;  4L9B A;  1W2U A;  2ID4 A;  2QTW B;  1W6O B;  4CYD A;  1ENQ A;  4LIU A;  5C7G A;  4ES8 A;  2FDH A;  5JR2 A;  2JE7 A;  2UYB A;  3VN4 A;  1R1A 3;  1VBA 2;  4XUN A;  4EN7 B;  1SBD A;  4CXY A;  1HRI 2;  4J1W A;  1RHI 1;  1BJQ A;  1U5Z A;  2EID A;  3WDT A;  3FHI B;  1K5M C;  1RXG A;  2J22 A;  1EY2 A;  2X29 A;  4ZPI A;  1RUJ 2;  4HBN A;  3O12 A;  4L0P A;  2OQ7 A;  4RQP A;  4BIS A;  1CQ9 A;  1RGS A;  1N1S A;  1RJ7 A;  4MXW B;  1H4H A;  5C3R A;  3IDB B;  4P9L A;  4S2G A;  5LEJ A;  3E6C C;  3T2Q A;  3UT0 A;  2GNT A;  1QJY 2;  1QQP 2;  1UX6 A;  4Q27 A;  1VE0 A;  2XOM A;  2QQL A;  3MLK A;  4CUA A;  3H8O A;  2WT2 A;  2OXB A;  4P00 B;  1ENS A;  5ACA 3;  3GF6 A;  2B5H A;  2E7T A;  1W8U A;  3R4S A;  2ARE A;  1LCL A;  2E26 A;  3G7D A;  3WDX A;  1JMU B;  1ZRE A;  2D6P A;  4R9B A;  3OB8 A;  1RVF 2;  1PNF A;  2WC2 A;  4LO7 A;  4HMZ A;  1YEW A;  3VZM A;  1QMJ A;  2OQ6 A;  5CFD C;  4H7L A;  1GV9 A;  2A7A A;  2HBU A;  5FPX A;  1VBC 3;  2UWC A;  2ILM A;  3KS7 A;  1PO2 1;  3MUZ 1;  1N3P A;  2ZHL A;  3HNM A;  1W6P A;  3WSO A;  3ZIX A;  3VBH C;  3RSJ A;  3V56 A;  5GZC A;  3MIH A;  5HPO A;  3RMX A;  1UU6 A;  1OKQ A;  2BNN A;  3HT2 A;  5GAL A;  2Z4F A;  4AGR A;  2EAA A;  1F4H A;  1DQ4 A;  2XBO 3;  3T08 A;  4QMA A;  2P3Y A;  4WVM A;  5HXV A;  1AL2 3;  2VMH A;  1H9W A;  1G6N A;  4FPL A;  4JZR A;  3GZU C;  1BZW A;  2PMW B;  4CP0 A;  3V0B B;  3CKH A;  4Q5O A;  2IZW A;  5BNN B;  4Z2W A;  2X09 A;  3AKR A;  2Y0I A;  5I8T A;  3J8F 3;  2OZ6 A;  3VDC A;  4GUL A;  3ZYR A;  4CCN A;  4I0A A;  5FO8 B;  2VOX A;  1JZ3 A;  3ST7 A;  5ACA 2;  4LKD A;  1CIY A;  4NRQ A;  5KWR A;  4QPI A;  5EJ3 A;  3NV1 A;  3URF A;  4Y24 A;  2C9A A;  4QB1 A;  1WLC A;  4PQ9 A;  4N9H A;  2G9G A;  2RMU 1;  2WNE A;  2BRT A;  4OZO A;  5C3P A;  2J1T A;  3KCY A;  1NX9 A;  2PHF A;  3AMH A;  4IGP A;  4M4P A;  3S5Q A;  1XU2 A;  3FX3 A;  3A0K A;  4OUM A;  4AEM A;  3DGT A;  2VBB A;  1VBC 2;  2IXL A;  4XF3 A;  4OUS A;  2FBE A;  2FMY A;  5FK7 A;  5FZ8 A;  2OVU A;  1W06 A;  1JBC A;  4K3U A;  2B42 B;  3KWV A;  3HBZ A;  1UYY A;  2LM3 A;  2HKX A;  3MW3 A;  5FTT C;  2PHL A;  1QHD A;  1UIK A;  4LLO A;  2O14 A;  2VZS A;  4YW1 A;  1TME 3;  1W8H A;  2W52 A;  4YFZ A;  3CJI A;  2WNU C;  2XBO 2;  4MGY E;  2XJP A;  1FOD 1;  2BOI A;  4HSJ A;  2B9U A;  1L7Q A;  2E33 A;  4IET A;  4N53 C;  4NWW A;  4YLZ A;  4OHX A;  1VB2 A;  2MHF A;  3AZZ A;  2ZGM A;  1WCK A;  4IE5 A;  1AL2 2;  2EXH A;  2VW1 A;  1OFS A;  2Q1Z B;  4JAA A;  2WDB A;  2OA2 A;  5FYV A;  4LBL A;  3U14 A;  3BTA A;  4CDU B;  1HRI 1;  4YVS B;  1GZ9 A;  1UY4 A;  3J8F 2;  4CUG A;  3RZZ A;  1CES A;  3SHR A;  3WHT A;  2ZEW A;  3ZYJ B;  3GAL A;  4AED A;  2ZX0 A;  3BPZ A;  3WVJ A;  1SHW B;  4Q1R A;  3K51 A;  4QXB A;  1NE6 A;  1OQ1 A;  2WNV A;  5EP9 A;  1QQP 1;  3JB8 A;  4IV3 C;  1HLC A;  3WCS A;  4DEV A;  4UW5 A;  1W8T A;  2VNR A;  1WW7 A;  3LOI A;  1NXM A;  1UAI A;  3SCF A;  4CP2 A;  1RIT A;  1BVP 1;  1EAH 3;  1UY2 A;  3DPR C;  2ZAC A;  2XVL A;  4LJH A;  4QX1 A;  4AQ6 A;  5JLV A;  1E5R A;  1UXX X;  3I2D A;  1RVF 1;  3WP6 A;  1ZYB A;  2VBD A;  1CPN A;  1DQ0 A;  1V6J A;  3PME A;  4GJY A;  4MLO A;  5DZE A;  3VHN A;  1I9R A;  2JG9 C;  4XHX A;  5F7U A;  4NJ4 A;  1CVN A;  3OTF A;  1W9T A;  1OVS A;  1TME 2;  1SEF A;  3LAG A;  4DQA A;  2JD4 A;  2FMD A;  1ASJ 3;  4I30 A;  5CAD A;  1VJ2 A;  4BQ3 A;  5FOJ B;  2FCT A;  2RS1 3;  4UXA A;  5FP3 A;  3RRD A;  3RYR A;  3GBW A;  2XJR A;  3JU9 A;  3WF0 A;  4XQ4 A;  2CGO A;  1R1A 1;  4FAG A;  1NLS A;  2OS2 A;  1H8T C;  2ZGU A;  3LIH A;  1SLL A;  3RVH A;  1TE1 B;  3Q8F A;  3T3Y A;  1WCU A;  1COV 3;  4Y33 A;  4A6S A;  3NKT A;  2VZU A;  3B3Q E;  1TZO A;  3R4U A;  4M0N A;  3RZM A;  3USS A;  1F5F A;  3BU7 A;  5A33 B;  2QCS B;  3IB3 A;  5F5C A;  4Z1V A;  3V0A B;  1AR9 1;  3WT3 A;  1Q8S A;  3H7Y A;  5IFP A;  1HQW A;  2WS9 2;  3H3Z A;  4ZY9 A;  2VQ0 A;  5T52 A;  5A3T A;  1YQ8 A;  5JOW A;  4FFI A;  1PVX A;  1NLR A;  5JZG B;  3QAC A;  2JG8 C;  1KFU L;  3FJS A;  4XFH A;  5C9A C;  2V09 A;  3FC0 A;  4LEJ A;  1EAH 2;  1ULD A;  4QX7 A;  1MS9 A;  3WOG A;  5FUN A;  3VBR A;  1XXN A;  1DQ2 A;  1QF3 A;  2IXK A;  1AXZ A;  1ENX A;  1RIN A;  2A5Z A;  4F3J A;  5A3N A;  5ABJ C;  3O1O A;  1W8O A;  1LRH A;  1VBC 1;  2DWR A;  2ZZJ A;  4LOR A;  2Y60 A;  3OOX A;  2UY8 A;  4QU1 A;  5FXW A;  5JXH A;  3N7M A;  1VB4 A;  1K5M B;  1ASJ 2;  2RS1 2;  4D94 A;  1OXC A;  3PIJ A;  4KGG A;  5KHJ A;  2G19 A;  1W0P A;  3AFG A;  5LRR A;  2O0O A;  1AJO A;  3POY A;  4I0B A;  5I91 A;  1UZY A;  5CB7 A;  2GNM A;  4GD4 A;  4HK8 A;  4QX3 A;  4IV1 A;  5ANN A;  1W3X A;  5FZ7 A;  2CU5 A;  2YYO A;  3OBA A;  3VDD C;  1COV 2;  1YYN A;  4WZC A;  5D8A A;  5LA9 A;  5K9Y A;  3N9N A;  2DCZ A;  5DQ0 A;  2ZPX A;  3VZL A;  4AEJ A;  5JCT A;  4S2D A;  1W9F A;  2GC3 A;  2PHT A;  1REF A;  3LEK A;  3T1L A;  5I0T A;  4HPK B;  3SMH A;  3J8F 1;  1HXS 3;  2ES3 A;  5CFD B;  1IS6 A;  2WA3 A;  3O1M A;  4LUL A;  4JC1 A;  3FN9 A;  2BGC A;  5A7S A;  4I02 A;  3VBS A;  4AQT A;  4NRM A;  2FDF A;  2GH8 A;  3VBH B;  4AHY A;  5AC9 3;  5FV3 A;  4Z8B A;  2CL2 A;  3HQU A;  2XJQ A;  2JEM A;  4BQY A;  4CDQ C;  4C1X A;  1LOG A;  2BQP A;  1SFP A;  4KBZ A;  1VPH A;  4M3C A;  2QJV A;  1R08 3;  2QQI A;  3H9A A;  1CX4 A;  4ASM B;  4AVT A;  2BBA A;  3CF6 E;  2KD7 A;  4QXC A;  1HV0 A;  1S1A A;  2VZ1 A;  3MIG A;  3P3P A;  4PDW C;  5HCB A;  4CXW A;  2RJK A;  4P14 A;  4R52 A;  5FY8 A;  4Y3O A;  4MHU A;  2VEC A;  5AVP A;  3OF1 A;  4CP9 A;  4M0H A;  2VNG A;  1GWM A;  4FO9 A;  5BNQ A;  4I0W B;  1O8S A;  2R7E B;  2JX9 A;  3PVB B;  4BJ0 A;  1X8E A;  3OY8 A;  1HDK A;  5JVV A;  4PIZ A;  3RDI A;  1UZZ A;  4YM3 A;  2DYC A;  1O91 A;  3ILN A;  4PQQ A;  4MGT A;  4TXW A;  3W21 A;  3O1R A;  1HXS 2;  1CAX A;  1LGB A;  2R06 3;  3K2O A;  3M3Q A;  3O7O A;  2QVS B;  5CZK A;  5EXO A;  5LA0 A;  3WF2 A;  1QXR A;  4B8E A;  4W8J A;  3TNP B;  1UZW A;  1UOB A;  4ISR A;  5I0S A;  1Z7S 3;  3K46 A;  1LGC A;  5AC9 2;  4ONU A;  1ND3 B;  4N43 A;  4YGB A;  3ZFF B;  4JGY C;  4OCT A;  3ZR6 A;  4MGQ A;  2P3I A;  1EAH 1;  1OPM A;  3C7O A;  4XF9 A;  4TN7 A;  5DAV A;  1RC6 A;  4MUV A;  4N53 B;  4AK3 A;  1LUL A;  1POV 0;  4W6Y A;  1Q3E A;  1R08 2;  3JB4 C;  4JKL A;  3IZO A;  2VUL A;  3RFR A;  3CBN A;  2ERF A;  1OPO A;  4JX0 A;  4XHB A;  5FRE A;  4ES9 A;  1FAY A;  4MGK E;  4Q2F A;  4YWA A;  5EIY B;  3FFZ A;  5FO9 B;  1JYW A;  2JDP A;  3VD7 A;  5KHK A;  3DKW A;  4DXZ A;  1ASJ 1;  4ARX A;  1XC6 A;  1MR5 A;  1MVQ A;  3LEI A;  4XOG A;  5FBJ A;  2W1W A;  4CSW A;  3NV3 A;  4UWD A;  3UL2 A;  5K0U C;  4MV2 A;  4FTB A;  4IV3 B;  3USU A;  5E6H A;  5APA A;  4AHW A;  2P34 A;  3RZH A;  3ITQ A;  1W6N A;  1VR3 A;  1WLW A;  2A6Y A;  4PJY A;  4BOW A;  2VC9 A;  1JS9 A;  2Z79 A;  5GJ6 A;  5A3U A;  3NO8 A;  3ZYH A;  2WLQ A;  2HBT A;  4OI2 A;  2R06 2;  3ZFG A;  5DZG A;  3CDZ B;  5IAV A;  4BIO A;  1GFF 2;  1UPS A;  1J3Q A;  1IS4 A;  2JDH A;  5FYU A;  5T55 A;  3ZFE A;  2D43 A;  1Z7S 2;  4F7Z A;  3NVC A;  1GZT A;  1MQT C;  1MVE A;  4FFH A;  4IQP A;  4AR2 A;  3TBD A;  2Q4S A;  1QJZ A;  4LR4 A;  1BYH A;  3ROU A;  4XZP A;  4Z82 A;  3TN9 3;  2NM1 A;  3PJQ A;  3VB9 A;  4AAP A;  3WNM A;  4QKB A;  2HWC 3;  1XB9 A;  3OGS A;  3VZN A;  4L2N A;  1J3R A;  2CNA A;  4FPF A;  1JXN A;  4YZ4 A;  3T2T A;  4CEY A;  2KXL A;  4WVZ A;  3ZMO A;  4YVW A;  4JHT A;  2X5I A;  4CTE A;  4ZON A;  5GZD A;  2BW8 A;  4JKM A;  3RZJ A;  2P17 A;  3ZYG A;  4NWV A;  4IXL A;  4XMI A;  4LNV A;  3VBF C;  3IDE A;  4XW3 A;  2VNO A;  1JYC A;  2PEL A;  4AQ2 A;  4GH4 C;  5FO7 B;  3I2F A;  2B7Y A;  3ACI A;  1SLI A;  5LBC A;  1AR6 3;  1LES A;  3WG3 A;  1XSQ A;  3NAP A;  1FMD 3;  1S0B A;  1PGW 1;  2WSU A;  4XJZ A;  4LK6 A;  4Q8L A;  2JG8 B;  3P1I A;  1VBD 3;  5C9A B;  4Y1U A;  5BNP A;  5E88 A;  4CU8 A;  3KGL A;  1B35 C;  2R04 1;  3KV9 A;  5D1I A;  1XBF A;  3AP9 A;  5FKB A;  4E4Z A;  2QQP A;  3F95 A;  5ABJ B;  1FPN 3;  1OOP C;  4B1M A;  1DGR N;  3J7H A;  4KU7 A;  4AFD A;  2JDN A;  4AF9 A;  3LCP A;  1JW6 A;  4I3G A;  3W5M A;  3TN9 2;  1PIV 3;  2R1D A;  5AC9 1;  3KGZ A;  1RB8 G;  3OD0 A;  3PVE A;  2BGP A;  2HWC 2;  5A70 A;  2VG9 A;  2W95 A;  4QGN A;  4UT5 A;  5DAQ A;  4X8P A;  2J1E A;  3WD5 A;  1LOF A;  2BOJ A;  4Y22 B;  1R08 1;  3CU7 A;  5KXB A;  4DOU A;  1KGY A;  3VDD B;  4PI2 A;  3WY6 A;  2DBI A;  2IXI A;  5J98 B;  4JDN A;  3MLL A;  2VUJ A;  4RA0 A;  3VBU C;  4K1Y A;  4CPB A;  3JQW A;  4KWU A;  2BDR A;  5CA6 A;  4BM8 A;  1VIW B;  4D6Q A;  5IVY A;  1DYK A;  1QJE A;  3TYJ A;  1AR6 2;  1IPJ A;  3GBG A;  5C5T A;  1ENR A;  1FMD 2;  3OYW B;  2ZEZ A;  4V1P A;  3H1W A;  4NVP A;  1AR8 1;  3JXS A;  4LTA A;  1VBD 2;  4NII A;  3MBW A;  3WDU A;  1UPI A;  3VKM A;  1LHW A;  4XQW A;  1F5J A;  1JZ8 A;  3ZYP A;  4DY5 A;  5A1F A;  1DYO A;  5KXE A;  4R9D A;  4YAR A;  1PK6 C;  1SLA A;  1MS3 A;  3NL1 A;  3O14 A;  2D93 A;  2R06 1;  1FPN 2;  1WMD A;  2GSY A;  3AZX A;  4CDQ B;  5J09 A;  3PL0 A;  4LIV A;  2AEZ A;  4OVE A;  1V6I A;  4MXW A;  1UNB A;  4KGQ A;  3I3M A;  1NG0 A;  1QDO A;  3SXW A;  4OQ9 A;  3RWN A;  1PIV 2;  5FPZ A;  4UBH A;  1N1V A;  5HCH A;  4PHZ A;  2W94 A;  1GNY A;  1VAK A;  4GMP 0;  1CGP A;  4PDW B;  4QX0 A;  4QKD A;  2VW0 A;  4QXH A;  3FBY A;  3VBO A;  1QWR A;  2PN5 A;  2W1Q A;  4RN5 A;  1H1A A;  4BHP A;  1EYB A;  4CDX B;  1C5H A;  1W6M A;  2Q5T A;  5FJK A;  1QJU 3;  1UQX A;  3LFI A;  2CY6 A;  3R4D B;  2JDM A;  1V6M A;  2Y34 A;  1VBB 3;  1N47 A;  3E5U A;  3HNY M;  1IS5 A;  3PTR B;  2GDF A;  3H0O A;  3RG0 A;  4QX2 A;  5FY0 A;  2XL7 A;  4MO3 M;  4A4A A;  3WW3 A;  5BNO C;  4QXK A;  1W0N A;  1HQL A;  4DXS A;  4WZF A;  1OF4 A;  3BTX A;  1AYN 1;  2LAL A;  1UMI A;  1TG7 A;  4BME A;  1RUF 1;  3VKN A;  1JTZ X;  3NNL A;  4JGY B;  2AR6 A;  2DCY A;  3AJZ A;  4KL1 A;  3J7M A;  4PIY A;  4DEQ A;  1BEV 3;  2RS3 3;  3JBG 3;  2AYH A;  1AZD A;  4DRV A;  1WMX A;  3V0B A;  1JH5 A;  3LIG A;  3DUI A;  4L8Q A;  3NNG A;  1C1L A;  1PGL 2;  1D7P M;  3VZK A;  1F35 A;  1UIJ A;  2HJI A;  3H42 B;  1V0A A;  3IIA A;  3IT8 A;  1T2X A;  4PLO A;  4UBG A;  1OMI A;  4XUQ A;  2RJ2 A;  4XF0 A;  1SFY A;  2DTY A;  1OI6 A;  4XJA A;  1XNB A;  4H3W A;  5J3U A;  4ZU5 A;  4NIG A;  4DUX A;  2JKB A;  5LY1 A;  4CEW A;  4XBN A;  4Y1Y A;  4QKN A;  3SNM A;  4JRL A;  5IAT A;  1YIF A;  1RUN A;  3LSE A;  4BXF A;  3VKO A;  5DZF A;  2LRO A;  5G05 L;  1QJU 2;  2R6Q A;  3JD7 3;  3O0W A;  2EAL A;  4GQ7 A;  5DAB A;  5FY9 A;  1QH7 A;  4BQ1 A;  3RNS A;  1QKQ A;  4FPG A;  1GYK A;  1VBB 2;  2PAK A;  3AYE A;  2H0V A;  2D3R A;  3MPP G;  2DCT A;  3I3E A;  2IVJ A;  2OX0 A;  5FMB A;  2W39 A;  1CJD A;  4RR3 B;  4RS5 C;  3ZYI B;  2HWF 3;  3MIE A;  2YRO A;  2YV8 A;  4U2A A;  3FUO A;  1S2B A;  2PLV 3;  2UWB A;  2XJS A;  1ND2 C;  3J7N A;  3Q8E A;  4XVH A;  4B7K A;  1A8M A;  5LCW L;  2RDS A;  1KXG A;  1T6G C;  2UWA A;  1X7N A;  2ZMK A;  1AR6 1;  2OYZ A;  3AB0 A;  4N7I A;  3HPN A;  4YG0 A;  1MQT B;  4XXA A;  4AWD A;  1CWP A;  1OLM E;  4FPH A;  4NAM A;  3U37 A;  1VBD 1;  1BEV 2;  1DIW A;  1NQD A;  1RMU 3;  1SPP B;  2RS3 2;  3JBG 2;  3PVO A;  3RMY A;  4GKX A;  3O1S A;  4P9W A;  4Y1V A;  5CIS A;  4XJ9 A;  1A6C A;  3ZXJ A;  5LWB A;  4PBP A;  4QWN A;  2L9L A;  4OUE A;  2MPF A;  2EIB A;  3AMQ A;  3MID A;  3AKP A;  2JWP A;  3MEP A;  4E2Q A;  1UOG A;  5IT6 A;  2HH9 A;  2E63 A;  1EPW A;  2UU8 A;  2ZKN A;  2BNO A;  1DZR A;  2AH2 A;  2WA4 A;  5C8C C;  1X33 A;  3GZT B;  3NW4 A;  5JIA A;  4XPV A;  3A0N A;  4B3N A;  5BYN A;  3VBF B;  4YZ3 A;  1LU1 A;  3ACL A;  4FQZ A;  4GH4 B;  3PUS A;  2Q8C A;  3LEG A;  2WSV A;  1QJF A;  1TNF A;  3KQ4 B;  4NPL A;  5KHG A;  3N36 A;  1KRI A;  4NAO A;  3S6P A;  1ZZ9 A;  4YRD A;  4YW3 A;  5LA2 A;  3ZKU A;  3III A;  1NA1 C;  2C4X A;  2HWF 2;  2VW2 A;  3AZY A;  3MFA A;  2ET1 A;  5HCF A;  1SG3 A;  2PLV 2;  2Z2S B;  4QPG C;  3AL5 A;  4XMA A;  4A7Y A;  5LB6 A;  1Y3T A;  5DAW A;  3D0J A;  2GP3 A;  1XSR A;  4IES A;  3IAP A;  5JPN B;  4ZU4 A;  5FPU A;  4XJU A;  4OHV A;  1RMU 2;  1NLQ A;  2J7M A;  3WNX A;  2P6H A;  1K45 A;  4V2W A;  4LUK A;  2VVF A;  5C8W A;  4DFS A;  3CZJ A;  4H14 A;  3BUC A;  2AAC A;  4LO6 B;  4UW4 A;  5K7P A;  4FFF A;  3ZXL A;  4QHB A;  2XLF A;  4UFI A;  3TAY A;  1DGR A;  3ACF A;  3AL6 A;  3GXU A;  5B4N A;  2JDU A;  3SKJ E;  4CCC A;  5LA1 A;  3IPV A;  3VBU B;  3KV5 A;  3PJY A;  5JZG A;  2C0Z A;  3IAQ A;  3ZMN A;  1O5L A;  1IPK A;  3ACG A;  1ZRR A;  1FX5 A;  4OZX A;  4P5H A;  5ERL A;  2BWC A;  1LHO A;  1OD5 A;  2XGX A;  4QD2 A;  2E51 A;  3HN3 A;  4XQD A;  5FZ3 A;  4XUP A;  1BLZ A;  1UY0 A;  3K3N A;  4TWT A;  1W39 A;  4D7S A;  3FLR A;  4GAL A;  2ENR A;  3WF1 A;  1XE8 A;  1XOY A;  3N9L A;  3BAL A;  3MUY 1;  5LY2 A;  2NZ9 A;  5F6K A;  3A7Q A;  3H50 A;  2XR4 A;  4MVT A;  1JI6 A;  2DUQ A;  1D2S A;  3K4D A;  1WBF A;  2FDK A;  4WM7 A;  1GZW A;  3HAG A;  4GKY A;  4NHK A;  3I2I A;  2BGO A;  3NNJ A;  1C3H A;  3GDB A;  3AX4 A;  2W3J A;  4EWE A;  3GHM A;  5CEH A;  3AK0 A;  4JDM A;  1BEV 1;  5JAX A;  2CSG A;  1BHG A;  2OPW A;  2GZW A;  1PX4 A;  2GC1 A;  3S7I A;  2BWA A;  4XET A;  2DCK A;  5CKQ A;  1DLC A;  3SCG A;  4KNC A;  1LED A;  2VCA A;  4RQP C;  1JOB A;  3C7H A;  5C3Q A;  4CCL A;  2XH6 A;  3WIN E;  2B46 X;  2VGD A;  4HZF A;  3U0Z A;  4Q0S A;  5TSW A;  3WDV A;  1UKG A;  4AFB A;  4E9K A;  2DVA A;  3JZV A;  1X36 A;  5BNO B;  5JXG A;  4ARY A;  1YHF A;  1TVG A;  1LHV A;  3B00 A;  3JD7 1;  3ME2 A;  4R4X A;  3GBF A;  4EJR A;  3I54 A;  3VHO A;  2A1X A;  5CAZ A;  1C28 A;  1RUG 1;  4KU8 A;  5C6C A;  4ZZ8 A;  4IUG A;  3PIG A;  5CG8 A;  2HWF 1;  4JTO A;  5SV8 A;  2QFE A;  3PVN A;  3AC0 A;  4KH9 A;  4A3Z A;  2PLV 1;  2NPI A;  2ZGK A;  2EXI A;  4PF1 A;  1LU2 A;  1S0I A;  4FAH A;  3OD4 A;  1GOF A;  1F4A A;  2WFF 3;  3IDA A;  1G8W A;  4AW7 A;  3GJA A;  5HBA A;  2TBV A;  2LTN A;  2VUA A;  3B5L B;  1OQE A;  2R49 A;  3OGG A;  2WO7 A;  3MIB A;  3B69 A;  1R09 3;  4LHS A;  4Q4Y 1;  3T09 A;  5B4X A;  3SH4 A;  2PAM A;  5FPB A;  2D3P A;  1ZM1 A;  5FP7 A;  1C8M 3;  4IL7 A;  3ZN5 A;  4A7K A;  2D98 A;  2NLR A;  1JUH A;  3AXD A;  4QQP A;  3LB9 A;  1LEM A;  3WNK A;  3VD4 A;  2Y0O A;  4WM8 A;  2QQU A;  2DCJ A;  4AOC A;  1OBN A;  2RM2 3;  1UN1 A;  2D6K A;  4HK9 A;  2FDJ A;  4UF0 B;  5HXM A;  3ZYF A;  2DVB A;  1IPS A;  4EZ4 A;  3E6B A;  4RS5 B;  4CU6 A;  4OHY A;  4LMF A;  5KHH A;  4COY A;  4CCO A;  1ND3 A;  4XJW A;  3ZFF A;  3AMM A;  3HWJ A;  1MAC A;  4QPI C;  1ND2 B;  1WLD A;  1J59 A;  4PBO A;  5E1R A;  3KVA A;  3N7K A;  3RWK X;  1DBN A;  1UZV A;  4BZ4 A;  3SKV A;  3C2U A;  1GBG A;  1QNW A;  2VMF A;  2XHK A;  1L7R A;  1J83 A;  1ZBE 3;  2EA7 A;  3ECQ A;  4MAD A;  5FIX A;  1VBA 1;  3NV4 A;  1OD3 A;  3KD4 A;  2Y6L A;  4N9I A;  1KIT A;  2FZ1 A;  2VAU A;  2YXS A;  4LHL A;  5CVR A;  5FZM A;  3I3B A;  1ZA4 A;  3ON7 A;  4GAZ A;  4P9J A;  4BH9 A;  2WFF 2;  2ZGO A;  5JXI A;  1RUJ 1;  1MZ5 A;  4E4H A;  2K0G A;  3O0V A;  4WV8 A;  3I59 A;  5C4W A;  3ETP A;  4WVW A;  4NN0 A;  3T2O A;  3ZN6 B;  3CJI C;  3WR0 A;  1QJY 1;  2OKX A;  1O6U A;  2LS6 A;  2IUW A;  1R09 2;  3FMG A;  5J48 A;  5C8C B;  2WS9 3;  1C8M 2;  5G04 L;  4K8F A;  4YM0 A;  3HD8 B;  3AXE A;  2Y8K A;  3IDC B;  1O4Z A;  4FXG B;  3KHC A;  1ZRF A;  2GP5 A;  2JE9 A;  2Q30 A;  3Q8B A;  5H9Q A;  1V6O A;  5I0D A;  3KV4 A;  2J1U A;  2RM2 2;  3GZE A;  4IGQ A;  1WW5 A;  2O8Q A;  1D4M 3;  3BYW A;  5FXX A;  1WMF A;  5JIU A;  2FCU A;  5IJR A;  4AED C;  1NA1 B;  1FV3 A;  1DG6 A;  1WBL A;  2RDR A;  1FV2 A;  2PYT A;  5F5A A;  2Y6G A;  3RZL A;  1Y7B A;  2WNV C;  3WP4 A;  2W87 A;  2XG3 A;  4QPG B;  4AVA A;  2PXJ A;  1RUO A;  5GLT A;  1AXY A;  1UYP A;  4J1X A;  2BUK A;  3HEI A;  5EQU A;  1TEI A;  1DLL A;  1W05 A;  2VJX A;  1ZBE 2;  2MEV 3;  2N7G A;  3OSD A;  4LXL A;  1XPW A;  1V6N A;  1CAV B;  3I2J A;  2IXJ A;  5I0U A;  4GWI A;  1WD3 A;  5FMO S;  1YI7 A;  2P6C A;  2UY9 A;  3VHR A;  4EYU A;  1K5J A;  4R9A A;  4D6S A;  1S0D A;  5F39 A;  2XHN A;  2YB7 A;  4IE4 A;  4U36 A;  5DN2 A;  4DRR A;  1SLT A;  5FY7 A;  1YIP A;  3J7L A;  2W91 A;  1K3I A;  3OUH A;  4M00 A;  3U11 A;  5ACA 1;  2WAA A;  1S4C A;  1POQ A;  4LKS A;  4I2O A;  5LK7 B;  2JG8 A;  1CR7 A;  1A78 A;  1O3S A;  1JU3 A;  5A32 A;  3KB5 A;  3TEW A;  2A6X A;  2WWS A;  2GME A;  1KFX L;  2Y64 A;  1D4M 2;  1NYW A;  5IK4 A;  1EUU A;  1QU0 A;  5EFU A;  5I8S A;  4DS0 A;  4AFM A;  3WDW A;  2B9V A;  3U10 A;  3AMP A;  1HB2 A;  4LBJ A;  1FNZ A;  4CP1 A;  4NR1 A;  5F32 A;  2AGS A;  3ALQ A;  1APN A;  1VRH 3;  3X29 B;  1G9C A;  1W2T A;  3VD5 A;  5IVE A;  4NPR A;  1NAE A;  2QQJ A;  4Q4V 3;  2XBO 1;  3JCI A;  2F17 A;  1PNG A;  2OT7 A;  1D0H A;  1O7F A;  2MEV 2;  4QM8 A;  3VBR C;  4Y5S A;  4LA2 A;  3ZSL A;  1AL2 1;  1AX2 A;  2P3J A;  1O59 A;  3ABZ A;  1YO8 A;  5IFT A;  3WUD A;  3MYX A;  4YW7 A;  5FWJ A;  2HEY F;  2BPA 2;  4HON A;  4SLI A;  1W8N A;  1Y4W A;  4CZS A;  4AZZ A;  5IVF A;  5FPV A;  4CCK A;  2A73 B;  1TNR A;  5L19 A;  2R07 3;  4RQP B;  3VHP A;  3AKQ A;  4HOO A;  4PF5 A;  3OYW A;  1SBF A;  4C1W A;  2PHW A;  4AVB A;  3LA7 A;  1IQD C;  4PT6 A;  3WUC A;  1GNZ A;  1R09 1;  2C5D A;  1ODN A;  2ARA A;  1Y43 B;  4IV1 C;  1AXK A;  1C8M 1;  5D8A C;  3SEE A;  1NUK A;  1DF0 A;  3QD6 A;  4BLI A;  3H8R A;  1DQ1 A;  2CAV A;  3MGU A;  2WUH A;  4WVV A;  3BOD A;  1NCQ A;  2QDR A;  5T5J A;  2RM2 1;  4CE8 A;  4M01 A;  3VZJ A;  2JJ6 A;  2R0H A;  2Q1M A;  2WO1 A;  4AVV A;  1IHM A;  3IMM A;  1NY7 2;  1VRH 2;  4GWM A;  4BE3 A;  2JIC A;  3ZXA C;  1JYN A;  3DCQ A;  3TOJ A;  2XQR A;  1H6Y A;  3UV9 A;  2ZGR A;  3INA A;  4QQO A;  5CYY A;  4MET A;  1SZB A;  1TME 1;  3UET A;  3VBS C;  1W6P B;  1GWL A;  1KJL A;  4Q4V 2;  4K40 A;  2JD9 A;  2XDV A;  4W65 A;  3OPW A;  5LBF A;  1KEX A;  5C70 A;  2X8K A;  4AI8 A;  5FJH A;  3FL7 A;  4CDX A;  1ZA7 A;  1Q8P A;  5HCA A;  2R16 A;  1ZBE 1;  3DL3 A;  4XUT A;  4JRA A;  2V4V A;  2D6L X;  4Y1Z A;  2I45 A;  3WQ7 A;  2YC0 A;  2Y38 A;  3NJV A;  4KWJ A;  4WVM B;  3GYD A;  4Y26 A;  4HN1 A;  2GC2 A;  1IS3 A;  4NO4 A;  1GQP A;  1LEC A;  4KMQ A;  2WIN B;  5A6Q A;  3LSD A;  1AYM 3;  1JYX A;  4RHV 3;  2QE3 A;  2XLG A;  3WNP A;  2R07 2;  3K48 A;  2DUR A;  2H0B A;  5JPM B;  4RD7 A;  1HKD A;  1OVP A;  5L9B A;  3WXP A;  2PHU A;  3GCX A;  4XF4 A;  1ZZ8 A;  4JCK A;  4XF1 A;  1GOH A;  3AYA A;  1RXF A;  5DG1 A;  2XL9 A;  2WS9 1;  5DUU A;  5FP4 A;  2GMM A;  3EXU A;  4QPI B;  5FXZ A;  5F6L B;  4H2A A;  2WNU B;  3OEB A;  1SBE A;  1LOE A;  2ZAH A;  4HL0 A;  1JN2 P;  3RQ0 A;  5CFC A;  2RE9 A;  3MF9 A;  1Q8O A;  1A3K A;  4FTE A;  1D4M 1;  1OLR A;  4A2U A;  4QM9 A;  5J36 A;  5F8P A;  5LBB A;  1C1F A;  4NRO A;  4W50 A;  3RZK A;  5DPN A;  2VZT A;  4E2S A;  2V72 A;  4IGO A;  2W1S A;  3WNO A;  2BBV A;  2AEN A;  2C24 A;  4IE7 A;  4DNY A;  3TEY A;  4B7E A;  5FQ0 A;  4N43 C;  2IXC A;  5GLV A;  5EYY A;  1U5X A;  1AHS A;  2RS1 1;  2ZHM A;  3BOW A;  3OUJ A;  1ULP A;  3OUI A;  4AVS A;  1WW4 A;  5FZO A;  2XVG A;  3U1X A;  1B09 A;  4YM2 A;  4CDW A;  1WD4 A;  4COU A;  1I3H A;  2ZGN A;  1COV 1;  1AYM 2;  1KD7 A;  4RHV 2;  1J1L A;  4RR3 A;  1S0C A;  1YWK A;  5FZ6 A;  5HV4 A;  3S0M A;  4KG0 A;  3S5A A;  2QKD A;  1M06 G;  3DPR B;  3DEC A;  1N3O A;  3LWC A;  5F5I A;  5FWE A;  3WNL A;  4BA6 A;  2Z69 A;  2VOK A;  3S30 A;  3FLT A;  3ZYB A;  3N9P A;  3RI8 A;  1LKN A;  2WZP P;  4AED B;  2JG9 B;  3CJX A;  4LUM A;  3M3C A;  5FYM A;  1Q56 A;  2WQ4 A;  3HIF A;  4Q4W 3;  5CKM A;  2WNV B;  4MGZ E;  4B1L A;  1H9P A;  2E6V A;  3ZPY A;  5AVA A;  1YQ5 A;  1F9K A;  2YBK A;  1OHF A;  5IVB A;  4YZ1 A;  4XTP A;  3IBM A;  5ANQ A;  4L11 A;  3T1M A;  5KHI A;  2ZA9 A;  3BI3 A;  4XAB A;  2BER A;  2MNG A;  3D4K A;  3KF5 A;  4P02 B;  4QGL A;  4Z07 A;  1MS1 A;  3ZFG C;  2YC4 A;  3AFK A;  2YDE A;  4ZU7 A;  2RV9 A;  1H8T B;  3NNF A;  4NIH A;  4XFA A;  3ZFE C;  2UUR A;  5A7W A;  1W3V A;  3B9C A;  1NY7 1;  1NZC A;  2EIC A;  1NCR A;  5DDJ 3;  1E57 A;  2WL1 A;  4C0B A;  4P9X A;  4Q4V 1;  3T0B A;  3T0A A;  1RUH 3;  2PHX A;  2VOT A;  3Q9O A;  5L7O A;  2A6Z A;  2WT0 A;  4UYB A;  2BNM A;  2WFP A;  4CEY C;  1VMH A;  4P08 A;  4QB2 A;  3UES A;  1POV 3;  3AVR A;  1RUI 3;  4YVW C;  4Q0P A;  1AL0 G;  4OI0 A;  3OJB A;  3AM2 A;  2X5I C;  2YGL A;  4TLF A;  2HWE 3;  4Q0V A;  1HB1 A;  1HXS 1;  2DUO A;  3POE A;  5C33 A;  1HB3 A;  3I2G A;  1JZ7 A;  4ZKT B;  1Q5O A;  2ZMN A;  3KCX A;  1WA4 A;  4Q4W 2;  3C7E A;  2HWD 3;  3OGV A;  4Y20 A;  3WG1 A;  2AEY A;  1QEX A;  3J26 N;  4XFF A;  4E8D A;  1JZ2 A;  3POF A;  2DTW A;  2RJL A;  1GLH A;  3D6E A;  1I6X A;  1QGL A;  3NAP C;  1Y9M A;  3LDR A;  4K9S A;  2SLI A;  3O1P A;  4OHZ A;  2XWB B;  1RUE 3;  1CIW A;  1QJX 3;  2VQU A;  3RS6 A;  3ZSE A;  5JUV A;  1ZRI A;  2NN8 A;  1RL3 A;  5BNP C;  4JGZ A;  3D0S A;  1FNY A;  2RG4 A;  2HLE A;  2RR1 3;  5T3N A;  3HR9 A;  3VBR B;  2DVG A;  1H1I A;  2K9Z A;  5IVV A;  1ST8 A;  3I2H A;  2EXK A;  4XFB A;  5L9R A;  4BDV B;  2WZ8 A;  5J96 B;  3DYO A;  2R32 A;  4CU9 A;  3WW2 A;  3N35 A;  4MYE A;  4AE2 A;  5DDJ 2;  1YFY A;  5FZH A;  2ETE A;  2DFC A;  4F8A A;  1HX6 A;  2ZEX A;  2ORX A;  3HQR A;  3ZXG A;  2ZJC A;  3PLQ A;  1RUH 2;  2CHH A;  4UFJ A;  4CCE A;  2EXJ A;  2JB8 A;  3DKQ A;  4LHN A;  2P3K A;  5BUV A;  1UMZ A;  3CHX A;  1W6O A;  1W99 A;  1WLT A;  3I8T A;  3NJZ A;  1EV1 3;  1VAM A;  1ZZB A;  1LOF C;  5H9R A;  1LOD A;  3T4H B;  4D69 A;  1RUI 2;  3MW4 A;  4MHR A;  1DYP A;  3FBM A;  4IV1 B;  4ATE A;  4RYD A;  2P1B A;  3HVD A;  5IWF A;  4AQS A;  5FPA A;  2HWE 2;  3ES1 A;  4LBQ B;  1AYM 1;  4OHW A;  4RHV 1;  3K75 B;  1QXP A;  2Y33 A;  2J1V A;  5FOB B;  2YU2 A;  2CGN A;  2HWD 2;  2IVI B;  2ZEY A;  4H55 A;  1MEC 3;  4LOS A;  1HN0 A;  1JHJ A;  3UGH A;  5J1X A;  3BB6 A;  1Z7S 1;  3HMY A;  5HI0 A;  5IYY A;  2B4K A;  4RGK A;  1RUC 3;  1UD1 A;  1RUE 2;  1KJR A;  2BTV C;  1IKP A;  1QJX 2;  1S2E A;  3NNM A;  3RGB A;  3ZOI A;  4C91 A;  2WJS A;  5C5U A;  5A1L A;  1DGW X;  1W04 A;  3KZ4 C;  4XUO A;  2CDP A;  4EN8 B;  1W9Y A;  3WLU A;  2RR1 2;  1I5P A;  2ET7 A;  2XUM A;  4Q8K A;  1N3Q A;  3NWK A;  4O7X A;  1DGW A;  4MH0 E;  1SCS A;  2JE8 A;  5L73 A;  5EZW A;  1XU1 A;  5E89 A;  3ELN A;  1LHN A;  2WWJ A;  3LPF A;  4M3C B;  5FRA A;  3BCW A;  4NRP A;  1ALY A;  3UJQ A;  5IVC A;  2JDY A;  3FLP A;  4XIL A;  1WCQ A;  3QBQ A;  4H7M A;  4ZXE A;  2NQY A;  4N7U A;  2QDN A;  1MZ6 A;  3UJO A;  1F15 A;  3KVB A;  4PIX A;  1EV1 2;  2Q1F A;  2VZV A;  4MSV A;  2UYA A;  3N9O A;  3U75 A;  3CQO A;  3VBO C;  4CP9 B;  4YZ2 A;  4GB3 3;  3EYP A;  4M3C F;  3MZH A;  5D2A A;  3JQX A;  3OBT A;  1PX3 A;  1H2K A;  3U78 A;  3OY8 B;  2G1M A;  5DUW A;  1CON A;  2BEO A;  2VTX A;  3GNE A;  4G3Y C;  4MXV A;  2FQP A;  3UKN A;  5BNN A;  1OUX A;  4NUB A;  1BMV 2;  5F9T A;  2WT1 A;  1MEC 2;  3ZSK A;  2Y6J A;  3PU3 A;  2G9Z A;  1CAX B;  4IEW A;  4QX5 A;  2XML A;  5FUP A;  2VD7 A;  3HQX A;  1RUC 2;  4N90 A;  5KC5 A;  4J6G A;  4JQR A;  4Q4W 1;  3THC A;  4KI5 M;  1ZRC A;  1O3T A;  1UOF A;  4LQR A;  3TN9 1;  5IUQ A;  1Y9Q A;  5A7Q A;  2E7A A;  3WW4 A;  1OH3 A;  4N43 B;  4XCB A;  4AI3 A;  3O1U A;  4S2F A;  1VBE 3;  1HV1 A;  1XE0 A;  3CEW A;  2AUY A;  2HWC 1;  3PUA A;  5JOZ A;  1CJP A;  2F6B A;  3E5Q A;  2KM2 A;  4HT1 T;  1UYX A;  4TLG A;  3PUI A;  3OCP A;  5F3C A;  2GN3 A;  2O1Q A;  5KC6 A;  1W9S A;  3RJR A;  1CAU B;  2WRA A;  4MGI E;  1V00 A;  1SDD B;  1JOD A;  2AZ5 A;  3EJK A;  4DXR A;  3WF3 A;  2DFB A;  1BK0 A;  5I8Y A;  5DDJ 1;  2WZR 3;  3ETQ A;  4CEW C;  2IFW A;  1PO2 3;  2QNK A;  4Q4X 3;  1RUH 1;  2W08 A;  2YZ4 A;  1X8M A;  3N9M A;  4O65 A;  4GB3 2;  4LIT A;  2JIG A;  1RYY A;  1FMD 1;  2SBA A;  4GMP 3;  5EPA A;  2XJV A;  1ULE A;  4CU7 A;  3MFC A;  1MS4 A;  2JIJ A;  3B01 A;  3LQC A;  4ISQ A;  2GN7 A;  3USU B;  1Z0H A;  1BKZ A;  1POV 1;  1W28 A;  3ILF A;  4W6W A;  5FZC A;  3SLI A;  4Y1X A;  4CDU A;  5FYZ A;  2HWE 1;  2VZQ A;  4YVS A;  2YPJ A;  3BU0 A;  2WZE A;  3BVC A;  3ZX7 A;  1FPN 1;  3PTY A;  4FBF A;  3L9J T;  4AG4 A;  3JUU A;  5SV5 A;  5D21 A;  3EB7 A;  5FYB A;  5I0R A;  2JDK A;  4A45 A;  3SIT A;  2D3S A;  1FI2 A;  4WBB A;  4XIO A;  3ZFE B;  2XJU A;  3CLP A;  4FP3 A;  2ADD A;  1PIV 1;  1WGP A;  2QQW A;  1CZT A;  2WN3 A;  3NMB A;  5JDB A;  1AJK A;  3GJB A;  1VBE 2;  3D3A A;  5FXV A;  4E8C A;  3U4S A;  4AHX A;  4HKO A;  1QJX 1;  1OUS A;  4YFW A;  1YCI A;  4FFG A;  4HVR A;  3FUQ A;  4QDR A;  1AUY A;  2VMC A;  4IE0 A;  2VM9 A;  3PDQ A;  3I2K A;  2RMU 3;  2RR1 1;  3OPT A;  5F5Q A;  3O5S A;  4AI0 A;  2V5Y A;  4P5Y A;  2VMG A;  2ZX3 A;  4A6O A;  3GHN A;  4CEY B;  4EWD A;  4URT A;  3NST A;  1NA1 A;  2VO5 A;  1JUI A;  4M3C E;  2VOV A;  4YVW B;  1B35 B;  3O0X A;  2VZ3 A;  5FP8 A;  4B4R A;  2NMN A;  2WZR 2;  4D7T A;  4KQ7 A;  2X5I B;  5A6Y A;  1P8J A;  3DXU A;  1PO2 2;  4Q4X 2;  4IEY A;  3AKT A;  1LTE A;  4GZ9 A;  2Q8O A;  1SAC A;  3O1V A;  1OOP B;  3N7J A;  2A6W A;  3QOP A;  1MZE A;  3TEX A;  3B9I A;  1G7Y A;  2VE1 A;  2E7Q A;  2YFZ A;  4FPY A;  5GLU A;  1W6Q B;  2BP6 A;  2QQM A;  4KWK A;  1REE A;  3MPB A;  4JHZ A;  4YW4 A;  1FOD 3;  4QPY A;  5FZK A;  3NAP B;  1LHU A;  3PHM A;  4K20 A;  3ZIW A;  1OSG A;  1X82 A;  3C7G A;  1G86 A;  3IWZ A;  1PMJ X;  5BNP B;  1AVB A;  1OA4 A;  1GMM A;  2VVD A;  1UF2 C;  2CWM A;  4NHY A;  4YG3 A;  3ZDV A;  2I07 B;  1JU4 A;  1QIQ A;  3C8X A;  3AVS A;  1M4W A;  3CMG A;  4LBN A;  4XDO A;  5A33 A;  1BMV 1;  1PGL 1;  3V0A A;  2G9F A;  3MHZ A;  3LOB A;  1DCS A;  1S2K A;  3K4Z A;  3ATG A;  5FFO C;  1YLL A;  4HFS A;  2DVD A;  2BFU S;  4FVV A;  1EPZ A;  1W90 A;  3BIE A;  2YHJ A;  4Q26 A;  4XEZ A;  1CAW B;  1WUV A;  1U5Y A;  1G9F A;  2PTM A;  1YQ6 A;  1ZZ7 A;  2BYV E;  2RMU 2;  3HN1 A;  5KR7 A;  4D3W A;  2R0F A;  5LAT A;  4ATF A;  1TMF 3;  4YZ5 A;  1PGS A;  1QJU 1;  1ULG A;  2JEC A;  3KV6 A;  4FPE A;  3SH3 A;  3FWE A;  5T50 A;  1W9W A;  3NJX A;  4R4Z A;  3MIC A;  3AKS A;  4UFK A;  3U4X A;  1VBB 1;  2QQO A;  2VH9 A;  3HNB M;  4CA9 A;  1PK6 B;  4ASL A;  4G9S B;  3POJ A;  4UFL A;  1K5M A;  4Y5T A;  3VKL A;  3ZN4 A;  4QHO A;  5FZB A;  5BY5 A;  3WNN A;  5F2W A;  4AYU A;  5JZG C;  2VZP A;  1V70 A;  3VDA A;  3UNP A;  3OGR A;  4XZU G;  5K0U B;  2GU9 A;  3W5N A;  1LEN A;  1K12 A;  3BGA A;  1FOD 2;  2ZX2 A;  3BKZ A;  4GB3 1;  1W03 A;  3UKT A;  5HV0 A;  4FP2 A;  2WII B;  3EO6 A;  1AX0 A;  3FZ3 A;  2GND A;  1S0F A;  3TB0 A;  1WWY A;  1F8V A;  2RS3 1;  3JBG 1;  3KLS A;  3HJR A;  1VLN A;  4HG6 B;  4RFT 0;  1ULO A;  4CCD A;  1NKG A;  2W9X A;  3LA3 A;  3K3O A;  4HPK A;  3UGF A;  5T5O A;  3AYD A;  1GSL A;  3DEM A;  1LGN A;  4X8N A;  5JI7 A;  5CFD A;  1GIC A;  4C90 A;  5JSO A;  2ORZ A;  4OFG A;  1V9U 3;  3IM0 A;  4WM7 C;  1AR9 3;  1ZZ6 A;  3DF0 A;  1SDW A;  4LKE A;  4LBK A;  3VBH A;  2BU9 A;  2F4P A;  1VBE 1;  2YBS A;  3OBZ A;  4BK5 A;  4DIQ A;  5FZD A;  5A6Z A;  2B39 A;  5J37 A;  1YQ2 A;  1TMF 2;  5FZL A;  5A7N A;  3VL8 A;  1GKB A;  2G4I A;  2GH2 A;  3KT1 A;  1BBT 3;  3VBO B;  3C7F A;  3TNQ A;  4D8M A;  4QQL A;  4ERO A;  5FZF A;  2VXR A;  5FP9 A;  1JYI A;  3AP6 A;  1QY4 A;  1XE7 A;  1W6M B;  1J58 A;  2OW4 A;  4HKL A;  4K6B A;  1FT9 A;  3N3H A;  4BMB A;  1LOA A;  2ZKL A;  1SMV A;  3ZVX A;  3ACH A;  3IMN A;  2DU1 A;  3I2O A;  2WZR 1;  3MDP A;  3B93 A;  2ATF A;  3LDK A;  2H6C A;  2Y6K A;  2BVB A;  4Q4X 1;  3SC7 X;  4E27 A;  3UKV A;  4BPZ A;  5FLI A;  3CNA A;  4IEV A;  2CV6 A;  3O1T A;  4FOY A;  3LE0 A;  4AI1 A;  4IEZ A;  4GMP 1;  4XAC A;  1QXJ A;  1QNY A;  3MW2 A;  4YW2 A;  2KR2 A;  5M0T A;  4DUW A;  1OLQ A;  4BLJ A;  1SLC A;  5FMO L;  5LEK A;  3KT4 A;  1RMU 1;  1R1A 2;  3MV1 1;  2GC0 A;  2VZR A;  1ZBA 3;  5C71 A;  3EHK A;  3THP A;  5JOX A;  1G9B A;  4IEU A;  3BN6 A;  3MF6 A;  4RGG A;  1X50 A;  4YW5 A;  1XJA A;  3I4I A;  3THD A;  3AYC A;  4QX8 A;  3SH5 A;  4AVC A;  2WO3 A;  2XQX A;  2Z42 A;  2YPD A;  5FZE A;  5IHR A;  1ZRD A;  5FPL A;  2WAB A;  1V9U 2;  3PNA A;  1IG0 A;  4DUV A;  1AR9 2;  2C6S A;  3AMN A;  4DY3 A;  2XJT A;  2VQT A;  2IFR A;  5AFB A;  4Z92 B;  5GZE A;  5FDB A;  2X53 S;  4FOQ A;  1HJF A;  1S55 A;  2X05 A;  4CEW B;  4UW3 A;  5JSR A;  2X10 A;  1KS5 A;  1BBT 2;  2QUO A;  2WNU A;  4ZS3 A;  4N53 A;  1DU3 D;  1VMF A;  2E31 A;  1Q8Q A;  5FCC A;  3POG A;  4WM8 C;  1W2N A;  3WQB A;  3VZO A;  5EHD A;  3E6D A;  2JB4 A;  5DMY A;  4LO5 B;  2XUE A;  2VTX J;  4LK7 A;  2VVE A;  1ND3 C;  3ZFF C;  1DGL A;  4AGG A;  1US3 A;  1YXW A;  4DB5 A;  2RHP A;  2CAU A;  4XJ8 A;  1ZX5 A;  1UWW A;  4IV3 A;  4HVQ A;  3T0D A;  3KT7 A;  2OII A;  1H2L A;  1ZBA 2;  2WN2 A;  4PLM A;  4AEK A;  2ZHN A;  5FLJ A;  4QGM A;  4XIK A;  1FAT A;  2Y6F A;  5FMC A;  1O3Q A;  1H2N A;  4AFC A;  2YC2 A;  4RSU A;  1MS8 A;  4OMD A;  2BZD A;  3DPR A;  4XBL A;  4ZHN A;  3ZXF A;  5JXJ A;  1AF9 A;  1H8V A;  3LF7 A;  5EYX A;  2VU9 A;  4KG8 A;  5JSP A;  4IDZ A;  3VD9 A;  4K8R B;  1DZT A;  1VMJ A;  1OC1 A;  3ZXD A;  4OQ8 A;  4NID A;  2ZCW A;  4R9C A;  2JG9 A;  5C4W C;  3M70 A;  4GWJ A;  3VD3 A;  4Q1P A;  4Z2A A;  2PQQ A;  5DUV A;  5FYS A;  4ASK A;  3APB A;  1DQ6 A;  1PZ8 A;  1W8W A;  2VCM A;  2A3W A;  3Q8C A;  4LBO A;  4YSF A;  1GUI A;  3ZLI A;  2I2S A;  2V5D A;  2XON A;  1LOB A;  2C1F A;  1TMF 1;  2WWU A;  3EBR A;  5FZ0 A;  5GZG A;  5IAX A;  4V2V A;  1Q43 A;  4EN0 A;  5FUI A;  4BWO A;  1H8T A;  1E5S A;  5E8A A;  2XKP A;  1GU3 A;  1H2M A;  1ZVF A;  1UMH A;  2C26 A;  3KHB A;  4ITC A;  3A21 A;  5F3I A;  4EN6 B;  5H9P A;  1C4R A;  4I01 A;  3RYP A;  1XRU A;  1MZF A;  2KA3 A;  2RDQ A;  2WO2 A;  3POI A;  3T30 A;  1XNC A;  2VTF A;  2EVX A;  1L7L A;  1J3P A;  4Q29 A;  1FXZ A;  4CVU A;  3AZV A;  3E1F 1;  3OEA A;  1DFQ A;  4W4Z A;  5CKN A;  5FR3 A;  5T5P A;  3WV6 A;  4N8M A;  5C9A A;  5JMO A;  5CG9 A;  1QH6 A;  4NHM A;  2WYS A;  1R1Z A;  1V6L A;  4LBM A;  3WCR A;  4E4S A;  4BU2 A;  4J25 A;  3IN9 A;  1PM4 A;  5CU1 A;  2A6V A;  1OH4 A;  3QCW A;  4IE6 A;  4AFA A;  2VUD A;  5ABJ A;  3ENR A;  1GNH A;  5CIR A;  2WKK A;  5BPX A;  2YG0 A;  4COW A;  1HRV 3;  2BJS A;  1F31 A;  1MS0 A;  1V9U 1;  1GP6 A;  2PHD A;  1OQD A;  1BVV A;  2TEP A;  3MI8 A;  4NPM A;  1E5H A;  5L9V A;  3TWI A;  4QKF A;  3IPV B;  1PVC 3;  3VV1 A;  1S0G A;  1ZZC A;  5LAS A;  5A7O A;  3ASI A;  1JYT A;  3LFM A;  2CGP A;  1NQJ A;  1BBT 1;  1C57 A;  2VMD A;  4FSJ A;  1E5I A;  1UOJ A;  3WQ0 A;  3OG2 A;  5FYC A;  5T5L A;  1O5U A;  4Y22 A;  3AZW A;  2TNF A;  2FDI A;  2JDZ A;  4QT6 A;  3VDD A;  5A80 A;  2XKO A;  4FQ4 A;  3U07 A;  1UYZ A;  3C3V A;  3DYP A;  4HKW A;  3GGL A;  5B2G B;  1CZV A;  1IZ3 A;  5FAX A;  1ULC A;  3SQO A;  3I3Q A;  2J1R A;  3SIS A;  1A8D A;  4OLL A;  2FZ2 A;  3OBR A;  4G4F A;  3VKF C;  4FOV A;  4BQX A;  1WA6 X;  4XFG A;  2WFF 1;  1MS5 A;  4CXX A;  4OMC A;  3SEP A;  2XPJ A;  3GCW A;  3EMR A;  5FZA A;  4TSV A;  3WX5 A;  3E97 A;  4COZ A;  1PMI A;  3I49 A;  4D0Q A;  4I09 A;  2ZXQ A;  1GZW B;  1OLM A;  4WM7 B;  4XE9 A;  4LOT A;  2LUW A;  1YJL A;  4FPO B;  4O9G A;  5IK5 A;  1WCS A;  1ZBA 1;  5T54 A;  5JWP A;  2RS5 3;  3R05 A;  5FY5 A;  4LLF A;  4LBQ A;  5EJZ B;  1STM A;  4AL9 A;  1UKR A;  3DV8 A;  1GQH A;  4CDQ A;  5A6X A;  2JDA A;  1N1Y A;  4DO0 A;  3L2Y A;  3RJ2 X;  2CTV A;  1DQ5 A;  1HRV 2;  2R04 3;  2TUN A;  3POS A;  5FZ4 A;  2J42 A;  2YUE A;  2ZGL A;  4UW6 A;  4XDP A;  4IND A;  3S7E A;  4E4D X;  3QH6 A;  4A7Z A;  2ZOE B;  4BYY A;  1OA2 A;  3VDB A;  2WNO A;  1PVC 2;  1AR7 3;  1LNS A;  1IG3 A;  3D5O A;  2HYK A;  3HT1 A;  2W46 A;  2VZO A;  4FPK A;  4PDW A;  5FZ9 A;  1YUD A;  2ARC A;  4A3X A;  2VQA A;  3M7A A;  1RTV A;  4XC9 A;  4GA9 A;  2CYF A;  3N7L A;  1W2O A;  4QDQ A;  3ZKY A;  4KBB A;  1IGO A;  2GAU A;  1HB4 A;  4BQ2 A;  1HQN A;  4FT8 A;  3SCH A;  2W68 A;  2E9Q A;  3UYJ A;  3HBK A;  2ZX4 A;  2OUJ A;  1NCQ C;  2GMP A;  4K21 A;  2FD8 A;  3KCC A;  5DXD A;  1VRB A;  4ZXK A;  3WHU A;  4HET A;  3LZZ A;  5CNA A;  4HSL A;  2QQV A;  4Q0U A;  3PUR A;  1G9D A;  1NXD 1;  2HYX A;  1QOT A;  2P5B A;  1SCR A;  2ZAB A;  4EN9 B;  2RS5 2;  4LO4 B;  1PMH X;  1GAN A;  1PGW 2;  4FCA A;  4Y5Z 0;  4JGY A;  4CDX C;  4IER A;  1AR8 3;  5F37 A;  2VY0 A;  2JEN A;  4KWL A;  4XBQ A;  3ILR A;  2R04 2;  3M3I A;  3ES4 A;  3KQR A;  4LBQ D;  5A3O A;  1DZQ A;  5DAX A;  5LBE A;  4WM8 B;  4DMI A;  2D5F A;  1C5I A;  4BB3 A;  5C3S A;  4GIQ A;  1AR7 2;  2YY1 A;  2A71 A;  1VAV A;  1RUD 3;  3E5X A;  1RED A;  3H7J A;  2XB6 C;  2ZGQ A;  5F3E A;  3T4V A;  1CX1 A;  1QDC A;  2D5H A;  3P6B A;  3NKG A;  4AI2 A;  1US2 A;  2OZJ A;  3WG2 A;  4EZH A;  5LRS A;  4BQ4 A;  3THT A;  3WF4 A;  5CBL A;  4A41 A;  5EJ1 B;  2B45 X;  3CJI B;  3J9S A;  5K0U A;  4HN0 A;  1GWK A;  4OYU A;  5FYT A;  2MEV 1;  5CFC C;  3P5B A;  4NHX A;  3KSC A;  1UXZ A;  2RVA A;  5FZI A;  1CAU A;  5F1R A;  2XXZ A;  4CCJ A;  4CUC A;  1U12 A;  3MV0 1;  1NZI A;  3W59 A;  2D6O X;  5A3P A;  4RFR B;  1DP0 A;  2QQK A;  1L3J A;  1WW6 A;  2JXA A;  2V73 A;  2VCB A;  3LGR A;  4FPJ A;  4HVO A;  5C3O A;  3AJY A;  3RZG A;  1JYV A;  1S0J A;  3WEZ A;  4L97 A;  4EV0 A;  4D6R A;  2YMZ A;  5IVJ A;  1OFN A;  5JI9 A;  5KXD A;  3POB A;  1AX1 A;  1MQT A;  3I59 B;  5C4W B;  1K42 A;  1OA3 A;  4W6X A;  1ODM A;  4F83 A;  1AYN 3;  1AR8 2;  4B29 A;  1G9A A;  4CDW C;  1URX A;  2HWB 3;  4MGS A;  1SPP A;  5IW0 A;  1XYN A;  1RUF 3;  5BV6 A;  1U5I A;  1XNA A;  1GP4 A;  3MO4 A;  2VL4 A;  2ZS6 B;  3PMS A;  4RR3 C;  3FFQ A;  3W9A A;  3ZXE A;  2ZML A;  3POW A;  4CUB A;  2B8M A;  4MG2 A;  4COV A;  1HRV 1;  2I74 A;  2W2I A;  1RUD 2;  4ZS2 A;  1I5Z A;  1YQC A;  4L92 A;  4NE9 A;  2VPV A;  2QZ2 A;  4AHZ A;  1JZ5 A;  1CD3 G;  1VRH 1;  1PVC 1;  4AXO A;  1J84 A;  2YFU A;  3LD8 A;  4YM1 A;  4XTM A;  3CL1 A;  3VBF A;  2WAO A;  1H6X A;  2YGM A;  4NHL A;  5A7P A;  2Q0A A;  2ZX1 A;  2ZGS A;  4GH4 A;  1HJG A;  3LDB A;  3PU8 A;  3AP4 A;  1BK1 A;  3MLJ A;  4YYO A;  1HIX A;  2GNB A;  5KXC A;  1SFN A;  4QDS A;  5FY1 A;  1W2A X;  2HEV F;  2WBK A;  1UY1 A;  4LE4 A;  2PA7 A;  4NOT A;  2DU0 A;  5F3G A;  5IK8 A;  2PQS A;  3DXT A;  3WW1 A;  1X9T A;  5IK7 A;  1B35 A;  4JKK A;  4CRQ A;  4UAP A;  4YGC A;  4QQ2 A;  5BXX A;  3W20 A;  3Q8A A;  1XYO A;  1ACC A;  3S57 A;  2R07 1;  1V6K A;  2EF6 A;  1NCR C;  1OOP A;  2P4E A;  3M1H A;  4IEX A;  4EQV A;  4YGE A;  1YNA A;  4C0H A;  4BCU A;  1QOS A;  1AYN 2;  1W6Q A;  2HWB 2;  4XDQ A;  3DN7 A;  3H1Y A;  1RIR A;  1RUF 2;  2R30 A;  1XNT A;  2VME A;  2RS5 1;  5L7O C;  3H1M A;  2A75 A;  2J1A A;  1J1T A;  1X9P A;  3NQH A;  5AFE A;  5A32 B;  4JQT A;  4OI1 A;  1D0G A;  1SLB A;  4XAA A;  3F2Z A;  4CCM A;  5FMD A;  2K2S A;  4LE3 A;  1UW8 A;  3K77 A;  1LAJ A;  2E53 A;  5DG2 A;  2ZBJ A;  1H30 A;  1AR7 1;  3VBU A;  4BK4 A;  4QB6 A;  2W47 A;  3WG4 A;  2EIE A;  4QPW A;  2GAL A;  3QLQ A;  1CAW A;  1UZ0 A;  1R64 A;  1H0B A;  3B7M A;  3M8L A;  3FHQ A;  1O4Y A;  4P9G A;  3RI9 A;  3WP3 A;  3PUH A;  1YC6 1;  1PHM A;  5FKC A;  1WCD J;  2QZ3 A;  5JOY A;  4FOW A;  4JGZ C;  1NOV A;  1RJ8 A;  2VNV A;  5FLH A;  3WZ1 A;  2E32 A;  2VUC A;  1JZ6 A;  1LB2 A;  2VMI A;  1GP5 A;  1QOO A;  2D44 A;  2EAK A;  2RDN A;  5D8A B;  1HW5 A;  1PK6 A;  1ZNP A;  4XFI A;  4UOJ A;  4YGD A;  4GXL A;  3IKW A;  3ZO0 B;  1DDL A;  1C8N A;  2PAE A;  4EWA A;  1PO1 3;  2NYY A;  2ZZQ A;  4JTN A;  5GLW A;  2P37 A;  4ORF A;  2XWJ B;  2XVK A;  1OUR A;  4PCR A;  5I93 A;  3LEM A;  2ZTN A;  1XND A;  3I97 A;  4IEO A;  3VBS B;  2CWS A;  1CZS A;  4JVA A;  2WYF A;  4TTG A;  4XFC A;  3ZDS A;  4SBV A;  3WQ1 A;  3NJY A;  2D7F A;  2DUP A;  4FXK B;  3DYM A;  4LPL A;  1F2N A;  1H1M A;  2P2K A;  2Z5W A;  4GWN A;  1NCQ B;  4PLN A;  4R8H A;  2A3Y A;  4K1Z A;  4QU2 A;  1RUD 1;  3BTZ A;  2VXJ A;  1O3R A;  2XLA A;  3A4U A;  3R6S A;  4JDO A;  2FDG A;  3VL9 A;  5FYH A;  2O8O A;  2WR9 A;  1UX7 A;  4XCA A;  5FYY A;  4X6R B;  3B94 A;  2CDO A;  4BQW A;  2VOW A;  1A34 A;  5BNO A;  4EE2 A;  5GZF A;  4IW3 A;  2QBX A;  1YFW A;  2YU1 A;  3UK9 A;  3FHA A;  2A70 A;  4QHZ A;  1CPM A;  2J1S A;  5KBF A;  3H3L A;  4YNI A;  3ZR5 A;  2ARX A;  1MPX A;  3D82 A;  3OGJ A;  2ZHK A;  4TZD A;  2Y6H A;  5FZG A;  2QQN A;  2Y26 A;  4AGV A;  2VR4 A;  5A3L A;  1WME A;  1UY3 A;  3R0R A;  2EIG A;  3PUQ A;  1JOJ A;  1PO1 2;  1RHI 3;  4O9E A;  2ARB A;  2JKX A;  1EP0 A;  1VP6 A;  2VCC A;  2IWG B;  1OT5 A;  4CPB D;  5J7M A;  3VUO A;  3V64 A;  5JMC A;  4P9I A;  4BXS V;  3H3U A;  3M2M A;  4OUL A;  3KM5 A;  3ZXK A;  3N9Q A;  1IQA A;  4FTS A;  2HWB 1;  1BCX A;  1UO9 A;  4RGA A;  3W58 A;  4FPC A;  1CN1 A;  2WQZ C;  3VGI A;  4Y4R A;  4D7Y A;  2LRP A;  5ISL A;  1XNK A;  4XXP A;  2DV9 A;  2PHR A;  3M3O A;  1JOP A;  4JV4 A;  5L36 A;  2Q8E A;  3ORJ A;  2W92 A;  2BFU L;  4YG6 A;  1PZ7 A;  3KF3 A;  5F2S A;  3OPZ A;  3UGG A;  1GQG A;  5BNN C;  5CFC B;  3NRU A;  3TEZ A;  5H9S A;  4UF0 A;  2VBP A;  1W0O A;  3LPG A;  5FZ1 A;  1O4T A;  3CZU A;  4TYS A;  4LKF A;  4RS5 A;  5A3W A;  4UI9 L;  1GR3 A;  1NE4 A;  3AP5 A;  3H8X A;  2IXH A;  3A22 A;  1WZX A;  1ND2 A;  2HEW F;  2D6N A;  2H6B A;  5FQ0 B;  3ZSM A;  2ZGT A;  1NT0 A;  4NIA A;  5FYI A;  1Y9G A; 
#chains in the Genus database with same CATH homology
 4ZON A;  5EP9 A;  4BQY A;  4Y5S A;  5DAX A;  3NNM A;  4ZPI A;  5LBE A;  5C5U A;  3NNL A;  4KBZ A;  4NHM A;  4XAC A;  4J25 A;  5LBC A;  5M0T A;  3KT4 A;  5ERL A;  2RDN A;  4MHU A;  5L9V A;  4XAB A;  5A3U A;  4NHX A;  5LAS A;  3NNF A;  5IAT A;  2FCT A;  2HBU A;  3MGU A;  4NHY A;  2FCV A;  3W21 A;  2G1M A;  5DAQ A;  4NHK A;  3NNJ A;  4BQX A;  3GZE A;  4NMI A;  2RDS A;  3EMR A;  2FCU A;  5LBF A;  4JZR A;  2OPW A;  2RDR A;  5DAV A;  5LAT A;  5DAP A;  2V4A A;  4Q5O A;  4XCA A;  4BQW A;  4XCB A;  4IW3 A;  5C5T A;  5EQU A;  4Y5T A;  3KT7 A;  4NHL A;  5L9B A;  4UWD A;  2RG4 A;  5HV0 A;  2A1X A;  3PL0 A;  3ITQ A;  5L9R A;  4XC9 A;  2G19 A;  2JIG A;  2HBT A;  3OUH A;  5EPA A;  3W20 A;  5IAV A;  2JIJ A;  3HQR A;  4NAO A;  3DKQ A;  5LBB A;  5LA9 A;  3GJA A;  5IAX A;  3BVC A;  3OBZ A;  5LB6 A;  5DAW A;  4MHR A;  2Y34 A;  3OUJ A;  3OUI A;  3KT1 A;  4XAA A;  2Y33 A;  2RDQ A;  3GJB A;  3HQU A;  5HV4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...