4QAWA

Structure of modular xyn30d from paenibacillus barcinonensis
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
537
structure length
537
Chain Sequence
ASDANINLSSEKQLIKGFGGINHPAWIGDLTAAQRETAFGNGQNQLGFSILRIYVDDNRNNWYREVATAKRAIEQGALVFASPWNPPSDMVETFNRNGASAKRLKYDKYAAYAQHLNDFVTFMKNNGVDLYAISVQNEPDYAHDWTWWTPQEILRFMKENAGSIQGTRVMAPESFQYLKNISDPILNDPQALANMDILGAHTYGTQIKDFAYPLFKQKGAGKELWMTEVYVPNSDNNSADRWPEALDVSYHMHNAMVEGDFQAYVWWYIRRQYGPMKEDGTISKRGYNMAHFSKFVRPGYVRVDATKNPDTNTYVSAYKGDNKVVIVAINRGTSAASQRFVLQNGNASTVSSYVTDSSRNLASLAPINVSNGAFTAQLPAQSVTTFVANLSGGNSGGGNVNTGTTYEAETGTTLTDAVVETLYPGYTGSGYVNFNAYTNSAIEWNAINNMTTGTKNVKFRYALESGTRNLDIYVNGTKVLSNEPFTETGSWSTWGEKTIQVAMNSGVNTLRIVTTGTEGPNMDNITVTASAKGELNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Analysis of Glucuronoxylan-specific Xyn30D and Its Attached CBM35 Domain Gives Insights into the Role of Modularity in Specificity.
pubmed doi rcsb
source organism Paenibacillus barcinonensis
molecule tags Hydrolase
molecule keywords Xyn30D
total genus 159
structure length 537
sequence length 537
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
A PF17189 Glyco_hydro_30C Glycosyl hydrolase family 30 beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4qawA01
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4qawA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4qawA02
3AXIA 3F5LA 4W87A 1IZJA 2J1UA 2E9BA 4DUXA 3SUVA 2DSUA 4P7LA 1UXXX 3GXIA 3NNGA 4UQAA 4BA0A 4PBGA 2YBTA 3ARRA 1CIUA 4QLKA 4W84A 4BCEA 4D1IA 2PQSA 3WY2A 3SCRA 3AC0A 3AHTA 1ZBWA 4MB3A 1V3HA 3BMWA 3L4ZA 4H41A 4B16A 1JYNA 1AVAA 3QOMA 4PTVA 4D6DA 3ACIA 1V0LA 2JALA 4PF1A 1HJXA 3ZQ9A 1O8PA 3BVVA 2WMGA 4D6IA 1F4AA 4MB5A 2F1AA 1VFOA 4MDPA 1G0CA 3T2OA 3BXWA 3LQCA 5IHSA 4FNUA 1HJQA 3BH4A 4HOXA 3I2GA 4J27A 2YC4A 3HPNA 1UR2A 3GYCA 4X0VA 1CENA 4CGTA 4Z2GA 1SHWB 4XZUG 1BAGA 3L2MA 6A3HA 4RN5A 5E6ZA 2WZ8A 4U2YA 1FP9A 1B0IA 4OMDA 1ISVA 2WAGA 2VT0A 3NDYA 1OINA 2XPKA 4NSBA 1M01A 1LG1A 1TFVA 1HXKA 5GNYA 4QB1A 1UWTA 3AHYA 2DIJA 1JDAA 1BYDA 3B9EA 3PHAA 1X6NA 1Z32X 1OT1A 2WMIA 3CMJA 3NSXA 4W88A 3SEEA 1LL7A 1KGWA 1E6QM 1W2PA 2E31A 1SYTA 1I1XA 3RM4A 4DUWA 1DWGM 5ABGA 4J3WA 3EDJA 1DP0A 5G04L 1D3CA 2D0GA 3WDPP 4EAMA 1RP9A 2YA1A 2EPKX 1UD6A 3U37A 2W47A 1RYYA 5D4YA 4WSJA 3QHOA 1W8NA 3GNPA 1JD7A 1E6PA 1ISYA 3E1F1 3BCFA 4HU8A 1PAMA 1SR0A 5LA2A 1JXKA 1QW8A 5I23A 3AIEA 4FNSA 2XJ7A 2YJQA 1G9HA 1JIBA 1E55A 3HMCA 5C8BB 1JL8A 1E4NA 5I78A 2WHKA 4ATWA 1H49A 3N9KA 2WZEA 1J01A 1HX0A 4E2OA 2DH2A 1CX1A 5D9MA 4MNKA 1MXDA 2NT0A 3FHQA 1MPXA 3SUWA 5DF0A 4UQDA 1P8JA 2WMIB 3OIHA 2CKRA 4X9YA 4UQ9A 5DPNA 1K45A 4KH2A 2G3JA 2C4XA 1QNPA 1SMAA 1WDSA 4N42A 4S3JA 3MV01 1DYOA 2YOCA 4LHSA 1KXHA 4CD7A 1H11A 1UY4A 3GH4A 4YN5A 2ID4A 3RM8A 3PTKA 3LPFA 2ZXAA 2V3FA 2J7BA 5M03A 1W1PA 3O2LA 1PZ3A 1PJ9A 3DX3A 3WSUA 2J79A 1ZB5A 1MW3A 4HZ6A 1GNXA 1HL9A 1B3XA 3OLEA 1UXZA 2J7GA 2D22A 3RCNA 5JBFA 4BQ2A 3WQBA 3PZ9A 4J3SA 5TD4A 1JZ6A 4J3UA 2WQ8A 4HA1A 1WP6A 3W0KA 4AD0A 2EPMX 2V4VA 3ARXA 1BGAA 2G3IA 4TXEA 5KZ6A 2UY4A 5BCAA 4IPNB 1LJYA 4CUBA 2WVTA 4CU7A 2WZIA 2BXYA 2WMFA 1BG9A 4W8JA 2PWDA 3WQWA 1HNYA 1JDCA 3IK2A 1W99A 4CVUA 4JHZA 3ZO9A 1GNYA 2VO5A 1L0PA 5EB8A 4CKQA 1JYVA 1GZJA 1KQZA 4BQ3A 2W3JA 4DWSD 2QQKA 2IUZA 3KLLA 1PMHX 2QBXA 3VIPA 2XFFA 1M03A 2G41A 3U7BA 4MJ4A 3L4XA 3AICA 2E8YA 4AMWA 3PZUA 4JFWA 2VQUA 3IGUA 3GZAA 2UY5A 1BGGA 2XG9A 2VZ3A 3SURA 3WEMA 3BAKA 4E8CA 4NRSA 4MNMA 2PWFA 4M1RA 1H41A 4AZBA 1QI5A 4NZFA 4AD5A 1E4LA 2YA2A 3CZ8A 2PBOA 3SEPA 4MAZA 2DPEA 1DLCA 4ZE5A 3DHPA 3C7EA 2OW7A 5FL0A 3T09A 2CHNA 5CPTA 4HPGA 2YL8A 4MGQA 3VOCA 1V6YA 1NH6A 1UA3A 2E8ZA 4XUTA 3WEOA 2BHYA 4AY1A 2DQXA 3VD7A 1XH2A 3VILA 3D50A 4WLCA 1UHVA 2ZIDA 2E32A 1MFVA 1J9YA 1YQ2A 4WKHA 4OKDA 3K8MA 2BXZA 4MADA 1MFUA 5I0DA 2J7DA 2WVVA 2Y24A 1XYZA 1QPKA 3CHFA 2NT1A 4XUOA 2J1TA 3VNZA 3VIFA 1HP4A 4QCEA 3CZJA 2JD9A 5ABHA 5E9AA 1UQYA 3VMPA 1DWAM 4R27A 2PWGA 1HJWA 1WB0A 3LRLA 1BPLB 3N12A 5JBEA 2QMKA 4ZY9A 3WUGA 3ZSSA 4A3YA 4UQEA 3CUIA 4Y7EA 1ISWA 4D6HA 4HMCA 5BROA 3LXBA 1CECA 2F61A 2C8NA 2XM1A 1L7RA 1US2A 3AIQA 2WMKA 4JIEA 5IJRA 4MJ2A 3TP4A 4FLSA 4FF5A 2XGIA 5FKYA 4Z2AA 2LW8A 3EJUA 2CIPA 1UZ1A 2WN3A 4JFSA 3CPUA 4GQQA 1J84A 2GJXA 1E71M 1NWRA 3KZSA 4UQBA 2E3ZA 2VCBA 3IJ9A 1TMQA 5A8NA 4J3XA 1TVPA 1BSIA 3DECA 5CPQA 2RGLA 4HOWA 1C8YA 3MI6A 2BGPA 4D0QA 1FH7A 4CU9A 2D1ZA 5CJ5A 3G6MA 5D9PA 1G94A 5B4XA 4AWEA 1UWIA 3ECQA 3MU7A 3T2PA 3WL0A 4TOQA 3AI0A 2B31A 4OJYA 3WBAA 4AIOA 3ARUA 3VPLA 1DWFM 1KR0A 4ML4A 3AXHA 3FN9A 1QWUA 1BVZA 3CZUA 1O7AA 1HIZA 2W1WA 2YC2A 1XH1A 5JBDA 4GI8A 1F4HA 5EFFA 3SKJE 3UR8A 1MWOA 1X1NA 4KGJA 1MW2A 1FHLA 1W0NA 5D8ZA 2OYMA 1C8XA 3HJEA 4U31A 3VO0A 4PSPA 3WMCA 5A1AA 1E1EA 2FE0A 5A6AA 3L4YA 4XUQA 4QFUA 3VU2A 2GUYA 1QOXA 5I5RA 1NOFA 3NJ3A 1VEMA 3TOPA 2DDXA 3RIKA 1ZBCA 3C7GA 3WQ4A 1GQLA 1DWJM 3W4RA 3U7VA 1TE1A 1E5JA 2F7PA 4HZ7A 2VURA 3A23A 5JXIA 3CHCA 1O8SA 3LPPA 3OGVA 3UG4A 4PUEA 3ACFA 4HG6B 4CN4A 1DWHM 1W91A 4AD2A 1OGSA 1BTCA 1UASA 1WE5A 4Q22A 2QQNA 2ZX8A 1LG2A 1E1FA 3AMKA 3WF4A 2BY2A 1EO7A 1UKSA 2ORXA 3S5ZA 2VQTA 1QI4A 2CESA 4L4PA 3D3AA 1JAKA 4QPWA 2WANA 2VZTA 3AS3A 4F8XA 3AS2A 4LQRA 3A3HA 3BLPX 3ZSTA 2JF7A 4DWSC 3FY1A 4PMNA 3BLKA 4PMOA 1KXTA 1LQ0A 3DDGA 4A42A 3WMBA 2PF0A 3BVUA 3W29A 1C91A 3K46A 5EJ1B 4MB1A 3N04A 3WUFA 4KWUA 1PMJX 3BAIA 1XYFA 4MNLA 3WDJA 3F5KA 1XD1A 4WKFA 1UWUA 3AHVA 3N13A 2GVYA 2O9TA 5A6JA 2J1SA 3IANA 1TVGA 1JZ4A 3AIBA 1G1YA 3NQHA 1JDDA 2J62A 2X8RA 3AISA 2JEPA 4S3KA 1T2XA 3D5HA 4W5ZA 1V0NA 1TQSA 3TTQA 3LE0A 3VIGA 2E9MA 5M3WA 1JI6A 4LPCA 2YL5A 4JKLA 4QLLA 1WZMA 5CYYA 3VIMA 3M46A 3CIHA 1H1NA 2B9VA 4NZJA 2J75A 3AYRA 4B3LA 1N82A 4Q7NA 2BY0A 1SMDA 2W87A 2WUHA 3CV5A 5BRPA 2VMEA 2YFUA 3VGEA 1KB3A 1ESWA 2X1IA 1EIBA 3VIHA 4KI5M 1CDGA 3WD3A 2RVAA 1VBRA 4XV0A 3VSTA 1KWKA 4AG4A 3PUHA 4UZUA 1UKQA 3ZR5A 3F2ZA 5J1XA 1PX8A 3G6LA 5HOSA 3A6OA 4FNPA 4FMVA 1EOMA 2Y6GA 3SCVA 4TVUA 5A2BA 1J0HA 2GDVA 4XB3A 3M07A 1UWRA 4CN6A 3AQUA 3I3DA 3WD0A 1ULOA 5IFTA 1VF8A 3BN6A 2WPGA 4W89A 3CO4A 4L4OA 4JKMA 1TZ7A 2F2HA 3MKKA 3CLWA 2BFGA 4P7RA 4ZZ8A 3GTNA 1H5VA 1PBGA 1B3WA 4DWSB 4UAPA 1E4IA 1E72M 1BG4A 3VDCA 1OCQA 1W9UA 2WXDM 4GXPA 3IAQA 5AC5A 4KMQA 4GQRA 4TTUA 4UOJA 1E3ZA 4W93A 3WDHA 3LEGA 3AROA 4AD3A 4MNJA 2D0HA 3CQOA 1I1WA 1CGVA 3C7HA 2WC3A 2WNWA 4QX2A 1HT6A 4Z2JA 1E0XA 5HDRA 3LMYA 1W9XA 5AC4A 4PUDA 1T0OA 2G8ZA 2X05A 3KL5A 4CU8A 4DXRA 1C7SA 3NCOA 5A8OA 4PMVA 3N1AA 4HMDA 2VZSA 3UEQA 2ZEWA 2WZHA 3WL1A 1GW1A 1OIMA 1P6WA 4UFHA 3WD1A 3HG5A 2E26A 2VZPA 1HKIA 2EPOA 4PQQA 2VOTA 1CXEA 3WEZA 3TA9A 1U33A 3POCA 1PZ2A 2CPUA 1GONA 5BRQA 9CGTA 2VX6A 4ACZA 5IDIA 2KD7A 3PZNA 4KGLA 2EACA 1CLXA 2OW6A 1J11A 1C7TA 1R75A 1E0WA 2QQIA 4RYDA 5CLTA 1IQDC 3HNYM 1MQRA 2WHMA 4MGSA 4PMZA 1W9DM 5DEZA 3IJ7A 3MSGA 2CCRA 2CDOA 3T08A 3K4DA 2BGOA 3WH5A 2QV4A 3CZKA 1QI0A 2CNCA 4NX0A 2F7QA 2OYLA 4J3TA 4W7VA 5CXPA 1GUVA 2ALWA 1HXJA 4AMXA 2ESCA 1K9TA 1W1YA 1FH9A 1QX1A 1UMIA 3MUY1 3LPGA 3VKKA 3WD2A 1JF6A 4XUPA 1GQKA 2DDUA 1TUXA 2W95A 4P7NA 3VIKA 4PMXA 2DSWA 2W4XA 3TV8A 1GMMA 1B3ZA 3WH9A 2VVSA 3KLKA 2W46A 5CQ1A 3OGRA 1ZU8A 1JZ8A 3TTYA 3AIVA 2BBAA 2EIBA 3RDKA 4WF7A 1E0VA 1CNVA 4E8DA 2NW0A 1C92A 2W5FA 4DO5A 4H04A 4OOUA 5A8QA 1BLIA 3WFLA 3WUEA 3N18A 3THCA 1QNRA 1V3KA 1R7OA 4M82A 2JFEX 4QDQA 2GJPA 1VEOA 1UKOA 1HVXA 3OBAA 5JXHA 1W32A 2HLEA 4CUCA 3VGDA 2Q8XA 1NOUA 5D8WA 2Z1SA 4JCLA 2Y64A 2XYLA 2X2JA 3CTTA 3C7FA 3ARQA 3HG2A 1XV8A 1W9WA 2X2HA 3B8SA 4IUGA 2DEPA 3RJYA 3FAWA 2BHZA 3ARPA 2J1AA 3CKHA 1W9TA 1ZL1A 4B9YA 4AEEA 4M24A 2Y2WA 3BC9A 3A47A 3A7QA 5JMOA 1GOOA 2QLYA 1UD5A 3D51A 1G01A 3O6AA 4NZCA 1KQYA 2X2YA 1CXHA 1HJSA 2FHFA 1BFNA 4B15A 5CSYA 1UD3A 4JX0A 1B2YA 3F4VA 4AZ7A 1W9PA 3QOKA 2MANA 4MOAA 2AOSA 2J47A 2YLAA 4EK7A 2R7EB 4NXSA 4W4ZA 1Y7VA 5A6BA 1VB9A 2ZUTA 2F7RA 2WC4A 3MANA 2Y6HA 3BGAA 1VFFA 2DCKA 1MQQA 2A3AA 4ACYA 1UX7A 4PSRA 1R46A 4JFUA 4NRRA 1CXIA 3I97A 1MYRA 2DT0A 4LYPA 2EBNA 1UR1A 4M81A 2XWDA 2PI6A 8CGTA 3BUPA 4AZHA 2WWDA 3VSVA 2BZDA 3T0DA 3GXPA 3SCSA 3PZGA 1JFHA 3VIOA 1M04A 1OD8A 3BUIA 2FH6A 1TG7A 3MBWA 2BY1A 3ETPA 1KTBA 3A4WA 3D4YA 1UYXA 3ALFA 1W3JA 1RPKA 5DQ0A 1KGXA 1U30A 4QCFA 3BLBA 3WKZA 3A4XA 1CGWA 1UWWA 3WUBA 4UFMA 2Y6LA 3DDFA 1UH3A 2ZWYA 3GXMA 1FA2A 3A21A 3TONA 1K3IA 1WDQA 5AYIA 2WVVB 3HG4A 3U5YA 2J1EA 2VRJA 3VMOA 2RJ2A 3CIVA 4D71A 2WK2A 1QHOA 1OF3A 4C7GA 3VGGA 4U2ZA 1B90A 1UY3A 3AIUA 1WKYA 1ISXA 1HL8A 5FOOA 1W9BM 1PIFA 5LYRA 4AXNA 3IAPA 1R85A 2OSWA 3ARTA 3VD3A 3W5NA 2XIBA 5B4NA 3NSMA 5ABFA 4PRWA 2WN2A 3VIIA 4BDVB 3A22A 4FI9A 1V6XA 4MPKA 3AJ7A 4PMUA 1GOGA 4P8UA 2VL4A 3ZIZA 1DHKA 3SCOA 4P00B 4ZXOA 4A44A 3K75B 1LWJA 5EFDA 2JF6A 2YDQA 3ARYA 6TAAA 1Q6FA 4JKKA 1EA9C 1YHTA 3K8LA 1HF6A 2XSBA 3PTQA 4JZ5A 2FGLA 3GNOA 2ZXBA 2V72A 1FHDA 2Y5EA 5D9OA 5GQBA 4RE2A 5DMYA 2X2IA 2ZUWA 2D3LA 1UY0A 2W9XA 3LXCA 4QB2A 3P1IA 4AC1X 2YL9A 5I24A 3SCPA 2A3EA 1QW9A 5A69A 3UG5A 2ORZA 4U33A 4ATLA 4BS0A 3A24A 3VNYA 4DXTA 2J78A 1V6UA 2J77A 4JL1A 1B31A 1GJUA 1GORA 1HKKA 1XNAA 2W67A 3T0AA 2GDUA 5EMYA 1JAEA 3AHZA 1UH4A 3CDZB 1EUUA 3JXSA 3RPMA 4C7DA 1R7AA 2OWXA 1QNSA 3VUPA 1CYGA 1FP8A 4BQ4A 1FFQA 3BVWA 2WAOA 1V0KA 1UUQA 1ZBVA 2RGMA 3HG3A 1SZNA 3GGLA 5JXJA 2WHJA 1HTYA 1A47A 1ULPA 4LYQA 1BYBA 2FYVA 1W8OA 3VSUA 2QHAA 3AMCA 4P08A 3CHDA 5F7UA 1XD0A 1WZAA 1E3XA 3VINA 4Z2KA 4LYRA 3ZMRA 1UYYA 3VIJA 1RP8A 3H54A 3BSHA 4ZXLA 2VZOA 2EIEA 3DX1A 3ZJ7A 1H0GA 1BVNP 2YA0A 4F9DA 2PB1A 4JFVA 3WNOA 2WCAA 4CD8A 1WO2A 3EJQA 3AZRA 4PMRA 3RMEA 1TCMA 4M56A 2E9LA 3I2IA 1HN1A 4GKLA 2O9OA 1J10A 1E43A 4PTWA 2ZXDA 4CD5A 4RE3A 3CGTA 3SCNA 3EJRA 1WCQA 1UY2A 1W9VA 2HISA 5M17A 3AIWA 4EE9A 3EMQA 2VRQA 3PUIA 4ZZ5A 5LA0A 2VZRA 1H09A 4KRTA 3HN3A 4LKSA 2YFOA 3WQ6A 3FNDA 1QHPA 2WYSA 1SFSA 4MDOA 2VC9A 3GDBA 3RM9A 1CZ1A 4RL3A 1ITCA 4JAWA 3DC0A 2VMFA 1W2VA 3I2KA 4GZ9A 3EDFA 2YKKA 1GOKA 1UH2A 2YG0A 3SIMA 1TQVA 1O7DC 2Y6JA 3NSNA 4U5IA 4AYGA 2GSJA 4MB4A 2ZICA 4U3CA 3OEAA 1G5AA 2WW5A 4D6CA 1PS3A 5D9NA 2FHCA 1MW1A 2Y8VA 4EANA 2XSAA 4IPLA 1UKTA 2WO3A 2VCCA 4MAVA 3EMCA 3WNKA 3SUSA 2ZUVA 1NP0A 3L4VA 1CXLA 3ARZA 4A41A 4A3ZA 2XM2A 3IB3A 1E15A 3WMSA 1BQCA 2WSPA 3CZLA 2W1QA 1EDQA 1VAHA 2CBUA 3ZT6A 4QX3A 2WDBA 1WZLA 3WFZA 1E6SM 3BCDA 5JXGA 3ZT7A 2CBJA 1J0KA 3FL7A 3VTRA 1CGTA 5CSUA 4D6JA 1TA3B 3KL0A 1QI3A 4GWJA 4DO4A 2XWEA 4X0NA 5A6LA 2VM9A 4CN1A 1L7QA 2W66A 2YDSA 2CXGA 2NSXA 3VM5A 2ZX5A 4QX1A 1NWSA 1R34A 2FH8A 4U5KA 3W6LA 4TXWA 2FHBA 1HJVA 3VMNA 1XNTA 2FGZA 1GVIA 4OZOA 4LGXA 3UESA 4V28A 2J7CA 3SCUA 4TVCA 1BYAA 2W61A 3D52A 4XUNA 3NJVA 2C9KA 1MW0A 1NARA 1GCYA 1US3A 1K12A 5DT5A 4J3VA 3I2HA 3VD4A 3MSDA 1TQTA 2J8GA 2X0YA 3CMGA 1B3VA 4DM2A 4AZGA 1K9FA 4D6GA 1WNOA 3KWXA 4GI9A 2TAAA 2J4GA 1J0JA 1XGZA 1UR4A 1CGUA 5A6BD 1QI2A 2FDMA 4HZ8A 4E4PA 1CZSA 2PC8A 3LRMA 2VZVA 4CCEA 1B3YA 1Q6EA 3MV11 3AZSA 4LXFA 1NQ6A 1EXPA 3HNMA 3KL3A 4UQCA 1V0MA 3K4ZA 4BJ0A 1EHNA 3AIRA 5CG0A 4M29A 4UFKA 3ZR6A 4ARXA 3OZPA 2B4KA 5C71A 2VI0A 1NKGA 3CUJA 3LRKA 1SDDB 1O6IA 5CGTA 2WHLA 2CERA 1XSIA 1NAEA 5JIWA 3CZEA 3S5YA 1W1TA 2ZUMA 3WH8A 4XZWA 3OGSA 4W8BA 2J7MA 3NRUA 3OLDA 5A8PA 4BQ5A 2V3EA 2J1VA 2ZEYA 3WDIA 4QB6A 2G4FA 4QDRA 3CZSA 4Z2IA 3VX1A 1JZ7A 3W37A 2OKXA 4CD6A 4L0PA 3OEBA 5A6KA 4GZJA 2ZWZA 1VRXA 3SKVA 2GK1B 4UR9A 4HP5A 2X10A 2DGAA 2WB5A 2VJXA 2XONA 4DUVA 3VVGA 1WPCA 4AEFA 1R8LA 5DO8A 4TVDA 1UG6A 1D7PM 3WELA 2CBVA 4PEEA 4LPLA 2EPLX 1J83A 2XIIA 2VZQA 2W1SA 3OZOA 1PPIA 3W81A 1K42A 3I2FA 1GOMA 1NP2A 5A95A 1R86A 2QQJA 2VR4A 1Q6GA 2XFYA 1VFMA 1LLOA 2WLZA 5AY7A 4QX0A 4ZE4A 3BUQA 2EQDA 1GHSA 4KRUA 2XVGA 3UCQA 3CBWA 4XVHA 2VX5A 3TTSA 5C70A 4W8LA 2LS6A 2C0HA 1QWNA 2BVYA 2WVUA 1OF4A 5A94A 1W3HA 1OWQA 3CUFA 5JUVA 3KE0A 4OBSA 1R47A 1CEOA 4P5YA 4URIA 3VGBA 1NUKA 2VTFA 3IIIA 1QVBA 2V3DA 2UY3A 1AMYA 1KGYA 4H8UA 4DM1A 2ZXQA 4W7UA 1E4MM 4HTYA 2EJ1A 3O9NA 4GPNA 5FD0A 4H2CA 3WQVA 1WDRA 1CBGA 3HOBA 1L8NA 1UR9A 2W63A 1MVYA 1UWQA 4MTVA 1JD9A 2D24A 3AZTA 1OD0A 2GJRA 3BAWA 1H2JA 3ZJ8A 1XC6A 3DYPA 2J8FA 3BAYA 4UCFA 1E6NA 2UWFA 3WSOA 2OSYA 5BXTA 3K77A 4GIAA 1DWIM 4AMCA 4UI9L 1UA7A 2WO1A 3T2QA 2EXOA 1JFXA 2J7HA 3THDA 2G3NA 3DX0A 4UFLA 4ZXEA 3B9AA 4UZSA 5FIPA 3W38A 3VX0A 4ZENA 5HNNA 2V5CA 1EDTA 1E6RA 1V02A 1K9EA 2WVSA 4W8AA 4C7FA 1CPUA 3OLIA 4P8WA 4Z2LA 3GM8A 3MS8A 1NWUA 4H8VA 1GOHA 3VD9A 2AAAA 1NOWA 2BV9A 3PZVA 3W25A 3CZNA 1EQPA 1TA3A 1FFRA 2WLYA 3EJSA 4PTMA 2EADA 4PTXA 5GNZA 4PCTA 3W6MA 3GBDA 2D23A 4NI3A 3SCWA 3BAXA 4W85A 3BUBA 3AFBA 3D4ZA 2JEQA 1PX4A 4WJXA 5EBAA 4LX4A 1JI2A 4AISA 1CGXA 2XHNA 2QF8A 4GZIA 5FL1A 1ODZA 1JZ3A 1V3IA 1H6XA 2J74A 1OB0A 1UZ4A 3AS1A 3IJ8A 5HBFA 4FNQA 1V6VA 3PZTA 2VMDA 3EDEA 2WBGA 2WMHA 1Q4NX 3PZMA 1UD2A 4ZFMA 2F18A 3M7SA 3OB8A 1OGBA 2ZUSA 3II1A 5I2UA 1C93A 3W27A 2YFNA 4M80A 3WENA 2WWCA 3W24A 3SUTA 2A3CA 5AYBA 4AZ5A 4AZCB 3WQ8A 5JR2A 1AQMA 2XQXA 4ARYA 4W86A 4K68A 5A8MA 4BK4A 1V3LA 1HJUA 4FLQA 2L9LA 1PEZA 5G05L 4U3AA 1QNQA 2VCAA 2VZ1A 4AYSA 1U2YA 3SUUA 4HOZA 2XVLA 1V6WA 2CYGA 5ABEA 5E09A 4UFJA 1EO5A 1UD4A 2EO7A 1J18A 3C7OA 1GOIA 3EMZA 3LX9A 2WSKA 2CBIA 2XVKA 3VGFA 3J7HA 1GVYA 1V03A 3HNBM 2E33A 2PWHA 2EPNA 1UY1A 2YLLA 4R5EA 1BF2A 5A3HA 2DT3A 1AQHA 2WCSA 3ARVA 2J7FA 1XCWA 5KEZA 3CH9A 3KEHA 4TX8A 2CEQA 5E0CA 1JNDA 1C3FA 5ECUA 1D7FA 1I75A 4HA3A 3W28A 4AZIA 3MMDA 4JFTA 4GO9A 1J0IA 1D2KA 1OM0A 4FK9A 4FLRA 3WN6A 3EDKA 2J22A 2AMGA 5IXEA 1VBUA 1FOBA 1E70M 3BAJA 2XUCA 4W50A 1LNSA 3MUAA 1NM9A 2J7EA 4DEVA 1UD8A 3JUGA 2QQMA 1E40A 3RO8A 2WMJA 3IDAA 5A6MA 4OUEA 2Z1KA 3P6BA 4UNIA 3K1DA 4CVWA 4TTGA 1OSEA 4GWIA 3VD5A 3AHXA 1W1VA 1MXGA 1BYCA 3QR3A 4D6FA 3MMUA 2WBKA 3LEKA 3ZJKA 2IGTA 3TTOA 3GXTA 4AIUA 1R33A 2WM0A 4CD4A 7CGTA 1GUIA 1EHAA 2VR5A 3EJPA 1B30A 5BYWA 1KFWA 3NUKA 2D20A 4UTFA 2DT1A 1CXKA 1ODUA 1IV8A 1UOKA 2W92A 3ABZA 3DX2A 4JHOA 2JE8A 2A3HA 1ZJAA 3UR7A 3OLGA 5JIPA 1GPFA 1QHZA 4WIWA 4TX6A 7TAAA 3UNPA 4NXKA 2DT2A 2XOMA 1EOKA 3MUZ1 2Y4SA 1XSJA 1K6AA 2WO2A 4GI6A 1LL4A 3WDRA 3M6DA 2J1RA 3HU7A 4RE4A 3W26A 3SCTA 4QLJA 3EJTA 5E6YA 2WC7A 2JDAA 5M5DA 1AQ0A 1DTUA 3U57A 1E56A 4HPHA 3GH5A 3BUDA 3VDBA 3H55A 1BHGA 3WNPA 1TVNA 3BMVA 3UERA 5EJZB 1SG3A 1A3HA 2EAEA 3WQ5A 4CCDA 3N11A 2OWWA 1KCKA 1WAWA 4M4PA 1V3JA 4ZEPA 3MMWA 2OSXA 4V2XA 2CITA 2PBGA 2OLHA 5DT7A 4FLOA 1GJWA 2VNCA 2IXVA 4P7OA 3BVTA 4DO6A 3CUGA 4ET7A 3I2JA 5C7GA 4OIFA 2W91A 2ZEXA 3APGA 4PT6A 1E6ZA 3MO4A 1C8QA 4LQ1A 2WKLA 2O92A 1XH0A 1JYXA 3PN8A 1XPWA 3PZIA 3UG3A 4MO3M 1VFUA 4IM4A 4YPJA 1OIFA 4OBRA 1CLVA 5GPRA 4ATDA 3A5VA 1KR1A 3ARWA 2GFTA 4PMQA 3VGHA 4JL2A 3CHEA 2BS9A 1MQPA 4EKJA 2EABA 4XX6A 1LF1A 4GZEA 5I6SA 1HWWA 4M8UA 1DEDA 3ARSA 4GO8A 2XGBA 4AIEA 5CGMA 3NDZA 1KTCA 3PBGA 1RH9A 1KWGA 1UYQA 1VJSA 5BWFA 5I77A 1JF5A 2QPUA 1GQJA 4UFIA 1VJZA 2RV9A 4PMYA 2Z4FA 3HEIA 3HZ3A 1E6XM 4QP0A 2QMJA 3ZOAA 1OT5A 1GOFA 3WDQA 1UQZA 1GQPA 2XN0A 1UR0A 4AZCA 2G3MA 1J0ZA 2VUYA 5E1QA 2VZUA 4F79A 4W5UA 1EGZA 1JI1A 2BVDA 3I3EA 1EH9A 2E40A 2W62A 4XUYA 3NYDA 3W82A 3GNRA 3WNNA 4A45A 2ZE0A 2HVMA 3WH7A 8A3HA 3NIYA 1EDGA 4HA4A 3GXDA 1CWYA 3EDDA 4QDMA 3H53A 2EIDA 1X6LA 2OWCA 2IXUA 5CZKA 3QGVA 2C26A 1FH8A 3PZOA 1W3KA 5EIYB 1CTNA 1XRVA 1S46A 2Y6KA 5HXMA 2W94A 1OT2A 5I3DA 3AYSA 1H6YA 3BSGA 4UOZA 2YL6A 1HKMA 2DSZA 1WCGA 3RILA 1HKJA 1KXQA 2XVNA 3WD4A 4OOZA 5A2CA 3K8KA 3AXXA 1I5PA 2O9PA 2WABA 4FNRA 5ABFB 1XHGA 3LXAA 5IFPA 3HJRA 1K9DA 4P02B 3ZM8A 1Q6CA 1JHJA 3AMDA 1QBAA 3W53A 1R64A 4AAXA 4H7VA 1GU3A 1IT0A 1JXJA 2E4TA 4N0RA 5I79A 1QNOA 2D2OA 4AW7A 3FW6A 3K4AA 5LCWL 2XHYA 2D3NA 2DSVA 3PZQA 3AS0A 2ZX9A 4DXSA 2C7FA 1V3MA 1ECEA 3GXFA 2DCJA 3GXUA 4Z2HA 3L4WA 4A3HA 3L2LA 1UKPA 3L4TA 2BVTA 3OG2A 1VEPA 2XVPA 4CU6A 2D73A 6CGTA 4YHGA 1RD6A 2V38A 1J12A 4CUAA 3WF3A 2BNJA 3DX4A 3L4UA 2ZEZA 4BXSV 3OA5A 3ACHA 1CZVA 4UOQA 2F1BA 3WF2A 1QBBA 1KEXA 3VDAA 2GK1A 3ZT5A 2DIEA 2EICA 1GOQA 1OD3A 2YB7A 3B9DA 2OYKA 1TQWA 1KBBA 5IYYA 3GXNA 1KCLA 3LEIA 3FHAA 4J28A 4PMDA 1B1YA 1B9ZA 4JCMA 2Y8KA 1J0YA 3WIJA 1VIWA 3W5MA 2QQLA 3T0BA 4AD4A 3WY3A 4PN2A 1UYZA 2CHOA 4M4RA 3NJXA 2VVNA 1VENA 4PYSA 4D1JA 1TQUA 1EQCA 1JU4A 2WCGA 1ITXA 1O59A 1C90A 1LL6A 3AMGA 4XURA 1H4PA 2F8QA 1PIGA 1W3LA 3CUHA 1XCXA 2JIEA 4NF7A 4A4AA 3WF0A 1CXFA 5DFAA 3BVXA 1W9SA 2QQOA 3VM7A 2WKGA 4TUFA 1H0IA 1JGIA 1EUTA 3RJXA 1JG9A 4F9JA 2ZX7A 2XN2A 3DHUA 5A6SA 1E5NA 4IISA 3EBVA 3DYMA 2YFZA 3S2CA 4XZBA 2W1UA 5IHRA 2VX4A 2JIWA 2YDRA 1JU3A 1ZJBA 3EYPA 2E0PA 4W7WA 1GQIA 4F66A 2F7OA 5BXRA 2VX7A 1UR8A 2EEXA 3F5JA 4WKAA 4P7QA 1GOWA 1NX9A 3S6TA 5CPSA 3GBEA 2A3BA 2V3GA 1KXVA 1ZS2A 2X0HA 3AOFA 1HP5A 3N15A 3GH7A 1Q6DA 3QHMA 3I3BA 5E70A 2VMCA 1UZ0A 3VDHA 1IZKA 2BY3A 1HVQA 4P8VA 3SCQA 3CC1A 1UWSA 3CZGA 3A4AA 1JYWA 2XTKA 1TR1A 4GINA 5E0FA 3ACGA 3WBEA 2J25A 3FAXA 1PX3A 1OGGA 2X09A 2VRKA 2BERA 4H8HA 1CIYA 3EB7A 5DN2A 3QHNA 3POHA 1KGUA 4J7RA 2PWEA 3U5UA 3WY1A 5A2AA 1R87A 1H3GA 4DEQA 4WK9A 4OMCA 1WZKA 2UY2A 4HMEA 7A3HA 3WNMA 5FUIA 3FXYA 4BK5A 2D0FA 1M53A 1JZ5A 3UETA 4YHEA 4A6OA 4D72A 1E73M 1E9LA 4OGZA 5HPOA 4DWSA 5CLWA 3AMLA 3N17A 2HYXA 1JNEA 2V5DA 3ALGA 1KBKA 5BXSA 4D6EA 1ZBKA 4B3KA 2O9RA 2ZUUA 2BHUA 2QPSA 2CETA 1WDPA 2ZUNA 2JKXA 1CZTA 4FNTA 3MUIA 5GNXA 1UMHA 3C8XA 3WY4A 4WSKA 1LWHA 4CCCA 1OH4A 4BF7A 2DH3A 3DYOA 5LA1A 4V27A 3LPOA 1M7XA 3WNLA 3WF1A 4QDSA 1ISZA 1V08A 4HU0A 2CKSA 5HPCA 4OYUA 4B9ZA 1JZ2A 3PTMA 3WH6A 1V02E 2GJXB 4QAWA 5FCZA 2WAAA 1NWTA 4D8MA 4AD1A 2XN1A 3ZJ6A 5BXPA 1XSKA 4P8XA 2CDPA 2YBUA 2ZOXA 2DSKA 1CGYA 4BZYA 2XFRA 4AZ6A 1OBAA 4ACZB 4PCSA 2YIHA 1GHRA 2ZX6A
chains in the Genus database with same CATH superfamily
3N2BA 4A7UA 2Z6JA 4PJHB 1POJA 2PRMA 4X2PA 2DSUA 1U1HA 3GXIA 4AAPA 2G4JA 2BSED 3D4KA 3NJHA 2IVJA 1AE6H 3OKDB 4CEWA 2AJSH 3NFUA 2FTPA 3NL6A 2FJUB 3OMZA 4PRID 3BVVA 1Z7JA 1DHPA 5E7FA 4NFBA 4MLJA 1RULH 3BH4A 5EA0H 1EBPA 1CFNB 3UKTA 2RS51 4UMBA 1PTAA 4XB7A 5BVJA 5FY8A 1R3HB 4QYAA 1I31A 2ZZJA 1XTMA 2NX9A 4RFRB 3IU3B 3RGTA 4IHOA 1L9SA 1HC1A 1UENA 1NTDA 4QXUL 5LATA 4BQ1A 2IAMC 3EWBX 1E7VA 1YUHA 2I25N 1IYXA 4OCWL 1Z7S3 3OAUL 5T5NF 5F72S 4EUPB 1QSEE 4GG9A 2J12B 3SIZA 3KWTA 5TE4H 2GC3A 3LRGA 3HMCA 2A0NA 5B38B 5IWLC 3R0NA 2FTWA 1OC1A 3C2EA 4DP1X 1CX1A 1MPXA 1HDMB 4PJ7F 3RZWA 5LN4A 1T8XA 4KY1H 1G4MA 3APYA 4HKLA 3ILPB 4NZ8A 4ZMAT 4C55A 3BWAB 1IWPA 4Y2NA 2HPIA 3RZZA 1GGOA 1FCBA 4XILA 4X5WB 1NMAH 3QI9C 5DWUL 1T6MA 3TE9A 12E8L 2EDHA 5CADA 3VFOA 2CR6A 1O3TA 3LNIA 2RIKA 4YHYB 3VFVA 3T6VA 1YYNA 2YC1B 4QGYA 4ZMNA 3O6FD 5CKGA 5JIHA 4CUBA 1IKFL 3D09A 3D9AH 5EF0A 4XPBH 3C5ZA 4DQOL 1IM9D 4DNMA 3CN1A 5AL8A 2OX0A 1P6CA 4S1DD 5GLWA 1PMHX 4Y4HD 1OF2B 2PN5A 3SKNB 1NGZB 1U3HD 5DSCB 5TQ0H 2PWFA 4CQBA 3PVFA 2XJLA 3MRKA 5L8JB 2V37A 1Q6QA 1BCXA 4A8NA 5K9JH 3MV9E 5C8WA 1NGQL 3GJFA 1XPYA 2VERN 1PF3A 4ZE5A 3TDFA 1BAFH 4HPGA 2D31A 5SWSB 3WEOA 2DQXA 4K3JL 1OLZA 4ZO9A 1W5PA 4FOUA 4RVBA 1A14H 1LILA 3TOYA 4XUOA 2D6PA 2ADFH 1EAOA 3QDGB 4RFNB 1DL3A 3G0XA 1WB0A 4JAMB 1JBCA 4XWOC 4WM8C 3OXSB 4HIEB 1QU4A 3S98A 3IRDA 3PAYA 5G55A 5IMKA 2FT7A 3ZLGA 2C4FT 1ZNNA 5E2WH 3RL1B 4V33A 4QDGA 4J8RA 1UKGA 3UTPE 1S7SB 1B4JL 2LW8A 2IALB 2CIPA 1FV1A 5BNOC 5F4SA 4JY6A 5CZRA 2QDHA 3PHSA 4HKBA 4QHRA 2YB1A 4G11A 1BSIA 2O4EA 4LQFL 3PUQA 5JI7A 3KR3H 7REQA 2R2EA 3RKDD 4M51A 5BNNB 2D1ZA 4Q2ZB 1O6SA 1UM5L 2H0BA 1A6AA 2YWYA 1BQGA 3VRIB 4FXFA 4GSUA 1RPXA 1OEPA 1WUFA 1DYKA 3MWCA 1Q94B 4BQ8A 1FNGA 1U3ZA 4NO0B 3O11B 2G5RA 4QMEA 4MQXD 4ONGL 3SE9L 3EOUA 3Q5TA 1CG9B 2DJMA 1BEV2 1V6NA 1X1NA 2M8XA 3BJTA 2OYMA 3VO0A 1A2YA 4BFBD 5LBEA 4S3GA 4Q6IA 1KLYA 4XUQA 4Q4V3 5EC2B 4P23D 1ZREA 3JT0A 3FONA 1LROA 3RU8X 4DIQA 1FNYA 1O12A 5T8GA 2N7GA 2ZTNA 2YC1A 5HINA 2VURA 3LS5H 1NEZG 3NQFA 4B7EA 1RUPL 4V1DD 1V6IA 1MHEA 1WBZA 4XJUA 5KVEH 2V17H 3N85H 4JDTL 2R1XB 1FGVH 3S97C 4TQEL 4EROA 1G9DA 4QRBA 3AS2A 1GKEA 1M5WA 2VDRH 4JPWH 1ZMYA 4JEJA 2E63A 2C24A 1P5UA 4PJAE 1YEHH 4QGTA 2GVYA 2HH0L 5CD3B 4YOKA 1TITA 3TJHC 1S7VB 1HRV1 2O9TA 4U3HA 5KBLA 4RZBA 3QUXB 3KPOB 4TUJB 1G1OA 2INZA 3QBQA 3WKML 5IWLA 1OUSA 5FA3B 2YZ5A 3AYRA 4B3LA 1N82A 4DXZA 1BWLA 2QV2A 4LLUA 3OGCB 1KB3A 1S7XB 4R7NB 1B0WA 4KKCD 1OF0A 1FO0L 4KXCA 4TKWA 4EOWH 3JW7A 3GTXA 4WWKD 2WXKA 2GJNA 5FYLE 3TOJA 2FVKA 3S34L 3QUMH 1RJPA 2BFGA 3R94A 1OQ1A 3IT8A 1HHIA 2B14A 3HCVA 4HUWB 4JFPB 3IIVA 4WUIA 4GUCA 1IGFL 1NCBL 5FOBB 2ZGKA 5GRUL 4K8RB 2PYEA 4RGOH 3TX4A 3ZSKA 5FMCA 3SCHA 1E0XA 3A9BA 2ITFA 4XHJD 2WFPA 3ITGA 3W7IA 1LE5A 1F07A 3ZPDA 2ICEC 1F3DJ 4LLDB 1T5KA 3ANYA 4XPBL 4H44C 1FWXA 4KWWA 1PZ2A 4ZO8A 3BANA 4P61A 5D4QA 3KUMA 5T5FA 3L0GA 4TZDA 2J9YA 4OV9A 2EDWA 1AODA 5A7PA 3JV6B 2GSYA 3LKNA 1NJJA 5C3OA 4WTWA 4XTPA 1UMIA 3VKKA 2VDIA 1G9BA 3MRPB 3VXOB 4PVNA 3CQIA 1WBZB 5GZFA 3V0VA 2PAJA 1GMMA 1UM6L 5FYSA 1IGWA 3ZDZE 3EJZD 5BNKA 5ADPH 2VR3A 3IJ6A 1PVC2 1QTSA 3N18A 2ZSWA 4ZOBA 4QDQA 1VEOA 5AYUL 2ZRVA 1I1AD 4YTUA 2E59A 4Z1VA 1H3VA 3FO1B 4U0RC 4PRDB 3NQIA 5I8CB 5FREA 3UZQA 4XNZC 3QRLA 3PWUA 5TFSL 3WS6C 1QFEA 5E8AA 1R3YA 4IJTA 2E77A 1FCVA 1D8CA 4IRSD 1KQYA 4M1CD 1W8UA 2J6EL 4L9DA 3M0VA 3FFOA 1YIFA 1JZHA 1FY6A 1XXDC 4BBWA 2WINB 4EK7A 3L5LA 4AQZA 5T9CE 3BGAA 4AGNA 4OZIB 1ND2A 2A3AA 1VMFA 4LCRA 1NIBA 3WP5A 4HIBA 1SEBA 1Q9KA 1LEGB 3P0XA 4EWND 1TMF2 5D72L 3GMMA 3VIOA 3TSBA 1H1IA 5FZIA 1G4RA 4QYOA 4M6AA 4N0UB 3BLBA 1ML0A 4GP4B 4DZBA 3JWNC 3DDFA 1T04B 4KMTL 3VL8A 4P4KB 2VRJA 2P5WB 1POV1 4YW5A 4UTTA 1FGNL 1WKYA 3H8XA 4C6BA 3U07A 2HLFD 1QOPA 5FDYA 3ONCA 3MJ6A 5B4NA 4JM4L 3OYWA 4AQAB 4Y1XA 3W1LA 3QRBA 5I76B 3EA3A 5D7LD 3ZIZA 5D96C 4HWUA 1NYWA 2ZPKH 2QGCA 3W2JA 5JZGC 1J5HA 3OZKA 3B0PA 2QZ2A 5G2IA 1R17A 3GXUB 4BWLA 4HKZA 2A9MH 3KBWA 5FYLL 2W9XA 1NOLA 5C9AC 3VKNA 4R7DA 4LSDA 5EZLB 1KIPB 4FFFA 1XYLA 1WZ1H 1D5XA 1Y18A 4DYEA 4BS0A 1Q8MA 2VUCA 4Q4X3 5CN3A 4FQ1L 3IXTB 2WNNA 4OLVH 1E5YA 4N0CC 1WAAF 3QG6B 3V0VB 4IESA 2DZBA 4H0LC 4ZW6A 1RY7B 1T0NB 3CV6A 4IXHA 1FO0A 5C6WH 4N2OA 4BQ4A 4AHPA 4WV1A 3DMMB 4S3AA 3KHJA 4IMLA 4NOFA 1A1MB 1OSPH 4PRDA 1HJFA 2B4GA 3MZ2A 2X5IC 1Z5LA 1XNDA 1MNUH 2X89D 1CQ9A 2GOUA 1RP8A 3BSHA 4Y9AA 2VZOA 2BX7A 4OLUH 1M56B 2NX3A 3BI3A 5L2KE 4AR2A 3EJQA 3SHSA 4FOWA 1HJCA 4FTEA 1I9JL 4BM8A 2IPUG 1NOAA 3H2PA 1DQDH 5IGXH 2OX5A 2FHRA 4KRTA 4LKSA 4R4BB 2HJFA 2PCXA 1R3VA 4FZIA 3KYOB 5BVJB 1EYWA 3DC0A 1D9KA 3NJFA 3CLMA 2CDFB 2PXYB 2LVEA 5FPZA 3I6EA 3GK8L 4X8JB 2W65B 4XN4A 1ZLSL 2EG8A 2ZGMA 1G5AA 1ASJ2 2NW2A 3SGEH 4JYFA 1G9NC 1YXWA 3C87A 4NB7A 1E15A 3DDMA 4LPXA 4FL4B 2QJHA 4I30A 1YBQB 1EDQA 3ANUA 3UA3A 3ZT6A 3SJVE 3K2UL 4PJ6A 3RG6A 4NKDB 3ASNB 2P17A 4FI4A 3AW5A 7PTDA 3T4CA 1G7VA 3S36L 1XNTA 2R073 4WEBL 1U21A 2DURA 1XNBA 1NLQA 5C2BH 1KJLA 2FPVA 1MHCA 1BEUA 2FCUA 4AI2A 2E5EA 5D8AB 1Y6NR 4PRPE 4K1YA 1UW8A 3P80A 4D6GA 1WNOA 3MNVB 1W04A 5DMMA 4WW2C 4WFEE 4CCEA 4E8GA 3I9GL 4AC4A 5EMMA 5FYHA 4Y26A 3IFNL 4NGHL 4KK5C 1DVUA 4XVJH 1MJJB 2CJTA 3V9EA 2ITDA 5BV7C 5FM4A 5H4YA 3T55A 2CDGA 4N68A 2JIXD 2QVKA 3VXMD 3N1GC 4W9KC 2B5IC 4YSRA 3JVGC 2ARJA 4BQ5A 2R2HA 1Z5YD 4PODA 4MNQB 1GGIH 4MLSA 4ANWA 3VI4E 3K51A 1HB3A 1JZ7A 1OAXL 2VOVA 5EZWA 3ES1A 2DGAA 5CKNA 2VJXA 4DUVA 4E9VA 1V51A 2F9RA 1ONEA 2Y61A 3IS4A 2BIIA 3LN9A 1MCWM 2O6EA 5KHIA 1NP2A 3O2DH 4AWJC 1KCSH 4ZX5A 1CQYA 3WQGA 3IIXA 4ZTPH 2W1NA 2DBNA 5AQ0A 2WW8A 1HSBA 4KCVA 1PLGH 3CQKA 2FJFB 4XVHA 4IL7A 2LS6A 5HCFA 4FAAB 2YDAA 5A94A 3HZYB 1N19A 1GSLA 4Q3MA 1E4KA 1KTLA 4INFA 4X3ZA 1MCOH 1A5UA 2QFRA 2QR6A 2G2RB 3MLWL 4K8EA 4RGNB 4X5RA 2P5EE 5C8CB 1KGYA 4NKMB 2ZXQA 4DF0A 4LANA 5DC4B 3D85D 3DK0A 5GRYA 3OHXB 4X8CA 1LOSA 1FATA 4YHZH 1UWQA 4HJ0D 1OZTG 3KS7A 1MOEA 4AENB 2IDTA 2EXYC 1QY4A 1R4XA 2IIJA 1CAUB 4A6YA 4M6NL 1CFTA 2ZUQB 3SODB 2Y5SA 3MRJA 4X7TB 1GZTA 3HLAB 4PJDE 2WLIA 1EP2A 4UT7L 1AKJA 2AAAA 3TNMB 1IS3A 4S39A 3SPCA 1EQPA 4RA0C 3ULUE 2Q2EB 1SLTA 3IN9A 3O1SA 3Q06A 1JCXA 4ODSH 2XG4B 4DY5A 1H8TB 1JGDB 3FFDA 3IDYC 4OVXA 1QDSA 2J43A 2JDPA 4LBKA 3GHEL 4GXFA 1CGXA 3FT2B 3MNDA 5KYWB 5I1KH 1I9EA 1QNZL 2ZA1A 3DOPA 1XB9A 4I6VA 2P6HA 4M5ZH 2DZSA 3BT2H 1JNLH 4A6GA 3O8XC 2P5EA 2X2GA 4EQ2A 2E7FA 4ETQA 4FPEA 4CEWC 5C9RA 1WW6A 1A6TA 5ANME 1X98A 5JR2A 1AQMA 2XQXA 2D3JA 1FNHA 2CZNA 3Q9QA 4OZFB 2NNAB 1N70A 4YR6A 4N0FA 3SH5A 2CYGA 4ORIA 1MRAA 1ZD6A 4HUVB 1CFMA 5BMFL 2QVNA 4P5MA 4N8VA 3WJJA 4LPUA 1GVYA 5H37G 1BW8A 3CSYB 4YDIL 4DZAA 5AKRA 4KWKA 1BBJB 2R4SL 1TE6A 4F8OA 3DBXA 2OQJB 8TIMA 2I60L 1U3JA 1KXTB 4PJBA 5FFOC 1E50A 1G7PA 1VBUA 1EV13 4IGBD 1RK1A 5D04C 1CTMA 3EX3A 1BDYA 1F3EA 4BSWA 3G5VA 4EX4A 1UJ3A 4Q0XL 4TPRL 4UM9A 3FU0A 3MJWA 5AD0A 3NPUA 1T3FA 1BYCA 5DZPA 3E5PA 3P74A 1LGCA 3TVMD 2WM0A 3M5ZA 3CO8A 2W07B 4Z7OE 4N2NA 3QUYD 4HBNA 3QCTH 3FF8A 1U8OA 3QHZL 3GVVA 2A75A 2X28A 4RESB 2QGBA 3ILEA 3B3IB 1L3JA 1KKOA 3N34A 4NHCH 4HBKA 2CAUA 4Y19A 1RUKL 5ID0B 4P2RA 3U57A 4N1HB 1PJWA 3T4YA 2P5BA 3N6QA 1OF2A 2Y70A 2DVTA 1RCQA 2GQ9A 1MEWA 5MHSE 4PJ9D 4MFEA 2PU0A 5FDWB 4PJCF 3O12A 1U3HC 3T3PE 4OCTA 3BFOA 3N9OA 3FSWA 1WAAA 2G0LA 4GK8A 2V2TA 3U10A 2QKSA 2EKCA 2BMBA 2NMNA 3CUGA 4MQ7A 3KBPA 5CIPB 2E7MA 4N6QA 5IV2A 1OD5A 3TNMA 3QDJA 1X96A 1TKWB 1PIIA 5EUKA 1FL3A 1D2QA 3WLKX 3TA4D 4K9JA 2ZKLA 3PWJB 3E8VA 4WCYH 3VRJA 2H1XA 3KCPA 5GISL 4PUMA 4GZEA 3KT4A 3S2AA 1XIEA 4XD5A 2BUKA 4M8VA 5IMKB 4JRXB 3NDZA 5AYXA 3PNRB 3FIGA 3TZVC 3ZDZF 3G0UA 3LHVA 2PD5A 5CINL 1JPHA 3IPVA 4BB3A 4FA3A 2WKOA 3EG9A 4EN8B 4EIGB 1UQZA 2XWBA 3FJNA 2XN0A 1OM9A 2YXFA 4OM1H 4XAZA 5H2ZA 2WYIA 4GQ9L 5FA4B 5EN2A 3TQ0A 3I3EA 3V0GA 2F54A 3H7BA 4LA2A 3GVQA 5J04A 7REQB 2X9WA 3NN8B 3X1EA 3NIYA 2CSGA 4UDTB 4JFZL 3BLEA 1X6LA 1SDAB 4ZDHB 1UM6H 4JFEB 5GJMA 1TMF1 5EIYB 5BZZA 5KUMA 4HC1L 2APBA 2BOCA 5IQLA 4YEEA 2XPZA 3DC8A 4LO7A 3ILQD 4W6WB 3B5TA 1QNYA 3DI0A 1KM2A 1SW3A 5CEZE 4HOOA 1DZBA 1KV7A 4MDRA 4QPYA 4P02B 1EFQA 4L4JA 1OZMA 2HVNA 3QPZA 2E4TA 4NENA 3HBKA 2HH9A 4NT6A 4R3UA 3P02A 3K4AA 3FSAA 1J6PA 5I3GA 4C4KT 4A3HA 1WXZA 3FUDA 1SUXA 3FU9A 3ROLA 1NCNA 4IGPA 2ZA9A 1OHQA 2NW3B 4LBQD 4H26B 5JIIA 3TN0B 2VE1A 4ZX4A 2K9ZA 4WHBA 1KBBA 1ZT4B 1RURH 5IF0A 4WFFD 1B9ZA 4EXKA 1K8ZA 4V15A 3WIJA 1VIWA 4GRLD 2XPJA 3AMQA 1EJRC 3F7RA 4EVNB 3N9QA 3VQMA 4P9JA 3ELAT 3MSPA 3Q5YA 5ISZA 3JD72 4AG4L 3RVTD 2X4QA 1H4PA 5TDOA 1N2RA 1YLLA 5I30L 5DMJB 2WXLA 3S30A 1P5VB 2KLRA 1H0IA 3LTSA 4WM7C 3EBVA 4A7VA 3NFNA 3B9KC 3O3EA 1SUHA 5AG9A 3NNTA 4DYJA 4HHGA 3IVTA 5HYQA 2ZGQA 5DFWH 3NEXA 5LRSA 3ZQXA 4PR4A 2ENSA 4XPAL 2RDXA 1Q6DA 4BKLA 5EA0L 2VMCA 3LRHA 1CD1B 3PNAA 2OEMA 3TIDA 2FLRT 4CADA 4DRRA 1LAJA 1X9PA 3NCYP 3B9KA 3QXDA 1PLBA 3RPQA 3G18A 1ZHBA 3HS9A 3HZKA 1L0XA 4HISA 4YCPA 4R3SB 5IB5A 4WO4A 1RUC3 4KQNA 2YQ3A 2P0IA 2YYOA 4S3BA 1O9ZA 3ABXA 4GWEA 1W3XA 3USUB 5DUMH 3BTYA 1TQJA 2V5DA 4HUXA 4NQ1A 1UXSB 3ARBD 5JQHC 1CIWA 3PUAA 4WVRA 2OXGA 1AXSB 5INDA 4WSKA 4BF7A 3DYOA 1A8DA 2Q20A 1V08A 4CDQB 4MMYA 4B9ZA 1SXCA 3VNJA 2E7LC 3DROB 3GNMH 2R0KH 2WB1A 4XHJC 2IAAC 4XVUD 2OT0A 3DSNA 4GKOA 5DHEA 4AWSA 3LTVA 3PDQA 3RXZA 1KIRB 3AXIA 4FQJH 2C19A 4KTEH 3WLOA 3B02A 4JDEB 1G4EA 2EILB 4BJLA 4LALA 1U1UA 4MZYA 1OQOA 3ROLB 4WJ5B 4YWAA 1ECYA 3SCRA 2YBRB 1IE4A 3ZE1E 1HKWA 2BOEX 4NRYB 1EBGA 4HJ0C 2PGWA 4TU1A 4HOXA 2VM8A 4FZEL 4BXVA 3FUMA 3JYCA 1CESA 2QDRA 5LK5A 4Q4OA 4EN0A 1ME9A 1UNBA 4WI8A 2EP6A 3HRZC 4XF4A 1B09A 1TME3 4U2YA 3VLBB 4UTLA 5K9OB 3HJZA 1QO2A 4NSBA 3EKZA 4XE9A 4FQLH 3G6AA 4JPKH 1TFVA 4NNYB 4MA8L 1P5VA 2EXYD 2JKSA 2WSDA 5T3NA 4E38A 2PA6A 2QS8A 4Y8AA 4Y2OA 4GUOA 1OKEA 2KDYA 4HXCA 3GJAA 4Q58C 3RVXC 5FHBL 2VERA 3KZ8A 3K81A 1UYPA 3LBMA 1BEV1 2YA1A 1EEYB 1EGJH 2ZKWA 2BS71 3ZIMA 4MJ6A 4EI5B 4HU8A 5E5LA 3ELQA 3ES6B 5LA2A 4BISA 3N9NA 4IYKA 3ARBB 3KM8A 4NZ5A 3E2QA 5CJQH 1E4NA 1OOWA 2Z0BA 1SEQH 3UDWC 4AYDC 2NT0A 2GMMA 4JQAA 4L6DA 4UQDA 3VHPA 4BQXA 2QZ5A 1CR9L 4C54A 4CC4C 4B4RA 3GEFA 1QNPA 5A3ID 4N42A 3NACL 3LDRA 1KXHA 2PDCA 2EEBA 5EU5A 3PNWA 3MW7A 2P3JA 5M03A 1XNCA 1I7ZB 1HL9A 3ZXJA 3WQFA 2D22A 5CVRA 3DSFL 3V4BA 4K7PY 1P4BH 4HUXB 4M7KL 4G5ZH 5B4MD 3U8GA 4YZ5A 3D18A 4UU9B 2VXTL 3UJIH 5HULA 4LIQE 4L3AA 4XVTL 4GABA 2X3CA 4XJWA 3OR6A 1JDCA 5E9DA 3RZGA 5DJ2B 3P9MB 3K6IA 2GL5A 2ZZ1A 2BW4A 4FTVB 4GCXA 2WZ6A 2QBXA 2XFFA 4K8GA 5T3XL 2VQUA 4YDLC 2OMTB 3V4PL 1HRV3 1KBJA 2BSEA 3AYDA 3L17A 4LFHD 2HWF2 5AWNH 3U4SA 4AD5A 1P0DA 5E00B 5KBKA 2E9QA 1PTDA 2RA1A 4L92A 4X22A 3MBWB 4DN3L 5BW7A 1BAWA 2V9QA 1V6YA 3ZS4A 3BJFA 2NNXA 5D7IE 3P40A 5DN1A 3VCRA 4WW2B 3MYZA 2PDYA 1YQ2A 4AU0A 1EZVX 3AQZA 4GKTA 5I0DA 4BEUA 5ECJE 3N3MA 1IGJB 2HT2C 3FMGH 5E9AA 2ZZ2A 3C8KA 2QMKA 1F2QA 2BU9A 2VVEA 3SBWA 5FKAB 4BFNA 3DXAD 2GTZA 1A6CA 2V5JA 4X7TA 4UTKA 5HJYA 3F84A 4I6KA 5C9ZA 2PHWA 1US2A 4JIEA 3FB7B 4PMJA 2HWB1 4Q4V1 2YUVA 4ZMOA 5D70L 4LAQL 5ICUA 1AFSA 3KPQB 3VDDC 1NBZA 2H32H 2V81A 3MI6A 4S3EA 1OVPA 5AVHA 5B4XA 1H7OA 2F8OA 4TVPD 4XETA 2DDQH 3V6OC 2B31A 2R071 4P46D 3C0JA 1OAUH 3WFCH 4AIOA 3RYMA 2AQ2A 5ID0A 1OLMA 3AXHA 3L65A 1V77A 2W65A 2F5AH 2IADB 2CLIA 4ZXBA 2BNQA 4YMZA 3T0TA 3HJEA 1KV5A 4KG8A 2WQ4A 2WNUB 1QSFB 3LHPL 5CWSB 5I18H 4AF9A 2WWMC 1ORSA 5I74B 1AR63 3SH4A 3J4UH 1XLHA 4ZQRA 3VXSD 4J40A 1WIPA 4GMEA 4DP7X 1CF8L 1YUKB 3KD4A 2DVBA 3D3VA 3O16A 5LAXA 1KPRA 3WY6A 3VBSB 1C1EL 1Z6JT 3WJLA 3ISWA 3F7QA 1PWLA 2HZHA 5HCHA 1WE5A 2GH2A 3JWDC 2QQNA 3WUWB 1A2YB 1DUZA 5T1KB 1ERNA 2PP3A 2PUZA 2ZJSL 1C16B 3F7YB 5IB4B 2CBQA 5I1HH 3GSNA 4HPYH 1BRLA 1INDH 3RAOA 1U8QB 5IESH 3IFLH 2FNBA 1QBMH 4JGYB 5J6HB 1AD1A 4O02A 1E5IA 2NNCA 1LJMA 1X4XA 1IR2A 2H26B 1BXVA 3K80A 2QE3A 5FM5M 4JPVH 2PGRA 3HFML 4H9ZA 3B2VL 4JO5A 4UAOB 3VIGA 1NGYB 2OP4L 2LAAA 4URAA 2H1PH 1EEZB 3QPQC 1R0MA 4Y1AD 4UNTA 3OTRA 1SMDA 3CVBA 4XVEA 4LVDA 5EMLA 4OCSL 2WUHA 3CV5A 1VFHA 3L9BA 4RDYA 5FBJA 5C6MA 1EIBA 4XFIA 2I7OA 3HR6A 4DYKA 4AG4A 1GW9A 3VWKD 1FP5A 5F7BA 5IQ9A 4IRSB 3COTA 5A2BA 1SLLA 3V1HA 4Y9PA 4XXWC 1VPOH 2ZOLA 3R06A 1RA0A 2H4EA 3HWJA 1YQ6A 4FI7A 3RR4A 4CGUB 3OMNB 2WSRA 2RKXA 4N43C 3VRJB 3PUEA 4Q5OA 4NQVB 4PLMA 3RG1C 3GBNH 2P5ED 4FFVC 1S1PA 5I03A 4YVSA 1PMIA 4K23H 5AC5A 3C60B 4XT1C 3NV1A 4XMIA 1PGL2 4JGUA 2RG4A 3OHXA 3OHIA 5IJVA 1I9CB 4Z2JA 5BV7H 3S1XA 1TNRA 1H19A 3TYDA 3G3LA 2FJSA 3T4AA 3SE3C 1JK8A 3W1UA 3US0A 2XX1A 7XIMA 1R3JA 3UY8A 2X1SA 3DFNA 4LKDA 2CPUA 2HTMA 2VX6A 3GG8A 2R83A 2KD7A 1C7TA 3WGUB 4KCWA 4HH8A 2B2XH 4QRRB 1W9DM 2R2BB 3O6DA 3CAQA 4YQXH 3FO0L 3D3VB 2VP8A 1SBSH 2Z35B 3BESR 4ALAC 1KF9B 3J7MA 4BKLB 3U6XA 4DBUA 5CQ1A 2AV1A 3ABLB 3ZQWA 1SSDA 3RDKA 1WCDJ 4DGUA 1M7DA 1PCXA 1WD8A 1KLFA 1XLIA 3V55A 3NV4A 2GJPA 2ZG3A 3TFKC 3OBAA 4D2NA 5JA8B 2V33A 3ZN6A 2XWTB 1TVHA 1NBQA 2Y64A 2JJSC 3HZKB 3C5SB 3G1AA 1BVP1 4MMZB 1QR1A 2ZACA 3CBKB 4D2JA 3HC4L 2CUMA 1DDHB 3C5ZB 2HRPH 2DI7A 2AQPA 2E7DA 6XIMA 3WJJC 5C09D 4GRLB 4XOCA 2Y69B 3LVTA 1TQCC 3FN3A 4S23A 3RO6A 1CE1L 3W9DA 3FO1A 4LYPA 3B94A 3BT2L 2PDUA 3YPIA 3DGCR 5JI9A 5E9NA 2A6JB 1BYNA 3PWUB 4HEMA 4LBQB 1TYGA 4ISVB 3G22A 1O6TA 4FJZA 4OLZH 1JHLH 2WWOA 4JZRA 3R1ZA 3VFTA 4PBDA 2A1XA 4ICXA 5ID1B 5IHUL 5HHPB 4UBPC 2EC8A 1WJ3A 2WVVB 4RMSA 2R8WA 2X6BA 3CIVA 4KV5F 4AEOA 4HKWA 1QR7A 5FEXA 4QY8A 5FOOA 5DBUA 3BGFB 4I2XE 2XH6A 4ZS3A 3FX4A 4UXDA 1ICPA 3WHXB 3T40A 3BVJA 1BECA 5K59E 5FYJH 4IGQA 3AJ7A 2ZX0A 1WAPA 3ISYA 4L4TE 4L29B 1ZHBB 3HPLB 4FQZA 3CSFA 4Q4IA 5AAWC 4JZ5A 4D8OA 3GNOA 5D71L 2ZUWA 4N0CD 1UY0A 2HG0A 2GGEA 2GW5A 3STGA 3K3OA 5C08D 3VRIA 4L3FA 1TRDA 4OLXH 3KCYA 2J77A 2PPEA 3LNFA 5AC6A 2ABBA 4D3CH 1B4LA 4H5SA 3FLPA 1OG0A 3HE6D 1X7TA 5DY2A 1W0OA 3QXWA 2QELA 3ZX7A 3W71A 2YY1A 2TSBA 3CEWA 4OF7A 4LF3A 5EBMA 3R5EA 1FFQA 3I6GA 1MCJA 3SCMB 1ETA1 1AG6A 3GGLA 2WLJA 2RR3A 3MLVH 5JW4N 4KX7A 5DYOA 1TME1 2BP5M 2JTDA 4JO2L 4GH4C 2O14A 1NCRB 4BU2A 1KB5L 4AUBA 1VMHA 4NKIH 4E4DX 3PQYE 4YEFA 1WITA 3OPTA 2LOEA 5EOTB 3EKGA 1TX0A 1K4DB 1DGLA 1WO2A 2VGDA 3E49A 5FPIA 2DVGA 1JUEA 3D5OA 2FUQA 5HGHA 1XCQA 4PJXB 3EJRA 4PJGE 1F3JA 5AOMA 1HL2A 5SX5K 4CNPA 1TENA 2WYSA 3FXIC 3VFUA 3OZLA 1AGBB 4Y4KD 1UT2A 4ZT1A 3TEYA 2WXMA 2BNUB 4ZUUB 3MV8B 1LP9A 4YGDA 2J8UF 4FQ2H 4JZJC 3SIMA 2AP2A 2E7CA 2VC2L 5KSUB 2WW5A 5HUOA 2DZTA 4LKCB 1RHI1 2FWUA 3BN9D 1TYEB 2AC1A 1SM9A 4XPTH 3Q2LA 3RZCB 4H4NA 4A3ZA 4G7SB 2BIQA 4E3VA 1BQCA 1DQ4A 5K93A 4KHXL 4BE6A 3WFZA 3E3QC 3G9VA 2Y6SC 2O5ZH 1REIA 3J7NA 5LKYA 3FH7A 3JD73 3H9HB 1RK0B 2VM9A 2J44A 3ARED 2I7GA 3VBHB 1JGEB 2G3ZA 1PCWA 1D3GA 4GISA 3SPGA 2JKRM 1QPXA 1S7WA 1HJVA 3ZE2B 4IL2A 3QNYA 5L4MA 4ETYA 3GG1A 6TIMA 3DOSA 3R10A 3O6FB 4MXVF 4OTKA 3CZFA 4NQQA 3IN0A 4Q4QA 4ANKA 3LRMA 5FYKE 4UF7C 3BDYH 3L3IB 3OP2A 1XRFA 1OX6A 3L7EA 1BLNB 2HVBA 1I7TB 1QKZH 4MCNA 1QJX3 2CERA 3S9YA 3C2RA 2QUTA 2RAMA 4JD4A 5I1EL 5DAWA 3LFIA 5T3XE 1PHQA 1NQBA 4BHPA 1W03A 3CFBB 2SEBA 4HZ1A 4E2GA 1A53A 4LIQH 2GK1B 5KZCD 4LEJA 3EWDA 5CBIA 2OZ0A 3QA3B 1AYM3 4ZXBB 3ICJA 4F1ZA 2QQLH 4IIHA 5AKSA 3MU3A 1CPNA 4TSBL 1CAXB 4I5BA 4OM0L 1K42A 4J1OA 4URTB 2ADGB 4JS7A 1FFNA 3AT9A 3R8BB 2WLZA 2FMYA 1ZLWK 1N7MH 3BUQA 4JN2A 4HCDA 3GTHA 1UJTA 1GHSA 2XVGA 5BMFH 1I0DA 6PCYA 4PC8A 1OF4A 1W3HA 2C9RA 2ZWSA 3MJYA 2VTXA 4HPOL 3NBNA 3LEXA 1KBIA 4WU5A 3UJJH 1FC1A 2O6FA 1K6WA 1SXNA 3ZFHA 1B4KA 3FCTB 4JVUA 3VZMA 1W2UA 2BJML 4PRIB 2MQGA 3VHNA 1YNLH 4B9JA 2D24A 3BP6A 4Y9OA 2CXEA 2J8FA 1NGXA 4EIBA 4UCFA 3WFAA 3PMSA 5E5CA 2FBOJ 2J6EH 4OHYA 5AN7A 4EPDC 3TJLA 9XIAA 4Q6IC 1M1XA 2J7HA 4U6XA 4YLCA 5D8JL 3W7NA 1QO3A 4FFZH 5FJTA 5HNNA 3NCBB 4FP1A 3QKEA 3H4HA 4XFHA 4BOWA 1GOHA 2WYTA 1HSAB 4BHUI 2IH3B 4GKZB 2AGTA 3TLRA 1FDLL 4JG9A 2YZ4A 3SW6A 2OXNA 1AUSL 3PPEA 4PE8A 3FKUS 2GJLA 1VGKB 5FYLD 1VFAA 2PCPA 5I0XA 4TOYL 3KGZA 1D9KC 2R0LL 3AQYA 1XPGA 3VB9A 2P43B 3PWPD 4GS7B 4JPIA 2WBGA 2WMHA 2EVFA 1DJWA 5M1TA 3HMXH 1DVFA 1D2SA 5T5FL 3UBFA 2W0LA 1MWAB 3WOVA 3TLLA 2VIRB 3DBPA 5IOBA 1H9DA 1K7XA 1UUMA 4DJFC 4I89A 3QYQA 3N55A 2A5HA 3KPRB 1G7HB 3BTAA 1AUYA 1GOIA 3RDIA 2CBIA 5FK7A 2XVKA 4YZWA 1VJ2A 1V03A 2YXOA 1JWMA 2WSYA 4R5EA 4ZQKB 2C1PA 4APQD 5EC1A 4YHIA 3L1GA 2NXZB 2J7FA 5C0IA 3MRDA 3ULVE 4CC0A 1D7FA 4HA3A 2H8ZA 4BINA 1D2KA 1OL0A 4JGYA 3JSSA 2OMVB 1O3RA 2X1RA 4IRZH 5DTFA 4HIJA 3NJZA 4E41E 3MRRB 5JYMA 3W9ZA 3GDKA 3MDJA 4DP2X 1NLBH 5LKNA 3BW9B 1MXGA 1W8TA 1E27A 4Z3HA 43C9A 2GH8A 2Z69A 3T0WA 2JDYA 3UZYA 1UFUA 5DAQA 2X87A 1NMCC 2DT2A 4NUWA 3OY8A 2VLLA 3HU7A 4RE4A 1WS7A 4Y5XB 4QLJA 5E6YA 4NNCA 2WC7A 2HWF3 1AQ0A 3CL6A 5DD1H 3VKDA 4PW4A 1W72B 2WZPD 1NG0A 4H25B 4OV6F 5CBAB 2A6XA 3BD3A 4NZRH 2CHWA 2FLMA 3RS6A 4L0ZA 4D6RA 4JRYE 5F1NA 2VNCA 1SSGA 1ZY9A 1MEC1 3AREB 4DCQB 4L2YA 4CMMA 4YJZL 4C60A 3UYOD 1N7KA 1AH1A 1WOAA 3L95B 5JHDE 1PHWA 3LS4L 3GK8H 5K9DA 1A3RL 4Q6JA 2VD9A 1VZIA 3ULUF 2WZAA 1R093 1MPAH 4H6RA 1E4WL 4MJ5A 5DJXA 5IK3B 4XCNB 4FXGB 3HEIA 2DQMA 3HZ3A 1S5HA 1OAJA 4A3QA 1H6TA 4O2FA 1FYTE 4WEVX 3UK9A 3KJ6H 4K2UL 3WFEH 3UOAB 3JBG2 5F6LB 2ORBL 2DYCA 4YC2B 1C3HA 5BOFA 2BVDA 3QACA 1HGYA 4XUYA 4QQ3A 3L3DB 5C33A 3HQ1A 1YCIA 4WW2F 3TN0D 4ANVA 5AOLA 2IGLA 5EO0B 2DTMH 1TPEA 5JHDA 3E2SA 2R2CA 2D7TL 1DVQA 2OIIA 1I2RA 2YPLB 4A39A 4Q8NA 3GMQA 3T3MF 4MWAD 3MRGA 3ZPOA 4QX7A 5HV4A 1HKJA 3U2SA 3FFCA 1GYLA 1I5PA 2X1QA 1ACXA 5F9AC 5ABFB 1N9PA 5TNVA 1ASJ1 2X7LA 5IFJA 3HBLA 4JFOA 3C6CA 2PAMA 1BXHA 3LKSA 4X4MA 4G5AA 2DSVA 3MYXA 3W7PA 3O6YX 1J5OH 4YHNB 1V3MA 1VCAA 3SOBH 5HYSA 3MFGB 2DCJA 1UKPA 4HHPA 5ACZA 1XCTB 4ICNA 4YHGA 4CUAA 1J5CA 3A5FA 4U28A 3KPMB 5B80A 1OK4A 4Y9FA 1IC0A 4ZTOL 1KEXA 4X5XB 1OD3A 1IE7C 3UZEC 3BN3B 4ZQPA 1KCLA 5C0BA 1JPGA 1KNWA 3K0WA 4DGYL 1SFJA 2E6AA 4PJ9C 4LHNA 3B56A 1X7SA 1C16A 4KW2A 2Y7EA 4JM4H 1Q1JL 1TELA 2PS2A 4TM9A 4XX5A 1JU4A 4UIOA 5D71H 1DQWA 4I0AA 4XURA 4LBEA 4OR1A 3B06A 1P4CA 1T21B 3HZYA 4PP2A 2XBDA 2INFA 4O16A 1RUSA 2C3WA 3DFPA 3DYMA 4H88L 4KO6A 3ZYIA 2JIWA 4XPFH 1SGJA 4Y1TA 5CSZB 2E0PA 3DJRA 1F4XL 4IFKA 2VR7A 2P53A 2ZRXA 4HSAC 4L1GA 4ADSA 5H37H 1FDYA 2ZWLT 5DGRA 2BY3A 4KL1A 5KYYA 1MZ5A 4R2GD 4UTUA 3A4AA 4LY8A 2R8SH 3I2OA 3NW4A 3OKKB 2BBFA 1MKFA 4A55A 4YDNA 2OP4H 1KGUA 5CEYB 3RY6C 3CSTA 3GHPA 4WTZG 5I1KL 3O3EB 3JB8A 3ZZQA 4X5LA 4B4QA 2ZCHL 1W6MA 4JPVL 4N0YL 1TWZA 1RITA 2D0FA 4WM8A 2AQVA 4BXFA 4PD4J 5DZFA 4MZIA 4BSVA 5DY3A 2F53A 5L7OC 5AW2B 4WOZA 2PGEA 4UMAA 1RUJ1 5KYWA 2H7WA 4MA7H 5IESL 3WQ1A 4G8GB 1O6VA 3BLOA 4GD0A 2BHUA 4MZ3A 1WDPA 3GMMB 3V0SA 1C08B 3CWHA 2V9RA 1IXPA 4Q32A 3GG7A 3ROOA 2WC2A 3W2DH 3MYOA 4QT5B 4XSLA 2RGSA 1S9YB 5I8TA 3LCXA 2SFPA 2ESVB 2WKJA 4NJ4A 2XICA 3S46A 1XF3B 1AGEB 4LHUG 1VALA 1K4DA 4IFRA 3RL2A 5CJXC 2ZX6A 2O1QA 4P07A 5TBOA 1RSFA 3LZ5A 1ADSA 1FNFA 3TESA 1C5IA 4UQAA 4NHVA 1DQJB 4RBPK 4LRNL 4YL9A 1V3HA 1IQWL 4PPTA 3PVNA 3QARA 3UY7A 3PPSA 4R9BA 3N4FA 5C8JB 1G0CA 3WN5B 2E9JA 4C6KA 4F9PA 2CIIA 5D1ZB 4TSAH 3I2GA 1UR2A 3HPNA 4FFWD 1DQ1A 3N42B 1WBJA 1F42A 3DIDA 3U79A 1ZSHA 3CJXA 1JPST 1OINA 3WAJA 2VELA 1N8ZA 3UYJA 2ZKMX 5EOQH 3HR9A 2IPKA 3C2FA 3SDCB 3AHYA 5FZ0A 1OP5H 4P5KA 1I1CA 4XPFL 5AZEH 4MYEA 5JMOC 2H3DA 4WU7B 4IFKB 1RUI3 1KC5L 1PKQB 5KS9E 1L6WA 2Y33A 2Z7UA 4N6FA 3ITQA 4XZUA 3QHOA 1NDZA 2WXGA 4MQXC 3WDYA 2PLMA 2DLIA 1SLXA 4OFGA 3OKKA 1N47A 2X7VA 3EYFB 5AW3B 3F58L 1K02A 1H1YA 4NWTL 3VWKB 4X9YA 1NQDA 1K77A 3UYCA 5F0JB 3U30B 5G4NA 3D08A 4CD7A 5JTWA 3CSGA 1IEQA 4E0RA 1T0MB 1BXNA 1W1PA 5LRRA 5E4OA 3DX3A 1ZB5A 3ESVF 4S1SL 2WNOA 4GW1B 5GS0L 3RWEB 3ILDA 3H2FA 3APFA 1DBAL 2Y7FA 4JFDD 1A1OB 3UA4A 3DZ1A 3OPUA 3VZXA 1CLOL 1KLUB 4E27A 4GBUA 2WMFA 3WQWA 3N5AA 2VO5A 1L0PA 5EB8A 2WXNA 2IXQA 3ZE0E 2A6WA 3CEUA 4B5XA 3MLYL 1N4XH 1R3KA 2BNQD 3H7BB 2E8YA 3CVHA 5AC92 4U6YB 5EWIL 3C6SA 2AKRA 2VZ3A 1J05A 3VD2A 2UWAA 5T1KD 1RSYA 4ZFZB 1LK2A 4RETB 4M1RA 2WT0A 1H15B 3B9OA 1RUG2 2YHJA 3GRWL 3MV9A 2NLJA 4XE0A 3PL6C 3KPTA 4S1RH 3LB6C 2DV0A 4Y4FA 5E88A 4U3SA 4XUTA 5KS9F 4AY1A 1YJDC 4IOSA 3VD7A 12E8H 4W9CC 4LSVL 5EXOA 5LGXA 3ETBJ 3K8MA 3O41A 2J7DA 2GHWB 2J1TA 1KM3A 4CP9B 3EBRA 1HP4A 2JD9A 3WYRA 5BZWA 1IEVA 4MWFA 3S5OA 4HGWA 5IVYA 4HNLA 5HHQA 1JN6A 2HWC3 2IDQA 1YNQA 4A3YA 4RLDA 3QPKA 3BKZA 2A4ZA 1QO3B 4KO5A 3ZFGA 1IQDB 3DX6A 3ULSA 1P4IL 3L2HA 1WIOA 3V2AR 4G3YC 3PDOB 2OX4A 1BREA 1X9RA 5ISZE 1EFXB 3MCLL 1TMQA 4ZXBC 3VYLA 1JGVH 1KN4H 3UWUA 2NR6A 1T7YA 4ZUSA 4UMSA 1UYWL 3V6ZB 2W9EL 3WIIL 1AR2A 2F6KA 2NZ9D 2GIXA 5HNRA 2VLLB 4I8YA 4OJYA 2FWOB 1CIDA 2VXSL 4YBLB 2L7EA 2QVHA 3QO1A 4ODBD 1H5BC 1MEIA 2W1WA 5MP6L 1XZWA 4RNHA 2R0WL 2GABA 5EFFA 4JNXA 1XF4A 4ZONA 3L8QA 2A9DA 3EWYA 1J1OL 1UOGA 4K20A 4FG0A 4IGSA 3ON7A 3EAKA 2OW4A 2NQCA 5A6AA 2HJPA 1T1ZB 4QFUA 1W9FA 4S1SH 4ZMYA 1CN1A 3RWEA 3AM2A 3ILRA 4Z5RA 3U46B 2IPUK 4CMMB 4NO3B 2QUNA 2EEFA 4LTSA 2B1HL 2VW4A 2Y6SD 1HFBA 4ZW3A 1O8SA 1GBGA 3LPPA 3O3DA 3IU3A 2FQEA 1T66D 3TLQA 4HONA 4JV4A 1OGSA 1PVXA 4QJ4B 1S5IH 3D0AA 1F9CA 3DBNA 2DWTA 5ECVA 4O2EB 4KFOA 1T04A 4PEKA 2E09A 1QVOB 1LDPH 2K3TA 2WLPA 2ONEA 3NQ2A 4A21A 4L4PA 1NCCL 4LDCA 2VZTA 4LQRA 2CDEA 1E0OB 4F15C 5FBZA 1G6RB 4XC1H 3ZKYA 1KM1A 3MFAA 4S2BA 5GRJL 3UJSA 3GYEA 1W16A 4AH2A 3SBQA 4UQ3A 1RV8A 3SGDH 4ROPA 5IDZA 1XD1A 4IUOA 1JGLH 3GSUB 4PI2A 3IMWA 2WP3T 2BDQA 4JTNA 3LKRA 1OCRB 3IANA 1AW2A 1RUKH 2AQ3A 4MJJA 4GP5B 5GGSY 1B9BA 2J75A 1DXIA 2WFF2 5B8CA 4GQPH 4Q89A 5CCJA 5F7WC 4G7EB 4LLWA 1TNMA 1PGSA 3GCXA 3F2ZA 4HT3A 4P59L 4AZ8B 4U1IA 2V4LA 3NTCL 4I4WB 2ZC8A 2XZ7A 2K45A 1AIFB 4L4OA 4XP5L 2POTA 1TZ7A 3PJQA 4R33A 2ASHA 4IKJA 4AXKA 4O65A 5EF3A 3W86A 4CNTA 3IF1B 1B3WA 1G7MA 4GW5B 2YXVA 4NWVA 1S5TA 2BRRH 5A1FA 1LTEA 1W9UA 2B0SH 1NXMA 2Q2LA 4KMQA 1SQMA 3CQOA 1I1WA 4ZX3A 2WNWA 3CXDL 3GTIA 4TQIA 3ES8A 4NQCD 2DU0A 5C0FA 2YD7A 1QP1A 2OFJA 2ZNXA 1F1AA 3NNLA 1OSZB 1U6AL 4M3KB 1P6WA 1PDKA 4PJFF 1M9HA 2OMXB 3FT9A 1FYTD 4CSSA 1NPUA 3WBYA 2WD0A 1GONA 2XV6B 3U25A 4PF5A 2JE9A 2GPTA 2R30A 3REVB 2R32A 2YBKA 4OUSA 2WHMA 2YPLA 3IJ7A 1GNHA 2GY7B 4Z7IA 2WXQA 1ORQB 4C5YA 1CAWB 1HXS1 4OM0H 2Q8BL 4I2XB 5IT2L 2VDNH 3NO5A 3WK0A 4NRZA 1B3ZA 4AIBA 4QQPA 2C6QA 5T5JA 3PNWB 1UT9A 4XO6A 1GH7A 3FU5A 1FWCC 4GXUM 2GJ6E 2X4TB 1WS8A 3FT0A 4EWDA 2ZKHH 5IVZB 1FAIH 5I0ZA 1J59A 3B7MA 1M1BA 3AL5A 5C7HA 3D48R 1C4RA 1GVFA 4JRYA 3V0AC 3BAEL 3CKHA 4O8AA 2AGJH 4HSLA 1XGUA 3H3ZA 1BD2A 1R1A3 2QLYA 2J1ZA 5L0QC 3STZA 1CXHA 2D6NA 3AZZA 1F3XA 1QJU1 4O52A 4ENLA 4FTVA 3KHCA 3BD4A 3VXSA 2JICA 3SQBA 5DI8B 1VFFA 3O6ML 3GFXA 3SGDI 2BOBB 4DTGH 2CAKA 4YAQB 3MLTB 5IHLB 1D4M3 4JN8A 1TCRA 1TPXB 4I48B 2NMSA 3GMRA 1HX6A 1ZVFA 1IEIA 3MBWA 3LQMA 3ZN5A 3ETPA 1ASPA 2G97A 5C0QA 3CVIL 3EYSL 3E5UA 4HDIA 3W56A 3GXMA 4UQIM 1DXEA 3NG5A 4KWLA 1IGML 4FN0A 1R1A1 3VMOA 3P82A 1QYGL 1ALDA 3FRUA 3QZNA 1HQRA 4KK6D 3OQEA 3SYQA 1ZA3A 4DP0X 4O1FA 4PQ9A 4XW3A 1CB7B 1ZSDB 4L8DA 5DRIA 2KYIA 5I91A 2V63A 2WNZA 4Y5XA 3UJOA 3NSMA 4NQEB 4YGVA 4HH9B 4BDVB 2Y1ZA 4AZZA 3TPKA 3NQCA 3Q1SL 4E9YA 1YMHA 1X5ZA 3GR4A 2CZ5A 4WWKB 4BFFA 2OPJA 2GT9B 5F3BA 5JOXA 3QJVB 2F6BA 2PHUA 3MDWA 5CCGE 2Y5EA 5GQBA 5FYIA 1ZA7A 2F9BT 4XTMA 2J7LA 3RWHB 3QULB 3QPXL 2YD2A 4GG6A 3NURA 4I7UA 1W8FA 3QJFA 2B0MA 5KVFH 2XDVA 2DQWA 4JYEA 4KMTH 4EKXA 4OTXL 3M9YA 4R4XA 1QA9A 1CAWA 1B31A 3C2OA 1SF5A 3N2CA 2IBBA 1HKKA 1HZHH 3SE8H 1UH4A 3N40P 4MXQC 3ST7A 2F19H 3PPFA 4HZAA 1O6UA 1OE1A 1OSYA 1VA9A 3KCOA 4MJ5B 2FFCA 4LPWA 4NZ1A 5JXEA 2FX8L 4OZ4A 2ZXGA 4GB33 5LIUX 4EUPA 1BZDA 3V0BA 4W9EC 1QQDB 4ECNA 3MRNB 1UIPA 3X3GH 3H3KA 1URXA 1U8LB 4QNPE 3D87B 1H0GA 3O9WA 4C6JA 4F9DA 3MI2A 3WJMA 1WSST 1JGVL 4GH7B 2KZHA 4MAUH 2I32A 1HN1A 3ULVL 1HIMH 3LZRA 2IS7A 1BJ8A 3LB6D 2J27A 4B9IA 2YGMA 3H26A 4PTDA 5I9QC 1H09A 1XF1A 5I1CL 4DAFA 4Q4KA 1WA6X 3RRXA 1I8KB 1AXYA 1RUD3 4YXGA 1J9TA 2QZQA 1PDYA 3QRGL 4LUTB 5HBBA 1IX2A 2AGSA 3BKCH 3ARGC 3EKCA 3LA4A 4LCQA 2H0PA 1QWRA 1TQVA 4Y7MA 4R4NC 4LUMA 1SJMA 3BYTA 1YJDH 3PTDA 4PW9A 4R26L 4XJAA 1UR3M 4PRHD 4X4ZA 4HA0A 4HDIB 4WVXA 1NBVL 3WNKA 2P3KA 2L3BA 4D7BA 2C79A 3DUUB 4U7SA 3WMSA 1CI1A 3W1AA 4IGBC 2IV8A 3BUYA 3ATAA 2WDBA 5C2XA 2XA3A 1LU2A 1U58A 1J0KA 1GANA 1DQXA 4I18C 2ZSVB 2Q86B 2NSXA 3AU6A 1OALA 3GWJA 4ZMVA 2VOXA 2CSPA 2P8PB 3EGXA 3PVEA 1GVIA 4KY2A 2HTLC 2AXFA 1M9SA 3UESA 2EG6A 2FX9L 2AERT 4WIQA 4KXAA 4Q4PA 3OOQA 4ZFOA 1TQTA 2WWUA 1B3VA 1IS5A 1K9FA 3KWXA 3STCA 4U3XA 4D9QD 4W9HC 3F2DA 1J0JA 5DXWA 4YM1A 2J88H 3BZEB 3QVQA 4N9BA 3ZTNH 1A1OA 5DZNA 3DOHA 3JV4A 4XPHL 3B3IA 4LXFA 5I75B 4LH8A 1S5VA 3LCFA 1UQSB 4CSPA 4NRYA 3ZR6A 3G5YA 4B0MM 5C71A 3TVMA 4HU3A 1BEYL 1SDDB 4KZEH 4MNGA 4JJOA 2HWD2 3S5YA 1W1TA 2Q3ZA 3WH8A 15C8H 2AJYL 5FCCA 2FDHA 4NLHA 5DUBA 4KQ3L 5KYXA 3CZSA 1OE3A 4L0PA 4R2GC 1L3WA 5C0CE 4ZTOH 3EGJA 2XIJA 3TVAA 3ZJAA 5BJTA 3NNFA 5B7FA 4PEEA 4BMEA 3VAEA 3GZPA 3UZXA 2RR12 1FPN1 1A78A 3S37X 3TVMC 1E9ZB