4QAWA

Structure of modular xyn30d from paenibacillus barcinonensis
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
537
structure length
537
Chain Sequence
ASDANINLSSEKQLIKGFGGINHPAWIGDLTAAQRETAFGNGQNQLGFSILRIYVDDNRNNWYREVATAKRAIEQGALVFASPWNPPSDMVETFNRNGASAKRLKYDKYAAYAQHLNDFVTFMKNNGVDLYAISVQNEPDYAHDWTWWTPQEILRFMKENAGSIQGTRVMAPESFQYLKNISDPILNDPQALANMDILGAHTYGTQIKDFAYPLFKQKGAGKELWMTEVYVPNSDNNSADRWPEALDVSYHMHNAMVEGDFQAYVWWYIRRQYGPMKEDGTISKRGYNMAHFSKFVRPGYVRVDATKNPDTNTYVSAYKGDNKVVIVAINRGTSAASQRFVLQNGNASTVSSYVTDSSRNLASLAPINVSNGAFTAQLPAQSVTTFVANLSGGNSGGGNVNTGTTYEAETGTTLTDAVVETLYPGYTGSGYVNFNAYTNSAIEWNAINNMTTGTKNVKFRYALESGTRNLDIYVNGTKVLSNEPFTETGSWSTWGEKTIQVAMNSGVNTLRIVTTGTEGPNMDNITVTASAKGELNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Analysis of Glucuronoxylan-specific Xyn30D and Its Attached CBM35 Domain Gives Insights into the Role of Modularity in Specificity.
pubmed doi rcsb
source organism Paenibacillus barcinonensis
molecule tags Hydrolase
molecule keywords Xyn30D
total genus 159
structure length 537
sequence length 537
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
A PF17189 Glyco_hydro_30C Glycosyl hydrolase family 30 beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4qawA01
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4qawA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4qawA02
3GNOA 1W1VA 3GGLA 1M7XA 4Z2KA 2DH2A 4CUAA 1BVZA 1HJSA 1JNEA 4R5EA 3LRMA 1TA3A 4AISA 4MNMA 1IT0A 1J0ZA 1SZNA 1JYXA 2CERA 2C9KA 3RM9A 3UG4A 2W3JA 4GWIA 5BXRA 2QQOA 2Y4SA 3WF1A 1CNVA 4D71A 3AS0A 2CBIA 4UOQA 4CN1A 3AC0A 3AZSA 3VIFA 4MB4A 3AIRA 2BERA 1QI3A 1W1TA 3SURA 4AEFA 3ZM8A 2J7EA 1E55A 3NJVA 1JI2A 1QHPA 4DO6A 1JU3A 2G3MA 1B31A 2GSJA 3BH4A 3WNKA 1UR4A 3MSGA 2G8ZA 2EIDA 3VIOA 3LEIA 3C7GA 3CKHA 1NQ6A 3ARTA 1PJ9A 4GI8A 2BXYA 1MVYA 4W7UA 3G6LA 1HIZA 2E8YA 1JYVA 3WH8A 1DHKA 3EJQA 2WSPA 1RD6A 5A3HA 1BGAA 1UX7A 2XIIA 5CJ5A 1QWNA 4RYDA 4UTFA 3VGDA 3VD7A 5DT7A 4D6EA 3WUEA 1UD5A 3ZSSA 3K46A 2WHLA 1PEZA 2ZIDA 1Q6GA 3BVVA 4UR9A 2WWCA 1E6QM 2YA1A 4MTVA 1NWTA 2XYLA 2BY0A 1VFOA 1MWOA 2Y6KA 1QBBA 2C7FA 2DDXA 2E9MA 1BYBA 5A8NA 2EIBA 1BTCA 3BUBA 4RN5A 3D4ZA 2QBXA 4MNLA 3C7FA 1OF4A 2O9TA 1HXKA 4B16A 1A47A 4PQQA 4X0NA 1KFWA 1JF6A 2XUCA 1OD0A 2OSXA 4BF7A 3POHA 1HJWA 3A4XA 1BLIA 4LGXA 2YBTA 3CIVA 3WMSA 1GOMA 2BXZA 3CHCA 2XVNA 4W5UA 4P00B 2J7HA 1O6IA 1QVBA 1GHSA 4E2OA 4B9ZA 1B3WA 2G3JA 4CD5A 1FHDA 1E3ZA 3WELA 5AC4A 3RPMA 4JL1A 4D8MA 5I6SA 2VMFA 2X2IA 4J3TA 4PMYA 1CX1A 2YJQA 3WDPP 1VJZA 5A2AA 2YDRA 2WN2A 4QDSA 3OLIA 4W93A 3WFZA 2PC8A 3MMDA 5BYWA 1EO7A 2BVTA 2CETA 1OD8A 2UY2A 5M17A 3M7SA 1W9PA 4V2XA 3OA5A 3KL3A 1TR1A 3LX9A 1BSIA 2JF6A 2XSBA 3CZEA 4H41A 1C8YA 4ARXA 2F7PA 1KBKA 2W87A 4AZ5A 1CTNA 4F9JA 5DPNA 1Q6CA 4LYQA 4UZSA 2O9PA 5E09A 2F7OA 1BAGA 5I79A 4MPKA 3S5YA 4PSPA 2ZUTA 5E1QA 1DWFM 2WK2A 2EPLX 2DSZA 4A44A 4L4PA 4M81A 2YFNA 3EMQA 5BCAA 5JR2A 1JDCA 4Z2AA 3CZKA 2W61A 2XG9A 2WXDM 1HJXA 2CNCA 5CG0A 1ISXA 1JD7A 1K9EA 3AIEA 1WE5A 3LPGA 2V3EA 1X6NA 2CXGA 3I3BA 2CDOA 4D1IA 5FIPA 1ULPA 4DWSB 3VDHA 3BUIA 3GH5A 1EHAA 3VGBA 2IGTA 4U5KA 3I3EA 1LNSA 3NRUA 3SUWA 1TQUA 3RCNA 4IUGA 3CO4A 1OT5A 1W9DM 4Z2HA 1HXJA 4N42A 4H8VA 4MGQA 4ZZ8A 2WCSA 3SCWA 1UD8A 2E9BA 2ZX6A 3VO0A 2WPGA 2WZIA 2ZOXA 3EMZA 2X0YA 3CC1A 2XGBA 3QOMA 2WMHA 3W82A 3PZNA 4TVUA 3WN6A 1B3ZA 2OWWA 1ISZA 2WMGA 2NW0A 1R33A 2D20A 4PCTA 1JG9A 4FLSA 3RILA 1HF6A 2W5FA 4AZGA 4QFUA 1GQLA 5IDIA 3C7EA 1E6NA 1VENA 3K8KA 3NJXA 4Z2JA 1W1PA 5JBFA 2JKXA 4P8VA 4W8AA 1T0OA 3RM4A 4GO8A 2CKSA 3VMOA 3B9AA 3RJYA 2VZVA 4HU8A 1CXHA 4PUEA 3RM8A 3DX2A 3WENA 2W62A 4GINA 3AS3A 4AD2A 2WAGA 1J0IA 1PAMA 1J84A 3GXFA 3LXAA 5GNXA 4P08A 2CYGA 1L0PA 4ATDA 2PWHA 2WMFA 5BWFA 4BQ2A 1DLCA 2WVVB 2W47A 3WY2A 1GOQA 2BZDA 1UD4A 1W9SA 2BVYA 2FH6A 1QW8A 1QNPA 4JL2A 1W3HA 3W5MA 2Y6HA 3CLWA 3K75B 2C26A 2QLYA 2ALWA 1UZ4A 1U30A 1G0CA 4LPLA 3FHQA 3DC0A 3MKKA 4JAWA 4KWUA 2EXOA 4CU8A 3ALFA 3HPNA 4BCEA 3LEGA 3WMBA 3BCDA 3EDEA 1X1NA 3UR7A 4M1RA 2W9XA 2VO5A 1A3HA 2J7BA 3U7BA 2EIEA 3QHMA 1LWJA 3CPUA 3H55A 5D9MA 1UWQA 2W66A 4AXNA 2X0HA 3CUIA 2XIBA 4QX1A 3H53A 1LL4A 5CLWA 3VD9A 2VCBA 4FNTA 1UY2A 1GOHA 1US3A 3MUIA 3EDFA 1TCMA 1E1FA 3VM7A 2VZSA 1OBAA 2ZX7A 4WF7A 5DFAA 3NDYA 3VILA 3CIHA 4TTUA 2YL9A 1JDAA 2NSXA 2JD9A 2ZUSA 1C8XA 3GH4A 4QDMA 3A22A 4MDPA 3BUPA 3CTTA 1XSIA 4CD6A 3PZGA 2WMIB 1OIMA 1M04A 4D6HA 1ITXA 3FY1A 2J7DA 4CGTA 3CQOA 3OGRA 1TQVA 2YDQA 1GJWA 3BAJA 2VI0A 2XFFA 2WBKA 1NWSA 3WD4A 3NYDA 1L7QA 4WJXA 4CU6A 8CGTA 3PZ9A 2PWFA 3AMCA 3ZO9A 2WHJA 1FP9A 4OGZA 3WH7A 3EJTA 2F1AA 3N1AA 5FL0A 5TD4A 5DMYA 4MB3A 5EIYB 1GQKA 3NNGA 1FFQA 1O7DC 2BBAA 2DT1A 3U5UA 1ULOA 3SCVA 5JBDA 2WMJA 1CECA 1WDSA 4OMDA 2EO7A 1R46A 1EHNA 3UG5A 1OWQA 1G94A 4P7RA 2DIJA 2VZ3A 1E3XA 2OYKA 3WMCA 1OD3A 2J7GA 4KI5M 2VZTA 4ZXOA 5E9AA 5FD0A 1DTUA 1UD2A 2VTFA 3CZJA 2WZEA 4GZIA 2BHUA 2Y6GA 2VNCA 3L4UA 1GW1A 2C0HA 2G3IA 1BHGA 3JUGA 2JALA 1VRXA 1C92A 5E0CA 2EBNA 3SCPA 7CGTA 3VIKA 1WDPA 4CU9A 2YL6A 1XNAA 4XB3A 2JE8A 2YBUA 2J25A 2X2YA 3A4AA 1CZSA 1NWUA 3VIGA 1WCQA 2W91A 3AHYA 2F7QA 3CHDA 1IZKA 3W5NA 4A42A 5HOSA 2E0PA 3HNBM 4AZBA 3VD4A 5C8BB 3NCOA 2F2HA 2WUHA 2XN1A 1H41A 1W2PA 4NRRA 2C8NA 2MANA 1RP9A 3WBAA 1DYOA 4CCDA 3KE0A 2OYLA 1WZLA 3E1F1 3N04A 3N11A 1V6VA 1ZU8A 3WF2A 2XPKA 5A6MA 2BY3A 3MUZ1 4AG4A 1CIUA 2QMJA 1GOWA 4V27A 3D51A 3AMLA 3VD5A 3EBVA 3AFBA 3SCRA 4AEEA 5G05L 3W27A 3DHPA 3MS8A 4HMCA 4MAZA 4NZJA 1EA9C 1E9LA 3PTQA 2CBJA 1B1YA 1UR0A 3FN9A 2W63A 5HPCA 3OLGA 3GXUA 4GO9A 4PTWA 4W7WA 2EPMX 5HPOA 1KWKA 1QOXA 2YL8A 3U57A 4OUEA 4DXTA 5FOOA 2YDSA 3N12A 1CXKA 3VX1A 4A45A 2XVLA 1PX3A 5GNZA 5A69A 3OBAA 5IYYA 1CWYA 4MNKA 3F4VA 1VFUA 2VVNA 2BNJA 3GH7A 1KXVA 1H0GA 1W9VA 3II1A 1D2KA 4JFUA 4M4RA 1PZ3A 1J11A 2BV9A 2VQTA 1GUVA 4MDOA 4D0QA 3QR3A 2VVSA 4RE4A 1KTBA 1OCQA 5M03A 2ZICA 3MV01 4ATWA 1G01A 1HN1A 2OYMA 1HKKA 1GOGA 5F7UA 1RH9A 3PZIA 4AZHA 4LYRA 3HZ3A 4HA4A 2J7MA 5FCZA 1GVYA 1ISYA 2EABA 3WDIA 1GONA 2EADA 4MNJA 3ZJ6A 4EK7A 1UKTA 2YOCA 2QQKA 1VBUA 4RL3A 3S2CA 4OYUA 2OW7A 3A6OA 7TAAA 1RPKA 4F8XA 1YQ2A 3FHAA 5EFDA 1UY3A 1TUXA 4HU0A 3CV5A 2W1UA 5A95A 1PBGA 3SUVA 5A8PA 4BK5A 3K4AA 4PMXA 2YLLA 1QNQA 2YFOA 2DDUA 2O9RA 2W94A 1GQJA 5D9OA 5CYYA 3BUQA 3GXPA 5JXIA 1DWIM 1TVPA 2X10A 3IDAA 3K77A 3MBWA 3UESA 4PMZA 4XUYA 1TZ7A 2ZX5A 1CIYA 1UYZA 3HEIA 3WY4A 4BJ0A 2WBGA 4JFVA 5DF0A 1GOFA 4PMUA 3MSDA 3AS2A 2XOMA 3GDBA 4PSRA 4D72A 3WUFA 2J8GA 1JIBA 2VZPA 1DEDA 2E31A 3CZUA 1WO2A 1QW9A 5ABEA 1UYQA 1DWHM 5I5RA 4DUVA 5D9NA 1XGZA 1ZBKA 1OM0A 3BAYA 1KGUA 3VGFA 3AXXA 4W88A 2V3GA 1FA2A 1MW3A 1G5AA 4W8BA 3WQ4A 1EH9A 4AYGA 1OGBA 3K8MA 3EDJA 4ACYA 2L9LA 2E4TA 2YA0A 3VVGA 3VU2A 1QNSA 4B15A 1J0HA 4D6CA 2FHFA 2E3ZA 3AYRA 3BAIA 1UWRA 8A3HA 4AIUA 1VFMA 1R85A 3WH5A 2ZXBA 2VRKA 2QQIA 4DEVA 3WSOA 5A6JA 1NM9A 4AIEA 3CDZB 1MW2A 2R7EB 3WSUA 3BMVA 5JIWA 2WABA 2QPUA 2F7RA 1E15A 4DM2A 2D2OA 3VSVA 4KMQA 1H11A 4QX0A 1VFFA 4AZCB 1OGGA 2Y2WA 3KLLA 2LW8A 2E40A 1TE1A 1RP8A 2ESCA 1KR0A 2O92A 4HPHA 1XSKA 3AYSA 4HPGA 1JFHA 1QHOA 4UAPA 2E26A 4JFWA 2OWXA 1XV8A 4RE3A 3ZR5A 2WVVA 5CGTA 2PWEA 5CGMA 5I24A 3ARZA 2Z4FA 4JKMA 3PUIA 3GBEA 2WHMA 3W38A 2J75A 3WNLA 2V38A 2CPUA 1FFRA 5HXMA 3FW6A 1JI6A 2D3NA 1KGYA 2WVUA 3VD3A 1V3JA 1CGVA 3FAXA 4FF5A 4DUWA 3QGVA 4NRSA 5CSYA 1NOUA 3LXBA 3H54A 3CH9A 3L4WA 3WDQA 3ACHA 2W4XA 3SCUA 1E6XM 1C7TA 1OGSA 6A3HA 3N13A 4GZEA 3ZJ7A 3AICA 5CLTA 4PBGA 4MGSA 1UXZA 3VGEA 3ZT5A 3W37A 1V6YA 1XRVA 4LYPA 4IPNB 3N9KA 4WKHA 3LPFA 3BGAA 4D6DA 4W50A 2OKXA 2X2HA 3EDKA 2PWGA 1UH4A 5ABGA 1ESWA 1CLVA 3LPPA 2UWFA 5D8ZA 1O7AA 3ACIA 1KBBA 1YHTA 1JZ5A 2D1ZA 4EE9A 1AQHA 5A2BA 4DEQA 2V4VA 3IJ8A 1UR9A 2ZE0A 3SCQA 1D7PM 1W9UA 1CGWA 5LA1A 2XTKA 3A24A 3A47A 4XZWA 3VUPA 4XV0A 1F4HA 1TG7A 2W1QA 3AXIA 5D8WA 1UR2A 3O6AA 1KQYA 3TV8A 2GVYA 3ZOAA 3VSTA 1NP0A 3WD1A 4QX2A 1MQQA 3ARPA 5CXPA 1UWWA 1NOFA 2YC2A 3AIUA 1UZ0A 3P1IA 4XUNA 3TTYA 2ZUUA 3DDGA 1CBGA 3HU7A 1E73M 1E43A 4CVWA 2PBOA 2ZEWA 4E8CA 1FHLA 1UG6A 3HG3A 1H2JA 2JEPA 1K6AA 2QQLA 4ZE4A 3EB7A 1WP6A 3AIBA 3WDHA 2D0FA 5LCWL 1I5PA 4CUCA 1V3HA 3SUSA 3I97A 1AQMA 5DN2A 1MXGA 1S46A 2O9OA 1R64A 4W87A 4P5YA 3O9NA 1MPXA 3PZMA 3WY1A 5GPRA 4JX0A 5A8QA 5GNYA 3AJ7A 4M80A 5BXSA 5A6KA 1JZ6A 3AIWA 4E4PA 3I2IA 1NKGA 4U5IA 1K9FA 2VJXA 1KGXA 3CZNA 1CZVA 3F2ZA 4TOQA 3L4TA 1JZ2A 1B3YA 1UZ1A 1CZTA 1C8QA 4HMDA 2WC7A 4P8WA 3WNNA 3PHAA 1UH3A 1JNDA 1TQWA 2J1EA 1EDGA 1GNYA 1R34A 1E56A 2CITA 3M6DA 3G6MA 3F5KA 5A6LA 2FGZA 4PCSA 1J0YA 1W1YA 4AZCA 1JU4A 3NSNA 1LG2A 4LPCA 1IZJA 2C4XA 3D50A 2VCAA 1MW0A 1LG1A 1MFUA 3OGSA 3VIPA 3J7HA 1MQRA 2DT3A 2GK1B 1R8LA 2CBUA 1NWRA 3AISA 1JAEA 3BC9A 1XNTA 2VM9A 3GXTA 3W0KA 1Q6DA 4S3KA 1SR0A 1VB9A 5ECUA 1BFNA 4ZXLA 1V0MA 4CKQA 4D6IA 3IJ7A 3LXCA 5ABHA 4J28A 2J1SA 1OF3A 1UQZA 3WBEA 2XN2A 1EUTA 2X09A 1W91A 3WF3A 4YHGA 1QHZA 2WB5A 3FXYA 1PIGA 1ISWA 2WMIA 4Z2GA 1B90A 2HISA 4AWEA 1NH6A 3CUFA 4DM1A 3VIHA 3WH6A 4GI6A 3WFLA 3A21A 1W2VA 4CU7A 3UETA 1KB3A 1EGZA 3P6BA 2J79A 2J22A 1WB0A 5JBEA 1W3LA 4OKDA 1MYRA 1HP4A 1W9BM 2CHOA 4URIA 3UCQA 4AC1X 3CZGA 5FKYA 3UG3A 3EDDA 4ZFMA 2D0GA 1W8NA 1BYCA 4X0VA 2WZ8A 4FNRA 4OIFA 5A6SA 1BGGA 4GQQA 2VZRA 4NX0A 5A1AA 2ORZA 1HNYA 4XURA 2WO1A 1I75A 4MOAA 4AW7A 1W9XA 1EDQA 1PX8A 2Y5EA 1K42A 5E70A 3CGTA 1UWTA 3IANA 1CGXA 3VM5A 1IV8A 4Z2LA 3AQUA 2ID4A 1LLOA 1ZBWA 4AMCA 4DWSA 5JMOA 3VOCA 1C3FA 3GXMA 1GVIA 2HYXA 1E4IA 3CBWA 3K8LA 1BYDA 1LF1A 4TXWA 5I78A 3HG5A 3SCNA 4C7DA 4CN6A 1KTCA 2RGMA 1KGWA 1KQZA 3WEMA 1BVNP 2B9VA 1E5JA 3NJ3A 4X9YA 3D3AA 1SYTA 1JXKA 4U31A 1JF5A 4BDVB 1JI1A 5AY7A 1UKOA 2XQXA 3NDZA 1CGTA 1HWWA 1P6WA 1E40A 1V0NA 1UR1A 1BYAA 5A94A 1EO5A 3AROA 3ALGA 3CHFA 1QX1A 1V3MA 2WW5A 3ARSA 1CGUA 3NSXA 1B30A 3ZR6A 2D0HA 5CPQA 4DWSD 4NI3A 4M56A 2GJXA 2AOSA 2A3AA 3OG2A 2ZX9A 4GWJA 4NZCA 3ZT6A 1CENA 1WZAA 2UY4A 1R7AA 2NT0A 5AYBA 4TX8A 4JKKA 5KZ6A 9CGTA 1E5NA 1VAHA 3S6TA 4J3WA 1D7FA 4HA1A 1HVQA 4ZY9A 4YN5A 2GJXB 4WSJA 3B9EA 4FLQA 4OBSA 1ODUA 1QI0A 4P8UA 3SKVA 3VKKA 3DYOA 1H3GA 5CQ1A 2JIWA 4PMDA 3UERA 4NZFA 5IFTA 4W7VA 4H2CA 1SHWB 5EB8A 4H7VA 2GJPA 4EANA 2ORXA 2WO3A 1QBAA 5KEZA 2VOTA 2VZUA 1HT6A 3I3DA 3BXWA 1H1NA 2QF8A 3F5LA 4K68A 4D6FA 3U7VA 3NIYA 1V02A 1K3IA 3MUY1 3B8SA 1UWUA 3L2LA 1Q6EA 4GKLA 1CZ1A 3MUAA 4NXSA 5A6BA 5BXPA 4P7LA 1FH7A 5ABFB 3K4ZA 4J3VA 3AOFA 3W6MA 2VZQA 1VIWA 3A7QA 3JXSA 2RGLA 3WIJA 3SCOA 3AIVA 3SUUA 4MB1A 3VNYA 4UFMA 1CGYA 3PZOA 2GDUA 1HJUA 4B3LA 3KZSA 4ML4A 4RE2A 3BAWA 3ARWA 2A3BA 5LA2A 2DSUA 5FL1A 3WH9A 3THDA 4WKFA 3MANA 3DECA 2WVTA 1H09A 2GUYA 1P8JA 4UCFA 2A3EA 1OIFA 4HMEA 1CYGA 2X1IA 1L7RA 1V08A 3WQVA 3B9DA 2FH8A 1NOWA 1SFSA 5EJZB 1V0KA 3VIMA 4UOZA 3NUKA 4M8UA 1X6LA 5DEZA 3BSHA 1V3KA 2XWDA 1QPKA 4ZXEA 3T09A 4QAWA 5CPTA 4BQ4A 3VDCA 2W46A 4UZUA 2V3DA 1GHRA 3BUDA 2EQDA 3ZIZA 3OGVA 2A3CA 2EICA 2JEQA 2XGIA 4A3YA 1H6XA 3TA9A 2F18A 4UQDA 3CZLA 4QLJA 1W0NA 5AYIA 3ETPA 4GI9A 2GDVA 4QLKA 4QLLA 4UQAA 1VF8A 1E6RA 1M01A 1L8NA 3NSMA 3ARVA 3DYMA 3DX3A 5FUIA 3IGUA 1SDDB 3WEZA 3MMUA 3W24A 3WD0A 1GOOA 2Z1KA 4D6JA 1H6YA 1AMYA 4OZOA 4YHEA 2G3NA 4P7NA 2J7FA 3GXNA 4XUPA 1NP2A 1MFVA 2CBVA 4AY1A 4A41A 3HN3A 4DO5A 3D52A 3LEKA 3L4ZA 1QI5A 1UMIA 2WKLA 1ZBCA 4PMVA 4W8JA 4MADA 2PBGA 4DO4A 1UWSA 1U2YA 5E6YA 4W8LA 3SIMA 1TFVA 3LPOA 2XWEA 3UR8A 3SEPA 1E0VA 4AD1A 4W89A 3AMGA 2WDBA 1R7OA 1JZ8A 3QOKA 3N18A 2WLZA 1QNOA 1M53A 1K9TA 4HZ6A 4Y7EA 1CLXA 2V3FA 1E0WA 3WL1A 4GPNA 2FDMA 3PTKA 4WIWA 4BA0A 1NAEA 4LQRA 1CXFA 1GMMA 3HOBA 1CXIA 5E6ZA 3WD2A 1WZKA 2XN0A 2ZUVA 2ZUWA 1V6WA 2E32A 3FL7A 3PZUA 4PMQA 1BG4A 3VDBA 2E33A 2YG0A 2VC9A 3EJPA 2Y6JA 1GNXA 5I3DA 3HJEA 4J27A 5BXTA 1O59A 3AZTA 1EOKA 3ABZA 2Z1SA 2XFYA 1MW1A 4M4PA 3IAQA 3A5VA 4P02B 3WQBA 2WN3A 1I1XA 2DPEA 2KD7A 4DUXA 2ZX8A 4AZ6A 3MMWA 3CMGA 3S5ZA 3VTRA 1R75A 2EEXA 3W28A 1V02E 4WSKA 4PTXA 1W9WA 1C7SA 1HTYA 4DXRA 1XH2A 3APGA 2V72A 1JAKA 1E0XA 1PPIA 2W67A 2GK1A 3DX4A 1H5VA 4UFLA 2WC3A 2E8ZA 2J8FA 3GZAA 2YKKA 2CHNA 5DO8A 4JHZA 1W3JA 2HLEA 2X05A 2BGOA 5A8OA 4FMVA 5G04L 3WL0A 4OJYA 4A6OA 3WD3A 3SCSA 3KL5A 2YC4A 4XUTA 1J9YA 5BRPA 3BVUA 2VZ1A 2UY3A 4J3UA 1D3CA 1XHGA 1GZJA 1IQDC 3DX0A 6TAAA 2WQ8A 1SG3A 1WCGA 1WZMA 2D24A 2VCCA 3OEBA 4TTGA 2WM0A 4PYSA 2CESA 3KL0A 5BRQA 1KCLA 1GQPA 5ABFA 3VIIA 3W26A 2QMKA 1FH8A 3PZTA 5AC5A 1UYYA 4FLRA 3EMCA 4DXSA 3QHOA 1W3KA 4ACZA 2XVPA 4N0RA 4BS0A 3VMPA 4UFHA 2J1AA 2ZEYA 1OB0A 1DWGM 3TTQA 2QQNA 1B3XA 2J1TA 2J4GA 3D5HA 1JHJA 2WAAA 3DYPA 4R27A 5I77A 4UQCA 3WEOA 1JL8A 3EJUA 1HP5A 2F8QA 4JCLA 3HNMA 3RO8A 4BQ5A 2WNWA 3ZJ8A 1ISVA 4GIAA 1E4NA 3OLDA 5CPSA 2ZWYA 4JFTA 1H49A 5A2CA 1UKPA 4CCCA 5IHSA 4JKLA 3HG4A 1W8OA 4UI9L 1PX4A 1J83A 3T2PA 4QCEA 2ZXDA 1G9HA 3TTSA 3VMNA 4CD8A 1WDQA 2W1SA 3ZSTA 3W4RA 3ACGA 2WKGA 1K45A 3BCFA 3ZQ9A 3WDRA 3BVTA 1EQCA 2VR4A 4QB6A 2WWDA 1C90A 2J1RA 4HOWA 2YB7A 4ARYA 5D9PA 2FGLA 1E1EA 2JIEA 3ARYA 3POCA 3A23A 5C7GA 1PMHX 4FNPA 3ZMRA 3VDAA 3CUGA 4HOZA 3AHTA 5IXEA 1GOKA 1OT1A 2OLHA 3HMCA 5I0DA 4TVCA 1GQIA 5LYRA 4AZIA 3CZ8A 3WY3A 2VX6A 3QHNA 2VMDA 2DEPA 1UKSA 4LKSA 4HTYA 2YLAA 1HKMA 1XD1A 4M24A 4AMWA 2G41A 4BK4A 1MQPA 3T0AA 4J3SA 4P7QA 1XD0A 4J7RA 1XYZA 2IXUA 5D4YA 4ZEPA 4WLCA 4F79A 4MB5A 4W5ZA 3GXDA 1R86A 1H0IA 3T2QA 2BY2A 1H4PA 4BQ3A 2BHYA 1UMHA 2XJ7A 2WLYA 2XSAA 4IPLA 1F4AA 1LL6A 5LA0A 3CHEA 3OZPA 4OOZA 3UNPA 1XC6A 2GFTA 2XONA 3T0DA 4CUBA 4JFSA 4NSBA 3OLEA 4GZJA 2W95A 1GUIA 3BN6A 4TXEA 3LQCA 1E4MM 3AXHA 3GNRA 2QHAA 5CSUA 1JZ7A 1FH9A 7A3HA 3CMJA 2CEQA 3BMWA 2Y24A 3CZSA 4CN4A 4ATLA 3SKJE 4XZUG 1I1WA 3SEEA 1B0IA 3FAWA 2ZXQA 1LWHA 4E8DA 1OINA 2V5CA 4GZ9A 5IHRA 3T2OA 3I2JA 4L0PA 5DT5A 3MI6A 5CZKA 2NT1A 3A3HA 2J7CA 2WO2A 3WF4A 5I23A 3EJRA 3SCTA 2WZHA 4MAVA 3BVXA 4D6GA 3D4YA 4H04A 4UFJA 2E9LA 5EMYA 2VQUA 1CEOA 4PMNA 4U3AA 1UOKA 4C7FA 1N82A 5E0FA 3WQ8A 1WAWA 3VGHA 1ZJAA 3NQHA 2UY5A 2D3LA 3PN8A 4WK9A 3WQWA 5DQ0A 3K4DA 5M5DA 1LQ0A 2AMGA 4J3XA 4H8HA 1O8PA 2B4KA 3VNZA 5JXHA 1J10A 3F5JA 2J47A 4AD4A 4FNQA 2DCKA 4P8XA 3L2MA 1PZ2A 3BLPX 3BVWA 4QDQA 4KRTA 2AAAA 1HKJA 4HZ8A 2WMKA 1HL8A 3WF0A 3TONA 4ET7A 2D23A 6CGTA 3IAPA 1UQYA 2D22A 1TMQA 2XM1A 4UOJA 1M03A 3BLBA 1KCKA 1R47A 4W84A 3HG2A 2YIHA 3DX1A 3L4VA 1QI2A 4LQ1A 4JZ5A 2XFRA 1JDDA 2VRQA 3UEQA 3TP4A 2FE0A 4W4ZA 1BPLB 4F9DA 2TAAA 1KXQA 3IB3A 1CXLA 5GQBA 1K12A 3VGGA 3AHZA 1E4LA 4ZZ5A 1UASA 3EJSA 3WDJA 4Z2IA 2LS6A 1GORA 4QDRA 1GPFA 4AD3A 2X2JA 1HL9A 5A6BD 2J78A 4AIOA 1UY0A 1NX9A 3OIHA 4D1JA 2YFUA 4PRWA 2WVSA 4MO3M 4Q7NA 2OSYA 1DWJM 1TA3B 1BG9A 1XCWA 2ZEZA 3HJRA 4PT6A 1VBRA 4FNUA 3PBGA 4AAXA 1KXTA 4GQRA 1ZJBA 1UY1A 2IXVA 2WAOA 4PMRA 2JFEX 1BQCA 5HBFA 1OH4A 1PIFA 4BZYA 2EPKX 4PUDA 1WNOA 4OOUA 3I2KA 2X8RA 1R87A 1V6XA 4OMCA 3ZJKA 5IFPA 2BFGA 4IM4A 3GXIA 1XYFA 2ZWZA 4YPJA 4HZ7A 2OSWA 1EDTA 4WKAA 3ARQA 2JDAA 1V03A 3W6LA 3BLKA 3KWXA 4C7GA 3N17A 2BS9A 3WUBA 3AI0A 4F66A 1UD3A 1JYNA 3OZOA 2XVKA 1TVNA 3CUJA 1ZS2A 2QPSA 2ZUMA 3WNPA 4JHOA 1JGIA 5IJRA 4QCFA 4QP0A 3AMKA 1XH0A 2QQMA 3N15A 1VEMA 4ZE5A 4EKJA 4U2ZA 2RJ2A 2Y8VA 2WANA 3VIJA 3OEAA 4OBRA 1W99A 3CUHA 4DWSC 5JXJA 3M07A 1UKQA 3AMDA 1B2YA 4UQ9A 3ARUA 3RDKA 2BHZA 4BXSV 2VUYA 3ZT7A 1Q4NX 1C91A 2ZEXA 3TTOA 3VINA 4LHSA 1E6SM 4FLOA 1W32A 4S3JA 2VT0A 4A4AA 1B9ZA 3L4XA 1Q6FA 3M46A 2W92A 1E71M 3WKZA 2CCRA 2CDPA 3OB8A 2HVMA 5I2UA 2F61A 1JXJA 3LRKA 4JIEA 3ARRA 3AIQA 2VRJA 4CVUA 2DT0A 4A3ZA 5B4NA 1JZ4A 4PEEA 1JFXA 4U3CA 1GJUA 5HDRA 3AS1A 3U37A 1AQ0A 1PS3A 3PZVA 2DSKA 1SMDA 2WSKA 3WQ5A 1Y7VA 2DGAA 3VX0A 1CXEA 4UQBA 4AZ7A 1J18A 5A6AA 3BSGA 3MO4A 3L4YA 2VMCA 4PTVA 1ITCA 3RMEA 2J62A 4PMOA 1V3LA 3LE0A 3FNDA 5C70A 2DSWA 5HNNA 3ECQA 3WUGA 1ECEA 4KRUA 1ZBVA 1UD6A 4EAMA 4AYSA 4AMXA 3ACFA 4XUOA 4HA3A 4PN2A 1KEXA 2QV4A 2WHKA 3RJXA 1ZL1A 4UNIA 2DQXA 3K1DA 1XCXA 1Z32X 1EUUA 4XVHA 4U2YA 5BROA 4XZBA 2W1WA 3GYCA 1EIBA 1LL7A 1LJYA 1T2XA 5M3WA 2EACA 1G1YA 4QPWA 4JCMA 1UWIA 1XSJA 4CD4A 2WC4A 1GCYA 4CD7A 1QWUA 4KH2A 1US2A 1J0KA 1UA3A 3PTMA 2VX7A 1UYXA 1HJQA 3IIIA 1E72M 4H8UA 2OW6A 1TQSA 4HOXA 3GM8A 3EYPA 2JF7A 1UH2A 4M29A 2CIPA 4LXFA 2A3HA 5C71A 4MJ2A 4W86A 2ZUNA 4P7OA 1J12A 3O2LA 2FHCA 5JXGA 2VX4A 4B3KA 1JD9A 3BAXA 1C93A 1O8SA 3T08A 5EBAA 1E6ZA 2PQSA 3C7OA 1W9TA 1MXDA 5J1XA 2EAEA 2Q8XA 2QQJA 2FYVA 1UA7A 2DSVA 2BVDA 2B31A 3TOPA 2PB1A 2IUZA 2J77A 1GU3A 1XH1A 5EFFA 2VX5A 3I2FA 3VPLA 2DH3A 2F1BA 1PMJX 3W81A 2XVGA 1UY4A 4PTMA 4FK9A 3SUTA 1GOIA 3IJ9A 2J1UA 1UHVA 2J74A 4QB1A 3MU7A 1QNRA 1VJSA 4IISA 4TX6A 2CKRA 4A3HA 2PI6A 1WPCA 3GNPA 2Y8KA 3GTNA 1JZ3A 1K9DA 3WQ6A 3W29A 2EPNA 1UR8A 1V0LA 4HP5A 3KLKA 2RVAA 4W85A 3AZRA 3PUHA 1BF2A 2VURA 3VSUA 3BAKA 1EXPA 2J1VA 2PWDA 5JUVA 1VEOA 1OT2A 3KEHA 1V6UA 1J01A 2Y6LA 4XX6A 2XM2A 4QB2A 1DWAM 2YA2A 4U33A 2WCGA 2Y64A 3DHUA 5EJ1B 1EOMA 4UFIA 1KWGA 1CPUA 1TVGA 4L4OA 4V28A 2ZXAA 2VR5A 3C8XA 1FOBA 1AVAA 2BY1A 4FNSA 1KR1A 1QI4A 4ACZB 1XPWA 4M82A 4PF1A 5A8MA 2VMEA 2VZOA 2BGPA 3MV11 4GXPA 1V3IA 2DIEA 4NXKA 1SMAA 2VL4A 1OSEA 2YFZA 4HG6B 1VEPA 1RYYA 3C7HA 2DT2A 2DCJA 4B9YA 2PF0A 2GJRA 1NUKA 1WKYA 3I2GA 3LRLA 1UXXX 1KXHA 3AHVA 1E6PA 1HJVA 1HX0A 1JYWA 4KGJA 4CCEA 2YL5A 1EQPA 1FP8A 2EPOA 4QX3A 3WNMA 4UFKA 1UUQA 3A4WA 4TVDA 3THCA 2D73A 1HKIA 3AHXA 2XHNA 2G4FA 4AD5A 4NF7A 2OWCA 1DP0A 2EJ1A 3I2HA 2XHYA 1CDGA 3U5YA 3HNYM 5JIPA 3IK2A 4TUFA 4AD0A 3T0BA 1ZB5A 4UQEA 3W25A 3RIKA 3PZQA 2FHBA 1E70M 1NARA 1ODZA 3GBDA 4LX4A 5B4XA 2WYSA 3DDFA 1HVXA 3WNOA 2V5DA 1U33A 3ARXA 4KGLA 4MJ4A 1J0JA 4Q22A 2RV9A 4XUQA 3W53A 1TQTA 1WDRA 2WCAA 3LMYA 4ZENA 1B3VA 4FI9A
chains in the Genus database with same CATH superfamily
3GNOA 4CUAA 2BDNH 1ME7A 4YDZA 4R5EA 4Q4Y1 2UZXA 4OCSL 1IEAB 2JENA 4LDEB 1LTDA 3TA3B 2CO2A 3EO1A 3NJZA 3W11D 6PAZA 2CUAA 4MWFB 1QSEE 4Y4KB 2CBIA 3AC0A 1BLZA 3AIRA 2H9AA 1AC6A 4XPFL 4HALA 5BU9A 2A38A 1GNHA 4NUGL 5FGCB 3RWFA 1D2QA 2XLGA 5ABJC 2XFXB 3W70A 1FJ1B 4L8BB 3SN1A 3N41B 1ANUA 3G5ZB 4AL8L 3WIFB 3OKMB 1QWNA 4N9GB 3MVTA 4YIQA 3T77B 1OPGH 2P1YA 2G19A 2VDPH 4KRPD 1KD7A 5HWJA 3TMLA 5FJIA 1MWOA 2D2CC 2DFAA 3K6SB 2GK0A 2QZ3A 5SV5A 5M7QA 3C3NA 5REQA 1WBHA 4A8RA 3CCHB 1QBLL 4PDWC 3CFTA 4K3DL 1BLIA 3SHSA 1I9IL 2Q3XA 4GQ0A 3F4WA 5CIPH 1ACYH 3G6DL 4DW2L 3U0WL 3MRKA 2TSAA 3P40A 1CD8A 5AC4A 3SQRA 3N3HA 5AVXB 1DJXA 3UBFA 3GIVA 1ZUAX 1IGSA 3M7OA 3I49A 4K2UL 3CFJA 1T40A 5KVDL 4F8QA 1DO5A 5D4HA 1PKOA 3QAZB 3N2CA 1BD2A 2ATMA 4JDEA 4COVA 4H41A 2VSCA 1U8IA 4NFDA 4LSQH 4JBRA 3UFIA 5JHAA 4Y22B 3G6AB 2ZUTA 4I48B 4PQXA 4N8UA 4BH8B 4GQBA 4HQQL 1T96A 3F2LA 4XMZA 4NHCL 3RPTA 5CFCB 1UXSB 2EDBA 2OR8A 1BD2D 3VDHA 2D3VA 2G2RB 2UZYA 4UV4L 2JK5B 3SCFA 3U4BL 4KJYA 4Z2HA 2QJJA 4XIMA 4P23A 5EMJA 4RAVA 1WUFA 3MLXH 4PI2A 3GVWA 5LHFA 4R83A 1Y7BA 1M1SA 1UB5A 4L8CB 3PSWA 4ROPA 1NVMA 1ISZA 5AVZB 4EVNA 1MDTA 4O58L 3GY1A 3KFTA 4C4KT 3KWWA 4FLSA 1GQGA 1N6QH 4MCNA 2WQRA 1T21B 5JBFA 3Q1SL 3EH1A 2J9YA 1GEHA 2GMMA 2F2KA 4PUEA 4L3EE 3R11A 4GSDH 3H7LA 3AS3A 4IKJA 5A43C 3K5XA 3GLZA 3ZYPA 2OOFA 2I17A 4A2SA 3ULSB 4FKKA 1QW8A 1W3HA 3K75B 2C26A 2CK0H 3QMTA 4MXVE 4J5NA 3QCUH 2Z65C 2P5PA 4HNTA 2XZCL 3ALFA 4QF1A 2E51A 3SOTA 1A3HA 4G6CA 4KKLC 3QQDA 2FEJA 4ES8A 4XCFL 5AZ1A 2FJHB 5FYBA 4QX1A 2B2XH 2X40A 2XT1B 1NIEA 5FSDC 2YBRA 3O6ML 1Q2SA 4WF7A 5FA3B 3AY4C 3HNVH 2PTUA 3CSGA 4CL7A 3SKJL 4X6FA 3FY1A 4CGTA 3HAEH 2YDQA 4DUOA 1XMEB 4M61B 3L08A 1RA5A 3TBWB 5E88A 1EDHA 3DXAB 2AH2A 2IGLA 1BXXA 1FWHC 4OD1H 4LLFA 2Q8BH 1RBLA 3CFIC 3UCRA 4Z7NE 1N1TA 4RWYL 5I0VA 1NEPA 1R46A 4EQVA 3R1ZA 3VD2A 4TNEA 1OM9A 2OP4H 2JKEA 4ZXOA 4LUJA 2XWCA 5CILL 5C33A 1RU9L 1DLFH 4LB8A 2HBVA 4MZ1A 4M1CD 2UZYB 3UDWC 3SCPA 3VIKA 1XNAA 3JU9A 4NP7A 1JRBA 1LOAA 4O28A 2IWGA 2J73A 3DX8A 3ABRA 2DVXA 1IF2A 4NRRA 3SQBB 1A6VH 3KYMB 2W8CA 3ATEA 4AYUA 1HESA 5JW5B 1A4LA 5A6MA 1CIUA 1GOWA 2PLMA 1DQIA 5FY9A 3B2UD 1JGLL 5F1IB 4FQ2H 1MH5B 2EPMX 3VACA 4K15A 4OUEA 3HMWH 4XFGA 1U8JB 2AKRB 5C0BA 2PHRA 4ZZKA 6REQA 3C4UA 2ICSA 1BFSA 4WI4A 3F4VA 3WL9A 2VVNA 1D5MB 4QEEA 1DL7H 2ATFA 1EO8L 3G1RA 4RE4A 3IM1A 5IVVA 3MRPB 2CGRL 5EU6B 3BYTA 2VAAA 2AEPL 4BFBD 1MS9A 3QPXH 1AJZA 2IDQA 5C0GA 2EABA 3TBVB 1A7QL 2XWZA 3S3DB 1IKPA 4K8GA 5HJLA 1H0BA 3KRZA 3S2CA 1K8ZA 4PJEA 4I9XA 3UC0L 1ZHAA 1F6FB 1MHPL 4RQQA 4P3DB 5A8PA 1ADDA 1PVNA 2Y07L 4FXKA 1MI5A 5L9FA 3BO8B 3GXPA 5I9QC 2X10A 3B5GA 1BCXA 1XYLA 1NJ9B 2W81C 2ZX5A 4IMKC 1S9VA 2D5FA 2R1WB 4Y7OC 2MIZA 5DRWA 5JYMA 2HPIA 4Y5TA 1D7CA 3WUFA 5SX5H 4ASMB 1YUHA 4P14A 2WWNA 4YHPA 2VLLB 3DGBA 3ULUL 1DWHM 5HY9A 4G8GB 5GZCA 2EC8A 3T7VA 1A9BB 1OM0A 3T05A 1DVZA 1EBHA 3VGFA 1TVLA 4L6HA 3GJFK 1MW3A 1RK1B 5T5FL 1Q90A 1E8XA 2DWEA 1R1A2 1MEXL 5AHLA 3BVNA 4GP5B 1S1PA 4QPIA 1NZCA 4KG0A 2FO1A 4FFVC 2CO6B 3CDZB 2AUYA 4QGLA 4PGEA 1TPWA 2P3IA 5CP7A 4ZFFB 1UZWA 2VEIA 1A6UH 2E26A 3JWDL 1OADA 3MCNA 3ZKND 2DYCA 1KTNA 1HH9B 4KV5E 3H0OA 1RUSA 5E9NA 3BCJA 4P57B 3QGVA 2LM3A 1D5MA 3H54A 5DLLA 1IGMH 4HYWA 5ILTH 3ACHA 2W4XA 2JJ6A 3SCUA 4XEZA 3VW3L 2WZTA 1I1EA 2XICA 4S2DA 1A6AA 3DXAD 4X4ME 1XICA 4GYKA 1BZ7A 1NCHA 1I8IB 4YVSA 4ZA0A 3A6CH 5AB3A 4YVSC 2DN7A 4F7PA 2N56A 1TIMA 5E2VL 4ISVB 2VDMH 2JWYA 8RUCA 2VLRE 4K38A 3AGVA 2EDRA 4RX4A 4EE9A 2XSXA 4PB4A 1OHZA 1W9UA 1Q9LB 1J93A 3VUPA 2H9GA 4TSCH 4JRXD 3UTTB 2V5YA 3APBA 2GVYA 1A4CA 3DIFA 3PG2A 3CLFH 1YO4A 5CEHA 2YC2A 2RA1A 4AKPA 4UT9L 1PQZB 4YDLC 1WQVT 3MRJB 4PIYA 4ICXA 1TTBA 2GBUA 4APXB 1UMZA 4B92A 5FLJA 1T20B 2EH8H 3N43B 3I97A 3QM3A 1GL4B 4QHKI 5DSCA 4LLAA 3T0WA 5FF6A 5G4NA 3B7MA 2YCEA 1K8XA 4L4TE 4AFBA 3RX8A 5L9VA 1FXQA 2H6UA 4S3AA 1FT9A 4AAPA 4M1GH 1IG3A 3U3HA 2A7PA 1AS7A 5F2MA 2CM6A 3PHAA 1B4JH 3RVHA 4NUJA 1EDGA 5EF3A 3KHDA 5FRAA 2JKLA 4HH9B 1HV0A 5FZHA 5FZ7A 3IV8A 1XIWB 1TITA 5AG8A 4BQYA 3FU9A 1URZA 2XYBA 3ARGA 2QKDA 3MLLA 1O66A 4D8ZA 3SO3C 3PR2A 2XIJA 3B0VC 4IEXA 4PD4J 2QVTA 2HKAA 4WWPA 1DPMA 4REQA 2VM9A 1HI6A 4IPIA 2WMPA 1Q6DA 1R3LB 4FQ1L 1AR1B 4JIHA 5E8OA 3BXNA 4BFOA 1KEGL 4GUCA 3TO4C 1Q85A 4LK7A 5HQLA 5HHOD 2Z0IA 1AJKA 5DMGC 3WQ7A 1OLME 4BQBA 3RDTD 2JK2A 1CBVL 5EORH 3LLXA 3FO9B 3LI0A 3TCEA 4LUSA 2F19L 4F33A 4LSRH 1BZWA 3P9WB 2YPLB 3BSMA 1QTYT 3RVWD 3UCQA 4AC1X 4Y9NA 3TR2A 1BYCA 3QUZC 4FNRA 1DBKH 1BGGA 1ZAGA 5E08H 1QT1A 2WO1A 2A4AA 1PX8A 4RESB 2Y7QA 4OQTH 4I90A 2Z6FA 3QDGA 5BWAA 1UU4A 2PDGA 3VRIA 4WU7B 2GH2A 4Y1UA 4E8GA 4LVFA 3M7FB 2LLEA 3MNZA 4W4OC 1BYDA 3W7OA 4MASA 4TXWA 4FL4C 4S2SB 3LIHA 1XDLA 3RJQB 4R2GD 1BVNP 2FCUA 2HDJA 3E49A 5B8CB 3JV5A 1POJA 4JUTA 2QJMA 1I5ZA 4ZNEA 2W65A 2PETA 1R9YA 4K8RC 4WU5A 4I89A 1HWWA 2GEEA 1V0NA 3FQNB 3V5DB 3NG5A 1B09A 5CBJA 4NI3A 3MOBL 3ARFD 3T65A 4K36A 3VFNA 2AI0L 1Z9SB 1PSCA 4GULA 1RY8A 2ZTBA 1HXS2 1EPWA 3FQUB 5FZMA 4FQLL 2XZQL 1Z44A 1KACB 4ZY9A 4RR3A 4BH7A 4FLQA 3HCVB 4KK6C 4LANA 3VKKA 4G9DB 5HGAB 4HYRA 4LBQD 4O15A 3L5HA 5IFTA 4W7VA 4F24A 1Y0LB 2B59A 2DZEA 4LKEA 3NPVA 2ZA9A 1K3IA 3CFQA 4ODHL 1CZ1A 5BXPA 3CJIA 3BLDA 1LNUB 2GP3A 4L1LA 4NBZB 5I16B 5FP4A 2Q01A 3NZUA 1AQ8A 1WYIA 4B3LA 5L2JB 5J1AA 1KM3A 4IRZH 2OCCB 4P9IA 1LVEA 1OJXA 2QDGA 5AG9A 4FA7B 4CQDA 3TT3H 1NE4A 3SBWC 5HUPA 3PFMA 4FP3A 5EBMB 2R4RH 2PR4L 5H2ZA 2YAMA 3MW4A 4P5TB 1YUKB 3LGEA 3ZIZA 5IM7B 2K7PA 1EXGA 3F8UB 5CIPB 3JB8A 4NERA 1ZPTA 3NAVA 1FWTA 1G7IB 4QLKA 2JKBA 2VY0A 1E6RA 3K6DA 4X7SL 3ZPOA 1E5HA 2H6PB 1ZLUH 2Z1KA 3PWNB 1X7NA 2BOIA 2J7FA 4XUPA 1NP2A 1MFVA 4DAIA 4WO0A 4DO5A 5CEZE 3LEKA 1NLSA 4O02L 4S2FA 4I5BA 2VUKA 3RPBA 1TFVA 3ZZQA 1U0QA 3ESVF 1I1AA 4X8PA 3HC0A 4GBXB 5F9WC 5DCBA 5EKYA 4X0KA 1E6JL 3PHOB 4K1GA 3D05A 4IRZL 1L2QA 4G2AA 4IW4C 4WHTB 1NAEA 1GMMA 1RCOB 1CXIA 2NVCA 4OAWB 3N9LA 4H6KA 1F18A 1IMHC 1PIV1 5LBEA 3W1NA 4MM1A 4ODXB 3VBOA 4DBSA 5AWNH 1TMLA 4M4PA 5U4NA 1HRI2 3TPUA 4MFDA 2Y9RT 2D6MA 2HLEB 4NNXB 1SU5A 4NYYA 4QDGA 4LSTH 5LRRA 2H32B 3GZAA 3HMXA 4B8EA 2C79A 2M8XA 2X05A 3KCCA 1L7TL 3KM1A 2DWSA 3KXFA 3HZYB 1CE6A 1C5DB 4LOVA 1MO0A 5FP7A 4CADB 1P7TB 4PYSA 1UAIA 2ZFAA 4I18A 5HHMD 2WOBA 1Y5WA 2VDNL 4IX0A 1T8QA 5IQ7L 2LFGA 1C1FA 4GHRA 4L9ZA 2GN7A 2EZ0D 4NJAL 2XVPA 4UFHA 5T1KD 4YVWC 1RZ7L 3FO0H 3N4AA 2YUVA 4A7YA 4OV9A 5M1TA 3S5AA 4GRMA 3WBWA 4UT6H 2EAAA 4PJDE 3ITVA 4NRXA 5CPSA 5I18H 4Z7WB 3UXDA 1YNTB 4NAFB 3IJEA 4UI9L 3FU7B 1UZDA 4EKXA 4YWIA 5D7LE 4GNVA 4FYTA 4RGAA 4E9YA 1F5FA 1OCNA 1PZ1A 4ZSUA 2YU1A 4AK2A 3H9SD 3QIUB 2I9TA 1FNSL 2GTWA 2VHLA 1H8VA 1RVKA 2K3HA 1CD1A 1RJRA 5ANQA 2JDKA 2QKIB 2HH0H 4P5TC 3B4UA 3IXAB 3L1GA 2DEPA 1CK0L 3LHAA 4OF6A 5JQIB 4OCXH 1JCYA 2JDZA 2VW7A 2Y07H 4JGNA 1HI6B 3FSZA 4L11A 4YFDB 3BODA 3GUGA 4XF3A 1X9UA 3GXDA 1H0IA 3T8LA 2BY2A 1UMHA 2AF2A 1EAPA 1F4AA 2O14A 4KWLA 2DU0A 1OP5K 1P5UC 4OVXA 4G9FE 1LL6A 3LIZL 3WKMH 2VXJA 3GXUB 1ONXA 2GFTA 2XONA 3KOWA 5HWNA 1ZOXA 5FM4A 3DSNB 5KVGE 1BK1A 3ELFA 1G9NL 5CEYA 1KCRL 2ZMKA 4CGUB 1H8TA 2Y24A 3H12A 3SKJE 4L3EA 1LWHA 3NGFA 3FC0A 2H6RA 2A6VA 1KV8A 1BBT3 1XLGA 4WTQA 4OFDA 4D6GA 4P5TA 3WLQA 1QP1A 4PB9L 1XF3B 3SJNA 3O9WB 4CC1A 4JO1H 4C47A 2AMGA 1APNA 2NYKA 1XIMA 4Y8AA 2CK2A 2Y1HA 2J47A 4LTSA 2GAUA 1OFSA 4AQ8A 2WJDA 1MJ7H 3SYOA 4KRTA 3TONA 5F37A 2XV3A 1JVKA 5SWUA 4GFIA 1R47A 4UM9A 3I6KA 4O9HL 5FSEC 4LQ1A 4JZ5A 2B7PA 4YLBA 3P4OB 2VDPB 2ZKLA 3V18A 4F9DA 3S0CA 4O14A 1DFBH 1SFDA 1KLFA 3RN6A 1K12A 1MCLA 2PSNA 4ALDA 1TMF1 4XSMA 5HV4A 4Z1YA 1S2KA 1GORA 4KO6A 5A6BD 1FNFA 3UL4A 1PZBA 3M3IA 2CC0A 3N14A 5L9DL 2A9MH 4YXLH 3F7VB 4L2NA 4PT6A 3V65A 3PBGA 4K21A 1YMMA 1T41A 5KYUB 4IX2A 1A2YA 3BWUC 2JDNA 3HQUA 1IARB 1LP9A 4OOUA 4Q8OA 1UMLA 4OMCA 4BRVA 2C3WA 1AR2A 2HFTA 2Q76B 1A5CA 4QR7A 5C8WA 4XO8A 4CRQA 1OSPH 3IRCA 2VXQA 1KGYE 2Q0AA 3CXFA 3KW8A 4U6VL 4M1DH 4OT1L 3WHUA 4OUSA 4KCTA 3J8F7 4REQB 3LEPA 3IDXH 2D97A 2CGYA 4Z42C 4XD5A 1BFVL 1FSKC 4GABA 1X4XA 2PCYA 3W00A 3PAOA 3VINA 2J88A 4NQEB 3IACA 2WNKA 1E0OB 3M88A 5FTTC 4LH8A 5DD5L 3L68A 5LNEA 3L2NA 4N9EA 3QO1B 3N7LA 2ACUA 3OB8A 3TBVA 1A4KB 3U6RB 3FRUA 4YC2C 3ZLQC 4KVNL 4A3ZA 1AFVH 1JCLA 1AE6H 5RUBA 3DL3A 3W7QA 4BCYA 5AFAA 4INFA 4Z8BA 2Z8WC 1XIWC 4MUZA 6ALDA 4TPRH 2A7RA 2EDOA 3I59B 2YMZA 3BSGA 4XI5D 1GW9A 4HJJL 4MGKE 4PMOA 2PZ0A 3NFSH 5C70A 2XJSA 2JKPA 1VCFA 3B0YA 2PDBA 1EUUA 3EO1B 5KHHA 1Q7MA 4L9DA 1PK6C 1F8TL 1PDZA 4QPWA 2CKBL 4AKQA 3HR5B 3UJEA 1H3TA 5CN3A 2YQ3A 3D0CA 2GW5A 1P1ZB 3F7YB 4LLYB 4ZSOE 4R0LA 5KN5B 1KPRA 1NOVA 3T08A 1AYN1 3RTLA 3TYGH 1REIA 4LOUD 4UT6L 2VXUL 1U8KA 1IBHA 5SWZE 4R88A 2VCMA 1TIUA 5CMAB 4MSVA 4PTMA 4ASTA 3TYEA 4M5TA 2P5BA 1ZEAL 4BHUA 5HJGA 4X7CC 3COOA 3AMMA 4OQTL 1NAMH 1E1CA 4KXZH 4MV2A 2J1VA 3WTTA 1SM3L 4YGCA 4QNEA 4L3AA 3ZVHA 2BVOA 4WXZA 4DVBB 2GC1A 5EZJB 3QD6A 2HLFC 3C8XA 4M3CF 4LRNL 4IIZA 4FNSA 2QHLA 5JOPD 4ZRGA 3LB6D 4XO7A 5KG9B 4F7MB 3ZLIA 4IGBA 2XHKA 3EJCA 3FUNA 3PUQA 5D30A 1D4M2 4Z5RA 1NFIA 3C9NB 3ZN6A 4Q29A 1J6PA 1E6PA 1JYWA 2DMKA 1P6CA 5DC4B 4QRSA 1R3SA 3I6KB 5A70A 4TZDA 4PS3A 3KDNA 2R1XB 4ZNCD 5EBGA 3LHWA 5F3CA 1OGTB 4US5A 3T0BA 2GUOA 4I6KA 3PSVA 3OAZH 5FYLD 4KGLA 2HT3D 1TQTA 4OCSH 4ZENA 1G7IA 2C9XA 4FI9A 1JRCA 4W4OA 3GGLA 2AJYL 4LGRB 4JRXA 1WH0A 4R4ZA 4Z3FA 1G9BA 4ISVA 4GWIA 1QVOA 1GVRA 5H2BA 3SLIA 4DJDC 1Z0NA 4ELKA 3ZTCC 4BFIA 3SURA 2I07B 5CP7B 5INDA 3LSBA 3C7GA 1ZLUK 3G6LA 3WFHA 3VGDA 2VGDA 1G1CA 3E0VA 2QQWA 4I0CC 4DP6X 3NH7L 1UR3M 2VCOA 3IK4A 4MTVA 4PWEA 1HB2A 2E9MA 2BVBA 2P7TB 1Q56A 3HHRB 1X5HA 4QXUL 3MNWB 1D6VH 3MMTA 3BQUC 3POHA 2BS8A 4ASLA 3ZS4A 4PTUB 4ERSL 1XOYA 2XVNA 5HHVH 3U6RA 3BZGA 1HQ4A 4A7UA 1B3WA 2DW6A 3MNWA 2X2IA 3LQLA 3QC6X 2NY6C 3GSVB 3T6CA 1ULFA 4BYHA 1S4CA 1OD8A 1AJ2A 3M7SA 4IIQB 4LLOA 3RZCC 2OMWB 4ADTA 1SUHA 2DOCA 1ZBA3 4RQPB 4AZ5A 1YY8A 1RK7A 2RDQA 4U1IB 4MPKA 3OYXA 2EPLX 4L4PA 1UWXH 3LDKA 3SJVA 2PDUA 1UJ3C 5EN2B 5G1YA 3QR1A 4UM8B 2XBO1 3KVJA 3ZYIA 3ZY7A 1WMFA 5C8JB 1N5AB 1UT2A 3O6FD 5A6YA 5ELIA 1EHAA 1GP5A 4XE0A 1AYOA 2NXZC 3PWLB 3CU7A 5E99L 4HJGB 1S9YA 4COYA 3GSWA 3KUMA 3RY6C 2J1YA 4I18C 2WCSA 3W20A 4YHNB 5D38A 1YJDH 3P67A 3G5ZA 1AR62 3V9FA 5A16B 4HHPA 1S9XA 2ZWNA 4AIXA 4QHMB 4AQ2A 3WN6A 3ZE0F 5D7IE 5IQOA 4MVBC 3FQWB 2P8MA 5DQPA 1AZRA 1D5XB 1U5YA 4KCWA 4OJAA 4PWGA 2FZ1A 1T0OA 3B9AA 3ECWA 1Y0EA 1OX4B 1FZMA 1Z69A 2W62A 3FB8B 2WAGA 2A3WA 1FHVA 2W47A 2Y36L 2BZDA 2RS13 3VYOA 1PU0A 3F4DA 3EEGA 2X9YA 2QLYA 3U6WA 4PRBB 4PW9A 3ULVH 2ZOUA 5ISZB 3B0UX 3P93A 2IALB 1WVZA 3UW6A 1PVC3 5JHDE 1ACZA 4YAQB 2C1FA 2P47B 1RZFH 4H44C 3EOEA 1UXMA 3EHBD 5FO9B 3TFXA 3ZDZE 2ZX7A 4HKZB 1PDKB 4QO1A 5F3GA 5FY7A 4MX3A 5F7DB 3HV8A 2R23A 3OGRA 1LOLA 1PTGA 5EH1A 4HKJA 2WBKA 3MB9A 5CZJA 1L9SA 5HWMA 2OT0A 2MHAB 3CFCH 3MCLL 4HJ0C 4IMLA 1FFQA 2DT1A 3SCVA 3HMXL 1PZSA 3DG6A 1AQFA 2DQJH 2OQLA 3J7LA 1EHNA 5I1AA 1RURH 2I60L 2DTWA 2GJZB 5JAXA 4M1GL 2VTFA 3LKRB 5A6TC 3KPOB 3H56A 5IVZB 1JEZA 2DYPD 4FG2A 2YPVL 1F1GA 7CGTA 1U5ZA 1WDPA 2YKLH 4XB3A 4I01A 3B56A 2O56A 3SYPA 3MIHA 3AHYA 4ALAH 3LZ3A 1LOEA 3AK0A 4PJFA 2OZNA 3B0XA 1WDAA 1FBAA 5JOFB 2I56A 3A5FA 1KCXA 5B1JC 1NGPL 4WEBH 3AFBA 1KLYA 5D03A 5BNOC 2DV6A 4PJ9B 4IK6A 3KLAA 4O52A 1QOXA 3ZPYA 2X28A 1TTJA 2EAKA 3EA3A 3FT3A 1JF1B 3VCLA 3KYKL 3DEQA 3CM4A 4GLRH 4AYEC 3BVJA 5GISH 4B0MM 3BP4A 2R041 3I9GL 5HV0A 3R8BB 1E50A 1OFPA 2G75A 1RJLA 3ALPA 3UZWA 1HKKA 5D2YA 4LYRA 1PO23 5A6XA 2GIMA 4BUGA 4K7VA 2QAPA 1R9ZA 3R10A 4NQTA 4FR1A 3N44B 1A21A 3WLWD 4H8WC 4OYUA 1MREL 2Y5QA 2QDDA 4KK9C 3IDJA 4JAMB 4XD6A 1SW7A 4N6EA 1AGCA 1WLCA 4AB4A 2Q2EB 1AA1B 3EA2A 1GZ9A 4WWOA 1JPFB 2GMEA 2XI9A 1NCAL 4WW2B 5FYJE 5KS9B 1OK0A 4PY8J 3K77A 1P0KA 1BECA 4JFVA 1G9MH 4LMFA 4KKRA 5I8OH 2N3JA 4ETQA 2R0ZL 4IFKB 3VBSB 3NNLA 4C6OA 1AS6A 5B39G 2QGEA 3BT0A 3CJPA 4EUPA 1Y8BA 3HHSA 3EWZA 2H3DA 4XBJA 4JFPB 1YO8A 4AK3A 4NRYB 1YN7B 4ACYA 4QYOA 4I09A 2EIZB 1XEDA 4L1TA 5MP6H 1FN4A 4Q97A 1A3RH 5CSGA 4DXKA 4YRDA 4GW4B 4DO0A 3HBGA 4ZMVA 4DM2A 4JO2L 3S36X 3T40A 2GYIA 1LRHA 2O92A 3LTYA 3AYVA 1XV8A 1W72A 43CAA 5FA4B 1FE8H 1E27B 5CGMA 2R1PA 3GBEA 1QD0A 2V38A 3KRUA 4G71B 2ZHNA 5LBSH 2ZUQB 1CGVA 3Q4DA 3O0RL 2H1PH 4N4QA 1R3YA 4IJRA 1FWRA 5D2NA 3QO0B 4H25B 4H2AA 3QZAA 4MGSA 5A2KH 3LQMA 3W37A 3GZKA 4FYSA 3O0WA 1V6YA 1J5HA 4HKXB 1QLEB 5CKAA 4PJHB 1M7OA 5DQJA 1G0DA 4Z17A 3FTVA 2ZBTA 3FT4B 3B2VH 3K91A 2E27L 2E7LA 1AS8A 3VZZA 3MNVA 5AW3B 1F11A 4XC3H 1S2WA 5CEXB 4YW6A 4IFRA 5FXZA 1TG7A 4W9TA 4PWJA 2WCPA 3O6AA 3LEVL 2HTLC 5HK4A 2A1XA 3FUHA 3UWZA 1AANA 2PO6A 3EYSL 2NYYC 1H9DA 3HRZA 3IIXA 3C75A 4N0FA 1KJMA 3B9KA 3O1SA 1BDYA 1N0XH 1ZLWH 1U2CA 2EF6A 3QQ0A 2CGOA 4QT6A 5F0PB 4IMEA 4P3WA 4N0CC 2WQAA 4KHTH 5CCKH 2K6WA 1ZREA 5D7LA 4WJKB 1MPXA 4K5OA 2GITB 5I71B 1PWLA 3ZTNL 3LS9A 1ALDA 3UROR 1AGEB 5CN2A 4P9HC 3L5AA 4U5IA 3N73A 4KKZA 4GCXA 2BSSB 5H9QA 2JSFA 4NIDA 1HIMH 2WXOA 1GT8A 4MPQA 5KHKA 5J12B 2VXRA 5FECA 1E56A 3SZKC 3D06A 4FAAB 4GW1B 3A9BA 1EEZA 5KYXB 1EAQA 1EYBA 2VQ1A 4LLDA 4QPIB 5FZ1A 4IHOB 4IL7A 3IFNH 1XYAA 3S9YA 3J7HA 4R3SA 4Z7OB 1JPMA 1Q9WA 5TPWL 5ILTL 4Z6AT 1BEXA 1M05B 1UOBA 4Q0SA 4G1EB 4I9MA 1V0MA 2DKUA 4GJIA 3SN6N 4R4NC 3TXVA 2GGJA 3DC8A 4UOW1 4Y5XB 3KVKA 4XMTA 3VQLA 5L2KE 3CN2A 1IEXA 2A74B 1YUDA 3DKHA 4HS8H 1PZ0A 4A35A 1NH6A 4HQQH 1C8M3 5BUVA 2DKMA 1VFHA 4XVJH 2GBTA 2R39A 3BPNC 1NY72 4U4BA 3A0KA 1JFQH 3H23A 5FAXA 4DGYH 2UUDK 4G5ZL 4RGOL 1ZPLA 2ZKMX 4N9CA 1HXYA 3EDDA 3FU6A 4H1LH 3FZUC 4NNPL 4R9DA 4JO1L 5DJCB 3SZ6A 2D98A 1GGBL 1JZDC 4NZDA 1EDQA 2BP0A 2DQJL 1C3HA 3QDJD 3APDA 1UWTA 3WW4A 3UAEA 3NSYA 1NL0L 2BDQA 1YMMB 1C3FA 4BE5A 4UTAA 4PV9A 1IC1A 2GJNA 5I76A 4UU9A 4WI9A 1WV2A 1UUSA 4COUA 3G6DH 4AL9A 2B9VA 1AO7D 4HIHA 1XFBA 3HI6L 5E7BA 5HGGS 2OQHA 4AF9A 3REQB 3B3BA 3A6CL 3ZLGA 5F1KC 1FZKB 1YI7A 3KBMA 2JG9C 4YGAB 1SHWA 5FMCA 3IMUA 2PDYA 4BUQA 4XO6A 3LIZH 4NY2A 2FFIA 3QZWG 4PFMA 1XR2A 3BKJH 3DI2B 1EJ8A 4YXHH 3WCRA 1A1OA 4AEDA 1OCCB 2CWMA 4EIUA 1WZAA 2P46B 2EINB 5IVCA 4UMGA 1VLIA 4Q4V3 3PWPA 4KY1H 4IXXA 4GB9A 1PCKA 3SY0A 3ZXDA 1HEZA 5DHXB 1AY1L 5I8YA 1ODUA 5FGSA 2V2TA 3QBUA 3PQYE 3U36B 4F37K 3UYPB 4CE8A 4PMDA 2HXUA 3S9ZA 2BSBA 5FQ0B 5J5EA 4W9EC 1AL23 3EOAA 4NZRL 4JIQA 5C9UA 5REQB 4AZZA 3LRGA 4UTJA 2V2WB 2MKLC 1U8PA 3L2LA 2P50A 4C6PA 3STPA 3W7EA 1W1IE 1H5BA 4X6BA 2WLHA 4EROA 2WGNB 3SUUA 5FLVA 3NCYP 3FHEA 2EDFA 2YC0A 4RE2A 4WGHA 2XJKA 4WKFA 1RUD2 3WH9A 4FULA 2X4PB 1X38A 4H83A 3NSDA 1H2MA 3QORA 3WS3B 1Q8SA 1HILA 2Z29A 3DVNB 1FYTB 2YCKX 2VDGA 5AHFA 2IANE 3ABKB 5AKVA 1Y9GA 2WSUA 2Q1ZB 5DDHB 3T3MB 3PP4L 3S42A 4I0PA 4ACTA 4QLJA 1BMZA 3I6GA 3EYUL 1CB2A 2A1WL 1MCCA 3RWEB 4QCIA 2ED6A 2GDVA 5KVEH 4ZO8A 5KN5A 1CG9A 2HH9A 4KZ0A 2TUNA 3QG6A 1SLIA 1VPOL 3WEZA 2V09A 2G3NA 1OH3A 4P7NA 3GXNA 3WNIA 3QCWA 4JY8A 3H4GA 2V5KA 2XQ0A 5H6HA 3WDVA 3D2TA 3H3PL 4PJXA 5ID1B 1MQTA 2VOWA 4DP1X 3DOSA 2OZ3A 4W89A 1R7OA 1J2BA 1CLXA 3ENEA 4N25A 4IMFA 1RCYA 1CFNB 1NGZB 3FDGA 3QR0A 5LIXX 5A3TA 5E6ZA 4YWGL 2IADB 1OYBA 4S1SH 1M05A 4Y1VA 3MRIB 2VR2A 1HHJA 2G9KA 2Z1SA 1Z7JA 3RPIB 4WV1B 5C54A 1MAML 2PXYD 5ES4B 3ECBA 4UIKH 4IP7A 1R75A 4PRBA 3WW3A 3TMQA 3UQNA 3VBFB 3QA3B 4WEVX 4JHAH 5I16A 2IPUG 3O3EA 1XCTA 1X5FA 3T4YB 3B97A 3ARDB 1BTMA 1KFBA 1KG0B 5A8OA 4FQCH 3IFOB 5JW3H 3N85H 1JTOA 1WCGA 3D0JA 2VCCA 2IKIA 4Y2OB 1CYXA 1HUVA 1KCLA 1V55B 1IE4A 4ODTH 1E5CA 4NHUA 1LL1A 3WG3A 4WCJA 1ZALA 2RHPA 2FWOA 2KQNA 1DWGM 2ORBL 3G1XA 4WTZG 1TQ5A 4UQCA 5EZIH 5IWLC 4QNWA 1WBYA 3OLDA 4MAUL 3W76A 1UKPA 4CCCA 2GU9A 1I9EA 4PRTA 3NKTA 2WQXA 3WG4A 1FC1A 3G9VA 4CDGC 1CB4A 5KC5A 1LTEA 3B3QE 4MKMA 4YZ2A 1H3PL 1JMUB 4YDJB 3BVTA 2P6HA 4E2BA 2FDFA 4ARYA 4E0CA 1LRQA 3KVMA 1OM3H 4EN3B 1PMHX 4OIAA 3HFMH 2EG8A 2J13A 3FE5A 3AHTA 3ETTA 1CAXA 3KVQA 3QDMD 3SY0B 4HUKB 1JGUL 3LEXB 1ZSHA 3GVVA 1DZRA 4U1HA 1QO3A 4IV3B 4ORZC 4HKPA 1CTMA 4PYHA 3J8F2 1VERA 1BVP1 4NO5B 1K4HA 3MP5A 4HNUA 1GGCH 5DUVA 4UC5A 4PCRA 3FSUA 3BN6A 5TDPB 2IVJA 4QUOA 1UOWA 3GNRA 3S5LB 4M00A 1NEZB 1ZHNB 4JDZB 3MOAL 4B9PA 4AITA 3CMJA 4KT2A 3S3CB 3UGRA 2KXLA 3U2IA 4H1LA 1MJ8H 3BCWA 1FCCA 3L1FA 2Z25A 1CF8H 4DQOH 2RFXB 1QPRA 5I17B 1OFAA 6FABL 4LUSB 3MXVH 1PTAA 2ZX2A 1WWCA 4Q4X2 4V1YA 4ZK8A 4BISA 1RHHA 3P9LA 4RAUA 3SYCA 1P7QB 2DQCL 1ND3A 4JEQA 4B50A 4TVPD 5D55A 3GRWH 1QTPA 5J1AB 1JPST 4JVWA 5DA4A 3TVMB 3SDXA 4P9YA 3I10A 3SQSA 3WF0A 1JMZA 3AMPA 2VDKL 1X1ZA 5IROD 3OZMA 4OF8A 3MROA 1W2UA 4NAOA 5AL8A 3FCSB 2IVIB 1JDDA 3NACL 4HKLA 3UEQA 4C8DA 4F2UA 2ZX0A 4EVNB 1DQ1A 1UUMA 4WUKH 4QRPB 3EJSA 2JJTA 4NNCA 4M5ZH 4K39A 4Y5SA 3SAZA 3LLFA 1GPFA 3C6EA 4CKVX 1SFYA 1NIAA 2XLFA 4PRWA 3RTQD 2NM1A 5IFAH 3V4UL 4IETA 2O5XH 1UNBA 3MCKA 4XPHL 5E03A 1OH4A 1WX0A 5B8CC 1EJSC 4PRIE 1R87A 3T77A 5BY5A 4FHAA 1FBIL 3QFJA 1Q0EA 3A0NA 2JH2A 1EEYB 3WUBA 2VE6A 4JYDA 4MZ2A 2PHFA 1JYNA 2Q7YB 5ICXA 1NA1B 2Q71A 2XVKA 2POZA 3E38A 1UZHA 2FT6A 1U8NB 1ZANL 3WFCL 4JFZL 3WNXA 2OX1A 1W3VA 1EFQA 1RUJ3 5B7YA 4HNOA 2HT4C 3MDWA 1G6RA 2HS8A 1I1RA 1KFXL 3LDBA 1K4CA 1AG1O 1VBD2 4WM7B 1E71M 3M9YA 4PAZA 1T7XA 4Y24A 2L8AA 2F61A 4JIEA 2MCG1 3AIQA 1XF2A 2C34A 3QJQB 3FH8A 2ONEA 3THQA 2DTML 2ITCA 1IM9D 5B4NA 4OVUA 3BIAX 2Y5JA 4QG9A 3V0TA 1C5BL 4C6BA 3M17A 4KTYA 3PBWA 2WHVA 1W54A 1ZA7A 3O2WL 2QHRH 2WSKA 4X6FB 3CT2A 2R2HB 4Q0UA 4H00A 5HMEA 3MO4A 1GW0A 4LO6B 5HNNA 5DTFB 1W0WA 3FWEA 4NAMA 3ACFA 1S78D 4QKDA 5K9QI 4DXXA 2WHKA 4IG2A 4P4RA 4BSWA 4IK7A 3VXMD 4Y4FD 3O0LA 3ESUF 2AC1A 5F8PA 4IICA 4QBXA 3GSRB 2WC4A 1TWSA 2A74C 3R13A 4OZGB 4AQ8C 3A3XA 5BW7C 3QJSB 2YBGA 5I1KH 3ZL4L 4FKEA 2NXZB 3OMAB 3QJHA 4DNYA 2QTVA 3EKCA 1UH2A 2EXYC 4CW1A 2CZEA 3ZGHA 1TPFA 4IS6B 5CP3H 3MLYH 3O2LA 4W6XA 4CZSA 1KYUA 5DY2A 4BCZA 4QRUA 3K72B 5DRWB 5DVPA 1FJ1A 2BVDA 3QWRA 4G6FB 1MJ7L 1BWMA 1LHWA 1V51A 4AE0A 3OJBA 3EOTL 1FDLH 2Z7KA 1PMJX 5EZJA 4UUJA 3AGWA 4Z7VA 5C7XH 2WTOA 7PAZA 1PLGH 3IRSA 3UBXG 1LB2A 1XBXA 4QOKE 5L7XL 4IEFA 3X12B 4YWGH 3F4CA 2B7YA 4ZSOB 1PEWA 3EAKA 3GNPA 2ADEA 1GYLA 4FXTA 4M43H 1P0SE 3PUHA 1ZENA 4QB2A 2GPTA 2OXHB 1M9WA 4G5AA 2QFEA 2Y64A 3FJ6A 4HUWA 3SCMA 1QNVA 4HEME 2ZXAA 4GG8A 1ND3B 3NPZB 5INCB 3FQTA 5I0TA 1IC4H 1C57A 3RFZB 3V16A 3K6NA 2GDQA 2CZNA 4NENA 3TBSA 4B9YA 5E8PB 4R53A 3M0HA 3I2GA 3GMMA 1MCNA 4KKAD 3O2DL 2A6ZA 2EPOA 4TSAL 2GG1A 1UM5L 5TFSH 4CILA 5J8OA 3S88H 1QOOA 1STMA 1ZT1B 1DVJA 1DQDH 1NF7A 3M4HA 2ICWB 2VUAA 1E70M 4FTBA 2F9RA 5B4XA 1U33A 4PUBH 1ND0B 3LPWA 2P8LA 1WDRA 1VGKB 3HRZB 1F2QA 1DQMH 4HVQA 6FABH 4KXAA 4HLEA 1BVZA 4HXBH 3UG4A 3DNKA 4XBEL 4PS4L 5DJZA 2WL1A 4A2FA 3LSOA 2DUAA 3BP6A 4M7LH 5L36A 3LENA 2C3VB 4QOKD 3JT0A 4B5SA 3X1FA 1UR4A 1S5WA 4LVGA 1BQLL 3LEIA 4JM2B 4A2LA 5JIKA 5XIMA 5HPMA 2IVFC 2WSPA 1DV7A 1A80A 5CG9A 3C3UA 2O6FA 3BOVA 4NEHB 3QFEA 1R3KB 5J4MA 3FN3A 5B7MA 2C1PB 3K46A 3LZFH 3OUIA 2CDGA 4LQFL 1B35A 4MBOA 1OABA 4M6MH 3IT8D 4RR3C 2C24A 2HTKC 4MWAB 2P4EA 1R3KA 1UIKA 1M06G 1OF4A 3GDMA 4BQWA 3CHSA 5T3NA 2XUCA 1B88A 1FE8L 2CGNA 4J2QA 4DVBA 3TN3A 4D9QD 3VKDA 3BWWA 1S9KC 4W9LC 3R0RA 4JL1A 5H37H 3T1MA 1GVQA 4OQ1A 4JFYA 3H2FA 3P73B 1TQXA 1AH0A 4QDSA 4M7SA 3GHRA 1LO5B 4FXRA 5FKPA 5IVJA 3QW3A 1ZBE3 2VWSA 4NQEA 4P0DA 3O0XA 3QUKA 3IWUA 4F48A 4KIRA 4AM0B 3MXWH 4F57H 5DPNA 1PZ5A 2FDSA 1BREA 3N2TA 5I79A 5EV7A 4YN3A 2H1LM 3GR7A 3V95A 2AABH 3NSJA 3IETA 4AQLA 1IVLA 3S2JA 4XH2B 1SFPA 1PW3A 1FHUA 1FNAA 1WE5A 4NKMA 4PS7A 5D8JL 3DN7A 3I3BA 3PLYA 1YFWA 4ZS7L 3KBWA 3O6MH 4MWFA 3PUAA 3WK2A 4QIUA 3GSNA 1NE6A 1GS6X 3OPZH 4IUGA 4JRYB 5HATA 1MLCA 3O45B 3Q01A 4IKIA 1ZAJA 2WZIA 3GX9A 1TPH1 1REEA 3PUUA 1M7DB 1C1EL 1INEL 3YPIA 3SDOA 3V6OC 2PPAA 3F01A 4S39A 1A9EA 5MHSE 1M68A 2OPJA 1EAOA 4BHUI 4MG2A 1AO7A 1K02A 4U49A 3OHIA 1E5SA 4Y2LA 2EXHA 1O7DE 4WK4B 5EO9B 5IDIA 1UM6L 3K8KA 4YX2H 2WFPA 3DCPA 3QUHA 2AGSA 3I3MA 3CSFA 4H0LC 4HU4A 4L37A 3KMDA 1RMU1 2PWHA 4PRHD 1DLCA 5F3IA 5HHNA 4BB3A 1ED3A 5JHLH 3BTAA 4I3PA 1Q7ZA 1JUFB 1GWKA 3QGAC 3TDFA 4RKAA 2Y70A 1HO1A 1G6CA 3NBNA 3GBWA 2EIEA 3QHMA 5KSUA 1UWQA 3O0KA 1BEYH 4LSSL 1WICA 2XIBA 3HC4H 2MKWA 1KFJA 4RR4A 4B3VA 4XAFA 2R4SH 1R3JB 4KZEL 1N5AA 3MUIA 5E4AA 3BDBA 2VTXA 4PJ6A 1RZKH 2HCZX 1YNKH 5IHUL 3CIHA 4MXWA 2X87A 2CKNA 3OR7B 3GG1A 1HX6A 3PZGA 3V0BA 3VBSC 3EW3B 1CD3G 1OIMA 2A5HA 1ITXA 4JDTH 4KJWC 1ST8A 3PUGA 5KJ7E 3QJZA 2LV4A 1F0LA 1OQEA 5CO1A 3IS4A 4X5XB 1GOXA 3EJTA 3NIGE 3WHTA 1NZRA 1O7SA 5TD4A 1THAA 1ZDSA 2J24A 3ATYA 1ULOA 3NK3A 2GL5A 2D3RA 2ZOKA 1XHHA 1NEUA 4RS5B 4XMVA 5F7KC 4KI5M 5FM5M 1N6QL 4PJDA 4GZIA 3KM8A 3SGEI 1JNHB 4Z2WA 4ZMNA 4PUMA 2APTA 1C92A 1NEYA 5K0UA 5HVHB 2BW5A 2RJGA 2JE8A 2XG4A 3VIGA 5KVDH 1E9IA 4PP2B 5FMBA 5ACZA 1NFPA 3GSNL 1HCFX 3URQA 2E09A 2CHRA 4A6SA 5F1SA 2YROA 1E9QB 1ZU8A 2B7OA 1L9MA 1OGAA 1VRSA 1H3PH 3AMLA 4HIHB 5CM1A 3EBVA 5FO9A 3NFNB 4XXCA 4AEEA 3SCRA 2ICWJ 1NELA 1NDGB 4QRNA 4C5ZA 4X6DF 3FN9A 1LBMA 4PTWA 3FYYA 2YL8A 3CJIB 4DXTA 5JORA 4PDWA 3N3TA 1DANT 4NKQB 5T3ZE 1VFUA 2HA1A 3RWGB 3L8QA 5HHXH 1ZIAA 4WDIB 3U4AA 5J06A 4GH3A 3E6HB 1MXSA 1FZJB 1QLRA 2IDSA 5A7EA 5GZDA 1WW5A 2DLGA 1GZHA 2VVSA 3FB8A 1FORL 1R4XA 1OCQA 5LBFA 3QQ1A 3AJYA 4XMIA 3EYOB 2CIKA 5M03A 2VABA 2AQWA 1T83C 2YD8A 2F8IA 3VBRA 3SFKA 5F7UA 5ADPL 2DV9A 4I7ZC 5F88B 1UN1A 2ZPKL 1PZ8A 3H70A 3PUCA 3M8LA 3LKRA 2EKGA 3TK7A 3FLUA 1DYPA 4TULH 2X9WA 2OELA 3A6OA 2FIKA 1J8HE 4NGHL 2IMRA 2GB2A 3VBUB 1QSFB 2KDYA 3IPVB 2DMGA 3RI8A 5A95A 1DLFL 2EIMB 4C1LA 5K9OB 1A6PA 4URTB 2YW3A 5DZGA 4N2IA 2MOVA 2Q0ZX 4EDWH 4WWID 4HG4K 1GOFA 3KBEA 3KS7A 3NFNA 4F93B 3DMMB 4GSQA 1JIBA 2XBZA 1DEDA 3KPSB 4FTVE 4ILSA 5F89B 1EPVA 2QIIA 4B5XA 5I5RA 4J3ZA 5D9NA 1R17A 3KH4A 4ZUSA 3NJYA 2J88L 4FR6A 5DXYA 4IU2A 2NY6B 3Q94A 1U21A 1FWIC 2O61A 3A4JA 2J43A 2W9EH 3F64A 3HZMA 1UB5B 4W9HC 3V9EA 5FCUH 1KN4L 1R85A 3L7RA 2WKKA 2BFUL 3RGBA 5AYTA 2WXJA 4NIGA 1XU2A 5JIWA 1XLCA 1T1ZB 3VSVA 3QCVL 4Y4KC 4S2CA 4IRSB 1KR0A 3RL2B 3S3GA 3QJUB 4OHYA 4QM9A 5T5OA 5I00A 5J5DA 3PU7A 3VNKA 4PWFA 5MEPB 4QSHA 3EO6A 5TF0A 4R4FL 5G5IA 3NDOA 5EU7E 4XHBA 3W1RA 1LILA 4PJIF 4D2NA 4HFWB 1W6WA 5FUOL 1MCWW 5C7ZA 1SFHA 3H21A 1EVUA 1UM6H 3C0SA 2ZSVB 4MXWB 5J11C 4NCC2 3QSRA 3HURA 4C6DA 4L56A 4FPYA 2OODA 2QL1A 1OGSA 3L1OH 3ZJ7A 2ISVA 4PWKA 3ZT5A 2PPGA 3FJTA 3OL2A 1YEFH 2ZGPA 3FIGA 5IFJA 2X2HA 4XMLL 2UWEE 1IR1A 2NXGA 1RB8G 1EP0A 1H6TA 4FALA 4HPKA 1U8LB 2D03H 5EU6D 2HTMA 3GVGA 1X9LA 5G4MA 1J1XL 2WXRA 1YHTA 5EF2A 4DI8A 3STCA 4YHLL 2XTKA 3QDGE 3VH8G 3WYZA 1Q0XL 1AHKA 3BRDA 3ZOAA 1XQNA 1NP0A 2QCSB 5C0CB 1TV5A 3CQJA 2X9XA 3TTYA 2ZUUA 1QK2A 2HX8A 2J5WA 2GJ6A 4CVWA 5A3IC 2FQDA 3UGXA 4MNGA 1ZLSL 3ELQA 2YUXA 3WKYA 4MMXA 3H22A 4MG4A 5IEHA 5DUUA 4AG4H 2E6YA 4EXBA 3BLLA 5DUWA 1QJEA 1A7PH 2R49A 1RUG3 2CWXA 3QXTA 3DKLA 1F05A 2XJLA 3T2NH 2FVKA 5AQ0A 2QGCA 1JE6A 4UW4A 4RBPK 1VBA1 4N7UA 2Q3OA 2WC7A 3N2JA 3THUA 3BQ6A 1PY0A 3QXBA 2UURA 5J9PB 1Q8VA 4PCSA 3K6OA 2VR6A 3DX6B 4CEWB 2HFFA 4OUUB 2PPFA 3OUJA 3NEOA 2Z91A 4JTIA 1MQRA 1WKEA 4WHBA 1SF3A 5IFAL 3NCJL 3VJ6A 1ENXA 2F5BH 1XNTA 2HSAA 3M6YA 4CEWA 1G5GA 5JORB 2AAMA 4FF9A 1T5WB 1CAVB 3FUEA 2B42B 3RP1A 1OZTG 4WNQB 3QQ3A 1U8HB 1HJFA 1XIIA 5I19L 4E9LA 1QFEA 4X8CA 4AWTA 4W9CC 3N91A 3UGUA 3R7MA 1FUYA 3ON7A 5E9DB 3W84A 3RL1A 3OODA 3CUFA 4NZ3A 4X83A 4LKXB 3IU3B 1N5YH 3A21A 3ZYOA 5DZFA 4LHLA 3QZEA 3JUUA 4PJEE 3P5BA 1GJPA 3JWNC 4QU1A 4ZQPA 1WB0A 5JBEA 2WB7A 3SECA 2XN9D 5DD0L 4MCMA 3RHWF 2LQRA 5LXVA 3OXSB 1OQ1A 3WHE0 3FCUB 1VR3A 4A1RA 1XL4A 2FMDA 3MJWA 2HKFH 1I9RL 5EN3A 1P4UA 2HMID 4P2RA 2Y8UA 1DO6A 1QR4A 3RZMA 2DEWX 2ID4A 3VFTB 3WFDL 1SZGA 4UTKA 5TFSL 2C13A 2CL2A 2IQAB 4JRXB 1YPZF 2E68A 1YRZA 3VHPA 1BAFL 1DXIA 1ZRQA 5FP9A 1JYTA 5F7WC 4OJFH 1D9EA 3BT2L 4KU1A 5H8UA 1UR1A 1C1LA 1ZVNA 3T4VA 3EGXA 3ZUNC 3WHXA 3ZR6A 2VTXJ 5AVUB 2E7CA 5D1IA 1HRI1 1T6MA 1U8HA 3TFKD 3PJTA 2QTEA 3ZL1A 1YQCA 3FRPB 4NFCA 1LNUA 1ORQB 9CGTA 1E5NA 3S4SB 1HRV2 2FYMA 4FC3E 1NSNL 2MJWA 1TZ9A 1QSFE 3ZL4H 3M0YA 1QUMA 4HJTA 2HBXA 3MW2A 4GUOA 3R8QA 1KF9B 2YGMA 1H1NA 1EXUA 1UATA 3MMEB 4NIRA 5F7HA 1Q1JL 4NXSA 5C9AB 4GRWF 3FT4A 1JGVL 4J3VA 2Z3FA 5GSRA 3U4FA 4DYKA 1CO1A 4BXFA 2ZZJA 1JUHA 4DVRH 3UPMA 3LV6A 3ILEA 1OOWA 4FKHA 2OMYA 4DBDA 2H26B 3MRHB 1U8MA 2EDQA 2G5BA 3LBCA 5ABAA 1OIFA 2CD0A 1PM4A 4NJIA 1NOWA 4Z7WA 4UOZA 1M4WA 3ANVA 2RR13 2DVTA 1J8HB 4QAWA 3SE8H 1YEYA 2Q6ZA 3WK1A 2IXCA 2YBVA 2VN7A 3B9IA 5CKGA 2APFA 1W0NA 5AYIA 5DDJ3 1H19A 2FHRA 4KS0A 3SE8L 2RMU2 4XMXA 3T0XA 2VXVL 2X4RB 3BLFA 1NCRA 5DD3H 2PS2A 2HVNA 3V0AB 3Q8CA 1KDKA 1HTIA 5JQ9A 3IIPA 4WW1B 4ZPTB 3EFOA 4YDLB 3FRPG 1O4YA 4L8SA 1KV7A 2RMU3 4HTBA 3SO7A 1DQDL 2R8SH 4AIZB 4TN7A 4NAEA 4O8AA 4NNXA 4PBWD 3EYFB 4Y7EA 3S2LA 3EWDA 4Y5Z0 4NDMB 3HGRA 2OQJA 4HB7A 2AQVA 2CLRA 1KXGA 1UYWH 2XZ9A 1R5VA 3BKCL 3BP6B 2ZP0T 4E5XG 3JT2A 3HC3L 3V7MA 1XCQB 4G80A