4QAWA

Structure of modular xyn30d from paenibacillus barcinonensis
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
537
structure length
537
Chain Sequence
ASDANINLSSEKQLIKGFGGINHPAWIGDLTAAQRETAFGNGQNQLGFSILRIYVDDNRNNWYREVATAKRAIEQGALVFASPWNPPSDMVETFNRNGASAKRLKYDKYAAYAQHLNDFVTFMKNNGVDLYAISVQNEPDYAHDWTWWTPQEILRFMKENAGSIQGTRVMAPESFQYLKNISDPILNDPQALANMDILGAHTYGTQIKDFAYPLFKQKGAGKELWMTEVYVPNSDNNSADRWPEALDVSYHMHNAMVEGDFQAYVWWYIRRQYGPMKEDGTISKRGYNMAHFSKFVRPGYVRVDATKNPDTNTYVSAYKGDNKVVIVAINRGTSAASQRFVLQNGNASTVSSYVTDSSRNLASLAPINVSNGAFTAQLPAQSVTTFVANLSGGNSGGGNVNTGTTYEAETGTTLTDAVVETLYPGYTGSGYVNFNAYTNSAIEWNAINNMTTGTKNVKFRYALESGTRNLDIYVNGTKVLSNEPFTETGSWSTWGEKTIQVAMNSGVNTLRIVTTGTEGPNMDNITVTASAKGELNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Xyn30D
publication title Structural Analysis of Glucuronoxylan-specific Xyn30D and Its Attached CBM35 Domain Gives Insights into the Role of Modularity in Specificity.
pubmed doi rcsb
source organism Paenibacillus barcinonensis
total genus 159
structure length 537
sequence length 537
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
A PF17189 Glyco_hydro_30C Glycosyl hydrolase family 30 beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4qawA01
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4qawA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4qawA02
4HOWA 3HNYM 1W8OA 1H3GA 1CZTA 3SCQA 3BC9A 3I2KA 1JYWA 4MOAA 4ZY9A 2J75A 5GNYA 2VVNA 3CZGA 4TVCA 2E4TA 4Z2KA 1W0NA 3L4XA 1E9LA 1V6UA 1KGYA 1MW1A 3WN6A 3P6BA 1WZKA 2XONA 4H04A 1FFQA 2AOSA 3B9EA 4QB1A 3ZMRA 2G41A 2DSZA 4W4ZA 1CXFA 4J3WA 2WC4A 5BXSA 2D2OA 3BVVA 3NQHA 1CPUA 2WWCA 1HVQA 1E6PA 1BYAA 1QI4A 4NSBA 1R75A 3VX1A 1W32A 1CIUA 4AEEA 4W50A 4A3YA 4AZBA 5HBFA 1V6WA 4DM2A 1GHSA 5F7UA 1R7OA 4CUCA 5I77A 5BXRA 2D0HA 3WNKA 1GOHA 1UY3A 1CBGA 1L7RA 3ARUA 3HG2A 3NCOA 4M56A 3SCRA 2YL9A 1XRVA 3UG5A 1HJQA 3ARVA 1KXQA 1WZMA 1PMJX 1K6AA 3LEGA 3N13A 3CUGA 1EUTA 4V28A 4AC1X 4W84A 3H53A 3WMSA 1HXJA 4A3HA 3EDKA 3AMGA 4QDQA 1H0IA 1KBBA 1TZ7A 1L7QA 5DN2A 4JKLA 2CKRA 3VOCA 3MUIA 4PMQA 3VU2A 4ET7A 4PMYA 4UNIA 5CSYA 3CLWA 5CPSA 2BGOA 4W8AA 5IFTA 3EDEA 5KZ6A 1WAWA 1UD4A 5J1XA 3GXIA 3CUFA 4QDMA 3SKJE 4NRSA 1EXPA 2WHMA 3G6LA 3FAXA 3B9DA 4E2OA 4QDRA 1ZJBA 3ZIZA 1GQLA 5BROA 1UA3A 4RE3A 2C8NA 1CGVA 1UZ0A 3HZ3A 1R34A 2ORXA 5I0DA 2J7GA 4AZ7A 5HXMA 1JXKA 1E3ZA 3ACGA 1JF6A 2FE0A 3VNZA 2XWDA 3BCFA 2PBGA 3FXYA 2Y8KA 3IAQA 1LL4A 1HL8A 3OZPA 5ABEA 4BQ3A 3CZSA 3WQWA 2Y6GA 4AIUA 3SCVA 1EDQA 3WY1A 4BQ2A 1CNVA 3MI6A 4LPCA 2GK1B 3WL1A 5A6AA 4QX0A 4PYSA 2E32A 5FKYA 2Y64A 3B8SA 3H54A 4CVUA 4BF7A 3E1F1 1XSIA 1QHZA 1JYXA 1PMHX 2W5FA 4UFLA 1NX9A 5GNZA 4AZ5A 1RD6A 3AIWA 2J1TA 4TVUA 4NZFA 1QNQA 5A6JA 1TA3B 3FW6A 1DWGM 2YFUA 5B4NA 1K9EA 1UWRA 1TVGA 3PTKA 3W6LA 2QQOA 1OIFA 2W87A 3LPFA 4JFUA 4U2ZA 2BFGA 4ARYA 2UY2A 3WDHA 3WENA 5FCZA 2A3BA 4CN4A 1UOKA 4MJ2A 2EACA 4XUPA 5HNNA 1AMYA 3DC0A 2XVLA 2WCAA 1V0NA 1DEDA 2ZX7A 1QHPA 3OLEA 3VMNA 2NT1A 1GQIA 4U5IA 4BJ0A 2X2JA 3U5UA 3VMPA 3IJ8A 2FHBA 1V03A 2CNCA 2J7BA 5G05L 2ZWZA 4E8DA 1K42A 2EADA 1D3CA 1DWJM 1TFVA 1AQHA 1J0HA 3RM4A 3LXAA 2XFRA 2WBGA 1KCKA 3CZLA 2W47A 5EFFA 3ARSA 4JX0A 4A42A 2DSUA 3APGA 1J83A 1J0YA 3VD3A 1NUKA 3UERA 5AYIA 4P8WA 4QX3A 2J1AA 2FGZA 1EIBA 2J62A 2QPSA 1JFXA 5JR2A 2WQ8A 2BBAA 3A4AA 4H8HA 1CWYA 1OGGA 1BGAA 3MMWA 4QP0A 3PZTA 3WY2A 2DT3A 4HU0A 2EICA 4FNTA 4X0NA 4EK7A 3GTNA 1NAEA 4NXSA 3DX0A 1PZ3A 3KLKA 4H7VA 1R64A 2QPUA 3ALFA 2UWFA 2HISA 2QQJA 1CXLA 1XD1A 1L8NA 3TTQA 1FFRA 2J77A 4MNLA 2WHKA 3WF3A 1US2A 4OMCA 2XHYA 1VBUA 5D9NA 5GNXA 3ZSTA 2J78A 4D6JA 4HOZA 3AHYA 3ZJ8A 2WAOA 3VIFA 2Y8VA 5DPNA 4DEQA 2WKGA 2PI6A 1G94A 4U31A 2XGBA 5I3DA 4URIA 1SYTA 1Q6FA 3ALGA 1V3JA 3VGDA 3W6MA 5LA1A 2PWGA 2YOCA 4UZSA 4XB3A 4QB6A 1OT1A 1DWHM 3F5LA 1QNRA 1X6LA 2BY1A 1KR0A 1WDRA 4LQ1A 2E8ZA 1UY1A 4DWSB 1UZ4A 2D3LA 4WF7A 1E0VA 2X1IA 3QHMA 5M3WA 3VSVA 1W2VA 1ISWA 3ARZA 1KFWA 1V6VA 4FNSA 4L0PA 4PTXA 1SG3A 1XSKA 3WELA 3C7GA 3S5YA 1H11A 1R8LA 2FYVA 5BRQA 4UFIA 1OF3A 2XHNA 3MANA 1D2KA 1EO7A 5FL1A 4J3XA 2GDUA 1X1NA 1E3XA 4DUWA 1JNDA 3N15A 2X0HA 1E5JA 4KRTA 5CPQA 2GK1A 1M53A 4JFTA 1Q4NX 3WF1A 2RGMA 4J3TA 2PF0A 4OUEA 1ISZA 4KH2A 2BV9A 1PAMA 1H1NA 1UUQA 3BMWA 3N18A 4KRUA 2VI0A 5A95A 1WKYA 1W3LA 1GZJA 4CD6A 3AZSA 4DWSD 1WE5A 1SMAA 1GVIA 2E9MA 4ATDA 3VDCA 2YLLA 3W5MA 2OW7A 1GOGA 5HDRA 2VZOA 1W3KA 3SCTA 1TA3A 4PEEA 3PZGA 4WKFA 1OT5A 3WNMA 3ACHA 3OGSA 4W5ZA 4J27A 3ACIA 3EMZA 5CLWA 3FL7A 3I3EA 1UWQA 4W7VA 1J0KA 3VUPA 3ECQA 2ZUNA 3CZUA 3WF0A 2JE8A 5FUIA 4QX1A 4MGQA 3W24A 3WNOA 4WSKA 4B16A 1MW3A 1LF1A 4JFSA 3MUZ1 1OGSA 5E70A 1W1TA 1A3HA 4P7RA 4ZE5A 3WQ5A 3BUPA 1OCQA 1KR1A 2XSBA 3UEQA 1XCWA 1E4MM 1UWSA 3CO4A 4IISA 4HMDA 2Z4FA 3VIKA 4XZWA 3MMUA 3LQCA 2YL6A 3AC0A 3D51A 2DSVA 3EJSA 4N42A 2WMIB 3GNRA 3CQOA 1FHDA 4J7RA 2W91A 3EYPA 3W81A 4H8UA 4P02B 3U37A 1O7DC 3S5ZA 2HYXA 3P1IA 3QHOA 4BS0A 3CZJA 4JL2A 1I1WA 2WYSA 3GXMA 1E0XA 1XPWA 4JKMA 2ZIDA 5AY7A 1NOWA 1UR2A 1JL8A 3MU7A 5I6SA 1IV8A 1HWWA 1CGXA 1UQZA 2WMKA 4Z2IA 2RVAA 3HNBM 2BXZA 3D50A 1UD6A 3PZUA 3VILA 3AIEA 5TD4A 3M7SA 5BXTA 1CDGA 1O8SA 3EMCA 3KL3A 1KCLA 2G8ZA 4P7OA 1W9DM 1EGZA 1UD3A 5A1AA 4TTGA 3VGEA 4DXTA 1JHJA 3NSMA 1GCYA 1OF4A 4UCFA 1OBAA 2VX6A 2CHNA 2VCAA 2ESCA 3WDQA 6CGTA 4HZ6A 5CYYA 1HN1A 2W92A 5D8ZA 1EUUA 3WD2A 3LMYA 5ECUA 1Q6EA 2CITA 4DEVA 2YIHA 3AHXA 1JZ3A 3VKKA 2A3EA 4XUYA 4FLRA 3L4YA 4J28A 3CIVA 4PTWA 2W1QA 4DWSA 2J7FA 2D22A 2IGTA 3KZSA 2ZEYA 2EJ1A 1MFUA 2DIJA 4HG6B 6A3HA 2X2IA 3HEIA 3GBEA 3MMDA 3AICA 4DO5A 3MS8A 3AYRA 3BAWA 2WAAA 3BAIA 4JHZA 1XH2A 3ARRA 3WY4A 4JFWA 3IAPA 5E09A 5FL0A 1HKIA 1K9FA 4LXFA 2F2HA 2YDSA 4JHOA 3VSUA 1ODUA 5M17A 2VZSA 2VM9A 2VCBA 5D8WA 5IHSA 4H41A 5IJRA 4P7QA 2YL8A 4W7UA 5DF0A 1E43A 3DHPA 2ZE0A 2WZEA 4PTMA 2DT0A 3F5KA 3POCA 2QQNA 4CUBA 1QNSA 4HTYA 2WO1A 4MNKA 3K75B 3WL0A 1VENA 1C93A 2WDBA 4HZ7A 3HPNA 3CPUA 3VD4A 2DT1A 2VNCA 2YFOA 3L4TA 4QCFA 1UWUA 3SIMA 1P8JA 2JIWA 2WO3A 2E31A 3OZOA 1KTBA 3NJVA 2J8GA 3PZVA 1E70M 3GXPA 4E4PA 1SZNA 3RM9A 3O9NA 4IPNB 3GGLA 3A4WA 1RH9A 4LX4A 1GORA 1GOKA 3MUY1 5D9MA 3HOBA 4YN5A 3OA5A 3DYMA 4KMQA 1C92A 2XPKA 1M7XA 4W85A 3LRKA 2YC4A 4YHGA 2J1EA 3SCNA 1EDTA 1LWHA 2PBOA 1HX0A 2WSPA 4FNUA 1V08A 1RYYA 2VR5A 4QLKA 4UQAA 4R27A 1JZ7A 5I24A 4P00B 2ALWA 4D6GA 1J12A 1ODZA 3LXBA 1MXDA 2O9OA 3VGGA 4OMDA 2WMIA 7CGTA 5A8OA 5I78A 4HU8A 3S2CA 2OW6A 1GUVA 4F9JA 4CD5A 2OSWA 2QV4A 5EIYB 4DWSC 4CUAA 1CECA 2XTKA 1B2YA 2B9VA 1UWWA 5CPTA 2ZX5A 3VMOA 3C7EA 1QW9A 4CKQA 4PSRA 1NOFA 4Z2GA 1H49A 1BFNA 2J22A 1W9VA 2J25A 5KEZA 3NSNA 1R85A 4BK5A 2MANA 2YDQA 4AEFA 1JYVA 4CU8A 2FDMA 3WF4A 1WZLA 4M24A 2WHJA 4JCLA 4P7LA 3PZ9A 3VIMA 4QLJA 4HA1A 1BF2A 3K8KA 2FHFA 2VZ3A 4UQDA 3HG4A 4P7NA 2JF6A 4TOQA 4K68A 4LYPA 3PZIA 5ABGA 5A8NA 1H41A 3T2PA 1AVAA 2WABA 1E6NA 3WUGA 3GBDA 2UY3A 2BS9A 1R86A 1EH9A 4UR9A 2WKLA 1SR0A 1C8QA 5BYWA 1UMHA 1UY4A 3PTMA 1WDQA 4AMWA 4UAPA 3FHAA 3LRMA 4OGZA 1JZ5A 4UQBA 4ACZB 4NZJA 3IDAA 1QOXA 1ULPA 2Y6KA 2PWFA 2W61A 3L2LA 4Y7EA 4BK4A 5LA0A 1HJXA 2DH3A 3AQUA 1ZU8A 2A3AA 2DT2A 4QLLA 4CU6A 4IM4A 4A4AA 3HG3A 1UKQA 3RIKA 3VX0A 3MKKA 3UESA 4M1RA 1CXKA 1PZ2A 2BHZA 1UD2A 3TV8A 2YG0A 1J18A 3GNOA 4NXKA 3W25A 4E8CA 1J0JA 3L4UA 4X9YA 3BAKA 2F1AA 4GI8A 1VAHA 2XJ7A 1W1YA 2OLHA 4EAMA 2VJXA 1E4NA 1R7AA 1IZKA 2WAGA 4PCTA 3W82A 1ISVA 1XYZA 3CTTA 2X05A 4A6OA 4AWEA 2EAEA 1JZ6A 3VIJA 1HL9A 4P08A 1UXXX 5AC5A 1XD0A 4WIWA 4FNQA 4TTUA 3AS2A 3SCWA 4D0QA 1J01A 4D6EA 3EDJA 2VUYA 1GVYA 2W95A 2CPUA 2EIEA 2HLEA 3ZT7A 3GH5A 4CD8A 3EBVA 3VGHA 2G3MA 1OT2A 5DT5A 1QI3A 3W4RA 3G6MA 1CGWA 1E6ZA 3AZRA 3SUWA 3OLGA 8CGTA 3RILA 3L4VA 2YBUA 3W53A 2NSXA 3W0KA 3VM7A 4UFMA 2YJQA 4W8LA 4OKDA 2VX4A 3WQ6A 5M5DA 1MVYA 3VSTA 3RJXA 4V2XA 3FN9A 3ZR5A 3CDZB 2BVYA 1JDDA 3WUBA 3U7BA 2ZXDA 3ARQA 4XURA 4PUDA 4OBRA 2J7HA 5E9AA 2WCGA 1IQDC 1EHNA 4M81A 1UXZA 2VMCA 4MGSA 1JIBA 5E0CA 3I2HA 3UETA 1SMDA 2ZX6A 3CZNA 3DX4A 4CVWA 5HOSA 2D20A 2XN0A 3GH7A 4MO3M 3OBAA 3AMLA 4Z2LA 1IZJA 1CZSA 3D52A 1UR0A 1EHAA 2X2HA 3D4YA 2VCCA 2OWWA 1GMMA 5CJ5A 1VFMA 1HNYA 1UKSA 2J8FA 4CCCA 3TP4A 1D7FA 4BXSV 2VX5A 2XVKA 2ZUWA 3ZM8A 2Y4SA 1JXJA 4DO6A 3KL5A 1VEOA 1OH4A 3O6AA 2J74A 3SCUA 2XYLA 4BCEA 2ZICA 3AIVA 4XUOA 3IGUA 1HKJA 4B3LA 4LQRA 1UH2A 4EE9A 1O7AA 1V3IA 4IPLA 4MJ4A 5A6KA 3L4ZA 2TAAA 2BHYA 2YFNA 1BYBA 1E73M 2QLYA 1MYRA 4ACZA 4ZEPA 5A3HA 2EABA 2BZDA 1JU3A 2W1UA 1JI1A 1XV8A 1ZL1A 1Q6GA 4ML4A 3BUIA 4MTVA 5HPOA 2QMJA 1LG1A 4HP5A 2XGIA 3UNPA 3UR7A 2X09A 4U33A 2OKXA 1JAEA 5DEZA 3LX9A 1UR4A 3GXDA 3WEMA 3JUGA 1PBGA 3N1AA 3CC1A 1UR1A 3KL0A 2WLYA 1UKOA 2WSKA 3GH4A 3PZQA 1E15A 1TQTA 2AAAA 1UY0A 3DYPA 2UY4A 3EJRA 3ZQ9A 4M4PA 5A8QA 4MB5A 2GJPA 1TUXA 4D1JA 1B90A 1BG9A 3BN6A 1E4LA 3AXXA 1HKKA 1D7PM 3ACFA 3FAWA 1WDPA 1JGIA 4B15A 3AHZA 4UI9L 1V3KA 3W5NA 3CH9A 5D4YA 1KWGA 4QX2A 2V5DA 2CBIA 4PMXA 3EMQA 3OIHA 2HVMA 2BY2A 1MW0A 1HTYA 3DX3A 5FIPA 4B3KA 5LA2A 5I5RA 1EQCA 2V5CA 1WCGA 4MB3A 2J1RA 3GNPA 2EQDA 4MAZA 3II1A 1XC6A 2J1UA 4P8VA 1PEZA 3CZKA 1HKMA 2WMHA 1GOOA 2CIPA 1M01A 5HPCA 3W38A 2F7OA 1UASA 1JYNA 3ZO9A 2W46A 2CXGA 3AFBA 4GZ9A 1B3WA 5JBEA 3BUDA 1G01A 1W9WA 1UQYA 3AJ7A 3BLKA 3ZJ7A 2EPMX 1BVNP 2W67A 1DLCA 2WM0A 5EBAA 3GXFA 3OLDA 4JCMA 4PSPA 2E3ZA 4MADA 2AMGA 4OJYA 3BVTA 1H5VA 1VEMA 3CUIA 4NF7A 1NWTA 5JXHA 3N12A 1JG9A 3N9KA 2LW8A 3AS3A 2XIIA 2Y2WA 2QQMA 1KXVA 1QW8A 2JF7A 1TVNA 2XIBA 4AXNA 3BSHA 3OGRA 1H0GA 3O2LA 2DSWA 1MWOA 3IB3A 3NSXA 3ZT6A 3WSOA 1J10A 1V3MA 3SUUA 5IXEA 2OYKA 1ESWA 1EDGA 2BHUA 2FH6A 3IIIA 2E26A 1QBBA 2EBNA 2G3JA 2VZUA 2XN1A 1PJ9A 4PMOA 2YLAA 4DUVA 2E9LA 4ATWA 1H09A 1UR8A 4AMXA 1GU3A 1JD9A 2DEPA 3CV5A 1FP9A 5A69A 1GOWA 5CGMA 1BVZA 3KEHA 1J9YA 1OWQA 2Y6JA 1VIWA 2JALA 2WB5A 4FLQA 3LEIA 5EFDA 1QNOA 1ZBWA 1UYZA 1I5PA 3T0DA 1BLIA 4JIEA 2NT0A 4MAVA 4GZJA 2J1SA 2YDRA 3U5YA 2E8YA 5I2UA 4M80A 5CXPA 1J11A 3LPPA 4CCEA 4PMRA 4M4RA 3MBWA 2PB1A 4FNPA 1B31A 4HOXA 2QHAA 4PRWA 5AC4A 2C0HA 2VQUA 3VO0A 2VRJA 4W88A 1MFVA 1GNXA 1TMQA 4WLCA 1XH1A 4W93A 1U30A 4HPHA 1CX1A 3I2IA 2V38A 3OGVA 4J3UA 4M8UA 3J7HA 2F8QA 3F4VA 1K12A 1E1FA 4YHEA 2WMFA 3I2FA 1O6IA 1CGUA 1H6YA 3MSDA 4XUTA 4CCDA 4WKAA 2ZX9A 3SUVA 2VMEA 1RP9A 3N11A 2JEQA 3OG2A 2BERA 3PBGA 3C7HA 2VR4A 3AS0A 4MNJA 1JZ8A 2W62A 4GZIA 2NW0A 1EOKA 1SDDB 4DM1A 4D6HA 5E6YA 2JFEX 1CXHA 3HN3A 1S46A 1NM9A 1E56A 3BAJA 4AZIA 3EJPA 4ZE4A 5A8MA 1CGYA 3OLIA 4QCEA 2BVDA 3WD1A 4LYQA 2WPGA 2GVYA 4H2CA 3QR3A 3PZMA 4PMDA 1TR1A 2FHCA 1CGTA 9CGTA 2DDXA 3CHDA 2D73A 2WHLA 2EPKX 4XZBA 3AISA 7TAAA 1C7TA 2EIBA 4HMCA 1KXHA 2F7QA 1H6XA 2VMFA 4PBGA 3WEZA 5C71A 4P5YA 4XVHA 1FP8A 4D6IA 4JZ5A 4CU9A 3TTYA 1QX1A 4AIOA 1NQ6A 4RL3A 4OOZA 4U3AA 1LL7A 1WCQA 2W66A 2WMJA 2WVTA 2QBXA 4PMNA 1US3A 4GI6A 5A8PA 1O8PA 3MUAA 4X0VA 3THDA 1GQJA 3I97A 4BA0A 2J7EA 5CSUA 3QGVA 2X10A 4U3CA 3GDBA 4F66A 1C91A 3DDFA 3BCDA 1TQSA 2DDUA 4DO4A 2GUYA 4PQQA 2ID4A 3WEOA 3WH6A 3K1DA 5DFAA 1UY2A 3HJRA 1QI0A 2WZHA 4GI9A 2ZEXA 3WBAA 4Z2JA 4W7WA 4N0RA 1XSJA 3T0BA 2CBUA 3WH8A 3AOFA 4F8XA 1UYYA 3I2GA 2WVUA 1UD8A 4ZXLA 4A44A 2VZRA 1BSIA 5IDIA 3S6TA 1XNTA 1YHTA 3WQBA 4UFHA 2WZ8A 4QDSA 2V4VA 3IANA 1DWAM 1EOMA 4ZZ5A 2PC8A 1JZ4A 2ZXQA 3TTSA 1UYXA 1E5NA 3I2JA 3ARWA 5JUVA 2D1ZA 2PWDA 3WFZA 2JDAA 3WQ4A 1GOIA 1N82A 1UG6A 1TG7A 2YB7A 3ARYA 1PS3A 1IT0A 3I3DA 1VF8A 1UHVA 1KGUA 4Z2AA 4NRRA 4XUQA 1HT6A 1MQRA 1X6NA 2O9TA 3N17A 5GQBA 4F79A 4A45A 5CGTA 2EIDA 3WSUA 3LPOA 3IK2A 2V3FA 3FY1A 1Z32X 3M6DA 3T2QA 4CN6A 1VJSA 1ITXA 3AI0A 5FD0A 2DIEA 3W27A 4QPWA 1VRXA 2CHOA 2XSAA 3AS1A 5EJ1B 5C70A 1DHKA 1W3HA 3CZ8A 3U57A 1QVBA 2VX7A 5CQ1A 1UKTA 4GQQA 4TUFA 1QBAA 3DDGA 3AHVA 3BXWA 1PX8A 3VDHA 1K9DA 3BUBA 4D6FA 3WFLA 1LWJA 1VBRA 1JDAA 4EKJA 4IUGA 2V3DA 3NJ3A 1E55A 4CU7A 3NUKA 3RMEA 1WP6A 4PN2A 5CZKA 2ZOXA 2WWDA 1JNEA 1PPIA 3T2OA 2XG9A 4J3VA 2ZEWA 3WDPP 2CBVA 4D71A 4PCSA 2VL4A 1GHRA 1NARA 1ISXA 3WDJA 3K46A 4M29A 2BY0A 3MO4A 4LPLA 1QI5A 3PN8A 3RCNA 1R87A 3VDAA 1BQCA 1BG4A 2JKXA 4RN5A 2DCKA 4RYDA 4ZXEA 4XUNA 1G0CA 3GXNA 1E72M 3AMDA 1B3ZA 2W63A 4AD1A 4AZ6A 1U2YA 3K4ZA 3NRUA 4BDVB 3TONA 1XH0A 3BMVA 4P8UA 4GIAA 2VVSA 1LJYA 1RPKA 4W86A 1DWFM 3NNGA 2C7FA 3VD9A 1HVXA 4NX0A 3AHTA 1EO5A 2VZ1A 1TCMA 3C7FA 3DECA 1R46A 1ZBKA 4PMVA 4BQ4A 2KD7A 4LHSA 3WNNA 1GOFA 5B4XA 5JBFA 3AIBA 3N04A 5A2BA 4PTVA 4GQRA 1PX4A 5AYBA 2XWEA 3K77A 4M82A 3L4WA 3F2ZA 1LQ0A 2X2YA 3BUQA 5EB8A 4UTFA 2Y6LA 3ARTA 1NWRA 1JI2A 1RP8A 1E6SM 4S3KA 3PUIA 1V6YA 3BLPX 1W8NA 3HG5A 4KI5M 1M04A 2J79A 3CHCA 2F18A 1NOUA 2OWCA 3SUTA 3WUFA 3FHQA 2DH2A 3LPGA 5A6BD 2BGPA 4MB4A 5A2CA 1GQKA 3LRLA 4YPJA 3UCQA 2W1SA 3D4ZA 2D0GA 3ZOAA 4AY1A 1GNYA 3KE0A 1HXKA 1VJZA 6TAAA 4Q22A 5IFPA 2XM1A 2WUHA 2ORZA 1LLOA 5BRPA 4GPNA 3VVGA 1OD8A 3BAXA 4ACYA 2Z1KA 1W1PA 1PX3A 2RGLA 2VURA 2UY5A 3K8MA 4W87A 4V27A 4MB1A 4KGJA 3VGFA 1C8YA 2QF8A 5JXGA 3AZTA 4GXPA 1QI2A 1NWSA 5JMOA 1WZAA 4FI9A 1XCXA 3M07A 3ZSSA 3AIUA 2D24A 3DX1A 1VFUA 2ZUTA 1HJUA 4JL1A 1V6XA 2A3HA 3PUHA 1MQPA 1BAGA 3WQVA 4RE2A 1K45A 5JXIA 4GWIA 4W8JA 1KQZA 2GJXB 2J7CA 2O92A 3TA9A 3H55A 3OEAA 3IJ9A 1GW1A 2G4FA 1V0MA 2WW5A 1NH6A 3SKVA 3VIIA 1CLVA 1QHOA 3RJYA 3WMBA 3T08A 4OOUA 5IHRA 4TX8A 4CD7A 1ITCA 1XNAA 3QHNA 1NKGA 1UWIA 1V02A 2FGLA 1YQ2A 1KXTA 2XN2A 3C8XA 2ZWYA 2PWEA 2WO2A 2WCSA 5C7GA 2A3CA 1KTCA 4WKHA 2JIEA 4U2YA 4TVDA 3LXCA 5DMYA 2V3GA 2ZUMA 1DWIM 2RJ2A 1C90A 5BWFA 1GONA 1K9TA 1W9PA 5D9OA 5I79A 1LG2A 4BZYA 1ISYA 5G04L 4OBSA 2Z1SA 2Q8XA 2CERA 1R47A 1JZ2A 1UYQA 1UZ1A 2ZUUA 2EEXA 4S3JA 1DTUA 3W29A 3WDRA 3WH5A 2XOMA 2YFZA 1DYOA 1M03A 2J1VA 1OD0A 3LE0A 4C7DA 1J84A 5A2AA 3ABZA 1OM0A 2VOTA 1WPCA 4Q7NA 4TX6A 4WK9A 3IJ7A 2PQSA 3SEEA 1E6RA 5BCAA 1E6QM 5JIPA 2VRQA 4GO9A 2BNJA 3K4DA 4L4PA 1UD5A 4H8VA 3VIPA 1UKPA 1B9ZA 4FNRA 4XZUG 3NDZA 3A5VA 5A6BA 4AISA 3AMCA 4HA4A 3WH7A 3ARXA 4UOQA 4R5EA 1UMIA 2X0YA 1B3YA 1CZVA 2VC9A 3PTQA 3EDFA 2B31A 3L2MA 3A3HA 2G3IA 2W3JA 2CKSA 1NP0A 2B4KA 2CYGA 2C9KA 3NYDA 1B3XA 1W1VA 3VGBA 3WIJA 5LYRA 2YA0A 4JFVA 1H2JA 4CN1A 3UR8A 3A23A 2G3NA 1V0KA 5A6MA 3NDYA 5FOOA 1OD3A 2J47A 3F5JA 3AXIA 4MNMA 5EJZB 5E6ZA 3OEBA 4AG4A 2VTFA 3AXHA 2VRKA 3RDKA 1Q6DA 3VIGA 3ARPA 1EA9C 1JD7A 4Z2HA 2CDOA 2XFFA 1LNSA 3WUEA 3MSGA 4AYSA 1CLXA 4WJXA 1HJSA 3W37A 4PMUA 2WN3A 3UG3A 3T0AA 1JAKA 2PWHA 4UQCA 1ZBCA 1HP4A 1GJWA 1NP2A 3WNPA 1ZJAA 1HP5A 3A7QA 4FK9A 3ZJKA 1FA2A 3CHEA 2W1WA 3EJTA 2WN2A 4MPKA 1B30A 4GINA 4DXSA 1FH8A 1JU4A 2W94A 3PHAA 1PIFA 5E1QA 1SHWB 2RV9A 4AIEA 4ZXOA 3CIHA 1KQYA 1W9TA 4W5UA 4TXEA 4DUXA 2VO5A 4C7FA 2OYMA 1HF6A 2IXVA 1ZBVA 4OZOA 3KLLA 3VPLA 1CXIA 1KEXA 5C8BB 3VD7A 8A3HA 4OIFA 2O9PA 3VD5A 7A3HA 4LGXA 1ZB5A 2J7MA 1I1XA 3UG4A 3BH4A 4JKKA 1MPXA 3CZEA 1B0IA 2V72A 3WNLA 1GOQA 3C7OA 1C3FA 5EMYA 3KWXA 4A41A 2EPNA 2WVVB 2GJXA 3MV11 4HA3A 2IXUA 3ZT5A 1VEPA 4AMCA 4LKSA 2ZUVA 3W28A 1ZS2A 1QWNA 1MXGA 1I75A 1G9HA 3AROA 1JI6A 3DYOA 1EQPA 1AQ0A 1Y7VA 3DX2A 3WBEA 3GXUA 4MDOA 1G5AA 2CBJA 4UFJA 3ETPA 2YC2A 1HIZA 1R33A 4UZUA 5DQ0A 2WMGA 3A6OA 4NI3A 3AYSA 4D72A 3TTOA 1MW2A 3RM8A 4HMEA 2VZTA 3A47A 2QMKA 4AZGA 2DGAA 3SEPA 4OYUA 1W2PA 1OGBA 1FOBA 3CMJA 3MV01 3BAYA 3EDDA 1W9BM 5A6SA 4D6DA 2F61A 4FMVA 1WO2A 1KB3A 2IUZA 2E0PA 4KGLA 1TVPA 2F1BA 1W91A 4ZENA 4CGTA 1P6WA 4GZEA 3VIOA 2E9BA 3A4XA 3WF2A 4PF1A 2OSXA 3VDBA 1TE1A 1GOMA 2YBTA 1C7SA 2EXOA 3M46A 2J7DA 3POHA 4QB2A 5M03A 1E71M 2EPOA 2WANA 1Q6CA 5LCWL 1BTCA 4AW7A 3VTRA 5A6LA 1XGZA 1T2XA 1SFSA 2DPEA 2C26A 2LS6A 1HJWA 5ABFB 1OB0A 1ECEA 2QQKA 2V3EA 4AD3A 1KBKA 2XVGA 1QWUA 2CDPA 4AD2A 2E40A 2WBKA 4UFKA 4U5KA 4D6CA 4AZCB 2OWXA 1E40A 1GPFA 2GJRA 3TOPA 2DQXA 1BGGA 4LYRA 1E1EA 1FH9A 3U7VA 4AAXA 5DO8A 1E4IA 1VB9A 4CD4A 5A94A 2ZXAA 3WD0A 5D9PA 1J0ZA 2XFYA 1V0LA 1UWTA 2WNWA 1W9XA 3HU7A 2JEPA 2C4XA 4FLOA 4AZHA 2F7PA 1UH4A 3AIQA 1KWKA 3RPMA 1C8XA 2XUCA 4FF5A 3CMGA 5GPRA 3OB8A 3CBWA 3DHUA 3HMCA 1L0PA 1VFFA 4B9ZA 4BQ5A 2ZXBA 3CUJA 4DXRA 1G1YA 2ZEZA 4ZFMA 3SCOA 1ULOA 1OSEA 4GKLA 2WC3A 1WB0A 1T0OA 1K3IA 1W9SA 2GDVA 1PIGA 4ARXA 3QOKA 3VIHA 3ZJ6A 4UOJA 1AQMA 4GWJA 1CIYA 3GYCA 3QOMA 3SCSA 3GM8A 1CYGA 2QQIA 2GSJA 3GZAA 2WLZA 5JIWA 2WK2A 3SCPA 4ATLA 2VZPA 2YA1A 1V3LA 1FHLA 1JDCA 4KWUA 1H4PA 2Y5EA 2F7RA 1HJVA 4WSJA 1CEOA 1F4AA 2D23A 1UA7A 2ZX8A 1JFHA 3SURA 3LEKA 4UQEA 3WH9A 2Y6HA 5E0FA 4J3SA 4UQ9A 2JD9A 3RO8A 2BVTA 3K8LA 1CENA 3BGAA 1UH3A 1CZ1A 3BVWA 3CGTA 2D3NA 4HZ8A 4D8MA 2CETA 3D3AA 4RE4A 3BLBA 1UX7A 2L9LA 4JAWA 2CCRA 1VFOA 3WD4A 3HJEA 1GQPA 4XV0A 2VMDA 2WXDM 2BXYA 4C7GA 2WVVA 1FH7A 3WMCA 2YL5A 3EJUA 4AD5A 2YKKA 3B9AA 1TQVA 4F9DA 3NIYA 3A22A 2Y24A 2O9RA 4AD4A 1KGXA 2XVPA 2QQLA 3HNMA 2VT0A 3WQ8A 2W9XA 3AMKA 3A24A 2EO7A 3NJXA 4P8XA 3GXTA 5IYYA 4MDPA 1U33A 2WZIA 1QPKA 4D1IA 1J0IA 2DCJA 1GUIA 3D5HA 4W8BA 2X8RA 3T09A 3PZOA 2CEQA 2D0FA 2EPLX 1UR9A 4AD0A 3WD3A 1B1YA 5CG0A 5I23A 1NWUA 3BSGA 2E33A 1XYFA 4HPGA 1W99A 2WVSA 1QNPA 1BYDA 1W9UA 1B3VA 1O59A 1BPLB 4XX6A 1E6XM 5DT7A 3EB7A 1V02E 2XM2A 2FH8A 1BYCA 1WNOA 1WDSA 4NZCA 3VM5A 1DP0A 3ZR6A 3WDIA 2W4XA 2VZVA 1MQQA 2DSKA 4PUEA 4GO8A 1GJUA 4L4OA 3SUSA 2OYLA 1E0WA 3CUHA 3BVUA 3K4AA 2ZUSA 4B9YA 3WKZA 5ABHA 3WY3A 5BXPA 1W3JA 3JXSA 3I3BA 5ABFA 3VNYA 5JXJA 1JF5A 2CESA 2J4GA 2OSYA 4UOZA 5JBDA 4TXWA 3PZNA 3EJQA 4AYGA 4PMZA 1BHGA 1A47A 3CKHA 4AZCA 5CLTA 1LL6A 3A21A 2VQTA 1OINA 1XHGA 3CHFA 1V3HA 1KGWA 1F4HA 2WC7A 2VZQA 2BY3A 2YA2A 2R7EB 3FNDA 1CXEA 4A3ZA 4QAWA 2GFTA 3AIRA 4W89A 3VINA 3W26A 4QFUA 1OIMA 4EANA 3BVXA 4FLSA 1TQUA 2XQXA 1CTNA 2XVNA 1TQWA 4ZZ8A 3THCA 4PT6A
chains in the Genus database with same CATH superfamily
2MHAA 3L5WA 4O9GA 1PGW1 3LK6A 2J75A 3W9ZA 1PD0A 2E4TA 4UTJA 1LQAA 3OBKA 3UAFA 1KDKA 3OYWB 4NN7B 3WN6A 2RALA 4FG6D 4POZD 5TQ2H 1WWCA 2XONA 1FFQA 2AOSA 4DYKA 3USSA 4KHTL 5FY9A 4ZW7A 2G41A 2Y06H 2LUWA 4MNQD 1JRHH 1CXFA 1IGMH 1WBZA 5E00B 5HK4A 2OZ4L 4JOMA 5FAGA 1I7ZB 2IWFA 2B7YA 3JWDL 3K6SB 1BA9A 4C0HA 5B22A 5IB4A 3VXRA 3C5ZB 1TTBA 3WIAA 2J1WA 1G1OA 3UG5A 4ZPTA 1VBA2 2PPAA 3LEGA 3WFEL 4RAUB 4NSKA 3U1QA 3CQ0A 4W84A 2Q9OA 4V2CB 5KTEH 3AO0A 1BLNA 5DY3A 1IBDA 3N3TA 3DUIA 3RDTB 1OCWL 1QKZL 5FDWB 4K7VA 3C6EA 2YGPA 3CUFA 1J2WA 5K9CA 4HN8A 4HC1L 1VBJA 1PVC1 3VZLA 2TRYA 3HF3A 2R23A 3WU1A 2D69A 2YPKA 2FD6L 2ORXA 4Y9AA 3LEYL 3C5ZD 1JF6A 2FE0A 2XWDA 1KXGA 4OSUL 4XBLA 4EVZA 1OOPA 2Z1BA 4W9CC 4IS6B 1UWEL 1UQSA 4EWEA 3VZOA 4HWNA 3RDTD 3W59A 2HFEA 2FEEL 2OXGB 5CCGE 2WINB 3KMDA 4WFHD 3KWWB 4ADIA 4AWJC 4UFLA 5ENLA 4FPFA 4D0BB 1RD6A 3WLJA 1W8HA 5GKAC 5B4NA 4MLRA 4IL0A 1VAKA 1G6RB 1A65A 1D2OA 3LVTA 5FYKU 5JDSA 4O1AA 2Q76B 3WENA 1RU9L 5TDNA 1ZPUA 4ABQA 5EU9A 4IHOB 1NCUA 5F0LB 2YAEA 3FQWB 2D98A 4X5XA 3I6KB 3SE3A 4XVJH 1GNZA 3NQ6A 3I54A 4BZ1L 4X8GA 1UMYA 2YPVH 1LQSR 4R4BB 1DWJM 4YARA 4FSJA 2QGBA 5JOFB 4EACA 4P5MA 2XRAH 1Z42A 3GY1A 3QAQA 4HVXA 2OZ3A 3ARSA 1J0YA 4LBUA 2AS5M 4NIKB 3OYZA 4KWLA 4Y9PA 4XWGL 2VERA 4MMWA 4RETB 2CGOA 3HR5A 3CLEH 4V1PA 4OCRL 1CWYA 3POEA 4LESA 5C8JA 2HFGH 3FB6A 2YRBA 1VBE3 4Z1CA 3APFA 1E4XI 2BMKB 3IDGA 1E6OL 1OAYL 2WXMA 4MNLA 1F07A 3AM2A 5GNXA 4DZ5A 4FPKA 1R3JB 2APFA 4MHRA 4PRHB 1XDTT 2BOGX 3N25A 5DPNA 5A32A 4PU2A 1V27A 1DCEA 1C28A 2E6JA 3INUL 2WXFA 4X99B 1LGCA 1R0AL 5DMKB 2QYGA 5MEOB 4AC4A 2OMWA 3QHMA 3AFGA 5ISZA 1JPFA 3VSVA 3RY6C 1ISWA 2OI9C 1S7UA 5J7CC 3D2UD 2GJ6E 4L0PA 2QQQA 5D2VA 1XSKA 4X9GA 4UFIA 3ZHFA 3NH7H 2OIIA 4RHV1 4J3XA 4PRHD 1OYAA 2QDHA 2G1MA 5CUSH 3P30L 3HQRA 3DMMB 2FYMA 3G5ZB 4OUEA 4IMGA 1RJZB 2FWOB 4Y26A 4KRUA 5KVGL 3DFHA 5A95A 3FO0H 3L5XH 1W3LA 3BH8A 4WVMB 4HBCL 4GW4B 3W5MA 4YL2A 2VZOA 3GYDA 3SDDB 3QO0B 4HXAL 4O12A 3MUXA 3N40P 1VZGA 4KHXL 2R0LL 4JHUA 4I5RA 3ECQA 1ZANH 3DMMD 5GSRA 3CZUA 1U95B 4IMEA 2NY2B 1HXMA 4NWWA 1UUSA 4B16A 3EXJA 4JMXA 4C47A 1TO5A 3WQ5A 4B53A 5B3JE 3LIZH 3O2WL 2Z4FA 4Y2DC 2IPKA 2DVFA 2BNMA 1J1PH 1WAPA 4JDTL 5TTRA 3SDDD 3TAKA 5AZEH 1RLWA 2WMIB 1MDTA 3ASIA 4P5TB 3IFOB 3BZEB 4LMQE 1ME7A 4NJAL 1ZZBA 4BS0A 4Z7NF 2RE9A 3I4IA 3FB8A 4JL2A 2NY2D 5D05A 1QT1A 1HWWA 1SFPA 4EVNA 4GS7C 3LZPA 5CFDB 5BVJB 4LNRA 5A1AA 3KLHD 4DXTA 1YNPA 2ZA9A 3QWOA 5GRJH 5CEXA 3PU3A 4P5TD 1THCA 3TOJA 3I6LD 3BP5B 2Y7GA 2B8MA 3H4XA 5F7LB 1EUUA 4YW1A 3Q5OA 5IV2B 3T6XA 2D6NA 4HUWB 4JK0D 5KS9F 1U8IA 5LHEA 2ZCZA 3G7TA 4G7RB 1HTIA 1NG0A 2ZKWA 4NVTA 2XJKA 2W60A 4R7NB 3L8QA 5DG2A 4MS6A 4NAJA 5I0ZA 1OWWA 4OBTA 3T4VA 2Q6WA 4CQCA 1H2MA 4GRLB 4C8XA 3NZ8A 3GNML 1U1HA 1I1YB 1BVLB 1LO4L 2WZEA 3LV6A 3EFFB 1D4M1 4K8RL 5SWZB 1LEDA 2QQNA 1HYRC 4JCKA 3R05A 2VLRE 1FWHC 2WNNA 3ESPA 1KFGA 2YFOA 1QSFE 1IE5A 1WBYB 1KJMA 3FU7B 4A8RA 1A8MA 1FIGH 3ALXA 1I6XA 4MJJA 1QJX1 5IEKA 4ZFGH 2A6IB 2A6YA 2Z2BA 3MUY1 4GRLD 4R7LA 2IH3A 4XMKL 1MFBL 1MFMA 2XPKA 3D25B 2C71A 4E8GA 4YFLF 5SWZD 3K3NA 2ATAA 5KOMC 4QHOA 1N1VA 4IE4A 1PDKA 3GPSA 3LBCA 3QH3B 5HUPA 1O6VA 5I78A 2PHUA 4K1GA 2ZA3A 2AEZA 3LN5A 3I7RA 2Q7NA 4XN1A 4F1ZA 3VMOA 3C7EA 4OV9A 5MHSE 2OCJA 1HOEA 3SDXB 2WZR2 3NSNA 2MANA 5EYXA 1NSNH 2X4UA 4HPXA 2ICWA 4KV5E 1MLCB 4JO5A 1OI6A 1AZUA 2K4AA 1MCKA 1YTKA 4HKPA 1M05A 5L9VA 5J12C 4F9PA 5E4IA 4EI5C 3MHUA 2AZ5A 2G2PA 3QDMA 4Q14A 4ODBD 3TN0C 1SR0A 3URAA 1QBML 5FK8A 3FHAA 3G2GA 3CF6E 4MX7B 4Q3MA 4JE0A 3EXSA 1RCXB 5LEKA 5INCB 5GJTL 3TBTA 2EDNA 3DF0A 1O3SA 4R8WH 3AXLA 3HG3A 3E0VA 1PZ2A 2K6ZA 3VKDA 1J18A 4WOQA 3T3PE 4DVRL 3U2IA 3BZDA 3GLAA 1WAEA 2ZX1A 4PRAB 5E2TH 3GMNA 4PCTA 3CDGB 4IE0A 3HMJG 1S3KH 3A0OA 4P46B 4XP6L 4F7MB 5C2BL 4KETA 4TTUA 4NQXA 2VYOA 1H8TB 3SCWA 1AFSA 1IEBB 1KPRA 2VUYA 1FAIL 3EDJA 4GE8A 3W9AA 4X0KB 3DN7A 1GZ1A 1U5JA 3T55A 3E2QA 2NV2A 3CVHH 2QXWA 4U3XA 1LROA 4DVBB 5EORH 5FYJD 2PTTA 4PJFA 3FGCA 5DY2A 1FWGC 1PG7W 4PJXA 3U0TA 4UTTC 2NUXA 4P46D 2RA1A 4ICXA 5ICZA 4F2FA 3OCPA 1QDOA 1LO5B 5AOKA 2A21A 3WLRA 3FN9A 3ZR5A 1WX0A 1Q7QA 3AT8A 3W88A 3DV6B 3SJNA 2ZWSA 4FXLA 4RFT0 3Q94A 3SOTA 3W7RA 3VE9A 1O75A 1JIBA 2WYFA 4DN3H 5I1KH 1R2SA 3OBAA 1CZSA 1HSAA 3FJTA 4RSUA 2X2HA 3GSUB 2R2CA 1VFMA 4AUJA 4UQIM 3IPWA 3TN91 1JRHL 2PPFA 2Q09A 1M9SA 3JVFC 3LEMA 1DQTA 3CSBA 4LKEA 1BZDA 2XHKA 5D2LA 4LAUA 5H37H 4IYKA 4AGOA 4ZEPA 3V7AE 3JWNE 4N25A 1JPMA 2L7JA 4YPGB 3VBSB 3BUIA 4MZ8A 4Q4X3 3C8NA 6PAZA 3QIBA 3O4LA 1RJ7A 5MENE 4NOFA 3QORA 3FIGA 4Y1YA 1JQVA 3TQKA 3WHTA 3M0VA 3WOGA 3CC1A 4QWNA 3UGXA 4KY2A 1T89C 5AD0A 5DD6B 1PZ1A 3DYPA 5IKCB 2FLRT 5A8QA 4HJJH 1KYAA 2GNTA 2H5UA 1Q6OA 3PCYA 3O6FC 1ES0A 3QMRA 4NNYB 5IQLA 3DTXA 4JQ3A 3IJEB 1YEKH 3VG9C 3EMQA 1ZHKA 1QTYT 4ORMA 4B27A 3L3IB 1PEZA 1HKMA 3VXSB 1XEDA 4O2CA 4XNQA 2GEQA 4QRPB 4YIQB 3FU0A 3C8KB 3ZJ7A 3QW4B 3EFDH 4YZ1A 4Y19A 3DFYA 3HAGA 4JCMA 4AUYA 1ASJ1 2GNDA 5AAMA 2CL2A 4E3TA 1LOAA 2VECA 5F9OH 4NF7A 3N12A 4RA0C 1QW8A 1CC3A 5DJ2B 2OS7A 5GIRA 3PYCA 3VXSD 3IB3A 4PREA 1QJU3 3AQYA 4IEFB 4QRPD 1AODA 1NEPA 4XVJL 5ESVB 4YVWB 1GVOA 5D4QA 2VZUA 3SPHA 2YPVL 4KKAC 2VAJA 5TH2A 1DVJA 3MREA 2JWYA 4WI4A 1JVOA 5E8EA 4Y4RA 1VIWA 4H40A 5C3IA 1QNOA 2GJNA 5K9OB 2OTUB 3S4SA 4JIEA 1I9RH 3QI9C 2E8YA 1J11A 2EGZA 3KHCA 2K78A 3CLEL 2IIJA 4LKCB 1YMHA 2E74C 2EDOA 4PRWA 3H9HB 4X5PA 2LALA 2HFGL 4P9JA 3OD0A 3VO0A 1UNBA 4MXQD 4LBAA 4JTSA 4IV1A 4Z7UA 5L2JA 4DGIH 4IGOA 3BPLC 4HPHA 5D9SA 1IKOP 4CC0A 4O5LL 1AR81 3QDME 1NELA 3MIEA 4KWWA 2ZAAA 1XH3A 1X33A 5L8KB 1M1BA 1XWYA 2VMEA 1V5JA 1S5IH 1BZ8A 3OM3B 2BERA 3V75A 3ATAA 4YOKA 2VOKA 1IG0A 4BQWA 4JFQB 2ZPXA 4PYGA 5CSZA 1MDLA 2R072 4X9IA 1XQNA 5IHHA 3GUWA 2BVDA 3NH7L 4H2CA 2DLHA 5CUSL 4GLRI 3AISA 1OLZA 3IGAA 4LHJB 3EEZA 4P23B 1FVEB 2QFPA 1U8LA 2Y70A 4ANKA 1RUAH 2UXVA 4ODWB 3M0KA 4CGUB 5I09A 4KJPC 2B15A 4FI4A 1FNYA 5M1TA 1XQ4A 3QGVA 2X10A 3TVMB 1Q9KA 2ACRA 5IQ9B 3JBG2 1AOZA 3APBA 4H14A 1HXYB 1ZANL 3ML8A 4GB32 4JQAA 1QRND 4P23D 5GGRY 4W7WA 5HYQA 4G42B 1PHWA 4HAKA 4PJFE 2J7LA 2OVLA 3H23A 3RR1A 5AAWA 2QR0A 1ULCA 5I1CH 4BV1A 3OPZH 1EOMA 3LIZL 1J1PL 4A7GA 4B95C 4AX7A 5AZEL 2HRWA 5L7XH 2D1ZA 4QCIB 2PWDA 4N2KA 4R34A 1U8PA 4EIBA 4HUXA 1UHVA 5T1KB 3GHMA 5GQBA 4JEJA 1YWKA 1UT9A 5EO1B 2HLFD 3WZ0E 2F54B 5IK7A 5G1MA 3QG6A 4OIAA 2HWC3 3NCMA 4XT1C 1UPMB 1UKTA 2VLJB 4D0CB 3AHVA 3VDHA 3UZEC 3PR2A 4I9JA 3WFLA 5GRJL 1XVSA 4UB0H 1YY9C 4IUGA 4IBWA 1E5HA 4NPMA 4D7SA 1JNEA 2HWE2 4F4RA 5C9AC 5E2JA 1ADOA 5T1KD 3IETA 5AZ1A 4M29A 2F54D 2R1XA 2VUKA 4RN5A 1FH5H 5FYLE 3OW1A 5FO7A 3UCRA 3L3JA 1UC5A 1AE6H 2VLJD 5IMMB 3BYTA 1WICA 1EXGA 3S36X 2VVSA 4W86A 5KYUA 4GW5A 2YPLD 4X7SH 1ZBKA 4D69A 4PMVA 1EWHA 4D8PB 4HNUA 4PGDB 3MV7A 1J9TA 1F05A 4B97A 2WCPA 2BOBA 2QQUA 4U4MA 3V0HA 1QMJA 4MJHA 2HXAA 3CK5A 4UTBA 3E6FA 3KYMA 1PTGA 2E6DA 3W1PA 4Z77A 1N0LA 1GH7A 3UCQA 1NYWA 5CZSA 3QIUC 3O81A 3J7NA 1FIGL 4ZS7H 3NQKA 4DPNA 1YBQA 5I0RA 3VDDB 4ZZ9A 2PXJA 3PANA 2G9HA 2P47B 3G1XA 3ZJAA 5GZOA 1SQ4A 3OAWA 1AGBA 2MEJB 1M7JA 5HJXA 2LE9A 2ZOLA 1E2VA 4PZVA 5LGXA 5HGHA 3RX4A 3AKPA 3AZXA 2J4WH 5GRVL 2O8OA 1IKNC 4HS3A 3EOOA 3FS2A 4ORIA 1MCWM 3DX1A 4MMZB 3ZYZA 1FUYA 4JL1A 1V6XA 1VZWA 3U2CA 4QR7A 5JXIA 1PNDA 4Q27A 4HJUA 3S2MA 2H0FA 3WQDA 3V1PA 4ZPIA 5EU4A 1NSNL 5C33A 4ZO6A 1W0MA 2G2RB 1L9PA 1PSCA 1SBEA 2XQYA 3II3A 2OQJB 3QIWC 1PZ9A 4EE2A 5C7GA 4TVDA 4LO6B 1JVKA 1NDMB 3IIOA 3GK0A 2YCIX 5BWFA 5FY0A 3O1RA 4WEVX 3MLWH 4YLQT 3SNMA 4S3JA 4MWAD 4YNIA 4FKHA 3RR4A 4LRIA 4OVXA 5HHME 3KLDA 5AYXA 4XFBA 4R8WL 4YSFA 1Y18A 5C8CC 2OUJA 1MUMA 4P48A 5DFVD 4R83A 4G5ZH 1J5SA 2Y7QB 1SZEA 1SLBA 1D5ZB 1BGXH 3SGEI 2YBKA 5E2TL 1RVKA 1F35A 1GCFA 4OCMC 3WMLA 4EAYA 4APXB 2XV0A 3SQBA 5JMOC 1S3KL 1TSIA 1QJY1 2ZCLH 5DMLA 3BRDA 4K2UH 4KJYB 2OYPA 2Y69B 1EA9C 3WBXA 1I85A 1JD7A 4V1DB 1A3WA 1VBGA 2I2SA 3DU0A 2CLVB 3H9SB 1AJ2A 4FPGA 4OECA 4C83A 4XTDA 4HZLA 1E5CA 4UQCA 3N2BA 4WM7C 3WNPA 1ZJAA 5EORL 2NXZC 4NT6A 2HAZA 1BF6A 1OGPA 1RUI3 4AJVA 3L68A 1JPGB 1YFUA 3MFAA 4LLUB 3MYZA 1YNTA 4NIGA 4PIZA 4PGBA 3KLLA 5ADPH 4FF9A 2YB4A 5FZEA 4GQ9H 5EPAA 3H9SD 5I6PA 3DH7A 3MRQA 4YHZH 1G84A 2PHTA 4A41A 3ZKMD 1VJ2A 2WVVB 5PCYA 1IGWA 2IXUA 3ZMNA 4DN3L 5I1KL 4PJ8B 5M94B 1UPPA 5HJBA 5DO2C 1SBBA 3CD4A 3INOA 2DU0A 5DDJ3 2ZABA 3HPZA 4ZW5A 5D7IF 5JHDE 3BEWB 4JNMA 4KQ0A 2B7PA 2DGAA 2FWUA 2J9YA 5HVFB 3N1QC 3ES6A 3BLEA 4YAQA 1BXBA 3IXTA 4JREC 4PJ8D 1BQRA 3KGLA 2J7DA 4D6SA 4F3FA 1F4WH 5F3HA 4LHUB 3VTRA 4WR3A 2OZ8A 1U5HA 2NR6C 1QRKA 2P7TA 3SBQA 4JQ4A 2GI7A 1MVEA 4ZOEA 2P8BA 3DVNB 2IQAA 2DW7A 3FTWA 4HJJL 1B4JH 4O50A 4LO9A 4G9PA 2WYTA 3TC7A 2WQXA 5T5FA 1E4IA 5A94A 3GJEA 4MTMA 4G3YH 1YEKL 4QAIA 4M43H 2BP6A 4NL1A 4F2UA 4ZB2A 1EXBA 1E65A 3CMGA 4G4FA 4LHUD 4BQ6A 2AJUH 4UTLA 2YV8A 3TR2A 3N1PC 1XLAA 3BLFA 4ZU7A 5FOBB 4U05A 1H0DB 1FVCA 1U8MB 1BD2E 1HGYA 4MJIE 4Y5YB 1NZCA 4L29A 3SCSA 4XHBA 4BD4A 3UYJA 4A7KA 1M1XA 3TA3B 2VZPA 1R30A 5A8GA 2GYSA 1JDCA 2DFCA 1SHWA 3HA0A 4WSJA 5F9OL 2DWDA 1LEIB 1PKYA 4ZTOL 3BGAA 4Z8FH 3Q67A 2D3NA 3VHRA 4QTHB 4RE4A 3PVEA 3GU1A 5AW0B 3DG3A 3KD4A 2HVNA 3ZFGA 2OTDA 1TQVA 5FZMA 2V9QA 3A22A 3VWJA 1XIHA 4OLUH 4NO0B 4D1IA 2HH0H 3QS2A 1I9RL 4ZW8A 3T09A 2IWGA 1BXUA 2AC0A 1SJDA 2OPKA 5CG0A 5I23A 2E33A 4O9EA 3GU2A 2VQ0A 3UJTH 5HP5A 1V8HA 2ADIA 4DJMA 1SXZA 5DZJA 1EZLA 2C15A 4DGIL 3FO2A 3TNNA 4HSLA 3POIA 4NO0D 1KTKE 1NY72 5AC7A 2ZRYA 2XPGA 3HGJA 5T3XE 1LNUB 4G70B 3WY3A 5BXPA 5CBJA 4QRNA 5TE7H 1S5IL 5GZND 5D7KD 5JBDA 1BHGA 1ZJHA 4N8UA 4GD0A 1F4HA 2BY3A 3X1FA 3CX5J 1TEYA 2F7IA 4US6A 2BOLA 3QHZL 4X7TB 3L9EA 1W72A 2Z8WC 3SCQA 1OIOA 2A9MH 4ZY9A 2VAAA 5GNYA 3QZ6A 3GDKA 2X1QA 4DIXA 1RUAL 4LJ3A 1ENRA 4I8DA 4FQQB 2H2SD 3OKYA 5K4XA 1CLZH 3DXAA 2V37A 5ABZA 3PP3K 4ZX4A 1GPWA 5FA3A 1UP3A 1IBFA 3WUCA 1WEJH 5HMDA 1DGRA 1V6WA 1G7YA 3SM0A 2YPJA 4EIGB 4MRCA 2WIMA 4AGQA 3VXQA 3D0AA 4NKOB 4M7TA 4HUNB 3NIDE 1EWEA 5CC3A 2IH8A 1XF4A 1WZMA 4K8RB 1YDVA 1FTXA 3GQYA 4GALA 5AVZB 3VFNB 5I1CL 1XYOA 3OPZL 5AVHA 2CO1A 4QT5B 2X0WA 1MFAH 3Q43A 4PLJC 4N0FB 4DERA 3DI1A 3GXIA 1PZ7A 3ASOB 5L7XL 1EXPA 1D8CA 3G6LA 1AR61 4OF5A 3HRPA 5C3OA 4XCAA 2P76A 1CFNB 4IRJA 4YHLH 5ECGA 4NB7A 1U5ZA 4XN5A 4QRFA 3PWNA 4PWKA 4GFTB 4X5RA 3QUYA 1GEHA 3P4MB 4EX4A 3AUJA 4P3CH 2WNUB 2GZXA 1Q8AA 2X9WA 1AD4A 3UZQA 4AGLA 2MPVA 2UYBA 5SX5H 3CH0A 1J5CA 1Z0NA 2ARBA 3LPFA 4DELA 3NQMA 4L3CB 4Z1PA 5IMLB 3L0GA 1AE6L 2DQMA 5C09B 3GTTA 4Q8BA 3DDMA 3EA2A 4YXKH 2AXFB 3OODA 5LRSA 3OJMB 5FJIA 5DRWA 3OP2A 4ZB0A 2KDYA 5IEHA 1G6NA 3DIFB 4E9XA 3SGJC 4P9GA 2PMZA 2EXHA 2YGLA 4JYFA 2W47A 5DELA 4UW5A 4WNQB 3B2UC 3LA2A 3M0LA 4PJCF 3IACA 2Q1FA 4Z0JA 2W88A 5C09D 1NA1A 2YAOA 4MQSB 2OVUA 3MPBA 3WY2A 2DT3A 3STLA 1IR2A 1NAEA 1QJFA 4LBJA 3W22A 1FJ1B 4ZS7L 2ETEA 2HG5B 5KSUA 1S2BA 2HVOA 3H9YA 2FDSA 1C5DA 1VPQA 2PDHA 1XFBA 4B91A 5DYFA 2QCCA 4XVUD 5AOMA 1H3WM 4URIA 4AZ8A 4NGHH 1SEQH 5JAXA 2HRLA 5DD1L 3IJDA 4FOJA 1N4XH 1VERA 4PJEE 2P5WE 5M3WA 1BZWA 2F84A 5C0IB 3BOXA 4NI6A 2CJ3A 2OUHA 1X9TA 1V6VA 3QQ9D 1AFVH 3A12A 2FYVA 5FPUA 3RX3A 4GCAA 1D2KA 1EO7A 1AIZA 2WOBA 4LLYA 5DMGD 2VD7A 1TJRA 3M5XA 3N15A 1WOAA 4OZHB 5HYFA 5C7VA 4KH2A 2BV9A 5DZEA 3T77B 1RGSA 3WV0A 1B57A 2GAZA 1PYWA 2ZXGA 1OE3A 4FPSA 1GOGA 3G6AB 1J2BA 3EEGA 3MLWL 1J6PA 3PZGA 2CUMA 1KEGL 5KJRH 2XBO3 3N3HA 1LKNA 3STCA 5EO0A 1PWMA 4MGQA 1W03A 3MGTB 4QD2A 4M5ZL 4NHUB 4IBYA 1HCFX 5U7SA 1BAWA 5C0CA 3M2MA 4DNYA 2EXTA 1Q90A 1MUWA 3TEYA 1IEHA 1PZ5A 4G5ZL 1U3JA 4ZFCA 3TSMA 4DP1X 2B3IA 1BGXL 4MJZA 3GNRA 2W91A 3R4DA 3G7DA 2RJMA 3BO8B 2RMU3 3KG5A 3P1IA 2ZCLL 3CFKB 4K2UL 3S8WA 2FCVA 4XNYH 5C07B 3A4UA 2D5HA 1TWWA 5F7DB 1AL23 4GVGA 3CXOA 5GRUH 2Z00A 3PZUA 1A6AA 4FQXC 4AQLA 3KL3A 2G8ZA 2PHDA 3MROA 3VGEA 3P62A 5DJCB 2YGNA 1PB0A 5E8OA 4LPXA 3IN2A 3IU4L 1EFXA 1HE8A 1F4XH 3M9YA 2OX1A 1EZWA 1TJPA 1OFAA 5ADPL 1JSYA 3UGGA 2A3EA 4L56A 4PJ7B 3L4YA 4GH4C 4L9LB 4LXLA 4AKPA 4ZSTA 2EJ1A 3QNZB 4GXFA 4L37A 5HDOA 4YHZL 4HEME 4G8EA 4ZUTA 1NDGA 3LH9A 1B4KA 2R4SH 4NN5B 5E1AA 1FFNA 1Z8AA 2HCZX 3NPZB 1LTXA 5IOKA 4W7UA 1SZFA 1V9U3 2HWD3 4XF3A 3F5KA 2R29H 1WKFA 3COTA 1PZUB 4C56B 3QUXC 1AYM1 3MLJA 2JTDA 4LY8A 2H32H 5L2KE 2WO3A 3R4UA 4FQZA 5JVLA 2UWEB 3GGLA 2GYIA 1F4WL 1KFEA 3QSTA 1CGPA 3WFDH 4LOUC 2BVQA 2EDQA 1TSHA 5ETUA 4M0XA 1XIFA 4XO7A 4FNUA 2I9UA 3ZSLA 3IKCB 4XZIA 1B4JL 3FXIC 4G56A 4Q4X2 2OMZA 4D6GA 1XLKA 1AZBA 5I6LA 2Q8BH 5LXEA 4G3YL 1PE1A 4M43L 2XSXA 3PJYA 2XY1A 3SDCA 4H8WC 4R4FH 3O1UA 4UM9A 2XTKA 4XIAA 1RUKH 2AJUL 3NJHA 4CSZA 2P34A 3CV2A 4NUMA 5CBIA 5B39B 1TZOA 1JYVA 3US1A 1TRDA 4IF2A 2Y60A 4P7LA 1PS9A 2HT3C 3NA8A 1JHKH 2GK2A 4AQSA 5CD5C 2DWYA 4BSJA 4K68A 1MQ8A 1H41A 4F48A 2WABA 1KIQB 4Q0UA 2WKLA 2P52A 3LOIA 3OHXC 4TNFA 2GQHA 3CVCA 3FO9A 1NF7A 1QK0A 3BK0A 4A3XA 4JX5A 4Z8FL 5I6OA 4X9HA 2PF6A 2ESVB 2G3XA 4BCZA 4IM4A 4QQOA 3R18A 1ID5I 4UTWA 2YG0A 4OLUL 3EQEA 2Q7YB 3ITGA 3MNWB 1VESA 1KS5A 3BD5A 4YWIA 3QXBA 4E9WA 3WHE0 2HH0L 1F7BA 1AYN2 1ADWA 2X05A 3WLMA 2Y5TB 3SODB 3I59A 3S98A 1L2UA 3UJTL 3BP7B 1Q66A 2ESVD 3V0SA 2IAMD 5E0QA 1Y4WA 4RDQF 3TEVA 3CQKA 4RQPB 4E41B 1ADSA 4BK5C 1ZLPA 3X2QB 4GCXA 2QJJA 1KTLB 2G3MA 4U1LA 3B04A 4LGRB 5F21B 2YARA 4D8OA 2DQJH 3QWRA 5TE7L 2NY5C 4FX7A 1M7IA 4Y2WA 4ZG1A 1RUH3 5DJZA 4QNWA 1G6VK 1QACA 1ONRA 1Z48A 3P3SA 1G7MA 1MVYA 4UMSA 2L8AA 3RX7A 3CN3A 3SRDA 5D7JC 3OPUA 4E41D 3UPMA 2VABB 2X4OA 3ARQA 4XURA 1W8UA 3VH8B 1G0XA 1IS3A 3NNMA 5JLVA 1PGL1 4DINB 3IVKA 2VEIA 1C5BH 2A9ML 3PUCA 4YXGA 2DF3A 3CZNA 4OCXH 1EHAA 2DD8H 1CLZL 5AOZA 1HNYA 3CSGA 2YMZA 1XL9A 1XR2A 3TP4A 4KQ4L 4NCDA 3MBWB 2JJUA 1R092 3HFMH 2C5DC 5G4MA 4JHTA 3LKOB 2YQ2A 4KKQA 4US5A 4BK8A 1BBJB 1MYRA 1ACZA 1JU3A 4FA3A 4M5PA 1X5LA 3TEZA 1LG1A 5C7HA 5IROA 4IGNA 2FWLB 2GAUA 1GSMA 3LX9A 2UWCA 1MFAL 4H1LA 5AALA 4XNBA 3WE1A 3PZQA 3QZWG 1E15A 2AAAA 1RUD2 2F08A 4DPCX 1E9YB 5FF6A 3VBUC 4KI1A 4OVUA 3RHWF 2V2CA 2EIGA 3AXXA 3CMOL 2IJ0C 3M0XA 3QHFH 4O18A 3LNEA 1WDPA 4Y24A 3SPVA 1DBKH 1X9UA 4ZXBC 4DP7X 1I3RA 1RZJL 5I93A 1XYMA 3Q01A 4AQEA 3MPPG 5IREA 1ZLDA 3QRBA 4KU8A 3WQEA 2J1UA 4UAOB 1JQXA 1CE1H 1U92B 4H7CA 4ATFA 5FY8A 3FU8A 4GZ9A 3BUDA 4ZS6D 4XETA 3EO1A 3TH4T 2WKOA 1H9PA 2WM0A 3BGMA 3OLDA 2JI3A 3GF8A 3K51A 3NAPA 3H24A 2E7BA 4XDQA 2GGHA 3BVTA 1BX2A 4MDIB 2ZG2A 4ZU5A 5JXHA 4J1UA 4DESA 5LHDA 2Y5JA 2KPNA 3NIFB 4MCYA 2GUBA 1H0GA 4IG2B 4FQHA 3BVNB 5FZOB 4OY9A 4LEFA 3MVTA 4KRPC 3U82B 1EJXC 2KZ1B 4X8NA 4YXKL 1IIKA 4C6EA 1UVQB 2Z6JA 2YAMA 4PRPE 3BTZA 5L88H 5LN4A 1FPTH 3B7UX 4YHPA 3ZDXE 3O4OC 3KEHA 5DJXA 4NQVB 1LP9E 3MRKA 4G9FE 4Y16C 2NT0A 4M80A 1J6OA 3ILPA 4F7EB 5A2LH 2EC9T 3P14A 2ZZ1A 3TBVA 2ZZJA 4OFVA 3LQMA 1T22A 4EAEA 1DHKB 2X4NB 3BH9B 2P6CA 5FBZA 5G4OA 5I66A 4M8UA 4HGWB 4HJ0D 1FX6A 4KX7A 3RRQA 3WBYA 1KIUA 3D0LA 2Z7WA 4H13C 1H63A 4JGZB 3ZXJA 1H15A 4JRYD 4U6YB 5JQIB 2JIXA 4WTQA 4NGHL 3RWIA 1SEQL 3VXUE 3T2NH 1JZ8A 1N4XL 2FRGP 4FFVD 2AAMA 1H5BC 2JFEX 4XBPB 4XCBA 1OM3H 3FUIA 2HX9A 4NRPA 4XVEA 4JG0H 5CFCC 5HUOA 1RZGB 1AFVL 2WPGA 4LKDA 4F5CE 4FFTA 2ZA2A 1PO11 4EDXA 5FEXA 2F7QA 4FZ8H 1MDAA 4BKTC 4LUSA 1XHHA 1S0FA 1N7MH 1M7DB 4NBYB 1XYLA 4OOZA 2OCZA 4JTUA 2DQEH 2FTAA 5JH2A 5FCCA 3LOBA 3EH4B 2XIMA 1GS8A 5SV8A 1CAWA 3W7QA 3FMGH 2ADGB 1MQKH 5G4WA 4N87A 4QQ2A 3JVAA 3RG6A 4N0UB 1F2NA 3UTTE 4NRYA 3WBAA 2XWBA 1B3IA 1AZZC 4DK6A 4QIUA 4TUUA 3AOFA 3VI3F 3VOIA 4NQQA 2ODIA 3RU8X 5CU9A 4ACPA 3GMOB 1DWAM 3KLAB 3ZXFA 2ZXQA 3ZN6B 2VISA 1ZE3H 2RCSH 3Q6GH 2FDJA 3POJA 1ASPA 4YHNB 1JUFB 2J6EH 3T8MA 4KY1H 3ZLQC 1HO4A 4LCSA 1KGUA 4NRRA 3F2BA 1ZGLM 4LDEB 1HSBA 2ZQ0A 3ME0A 2J20A 2NNFA 1GL4B 3SKMB 3DK0A 4C4KO 2CHOA 5GRUL 3GSXA 4OM0H 1WUVA 2PFHA 2P53A 2PODA 2I17A 1A78A 5JMUA 3QYCA 4A2FA 2YAQA 4EKJA 3AREC 3VSQA 4ZAKC 1W6OA 3NUKA 3KQ4B 1S78D 4HQQH 4G59C 1UR3M 3QJHA 3JR2A 5E9DE 1GHRA 3BKZA 5LA9A 4IQJA 3NPXA 4RNRB 2JKXA 4NROA 4ZXEA 1G0CA 4Q4Y3 1O66A 1UZHA 2JG8A 1X5ZA 1RUI2 3BP4A 5A6QA 3FYEB 3MDUA 5DJ8B 1T1WB 2R4SL 2GPTA 3BGGA 3C7FA 2AP2A 2P0IA 4PLKD 1KCZA 4AH2B 1F56A 4CTEA 4XACA 4Q4PA 3P3BA 4S2DA 3VBHA 2DZSA 3IARA 2R29L 4MG2A 4FP8H 4GKTA 3L3OA 2ZG1A 3N44F 2OFQA 3WMQA 1NWRA 1JI2A 5CPMA 3O2DA 1REQB 4YEFA 3CHCA 4DN1A 1IL1A 4PCNA 3QJZA 2OGJA 4TNGA 4PJGF 5E1HB 5DDJ2 3PWJA 4XJ8A 4QQHA 3MZNA 1PEWA 5L73A 4Q22A 1ZA6A 5IFHH 1GIGH 1H19A 1TJ1A 3LKQB 1ZTXL 3H0TB 1FKXA 2ZGUA 5ANME 2ZTKA 3PUAA 3C3UA 1IGIH 4DXXA 4H6EA 2GUUA 3VGFA 2OODA 3NTCH 2VN6A 2Q8BL 3D5OA 3MRBA 1X5HA 2YSTA 2VLRA 3FV9A 5IR1A 1KNOB 4R4FL 3H8XA 1AS6A 1QSFA 4KKPA 1RUKL 4QRRB 4JTEA 4N43C 2DQDH 3T44A 3FZ3A 1NH6A 2PP9A 4IEYA 3QRGH 1AYRA 1JHKL 1PJWA 4LSRH 4OI8A 1ZY9A 2JVUA 2G0KA 5A3OA 4XBQA 2JLLA 4NAFA 3F6JA 2FQEA 3RLSA 1NCRA 3OU8A 2PTZA 3GPEA 4QRRD 2HWF1 3SY1A 2ZUUA 1QXLA 2Q1ZB 2O55A 2YFZA 1EJ7L 4FD0A 4O2FA 3GD1C 3B6SB 3TT1H 1DEEA 4P2RE 2QV5A 4DP4X 3FUNA 5D71H 4PGZA 3KRSA 5DA0B 4XFFA 3WH7A 1PTZA 3RUGB 2I32A 3WCZA 5IMKA 3PQYB 3GBNH 2Q8ZA 3UYRH 1JNJA 1K7XA 2CWMA 3TBDA 1W1VA 4Z7WF 2OZNA 3WX5A 4CW1B 1A5SA 3K71A 1MQTC 3H9ZA 5FYKH 4F7ZA 4LU0A 3EYSH 1HJCA 5HJDA 1DF0A 3ITYA 4LEXH 5ID0A 4Q74A 3W37A 3T0AA 4N0CD 4PJHB 4PG2C 2Z1XA 1E7VA 3GF6A 3HWJA 2XY2A 3AXDA 1QXPA 2DQJL 3RS6A 3P5ZA 4XTIA 2PU0A 4I3GA 5JA9A 1HF6A 4UNUA 1ZBVA 1I1AB 3WEBA 3KCOA 3AKTA 3B9KB 2DZPA 1PNCA 4LBEA 1J9CT 3V5OA 1VR6A 2EVXA 2DLTA 1G9DA 4MYPA 1C5BL 1E27B 2GJXA 4E4UA 4Q89A 4CNSA 4HA3A 5HY9B 1CQYA 3FOLA 2ZUVA 4Q6IA 2NZ9A 1S1PA 5H2BB 2WNXA 3WJJC 2RHPA 3DX2A 1EEYA 2DD8L 5KSVB 3D82A 4UFJA 4XF9A 3CFBA 5KG9B 4YM3A 1I1AD 3ULSB 3TTOA 5CD3B 4N4YB 2E7TA 3ILQC 3B9KD 1FOD1 4HJGA 3HFML 3E02A 2F61A 3Q2WA 1GTNA 4KGLA 3EYFA 3V95A 2NXHA 1AP2B 1OQFA 2X44D 2G5RA 2GGIA 4AVAA 2BSTB 3HBZA 5KYXA 4DEFA 2Y6TE 1ZSDA 2O5ZL 2Q5BA 2YBTA 4CVZA 4L3EB 2VSKB 3TCLB 4H6RA 1UCWA 4AD3A 3O1PA 4KI5E 4O00A 1H7NA 4UILH 3UTZB 1JWUB 3E2SA 4C6MA 3QHFL 2ZXAA 1DBKL 2IXIA 2HVJB 2F68X 3E0WA 2WTRB 3NZSA 4L3ED 4FFZA 4YQXH 5FUZH 4R52A 3S3DB 4B9ZA 1G1YA 1ULOA 1OSEA 1QBLH 3PWVA 3V7PA 1CE1L 1T0OA 5FZ4A 3T4AB 1MEWA 1PIGA 3B83A 4GRMB 1NEZB 5MENA 1K72A 3EHKA 3TV3H 5HVHB 4ATLA 2ARWA 2WXKA 1ZHBB 2YLKA 4ELMB 1H4PA 1XYCA 2D23A 2NTFB 1UIPA 4TULH 1SHMA 1JHNA 4AWTA 5E0FA 5CVRA 1W5PA 5AHFA 1HOCA 4UU9A 1TZHB 4X5WB 2L9LA 1SLXA 2EEAA 3EJUA 2YKKA 4PTTA 5L88L 2KERA 1S5WA 5KXCA 3EKCA 4KXZI 3RFRA 4JDEB 5H9QA 3OX8A 1FPTL 2G50A 2OB3A 3ZS4A 5I76B 3HC2A 5J11B 3NCJH 1FVDA 3WJMB 5C4WC 2X8RA 4Z95H 5DUWA 2D0FA 4PJ9C 3DARA 3W76A 5DCBA 4I18C 4LS2A 5CJNA 4B2DD 4WIQA 3REQB 2XM2A 2FH8A 5DFWH 4QEEA 2NXIA 1I6NA 3RWGB 5F1IA 5D5ME 5EGRA 3F65A 4AXKA 4TU1A 1H60A 2W9DH 3ZN5A 1JF5A 5IVXB 4C1NB 2YD8A 4Y0GA 3T2NL 1VFAB 4FTVE 4PMZA 4WV8A 4AOCA 4GNJA 2RR3A 1OINA 5TSWA 2WC7A 1YPIA 4W4OC 1CXEA 1OM3L 4RDWA 3R7MA 1TTCA 4W89A 3VINA 4WO0A 2PLV2 4C6LA 3BVXA 4JG0L 4PRBB 4FXKB 4JFDA 5DLMH 2Q3AA 4CSSA 1FLTX 2Y6SD 2HMCA 2I5IA 3G5WA 3ID7A 1Q7ZA 4FZ8L 4GT7A 3H7BA 1SLLA 4F0HA 5I6NA 1KJRA 1N7ML 4TL5A 1HILA 1BVKA 4HFWA 2DQEL 3MMEB 3WLIA 3ZMRA 2V33A 3FTGB 4W4ZA 1BZ9A 1H3TA 3FMGL 2P44B 2GJJA 1MQKL 4PV8A 4FZIA 4JO3H 4DUOA 2D0HA 3WNKA 5HWNA 4XMAA 1U8CA 5HHQB 2AJ3B 1U58A 1JPKA 2J8TA 1QMUA 3KFTA 4HA0A 1PMJX 4B1LA 2FQFA 2ALDA 3W57A 1LHWA 3VOCA 2ITCA 1R3VA 1U41A 3APYA 4PMYA 2XTJB 3IGSA 2RCSL 3Q6GL 3TEWA 2R15A 5AKVA 1IBYA 3B9DA 4GG6E 3VCLA 5DZ9A 4IL7A 2OZTA 2N0MA 2SFPA 2B9AA 4GX9A 4YZ5A 2J6EL 3TBBA 4KY1L 4L1DA 3WJXA 4H20H 3UC0H 4Z1BA 2I27N 3S96B 1INEH 1LL4A 3VFUB 3CZSA 3ULUF 1A3RH 2XETA 2BIHA 3OJ2C 4L4VE 4OM0L 5I03A 4BE5A 3UKTA 4BQ2A 1V79A 4JN2B 2XTJD 4H4NA 2J6WA 4CVUA 2YD4A 2VDLL 1V93A 5GNZA 1AL22 1LCLA 3FQXA 2W38A 3DX9A 4HQQL 1CFMA 3ABKB 3GTFA 4L1XA 4LSQL 1UWRA 5HNRA 3PTKA 1R083 3TLQA 1GKPA 4C6DA 4I9WD 4M8VA 2F19H 4K20A 3KNBB 2DQGH 1V0NA 1QHPA 1GHFH 5TQ2L 3U5UA 1D9KB 1PVNA 2ZKXA 2FHBA 1V03A 2CNCA 1P1ZB 4GQPH 2H6OA 2Y06L 3AMMA 2DLGA 3ZKYA 5D38A 1IGML 4GYBA 1A0EA 1JYTA 3QXVA 4GSUA 4RBPK 4FP8L 1J83A 2H8XA 2AEWA 3TC3A 3ES4A 3GBMH 4L1LA 1PLBA 3B3BA 4UR8A 3RYRA 1OSZB 4PP1D 1HEHC 3W21A 3MMWA 4XSLA 4HUMB 1DN0B 2OOGA 3DURB 3ZXWA 1U3HA 1V6MA 5KTEL 1D9KD 3SITA 2D7NA 5IFHL 1GIGL 4KNTA 3VYOA 1YXDA 3QXTA 5IB1A 3GYRA 3I68A 1HIXA 3S0PA 1OPOA 2XGBA 2CHZA 4KFNA 1IGIL 1V3JA 2YUVA 3VRLE 3W58A 3OGCB 5KZCB 3JD71 3NTCL 1KOAA 4UZSA 4XPAH 4QB6A 1DWHM 3HN5A 1QNRA 4S38A 3V9FA 5HHXH 3CFUA 1MG3C 5D55A 4KKCC 4YZWA 2LU4A 3BISA 4XMIA 4Z0XB 3B8UA 4FNSA 1M5WA 2IALA 3ZDYB 3GAYA 4LTSA 2DQDL 2EKGA 3WUDA 3QGKC 4CDUB 3GNXA 4DUWA 3U30C 2CDGB 3GI8H 4FERA 2ATSA 3EAKA 1V6KA 4KRTA 3UTPE 3QRGL 5I5JA 5KZCD 2NRDA 1CICA 1PAMA 5CJXC 1IXQA 1YIXA 3KHJA 1ND3A 4CD6A 4PGEB 1KSRA 3VW3H 4XZUB 4UC5A 2Y62A 3MO1A 5HYJB 1F45A 1KJ3H 2PD9A 3W7KA 4WKFA 4Q0SA 2LABA 1VBC3 4PHZA 1UF2C 2VGBA 1HH6A 5BNNB 4NRMA 1J0KA 4FG4A 3TT1L 3I6LE 3B5LB 5DMMA 5LWYH 1SJHA 1D6EA 5D71L 3KPPA 5TF1H 2O7SA 2XRAL 1PU0A 3LGDA 4P7RA 4F7CB 3ZOIA 2I07A 3GBNL 2TYSA 4HMDA 4OAWB 3UYRL 4LVNC 3CHRA 4BWLC 1JGDB 1VRH1 3FSWA 3VD2A 5HYJD 5D6DA 1V10A 1L0XA 4JAMB 4M6AA 2VIRB 5FO8A 4AT6A 4JFDE 3U48A 3NG3A 1OALA 5FM5M 5FYKL 3CZJA 4AVVA 4Y33A 3SYAA 1E0XA 3EYSL 3M47A 4G7EB 3GMQB 3AAZB 5J6SA 1S4CA 3RGVC 2ZVIA 3SKJH 2BWIA 1RJCA 4LEXL 1CB7B 3BPWA 2NVDA 1BKHA 1COV1 1SPQA 5F89B 4C5ZA 1XE0A 4JICA 2ZYSA 3ULUC 3VFOB 4OKVA 4IW4C 2IXKA 1HN1A 4E5TA 3PDOA 5D8ZA 2R063 4CEYB 1JZ3A 3VV1A 4QRQB 1ZTMA 2YEZA 2VDOH 1CAXB 3AJZA 1AXYA 2DWEB 3TWIA 4ITCA 4F57H 1J3RA 2X5IB 3B1UA 4N53B 5EO9A 4ZCWA 3IAPA 2FJHB 4WK0B 1T1YA 4LXFA 3FO0L 3L5XL 1I8LA 3RJOA 4RFNC 2VE6A 4H41A 3IDCB 1YXCA 3QR1A 5HDBF 5KYNA 4N7UA 2CHRA 4FO4A 2ZE0A 4OHQA 3KWSA 4NQCB 3VABA 2VEPA 2Z42A 4NAEA 3SIMA 3MRMB 2E31A 3LCFA 1TITA 2G4GA 4QHBA 3ESVF 4YHYB 1S7WB 4NKQB 5JMCA 3TJIA 2Z4QB 3N9RA 3S3CB 2RR11 3TVMD 3GZPA 3ZKNC 3NEEA 2ODHA 3ZHDA 1OC7A 3QR2A 4ZSUA 3ZXGA 4NQCD 1EV12 3NCBB 2G4EA 3VZKA 4G80A 3BCJA 3PLQA 1JJKA 4UILL 2EAAA 1QG3A 4AGVA 1RUSA 3L7FA 1J1TA 4WU7A 5JHDA 1STMA 1W2NA 3CSYA 3JTSB 2NQLA 4F9JA 3WW1A 2GGJA 1AR93 2Y5QA 1RSFA 5T55A 1UWWA 5DZPA 4YQXL 5G5DB 4KXBA 2GC0A 1F6PA 1QBLL 4DAFA 3EG9A 2E5DA 1X9LA 3IXAA 1UOGA 5INDB 1VAVA 3OGOE 1EGMA 2X4RA 3SKOA 3M43A 1LDCA 3TV3L 1IVLA 1CDHA 1ND2B 1GJPA 5C0BE 4LUYA 1TKKA 2JK2A 4LAJH 1RINA 5AVQB 2LT9A 1FX5A 4TULL 2Q8LA 1U2CA 3IDEA 1BOYA 5DS2A 1XXFC 4FQPA 2BIMA 4B90A 1UPSA 2J9ZA 4CDWC 3KYNA 4F24A 3MIHA 1ZU8A 3TH2T 2CIIA 2A7RA 4E2SA 3OBTA 4M6NH 3IMMA 3QN3A 3NNJA 1GY1A 5F96H 4Q5OA 2Z31C 2AQTA 2C1FA 5LY2A 4W9FC 1BD2A 4MJIA 1GANA 3NCJL 2ISFA 4IIBA 2ATFA 2HV5A 2DL9A 2W80C 5G2WA 2AQNA 2IKGA 2WAGA 4Z95L 2CD0A 3SD5A 3RNQB 1XKJA 4RZKA 3B9CA 3D85A 3LD8C 4ADTA 1D9EA 5J96B 3S3GA 5TJWK 1C16A 5F3GA 4ZFGL 3WJYA 1RUC3 5SX4I 4JPSA 1N9PA 2UZYA 1ZLVH 2AI0H 2HLEA 4XG1A 4JAAA 3RIFF 3LEVH 3PF3A 5CPNA 2OPWA 4F7KA 2W9DL 1GTEA 4DJDD 1E9QA 1YSOA 5AYQA 3MNZB 3RILA 3ARDC 5I30H 5J9PA 4ZUVA 2F6XA 2LU5A 4QPIA 1GP6A 3B7RL 4F33B 3KM2A 2IPGA 5IRPA 3F5WB 4MWFA 3D47A 4DBUA 4IU3B 7PTDA 5GSVB 5I19H 1DVZA 4O2EB 5DLML 4YIWA 1OV8A 4P5KA 1PO21 4N1HB 4HIEB 5E0CA 4TSAH 1KM1A 2OQ7A 1FP5A 2QKDA 3N41F 3IU3B 1BZ7B 4B9FA 5EULV 3V36A 1D7FA 5XIMA 3USUB 2K4WA 2J74A 3TN4A 3KVBA 3MLTA 3IGUA 1OB1B 4JO3L 3HBLA 1BDYA 5B8CA 1M7UA 4Y4KA 3BVDB 4PJBE 2VUCA 3BQUC 5DS8B 1J96A 2HBUA 1OTTD 2ZKNA 4U33A 3H4HA 5E99H 2KZBA 1JAEA 5DUBA 2XH7A 1NBCA 2H32B 1UENA 2UY4A 3BVCA 3C6LA 5HINA 1F18A 3E6DA 2PGWA 3DOPA 3DVFA 3NM1A 4J4KA 3UJQA 1D7PM 1MS5A 4PM1A 2PELA 3UC0L 4OHXA 2BOFX 3MUCA 4GIYA 1IRAY 1INEL 3CH9A 2NCMA 1IO4C 5F7YC 4FJZA 3OIHA 1A3RL 4HLZG 2E63A 3CVHL 1O6SA 1WXJA 1VCBC 4IUOA 4MAZA 2AQVA 3GM0A 1Y43B 4P8VA 3CZKA 5GGSA 1B0GB 3V0VB 3L2YA 5CEWA 1W9WA 4HANA 2A3WA 5EIIG 1DLCA 3WEXB 3GXFA 3OQ3B 4OJYA 4HOOA 4V1DD 2VH9A 1H5VA 2AYHA 3L81A 4PFEA 2PWVA 4C54A 5T1JA 4KG0A 3ROOB 2DU2A 2F19L 4ORZC 2F5AH 4AXNA 1Q6RA 2CLRA 3EA3A 4KCTA 1XF2A 3LKJA 5BY5A 1GVEA 3NAAH 3IDIB 3PGCB 1BW8A 3O8XB 4K40A 1GU3A 1OKEA 2FB3A 4D9RD 5CGYD 4LT9A 1WGVA 4A7VA 4PLNA 3CHOA 3GBML 4PUUA 5HGDA 2XZQH 4MYAA 3U5YA 3FT4A 1JNNH 5FM8A 3OV6A 3PJWA 3JVGC 5CA6A 1CU4H 1AQDB 5LBVA 2WO5A 1IEAB 8FABA 5BYNA 4W88A 4EMZA 3O8XD 5IESH 2OSLB 3PAUA 2NY3C 2FIRT 4LV9A 2F8QA 2WLKA 1T4KA 1S6NA 4KZCA 1KLYA 2V8MA 2DZWA 4R9AA 2FDGA 2BFUL 4TVSa 2PP1A 3T0EB 3P40A 1F76A 2OR2A 1MCQA 4XPAL 1G7VA 5HHXL 4RR3B 1WDDA 3QCUH 1RSYA 3HE7A 4AZIA 1CGYA 4ZZKA 4U1IB 4LYQA 4G5AA 1NWOA 3AT9A 3CU2A 2ZCGA 4IXXA 2YR3A 1KBJA 3E5BA 3GI8L 4CC4C 7TAAA 3DJ9A 5BV7C 3VQMA 3T0ED 3PWPB 3EFDL 5CCHE 4A2SA 4LYKA 1IBBA 1RZ8B 3CFJB 3HQ1A 4Q33A 3S46A 4KG8A 2W0FB 2W66A 4HFSA 3HI6H 2GSGA 3LN4A 3ETBJ 3VW3L 5AVWB 5FYHA 4QHNB 1H9DA 1KJ3L 3GC2A 1L5GB 1LDPH 2X6BA 4PJEA 1VGEH 2GUYA 2P5WA 1XYBA 3QTGA 3TYFB 2WP3O 4ZRGA 4N2DA 3C5JB 2WZHA 1BBDH 2VLME 5DK2B 3P5BA 3PWPD 5LWYL 4N0RA 3QC3A 4RDVA 12E8H 3KPNB 4H7ZA 1XSJA 3TA3D 2NX5E