4QAWA

Structure of modular xyn30d from paenibacillus barcinonensis
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
537
structure length
537
Chain Sequence
ASDANINLSSEKQLIKGFGGINHPAWIGDLTAAQRETAFGNGQNQLGFSILRIYVDDNRNNWYREVATAKRAIEQGALVFASPWNPPSDMVETFNRNGASAKRLKYDKYAAYAQHLNDFVTFMKNNGVDLYAISVQNEPDYAHDWTWWTPQEILRFMKENAGSIQGTRVMAPESFQYLKNISDPILNDPQALANMDILGAHTYGTQIKDFAYPLFKQKGAGKELWMTEVYVPNSDNNSADRWPEALDVSYHMHNAMVEGDFQAYVWWYIRRQYGPMKEDGTISKRGYNMAHFSKFVRPGYVRVDATKNPDTNTYVSAYKGDNKVVIVAINRGTSAASQRFVLQNGNASTVSSYVTDSSRNLASLAPINVSNGAFTAQLPAQSVTTFVANLSGGNSGGGNVNTGTTYEAETGTTLTDAVVETLYPGYTGSGYVNFNAYTNSAIEWNAINNMTTGTKNVKFRYALESGTRNLDIYVNGTKVLSNEPFTETGSWSTWGEKTIQVAMNSGVNTLRIVTTGTEGPNMDNITVTASAKGELNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Analysis of Glucuronoxylan-specific Xyn30D and Its Attached CBM35 Domain Gives Insights into the Role of Modularity in Specificity.
pubmed doi rcsb
source organism Paenibacillus barcinonensis
molecule tags Hydrolase
molecule keywords Xyn30D
total genus 159
structure length 537
sequence length 537
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
A PF17189 Glyco_hydro_30C Glycosyl hydrolase family 30 beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4qawA01
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4qawA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4qawA02
2ZEXA 3APGA 3AIQA 2E8YA 5G04L 2VQUA 2QQIA 2BVTA 1FH9A 1UYYA 1GOMA 2UY2A 2X2YA 5IYYA 1IZJA 2B4KA 4OKDA 5CPTA 5A6AA 2A3AA 5A2BA 3RJXA 3GH5A 1KCKA 1PX8A 1W0NA 2FGZA 1AQ0A 4D8MA 1QNQA 3UG4A 1WDRA 4RE3A 1VENA 2W5FA 5BXTA 5LA1A 3SUTA 3EJUA 2WBKA 3PZ9A 2FDMA 3RJYA 3ZJ8A 2W46A 3AI0A 1XYFA 4PMQA 3OEAA 1U2YA 4QPWA 4HMDA 3MSGA 2XG9A 3OLGA 3VX1A 4TTGA 2G3IA 3CGTA 2EXOA 3DDFA 3GGLA 2Z4FA 1M01A 1UD2A 2ESCA 3WD3A 1V6XA 2W1QA 1W1YA 3LQCA 3VX0A 1V3KA 3VPLA 2IUZA 4A4AA 2L9LA 3VOCA 1C8QA 2CETA 5E9AA 3VSVA 1DLCA 1QI0A 2EAEA 4QDSA 3EJSA 4BK4A 1ISXA 1EDGA 2BY1A 3K77A 4AD4A 4CCCA 1E4NA 2PWHA 1CWYA 1XPWA 1UZ4A 4AZ7A 2WMGA 4DXSA 5G05L 5EFFA 5E6ZA 1HL9A 4H2CA 1E9LA 3F2ZA 4AZIA 2OLHA 4AZ5A 2JIWA 1QNSA 3LPOA 3VIPA 1WZMA 1GOHA 2VZSA 1HIZA 1MQQA 4TOQA 3UR8A 1WP6A 5LYRA 4AD1A 2DIJA 2WAOA 3W37A 3BAXA 2VTFA 2XVGA 7CGTA 1KQYA 1UWSA 4HA3A 4AIOA 1V08A 1CXKA 1E5NA 1J12A 4JAWA 2X0HA 3WF4A 4PSPA 3PZTA 1HWWA 2XUCA 4PMZA 3VGDA 1Z32X 1WNOA 1EO5A 4A41A 1WCQA 3VD5A 3IAQA 4MTVA 1V6VA 1CIYA 1EHAA 1RPKA 4AEFA 3IK2A 4R27A 1TQUA 3B9EA 4CU6A 4XUTA 4BK5A 2F8QA 4HMCA 2VC9A 1SFSA 1PMHX 2FH6A 3HG3A 3TTSA 1E55A 4QX0A 2YL8A 1JYVA 1B9ZA 4QP0A 3KZSA 1KGUA 3GBEA 2D22A 3QHNA 4E4PA 4WJXA 3FL7A 1UY4A 2WKGA 4LYPA 3UR7A 2Y8VA 3D4YA 4P7RA 2J78A 2XHYA 1NKGA 4GZJA 1E5JA 2X1IA 4E8DA 2J1AA 2UWFA 4HG6B 2J7FA 3ZT7A 1EIBA 2VZTA 3AYSA 3LEGA 2WMKA 3ECQA 1GUIA 3F5KA 3GH4A 2RVAA 1OF3A 2OYKA 5JIWA 4AEEA 4XURA 3PZVA 5ABEA 4W4ZA 1MW3A 4UI9L 4FF5A 4IPNB 5C71A 1XYZA 1TQTA 1E3XA 1OF4A 2DSZA 5DQ0A 2XM1A 3CHEA 3BUBA 3GXTA 2EACA 1C8YA 4ACYA 3GNRA 1K45A 3ZJ7A 1SHWB 1ODZA 2E31A 3ACHA 2Y24A 2CERA 2GSJA 2BXYA 1QNRA 1O7AA 2GDVA 4NXKA 3S5YA 4CU8A 3W4RA 4FLOA 3CC1A 3WH8A 5FL1A 2AOSA 3AYRA 2WAGA 5HXMA 3AFBA 4XUQA 5DMYA 5D9PA 3U5UA 2J7DA 4CU9A 4WKAA 2EPKX 2VR4A 1V0MA 5LA0A 4LGXA 4JFVA 2AAAA 3ZT5A 3W38A 2UY4A 3ARPA 2W92A 3C7EA 2WNWA 3CKHA 1JZ8A 1UH4A 5FKYA 4A44A 1BVZA 2XIBA 3THCA 4BQ3A 2XIIA 1TVGA 1KWKA 1ECEA 3EDFA 4A3HA 3D5HA 3T08A 3BAYA 3IAPA 3J7HA 1BG9A 4CGTA 6A3HA 2XN2A 1JI2A 1IQDC 1UY0A 3AS3A 1OSEA 1DWFM 2WZEA 4J27A 2EPNA 4AXNA 2WLYA 5I24A 3MV01 1HJQA 3N17A 5I5RA 4HTYA 5F7UA 5CGMA 3I2HA 3WH5A 1KBKA 3LRLA 3VGFA 4UTFA 5IXEA 1GPFA 2WLZA 6TAAA 1SYTA 2X2JA 3FW6A 1LLOA 2GK1A 2DDUA 3NDZA 2GJXA 1V03A 1M04A 2JFEX 3AHXA 2Z1SA 1W9SA 1KBBA 2BXZA 1CGVA 5BRPA 3F4VA 1HP4A 2D3NA 3VIIA 3WY4A 1JYNA 4XUOA 1GU3A 3T0BA 5JBDA 2WO1A 2C9KA 3AISA 5BYWA 1H5VA 1E4LA 4AAXA 2J62A 2CITA 3NSXA 1ITCA 2OYLA 4B15A 2VX7A 1OD8A 2CBUA 5M17A 3VIOA 3AOFA 3WF0A 4UR9A 1VF8A 1JG9A 2J1TA 1WZAA 5D9OA 1ZBKA 1W9TA 3ACFA 4M80A 3WDJA 4CU7A 2VZUA 3BUDA 3BVTA 4WLCA 3HOBA 3OB8A 4UFHA 2GJPA 2HISA 2WUHA 1OGBA 2NT1A 2X0YA 4UCFA 2V4VA 3KLKA 1V02E 2JF7A 2OYMA 3VILA 4JL2A 4ATDA 5ECUA 2ZWYA 2GJRA 1SMAA 4UNIA 1P6WA 4H8UA 3WEZA 1VEPA 4KRTA 3FNDA 5JIPA 4LKSA 3CO4A 1TVPA 1MW2A 2WXDM 3DX0A 1NUKA 2CKRA 1FA2A 2OSYA 1NP2A 1DHKA 2EEXA 4OYUA 1EXPA 3VSTA 1MPXA 2HLEA 1E56A 1JXJA 3WF2A 3GBDA 4OZOA 3NJXA 2EJ1A 2YA0A 1N82A 1B30A 2WMHA 3S6TA 3CZUA 3SCPA 1J0JA 2E9MA 4TXEA 1J83A 1E1FA 3BGAA 1WCGA 3NQHA 1SDDB 4CUBA 1CIUA 2OW7A 2XVNA 2V72A 3P1IA 2YL5A 3IJ8A 1GZJA 3WUEA 4KI5M 4J3UA 4AD5A 2J25A 4V2XA 1TMQA 1OH4A 3ARVA 4BQ5A 3CUIA 3WD0A 4PRWA 3UNPA 2A3BA 4PMVA 2X05A 4NI3A 2EPOA 3WD1A 3KL0A 1XD0A 3EBVA 3SKVA 4PCTA 2VQTA 3D52A 4OJYA 2CXGA 2WVVA 1HXJA 2WMIA 3PTQA 3NSMA 2XHNA 1J11A 3W82A 1OGGA 1CXHA 3BAWA 3WDRA 2XVPA 2E32A 1PIGA 3FAWA 3DX4A 4B3LA 4BCEA 1LG1A 4UQDA 1W91A 1H0IA 4Q22A 4W50A 1R86A 3WL1A 4LPLA 3O2LA 1UWIA 2DCKA 2WVSA 5HBFA 4IM4A 1M53A 1QW8A 3CH9A 4U5IA 3CLWA 1JDCA 1UYXA 1ULOA 1W9PA 1JU3A 4PTWA 3SCOA 1FOBA 3CZNA 1VFUA 4FLRA 4Z2JA 1PEZA 4J3TA 1SG3A 1W9WA 5A6LA 3ETPA 3LMYA 4IUGA 3PZOA 2XGIA 1G9HA 1PX3A 1XH2A 1NH6A 4V27A 1OGSA 1U33A 2EADA 2DEPA 2DIEA 1OIFA 3AXXA 3A47A 4ML4A 2ZXDA 2J47A 2ORXA 1UWRA 1ISVA 1J84A 2PC8A 3QHMA 4IISA 5CQ1A 2WW5A 1PZ2A 3BAKA 4FNUA 4U31A 2JKXA 2QQMA 1LL7A 1UWWA 1GHSA 2CHNA 4JFSA 4FI9A 5DPNA 1W3KA 3GNPA 1R75A 2ZE0A 3T2QA 4GWIA 3ZJKA 4MNKA 2J1UA 1JZ2A 1VFMA 5EJ1B 2G8ZA 2YL9A 3EDKA 4KH2A 4ACZA 4OBRA 3ZO9A 1HP5A 4AZ6A 2E3ZA 2O9TA 5BXRA 4RYDA 4P8XA 1QVBA 2QQJA 3LPFA 4ZE4A 1UASA 1DEDA 1W2PA 3I2GA 4Z2LA 4CN4A 8CGTA 2W47A 1W3HA 1R7AA 3MSDA 2KD7A 3NDYA 2IGTA 2EPLX 1V0LA 2VURA 5GPRA 2YKKA 5M3WA 1X6NA 4P8UA 1UX7A 1OD0A 1XCWA 5I78A 5I23A 1K9DA 3WQ4A 2E4TA 3RIKA 2OWCA 3W81A 2XSAA 1KR1A 2XWEA 2QBXA 1ISZA 5JBEA 3ZSSA 4WF7A 2CCRA 1NOUA 2BHZA 2BGOA 4FNSA 1VJZA 3IDAA 3OIHA 2GJXB 3BVVA 4OOUA 1B2YA 2VZ1A 4LYQA 4X0VA 1QOXA 3AMGA 3SURA 1E73M 5A6BA 3TTOA 1E6NA 4GXPA 3VGHA 1GNYA 3P6BA 1BYAA 5HNNA 2PWDA 4JHOA 4OOZA 4UQAA 2C26A 4PMOA 1LWJA 4D1IA 3GNOA 5BXPA 2R7EB 1BVNP 5HDRA 4QLLA 2YLAA 1TUXA 4WSKA 3PUHA 2PWEA 4HOXA 3UESA 3WQBA 5B4NA 2DGAA 2Y2WA 2J8FA 4M81A 2VRQA 2DCJA 1IV8A 1M7XA 5ABGA 3NNGA 2WPGA 2PBOA 2D2OA 3T2PA 2YFZA 4XZBA 4UQEA 2J1EA 4CD4A 2OSWA 1GOKA 1Q6EA 1QWNA 1WZKA 3WY1A 1UWTA 3AS2A 2EIDA 2VRJA 3HJEA 2E40A 1AQMA 1FHDA 4MDPA 2VZQA 3N18A 4ZE5A 1V3HA 4BA0A 3I2KA 2O92A 2YDQA 2CIPA 5D8WA 3LE0A 1E6QM 3WNKA 3WQWA 2YFOA 1R46A 1M03A 2JIEA 1H49A 3CBWA 4EKJA 3II1A 3DC0A 4BQ2A 3LRMA 1KFWA 3PZQA 1V3MA 4GIAA 1K3IA 2ZEZA 1UMIA 4W7WA 5BWFA 3WF1A 2VZ3A 4HOZA 2YA2A 1Q6DA 4CUCA 1V02A 2F61A 4ZY9A 1Q6FA 1WB0A 3KL5A 1QBAA 1J01A 2WVUA 4CN6A 1U30A 4DUVA 1OT5A 1V3JA 1CXFA 3LPPA 4HMEA 2YOCA 2WB5A 4ZXOA 1JNDA 5I3DA 2D20A 4AIUA 3ACIA 1UZ1A 1L0PA 3F5LA 1B3VA 1H11A 5E0FA 4LQRA 1DWIM 5ABFA 3HG2A 4AY1A 1W1PA 4GZIA 1GQJA 4UOZA 7TAAA 4QB6A 3EJRA 3MMUA 2WC3A 1H6YA 5A8OA 5DN2A 2YFNA 1QHOA 3WEMA 4GI8A 4CUAA 1E15A 1V6UA 4M4PA 1VFOA 3DHPA 3WUBA 2WZIA 3O6AA 1VAHA 1TR1A 1JAEA 4XUYA 1WDQA 2EICA 4DWSA 1R7OA 4NRRA 2A3CA 1RD6A 4AZCB 2XVKA 1BYCA 4WKHA 2WMJA 3FY1A 4RL3A 1H3GA 2VR5A 3BVXA 2VZVA 3ARUA 4QX3A 4PCSA 1ITXA 1ISYA 2E33A 2PWFA 2WWCA 3MANA 3BUIA 1CEOA 3VD4A 4PMYA 4P08A 3NIYA 1QBBA 3JXSA 5LCWL 2WMFA 2CNCA 5E70A 2UY5A 3VD3A 3U7VA 3BAJA 5GNYA 1G5AA 1BGAA 1JYWA 3WBEA 1GW1A 2XFRA 2CYGA 1RP9A 2WWDA 1Q6CA 5FL0A 3WD4A 4F9DA 2YL6A 3HZ3A 3WNLA 2VRKA 2G3MA 1R8LA 4PMUA 3L4YA 2EIBA 5JMOA 1JZ7A 1IZKA 3A21A 2YIHA 3UCQA 4LX4A 1B31A 1H2JA 2ZUMA 2VT0A 3ARXA 1W9VA 3A6OA 2OWXA 1I75A 2BS9A 4C7DA 4W8AA 2ZICA 2J77A 1NWSA 5CG0A 2VM9A 2WDBA 3W27A 1SZNA 1UQZA 1DWHM 1OINA 1XCXA 1C92A 3VDCA 4MAVA 1QWUA 4HZ8A 1A3HA 4P7LA 4PSRA 1R34A 5M5DA 4AMXA 3RCNA 4DO4A 1J9YA 4BF7A 2UY3A 2PBGA 2J7GA 1E43A 2G3JA 3VD7A 3CZLA 3AMCA 4BJ0A 1ZL1A 1QHPA 2O9RA 4MO3M 2VX6A 5A3HA 3RO8A 3N12A 3L4TA 1HVXA 4U5KA 3WDIA 4MNMA 1OCQA 1DTUA 3VDAA 1FH8A 4ZZ5A 4JIEA 3L4WA 1CZTA 3GH7A 4Z2IA 5BXSA 4X0NA 2Y64A 1HL8A 3WQVA 1F4AA 2WANA 1GVYA 1JU4A 1BHGA 1AVAA 3D51A 1JDAA 1QPKA 2F1AA 4W8LA 2XSBA 3GXFA 4JKKA 3AIUA 4Z2HA 4MJ2A 2WO3A 1VJSA 3GXNA 3POHA 2XM2A 3I2FA 1E3ZA 3DYPA 3T0DA 4K68A 1XSIA 2W91A 1W1TA 3HMCA 3B9AA 5A8MA 5D4YA 1C7SA 2Y4SA 4Z2GA 2WHKA 2D73A 1UWQA 2D0HA 1H4PA 4AC1X 3TTQA 3I2JA 3ABZA 1PS3A 1BQCA 2WHLA 1UD4A 3IJ9A 2G4FA 1TG7A 4DEVA 3SCNA 4D6FA 1GOIA 4W5ZA 1UKTA 2NSXA 1HJSA 2EPMX 4JKMA 3LXAA 2D0FA 1W99A 4A6OA 3DYMA 3AQUA 2Y6LA 3TV8A 3VD9A 3WQ6A 1E6SM 5CJ5A 1CLVA 3L4XA 1J0IA 1L7RA 5CGTA 4D72A 3M46A 4M24A 1OT1A 1TCMA 3UG3A 1G94A 4EAMA 4EANA 2W63A 2BFGA 2A3HA 2ZEWA 4PMXA 2WCGA 3WY2A 4NRSA 3VU2A 4UQBA 4MDOA 1VEOA 2F7PA 1WDPA 4AMCA 4DWSB 4F8XA 5C7GA 2JEPA 3KL3A 3SUSA 4W93A 1NM9A 1V0NA 2CBJA 1HTYA 3W5NA 4A3YA 5A8NA 2VCAA 3IANA 4UZSA 4QCEA 4YHGA 1J18A 3MI6A 1QW9A 3WD2A 1DP0A 4DXRA 5CSUA 5IHSA 1HT6A 1E6XM 5J1XA 2VI0A 5DO8A 1BPLB 1MXGA 3VNZA 1HX0A 1BYDA 1D7FA 3A5VA 1TE1A 3VM5A 2WVVB 2J7HA 4BS0A 3ZR6A 1NP0A 4J7RA 2W1UA 3CDZB 1US3A 2QMKA 1MW0A 2X8RA 4GZ9A 4AYSA 3HJRA 3PTKA 4M29A 1TA3B 1VFFA 1Q6GA 4LPCA 3GTNA 1H0GA 1E0VA 3EYPA 2QF8A 4P5YA 3CIHA 2GFTA 1XGZA 4QDMA 3BH4A 1UG6A 3A24A 2VMEA 3L4UA 1TZ7A 1RP8A 1MYRA 1US2A 3CUFA 4N0RA 4W88A 1UKPA 1LQ0A 3GXPA 4AIEA 4CD5A 3M6DA 3M07A 3S2CA 2CKSA 2XWDA 4W7UA 4YN5A 3RDKA 1HJXA 3PZMA 4D1JA 5BRQA 3E1F1 1CBGA 4PEEA 4NSBA 4A3ZA 4GKLA 1GOFA 4GWJA 4D6EA 4QLJA 2XGBA 2XONA 2BHYA 2F1BA 1XSKA 3VMNA 4NZCA 4GPNA 2RJ2A 3VUPA 1TQVA 1K9FA 5JXJA 1CXEA 4P02B 3SKJE 3VSUA 1ZBVA 3WMCA 5I77A 4Z2KA 3I2IA 4ZENA 4P7NA 5D8ZA 1JYXA 1CGYA 1UH3A 4GO9A 1F4HA 1TA3A 1XRVA 5FIPA 1PX4A 1KTBA 4GINA 3A23A 2E9BA 1OIMA 2J1RA 1P8JA 4RN5A 1B90A 4N42A 3UERA 1KEXA 4ET7A 1J0HA 3C7HA 1DWAM 4J3SA 1K6AA 3SCTA 4PTVA 2C7FA 3A22A 3NRUA 3HPNA 4U33A 1GUVA 3VGGA 3BSHA 1GCYA 3ARRA 2J79A 3ARZA 5EJZB 1MQPA 1UD6A 3GXIA 4A45A 4QCFA 4U3AA 4UQ9A 4MB4A 2FHCA 5CLWA 4ATLA 1W2VA 1V3IA 3BLKA 1JF5A 3B8SA 2J1SA 1W32A 1KXTA 3D4ZA 1JL8A 1JAKA 1JHJA 3MUIA 1D3CA 4U3CA 2F7OA 2W95A 1HF6A 5E0CA 4WSJA 1O59A 2WKLA 4HOWA 1EUUA 3CZEA 3AHTA 2FHBA 1HVQA 2OSXA 3WDHA 2RGLA 4GQRA 1E6PA 2GUYA 5HPCA 3HNMA 4CD6A 1BLIA 1OT2A 1JZ6A 4KMQA 2VMCA 3HU7A 1G0CA 1ULPA 2BY2A 2WC4A 1ZJBA 5A6KA 5CLTA 1CTNA 4TTUA 4UQCA 4W7VA 4HZ6A 3CIVA 3VIMA 1PMJX 3MBWA 1MWOA 2ZUWA 4TUFA 2YG0A 1J0YA 3AXIA 3OLDA 2J8GA 4AD2A 2ALWA 2D1ZA 4LYRA 5IJRA 2DT0A 2ZUVA 3U5YA 1FHLA 3DYOA 4MNJA 1GOOA 1KXQA 3CHDA 3LXCA 3C7GA 1XNAA 3GM8A 1GNXA 1VRXA 1LWHA 1KTCA 2W61A 3MS8A 2G3NA 3PZGA 4W5UA 1CXIA 4TX6A 3WH9A 2EBNA 1UR2A 4DM1A 3WQ8A 1EO7A 4XZWA 3OBAA 1XV8A 2PF0A 3AJ7A 3ZQ9A 4D0QA 2X09A 3GXMA 1KR0A 3PTMA 5D9MA 3K1DA 4JCMA 3BMWA 4NZFA 4HU0A 2C4XA 3MUAA 3G6MA 1YQ2A 2GVYA 3ARQA 1CGWA 3EDDA 4QX1A 4B16A 3G6LA 3CTTA 5IFPA 3WELA 2XTKA 4H8VA 4XB3A 2X2IA 2ZUTA 1BTCA 5HOSA 2CPUA 1W9XA 3PBGA 4AD0A 2B31A 2PB1A 2VX4A 3RMEA 4AD3A 5AC4A 2QHAA 1MVYA 2J7CA 3CMGA 4D6IA 3F5JA 2CHOA 2QMJA 5EIYB 3FHAA 4ARYA 1UKQA 1JDDA 5ABFB 5DFAA 2NW0A 4W86A 5A95A 1GORA 1QHZA 4XV0A 2YA1A 1UD8A 1UYQA 4JFUA 4YPJA 4W87A 3VINA 5CSYA 1W3JA 3AZRA 1UXZA 4AW7A 5I79A 3WN6A 3H54A 1LJYA 3CZ8A 4CN1A 1W9BM 4MAZA 3A4WA 4V28A 1V6WA 4ZXLA 1VBUA 3HNYM 2PI6A 3CZGA 3U7BA 1KGXA 2VOTA 2QQLA 3OGSA 3VVGA 1E6ZA 2Z1KA 4L0PA 4MGSA 4W8BA 4UFLA 4MB1A 3QGVA 1B3ZA 1UD5A 1JZ3A 3AICA 3WDPP 1KXVA 3K8LA 1UZ0A 1WE5A 1J0KA 2X10A 4CCEA 1X6LA 2WHMA 2ZIDA 2V5DA 4NXSA 2VZRA 4PYSA 2EO7A 1FP8A 4HU8A 3VIJA 3DX2A 1CZSA 3N9KA 2IXUA 2WM0A 1JD9A 3WFZA 5A2CA 1R87A 5FOOA 4AZCA 5E1QA 3NJVA 3BCFA 3OLEA 4URIA 1BSIA 5JXHA 1XSJA 5DT5A 1B0IA 3CZKA 3HEIA 2QQNA 1E6RA 4D6HA 2QQKA 5BCAA 1XH1A 1W8OA 2F7RA 4MNLA 2XFYA 3VKKA 2O9OA 1UR4A 1C8XA 2PQSA 3UETA 1ZB5A 4B9YA 2V3FA 4OIFA 3N11A 4PN2A 1C90A 1IT0A 2J7EA 4DO6A 4HZ7A 4PT6A 1FFQA 1OBAA 2VJXA 3EJPA 3HNBM 2ZXBA 3PZUA 4OUEA 3ZSTA 2JDAA 4UOQA 1TFVA 3EMZA 4MJ4A 3W0KA 4XZUG 3CHFA 4JZ5A 1KGYA 1QNOA 2XN0A 1UR1A 2XVLA 5JUVA 3L4VA 4WK9A 1B3XA 5A6MA 2WVTA 2W66A 4IPLA 1O7DC 1UY2A 1V3LA 1JZ4A 3AHZA 4CCDA 1JXKA 1NWTA 2DPEA 3IGUA 3PZNA 3AHVA 3N15A 4DXTA 5CPSA 5JXGA 1UOKA 4FNQA 2QQOA 3WL0A 5KEZA 2W67A 4DEQA 3WSUA 1CX1A 2XJ7A 1GQIA 3I3DA 1ZJAA 4QB1A 1NOWA 9CGTA 2BNJA 4CD7A 1AQHA 3QOMA 4D6JA 1D2KA 2TAAA 3OA5A 3W6LA 5A8PA 2F7QA 2WSPA 2JE8A 2WABA 3A4XA 4M82A 1CENA 2ZUUA 4J28A 2ZX5A 1K42A 4QX2A 2XOMA 1V0KA 3VIKA 1ZS2A 2LW8A 2WO2A 1E71M 5DF0A 3IB3A 3BN6A 3I3BA 1GONA 4AMWA 3MU7A 4L4PA 2QPUA 3W25A 1HKKA 1UY3A 3RPMA 4H04A 2AMGA 1NWRA 4M56A 1UR9A 3OLIA 4DUWA 2F2HA 1BAGA 2RV9A 3EB7A 1JIBA 1QX1A 3QOKA 2BV9A 2FH8A 1QI4A 5IDIA 1MW1A 4D71A 2J75A 2VMFA 2V3GA 2DSUA 4QAWA 1HKJA 3WMSA 1H41A 3QR3A 1WPCA 4B3KA 4JFWA 5AC5A 1CPUA 2BERA 3EMQA 1BGGA 4X9YA 4P7OA 3K8MA 2EIEA 1UKSA 3S5ZA 3BUPA 5DT7A 5I0DA 4UFIA 3WENA 1UHVA 3ZIZA 3FN9A 2HVMA 2W1WA 1LL6A 1JI6A 1GOWA 2WN2A 3ZJ6A 1NQ6A 1QNPA 2JEQA 4QDRA 4AISA 3TTYA 2C8NA 3BC9A 3LEIA 4OBSA 1JFXA 1J0ZA 3M7SA 3CZSA 2ZUSA 4QDQA 1EQPA 3VDBA 4BQ4A 5ABHA 3B9DA 3MO4A 1WZLA 2BGPA 1C3FA 1ESWA 3WEOA 3EJQA 3SEEA 1E4MM 3W53A 4JHZA 3VIFA 4E8CA 1GQLA 2DSKA 3WFLA 4FNPA 3VGEA 1CNVA 3RM9A 5JBFA 3CZJA 3AMDA 1J10A 4TX8A 1ZBWA 4HA4A 3ARTA 2QPSA 3W28A 4C7FA 4UZUA 4D6GA 2WSKA 4CKQA 4HPHA 2ZXQA 4H41A 5GQBA 1E0WA 1B3YA 4W85A 2BY3A 2RGMA 2YC2A 1E40A 1XC6A 4AG4A 2NT0A 2VCCA 3FAXA 4UFJA 1G1YA 2VMDA 3AROA 3K4DA 1HJVA 4ACZB 1WO2A 2CDPA 4H7VA 1GQPA 5KZ6A 4UOJA 4J3VA 3WNNA 2BBAA 4FK9A 3RM4A 2YDRA 1TQSA 1UR8A 3MMWA 1ODUA 2B9VA 5CZKA 2Y6JA 3GDBA 1C7TA 3VTRA 3SCUA 3WIJA 2V3EA 1H6XA 2WCSA 4CVUA 1PIFA 2VVSA 3WF3A 1MQRA 3HG5A 3T2OA 3AIVA 3RILA 4Q7NA 3ZT6A 1LNSA 4M8UA 1NX9A 1O8SA 3POCA 4FLQA 4TXWA 1R33A 3ARYA 1UYZA 2Q8XA 4RE4A 3TA9A 1VB9A 2DT1A 1CZ1A 2F18A 5A69A 3C7OA 1S46A 2WYSA 3HN3A 2FE0A 3H53A 1EDQA 2E8ZA 1PZ3A 2ZX9A 3THDA 3PUIA 5TD4A 2W62A 2VX5A 2WMIB 3PHAA 1QI5A 3D3AA 3W26A 3AMKA 3VDHA 3AZSA 3IIIA 3IJ7A 1EUTA 2X2HA 3ZM8A 2MANA 3AIWA 3SCWA 3K8KA 1W3LA 3A7QA 4BZYA 5EBAA 3OEBA 4QB2A 1TVNA 4AYGA 2D24A 4OGZA 3OGRA 2JD9A 4KRUA 3U37A 3SCSA 3CUHA 1UR0A 4QFUA 3OGVA 3W24A 3NCOA 5D9NA 4P7QA 2A3EA 2CBVA 3SCQA 3WH6A 3L2MA 1VEMA 1NARA 1K9EA 1HJWA 5I2UA 1XNTA 3BLPX 2E26A 2Y6GA 2Y6KA 1Q4NX 3SCRA 3QHOA 4KWUA 4CVWA 2V38A 4P00B 3LX9A 3NYDA 1B1YA 4DM2A 3SCVA 1VBRA 3OZOA 3GXDA 3DX3A 1GOQA 3BUQA 3TOPA 4ZXEA 2QV4A 1K12A 2GK1B 3VNYA 3MV11 1R47A 4AWEA 2PWGA 2DSWA 4AZGA 3VMPA 3TP4A 5FUIA 1EQCA 5GNZA 4GQQA 4PUEA 2Y8KA 1JF6A 4M1RA 2WCAA 2ZX8A 2VNCA 1YHTA 3PZIA 3LXBA 5A6BD 1HKMA 4FMVA 3GZAA 3EJTA 4UFKA 3BXWA 3BSGA 1HJUA 1UUQA 1T2XA 3AS0A 3I3EA 4GO8A 3LRKA 2Y5EA 4E2OA 1L8NA 4MOAA 5I6SA 2Y6HA 3AIEA 1XHGA 2G41A 4JKLA 4F66A 4TVUA 4ZFMA 1JI1A 4L4OA 5GNXA 1W9DM 4D6DA 1ZU8A 3U57A 1Y7VA 2CDOA 2D3LA 3MMDA 1GJWA 2CESA 1EA9C 2FHFA 2EABA 3CUJA 2D23A 4W89A 4LQ1A 1WAWA 2XN1A 2WZHA 3RM8A 4ZEPA 3K4AA 3MKKA 1UMHA 4XVHA 4WKFA 3DHUA 5E09A 3K4ZA 1KWGA 5A6JA 4HA1A 4LXFA 1PJ9A 2DH3A 4MB5A 2C0HA 3MUZ1 4LHSA 1CGXA 2YBTA 5CYYA 1EOKA 3K75B 1E70M 3VM7A 2OWWA 4DWSC 1L7QA 2VO5A 4S3JA 1HKIA 2XFFA 3AXHA 1EH9A 2CEQA 4U2YA 1K9TA 4OMCA 3VGBA 2V3DA 1KB3A 8A3HA 1R64A 1JNEA 2BVDA 3H55A 1GVIA 4GZEA 4GI6A 2VVNA 4KGJA 3BMVA 4UAPA 2JF6A 2JALA 1D7PM 2WN3A 4HP5A 4M4RA 3LEKA 3DDGA 5A1AA 1CDGA 3N1AA 4EK7A 4J3WA 3GYCA 3CMJA 1KXHA 1JGIA 3SEPA 4MB3A 2E9LA 2DH2A 4PQQA 4RE2A 3OG2A 3WH7A 2BZDA 3VO0A 1H1NA 5A94A 3AC0A 2OKXA 5C70A 4S3KA 4PTMA 1W9UA 3OZPA 3WQ5A 2J1VA 4Z2AA 3FHQA 1MFVA 1TQWA 2QLYA 1UA7A 3BCDA 3D50A 3ARWA 2DSVA 5DEZA 1R85A 2WHJA 1A47A 1VIWA 3HG4A 1I1XA 5FD0A 2VL4A 4YHEA 4P8VA 4GI9A 2D0GA 3T09A 2ZWZA 2J22A 2DT2A 2E0PA 1HN1A 4BXSV 1DWJM 2ZOXA 2BHUA 5M03A 3KE0A 4NX0A 1JZ5A 2WZ8A 3ZOAA 1CXLA 2VUYA 1CGTA 1BYBA 3NJ3A 2VZPA 5JXIA 2WC7A 1BFNA 4Y7EA 4FNRA 1ZBCA 5AY7A 3W5MA 1ISWA 4PTXA 1SMDA 3T0AA 1UKOA 1DWGM 3FXYA 1UH2A 2BY0A 2ZX7A 3N13A 1T0OA 1FP9A 3NSNA 4PF1A 4JCLA 5E6YA 4QLKA 1BF2A 3WDQA 3SUUA 2DDXA 5IFTA 1UQYA 3NUKA 4CD8A 2EQDA 1CGUA 1HNYA 3MUY1 1EDTA 4F79A 2ZXAA 3A4AA 1UA3A 3KWXA 1GOGA 1XD1A 1OM0A 6CGTA 1DYOA 1CECA 1C91A 1W1VA 1EGZA 3ARSA 2ZUNA 5JR2A 1EHNA 1MFUA 3EMCA 3ALFA 2VZOA 1LL4A 1O6IA 2ZX6A 1CLXA 4NZJA 1E1EA 4H8HA 2YB7A 2BVYA 3AIRA 4MADA 4FLSA 2J7BA 3AZTA 3ACGA 1LF1A 5A6SA 3CPUA 4NF7A 4JX0A 3AS1A 3AMLA 5EMYA 4ARXA 4DO5A 1GMMA 5CPQA 5C8BB 3CQOA 4KGLA 2YDSA 1KQZA 4D6CA 1G01A 1NWUA 3WBAA 1CYGA 3TONA 1OB0A 4TVCA 3EDJA 4UFMA 4P8WA 1RH9A 3VIHA 2YFUA 1AMYA 2XYLA 1QI3A 2VCBA 1UY1A 4XUPA 3O9NA 4AZBA 5LA2A 2J7MA 1WKYA 2YLLA 5EB8A 1KCLA 3SUWA 3CHCA 2DT3A 5B4XA 2W4XA 4JL1A 3ZR5A 1WDSA 3BAIA 2DQXA 4R5EA 4U2ZA 3SIMA 1UD3A 3L4ZA 1GQKA 1E72M 3VIGA 1I5PA 4XUNA 2FGLA 4C7GA 3SUVA 1V6YA 3DX1A 2YC4A 3BVUA 3WY3A 3WNOA 1PAMA 1KGWA 4B9ZA 3W6MA 3BVWA 5EFDA 3N04A 1JD7A 1CZVA 1E0XA 4AZHA 2W9XA 2V5CA 4PMRA 1JFHA 3LPGA 4W8JA 3GXUA 1NAEA 2W94A 2GDUA 5A8QA 2YJQA 3C8XA 3UG5A 1OD3A 4TVDA 1RYYA 1MXDA 2WK2A 1PPIA 4HPGA 3AHYA 4PMDA 5AYBA 4MPKA 1UXXX 4ATWA 3K46A 4F9JA 2ZEYA 3WNPA 1X1NA 1W8NA 1PBGA 4DWSD 2OW6A 2YBUA 2XPKA 1NOFA 1GHRA 5IHRA 4JFTA 2FYVA 4BDVB 2HYXA 1SR0A 4W84A 5BROA 5AYIA 2WBGA 1FH7A 5FCZA 1E4IA 4WIWA 1XH0A 4PBGA 2CBIA 2XQXA 1I1WA 7A3HA 3PN8A 3CUGA 1O8PA 1UWUA 3WKZA 4A42A 2W87A 3JUGA 3CV5A 3C7FA 3ZMRA 3WSOA 3KLLA 1EOMA 3WUFA 1C93A 4J3XA 1LG2A 3ALGA 3AIBA 4PMNA 1GJUA 3W29A 4DUXA 2O9PA 2W1SA 2W3JA 2WQ8A 3KEHA 1QI2A 3BLBA 2ORZA 2J4GA 3EDEA 2WAAA 5CXPA 4EE9A 2ID4A 4ZZ8A 4OMDA 3I97A 5A2AA 4XX6A 1FFRA 3UEQA 1OWQA 1B3WA 2IXVA 2J74A 3A3HA 3WMBA 1BG4A 3WUGA 3DECA 3WNMA 1H09A 4FNTA 2LS6A 3L2LA 3VMOA 1HXKA 4PUDA 4MGQA 5HPOA
chains in the Genus database with same CATH superfamily
4FAGA 5K1NA 4KESA 5H35B 3FFQA 4KRLB 5G04L 4QEEA 1R3KA 2NMNA 4KAQL 2H8PA 2CIIA 3FBQA 1R17A 2O5ZH 5IYYA 5CPTA 3GHEL 4GXFA 4X5XB 1VR6A 4K6AA 4O19A 2TSYA 5FYJE 4D8MA 4POZD 5FZKA 2Z8SA 1CICD 3OKDA 4DNYA 2KLSA 3S8WA 4B8EA 2W5FA 3GYRA 2E9GA 1LQBC 1QJU3 4RX4A 4F57H 4NQEA 2NXHA 3OEAA 2EG6A 2J8UA 4TIMA 2XACC 5GS2H 1OVSA 1S0IA 4E9WA 4QR6A 5K2ZA 5C4WC 1KLFA 3G6JB 2QDNA 1W8TA 4IDZA 4QHPA 3NFSL 3S8GB 4PWGA 5C0GA 2EAEA 4XP1H 3HI1B 4CCZA 4CCCA 4AB4A 2V5YA 4XKMA 4G7YL 4CDXC 2WMGA 1ZHNA 3N1QC 4P4KD 1WJ3A 3VHRA 3K71A 3EYVA 1MPAH 1QSZA 2VSKB 4L6HA 1NG0A 5J13B 1GGTA 1VLXA 4W70A 3CFKB 3HD8B 2X0HA 3OPZL 4Z7OF 3O1PA 2PCPB 4F37F 2OULB 1KC5L 4HNVA 2P5WB 4R4BA 5DO2C 3T8VA 1GZ9A 1EJUC 5D2NB 1XBZA 1K02A 3D33A 4XMTA 1V6VA 4I0WB 4DOHB 4CNIA 4PQ9A 5KSVA 3GI9H 2VJ0A 4C6FA 4IQJA 1KGUA 3T7VA 4E4PA 5KZMA 3CAQA 1PTGA 5EKYA 3NFNA 2IQ9L 3TFKD 5F88B 3M16A 3SDYH 3CDGB 1DBBL 3F7PC 5LZLA 4A8NA 2BDQA 3OG3A 2AQWA 2CXKA 3DX8B 5GGVH 2QUMA 1I9IL 2G75B 4UI9L 1DIEA 5GM0A 3N9LA 3S5NA 1TQTA 2K7QA 1TJRA 4LR4A 3O0KA 1H3UA 4IETA 4RWHA 5H35A 4JN7A 2IGLA 1PK6A 2BOBA 3BQ6A 3TSDA 1OFNA 2Q6WB 2BP1A 4XMWA 4XXAA 4E41B 3FS9A 4HNTA 4UINL 1KDIA 4C6QA 2Q8BH 4CU9A 4WKAA 2B4CC 4O1CA 4ZAKD 3ZT5A 3W38A 1BVLA 3FFCA 2ZADA 5C7ZA 2UURA 2UYBA 2H47C 3HG0A 2ITCB 2IANB 1ECEA 3EDFA 3MV8E 1DIDA 1KB5H 1BG9A 1OW0A 3C60C 1CX4A 1P53A 2PE4A 4MZRA 2VGBA 2WLYA 4LSTH 3U1SL 1DZQA 2HPTA 4RDQF 4OQTL 4A7VA 1KW1A 3FKUS 3Q5TA 3I3MA 1UUSA 3P0WA 3BPLC 3W7KA 3FW6A 2BDRA 3O0XA 2WWNA 4BCXA 2C1OA 1Z78A 3A12A 2F54D 1KBVA 2BXZA 3V5HA 4DBDA 2ZZ7A 3JQOB 4YX2L 1ND0B 1TTQA 5FFOC 3OJMB 4MD5B 4HSQA 1IEBB 5E00B 5DDHB 3KNBA 1EK3A 4A2GA 4OCXH 3AOFA 3RYRA 4MVTA 3WF0A 4UUIA 4LCIH 2HWGA 2GZXA 4AJWA 2GJPA 2NY7L 1WBZB 4UCFA 2V4VA 4GWMA 4IJ3C 4RMUA 2BNUA 2QCEA 4IDJH 3O14A 4Z92B 4A38A 5DX7A 1BQGA 2DYSB 3H9SE 4DP7X 1BD0A 3NIGB 1NUKA 3OZ9H 4Q29A 2OR2A 3S35X 2VLLB 3ZTDC 3LZ5A 1VLIA 3FT4A 4UT6L 3P5BA 2DICA 4L61A 1SFTA 1WQVT 2CDGB 1S2KA 4QOKD 2AXFA 3O1RA 1AO7E 4XQDA 3NQHA 3LCHA 3QC3A 1I7ZB 2Q0ZX 4MJIE 4IW3A 1GZJA 2GQHA 5BNPC 4APXA 5DYOA 3PTYA 4PJFB 5T3NA 4Z3HA 3DVIA 3M7OA 4Y2DB 5F7DB 4U6XA 5KBPA 4XF9A 3KM5A 5H4ZA 4QHBA 3MX0A 1DLHB 4PCPA 3VFNB 2AXWA 4WGWB 3FAWA 3PC0A 4ZONA 3Q9PA 4PS8A 1M53A 4PLJD 2PDQA 3C2FA 3V9FA 2QKIB 3EBHA 3LN5B 1M71A 1JU3A 1DO6A 3G7TA 4R9HA 5TJWK 4PJ7B 2OO0A 2B20A 3VOHA 3QIBA 4PDWB 1OE1A 2NYKA 3GPEA 4KDVA 2J47A 2ORXA 2DWDA 4NM8H 2ZSVB 2ZGRA 3BLEA 2FNWA 4UTMA 4JZOB 5A1FA 4OI4A 4KH2A 3T71A 4AL8H 4XPBL 3DXIA 3FEMA 4G8AC 3RI5K 5T5FH 5IK4A 3ZYJA 5DHXB 4QWWC 2QSQA 5TQ0L 2PCFB 4XCNB 1KR1A 1J5HA 2OKTA 3NR0A 5ADPH 2FBEA 2CK0H 2ZBJA 4HEMA 2BGOA 4FNSA 5D9SA 3BVVA 4Y89A 4Y33A 5JZ7D 4E4UA 3AMGA 5EIIA 3MLXL 4JM2F 3KYAA 3VDGA 4GXUM 2PP7A 4PJIB 4B9CA 5AOZA 3FT0A 4RSVA 5J8LA 2Z31C 1SEBA 4QLLA 5CJXC 1LNUB 4DHLA 2EE9A 3F00A 5B4NA 3ARGB 3TPKA 1CICC 3S6PA 3RR1A 2VENA 3NNGA 2HBUA 3MC5A 5FUCC 1DGLA 2ED8A 4RPQA 4HCRA 4PUBL 1IEXA 1B4KA 2COVD 3ETQA 1WA3A 3JT2A 4M6MH 3QTGA 3NPSC 4I13B 2R1NA 3BESR 3T2NH 1MCNA 4NAQA 2XJLA 4AYUA 3DKLA 1BM3L 1O66A 3I8TA 2AGJH 3TBVA 3NSJA 2QJGA 4JDTH 4HF5H 1QBAA 4PBOA 1YKWA 1WFJA 5C0IA 5TDOB 4LDOB 1DUZA 3VKLA 4A7YA 1U30A 1OT5A 3OVPA 1R3WA 4ZXOA 3SGZA 1KFJA 3PHMA 4Y9CA 2A6XA 2ADJA 4BZ1A 4GZIA 3BEVB 2EE2A 2WC3A 3N4MA 3QFDB 5LQBL 2Y36H 3TPUB 1JGVL 3HN8A 1TR1A 2HJLA 4XN2A 2WFF2 3AXKA 3ILQC 4XQWA 3MYJB 1C5DB 4ODWA 2EH7L 1A5LC 5T1LA 3TN93 1D8WA 4OCMC 2YD3A 1R5VA 2VM3A 5HI5C 3VBFC 5C2GA 2DYRB 3RAOA 3EYOB 4ELMF 2NXYB 5LCWL 3IPVA 1Z9SA 4IU3B 3O06A 1WT5C 2DZXA 1F05A 5DHVH 3FB5A 3IE4A 2MNWA 3NBNA 1E4XI 1F7BA 2C9SA 5LZ6A 1P6FA 2K7PA 3O3DB 1KN2L 4WENB 3WJJA 3H2EA 4WWKC 1XIIA 5FS5A 1NC4D 1IWBA 3VA2C 2ESVA 4MY8A 1ROWA 4AFDA 1FZKA 1OINA 2A73B 1C92A 4GXVH 3W1XA 3N3EA 5EU3B 1PD0A 3ZLQC 3O6LL 3ALQA 1IEAA 2G3JA 2IALB 1IKFH 2DQTH 2NP0A 1IWPA 3WYZA 1C08A 4IHOA 4ESKA 3AG1B 3HI5H 1EANA 1G9NH 1YYCA 4X0NA 4KVCH 2VFHA 4IGNA 1BHGA 4YBLB 3LCGA 1HJBC 1UM4H 5D1QB 1Y3TA 4W8LA 1ORSA 3TEUA 3GXNA 1VPXA 3H8XA 3DYPA 3UJIL 4K68A 4PRIB 1T0NA 4X7SL 3FCSA 4TLFA 3FCUB 2B7QA 1OCRB 1YHFA 4HSJA 1PS3A 2Q86A 4IGBB 3G1XA 1YMME 3OUHA 4YHPA 3UP1A 4DEVA 1V6MA 4RDQG 3ID7A 3VZJA 5MEOB 2AUYA 4JQIA 4ODSL 3AZVA 5I0YA 3N1GC 5E2VL 5AOUA 3THQA 3EHKA 1G6RB 3RI8A 4HWBL 4YC2B 1I3GL 2LU3A 2HJLB 3AKTA 1Z0HA 1FHUA 5HK4A 3MI6A 3S6OA 2J5WA 3GJFK 4N9CA 5KUKA 2JKNA 3HG1E 5I74B 4O1FA 4MMZA 3GHBH 3OY8A 4QPIC 4QX5A 1D7FA 2RS52 1LCOA 2WNOA 1YXCA 4J7RA 1HHJA 4HPXA 4XP6H 3LBMA 2C34A 4LPCA 1HEZB 2VQ0A 4DJMA 5J4MA 1OGTB 4NR1A 1UG6A 1BMV1 5E88A 5LB6A 2H0EA 3P11H 1TZ7A 4Z1VA 3QFJD 4HT3A 5JOFB 2HWF1 4OFKA 2FTAA 4EAEA 4ZFOB 1QTYT 1ZZ6A 3FYEB 4YBQD 3BDYH 3EEGA 3N2BA 2VNOA 4DPAX 1XSKA 2EIZA 3RYPA 5HGBB 3D87B 1CXEA 3F4DA 4RRPM 3W00A 5CBAB 1YQVH 4EVNB 5DBTA 1CGYA 1JCKA 1ZANH 1F4HA 1KRBC 2Y89A 1Q8JA 1EGMA 4AT6B 1P69B 1UXWA 2XZCH 3MJGX 1MCOL 5F3BB 2XPZA 3F12A 4XBKA 1T99A 4UBPC 3IRCA 3VGGA 2PHFA 3DOSB 1UD6A 4I1PA 1W6OA 1X4ZA 4Z7VE 2GGJA 4KI5D 3M0ZA 2WTRA 3UU0A 4GAAA 5A32B 5HYJE 2G1MA 1JAKA 3QJHA 1E6JH 4LOEA 1FWIC 4BZ2L 4KGQA 3GZUC 3THPA 4TR9A 2EKGA 4AJVA 2WR9A 4UTHA 5E6UB 4H88L 4RDWA 4RV8A 3WDHA 5IJCC 4AJ0A 1E6PA 4AE2A 4X9HA 4FOWA 5TK4A 3HURA 1ULPA 2P3KA 3KD4A 1ZJBA 1R3IH 2NQ3A 1YPXA 1HRV3 1JN6A 4ZYKA 3VB8A 4XN8A 4KZEL 1BEXA 3DO4A 5DMKB 3SKNA 4IEYA 4TZDA 1F3XA 4KCTA 2G5BA 3MS8A 1YA5A 4TX6A 5EEYA 5JU6A 4PRAB 1EO7A 4PJCB 4K5OA 2PODA 3MRJA 4HWBH 3IXTB 2VAJA 2WAQA 2DWEA 4YZ3A 3GXMA 3W6YA 1RCYA 4XE5B 1F11B 4DKTA 3ONBA 1AR82 3EDDA 2GT9A 5GLUA 4MG2A 4MZ2A 3NZGA 3MMEB 2V5KA 2X2IA 5F5AA 1GSKA 1XLDA 2VOMA 1GC1L 4NQEE 1Z5LA 1JTTA 4NP4H 4TMCA 4TF4A 2OBGA 3N40P 1PWLA 4WZ9A 3GDLA 3P8JA 3FTYA 5DVLA 1RA0A 4LLDB 4PGJA 4PUKA 3NABL 3NOYA 2Z6IA 2CLRA 1FH2A 3MBEC 3TZVC 1ZPTA 3AZRA 4YGBA 4GYFA 4P9HC 4HJTA 4DZ8B 4OV4A 2C3XA 3MA8A 1TPUA 3A4WA 2R0ZH 3OGSA 3OGCB 1W03A 4QXCA 2O7SA 3MW4A 1MF2H 3LKPB 1KIRA 4GW1A 4WJ5A 3Q06A 3R7QA 2O5XH 2F2KA 4B9JA 4RS5C 3UPBA 3NNTA 3L2YA 4M8QB 2JQAA 5A2CA 5ACA1 5FOOA 4EQ2A 2X1QA 4LSVL 1AO7D 1D2QA 3HEIA 2QADB 4XRCA 1XIEA 1UW9A 4YG0A 3QJSB 4L1WA 3CQ0A 3DBSA 2HQAA 1W8OA 1M3UA 3GEFA 3AY4C 5I3GA 3GR4A 2GUBA 1C8XA 1M05B 1BAFL 1CAXA 1C90A 4PJCE 4OUEA 1JTOA 1PO22 3S98A 4S10A 4Z5RA 1MAMH 4FQCL 2G9HA 5A6MA 5FZLA 4H14A 3WBWA 3QULA 1SM9A 4M8QA 4OW6A 2F6UA 3LCYA 3NP4A 2W67A 3FVDA 3D25B 2G0WA 4QQOA 4XEZA 5D1XC 3VUAA 4M82A 4WX2A 2K4WA 2GY5A 1M4KA 2ZX5A 5JW3H 3SPGA 2WOQA 1XIMA 3RWFB 3AZXA 5AYUH 1UY3A 1LRQA 1PLGH 2C7UB 4PUJA 3BUCA 1BAGA 5I17A 4J8RA 3EW3B 2I24N 4IGMA 1U22A 3AZZA 3L16A 3VXMD 5EN2B 4QWNA 1HQRA 1FKXA 3AYCA 1GZQA 1YY9D 4ZOEA 3W9DB 2GAUA 3FN9A 1CVSC 2EUZA 4LWWA 1QLRB 1IKFL 2DQTL 3FO1A 3D3VB 2OUHA 2JEQA 4AQAA 4FA6A 1S2TA 4GS7C 5DHYB 4KJWD 2ZVRA 1TME3 4ZUUB 4X4ZA 2NY0C 3PULA 1V7NH 5ABHA 3MO4A 4YE4H 1W5NA 3EOAA 1ZLSH 3KVQA 1A1MB 1T66C 3RMJA 5CMAB 3GK8L 2PGWA 4G5DA 2YRLA 4OFYD 4JX4A 5FUPA 4AVIA 3UJJH 5FUOL 3V8CA 5BUGA 3LZOA 4JIQA 3FOLB 3UGFA 4NYYA 3SRFA 3ROLA 3O8XB 5FTTC 3LBOA 1G1YA 3NZ1A 4IU2B 3AITA 2CLZB 1GKRA 4G1EA 4J3VA 4R0LC 1ZKAA 1TQSA 4Q97A 2ESVE 3MRPA 4UYQA 1Q90A 4N9IA 1MQRA 2UZXA 2HH9A 3NJHA 3POCA 5I16B 4ZZ9A 1A5MC 3CN0A 2I9TB 3DRTB 1WLDA 2GNTA 4YHMH 1NC2A 2VQ1A 4NHUB 5A3NA 5LAXA 2PYEE 2KC0A 1JZIA 2V5SA 4POCA 5DXXA 3PHAA 3POSA 1OPGL 5IREA 3AMKA 3SCWA 2W07A 2NR6A 2A79A 4LVGA 1ONAA 3BIAX 4KU1A 3HLAB 3O41B 5L7OB 3BYTA 1D6EA 3BLDA 5CAKA 2CYFA 3W24A 4YSSA 5D9NA 5HQMA 5HYJB 5HYSB 3ZFFA 2ENPA 1XF2A 2HBTA 4P00B 3APFA 1T66D 1Z6KA 4HMNA 5FC9A 3BANA 3S36H 5HHNB 3OG4B 4E4FA 3VMPA 4PUEA 3H42L 2ZX8A 5L0QC 3VI4E 1S1AA 5J5EA 2BVPB 4Y1SA 1HH9A 3BQ5A 2FQFA 4CDWC 1KDMA 1TO5A 1WEJH 4YVNA 4X9FA 3QV8A 5GNXA 1W9DM 3LKSA 3MW2A 5DK3A 1FWFC 5T5LA 1NE6A 1EA9C 5TIMA 2EABA 5FJUA 4ZK8A 3UJTH 1LQ2A 1PHWA 3LZNA 3UAAA 3K7UA 1FWDC 2XZAL 3MXVH 4HYVA 1UJ3B 3O6CA 1A4JA 3FMGA 1MCQA 1FSKC 2YBKA 5E99L 1EOKA 1S2AA 4W9HC 5T3ZH 3S1GA 4DWSC 3O1UA 4JJOA 4PB5A 2I60H 1EH9A 2AZ5A 3PBVA 1M2OA 1GXEA 1PD6A 1G7JA 2FO8A 4NM4H 5CJNA 1OM3H 3PNWA 4JFEE 5E99H 2XNAB 2VM4A 2CM6A 5I8CB 3UTOA 1RUJ2 3CEWA 2KDYA 4M4RA 3MLSH 4XSMA 3NEXA 1CU4H 5IESH 5LHDA 3U6RB 4N43A 5FXVA 4G8GD 3WH7A 1FATA 4XNMB 4FXSA 1FWJC 1ICSA 4FFFA 2R062 2QLYA 1OAYH 1G9EA 4BQBA 5HYEA 1A47A 4Q4EA 5FAJA 5AW9B 3SY5A 2ZWZA 4V1PA 4BXSV 4XZPA 4HS3A 2ZHNA 3QOPA 1OAZH 3ZKSD 5IV2B 4Q8BA 5EDXA 3ZOAA 5JCTA 1RUF2 5SWZD 1GYVA 4Q0XL 1MFDL 3UW6A 3O41A 3QO1A 4DELA 3CD4A 2QCHA 3HS0B 5D5MA 3S88H 2X7VA 5I8EA 2ZX7A 1BXXA 1FP9A 3PWUB 1E3FA 1IQ8A 2BRTA 3BP6A 1A5NC 2DDXA 3UPRB 2IH3B 3IWVA 3C60A 1W2AX 3UPMA 2HTKC 1ZXKA 5EZOH 3ARSA 2ZUNA 3UYJA 2VZOA 4X42A 1LL4A 1CE6A 1FN4B 2ZCWA 3J8F2 5JHBA 4DJEA 4L37B 3U0WL 2YQ2A 2LRPA 3C2AL 1LEMA 5C8BB 4R4FH 4H19A 3VI4F 3DV6B 3TONA 4RLDA 1L3NA 4NI8A 4PHZA 1AMYA 3T77B 4MLSA 2AMXA 4XUPA 4FPKA 5T5NF 1GZCA 3G1YA 2DVUA 3BW4A 5FM8A 3LM7A 3MOBH 4ICMA 4UQ2A 4NZRH 1DN0A 1CBVL 4WGVB 1B9KA 2E9WA 3P3UA 4U2ZA 3VXGA 4ZAKA 4XBNA 1RUJ3 5EHFA 3RI9A 1SJEA 3SUVA 1HGYA 3ZKNC 3W6MA 2AMUA 1UMYA 1CZVA 4A21A 1H0BA 5I0RA 2D4FA 1XDLA 2FTWA 3CX2A 2ISWA 1ZEAH 4NCC2 1Y6NR 4MJZA 2ZEYA 4ISVA 1AXSB 1OGAD 3SJVA 3OR7B 1Z9NA 4L65A 1T04B 3P9WB 1RFDH 4PRHE 4TUUA 2Z35B 5SV3A 1ZLSL 2CO6B 1ZCRA 2A75A 4XHJD 1YRRA 1S9VB 5AHMA 1K8CA 3W1QA 4GUPB 3F7YB 4IIQC 5CWSB 3PS7A 3AGVA 2IXVA 4Q3MA 1XAUA 2BIIA 3DECA 5E2UH 2OMVA 3EBIA 4Q89A 4FFHA 1MIML 4BI6A 1HXKA 3NKTA 4G6KH 3OHIA 1FCVA 4NKOA 4GYKA 3SO3C 1YNTF 3BPZA 2V30A 4H9YA 3EH5B 1L7TL 1GOMA 5BNPB 1IZJA 5HR6A 3QH2A 5CC7A 5C3OA 4Z7VF 3ZYFA 4WWKB 4IMFA 1KCKA 2JXMA 3LKOB 2R073 2HTLD 1NFDF 5IMMB 1I2NA 1UU4A 5L2JB 3HPFA 4IEZA 3PAUA 1AJ7L 1EEYB 1VENA 3QZPA 3SUTA 5I28A 4MQXD 1J8SA 5B21A 1W5PA 3O0RL 2DUXA 4AAPA 4LVDA 4I87A 3HKFA 4GCAA 4E0RB 1M01A 3PANA 4LHNA 1AS6A 5J1AA 2W1QA 4R26L 5HVGB 5E8PB 5B38A 2PWUA 3PDDA 5F8QC 3ZYBA 1HQLA 2YQBA 5DD3H 4ONVA 4MX7B 3NPUA 3D39B 1G9MH 5BRBA 3GMQA 1NKRA 3GG7A 4H2CA 2IH9A 4U0RB 2SEBA 2AC1A 3H3ZA 1KBWA 1VMFA 1DQ2A 7CGTA 4YWIA 5E9DE 4L4JA 2LE9A 3O6ML 1LU1A 1ICTA 4IFKA 3WW4A 1NAML 1KUMA 3X12A 4FTVE 1OXCA 1MHCB 3TJLA 4N3UA 1MCCA 3MOAL 1G1CA 2ZWSA 3TCLA 3VWJA 1HHKA 1P0DA 4AEFA 3N44F 1R5WA 1TQUA 2OELA 3BQUA 1LHOA 4ZOCA 1EAPA 3VFPA 5FZCA 3QFEA 2Z2UA 4HJGB 4BPZA 1W8EA 4BEQA 4NENA 4NNYB 1PGRB 1RUKL 3D4YA 1GS7A 5D7SH 4GZJA 4O9GA 1KCRL 2YGVA 3LKRB 2P2KA 1FORH 3T04D 4LEOA 3KW7A 3ECQA 4GH4C 4R5TA 4XURA 1GVOA 3IVKB 1HZLA 1N1TA 3D2TA 3BUBA 3B03A 1MAKA 5GHWL 2ZXGA 4ITCA 1Q8OA 1HHKB 1NLQA 3B69A 4J6RL 1XBDA 3QQ1A 2VQ4A 4EE2A 5I07A 2XWTA 3L3GB 4NC0B 4A7GA 4QRRA 3U7YL 2OMUA 3KR3H 3ARFD 1SY6H 2YSTA 4L8BB 2Y33A 1U8NB 4IEWA 4NKDA 1XXXA 4AH7A 3F8UB 2PHDA 4Y4HA 5IVYA 3S9DB 4KWWA 4PMEA 1AHKA 3BZEB 3LKJA 2YD8A 1DVFB 4PRPE 1FO0A 4NQDB 4OJFH 1JI2A 5L7OC 3VKJA 4AGQA 3VFOA 1IVLA 4JANB 4OI7A 1X8MA 4M93B 1MCPH 3NG3A 5C0FA 3MHGA 1YNKL 2WZ5A 3LEYL 4W6YB 4XMIA 3F4VA 1ZFJA 1XTMA 3AISA 4O50A 1H5VA 2CITA 2FQPA 1SQ2N 4P2OD 3L5LA 3TMLA 5M17A 3FSOA 1UQSA 4FLHA 5MENA 5HJYA 1P1MA 5T50A 1EYBA 4M80A 1I8MB 2Q1EA 3TN3A 2A85A 3U4AA 3TO4D 3VILA 3VFOB 2F8XC 1JPKA 2BFVH 1P6WA 2P5WA 4H8UA 1V8EA 1ASQA 3C09C 3JU9A 1F00I 7ODCA 3B7YA 1DHKA 4PJDB 5FAXA 1EAPB 3VFPB 4N2LA 5GJTH 2DKUA 1VRH3 3KLQA 1WCGA 1SDDB 1TZGH 3U2IA 4RZCA 3LKRA 3ZHNA 5GS0C 1TMQA 4G3YH 2WD0A 4ZMWA 4U3SA 1PGW2 2RHPA 4EIUA 1W2OA 1X5GA 1MZHA 4B9GA 3JZUA 5KANI 3WZ0E 2NNXA 3W82A 4AQEA 2X7LA 1RVF1 3WDRA 2XVPA 2JB6A 2R0LH 4PWIA 3BPLB 4DZAA 4WZCA 5C3SA 2IPUK 3SDAB 4G9FE 2WVSA 1DJSA 2VKZG 3WJLA 1JJUA 5FUCE 2IQ9H 2QVKA 4AEDA 3ZHKA 4EXKA 1AHWC 1EWHA 5DJ0A 4S3BA 3UJFA 5BOPA 3CN4A 4UQIM 4J3TA 1AGDB 5A6LA 4DPBX 3RTQD 4NHCL 1Q9KA 1PX3A 1NH6A 1HQTA 3MI8A 1KGCE 1XUUA 1OIFA 2CO7B 2WNZA 1UVQB 2DW7A 4LCWA 4FYQA 1QFOA 4IISA 3UFIA 1X5MA 4ODSH 1DVSA 1JHKL 4JFSA 5JW5A 3WU1A 5DPNA 4GWIA 3B3DA 4Y5YB 5CCHE 1CMOA 4IIQB 2E3ZA 3QJOA 3QDGB 4NU7A 2V5BA 2D7NA 2NY3B 3TN92 4JC1A 3BWUC 5C09A 2P8BA 2EPLX 4YX2H 3HBZA 4XPVA 3GMPA 4MGYE 4B4QA 1PCSA 2BHZA 3OIHA 4HCDA 3EXTA 4HIPA 4I3SH 4GHRA 4WBBA 1EP1A 3UBGA 1N8IA 2Z31D 1BYAA 3CT2A 3UKVA 2X4RB 1EDYA 3IMRA 1RITA 2IH1A 4PR5B 4QPYA 2JGQA 2Z28A 2R7EB 3POWA 1KM5A 3W58A 1OKEA 2EKSB 1DHKB 4IIQA 1QPPA 3B0YA 2XWBB 3FU5A 2VRQA 5BOEA 2A6KA 3T2PA 4JDNA 3GI8L 4Z3IA 5DO2D 2NWRA 1Q6EA 5BQDA 2VXSL 4RMVA 1QWNA 1A1OB 3AS2A 1FHDA 4UDTA 3SZKC 4N5UA 3N18A 3USZA 1X7SA 4QGCA 3F6LA 5SX5K 4C59B 4Z07A 3UAEA 4PW4A 2V9DA 3CBWA 4S2SB 3P30H 2X4QA 3DX9B 4M5PA 4B0MM 4R7NA 4XP9H 4RNFA 2JELH 5G5IA 2DCTA 5K0UC 4KG0A 1T1XA 5D8AC 1A1NA 1S8DA 4C4KO 3S9IA 1DJGA 2YD1A 2MCPH 3IU3B 4ANWA 3G1VA 4DP0X 1XDMA 1AUYA 2XV2A 2DYPA 1T7VA 2RIKA 4Z3FA 2YBRA 3SKJL 2J73A 4QITA 3V4UL 1E9QB 3L81A 5MI0B 1EJXC 1W1PA 5DVOA 3R8GA 4LHUD 5AC91 4UR7A 3GIQA 4OSUH 1NMBL 3SKMB 1SYSB 1I3UA 2WZIA 5HY9B 3QUML 2C6QA 3CDGA 3FONA 1WDWA 5DDHA 2WLNA 4DWSA 3KXFD 2A3CA 1UQXA 2ED9A 1UM5L 1WXYA 3F7KA 4OKVB 2K4AA 4QCIA 2B0SH 4YHLL 2GJ6A 4WW2A 4DT2A 4ASTA 2E33A 2WWCA 3BJSA 3MANA 5HQEA 3QNYA 1GZPA 4OLVL 1CFVL 3UTSD 1ZBE1 3O4LE 4IXLA 4PJIE 3DFNA 5C07E 4HHLA 2NW2A 3JZEA 2OMWB 3OX8B 3ENEA 4B97A 3FEQA 4OLUL 4KJYB 1DFXA 3RU8H 1V5XA 2QJJA 5L7XH 4OZFA 3IKWA 2VRKA 5DJXB 1U95B 5HMFA 4XG1A 1NMAH 2VISB 3ABOA 1OL0A 1FQ0A 3A6OA 3QDJD 2W3ZA 4DIAA 1VYSX 3U8GA 1NWSA 5D1XA 2WWJA 3B4UA 4COZA 4Y9OA 2VDPL 1UO9A 1KKOA 1YNTB 3RNKA 5CSZA 1JK9B 3IMSA 2NMOA 1WBFA 2Q01A 3P3TA 3RKDC 5BRZA 2PBGA 4GALA 3MN8A 3N9PA 2VLRE 3GSUB 3CZLA 3AMCA 3V5OA 3RO8A 1F4XL 5PCYA 5IF0B 3UBXI 2ALDA 4K7YA 1I8UA 3B8UA 3MZHA 4WRHA 3S4SA 2QF7A 1U95A 1KJ3L 2WANA 1DANT 4X9GA 3OXSB 2Z93A 3TJEH 4XAKD 2NVCA 4AGOA 1RUJ1 1S9XB 2QKDA 1J8HA 3ZHFA 4JY8A 4IMKC 3EFOB 1Y1UA 1XRSA 4LSVH 4I0BA 2BSBA 1W0VB 5BS0D 2OZ8A 3ZVHA 4PLJC 1OD5A 1UD4A 3P7YA 4BFFA 2PDYA 3NN8B 5HDQL 3UJOA 4XNXL 5FKCA 1N8OE 2A4EA 1NCRA 1NANH 4LDLB 5LNVA 4TRPH 5MP6H 5KYWA 1RK1A 2FGBA 3EKCA 2F7PA 4I0KA 4I9WD 3KRZA 1UOVA 4J3OH 1EA0A 1NM9A 5A8NA 5DC2A 3ZGIA 1SACA 2Y38A 4KW2A 4U3HA 4IF2A 4RFOL 1C4RA 1LEKA 4LEFA 2C3VA 2FX8H 3CDZB 2QMKA 4ZMLA 3SY6A 3HJRA 1P1ZB 4KTEL 3C6LB 2H1XA 4GJIA 2LFGA 3CVIH 3BH4A 1NY72 4HZAA 1T89A 5DMGC 1E5ZA 2QPFA 3CFCH 1IARB 1FNSL 1MEIA 4W7UA 1LD9A 1K5MB 4Y1YA 3UXAA 3K72A 2G2PA 1NMBH 3ULSA 1AR63 4MZIA 4G8GE 4P3CL 1FOD1 4L11A 1TTCA 1S38A 4AI7A 4NOBA 2RS31 4NZCA 2CY6A 5AW7B 1U5YA 1YEKL 4GRWB 4S0SD 3SKJE 2Q2LA 1YC8A 4OZIA 3RX9A 4XP5L 2HWE2 1JVLA 4GO9A 3LKNA 5I1HH 1TA3A 4Y1AA 1W5QA 2JNZA 2L04A 4DWHA 3LKQA 4I18C 3OJBA 3C2RA 3M17B 5HHPB 2VNVA 1ZWIB 2AK4D 3NCFB 1XXFC 3GK8H 1W28A 2BJSA 3ARRA 4QAMB 2ZUYA 3H2MA 1KN4L 1JF5A 4ZTEA 3EYQD 5KHKA 1VBB3 1S2VA 4OZGE 4GW4B 4JFHD 5EIIB 4M3CB 2OZTA 4QS6A 2PO6D 1M4WA 1EUUA 3OBEA 1RZIA 3HMJG 3IVUA 4LBAA 5CZRA 4QXTA 2ZX4A 4TNWK 4GYBA 1FTXA 1KCBA 5H9RA 2FVNA 4XO8A 3DETC 4AFMA 3HNMA 4ONOA 1RZ8A 4GRWH 1ELSA 3VBFB 1RQBA 4KMQA 1MSSA 2PGFA 1RUPL 2BY2A 1YIFA 5DMGD 1S1RA 5EFUA 2ALAA 4XKYA 1RQ5A 1MLCA 4LO8A 3MR9A 4GVFA 3RX4A 4ILSA 2UUDH 4WTZG 1KXQA 1GNXA 1HXYB 4JFEA 1WUNT 2GBUA 4YJZL 2QQKH 1KCSL 2NY5L 2OQ7A 2WYZA 4Q58C 3PTMA 4WUIA 1TYJA 1Q94A 3OUJA 4HU0A 1TEGA 4OF8A 3WG6A 2YAEA 4F2TA 2Z91A 5E5LA 2CA4A 4F58H 2DJXA 1AQDA 2Q3AA 3B2DC 3WCRA 3HR6A 2OXNA 1W9XA 1CE1L 4OGQC 2JI1A 1HEJC 3CLMA 2HRLA 5TE6L 3CMGA 2HS8A 3F5JA 3MBWB 3IDJA 5DJ2A 3KRBA 3TBSA 1MIEH 3QUZD 5D2NC 4KQNA 1G7PB 3QFDA 5E8DH 3IUDA 1AYM2 3UZQB 4Q26A 2IGFH 2Z6FA 1RZGA 3ASNB 5DZFA 4OVVA 5C0AA 3CV7A 2WQZC 1AX1A 1PO21 5LBGA 1OF0A 4Z77A 5IOPA 2CJ3A 4C8XA 2HFTA 2J8OA 2X4UB 2D4DA 5C09E 1MZ5A 3TS8A 3AVSA 1AAJA 2H26B 5KXDA 4HU8A 3IPVB 1UB3A 3WN5A 1KJ2H 3UMNA 4LBLA 1J8VA 1F1AA 1LO3L 2SFPA 3DPBB 1BPVA 3TW7A 1MAJA 4AY7A 2O4QA 2Y62A 1OARL 1FFOA 5BCAA 2VYRE 4A2DA 4BBWA 4QXWA 1MRCL 4P9YA 1RZGB 4UI2A 1T6GC 5FZ4A 1SJCA 1AW1A 5AD0A 4RMSA 5L6UA 4G3YL 4OZGF 1U3ZA 3WQPA 3P0VH 4X6QB 3CN2A 3H7BA 4OCTA 1EEUA 2UV3A 5DRZB 4YRDA 1UURA 3BP5B 1KIPB 3HMWH 4GH3A 5F96L 4C6DA 1BD2E 1B3XA 2A99A 1V6NA 4ADGA 1L5GB 4DB7A 1E9OB 4EUPB 4NKMA 4AQ1A 3N15A 3NQMA 3KYOB 4JNZA 4K2SA 3IJ6A 2KPNA 1X5KA 5AHEA 4TU1A 1GY2A 4D6JA 1S5IH 4M5ZL 2ZA1A 3I4IA 4HIEA 2O6PA 3ARED 2F7QA 1ZDQA 2WABA 4PIRF 3GBWA 4DRRA 4TQTA 1YRKA 4J28A 4XVSL 3W86A 3QF0A 5CHNA 5J98B 5IHHA 4P5RA 3V55A 1WA4A 3C8DA 4RISL 5HBBA 3MA9L 5IDIA 2EZ0D 5BOZG 4U10A 3AM2A 3QQDB 5CD3A 4KERA 3QEHA 2NN8A 2JKTM 3MT1A 5IBLD 2V7HA 5E94B 3LHUA 4GQBA 1MKFA 3FPXA 4QDRA 1ASJ2 2C8NA 1AOHA 3ZVXA 3QSTA 1A4CA 2FCTA 1ZRCA 3LRSA 4H40A 3BYYA 1SFLA 1YEHH 5JIIA 3DSNA 3BH8B 3T0TA 3O4LA 3EJQA 5FZMA 4PH8A 4G59C 1T6VN 2BC4A 3HUJB 1GQLA 5ABZA 2PLTA 1NC4A 4NN5B 4AGLA 1J10A 5EULV 2W2IA 3IKCA 1Z7S2 2WIMA 3MI2A 2BOEX 3Q43A 3L45A 3SDXB 4Z7WA 4Y9GA 1IGYB 2ENSA 3NSTA 1GZHC 2EE0A 1O7FA 1B35C 4M7ZB 2VJ8A 4BSVA 1H63A 3WLRA 2MNUA 2J88A 5KZ6A 3L1GA 1A80A 1AANA 3DUUA 2ZYRA 1A02N 1SM3H 3CV2A 5D1XE 4R8HA 1FFOB 1FZOA 2R2BA 4ZQCA 1AO7B 3QEZA 1YNPA 1QDSA 1IILE 2JKWA 1W5MA 4GB9A 3TK7A 2QJNA 1MDLA 1QXRA 2FMDA 1AGCA 4DYEA 4OCSL 4XNBA 5L8LB 4Z7QE 2RCSH 5HHXH 3AFKA 1P5UA 3FCSB 4BV1A 4R52A 2E8ZA 4FFIA 2CW6A 3VRIB 4WI8A 1B4RA 3RDIA 3R94A 5I1GL 1LOSA 2RDXA 2VXQA 1P4BL 1A6AA 5CR1A 4TNVK 2OA2A 3MKGA 3ORWA 4P5KB 4ZG1A 4TUJA 1UXWB 3E5QA 4KUZL 3OGVA 2FQEA 5JHAA 1U1HA 2YC1A 5C0AD 3ARBD 3E9AA 4CNSA 1VEMA 3IDGA 1EHXA 2UU8A 1C5IA 1MRAA 4XC1H 1QLFB 1FC2D 2RS51 1UC5A 4FADA 2Y6KA 1Q4NX 1TYEB 3AQYA 5ITBH 3F65A 4ZFZB 2V8LA 1XF3A 5KVEE 2Q9OA 1CVRA 1UOLA 2IJ0C 1LTEA 1J3PA 1EQCA 1G8WA 5EC2B 1KJ3H 2P44B 5IW6A 4S0HA 5K9KA 2VNCA 4KX8A 4IRZA 4PW3A 1VDGA 4AHYA 3BSGA 1H2NA 2DQHL 4JRYA 4LSSL 4QHOA 1D4M1 3I2DA 3CDFA 1WT5A 4NWUL 3G1HA 2OZ6A 4XZ4A 1GGCL 4NPRA 4L5FH 1UZ6E 5KR7A 5EC1A 5E23A 1AACA 2AK4E 1U8CB 4HVXA 5SWSE 2ZOLA 1KWGA 1YFXA 1H5BB 4L9LC 4DKDC 5F4WA 4BF5A 4XJWA 7REQB 1GP5A 2OWWA 1Q43A 2CJSA 5IGXL 3M1BA 4PJYA 1G9FA 4HWUA 4U2YA 2YXOA 1Q72L 4ZS2A 4B7EA 4GRMA 5I8OL 2A21A 4UAPA 4FEZA 4ZFGH 1D7PM 5I73B 2GITB 3ULUE 3HT1A 4K7PY 1QO2A 5F7LB 1WOAA 1QG3A 3DUUB 1NBYA 1E5CA 4FN0A 5D96B 3D6NA 3CEPA 3H6OA 5EEUA 3B9KB 4YIQA 3C9NA 5A94A 3WL9B 3HB3B 2RMU3 3CQHA 2HWE3 3D0SA 3K6SA 2JJSA 4LULA 3GBMH 3MWAA 3MNWB 4OJEH 3AG2B 1R85A 4BGLA 1VIWA 4XNYH 4Z7QF 1I1XA 2FGWH 2P7TA 2WT2A 1B6DA 1YG9A 1A6UL 3MPCA 2CKBB 2QKIC 1NOLA 4DF9A 4YXKL 2UBPC 3LMJL 4J23A 4C65A 4Q4V2 3E96A 3N9NA 3WCYA 3PAJA 1I1FB 1RIRA 4NQSB 4YSDA 1YEDA 2GWNA 3E0FA 1DUYB 3I50H 3SDDC 1X1OA 2B7OA 1V05A 2BCKB 3AJZA 2ITDA 1DWGM 3NSNA 3VWKC 3AWNA 2IADA 4GY4A 5H94B 3D34A 2FQGA 1S7QA 4JCLA 1MS3A 2ZZ1A 1D6EB 2FT8A 1MCDA 2I74A 5CP7B 3G5YA 4Y4FA 2G4GA 4Q4W1 4OUUA 2OYZA 4NHXA 2XPYA 4F7PA 2CDFB 3NVDA 4WHCA 4NZJA 5GJMA 3MV7D 1ENSA 4N0UB 1H1YA 1ORQB 3N2OA 4MADA 2CIKA 1POV0 5A6SA 5DLML 3I84A 1D5MA 2I16A 5EMYA 2Y23A 4CJ0A 1F4YH 1O3TA 1KQZA 1N5YH 5BO1H 1BVKA 2FK9A 3NZ8B 2HH0L 2RUSA 3S1XA 5LCVL 3DMMD 1QI3A 2VCBA 1XYAA 3O9NA 3KBWA 4C8DA 4LSBA 1DJNA 1TPB1 1P1XA 2Q71A 1E72M 4EI6A 4XUNA 3QDMD 3FN0L 1GAFH 2IG2L 1HSBB 3PXLA 4LA2A 1PAMA 4PBXA 4QISA 1BVWA 3EXJA 3L7RA 5C07A 3TBDA 1G7QA 4MZ1A 1J5SA 3QJZA 1I3RA 4HHPA 1QSEA 3BN3B 4K2UH 1LHUA 4YGCA 5D7JB 3ZDYF 1UXXX 2OOFA 2WNKA 3LA3A 3FUHA 5MP6L 1EUNA 3PG8A 1J1LA 1MS1A 3P82A 4JRYD 5IQMA 2XQXA 5JPMA 1OI6A 1ETZB 4JAMA 3CV5A 4ICWA 3WUWB 3WSOA 5CU5A 1J5DA 3I7RA 1IT8A 4LO4B 1C93A 4S1DD 3M0YA 1L0QA 3NMBA 4C0HA 1GJPA 5I1CL 4ZTYA 4C1NB 4Y19B 3EYUH 2A1XA 3POJA 4YHNA 5IM51 2VKXA 2WSYA 2YD6A 4UW4A 4LLYB 3RWEA 1BG4A 5D4IA 4F3HA 1U3YA 2LS6A 2KXLA 3ECBA 2JWPA 4MS8D 4JREC 5HPOA 2ZEXA 4CSPA 2J8UB 4Q4X2 4DMIA 3N1MC 3MNMA 2GVGA 3ULVD 4MDIB 1QNYA 5ANNA 3CVDA 5FEZA 3FTGA 2VUJA 4IU2A 3WLPA 4MFEA 5TFSL 4MWFA 5CNAA 4RRPA 2PPEA 5HV4A 2FJSA 4PF5A 3ZVIA 4Y5XA 5B39A 3P0YH 4M6AA 4G72B 1MUJB 4G42A 3GHMA 1YIXA 4PYHA 4N0UA 4ZB5A 2XXZA 3REVB 2AQRA 2ESCA 1V6XA 2GI7A 3W2UA 5FPAA 3VSVA 1DLCA 1QHQA 3BJTA 4BF9A 5FFOA 3EJSA 3ERPA 4AD4A 2DI7A 4J8RB 2QZ2A 1RUNA 3B8TA 1UYWL 3L3IB 4MKNA 2DD8H 1UZ4A 3BUYA 3VKFC 3CFTA 2Y06H 3T3PE 4XBGB 1PV8A 5CEWA 3DTDA 3LPOA 1MQTA 4I2OA 1BBJA 4JQ2A 3UR8A 4I7UA 4BEUA 4AD1A 4KRZA 2XVGA 1AC0A 4JRXD 5CAYB 3L3KB 2XKNA 5DY3A 4AR2A 2XUCA 3SSGA 2QCGA 2VW6A 4PTTB 1BVVA 3OG6B 4SLIA 3U7WL 1LP9E 1LT7A 3VBHC 1I31A 1E9PA 3FUIA 5ANMB 2F8QA 1NCBL 4GNVA 3HG3A 4ENLA 4FCAA 3MLYL 4IGBD 3D4KA 5F5IA 3MODH 4BCZA 3N7MA 1HB3A 1CR9L 3QHNA 4GEIA 1HRV1 4KK5C 2TYSA 2N1KA 4FC3E 3G9VA 4J3OF 3KPRA 2BINA 2Y1AA 3UR7A 1DZ0A 2GNDA 1F6YA 5GGTA 1AS8A 4K9JA 3GC5A 4E8DA 1JXGA 5FF3A 2Q6WA 2VZTA 2BVUA 2HEJA 1WA0X 5IB4B 4E3VA 1QOOA 4Q4Y2 3TBBA 5HWNA 4MV2A 2YD7A 3FQTB 1QPQA 2PPDA 5FY8A 4NUMA 3IDIA 3RVWD 3B9VA 4M6PA 4BE3A 1WSST 2HUHA 3ZYGA 2E31A 4A22A 1J8HD 4NHUA 4NJAL 3HT2A 1KSRA 3ACHA 5IHBA 3P30L 3MNDA 1KM0A 4OCXL 1HN0A 2I14A 2F53B 1XLLA 3GSQB 4XFIA 1N8WA 2FD8A 4LGXA 3KWUA 2BRRL 3NPSB 5A7SA 4FFGA 3DL3A 2WJ7A 2W92A 2FATH 4ZD3L 4MAYB 1DBJH 4FE9A 1FI2A 3THCA 1U8KB 4XC9A 4JG0L 1HDKA 3QFJB 4JO4H 5ES4B 3IB4A 2IWGA 2EVXA 3F7JA 1YEJH 2E7MA 2YBGA 3W1PA 4C6JA 3U07A 4CVZA 4PB3A 3WD5A 3M41A 4X8NA 4R90H 3TNMB 1NIAA 1HL4A 4K3ZA 5AENA 6TAAA 5DZLA 1LLOA 5EO9B 1OOAA 3CMFA 4H7CA 3BOVA 1YC7A 1KELL 2XG4A 4EI5C 3RWNA 3WP5A 1IEHA 1O75A 4HIIB 5KHGA 5D7EA 5DJDB 3GMQB 2D6MA 1XISA 2EDWA 1L9NA 3VIOA 2WZR1 4XTRD 3RZKA 3QZWG 4FPEA 5D9OA 4MUZA 3TH4T 3UBPC 4X0KA 4HGXA 2HISA 1IEWA 4JOMA 2VLKE 3AUWB 5F6HJ 1H8NA 2E6JA 4HT1L 2CWNA 3G9AB 4FQCH 3VHPA 1LO4H 4BFAA 1SXNA 1BZ7B 3WOGA 1HKWA 1DVXA 1OG0A 2WXDM 3JUYA 5F7DA 2VCOA 3TBWA 2QCNA 5IJKC 2J8HA 2EJ1A 3ZVVA 2YA0A 5TQ0H 1QXJA 4BH8B 4N8VA 3BIBX 1A7OH 1CDJA 4WWKA 2YGPA 3JYCA 2JWYA 3IGAB 1CDCA 2WC2A 2IBZX 1A7PL 2V4AA 3X1GA 3N9GH 1JBJA 3CUIA 2BWGA 3DN5A 5LIKX 5IVJA 3NIDE 2AJXH 4YU1A 3LN5A 4IX0A 1QNWA 4QGMA 3I7DA 1VBB1 4DNMA 1F5FA 3T0EB 4XD5A 4LUYA 4JM4H 2WNUB 2XHNA 1OGGA 3WFHA 3BAWA 3DX4A 3SQSA 4RAUB 3LEVL 5AUMA 2C1PB 4E38A 2D03H 2D6OX 3UWZA 4HSAC 3JWDC 3D3VE 3I2OA 4LORA 3D39A 3ULUC 3AREA 4L9YA 1ULOA 4BMEA 4E5XA 4S3CA 4JIHA 1FOBA 5EZIH 4Z3JA 1KYOK 3NOIA 1PEZA 3R1ZA 4M1GL 4QR7A 3R6SA 4NKDB 1H0DB 3CXOA 3M1OA 2EDDA 4EN7B 2DIEA 3GBGA 4CSTA 1J84A 4GH1A 4OHXA 4U31A 3MYOA 3T6CA 4ATTA 2YO3A 4FI9A 4OM0H 4F37K 3CHQA 1VFMA 3SCMC 4ACZA 2FDSA 3O6FA 4UWMA 5HVFB 2QQJA 4LSQL 5K9CA 5CGQA 1NLDH 4QGLA 1RI8A 4WW2C 2NUWA 2D7MA 2X1XR 1EFQA 2DQHH 1U2HA 1ZALA 3WQ4A 4ANKA 4FFZH 1DTNA 3IDUA 4ZUWA 1ISZA 1RAMA 2CCRA 4JFZL 3KM2A 5KSAC 4Q9BA 5B38G 1IVTA 1UJQA 2AEYA 4M51A 5C9JA 2CLPA 2N56A 5LN8A 3EHBB 1MRDL 3QY6A 4X6CB 1E73M 3KPSD 3TTOA 2IFFH 1R3RA 1FNZA 4WO4A 1ADQH 4PVNA 3KLSA 4PLMA 1TUXA 1JXDA 4FQQA 1NGQH 3MACL 3K2UH 4R8WH 3PQYA 3AO0A 1MCJA 1IT9L 1JP5A 1W6LA 4UTBH 4UTAA 4Y5VB 2J1EA 2XJKA 4N8VB 2QHRL 2WZAA 4P99A 3DTUB 3VXUD 3G1RA 2AL1A 2FZDA 2DB8A 1JSYA 1E6QM 1QA9B 1ZZBA 1TEFA 3OHXC 1M68A 3UZVA 5TE7H 1Z89A 3OAZK 5KVDE 4W7WA 4GUIA 1XOYA 4FRWA 3F7YA 5CWSA 3BZEA 4PUNA 2R82A 1TV5A 5KJ4A 3VRLF 3B05A 2A6WA 1S5IL 4G8EA 1PIIA 1AQFA 5G5DB 4NQED 1QUPA 1SLTA 1A7RH 1O91A 2Y0OA 1V3JA 2XZCL 4PYGA 1BFSA 3PQYB 3NA4A 2WZ0A 1HHGB 2BIQA 1RUML 4AIUA 3B4NA 1EGJA 3E2HB 3R4RA 5CSBA 5A6ZA 3HPJB 3MMUA 3GMRB 5LBFA 2XZ7A 1Q8AA 3HHSA 3WI9A 5D8AB 2PDIA 2FB2A 4XUYA 3FFCE 4NEHB 4LSRH 1VGKB 4CC0A 3UZ5A 5ADOL 4BE6A 3LEPA 2ENYA 3ZDYB 3CFJA 1N1YA 1IC5H 4TNWF 4M61B 3SYPA 3JV6A 4NQVB 1XRTA 4B7KA 3BVXA 4QPGC 4YVWA 1QBLH 1XGTB 4B5VA 3DI3B 4WEUD 3INAA 3JXSA 4O5LH 1F3JB 3LQMA 2Z5WA 5E70A 4L9XA 2R32A 4BIFA 3BAJA 5B7FA 5KS9E 4FIRA 4TOYL 1Q6CA 2V5RA 3PG9A 4IWWA 4KMTH 1VFAB 3MIGA 5L19A 5IIEB 2YOAA 3PVFA 3ZE1E 4MTMA 1TZHA 3H2NA 2EVGA 4RQPA 3QIBD 5F97E 3A4FA 2QCDA 1IGML 3BLFA 3JV4A 2OQLA 1GHFH 4W8AA 3C2UA 1UNBA 3CQKA 1SZNA 1UQZA 2X4TB 1CESA 4LZKA 5KANG 4PBWD 3L17A 5CVRA 4Y2LA 1AXTL 4H20H 5A3TA 1HIXA 4G83A 2J1XA 2CRZA 3M8OH 2HX9A 1NQBA 3MRFA 3ETSA 4JHBA 3PJWA 4EJRA 4S2DA 4JHWH 3DFSA 3N12A 5GVJA 1HVXA 2APTA 1NCUA 2APVA 1RUAH 2WGNB 2R043 1KY7A 4N87A 4IL2A 4ZZ5A 2E6FA 2WLHA 4MASA 4XB8A 2L8AA 3L1OL 4HG4J 3EH1A 1NKOA 1D2SA 4EZHA 1UYWH 2XM2A 3I2FA 1E3ZA 5I0VA 3T0DA 3HMCA 4K37A 4IIDA 3KCCA 4A6YA 4EI5D 2BVBA 2NM1A 3ABZA 5FYLD 3MRFB 3RYKA 5XINA 3TIDA 1N8ZA 3UDWC 4KRPC 4LIQL 4JKMA 2A3XA 2WWMD 1M57B 1JGDA 4O17A 1P4IH 2ZYIA 4LP8A 5JXEA 4WVRA 5INCB 3GUFA 3I59B 3SGJA 1H8OA 1YI7A 3VU2A 3NM1A 1LOCA 1VGKA 5FZ6A 1F4WL 4ONHA 3SUSA 1HEZA 3VJ6A 5BOOA 2BP3A 1X97A 4NM4L 4IJCA 2VGGA 1J18A 2NNAB 2R4SL 1U3HA 2XV0A 1FV1A 3VOJA 1HT6A 3COOA 3FCPA 5EBLA 4Z7NF 1HX0A 3LENA 4V1DA 4KUCD 4H0HB 5C0EA 3GIZH 2DVAA 1BG1A 3B2PA 4N2KA 2YXVA 3B2XA 2ATMA 1RZ7H 5FO8A 3EYPA 5IQ7H 5G2NA 1I5ZA 1JWUB 2J6EH 1HXS2 1B3JA 2GQAA 3R4DA 5IMOA 2X3CA 4C6NA 2FDJA 2HNEA 2ZJSH 5CFCC 1UKPA 3PL0A 1YLBB 4KBBA 2WKKA 3VU1A 5AZEL 2NX3A 1H3PH 4KDTC 3R1GH 1S5HB 1FMD2 4PEEA 1FV1B 1GOFA 1UVQA 2XONA 2F1BA 3AMHA 4GPNA 1TQVA 3P9MA 1ZRQA 5C6TH 4JZJC 4XN7A 3TX9A 3VSUA 2XA8L 4RGOL 3IJQA 1PZ5B 4F48A 2ARJB 3ZYHA