4QAWA

Structure of modular xyn30d from paenibacillus barcinonensis
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
537
structure length
537
Chain Sequence
ASDANINLSSEKQLIKGFGGINHPAWIGDLTAAQRETAFGNGQNQLGFSILRIYVDDNRNNWYREVATAKRAIEQGALVFASPWNPPSDMVETFNRNGASAKRLKYDKYAAYAQHLNDFVTFMKNNGVDLYAISVQNEPDYAHDWTWWTPQEILRFMKENAGSIQGTRVMAPESFQYLKNISDPILNDPQALANMDILGAHTYGTQIKDFAYPLFKQKGAGKELWMTEVYVPNSDNNSADRWPEALDVSYHMHNAMVEGDFQAYVWWYIRRQYGPMKEDGTISKRGYNMAHFSKFVRPGYVRVDATKNPDTNTYVSAYKGDNKVVIVAINRGTSAASQRFVLQNGNASTVSSYVTDSSRNLASLAPINVSNGAFTAQLPAQSVTTFVANLSGGNSGGGNVNTGTTYEAETGTTLTDAVVETLYPGYTGSGYVNFNAYTNSAIEWNAINNMTTGTKNVKFRYALESGTRNLDIYVNGTKVLSNEPFTETGSWSTWGEKTIQVAMNSGVNTLRIVTTGTEGPNMDNITVTASAKGELNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Xyn30D
publication title Structural Analysis of Glucuronoxylan-specific Xyn30D and Its Attached CBM35 Domain Gives Insights into the Role of Modularity in Specificity.
pubmed doi rcsb
source organism Paenibacillus barcinonensis
molecule tags Hydrolase
total genus 159
structure length 537
sequence length 537
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
A PF17189 Glyco_hydro_30C Glycosyl hydrolase family 30 beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4qawA01
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4qawA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4qawA02
2YLAA 2IGTA 2VRKA 2J1SA 1B3WA 3W6MA 4X0VA 1W3HA 1PIGA 1ULPA 3N15A 1E15A 4A3ZA 1R87A 2QV4A 1TZ7A 1W9BM 2YC2A 2ZX6A 2A3CA 3PTKA 3ARWA 5IDIA 3NIYA 1E43A 1KCKA 3HNMA 3K4DA 1B3XA 2XFYA 1CLVA 1W9DM 1QHZA 2VO5A 3CMGA 3DDFA 5AYBA 2YFZA 1E4NA 4U3CA 2NSXA 1BGAA 3EDEA 5I3DA 1UY1A 3BLPX 2C0HA 1IV8A 1JHJA 3RCNA 1CZ1A 1US3A 1IZJA 3AMGA 2G41A 1EH9A 1XSKA 3VM5A 1V3IA 2DT1A 2JIEA 4GXPA 2WDBA 4PSPA 3CO4A 3U5YA 5EJ1B 1XRVA 3L4UA 4UZUA 2QF8A 1KEXA 1ODUA 3HPNA 5M03A 1NAEA 3VGFA 1XH0A 2WLZA 3VIKA 3H53A 1H49A 1CZTA 4AEFA 2EPNA 1H3GA 1FHLA 3GYCA 1TUXA 4PMXA 2XPKA 4DWSD 5I6SA 1VFOA 3VKKA 2D24A 3EJQA 4NX0A 4GZJA 4JAWA 5M3WA 1V6VA 5A6LA 1VJZA 2BY3A 3WNNA 1E0WA 5AY7A 2BZDA 2CYGA 4FMVA 2ORZA 1EGZA 4C7GA 1W3LA 1R46A 1C7SA 2DT3A 8A3HA 3AIBA 1WP6A 2BY2A 3SCNA 4P7QA 5DO8A 1PPIA 2WW5A 1W9TA 3A22A 1TA3A 3O2LA 1W3JA 1G94A 4DXSA 5ABFA 1PX3A 3AIWA 3TA9A 2W94A 3MKKA 1UD5A 1NARA 3WNLA 2ZX8A 1W32A 2DQXA 4KWUA 1VEPA 4PMVA 5JXJA 1W0NA 4X9YA 3WQWA 3GNOA 4D6FA 5GQBA 1XD0A 1TQSA 1ISVA 2GDVA 5A8PA 5I77A 2HYXA 4U31A 1ZBCA 3A47A 2Y8VA 3KEHA 4AD3A 2BFGA 3ZR6A 1ITXA 4E2OA 1TFVA 1FH9A 5CPSA 4BK5A 3WIJA 5LA0A 1UZ0A 2VMCA 1CYGA 5EMYA 2VX7A 3DHPA 2J1VA 1KB3A 2VZUA 1E70M 4P7LA 2B4KA 3VGEA 1H4PA 4S3JA 1W9SA 2RGLA 2JD9A 1XH1A 4GO9A 2FDMA 5G05L 3IJ7A 4D6DA 3L4ZA 5F7UA 1RYYA 4HA4A 2JEPA 1UH3A 4PQQA 2X2YA 4AW7A 4B9YA 1L8NA 1QNOA 4JKLA 3VDCA 3AZRA 1CDGA 1GQIA 1NH6A 2Y4SA 2ZWZA 4GI6A 1QI5A 1JZ7A 2E32A 5I23A 2Y2WA 3W6LA 3NYDA 3QOKA 5ABHA 3AHTA 1EUUA 1UY2A 3N04A 3KL0A 1HJUA 3CZLA 2PBGA 1J18A 3OLGA 1AQMA 3HG3A 4CD7A 5CJ5A 3KL5A 1HJXA 1JZ5A 2VURA 4W88A 4W5UA 2GK1B 4CUAA 3UCQA 3UG5A 1SG3A 1KTCA 7CGTA 4M56A 5CGMA 1DEDA 4XUOA 2XUCA 4BJ0A 2BGOA 3DYOA 4RE4A 1ISZA 4AD2A 1XPWA 2WHMA 4GZEA 1H5VA 3DHUA 2JALA 3WQBA 4S3KA 2GFTA 2BY0A 5A6MA 1FH8A 2WC7A 4HU8A 4IISA 4OOUA 1EOKA 3SCWA 3SUTA 1ZB5A 1OSEA 1HTYA 1EA9C 5B4NA 2VZSA 1VJSA 1E55A 1MFVA 4J3UA 3WEZA 3NDYA 2CIPA 3CH9A 4W8LA 1EOMA 3SIMA 2CHNA 3WEOA 4A45A 1MFUA 5JBEA 2VNCA 3WUGA 1RPKA 3CPUA 1CWYA 1W1VA 3HJRA 2XHYA 3L2MA 1JYXA 3VD9A 1R47A 3SCQA 4FLRA 1SMDA 3LPGA 3NRUA 1ISXA 4GWIA 2XHNA 4AWEA 2IXUA 1KCLA 2EPKX 2WK2A 1GOMA 3CGTA 1SDDB 4W7VA 2WMHA 3AMKA 4ZY9A 5I24A 3UESA 3NSXA 1QBAA 4LQ1A 3PZUA 2F8QA 3WELA 2EIBA 5D9PA 3FL7A 1NWTA 1KQZA 3WDHA 2C8NA 3C7GA 5J1XA 1BG4A 4J3VA 2PWGA 3MO4A 5CZKA 4PMQA 2F7PA 5D9NA 1KBKA 2OKXA 4CD4A 3S5ZA 3WD1A 4PBGA 2QQOA 3H55A 2VCAA 1CZSA 2XM2A 2CBJA 3PZ9A 4W89A 3LRMA 4AAXA 1CNVA 2PB1A 5A6SA 2ZEWA 2G3IA 4FLOA 1E6NA 1Q6FA 4W7WA 4UQEA 5LCWL 4V27A 3BSGA 4U5IA 4CN6A 2ZXAA 4HMCA 1GPFA 5BXRA 1R85A 4W4ZA 3WBEA 2GJRA 2OW6A 1H6XA 4BQ3A 3L2LA 4JHOA 3WH9A 2DT0A 4AC1X 4BZYA 3GH5A 4L0PA 2FHBA 3WSOA 1DHKA 3A24A 4D1JA 1V6UA 1W3KA 3CHDA 2ZXQA 2A3EA 2Z1SA 4HMDA 3ZJ8A 5FL0A 3MV01 3OLDA 2YFOA 1OT5A 3ARSA 3HN3A 3U37A 3U7BA 1HF6A 3F4VA 1NOUA 2G4FA 4AYGA 4ARYA 1W99A 1JU3A 3TTSA 3M46A 2XGIA 3LEGA 1DWIM 3UERA 2D23A 4LYQA 1J84A 3LEIA 1Q6EA 3OG2A 1E71M 2ZUSA 3WNMA 3DX1A 2J47A 2PBOA 1EDQA 3ZT5A 2KD7A 3AC0A 1UYQA 3APGA 3BC9A 1UD3A 4KH2A 2FHCA 3AISA 5C8BB 3HZ3A 4H04A 1PZ3A 1UWQA 2PWFA 1R64A 3I2GA 4MGSA 3LPOA 2VZPA 2VX5A 4BQ5A 1OGBA 2J8GA 4AD4A 1JGIA 1UOKA 1FHDA 4U2ZA 3AJ7A 5E6YA 1TR1A 2XSAA 4DM2A 3BCDA 2WWDA 1UWRA 3RJXA 1FH7A 5A2CA 1UH2A 4H41A 3K1DA 2J1TA 3WD0A 4TVUA 3I3BA 4HZ8A 4N42A 4J3XA 3MUY1 3UETA 1G0CA 2XONA 1FP8A 3B9EA 3CQOA 3ARQA 3VDAA 5C71A 1XYFA 2VQUA 3BUQA 3W5NA 5C7GA 1MW1A 3WENA 1M01A 3BVVA 3CLWA 4Y7EA 5CSYA 2WN3A 2F1BA 4DWSB 1GJUA 4DEVA 1LG2A 4JCLA 4GINA 3VOCA 2CBIA 2J77A 3AROA 2VJXA 4QAWA 3GDBA 1C8YA 1LLOA 4W84A 2OWWA 4R27A 3RPMA 2QQJA 2WVUA 1E6RA 3BAIA 1K9EA 2J7DA 2YL6A 3VD3A 4D1IA 4D6IA 1K3IA 1UX7A 3WDQA 2QQNA 3WSUA 2CHOA 5CSUA 1OT1A 4XUNA 1R7AA 3ARZA 3SCTA 2BVTA 4UCFA 3D52A 3LXAA 4MDPA 1V3KA 5E09A 2F7QA 5IYYA 1D7FA 1MQRA 5I2UA 1J0KA 2ZXBA 1WZLA 3ARPA 4W5ZA 4ATDA 2DCJA 4AMWA 2YLLA 1KXVA 1JD9A 2JE8A 3VNZA 1UY0A 1CXHA 1GMMA 3WNPA 2J22A 2YJQA 1HL8A 1SZNA 1QBBA 5FD0A 1JZ2A 1CXKA 1OF3A 3WBAA 1NX9A 3ACFA 3BLKA 4PF1A 3EJUA 4JL2A 2XWEA 4CCDA 4FNRA 3WMSA 1EQCA 4YHGA 1CXEA 2ZUUA 2XWDA 1GW1A 3NCOA 1Y7VA 3AS0A 2Y5EA 1J0YA 1JDDA 3BVWA 2WPGA 3VD7A 1A3HA 3K4ZA 2D20A 1K6AA 1GOHA 2OSWA 4KRTA 4J3TA 3ZJKA 2A3BA 1UUQA 5E1QA 1UXXX 8CGTA 1R7OA 2VZ1A 3C7HA 5I78A 3ALFA 2LS6A 4BCEA 2J1AA 4BS0A 1CXLA 1BLIA 2XYLA 2OSXA 5DN2A 3VDHA 3IJ8A 2JFEX 4WKFA 2OYLA 2J1EA 1HKIA 3A3HA 4ATWA 1R86A 3MMUA 5D8WA 4LYPA 5A8MA 4Z2AA 3KL3A 1E0XA 3DX4A 3A6OA 3K77A 3N9KA 3CMJA 1GQKA 1RD6A 2O92A 4OGZA 2W4XA 1UWTA 3SUUA 3M7SA 2WVSA 3BVTA 1XSJA 3ZJ7A 2EIDA 2IUZA 5CLWA 1MPXA 2V4VA 4LPLA 2J7EA 1UYYA 5JXGA 1RP8A 4UQDA 4OBRA 1OIFA 4DO6A 1V03A 4AXNA 2ZX9A 1JF5A 1V3LA 4A44A 2J78A 2CBVA 2E9MA 1W9PA 2DDUA 4FI9A 5LA1A 3VIGA 3OGVA 3VGGA 4BXSV 5FUIA 2O9RA 1LQ0A 2A3HA 3A4WA 1SFSA 4JFWA 2E31A 5IFTA 3RM9A 1E6QM 3POHA 3EB7A 3LPPA 1V3MA 4EE9A 1DWFM 3BAWA 4AIEA 5CYYA 1GUIA 1KR1A 2ZEYA 5G04L 4GIAA 2ZEXA 2V3EA 3VM7A 3ZT7A 2EJ1A 1UR8A 1E72M 3VTRA 2YOCA 3PN8A 3C7OA 3P6BA 2CKRA 4PEEA 2DSZA 2R7EB 2ESCA 3HOBA 1JL8A 5DT7A 1B9ZA 4W87A 2WLYA 3T08A 3SEEA 1WNOA 3EJSA 1BPLB 3BAYA 4ZXOA 2Y8KA 4A6OA 1W2VA 3BMWA 3BN6A 2F1AA 3MMDA 1S46A 1UA3A 2VX6A 2DIJA 1JDAA 1HN1A 3WQ8A 5M5DA 5HBFA 1GNYA 1JZ3A 4D6GA 2WO2A 3PZNA 3IJ9A 3W81A 5IFPA 4DXTA 2PWHA 2DCKA 1TQWA 2WZHA 5A69A 1V0KA 2ALWA 3WF3A 1V3JA 1GVYA 1TQUA 1H6YA 3CZSA 1PMHX 5IJRA 1GOOA 1GQJA 1HWWA 3VIJA 3GBEA 1CGVA 3AHXA 1MQQA 2EPLX 3WKZA 4M82A 1X1NA 4PYSA 2OSYA 4MB1A 4WLCA 5JIWA 3DX0A 1UWIA 4QX1A 1MVYA 4AD1A 2D22A 5FKYA 3OZOA 1VFUA 1U30A 1EIBA 4P8WA 2DPEA 3AOFA 3BCFA 3FHAA 3VPLA 4E4PA 2XVLA 4RYDA 4NSBA 5I5RA 2YB7A 4A42A 2PI6A 2WHKA 5EJZB 3NDZA 4A3HA 1PJ9A 4W50A 4KI5M 4D6CA 4JKKA 3ACHA 2C4XA 1XYZA 4URIA 3EDJA 1RP9A 1UKTA 3POCA 4HZ6A 4ACYA 1DWHM 3OIHA 1MW2A 4HU0A 2YG0A 3PZIA 1C8XA 4UQ9A 3THDA 3NJ3A 1EUTA 1BYCA 2LW8A 3AIUA 2CETA 4RL3A 2W5FA 4JFTA 2EAEA 5BROA 3T2QA 3ZMRA 1E6XM 4TTGA 4P8VA 4GWJA 1E56A 3IB3A 1ESWA 5A3HA 2BVYA 1W91A 2VMFA 3JUGA 2QMJA 1J10A 1H09A 3RIKA 3TOPA 4D6HA 3C7FA 4FNPA 5TD4A 5E9AA 2DSWA 1UD4A 4WSJA 4MAVA 1W2PA 1E0VA 4AY1A 2VVNA 3MUAA 3AI0A 1U33A 1FFQA 4HPGA 1FA2A 5DPNA 2D0GA 1QNQA 2FE0A 3DC0A 3AYRA 4OUEA 2WB5A 1TVNA 2ZWYA 4V28A 1C8QA 1V6WA 3VSVA 1TA3B 1CGXA 5A2AA 3II1A 4XZBA 1JXJA 2JEQA 3RJYA 3BUIA 4KGLA 1ODZA 3U57A 5ABFB 2W1WA 5EBAA 4M8UA 3OZPA 1VRXA 1NUKA 5ABEA 4ET7A 1KGUA 1XNTA 4QX0A 1WDQA 3DX3A 4MO3M 1H2JA 3KZSA 5A2BA 1KFWA 2WZIA 1JG9A 2VCCA 2QHAA 1J12A 4U5KA 4AYSA 5IXEA 1NM9A 3CUIA 2E0PA 2XG9A 3D51A 3EMCA 4P5YA 1LWHA 4K68A 2OW7A 1PEZA 2GDUA 2ZICA 4CU6A 1JDCA 3BSHA 1ZBWA 4MAZA 3CKHA 5EIYB 1J0ZA 3CUGA 2WMIA 3SCOA 3DYPA 2WCGA 2VZ3A 2PF0A 3AHYA 5ECUA 2E8ZA 4QDRA 2QQLA 3AMLA 3LQCA 1GORA 4Z2HA 3WL0A 2WYSA 1TQVA 4W8JA 1EHAA 1QWUA 3ECQA 4M4PA 1GQPA 2J7FA 2JDAA 2YL8A 2XVNA 3OEBA 4OYUA 4ARXA 2D73A 4PTWA 4F79A 2WKGA 1MW3A 1C90A 3MU7A 4ZFMA 5HPOA 4AZ5A 1B2YA 2X09A 1QHOA 1CGYA 4CCEA 1XSIA 2WVVA 2Y64A 1Q6GA 1GOQA 4PCTA 2Y6HA 3SEPA 3GXPA 3NJXA 1WDRA 4NZCA 1OBAA 2F7RA 3GTNA 2ID4A 4DM1A 1XCWA 2UY5A 1GJWA 1TG7A 2ZUVA 2FHFA 3MUZ1 2A3AA 1J11A 1LL4A 4ZEPA 2VZOA 4LX4A 3BUPA 3NUKA 4ACZA 4QPWA 2WAOA 4TOQA 1O7AA 3WF1A 4H8VA 3ARVA 3AIRA 2AOSA 4B3KA 4M4RA 3FNDA 2WVVB 2X10A 1OH4A 1XCXA 5JBFA 2V3DA 1W1PA 2BY1A 2V3GA 4MNMA 1KR0A 1F4HA 1E6SM 4ZENA 3W37A 4E8CA 2VZQA 2CBUA 5AC5A 3AMCA 3OEAA 1QHPA 3OGRA 1ZJBA 2D2OA 3C8XA 5B4XA 1HNYA 1QNPA 2V38A 3AZSA 4P7NA 4XV0A 3W4RA 2BV9A 3GGLA 3RMEA 2X05A 3NJVA 1GCYA 2CKSA 2NT1A 4HA1A 4H8UA 2V5CA 5D9MA 3WQ5A 2WXDM 2JF6A 1WCGA 4UQAA 4PTXA 2WZ8A 4B3LA 4Z2JA 4QB1A 2ZEZA 4BQ4A 3QHMA 4AZBA 4QB6A 4M80A 2BHYA 3D3AA 4PMOA 3VNYA 5D8ZA 3ALGA 2CXGA 4GKLA 1H41A 4P7OA 1NP0A 4MOAA 1ULOA 4MDOA 1GUVA 3BXWA 2W87A 2B9VA 4QCFA 1CPUA 5HXMA 1PS3A 1M03A 2DGAA 4EK7A 1SYTA 6A3HA 4JL1A 2RGMA 1WCQA 1W9XA 4U2YA 4EAMA 3HU7A 4LGXA 1K9TA 3T09A 1V0LA 4MJ2A 1JI6A 1P8JA 2L9LA 1JNDA 3QHOA 5HNNA 1OGSA 1LNSA 4J27A 4UR9A 3GXFA 3RM4A 2VR5A 2OLHA 3I2KA 5IHSA 1J0JA 4QCEA 4NZJA 1SHWB 2EEXA 2E4TA 3VGHA 3PUHA 1DLCA 3SUWA 3VIIA 3ZT6A 2BGPA 4CD8A 4UOJA 3CTTA 2EQDA 4CD5A 3A21A 2WM0A 1GOGA 5CLTA 4FK9A 3DX2A 2X1IA 3I3EA 1EXPA 4UFIA 3SUSA 2FGLA 1WZAA 2J7BA 1JYNA 3ARTA 1CBGA 2HISA 3SCVA 2Z4FA 3I2HA 2GJXA 4PTMA 5KZ6A 4AEEA 1KGYA 3EJPA 2E9LA 2YBUA 1EDGA 4D71A 4D6EA 1L7RA 4P08A 3W82A 1WAWA 3WMBA 1QI3A 1L0PA 2BHUA 2F61A 1JIBA 4MGQA 3HNYM 3I3DA 4FF5A 2BHZA 2MANA 1CX1A 5DT5A 5E0FA 1HJWA 3W53A 3PZMA 1UR2A 3NNGA 2W47A 4CD6A 5BYWA 3MBWA 1MYRA 1JZ8A 2CCRA 2GJPA 4W8AA 4D8MA 1J0IA 1OCQA 3EDFA 4QFUA 4XB3A 3K8LA 1CEOA 2VX4A 4ZE4A 3AIVA 2C7FA 1HJSA 5GNXA 4YN5A 4DO5A 4CCCA 4DO4A 3OBAA 3RILA 1MXDA 1I1WA 1G01A 1PIFA 2YL5A 3W26A 1F4AA 5GNYA 3IDAA 3VSUA 3CDZB 2QBXA 3GH7A 1QW9A 2BS9A 5BRPA 1GOIA 2CDPA 2E40A 4QP0A 1JAKA 2CPUA 1ZBVA 3AXIA 3F5LA 1XH2A 1QOXA 3IAQA 3PBGA 3VILA 4FNSA 3AMDA 4UZSA 1DWGM 2V3FA 3ARUA 3EJTA 4KMQA 5LA2A 4BF7A 4MB5A 5LYRA 2ZX5A 3FW6A 2PQSA 2DH3A 1TVGA 5BRQA 3SCUA 4UTFA 3WNOA 1KXHA 1GZJA 3K8KA 4CKQA 4M24A 3HMCA 4KRUA 3EYPA 4PMUA 4CU8A 1GNXA 1X6NA 2WVTA 1UMHA 6CGTA 3A4XA 4UQCA 4W85A 3D5HA 3AS1A 1W1YA 2ZXDA 4AISA 3VMOA 2NT0A 4W86A 1CGTA 2XN2A 3CHCA 4GZIA 1B3VA 2W92A 1Q6CA 2QLYA 1ISYA 4FLQA 2EPOA 1UMIA 2XQXA 3THCA 3MS8A 4GQRA 3RDKA 1OWQA 2Y6JA 2CERA 4P8UA 2ZX7A 1AVAA 3MSGA 5E0CA 1BYDA 5JMOA 3CUJA 4MNKA 5EB8A 4X0NA 2YFUA 2XSBA 2RV9A 1YHTA 3CHFA 2J4GA 5GNZA 2J62A 1HVXA 3GBDA 1GOFA 3AZTA 1KWGA 2E9BA 3I97A 4L4PA 2QQKA 1I75A 4PRWA 1NKGA 3MUIA 3A5VA 2QPUA 1TQTA 1R8LA 2YA0A 3TTOA 1GOWA 3ZSSA 4AZCA 4H7VA 1GQLA 2J7GA 2Y6KA 1XGZA 3FY1A 3CZUA 1HP4A 3HEIA 3I2IA 3CIHA 1CLXA 4MADA 1M53A 2WZEA 2XJ7A 5JR2A 3WUFA 4AMXA 3CIVA 3F5KA 3T0DA 3O9NA 2XIIA 4C7FA 3IK2A 1J01A 3SCPA 2UY3A 4P8XA 3VX0A 1WDPA 3J7HA 2EIEA 2B31A 3FN9A 2FH6A 1BTCA 4AMCA 2WC4A 1O8PA 4AZCB 2F2HA 4D72A 2XM1A 2XVGA 1ZU8A 4CGTA 1BYAA 3CZJA 2ZE0A 1UR4A 3PZVA 4JIEA 3ZJ6A 2WMGA 1JI2A 2J7MA 1OD3A 2G3JA 4UFJA 3A7QA 3FXYA 1KXQA 3HJEA 2O9OA 3EMZA 2C9KA 4NXSA 3S6TA 3LX9A 2W1UA 4LXFA 2J8FA 3B9AA 1L7QA 4HA3A 2ZIDA 4JZ5A 3K46A 4M29A 3ARYA 4HOWA 1C92A 1V0NA 3ETPA 1Q6DA 1PAMA 3CZ8A 3MANA 5BXPA 1W9UA 3S5YA 4MTVA 1HL9A 2XVPA 2CDOA 2TAAA 4R5EA 1B31A 4RN5A 5DFAA 4XUTA 4XZWA 2YA2A 1EO7A 5JXHA 4OOZA 3VSTA 5A8NA 4QX3A 4NRRA 1VBUA 3M6DA 4IM4A 7A3HA 5JBDA 1A47A 1OIMA 1VFFA 3GXMA 2Y6LA 2DT2A 1JYWA 2Q8XA 1QVBA 1T0OA 4DUWA 1E4IA 2YL9A 1G9HA 1G5AA 2XFFA 3OLIA 2EADA 3EDKA 1KWKA 5JUVA 4IPLA 1ISWA 4OMDA 3VGDA 4WKAA 3LRLA 5A1AA 4AZ7A 2C26A 3C7EA 3GH4A 5HOSA 1E4MM 3AS2A 2J79A 1E73M 2YKKA 3CZKA 4DXRA 4PT6A 4AZIA 4J3WA 4XX6A 3B8SA 3AXXA 3D4ZA 4AD0A 1UWSA 3DDGA 4DWSC 1UKSA 2WANA 2CESA 1OB0A 1LG1A 3UG4A 1FOBA 4HZ7A 4L4OA 2PWDA 3N11A 3WQVA 5FCZA 4TVDA 4QDQA 3N1AA 3G6MA 5AYIA 2X2HA 1BVNP 4A41A 1B1YA 3WDPP 3HG2A 4QLJA 4AG4A 3HG5A 1UY3A 4MPKA 5A6JA 1RH9A 4GI9A 3I2FA 3IGUA 4OIFA 3IIIA 1C91A 3CUHA 1IZKA 4TX8A 2OWCA 3E1F1 4HP5A 1UD2A 3LXCA 4PMNA 3WD4A 3VMNA 1E1EA 1HKJA 1SR0A 3WD2A 3WEMA 1R34A 2X0YA 5A8QA 4OJYA 4XUPA 2VOTA 2EBNA 1QW8A 5FIPA 2E26A 1K42A 3WDIA 4RE3A 4HOZA 3EBVA 5BCAA 3N13A 2W91A 5EFDA 3WY4A 3SKJE 2HLEA 2VVSA 2W63A 1CXIA 1EDTA 4OMCA 5CQ1A 2DIEA 3EMQA 2PWEA 1MXGA 1JFHA 3TTYA 3OLEA 4PCSA 3BUBA 4HTYA 3EJRA 2WHJA 3ARXA 3VU2A 4QLKA 1BQCA 2VT0A 4PMYA 1HKMA 5A6KA 2FH8A 1V08A 1HP5A 4YHEA 3AXHA 3W38A 3MV11 3VO0A 3KLKA 3AICA 2ZOXA 4JFUA 5FL1A 2VI0A 2W1SA 4BQ2A 3M07A 3OA5A 5BXSA 1XC6A 1XV8A 2WAAA 2WCAA 2E3ZA 4QLLA 1BHGA 4MNLA 1CECA 1GONA 2VZVA 2ZUNA 3SUVA 3VIFA 1WKYA 3O6AA 2CNCA 3NQHA 3FAXA 3UR7A 3VINA 2EABA 1KQYA 3CZGA 1XD1A 2VUYA 1K45A 2DSUA 4IUGA 1LJYA 3VIOA 4OBSA 3ZM8A 3VUPA 4FNQA 1OD8A 4UFLA 3CV5A 2YFNA 3IAPA 4LYRA 4PMRA 1UR0A 1V02A 1PBGA 2CITA 1QNSA 3TP4A 3AQUA 2JKXA 4TXWA 1QPKA 3QR3A 1JFXA 2WAGA 4PUDA 3VMPA 4XZUG 4TXEA 4UNIA 2EXOA 1LWJA 3BAXA 3P1IA 4PMZA 4NF7A 3NSMA 3CZEA 1C93A 5DQ0A 1NOWA 1E40A 3L4TA 4FNTA 3WUBA 1AQ0A 4UOZA 2O9TA 4W7UA 2J75A 1SMAA 2BXZA 1UHVA 2BERA 1HIZA 2J7HA 5AC4A 1UASA 3DYMA 3ZOAA 1B30A 2GK1A 4N0RA 1PX4A 4Q22A 1OGGA 4H8HA 2EACA 3FHQA 2WBGA 2Y24A 3A4AA 1E3XA 2Z1KA 1QNRA 4W93A 4AIUA 1JF6A 3GXUA 5JXIA 3I2JA 3ABZA 1WB0A 3AHZA 4CU7A 1HXJA 3WN6A 2J1RA 5C70A 4UFHA 2WMIB 2VZTA 2W61A 5E6ZA 2UWFA 1IQDC 2F7OA 4B15A 2XGBA 1NQ6A 3OGSA 3DECA 1D3CA 2QQIA 1J0HA 5KEZA 3PZOA 4PMDA 3QGVA 3VD5A 2YDSA 3AS3A 4LHSA 3VDBA 1Q4NX 2WBKA 3VVGA 3AFBA 4CVUA 2V5DA 1HT6A 2VZRA 1DTUA 4B9ZA 4PTVA 4EKJA 2O9PA 1CGUA 1WZMA 4NI3A 1W8OA 1JNEA 2WCSA 1DWAM 2XN1A 4DUVA 4LQRA 2WSPA 3FAWA 5I79A 1O59A 1FP9A 1CIUA 1HVQA 3LMYA 3CHEA 3G6LA 1UY4A 2WUHA 3WMCA 1QI2A 2RVAA 4CVWA 3EDDA 2OWXA 5A95A 2WC3A 4Z2LA 2VMEA 4W8BA 1H11A 3AIEA 3PUIA 5CGTA 4P02B 2CEQA 4AZHA 4BK4A 3PZQA 3T0AA 1NWUA 1E1FA 1VF8A 4JFVA 4NRSA 3W29A 3TV8A 1ZL1A 4H2CA 3VX1A 3K8MA 4QB2A 4ZZ5A 1LF1A 5CPQA 1OT2A 4P00B 4ACZB 2OYKA 3KLLA 4WKHA 2WMFA 4CN1A 2WWCA 1OM0A 2WN2A 2EPMX 1JAEA 1WO2A 3WFLA 4JCMA 3D50A 3MI6A 2WMJA 1V0MA 4U33A 1VIWA 4XURA 2UY2A 3ACIA 2X0HA 3HG4A 3GNPA 4JFSA 5FOOA 3RO8A 3W28A 1OD0A 2W66A 1OF4A 1I1XA 1BF2A 1UZ4A 3A23A 3U5UA 3N17A 4HPHA 4PSRA 3W27A 4TUFA 5A6AA 3BVUA 1QI4A 2D3NA 2YA1A 1VENA 2GUYA 1E5NA 5EFFA 1US2A 3UNPA 3AIQA 4GPNA 3T2OA 3GM8A 3TTQA 3ARRA 2W62A 3WY3A 4TVCA 2RJ2A 4MB4A 5A6BA 3BH4A 3WY1A 3LRKA 1CIYA 1K9DA 9CGTA 3CUFA 3IANA 4GO8A 2EICA 1HKKA 4XUQA 1TVPA 4NXKA 1KTBA 3WF4A 2PC8A 1GU3A 4ZXLA 4GQQA 2X8RA 2D0FA 1V6YA 3CBWA 2W67A 1PX8A 3PTQA 1T2XA 1JXKA 2EO7A 1LL6A 4WIWA 4FNUA 1AMYA 3WQ4A 1M04A 1DWJM 3SKVA 1WPCA 3GXNA 3WNKA 3LE0A 4FLSA 1VB9A 1J83A 2VRQA 3CC1A 1UR1A 3N12A 5GPRA 1WDSA 1BVZA 4HG6B 4Z2GA 3ACGA 4F9DA 1ECEA 3UEQA 1G1YA 1GOKA 4ML4A 1GVIA 2VCBA 3B9DA 2UY4A 3W0KA 1KBBA 3D4YA 1JZ4A 2E33A 4YPJA 4TX6A 2DDXA 2FYVA 3MSDA 1TE1A 2W1QA 1E9LA 3F5JA 2BNJA 3PZGA 3T0BA 5E70A 2BVDA 1LL7A 2XIBA 1X6LA 2D1ZA 1TMQA 4WSKA 1UR9A 3MMWA 1B3YA 3SCRA 4F8XA 1ZJAA 3H54A 4EANA 3WF0A 3AYSA 1BYBA 2E8YA 1XHGA 2VM9A 1BFNA 4E8DA 3GXTA 1K9FA 3WFZA 2IXVA 1EHNA 5JIPA 1JU4A 1O6IA 4OKDA 4AZGA 2YBTA 1P6WA 1W1TA 1HJVA 2GJXB 3LXBA 3SCSA 1KGXA 3VGBA 4PN2A 4D6JA 4MB3A 1GHRA 3UR8A 1UXZA 5ABGA 1UQYA 4BA0A 1E3ZA 3ZR5A 3N18A 2ZUMA 1DYOA 4GI8A 2YIHA 1HXKA 3GXIA 2DSKA 4AZ6A 2F18A 4ZE5A 1CXFA 2YC4A 2ZUTA 1VEOA 3GXDA 1PMJX 3LPFA 1FFRA 1WZKA 1E5JA 3BMVA 4M81A 3S2CA 4DWSA 4C7DA 4PUEA 2DEPA 3KWXA 3PZTA 2VRJA 1W8NA 4Q7NA 1C3FA 3GNRA 2NW0A 3CZNA 3VIMA 4U3AA 4WJXA 5D4YA 4QDMA 1JD7A 1W9VA 3W25A 3UG3A 3WH5A 1E6ZA 3BGAA 3ZIZA 4F9JA 1XNAA 2WQ8A 1I5PA 2W95A 4D0QA 3W5MA 1TCMA 3L4YA 3WH7A 1UKPA 2WNWA 4M1RA 5A94A 2VR4A 2ORXA 4DUXA 2DH2A 2FGZA 1H0IA 1PZ2A 2V72A 2GSJA 1UWUA 1UKQA 2QPSA 5BWFA 1EQPA 3L4XA 5BXTA 4JKMA 1UH4A 2WKLA 4J28A 1R33A 2XOMA 5CG0A 2XVKA 1H0GA 1V02E 5DMYA 1MW0A 4HMEA 4CUBA 4ZXEA 1R75A 2WHLA 4ATLA 1J9YA 2VQTA 1M7XA 4RE2A 4J7RA 3VD4A 4J3SA 4V2XA 1BGGA 1UKOA 1N82A 1HJQA 4AIOA 1OINA 4UOQA 1NOFA 4A3YA 1O7DC 4QX2A 1BAGA 1UD6A 1CZVA 2HVMA 3TONA 1CGWA 4WK9A 3PTMA 3WDJA 3WY2A 2BBAA 2WO1A 3RM8A 1NWSA 4IPNB 2G3NA 1KGWA 2WMKA 2WSKA 2DSVA 5I0DA 1C7TA 2J1UA 4A4AA 3NSNA 1BSIA 4UQBA 4WF7A 1UYZA 2BXYA 3VIPA 2W46A 4HOXA 4QDSA 4KGJA 5CPTA 4CU9A 2W3JA 2VL4A 1NWRA 2XN0A 1H1NA 4TTUA 1BG9A 1QX1A 2VTFA 2J7CA 3F2ZA 1JZ6A 2J74A 2JIWA 1E6PA 5IHRA 1VAHA 2AMGA 3KE0A 5DF0A 4DEQA 6TAAA 3L4WA 4XUYA 2VC9A 2WABA 3WH8A 2QMKA 1UYXA 1WE5A 5HPCA 3L4VA 7TAAA 4UAPA 3WD3A 1UD8A 1U2YA 1UA7A 3BAKA 1VBRA 4P7RA 1MWOA 2WO3A 4Z2KA 1D7PM 3WUEA 1KXTA 1JYVA 2X2IA 4JX0A 2D3LA 2XTKA 1YQ2A 1V6XA 2VMDA 1CENA 1CTNA 1VEMA 2JF7A 1B90A 2ZUWA 1MQPA 5D9OA 3SURA 3U7VA 4AD5A 2X2JA 4XVHA 3QOMA 1VFMA 1ITCA 3W24A 2J25A 1B0IA 5HDRA 1QI0A 3OB8A 1ZBKA 1QWNA 1D2KA 3K75B 4GZ9A 2AAAA 3BLBA 2G8ZA 3AHVA 1IT0A 3WL1A 1O8SA 3WDRA 2YDRA 5DEZA 3VIHA 4UFMA 3QHNA 2Y6GA 3BVXA 4UFKA 4BDVB 1UZ1A 4NZFA 1ZS2A 4LPCA 3LEKA 2QQMA 2W9XA 4B16A 5A6BD 2G3MA 4UI9L 1HX0A 4F66A 3PHAA 2YDQA 1EO5A 3WQ6A 4LKSA 2XFRA 1AQHA 3HNBM 1GHSA 5M17A 5A8OA 4ZZ8A 1DP0A 4MJ4A 3ZSTA 1NP2A 4MNJA 4Z2IA 4CN4A 1UG6A 1W9WA 1E4LA 1JI1A 2GVYA 3ZO9A 3WF2A 4OZOA 2OYMA 4CUCA 1B3ZA 1K12A 3WH6A 3GZAA 3BAJA 3K4AA 1UWWA 3T2PA 1Z32X 4JHZA 1V3HA 5CXPA 1UQZA 2D0HA 3ZQ9A 3JXSA 3BUDA
chains in the Genus database with same CATH superfamily
3LCLA 1XGTA 3CCHA 4OGQC 4P9GA 4NZUH 3BO8A 4JFYA 3P84A 3ZLIA 3VBFA 1H8LA 3DRTB 3RZMA 2A83B 1PIV3 3NIYA 4ZO8A 1T20B 2ZGPA 3HNMA 2ZBTA 3CMGA 1RQEA 5FHBH 3DDFA 3TBWB 1YC61 2NWRA 3DK0A 1OIOA 1QBML 4JTKA 4YDZA 3WG7B 4OHWA 3RCNA 3FYIB 4M8RA 1IZJA 3IGHX 4PJXF 4HJWA 4UZUA 1Y18B 4I85A 3UBXA 1IFHL 3HE6C 1BJQA 2AF2A 1CZTA 1WLTA 2JDZA 2O61B 4BH8B 1MR5A 3S2JA 3S7EA 5EN2B 1RUG3 1XVSA 3FFDB 4JBRA 3NEEA 1GWKA 5GGVH 1GCFA 2LQRA 3O8XC 4M93C 2BSDA 5C97A 2O6CA 2ZKNA 3GDKA 3VTMA 3OXRA 2R9HC 1ZA7A 4XC1L 1W8GA 3LZ5A 2PTUA 5AG9A 1PPIA 3L17A 3EOAB 2JB8A 5ABFA 3RNQB 1N6VA 1CU4H 2KT6A 3IEBA 3GW3A 5DVKA 1OY0A 4E9SA 1SY6H 3V6ZA 3UAFA 5I1KL 4LKDA 3US0A 2XKNA 1AXSA 1W72B 1ZCRA 4Z3JA 2P3ZA 4UOW1 4E0RB 4RQPB 2RCSH 4BZ1L 5KHGA 1ITXA 4FQPA 2FCVA 5EO0B 4K15A 4AY8A 1ORSA 4B5XA 1NCBL 3BPLB 3J27A 4JN7A 3DO3A 3M1HA 3BYWA 2CO6A 4XDPA 3DI1A 1DQ2A 4BZ1A 2PPCA 4QTHB 4EJ1C 5GLVA 1IZ3A 3ZIWA 3DOHA 4B9YA 4YDVB 1QNOA 2ANUA 3AZRA 2CLRB 4AHXA 4Q8LA 5GJMA 1ZSHA 1AY1L 5DHEA 3W6LA 2F19H 4NI6A 4YXHH 4XODA 3N04A 3HPXA 3MRCA 1J18A 1JUKA 1IE7C 3UAJD 5SWZB 2A3WA 1EBPA 2EDNA 3KS6A 1RZIB 2GUOA 2FLMA 3QXAB 5FPBA 4ADSA 4NNPL 2CPCA 1IE4A 2XRAL 3EWBX 4A6YH 4FSJA 1ULFA 1U93B 2H1PL 1YPXA 5C0BB 1SW0A 1EZUA 2BNRA 3VZKA 3VDDA 4YC2C 1TEGA 2Z5WA 2JB5H 1EWEA 1S4IA 4B9IA 3DTDA 3WFDL 2R32A 3WEZA 2ENSA 5BMWA 1V6TA 4QROA 1CWYA 3QYSA 3ZTDC 4PLMA 3CVDA 2Q86A 2EKSB 1WMDA 1E0TA 2DQEH 2YPVH 4U05A 1XYPA 3S96A 4MAUH 3S57A 4QQUA 4XP4H 1PZBA 3B9KA 3ZBMA 3WJWA 4E42B 2OMZA 3ILNA 3B7MA 1YPFA 2GDQA 4QHOA 1WW7A 1RUI3 1QK0A 3AWOA 3UTZB 1ZJIA 3DFOA 2CXEA 3A4FA 5CG9A 1PTAA 4LDCA 5JLVA 1LUCB 4JYDA 3KW7A 5GZOA 1GPFA 4Q4QA 4XBGB 1QIQA 2IC1A 1R85A 2AXWA 3L2LA 4LF3B 4ALDA 1W15A 3EA3A 5EMKA 4OR1A 3WV6A 3LKNB 2J6EA 2A3EA 5BQ7A 5IW6B 2QVHA 2RDSA 4HD9A 3PP3H 3F6LA 2EIGA 3F4VA 4BHUA 5KC6A 2MCPH 1CDUA 2B9BA 1BXAA 1R3LB 3K51A 2R69L 2PELA 1SJCA 2I5YL 4Y2NA 4H14A 1SPQA 3ECVA 1A5KC 4ABVA 3OG2A 1ANUA 1T96A 1T7VA 4QM1A 1AZDA 5C0IA 2I45A 1JF1B 3KBPA 1SM3L 3BC9A 3RWGA 3B83A 5E8PA 2J72A 5C2UB 3PUEA 2ERJB 2YHGA 1BBT2 3G24A 4H9ZA 3INPA 4U1LB 3GRIA 1ONQB 3RJXA 1LMKA 1DQML 2FCUA 4PD4J 2DQCL 2HXUA 3UWQA 4ZNEE 3USUB 4MG2A 3OTTA 5HHQB 2ZHLA 2CY6A 2YZRA 5FYCA 1P7KB 4LUTB 4LSPH 4Z7NF 3QJSB 4PV1C 4K7YA 4W84A 2HYKA 2QQJA 3F58H 5D1QD 4GHRA 2Y6TE 1QJU1 2V81A 1RMU2 4K9EL 1BXHA 3SCTA 3MCG1 5SV8A 3LRSA 2FD8A 1YI7A 3G6DL 4IFOA 3SN4A 5F89A 1WZLA 3RHWF 4YSTA 4TU1A 1JYCA 1GGUA 2X88A 4M5ZH 2WFF3 1UMYA 1KXVA 4PY7A 3HMXL 2J22A 2DYPD 3O1SA 3WTTA 1W5PA 2I7SA 3WXWH 4LVGA 3DN5A 2Y2YA 1QGLA 3D4CA 3MV7D 2F68X 5EU3A 4LUKA 4XTIA 4O4YH 4K1ZA 2GCYA 2CGYA 4HWEL 1QMJA 3FSOA 4F33A 4LEBA 3K4ZA 3SPJA 4FTDA 3W84A 1F6KA 1GOHA 2AI0H 2VW6A 4J3TA 3EUDA 3C2UA 1UUSA 3RA7L 3H3UA 4MA7L 4QD2E 4QXUH 5D02A 5FFLA 2DFCA 3VDHA 3WE6A 4ZXBB 5KVFH 5FFOA 5IFHL 5DCCA 2W4XA 3VKNA 3HR6A 3SUUA 3M7SA 3CN0A 1UO9A 1MPXA 4ANVA 5AFEA 4GLRI 3BANA 4KI5F 4DO6A 3K2OA 3GU2A 5G5IA 1JWSA 3GNDA 4PHZA 2HMCA 5F5CA 3LPPA 1QFWL 1DWFM 2NXZC 3BAWA 2ZDRA 2XZQH 5DMIL 5AW2B 1T0NA 4G8AC 2V3EA 2D5HA 2QW5A 2DSZA 1TV7A 1EGJL 3RHWK 4YDIL 3R4SA 4XB8A 3BARA 3S46A 3FQUA 1PTGA 5I6LA 3QR0A 1OFNA 4MXVA 1U4FA 5AKRA 3ZFFA 2DIJA 1V6LA 2L8AA 3CWOX 2WJFA 1FOD3 1JV2B 3AYCA 4FNLH 5DZVA 1A3XA 5LBSH 1IAOA 4PRPD 1GVYA 1NCAL 4TYUA 4YO0B 4EVNB 1WW5A 3VXTA 4GSRA 5EMUA 5CBJA 1FGVL 1U30A 3RX2A 1SBSL 3UTSB 3AOFA 1QQP3 4XTRD 3VPLA 3OF6D 3NDZA 3QAZB 1G7PB 1FCQA 3ACHA 1AR62 5LG6A 4Q4Y1 4XBEL 2YG0A 2A1WH 1RZMA 2JK2A 3HZVB 2C71A 3FQXA 2OS2A 4GQ7A 2O6PA 4LSQL 2B16A 2PWUA 1G4RA 1L6YA 3SBFA 3W86A 2G5BB 4ONUA 4R7DB 2A6LA 2GYSA 1SSDA 2AXJA 2FEDC 3H3LA 3R10A 3UPRA 5HSFA 4AY1A 4FA3A 3TKFA 1BVNT 4NKIH 5KYXA 4LESA 3TN0C 3IBOA 1VQTA 4GFIA 2ZWYA 3ZO0A 2G0LA 3TLLA 4AITA 2FTAA 1GIGL 2IS7A 2EH7L 2R29L 1MXSA 2VLLA 4MY9A 1T04B 4F0SA 2XLLA 2GITB 3M3IA 3BD5A 3MNVA 1A6PA 4DJDD 1H2JA 4NRZA 1ZLUK 2WWSA 1KFWA 1IEAB 4YUEL 1KBGH 4KI5C 3RKPA 1APNA 5A7QA 1S38A 3AGWA 1LULA 1C8M2 1YA5A 4P5YA 1E1CA 3OJVC 1DGLA 2NQHA 3LV5A 3C0QA 4IBQA 2FSDA 3RJ2X 2GY5A 4YSSA 3MRRA 2VUOA 2OT1A 3BV7A 3FZ3A 1YNYA 1Z9MA 2PDHA 3GMNB 3WP4A 2VE6B 1GOQA 1NGZA 2CLIA 1KD7A 2OL3B 5LUMA 2GSYA 1REQA 5DT1H 2ZHKA 3WG1A 2OVLA 1HHKB 2H32B 5CCGE 1L9TA 1QR1B 4NNAA 4H8VA 4WW2C 2IPKB 3ARVA 3UKVA 3CAQA 3KYNA 1JZGA 3WIIH 2BY1A 2OQHA 5I9QB 4YXKL 1E9PB 5TE4H 4E8CA 3CHSA 4Y8EA 4DKEL 4DGWC 3EX1A 1TNNA 3GFXA 1J5SA 3VU1A 3UJIH 3TPUB 1HZHH 1OCJA 1UB5A 2D03H 2BV9A 4CQ9A 3QJHA 3F65A 4GGHA 2Z8VC 2I9TA 1H6TA 4Z2JA 3WKML 4BQ4A 3T42A 3LKOB 4OLWL 4LLWB 5D8ZA 3SY1A 3AZVA 3MIHA 1NP0A 4Y4FB 1PGW2 5C8JB 1GUVA 1M2VB 1WBFA 3M7FB 2DQJL 4X99B 1MCIA 5DCDA 3P30L 4L29B 1I6XA 4KHTL 4WU5A 3GZKA 4DJFD 4XP1H 2L9LA 4ZAKC 3BZEA 2POTA 5KVEE 3DG6A 1NMCC 1RZPA 1A0QL 4LCYB 3HC3L 5H37A 3PUHA 3GI8L 4FA6A 3VIIA 3UNTA 3O2DH 4UOJA 4MLJA 2EQDA 1KRCC 3EYQC 2D9QB 1PVXA 2Y07H 3QZEA 1UOFA 2WL1A 2HKHL 2OO6A 4PTMA 5CGYC 1IG0A 3SJVD 1DXFA 3GHUA 4Z42C 4KNCA 4CADA 4JE4B 2JIXB 4OJFL 4AWDA 2MANA 1T6MA 5DT5A 1W8WA 1HJWA 3MSYA 2YAOA 2R1YB 1JZ8A 3GVGA 2D3JA 1J0IA 3WTVA 5CJNA 3K8LA 1IAIM 1J9SA 4CEYB 1XGQB 4B7IA 2E3VA 3OBAA 1AXIB 3ELFA 5I03A 1R092 1WCSA 2OPCA 2UURA 4Z8BA 3LHWA 4WKZA 5JIKA 3FFCD 3LZRA 3GDLA 2QQNL 4P4KB 2CPUA 2WYTA 4ZOEA 1ZBVA 4K94H 4AVJA 3F5LA 1EXUA 4QHUB 1E4WH 2PF8A 4B1MA 2XIOA 3BZFA 1RHI3 3OD3A 5LNEA 1JK8B 1X6NA 4WHTA 4PMFA 4UQCA 5KUMA 5I0VA 1N5YH 1NGQL 2V8LA 1Y0EA 2ZXDA 3MJ9H 3KQ4B 4AISA 2NT0A 4N9GB 4YW7A 4IEFB 3MA7A 1Q6CA 2RB8A 5TE6L 2PDYA 1URLA 4XBQA 3RRAA 3VFWB 1N10A 1QMUA 5AL0A 4IRJD 5J6HB 2J62A 2X6AA 3M5ZA 4N25A 2JH2A 4G42B 5HYFA 4OCSL 1F02I 3L2NA 1TZHA 2EDEA 5EP9A 4KMLB 1ZPLA 1HWHB 4DBDA 2PW1B 3MHFA 4PV8B 4H7VA 4XXPA 1OM3H 4HPXA 4P57B 4AQ1B 3CZUA 4GNJA 4Y5TA 3S34H 5DRNA 3BN9D 2VLMD 32C2A 5GS0D 3QUKB 3SCPA 4XD3A 3F03K 4K2UL 1BQLH 5HDQH 2QVIA 1U8KB 3DJTA 3MNZB 4IIHA 4AZCB 1OLQA 3G1AA 1NMAL 1BYAA 1E28B 2WMGA 1XU2A 1CZ8L 3RG6A 2NQ5A 3LOBA 1ORQA 5IB3B 4P5MA 3EMZA 4E5XB 2FQIA 3ZYRA 5FMBA 1ADWA 4EPBC 4NENA 4L4TE 3H6OA 3B9AA 3LYEA 3JWNC 2QSTA 2QHRL 3URNA 1FLRL 2YW3A 2BVQB 2D31B 4N8UA 2Y33A 2L04A 3CJPA 1DZRA 3E6BA 2YUVA 2AXHA 3BXNA 4WOQA 4X6CE 1S7TA 4YGCA 3BPCB 2Q30A 3BFQG 1XCQA 4S2GA 1OIMA 2QHLA 4A6SA 1RKRA 5M2FX 3P74A 2CRYA 4WGXA 2AJXL 4RMTA 1QVBA 1E4IA 2YL9A 4PGDB 3KDPB 1OQ1A 1RFDH 5HDBE 4WI2A 2VN5A 3UP1A 3VXOA 1ISWA 4OMDA 3N40F 1FFNA 5DELA 1FNSL 4HHPA 2C26A 1E4MM 1TVBB 3PDDA 4LUSA 3C0SA 1NMBH 1Z48A 2Z35B 3Q2CA 2VNGA 4AD0A 5CFCA 1ZLDA 3CSGA 4HVOA 1O4TA 2CESA 1OB0A 1QUNB 4MMZB 3WQ7A 5AYIA 4A41A 4D6QA 2R8WA 1F61A 2I5IA 2WQAA 5LGHH 2BVEA 4XAZA 2WZPD 4KTDH 1HESA 2BP1A 3KNBB 3TSBA 3WEMA 1R34A 5DGQA 3A3YB 5FJJA 1RJYA 1V6JA 4MA1C 2R063 2VVSA 3QISA 1LKNA 4OMCA 4FQJL 4CDWC 2NXYC 4JFDE 3TV3L 3CK0L 4NWVA 4KK5D 2VT0A 2P8BA 3VO0A 6FABH 1KEGL 2WLNA 3TC9A 3RPIB 3SC7X 2OGYA 1XV8A 5GIRA 3OOQA 1C1EL 1D9KC 2NY7H 5AVSB 3HB3D 1MRFH 5IMKB 3UGGA 4IOTA 3EO9L 2CDFB 3GBMH 4FFZH 2WXKA 3X1BA 3ERXA 1XSQA 1ASJ3 1W0YT 3IAPA 2QADC 5C0RL 2C3VA 4CDXC 3VMPA 5DI8B 3SCMA 5D1ZA 1UNBA 3I54A 4K8GA 4HWNA 3QMRA 1HE7A 1GGTA 3NKGA 1A4JA 3ZPOA 4W7UA 4BFNA 9XIAA 3KM8A 4XF4A 3AUJA 3ZPYA 1OC7A 4XOAA 2GH8A 3BJFA 5FF6B 2PC4A 1QNRA 3PWVA 3I2JA 2EVXA 4A35A 5JVLA 4Z76B 4Y20A 1OSPL 1J3RA 5FIEA 3HIZA 2UWFA 3QRLA 1D3CA 5KEZA 3F84A 3QCVL 4PMDA 1QU4A 3CV2A 3NIGF 1I5ZA 1W56A 3OYZA 4MHHG 4N2IA 2BBFA 5D2WA 4Y9OA 4PAZA 2N1TE 1PO11 4HOMA 3G5YB 1CQ9A 1GZQB 4S0HA 1CIUA 1HVQA 1U5VA 3TW6A 2YBKA 5FWEA 3ZLHA 1F3EA 3NVDA 2JDUA 1EJFA 1UMLA 2OWXA 4QIRA 4XCAA 4AEIL 4G7VH 3NW4A 3H9HB 2EYTA 4G8GB 2FTYA 3MX0A 4RXFA 5APAA 4RQQB 2RS12 3F2CA 4E3VA 4WKHA 2WMFA 3IGAA 4D8ZA 2YD6A 2A9AA 2KC0A 1OSZB 1AG1O 6REQB 4R8WL 5ABJB 2UY2A 1YYMH 4FPEA 4U6XB 3AITA 1TIMA 4WV1B 1TZIB 3DMMB 2Q87A 3MJGX 3RFZA 2PTTB 1QI4A 4H26B 3B2UC 3W76A 2DU2A 5PAZA 4KBXA 5CEXA 3WG3A 1DO6A 2PC8A 2HVOA 3TZVD 4ZTXA 5FYKD 4OE7A 5JMUA 3FU9A 4HXAH 1DWJM 3ZHNA 4E2DA 2C7UA 3L13A 9XIMA 1GOKA 4HN4A 4NI8A 4APXB 5FY9A 4MAYC 3GNEA 1LL7A 3ES6A 3IMRA 1KYUA 2UXTA 5AOJA 4H9TA 1BYBA 3QH2A 4E8DA 2KKQA 3CQIA 4I0CC 3JWOH 4LHUA 1X7SA 3E2RA 2ICWJ 3QUXC 4I90A 1EX0A 4O51B 3WBDA 1FO0H 1TJXA 1VEOA 3WUWB 2SBAA 5JHMA 3MBWB 3RZLA 3PZTA 3PTDA 3NFSH 3NSTA 4KY1H 3IFNL 1FFOA 2DPKA 1ZZ6A 1KRMA 1JD7A 5LGJA 2DP3A 3EBRA 4LITA 1G4EA 3EKGA 1LECA 3OHXB 1WAAF 3TXZA 4D8OA 1LTDA 3KWWB 3PJTA 3GRBA 5G55A 1UWYA 3S37X 4GRWH 4OIAA 3MW3A 1TJHL 3W7EA 4O19A 1YUHB 2CALA 1YVLA 3RL1A 1YAZA 3P3SA 4ODUB 2W9LA 1MS3A 5A7WB 5FM4A 3C8HA 4X8XA 4H8NA 1VS1A 1HJQA 4JO3L 3N9GH 2CKNA 3KT1A 2H6RA 1IGYA 5SWZE 2HWE1 4QX2A 1UD6A 4PVMA 3PTMA 3WY2A 4O1EA 2D7TL 4QXHA 2PGRA 2K9UA 1VLXA 3RM8A 5C86A 2TYSA 2WNVC 3KDMA 3QDME 5T1LB 3S97C 4HJUA 4TSAL 4UQBA 2HVNA 1QSFD 2QVTA 3H0OA 4HOXA 1XTLA 2FX9L 2D69A 4PWJA 3BJTA 1NWRA 3OQ8A 2B59A 2R0KL 3MRBA 1VAHA 3L9CA 4EI0A 2W9DL 3QHFH 3FQYA 2WXIA 1Y6NR 1VBB1 4UAPA 1U2YA 2HCZX 2DYRB 1UG9A 5AYUH 5TE7H 3RJQB 1S1RA 2BK8A 4LBJA 4DT2A 4DVBB 2F53B 3ALWA 4AD5A 3VI2A 3W24A 3FDGA 5H8MA 1GEHA 3MROB 3P9LB 3AKPA 3ETBF 4ADJA 1T66C 4BRVA 3E0IA 3GSNB 2G60L 5IWLC 4NZFA 4KERA 3B6SB 5KETA 2PYEA 1KXTB 4UI9L 3F7RA 4F66A 3HGOA 5H4ZA 2YDQA 4US6A 1O5DT 4AL9A 4FQIH 3HNBM 5LCVH 3IE4A 2GSIA 4L1WA 1UG6A 5FO9B 2C1OB 3GTFA 2Y7MA 4DAGL 1W9YA 4UTJA 1UGNA 4DXVA 5CXPA 3ZQ9A 1YEFH 3BMXA 1NGXB 5C0NC 3I59B 2MCMA 1PIGA 1KB5A 1SQ2N 4L6HA 2XSXA 5BNKA 1UXWA 3PTKA 5IDIA 2AJUH 5DK2B 2O6FA 3FTSA 3MV8D 1QHZA 3MN8A 3VFUB 1S7QB 2E27H 2OCFD 3KPQB 1J1OH 4QEHA 1CWPA 2FPVA 3FO2A 5F6IB 2NQ3A 1W3NA 5HINA 1A1NB 1CLCA 1FDZA 1N3OA 2K0GA 5JO5B 5CINL 3GYCA 3EO6A 3CFKA 5I6SA 5JDBA 1KZYA 2EYSB 4JAWA 1VJZA 4DB7A 2YPLB 1WD4A 4ODSH 5I18H 3A0NA 3C5SB 3F7LA 5I1IL 4PB4A 4JQVC 3ZHLA 5FKAB 4F40A 4ORFA 4Z77B 3APNA 4H55A 2EDQA 4I3GA 1W3JA 4Q26A 4PJGA 4JAAA 5K0UB 3IXTA 4NQQA 3K7UA 1RZJH 3TIDB 1LP9E 2W60B 4JVUA 1NBYA 3BICA 3QS3A 5SX4I 2ZA9A 3WUCA 1RV8A 4D8AA 3FFOA 3IBEA 1IM9D 5G4EA 2Y8VA 1DCLA 3KEHA 2H6BA 4P2VA 4HLZH 4UT6H 3WIJA 1C8NA 3ELNA 1KNWA 3LBMA 4N53C 1B4EA 2B4KA 2GNMA 5SV5A 1CLZH 1ZRCA 1DQTA 1OHFA 2X2YA 1I8KB 1A4CA 1R3IH 2DVBA 4AVAA 4M43L 1RA0A 4A39A 4W9FC 4XVSL 4ZZFA 5EUOA 1UZ6E 1MCCA 2SEBB 3STPA 5D32A 2EE0A 1TG8A 2ABAA 1TTPA 3DJRA 3KVLA 3GRGA 3NG3A 3NQFA 3QIWA 3WJLA 1AQ8A 3BWUF 4AD2A 1EEZA 5HVGB 4FXKB 1ISZA 2ATKB 3QUZA 2H6OA 3EH2A 3PHOB 4TNFA 2I25N 4PR5B 4G6ML 1IAIL 4V15A 4L3CB 5J12B 2F8XC 2JCCB 2I26N 1KLFB 2VZSA 3K1KC 5EDSA 3FX3A 5LVEA 4R96B 5JDSB 5HYSB 3M0KA 4W8LA 4LVOB 1TKWB 2WBJD 3I6EA 3HTLX 1E2ZA 2GTWA 4LTAA 2CK0H 1MDTA 4K3JH 2YUXA 1EYWA 2WK2A 5GRXG 2JDMA 1Q2SA 1QKZL 1Z41A 4RBPK 3PZUA 4FQCL 3WELA 3TK7A 1XR8B 5EEZA 1P0DA 1MVEA 3T6QC 2A3YA 1I9IL 1VIWB 4PMQA 1LQ2A 2OJEB 1W1IE 1W37A 2WNUA 3V79C 2YYOA 2CAKA 1RZ8A 3M41A 1F90L 5FZHA 3IM0A 5A6SA 2ZEWA 4D7TA 2YBPA 4IETA 4KWWA 3DVNA 1AR73 5CJXC 2A38A 3T2NL 4M6MH 4ZMAT 1WBHA 4ENEC 5D4IA 4L0PA 4F5CA 5EPMA 1R0AL 4PIXA 4C83B 5JTWA 3MFFB 3EAUA 1S2KA 1WKEA 2IALB 2VH5H 4AJYV 4C1NB 4JFZL 3T4YA 1HF6A 3B8WA 4WHYG 5KYYB 5D8JL 1AD4A 1KFUL 1T2QH 4F83A 5JCTA 1RUSA 2XGIA 2NY4C 4RVBA 4HJFA 3B02A 2MNGA 4GIPD 3EOTH 3NZRA 1UWGH 4N7UA 4HANA 3PY9A 3R5EA 2PE4A 5BUVA 2A7RA 5DUPL 4ELMF 1YMHB 5JPNB 4O50A 1ZZMA 3UBXI 3UJRA 2R0HA 1MDRA 1JGIA 4APQC 4P23B 1UOKA 5C9KA 2YBGA 1DBAH 3LD5A 3ZN5A 1G7HB 7ODCA 1ETB1 4W4OA 1AX0A 1H0BA 1FP8A 2PCEA 2OMVA 4U4BA 3TYAA 4ZUVA 5SV3A 4R4BB 3S5LB 4UMBA 1AR82 3GHBH 1KB9K 3L45A 4Q6IC 4F7EA 4DO0A 2HT3C 4V1DD 2J7DA 4RLDA 1ET5A 2QCDB 1G4MA 4HT3A 5IVEA 4RZ4A 4YN3A 4D9LH 3GY1A 2LGNA 4HZLB 4URTB 5C9AC 2R15A 1PG7L 2YLLA 1WWCA 3D3VA 4V11A 5LBGA 5C5UA 2E1DA 2BNQA 5D1XD 4OHVA 5ICZB 3QN3A 5G1TA 5INDA 1XG3A 2WPGA 3HAEA 2ED8A 1D2OA 4H9XA 3SDAC 4HUNB 1RUAH 3C5ZC 2V4AA 4UTWC 1GYKA 4KO5A 4KTEL 4BCEA 1CXLA 5EOCH 5E1RA 4WI9A 4QNPE 5DN2A 1BEXA 4OF5A 3WJJA 1PKNA 1NUFA 3BKZA 2IG2L 5ITFA 3PXHA 4WGVB 4G8FB 2O72A 3B1UA 1GQKA 1UWTA 3PAOA 4GMEA 2F58L 1J1PH 2IUZA 2V4VA 2DZPA 2HX7A 1V03A 5I8CB 4Y1XA 4LAJH 4A44A 2J78A 3T6WA 1WHOA 1IKQA 1RUH2 2CBVA 3VIGA 2J88L 5JIHA 2GIYA 2CDGA 4LO6B 2Y0SA 4KJQC 4IUOA 1AQDA 4GQGA 1V3MA 5GS2H 4QXTA 5CZVH 5B39A 4WEVX 1P0EA 3SN0A 5IREA 1J86A 5E6IA 2B2XL 5B38A 5DTFB 5FYLD 4UU9B 1H3VA 3X3GH 3L3OA 3T08A 5DGRA 2YSWA 3TNBA 5JHBA 4XMZA 3HN8A 1YPZE 2Y8KA 1W2VA 3ABRA 3VNIA 3SKNA 5AOZA 2F1AA 2A6KA 5GGTH 2JB6A 3TYCA 1G4PA 3WQ8A 4NP4L 1MHHB 4DYEA 4F8TA 1JZ3A 4OECA 4AQAA 1TWIA 3W81A 4Q14A 1P7QA 4DRVA 5L88H 2RM23 4Q0PA 2DV9A 1C9DA 1QTWA 2V63A 5DD3L 3CZSA 2IW0A 5I17B 1P5BA 4XZ9A 4H1LG 3ALXA 1FV3A 7PCYA 4UTTA 2X70B 1JHKL 4NN7C 2AR6A 3HAGA 5I5RA 4A42A 2EDDA 5GISL 4BJHA 4A3HA 2F6UA 4KI5M 3UTQB 1FE8L 4M7SA 1XYZA 2OJZL 3SO3C 1DQDH 5HHVH 2R83A 4LDOB 4YXLL 1W6NB 2MH4A 4BHUI 4W65A 4Y9MA 4W9IC 3ZGIA 1C16A 1W6OA 4RL3A 4N1EA 5IVZB 2Y61A 4AF9A 3PYCA 5C3SA 2JKTM 2ZQKA 5HI3D 3RIKA 3DFPA 2E68A 3S35L 1Q6OA 2IAMA 1HZYA 3TF7C 1W2PA 4H4IA 3MUAA 1U33A 4G7EB 4RR4A 3BGMB 4MFHA 2YGYA 4GJTB 1GP6A 1SJEB 3FB8A 1KBIA 4N85A 4LCUA 1TA3B 2ORBH 1V7MH 3EBIA 2FPYA 4DJED 4GGBA 3U57A 4MX3A 3N41F 4B97A 1VR3A 3GWQA 1ME7A 2APXA 4Z1DA 2WFPA 3ZL4H 2Y7SA 4LLOA 1QDSA 4S1SL 3LI0A 1AXZA 3NK3A 3CLEL 2XN9A 1GGIL 2WWMD 3WR0A 5FA3A 5JMRA 1JDCA 3SYQA 4YZ4A 2OXBA 4P07A 4XO5A 4BM8A 3NJIA 1NL0L 3NCYS 1LQBC 1FWDC 3D0LB 4AH2A 2WZ6A 4E5TA 5B39G 3IJYA 1TFPA 5JOFB 2CUAA 3DFYA 3D47A 3OEBA 5BV7L 4QUOA 5AFAA 2WKGA 3CEUA 4XNQB 5ADOL 1ZVYA 1ZS8A 2X1OA 2DLFH 3HA1A 1Z8AA 4D3CL 4W6XA 4QTFA 4M1DL 4EDXA 2WKJA 2ZSVA 1WDRA 3VBRB 4P99A 1QPQA 5XIAA 2X40A 2ZUVA 3DIFA 1DQLL 1ET8A 3G6JE 3NUKA 2DWDB 4E6MA 4PLKC 2UY7A 1DLFH 1KZQA 3FNDA 3L7FA 5IQ7L 3VAVA 2HUEA 1YJDH 2OMYB 3S37H 5DFWH 5J1TC 3RDTC 4S2CA 2TRYA 2X4UA 1W0WA 1SLXA 1K5MB 1A7RL 1RY8A 1BIIA 2D7NA 3HVNA 2BCKB 4O02B 1CURA 4NGHL 1GCYA 1KGJA 3KR3H 3WQ5A 2VEFA 1RK1A 2LVEA 2WZ8A 5D7HA 4L4TB 5AWNH 2YCLB 3FUKA 5D38A 3OXSA 5C0JA 1LRHA 4NIAA 4FPCA 2BHYA 1UM4H 3AKQA 4GKLA 4P7OA 4EN6B 5HGHA 1C08B 3UJ2A 4UINL 1PKYA 4ZSOE 3C2RA 1CJDA 5B3NA 2B9VA 1CFQB 3ZSLA 1GEQA 2DGAA 2NYYC 4N4PA 2NWSA 5IB5A 3KYKH 5AVRB 4LBSA 1VP6A 2P28B 4MJ2A 1LEMA 4WUKL 5KTLA 3RM4A 3UTTB 2EALA 4B9JA 3MBEA 3HFTA 4QCEA 1LYXA 1K85A 3SUWA 5KR7A 5HWJA 2UY6A 1H3TA 4RAVA 1CQYA 3CTTA 3G5XB 4QYAA 3PL6D 4CD5A 2Z92A 3AGVA 4NQDB 3BDXA 1TRIA 1WAEA 5I1EL 5DUJA 1Q9LB 4C0BA 4GH4B 4HK3N 4ZOCA 2BDNL 4JANA 1TPDA 4ZYKB 1N26A 2WZ0A 4FQHA 4XYXA 3NJGA 4FA7B 1FYUA 1OCQA 3IPVB 2HK0A 1ZANL 3VNDA 1LD9A 3DV4A 1G6CA 1G6VK 3VAEA 5CR1A 2YL5A 1FY6A 1NE6A 3IFOA 2W65A 1A21A 3BPOC 2P88A 4AVOA 3U7YH 4XO8A 2HWC3 2XXFA 4JFDB 1QWKA 3CC5B 4QYOB 1ZT4A 1UP2A 5SX4H 3U78A 4KMQA 4R85A 3ARDB 1RURH 1J3PA 3HE6A 4B5WA 1TVGA 1YDNA 1D5IH 1RAMA 4Q9BA 1Q85A 4BI5A 3RPQA 3ESOA 4NILA 1W1YA 5K69A 4AI0A 2YSSA 1I1YA 4PW4A 5DURB 1S3HA 3VFSB 4QE4A 1YIXA 2RDXA 3HBLA 2J8UA 4XNYL 3VB9A 5EUKB 1YNKL 3QIBB 4P2QE 4PV9A 4LSRL 2E7BA 1CFVL 5ABTA 3I97A 5D2LE 4L4PA 3QPQC 1N67A 4PRWA 5F9OL 1TQTA 3EWZA 1GOWA 1X4ZA 3KM2A 4Y3OA 3GVRA 3QWRD 3PHQA 4W4QA 1N0LB 2VM8A 3PSWA 1X44A 2NNCA 3O9WD 5CSZB 3DKLA 4XVOA 1DL7H 2B31A 1R5VA 3F04A 4GY4A 1EMTL 1O8PA 4G8GE 2YAPA 3ARFC 4CJ0A 3IMNA 1CCZA 1KM0A 4PB9H 1TWWA 1B4JH 1BYHA 4JO8A 3QACA 2RR13 5FJTA 1KTNA 2YZ8A 3Q37A 3VBHA 4QPIC 4L11A 5T5OA 1ULCA 1YY8A 4HMZA 3ETPA 3TIEA 3AKRA 4XUTA 5DFAA 1H2NA 1VPYA 4NFDA 4LEJA 4IM4A 2OMUB 2BASA 3BWAA 4NQCD 5BZDB 1OTSC 1WIUA 2Q8EA 3O3AA 4BKLA 4LCWA 1S55A 3LN4A 2O56A 5L8KB 2VFEA 3L5WA 3WMPA 3QNXA 2Z6JA 1ZTMA 3OLIA 1QLEH 3VQ2C 1OFAA 4OQTH 3MFAA 5I8EB 2KAUC 2GDFA 3PDQA 3DUSA 1KJ2B 1H0DA 4BIFA 1I7UB 4JR5A 1WUEA 1EV12 4IP7A 1JPSH 3T0ED 4M61A 1W3XA 4DWSC 5J5RA 2DKUA 4PJXA 1IGFL 1N3QA 2WXRA 1B1YA 4Y5YA 3MLSL 1G0XA 1DQ5A 3HG5A 3EF7A 1GYUA 1MHPH 2XQRA 3T4AB 4MDJA 4OZHE 2Q4SA 2E53A 4GXVL 3CBJB 4HUWA 1KGYE 2OMWB 4FTVE 4XUPA 1G7YA 2IXQA 2WUBH 4WWID 4H01A 3NPWA 4UYPA 5EFDA 1FDJA 3WFCH 2H6PB 1OCOB 2PWEA 4GUPB 1VMJA 3D0SA 4K3GA 2E5CA 3KCYA 1SR9A 3ZKNC 2RMU1 4PMYA 4NZTH 1IEIA 1IFHH 1W1ZA 2YO3A 3WLPA 3NEXA 1S7SA 4P4RB 5C2CA 1A6WL 2VZVA 4YLCA 4GKOA 2FBOJ 5GGUA 4JPVH 3NQHA 4F2EA 5EJ3A 2EDLA 5HHOE 5J6SA 3PABB 2QULA 3E7JA 5CCKH 3LYRA 4FF9A 3VWKB 1AJKA 4YR6A 3S36L 5KZMA 1LO2L 2CITA 3NGJA 2JKXA 2AEPL 5D7IF 1W9FA 4FX7A 1RPUA 4NQVA 1YEKH 2PO6D 3WEBA 5CBIA 4MFEA 3P1IA 3I65A 1NOWA 3Q2DA 5AENA 4IP4A 5D71L 3AKSA 3I02B 2WINA 1HIZA 4X9HA 3ZOAA 1PX4A 4BZ1H 4QGMA 1IBYA 2WBGA 4IS6B 1A6ZA 3D18B 2GGEA 2VVDA 1E90A 1PQZA 1HYSC 4FQ1H 1N2RA 2IWGA 2QKFA 1L0XA 3A4JA 4HZAA 4E4SA 4YHPA 1F8MA 4OLXL 4G7RB 3VABA 3W21A 5EZIH 3TJXA 1QPXA 2WT1A 4BGDA 4IIQB 4D0DB 4Y1YA 1JNEA 1UZHA 2XN1A 3CJIB 3VZMA 1DVFC 2Y34A 2CFFA 3QDMB 5HGAA 3TX9A 2F53E 3HE7A 3UJFA 1ZA3B 2ESVE 3J8F1 2P3IA 1KENL 2CEQA 3WQFA 1HKLH 2UX7A 4QHZA 4Y4HD 1ML1A 4G8TA 4HJIA 3MNDA 3JZYA 3U4XA 5A3NA 1OE1A 4YG3A 4I09A 1OM0A 1AL22 4NPRA 4O52A 4PTNA 1CDYA 4O1BA 4FZ8H 3TFXA 4MWAB 4ML9A 2RDWA 4JN2B 1PY9A 3VFVA 3P3TA 3LERA 5DUWA 4FG0A 5ERWA 5A6AA 3MRDB 3SE8H 3U2SA 1OC5A 1U8MB 3QRGL 2J1ZA 3U0WL 1HHIB 2BJMH 3NAPB 1ZGLA 1GICA 3KCWA 3Q9OA 3U11A 4CDQB 1CIYA 3TW9A 3IANA 4NXKA 1YW1A 2A9DA 3K6IA 4NRPA 3DX9B 1F4YH 3BKCH 3LJ3A 5KTEH 3NL5A 1KM6A 3O7OA 4LEXH 2VDIA 1EJUC 5DRWB 4L64A 3EYUH 3E6CC 3WLKX 2ATPA 3TFBA 1LL6A 1JPIA 4LFHG 1G87A 4MMYB 2BWAA 5HDWA 4JMXA 1G1YA 1T5XA 4EE2A 3MJ7A 3NAVA 2NQYA 1JN6B 4HF5H 3T3PF 3IUIA 3L21A 5TDNA 1TE1A 2CHDA 3WS3B 3V4VB 4UBPC 3TYUA 2J6EH 1MZEA 3MMWA 1B3YA 2YPLE 1ASOA 1AR92 3LNIA 4OKDA 4Z1PA 1D0GA 4Y19D 4UBGA 5JNYA 2E7HA 3QHTC 4A2FA 4D6JA 1IARB 2ICES 3UR8A 2R69A 1Z5HA 3N18A 4U6VL 2EIMB 3H2EA 3EJYD 4L1XA 1CXFA 1B4KA 3WN5B 3IKWA 1N8FA 3BMVA 1DSFL 4EN7B 5F9TA 3Q2LA 4Z7WF 4IE6A 3RYSA 4Q4X3 2CUMA 3VIMA 2JI1A 4L9LC 1C8PA 3QPYA 3GVVA 4NHKA 1W9VA 1P48A 1E6ZA 4OM1L 3FJTA 1P5VB 3BP5B 3ZZ1A 3RZZA 3DPRB 2BRTA 2Z27A 5TPWL 3HQNA 5LK5A 4A8LA 3POIA 2ZGSA 1I0BA 1H0IA 1PZ2A 3GKWH 5IVXB 1H3UA 5LG1A 1M7UA 1LP9B 3PC0A 5J3HC 2DS4A 2PP7A 3QJFA 4XFIA 4LE8A 4ATLA 4G6AD 5E6RB 3BISA 2IOMA 4O0QA 4U1HB 3NOEA 1UKOA 1H8TA 4K2SA 3US9A 1NOFA 4DZHA 5BW7C 5DBUA 1SLIA 2WTRA 4NQSA 4UNVA 1Z6KA 2RD0A 1B88A 3ROLA 3EW3B 4OUUA 3TN0A 2WO1A 3MP5A 4WM8B 4DW2L 3HMXA 4WWOA 1EEXA 3PVOA 3CAVA 1I8LA 1BQGA 1C7TA 1HLCA 1K8YA 2ARJQ 3B3IB 4NWUH 3A9BA 4WVWA 4Z1BA 2G9FA 3KMHA 5DD6A 2JCCE 1O4UA 1IGMH 4P5KB 1DGWX 2DDQL 5AUMA 5CF3A 4PWFA 1YHPA 2LT9A 3I6LD 1SXNA 2DQIH 2WABA 2IMNA 3R8HA 1VBD2 1BMV1 3U2EA 5FOJA 2IQ9L 4LSSL 2JSFA 1V6XA 3BP7A 3KM5A 3W87A 5EKYA 3O6YX 1DIEA 4X98A 2Z6FA 3LSOB 1NLDH 2YCEA 4NBZB 3OPTA 1D4M1 5HGBB 5IFHH 2DWSA 2ARXA 6TIMA 2WO3B 2W9XA 4O13A 4B16A 4XXDA 1HX0A 3WTXA 1YQ5A 4JFED 3NJYA 4PVNA 1MS5A 2PP8A 3DETD 3CV6A 2WUCH 5F7EH 4NAMA 1E6JL 3EOLA 4R8HA 3QXTA 3GZAA 5DS2A 3Q6FA 4I9AA 1HQRA 3K4AA 1OABA 1EGJA 5DMIH 3UR5A 2JWYA 1YEWA 1OHLA 4UWQB 1MJUH 1ND3B 4YDIH 5T26A 3O6KH 1ULPA 5GGQL 2RDQA 4WW2F 1HSBA 3Q2WA 2A3CA 3C0LA 4GNVA 2GSHA 2FCBA 3PWPB 1R17A 3ZYZA 4OI1A 2BC4A 3Q9PA 3B0VC 4C91A 2JJWA 4YHNA 1GZPB 4I48A 1AQKH 5A3IC 3U75A 4M48H 3LSDA 1LU1A 3TWIA 1I8JA 1QUPA 4CCLA 3ZZQA 2A3XA 3L4UA 4HGMA 1R5WA 4FXGA 2GP5A 3VSQA 2EPNA 5JPMA 1NAMB 2XPKA 5FC9A 2NMSA 4WK4B 1V6VA 1U8HA 1BECA 2RDNA 3ZWSA 3GZTB 1WF5A 4QXBA 3R58A 1DJZA 4FMVA 1EGZA 1C12A 1OTUD 5C33A 4JGJA 5T3ZH 4CVXB 4NZ8A 3L12A 3SCNA 2J20A 4HAGA 5A5WA 2WW5A 4JDYA 1TEYA 3P80A 4JZJB 1IC5L 2R1DA 1VFBB 5C08D 4I1RA 1AYOA 2Q8BL 4HZMA 3NAAL 5BVJA 3OJ2C 1PFOA 4IJTA 2OXGB 5HQLA 4FX6M 1BQHG 4IIDA 4MD5B 4X4ME 2GVLA 3LZFH 1QHQA 2EDHA 4CNIA 3LCWA 2G9KA 4NFCA 5AC93 5A8PA 2YB1A 1ZBCA 1TJPA 4FOKA 3BT2H 4BBWA 1W2KT 2LU3A 3MO1A 3VXRE 3QQ0A 1S5MA 1DUZA 1KN4L 3ZR6A 4HN1A 4MQ7A 5E7BA 4BK5A 1H3XA 4LU5L 1CMOA 1Y6KR 2IKIA 5C09B 5HHXH 2R29A 1UIJA 2FZ3B 5CEHA 2HN7A 3C5JB 3PAVA 4A7TA 2JGYA 2BB0A 2Y4SA 4ORMA 4DBEA 2ETWA 3GALA 5IJDC 1YYAA 2Y2WA 1HDMA 1TUFA 1XIWB 3B7SA 3NYDA 1XBFA 2ZG3A 1E4XI 2K9ZA 2WLKA 2PBGA 1RQHA 3MV9E 2C3WA 5DZPA 3CBKB 3I3QA 5BVPH 3MPCA 3UG5A 3DJSA 2XKSA 2C13A 2VAJA 2F74B 3UYOD 2PQQA 3TO4D 1UFGA 3SJNA 1ICTA 3EPOA 2CO1A 1H9PA 4X5WA 4WGWB 1H7RA 4PS3A 2X6CA 1C5IA 2WNXA 5A6MA 3JU9A 3FBMA 5DEFA 3VFMB 2RMNA 3E6HA 2PRLA 1XQNA 5BO1H 1PYMA 3CQFA 4QGLA 1QF3A 3NK4A 3KCXA 2JE7A 4AV5A 1U91B 1VGAA 4FX8A 3A0KA 3O07A 2A73B 2AGJH 3AREB 1RJ7A 3SGUA 2VR3A 2CIPA 4HJEA 3T0VA 1XQKA 3ONCA 2R49A 4HX1A 3ZSEA 4TOYL 4L65A 4JFOB 4Z0JA 3P40A 3ZE0E 1ZBA3 3EYVB 3FT1A 5BOOA 2R9RA 3E38A 1KCLA 1HILA 1GOMA 1R3HA 1NKRA 4W7VA 2WMHA 4LQ1A 2EIBA 1KQZA 3F83A 2JGQA 5DQ9B 3FUMA 5CZKA 4TTDD 1FZJA 5BU6A 2ARWA 1DANU 3N85L 2QCSB 3RGVA 5DUVA 1ZBE2 4EQ2A 2VXTL 1SHWA 4WJG3 3IJSB 1OK4A 1CG9A 5KBPA 1X9LA 4DZAA 3CFEB 4XTPA 4OWGA 4M02A 1HRI3 2ADEA 4PRDB 2ATAA 1YPZB 4BQ3A 3C60A 3KYAA 2C6QA 4KUZL 4LBEB 1POV1 1KTLB 4IMCA 5FAJA 1QNYA 5ANMA 5IVOA 4KHTH 1R3KA 4FI6A 2BM3A 5H37H 3NSJA 4P2RE 1YECL 3KQRA 4OCTA 1RUF1 4Z0BL 3UXAA 3BDKA 3DJ9A 4LK6A 4PJ8A 1ZVHA 3MGTB 1RLBA 2D23A 3LQLA 3DROB 3KPPB 2XH6A 2ZUQB 3HC3H 3GF6A 4NJ9L 3LFIA 4DKFH 4K3ZA 3EOEA 5IQLA 3DXIA 5L7OC 3HZ3A 3P69A 4H04A 1PZ3A 2C14A 5T1MB 2WJSA 3WI9A 3B5GA 1N18A 3OF1A 4HN0A 5EF0A 3HI5L 4LBQD 1ZVFA 3M3CA 1UH2A 5CC7A 1IO4C 4MUVA 4UILH 4N86A 3VDAA 4AKPA 1D2SA 1XOYA 4WNQB 2QSCL 3IAGC 1FNHA 2UWEF 4LCCA 4XC9A 3J7NA 3GDBA 4IKIA 5DS8B 4WUUD 4CA4A 2CUHA 5EDXA 4K7PH 5E7FA 5F3EA 6XIMA 3IDXH 2QQNA 5HA7A 4ANWA 1R7AA 1UZ8B 1GG1A 3TLQA 2N59A 3CSTA 2H3DA 3Q6GL 4KK9D 3MT1A 1ZLVK 1DVTA 1O91A 1CFSB 4HUUA 4HJJH 2X1RA 4GUOA 3DVGB 2YXOA 2PHLA 2GC0A 2RS52 2YJQA 3B97A 2ZCGA 4TS6A 4C47A 1O3SA 2CBTA 1KRIA 4ODTL 4R7NB 5DRCA 1NX9A 5BZXA 1D9KA 2DWEB 4QWWD 2PD5A 4XEZA 5CG7A 4K8RC 4FMFA 2VENA 5TE6H 3VFPB 1PZ7A 5T33H 2VZ1A 4JEGB 2X7WA 4MYXA 3NO3A 3VI4F 1AGFB 2OSLA 5T50A 4QBXA 4XB7A 3LEXA 1W6MA 4XNUL 2Z0IA 4HUMB 5BNPB 5L6YL 4YHZH 3ZYIA 1FVDA 3HNTL 4R9HA 4XVJL 3QDJA 4JW3A 3JWNG 2IQAA 5HDLA 2J9XA 5IBUG 5F4WA 3HPZA 1RL1A 4ISQA 3G6JB 4JYFA 2RAMA 2QE3A 3LHZA 4RLIA 2VGDA 1IEBB 4GIEA 4GULA 3O6CA 2ZEXA 3L68A 3CFCL 3I7QA 2A6DB 3JVGC 4DERA 3LU2A 4N6RB 4HG4K 4MWFA 4HPOH 1VPQA 2AVGA 5EO1B 1H5BC 5A6XA 4IM8A 3ZYBA 5IVCA 1MVFA 2ZZ7A 1M1BA 4QKFA 4HK0A 1FTXA 1FLRH 4H0HB 2HQAA 1DEEB 3UTTE 4L9XA 3I4KA 3LLFA 4ZO6A 4D6GA 4YZWA 4JDTL 1QUMA 5D7JB 3NMBA 3BYTA 2Q6WB 1S78D 2MUCA 3PJSB 1NICA 5CD3A 1M1XB 4R4NC 4NQDE 5I15H 4A2DA 4QT5A 1A7NH 4ZSOB 5KWYC 4BU2A 3OKOA 2VNVA 1XDMA 5EU6E 3FU7B 2GWGA 2VCMA 4NASA 4N4YB 3DX0A 2OODA 2ZJSL 1MVYA 4PTDA 3TN91 3OZOA 5CAZA 1QQDA 4IPIA 3BCFA 3WLMA 1MCPH 2EDRA 2XA8L 4JRYD 1OD7A 3HRZB 1W2OA 5I3GA 4ACYA 2FJFA 3WLBB 3QK0A 5I16A 1F3XA 4ZI8A 5I1CL 3UGRA 4XZHA 5C0AD 1MS9A 4KXCA 1ZSDB 1RK5A 4M5PA 4MY1A 1M65A 4PJ5E 5TD4A 3R13A 4H83A 1XR9B 3KS0H 4BISA 1HUVA 2E67A 5I1LB 1UIOA 3QG7H 4MAVA 1ZLEA 4MAYA 1TTBA 3A4UA 4PRIE 3GJFB 4NIDA 3O3BA 2H0PA 3EYFA 1CC3A 5DJ8B 1TVNA 4H2AA 4FQJH 1CF8L 3CK0H 1QJZA 1TXKA 5DVOA 2AKZA 4OZFB 4X9FA 4NN0A 5IW1A 3PE9A 4M8UA 3TM6A 2G0KA 1KJMB 5FM5M 3QUXA 2OTUB 1QCWA 4NVTA 3VTAA 4LUJA 5EEYA 4H7MA 1NSNL 1YEYA 3CUIA 3QKEA 3BI3A 2AK4D 1KIUB 3JZUA 1PYWB 3G6AB 1Q1JL 3CKHA 2I69A 3IKCB 3DYPA 3QSTA 3STLA 2MNUA 4MNQA 5C9XA 2APSA 1H7NA 2Y89A 5F39A 2YROA 1PIV2 1GKRA 5A70A 2YL8A 4OYUA 5DEJA 1U5XA 4F79A 1ONAA 4P2QB 2EC9T 4AZ5A 3LMZA 3MVIA 4JPSA 3KAOA 2WVVA 4WKXA 4JTGA 4X9SA 1RD5A 5D2LB 3FTGB 3G04B 3GTNA 3S8FB 4X42A 5IHUH 5AW9B 5DLLA 3N1PC 5DQDL 3S6DA 4OCMC 2VZOA 1AXKA 2B81A 4D9QE 3WF1A 3RZGA 3MP3A 1OSPH 4M4RA 4OFQA 3GKAA 3QCVH 5C7VA 5EH1A 1VAVA 1TJGL 3FJLA 1OFBA 4ERGA 3OGRA 1MRCH 1IAMA 4JQIL 2WNVA 3IFLH 3W4RA 2O5XH 3IU3A 3ITLA 4CPBD 3RMEA 1FZOA 2PPAA 1MOEA 5CUSL 1M9HA 3WFAA 2IANE 1S5VA 4HA1A 4DSYA 2WXDM 3DL3A 4REQB 4WM7A 3M8OH 4XPBL 4Q4W3 1T5AA 2VLKB 3PAZA 1A5BA 1R2RA 4DZ8B 4K5OA 3ALGA 1OFQA 1EK3A 1H8NA 5IKCB 4P9XA 2MPAH 5CA6A 1CPUA 4NC1E 1SYTA 1L3JA 1G7MA 5I66B 3HT2A 3O1VA 2J12B 3QHOA 1LNSA 2BNUA 3GXFA 1A4KA 2FEJA 3GSUA 2VR5A 2Y8UA 3WEAA 5IHSA 3T6CA 1HH6B 1RZFH 3QBQA 4UF0A 1PNDA 3BOLA 2NTFB 3ZT6A 1MCSA 4EI5B 3WDYA 4MZUA 5CKAA 5CLTA 3NN8A 2J66A 3DX2A 3EBHA 1ZNNA 5FECB 4OQ9A 4MZ3A 3ENEA 1BLZA 2FO4A 4IE5A 1Q72H 1EDGA 4P08A 2VMJA 2QFEA 1GMIA 3E6EA 4MGQA 4FF5A 1ONRA 1UM5H 5MHBA 4B7KA 2W47A 5BYWA 2VOMA 2H9AA 1W0OA 2CCRA 4W8AA 5GJSH 5FP8A 1QACA 4WO4D 3DUGA 1IC4L 2VN6A 2J57A 4OZHB 1CEOA 2VLRD 5K9KA 4ZE4A 2D8KA 5HAOA 5GXBB 3ZTJG 4FTVB 1L6XA 2Z7UA 3APDA 3RILA 1QRNA 4GKZA 1G01A 1WAAA 5DJDA 5JWPA 5HTSA 3HZYA 5CZXD 3JTTB 3VH8B 2E40A 3CX2A 3AXIA 5GHWL 5BNOC 1R3JB 3B34A 1K6QL 3V1PA 4ZS7H 4UZSA 5DLMH 1CESA 2PQSA 2APBA 5BRQA 1IWAA 1K4DA 2DM7A 2NW3A 1T03L 4WW1B 3LZPA 1NE4A 5F8PA 3I3MA 4IIEA 4XCEA 3OY8B 4XNDA 1VADA 4JQVA 2XN2A 3B05A 3LH2H 3UOAB 1IT8A 5HHOB 3OIXA 5C5TA 1SW7A 1RUE2 3RDKA 2BW8A 5K9CA 3TGXA 5E0CA 2GG1A 4ROQA 5E9DA 5ENWA 5F7NC 2CIKB 1DQJB 1KWGA 1F6PA 5L7XH 1E4XH 4GRMA 5ETUA 2RE9A 4GBXD 4PVLA 1I1CA 4P2OD 2DZWA 2OA9A