4QAWA

Structure of modular xyn30d from paenibacillus barcinonensis
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
537
structure length
537
Chain Sequence
b'ASDANINLSSEKQLIKGFGGINHPAWIGDLTAAQRETAFGNGQNQLGFSILRIYVDDNRNNWYREVATAKRAIEQGALVFASPWNPPSDMVETFNRNGASAKRLKYDKYAAYAQHLNDFVTFMKNNGVDLYAISVQNEPDYAHDWTWWTPQEILRFMKENAGSIQGTRVMAPESFQYLKNISDPILNDPQALANMDILGAHTYGTQIKDFAYPLFKQKGAGKELWMTEVYVPNSDNNSADRWPEALDVSYHMHNAMVEGDFQAYVWWYIRRQYGPMKEDGTISKRGYNMAHFSKFVRPGYVRVDATKNPDTNTYVSAYKGDNKVVIVAINRGTSAASQRFVLQNGNASTVSSYVTDSSRNLASLAPINVSNGAFTAQLPAQSVTTFVANLSGGNSGGGNVNTGTTYEAETGTTLTDAVVETLYPGYTGSGYVNFNAYTNSAIEWNAINNMTTGTKNVKFRYALESGTRNLDIYVNGTKVLSNEPFTETGSWSTWGEKTIQVAMNSGVNTLRIVTTGTEGPNMDNITVTASAKGELNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Xyn30D
publication title Structural Analysis of Glucuronoxylan-specific Xyn30D and Its Attached CBM35 Domain Gives Insights into the Role of Modularity in Specificity.
pubmed doi rcsb
source organism Paenibacillus barcinonensis
molecule tags Hydrolase
total genus 159
structure length 537
sequence length 537
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
A PF17189 Glyco_hydro_30C Glycosyl hydrolase family 30 beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4qawA01
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4qawA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4qawA02
2VTFA 1MFUA 3GXDA 4N0RA 4Q7NA 2VZTA 3W29A 1QI3A 4JKLA 4MGSA 1PX8A 4AYSA 2E3ZA 2W87A 1FA2A 1ZBCA 3VNYA 3UG4A 3N13A 1ZB5A 3A3HA 2DT2A 1M01A 2W95A 2J7HA 3PTMA 3BUIA 3H54A 1AQHA 3WEZA 3VGFA 4CN6A 1JHJA 1ZJBA 2L9LA 2DSUA 3U7VA 3VMOA 4AY1A 1DWFM 3MO4A 1TE1A 4UFKA 3AS2A 4OZOA 2G3NA 1FH7A 4ACYA 1L7RA 1UOKA 1VFOA 5HOSA 3JXSA 4JKKA 1C8QA 1HKIA 2J75A 5A6SA 2F1AA 2NT0A 1XCXA 2WHKA 1M03A 3LRLA 3VM5A 3BXWA 2EICA 2A3AA 3G6MA 2WAAA 4GXPA 1LWHA 2FGLA 1XHGA 3VDAA 3WNMA 1JZ7A 3MSDA 4PMVA 1OGBA 6TAAA 4JAWA 2O9RA 2ZEYA 5GNZA 3CKHA 1CZSA 3A4WA 1W3HA 1KGXA 5E0FA 3BUPA 1R87A 3KZSA 2J7BA 1XV8A 3ETPA 2QF8A 5DT7A 2EQDA 1W3KA 4WLCA 1W2VA 1GQKA 1B31A 1JDCA 3MMDA 1WZMA 2WHLA 1JF6A 2PWFA 3W38A 1AVAA 4S3JA 1IT0A 3WQ4A 4ZEPA 4Z2JA 5HXMA 3VGDA 4U31A 1ZS2A 4QFUA 5I23A 1OINA 3AIWA 2PWEA 1XH1A 1NWSA 1M04A 4C7FA 4AEFA 2WCGA 1ZJAA 4A3HA 2IGTA 3EMCA 4RN5A 3AOFA 3W27A 3AZRA 2HYXA 2E8ZA 2XFFA 1CXLA 1CEOA 1WCGA 4AZGA 3PUHA 5BXTA 4H7VA 2VCBA 1EIBA 1EHAA 4PTXA 1EHNA 4WSJA 4W87A 4ZZ8A 3WUEA 1CXIA 4PCSA 1SYTA 3UR8A 2XN0A 1EO7A 4HZ6A 2W66A 1J11A 4AZIA 5A8OA 4J7RA 1IZKA 5JUVA 2J1SA 1CGUA 1NUKA 3W6MA 3PZ9A 4S3KA 2E0PA 1PMJX 4P8UA 1MW1A 2W63A 1EUTA 5FUIA 3L2LA 3RMEA 3PZUA 3VMNA 1ISXA 3VSVA 2OYLA 2VC9A 2XPKA 1PMHX 3MSGA 1XD1A 4PMDA 4URIA 2BBAA 2ZE0A 1VENA 1ITXA 1KR1A 1UYYA 1XSJA 1J83A 3CZEA 1TVPA 2OLHA 5A8PA 1GUVA 5EFDA 1B9ZA 1Y7VA 3LXBA 1B0IA 3WH5A 1TA3A 2E9MA 2CITA 1GJUA 1H4PA 2QQJA 4PTWA 2DSZA 4D6DA 3DX0A 1W32A 4F9JA 1WDRA 1JFHA 2WMIA 3KL3A 2VZUA 2VZ1A 4L4OA 3EDEA 2TAAA 5A69A 4A44A 1E4NA 2WN3A 1UR9A 3ARRA 1KQZA 2DSVA 1G9HA 3BC9A 1JYNA 1N82A 1QI0A 3RDKA 3A5VA 4DO4A 3K1DA 2W1QA 1BYBA 2JALA 1UR8A 2PWGA 1D2KA 3T0AA 1E56A 1K9DA 3FXYA 1GORA 3I3EA 1K9EA 3M07A 3PN8A 3LPPA 1E0VA 3CZNA 1KR0A 1XC6A 2XM2A 4ZENA 3OGVA 1CIYA 3RO8A 2NT1A 4XUYA 3RM4A 1E0XA 1FH8A 5GPRA 4BXSV 2YBUA 2XGBA 3B9AA 3C8XA 4TXEA 1ZU8A 3BLBA 4H8VA 1HNYA 2F18A 1NKGA 1W9UA 2F7RA 1UKQA 1H6XA 3K75B 3RM8A 3L2MA 1GONA 2G3IA 1KCKA 3ZT7A 4OYUA 1EQPA 3CUJA 3H53A 3NQHA 3ECQA 4HTYA 3CHCA 3AQUA 1BHGA 4R5EA 3P1IA 3GTNA 1UWRA 1K9FA 1EDQA 2JF6A 3K4AA 1NQ6A 5IFPA 3WD4A 5J1XA 3ACIA 3DECA 4ZZ5A 4XUOA 4ZE5A 5GQBA 5DFAA 4P02B 1TG7A 2OWXA 3VIHA 3WEMA 3GYCA 1H1NA 3MU7A 3EJPA 1I75A 4RE4A 2XGIA 3WSOA 1NP2A 4W89A 3S5ZA 4AEEA 2YKKA 2JIEA 4B16A 3S5YA 4BF7A 4P7NA 3IGUA 3WH6A 2YA2A 2WMKA 1C8XA 2C26A 2E26A 1UMIA 2DEPA 1V3HA 1V3LA 4J3WA 1VBRA 4PYSA 2W3JA 4A41A 2BXYA 3CGTA 2XIIA 4KGJA 2ZX9A 3MMWA 2YBTA 1OWQA 2XM1A 3ARVA 1BLIA 5I0DA 2PQSA 1NH6A 1UY0A 1UH3A 2EABA 1JD9A 2QPUA 4AD0A 1ODUA 1S46A 3CH9A 2CHOA 3WNKA 4D71A 1UZ4A 2WO2A 2XFYA 2YL9A 3CUGA 3BAWA 4ZE4A 1UKTA 4CD7A 3WFZA 4UQBA 2DDUA 1KXVA 2BHZA 1HT6A 4HOWA 1BTCA 1PZ2A 3ARTA 3N1AA 3IJ9A 1MW0A 3BSGA 1WCQA 2Q8XA 4AIUA 1PEZA 3N11A 1OF3A 1CTNA 2QQLA 5IHSA 3BGAA 5IFTA 2YFOA 2FDMA 1TMQA 4DO6A 2BHUA 1LWJA 3WQVA 2WWDA 1BAGA 2WK2A 4C7GA 3FL7A 4OOUA 4NZCA 1PBGA 3WY1A 2MANA 1CZ1A 2QV4A 3ZSTA 3WQ8A 3OB8A 2X1IA 1BG9A 2D1ZA 1VAHA 1XRVA 2EIDA 3EJTA 4MO3M 4TTUA 3LPFA 2UY5A 4KH2A 1R75A 2QQIA 1UWQA 3AYSA 1RP9A 2DH2A 2BY1A 2J1TA 4AMXA 2LS6A 3GXMA 2WWCA 4PRWA 1GU3A 2JEQA 5DO8A 2WZHA 1UA7A 3DHPA 1D3CA 3W5NA 4XZBA 1V0NA 1QWNA 3HG4A 3BSHA 4GWIA 2WW5A 2JKXA 1UXZA 1CXEA 3GXPA 3WD0A 4CVUA 4CCCA 3IAPA 4HMCA 3CV5A 4ATLA 1BYDA 3VD4A 3CZKA 3BVUA 2XHYA 4ACZA 5JBEA 3VMPA 1X6LA 3KLKA 5DT5A 2OSWA 2ZXDA 4L4PA 2D0FA 1I1WA 2DCJA 3DHUA 5HPCA 2EPKX 2D22A 2J77A 3I2GA 2VJXA 3FW6A 4ZY9A 4NZFA 4PMUA 1Q6CA 2C4XA 2W92A 1WAWA 1CGVA 4FI9A 4TOQA 4IUGA 2V5CA 2VZOA 3PHAA 1ITCA 4P7RA 4HU0A 3VINA 4OBRA 3WDJA 4J3TA 2IXUA 1XPWA 2D24A 3KL0A 1R47A 4JZ5A 4LYQA 4FNUA 3FHQA 1W9TA 4N42A 4H2CA 5E9AA 1EXPA 4U2ZA 1CDGA 1L7QA 5HNNA 4K68A 4CU6A 2EEXA 2DT1A 4J27A 2D20A 3S2CA 3WUFA 1WNOA 3W37A 1KGUA 3AHXA 3CZSA 2CKSA 1GPFA 4FNPA 4D6HA 2WSPA 3MBWA 4JX0A 2BV9A 3CIHA 3AJ7A 3CLWA 1GUIA 2DIEA 2X2HA 3M6DA 8CGTA 2V38A 3BMWA 1CXFA 1OIFA 4PSRA 4PTMA 2WMJA 4WKFA 1QI2A 4UNIA 2B31A 2XG9A 3ABZA 2J78A 1MWOA 3VM7A 1E4MM 1G0CA 5FOOA 4L0PA 2W94A 1OF4A 4M1RA 1QI4A 2CDPA 1BVZA 3BUQA 1UZ0A 3U7BA 3RJXA 1W0NA 3LRMA 2YDQA 4Z2IA 2GVYA 4EAMA 5LCWL 1B90A 2WVUA 4KMQA 3L4WA 2XOMA 1OT5A 3LX9A 3A24A 1LQ0A 5B4XA 2EJ1A 5DF0A 1OH4A 1FFRA 4CGTA 1ULOA 3BLPX 2JEPA 2WO3A 1DLCA 4LQRA 4KWUA 1VJZA 2J7CA 4HOXA 4BQ2A 3ARSA 4TVDA 4UQCA 2RGLA 4OUEA 2ZUWA 1JAKA 1XYZA 2E8YA 3O9NA 1JYXA 5B4NA 1EQCA 2JDAA 1Q6GA 1CXHA 3WBEA 1A3HA 1J0HA 1GVYA 5AY7A 2HISA 4W93A 3OEBA 1R33A 2NW0A 6A3HA 4OGZA 3OZPA 3QOKA 3L4TA 1QBBA 1UUQA 1HP4A 5JIPA 2VMCA 1JZ4A 1GOQA 2CBUA 3SCRA 3UERA 1W9DM 4JHZA 3VX1A 4UAPA 1UD6A 5CGTA 2WDBA 3T09A 3AMDA 4FLRA 1EDTA 5A95A 4AIOA 1LG1A 7CGTA 1EOMA 1BGAA 4AWEA 4D6GA 3GDBA 3SKJE 1E5JA 3WD1A 3NIYA 1NOWA 3WD2A 2G41A 3HJRA 1JD7A 2F1BA 3PZTA 2ZEWA 4BA0A 1HJSA 3GNOA 4UFHA 4M4PA 4UOZA 5JXJA 2JIWA 2VNCA 1GNYA 1KEXA 2GJXA 4QP0A 3WH9A 3ACGA 3AIUA 2F7PA 4P8WA 1QNRA 1FHDA 1HX0A 3GBDA 1UD4A 1XD0A 3ZIZA 2HVMA 1B30A 3N17A 1EO5A 4W5UA 5I3DA 3W26A 4M4RA 1E4IA 1C7SA 3T0DA 2XQXA 2WVSA 7A3HA 3ZT5A 1NWTA 5AYIA 3AS0A 4FK9A 2JFEX 4UQ9A 2J8FA 2F2HA 1MPXA 2W47A 2VRJA 2OWWA 1TQTA 2VX6A 3OGRA 4J28A 5A8NA 2VX4A 4AW7A 1GOFA 4EANA 4ARYA 3KE0A 5A1AA 1GOOA 3SUUA 3VTRA 4GWJA 5C8BB 4M29A 1OD8A 1H2JA 4R27A 5DQ0A 2VQUA 5EJ1B 1JAEA 4B9ZA 4AZHA 1XYFA 3LXCA 1SMAA 1CGYA 4RE3A 2OW6A 2ID4A 1QNQA 3VGGA 2E31A 4UQAA 3LQCA 3AI0A 1QNOA 5ABGA 1DYOA 1WDPA 1QPKA 3UCQA 2AMGA 5GNXA 3GNRA 3HNBM 1H0IA 2FE0A 4Q22A 5A6JA 2UWFA 3N15A 1R46A 2VR5A 1OM0A 3HZ3A 5BRPA 1GQPA 1E6QM 4NSBA 4AD4A 2QBXA 4AC1X 4WJXA 3ARXA 3VIJA 3D4YA 3I3DA 1OIMA 4KGLA 1KGWA 1K12A 4WIWA 4B3LA 1B3XA 1MW3A 2D0GA 3AS3A 1NWUA 3UG5A 4CD5A 2ZICA 3AMGA 1V3KA 5LA0A 3ACHA 4JCLA 1E5NA 2VOTA 1V6UA 4BQ5A 4MB3A 1G01A 1WE5A 1KXTA 2F8QA 3BH4A 4GZ9A 3ZJ6A 4AZCA 2AOSA 1T0OA 2OYKA 3EDFA 3DYOA 1K9TA 3MUZ1 2O9TA 1UWSA 3MUIA 4TX8A 1DWHM 5CG0A 2UY4A 1HIZA 2EXOA 3PZIA 2DH3A 4CU7A 2C7FA 3WL0A 3ARZA 5BXSA 4LYRA 4QDRA 3BAKA 2VCAA 2WC3A 1JU4A 1B3ZA 3B9EA 2OW7A 1HJVA 4MPKA 1UD3A 1V6WA 4BJ0A 3BVVA 3TA9A 2WKGA 4FF5A 4Z2GA 1W1YA 5GNYA 1BGGA 2J1UA 3NRUA 1XSKA 1UQYA 4LHSA 3AHYA 2XVGA 1PAMA 1QNSA 2DPEA 5A2AA 4GZEA 1E6SM 3CHDA 3FY1A 1KCLA 2A3BA 2EPNA 3QHNA 3AHTA 1PJ9A 5ABFB 2CNCA 4B3KA 5JXIA 2V3GA 3NSXA 4QPWA 1DEDA 5CPQA 1X1NA 3BCDA 1V02A 2J1RA 1TCMA 1OT1A 4GQRA 4MNMA 2WVVB 3CDZB 3EMZA 1ESWA 3ZJ7A 3ZR5A 1HKJA 1P6WA 2BY3A 1Q6DA 1SHWB 4FNTA 1R64A 1GW1A 1WO2A 1JDAA 1CBGA 1OD3A 4W8BA 2QQMA 4W8JA 2VZQA 2PF0A 3LEIA 4M80A 4PF1A 2DT3A 4HG6B 4U3CA 2ZX6A 4BZYA 3IK2A 2BVYA 2Y6HA 3KLLA 4X9YA 2J7EA 3AYRA 4U5KA 1GQJA 3BUBA 4W88A 2VT0A 3GXTA 2WMGA 2ZUMA 1UKPA 1WP6A 4XUQA 2O9PA 4QX3A 1VIWA 3SCTA 1UY1A 3ZQ9A 1J9YA 1OT2A 2VZRA 5IJRA 1CENA 4KRUA 4A3YA 1E1FA 4AISA 3T08A 4IISA 1JI6A 1LNSA 4ARXA 3TTOA 4AMCA 1C93A 1UYZA 3W5MA 5DPNA 3IANA 3GNPA 1MXGA 1KTBA 1EA9C 1UZ1A 2CIPA 3GBEA 1BFNA 2ZX8A 1XSIA 2G4FA 3EJSA 3B9DA 4GQQA 2E40A 3APGA 3P6BA 3SCQA 2EAEA 1V3IA 4FLOA 4PMZA 4JFWA 2G3JA 2VX5A 4JHOA 3ZSSA 1BVNP 2ZUVA 5IYYA 1B2YA 3AZTA 3BAJA 2YC2A 1W9WA 1O59A 1UKSA 2XVPA 1VEOA 2FYVA 1MQPA 3ZT6A 3OLGA 4WF7A 1IQDC 2YFZA 4W4ZA 4XUPA 1LF1A 3W82A 3CZLA 1DWAM 3FAWA 2WHMA 2G3MA 1QNPA 4AMWA 4B15A 4LQ1A 2WMFA 5D8WA 3OIHA 2XWEA 1NARA 2Y6KA 2GK1B 2DSKA 2WLZA 4DWSA 1RPKA 2BXZA 3TONA 1W1VA 1CECA 1GHRA 3ZJ8A 3POHA 1RYYA 1BG4A 3F5LA 1VB9A 3RM9A 3F5KA 5A6BA 3WF2A 4P5YA 3SCPA 5JBFA 3F4VA 4P08A 2JF7A 2LW8A 3EBVA 3PZOA 3PTQA 3OLDA 1U30A 4GO8A 1EH9A 4XVHA 1HJWA 1NWRA 4W50A 3WH8A 2HLEA 3OLIA 1E6XM 3TTYA 4UFMA 3AMCA 1TQSA 2YIHA 2GDVA 5AYBA 4CU9A 4P7LA 1G1YA 1LG2A 4OIFA 3ARUA 4QDMA 4NXSA 1SFSA 1HL8A 2W1UA 4MOAA 3WNPA 3GH5A 2WKLA 1E4LA 3OZOA 1E40A 1ZL1A 4D6EA 3K8MA 3ALFA 1ZBVA 3AROA 4J3UA 1E72M 2A3HA 5A2CA 3HG3A 2XIBA 2EIEA 3WQBA 3GXUA 2WZ8A 3AC0A 3DYMA 3CO4A 4H8UA 4PMYA 5M17A 2Z1SA 1IV8A 4UZUA 2ZUNA 4W8AA 3WDQA 5IXEA 2W91A 1JNDA 5JIWA 3VOCA 5M5DA 2GSJA 3HOBA 1C7TA 3BVTA 2W67A 1VEPA 1E0WA 4W7WA 1KBKA 3WN6A 2V3FA 2WZEA 1FFQA 5E6YA 3I3BA 1C92A 3WDHA 2W61A 4NZJA 2VURA 1GZJA 3BN6A 1PZ3A 2X2JA 4MTVA 4HOZA 4MB1A 2QQKA 2RV9A 1VFUA 1CPUA 3H55A 4BK5A 2BVDA 2J7GA 3CQOA 4U2YA 1UWIA 2UY2A 2PBGA 2YG0A 3AFBA 3SCNA 4DM1A 4FNRA 2IUZA 3VIMA 3ZJKA 3SCSA 2BERA 3ALGA 2YC4A 3VX0A 3UR7A 4M82A 5F7UA 1PPIA 4F79A 1LL4A 4M8UA 2VO5A 4XUTA 2WQ8A 5A8QA 1V0MA 4F8XA 2XSAA 3CUIA 1QW9A 3FNDA 3WD3A 2V4VA 1J12A 3G6LA 2B9VA 1W2PA 4QLJA 6CGTA 4ZXOA 2W4XA 1NM9A 3GM8A 5DN2A 3PZGA 3LXAA 3TOPA 1H49A 4AZ7A 4AZBA 4GPNA 2WB5A 1UYXA 3HEIA 2BFGA 4YHEA 3ZO9A 5JXHA 1CGWA 3N9KA 3SCVA 3AS1A 5I2UA 4LKSA 1PS3A 2ESCA 1GOGA 1PIGA 1GMMA 2ZWZA 3ACFA 4OKDA 2QPSA 3A4XA 1ISYA 3SEPA 1Q6EA 5DMYA 4LXFA 2O9OA 4KI5M 1I5PA 5CPSA 1DP0A 3I2FA 3BMVA 4U3AA 3WY2A 4PCTA 3VD5A 5FCZA 4CD4A 1JZ2A 3BAYA 4ZXEA 4W7VA 4P8VA 4DUXA 3QGVA 4AD3A 3CMGA 4HZ7A 2ZUUA 3K4DA 3UETA 4H04A 2XYLA 4DUVA 3F2ZA 3HNMA 4BQ3A 5D4YA 2VMDA 4CD6A 3IAQA 3A4AA 4XUNA 2ZXQA 3KEHA 4GZIA 4NI3A 2YFNA 2QMKA 1V6XA 3M46A 8A3HA 1J01A 5A6AA 3AHVA 1JZ8A 3RIKA 3LMYA 1DWJM 2PBOA 3CBWA 4PMXA 3OBAA 3VIOA 5EFFA 2RGMA 1YHTA 5C71A 1E1EA 3WIJA 3I97A 4IPLA 4AZ5A 4XZUG 3EMQA 5CJ5A 1G5AA 3WELA 3WH7A 4DO5A 5A6MA 5CZKA 1M53A 3WY4A 1FHLA 5D9PA 2JD9A 2F7OA 2VRKA 3C7EA 5A94A 2E32A 1GQIA 2V72A 4CVWA 3QR3A 1UWUA 1H0GA 3S6TA 3LEKA 1E71M 4MNLA 4MNJA 4BS0A 2V3DA 3PZVA 3HJEA 1C3FA 3JUGA 4PUDA 3ARWA 2R7EB 2X09A 4A3ZA 5CXPA 1VFMA 3VSUA 1NP0A 5M3WA 3DYPA 1W3LA 4CN1A 3TV8A 2W5FA 1MQQA 1JG9A 1MQRA 4DEQA 2W1SA 5A6KA 4F9DA 1DWIM 4HPGA 3WY3A 2X2IA 1P8JA 1TR1A 1MVYA 1DHKA 2ALWA 1UWWA 4NRSA 1LL6A 3FN9A 1XGZA 4AD2A 3WF3A 2PC8A 4ML4A 3OLEA 3PZNA 2YJQA 4YN5A 1OD0A 5LYRA 1BSIA 4D1JA 2WCAA 2CETA 1VFFA 1CLVA 1F4HA 2WSKA 1BPLB 4UFLA 5D8ZA 1JYWA 3K46A 5FL1A 5EJZB 2EPLX 5I77A 3VILA 1M7XA 2FGZA 4V2XA 3NYDA 2YL5A 2WO1A 1HXKA 2Z4FA 1L8NA 2WHJA 3WNOA 1PX3A 3DC0A 1JU3A 1F4AA 3ZOAA 1H3GA 2FH6A 1LJYA 2VM9A 2BVTA 3MANA 1US2A 2JE8A 1H09A 3WF0A 1OBAA 4LYPA 3WFLA 1XNTA 4MADA 1US3A 4FMVA 4D6IA 2VL4A 1HTYA 3NDZA 4RL3A 4V27A 4OBSA 3D52A 2X0YA 3ZMRA 2B4KA 1GOHA 1GOMA 2BNJA 2J7MA 2YOCA 3AICA 3B8SA 2EPOA 3BUDA 1J18A 1JI1A 4HA1A 2EPMX 1FOBA 3WMSA 1GCYA 1HL9A 4JKMA 3TTQA 3GXFA 1D7FA 4FNSA 2F61A 5A8MA 1NAEA 3QOMA 4MB5A 2CKRA 1HVXA 3HU7A 3SURA 2EO7A 3POCA 3SEEA 3BAXA 5E0CA 5CSUA 3CUFA 1L0PA 4V28A 1UYQA 4H8HA 1MFVA 1V0KA 2Y24A 3CC1A 3EJRA 2DCKA 2QQNA 2Y2WA 1V08A 3AMKA 1CNVA 1KBBA 3BCFA 3UG3A 3VDBA 1E43A 1KB3A 4MB4A 2WYSA 3DDFA 1HJXA 1UY3A 2GDUA 4BDVB 3WF1A 3SUWA 2WCSA 3GXIA 5E70A 3A6OA 2OSYA 4PEEA 4CD8A 4W7UA 1JXKA 1OCQA 2W62A 1NOFA 2WAOA 1SZNA 4JL1A 3SKVA 2YL8A 3C7GA 3O2LA 1R7AA 2YDRA 1V6VA 4C7DA 5CGMA 1JDDA 1EGZA 1XCWA 3GH7A 2VCCA 1SG3A 3CIVA 2V3EA 4UCFA 5I78A 3HG5A 1SDDB 1QI5A 3IB3A 4PUEA 4D0QA 5BYWA 3L4XA 1KXHA 4AD5A 1G94A 3RPMA 1UKOA 4MAZA 4EKJA 3WF4A 1W3JA 4QLLA 2Y6LA 3GH4A 1BYAA 2WVTA 3MV01 4W86A 4LX4A 1ISWA 4HA3A 1TZ7A 3IDAA 2D23A 4Y7EA 3VKKA 2A3EA 1OGSA 4U33A 1TVNA 2ZIDA 2VUYA 1HKMA 1UQZA 3D3AA 1QHPA 1AQ0A 3WNLA 5CLTA 2VX7A 2DIJA 1KGYA 4HPHA 4PSPA 3TTSA 1D7PM 1FH9A 1V6YA 3AIEA 2WBGA 1MW2A 5ECUA 1W8OA 1H11A 3WL1A 5HBFA 3DX1A 1HKKA 4JFTA 4QX0A 2VMEA 2GUYA 3VU2A 4UTFA 1UMHA 3OGSA 4M24A 5CQ1A 5EBAA 4AZ6A 1CZTA 2VR4A 2D2OA 1RH9A 3GZAA 3NDYA 1VRXA 1TA3B 2EIBA 4AYGA 2J1AA 4TVUA 4ZFMA 1ISVA 1E6PA 1O7DC 2WMIB 1O8SA 4UOJA 5EIYB 3WQWA 1SMDA 4XV0A 4DEVA 4CCDA 1Z32X 2Y5EA 2ZX7A 3CZJA 5C7GA 1E9LA 4UR9A 1K45A 3VIPA 2VZVA 1QVBA 3T2PA 3VD9A 2W1WA 4A45A 1V02E 4ZXLA 5I24A 1QHZA 3WUBA 2W9XA 3SCOA 3AXHA 3SCUA 1XNAA 1B3WA 1W9VA 1KFWA 2J7DA 3W0KA 2Y6GA 2ZUTA 1KTCA 4AG4A 3OA5A 1IZJA 1YQ2A 3C7FA 1MXDA 4YHGA 3SIMA 2CBVA 3AMLA 4A4AA 1KXQA 1W91A 1CLXA 4Z2KA 2J22A 3U5UA 2YLLA 1H5VA 1XH2A 2J79A 1KWGA 3A7QA 4DWSB 4TVCA 4J3XA 4XB3A 4AIEA 1UXXX 2PWDA 3MKKA 1J0KA 4GIAA 2EACA 1WDSA 4HMDA 4W8LA 4CUCA 3AZSA 4MJ4A 2VI0A 2CYGA 4CN4A 3RJYA 5LA2A 2X2YA 3VNZA 3J7HA 2RVAA 1UY2A 1FP8A 4X0VA 3AIRA 4MAVA 4IM4A 3RILA 3CZ8A 4JFUA 4D6JA 5HPOA 1ULPA 1T2XA 1WZAA 1HJUA 2KD7A 1V3MA 4E4PA 1XH0A 2QHAA 1UY4A 1E70M 2CPUA 3THDA 4CUBA 5I5RA 5G04L 2YLAA 2ORZA 1UG6A 5CYYA 2X8RA 1GQLA 2WC7A 2VZSA 1JNEA 3MS8A 1W9XA 3GXNA 1KWKA 2GFTA 2XTKA 4PMOA 4TUFA 2CXGA 2ZXBA 1CYGA 4NRRA 1JFXA 3WNNA 5BWFA 4MGQA 1K6AA 3SUTA 1A47A 1UH4A 2BZDA 5FKYA 3N04A 3UNPA 3O6AA 4XURA 3WMCA 5ABHA 3KWXA 3VUPA 3IJ8A 4QCEA 3WDIA 3QHMA 5A2BA 3A47A 1QX1A 3WKZA 3TP4A 3VIIA 3BLKA 5CPTA 5IHRA 1Q6FA 1NOUA 5ABFA 2ZUSA 2C0HA 2QMJA 2ZOXA 4JL2A 2WC4A 3VD3A 2XJ7A 4JIEA 4WSKA 4OOZA 4MDPA 3W53A 4WKAA 3UESA 3AXIA 5A3HA 2WVVA 2YA1A 5G05L 4QX1A 3VPLA 1ZBKA 2A3CA 3W28A 3D4ZA 1UX7A 1GOIA 4XZWA 4ATWA 1H6YA 1UD2A 1VF8A 2WANA 1C91A 2WN2A 2CBIA 3VIGA 3I2JA 3RCNA 3FAXA 4GZJA 2GJRA 1JL8A 4DXSA 2Z1KA 5JR2A 1E6NA 5E09A 1GJWA 4P8XA 3VGHA 9CGTA 3CZUA 4W5ZA 2CHNA 1WDQA 4WK9A 2WUHA 3W25A 3MI6A 1E6RA 1LL7A 1MYRA 1K3IA 5DEZA 4QB1A 2YA0A 2Y4SA 1VEMA 1QWUA 1UASA 3HNYM 1NX9A 4EE9A 3VGBA 3C7HA 3QHOA 3VIFA 1WZKA 1DTUA 4ACZB 1E3ZA 3L4YA 1OGGA 4GI8A 3F5JA 4QAWA 4UQDA 3BVXA 3ARPA 3NSMA 4UFJA 1CGXA 1UR2A 2CESA 3A22A 5AC4A 4FNQA 4CUAA 3BVWA 1I1XA 3CHFA 3BAIA 4DXTA 3A23A 1JXJA 3KL5A 1JF5A 1E3XA 3I2KA 1WPCA 3WDRA 4AXNA 1GOWA 3HG2A 4DUWA 1R86A 5HDRA 2X0HA 1BF2A 1V03A 3K77A 3VSTA 3K8KA 4ATDA 4M56A 2D3NA 3EDDA 1ISZA 3T0BA 1AQMA 2XVNA 3K4ZA 4CKQA 3NJVA 3SUVA 4M81A 5E6ZA 2J4GA 3VDHA 2GK1A 3MV11 4DWSC 1CZVA 2E9BA 1JZ6A 3WBAA 3LPGA 2DQXA 2ZEXA 3WQ6A 4CU8A 2ZXAA 3GGLA 3II1A 1OB0A 3AISA 3T2QA 5EB8A 1O8PA 4JFSA 2XONA 2YFUA 4OMCA 3D51A 1QBAA 3NUKA 1W9BM 1JIBA 1B1YA 3HPNA 2GJPA 2J7FA 1UR0A 5TD4A 4TTGA 2VMFA 2CERA 2DSWA 1B3VA 5D9NA 2VVNA 1TUXA 5FL0A 3LEGA 2D3LA 5JXGA 1HF6A 1J10A 2Y64A 4AAXA 3PZQA 2E33A 3SUSA 5ABEA 2XUCA 4EK7A 1W1TA 4TXWA 4U5IA 1J0IA 2ZEZA 4W84A 4HU8A 2RJ2A 1W99A 5IDIA 3WQ5A 3A21A 1X6NA 2WNWA 2BS9A 5C70A 2PB1A 1UHVA 1C8YA 3CUHA 3MUAA 2NSXA 5BXPA 3L4UA 1HP5A 1UR1A 3WDPP 4YPJA 1UWTA 3D5HA 4GINA 5JBDA 1O6IA 3N12A 4JCMA 2QQOA 3U5YA 4AD1A 2BY2A 1TQUA 1TVGA 3I2HA 4DXRA 1ZBWA 3LPOA 2CBJA 5D9MA 2VZPA 1QW8A 5D9OA 3MUY1 4E8CA 2VVSA 2Y6JA 3VDCA 5BCAA 3EJUA 4BQ4A 3FHAA 3U37A 4W85A 1J84A 1BQCA 1QOXA 2YB7A 4LPCA 3NSNA 2XFRA 1V0LA 3N18A 5E1QA 3PBGA 2BHYA 5BROA 4QDQA 1VBUA 2XVKA 4KRTA 7TAAA 1R7OA 4GI6A 1TQVA 4DM2A 5EMYA 1E6ZA 1SR0A 2CCRA 4HP5A 5A6LA 2YL6A 2J8GA 3LRKA 1UA3A 1CXKA 2J1EA 5BXRA 4PMNA 3SCWA 1DWGM 4D72A 4CCEA 3ZR6A 1J0JA 2UY3A 3ARQA 2C8NA 3DX3A 3T2OA 4ET7A 4RYDA 4Z2LA 2Y8VA 1UD5A 1RP8A 2FHCA 1PIFA 2V5DA 3VIKA 5JMOA 4LGXA 4JFVA 4E8DA 3C7OA 4PBGA 2D0HA 1TQWA 1O7AA 2FHBA 4DWSD 3WEOA 3HN3A 1U2YA 4GO9A 1R8LA 2OWCA 2WZIA 2VRQA 2E9LA 1GOKA 4PN2A 1WKYA 3W4RA 3THCA 5A6BD 2J74A 1GNXA 2GJXB 3EJQA 3AXXA 5I6SA 1WB0A 4GKLA 3AIQA 3WSUA 1CX1A 1K42A 1JZ3A 2J47A 4PMQA 3W81A 3EYPA 2J1VA 2XWDA 3UEQA 2OSXA 4LPLA 5BRQA 3IJ7A 4MDOA 2AAAA 1E55A 4D6CA 4NXKA 4UQEA 4P00B 4OMDA 4D1IA 3NJXA 1CGTA 1R34A 2CDOA 3LE0A 4Z2AA 2X05A 4QDSA 1ODZA 1BYCA 2EBNA 1U33A 4UOQA 3ZM8A 4FLSA 3NNGA 3W6LA 1TFVA 2WXDM 3AHZA 2BY0A 1WZLA 3DX2A 4J3VA 1J0YA 4E2OA 1UH2A 1PX4A 2WLYA 4OJYA 4FLQA 3VO0A 2YDSA 4PQQA 1W8NA 3CHEA 1CWYA 1ECEA 1JZ5A 1EDGA 2WM0A 4UFIA 4XX6A 2F7QA 1J0ZA 3D50A 4HA4A 4A6OA 4BCEA 1H41A 1HXJA 1V3JA 4UZSA 1R85A 1C90A 2O92A 2WPGA 3AIBA 4J3SA 5I79A 3PUIA 4QLKA 2IXVA 4QCFA 5FD0A 3VVGA 1UD8A 1HVQA 3OEAA 1KQYA 3CMJA 3PTKA 3EDJA 1GHSA 4Z2HA 4BK4A 1GVIA 4D8MA 2XSBA 4QB2A 5AC5A 4UI9L 3E1F1 5KEZA 3M7SA 3HMCA 1QHOA 2EADA 1AMYA 3DX4A 1FP9A 3W24A 5M03A 2D73A 2Y8KA 4MNKA 4QB6A 1OSEA 3WMBA 3ARYA 1EOKA 2W46A 2QLYA 4GI9A 1JI2A 2X10A 4HMEA 4IPNB 1JYVA 4TX6A 1VJSA 1W9SA 5FIPA 4QX2A 3PZMA 3EDKA 2BGPA 1EUUA 4HZ8A 4AZCB 2XN1A 2ZWYA 4WKHA 2DDXA 4D6FA 2WAGA 1RD6A 2PWHA 2WBKA 2ZX5A 4NF7A 1Q4NX 2E4TA 4NX0A 1E15A 3VGEA 1E73M 1W9PA 3K8LA 2ORXA 3AIVA 2J25A 5KZ6A 4RE2A 3EB7A 3WUGA 2XVLA 1CIUA 3CPUA 4A42A 1JGIA 2CEQA 2DT0A 3U57A 4PMRA 2VQTA 3CZGA 2BGOA 2DGAA 2J62A 3L4VA 3CTTA 5CLWA 1UR4A 3L4ZA 5LA1A 1W1PA 2WMHA 3WENA 4P7QA 3DDGA 2XHNA 3OG2A 4PT6A 2OYMA 2PI6A 1HWWA 3MMUA 3NJ3A 2FH8A 1B3YA 4MJ2A 4B9YA 2VZ3A 1LLOA 4H41A 2XN2A 1HN1A 4P7OA 5CSYA 3NCOA 4PTVA 3VD7A 2WABA 3I2IA 2G8ZA 2C9KA 2FHFA 4X0NA 2OKXA 4F66A 1HJQA 3IIIA
chains in the Genus database with same CATH superfamily
4PRDA 4Y3OA 2VIRB 2YPVH 2BRRL 4WK0B 2IDCA 4U1HB 1S0CA 4NY2A 3RZCA 3J8F1 4W9DC 3N9SA 3WJZA 1MHEB 4PY7B 2L9LA 4U3SA 3VDDC 2VP8A 4JG1L 3ZQXA 4AR2A 2NQLA 4GH4A 4BUGA 1UA6H 2DZXA 3FTYA 5FIEA 2ADIA 4YHYB 2P7TA 4PG2C 4B92A 5AZUA 4PMVA 5EU4A 1FX5A 3MR9B 1Q7ZA 4FFIA 1EP0A 2R4RH 2VXSH 3UPWA 1XJBA 1GC1C 3FFSA 5D04C 1YYMH 2PTTA 3FB6A 5CEZH 4HDIB 4WLCA 2KQNA 1S9YA 3HI1A 4KFOA 2ICEB 2PDCA 3SDAB 2WJEA 3BP4A 4LAMA 1KXQE 3T3PB 1IC0A 3AT9A 3PWIA 4BISA 3QQ0A 1SDDA 3O1UA 5JHBA 4NMIA 4CNSA 2JCCB 4AEFA 5GGTH 3RPKA 4X99B 4A3HA 2BVQA 2BSED 4NM8L 3W27A 1N0XH 2XH6A 3LENA 4HW6A 4AL8H 2FO4A 2R56L 1OB1B 2E67A 4M6QA 1LP9A 2HXUA 4DPQA 2SODB 5C6PB 3PFRA 2IFWA 4AH2A 4U10A 5AW9B 5LN8A 4H25A 1PMJX 2YGYA 1KTDB 3B2UC 1WJ3A 1ISXA 1YJDL 3IJIA 2QLVB 2XPKA 1RJYB 3QDJD 4X8GA 2CY6A 2AEPH 5K3VA 4NKMB 3M3QA 1XSJA 1UJPA 5A8PA 1H15B 3FFQA 2Q7YA 1NBYB 3H1MA 1SJMA 5FV1L 4A7KA 4FP1A 4E9YA 3KL3A 3H9ZA 3W23A 1RUF3 2HCVA 4EUPB 1QNIA 2PWGA 3QO1A 3RYKA 3V0GA 3PHOA 1ZZ6A 4UTBL 5I0SA 4U6XB 2UZYA 3KSCA 3UTPE 3VXGA 4Z7UA 1OSGA 2YCLA 3ULVC 4TXEA 4AF9A 2P8CA 2ZGPA 1GONA 1RUC1 2NNAA 4N6RB 3PQYB 4FSJA 3CHCA 3FQUB 1CB7B 3FT3A 4KUCD 1ZLDA 3QG6A 4YWIA 4DQAA 5GQBA 4NZ8A 1G4SA 4KTEH 1HJGA 3EJPA 4GP5B 2CDEA 1PLGL 3OF6D 2YAFA 2GVGA 4CSPA 4R9DA 1BXVA 1ZE3H 1TSHA 3R8GA 1VBRA 3BANA 4Z7NB 2BSTB 3JWDC 3IYLW 4LARL 4C83A 1CCWB 3C6CA 2Z93B 4JO2H 3F01A 4PWJA 3E5UA 2KXLA 2DUAA 3ULSA 1AZVA 4U6TA 3OBTA 4HOWA 1BTCA 3W2JA 2ZCZA 1E27B 3Q5TA 3G1VA 2YCJA 2ZRWA 1JVLA 4MA1C 2K46A 3VWJC 2FDMA 3B0PA 2BHUA 3DXAA 3I85A 4KV5E 1QTSA 3KEDA 3NQBA 2HUHA 2FPTA 1YY8A 5E08L 1OEPA 1BG9A 3IGHX 2JSFA 3W75A 3H2CA 2KLSA 1ASOA 1FUNA 4GQPH 3K30A 3C08H 4MDRA 1OP5H 4H1LH 4FBFA 4H6RA 5EZJA 3BODA 3E2VA 4HMCA 4NP7A 3I4IA 2G4JA 2CLVB 1MWAL 3VMPA 4UT6L 1YEGH 3NJNA 4WHTB 5EPDA 3MODH 1ZHKA 1JPFB 4KBBA 1ZK9A 2P46B 4MKNA 2PHDA 4PMUA 3LM3A 4DTGH 4APQA 4OCSH 3GJBA 2ZWLT 3DMMC 4JFDD 5I66B 2ZE3A 2FDHA 5DMGC 3S48A 4P8QA 3B6SA 5D6DA 1KXGA 5K39A 1ONRA 3PHSA 3IU3B 4QBXA 1OZQA 3LEVL 4UM8A 3B69A 3ZKNC 3QDGB 3KXFE 1S5NA 2CL2A 3CZSA 3RR1A 1EZ2A 4V2CB 1CK0L 3ZPDA 3VDDB 5FACA 1JGVH 3GBLA 2QV2A 4LCUB 1CXFA 2ENPA 1FDZA 3CL6A 3RLHA 1QI2A 2IXCA 4R8HA 4XMUA 3E0GA 4RUBA 3RPQA 1U8LB 3GMQA 4OFDA 3SKUD 2CW6A 2WNNA 5DZ9A 4UBPC 4XNUH 2WVUA 5E2VL 5K9JH 1JCYA 3O3BB 2YUZA 3A24A 4FXFA 3MQIA 5HDOA 4R52A 4OFYD 1X50A 3TOJA 2JDNA 2QZ3A 4NNXB 1GZ9A 4OUEA 1A66A 5BV7H 3CJJA 1RU9H 2JDAA 2ZZUT 2X4NA 2WUBL 2VUJA 1ZT4A 5AY7A 3OEBA 3ZHLA 3GO1L 1P4LB 2VDML 2OYZA 4MZ1A 1LO4L 2Y6TE 1IJ9A 3MCOA 4ZMPA 1MCWM 5A95A 3NIYA 1ULDA 2DTMH 3FFCE 1E3FA 1NFIA 1MF2L 2VNCA 3UZQB 1HX0A 5IOBA 1OX4A 3DGDA 3QQXA 1ONWA 2EINB 3VFGL 1N59B 1E4IA 2HWE3 4IH3A 4LUMA 3CT2A 4XAWH 1DLHB 1A4LA 2GQ3A 4FK9A 2JFEX 2NLIA 2ESVD 4OT1H 1I7RA 2V2WB 1FWIC 4PG9B 1VLNA 1P5UC 5TTRA 1GOFA 4F3HA 4URKA 1RIRA 1IAOA 3VTRA 4UBDD 1JERA 4JTKA 4R27A 3SZ6A 1WD4A 4B9ZA 4XPBL 1AL0G 5A7NA 3ZE2B 1RLCL 4WGKA 1FWEC 3AI0A 4WI8A 1WGPA 2FJGA 2VLKA 2O61A 3QS3A 4CADA 2PTDA 2IPGA 5IFJB 1CDBA 5MF5A 2X30A 3QJSB 3QI9C 4HKJB 2IXKA 2YJLA 1ZZ7A 3PJNA 3ILEA 4GHRA 1RUG1 4OLXH 4XFGA 3A4UA 4N4YB 2NW3A 4JANA 2XJRA 4XFAA 4G6AD 4MLJA 1NGWB 3ZJ6A 3CQQA 5ACZA 4AI8A 4E4ZA 1X5MA 1T0OA 3OWRA 3CSYA 3ROLA 3AYTA 3D4KA 5F3HA 3MUIA 4JBRA 1HIZA 3PZIA 2C7FA 2YD4A 5IJCC 2RH9A 1KLZA 3TN93 4JAMB 5C0BD 2M1KA 4PJ7A 2PCQA 1CYWA 1A5NC 1B3ZA 2PDFA 1JVOA 4L7ZA 2FDGA 3LCIA 3VRLE 5L7OA 4KI5C 1WQ5A 2GQHA 3WX5A 3BDYH 4IHOB 3AHYA 2HBTA 4C6MA 2UWEE 3LRHA 5DZOA 1UL9A 5KS9E 1E4JA 4HYRA 3JTBA 4LC8A 2EPNA 3TKFA 4LHUA 4JHMA 3E2HC 3UYRL 5I8OL 1V9U3 1D4VB 4E2SA 2O5XH 1P6WA 4GC3A 4MA1B 4YHNB 3VWJB 4LSQH 5DRZB 3KDNA 2DY3A 1OD3A 1QXRA 3DETD 4DP8X 1V6TA 2GDQA 4HS8L 4U3CA 4LEXL 4XZPA 3OZYA 1H1IA 2FQGA 3E74A 1EBPA 2J7EA 2H8XA 4EZKA 3HRZA 4HMZA 1KO0A 1FHVA 2ZA9A 5FZ8A 2ICWJ 3DRQA 4FABH 2NYYC 2XISA 2OR2A 5BNOC 4Z3HA 1MXGA 2K7PA 3GBEA 4PVNA 2ZX8A 3V8CA 4A7GF 2QFRA 5EU5B 3SDYH 4FLOA 1MFMA 4QGYA 1EEXA 3WXVL 1F07A 4P59L 3G1DA 4ZMLA 1XGRB 3S37H 2YC2A 3OKNB 2W0PA 3ARGD 3RJ2X 3C6EA 1OGTA 3FAWA 5FM8A 4LQ1A 5F3IA 5KYUB 3DMMB 5HJGA 1QNWA 4UBGA 2GC1A 1Q9WA 2HPIA 4NJIA 3RGTA 1DFXA 1GHRA 3POHA 2VLJD 4R97C 1OTSD 2VAJA 1TEFA 1KN2H 3F4VA 5I3JA 2CGRH 2F08A 5CFCC 5BO1L 4D69A 2R0KH 3EOSA 1QR1A 1P6CA 4FXJA 3M0XA 4GOAA 3RZCD 2Z92B 1ZT1B 1MFCL 3BOWA 4Y7OC 5BZWA 7ODCA 2F19H 1I8LA 3KDMB 1J8SA 4Q6KA 2F9RA 3EWUA 3ATZA 4JO5A 4RA3A 5FW7A 4FG4A 2WSUA 2J12B 1E4LA 4LHQB 4XP9L 3I8TA 4H6KA 3T9WA 1OP3H 2GK0A 5DRCA 2HVJA 5DMNA 2LTQC 2Z91A 2Q0AA 5LAPA 2WQ4A 3CZFB 4PBOA 1LOCA 5M17A 1BQHG 2C9VA 4HGMA 3IKCB 5F2MA 5EU3B 2W9EL 3PV6A 1FFQA 3TNBA 4NPKA 5FYKU 4DGWC 1FRBA 1NDZA 4HIHA 2VEGA 4X6BB 2XCMC 3BWUC 4WWOA 1I85A 5E03A 4IICA 3QZLA 1DO6A 3OQRA 2MHAA 4KAQL 3WBXA 4PBFA 3GLDA 4G7SB 3MXVL 1ODMA 1JZHA 1F6FB 4XMKH 3O3DA 3Q9OA 1YSOA 3ARDA 3AWFA 3UJSA 2W4XA 3TROA 2VQ1B 3GM8A 4FAAB 1NIBA 4QTHA 5KZEA 3CYJA 2W59A 4QXIA 3BZEA 4GUPA 4WM8A 1SM3L 4HLZG 4LJHA 5DEGB 5FZ0A 2INZA 4MWFA 1VAVA 1OD9A 4K3EH 1TCRA 5JNYB 1TPUA 1P5UB 4LXFA 3DVGA 3U78A 3MPPG 1U8MA 5IVVA 4X22A 2E7AA 4HVQA 2DYSB 2XYLA 4M9PA 5T5JA 4BE3A 2A4AA 5C07E 1G9FA 4HK8A 1ETA1 3WMLA 2BRRH 1JF1A 2FWUA 4FF7A 2O5ZH 5C9XA 2WWOA 1XRUA 4ORZC 4DPCX 4O53A 1XH3B 1CFMA 3DUHA 3WXPA 3KRSA 5CJ5A 1G5AA 1Q2RA 1TJHH 2VULA 4CNIB 4JO8A 4FX7A 3QI9B 2RIKA 4PRBB 2UZ9A 1ZBE2 5G4HC 1N4XL 4JG1H 2VRKA 5A94A 5K9QG 1NOAA 4XFIA 1QQP3 4G43A 2WOQA 5F7FA 3L5AA 4I0KA 2WS91 1AS8A 3D0CA 4QMEA 3VH8G 5FHBL 3WS6A 3LQAH 5HHME 4EF8A 3DYPA 2XV2A 2ZOLB 3PUCA 4EBQH 2HXAA 2W1SA 4P9XA 3O15A 1MZ5A 5CSBA 4B5XA 4EROA 1TPDA 1G4RA 3VQLA 1LL6A 4FOJA 4G56A 5TH2A 5TE7L 2JKAA 1UIKA 3GSUB 4BI5A 5FFOC 1BSIA 4DJFA 5BRBA 2D6OX 5F8RC 2ZRYA 1TV8A 4UFLA 4HKOA 2HFFB 4L99A 1I1FB 1AC6A 4NM8H 4V2XA 4DP5X 4G1MB 3QQ9D 1HTIA 1DQDL 3NACL 3EWDA 4HNCA 1HXKA 2B45X 4XAZA 5LBCA 3E2HB 1SSDA 2ZHMA 3GNML 5D6CA 1GGTA 2R56H 2EHHA 1UZDA 1MCPL 3J27A 2FH6A 3P4LA 4HT1L 1XLDA 4XN8A 1WD8A 3O11A 3BP6A 3PJWA 3VFNB 2J7MA 5IVJA 4K6AA 3DXAD 4MVBD 4NJAL 4UNUA 1IMHC 1FAIL 5LW9A 2F61A 5BXXA 3QOMA 3W7GA 4NERA 2ADEA 5LEJA 1TME3 4G7EA 4QQOA 1L0PA 4H8HA 3QNYA 2WXOA 3FKKA 1QYGL 1BZ9A 1KBBA 4Y19A 2FYYA 5BNOB 4JIIX 1HHJB 3TBSA 2XBDA 2KQMA 3IEBA 2EDJA 2Q1MA 3P5ZA 4UTBH 3ZIWA 3N42B 2R1BA 4QNEA 3KBHE 4WHCA 3GH7A 5DBTA 4YDZA 5I15L 3SN0A 1H2MA 4K0OA 3REWB 4LLUA 3D09A 3DTXA 3B2DC 4NRQA 3S5LB 2ATSA 4QX8A 1MQKH 3LMJH 4XFBA 1BEXA 4MJ5A 4R97B 4Z7NF 3QGKC 1J5OL 1ET5A 4NI6A 1BM3L 1GL4B 2VUYA 4LPYA 1AKJA 5CFCB 3T6VA 4JQ3A 3HG1A 3ENEA 3FTVA 1AA1B 2YARA 2C9QA 1PLGH 4JE0A 2RR13 3GU1A 3VNJA 2CDFB 1CZTA 1TMLA 1X7SA 3FQWA 1UZVA 1TA3B 4S23A 1G6CA 4I7VA 4LARH 2D9QB 2LTQB 1U92B 2ZG1A 3GSQA 3VIPA 2I25N 4A45A 3EHKA 3SCUA 1M4WA 3MNMA 1E5BA 5ID1A 2PTVA 3TFBA 3AQXA 3G3MA 5E6IA 4JQXA 1PGSA 1XJAA 4KHTL 5MHSD 3VFRA 2X70A 5LGKA 4NUPA 4NJHA 1F3TA 4L6HA 4X5RA 3RNDA 3D2UB 4IU2A 1LEKB 3GNXA 1H5VA 3SODB 1I6NA 3WOGA 4FAHA 4GEJA 3QEQA 1VZIA 2X89A 3AZSA 2XZQL 1R1ZA 1AGDB 3AP7A 3M5XA 4X61A 2Y23A 3VG0H 2FIQA 4TSAL 1UY2A 4M7ZC 3GS4A 4NG3A 4ZFOL 2W88A 3TSMA 2R1WB 4GSRA 4D0BA 2QPEB 3W00A 5DFVC 3LKPB 2GSGB 5HHQB 1NLBL 5JH1A 5IVXA 2CHWA 5FYLD 2GFTA 1JHTB 4LGRB 4FYTA 1CYGA 1NTHA 3W7KA 4GXUM 4J8QA 3SNMA 3UXFA 1K6AA 1TJIL 4P4KC 1UH4A 3UCDA 1ERNA 1ETJA 1YUHA 4QCEA 2OX5B 3UXKA 5IVCA 4ZZ9A 2VJ8A 4P5KA 3PWPE 3SCGA 2H32A 2A6WA 4ZFZB 4BE6A 1HESA 1QO5A 4EXBA 4DKAA 3ZBMA 1PY0A 1GP5A 3LEVH 4GIEA 3K3NA 1XE7A 1LMIA 2WVVA 1URLA 2YA1A 2VLKD 3D4ZA 5JZ7C 1T4KA 4WEVX 1SM9A 1IBHA 3L0KA 3Q5YA 4ABQA 4DHLA 1U3HA 1CU4L 2OK0L 2EZ0C 3L5LA 2OTWA 3WAKA 4URTA 5L8LB 2WNVC 5L9FA 4AENA 5XINA 5B3NA 1ZA7A 1I6XA 2BLFA 3CHVA 5CZXD 4F7PB 1NX9A 5BOJA 5IB2B 3WLOA 2QJJA 3HR9A 1CN4A 5E2VH 3WJXA 2V69A 1DTUA 3MCG1 4L11A 3ITGA 4Y1AA 5KHGA 3S2AA 3DHJA 3NKTA 1RXOB 3KT1A 4J2QA 2OA2A 4AVNA 3VSTA 5I18L 3LG3A 4XP6L 5BRZB 2WUBH 3UDWA 4Q8BA 3FUQA 3H3UA 2CU5A 4KWVA 2ABAA 4M5ZH 4A66A 2MNGA 2A3TA 4JHAH 3PUSA 4MNQA 2AQRA 3W2NA 4N1HB 1X7FA 1GS8A 2GEEA 3ITLA 1OW0A 3QXDB 1MF2H 1WBJA 5BMWA 1I0DA 2SEBB 3ZE2F 3W1AA 2FQIA 5DFWH 3S3SA 4FQHB 2POZA 3VFGH 5DO2C 4R7DB 2AEZA 4AX3A 3ZHNA 1QDSA 1GGIL 4QGTA 5JBDA 4KHXH 3GIYA 2RFXA 3BIEA 1XIDA 1V0AA 5GGUA 2A85A 2VN4A 3ONCA 3VDCA 4XPBH 5FY9A 2OMXB 1LRQA 3CAQA 3C5ZC 5BXFB 3MUXA 3QB7C 3L1FA 4D9PA 2VGBA 2E5EA 4E9LA 3R8BB 1MAKA 1CVNA 1P1ZB 1G7UA 2CCRA 1AH4A 1KYFA 1JXNA 3LD8C 5BXRA 2RBLA 4Q8KA 2H0EA 4XTRD 4D72A 5CP7B 4FF9A 4HHAA 3IGAB 4YDKH 4M0NA 1JQVA 2VEKA 5LNUA 4OT7A 3AP9A 4OQVA 3IT8D 1KLUB 1RIHL 1SEQH 3HIZA 4MD5B 3F2LA 1DQJB 1U2YA 4GO9A 1O5LA 3M3CA 4AG4L 2Y7DA 4Z7VB 1D7KA 3LHAA 1KFEA 4OGXL 4JLRA 2R69A 3L2HA 1SRDA 1VLWA 4M7LT 5MERB 1OK0A 3WSUA 3KVDD 2ARXA 4IGHA 3ARFA 2BGSA 4PMQA 3STPA 1UT2A 5JLVA 3WAJA 4FP8L 4HFWA 2AUYA 3Q8BA 3AG1B 5T3ZD 3I7SA 1CR7A 2CNAA 3L54A 1QK0A 4MXVF 4O02B 4NJGA 2DP3A 1XF3A 4ORIA 5E7BA 3EYVA 3DGGA 3MZTA 4Y1VA 5IJVB 4EVNB 3KTCA 2ZA2A 4L9ZA 1EBHA 4NUJA 5I8OH 3GHEL 5JOZA 3F7VB 4LOEA 4MNHB 3B97A 2J8OA 3O0VA 5D1ZI 3G22A 1J1PH 2J27A 1UJ3A 4IFRA 2AEQH 3LOIA 3CIAA 5KVDL 1X5ZA 4EOWL 3H4GA 1UZGA 1VE0A 3NJJA 1IGYA 5M03A 5IG7B 5FYVA 5CZRA 3RY4A 5CPNA 1ZT7B 4QB6A 4LCSA 3NCJL 4M7ZB 1WA6X 4IPNB 5FIPA 4H8NA 1HRV3 4D6FA 4NAJA 1TNMA 1O75A 1GZ1A 1S8DB 2ZGUA 3ARDD 1R5VA 2E4TA 1VKXA 5D4HA 2F84A 1SO6A 4YHZL 4PRNA 2J25A 3EB7A 3WXVH 3ZXDA 2NXZD 5I1CL 4GJYA 1ED3B 1QBML 1W1PA 4P4KB 3G5YA 1OPMA 1RUE3 2PP1A 1LE9B 2KC0A 4E38A 2CWSA 1XE8A 3CX2A 5E9DB 4J6RH 2ARCA 3KOXA 3NQDA 1U12A 5FRAA 3TV3L 1XLBA 2FHFA 3O0RL 1FYHB 1KJMB 2PPCA 3D9AL 3HMYA 2FFCA 1TV3A 2ZCGA 1G43A 2CIIA 1FA2A 4S2SB 3C0QA 1M01A 3UWQA 2XICA 3JZYA 4X6DB 3NDYE 1MFCH 3AYEA 2WUCL 1M41A 4I3SH 1OUXA 1VFOA 5HOSA 3QZEA 3LRLA 1ORSB 2WNVB 4C6JA 3G6MA 2YGPA 3HN5A 2Q86B 4L3CA 4C6PA 1JH5A 1LEIA 1VPXA 4B0MB 4K2UL 2CIKB 1A3XA 1N8FA 5IK8A 4HPYL 2X7WA 1NCQA 1VLXA 3LLXA 3MACH 1XV8A 1K8DB 5DT7A 3RG0A 3QUML 3AB0C 3SQBA 2PGRA 1PD6A 4AL8C 2WXLA 2W9EH 1WZMA 1QXJA 3CBRA 4P5MB 3KFTA 3AAZB 3OODA 2XN9E 1OT4A 4W81A 5FZ4A 3OZ9L 1TVLA 2XG5B 1ZPLA 4YE0A 3TJEH 3EWWA 4DJFD 4C7FA 2WCGA 3OGCA 5DUBA 4EN2A 4RN5A 1NAMB 3KWVA 5LXEA 2ISSA 3NQFA 3V0SA 2RM21 4BB3A 2XB6C 1SVDA 4OHZA 4E2BA 4DZ5A 3FJSA 1OLQA 2R2EA 2YBRB 3NCMA 1EUTA 4HWNA 3UD6A 1Z0NA 4XBJA 4HSOA 4IMDA 2PDJA 2YD1A 1VR6A 1ZVSB 1F1DA 3PIQA 5JIKA 5EFDA 2VYOA 1OOWA 1M1XB 7PCYA 1G7IB 3CNKA 1B0IA 3L1OL 3ZFEC 1NUNB 1GJUA 3ZYJA 4BM8A 1Q9LB 2R23A 5CCJA 3LY6A 3NABL 2VZ1A 4A8RA 3LU2A 2JG8C 3I6LE 1UR9A 3MLVL 3GYDA 2BVOB 4B5UA 5EBMB 2NMOA 3HE6C 1H51A 2WZPP 3C5ZB 3H0TA 4JPKL 1D5RA 3EYUL 4BKLB 4WCYL 1J79A 5IHHA 3RM4A 1E0XA 3EG9B 3NIGE 3C2AH 2OQLA 5FJOA 3LD8B 4W4OA 2XGBA 3C2SA 4OZGB 3O05A 3QQ4A 1W9UA 3ENLA 4UT5A 5F9DC 2B1HH 4O2FB 3G6JB 1B54A 2ZGKA 5C09B 4OYUA 2R0FA 3BW9B 3BMXA 4HTYA 4U7KA 1H9VA 4RZ6A 5CZTA 1NQ6A 1ZE3C 3OB0K 1KJLA 4LSTH 2O6DA 1JR1A 1P7HL 2CGPA 2IMNA 3MOQA 3AUWB 5FHBH 4XUOA 1AKJD 1FJ1A 1TG7A 3QXTA 4FXGC 4Q32A 1J8HB 3HEIB 1AHWC 3VAEA 5I6MA 3HG1D 1VDGA 3ZUNC 3D18A 2UZXA 3ZDVA 1PZBA 4EDXA 3T8QA 4BF7A 3MNZA 1LO5B 1O5QA 4PZVA 1YMHA 4JPVL 1SDAB 4PJ8A 2DEPA 3WFDL 3B1TA 1TPFA 3SRFA 4X6CA 3NJHA 3VUOA 3V65A 1NFAA 3GK8L 5I0DA 5DURB 3CVDA 2PQSA 1U42A 2DZWA 1ZHLB 1KDKA 1PM7A 5KOMC 3TCXA 2NYZA 1FYUA 3VBSC 5DVPA 3S1VA 5BU6A 4HT1H 4FI4A 4Z6AT 5L4MA 4L9LC 1NCIA 3TLQA 1FFPA 1QD0A 1AS7A 2AYHA 1PG7W 2BW8A 1FHNA 4QHUB 1EY2A 3FSWA 5AC92 1BX2B 4NJAH 3QUZA 3EGXB 4YAQA 3RA7L 1R083 1FAIH 4NYLA 3WY1A 2NQCA 4MNGB 4J4PD 1TZAA 3EBRA 5HHPA 4G8FA 2X89D 2B3IA 5T33L 3HI5H 3CL8A 2ZOKA 4PBVC 2JEQA 1N8ZB 3JRKA 4L4TB 1X9PA 3N19B 4JFHD 3AACA 4PLOB 1MUWA 5ES4B 4I9XA 2JKXA 3CXHK 1C9DA 4WWKD 3N50A 3N40P 4L0YA 2SFPA 4HKPA 4NFDA 3VXMA 4E41A 3QORA 1FC1A 3H42L 3MYJA 3AY4C 4M43L 1YEYA 1F3DH 4I7WA 5CD3A 3QPXH 3GMPB 3BRFA 2LRPA 3OXSB 4CDXC 4UMBA 5DJ8B 4M6VA 2ZOUA 4HPOH 1XINA 2VZOA 3ZRCC 4Y4KA 4TTDD 1X5KA 3O3UN 1T80A 4Y0GA 1J5OH 1BM3H 3C2FA 5GLVA 1SPDA 4AHQA 3QO0A 2OXGB 4RSYA 4MG2A 2WSPA 3CIHA 1A1OB 4ZB2A 3FO0L 1ZWIB 1HE8A 3TXAA 3M43A 1LBMA 1U9KA 1CI5A 1J8KA 1U3HD 1LYXA 4KCVA 1H7NA 1T1ZB 2G75A 3BUQA 4RAVB 1UZ0A 1PJWA 2Z0UA 4OLYL 1REDA 3GZUC 2YSWA 4EAMA 5BV7C 3MV7E 5L2JA 2OZNA 3ONBA 1E5IA 3AB0B 2FDJA 1ZZ9A 5FY7A 3BLPX 1IFHL 3RYPA 4Y1AD 2DV9A 3LI1A 4KHTH 1PGL1 4N5EC 3O9NA 1ADWA 2HG0A 3LHUA 3GHMA 1W6PA 4JRXB 1JZ4A 1GOQA 4R3SB 1SO5A 1UD6A 4XCEB 4MNQD 3TEXA 3PU7A 3SKJE 1J48A 1SBSL 5KC5A 1AODA 4Y9MA 4B0MM 3QDJA 1GOXA 3AIUA 1QNRA 3T65A 4Z7QE 3UP1A 1B30A 2WINB 4M7SA 5F1UA 4M4RA 2CWNA 4UWQB 1NLBH 2P5WA 1OANA 1W6TA 3ETBJ 2X5PA 3ZFEB 2J8FA 2F2HA 4MDJA 1S0EA 3QJAA 2J55A 3UWVA 2VRJA 2MQGA 2JG8B 5FPZA 3G9AB 3MPCA 2IWGB 3SUUA 3GMMB 4EN3A 3HE6B 4YNYB 2J88L 4R7NA 5KG9A 1CFSB 1XB8A 4RA0A 1SMAA 3US1A 3B03A 2OW6A 3C5QA 4X4ZA 3JVAA 3ME3A 4LB8A 1VBJA 2FE0A 3SISA 3N4AA 3DX7A 5CADA 4JY8A 2Z0IA 4FGMA 1WC7A 4OGYL 3ZHDA 1E8YA 3DFOA 4GB9A 5FJIA 5E5RB 5CJMA 3U2ZA 1BQLH 1ID2A 3HN1A 1PIV3 4WIWA 3MGOB 1CU4H 2MTPA 1TVDA 3Q45A 4YE4L 1VBE3 1PXGA 3O41A 2BNQA 3AZXA 4JHBA 3HB3D 1EP2A 3PIGA 4U4MA 4HCLA 1WE5A 2QVKA 4GZ9A 2R29H 1S0GA 4FXGB 3RRQA 2GITB 1DWHM 1AHWB 2NQYA 3AMQA 3ARFD 1FPN2 1ZTXL 4Q4V2 1A7OL 3T4VA 4JUSA 4LYRA 4GB32 1AD4A 4F2ME 2WC3A 1ZZMA 5J4MA 1Q38A 3ON7A 2BLEA 2YWZA 3WG2A 3P93A 4QRQA 3QF0A 1HFBA 1BDYA 3UO1L 1XIIA 1YEIH 4Q4RA 4I02A 4P9JA 3R7QA 5I18H 4XP6H 2AANA 2CBOA 3D3FA 1MFEL 3LKJA 1IFGA 2FZ1A 4N8PA 1G9EA 1FBAA 4B3KA 4TIMA 3D46A 2NUTB 2ZMNA 5L2KE 3WUWA 3VBSB 2QCGA 4KH9A 1V02A 1E9YB 2CCVA 4HUCA 1OT1A 4PV8B 3EMZA 4L9LB 2R24A 5IAVA 1ND3C 4Z23A 1GW1A 4H1LB 3MV8A 1EDHA 3EZ4A 4OLEA 4BHUA 3AYRA 4P9GA 4GG9A 5A7WB 1GGIH 2ADGA 3K2UL 1VIWA 1MNZA 4OLVL 3P0GB 1C8M2 4XVTL 4YHPA 1P4UA 1JI6A 1WXJA 4RSVA 1UYZA 2E7HA 1WDWA 2VE1A 3A0KA 1U95A 2G4FA 4EI6B 4IJ3C 2WNUC 3W6YA 1J3QA 3BI3A 2ZUVA 1LRNA 3IDJA 4YFLF 3WO4C 3ZXGA 3VW3L 2R83A 1ELSA 3MRBA 4CDXB 1LF1A 2YFZA 4KZEH 1PNCA 2FKPA 3CZLA 4B50A 3BARA 3ZY7A 2JLLA 2EXWC 1RIHH 2JJSC 2BXZA 4RZCA 4PTNA 1UKRA 5ACLA 3D39E 3F5LA 3U48A 4OGXH 3VD1A 4K9SA 4QCIA 3TTEA 1T1XA 3SGJA 1NEZB 2IWKA 2ZBTA 1S9XA 4E0RA 2WNXA 3CSTA 5FYKE 2NR6D 3H3PH 5K9OA 4FHJA 4DINB 3BIKA 5DU7A 5EEXA 4WGVB 5GGSB 5D1QE 1NBZB 1MNNA 1Z9OA 3U7YH 4F8LA 4N87A 1AJKA 4OI4A 1DZ0A 4M8QA 3K8MA 3IVSA 5A2CA 5BV7B 4Y5VA 1AR72 1TU2A 3W9AA 4OFYA 1T41A 1IV8A 4UZUA 2ZUNA 2AGKA 1MAML 2W91A 2X12A 3GHEH 4IRZA 5FECB 1WG3A 3QA3A 3NN8A 2QUMA 1DBAH 1IEIA 3KYNA 2VXQA 4N9CA 3W2KA 4KJWC 4YGVA 1RVF1 3ZTJH 2BWQA 5AL0A 1UN1A 1J8VA 1Z3GL 5KHIA 4R4FH 4EWDA 4EOWH 5DK3A 3FQTB 4DM1A 4OQ8A 3AWEA 1OC6A 3WTSA 2BERA 4L1BA 1QKZL 1DVQA 1NFDF 3LEXA 2YWYA 2VO5A 4FTVB 5AYZA 4OKVB 5F0LB 1MZZA 2XSAA 1QW9A 3H3KA 1NE6A 3RVWC 3L0GA 4JM2F 3GZEA 3IIAA 1I9IL 2E6PA 3OKDA 2BGCA 5HGGS 5T9CE 5I1AA 2IANB 2VN6A 5I09A 3MFFB 1JWUA 3OD0A 2ESCA 3FB7B 4E9VA 4Q7BA 3A4XA 4X6DF 1POKA 3Q37A 2AMXA 3KBNA 1NCAL 4ELME 5EKYA 4PJBA 1QSFE 3IK4A 3PNUA 1QVOB 4JRYB 3RYMA 2XKNA 3O1TA 5FSEC 3EWBX 4S3BA 3GBGA 3BTAA 4DZ8B 1E5CA 1LDSA 5B38B 4GS7C 2XQ0A 4JKPL 3RX4A 2K0GA 2DM4A 1XGPB 4HWZB 1XDMA 5KINA 1OAUH 3VXOA 3K2IA 2FDIA 2OJZL 5DJCB 4EAYA 1QJU3 4L37A 2A6DB 3V64A 4N9EA 1ROCA 4XVUD 3LQAC 3TNNB 3P3SA 3UEZA 3UTPD 2WUCH 4XETA 2J13A 3GBML 4TSCL 3LEKA 3FB5A 4MNLA 2PCFA 3NP4A 1HCZA 2GK2A 4GG8A 4K2UH 3W9DB 3ZFGC 5D9SA 2DBJA 3SY8A 2X42A 1AR2A 1MVYA 3DV6A 3HQPA 1YECH 4UW6A 1UWWA 2YYTA 4YVVA 3W2DL 3PJUA 5B7EA 4IKKA 1J1LA 2PC8A 2HROA 4IETA 4PGBB 4G9FA 4UV4H 4IF2A 5LBSA 3NVQA 4PJ8D 1ENQA 4Q0VA 3SCMA 2FZ9A 3KTSA 3MRKB 4LP5A 2Z42A 2FGZA 2F8OA 2NY3D 4OU3A 3RGBA 1EXHA 4YM2A 4XG1A 1IQ8A 4PRPB 1L8NA 4Q1RA 3CH8A 3EWYA 2YPLA 3UGXA 4AGNA 1KGIA 4DKFL 1A3LL 2KBGA 1GGBL 4GUHA 1ND3B 4LUTB 2DM3A 2DVGA 3UBGA 1W0WA 2AQNA 5F2GA 1H7XA 2A6XA 1ZMYA 3BQVA 3G1SA 1LD9A 4CNTA 2NCEA 3JBG1 4PUWA 3WMSA 3T1LA 4IWWA 3TTQA 2D97A 4U0QB 4ZJ9A 5SWSB 4FEMA 1SFYA 5E0CA 3BLEA 2AXGA 4ADIA 1AXKA 1AI1L 3EJRA 3NABH 3OKMA 3MLVH 5I0VA 4O0ZA 2WYSA 3WF1A 1QZNA 1IKNC 3G5WA 4X5WA 3MHFA 4IJ3B 5EORL 2WNUB 4W7UA 4RGNE 4N90E 2PTZA 4WCYH 2YDRA 1MO0A 3ARGA 4AEHL 3QORD 3IF1B 1EGZA 1OD7A 4JGYA 1US0A 3WO4B 5I1GL 5FA5A 4CDWC 4FOKA 3QNZA 3EKZA 3POYA 4GKZB 3J07A 4LCYA 4IG2A 3AKRA 2VELA 3STLA 1UKOA 4EKJA 2HB0A 1LR5A 4Y4KD 2YQ2A 4Y7EA 2WFPA 5AOKA 3HCVB 4UIKL 3G5XA 3L3HB 5AYUH 4A2DA 3ZDZE 1SLAA 1C5BH 5E8OB 4TOYH 2WA3A 2DIJA 4X7EC 2NZ9A 2V0AA 2ZZJA 4N0UA 4YR6A 1MW2A 1AZRA 2PDHA 5I91A 4GALA 3N25A 2HLAB 3BQ6A 2WXMA 4ZPVA 1RSCA 4OH2A 1NANI 2XFXB 5LGZA 1E9ZB 2ENSA 5C2CA 4JPVH 3QPQC 3MDPA 4ZFMA 5B1CA 4RE0A 1YCSA 3ZPYA 1FWGC 3KVKA 2YMXH 1BXXA 5HI3C 3DX5A 1FP5A 1T3FB 3QLLA 1RITA 1MVEA 1AG0A 3QEZA 3NO1A 4AQLA 1OZTG 1W9VA 3HA0A 4GRWH 5AZ0A 4OLZL 2XA8L 5LBBA 2YGVA 4HSJA 2CBVA 3GKWL 1DQ1A 4LS1A 1CLXA 3U5UA 4F3FB 3A7QA 4XB3A 5KSVB 3RA7H 3APNA 5BW7A 3KYMB 4IIHA 4B3NA 1CJPA 3P3BA 4XJ8A 1WUFA 1MY7A 4MAVA 2JKEA 3IB4A 4ASTA 4BA6A 4HJSA 1TETL 1T2XA 3N2BA 3HIJA 2QHAA 4CCLA 1Z42A 3FFCD 5G04L 4EZHA 2WC7A 2GUOA 3T4AA 4M43H 1HZLA 4TUFA 2P5WD 3KS5A 3TC6A 1U8JB 3IWUA 3UNPA 5PAZA 2CZVA 1YADA 3RX3A 4QOKB 2F58L 4NCC2 2RS33 1QX1A 4UM9B 1L9NA 1ESOA 1OX6A 4EN3D 5IHRA 1K85A 3WG4A 3OJBA 1UZ6E 4GS7B 1B4LA 1MH5A 5J7CC 4OOZA 3OX8A 1MCQA 1QLEL 3CDZA 1ITQA 1XBXA 1VF8A 2I16A 1ZSHA 2EKSA 3FUKA 4FQXC 3OPSA 2Y1HA 4GZJA 3FO0H 4RWYL 1E6NA 2CBMA 3RGVA 2OTPA 3TA6A 5KUMA 3ME2A 2H7WA 3THML 1AJ0A 2BNQD 3DO7B 4MQ7A 4CUGA 2Y4SA 4PRHE 5DRWA 3CB3A 1GP4A 2E4FA 4OLYH 3ZFGB 4RMRA 1U5ZA 1RIVL 3GGWA 5C7XL 2LU3A 3C7HA 4NIYE 4HYTB 5HI0A 3W11D 2BSBA 4BBWA 4J8RA 1WZKA 4LEFA 4O2CA 1GWMA 4A2HA 1CGXA 2GVEA 3F7RA 4ATFA 1L9TA 5DX7A 3CO2A 2OBGA 1WPCA 3WDRA 1HQRB 5HDRA 2Y0IA 2KMWA 1AXSA 3IGLA 2VLLB 1ZHAA 3W07A 1WVZA 4NKIL 5FXWA 4QKDA 1N68A 2ZXAA 2RDXA 3NCYP 3GC4A 3MRJB 2IAAC 3T2QA 1RUML 3OSKA 2P50A 2IUWA 3OG3A 5IF0A 1YEKL 3U2IA 3D51A 3WHTA 1KB9J 3S8WA 4KXDA 1FNZA 1I9RA 1GZTA 1UR0A 5JI7A 3UGHA 3PXLA 4K8RH 1WZ1L 2HX8A 1PKQB 2VVNA 1LHOA 4EF3A 2OEMA 3MV8D 4JX4A 3S3CB 4U5IA 4HU8A 5IDIA 4OFGA 3LKQB 3QJQB 4NP9A 2D93A 3ZFFA 3P80A 4KOBA 1S5HA 2PYEB 3DERA 1AW5A 1TMF2 3I68A 3TWCH 1O6IA 4JCMA 5EV7A 4KXZH 4WVMB 1JW6A 1H8TA 4IV1A 3QLQA 3Q1EA 5CBJA 4LBJA 3MUY1 2CO3A 2OKMA 4N2YA 1RZ7L 3H9YA 5EULV 2PF6A 1XLMA 3UCCA 1QLFA 2UYAA 1TZIB 1TPC1 3TMLA 4DM2A 1M1SA 2QCFA 2I9EA 4CDWB 4C6FA 3DEQA 1K4DB 4YSRA 2K7QA 3KG5A 3ZR6A 4OGYH 4YSAA 4ET7A 2IDUA 2FHCA 3VIKA 5FZBA 2Y89A 2VFHA 3D8CA 4IBZA 1OGAB 3INOA 3Q3GA 4YE4H 3KP0A 3JYCA 4WVRA 3BKCL 3WIIL 1WKYA 3PAJA 4YWAA 5HBAA 1GNXA 3DUUB 4LO5B 3GRIA 4BUQA 5HV4A 2ZKLA 4BWLA 2DW7A 2XWDA 2F54A 2OSXA 5AOUA 1ZTXH 1L6SA 2OL3L 2CO6B 4I7UA 5AYQA 2Z4TA 2P8MB 3NJXA 2WLLB 3TXVA 4EI0A 4B91A 4IGQA 3LHPL 1BYCA 2Z1VA 3GVVA 3UO1H 2ZZQA 5J6HA 4M5YH 4NNCA 4IXXA 4GKTA 2Y5TB 2EXKA 2A9ML 3AYCA 3F6JA 3VXRA 5E0KA 3ZGHA 3M0JA 3MHZA 4AQTA 1Z0MA 1AR63 4XZNX 1TIUA 2DVXA 5FF6B 4B53A 4FI7A 2P3YA 4PREB 4C55A 2VDQL 5IR1B 1D5XB 2ZNWA 1PZUB 3V0JA 4MS8C 3UWZA 1FP9A 2MNUA 1OALA 3DKWA 3ECUA 4KVNL 2DBLH 1G9BA 4OV5B 1S3RA 3LB6C 3FQNB 4G80A 4MNKA 2CLRB 3K2UH 1DQML 4OLVH 4HMEA 4XO6A 1VJSA 4QX2A 3PZMA 4L92A 2ZWYA 3R2GA 1RY0A 3WLWC 1UYWL 3DN7A 3LIZA 3J8F7 3NIDE 4JDMA 2ORXA 4XBQA 2Z6IA 4RE2A 3WUGA 4YTUA 2R071 1IOAA 2YAOA 2C9RA 5I73C 2AS5M 3X13A 1RA5A 1A8DA 3O4OC 2CHRA 4M7LL 1GICA 5INCB 3RTQD 1T5XB 4WGHA 5G2WA 3NJ3A 5I30L 4O4YL 4HJTA 1LLOA 2FLBT 3H4XA 3LGGA 4ZQTA 4HN4A 2WABA 3EX1A 3HUJB 4H8QA 2JG9C 1VBC3 1FAYA 1FCUA 3W29A 3WEAA 1MCOH 4JN7A 2VDLH 1OAJA 1FOD2 4R4BA 3D47A 3AX4A 1IBYA 2J2ZB 5LGYA 4FQXB 5C07D 2IS7A 2XJLA 3WINE 3VGFA 5KYXA 5JDSB 4HAGA 2IOMA 1KCBA 3NFSH 1U8HA 5DRIA 2NT0A 5F96H 3OWEA 2ATKA 4J1UA 2Y7FA 6TAAA 4QRSB 2O9RA 1AH1A 1NVMA 3KNBA 2BSSA 3D82A 1SDYA 3AUVA 3VE9A 5C0NC 2E7LA 1CD8A 3FUDA 1LK2B 4MYWB 1FNYA 2TBVA 3ZN6B 3LCPA 2XUWA 4PJGE 3Q2DA 1HB1A 3LCLA 1ZFJA 5HXMA 2ZZ4A 4G9FD 3VGDA 1CD9B 1SBBA 1Z3GH 2V7HA 1OINA 4JG0L 3U6XS 3SCMD 5ELIA 2Z1WA 3EUDA 4AVFA 2VWEE 3ILRA 1A6ZA 1R3HB 1NT0A 1QKZH 1SJDA 5JZGA 3QBUA 4Y20B 1NZIA 4W87A 2YPLD 1TJPA 4JM0A 4X6EB 3W7EA 4Z7OE 5F7MC 2DLIA 1A1NB 1QEXA 2VC9A 1I9IH 1RMU1 4S3CA 4XAAA 2RDWA 4LU5L 1W8FA 2O7QA 2Q01A 1UYYA 3S47A 1CPNA 1FPTL 4HF5L 4F0MA 2CAVA 2E53A 2WA4A 1A3QA 2QQJA 4E9SA 1W32A 4JJ5A 1NCAH 1UGKA 4M3CE 2WN3A 3ID7A 1QI0A 4LULA 1NJJA 1F11B 2EIKB 4O8RA 1V54B 1NOLA 5IOPA 1PO22 1MHCA 1CFQA 1ENRA 3VCRA 3ROUA 1NCWH 5JW4R 3IT8A 3L1GA 2CUMA 2FD6H 2H8PB 4U1MA 4LIUA 3M4HA 3LQZA 1OE3A 4M61A 3WJJC 3RUGA 1AGCA 6XIAA 4XABA 1XZ0A 4B5EA 5IFPA 3R58A 4FRWA 4LBRA 3FF8A 2CJTA 1W37A 3WBDA 1UOWA 3EOTL 2NZ9D 1NICA 2A5ZA 4NYYA 1UWXH 4OZXA 1ONQB 3H2MA 2XFWA 1VBA2 2AVFA 2YKKA 2H2SC 3HGJA 4OZHE 4DGYL 1OQEA 3W2DH 5HI5D 1LCOA 1S3KL 4GX9A 5GJTL 1V3LA 2HBXA 1BXHA 4OHVA 2DZTA 5H4YA 3QRGL 1NH6A 1UY0A 4AD0A 2G37A 2WYFA 5FUPA 3GIPA 1R3JA 2WSYA 3TJHC 4DPNA 3BKYL 4N9IA 4XMPL 1A3LH 1KXVA 5EOTA 2OJPA 1GGBH 1KIPB 1MW0A 4RMVA 1OF3A 4WXZA 1OLLA 4F7CA 3KLHD 2E75C 2VBBA 1WAUA 1JN6A 4AEMA 5D8AA 1ZAHA 1R3QA 4LV9A 4DP2X 1KCSL 1MRCL 3P4OA 2ZVRA 1DJGA 5EPAA 2OQJA 4AFYA 4K15A 2INFA 4RAUB 5CF3A 3TEYA 3UTOA 5KITA 3EJTA 1A4KB 1QP1A 3HZVB 3IDMB 2QQIA 1BEUA 5DQDH 4RDQF 1AI1H 3ELNA 3DI2B 2X4SB 5AZEL 1XNBA 1U8KA 2I9TB 1J9QA 1ACZA 1PDZA 3VACA 5EORH 3CZKA 1V8EA 4UR8A 2XFGB 2WFF1 4FPKA 4AWSA 3KLKA 4E4DX 2ZF9A 3QUYC 5I73B 5E94A 5HPCA 2ZGSA 2EPKX 2AF2A 3IETA 3SQMA 2E9IA 3O4OB 4JRFA 2C4XA 3PWJB 4JY5H 2HE5A 3PHAA 5I8YA 1M6OA 2Q3AA 1JUBA 4DIXA 4A6YL 4G9DB 4XDPA 2IXUA 2GJZA 3G1AA 3MNVB 4LSPL 2JG9B 3D0VB 4UIKH 2NLRA 1SFHA 4WJ5A 2FZBA 2NQJA 2ZKNA 1ZM1A 4KITB 4FHAA 3M0LA 4FNPA 3CJIA 2B20A 4JDZB 4KK6C 4ZQCA 2JKPA 1WYIA 2JIXA 3F3HA 3RGVD 5LY2A 5D5MA 3ABZA 3VM7A 2NQDA 1IKPA 5HGAA 2X4TA 5A3OA 1DE4A 5C3QA 3K2MC 3TO4C 3BP7A 3FQ1A 5IRPA 2O6CA 1VBD2 5KYWB 4CGTA 4DX3A 1XQ4A 4OLZH 4UMSA 4LO7A 3IXAB 4GW4A 2CZDA 2O1AA 1JAKA 1KBPA 5IHZA 2E8YA 3IDIB 1H7WA 4B4FA 5IB5B 1FVCA 1OVDA 4LVEA 3ZYIA 1COV1 4I2XE 5DJZA 2OGJA 2G0KA 4JHZA 2WKOF 1XBVA 5F7WC 4WNJA 4LAKA 1IM9B 1JODA 5DCDA 1BGAA 1ADQA 1NOWA 1CB4A 1MN4A 2BG5A 4UFHA 3B7SA 5F1NB 1PO13 5JXJA 2BDQA 4QO1B 1YJDH 2F7PA 2HE8A 5DXDA 4DEUA 1YEWA 1EO5A 3X11A 4HUUA 3COTA 43CAB 4MGKE 2RMNA 1RK5A 4HJWA 1AXZA 3NQIA 3WQ1A 5EIIG 2KZHA 1MPXA 1INEL 1CDHA 3OVPA 4OAWB 1TQTA 2Y69B 1H1AA 3UWEA 1WDAA 2F58H 4GH3A 4TUJB 4ODSL 2A21A 4A6SA 3KMHA 5SV4A 4WQOA 2A71A 3VKBA 4NP4L 3VGGA 5DFTA 4IESA 3DK0A 5F9JB 4EYUA 2DYPD 1QLEH 1YBQA 5FY0A 2AC1A 1LYQA 1JZGA 1AR92 4DXXA 2LLEA 3PP3K 4JFZL 3VBRC 3POFA 1BZ7B 1IGCL 4RWYH 2K1MA 1GZQB 5BVPL 4O00A 1PKMA 1IS5A 2HWD2 2UY6A 4IKIA 2ZICA 2HFGL 4PLNC 3H7VA 3FSAA 1HB4A 4O50A 1E5NA 3ROOA 1ETZA 4NQCE 4GD0A 3QD6A 5J56B 1WSST 4GEIA 4JGUA 3KLAA 5C7XH 2QW5A 2YXMA 3P0XA 1XHHA 5ENWA 1TOXA 4W4NA 1SN5A 4S11A 2XQBL 2F54D 3ARBC 3H4HA 3PUUA 4YLCA 1EEQA 3I6GA 4KKBD 5GNYA 3DROB 3U4FA 3ISIX 1IILE 2LR4A 1NA1A 1VMJA 1UQYA 4LLMB 4LHSA 3IFPB 2YCKX 5A2AA 3ZW3A 3VXRD 2DZEA 2J7LA 4N4QA 3QRHA 5CPQA 2NVCA 4CQ9A 2EAAA 5E6RB 3ZSJA 2AL1A 2ARJB 1IB5A 1RUMH 4G8AC 1YEKH 4AYID 4LRSA 1BP3B 4FNTA 3VZMA 4PJFA 1CBGA 4HUWA 4W8BA 5EJ3A 3KLDA 4J4PA 1TYGA 3MGTB 4U6YA 5E08H 4RHV1 2ZAIA 4KL1A 2CCWA 3NK4A 4PCPA 1Z7S3 5IUQA 1ZP3A 1ZPUA 1KYAA 1JCVA 4MGIE 1KJVA 1CYXA 2Z27A 4WWKA 4M3KB 3ES6A 2XBO1 5CJOL 5L0QC 4FLHA 1XIMA 2PP0A 3WFBL 3USZA 3I3MA 1MWAH 1Q43A 3P6BA 5AVXB 5I8EA 3QMRA 1GHFL 4UT6H 3V7MA 4TZDA 3B94A 5BOEA 2Y22A 3GFZA 3QUYB 4OJAA 3GJFK 4TU1A 4IEXA 5FZOA 2XMLA 3BAJA 1DHPA 1S7WA 2XXZA 1A78A 2XH7A 1YDPB 2YSSB 1JNLL 3PAOA 4N8CL 1QNPA 1MI5B 2O5NA 4AMWA 4D0CB 4MSWA 4TUOB 1U21A 2VKXA 4WRLA 5F1VA 4B9GA 4DWSA 1W1VA 4JM2C 1RYYA 2EE0A 3PWNA 3ZVVA 4QEEA 3M17A 3WIIH 5BUPA 4DRSA 1GPOL 1HHKB 1WAAA 1YTKA 5J11C 3G1HA 2NY7L 3RRDA 5KVFE 1CK0H 4FKKA 2VABA 1EC8A 1TQSA 1AGEB 2VO8A 1UACL 4X0KB 2OL3H 5CEXB 3ILFA 4Q4MA 4ORGB 3VKAA 3IJSA 4LLQA 2V9DA 4GUOA 2W1UA 1HNGA 4LCRA 3EGSB 4HN1A 4HSQA 2RMU1 3W1TA 2A9MH 3TO4B 4XOBA 1OXYA 2E76C 2F5AL 5B1AB 3DYMA 2AKZA 3CC5B 2PR9A 1QSEB 5FYLL 1XB9A 5D2LE 5GS3A 1MQTA 1OYCA 2A6IB 2V8LA 1KEGL 3HMJG 5CBIA 5EZLA 1CWPA 4MB1A 3H2OA 3GO1H 2VDMH 2OMNA 2J7GA 1LO4H 4GY4A 3B93A 4E2QA 5HYQB 2CSGA 2ZSWB 1QOOA 2XN9D 4KVNH 5DJ0A 2ZGLA 4AQAB 4X5XB 5AQ0A 2DD8L 4UTKA 1TV7A 3JUZA 1OYBA 2QDDA 4G59C 3HUJF 1EPWA 4E36A 1LHVA 3R6SA 2QT3A 2YBGA 4QRTB 4A37A 2R9HC 4REQA 4RQQB 1F90L 3AS1A 3MUGB 2MRYA 4OZFG 4U1LA 2MOVA 3B7UX 3WNJA 5EN3A 3OBEA 1RZQA 4KI5M 1DP0A 2E6QA 4M7LH 3CV7A 1UVQB 2ODOA 2VXTL 4ZXEA 5I30H 4O4YH 4DUXA 2CKBA 5GRZA 3CMGA 3KD4A 4EPEC 3L3JA 5D21A 3NL5A 4IMKC 3R19A 2DQEL 3APCA 3GAKA 5MEOB 4Y1TA 1W3TA 5EEVA 1DWJM 3LMYA 5J5EA 3OBAA 3PVOA 3Q1SL 1R9YA 1YHTA 3VBRB 4IPLA 4M19A 1DQKA 4XN5A 2X1WL 2DKUA 4KKAC 1BBT3 4GQZA 3EOBA 3URAA 1IHIA 2FEDC 4PJDF 4Z5RB 3MRHB 5HD8D 2GSHA 3V0TA 3GZPA 1IZCA 2WTPA 4DKTA 1GKEA 3RZWA 2YHJA 1JG9A 2Q3XA 2W6RA 4XN2A