4QAWA

Structure of modular xyn30d from paenibacillus barcinonensis
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
537
structure length
537
Chain Sequence
ASDANINLSSEKQLIKGFGGINHPAWIGDLTAAQRETAFGNGQNQLGFSILRIYVDDNRNNWYREVATAKRAIEQGALVFASPWNPPSDMVETFNRNGASAKRLKYDKYAAYAQHLNDFVTFMKNNGVDLYAISVQNEPDYAHDWTWWTPQEILRFMKENAGSIQGTRVMAPESFQYLKNISDPILNDPQALANMDILGAHTYGTQIKDFAYPLFKQKGAGKELWMTEVYVPNSDNNSADRWPEALDVSYHMHNAMVEGDFQAYVWWYIRRQYGPMKEDGTISKRGYNMAHFSKFVRPGYVRVDATKNPDTNTYVSAYKGDNKVVIVAINRGTSAASQRFVLQNGNASTVSSYVTDSSRNLASLAPINVSNGAFTAQLPAQSVTTFVANLSGGNSGGGNVNTGTTYEAETGTTLTDAVVETLYPGYTGSGYVNFNAYTNSAIEWNAINNMTTGTKNVKFRYALESGTRNLDIYVNGTKVLSNEPFTETGSWSTWGEKTIQVAMNSGVNTLRIVTTGTEGPNMDNITVTASAKGELNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Analysis of Glucuronoxylan-specific Xyn30D and Its Attached CBM35 Domain Gives Insights into the Role of Modularity in Specificity.
pubmed doi rcsb
source organism Paenibacillus barcinonensis
molecule tags Hydrolase
molecule keywords Xyn30D
total genus 159
structure length 537
sequence length 537
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
A PF17189 Glyco_hydro_30C Glycosyl hydrolase family 30 beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4qawA01
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4qawA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4qawA02
4W5ZA 4EANA 3C7EA 2XGBA 2QQOA 4ACYA 4P7NA 4PMZA 4TXEA 1P8JA 2E3ZA 1JYWA 5D9MA 3WNMA 2JE8A 1JXKA 1GU3A 2ZEYA 1UH2A 4UFIA 2D2OA 4MAZA 2UY5A 5CGMA 1EGZA 4HTYA 1BF2A 9CGTA 4ACZB 3AHTA 3DX4A 2VRQA 2OWCA 3WENA 3TP4A 5JXGA 3WY3A 1QI2A 3ARPA 4URIA 2V4VA 3OEBA 1V6UA 2MANA 3LPFA 1W8OA 1XC6A 3I2JA 3WDJA 3WQ6A 2F1BA 5D8ZA 4U2ZA 1R7AA 4CU8A 2W9XA 2JIEA 1QI3A 1JU3A 3W6MA 3GXMA 3WFZA 4IISA 4J7RA 3GXIA 1VFMA 4TTGA 3VIFA 1UY4A 2PWFA 4Z2IA 1GOHA 3SCPA 2QQKA 1WP6A 1HJWA 4MB3A 4H7VA 3N9KA 5IDIA 2E31A 1BLIA 2D23A 1FOBA 1QWUA 2G4FA 3WF4A 4C7FA 5IXEA 1JAKA 3O2LA 4OOUA 3HJEA 4TX8A 4WKHA 3DDGA 2X09A 3PZVA 3U5UA 2LW8A 5DT5A 1OM0A 1RP8A 3AQUA 2W1SA 3KZSA 3B8SA 2WK2A 3EDFA 1E1FA 2O92A 2JKXA 1MXDA 1UWQA 1I1XA 2PQSA 4D6IA 4OMCA 4XV0A 1E70M 1HP5A 4Z2GA 4QX1A 5A6SA 4QLLA 2D1ZA 1XSIA 1JYNA 2VNCA 1RP9A 2NSXA 1M7XA 1JZ8A 5HPCA 1VAHA 3N04A 4ATDA 2ZUNA 2OYLA 2VVSA 1JNEA 3CZSA 3IAQA 1XCXA 1WO2A 2NW0A 1KQYA 4MNKA 4MOAA 3VDCA 2D20A 3S5YA 1V3HA 4CKQA 3CIHA 3A4XA 1QI0A 1J01A 1UY2A 2J79A 2YDQA 3PZNA 3VDAA 1JZ5A 4LGXA 4UQ9A 4NSBA 1HJQA 2QQLA 1E6SM 4KRUA 4HA4A 2WKGA 1EHAA 1WKYA 1R47A 4FNTA 4WKAA 2JDAA 1BPLB 3HNMA 2Y2WA 3WY1A 3AJ7A 1C93A 3VX1A 3CZJA 3OIHA 4HMCA 2QQMA 2WSKA 4AIUA 1DYOA 1Q6EA 1B30A 1UQZA 2JEQA 2BERA 1HJVA 1JGIA 2F7RA 2E4TA 1ISZA 3BVWA 4LPLA 3AXXA 4F8XA 1TMQA 3CHDA 1PX4A 1WZAA 1ITXA 3AHYA 3W27A 4V27A 4M80A 4ML4A 2ZICA 1UH3A 3LXBA 2R7EB 4M1RA 3VILA 4J3XA 1HF6A 2ORZA 3ZJ7A 1H3GA 4PTMA 3HNYM 1GNYA 2VMEA 1EIBA 4H2CA 4UR9A 4HA3A 4AZCB 4FLSA 3DECA 3EMZA 4L4OA 2WMGA 1HL8A 5I0DA 3AS2A 3RO8A 1PJ9A 2PF0A 2BHUA 2IXUA 4JHOA 2CBIA 3SURA 4LXFA 2VZ1A 2CKSA 2XGIA 3S6TA 4QB1A 4W8AA 1UA7A 3WUFA 4ZZ8A 3ZT6A 2WHJA 1KBKA 1W99A 2G41A 1CZ1A 3EJQA 4OMDA 5AC5A 2PI6A 4UQEA 2JF7A 5CZKA 4JZ5A 3L2LA 2DT0A 7CGTA 5A69A 2E0PA 2BXYA 4Y7EA 1CGXA 1OD8A 4OYUA 1W0NA 1H11A 4JFWA 1ZS2A 2FH8A 1E6RA 1SHWB 2XG9A 3C7HA 2EIBA 3VD3A 2Y64A 4PCSA 4E2OA 3N13A 1XPWA 3S5ZA 1EO7A 3MV01 1KWGA 5IHSA 3WFLA 2J7DA 1W2PA 3BCDA 1CXHA 3T0AA 4PMOA 4TTUA 3VX0A 3MV11 2QQJA 5A6LA 2VMDA 2DT2A 3MANA 2WCSA 1ZBKA 2QQIA 4FLRA 3HG2A 1TA3B 3NUKA 1BTCA 1DLCA 4ACZA 1I5PA 3ABZA 1KGYA 1VEMA 3VM5A 3VD7A 3ECQA 1E9LA 4FNPA 1UR9A 1VFOA 3L4YA 3OGRA 1SG3A 2F2HA 5A2BA 3WY2A 2HISA 3BAJA 1SYTA 4JFTA 5FL0A 2GJXA 1W9DM 1UKTA 1EUTA 1ISYA 3TTSA 1TUXA 4HMDA 3A7QA 1FFRA 4D6HA 2E33A 2YFNA 4MAVA 5DF0A 2J78A 3WL1A 3I2IA 4GWJA 3VU2A 1E6NA 3BUQA 3VTRA 1DEDA 5J1XA 4XUYA 3W25A 4H8VA 2VMFA 2OSYA 3GXTA 2W1WA 2Y6HA 4WLCA 2XOMA 4DUWA 1KBBA 1JI2A 1BGGA 3WDRA 3LEGA 2F18A 2ZX9A 4LQRA 4PMQA 1GJWA 3OGVA 4BK5A 1NWUA 1V6YA 1PIGA 2EACA 3CUHA 3QHOA 2ZUSA 2X0YA 1L7QA 5EB8A 2CHOA 2X1IA 5A8PA 3T2PA 3OGSA 4B9ZA 2J1SA 2X05A 3RMEA 4HOZA 4BQ5A 4W87A 1O6IA 3L4TA 1WDPA 2J7EA 4AIOA 4P7OA 3A3HA 1JAEA 4DWSB 3M46A 1VFFA 5JXJA 3FHQA 3I3BA 1TCMA 3CUJA 1ZU8A 3WF3A 1MVYA 1UWSA 2EXOA 3UG4A 5C7GA 1CLVA 1H5VA 2W1QA 1XSJA 1GQJA 3BXWA 1NOUA 4MPKA 1IV8A 3HG5A 4DO5A 4V28A 3T0DA 3VIMA 1XH2A 2BY0A 1JFXA 3WBEA 2WMIB 4W5UA 5B4NA 1FH9A 3ZSTA 3NDYA 2VQTA 1C8YA 1QNPA 5IHRA 2GUYA 2V3GA 3CUGA 3NJVA 2AMGA 4BQ2A 1B3XA 2EPNA 1E6QM 2WPGA 1J10A 4D6FA 3EB7A 1RD6A 2WZ8A 4BZYA 4R5EA 1J0IA 1YHTA 3WH8A 4ZFMA 3HMCA 4F9DA 3EDDA 3LX9A 2OWXA 4FF5A 4LYPA 3S2CA 1GNXA 2VCCA 2G3JA 5JBDA 3QOKA 3WDHA 4A6OA 1E73M 4LYQA 1R86A 1GQPA 3W38A 3IAPA 4E8DA 2GDUA 1E5JA 1LJYA 5A8NA 2J22A 3WNOA 1WPCA 3RM4A 3WKZA 1E40A 2J62A 3RILA 2J1EA 1K9DA 5BWFA 2VM9A 5ABEA 1LF1A 3MSGA 1UKOA 4NZFA 1H6YA 3BCFA 1K45A 4BJ0A 1A47A 2VJXA 3U57A 3RM8A 3CC1A 1PZ3A 2CCRA 4CCEA 4WJXA 1R8LA 4TVUA 3UEQA 4UQDA 2VL4A 3VIKA 3FY1A 1F4AA 1PX8A 2YG0A 3O9NA 1E56A 1UY1A 4FI9A 1CBGA 4TX6A 5C71A 5GPRA 2O9PA 2PB1A 1KXTA 2PC8A 2VZOA 5I78A 2Y8KA 5A2AA 1V6WA 3TTYA 3VGHA 5CYYA 1H0IA 3TA9A 3FHAA 5JXIA 4N42A 1QI5A 2WAAA 2WYSA 3C8XA 1BSIA 3WDIA 1EQPA 1NH6A 1VF8A 3MSDA 1J0HA 3AMKA 1OT5A 5A1AA 5ABGA 3NSXA 5IFPA 2ZX7A 1GHSA 2UWFA 1LL7A 3W5NA 3CLWA 1UY0A 1NWRA 4B16A 1ISWA 2WUHA 1W9WA 1DWAM 1V6VA 1GQIA 1XHGA 3CQOA 4A3ZA 5A8QA 1T2XA 3AS0A 2V5CA 4CD6A 3H54A 2V38A 3ACHA 1OWQA 2LS6A 1ODUA 1R33A 2BY1A 3C7OA 1ODZA 3PZOA 4RE2A 2DDXA 3VNYA 1JZ7A 1CNVA 5LA2A 2CEQA 1XD1A 1HKMA 2Y5EA 3T09A 1UG6A 3LPPA 5LCWL 2X10A 2CBVA 3DYMA 2F8QA 3II1A 3WN6A 4U3AA 5A8MA 5JIPA 2W67A 5CSYA 4DXTA 4Q22A 2RGMA 2L9LA 3EMQA 3BMVA 5FUIA 4BXSV 1PZ2A 3AYRA 1E4LA 5GNYA 2WANA 1HNYA 2WC7A 3L4ZA 3W82A 2ZXAA 3MMWA 1KR0A 3G6LA 4CUCA 1OCQA 1UR2A 4ZY9A 1TQTA 2IGTA 1JHJA 1NARA 4WSJA 4UZSA 3N11A 5A8OA 2PWHA 2F7OA 1HKKA 1OD0A 3F2ZA 2C26A 1JI1A 2OW7A 1UR8A 2G3IA 1XYZA 2A3HA 1JNDA 5JXHA 5EFFA 1KXVA 2E8ZA 2VVNA 5ABFA 1KGUA 2DIEA 1UMHA 3QR3A 3GNPA 3WNKA 2OYKA 2V3DA 1UA3A 2CDOA 4A41A 2EPLX 4D6DA 4GZ9A 4UFLA 3UNPA 2E9LA 3CZEA 1OF3A 3PZIA 4QCFA 2V3FA 1UYYA 4EK7A 4X0NA 2DEPA 1VBUA 3VIHA 3WMBA 2QMJA 1K12A 2W94A 3ZR6A 4HU8A 2ZUWA 2WO1A 4GIAA 1MFUA 1QHPA 4C7DA 5A6AA 3WEMA 1E4IA 2IXVA 4FNUA 1JZ4A 1CPUA 4UOJA 2RJ2A 4GZJA 3SCWA 3M07A 3PZQA 4U31A 1EDQA 5AYIA 4UFMA 2XWDA 3SUVA 5HXMA 3AC0A 3GGLA 2BV9A 3NSNA 2YFOA 1GOFA 4PBGA 3DC0A 3PBGA 5D9NA 4A4AA 1MPXA 1RPKA 1UX7A 5CQ1A 3CGTA 3CZGA 3T08A 2HLEA 1UKPA 6TAAA 3VIPA 4W50A 4HG6B 3MUY1 1R46A 1CZSA 1V0NA 2WZHA 2VZSA 5HNNA 1D7PM 2VC9A 1UOKA 4ZXEA 1G1YA 2WLYA 2DT3A 3THDA 1MXGA 4AG4A 2BGPA 1GOMA 4M4PA 1OGBA 2JF6A 1GOQA 2UY3A 1VJZA 1PAMA 3BGAA 3BVUA 5DQ0A 2FH6A 1JF6A 4AYSA 2CBUA 1LNSA 3IJ8A 4BK4A 1V6XA 1MW2A 3VGEA 1E4NA 3BUIA 3ZJ8A 3VGGA 4AZIA 1DWHM 2J1VA 1SR0A 4UFKA 3VVGA 4LHSA 1UMIA 3C7FA 3CIVA 2X2IA 2VRJA 3TONA 2FHBA 1TQWA 2PWDA 4D6GA 2YL9A 3U7BA 1VB9A 1W1TA 3GBDA 1EH9A 2UY2A 1VEPA 2E26A 4UQAA 2W62A 3AIWA 4DEVA 3I2KA 1UKSA 2WB5A 1CEOA 1W1PA 4GXPA 2XFYA 3BLPX 2VOTA 1KR1A 4LPCA 1NX9A 1GVYA 4MJ2A 6A3HA 1BYBA 2YIHA 3EBVA 3HZ3A 2FE0A 1OBAA 4PTXA 1OGSA 5A6JA 3ZT7A 2WO2A 1HWWA 1EDTA 3OLIA 1JYXA 4P8WA 1JFHA 2WBKA 1J84A 2ZEWA 3I2FA 4DUXA 2GJXB 1J0KA 2YKKA 1CTNA 1CXEA 4M29A 1VBRA 4ARXA 4L4PA 4P7RA 4XZUG 2PWGA 1Z32X 2GK1B 3VIIA 1E72M 2Y6KA 1UYXA 5DN2A 1JYVA 2GDVA 5BXTA 1QVBA 4GKLA 2F7QA 1Y7VA 4MTVA 1TQUA 2DSZA 2WHLA 2JFEX 4AZ6A 1ZJAA 4QPWA 3SKVA 4AIEA 3KE0A 4JKLA 3N18A 1MFVA 4ZXOA 4RN5A 2WWCA 4KGLA 3A6OA 5LYRA 1NOWA 3AZRA 3WH5A 2VZRA 3AZSA 3AMDA 1JXJA 4BQ4A 2HYXA 2VI0A 3AIUA 4P7LA 2BVYA 4AC1X 1V3JA 2GJPA 3L4UA 4J3SA 5B4XA 1FA2A 2WAGA 3D50A 2DPEA 3MUAA 5FCZA 5EBAA 2ZWZA 4FMVA 4XUOA 3DX2A 3RCNA 3PZ9A 4DXRA 2ZWYA 1CECA 1ITCA 1HX0A 3K8LA 4OBRA 2Y4SA 4DWSA 4DWSD 3SUTA 1Q6GA 2DQXA 2AAAA 3E1F1 4X9YA 1CIUA 4AZHA 1H2JA 1NAEA 3HU7A 4CU6A 4CVUA 2ZX5A 1B1YA 3PZTA 5CLWA 1BGAA 2VT0A 4JX0A 2B31A 2XPKA 3KLKA 1CZTA 4QB2A 3WH7A 1CZVA 5CG0A 2Z4FA 3BUDA 2C0HA 3LRKA 1DP0A 2ZXDA 5I23A 1GJUA 2BFGA 5CGTA 2EAEA 3NYDA 4RL3A 4DEQA 5HDRA 4A42A 4KH2A 2CETA 1MQPA 1DTUA 1JI6A 4GZEA 1K9EA 1QX1A 5E6ZA 2VZQA 3PTKA 4NF7A 2ZXBA 3W29A 4ATWA 1CENA 2VZUA 1AQ0A 4W85A 1MQQA 3VIOA 4GPNA 1G0CA 3F5JA 5D9OA 3VINA 4EE9A 1W9PA 2DH2A 1FH7A 1SMDA 3UR7A 3UESA 4BDVB 3WEZA 3ZQ9A 3ZJKA 3WD0A 3BN6A 4WSKA 2YOCA 1PMHX 4D72A 2OKXA 3P6BA 1VENA 2GVYA 2XJ7A 2DIJA 1GZJA 1W91A 4CD7A 1HTYA 3WNNA 1M04A 1CDGA 4P02B 1AQMA 3FN9A 2RVAA 3HNBM 4HPHA 2QF8A 5BYWA 2W63A 3IANA 4ZE5A 4XB3A 2FGZA 3LEKA 4HOWA 4M4RA 3ARZA 2QV4A 1AQHA 2YBUA 2ZEZA 4CD8A 3T0BA 4F9JA 4XUPA 4HU0A 1VRXA 3OZPA 3K77A 3I2HA 2XYLA 2VX7A 4J27A 4AZCA 4UI9L 4NZCA 3K4AA 1XH1A 3VD4A 2W5FA 3OLEA 3CKHA 1H49A 1QW8A 1R87A 3SKJE 2J77A 1XNAA 4P8XA 4NXSA 2J7BA 5E6YA 3J7HA 3WQ5A 2NT1A 3VMPA 2VX5A 3M7SA 1U30A 3OG2A 2XHYA 2YLLA 3GNRA 1OSEA 4Q7NA 1BG9A 1NP2A 4QDQA 2EABA 1B3VA 1V3KA 1YQ2A 4OZOA 4U5KA 4CN1A 1VFUA 1QBAA 2J1RA 1B31A 1ISVA 1UHVA 3GZAA 3TTOA 1WE5A 1UH4A 4MJ4A 3SCVA 1M53A 4S3KA 2DSKA 2X8RA 2BVTA 4ZENA 3SCTA 1B3ZA 3BLBA 3N15A 4NXKA 2OW6A 1QHZA 4FK9A 1FFQA 3BVVA 3SUSA 3ZOAA 3GNOA 1R34A 1QHOA 3MU7A 5DEZA 3SIMA 1XD0A 3SEPA 3AIBA 4FNRA 3A23A 1W8NA 1QWNA 1TVPA 2KD7A 2EEXA 4TXWA 1E0WA 3NDZA 2YB7A 2D22A 3K1DA 2UY4A 2QPSA 4GWIA 5CLTA 5IJRA 1BAGA 1WNOA 1GQLA 2RV9A 4B3KA 4XUTA 4D1JA 2Y6LA 2WSPA 4YPJA 1QPKA 1B3WA 4W8LA 2YJQA 4DM1A 3FW6A 1LL4A 4PMYA 1OB0A 4CU9A 3SCSA 1KCLA 2XM1A 3PZMA 1UKQA 2QHAA 3OLGA 1LG2A 1O59A 5HOSA 1ZJBA 3D4YA 3IK2A 3DDFA 4B3LA 1C92A 3TOPA 3EDJA 3AXHA 4LKSA 3F4VA 3WMSA 1EQCA 5GNZA 4M56A 1HKIA 1V3MA 2XHNA 3BSGA 3WQWA 1WDQA 1XH0A 4MDOA 2QBXA 1H41A 3ZJ6A 4UFJA 4MGSA 1UWIA 4UNIA 3ALGA 2WO3A 1JZ2A 3JXSA 4P08A 3W37A 2J1AA 3GXUA 3OEAA 3BC9A 3GH7A 3LMYA 1B3YA 1QOXA 1KXHA 4D8MA 4LX4A 2WAOA 3WNLA 1IQDC 4XURA 1FH8A 3CUIA 2FYVA 1US3A 5DMYA 2CIPA 2CBJA 1UXZA 2XSAA 1NM9A 1QNOA 5CPQA 2EQDA 3UG3A 2WHKA 2PBOA 1EA9C 2O9OA 4AZGA 2V3EA 1UZ4A 3AHZA 2DSWA 1EDGA 1BYCA 3B9AA 2X0HA 3AIVA 1WZMA 1O8SA 2X2JA 2ZOXA 4E8CA 4A3HA 2O9TA 5BRPA 1E55A 1JZ6A 2WKLA 1LL6A 5D9PA 2B9VA 4GO9A 2V5DA 1GCYA 2E8YA 5A2CA 3DYPA 3VIJA 3U7VA 1ECEA 3DX3A 1V03A 2J25A 4H41A 4PTWA 3NRUA 3D4ZA 5C70A 5E0CA 4LYRA 3VMOA 5CSUA 1UD5A 4R27A 5BXRA 5BXSA 5I24A 2AOSA 1QW9A 2EJ1A 5TD4A 1HJSA 3CZLA 3N12A 3LEIA 4J28A 1HVQA 3W26A 1K3IA 4DO4A 2XSBA 1JD7A 1E0VA 3D5HA 2WN2A 2QLYA 4OBSA 3APGA 3DX0A 2YL6A 3ZR5A 2XQXA 4JKMA 4MGQA 1V3IA 2J8GA 3A4AA 1TFVA 1UWUA 2VURA 4EKJA 2Q8XA 2DCJA 4BF7A 3CH9A 4OOZA 2D0HA 5M5DA 2WVUA 4WF7A 2BS9A 1TQVA 1GOIA 1T0OA 3ARSA 1V0MA 4W84A 1L0PA 2J7GA 5EJZB 2D0FA 5BROA 4JIEA 2YL8A 1JD9A 1LLOA 4PRWA 1W1YA 3EYPA 4UOQA 3A24A 5EJ1B 3ZT5A 4OJYA 2BZDA 5DT7A 1CWYA 4S3JA 1KEXA 1AMYA 3AIRA 3AOFA 4AXNA 2DT1A 5E70A 2DGAA 2G8ZA 1NWSA 5A95A 4AYGA 1TA3A 3BUBA 2BHYA 2WBGA 2WM0A 4B9YA 2OWWA 1C90A 2W4XA 3EJSA 3MI6A 1K9TA 4M82A 5DPNA 4CUBA 2E40A 3PN8A 5M3WA 1MQRA 2EBNA 4AZ7A 5G05L 1O8PA 2XVGA 1E6XM 1EOKA 2VZ3A 4GI9A 4AD3A 3I3DA 5D4YA 4PMRA 2XM2A 3SCNA 4AISA 2F1AA 4ZEPA 4AY1A 1U33A 1PMJX 5KZ6A 3WNPA 2J74A 3G6MA 5ECUA 1OT1A 5I3DA 4PT6A 2FHFA 1UWRA 3F5LA 5A6BA 4U5IA 2YA2A 4HOXA 3DYOA 1EO5A 4HA1A 2YA0A 3U37A 1XV8A 4F66A 3SCUA 4B15A 3BAIA 4W86A 3P1IA 3AS1A 4W89A 4Z2JA 1JF5A 4UTFA 3BSHA 1HKJA 3ARVA 2W1UA 1K9FA 1W9SA 1MW1A 4P8VA 3QOMA 4CGTA 2QQNA 1UD8A 3WL0A 3KLLA 2VCAA 3VO0A 2WVTA 3WD1A 4AD2A 5HPOA 1R75A 4NX0A 3LPGA 3WSUA 2ZE0A 4AWEA 4J3WA 3PZUA 3ZSSA 2A3AA 2Y6GA 1PX3A 2ALWA 1BHGA 3AFBA 4QP0A 3ALFA 1NWTA 3VGBA 4KI5M 3PTMA 3MS8A 2XVKA 1J0ZA 2VO5A 2XFRA 5FD0A 3NIYA 3UR8A 3RM9A 3BVTA 1W2VA 4BS0A 3CMJA 2YA1A 1HXJA 2J7CA 2J8FA 2WMIA 2GJRA 1ULOA 1PS3A 3H55A 5E1QA 4P00B 1TR1A 5I77A 5LA0A 4W7WA 2OSXA 2Y8VA 1M03A 4D6JA 1UWWA 1HIZA 3WIJA 1L7RA 1M01A 5D8WA 4YN5A 2EPKX 1UD3A 1L8NA 2YBTA 1R85A 3ARRA 2W95A 5A6MA 2W61A 4D1IA 4JCMA 2BHZA 2XN2A 1OD3A 1C91A 1NP0A 5F7UA 3I97A 1GHRA 1GMMA 3WF2A 5BXPA 2D3NA 4UQBA 1V3LA 4JFUA 1G94A 4H8UA 3HG4A 4NZJA 4QDMA 1AVAA 3K8MA 2VX4A 1GQKA 3EDKA 1JU4A 4QX3A 3FAXA 3N17A 3BAXA 4W8BA 2NT0A 4CVWA 3ZMRA 1GORA 4H8HA 1TG7A 4J3UA 3FAWA 4K68A 3L4VA 1W3KA 1W32A 3GBEA 2D24A 3CPUA 2Y6JA 2EPMX 2XVLA 3WD3A 3K8KA 7TAAA 1UR4A 3OA5A 2FHCA 5CPSA 5FL1A 3VGDA 8CGTA 1BQCA 4RE4A 1JL8A 3NSMA 4W93A 4XUNA 1B0IA 1W1VA 2J4GA 3EJRA 3K75B 4XZBA 2WNWA 3RDKA 1JDDA 3POHA 1OINA 5ABHA 3GYCA 1R64A 5LA1A 2EO7A 3WD4A 2XTKA 2RGLA 1CGWA 4CCCA 2WZEA 3JUGA 4W8JA 1PBGA 1SMAA 3RIKA 3LE0A 2JALA 1B2YA 3AHXA 4U2YA 3QHMA 3WSOA 2GSJA 1WCGA 5EIYB 4AEEA 4W88A 1Q6DA 1TE1A 2ZUVA 3CTTA 5IYYA 2Z1KA 1JDAA 4RE3A 3FNDA 1WCQA 1OIMA 3POCA 2G3NA 4QCEA 3GXFA 1V02E 3GXDA 3ARUA 1KQZA 1DWIM 2DDUA 1LG1A 5BCAA 4MO3M 3KL3A 3BAWA 3ARWA 4HPGA 4CCDA 4PUDA 1H0GA 1HJUA 3VOCA 1V0LA 2HVMA 5E0FA 1UYQA 1UWTA 1ZBVA 3K4DA 4J3VA 3W53A 4WKFA 4QB6A 2BGOA 1KB3A 1KGXA 1C8QA 3A5VA 3T2OA 3ETPA 1S46A 3RJXA 2D73A 3WQ8A 2CESA 1EXPA 2XONA 4HZ6A 3WQ4A 1UY3A 1I75A 3SUUA 3VSTA 3MKKA 2JD9A 4P7QA 2ESCA 1V0KA 4D71A 2J1UA 3VDBA 2OLHA 1BYAA 3VDHA 4BQ3A 2A3CA 1W9UA 4U33A 2WMHA 4HZ7A 2WMJA 4AZBA 1WDSA 1KCKA 1SDDB 3K46A 2XIBA 4MB5A 1TVGA 2VR4A 1E6PA 3IGUA 2W47A 1MWOA 3NNGA 6CGTA 3L4XA 2XN0A 4H04A 4FNQA 1XRVA 3B9EA 1WDRA 5JMOA 2GK1A 4JHZA 4D6EA 1FP8A 1B9ZA 1TZ7A 5I2UA 4PCTA 1XCWA 3GXPA 7A3HA 1XYFA 1OF4A 2WLZA 3ACIA 4NRSA 2W3JA 3BUPA 2F7PA 2VUYA 1WZKA 3O6AA 2C7FA 2A3EA 4MNMA 2WCGA 4PUEA 4PMVA 5JR2A 2WMFA 2XWEA 5E9AA 3CUFA 4UAPA 3A4WA 1FP9A 2W91A 1C8XA 2VTFA 3AS3A 3W0KA 1TQSA 2DSVA 3ARYA 3CHFA 2TAAA 5EMYA 3LPOA 3EJTA 5JBFA 4PMUA 5DO8A 2DCKA 2EIEA 2WVSA 3L2MA 4IPNB 3OBAA 1ZB5A 4QDSA 4Z2AA 4HZ8A 5JIWA 3VSVA 4CU7A 1E0XA 1K6AA 3LRMA 3CO4A 1CXIA 3UCQA 3HN3A 4FLOA 4A3YA 3WUGA 3AMCA 2F61A 3IIIA 1QBBA 3M6DA 3W28A 1J11A 1E4MM 3D51A 1Q4NX 2WVVB 4PYSA 1CGUA 5JUVA 1UR1A 5GQBA 3ACFA 3RJYA 8A3HA 3DX1A 2BBAA 1JG9A 2ZUUA 3OZOA 2ZXQA 4M81A 4IUGA 2VMCA 3EMCA 2BVDA 1GVIA 3WQBA 4BA0A 3PHAA 5FOOA 3AIQA 3VUPA 3D52A 2PWEA 1KTBA 4WK9A 1ULPA 4XUQA 3ACGA 2WC4A 4GQRA 4GQQA 1UZ0A 3W5MA 4QX2A 1EOMA 4MB4A 4AZ5A 2WW5A 4QFUA 3TTQA 3VD5A 4HP5A 5I6SA 3THCA 4M24A 1KTCA 4OIFA 4OUEA 4JFVA 4AD0A 4CN6A 4AD4A 2WQ8A 4AD5A 3MUZ1 3W24A 4XX6A 5I79A 3EJPA 2E9BA 3CZ8A 4CUAA 1O7AA 1GW1A 1G01A 3T2QA 1CXKA 1NQ6A 2IUZA 1QNRA 4IM4A 3W4RA 1RH9A 1DHKA 4QX0A 3VKKA 4N0RA 3I3EA 3CDZB 1UZ1A 2EICA 4P8UA 5CXPA 3MO4A 1WAWA 4PMDA 2OSWA 1E6ZA 3ZM8A 1GPFA 3WUEA 4CN4A 2J7HA 3ARXA 3B9DA 1LWHA 2XIIA 1E43A 1DWGM 2BY3A 3VD9A 4AMWA 1J18A 2ZEXA 2XN1A 4AMCA 3CZUA 3WD2A 1US2A 4MNJA 2CITA 3UERA 1Q6CA 1BFNA 3RPMA 1UUQA 1KXQA 4M8UA 4C7GA 1C3FA 3PTQA 2XVNA 1CXLA 3QHNA 3IJ7A 1W9VA 2ZUTA 4TVDA 1ZBWA 1XGZA 3NJXA 4PQQA 1GONA 2W66A 4JAWA 3VPLA 1GOKA 2ZX8A 3SUWA 1HN1A 1UYZA 4GZIA 1H09A 1JIBA 2CYGA 3GH4A 3SCQA 3ZO9A 1IZKA 3EJUA 2YDRA 4DO6A 3AIEA 1OIFA 1PPIA 2W46A 3AI0A 1WB0A 4J3TA 4CD5A 1LQ0A 1GOWA 1ZL1A 2XVPA 3AMLA 4UOZA 1E15A 4MNLA 3VGFA 1UASA 1CIYA 3BLKA 3LRLA 4GI6A 4YHEA 4W7UA 5M03A 1K42A 3HPNA 3LXCA 2CKRA 4GINA 3F5KA 1HVXA 4JCLA 2D3LA 2G3MA 2FDMA 3ARQA 4ATLA 3AHVA 5HBFA 4QAWA 3HJRA 3ARTA 1X6NA 2WCAA 2WABA 1D2KA 3PZGA 1MW0A 4UQCA 4ARYA 3VSUA 3LXAA 1RYYA 3EDEA 1X1NA 4V2XA 3BH4A 1BVNP 4AAXA 4PEEA 1BYDA 1CGTA 1X6LA 3D3AA 3K4ZA 4KWUA 3KL0A 3DHUA 4OKDA 2BNJA 2XUCA 1OT2A 2X2YA 5M17A 4L0PA 3I2GA 3VMNA 3H53A 4PSPA 4FLQA 2CXGA 3HOBA 1W3JA 3GM8A 2C8NA 2CPUA 2JEPA 4A45A 4W7VA 5AY7A 2D0GA 3IJ9A 1E3XA 4UZUA 4P5YA 2GFTA 1V02A 2WC3A 4TOQA 2WDBA 1KFWA 1UQYA 1XNTA 3QGVA 1G9HA 3VNZA 1ZBCA 1HL9A 4Z2KA 2VZPA 2YFZA 2E9MA 3WELA 1EHNA 2CNCA 2C9KA 4KMQA 3CHEA 1A3HA 2CHNA 1G5AA 3GTNA 1J0YA 2J47A 2CDPA 3TV8A 5FKYA 3A47A 4D6CA 2ORXA 2V72A 1WZLA 4CD4A 2X2HA 3PUIA 2J75A 1VEOA 2W87A 3LQCA 1E5NA 1W9TA 4PMNA 1EUUA 3KL5A 2Z1SA 3GXNA 5A94A 1IZJA 1KWKA 2ZUMA 4DXSA 4JL1A 3FL7A 4EAMA 3NCOA 4ET7A 5I5RA 4QLJA 2BY2A 5IFTA 1J9YA 2J7MA 4GI8A 3WDQA 2VRKA 3AYSA 2YC4A 2VZVA 1HJXA 3BAKA 2ID4A 1E71M 2WMKA 1VIWA 2ZIDA 4KRTA 4FNSA 5C8BB 3WEOA 4Z2HA 5A6BD 2QMKA 3BMWA 1CYGA 4ZE4A 1GOOA 1GUIA 2WXDM 4QLKA 3KWXA 5DFAA 4UFHA 4DM2A 3FXYA 4LQ1A 1P6WA 4UCFA 1J12A 1H6XA 2J1TA 2EPOA 3W6LA 1W9BM 4MADA 4WIWA 4F79A 3IB3A 3SCRA 3MUIA 3WUBA 3SCOA 1UXXX 4D0QA 1BG4A 5FIPA 3IDAA 5EFDA 1DWFM 1B90A 4MB1A 1UR0A 4XZWA 2VCBA 4OGZA 1F4HA 1CX1A 1CXFA 1HT6A 5E09A 3AMGA 2YC2A 1IT0A 1Q6FA 1NUKA 3AROA 3WQVA 4YHGA 3A21A 5CPTA 1BVZA 3MMDA 3WF0A 2WHMA 1PIFA 4TVCA 1KGWA 3AXIA 3A22A 1MYRA 2YLAA 2EIDA 1O7DC 1D7FA 1UD2A 5A3HA 3WH9A 1QNQA 1R7OA 3W81A 3HEIA 2WN3A 4E4PA 3DHPA 1D3CA 1HP4A 2DH3A 1OH4A 2YL5A 3L4WA 4PN2A 4RYDA 5ABFB 1DWJM 1H1NA 3GDBA 2JIWA 5BRQA 5AC4A 3WMCA 2E32A 2DSUA 4DUVA 4PF1A 2B4KA 1H4PA 1GUVA 3ZIZA 1W9XA 3VM7A 1NKGA 4NRRA 2O9RA 2VR5A 4AEFA 2ZX6A 1E3ZA 3WH6A 4KGJA 1PEZA 2J7FA 3GH5A 5AYBA 1FHLA 2VX6A 4IPLA 1N82A 1E1EA 1HXKA 4Z2LA 1FHDA 1SZNA 4X0VA 4AMXA 1XSKA 3WF1A 4TUFA 5JBEA 5A6KA 1C7TA 3WY4A 1QNSA 1I1WA 1CGYA 4U3CA 3CBWA 1CGVA 1VJSA 1JDCA 4XVHA 1J0JA 3WDPP 1GOGA 5CJ5A 1MW3A 3HG3A 2W92A 3BVXA 4GO8A 2C4XA 1ISXA 4BCEA 2Y24A 2PBGA 5KEZA 4JL2A 3BAYA 1C7SA 3N1AA 1OGGA 3U5YA 4QDRA 1SFSA 1UD6A 2WWDA 5GNXA 4JKKA 1UD4A 2VZTA 4A44A 3MBWA 2A3BA 1ESWA 1W3HA 3NQHA 1JZ3A 4NI3A 3CMGA 2CERA 1W3LA 1LWJA 3CZNA 4ZXLA 3CV5A 3C7GA 2QPUA 3KEHA 3PUHA 3UG5A 1NOFA 3AZTA 4HMEA 2OYMA 1QI4A 3WBAA 4W4ZA 2YDSA 2XFFA 4AD1A 2BXZA 1TVNA 3NJ3A 3CZKA 3UETA 2WVVA 1V08A 2EADA 4ZZ5A 1CLXA 2FGLA 4PMXA 3VIGA 3CHCA 1U2YA 1J83A 3SEEA 3AICA 4MDPA 4DWSC 4JFSA 4PSRA 2WZIA 2YFUA 4PTVA 3AISA 5G04L 2VQUA 4AW7A 3OLDA 3OB8A 3MMUA
chains in the Genus database with same CATH superfamily
3BODA 3WTUA 3GIVA 1SR9A 5C54A 4LIQH 4DKFL 2JE8A 5L7XH 2GAUA 1XMWA 2BJML 1F5FA 2BOEX 3PMEA 9CGTA 5IESH 5PCYA 3QW9A 2DQCL 2OWCA 1RZKL 2B7QA 1VYRA 1THCA 4J2XA 4MIMA 2ZZUT 3OEBA 1QLFA 2MANA 3WLNA 5F88B 5J3UA 3RWNA 2F1BA 3ONBA 4MBOA 3O07A 4KH9A 3MRFA 1FNFA 4LLUA 3R8QA 4TIMA 2GQ3A 2PD9A 4AWUA 1YECH 1YNLH 2YGLA 4DJED 1BLIA 4O2FA 3WF4A 5HSFA 5IXEA 2Z4GA 1WWWX 2DWEB 4MQSB 3CFKB 5BS0D 1W1IE 3QH3A 3NZHH 1BCXA 4L9LB 5AUMA 2W9MA 4WGVB 2LU4A 1RP8A 1H2LA 3AY2A 1IS3A 2Y1HA 1A6VH 2YZRA 3MGAA 3QZPA 4LSPL 5XINA 3OKLA 3AW5A 4L4TE 4IK7A 1JYNA 3MJMA 4YZFE 4UTUA 1WD3A 4OUUB 1A6PA 3FO9A 3WK0A 4X7DC 4QG8A 2NYZA 4D9LH 5HWNA 3EWDA 1WO2A 2VIRA 5AC91 3NIGB 1V3HA 3IEAA 3WTTA 4XMUA 1QW7A 2CAUA 1MMFA 4UQ9A 1RUSA 3F7KA 5D7JC 4MGYE 3CZFA 4J8QA 3EHBB 4QQPA 4Y4FB 1GH7A 3HUJB 4TV5A 4NRXB 3I50L 2JDAA 4GAZA 4WY0A 4GAAA 1QTPA 4WI0A 1CZ8H 5FF4A 1N6QH 4R8WL 2BNQB 4HH8A 3HG0A 3NKGA 3UJJL 5D8AA 2HKXA 4F8XA 4JNZA 2C4FU 5HYSB 3VVVA 4EXAA 4ZUVB 5JMCA 4DOHE 3RU8L 4AVFA 4FLSA 4OTKA 4HT3A 2K70A 1DGWX 3FFDA 2Q8OA 4WNQB 3BGFB 4YYOA 4OMDA 1TOXA 2PI6A 1OAUL 4N0CD 2DMBA 1QK2A 5EBWA 4O12A 3DBNA 4GP8B 2QGCA 1JK9A 2JG8B 3DX9B 2YD4A 5L9BA 2E0PA 2YXSA 4JFWA 4FXGA 4JO2L 2DI8A 3N9PA 4AYFB 1E6RA 3L66A 5AZ2H 5FWRA 3T0AA 1K5MA 2PR9A 4FQCL 4L6HA 3TWYA 4P99A 3AZXA 3SFWA 2K4AA 1FORH 2V5BA 4Q6JA 3ULVL 4BQWA 5GZNA 4KU7A 1JULA 3JWNH 3MHGA 4NAQA 2E33A 4KQ4L 2CU5A 1BM3L 1U8NB 3GTVA 1OVSA 3WIFB 3EXLA 4KRZA 2X6CA 2X9ZA 5I09A 2R1PA 4ZUUB 3US0A 3HZMA 2ZSWA 2JLPA 4XBNA 4KMTH 3CFQA 4LQRA 1DQQB 3OGVA 1BBJA 1P0DA 5CIRA 3PQYB 1O7SA 4QLRA 3S9IA 2CHOA 3VDDB 5DMIL 2RS13 4KKAD 3R10A 4I30A 5JXJA 1ADWA 5JOZA 1N6UA 3LQZA 2RR3A 1JVOA 1H5VA 1XSJA 3UG8A 4FAGA 4AFMA 2ZACA 1IV8A 3WD5L 1Z3GH 5HGAB 5I2IB 2OAAA 4XFAA 5G2IA 3TA4D 3BQUD 2VLKE 1C8YA 1QNPA 2BLFA 3REVB 1Z8AA 4BQ2A 5TDPA 3N1PC 2ADEA 3VFWA 5KWRA 2WNUC 1BAWA 3MUXA 1I8LA 2QFRA 3QXTA 3FQWB 3VWJB 2WJDA 2A7BA 2WTPA 2M26A 4J2MA 4RKAA 5BNNB 4GKSB 4JM2C 2J22A 3BX7C 3FLRA 3QHZL 2VM9A 1CO1A 2XX0A 4WSHA 4DB7A 2BTMA 3KGUA 4TS6A 4JIIX 4KK6D 5CKAA 1RQBA 3USZA 3UAFA 5E2UL 2JWPA 1ZHAA 6PTDA 3KRBA 4UTAL 1L6ZA 3NJLA 2A73B 4PMJA 3QYNA 1YDYA 2JCCF 5JXIA 1KPRB 2WS91 4FPEA 1OGAD 5ABGA 5IQNA 4BSVA 3S3BB 4S10A 3RI5F 2IH1A 4NKDB 2ZRWA 3WAKA 2ENRA 3RZHA 3HB9A 3FYIB 4A66A 1OAJA 3Q5YA 2UYAA 3B06A 4LOTA 1T0NB 4DW2L 2O5ZH 3BW9B 1GIGH 1IQDB 4Y0GA 5HHOD 3D39E 3PZOA 2F9BT 3K6FA 4QHNB 1MHCA 3Q37A 1HKMA 2VGLM 4DAFA 2ZCWA 1FRBA 4XCEA 1D8CA 1YDNA 5A3MA 3GBNL 1YNTF 3T4AB 1FHGA 1UCBL 5JPNB 4GAYB 4N9BA 5FIXA 3C75A 1ZV9A 4GY1A 3WEXB 2H9AB 4JY5H 2YPDA 4OGAC 4C56A 4QNEA 4BJHA 4GG6E 1MWAH 3IMUA 2PTUA 4PBEA 2GW5A 4YGAB 1JHJA 1U0QA 2E6JA 3M16A 5A33B 3MRRB 1NZIA 1TQ5A 3PU3A 4P9GA 3VXQA 4JFOB 4JAMB 3HPSA 3LLXA 1FF5A 1NMAL 4X2PA 2Y69B 2BSTA 2GUUA 1S0JA 3GSRB 3GLEA 3VH8A 4OCTA 1FNYA 1F07A 3PZIA 4QCFA 4X0NA 1GVQA 3DUGA 4J35A 3GC5A 2YAPA 1HCZA 2QQKL 2JK2A 3OZ9H 1F8IA 1JZ4A 4GBXC 4EMZA 2IXHA 4UFMA 3TSBA 4NRZB 2YPJA 3F7RA 4H0LC 2PDNA 4LVHB 4A1RA 3FZUD 3BQUB 3FDKA 4ATFA 3M4FA 5GZCA 4HDIB 3UD6A 3WW4A 4HUCA 4DVBA 1BQRA 2Z64C 3SKNA 3TH4T 3CM4A 2CRMA 1J5OH 3QEHA 1NDWA 4QHZA 3PWVB 2XNAB 3L2YA 1ZZ7A 1AL21 5JXQA 3RITA 1BYPA 3AALA 2VLRA 3OEXA 1OLMA 2MPAH 5JHDE 2Z34A 2ZHNA 2WA3A 3QCUL 4AYBA 4QQUA 1MQTB 3QRLA 3VL8A 5G55A 4Y2DD 3NRPA 3I2KA 5DBUA 4PJDA 4FOMA 4PJGB 3TESA 2XFYA 4LPCA 5B1KA 4ZFZB 4IQPA 3SN4A 1KG0A 4Z7UB 3QZWA 3QFGA 4MMYA 4DZ8B 1OADA 3U9UA 3QRFM 3E96A 1A5BA 2PELA 5CP7A 5JXAH 1JGVL 1IR2A 4IOSA 1JFHA 3CIXA 4GIRA 4WDIB 4XJ9A 1LOLA 3R8GA 2K8MA 2VAAA 1MUJB 4GW1A 5I16A 2RJGA 4OLWH 4YX2L 5D1QB 2AQ3A 2IQ9L 5GGSY 4XKMA 3SKVA 1WUEA 3QBQA 1MFVA 4JDEB 5AL0A 4RN5A 5CZSA 3DVIA 1OCJA 2DUQA 3AZRA 4AWTA 2PGFA 2VI0A 4MAYD 1KYFA 2GSGB 1XAUA 4W6WB 5AVTB 1OWWA 5CILH 2ZWZA 2IWFA 3EOOA 3K8LA 3T3PE 4WY0F 1PHWA 1EEZB 4WFGE 4HXBH 3DX7A 5F2SA 3W3BA 4AZHA 2FB3A 4IQEA 4ADUA 3CIWA 4E9YA 5KETA 2FQGA 1B0RA 1QF3A 5ESQB 2OPJA 3O15A 2DTMH 2NUXA 2XJRA 1PW3A 4DBWA 1PD0A 2APXA 4ORFA 1JI6A 4XPBL 1QX1A 4X8NA 1CENA 3GGWB 2RGSA 4Q0UA 3WUDA 3RWEB 4YJZL 3N40P 3CC5A 3PR2A 3EYSH 3ETSA 3UESA 2MNUA 2WXPA 2ZGSA 1YEWA 2QKDA 2JJ6A 3BZGA 4PTUB 1FNAA 3HNBM 2Q8BH 2OPCA 4RV8A 4QM8A 4L1HA 3FA5A 3H23A 1VMFA 2X5IC 4JTFA 2Q8BL 1IT7A 2QELA 4TULH 4X60A 1DBJL 4TNEA 1N5YL 1OURA 4A7QA 4I01A 1U12A 1FCGA 3VD4A 3EOSA 2JCCB 2Y7FA 2JD4A 2NY5L 2FO1A 3M70A 4Q7NA 4JFEA 5EPAA 1QFPA 1BVNT 1WDWA 4LLMB 1RUPH 3NM1A 1UMLA 2CL2A 2G75A 5I6MA 4HJGB 5SWUA 3CPRA 1OLRA 3LIZH 2EDKA 5IT2H 2B7YA 4FK9A 3D07A 4APQA 3BVVA 2XJSA 4Q0SA 2BOFX 3B8TA 1BEYH 1OT4A 1G69A 4FNRA 4HJSA 1Q56A 4XCCH 3HOGA 2Z8VC 2QVIA 3HE6A 5IJRA 4NZRL 4ILDA 3IN9A 3NVCA 3UIYA 2NX9A 3BDYL 1Z48A 4YNYB 3B9NA 3ARBB 4C6CA 4OGAD 5IMOA 3AL6A 4M93B 3KLHD 3KVLA 4O50A 1J4EA 6XIMA 3LV3A 4KFMA 4XVTL 2QEZA 1EAOA 3UMTA 5B38A 3L1FA 3WNLA 5CFCB 4Y1AD 3O3BA 4KROC 2VABB 4M6OH 4OT7A 1LM1A 2JQAA 1IBHA 2C1GA 1FTXA 1EA9C 1Q38A 1UZ4A 4HF5H 3AIVA 4PW9A 4F5CE 2QKIB 1FI8C 1YO4A 2WNOA 4E8CA 3OQ8A 4XNYL 4JQXA 1IARB 1ZGLA 4MNGA 3RVTD 1FNLA 1QSEB 3VIJA 1BQLL 5C70A 1FX6A 5REQB 1X7QA 2QW5A 2JLLA 4YS4A 1EKOA 1AGEB 4PR5B 3D5HA 1OCBA 3UYIA 3CQ0A 4MJIE 5FMOL 3OGCB 2V5RA 3HIJA 1F7BA 3UZEA 4O16A 1HO4A 4FMFA 5FQ0B 5I0XA 4MZRA 2VECA 2POTA 3ZKMD 1EPZA 5GGRB 3ABQA 4Y8FA 5DMKA 4PH8A 1LXMA 1B57A 2HE8A 4QNWA 5MEOA 4RDVA 3HN5A 5M94B 4UQ3B 1CD0A 1P53A 4WJ5A 4ELKA 3WFDL 1R6WA 4N4PA 3F12B 1KELL 5CCJA 2Y89A 4M7ZB 1R3YA 5JR1L 1AXSA 4RMWA 1UZWA 5A80A 4AISA 5FP8A 4M62H 4U0RC 4G7RB 1WS7A 5LIYX 5CU1A 3L1OH 4MFEA 3EGDB 15C8L 2ZT9C 5KHHA 2YLHA 3KYOB 4XILA 1O4UA 2VDOH 2EXIA 1P4BH 2WBXA 4DGIL 3N41B 3ZDYF 4GNVA 4CZSA 2PABA 1R3WA 4MMXC 3CHQA 3B03A 4TVPH 2FDKA 3RR4A 3O6CA 5HPOA 3FTWA 4QAMB 1DDHA 2VO5A 3D05A 3LA2A 3MJ9H 4YYCA 2WFF3 5J56B 1HC1A 1HRI2 1ULOA 3H55A 3ALQA 4MX3A 4W7WA 4HUUA 4NM4H 2NYYD 2NY7L 1LLZA 2FNWA 4NUJA 1BGXH 2YPKA 4QM9A 4FQXB 2XN2A 4MNQE 3LEYH 3PUCA 1GMMA 5K7PA 4LKEA 3QP3A 4OTXL 3Q1EA 3CLEL 3K8MA 3X3FH 5D2LE 2DQDL 2N7AA 4A35A 3E5QA 1SJVA 4X7TB 2OR2A 3P62A 2X70A 2XVLA 4N24A 4ZUTA 3NQ7A 5DZEA 2J4WH 1OXCA 2HWF3 3CDZA 4HKBA 3WFBH 2BX5A 3F00A 1DUZB 1F61A 4XIOA 5K39A 3PPCA 3RAOA 1BGXL 2OI9C 1I3GL 2IANB 1L9SA 1DQ4A 3WSOA 1K5NB 2BNRB 4GA9A 4ISQA 3AP4A 3AKQA 1WCQA 4QCEA 3GBMH 3SCMD 3GXFA 2X3BA 3RG1C 3RKDC 4Z3GA 4OCWH 3ELNA 4FALA 4G1EB 1FGVH 4GAGH 2MOVA 5E5CA 2BW4A 2HMCA 1KFEA 1V0LA 1FCBA 4PWFA 5CM1A 4JTUA 3APTA 3DX6B 3CPGA 3L48A 1GBGA 1IQAA 2AQVA 5B39B 4HZ6A 1TVLA 5BY5A 2ZVRA 2QJIA 4LLWB 1JHKH 3IGFA 1BZ7A 1S7QB 2A9DA 3DSFH 1HXS1 3HFML 4L97A 1VBC2 2VERA 4YNGA 5E6IB 3P30H 2R0WL 4MUVA 3ZDZE 3GXPA 3EYFA 3TT3L 2VDLL 1C8XA 4MYEA 1JBCA 4A3UA 2WZPD 1TEIA 3KPTA 4S1QH 5DCBA 1QOPA 4JRLA 3B7MA 4UXAA 2Y7NA 1EYEA 3E2QA 3VSVA 1CT8B 1MQKH 3P3NA 4QEHA 1EMTH 2OUJA 3ZKYA 4BHUA 3MV8D 1PYWB 1OOPA 3RL2B 4JHAH 1V6KA 5JLVA 1XFCA 1DQKA 2BIIA 4XC9A 5H8MA 3S30A 3VZXA 2BVDA 4O0QA 2F17A 3MZHA 2FNBA 3VI4F 1T3FA 1TPDA 5DJCA 2LOEA 3B37A 4OZFB 3M0LA 5F2LA 1TFHA 1XXXA 1UZ0A 4JG0L 3O2VL 4QFUA 2X6MA 3TTQA 3FUMA 2Y7QA 1QDOA 3LHZA 5D7KD 5HUPA 3U2EA 1MJ7H 3OP2A 4AD0A 3O6MH 1H3PL 1RJQA 1TO5A 1KV5A 3EJPA 2X4QA 3H1YA 4WXZA 3M7WA 4JB9H 1UZVA 1GWKA 3DV8A 5IMMA 3M2MA 2JVUA 3AMPA 3COTA 1HAWA 1WEJH 1YXYA 3I3EA 5EQUA 5EJ3A 3QLDA 3O6KH 1K5WA 3TJHC 4RISH 4IBUA 4L4VD 3QDMB 4HUVB 3QFWA 1TV3A 1QWHA 1DGWA 3TFCA 3WD2A 2PLV1 3MNVA 2WO2B 1M5WA 3RPMA 4CGUB 4BEUA 2UX7A 2HWD2 43CAB 3DI3B 1G7VA 4ODWB 1R3HB 2PO6C 3T3PB 2QUMA 1NFIB 3TM6A 3BWUC 5C2CA 2B46X 4RGNC 4M1GL 2FX9L 2HT4C 4G70B 2E63A 3M0MA 4JY4B 1NMCB 4NKOB 1GOWA 1ID5I 1ZVNA 4JQ4A 4WV1B 4X61A 1WEJL 3PVEA 1MFNA 5AVAA 1VCAA 1PZDA 2HQAA 4COYA 4QOKE 5KSBA 1ASJ1 1M7UA 2AV7B 5BOEA 1RITA 2HRHA 3R06A 3EX3A 2R1BA 1VAVA 3BV7A 2IC1A 3TNQA 2LAAA 3O11A 3OXRA 4UMAA 3G6JA 4KWUA 3LZNA 1MRDL 2IPGA 1D6VH 5T1DL 4F83A 1QASA 1FXZA 4XP5H 4IE4A 2ZG1A 4A45A 1CU4H 4L4JA 2WNQA 3JD71 3F03K 3UZQA 3MRLB 3GDMA 4DOUA 5C0BE 3TBYB 3C0LA 3ARFA 5BJTB 3TZFA 4U7KA 1FKWA 4NBZB 3FUQA 4U4MA 1AFVL 5FKYA 4X6DA 3B0YA 1K6QL 3PUIA 1R1CA 1TTAA 3CXHK 4PJFE 1FYTA 3HOJA 2VU9A 4PVNA 3RJ2X 5C8JB 5C3TA 4DLFA 4TPRL 1EVTC 1OBNA 2IMRA 4O5LL 4YE0A 5C5UA 1OK0A 4HKZB 2BIOA 1TPC1 1MRDH 1YEEH 3VRIA 2OL3H 3RWJA 1G7LB 3GNXA 3TBBA 2HBVA 1AACA 4DM2A 1BXVA 3INAA 1OLME 2OFQA 4MADA 3TASA 3OAUL 3VTAA 4ETQA 1M06G 2W80C 3W6YA 4MM1A 3AVSA 3A3XA 4L6DA 4ZX4A 1J8RA 1ODAA 3UV9A 5AVQB 3LM7A 3QJFB 2Z26A 4MYAA 4JRYA 3CVDA 1O7DC 4ZX5A 4G3YC 3HEIA 2AAMA 1I8KB 2DZPA 3HS9A 5FM4A 1LILA 3EOEA 4P3DA 2GWGA 1DWJM 2ENYA 2FWSA 4UANA 3O4LE 1HQWA 4P2VA 3ES6A 4M7ZC 1W9XA 1NKGA 2A9CA 2ZX0A 1DQDL 3S47A 4FQQB 3WH6A 1DANU 4MX7B 1MH5A 4X0VA 3ELFA 1FWJC 5A6KA 4L3EA 2HJIA 3VXPB 3WY4A 1CE1L 1P7BA 4U3CA 1A7BA 3KXQA 2EYSB 3PDQA 2RE9A 4ZS6D 4C6EA 3QEQE 5IUCA 3B9KA 4WI7A 4GH4C 4GVFA 2R29H 3O41A 3DH7A 2IQ9H 3HNSH 1FBIL 2WWDA 1RY7B 1MS0A 4NJ9H 4NRPA 2E75C 1QKZH 3AY4C 1TXKA 4RHV2 1W3HA 3TLQA 2ZUYA 4NP4L 4K1ZA 4YXHL 3BZDA 3PHOB 3AUOA 3CMGA 1QMUA 4KEMA 1BF8A 1EP0A 3R13A 4ZBJA 4I87A 3U0TB 4D8AA 3L5WB 5BVPH 4GG6A 4KIRA 4FPGA 4J8RA 5FP7A 4Z8FH 2B16A 1NY72 3UBFA 1HKVA 3FT2A 5DDHA 4LCWE 3BUYB 2MMXA 1OOAA 4JFYB 3UTQB 5I8EB 4EANA 2XGBA 3OR7A 1OP4A 4NNPH 2GJZA 1BZDA 5F8QC 2ZEYA 4LV9A 4LEQA 4MVBC 4V1YA 3DX4A 4FFFA 4I0PB 4CCZA 3TP4A 5FYTA 2V4VA 2A0LC 5K1NA 2G5UA 4F9PC 2C71A 3VIFA 2PWFA 1ADQL 3IFOB 4A7GA 3UDWA 5CCKH 1IM3A 4I0AA 4B29A 5F7DA 4JIRA 3APYA 1TWSA 2IJ0C 5DT5A 4WFFD 1RIVH 1CJYA 4BZ4A 4H8WC 1UM4H 2VSMB 3BKMH 3GRWA 3J7NA 3IVKA 4XF1A 1F86A 4XDOA 3L45A 3VQ2C 2O72A 4MWAA 1Q0YL 1H15A 3K5XA 5IQLA 3K6SA 3GBFA 5LNEA 4PRHE 4KZEL 3S36L 2OYLA 2ZAIA 5LDSA 5C9AA 2A38A 2RTTA 1N0LB 5BOPA 1OW0A 4J6IA 3KQ4B 1M57B 4BSWA 4A7ZA 2CTVA 4PWHA 4LGXA 2QQLA 5KYXB 3KPRB 3VX1A 2QULA 1PQZA 2CLLA 2WSVA 1RHI2 3IDJB 3II3A 2JEQA 5CIPB 3RVVC 3TVMD 4JG1H 3CFJB 4LPLA 2DW5A 1LD9A 5AVNA 1URLA 3AHYA 4S3CA 2Z31C 4V27A 1T04B 4ITCA 3ISIX 5D1QE 1EAJA 5G1TA 2QDWA 3BZJA 3HNYM 1GNYA 2W65B 4ZRGA 1W6MA 1ZEAH 2X1UA 2RFXA 3NEOA 2A74B 4ZSOB 2VZ1A 4NHCH 2VD9A 5EO0B 1OP5K 5I6OA 3U36A 2MQ3A 2YHGA 2YEZA 4MTMA 4IRZA 3DGBA 4IU3A 3SZ6A 1ETB1 1OFEA 2KDGA 2HZHA 4AFAA 2V30A 3M1CA 1O5KA 4A7SA 1BXUA 1JWUA 3QHTC 4AT6B 4G5ZL 5BZDB 1V7AA 3LCHA 4W9EC 3PCYA 3TNMA 3V0VB 3Q9PA 2YBSA 2FVNA 1U8HA 3MYJB 5J3HC 4Q4Y2 1JPTH 4FFZL 5I03A 4YLQT 1H7PA 3WFLA 1UCXA 1CXHA 5EORL 1RLDA 1NTHA 3S8WA 5TE4L 4DGWC 5D09A 2A5ZA 1TA3B 1QFUL 1AD9B 2ATPB 4B95C 1KGYA 4GNKB 4WX2A 3VD7A 4PWKA 2B5HA 3LAFA 3DF0A 5EP9A 3AKRA 4E41B 4B27A 2GJXA 1CFSA 4MJID 5DJ0A 1WZ1H 1ISYA 3A7QA 2Q1MA 3H21A 1GYAA 3AZZA 4G6JL 2J78A 3R12A 1N1SA 3WL1A 5JPMA 3I2IA 2OG9A 5HYQA 1S7XB 1LL1A 1VRDA 1RALA 4LJHA 4NL1A 4XUYA 4FXJA 4ETYA 4WTQA 2OSYA 5IW3A 3LEGA 3MACL 3PGFL 3QACA 5KXBA 1IEWA 4PMQA 5CINL 1PCKA 3FB7B 2K7PA 3DVGA 3GZOA 2J1SA 3NXFA 3T8XA 4W87A 2OZ4H 4RDZA 3ZYIA 4P7OA 4MSWA 2X5IA 1JAEA 2G50A 2BWCA 3EBHA 3NQDA 3EFOA 3RI5K 4MXWL 4LSUL 4HFWB 3UWWA 4N4YB 5IJDC 2Y3NA 4Q7BA 4DWDA 2MRYA 3GNEA 4NO2B 3V5CA 1TPEA 2E9QA 5ALCL 1VBB1 4PF5A 3B1TA 1RV6X 5E8DL 3VE7A 5ENWA 3KVAA 3L3IB 2AEOA 4R5EA 4P59H 1J0IA 5A6IA 1NIEA 2X0WA 4X6EA 1FDYA 4CVZB 4HYTB 3DVNA 2IWKA 1ORQB 3T05A 1JOJA 3JD73 1E5JA 2OMWB 1L2QA 4JY6A 1ZHKB 1OAKL 3I2CL 3QDAA 3L1OL 3FC0A 1GP5A 1XGRA 1K5JA 4TVUA 4Q0XL 4UQDA 1NU5A 4AX3A 4LLYB 4Y1AE 3I49A 3TOJA 3U10A 1W0VA 4YGVB 3X3GH 1OH3A 3EUUA 2PB1A 5ETUB 4N2YA 4XNXH 3BRFA 5F9TA 3B94A 2KYIA 3DJSA 4Y1TA 2FATH 1TYJA 5JSPA 3DIFA 2GGEA 4EYUA 5ICYB 5I76B 4YVWC 1XL6A 2J8UB 3P9MA 2ZONA 2UVEA 4K9JA 1LK2A 3BN9C 1XHGA 5A8QA 4OLXL 3N06B 4GG6F 3POBA 2DPKA 1XYMA 4XH2A 3E5UA 1I2OA 2C3VA 5FO9A 1ODZA 2ZKHL 1KXQE 5ABAA 2P37A 2R2EB 2F8QA 3WN6A 4M5TA 4REQA 5CB7A 1OAUH 4LBOA 3EMQA 4GUFA 2P53A 1KB5H 2IXKA 3LCLA 5K1VA 3L4ZA 4ZODA 1ELSA 4XFCA 1KR0A 1ZUAX 3PE9A 1OB1B 5LHDA 3TLLA 4X42A 1S1RA 3EX4A 4GQ7A 1W5QA 4F40A 4Y1AA 4EWEA 1JI1A 1M3IA 1UR8A 1FH2A 2DDQH 5ABFA 1ZRFA 3F58H 1EJOH 4HWNA 2GL5A 3AT0A 1UA3A 2V2WB 4EIZC 5IBLC 1JERA 2MH4A 3B4UA 2ZXGA 3PL6B 4XC1L 4CC4C 4JN6A 2V3FA 5DJZB 2EDYA 4YSAA 3V6ZA 2P3KA 1VBUA 1YMMA 2XG5A 4YHMH 2R8SL 4PJ5B 3ZPOA 3LXUX 3QJUB 4F0KA 3WFAA 1ZTMA 2RJMA 2BV9A 3GJFH 2FZ3A 3V4PA 3DC0A 4LCYA 4KI5C 5CF3A 2CKBB 1C9DA 5LG6A 2CLHA 1UURA 1FWWA 3THDA 2HKFH 1GOMA 5FDBA 2Y7MA 4AY0A 4ZFGL 3BOVA 4NAOA 2FQIA 2F19H 5LJYH 2J9YA 5F9DC 2AK1L 4QJ3B 3TBWB 5IK7A 2VDML 3NL5A 1EL3A 4GB33 1FAIH 5CISA 4NERA 3HIZA 3FQRA 2ZJCA 1OP3K 1WCUA 5EU4A 2W62A 1YYML 1TWZA 4NO5B 4N22A 1KR1A 4X2RA 2AANA 3H2QA 2IVFC 5BMFH 4WWOA 2CUAA 1OBAA 4LXLA 2H47C 3X2QB 3V52L 1MCQA 1PGSA 3CWHA 5BNKA 4S39A 3HVNA 5TH2A 4K6BA 3V4PH 4JX5A 2XG4B 2IPKB 3MGTB 5KYYB 3RIAF 1NAL1 3MW4A 1CC3A 4LITA 1N8WA 5DN2A 4B9CA 2V5TA 2L8AA 4TV3A 4IEQA 2X4SA 3X29B 3V5HB 1FMD1 4JHTA 4HLZG 4E2DA 3ZQXA 4N5EC 3RZCC 1NDMB 3PM6A 3AZSA 3AMDA 2GBUA 1FY6A 4P23C 3NH7L 4BQ4A 4AC1X 2ZAAA 1L9OA 3EXUA 4B60A 2QQUA 1V4YA 4ADJA 3HNVL 4YSUA 3RNKA 1LT8A 4ZUWA 3DV6B 3GJBA 1X8MA 1Q6GA 4AC4A 1H3PH 4E42A 4AHQA 3CN2A 2JB5H 3EGSA 5KHJA 2XPKA 1U3HC 3VBSC 1AR71 4WHDA 5LAXB 1S5IH 5I1CH 2DJMA 3TE9A 1U8MB 2AC0A 5I75B 2EVIA 4DEQA 4R9OA 1MQPA 2O5ZL 2F15A 4F1SA 3JB4C 4ISVA 4NWUH 1ZLSH 5JZ7C 2B45X 4W85A 4YW7A 2ZTJA 5H9RA 3VWJD 5JORB 2R24A 2BDQA 5J0BA 3IWVA 2E47A 2PRMA 2NZ9A 3SHRA 4PBPA 3P0WA 2BNOA 4F8QA 1OWRM 2YXFA 1HTYA 1ED3B 3MCOA 1H1IA 3U4EB 3NEEA 5D4IA 4HFSA 3CQPA 3GRWH 3VXGA 1DJQA 2JB5L 4MZIA 3QYCA 2ZEZA 4PPTA 1M7OA 2JEMA 1NGXA 8TIMA 3NABH 5CLXA 3K77A 3EOUA 4PI0A 2L7UA 4G1MA 5I00A 4UT7H 5DANA 3QG6A 3ZDYE 2NXZB 2ZKXA 3SKJE 1S38A 4W9CC 3NBNA 3EFDL 4IIDA 1AJ2A 3WKML 5EBMA 2OP4H 3H9ZA 4RS5A 3RL1A 1TV2A 1RUC2 4D8LA 4OZOA 3MWCA 1SBDA 3FUFA 4CN1A 1P0EA 1M42A 3NJHA 4ZW6A 1SO6A 4PRHB 4FXTA 4NM8L 3T7VA 1B3ZA 4BWLC 2YXWA 3S97C 1YQ6A 5GS0D 3QC3A 1U6AH 3ULUC 4BISA 4PG2C 1JQXA 3XIMA 2O5XL 2YR1A 3KOWA 5DC9B 3BYWA 1JDFA 5DHXB 5IWLA 4MD5A 1QFWI 3MIEA 5CLTA 3S88L 4HSLA 1W6TA 1UUOA 2FDGA 2AXJA 5FY0A 1O5DT 5KXEA 4R9HA 1SHMA 1OB0A 3ZLHA 1FAYA 4BELD 1RZQA 4QMAA 1ZJBA 2H3XC 3RIFF 12E8L 2RQ8A 1E8WA 1G9MH 1R3SA 1V10A 5JUEL 1L0YA 4D94A 1RUE3 3QDGA 3KCPB 4WCYH 4ANXA 5PAZA 4JM2B 5LNDA 1LESA 4YVSB 4Z07A 2R83A 4JHVA 3FUKA 2BP8A 4N8CH 1OGPA 3H7BA 3NOYA 3ULSB 5C0CA 3EJZC 1KV3A 1SLTA 4CP1A 2PODA 1FWAC 2Q0ZX 3MV9E 1NJ9B 1XQ4A 2EYRB 2XSAA 1KPUB 1PF3A 5I1GL 3HHRB 3TA3D 4QU2A 3HE7C 3NIFF 1A5FH 2VMGA 3BSZH 3JUUA 1KJLA 1E0OB 2V5DA 3AYVA 2DZUA 1ICSA 3CWOX 3S6OA 4AOCA 3AM2A 2J25A 3VN4A 3QXWA 3R18A 4A2FA 3C8DA 1QW9A 4DPCX 4Q14A 2ZGRA 2DVBA 5C0AB 3O06A 3CZLA 1V9U1 1MUWA 4G6AC 4JO8A 1K3IA 1TRIA 1R24B 2B77A 3TVMA 5J1SC 1FKXA 4XW3A 2QKSA 4E4DX 4ZR8A 3CH9A 2D0HA 4J3OG 4N86A 5ACA2 3RCYA 4QIRA 3O8XC 2I85A 3E49A 4NQVA 1HQ4A 1CAVA 4KZCA 2ITDB 3DRQA 3P54A 2HVKA 2KMWA 4KEVA 4XCFL 3VJ6A 5KVFH 4PMFA 5C0BB 3CJIB 1H19A 1W6NA 2EE6A 1L8PA 5AKTA 1JP5A 1OGAA 5HI5D 3WLHA 3FB8B 4IDZA 1M1XB 1RUI1 4LMQI 5AYUL 4KIEA 3FZUC 2CLIA 1Z7S2 3H2CA 3VCRA 2B1HH 1SFTA 3WHE1 1BMGA 5JXED 2XM2A 3UCCA 4DBSA 5ALCH 3TT1L 1T5WA 3MRPB 3HE7D 1GQGA 1JJUA 2Z1BA 4C56D 5LATA 2OJEB 5I3DA 1TO4A 4CEWA 3LSDA 3L3OB 1XCQB 2R1LA 4GYKA 3FO2B 1MCSA 2Z2SB 2E3VA 3OO2A 1UB6A 2F6UA 1N6QL 1TQCB 4LOVA 4OW6A 4Z2JA 1JF5A 4ALAC 2W1UA 4C6KA 4NYLA 4QE5A 1WV7T 4XAWL 3ENRA 4RX0A 3HRZC 1UOFA 3TCEA 1Z1WA 3WD1A 2WVTA 4IRZL 3OTTA 4J3WA 2I9EA 4M1CD 3S2AA 2D7TL 3X17A 3FTSA 5EKYA 4KBBA 3R0KA 2Y22A 2HLFC 4ES4A 4FJYA 4PRHD 3UJIH 2WMIA 4X7FC 4Q4W1 2WJEA 4EI0A 2DD8H 2JXMB 2R7EA 3ISYA 1YJLA 4XBJA 2P10A 1R85A 5A40E 3TNBA 3DUIA 2XUWA 1ZANL 1OPOA 4MHRA 3QA3A 4HV8A 1CFNA 3CU2A 2JKBA 1V3LA 1G94A 5F7NC 3VFUB 1LOAA 1NQKA 2NP0A 3O12A 1GS8A 1RQ5A 3UKTA 1V77A 3UJFA 3J9SA 3TBCA 2V4LA 1S5TA 3PWGA 2D24A 1FVEA 2BVPB 3VFSB 1A34A 2EXSA 5GZND 4AK3A 2AZUA 4RE4A 1JL8A 2VENA 5H4YA 3ZN4A 2GJ6B 3B8UA 3NZGA 1KRBC 2RDNA 4GSRA 5E9XA 2KZHA 1Q9OB 3LMZA 3WUWB 3INUL 5G4HC 4WVRA 1JEZA 1PBGA 3S3JA 2EF6A 2JALA 4QRUA 5JQIB 1OFOA 5F7EL 4OD2B 3AQDA 1POV1 3FNDA 4ODHL 1KFXL 1MFEH 2HPIA 3SKJL 5BCAA 3BI3A 5JDSB 4ODSL 2OXGB 3CDGB 3QG7L 3CJXA 1XTMA 1H0GA 4GC4A 5JDBA 3NW4A 4FQIL 3UTTB 3KDNA 2PQQA 2WM1A 1VBJA 1V6IA 2FR4A 5GGTH 1LBLA 2XZQL 4OJFL 1RFDL 4P7QA 1SVDA 2BSCA 3W9DB 1JPHA 3FMGL 1NCQC 4AY8A 5EXOA 1ZREA 1C8VA 4EDXB 3RB7A 4U33A 4PJAB 4IQLA 2I2SA 4NHCL 3WTYA 1SYSA 1O9ZA 1ES0B 1VCBC 3LCIA 2PLJA 1BM3H 3MREA 4OHYA 2WSYA 2NUPB 1LRQA 2QJGA 1FP8A 1KCSL 4MXVA 1UG9A 1RJLB 3HE6D 3WLTA 4XN9A 4QNPF 2W3JA 3N35A 2PHUA 4HBKA 4XOAA 1FI2A 4GXMA 2XSXA 2X4UA 4D8PA 4D0DB 2WNGA 4X98B 2ESVE 1AG0A 4BH8A 1CGPA 1MQKL 3HHMA 1QGLA 1MFDL 4QJ4B 2P3EA 4KS0A 2YK1H 4E38A 5JMRA 4M7JL 4IPNB 3FYEB 2NY6D 1H3UA 4A2LA 2D93A 5TTRA 3VRJA 4JQTA 4XI5C 1IFGA 3EO6A 1D5BB 1DJHA 1UU4A 1GZHA 3W28A 4GLRH 3EX1A 4U3XA 5FYSA 3LMJL 5EUOA 5FECB 1OQ1A 4FYSA 1LQAA 5J48A 4MHHI 1VIWB 1FT9A 1YPXA 3F95A 4IUGA 1Q3EA 3V36A 3PHAA 2PUQT 2PWEA 5J6GA 1A6WL 4YM0A 4QHKJ 4X22A 5AKRA 3NFPA 5F3CA 3GDKA 3WDUA 5HJLA 5D5MB 1YEHH 2ZKLA 2Y88A 4NQEA 1C5DB 5I66A 1E8YA 3CNKA 3UTSE 1O7AA 4WM7A 1A7OH 3S2LA 2DUPA 1KM5A 2BFVH 1OVPA 5CJQL 1YUDA 4CDQB 2IH3A 1QNRA 1X7FA 3LKSB 3PGCB 4UW5A 3VKKA 4DYKA 1I3HA 1IB5A 2OQ6A 3M86A 3VXMB 3UMNA 1SO3A 1AC6A 1QRNA 3SKOA 5K8SA 4JTCA 4FERA 1BRLB 1GVEA 2XQRA 1Z6KA 2NN8A 1US2A 3DI2B 3VBOA 1INEL 4R97C 4N8VB 4ZS7L 2X16A 2YRBA 3EO1A 3IDEA 5AAPA 3X3FL 3KMHA 2HMIC 1V7YA 4A7GF 1OZMA 1E9OA 2FQDA 4PW3A 4YDMA 4AKQA 1QWKA 3IWPA 2HP4A 2EXHA 3T0EC 3QORA 5C2BL 1EAH1 2AXHA 2REQA 2Z3FA 3GJFB 5FSDC 5T9BG 3D9AL 1X6NA 2I60H 2PO6B 4C4BA 3MRIA 1X1NA 1MJUH 2CLZB 4HISA 2V8ZA 2YPVA 1YNQA 4HWZA 5BNPC 4JGYC 3HLAB 2BNJA 3UOAB 2P17A 2DZSA 3P4LA 1J05B 3DO3A 4GAGL 4WEUD 4HSJA 2KS0A 2SODB 3S4SG 3CCHA 4ACPA 4W7VA 1K3UA 5GRWA 1OQDA 3MBXH 3M7AA 3C6SA 4Q6YA 4N0UB 5XIMA 1XGDA 1QLRA 1VEOA 1N8ZA 3TYGL 3CMFA 4XC3L 2BWAA 4XXAA 5E23A 1WIOA 4L8DA 5EOCL 5BV6A 1RUD3 1YJDL 4LVOC 2J6VA 2J7MA 2A2QT 4F0HA 4XKYA 1ZRRA 2VRKA 1A5CA 2VZVA 4Y4HD 3LB6C 2UWEA 5A6BD 2DBNA 4B5NA 5F5AA 1FFOA 3CFKA 5DFAA 4PYGA 4GSUA 4UFHA 3T1WA 4L9LA 1ZK9A 4X6CA 5I5IA 1U58B 1XAKA 5IG7B 1F5ZA 1AL23 2LTQB 4HPOL 5IB4B 3WUBA 3KGRA 4YEFA 4EOWH 4G83A 4S0TD 2YMTA 4AH2B 3OMAB 1F4HA 2JNZA 2HFEB 4ZFGH 4A7KA 3I9PA 5EEZA 1IIGA 5BQ7B 2FBRA 2R29L 3ARBD 2B0SH 4ZPVB 3FO9B 4U1JB 3SDAC 2INFA 4YG0A 1YXWA 2KL6A 3GSVB 2G95A 4YS1A 3LLDA 2BOIA 2G97A 3VXOA 2YZ4A 1IGTB 5CZXC 2EKSB 3GW3A 4PFEA 5I26A 4ANKA 1GPWA 4PN2A 1Q72H 4X4XA 3IFLH 5EEYA 1A7QH 3HUJA 3LIZL 5T1MB 3D06A 4QPGA 5FPBA 1NG0A 1CAUB 3CWGA 1VA9A 9PCYA 2Q9OA 3CX2A 5C8CA 3HNSL 2XCMC 3ZN5A 5LCVA 1Q8MA 4FADA 2J8UE 3MDJA 5HYSA 4HWBL 3S5LG 1UQSB 3HG3A 1HWGB 1WBZB 3OVUB 3NIGF 2HG5A 4DBUA 4ZSTA 5FOJB 2PGRA 2ZOKB 2WQDA 5D5MF 3LEPA 1E0UA 5K9OB 4AZ8A 1D5XB 4CCMA 4S2SA 4RESB 4NI3A 2ZX3A 3UWQA 3H9YA 3DSNB 4PGCB 4PJ7A 1UYPA 1W3LA 1LWJA 2NNXA 3RWIA 3RJDA 4I77H 4X8PA 3EF7A 4PJFA 4OU3A 5F5CA 2PLV3 2QPUA 2ADFL 3PUHA 4DP9X 4Q4IA 2NY2D 4UBHA 4NZ4A 1F3RB 5DFTA 3MJ9A 5JHLL 3KHCA 4HK5A 3DX9A 4IXHA 4UBGA 4GOAA 4OV6F 1U2YA 1CS6A 5KZCB 1BQUA 3DHMA 1M6JA 4XCFH 2EJ1A 3CHVA 2VW2A 3D39B 3B8VA 3NAAH 1M41A 2BTVC 1R3JB 3AXLA 2HRPH 2Z7KA 2L0DA 3LZPA 1A5MC 3LNPA 3HG1A 1EGZA 5KBMA 1AR62 1QI2A 3ARPA 1C8M3 1FWHC 2FECL 5DC0A 3DBPA 1LT7A 1JMXA 4EIGB 1XINA 1NIBA 3H7JA 5ESAB 2NR6D 4W70A 5D8ZA 1GYVA 4PJXA 3PFUA 4KEZA 3AG2B 4ENED 1MZZA 4O02L 3ZXAC 2R0HA 4E3VA 4HN1A 5AZ1A 5ENLA 2D23A 3ECVA 1ZMYA 3ZYHA 3AYCA 3R25A 1Z9NA 4GQ9L 4AQTA 2MHAB 5INCB 3U0HA 1VLIA 3GBGA 5G4EA 3HZMB 5FZAA 4Q4X2 1T4WA 2YW4A 1A25A 3G0SA 1R0AL 2BXVA 5ESVB 5DAQA 5DVOA 1MXDA 4OM1H 4QRQA 4B4PA 4HSHA 1W15A 4GUPA 1CD3G 4ANVA 1E70M 1HZLA 2BINA 4BMEA 3GMRA 4QGCA 1L6YA 5BO1H 2DLIA 3GZTB 1TIMA 2ATKA 2CBTA 4HBCH 3M1BA 5FXZA 5JZGB 3RWFB 1JNEA 3MUGA 1Z9SA 3AREC 2ALAA 1WIUA 4MGKE 1QK0A 3NO8A 5E5LA 1AYN2 1IZCA 2QUUA 1W1B1 1T4KB 2HT3D 3W85A 4C6NA 1J1XL 3BAEH 3KPSD 3UTZB 2RA1A 3AJ7A 3L0KA 4I90A 1JZFA 4AG0A 4AHXA 2WLMA 3DK2A 2D2CC 5JHDA 2MJWA 4C83B 5GRVK 5DYOA 2ZPKH 2XZAL 2ZGNA 2XH0A 4BRJA 3AXXA 2RR12 4UIMA 3VKFC 4R96B 5A3NA 1C5BL 1CE6A 4ICMA 1R081 3OGJA 3VILA 1HF6A 3ZJ7A 3JBG2 1TMF3 1EIBA 3QLLA 4GYPC 3PBYA 5JIQA 2E7LA 4XVDA 1IKFH 2IH8A 3MBWB 5I0DA 3DA0A 1K72A 2NQ3A 2PF0A 5KVGE 3MRBB 1MCPH 3QQ3B 5GIRA 2R1MA 2XGIA 5AHEA 3TVAA 4AH7A 2WNXA 3ARFD 3THML 1NFDB 1QQDB 2MUCA 1E2ZA 1S5HA 3K4WA 3L2LA 2FDFA 2JJVA 5CBLA 4ALAH 5CEZD 3S48A 3RWDB 5DRNA 1H11A 3CBKB 1L9NA 3H2WA 3NGFA 5I8OH 5KZCD 4MJHA 4GIEA 2FH8A 1B2WL 1JGEB 1SHWB 4YLZA 2OMAA 5AG8A 5IVEA 3D0VB 2EIBA 1G9ML 1FGVL 5J12C 3OR6A 2AJXL 5JIIA 3AWNA 3J26N 2XJQA 1IXOA 4RZCA 4UB9A 4DX3A 3EYUL 2FIRT 3AGWA 3UJRA 5KSAB 3J07A 1AZCA 5FYLH 4XMTA 5FZLA 3ID7A 1P7QD 1BOGA 2GOKA 1MY7A 2JMRA 1JS4A 3N42F 4OD3H 5D7EA 2F53D 1W2KT 4S3DA 1CYXA 5HDBE 3W1UA 5C0GB 2YFNA 5L8LB 4GWJA 4HUXB 1R092 1TEGA 4JDVB 4C4KT 1G43A 5TF1L 3MRRA 1BZ9B 2GK0A 3W25A 2W1WA 1JPGA 4HGMA 2EZ0D 4H3DA 5DDJ2 2XX1A 5EYYA 1SN2A 1YE6A 4EXBA 4HOZA 1EFXD 4HPXA 5LBBA 2APFA 5IEKA 3QSKB 1U5IA 1GQJA 1IVLA 1VBD3 2Y0OA 2B59B 1H2NA 3HI1A 3BN9D 4RBPH 1TJ1A 1FQ9C 4NP9A 4FFZA 3BQUA 5DCDA 2GUBA 4U1GB 1C8NA 3TYAA 4QT5A 4CCNA 4U1SB 5LBGA 2A77H 4G8FA 2DYPB 4FAAB 4BZYA 1ZA4A 1XOYA 4YHNB 1A3RH 4M5ZL 4XRCA 2A9BA 1MXSA 5AZEL 5CNAA 4ZFMA 3NWRA 2QTEA 4YNIA 4XAWH 1MCRA 4UR7A 3S2CA 5AW8B 3NNLA 2UWAA 4F48A 2OKTA 2R4RL 1OK4A 3C60B 3ULVE 4GY0A 3UTSB 3PNRB 4LUIA 4GRLD 5B3SB 1YYAA 4OGXH 3N34A 5DJ6B 1WWCA 1B9KA 5E88A 3VKNA 1F4AA 2UWBA 2YG0A 3UYOD 2AQ1A 3GBML 5JA8B 4Y22A 3PUQA 4WGXA 1PNFA 3VHRA 1V6WA 4UDUA 3B00A 3U9UB 3GSNL 4C5ZA 3C8XA 3DOSB 1G1CA 3E8UL 1QQP2 3NP3A 1S9VA 1HL4A 4B4HA 2OT0A 5A3WA 3NSXA 1E1CB 4L1BA 5HR6A 3EPMA 4JLRA 1S7SA 2RMU1 4P9HC 3LKRB 3BIBX 5I16B 4ZAKB 1Q94B 3LCGA 2I24N 4W9HC 4CMHB 2WO7A 4QF1B 4A2SA 4ICNA 1KB5B 4G7QB 5FKBA 1RL1A 3BOFA 2F6BA 3HFMH 4EJ1C 1OAQH 1IE4A 5DQ9B 3SBPA 1MFCH 1ROWA 4ZFOL 1TV8A 2B14A 2GQ9A 2D6NA 1SDAB 5EWSA 1VHNA 4NJHA 3GF6A 3DX7B 4I89A 4ZCWA 1XJAA 3U07A 1Y8BA 3DUSB 5EZOL 4KRPB 2PDMA 5DBTA 2YN3A 4YXLL 4DCQB 3QR1A 3CAVA 4Q8VA 8XIAA 4O1BA 1CPNA 1F6LL 2CNZA 3FXGA 3NT0A 5E4EB 4R26H 1LP6A 3G6JF 3QPXL 1FWFC 3PVBB 3ZTJH 3VBSA 1H0DB 5GGRY 4JY9A 2VPVA 1A6TB 1UMHA 5DC4B 3WNKA 4KKCD 3WFCH 4M03A 4HSNA 2H6UA 1FORL 2GFBB 5C4WC 5C9KA 3FNKA 5DD5L 2IXVA 5JXEC 3NV1A 5EU5A 1TTGA 4YSFA 1O9VA 3GGLA 4JTIA 1GOFA 1Z41A 1HZHL 4Y19D 5T52A 2E5DA 3AYAA 6TAAA 1IBDA 1EEXA 1Y0LA 1OEPA 3QV6A 3OZLA 5L0QB 3FLUA 4N25A 1FYTE 5AVHA 3BGAA 5BV7H 1LNSA 5C0CE 1MW2A 5ERWA 3DETC 5F70A 2APBA 4LHSA 3WQPA 1JUFA 1XZWA 4YL4A 2GHZA 1CG9B 3STZB 3VKBA 5E56A 2UY2A 2P0IA 4HBNA 5I8SA 1PLCA 4J1OA 1AW2A 4FFHA 4P2QE 4APQB 3S0PA 4FMKA 3MJYA 1B35A 4RGMC 3V4PL 4DNLA 3NPWA 1KJVB 5I30H 4N7UA 1OGSA 2YK1L 2YCEA 2AXGB 4MLIA 3P2VA 3T2LA 4G9PA 4F27A 2Z35B 3HRZA 3W9AA 1A6UH 1T1ZA 2QLVB 4XUGA 1F42A 5AOIA 5JOXA 4P7RA 3P9LB 1DQDH 1TQUA 4FABH 4NKMA 1MRFH 4LVGA 5AC93 3WJYA 3UBHA 4QPWA 5FO7B 2WC2A 4DKDC 3QNZB 2R1YB 1NLBL 2P4EA 3KXFB 1CUOA 2IOOA 3BH9B 1NCBH 2W39A 3Q94A 4F57H 3AIUA 4E9KA 1LM8V 1KYUA 1JMUB 2DPEA 3MUAA 4ZKTB 2Y4SA 2AAAA 4G6CA 1I8LC 1PHQA 4CU6A 3GBLA 2VT0A 4GYJA 2A6KB 1A53A 1TMF1 1F4XH 2C0HA 4S2CA 1LGVA 5TNVA 5CGTA 3LS5L 4J4PD 4HIIB 1ND0B 1UZ6F 3HF3A 1AE6H 5IATA 4IRSC 3BKJL 3WS3A 3S3SA 2HTMA 4NN5C 3NPXA 4IV1B 2WXHA 4EE9A 4X8JA 1ZAHA 2LQRA 2OJZH 4WSKA 4H5SA 1T5AA 4D72A 2NY6C 2YUWA 1ZE3H 2DIJA 4Q8LA 1JRBA 4B5WA 1CDGA 1TJRA 4HJ0D 1RUE2 4GX8A 2W63A 2ZTBA 3P93A 1A6CA 3UQNA 2JG8C 1FWTA 2A70A 4YGCA 4F9JA 3KOFA 5AAWA 4BR1A 4UDTB 4XP5L 3TN4A 3PJTA 1JQVA 2Z4TA 2Z7GA 4JM2D 3VFMA 2W5FA 1J2WA 3EPOA 1AI1H 2IOIA 1EDHA 1QW8A 4LEEA 1YJDC 4J9JA 2BVOB 1I85C 3R7RA 1KFJA 3MI3A 4FG6C 4H4NA 5MEOB 2RFGA 1OSEA 5MEND 4DNMA 4PV1C 4IKIA 3F12A 3KYKL 1XIHA 5SWZB 3MRFB 1AXSB 2Q76A 3JV4B 5MERA 4Z1DA 2YD0A 3ZDWA 3HURA 1CICB 1EUAA 1AGDB 1ZKAA 3QK0A 1RVF3 3EBRA 5FEZA 2BVTA 4H6RA 1A66A 5CEZE 2F08A 3KS0J 1K8CA 3M8LA 3HG1D 1QHZA 5DVLA 3V56A 1U5JA 1W6OB 3LEYL 1VYPX 2JB8A 3R94A 4HWEH 3SEPA 3CPLA 1W8NA 2DM7A 1S3HA 3D25A 5HHMB 2QVFB 2PD5A 3OKLB 4D1JA 4O9GA 5EOCH 3KH3A 1AD0B 5L2JA 2ZZ5A 3LH8A 3IDNA 1Q0XH 1W5NA 4L0PB 2ZFAA 3N4FA 1TITA 4ADIA 1G9MC 1XL9A 1JUIA 3VXME 2NDGA 1HYRC 4I1NB 2QQPA 2JDYA 1TPFA 2JENA 3HS8A 3BPLC 2CV6A 4YBLC 1U8CA 1USZA 4OLWL 4YX2H 4YFWA 4XMZA 1BJ8A 2GNMA 1EHLH 2O9OA 4Q4V3 2AEIT 2A2IA 3M0KA 3LZ3A 3TJIA 2WV8A 3GR8A 3ASIA 3NZQA 1SOQA 5TE7H 2ZOXA 3I8TA 2NY0C 1AJ0A 2O9TA 1NCAL 4LK4A 3K13A 3CDFA 1DUZA 4HK9A 4IESA 1CLKA 2CLVB 3HZKB 4NAFB 3NRUA 4F9LA 3KLQA 4B0MB 1TZIA 3DJRA 5AOUA 3LEIA 1T2QL 3LB9A 3USSA 3LH2L 1W1ZA 1UXWA 3VXUB 1QJX3 5FZOA 2JG8A 3PANA 4FD0A 5L36A 3R2GA 4EKJA 2DCJA 3N73A 2WVUA 5HYJB 2HWGA 3I84A 3S34H 1I1AB 3UIZA 4OZXA 3UAJD 3V4VH 4Q0VA 4IU2A 4IG2A 3POFA 4LP4A 1B3IA 5FCUH 3DX6A 3IMVA 3APCA 5DT7A 3FFQA 4NWUL 5LBSH 5IHHA 1EZVX 1NWSA