3AZZA

Crystal structure of the laminarinase catalytic domain from thermotoga maritima msb8 in complex with gluconolactone
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
250
structure length
250
Chain Sequence
EDWQLVWSQEFDDGVIDPNIWNFEIGNGHAKGIPGWGNGELEYYTDENAFVENGCLVIEARKEQVSDEYGTYDYTSARMTTEGKFEIKYGKIEIRAKLPKGKGIWPALWMLGNNIGEVGWPTCGEIDIMEMLGHDTRTVYGTAHGPGYSGGASIGVAYHLPEGVPDFSEDFHIFSIEWDEDEVEWYVDGQLYHVLSKDELAELGLEWVFDHPFFLILNVAVGGYWPGYPDETTQFPQRMYIDYIRVYKDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Laminarinase
publication title Crystal structures of the laminarinase catalytic domain from Thermotoga maritima MSB8 in complex with inhibitors: essential residues for beta-1,3 and beta-1,4 glucan selection.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 54
structure length 250
sequence length 250
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.39: Glucan endo-1,3-beta-D-glucosidase.
pdb deposition date 2011-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3azzA00
1DGLA 3D4KA 4XDQA 4FOWA 1LHWA 1HDKA 2DYCA 1JHNA 1HQLA 5E8AA 4FPKA 2R0FA 3BIWE 3VKLA 2ZHNA 1KITA 4YZ3A 5JOWA 4XBQA 1GLHA 5H9QA 4Q1RA 4UW5A 2D3RA 4ATFA 1CIWA 5CAZA 1UMZA 4L8QA 5GZFA 1MR5A 2D6NA 3B01A 5GM0A 3Q9OA 4M3CE 1V6JA 1GZWA 4YM0A 3TB0A 1UN1A 1S0DA 2JJ6A 3MW4A 1C57A 1LJ7A 3RRDA 3AX4A 1F31A 2AUYA 1C1FA 1SLAA 1G9FA 3WNXA 2DU0A 1QDOA 3WCRA 3AZWA 1W6QB 1V6OA 1BXHA 2E7TA 3NWKA 3PJQA 2ZHLA 1BYHA 2VH9A 1WD4A 2GNBA 4NOTA 3HMYA 2ZMKA 4XTMA 4Y1ZA 1QOSA 2D7FA 5CBLA 2JE7A 4C1WA 4DS0A 4YM3A 1WW4A 1VALA 4FPOB 4HL0A 4AGVA 2CYFA 2NMNA 3I8TA 2YXSA 3V0AA 3JUUA 4XE9A 4XJZA 4AWDA 2UU8A 2G4IA 3AJZA 2GDFA 3N35A 5DUUA 3V65A 1VAVA 3IN9A 5H9SA 4P9XA 3WHUA 5H9RA 5KXEA 3KQRA 4PCRA 1V6NA 2ZGSA 4XBLA 2D6PA 5HCBA 1S0FA 3WG2A 4YZ1A 4XZPA 3A4UA 3IKWA 5DUWA 1W6PB 3AP7A 4M00A 4ZKTB 1W0OA 1V6KA 2UWCA 2VUAA 5JLVA 2EXKA 2GALA 4YLZA 3OY8B 1IKPA 2ARXA 2ZGMA 3PMEA 1APNA 3N7JA 4Q27A 1W6MA 4FPJA 1W6NB 1QNYA 2EIGA 4YG6A 4BMBA 2YMZA 4YZ5A 3T1MA 1QOTA 3VKMA 5GLUA 1IS6A 4XJUA 4YW1A 4WVWA 2A3WA 1OKQA 2OVUA 5JOZA 1CVNA 3AYEA 4XJ9A 1LECA 4ATEA 2PHRA 4BMEA 5IK5A 3AZVA 3W59A 3L2YA 4YGBA 4YFZA 3WDUA 5T52A 1DQ0A 5KXBA 2P3IA 2ZGUA 2DUPA 3FUOA 2JDZA 2LALA 2ZZJA 3IPVA 4Y20A 5L73A 2P3KA 3DUIA 1Q8OA 3D5OA 5EXOA 2JE9A 1Q8QA 2PHXA 2W68A 2DTWA 2UWAA 4FPEA 4K21A 5GZEA 3ZSKA 4F83A 2OUJA 1CJPA 1CQ9A 3LSDA 4FP2A 3WUCA 2ZAAA 4XTPA 3WZ1A 5GLZA 2DUOA 3C2UA 4YM1A 4FPHA 2DV9A 2ZACA 2ENRA 2OW4A 3RSJA 1GSLA 1NLSA 5FRAA 3WUDA 4LBLA 2ZGRA 3QCWA 3I4IA 3O12A 3W58A 1EPWA 4TYSA 4AVTA 4M3CA 3WLUA 5T5PA 1DYPA 1MZ5A 2ZKNA 2A7AA 5DUVA 1FV3A 4FOQA 1GICA 4CRQA 1SBDA 2NP0A 4AYUA 1Q8VA 2LTNA 2ZHMA 2ZGPA 3B69A 2R0HA 2WT1A 3ENRA 3M3CA 3QLQA 3ZVXA 4LBQD 3HN1A 2Z42A 1UX6A 4XHBA 1YRZA 2PHFA 2GN7A 3ASIA 4XJWA 1GANA 2R1BA 1C4RA 2OUHA 1DZQA 3M1HA 4Y20B 1N3PA 1DIWA 2UURA 3TAYA 5KXDA 1AVBA 2D6OX 3O0XA 1SLLA 1YO8A 1W6OB 4ISRA 1NXD1 2W39A 1SBEA 1XQNA 4LBNA 3ZSLA 2P2KA 2ES3A 3A0NA 4BM8A 1GNZA 2P34A 1CN1A 3POSA 4YZ2A 1LGNA 2XG3A 2V5YA 4YM2A 1S0BA 2NM1A 4FQ4A 1JN2P 1AX1A 1KDKA 2ZMLA 2EF6A 4M3CB 4Y22A 2PHWA 2I2SA 3A0KA 4Y1YA 2GN3A 2VXRA 3AJYA 1IKQA 2P3JA 4P9YA 1LHOA 4WVVA 2EXIA 3BTAA 5GJ6A 4RA0A 2PELA 4I30A 1LHVA 1WCSA 4LBQA 1FX5A 4XXPA 4WV8A 2AR6A 1UZZA 1LOCA 2ZBJA 5CA6A 1Q8PA 3ZXEA 2D3SA 3AXDA 2JD4A 2A6XA 5IK4A 1MS5A 5DZEA 3WCSA 3NV4A 1VAMA 3FUQA 5F9TA 2CNAA 4KBBA 1G9AA 5HCFA 5T5LA 3V64A 3AK0A 3MW3A 4YW2A 4GWMA 3UL2A 1DLLA 5H9PA 1F9KA 3SH4A 2BQPA 2UWBA 1X50A 1IOAA 2R1DA 2ZABA 4GALA 4R9CA 2Q5TA 1QGLA 3SLIA 5DG2A 1AXZA 3IM0A 1N1VA 2ARBA 1JW6A 1MZ6A 1Z78A 2EALA 2ZMNA 1URXA 3M3OA 2E51A 3ZYPA 4DPNA 3N7LA 2WQZC 1JYIA 1MS1A 1N1SA 4Y1XA 1LGBA 3GNEA 2E6VA 3UJOA 3B00A 1N1YA 3NV3A 3ILFA 4ZXKA 2EXHA 1N47A 2JECA 2C5DA 2AGSA 3OPZA 3N3HA 5DZGA 1FATA 4XMIA 1ULEA 4PF5A 1ULGA 3KM5A 3WDTA 2XB6C 1G9CA 2E53A 1GZWB 1ULFA 3AZZA 4UW3A 4LBQB 4FOVA 3WG3A 3MEPA 4YGEA 2R16A 1ULCA 1JBCA 4Q8LA 1A8DA 4YW3A 1B09A 1ENQA 1V6LA 4MYEA 3T2TA 2ZGTA 4JCKA 1H30A 4UW6A 2GNTA 2VU9A 1AJOA 2EAKA 2C9AA 5T54A 4BPZA 5JMCA 1JOJA 1GV9A 5EYYA 3N36A 4JRAA 2B7YA 2VW2A 1CPMA 4YW4A 4GKXA 3T1LA 1AJKA 2TEPA 2VW1A 2WSVA 3U4XA 3V0AB 4K1YA 3VV1A 1YXWA 4XJAA 1LOFC 2ZGLA 1N3OA 3OYWA 1WLCA 2A3YA 1ULDA 1LGCA 4JC1A 1BZWA 4BLIA 5JDBA 2NZ9A 1R1ZA 1AX2A 1WBLA 4XILA 5E88A 5KXCA 3VKFC 1U0AA 5AVAA 3AP4A 1A78A 1GNHA 2SBAA 4OZXA 1DQ1A 2A6WA 1QMJA 3USUA 2DVFA 1DQ2A 1DFQA 2DTYA 1QF3A 2E7QA 2VY0A 1C1LA 4Y26A 1MACA 4Q8KA 4DRRA 1W6MB 1ENSA 4AGRA 1DHKB 5DG1A 4ISQA 4Q26A 1KRIA 1LESA 3LCPA 4FP3A 1WLDA 1SACA 4IQPA 3WDYA 4LBMA 2YY1A 3RMXA 1S0CA 1SFYA 4R9DA 4XHXA 4BLJA 5HCAA 1A3KA 3UK9A 2ZGNA 4FPGA 1D2SA 1OFSA 1AZDA 1SLIA 2AYHA 3B3QE 2ZGQA 1LCLA 3WG4A 3ZXJA 1Q8SA 4AGGA 1LOFA 4W65A 3IPVB 3OYWB 2VW0A 1G7YA 1HQWA 2DU1A 3M2MA 3N7KA 5GLVA 1SLTA 5E89A 4M3CF 5T55A 4Y1VA 4DRVA 4TZDA 3OJBA 1AXYA 2P37A 1AXKA 3AXEA 3NV2A 1RIRA 4XXAA 4GXLA 2GMPA 3OBTA 4GWNA 1LULA 2D6LX 3ATGA 1FYUA 1LHNA 2H0BA 5GZGA 1WW6A 5GZCA 2AENA 3D6EA 1AF9A 1MVEA 1VLNA 2GNMA 3B9CA 4P14A 3WOGA 4FPFA 1IS4A 1UAIA 3AYDA 2A5ZA 4XJ8A 1G86A 1JYCA 3H0OA 1SLBA 2FHRA 4HANA 2GNDA 4PBPA 1YYNA 3OBRA 4GA9A 3M3QA 1G9BA 2WLQA 2W08A 4DQAA 2A75A 2FMDA 2ZGOA 5JOYA 1WLWA 3PVOA 4K1ZA 4XYXA 4WZFA 2CWSA 1DQ6A 1Q56A 5F5QA 3FLPA 1DQ4A 4SLIA 5IK8A 2WKKA 2WJSA 3AP9A 3RQ0A 4C1XA 1DQ5A 2DURA 4FVVA 3POYA 1DYKA 1WUVA 2W52A 1LENA 1FV2A 2EXJA 1QU0A 4YZ4A 4AVSA 4FPCA 1S0IA 2DVDA 2D6MA 4LBOA 4NO4A 2AREA 1W6PA 1CONA 3AYCA 2PHUA 3ZXFA 2A6YA 3ZYRA 3WG1A 2CY6A 1RITA 1TEIA 4YGCA 1KDMA 1N3QA 3RMYA 3BOPA 1FNYA 1KJLA 1I1EA 1V6IA 1QKQA 1UZYA 3AYAA 4Y22B 3SISA 3OY8A 3FLRA 1DBNA 1SBFA 5T5JA 3ZPYA 1F5FA 2JKBA 4XBNA 4PBOA 1W6NA 4XIOA 3N7MA 1H9WA 3RS6A 4YGDA 3AP6A 3HR9A 1CESA 3INAA 3AZYA 5SV8A 2D3PA 2D6KA 3PVNA 5JOXA 1S1AA 4Q2FA 1S0GA 1ONAA 4RL7A 1QNWA 1FNZA 4R9AA 4YW5A 5T5OA 2KM2A 1PZ9A 3OGGA 2CTVA 1VIWB 1G8WA 1MS4A 1PZ7A 1W0PA 3WDWA 1CR7A 3MW2A 1J1TA 3AP5A 1I3HA 1MVQA 2A6VA 3POWA 3O5SA 1G9DA 4PQ9A 1LTEA 3SNMA 1HLCA 3R4SA 1UKGA 2WT0A 3V0BA 4FOYA 3VUOA 1ZM1A 2CL2A 1UL9A 2DWRA 1LODA 2YV8A 5IK7A 4FQZA 2WT2A 4U2AA 4BQ1A 3R05A 2R49A 2WSUA 1BQPA 3ILNA 5CNAA 1YI7A 1HKDA 5DXDA 3IMNA 3ZSJA 4AVVA 2ZGKA 1ZA4A 3JU9A 3GALA 1YIFA 4CTEA 2A70A 2RHPA 1PZ8A 4XMAA 1WD3A 1RINA 2DVAA 3APBA 4YFWA 5GLTA 5LK5A 2D43A 2ZHKA 1Y7BA 3AZXA 4R9BA 1JXNA 1MS0A 1GYKA 2A71A 1LOEA 2GMEA 1LHUA 3MPPG 1SLCA 4DFSA 3FFZA 1GKBA 3WDXA 3NV1A 4YG3A 1S0EA 2NYYA 1IS5A 4UW4A 1QDCA 4XIKA 1GZ9A 1JUIA 1V00A 3ZXLA 3LSEA 4ASMB 4Z8BA 1OQ1A 4M01A 1UPSA 2WNEA 3VKNA 1V6MA 3ZSMA 1MS9A 2AH2A 2NN8A 1O4ZA 1W6OA 3FLTA 1KQRA 1SCSA 4FPYA 1LU2A 2YZ4A 1N1TA 1LU1A 3V0BB 5EWSA 4XOGA 5GZDA 5BYNA 2NMOA 3O0WA 1LOBA 3DGTA 4Q1PA 1ENRA 1LOGA 1S0JA 2A3XA 3SITA 3VKOA 2SLIA 2HYKA 5GALA 1BJQA 2ERFA 3M3EA 5FREA 3WHTA 4U36A 1WBFA 4D69A 1IS3A 2DVBA 1FAYA 1LEMA 2YROA 4YG0A 4Y1UA 1QOOA 2PHTA 1SCRA 1Z0HA 3ZXKA 4CZSA 4FPLA 3WV6A 1WW7A 4GKYA 5IUQA 1D0HA 1WW5A 1LEDA 1O4YA 3R4UA 4LBJA 3UJQA 3WDVA 1MS8A 3AFKA 3ILRA 5JVVA 3O0VA 4P9WA 2GMMA 4BOWA 1GZCA 4K20A 5DZFA 3CNAA 3USUB 2A6ZA 1GBGA 3SH3A 1LOAA 1H9PA 1AX0A 2CWMA 5T50A 1W6QA 5GLWA 3WVJA 5CB7A 5DUXA 5EYXA 2ZA9A 3PVEA 4LBKA 3SH5A 2D44A 4Y24A 5IT6A 4ITCA 4H55A 3FBYA 1KJRA 1BKZA 1CPNA 2DUQA 2V73A 2DVGA 1MS3A 3RG0A 3BODA
chains in the Genus database with same CATH superfamily
5EJZB 1DGLA 3D4KA 4XDQA 5FJHA 2RE9A 5BXXA 4CCMA 1LHWA 5I8TA 1HDKA 3IIAA 5B4XA 4AEMA 1QY4A 4QM9A 4DUWA 4RYDA 2R0FA 2G9GA 4CCCA 5F5IA 4BQ5A 2R7EB 2YGMA 4XZUG 1O7FA 2JG8C 4KQ7A 4XW3A 5H9QA 5LBFA 5AFBA 1JZ2A 5CAZA 1T6BX 4Q4X3 2QQIA 1O3RA 4B1LA 4QKFA 1MR5A 3S5QA 2A73B 3B01A 2B4KA 1NG0A 2LRPA 2HWC1 5CYYA 5FMCA 2IUWA 2D97A 2RS32 4J6GA 3VN4A 5FO9B 4YM0A 3H3UA 2F4PA 1W3XA 4BIFA 1QJY2 4CP9A 3ZDSA 1O3TA 4PIZA 5K0UA 4BHPA 5FZKA 2AUYA 1G9FA 2VCCA 3J8F1 1S2BA 1W2AX 3AZWA 1BVP1 1B35C 2VXJA 3NWKA 1BXHA 3USSA 2ATFA 1WD4A 1OH4A 3RVHA 4DIQA 2YC4A 1QHDA 2FMYA 3HMYA 5KHGA 3P1IA 2ZMKA 3PVBB 4XTMA 3U75A 4JQRA 4KWLA 2JX9A 2R042 4OHZA 4D6RA 3G7DA 2JE7A 5F37A 1VBD3 1WW4A 5A3UA 4FPOB 1X8MA 4XFCA 1JYNA 3I54A 3JD73 4HL0A 4AGVA 1W2OA 2NMNA 4KNCA 3KLSA 2YXSA 4C0BA 2KXLA 3PNAA 4NROA 4XE9A 4RGKA 3AVRA 4AVAA 5TSWA 2G4IA 2JG8A 3AC0A 4OHYA 2DCZA 1RUE3 1ZVFA 3H1WA 1NCRB 1WMEA 4IE4A 1QJEA 4JKKA 4PCRA 3EQEA 1TZOA 1ND3B 4UBGA 2R071 4XBLA 5LB6A 1XU2A 1EV13 5C4WC 5B4NA 2GC0A 5JSRA 1PO22 3TOJA 2W5FA 3A4UA 3HIFA 3LFIA 4QGNA 5LRRA 5FFOC 5DDJ3 3UGGA 2W9XA 3AP7A 4ZKTB 1PK6B 5FP3A 2C24A 1J1LA 2UWCA 4MHUA 3WR0A 2ZGMA 1V9U3 2ARXA 1B35A 1W6MA 5FZ7A 1W6NB 1COV2 1EUTA 2YMZA 3T1MA 3WW4A 5FPVA 4P00B 2BFUL 5EV7A 4CP9B 1VB4A 1WCDJ 4YW1A 1W05A 5FPAA 1OKQA 1OUXA 4QM8A 3RFRA 4A6SA 1JZ7A 2QNKA 4XJ9A 5FKCA 4BMEA 5IK5A 3MLKA 3L2YA 3SKVA 4YGBA 3I59B 3AL5A 1DQ0A 1RUG2 3KF3A 3KMHA 2Y0OA 4WM7A 1NE4A 4W8JA 5FXZA 5A7WB 4CDWB 2JDZA 4XFGA 1YIPA 3JXSA 3POIA 1PMHX 2E26A 2JE9A 2W68A 1UX7A 3HOBA 2DTWA 5GZEA 3T09A 2LW8A 2F6BA 3ZX7A 1QQP3 3PU8A 4F83A 2OUJA 2QJVA 4FP2A 3T0AA 3OD0A 1PM4A 3POGA 1TME3 1UIJA 1NCQC 2RJ2A 3MO4A 5C4WA 4XTPA 3H42B 1VBA3 2VMEA 4KU8A 4N7UA 1GOFA 4NAMA 2DV9A 3D3AA 2HEWF 2OW4A 4DXZA 3EJKA 1IPSA 4LJHA 2WQ4A 2JENA 4PLMA 2ETEA 5FOJB 5FLJA 1EPWA 4TYSA 1H6XA 3VD5A 1OVPA 4QPIB 1ZZCA 4I01A 3WX5A 4OZOA 3SHRA 5IVYA 2VBBA 4CE8A 4NIDA 1SBDA 3IBMA 2B9VA 4MGIE 3B69A 2ZGPA 5A3MA 2R0HA 3ENRA 3LDKA 3M3CA 3QLQA 3ZVXA 3T0BA 4LBQD 4N8MA 3W5NA 4DO0A 3SEEA 2VECA 1YFUA 4AL9A 4QX7A 4GH4B 3I3DA 4PI0A 4CCJA 3MF6A 1GANA 3RPQA 2R1BA 3TNQA 1XNAA 1DZQA 3DL3A 4D6QA 5KC6A 4Y20B 1FMD1 1DIWA 3PURA 4XF1A 5FR3A 1AVBA 3ZIXA 3HVDA 5DAWA 1SLLA 1YO8A 2W39A 1SBEA 4X8PA 2P2KA 5A3TA 1HB2A 3N4MA 1R64A 1ACCA 4LOSA 4LHSA 5F8PA 4DB5A 2P34A 1ND2C 1NCQA 4DOUA 5E16A 3LFMA 4CDQA 1PX3A 1MQTC 4ZS2A 1LGNA 4L92A 2ZEXA 4BB3A 2C4XA 4AEDB 1JZ4A 4OHXA 1NXMA 1AHSA 2WS93 1JN2P 1AX1A 2E32A 5JI7A 2EF6A 3KD4A 3WF4A 4QAWA 4GMP1 1Z7S2 4D8MA 2ZKLA 4FO9A 4ZZ5A 1TNRA 1EYBA 2R061 4N9HA 1IKQA 2P3JA 2ZZQA 4HKWA 1W8ZA 3VBSC 3SXWA 3GZTB 3KCXA 3GM8A 2EXIA 3BTAA 5GJ6A 4D94A 4MX3A 4XCBA 3PUAA 4LBQA 3OGJA 3N9MA 1UZZA 1LOCA 2OQ7A 2ZBJA 2WQ8A 3MV11 1OXCA 1Q8PA 2KA3A 3ACHA 2D3SA 4RQPA 3I2OA 1HXS3 3FUQA 2QCSB 2W2IA 3BYWA 4W50A 2XMLA 5HCFA 4CDXC 1DU3D 3MW3A 4UI9L 4YW2A 1UYYA 5IVEA 2QBXA 1F5JA 3MV01 3VZMA 4CU8A 2PTMA 2R1DA 4D7YA 4MSVA 5ACA3 1UPIA 2Q5TA 3DYOA 1PO13 1ND2A 3PUIA 1UY3A 3MYXA 1VBE1 3AMPA 5J36A 3VGIA 2XKPA 3ZYPA 2HLEA 2KD7A 3N7LA 4DPNA 1JYIA 3UETA 4MOAA 2AZ5A 1MEC2 1N1SA 1IHMA 3MIHA 4QHZA 4FFFA 3ZN5A 1LGBA 2BOIA 1YQ6A 2EIBA 2ZTNA 4A41A 3HPNA 1N47A 1RUD3 4EROA 4AR2A 2JDKA 3N3HA 1VMHA 2FDHA 1ULEA 1X36A 2Z69A 3LWCA 1NX9A 1VP6A 3OB8A 3VBSA 3ECQA 5FPBA 3JBG3 1NZCA 1RUJ3 1J58A 2IVIB 2YUEA 2ZJCA 3KWVA 3OUHA 4OHWA 1HV1A 3WNLA 1OFNA 2BUKA 1JBCA 4X6RB 1A8DA 3I97A 1V6LA 2Y6GA 4MYEA 1BMV1 4CXYA 5AVPA 4JCKA 4XACA 1H30A 1DF0A 2HWF1 4LHNA 4CDXA 2HWB1 4NIHA 2C9AA 1TQ5A 1AR91 5I0TA 4G4FA 3TN92 1GQGA 3HQUA 1JOJA 5C9AC 1VE0A 4MGZE 4UFJA 4OYUA 4YVWA 4R4ZA 1ZBA2 3OBAA 2XLAA 1RVF3 5I0UA 4L2NA 3WF0A 3T1LA 1AJKA 2XDVA 2VW1A 3OGRA 4N9IA 5F1RA 3U4XA 2ZGLA 2FZ2A 2PMWB 3HAGA 1N3OA 5CKNA 1F4AA 4Z2WA 5ABJB 1XPWA 4BK4A 3I49A 3OTFA 4XABA 5JUVA 2ORZA 3HNYM 2X5IC 3FL7A 3ACIA 5FPLA 2OA2A 4JRLA 4CCKA 4EN7B 3PMSA 2VZRA 4ONUA 5IW0A 1RUH1 5SV5A 1DQ2A 1YQCA 3TEWA 2IFRA 4CVUA 2PAMA 3PTYA 1O4TA 3UT0A 2RMU3 1B35B 1W6MB 1W9TA 2XGXA 3LZZA 4JHTA 3N9QA 3ZR5A 4W4ZA 4AGRA 2Z5WA 5DG1A 4ISQA 3NNLA 3WP5A 1LESA 3LCPA 4FP3A 4ORFA 1SACA 3WDYA 3KQ4B 5C9AA 1F8VA 1KFXL 3UESA 5FZEA 2RDSA 1UQXA 1RB8G 4A45A 1Y9QA 5JPMB 1GQHA 4COZA 2JDPA 2RJKA 1RUF2 2ZGNA 1D2SA 2AYHA 4WM7B 4O61A 2ID4A 4JDNA 2W94A 4IV3C 3UYJA 3N9NA 4E27A 4XF3A 4W6YA 4IGOA 3CDZB 3PLQA 1U5ZA 3O14A 3VLBB 1SLTA 3MLLA 2DFCA 5E89A 3KV6A 3SCFA 4Y1VA 4DRVA 4RS5C 2P37A 3AXEA 2X5IA 1W2NA 2GMPA 3BTXA 4Q0PA 3TBDA 1LULA 1RHI2 2D6LX 4ZPIA 5GZGA 2H0BA 2RS12 5LRSA 3D6EA 4S2GA 1MVEA 5C3SA 1UU4A 4QPWA 5E6HA 2LUWA 4OUEA 3J7MA 3AYDA 5AC92 1BHGA 1OA3A 4XQDA 1TE1B 2VBDA 5FZFA 4BISA 1HB4A 2VQ0A 1VBC2 4GA9A 3PJYA 1PO21 5LBCA 1X9PA 2AEYA 2WO7A 4KI5M 1UZ0A 5JI9A 1UXZA 2CWSA 1Q56A 5F5QA 2J42A 1YWKA 2VCBA 4C8DA 4I0WB 1AL23 3Q8AA 4SLIA 1HRV3 2Q1ZB 2WKKA 3FZ3A 4C1XA 1UU6A 3GBFA 3POYA 1WUVA 3Q8BA 2W52A 4CA9A 3VHNA 1LENA 4NRPA 3VL8A 2CDOA 2HBUA 2QQMA 3CEWA 1GZTA 1XC6A 1PIV3 1JHJA 4FXGB 4AVSA 4DRRA 4C91A 4CDQB 3VHRA 5B2GB 3DXUA 4CCLA 4UFMA 1UO9A 1YQ5A 4BJ0A 1R081 1RITA 3DEMA 3RMYA 3SKJE 3BOPA 4H7LA 4P9IA 1V6IA 4ZY9A 3SISA 2VO5A 5J1XA 5FZGA 4TTGA 1BK1A 3ZPYA 4XDPA 1O5UA 2JKBA 3JB4C 4XBNA 2Y26A 3NVCA 3BALA 3I3BA 2DBNA 3AP6A 5FYYA 3HR9A 1CESA 4PHZA 3AZYA 3GBWA 3TWIA 3W21A 4Q2FA 4RL7A 2EICA 5I0DA 1CAWA 4RQPB 1OSGA 3ABZA 4QPGC 3WEZA 4IEYA 1CAUB 2BW8A 5CG9A 4QWNA 1POV0 4IEWA 5J37A 1X9TA 2CTVA 5C71A 1TVGA 3HT2A 3WXPA 1NOVA 3NJXA 4YVSC 4XQWA 4K3UA 1ZA7A 3WQ7A 1QH7A 3UKTA 1LTEA 2K46A 2WN3A 1ZX5A 3M8LA 1XXNA 3MUY1 3RYPA 4P5YA 2VZUA 4YWAA 5F3CA 3VUOA 1UL9A 1E5SA 2DWRA 3PU3A 1HV0A 2HWC2 2Q8OA 1ZNPA 5FY4A 5IK7A 1W8OA 2WT2A 2RVAA 2WL1A 1ZBE3 2ZEWA 3R05A 4FQZA 4QX2A 2K2SA 1W8NA 2R49A 2WSUA 4E8CA 1FOD1 4MGKE 4A6OA 5HPOA 5DXDA 4AVVA 5LBEA 3M7AA 1S4CA 5L19A 4Y3OA 2RHPA 1PZ8A 3QH6A 2OS2A 1H1IA 2BZDA 2J1SA 2XH6A 1YC61 1OPMA 2D43A 2ZHKA 1JH5A 3J8F2 4MUVA 4M0NA 4EN6B 2GMEA 1LHUA 3PTRB 3T2OA 4DFSA 4RSUA 1FT9A 1GKBA 3WDXA 3NV1A 3U78A 5C3QA 5FP4A 3PL0A 4YG3A 1IS5A 1SDWA 2VNVA 1Z7S1 4XC9A 1OH3A 1GZ9A 1JUIA 2JG9B 4PLNA 3ZXLA 4ASMB 1OQ1A 4CCNA 1POV3 2WNEA 2B45X 4CDXB 5FBZA 5I91A 3ZSMA 1MS9A 2HWD3 4P9JA 4BYYA 3RJ2X 1XE8A 5HXMA 5FY0A 1O4ZA 1AUYA 1KQRA 2W46A 3LEIA 5F5CA 1N1TA 3MICA 3H1MA 5L36A 4YVWB 3V0BB 2NMOA 2Y60A 3KV4A 2VPVA 3DGTA 2R072 2A3XA 2RR13 5FZIA 1HIXA 1AR61 2HYKA 4KMQA 1J59A 4AFDA 3LAGA 2Q0AA 1XSRA 2K9ZA 1Y4WA 3LQCA 1IS3A 1FAYA 1E5RA 3DKWA 2XBO3 4JTNA 4O7XA 1QOOA 4K6BA 3ZXKA 4RR3C 4CZSA 1NCRC 4CUCA 1WW7A 1ND3C 3RZZA 1WW5A 3K3OA 1LEDA 4LBJA 5FPZA 2WNVA 4IE0A 1MS8A 3AFKA 2QZ2A 2C9KA 2YPDA 3O0VA 4I09A 4LPLA 4V1PA 2R32A 2UYAA 2ZEYA 2O1QA 5EIYB 4K20A 5DZFA 3CNAA 1PM7A 4XFFA 1RUOA 2MNGA 4DNYA 1PK6C 1YJLA 1LB2A 3IDBB 3OPTA 4P9LA 4BDVB 3B5LB 3WVJA 2X10A 3QOPA 5FXWA 5DUXA 5EYXA 2ZA9A 1UWWA 2GC2A 3EB7A 3SH5A 4IUGA 5IT6A 4F3JA 2WZEA 2X53S 1KJRA 3DECA 4XUPA 5A1AA 2V73A 2DVGA 1MS3A 2XVKA 1H2MA 5C5UA 4IGQA 3IT8A 4FOWA 1EY2A 2H6BA 2W0XA 1JHNA 4EZ4A 2Y6FA 5E8AA 5CFDC 1WCQA 4CDWC 4CUBA 4ATFA 1D4VB 3LIHA 5C6CA 2J1VA 1AR71 3C3VA 3PUQA 4XVHA 2YPJA 1LRHA 5I0SA 5JZGB 4JAAA 2BVVA 4DY3A 3Q9OA 4M3CE 1ZZ9A 1UN1A 1VMJA 3IDAA 5A7NA 1C57A 4B29A 5A6ZA 1VBB3 3HQXA 3O1MA 1GP6A 2ET7A 4UFLA 1PK6A 2DU0A 1E5IA 2VOVA 2YU1A 3KGLA 2E7TA 3PJQA 4QPIC 2PA7A 2ZHLA 2VH9A 2XJTA 3D0SA 3J26N 2GNBA 1U5YA 4NOTA 3TEZA 1FMD2 2D5FA 2IXCA 1RUC3 4LUMA 4Y1ZA 2YBSA 5CBLA 2XJSA 4NR1A 1WCKA 4QX5A 4BE3A 4YM3A 5BNNB 3VBUB 1HRI1 1VALA 1SG3A 2DCTA 4M4PA 5CFDA 2XJRA 2HWE3 3V0AA 4XJZA 1Q43A 2GC1A 4AWDA 2UU8A 1Y3TA 4FT8A 1BLZA 3N35A 4PI2A 1VAVA 4QKDA 3WHUA 1R093 3H1YA 4AHXA 3ZN4A 4KWUA 4QXHA 1W06A 1RUF1 3LDRA 5KBFA 3VBRA 4CP2A 4MGQA 5I0RA 2R062 1D4M1 4YZ1A 1RGSA 5A3NA 1JODA 5DUWA 2W1WA 4AEDC 3CO2A 1WZXA 4M00A 1UOBA 2E9QA 1QXPA 3M3IA 4R8HA 4BQYA 5JLVA 1WMDA 3VZJA 1JYWA 2GALA 4YLZA 4ZU5A 1APNA 3N7JA 2V5DA 4PIXA 4QPIA 1QNYA 4YZ5A 4YYOA 3KZ4C 2JDUA 1JYXA 1OURA 1GP4A 3A21A 2RS11 3IDCB 3ORJA 3H3LA 4CU6A 4LKEA 4WVMA 4XJUA 3MHZA 4WVWA 4CUGA 4D7TA 4IEXA 3ACFA 3LA2A 4XAEA 2OVUA 2MEV1 3AYEA 4G3YC 2C6SA 2DCJA 4PF1A 4ATEA 3OPWA 4KG0A 5JIAA 4HG6B 4CSWA 4GJZA 1STMA 1VBE2 4QXKA 4Y20A 4Q4W1 2P3KA 5EXOA 2JDNA 1QJU1 3CQOA 3HN3A 4HKOA 2W3JA 3ZSKA 5IYYA 1AYN3 2YYOA 3RDIA 1CX1A 1CQ9A 5HXVA 4LUKA 3RZMA 4QQOA 2ZAHA 3M4FA 2FCTA 4GULA 4YM1A 4RHV3 1C8M3 2PLV1 4COWA 1GSLA 3VL9A 1NLSA 2N7GA 4LBLA 3I4IA 3HQRA 2BNNA 4AVTA 1DZRA 1MZEA 1ZYBA 2DDUA 4P08A 5T5PA 4EN8B 1DYPA 1MZ5A 1QJFA 3D0JA 1BMV2 5DUVA 2CSGA 1VRH1 1F2NA 1GICA 4AI3A 2HWB2 4AYUA 3KSCA 2LTNA 2VULA 1AR92 2QQKA 2RV9A 1US3A 4MO3M 5IFPA 4HVRA 3ZOIA 3HN1A 4Q4Y3 3ZM8A 2P4EA 4XHBA 1YRZA 2GN7A 3ASIA 4XJWA 2VTXJ 2B5HA 1O3SA 2OT7A 3H50A 3BU0A 5FJKA 2Z2SB 3TAYA 5HI0A 2D6OX 3ZO0B 4IEQA 3O0XA 4IEZA 3RI9A 5DAVA 4ISRA 1NXD1 4AXOA 1JZ5A 2VNOA 2DF7A 2ES3A 5KHHA 1QWRA 1H8TB 1GNZA 4R52A 4MGTA 4EJRA 5FYSA 4YM2A 3RJRA 2LROA 5HCHA 2KR2A 4JHZA 4X8NA 4LA2A 4FQ4A 1OF4A 1KDKA 2ZMLA 1RUH2 2XJQA 1O59A 3DYMA 3VZNA 3POFA 1US2A 2GZWA 5FZMA 2I2SA 3A0KA 2BWAA 4MXWB 4Y1YA 5ABJC 4ZHNA 3AJYA 1H6YA 1UCXA 3M70A 2WNVB 4QD2A 3WQ0A 2IXIA 4P9YA 1LHOA 1J83A 1VMFA 2WUHA 4QMAA 1C5IA 1H1MA 5JSOA 1I5PA 1FX5A 1V9U2 2I45A 3U07A 2AR6A 2VMHA 1RUI1 3ZXEA 3MIBA 5FBJA 2A6XA 1JMUB 1OLMA 4HVOA 5DZEA 4IV1C 3NV4A 5J96B 3O1PA 3W5MA 2CNAA 2V09A 4V2VA 2XJVA 1WMFA 1W3VA 3AK0A 3BU7A 2BRTA 4LIUA 4GWMA 3FWEA 4EYUA 2GP5A 4UFKA 1W0NA 5APAA 1A8MA 1PMJX 2BQPA 3IM0A 1MZ6A 1JW6A 1JZ3A 1Z78A 4MG2A 2QDRA 1QH6A 1VPHA 3K77A 4EV0A 4BQXA 3IWZA 1NQJA 5FZ1A 2RDQA 1R1A1 4WM7C 4L97A 1W8WA 2VMDA 5FZDA 3CZUA 2VTFA 5K9YA 5JAXA 1YJKA 1KFUL 3B00A 3LGRA 3U0ZA 3CU7A 1CAVA 3ILFA 2EXHA 5A6QA 2FDKA 1VBA2 4I3GA 2AGSA 3C7EA 5ABJA 4LHLA 1FATA 4PF5A 3KM5A 1GWLA 3U37A 1RMU1 2WABA 1CX4A 3WP4A 3AZZA 2PAEA 4UW3A 5BNPA 1EAH3 4FOVA 3MEPA 2E7AA 2R16A 4HMZA 3NNGA 4Q8LA 4FTEA 3EXUA 1B09A 2XWBB 4ZU4A 3T2TA 5LWBA 4IV1A 1ODNA 2X05A 2QE3A 2ZGTA 1Q3EA 4NAOA 3C7FA 3THDA 2VU9A 2WO3A 4ES8A 3JB8A 5T54A 1BEV3 1HN1A 4URAA 4BPZA 5C70A 4DY5A 1GV9A 5EYYA 4GWIA 4JRAA 4FXKB 2B7YA 1JS9A 3FHIB 4YW4A 5FV3A 1QJX3 3PDQA 3EHKA 5CFDB 4E4SA 3P3PA 3V0AB 2E63A 4LE4A 4K1YA 4MH0E 1YXWA 2RS33 4XJAA 4RFT0 1GOHA 1R082 1WLCA 1QJY3 4TSVA 2IXKA 4B7KA 1FXZA 2WDBA 1BZWA 1TMF1 4AG4A 4COUA 2XLFA 5K7PA 3VBRB 4UFIA 5FAXA 2OXBA 1OHFA 5D8AC 4CDQC 2WS92 2QVSB 3NAPC 1U0AA 2VVDA 2WFF1 2XWJB 3AP4A 2IFWA 2SBAA 3HT1A 4OZXA 1DQ1A 2A6WA 4Z07A 1KS4A 1DFQA 2R043 2VY0A 1QF3A 2JB4A 3LDBA 3MIFA 4Y26A 1ULPA 2OPKA 3J4UH 2PYTA 1GU3A 1UY0A 4DMIA 5EZWA 2FDJA 3K2OA 4AFCA 5BNQA 3EMRA 4O65A 3QBQA 1JOPA 4IQPA 2B46X 4WVMB 3NNFA 4BU2A 4F8AA 2Q30A 2JIJA 5HCAA 1A3KA 3UK9A 3OUJA 4RQPC 2HH9A 3B7MA 5HV4A 5FZ4A 4XFIA 3B3QE 2ZGQA 4I02A 4AEJA 5DABA 2JDMA 3O1UA 5EP9A 3FC0A 1DDLA 4NIAA 1PO23 1SHWB 1S2KA 1RXFA 5IVVA 1O91A 1KEXA 1FOD2 1WCUA 2BU9A 2VOKA 3GHNA 3R4DB 4ARXA 5GLVA 5I8YA 4LO4B 4AVCA 1Y9GA 1PNGA 3EYPA 2ZCWA 3NV2A 3HEIA 4HN1A 5JXJA 4GXLA 5D8AA 1COV3 3NAPA 2B8MA 4INDA 4PLOA 5GZCA 1LHNA 4CEYB 5FWJA 3TNPB 1VLNA 4M0HA 4P14A 1UNBA 1RUD2 2GNMA 5LBBA 1SPPB 5FKBA 1CZTA 2XVGA 4NHXA 2VMFA 4ASKA 4XJ8A 1G86A 5FP7A 1XNTA 4HANA 2WLPA 1L3JA 1YYNA 2G1MA 3ZPOA 3DKQA 4TXWA 4UBHA 1RUJ2 3ACGA 3M3QA 4Q0SA 4AHWA 1RUG3 4F7ZA 3AL6A 1W99A 5JOYA 3SCGA 1WLWA 2Y0IA 1DQ6A 2JKXA 3CBNA 4Q4V2 3WQBA 5C8WA 4HPKA 3FLPA 4B4RA 1CAUA 3MLJA 1PVC1 2JG9C 4TLFA 1AR62 3H8RA 2D5HA 2WJSA 3AP9A 2WZPP 2RM21 1AYM2 2VMGA 4FVVA 3KCYA 5JWPA 1WMXA 3UNPA 1NA1A 2PQQA 1YUDA 4S2HA 2RS52 1ALYA 2ADDA 1ASJ1 2XJUA 4YVWC 4QHBA 4LBOA 4NO4A 1W6PA 3AMMA 1UMIA 4A3ZA 4BZ4A 3ZXFA 3AM2A 3ZYRA 1TEIA 1VRBA 4I3PA 1N3QA 4YGCA 4WVZA 4MHRA 1I1EA 3AYAA 1UZYA 2VCAA 2BV4A 1W8HA 3OY8A 4ES9A 1XBFA 3CKHA 4YARA 4CP0A 2QDNA 3N7MA 1H8VA 4K9SA 2BGOA 4NRMA 3INAA 4Y5Z0 4Q4X1 3PVNA 1W04A 3ZIWA 1S0GA 1ONAA 2IZWA 1QNWA 3BB6A 5CEHA 4YW5A 1OLQA 1JUHA 1NE6A 2K0GA 5IFTA 3LEMA 4QDRA 2P5BA 2JG9A 4HKLA 4OI4A 1W0PA 2VQTA 4NVPA 1DCSA 4QKNA 2DBIA 1K45A 5FYZA 2JDYA 4BWOA 1UW8A 5EHDA 1XJAA 2IXLA 1H4GA 4D3WA 1G9DA 4L11A 2QQOA 1XNDA 3R4SA 1AR72 2BWCA 3SNMA 4A7ZA 4QPYA 4DUXA 5LA2A 3CF6E 3V0BA 3KVBA 2BERA 3KF5A 3POJA 4IGPA 3DYPA 4NHYA 4P5HA 1O6UA 2IC1A 3MI8A 4DXTA 1QXJA 3ILNA 3WY6A 1VBD1 3IMNA 2ZGKA 1ZA4A 3GALA 1CAVB 3JD71 5J48A 4XETA 3LA7A 4JQTA 5LK5A 3T0DA 4QDQA 4YFWA 4GB33 4CCOA 5JZGC 2HEYF 3GHMA 3AZXA 2OIIA 1GYKA 2A71A 5A1FA 4K8FA 3VDCA 4QX8A 1RUE1 1XE0A 3FFZA 3SMHA 2WWJA 1IPKA 5BNPB 3OCPA 5C5TA 1EV11 3KT7A 3THPA 3KV9A 1QDCA 1HRI2 4IV1B 4Z8BA 4NN0A 1UYPA 2IVJA 1V6MA 4IW3A 4H2AA 5DDJ1 3CL1A 4EN9B 1OOPB 3BPZA 5A7QA 2NN8A 2YB7A 1KD7A 3FLTA 1MEC3 5JR2A 1LU2A 1V9U1 2O8QA 4JGYC 1LU1A 5EWSA 3ON7A 5GZDA 3NJYA 4Q1PA 5BNNC 4UFHA 1ZRCA 3VBUC 1LOGA 1S0JA 2SLIA 3WHTA 5JXHA 1D4M2 4BIOA 4U36A 1PGW1 3U1XA 4XQ4A 4KG8A 2DVBA 2E31A 3HNBM 3NJZA 2BTVC 3I2FA 2P3YA 4AFAA 1LEMA 2FQPA 3I2JA 3JQXA 4KL1A 1BBT2 2PHTA 3LEKA 4YG0A 1G6NA 4FPLA 2O14A 4BXSV 5JZGA 1GWMA 4XAAA 2WZR2 3WDVA 2Y38A 1BVVA 3AMHA 5ERLA 3KCCA 1IG0A 5FYUA 4AQ6A 4RD7A 3TN93 5JSPA 1TME1 5F3GA 2VBPA 2JEMA 2V4AA 3S7EA 1V70A 3SH3A 2MEV2 3O1TA 1VBA1 2Q8DA 1H9PA 1IZ3A 1E5HA 4XFBA 3MGUA 1ZBA3 2XHKA 5GLWA 4EWDA 3PVEA 5A70A 4Q4W2 4JGYA 1BKZA 1CPNA 1QJU2 2UY9A 5FDBA 3BODA 1U5XA 1W9YA 5BNNA 4AI2A 3VBUA 5AFEA 1DP0A 4DUVA 2XLGA 4QX0A 1HQLA 3OGSA 4FPKA 4NRQA 2I74A 3BIWE 5JOWA 1KITA 4XBQA 2CGOA 5JIUA 2X29A 2PLV2 2YFUA 4UW5A 1REFA 1UMZA 2ZX4A 5FY5A 2J1AA 4Y33A 5GZFA 3P5BA 3KT1A 1AR83 4ZS3A 5G05L 3AMQA 5D8AB 1GZWA 1VRH2 3NAPB 2MHFA 3TB0A 4CYDA 1F35A 1S0DA 1YEWA 2JJ6A 2Y64A 3MW4A 4Q5OA 3WD5A 3E5XA 3AX4A 1F31A 2DCYA 3R6SA 1GP5A 2OKXA 1JZ6A 1YQ8A 1HJFA 1SLAA 2Q1FA 3C7OA 1CIYA 1QDOA 4META 3WCRA 2ZOEB 4HVQA 1U5IA 1W6QB 5LZ6A 4OUMA 4OQ9A 1RUF3 3J9SA 5G04L 1UY1A 2PFWA 4LNVA 1JOBA 4AVBA 5FPXA 3VD9A 2WS91 3AMNA 1ZREA 2XL9A 4QB2A 2WFPA 1QOSA 1S2EA 1DZTA 2AEZA 2QQWA 4C1WA 1J3QA 5D1IA 2TUNA 4HPKB 1VJ2A 1XOYA 1LR5A 3I8TA 1XE7A 4LIVA 3JUUA 3LPFA 5KHKA 3U14A 2VNGA 1QJZA 3KV5A 1RHI3 5F3EA 1NA1B 3T2QA 3IN9A 4W6WA 3HNMA 2C26A 2RR12 1HXS1 1V6NA 3KQRA 3P6BA 3T08A 3FHAA 4W6XA 4QXBA 5EJ1B 5HCBA 5AC93 1CD3G 1H8TC 3I3EA 5FZ8A 3V56A 3WG2A 3B94A 3IKWA 1VBC3 1W6PB 5FXVA 5A33A 4JDOA 4XUTA 5ACA1 4AQ2A 1PO11 2P6HA 5A7OA 3ZXAC 1W0OA 4JGZA 2VUAA 2VC9A 2EXKA 2VZTA 2Y34A 3OY8B 1IKPA 1K12A 1RUI2 4KGQA 2PQSA 4Q27A 3VHPA 4CXXA 4FPJA 3ZMOA 5A6YA 5KHJA 3AFGA 1WGPA 2WNVC 3VKMA 4BK5A 1ST8A 5CFCB 5A80A 1IS6A 2VQUA 4FTBA 1RUD1 2A3WA 2XONA 4C0HA 5JOZA 4QT6A 1E57A 5LA9A 3BTZA 1O8SA 3DPRB 2VGDA 1FPN2 3AZVA 2HEVF 3IIIA 3W59A 1T2XA 3VZKA 5A1LA 3WDUA 2BPA2 5T52A 4HONA 4RGGA 3JBG1 1RUJ1 2G9FA 3FUOA 5L73A 2LALA 1R1A2 3IPVA 2HBTA 4N90A 1K42A 4OMCA 3D5OA 5FK8A 1RTVA 2WA4A 4FPEA 4LO5B 3LKJA 4E2GA 3WQ1A 4AZZA 4FFGA 4Q4V1 4AI1A 1CJPA 3LSDA 3WUCA 2ARAA 4LLFA 1H8TA 3T30A 2W95A 1OUSA 2ZAAA 5GLZA 1ZZ7A 4CUAA 2DUOA 3C2UA 1RMU2 3LOIA 4FPHA 5A3WA 3NO8A 2ZACA 3ZN6A 4AHYA 2VOTA 1AYM1 4QU1A 4BQ4A 4E4ZA 3RYKA 5FRAA 3WUDA 1K3IA 1PMIA 3QCWA 3O12A 1IG3A 1RVF1 3W58A 2RS51 2WIIB 2WNUA 4S2DA 1H1AA 3K51A 4BH9A 2BBVA 1LKNA 1UMHA 2FDIA 1RXGA 4MXWA 1FV3A 2WA3A 1YFWA 4JKLA 2QKDA 4CRQA 4UT5A 2NP0A 1PGSA 1CJDA 1RL3A 3H9AA 2XUEA 3T4HB 2ZHMA 1YQ2A 4K7JA 2WT1A 2JXAA 4B4QA 3D8CA 4FCAA 1PNFA 4GWJA 3MZHA 2NQYA 2VUJA 3S30A 5FK7A 3I3QA 3H3ZA 5C8CC 3M1HA 5KXDA 1N3PA 2HWC3 3CJXA 2Y6LA 3GYDA 4GQ7A 3CMGA 4LBNA 1J84A 4XUOA 2RMU1 4GJYA 3URFA 3WW2A 3ZSLA 5JXIA 4BM8A 1TMF2 4GAZA 4JTOA 2WO1A 3H8XA 3SCHA 3I2DA 2ET1A 3POSA 3H7JA 5FMOS 2ZX3A 3J8F3 4NIIA 2XG3A 5BUVA 5F7UA 3UKNA 2WFF2 1W9FA 3RGBA 2VE1A 1OA4A 3RZHA 2RDRA 4QXCA 4IE7A 2WYSA 4M3CB 4Y22A 2PHWA 2WWSA 2FD8A 1W39A 5F3IA 1JZ8A 2GN3A 2VXRA 3GZEA 3VBRC 2VMCA 4NE9A 1OC1A 5IJRA 3R0RA 4RA0A 2PELA 1YFXA 4I30A 1LHVA 1C3HA 1WCSA 2ZX1A 2CDPA 2OQ6A 4XXPA 4N53C 3IAQA 2JD4A 5IK4A 3Q8CA 2Q8CA 3WCSA 1VAMA 5C8CA 2R073 3MBWA 5T5LA 2FDGA 4FFIA 2IXJA 1DLLA 5H9PA 4AE2A 5BV6A 5KWRA 2W1QA 1KGYA 4JGYB 1X50A 4GALA 3S7IA 2ZABA 4HETA 1H2NA 4LTAA 4TLGA 3RWKX 3W9AA 5IVFA 5HBAA 1L7QA 3QACA 1XYOA 2ZMNA 4LULA 3M3OA 2E51A 2WQZC 1MS1A 4TWTA 4Y1XA 5FUNA 3WNMA 3GNEA 3UJOA 1N1YA 4NHLA 2VAUA 1VB2A 1M4WA 3B9IA 3RZLA 1NY71 5GKAC 1AL21 5IATA 1XNKA 2C5DA 3OPZA 5DZGA 3VDDB 1HRV1 1XNBA 1YCIA 4XMIA 4RHV2 1ULGA 2ARCA 3I2GA 1OBNA 1GZWB 3ZFFB 1F15A 3NKGA 1ULFA 2CGNA 3DXTA 1BCXA 2RDNA 4CEYC 1PIV1 4YGEA 2G19A 4OHVA 4N53A 2VZOA 5LASA 3I2IA 4MZUA 1BBT1 4FTSA 1NT0A 1MZFA 2GC3A 2VVEA 4YW3A 1ENQA 3ZXGA 4AAXA 3MF9A 5IVCA 2XOMA 3VBOA 1PVC2 2WZR1 2GNTA 4MV2A 1AJOA 2EAKA 3CHXA 4XF0A 2XKOA 4Q4Y2 2RM22 4FBFA 2OYZA 5JMCA 3EBRA 5DAPA 4UOJA 2BOJA 4SBVA 3E6CC 2W92A 4FSJA 2JDAA 2YFZA 2VW2A 2Y6HA 1ZZ6A 2ADEA 4GMP0 4AAPA 1ASJ2 4KWKA 1MPXA 3SQOA 2AC1A 2CU5A 3X29B 4GKXA 2LS6A 2WSVA 1QXRA 3A23A 3HBZA 4YPJA 1W03A 3VV1A 4QU2A 1J3RA 4ET7A 2TNFA 5FYHA 4MGSA 1SZBA 2UY8A 1GUIA 3RYRA 4JC1A 4QGLA 1OF3A 1L7RA 3VD3A 5JDBA 2OPWA 3OEBA 3MPBA 4D7SA 5L9BA 1R1ZA 3T3YA 1WBLA 1OLRA 1DG6A 4GD4A 4XILA 5E88A 5KXCA 3K48A 4ASLA 5A33B 2WO2A 1A78A 1FMD3 1GNHA 4CEYA 4Q4X2 3USUA 3AKQA 3PUSA 2FDFA 4JGZB 1SPPA 2NLRA 1C1LA 2EIEA 3J7NA 1MACA 3O1VA 5I93A 1J3PA 1ZBE1 3HD8B 2VOXA 1DHKB 2BVBA 1KRIA 3LF7A 5CIRA 5CZKA 4AW7A 5K8SA 4LBMA 5FY1A 4L99A 4XURA 3RMXA 4XHXA 1SFYA 3AKPA 4R9DA 4BLJA 5FCCA 4AOCA 1CZVA 2JD9A 3ES4A 4GMP3 4CDUC 1AZDA 1XNCA 3WG4A 3ZXJA 1Q8SA 3ZFEB 4AGGA 2R063 1X33A 3AB0A 3IPVB 4W65A 2ZXQA 3OYWB 4LLOA 3ZYBA 4HZFA 3ZXDA 1G7YA 1HQWA 1AL0G 1VBD2 3JQWA 2WAOA 3N7KA 3C7GA 3JD72 2XJPA 4M3CF 5T55A 1POV1 4XF9A 1AXYA 1AXKA 2F17A 2J7MA 1RIRA 2HWD1 4XXAA 3I2KA 1RYYA 3OBTA 4GWNA 1NUKA 2NPIA 3ZN6B 3ATGA 3THTA 1FYUA 4HLTA 3FX3A 4N43A 2AENA 1AF9A 1RUE2 3WOGA 2JDHA 3WF1A 3DN7A 3L9JT 2OZ6A 3BUCA 2RR11 1EV12 1UAIA 2WNUB 3ZSEA 3ZLIA 1UU5A 4EZHA 4EE2A 2FHRA 2GNDA 4PBPA 5FZAA 4V2WA 3OBRA 3NJVA 3I2HA 5BNOB 1W90A 3IZOA 2WLQA 2W08A 4DQAA 1G9BA 5DDJ2 1VBE3 5A32B 3VD4A 2JIGA 5FZ3A 2FMDA 2XHNA 4IERA 2XBO1 3PVOA 4K1ZA 4CEWB 5BNPC 3Q8EA 3ZKYA 5K4LA 1PVXA 5JPNB 2Q8EA 1DQ4A 4A44A 4ARYA 4CDUA 3LE0A 1BEV2 1CGPA 1OA2A 1C28A 5LW9A 1OI6A 3VBFC 2XXZA 3DCQA 5BPXA 4A7YA 1DQ5A 2Y33A 2DURA 3ZYJB 2YC2A 1DYKA 1PGW2 1OOPC 3O1RA 2A1XA 1FV2A 1QJX2 5FQ0A 2EXJA 2W1SA 4YZ4A 3D82A 5IVJA 3VBHA 4MVTA 1FPN1 5LY2A 2DVDA 2D6MA 4RN5A 4I0BA 2AREA 4O9GA 1CONA 2HWF3 2PHUA 2A6YA 1QIQA 2HWB3 1ZZBA 3IAPA 3LA3A 2O8OA 1KDMA 3E6DA 4NHKA 1AR93 1QQP2 1W8TA 5FYMA 4H3WA 1ZRFA 1KJLA 4XCAA 4Y22B 1QKQA 2QFEA 1TME2 4Z82A 4AI0A 3FLRA 5T5JA 2OZJA 1F5FA 4LKSA 1RJ7A 3ZYHA 3NRUA 3KHBA 5ANNA 2UYBA 5SV8A 2BGCA 2D3PA 3LB9A 2D6KA 4IEVA 4NPLA 1S1AA 5JOXA 3TEYA 5C3OA 3K4AA 1PX4A 4R9AA 5FWEA 5T5OA 2KM2A 1PZ9A 3OGGA 4Z2AA 3PIGA 5IVBA 3RZKA 5C8CB 1VIWB 1G8WA 2FCVA 2QUOA 3AKRA 3CIHA 3VBFA 1ULOA 1PZ7A 2WC2A 3WDWA 1VBB1 3S0MA 4LT5A 4JX0A 3KHCA 4URTA 3RWNA 1OOPA 1CR7A 3MW2A 5CU1A 3AP5A 2A6VA 2J1RA 3POWA 3O5SA 4XPVA 1SFNA 5F2WA 1RUH3 2CL2A 3OEAA 3WW3A 2QQVA 1IQAA 1O3QA 1LODA 1RUC1 2BNMA 2YV8A 3N9PA 3UGHA 3KGZA 3ZSJA 5FYTA 4CTEA 4O9EA 4IE5A 1YIFA 1HX6A 5GLTA 2HWE1 3O1SA 1RINA 1UF2C 2QZ3A 2W91A 5IAXA 5JCTA 1SFPA 1XRUA 1Y7BA 5FZBA 4MADA 4R9BA 3HWJA 3MPPG 5FLHA 1SLCA 5FOBB 1OQEA 1R091 2BP6A 5JMOA 1WA4A 3E5QA 1S0EA 2NYYA 4N53B 1IPJA 5FYVA 2LM3A 4G9SB 3BKZA 4XIKA 1V00A 3VBOB 5FPUA 2P6CA 4M01A 5FO7B 2QQNA 3VKNA 4CPBD 4WZCA 3NSTA 3NNJA 1W6OA 4NPMA 1VAKA 1EPZA 1SCSA 3ZYIB 4E2QA 2YZ4A 1K5JA 3H7YA 5T3NA 4OQ8A 4XOGA 5BYNA 4HSLA 4Q0UA 1LOBA 1HXS2 4DEQA 3F2ZA 2W87A 2WAAA 3ME2A 3SITA 3GDBA 3PUHA 4JV4A 5JR7B 2V72A 5FIXA 5A6XA 1UKRA 4LKFA 5GALA 1BJQA 4CP1A 3M3EA 5FREA 5BY5A 4ZZ8A 2HJIA 2O0OA 4RFRB 1ZRIA 5ACA2 5M0TA 1O5LA 1SMVA 5CG8A 1PO12 1PGL1 5ANQA 5FTTC 1NA1C 3ZYGA 3IB3A 1ZZ8A 4RGAA 3J7LA 4QX3A 4GKYA 2BGPA 1D0HA 3R4UA 5IUQA 2W1UA 5DAXA 3UJQA 5JVVA 2DCKA 3K4ZA 4P9WA 2GMMA 1I9RA 2Y6JA 4BOWA 1AYN1 4KGGA 1X7NA 2C1FA 3USUB 4OCTA 1NYWA 1GBGA 4Y5SA 1LOAA 1UOGA 5FMBA 3CJIB 3MIDA 1AX0A 5T50A 3VZLA 4B1MA 1HQNA 1W6QA 4RHV1 1UIKA 1C8M1 2GP3A 4LK7A 1OKOA 4UF0B 4CPBA 1OQDA 4RR3B 4LBKA 3JBG2 3WF2A 1Y9MA 1W9SA 2D44A 3W20A 4UXAA 5ISLA 3S5AA 3FE5A 3ETQA 4H55A 4Y4YA 2VR4A 3FBYA 1K5MB 2DUQA 1R083 1RC6A 2ZX0A 3WW1A 4BQ2A 5CFCC 3RG0A 1LNSA 2YBKA 1UYZA 5FZCA 2CAUA 2DYCA 3DPRC 4AQSA 2VMIA 4HBNA 1JU3A 1YLLA 2ZHNA 4YZ3A 4COVA 1CWPA 4AK3A 1GLHA 1Q5OA 4Q4Y1 3FBMA 4Q1RA 2D3RA 2MPFA 1CIWA 2GU9A 5I8SA 4HT1T 1HB3A 5FZ0A 4L8QA 1RVF2 2D6NA 4UWDA 5GM0A 4MXVA 1D7PM 4NUBA 5FYIA 1V6JA 2GAUA 2JB8A 4OVEA 4LO8A 1OT5A 4QQPA 2VOWA 1LJ7A 4N43B 1GOGA 3RRDA 3TRSB 2FCUA 1OPOA 5F6KA 4ZONA 2PHLA 1OMIA 3SEPA 1C1FA 1W9WA 4GB32 3WNXA 4LORA 3DV8A 1ZRDA 1V6OA 4A2UA 2CAVA 4OULA 2WZ8A 3GXUA 1BYHA 2VZSA 1Y43B 2D7FA 5CFCA 3ST7A 1YHFA 4DS0A 1FOD3 2RMU2 1X8EA 4H7MA 1JYTA 4NMIA 1XYPA 4QDSA 1MQTA 2ZX2A 2CYFA 3DPRA 4CDUB 5J98B 3IDEA 2WYFA 2TBVA 2BYVE 3AJZA 2GDFA 5DUUA 4NWWA 3V65A 3VDAA 3CZJA 2CGPA 5FQ0B 3JCIA 5H9SA 4P9XA 5KXEA 5H9RA 1OVSA 1REDA 2ZGSA 3F95A 3VBHB 2D6PA 4PT6A 1S0FA 3BGAA 5FYCA 2XPJA 1C8NA 3GGLA 1Z7S3 3G6JB 3ZYFA 5LEJA 4XZPA 5FUIA 3AKSA 1WLTA 5K0UB 3BTYA 1NZIA 4QQHA 5CADA 3C8XA 1HW5A 4I0AA 5FZLA 3OUIA 3ROUA 1V6KA 3NW4A 3E1F1 3MIEA 4EWEA 2YDEA 1G9AA 3BOWA 3PMEA 1I6XA 3N9OA 4Q4V3 1ZRRA 5FMDA 2XR4A 2VJXA 1IQDC 1UZWA 2EIGA 4YG6A 4MLOA 4BMBA 1OLME 3ZFGC 1AR63 1QOTA 4B8EA 5GLUA 3ZDVA 1AYM3 4AFBA 1V0AA 1XB9A 1CVNA 1LECA 4XFAA 2PHRA 2EAAA 2RS53 2WNOA 4A3XA 4YFZA 3VBFB 5KXBA 3VHOA 1EAH1 2P3IA 2Q1MA 2DUPA 2JG8B 2ZGUA 2WRAA 3VZOA 2ZZJA 2VQAA 1D2QA 3DUIA 3VKLA 1Q8OA 4AHZA 1Q8QA 2PHXA 4K21A 3S57A 2UWAA 4NJ4A 4OI0A 3UV9A 1RUNA 4Q0VA 1NY72 1AL22 3P3NA 2BFUS 1DGRA 1BEV1 1HRV2 3WZ1A 4YNIA 1REEA 4YSFA 3VDBA 4Z92B 4E9KA 3RSJA 4WM8C 2ENRA 4QQ2A 3BN6A 2PHDA 3E5UA 4KBZA 5LEKA 3T4VA 2ZGRA 1QJX1 1PIV2 1AR82 2WWUA 3KB5A 4K8RB 1H4HA 4M3CA 4P9GA 3WLUA 4QB6A 4CU9A 2ZKNA 2RS31 2A7AA 2FZ1A 4IXLA 3VDDC 4OLLA 2VZQA 2ILMA 2QTWB 4FOQA 1F4HA 4PIYA 2P17A 1QJY1 3ZFGA 3ZFFC 5D2AA 1Q8VA 3AVSA 5FMOL 5CKQA 1QQP1 3N9LA 2V4VA 2Z42A 3FMGA 1UX6A 1W2UA 2PHFA 2Z79A 4LKDA 1AR73 3U10A 4BQWA 3WP6A 1C4RA 2EA7A 5DAQA 2OUHA 1UOJA 2FBEA 3LEGA 2D93A 3HJRA 4B7EA 2UURA 4HK9A 3DF0A 4JDMA 2OX0A 3RZGA 4NIGA 2R041 2ZS6B 4Z1VA 1W6OB 4UAPA 1XQNA 1UD1A 5J3UA 3MIGA 3A0NA 4MGYE 4R4XA 5C4WB 1IGOA 3U4SA 4KWJA 5A3LA 3GCXA 3OF1A 1CN1A 4CU7A 4YZ2A 2CV6A 2PAKA 2V5YA 4QKBA 4WM8A 3QD6A 4A7KA 5KHIA 1S0BA 3ZMNA 2NM1A 1W2TA 4L0PA 3GZAA 2YHJA 1ENXA 1HB1A 4Q29A 1DLCA 4AEKA 5L9VA 3VDDA 3Q8FA 1HRI3 5F39A 1H2LA 1C5HA 1SEFA 1ZBE2 4NHMA 2RJLA 3T2PA 4LR4A 4WVVA 3ZFFA 4AI9A 1XSQA 4IL7A 5F2SA 4PDWC 5FZOA 4E4HA 2VCMA 3LIGA 5CA6A 4LQRA 4JGZC 3AXDA 4AQTA 1JYVA 4J1XA 1MS5A 1COV1 4LO7A 5CKMA 5F9TA 4KBBA 4AF9A 4IV3A 3V64A 3RI8A 1NAEA 4C90A 2VG9A 3UL2A 1D4M3 2BBAA 2VZ1A 3SH4A 1F9KA 5FP8A 5A3OA 3U11A 2UWBA 4LHKA 1IOAA 3EO6A 4R9CA 2D98A 1QGLA 3SLIA 4RS5A 5DG2A 5L7OC 1AXZA 1NCQB 1N1VA 2ARBA 4E8DA 1BBT3 2EALA 1RUG1 4BQ1A 1URXA 2HWD2 3GF6A 2WZR3 4CCEA 3ZFEC 4EQVA 3PHMA 3ALQA 5C7GA 5J09A 2JWPA 4IEOA 4P02B 4XF4A 4EN0A 4J1WA 2YC0A 4EWAA 2E6VA 3WNKA 2RS13 3NV3A 3WT3A 1GR3A 5FY8A 1NLQA 4ZXKA 5DPNA 2JECA 3OBZA 4NPRA 2MEV3 3GCWA 4FI9A 5JXGA 3WDTA 2XB6C 1G9CA 2E53A 3NL1A 2Y6KA 2Q4SA 5FZ9A 2EIDA 2Z4FA 4KU7A 4XDOA 3KVAA 4LBQB 3THCA 1I5ZA 4PDWA 3WG3A 2XBO2 2VTXA 4Q4W3 3ETPA 4ZXEA 1ULCA 4D6SA 1OD3A 3FHQA 1NKGA 1QJU3 1D0GA 1U12A 5FZ6A 3RNSA 2WNUC 3QH7A 4A4AA 5HV0A 2WR9A 4UW6A 4L9BA 3ACLA 3KS7A 5BNOC 4AFMA 3FN9A 1XU1A 5EJ3A 4OI1A 3WINE 2IXHA 2PLV3 3N36A 4CEWC 5L7OA 1ND2B 1CPMA 4BCUA 1MQTB 3MFAA 2BJSA 4TN7A 5FY7A 3E97A 4Q0QA 2TEPA 3WP3A 1CAXA 3C7HA 2I07B 1LOFC 1FI2A 1VRH3 2J22A 3ZFEA 5LK7B 3B93A 3OYWA 5DQ0A 2ZEZA 2A3YA 1ULDA 1DGRN 1LGCA 2B42B 3ITQA 5A3PA 5KC5A 1VR3A 4BLIA 1UYXA 2BEOA 4PQQA 3NNMA 2NZ9A 4JKMA 3LPGA 5C3PA 2VM9A 3VBSB 1AX2A 3VKFC 1SDDB 4LA3A 4CCDA 2DFBA 5AVAA 5C3RA 4IETA 5IAVA 4FAHA 1QMJA 4QPGA 2Y8KA 2DVFA 2WINB 2DTYA 2E7QA 4KH9A 3WF3A 4QB1A 4Q8KA 1A34A 4HOOA 4XUNA 1ENSA 1NLRA 3OSDA 1X82A 4YVSA 2XQXA 3GZUC 3OGVA 4Q26A 4CXWA 5BNOA 1YI9A 2R30A 1VBB2 1L7LA 1WLDA 2IWGB 3KT4A 5EQUA 5A32A 4HSJA 2YY1A 4CEWA 3K3NA 5CISA 4IESA 1H2KA 1S0CA 2XQRA 4GB31 1P8JA 2J1EA 1UY4A 4FPGA 1OFSA 3ZKUA 1SLIA 4GZ9A 4UYBA 2VUDA 1LCLA 3BI3A 1DGWA 3K46A 1RUC2 1LOFA 4H14A 5LA1A 1W8FA 4XFHA 4GIQA 3VD7A 3O7OA 2VW0A 2JE8A 2ZPXA 1M06G 2DU1A 3M2MA 4LE3A 3VB9A 4OI2A 3BPSA 4TZDA 3LOBA 2HWE2 3OJBA 1RUI3 1DYOA 2VZ3A 3J7HA 1MEC1 4JVAA 1WW6A 1ODMA 3B9CA 1R092 5LATA 2VNRA 2WN2A 4FPFA 5FZHA 4BA6A 1IS4A 1UOFA 1W8UA 2B39A 2A5ZA 2C0ZA 2GSYA 2X09A 1JYCA 3MFCA 3H0OA 1SLBA 1CZSA 1FPN3 3RZJA 1HJGA 5CVRA 2A75A 3ZFGB 5C33A 2E33A 5C9AB 4OMDA 2ZGOA 4IEUA 1R1A3 4XYXA 3JZVA 4HFSA 2VL4A 4FFHA 4WZFA 3O1OA 4DXSA 4HN0A 2XL7A 5E1RA 4M4RA 1YFYA 4LO6B 5F5AA 3BIEA 3POEA 1A6CA 4NWVA 3VBOC 5IK8A 2VUCA 3IMMA 1H0BA 1OD5A 3I7DA 1WA6X 4Y4RA 1RMU3 4LEJA 3RQ0A 3TN91 5LY1A 2B9UA 5FP9A 1PGL2 4RR3A 1QU0A 1NCRA 2BNOA 2EVXA 3ZR6A 1ZBA1 1ND3A 4FPCA 3BCWA 1S0IA 2X5IB 2YBPA 5J7MA 1LAJA 2F4LA 2H6CA 2VVFA 1O8PA 1PHMA 5A7SA 4YW6A 4WM8B 1WWYA 5DN2A 2VZPA 3AYCA 3K4DA 4QX1A 3WG1A 2CY6A 1JU4A 4HXCA 2R6QA 5KR7A 1XYNA 1AYN2 2W47A 4JZRA 4LITA 4I2OA 1FNYA 5DMYA 1DBNA 1SBFA 4COYA 4DZGA 1EUUA 4PBOA 1W6NA 4XIOA 5IHRA 1H9WA 5LA0A 3RS6A 1C8M2 4YGDA 5LCWL 2AACA 4DINB 3FFQA 2YGLA 2H0VA 3HBKA 4ZU7A 3ELNA 5FZOB 1FNZA 1GWKA 2XUMA 1AR81 3MUZ1 4DXRA 2GH8A 2VZVA 4GH4C 3B02A 4LK6A 4LOTA 3H8OA 3CJIC 1TMF3 3GJBA 3AKTA 3TEXA 3I59A 5F32A 4CDWA 4IV3B 1MS4A 3L2HA 4FAGA 5A7WA 5D21A 1JI6A 3A22A 1J1TA 1KS5A 2PN5A 1I3HA 1MVQA 4X6QB 1W28A 4IE6A 2WFF3 4K40A 4PQ9A 4IEPA 4QHOA 4E4DX 1HLCA 1K5MC 1TG7A 1UKGA 1JTZX 2WT0A 3POBA 3NQHA 4FOYA 1ZM1A 4RS5B 2GH2A 3E6BA 4QQLA 1DGWX 5FY9A 4U2AA 2QQJA 3LD8A 2JICA 3BVCA 2D40A 1BQPA 1YNAA 4LXLA 5CNAA 2ORXA 1YI7A 1HKDA 2X8KA 4J25A 3MDPA 5F6LB 4BXFA 3JU9A 1GQPA 2A70A 4XMAA 1WD3A 2DVAA 3APBA 3H8UA 5FXXA 3S6PA 5FLIA 2L9LA 1JXNA 2YU2A 4D0QA 1MS0A 1RHI1 1LOEA 2WBKA 1EP0A 3A7QA 1UY2A 2J1UA 3TYJA 4PDWB 4A42A 4N43C 1TNFA 1CAWB 1UXXX 3WSOA 5AC91 4UW4A 2QQUA 2HYXA 4GH4A 5FO8B 3CJIA 2J1TA 1GNYA 3LSEA 1VBC1 3OG2A 5EPAA 1UPSA 4LMFA 4YRDA 4UF0A 3UKVA 3WNNA 2VD7A 2AH2A 2G9ZA 3FJSA 3I3MA 4FPYA 1SQ4A 3K75B 4Y5TA 5EFUA 1WKYA 3PIJA 1K5MA 2XVLA 5L7OB 3O0WA 3OD4A 2BDRA 3SC7X 4AI8A 2RG4A 1ENRA 3NMBA 3VKOA 5L9RA 1CAXB 1NQDA 2ERFA 4AEDA 1WBFA 1QEXA 1HN0A 1RJ8A 1BK0A 3NKTA 4OUSA 4OFGA 2CHHA 3WNPA 4D69A 4E2SA 4IDZA 1S55A 5FUPA 4HK8A 2YROA 4Y1UA 1SCRA 1Z0HA 2QQLA 4XEZA 1T6GC 3WV6A 3CLPA 3ES1A 3VBHC 1POQA 1O4YA 2HWF2 4DEVA 3ILRA 1PVC3 4WBBA 1GFF2 1GMMA 4BQ3A 5A7PA 1GZCA 3WNOA 3OOXA 2RM23 4QPGB 5K0UC 4B3NA 2A6ZA 4XUQA 4N7IA 2QQPA 4PJYA 2CWMA 1ASJ3 5CB7A 4B4PA 1UZVA 4YW7A 4S2FA 4YVSB 4QGMA 1EAH2 3GJAA 4WV8A 5IWFA 4ITCA 3GBGA 2P1BA 2HKXA 5FYBA 3UGFA 1KXGA 2PXJA 2YG0A 4Y24A
chains in the Genus database with same CATH topology
1DGLA 3D4KA 4XDQA 5BXXA 2RE9A 5I8TA 1LHWA 1HDKA 3IIAA 4AEMA 1QY4A 4QM9A 2R0FA 2G9GA 2YGMA 5H9QA 1O7FA 2JG8C 4KQ7A 4XW3A 5AFBA 5CAZA 4Q4X3 1O3RA 1MR5A 2A73B 3B01A 1NG0A 2HWC1 2D97A 2RS32 4J6GA 3VN4A 5FO9B 4YM0A 3H3UA 2F4PA 4BIFA 1QJY2 3ZDSA 1O3TA 4PIZA 5K0UA 4BHPA 2AUYA 1G9FA 3J8F1 1S2BA 3AZWA 1BVP1 1B35C 3NWKA 1BXHA 3USSA 2ATFA 1WD4A 1QHDA 2FMYA 3HMYA 5KHGA 3PVBB 2ZMKA 4XTMA 4JQRA 4KWLA 2JX9A 2R042 4OHZA 3G7DA 2JE7A 1VBD3 1WW4A 4FPOB 1X8MA 4XFCA 3I54A 3JD73 4HL0A 4AGVA 4KNCA 2NMNA 3KLSA 2YXSA 4C0BA 2KXLA 3PNAA 4XE9A 4AVAA 5TSWA 2G4IA 2JG8A 4OHYA 2DCZA 1RUE3 1ZVFA 3H1WA 1NCRB 1WMEA 4PCRA 4RR3B 4UBGA 4XF3A 3EQEA 1ND3B 2R071 4XBLA 1XU2A 1EV13 5C4WC 2GC0A 5JSRA 1PO22 3TOJA 3A4UA 3HIFA 4QGNA 5LRRA 5FFOC 5DDJ3 3AP7A 4ZKTB 1PK6B 2UWCA 1J1LA 3WR0A 2ZGMA 1V9U3 2ARXA 1B35A 1W6MA 1W6NB 1COV2 2YMZA 3T1MA 3WW4A 2BFUL 5EV7A 1VB4A 1WCDJ 4YW1A 1OKQA 4QM8A 2QNKA 4XJ9A 4BMEA 5IK5A 3MLKA 3L2YA 4YGBA 3I59B 4WM7A 1DQ0A 1RUG2 3KMHA 2Y0OA 4CDWB 1NE4A 2JDZA 4XFGA 1YIPA 2JE9A 2W68A 5GZEA 2DTWA 2F6BA 3ZX7A 1QQP3 4F83A 2OUJA 2QJVA 4FP2A 3OD0A 5C4WA 1TME3 1UIJA 1NCQC 4XTPA 1VBA3 4KU8A 4N7UA 4DXZA 2DV9A 2HEWF 2OW4A 3EJKA 2WQ4A 2JENA 4PLMA 2ETEA 5FOJB 5FLJA 1EPWA 4TYSA 4QPIB 1ZZCA 4I01A 3WX5A 3SHRA 1SBDA 3IBMA 4MGIE 3B69A 2ZGPA 5A3MA 2R0HA 3ENRA 3M3CA 3QLQA 3ZVXA 4LBQD 2VECA 1YFUA 4GH4B 3MF6A 1GANA 3RPQA 2R1BA 3TNQA 1DZQA 3DL3A 5KC6A 4Y20B 1FMD1 1DIWA 4XF1A 1AVBA 3ZIXA 1SLLA 1YO8A 2W39A 1SBEA 4X8PA 2P2KA 3N4MA 4DB5A 4DOUA 2P34A 1ND2C 1NCQA 5E16A 4CDQA 1MQTC 1LGNA 4L92A 4AEDB 4OHXA 1NXMA 1AHSA 2WS93 1JN2P 1AX1A 5JI7A 2EF6A 3KD4A 4GMP1 1Z7S2 2ZKLA 4FO9A 1TNRA 1EYBA 2R061 4N9HA 1IKQA 2P3JA 2ZZQA 4HKWA 3VBSC 3SXWA 3GZTB 3KCXA 2EXIA 3BTAA 5GJ6A 4D94A 4MX3A 4LBQA 3OGJA 4O9GA 1UZZA 1LOCA 2ZBJA 4WV8A 4RQPA 2KA3A 1Q8PA 2D3SA 1HXS3 3FUQA 2QCSB 5HCFA 4CDXC 1DU3D 3MW3A 4YW2A 1F5JA 3VZMA 2PTMA 2R1DA 4D7YA 4MSVA 5ACA3 1UPIA 2Q5TA 1PO13 1ND2A 3MYXA 1VBE1 3AMPA 5J36A 3VGIA 2XKPA 3ZYPA 4DPNA 3N7LA 1JYIA 2AZ5A 1MEC2 1N1SA 1IHMA 3MIHA 3ZN5A 1LGBA 2ZTNA 1N47A 1RUD3 4EROA 3N3HA 1ULEA 1X36A 2Z69A 3LWCA 1VP6A 3VBSA 3ECQA 3JBG3 1NZCA 1RUJ3 1J58A 2YUEA 2ZJCA 4OHWA 1HV1A 1OFNA 1JBCA 2BUKA 4X6RB 1A8DA 1V6LA 4MYEA 1BMV1 5AVPA 4JCKA 1H30A 1DF0A 2HWF1 4LHNA 4CDXA 2HWB1 2C9AA 1TQ5A 1AR91 5I0TA 4G4FA 3TN92 1GQGA 1JOJA 5C9AC 4MGZE 4YVWA 4R4ZA 1ZBA2 2XLAA 1RVF3 5I0UA 4L2NA 3T1LA 1AJKA 5F1RA 2VW1A 4N9IA 3U4XA 2ZGLA 2FZ2A 3HAGA 1N3OA 4Z2WA 5ABJB 3OTFA 2X5IC 2OA2A 4JRLA 4EN7B 3PMSA 4ONUA 1RUH1 5SV5A 1DQ2A 2IFRA 2PAMA 3PTYA 1O4TA 4DRRA 2RMU3 1B35B 1W6MB 2XGXA 3LZZA 4AGRA 2Z5WA 5DG1A 4ISQA 3WP5A 1LESA 3LCPA 4FP3A 4ORFA 1SACA 3WDYA 5C9AA 1F8VA 1KFXL 1RB8G 1Y9QA 5JPMB 1GQHA 4COZA 2RJKA 1RUF2 2ZGNA 1D2SA 2AYHA 4WM7B 4JDNA 4IV3C 4E27A 4W6YA 3PLQA 1U5ZA 3O14A 3VLBB 1SLTA 3MLLA 2DFCA 5E89A 3SCFA 4Y1VA 4DRVA 4RS5C 2P37A 3AXEA 2X5IA 2GMPA 4Q0PA 3TBDA 1LULA 1RHI2 2D6LX 5GZGA 5LRSA 2H0BA 2RS12 3D6EA 4S2GA 1MVEA 1UU4A 2LUWA 5AC92 3AYDA 1OA3A 4XQDA 1TE1B 2VQ0A 4GA9A 1VBC2 3PJYA 1PO21 5JI9A 2CWSA 1Q56A 5F5QA 1YWKA 4I0WB 1AL23 4SLIA 1HRV3 2Q1ZB 2WKKA 3FZ3A 4C1XA 1UU6A 3GBFA 3POYA 1WUVA 2W52A 3VHNA 1LENA 3VL8A 3CEWA 1PIV3 4FXGB 4AVSA 4C91A 4CDQB 3VHRA 5B2GB 1R081 1RITA 3RMYA 3BOPA 4H7LA 4P9IA 1V6IA 3SISA 1BK1A 3ZPYA 1O5UA 2JKBA 3JB4C 4XBNA 2Y26A 3NVCA 3BALA 3AP6A 3HR9A 1CESA 3TWIA 3AZYA 3GBWA 4Q2FA 4RL7A 1CAWA 4RQPB 1OSGA 4QPGC 5CG9A 4IEYA 1CAUB 2BW8A 1POV0 4IEWA 5J37A 2CTVA 3HT2A 3WXPA 1NOVA 4YVSC 4XQWA 4K3UA 3WQ7A 1QH7A 3UKTA 1LTEA 1ZX5A 3M8LA 1XXNA 3RYPA 3VUOA 1UL9A 2DWRA 1HV0A 2HWC2 2Q8OA 1ZNPA 5IK7A 4FQZA 2WT2A 2WL1A 1ZBE3 3R05A 4BQ1A 2K2SA 2R49A 2WSUA 1FOD1 4MGKE 5DXDA 4AVVA 3M7AA 5L19A 2RHPA 1PZ8A 3QH6A 1H1IA 2XH6A 3J8F2 1OPMA 2D43A 2ZHKA 1JH5A 4MUVA 4M0NA 2GMEA 1LHUA 4DFSA 4RSUA 1FT9A 1GKBA 3WDXA 3NV1A 4YG3A 1IS5A 1SDWA 1Z7S1 1GZ9A 1JUIA 2JG9B 4PLNA 3ZXLA 4ASMB 1OQ1A 1POV3 2WNEA 2B45X 4CDXB 5FBZA 5I91A 3ZSMA 1MS9A 2HWD3 4P9JA 4BYYA 3RJ2X 1XE8A 1O4ZA 1AUYA 1KQRA 1N1TA 3MICA 3H1MA 5L36A 4YVWB 3V0BB 2NMOA 2VPVA 3DGTA 2R072 2A3XA 2RR13 1HIXA 1AR61 2HYKA 1J59A 4AFDA 3LAGA 2Q0AA 2K9ZA 1IS3A 1FAYA 4JTNA 3DKWA 2XBO3 3ZXKA 5FPXA 1QOOA 4K6BA 4RR3C 4CZSA 1NCRC 1WW7A 1ND3C 3RZZA 1WW5A 1LEDA 4LBJA 5FPZA 2WNVA 1MS8A 3AFKA 2QZ2A 3O0VA 4I09A 4V1PA 2R32A 2UYAA 2O1QA 4K20A 5DZFA 3CNAA 1PM7A 4XFFA 1RUOA 2MNGA 4DNYA 1PK6C 1YJLA 1LB2A 3IDBB 4P9LA 3B5LB 3WVJA 3QOPA 5DUXA 5EYXA 2ZA9A 2GC2A 3SH5A 5IT6A 4F3JA 2X53S 1KJRA 2V73A 2DVGA 1MS3A 2XVKA 1H2MA 3IT8A 4FOWA 1EY2A 2H6BA 2W0XA 1JHNA 5CFDC 5E8AA 4CDWC 4ATFA 1D4VB 5C6CA 1AR71 3C3VA 2YPJA 1LRHA 5I0SA 5JZGB 4JAAA 2BVVA 4DY3A 3Q9OA 4M3CE 1ZZ9A 1UN1A 1C57A 4B29A 1VBB3 3HQXA 2ET7A 1PK6A 2DU0A 2VOVA 3KGLA 2E7TA 3PJQA 4QPIC 2PA7A 2ZHLA 2VH9A 2XJTA 3D0SA 3J26N 2GNBA 1U5YA 4NOTA 1FMD2 2D5FA 2IXCA 1RUC3 4LUMA 4Y1ZA 5CBLA 2XJSA 4NR1A 1WCKA 4QX5A 4BE3A 4YM3A 5BNNB 3VBUB 1HRI1 1VALA 2DCTA 5CFDA 2XJRA 2HWE3 3V0AA 4XJZA 1Q43A 2GC1A 4AWDA 2UU8A 1Y3TA 4FT8A 3N35A 1VAVA 3WHUA 1R093 3H1YA 4AHXA 3ZN4A 1RUF1 5KBFA 3VBRA 4CP2A 5I0RA 2R062 1D4M1 4YZ1A 1RGSA 5DUWA 4AEDC 3CO2A 4M00A 2E9QA 1QXPA 3M3IA 4R8HA 5JLVA 1WMDA 3VZJA 2GALA 4YLZA 4ZU5A 1APNA 3N7JA 4PIXA 4QPIA 1QNYA 4YZ5A 4YYOA 3KZ4C 3IDCB 2RS11 4WVMA 4XJUA 4D7TA 4WVWA 4IEXA 3LA2A 2OVUA 2MEV1 3AYEA 4G3YC 2DCJA 4ATEA 4KG0A 5JIAA 4QXKA 1VBE2 4Y20A 4Q4W1 2P3KA 5EXOA 1QJU1 3ZSKA 4HKOA 1AYN3 2YYOA 3RDIA 1CQ9A 5HXVA 4LUKA 4QQOA 2ZAHA 3M4FA 4GULA 4YM1A 4RHV3 1C8M3 2PLV1 4COWA 1GSLA 3VL9A 1NLSA 2N7GA 4LBLA 3I4IA 2BNNA 4AVTA 1DZRA 1MZEA 1ZYBA 4EN8B 5T5PA 1DYPA 1MZ5A 3D0JA 1BMV2 5DUVA 1VRH1 1F2NA 1GICA 4AI3A 2HWB2 4AYUA 3KSCA 2LTNA 2VULA 1AR92 4HVRA 3HN1A 4Q4Y3 4XHBA 1YRZA 2GN7A 3ASIA 4XJWA 2B5HA 1O3SA 3H50A 2Z2SB 3TAYA 5HI0A 2D6OX 3ZO0B 4IEQA 3O0XA 4IEZA 3RI9A 4ISRA 1NXD1 4AXOA 2VNOA 2DF7A 2ES3A 5KHHA 1QWRA 1H8TB 1GNZA 4R52A 4EJRA 4YM2A 3RJRA 4X8NA 4LA2A 4FQ4A 1KDKA 2ZMLA 1RUH2 2XJQA 3VZNA 2GZWA 2I2SA 3A0KA 2BWAA 4MXWB 4Y1YA 5ABJC 3AJYA 1UCXA 3M70A 2WNVB 4QD2A 3WQ0A 2IXIA 4P9YA 1LHOA 4QMAA 1C5IA 1H1MA 5JSOA 1FX5A 1V9U2 2I45A 3U07A 2AR6A 2VMHA 1RUI1 3ZXEA 3MIBA 2A6XA 4HVOA 5DZEA 4IV1C 3NV4A 5J96B 2CNAA 2V09A 2XJVA 1WMFA 3AK0A 3BU7A 4GWMA 3FWEA 1A8MA 2BQPA 3IM0A 1MZ6A 1JW6A 1Z78A 2QDRA 1QH6A 4EV0A 3IWZA 1NQJA 1R1A1 4WM7C 4L97A 5K9YA 5JAXA 1YJKA 1KFUL 3B00A 3LGRA 3U0ZA 3CU7A 1CAVA 3ILFA 2EXHA 1VBA2 4I3GA 2AGSA 5ABJA 4LHLA 1FATA 4PF5A 3KM5A 1RMU1 1CX4A 3WP4A 3AZZA 2PAEA 4UW3A 5BNPA 1EAH3 4FOVA 3MEPA 2E7AA 2R16A 4HMZA 4Q8LA 4FTEA 3EXUA 1B09A 2XWBB 4ZU4A 3T2TA 4IV1A 2QE3A 2ZGTA 1Q3EA 2VU9A 4ES8A 3JB8A 5T54A 1BEV3 4BPZA 4DY5A 1GV9A 5EYYA 4JRAA 4FXKB 2B7YA 3FHIB 4YW4A 1QJX3 3EHKA 5CFDB 4E4SA 3P3PA 3V0AB 2E63A 4LE4A 4K1YA 4MH0E 1YXWA 2RS33 4XJAA 4RFT0 1R082 1WLCA 1QJY3 4TSVA 2IXKA 4B7KA 1FXZA 1BZWA 1TMF1 4AG4A 4COUA 2XLFA 5K7PA 3VBRB 5FAXA 1OHFA 5D8AC 4CDQC 2WS92 2QVSB 3NAPC 1U0AA 2VVDA 2WFF1 2XWJB 3AP4A 2IFWA 2SBAA 3HT1A 4OZXA 1DQ1A 2A6WA 4Z07A 1KS4A 1DFQA 2R043 2VY0A 1QF3A 3MIFA 4Y26A 2OPKA 3J4UH 2PYTA 4DMIA 5EZWA 4AFCA 5BNQA 3QBQA 4IQPA 2B46X 4WVMB 4F8AA 2Q30A 5HCAA 1A3KA 3UK9A 4RQPC 3B7MA 4XFIA 3B3QE 2ZGQA 4I02A 4AEJA 3FC0A 1DDLA 1PO23 1S2KA 1O91A 1FOD2 3GHNA 2VOKA 3R4DB 5GLVA 5I8YA 4LO4B 4AVCA 1PNGA 2ZCWA 3NV2A 4HN1A 4GXLA 5D8AA 1COV3 3NAPA 2B8MA 4INDA 4PLOA 5GZCA 1LHNA 4CEYB 3TNPB 1VLNA 4M0HA 4P14A 2GNMA 1RUD2 2XVGA 4XJ8A 1G86A 4HANA 2WLPA 1L3JA 1YYNA 4UBHA 1RUJ2 3M3QA 4Q0SA 4AHWA 1RUG3 4F7ZA 5JOYA 3SCGA 1WLWA 2Y0IA 1DQ6A 4Q4V2 5C8WA 4HPKA 3FLPA 4B4RA 1CAUA 3MLJA 1PVC1 2JG9C 4TLFA 1AR62 2D5HA 2WJSA 3AP9A 2WZPP 2VMGA 1AYM2 2RM21 4FVVA 3KCYA 5JWPA 1NA1A 2PQQA 1YUDA 4S2HA 2RS52 1ALYA 1ASJ1 2XJUA 4YVWC 4QHBA 4LBOA 4NO4A 1W6PA 3AMMA 4BZ4A 3ZXFA 3AM2A 3ZYRA 1TEIA 4I3PA 4YGCA 1N3QA