3AZZA

Crystal structure of the laminarinase catalytic domain from thermotoga maritima msb8 in complex with gluconolactone
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
250
structure length
250
Chain Sequence
EDWQLVWSQEFDDGVIDPNIWNFEIGNGHAKGIPGWGNGELEYYTDENAFVENGCLVIEARKEQVSDEYGTYDYTSARMTTEGKFEIKYGKIEIRAKLPKGKGIWPALWMLGNNIGEVGWPTCGEIDIMEMLGHDTRTVYGTAHGPGYSGGASIGVAYHLPEGVPDFSEDFHIFSIEWDEDEVEWYVDGQLYHVLSKDELAELGLEWVFDHPFFLILNVAVGGYWPGYPDETTQFPQRMYIDYIRVYKDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Laminarinase
publication title Crystal structures of the laminarinase catalytic domain from Thermotoga maritima MSB8 in complex with inhibitors: essential residues for beta-1,3 and beta-1,4 glucan selection.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 54
structure length 250
sequence length 250
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.39: Glucan endo-1,3-beta-D-glucosidase.
pdb deposition date 2011-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3azzA00
3IPVB 2GN7A 5KXDA 4YW1A 3OY8B 1MS0A 3AJZA 3NV4A 3UJQA 4AVVA 3N36A 3UJOA 1Q8PA 2W39A 1QKQA 2GMEA 4Y20B 1IS5A 1KITA 4WVVA 5HCBA 3WUCA 2ZHNA 4YZ1A 5DUWA 2ARXA 1YYNA 5GALA 4AVSA 3AYAA 1WCSA 2LTNA 4P9WA 3U4XA 3VKLA 3RRDA 1ENRA 4PF5A 4LBJA 1F5FA 1CIWA 2D6KA 4Q8LA 4BQ1A 3VKNA 4XJWA 1JUIA 4FPFA 1LODA 1W6PA 5DG1A 1UKGA 1V00A 4YZ5A 3RS6A 3POSA 1FYUA 1IS3A 4K1ZA 3O0VA 2D6MA 2ZGQA 2V73A 1W6NB 1S0DA 2OUHA 4ZXKA 3V64A 1LOGA 4FPHA 3AYEA 2JKBA 4UW4A 4XBNA 3RSJA 3SH4A 1N47A 3AZVA 1AZDA 2R0HA 5F5QA 1LHVA 1SBDA 5DXDA 3TAYA 1WW5A 4TZDA 3MW4A 3W58A 4YLZA 1G9BA 2GN3A 1GZWB 2PELA 2D7FA 4RA0A 1WW7A 4C1XA 4BOWA 1W0PA 2WQZC 2D3SA 4Y26A 4RL7A 1X50A 3AP9A 5GLZA 3WG1A 3H0OA 4P9YA 1LGBA 1N1YA 5HCAA 5E89A 2H0BA 4W65A 2V5YA 1Z78A 3I4IA 3N35A 1CONA 2A6XA 4NO4A 3R4UA 2ZGPA 1I1EA 3QCWA 3GNEA 5JVVA 1KDMA 4TYSA 5HCFA 3L2YA 2UU8A 1HQLA 5JMCA 3N7MA 4LBNA 4BLJA 3OJBA 4YM1A 1C1FA 2CWSA 2EAKA 5GM0A 5IT6A 3NV3A 2YMZA 4ZKTB 1GBGA 1A3KA 1KQRA 5KXEA 4XYXA 1GKBA 3AK0A 4BLIA 2ZGMA 1GYKA 3O12A 1BKZA 2EXIA 1QGLA 2I2SA 1CN1A 2P37A 3WHUA 1CJPA 1VAMA 1QU0A 3ZXLA 1YO8A 4Y1UA 5H9QA 2VW2A 4Y24A 2ZZJA 3ILFA 5IUQA 1MR5A 4GKXA 5L73A 3VUOA 1ENQA 4K21A 3V0BB 3AX4A 1GANA 3BOPA 1N3PA 1LOAA 1ULDA 4YG6A 1YI7A 5DUXA 2DWRA 3O0XA 1IS4A 2R0FA 4Q1PA 3SISA 1SBFA 2D6OX 2W08A 3PMEA 1UN1A 2DVAA 4FOYA 3LSEA 1I3HA 3POYA 1D0HA 1SLTA 3AXEA 3WDTA 4Y22B 2DVDA 1IKPA 4FQZA 1QOSA 4Z8BA 2YROA 1CPMA 3AXDA 1N1SA 1MVEA 1UPSA 4YG3A 1LGCA 2A3WA 4K1YA 4XMIA 1XQNA 1S0CA 2P3JA 1ULFA 2DVBA 4YGCA 1V6LA 3O0WA 2A70A 3OBTA 1Q56A 1Q8QA 3B01A 2DU0A 4U36A 5H9SA 4M3CB 1W6PB 5GLWA 3PVNA 3AP6A 1SFYA 4DRRA 3WLUA 2UWCA 1AVBA 4AVTA 4XXAA 2ERFA 1C1LA 2D6NA 1S0JA 4PCRA 1DQ4A 1OQ1A 1TEIA 3PVOA 1W6OA 5T54A 2C5DA 2CNAA 2D3RA 4AGRA 1GLHA 2WSUA 5DZEA 2CY6A 1SCRA 4FVVA 1V6OA 2ZABA 2W68A 1AXKA 2A3XA 4XIOA 1JW6A 3UL2A 2D6LX 2W52A 4ISQA 3VKOA 3C2UA 1JXNA 1WBFA 1WLWA 4FOVA 1G7YA 1GNZA 1LOBA 1RITA 1UAIA 2A6VA 2GDFA 4YZ4A 2ARBA 2VUAA 3AYCA 4XHBA 4C1WA 4CZSA 1MS3A 1ZM1A 5EWSA 5FRAA 3RG0A 3GALA 4DPNA 1ULEA 4JC1A 3WZ1A 1N1TA 2EXKA 2R1DA 4LBQA 4FPOB 2DUOA 2AUYA 1DYPA 1RIRA 3ZSMA 1O4YA 2UWBA 1PZ7A 3BIWE 1QNWA 1LEDA 2OW4A 4YZ2A 5CA6A 1D2SA 1LOEA 1LTEA 1WD3A 2PHUA 3N3HA 4XJ8A 5FREA 5BYNA 2EXHA 1HDKA 4XE9A 2EIGA 4GWMA 3R4SA 1SLIA 2ZGRA 2JDZA 1JYIA 1BQPA 1Z0HA 2YXSA 2WKKA 5GLUA 1AF9A 1MS5A 1AX2A 5LK5A 4YM2A 3MEPA 3ZYPA 2JECA 2ENRA 5T5OA 4Y1YA 1H9PA 2UURA 2UWAA 5AVAA 3FUOA 4XBLA 4Q8KA 5EYYA 3NV1A 3WDWA 4M3CE 4YM0A 1HLCA 2D3PA 4LBOA 4XTMA 1WLCA 3FFZA 5GZDA 3JUUA 2E7TA 3UK9A 2TEPA 1DQ6A 3AP4A 1YXWA 1FV3A 2DVFA 1WBLA 2GNMA 3ZPYA 5EYXA 5T5PA 5JDBA 2AGSA 4FPCA 1DQ0A 2R16A 1MZ6A 4PBOA 2PHRA 3PJQA 3D4KA 5T5JA 2ZHKA 1MS9A 4FPYA 3FUQA 4YZ3A 3WHTA 1LESA 1H9WA 2A7AA 3V0AB 5KXCA 2R49A 3M3OA 4BM8A 3NV2A 4YW4A 5GLTA 2VXRA 4ASMB 2YZ4A 1OKQA 5IK4A 2WNEA 3SITA 1LULA 5GZFA 2AYHA 5T52A 4GXLA 2AH2A 2SBAA 2GNBA 2A6ZA 2NMNA 3IKWA 1DFQA 1SBEA 3IPVA 3FLPA 3DUIA 3OY8A 1LOCA 1W6OB 1ENSA 2E6VA 2ZGKA 4DS0A 3N7LA 4Y20A 1QDCA 4P14A 1UZYA 3D5OA 4FOQA 4F83A 1LU2A 1Q8SA 1WUVA 1W0OA 1G9AA 3AFKA 1V6MA 1PZ9A 1SCSA 5T5LA 3T2TA 2OVUA 3HMYA 1S0GA 3WG3A 4AWDA 1DQ1A 2Z42A 3AZZA 1AX1A 1CESA 2E51A 3MW2A 3A0NA 1WLDA 4M01A 3VKMA 4JCKA 1JOJA 1CQ9A 2DVGA 3MPPG 3Q9OA 2AR6A 2D44A 3LSDA 4WV8A 2ES3A 4Y1VA 4NOTA 4ATFA 1J1TA 2AREA 4YFZA 2NP0A 1FNZA 4LBQB 4Q2FA 4YW2A 1JBCA 4FP3A 2YV8A 4JRAA 3CNAA 2EXJA 1V6KA 4XJZA 2ZGTA 3AYDA 2JE7A 3OBRA 4ISRA 5E8AA 3SLIA 1MS8A 2PHWA 2CL2A 2ZBJA 2ZGOA 3M1HA 4WVWA 2ZGNA 4K20A 1N3QA 5T55A 3AP5A 3WDXA 5JOZA 2YY1A 2R1BA 2VH9A 2P34A 1DBNA 5JLVA 1Q8OA 1KJRA 1S0FA 2B7YA 1W6QA 1QOTA 2XB6C 1Q8VA 4Y1XA 4R9CA 1LHWA 1WD4A 4LBLA 4SLIA 2LALA 1DHKB 3IMNA 1G9DA 1NLSA 2ZKNA 1KJLA 2EF6A 5CB7A 3KM5A 3M2MA 2DURA 4L8QA 3WNXA 4XXPA 2NN8A 1AX0A 2ZHLA 1U0AA 2JE9A 4UW5A 3WG4A 2ZMKA 2RHPA 1V6JA 1LECA 4PBPA 1LOFA 3VV1A 1EPWA 1JYCA 1OFSA 3A0KA 1A78A 1SLAA 2CTVA 2E53A 3V0BA 4LBKA 3OGGA 5SV8A 2C9AA 4FOWA 3FLRA 3T1LA 3WCSA 2KM2A 2A5ZA 4FPGA 1SLCA 1AJKA 2WT2A 3ATGA 4LBMA 3AZWA 5E88A 3ZSJA 1VALA 4YG0A 4XIKA 4CTEA 1MS1A 1V6NA 3ZXFA 3DGTA 1F31A 1GZCA 5GZEA 3SNMA 4M00A 1G9CA 2VW1A 3LCPA 2A6YA 2D6PA 4CRQA 3HN1A 3AP7A 1BXHA 1WW4A 1YIFA 2GALA 1W6MA 2GNDA 1DQ2A 3AZYA 3B9CA 4D69A 4IQPA 4AGVA 1HKDA 1GNHA 3MW3A 1UX6A 4XBQA 1BZWA 1ZA4A 2WSVA 4FP2A 3FLTA 2JJ6A 2NMOA 5H9PA 3W59A 2GNTA 3BTAA 5EXOA 1LJ7A 2VU9A 3RQ0A 1UL9A 1CR7A 2GMMA 4P9XA 4M3CA 5IK8A 4XMAA 5GZCA 1S0EA 3OYWA 1LHNA 4BMEA 1JN2P 2Q5TA 2CWMA 1HQWA 1V6IA 2DU1A 3M3CA 1CVNA 4FPEA 3IN9A 1AJOA 3O5SA 3OPZA 1KDKA 3WDUA 1RINA 2ZAAA 4XJUA 1FATA 2FHRA 1O4ZA 1VAVA 4R9BA 5DZGA 2XG3A 4Y1ZA 5CBLA 2WLQA 1PZ8A 4XTPA 5JOYA 1DZQA 5GZGA 5IK7A 2ZGUA 3ZVXA 2DUPA 2PHTA 4M3CF 3ZYRA 2DTYA 1QNYA 1FX5A 1F9KA 2DYCA 1DGLA 1LENA 2AENA 3USUA 2DTWA 1R1ZA 2ZGLA 2P3KA 2CYFA 3BODA 2D43A 3N7JA 2ZA9A 5JOWA 4GWNA 3VKFC 4YFWA 1W6QB 3FBYA 2SLIA 4UW6A 4OZXA 1LCLA 3ILRA 1QF3A 4BPZA 4PQ9A 1H30A 1CPNA 4GA9A 3M3QA 4R9DA 4YGDA 3ZXJA 5GJ6A 1SLLA 3QLQA 1AXZA 4U2AA 5IK5A 3V65A 1BYHA 3I8TA 1LGNA 2OUJA 4HL0A 1MZ5A 3SH5A 3KQRA 5F9TA 2GMPA 4ATEA 5DUVA 2A75A 2NM1A 1ONAA 1LEMA 4H55A 1LOFC 3B69A 1UMZA 5CNAA 2BQPA 1W6NA 1QOOA 1G86A 3WG2A 4AYUA 1B09A 3RMYA 4YGEA 4FPJA 1UZZA 4KBBA 1NXD1 1QMJA 3IM0A 3ZXKA 4LBQD 1BJQA 1G8WA 1C4RA 2VY0A 1APNA 1FAYA 3JU9A 4XDQA 1GZWA 1JHNA 1LHOA 1S1AA 4GKYA 4YW3A 3ASIA 5JOXA 5DG2A 1MACA 3ENRA 4BMBA 3APBA 3RMXA 2WT0A 3AJYA 3AZXA 3PVEA 1GZ9A 1VIWB 2P3IA 2PHXA 4HANA 3ZSKA 3WV6A 4DFSA 5CAZA 2ZHMA 3B00A 4Y22A 4DQAA 4GALA 3POWA 2JD4A 1W6MB 4ITCA 3WDVA 3INAA 3WCRA 5H9RA 3NWKA 4XJAA 1Y7BA 2ZMNA 4XZPA 4YM3A 4XJ9A 4FPLA 4FQ4A 1GV9A 1FNYA 2WT1A 4WZFA 4XOGA 1S0IA 3V0AA 4MYEA 3TB0A 2E7QA 1URXA 3R05A 1DLLA 1N1VA 3WDYA 2G4IA 3ZXEA 3ILNA 4XILA 1WW6A 2DV9A 1DQ5A 3B3QE 4Q26A 2P2KA 5T50A 1N3OA 3SH3A 2A3YA 1AXYA 3OYWB 5DZFA 2A71A 1SLBA 1ULGA 3A4UA 1MVQA 1MS4A 4UW3A 4DRVA 1DYKA 1QDOA 2WJSA 1LHUA 1YRZA 1KRIA 3D6EA 4YW5A 2NZ9A 1IS6A 4XHXA 1LU1A 2ZMLA 3M3EA 1FV2A 5KXBA 1IKQA 1ULCA 2FMDA 1C57A 2VW0A 4I30A 2ZGSA 3ZSLA 4AGGA 2ZACA 1G9FA 2NYYA 1S0BA 1DIWA 4R9AA 3T1MA 2DUQA 4FPKA 1SACA 4Q1RA 2HYKA 1A8DA 4YGBA 3HR9A 5DUUA 5GLVA 4Q27A 1GSLA 2A6WA 3WUDA 3WVJA 2PHFA 3USUB 1GICA 3WOGA 1VLNA 3N7KA 1IOAA 2EALA
chains in the Genus database with same CATH superfamily
1AR82 5KXDA 4Q0SA 3LGRA 2MEV2 3OY8B 1MS0A 1NG0A 2HWE1 1OA2A 3NV4A 5DDJ1 5FZGA 3N36A 3UJQA 3UJOA 1WMFA 1SPPA 1UZVA 2GMEA 1WWYA 2ZHNA 5GALA 2PN5A 4AVSA 2LTNA 4ZS3A 4B8EA 5FJHA 3FWEA 1HW5A 4PF5A 1CX4A 4LBJA 4QB1A 3BUCA 3K4DA 4N53A 1CIWA 1VBC3 4Q8LA 4DEVA 4XJWA 3DCQA 3M7AA 4IETA 1UMHA 5DG1A 3ZLIA 4PDWA 5LASA 1XSQA 4KMQA 5KWRA 1OVSA 3ACIA 4JZRA 1K5MB 1RUG3 2CSGA 1SFNA 3RZZA 2Y0OA 2CGNA 1K45A 1W6NB 2BVVA 2OUHA 2Y6KA 4ZXKA 5IHRA 5K9YA 1HRV2 4FPHA 4P9LA 2OZJA 5F5IA 2JKBA 4UW4A 4LULA 3IMMA 3VBSC 2RDQA 3H3UA 5LA9A 2YGMA 3ZR5A 2XHKA 4D6RA 1LHVA 1SBDA 1JZ3A 2Z5WA 5FUNA 2ORXA 3W58A 2WZ8A 1J59A 1GZWB 4CCEA 5A7SA 1M4WA 2MNGA 2RR13 4ET7A 4BOWA 1O3QA 2D3SA 1TMF3 3GGLA 1MQTA 2XLAA 4JRLA 2Q1FA 1N1YA 4IXLA 1Z78A 2XKPA 5D2AA 1CONA 4CP0A 2RMU3 2VOVA 2QQNA 1AYM1 2QJVA 2ZGPA 4XEZA 3GNEA 5ABJC 3HNYM 3AVRA 1WMDA 5HCFA 5L7OB 5JMCA 3I59A 3N7MA 3AFGA 4BLJA 3S7EA 3OJBA 4CU7A 2IXHA 2CWSA 3H1MA 1ODMA 2EAKA 4I0AA 4Q4X3 5FYYA 4COVA 5LEJA 2FCUA 2YMZA 4ZKTB 1GBGA 3WW1A 4BQYA 4ARXA 4XYXA 3LIHA 3MV01 5FZAA 3WP3A 1Q5OA 2PFWA 3VL9A 4FFHA 3VBHA 1R64A 1WA6X 3O12A 5FXZA 2P37A 1QGLA 3GHNA 3UKTA 5BNPC 4LORA 4UFKA 3NO8A 4CPBD 1AR92 5FZ8A 2YU2A 3PL0A 4Y24A 3POJA 2ZZJA 2VJXA 4LR4A 4XF0A 4AF9A 3V0BB 2QQKA 2X05A 3IDEA 1N3PA 3SCFA 4YG6A 1YI7A 1ZZ6A 4AHZA 4B4QA 4BB3A 3O14A 3O0XA 2PA7A 2UYBA 3PTRB 2R073 4DZGA 4BQ5A 2D6OX 4UBHA 1BEV3 4QQLA 5C70A 1PO22 3E97A 3OG2A 4R4ZA 1OH4A 2CAVA 3LSEA 4Q5OA 5JIUA 2JB8A 3ZKYA 2DVDA 3I2JA 1IKPA 4AAPA 1QOSA 1RUF2 4Z8BA 5HPOA 2QDRA 1CPMA 1POV3 4TXWA 3HNMA 4AL9A 2WIIB 3LA7A 2R043 4BQWA 4XMIA 1RUE3 4RGAA 1ULFA 4YGCA 3N9OA 3CZUA 1JHJA 4N53C 3BOWA 5FYVA 2Y6HA 5C4WA 3TBDA 1KGYA 1Q8QA 1VBB3 1W2UA 4DIQA 5FMDA 1SMVA 2WS91 2XQRA 3B01A 2DU0A 1DGRA 3ZR6A 2RVAA 1UD1A 4PDWC 3I7DA 3PVNA 3AP6A 1I6XA 1UY0A 4UAPA 3WF3A 2G9GA 1OC1A 4EWAA 1AVBA 2JG8B 2VMIA 2HWB2 4DUVA 2VZPA 2VOXA 2J42A 1S0JA 1JYTA 1S4CA 4PCRA 3NKTA 2RS13 4XCAA 4GMP0 3PVOA 4Q4Y1 4RHV1 3PU8A 1FOD2 1R083 4LUKA 3UYJA 4PIXA 3JD71 1H4GA 1VBD3 4N43A 1V6OA 1WMXA 1AXKA 2WZR2 3WNNA 2WYSA 5FPUA 3E6BA 3E6DA 2W52A 2JWPA 4WM7B 3VKOA 1AR72 4G3YC 5FZFA 3LFIA 1MQTC 1RITA 1UAIA 2A6VA 3WY6A 3THPA 4B7KA 1ZNPA 3ELNA 3W5NA 5FXWA 1REDA 3ZFEA 1MS3A 3TOJA 3AVSA 3RG0A 1MEC3 2QQJA 1RVF2 1N1TA 2EXKA 2VNGA 1DP0A 4HT1T 3UGFA 3CBNA 2VVDA 2JEMA 5ANQA 1HN1A 1COV3 1RIRA 4Q0VA 3EMRA 2W92A 4HN1A 1PZ7A 3NAPA 3MUZ1 4LHNA 4UWDA 4NIIA 4QKBA 3VZNA 1W8OA 4M4RA 5F7UA 3I2DA 3N3HA 1JS9A 5FREA 4XACA 3PUAA 5BYNA 1FPN1 2EIGA 3MIEA 3VBHC 4XC9A 3ZMOA 3R4SA 1SLIA 1WCQA 2VZRA 2JDZA 2DCTA 1BQPA 1Z0HA 5F8PA 2YXSA 2WKKA 4COWA 3DL3A 1NYWA 1AL21 3HBKA 3HN3A 3RZGA 2HWC2 4YM2A 3ZYPA 4JGYA 3RJRA 4AQTA 2C24A 4IEUA 4IGQA 1UYZA 4URTA 2XH6A 1QJEA 2UURA 1ND2A 2VQ0A 5JXJA 2X5IC 2FCTA 3MIHA 5A70A 4QKFA 5AC93 5FZBA 1YFUA 4D0QA 5D8AB 5A32B 1AR61 1VBA2 4XFCA 2X10A 2E7TA 3H1YA 3K3NA 2WQ8A 4I0WB 4YVSB 5GZDA 3WNPA 4LO7A 2QQPA 3ZPYA 5JR7B 4CU9A 1T2XA 3AC0A 4KG8A 2YDEA 3BB6A 5DAWA 1LKNA 4MLOA 4K40A 1MZ6A 3U11A 1VRBA 2PHRA 1PK6B 3PJQA 4PQQA 4D7SA 4IE4A 2HWF3 3PMSA 1MS9A 3KV6A 4HONA 3LDRA 5JPNB 3WHTA 4BCUA 5C4WC 2GC3A 5D1IA 4YW4A 2CV6A 5GLTA 3VDDA 1QXRA 3LE0A 3VZOA 1W9FA 2R6QA 5F5CA 5GZFA 4LEJA 2MPFA 3M8LA 2RS53 3OUIA 4M4PA 3T3YA 5CKNA 3TN91 5A1LA 1O5LA 3IPVA 4BK5A 5FYTA 3FX3A 1W6OB 2E6VA 3UKVA 5F3GA 4I09A 3ZDSA 3ZFFB 4AEMA 2HWE2 4K8RB 5DDJ2 1W8ZA 2X8KA 4FOQA 1U5ZA 1HB4A 2R063 3TEWA 1G9AA 3VDBA 1SEFA 4HETA 4CUGA 4IESA 1DGWA 1PZ9A 3PDQA 4EN0A 4KGGA 4GB31 4DXTA 1KFXL 3I2GA 2Z42A 1QJFA 3NNGA 3OBAA 4PIYA 3O1TA 4QX2A 1YWKA 1WLDA 4M01A 4JCKA 3AMMA 5FZ4A 3MICA 3Q9OA 2AR6A 2D44A 4AI3A 4ATFA 3MI8A 4NOTA 1J1TA 2AREA 3MUY1 1UY3A 1FNZA 4LBQB 3PIGA 5G05L 4YW2A 1VBE2 5F3EA 1K12A 4BZ4A 1T6GC 4E2QA 4EN9B 2W3JA 3CNAA 1RUI1 3E5XA 4XJZA 2OS2A 4B4PA 3SLIA 2PHWA 3LD8A 2WA3A 1QJU1 2ZGNA 1TME3 1GOGA 1RHI2 2TBVA 4WVWA 5FP3A 3ZN5A 1N3QA 1UY1A 2VMGA 3B02A 5T55A 2LW8A 4OULA 5JOZA 1CAXA 2JKXA 4MGSA 3CU7A 3ZSEA 1H1AA 1M06G 1Q8OA 4L0PA 2JB4A 4JGYC 3CF6E 1CGPA 3RPQA 3I97A 1W6QA 1WA4A 3I3QA 4N7IA 1HQNA 4Y1XA 1ND2C 4H7LA 4R9CA 4GWJA 2Q4SA 1AYM2 1ZBE2 3WT3A 3CMGA 5C3RA 3EB7A 3NMBA 1OHFA 2ETEA 1RXFA 2BUKA 3IMNA 5FUPA 1PMHX 1G9DA 1QEXA 1QH6A 2IFRA 4EN6B 1RUC2 4L8QA 3WNXA 2YG0A 3ROUA 4HXCA 2W46A 5CIRA 5CG9A 3CQOA 3EJKA 2Y6GA 3WG4A 2ZMKA 4MGTA 2WNOA 3RDIA 4IDZA 1EPWA 1JYCA 3A0KA 5K4LA 1A78A 4LBKA 1WCDJ 4PI0A 1GZTA 1CAWA 5FP8A 2OKXA 2F6BA 3ETQA 3ZFGB 3FLRA 2YYOA 3T0AA 1OVPA 3VDDC 4IEZA 2WT2A 3ATGA 3ZYHA 4CCNA 5E88A 2FZ1A 3KVAA 2DCKA 3MF9A 4YG0A 4XIKA 4B29A 1MS1A 3ZIXA 1UO9A 3DGTA 4JDMA 1J3RA 3K51A 1DU3D 4V2VA 4OFGA 3SNMA 4BK4A 4CUAA 4C90A 5J3UA 1CX1A 4KH9A 3N9QA 2VUDA 1W99A 2VR4A 4GAZA 1W6MA 4ZZ8A 4WM8A 1DQ2A 2EA7A 2WN2A 3O1MA 5KHIA 4IQPA 4AGVA 1GNHA 2Q1ZB 4RS5A 4ZPIA 3RYPA 4XFHA 4CA9A 3NL1A 4CDQA 3CLPA 3I2OA 1BZWA 1VB4A 1Y3TA 3BTAA 5FYUA 4QU2A 5C3SA 1CR7A 4M3CA 4FXKB 1NCQB 4XMAA 2WS92 2XJSA 3JQWA 4KWLA 1V6IA 3M3CA 4MXVA 3WW3A 4RN5A 5FKCA 1GMMA 3OPZA 2XBO2 2HWD1 3OB8A 1RUJ1 4HZFA 5FZ9A 1RINA 5JIAA 4EE2A 1IGOA 5JZGC 4NR1A 2FHRA 1H4HA 1ULPA 4Q4Y2 3LFMA 2B46X 4RHV2 2VMEA 5LA2A 3ZXAC 2XG3A 3FFQA 1EV13 4Y1ZA 1W3XA 3ZYGA 1OOPB 2HH9A 2WFF1 1FI2A 1VMJA 4ASKA 3JB8A 1J3QA 4M3CF 1VRH1 2P17A 4WVMB 1F9KA 3F95A 5JCTA 4DO0A 2AENA 2YUEA 1YNAA 4RQPB 3VBFA 1QH7A 2CYFA 2D43A 3N7JA 1RC6A 3LEGA 1EAH1 4GWNA 4BH9A 2QZ3A 3EO6A 5FYSA 5FZMA 5ACA3 1PIV3 5JXHA 4K9SA 4P9JA 4A2UA 4HVOA 3THTA 1POQA 4QAWA 1R1A1 3DKQA 1Z7S1 3HVDA 4I01A 1SLLA 3E5QA 2O8QA 2BDRA 4MGIE 3I8TA 2OUJA 2IVJA 2PAEA 3SH5A 5C33A 1DF0A 4DMIA 2GMPA 1NT0A 3VLBB 1FPN2 2XJVA 2W2IA 3FL7A 1ONAA 4ZZ5A 1U5YA 5HV4A 1JU4A 3B69A 1QJX2 1UMZA 3VB9A 3WG2A 3RMYA 4RGKA 4JTNA 3OBZA 2HKXA 4GULA 1AL22 4IV3A 4Q4W1 5FLHA 1CAUA 2RJ2A 3X29B 1NXD1 3H8RA 2XGXA 4BA6A 3PU3A 5FO7B 3BIEA 3TNQA 4QQ2A 2OT7A 5APAA 1APNA 1FAYA 4V1PA 5BNNC 1OQEA 1IZ3A 2G19A 3OUHA 5EP9A 2BOIA 3KHBA 3VD9A 4Z82A 1XE7A 4E4HA 1L7RA 2K9ZA 2RJKA 5DAPA 2VUJA 2XWJB 3H42B 1J3PA 1KS4A 3AZXA 3PVEA 1GZ9A 1VIWB 2JIGA 2PHXA 2GC0A 4OHWA 2VOWA 4QM9A 4W6YA 5FPVA 3WV6A 3NJXA 2QE3A 3FMGA 3KCYA 4WM8C 2JD4A 3Q8BA 5H9RA 3NWKA 2UY8A 4CDQC 2MHFA 1YQ5A 4XZPA 5FOJB 1BLZA 4PJYA 5C8CA 3VBUB 1F35A 3V0AA 1S0IA 4AI0A 5FBJA 3TB0A 1URXA 4JQRA 1DLLA 1XNTA 3ZXEA 4E4DX 2BNOA 2XWBB 3ILNA 4KQ7A 4AHYA 1WW6A 2YC2A 2HYXA 1SFPA 1AXYA 2QCSB 2VMDA 3U37A 1W28A 3W9AA 1ULGA 4UW3A 3OTFA 3NNLA 5IJRA 1QDOA 2G9FA 2MEV3 1LHUA 1YRZA 1KRIA 4YW5A 4RFT0 4EQVA 4JTOA 2VMFA 5IAVA 3ACHA 5FZEA 1IKQA 3Q8EA 5FYHA 3IZOA 1A6CA 2ZACA 3LZZA 4BYYA 1OD3A 4GZ9A 4FPKA 1SACA 4YGBA 2HYKA 1A8DA 2WNVA 3HR9A 4AW7A 4FBFA 4A7KA 5HCHA 3WNKA 1OKOA 3WVJA 1STMA 3VBFC 1QXJA 4NPMA 2BERA 4MXWB 4Q0UA 4Y22A 2EALA 2ID4A 4AVAA 2GN7A 3AJZA 5F2SA 2PAMA 1HRV3 2FDJA 2B9VA 1QKQA 2W39A 4HKOA 1XU1A 5IATA 4QGMA 1D4M1 1WCSA 3AYAA 3KD4A 4IGOA 3U4XA 1Q3EA 2VNVA 4PI2A 3RRDA 1OF4A 3J7LA 3HQUA 3SCGA 1F5FA 3S5AA 5FQ0B 2D6KA 1O3RA 3EYPA 1YI9A 1OLRA 1XE0A 1NA1A 3VKNA 3AMQA 1JOPA 1QJU2 1W03A 3JBG1 1V00A 5AFEA 3NQHA 4LUMA 1PVC2 1OA4A 4PLOA 1UWWA 4QHZA 5CU1A 4AEKA 4JDNA 4LMFA 2ZGQA 4QQOA 1S0DA 4IV3C 5IYYA 4BXFA 1U12A 4CCJA 4LKFA 1BBT3 4BHPA 5FZ1A 3RSJA 3H8UA 5A3LA 1N47A 5I91A 2BU9A 4GH4C 3J8F3 5BNOA 3VBSB 1XE8A 4FT8A 3UGHA 2O8OA 2ZX1A 3A21A 3M4FA 1G9BA 4IV1A 2D7FA 4XF1A 2WYFA 4KGQA 3I3DA 4Y26A 4RL7A 1X50A 4RYDA 1ZBA3 3NSTA 5FK8A 3LOIA 5GLZA 5A7PA 4G4FA 1W2OA 2EVXA 4NWWA 4AVCA 5HCAA 5E89A 5E16A 2V5YA 1AR93 2B9UA 3AKSA 4JKLA 3I4IA 1UU6A 4TTGA 4LHSA 3VZLA 4INDA 1I1EA 3QCWA 4I2OA 4BE3A 3IDBB 3GCXA 4TYSA 5ABJB 1ZRDA 2UU8A 1GWMA 5C3PA 4EWEA 1I5PA 1Y4WA 4IL7A 2Q0AA 4X8NA 3DYOA 4A3ZA 1KD7A 2HEWF 4CCLA 1PO23 4NN0A 1KQRA 1QQP1 1GKBA 2XMLA 4LLOA 3F2ZA 4NVPA 4YSFA 5J48A 1RUF3 5LZ6A 5A7WB 1CJDA 5CVRA 2VCBA 3ZXLA 1QU0A 4CDUA 4E8DA 5BNPB 4Y1UA 5J37A 2VW2A 4RFRB 3ILFA 2JDPA 1S2BA 4K21A 2VBDA 5FZ0A 1GANA 3UV9A 2VQUA 1ST8A 3JZVA 2XL9A 2TUNA 1OUXA 4S2GA 4J1WA 3ABZA 4W6XA 1IS4A 2R0FA 3T4HB 2PAKA 4AHXA 1SBFA 3HT2A 3PMEA 2RM23 2EAAA 4FOYA 4GJZA 4XDOA 2BGCA 2HWB3 3POYA 2QQOA 2VL4A 4R52A 2JENA 3USSA 3T08A 1GR3A 1WMEA 3AXDA 5FYMA 1N1SA 1FOD3 1MVEA 1OF3A 2IVIB 1SPPB 1UPSA 5CEHA 3TEZA 4YW6A 1XQNA 1S0CA 1RUJ2 2P3JA 2UYAA 1I9RA 4AFCA 3CL1A 2ADDA 2DVBA 2B5HA 4DEQA 2WZR3 4EV0A 3O0WA 4N53B 2VBBA 4QMAA 3OBTA 3ALQA 4LE4A 5EZWA 5ISLA 4L97A 1AR73 3ZN4A 4CCKA 4COYA 1PO12 3N9MA 4NE9A 3O1UA 3GBWA 2H6BA 3IAPA 4PDWB 5K7PA 1UY2A 1W0NA 3UESA 1L7QA 3BYWA 2V4AA 1C1LA 3TEXA 2D6NA 2E9QA 2OIIA 2AACA 1RUNA 1RVF3 3ACFA 1TEIA 2VZTA 4FCAA 4LA2A 2CNAA 2WO1A 1GLHA 3KT1A 2WSUA 2BV4A 5DZEA 1EAH2 2CY6A 1SCRA 4Z2WA 5A3MA 2W68A 1VBC1 4QHOA 1H6YA 4IV1C 4H7MA 4XIOA 4Q0PA 3GZAA 2RDSA 1R1A2 3CJXA 3GZEA 1JXNA 1OPOA 4FOVA 2OA2A 1G7YA 1GNZA 1LOBA 2GDFA 3BALA 4E4SA 1MQTB 4HKLA 2JX9A 2V5DA 1RUG1 4XHBA 5FTTC 4CZSA 3OPWA 1YJKA 4D7YA 4B7EA 3GALA 4P5YA 2HWC3 4XAEA 3U14A 2B8MA 2CAUA 4FPOB 2XHNA 2BWAA 5FAXA 2X29A 1O4YA 1GQGA 1OPMA 2J1EA 2UWBA 4O9EA 3VBRA 1QNWA 4QPIA 1LEDA 2V09A 1W8NA 4IE6A 1RUH2 4D8MA 4YZ2A 1D2SA 1GU3A 1VBA3 1WD3A 2B42B 2L9LA 2PHUA 2RR11 2XUMA 2EXHA 1TMF1 4XURA 1PNFA 4GWMA 4LHLA 2ADEA 1BHGA 4N7UA 4LKSA 3VBHB 1JYIA 2RS33 4CDUC 2F4LA 1TZOA 5D21A 2LUWA 2RMU1 5LK5A 3OD4A 3MEPA 3I2IA 3VD4A 3URFA 2JECA 2ENRA 3ZYBA 1W39A 5A3PA 2O1QA 1H9PA 3I2KA 4GJYA 3QH7A 2DCJA 3KMHA 2QQIA 2P6HA 4Q4X1 4Q8KA 3ZYFA 4RGGA 5F3IA 3WDWA 4MZUA 4M3CE 1HXS1 2X5IB 5BXXA 4LBOA 2W5FA 1WLCA 3FFZA 2TEPA 3AP4A 2GNMA 2VTXA 1OFNA 4NRQA 5JDBA 3QBQA 2AGSA 4FPCA 4IEWA 4XUQA 2RV9A 2R16A 2ZX4A 1E5IA 4BDVB 3N4MA 2QTWB 4FPYA 2R7EB 2VCMA 4OHVA 1C3HA 2A7AA 3K46A 4MX3A 5C4WB 5KXCA 3M3OA 1EPZA 2R071 3NV2A 3RFRA 1JZ2A 5F39A 3WQ1A 4LJHA 2H0VA 4ASMB 1BEV1 1ZRRA 1EP0A 3U10A 4CCDA 2WNEA 4DOUA 3DPRC 4DUWA 4CVUA 4AK3A 4CDWC 5T52A 1B35A 2XKOA 2Q8OA 3MDPA 2A6ZA 3LAGA 4A6OA 4OYUA 4C0HA 4CDXA 1NZCA 1RMU2 4OHZA 1POV1 1SBEA 4CXYA 3DUIA 3LKJA 2J1UA 2WO3A 3B93A 3OY8A 1LOCA 3O7OA 4Z07A 3O1PA 2R041 1VBE3 3POEA 4IEQA 1QDCA 1RUE1 4FAHA 1UZYA 3D5OA 4LO8A 4F83A 1R092 5TSWA 4BQ2A 1LU2A 1Q8SA 1WUVA 2ZX3A 4C8DA 3AFKA 2VO5A 4QPGC 1VBB1 1SCSA 5FZKA 5T5LA 3T2TA 1RHI3 4Y5SA 3SEPA 3HAGA 1PGSA 4QGLA 4QT6A 5T3NA 1S0GA 3C8XA 1J83A 3MLLA 4QDQA 3AZZA 4YVWA 4C91A 1AX1A 1CESA 3MW2A 4ASLA 1V9U3 4HVQA 3A0NA 3VKMA 4CP9A 1JOJA 2DVGA 2RS11 1TNFA 4Y1VA 1R081 4LO4B 4A6SA 3MF6A 5FZIA 2Y6LA 3HQXA 5FKBA 3LPFA 1DCSA 1VBD1 1F4AA 3VDCA 3OEBA 2LROA 3MFAA 4A7YA 1ZBE3 5EJ3A 3VBRC 4QPIC 5DAQA 2VAUA 2JE7A 4CEWA 5E8AA 3NNJA 4N9HA 2ZGOA 1SG3A 4LXLA 1RUC3 4QX0A 5IVBA 4K20A 4D6SA 2BP6A 1UY4A 1PVXA 2OPKA 1IG0A 3CZJA 4A45A 3AP5A 5IAXA 5F2WA 1UPIA 2ZZQA 2VH9A 2ZEYA 1MEC1 4EWDA 1DBNA 2YB7A 4L9BA 4CCMA 1C8M3 4NRMA 2VE1A 2G1MA 2HBTA 1NY71 4AZZA 3FBMA 4JGYB 5CFDA 2LS6A 1O4TA 1COV1 1H2LA 1QOTA 3KLSA 3HEIA 1ND2B 2PHDA 3D3AA 1OSGA 1NCRA 5DABA 5ERLA 2LALA 1TVGA 4AI8A 1O6UA 1YC61 3EBRA 2FZ2A 3K77A 1NLSA 2ZX0A 1F5JA 1UYXA 2J7MA 2GSYA 1O8SA 3KM5A 5FUIA 5A33B 1BMV2 1O59A 4BQ3A 5C8WA 2WO2A 2YBSA 2NN8A 2ZHLA 2FDFA 4NROA 4TLGA 3T0DA 1U0AA 1AUYA 4YPJA 5FY9A 2JE9A 2VZSA 2K2SA 4NIAA 2X09A 4BXSV 2RHPA 5L36A 2W1SA 1LECA 3KZ4C 3OSDA 2XQXA 1LOFA 4PBPA 3VV1A 1SLAA 2VTFA 1D2QA 3V0BA 4I3GA 3RI8A 3EXUA 1HRI1 3PHMA 2C9AA 1HJGA 3POFA 3T1LA 3KV4A 5AC91 1KEXA 3ES1A 5LW9A 2PLV2 4FPGA 3VDDB 4CCOA 1AJKA 4LBMA 2QNKA 3AZWA 3ZSJA 2CU5A 1B35C 3LPGA 4PF1A 1UCXA 3ZXFA 2JG9A 4CDXC 3S0MA 2VOTA 5A3WA 5GZEA 3R4DB 3SCHA 2D5HA 2VW1A 3H8OA 2D6PA 1QWRA 4CRQA 2XBO3 3P6BA 4XFIA 3AP7A 1BXHA 4OI0A 1LRHA 2HWF1 4DXRA 4E9KA 2CHHA 3QH6A 3FC0A 4HOOA 4D69A 1HN0A 4XBQA 4QXHA 2BFUL 1ZA4A 1QJY1 2WSVA 4QXBA 3FLTA 2NMOA 3W59A 1TQ5A 1SQ4A 3IT8A 2VU9A 4P00B 3RQ0A 3PLQA 1GOFA 4QX8A 3SMHA 4YVWC 3VD7A 4W8JA 3AM2A 3O1SA 2NLRA 1YEWA 2RS51 3OYWA 1NXMA 3DF0A 3K48A 4XUTA 2CWMA 2HJIA 2DU1A 4FPEA 3IN9A 5FZHA 4LQRA 2ORZA 5KHJA 1Y9GA 4JKKA 4XUPA 4AQ6A 4F3JA 3I54A 5JZGB 4HKWA 1X9TA 1XU2A 4ZU7A 5DZGA 4CEWC 4ORFA 4CEYA 1JOBA 2C26A 3VHNA 1PZ8A 4XETA 4IGPA 1DZQA 3MYXA 2PHTA 4FSJA 4L2NA 1QNYA 3VD5A 2YGLA 3SKJE 4QWNA 1LENA 2BVBA 2AC1A 2DTWA 2HEYF 3K4AA 1NQJA 2ZGLA 1QJX3 4RD7A 1RUG2 5CFDC 2ZA9A 4LA3A 4NUBA 1BCXA 3J7NA 1W6QB 3AL6A 5FZ3A 4QB2A 4UFJA 1ASJ3 4E2GA 4N43C 4OZXA 1LCLA 1NCRC 5LWBA 3O1VA 3NJZA 4PQ9A 1DLCA 1H30A 1CPNA 2DBIA 2VNOA 5IVFA 5A3OA 4R9DA 1TME1 3HT1A 1GWKA 4IW3A 5JI7A 3ZXJA 1LB2A 4U2AA 3K2OA 3MIDA 2Y8KA 1LGNA 1HB2A 4HL0A 1MZ5A 3KQRA 4MH0E 5HXMA 3ZFEC 4H14A 5DUVA 3FHIB 4QKNA 2VUCA 3JQXA 4IEVA 1LEMA 4H55A 3LOBA 1LOFC 2CDOA 3ZIWA 5CNAA 1X82A 1G86A 4AHWA 3IAQA 1PMIA 1X7NA 4NHKA 2RMU2 3LEKA 1XYPA 5CISA 2YHJA 1CAWB 3VZKA 3ZXKA 1ZX5A 1BJQA 2XJPA 2B4KA 1ND3A 3NAPC 3PUSA 1G8WA 2VY0A 1NX9A 4AI1A 3JU9A 1OLQA 3OGVA 4Q4X2 2JG9C 1LHOA 1JHNA 5BNNB 1S1AA 5D8AA 1PMJX 1HXS2 1ZZBA 5DG2A 4XF9A 4YVSA 5C3OA 3APBA 2WT0A 3AJYA 5FPXA 3POIA 2P5BA 3MLKA 2VMCA 4I3PA 3Q8CA 3MIBA 3VN4A 2W47A 3POWA 4OUMA 1WCUA 4TN7A 1W6MB 3WDVA 4WM8B 2BTVC 1X33A 3AMNA 3MIFA 4FPLA 3C7EA 4CDQB 4P08A 3WF1A 2WWSA 4KU8A 5JI9A 2I07B 1PX3A 2IUWA 5KBFA 2E7QA 3H9AA 3J4UH 1N1VA 5ANNA 2VTXJ 2R072 3B3QE 2DV9A 3MLJA 2P2KA 4B1LA 1SZBA 3C7OA 5LBEA 2A71A 4Z1VA 3A4UA 1MVQA 1MS4A 3CO2A 3GZTB 3HQRA 3RJ2X 4DRVA 3BI3A 3WD5A 3D6EA 2QQLA 4K7JA 2BYVE 4K6BA 1IS6A 5LBBA 1HX6A 2X53S 3ZFFA 4QHBA 1FV2A 1X36A 5KXBA 3RVHA 1ULCA 1CAVA 4NMIA 4CEYC 2VW0A 2ZGSA 2B45X 4UF0A 2GP5A 3UNPA 2NYYA 4FTEA 3P5BA 5A6ZA 4OI2A 2DUQA 3KV9A 1QJU3 4LT5A 2AEZA 2BBAA 4N8MA 2E26A 4MGZE 1PVC3 2PHFA 4DXZA 3WOGA 1REFA 2P1BA 3N7KA 5DAVA 3VBFB 4AQ2A 4QB6A 4AVVA 2N7GA 3MHZA 4XPVA 3CDZB 3H3ZA 1Q8PA 1XBFA 1H8TA 4Y20B 5L9RA 4WVVA 5HCBA 4AVBA 4AOCA 1OQDA 4AI9A 1YYNA 3BKZA 2BBVA 1JZ4A 4P9WA 1VBD2 3VKLA 1ENRA 2Q1MA 2C9KA 4QX3A 5K8SA 3KVBA 5KHGA 2GP3A 1W6PA 3V56A 5A6XA 1XNAA 1RUD3 3RS6A 3THDA 3TYJA 2VZVA 5FP7A 4K1ZA 1IS3A 2Q8DA 1ZA7A 4EZ4A 5J7MA 2J22A 2JDMA 5ACA1 2V73A 1XNKA 5FLJA 1MEC2 2YPDA 1PIV1 1Y9MA 2P3YA 3ACGA 4IV3B 5B2GB 4Y5TA 4UT5A 1CAUB 1ND3C 1NY72 4BQXA 4AI2A 1YFWA 4XBNA 3SH4A 2A73B 4ONUA 3AZVA 3JD72 5A6YA 1AZDA 5F5QA 3SEEA 4LPLA 1L3JA 1YIPA 1WW5A 2WFPA 4GH4B 4QPWA 2GN3A 2PELA 2GH2A 5I0TA 4OI4A 1WW7A 1W0PA 2I74A 3K4ZA 3N9LA 3WQ7A 4AQSA 1W9SA 1X8MA 2ZJCA 4TSVA 3H0OA 4P9YA 5FOBB 1LGBA 2O14A 4PIZA 2UY9A 2XJRA 4AFMA 3GCWA 5A7NA 3N35A 2CGPA 2A6XA 3ST7A 1HV1A 4NO4A 1VE0A 2VVFA 2CGOA 3U78A 1W9YA 5JVVA 3FHAA 3ZFGA 1XRUA 4LBNA 2FD8A 1HRI2 3H50A 4YM1A 4ES9A 4Y33A 3ZN6A 5J09A 5J96B 3ME2A 3WW2A 1XYNA 1A3KA 2GAUA 1OBNA 4NAMA 3T2QA 1RJ8A 3BU0A 1F4HA 1I5ZA 1SHWB 2W1WA 4CP2A 4QPYA 2Q8CA 1BKZA 2EXIA 2I2SA 4QXKA 2XLFA 3WHUA 4FFIA 4KU7A 1BK0A 1CJPA 1G6NA 2BNNA 3N9NA 5DQ0A 3PURA 5L73A 1MR5A 3P3PA 4GKXA 5A33A 3VUOA 2YBKA 2K46A 4IE7A 4LIVA 3PUIA 3BOPA 3S57A 1UNBA 1W9TA 4GMP3 2Y34A 5DUXA 3PVBB 3NJVA 2VBPA 3ZXGA 4XDPA 1QJY2 1JUHA 3FN9A 5FLIA 4Q1PA 4LNVA 1PO13 2R30A 3SISA 3TWIA 4QM8A 1W04A 1QJZA 4DNYA 3KT7A 4OLLA 2WNUA 5FXXA 4GD4A 1I3HA 2MEV1 4XZUG 3AXEA 1AR62 4Y22B 1W8FA 4ES8A 4OMCA 1J84A 1H8TC 5FZDA 1EY2A 5EIYB 4RS5C 5FPLA 1NOVA 1UZ0A 1LGCA 2PMWB 4K1YA 4CUCA 3ES4A 4P5HA 1H2MA 2VQTA 1YQ2A 4Q4V3 3WR0A 5KR7A 1JZ6A 2LM3A 5DPNA 1O3SA 1GP6A 4MADA 4NIHA 3AMHA 2FDHA 4UOJA 4LLFA 2A70A 2DCZA 4HMZA 5A3NA 2RDRA 4IEYA 2ATFA 1AHSA 2BPA2 5H9SA 3LWCA 1FMD3 1UX7A 1W06A 1PHMA 4FI9A 1SFYA 1YQ8A 3WLUA 4DRRA 4E27A 1ZRIA 2ERFA 1AR83 5K0UB 2XXZA 3A23A 2W95A 1W05A 4RQPA 1HRV1 5C9AA 1OQ1A 3RYKA 1HB1A 3TN92 5T54A 2C5DA 1YLLA 3T30A 3D0JA 5JMOA 1US2A 5I0UA 3R0RA 1W2NA 4FVVA 5LY1A 1ZZ9A 3FHQA 4QKDA 3BVCA 3DKWA 5F3CA 2Y60A 1RUH3 2HEVF 2A3XA 5FZOA 3UL2A 2D6LX 1HV0A 4IV1B 4YNIA 1TME2 3C2UA 1WBFA 1NAEA 1WLWA 4BU2A 4GB32 2VZOA 4YZ4A 2FDIA 5FP4A 3VD3A 4ZHNA 1GQHA 4Y4RA 3RZLA 3DXTA 5C5TA 1ZM1A 4DPNA 3UETA 1F15A 3LDKA 3IIAA 3T09A 1ULEA 3T2OA 2FBEA 3D82A 1BBT1 2R1DA 1ZZ8A 3Q8FA 2WZEA 1E5RA 2BFUS 2DUOA 3ZFGC 3GYDA 5A7QA 2AUYA 3HJRA 3J8F1 3UKNA 4MO3M 3OD0A 3BIWE 3C3VA 3EQEA 3BPZA 4J1XA 1RUI2 4LOSA 2WDBA 4D7TA 5CA6A 5FO9B 1F8VA 5CKQA 2XPJA 3GM8A 2JDYA 2IXIA 1OI6A 2YFUA 1ZBA1 4WZCA 5I8YA 1X9PA 2ZGRA 5IFPA 4NIGA 4I02A 2G9ZA 4Y4YA 3WSOA 1AR91 3CHXA 1AF9A 4CDUB 1AX2A 1YQCA 4HFSA 1E57A 1OLME 4KL1A 5I0SA 5T5OA 2XVGA 2UWAA 5AVAA 3FUOA 3GBGA 4XBLA 4HVRA 5A1FA 2VMHA 5EYYA 3ZO0B 1W90A 3ZYIB 5I93A 1W2AX 1HLCA 2OZ6A 1PO21 4OI1A 5DMYA 2XVKA 2WNUC 2Y64A 3JUUA 1RUF1 1YXWA 3GDBA 1RMU3 1WBLA 2WLPA 5T5PA 1JU3A 1ZREA 3AMPA 1KFUL 1YFXA 3LEMA 3NNFA 5L9VA 2KA3A 4JKMA 2BW8A 5C8CC 2ZHKA 1UU4A 1R093 3GZUC 4W4ZA 3FUQA 4YZ3A 3WF2A 3B9IA 2J1TA 1LESA 3S7IA 3AB0A 3HBZA 1W8HA 1UW8A 1PGL1 2VXRA 3VHPA 5KHKA 4COZA 2RM21 5FPZA 1ZRFA 4M0HA 3SITA 4OCTA 1LULA 2HWB1 2VNRA 3HOBA 3DPRB 4GXLA 4HK9A 1O5UA 2SBAA 4CDWB 1OA3A 3ON7A 4RQPC 5CFCA 5C9AC 2NMNA 1UYYA 3IKWA 4MXWA 3FLPA 2KR2A 2WN3A 5IW0A 5CZKA 3LA2A 3SQOA 3N7LA 4XFFA 4P14A 1AYN1 3J7MA 2WZR1 5JUVA 1GOHA 1V6MA 5C5UA 1AR71 1VJ2A 1O8PA 2IZWA 2QQMA 3C7HA 4QPGB 4A4AA 2WNVC 3HMYA 5FFOC 4AE2A 1CZSA 3VDAA 2E51A 1IPJA 4P9IA 4PT6A 5FMCA 1ZYBA 1RVF1 3LSDA 3S30A 4F7ZA 4OHYA 2RG4A 2NP0A 5FMBA 4CU6A 4Q2FA 1JBCA 4OVEA 3HIFA 4FP3A 4JGZA 4MSVA 5F32A 1VMFA 4XFAA 1PIV2 2HWD2 3CJIA 2YV8A 5FY5A 4JRAA 2RE9A 3LQCA 5IVCA 2GZWA 1V6KA 3VBRB 4K3UA 2ZGTA 4QPIB 3AYDA 5DN2A 4XAAA 3OBRA 1NA1C 1OH3A 4DUXA 4XVHA 1MS8A 3M1HA 2CL2A 2ZBJA 5L9BA 2WFF2 4IEXA 1JODA 3BCWA 4AFDA 3DV8A 2YY1A 1C28A 1VRH2 1C5HA 2R1BA 4E8CA 2VECA 2HWC1 2P34A 4NAOA 4EJRA 1KJRA 4Y5Z0 1XNCA 4C0BA 2B7YA 2WR9A 5EHDA 3PUQA 2ET7A 3VHRA 2PHLA 5BNOC 2QBXA 1LHWA 3HNBM 5JSOA 1EUTA 5J36A 1WD4A 2PLV3 4SLIA 1UMIA 4HG6B 1VBA1 2D97A 3IDAA 2ZKNA 5F6LB 1HJFA 3ZXDA 3RZKA 1Z7S2 3M2MA 4UBGA 2DURA 5FY7A 4OQ9A 2RS31 2R32A 4UYBA 4LE3A 3BN6A 3WINE 5FDBA 1QIQA 1V6JA 2QQUA 5FYIA 2PYTA 5FY0A 4AEDA 1A34A 1GP5A 1OFSA 3KSCA 4UFMA 5JR2A 2P6CA 3OGGA 4O65A 2VC9A 5SV8A 3WNOA 4FOWA 4Q4W2 4OZOA 3I59B 4IEOA 3WF4A 5I8TA 5LBCA 2KM2A 2A5ZA 2HBUA 4FFGA 3C7FA 1VALA 4CTEA 5FIXA 1V6NA 4BISA 3VBOA 4NHXA 1B35B 5CFCC 1F31A 2ZEWA 1YQ6A 1GZCA 4CDXB 4IE0A 4M00A 5JSPA 5EV7A 1G9CA 1XJAA 2Y0IA 3U75A 5LCWL 2VGDA 3HN1A 2E31A 1WW4A 2WINB 2GALA 2VZQA 2QUOA 3AZYA 3B9CA 5DAXA 1H0BA 1HKDA 3MW3A 1UX6A 4JVAA 4DXSA 4HLTA 2Z79A 4RR3A 1ZVFA 1D7PM 2GC2A 2GNTA 3WQBA 5EXOA 1LJ7A 4XCBA 3J26N 3A7QA 3POGA 4E2SA 1NZIA 5J98B 3IB3A 1H2NA 2GMMA 2RDNA 4HPKA 4P9XA 4YVWB 1X8EA 5IK8A 4MV2A 4CP9B 2EICA 3GBFA 1LHNA 4Z92B 1W8WA 4PLMA 1W8UA 3OOXA 1AJOA 1VBE1 1JZ7A 4JHTA 4JGZC 1RJ7A 1H6XA 2IC1A 2HWE3 4R8HA 5DDJ3 3CJIC 5FY4A 3WDUA 2ZAAA 4XJUA 3G6JB 1VAVA 2YC4A 5FPBA 4CEWB 5CBLA 1RHI1 2WLQA 3A22A 4RSUA 2GC1A 4LOTA 1XPWA 3W20A 2YBPA 5IK7A 4QXCA 2BWCA 3M70A 2DUPA 1H8VA 3B7MA 2DTYA 4NRPA 1V9U1 1FX5A 4A3XA 3DECA 2DYCA 3WW4A 1DGLA 4JDOA 3USUA 1VPHA 5M0TA 4B1MA 2DBNA 5FZLA 1R1ZA 5C71A 3M3IA 2P3KA 3I2FA 4L99A 5KC6A 3VKFC 5A3UA 4ZS2A 5CFDB 2QVSB 2SLIA 1ZBE1 4UW6A 1BBT2 1YFYA 2WWJA 4O61A 2JICA 3U07A 4N43B 3JCIA 4BPZA 4EN7B 1NCRB 3M3QA 3J8F2 1D4M2 2C4XA 1RUC1 4YGDA 5LK7B 5GJ6A 5IK5A 5FV3A 1UQXA 3V65A 1BYHA 1HXS3 3FJSA 4XFGA 1GUIA 4KG0A 2A75A 2NM1A 3ZFEB 1C8M1 3NKGA 1ZBA2 3JBG2 1K5MA 4AEDC 1ALYA 2J1VA 1W6NA 2C6SA 1UOFA 4AYUA 1B09A 4FPJA 5AFBA 4Q0QA 1JYWA 1UZZA 3EHKA 1QMJA 1AYM3 3IM0A 3KCCA 2YU1A 2C0ZA 1C4RA 2Z69A 3NAPB 4XF4A 5EFUA 1GWLA 1D4VB 2ZX2A 2X5IA 1Y9QA 4JV4A 4XDQA 1GZWA 3VBOC 3ZOIA 1REEA 2JG9B 4Y3OA 3ENRA 5E6HA 3RMXA 4BMBA 1JZ5A 1RB8G 3U1XA 3KHCA 2ET1A 2AZ5A 1U5IA 3NVCA 3ZSKA 4DFSA 5CAZA 4ZU5A 2ZHMA 3DXUA 4DQAA 3NW4A 4HSJA 3NNMA 4MG2A 3INAA 2KD7A 3WCRA 4MVTA 4CU8A 1Y7BA 4YM3A 2LRPA 4RR3C 5L7OA 1DG6A 2WT1A 3H3LA 4WZFA 4JX0A 2WAOA 4MYEA 3R05A 4D6QA 1FXZA 2GH8A 4XILA 1PGL2 2ZEZA 5T50A 4Q26A 3SXWA 4EZHA 3SH3A 2Y33A 4J6GA 2RM22 3OYWB 3BTXA 2BGPA 4XQWA 1SLBA 4UFHA 3BTZA 5I8SA 3RZHA 4BQ4A 1QQP2 1E5HA 2XBO1 2FDKA 2OXBA 4E4ZA 3ZDVA 1PGW1 2NZ9A 1LU1A 3M3EA 1E5SA 2FMDA 1C57A 3H7YA 4I30A 1AYN2 3ZSLA 1CIYA 1UIKA 5IVYA 1G9FA 4AGGA 4CEYB 1PNGA 2F17A 1DIWA 4R9AA 5A1AA 2WUHA 4Z2AA 2WS93 5GLVA 3W21A 2A6WA 3RI9A 3WUDA 5JXGA 2E32A 4FTSA 1GICA 2C1FA 3IPVB 4HSLA 4YW1A 1T6BX 4Q4Y3 1IS5A 1KITA 2QQVA 4RHV3 3WUCA 4YZ1A 5DUWA 1XSRA 2ARXA 4XABA 3KGLA 3JD73 5FP9A 1OLMA 1US3A 5HI0A 3BTYA 5CADA 3H1WA 1MZFA 1OMIA 3AKPA 4BQ1A 4OQ8A 1NKGA 2JD9A 1JUIA 1K3IA 5SV5A 4FPFA 1LODA 4QQHA 3WF0A 1UKGA 1UXZA 4AFAA 4D94A 4YZ5A 2JG8A 1K5MC 3POSA 1QJX1 2DDUA 1FYUA 4L92A 3O0VA 4MGKE 2D6MA 2J1SA 3V64A 1LOGA 1ASJ1 5EQUA 3C7GA 5A80A 2R061 1ULOA 3AYEA 5BPXA 1ND3B 2WQ4A 4A41A 1HRI3 2IXLA 2R0HA 3G7DA 3N9PA 5DXDA 3TAYA 4TZDA 3MW4A 2YC0A 4YLZA 4CE8A 1VBC2 4WM7A 2JDNA 4RA0A 5BUVA 4NHLA 3R6SA 4LO5B 2QFEA 4C1XA 3O1RA 5A6QA 5F1RA 1PX4A 2WQZC 4N90A 5F5AA 1CAXB 1FPN3 3WG1A 3AP9A 2ZEXA 3I3EA 2RS32 2H0BA 4W65A 3DYMA 5FYZA 1AL23 5FWJA 2D40A 3R4UA 1O91A 3ZKUA 5LBFA 5L7OC 1J1LA 1S2KA 1KDMA 1UZWA 2OQ7A 2OQ6A 3L2YA 3PUHA 1HQLA 4B3NA 4DINB 1O3TA 4BIFA 1UU5A 1C1FA 1QJY3 5EJZB 2OX0A 4W50A 5GM0A 2XONA 4K8FA 3K75B 3NV3A 4META 5IT6A 5LEKA 3OUJA 2Y38A 5KXEA 1AR63 4MHUA 2RR12 4O9GA 3AK0A 4BLIA 1TMF2 5LB6A 3CKHA 2ZGMA 1GYKA 1OD5A 1QY4A 1RUOA 5IVJA 1CN1A 5I0DA 5J1XA 2IXCA 1VAMA 1YO8A 4PLNA 2E7AA 5H9QA 3RWKX 4AR2A 3KV5A 5IUQA 4FTBA 3ECQA 3SC7X 1ENQA 1CAVB 3AX4A 5FZ6A 4LITA 1NE4A 1ZZ7A 3LDBA 5FCCA 3RNSA 1LOAA 3T2PA 1ULDA 4UF0B 1XNBA 2DWRA 5CG8A 4QGNA 3I49A 3D0SA 2W94A 5FY8A 1GFF2 5EPAA 3ZM8A 2BJSA 4GWIA 2W08A 4PHZA 5F6KA 5A32A 1UN1A 2DVAA 1UIJA 3LF7A 4G9SB 4YRDA 1TG7A 5I0RA 1OURA 4Q29A 5BNQA 1D0HA 1SLTA 3WDTA 4IE5A 4FQZA 5GKAC 4MUVA 1EUUA 2YROA 3TN93 2J1AA 5HXVA 2NPIA 2Y26A 3GHMA 1H8TB 1PK6A 3GF6A 4MHRA 4YG3A 2A3WA 3SHRA 2BGOA 4X6RB 4RS5B 3B94A 3UT0A 5JZGA 2F4PA 1DDLA 1V6LA 2W9XA 1Q56A 3PTYA 1RTVA 4IERA 4H2AA 4MGQA 4GB33 4U36A 4HBNA 2EIDA 1W6PB 3KGZA 4M3CB 5GLWA 2JG8C 3OCPA 1BEV2 1PVC1 4JHZA 2JDHA 1TNRA 5BV6A 2UWCA 2JDKA 1V9U2 4AVTA 4XXAA 5JSRA 5LA0A 1J58A 4GQ7A 4F8AA 3WP5A 1DQ4A 1UYPA 3ORJA 5IFTA 3I3MA 4O7XA 3WNLA 5C3QA 1W6OA 1RXGA 2VZ3A 2D3RA 1Y43B 3RYRA 4AGRA 2R042 3MFCA 3DYPA 1RYYA 1RUE2 1O7FA 2ZABA 5FYCA 3H8XA 4HN0A 1RUI3 4WM7C 1JW6A 4NHYA 2WA4A 2WC2A 1VBB2 3NRUA 4ISQA 3T0BA 5AVPA 2NQYA 3U0ZA 1RUD1 2VZUA 1YHFA 3AL5A 3WX5A 2BEOA 4FFFA 2ARBA 2VUAA 4UXAA 3AYCA 4C1WA 5BY5A 2K0GA 4DB5A 2Y6JA 5FRAA 2OYZA 5EWSA 3AKRA 2AEYA 3OGSA 4N9IA 5LY2A 3WP6A 4JC1A 3WZ1A 1C8M2 2RS12 5FZ7A 4LKEA 4LBQA 5CYYA 3BGAA 1R082 4X8PA 3CIHA 1EV11 1DYPA 1XC6A 3VZJA 3ZSMA 3KWVA 5FO8B 1H2KA 3ZN6B 2OW4A 1YJLA 1S2EA 3LIGA 2P4EA 1LOEA 5FMOL 1LTEA 5BNNA 1W9WA 4XJ8A 2VXJA 1HDKA 4OUEA 3CEWA 4XE9A 1A8MA 3S6PA 4A44A 2WL1A 3IIIA 2PQSA 2BOJA 2DFBA 1BVP1 4NPLA 4XUNA 4A42A 4AFBA 3OEAA 4GIQA 1GQPA 2TNFA 4AXOA 2XLGA 5GLUA 1MS5A 2QQWA 1KS5A 1UXXX 4ZY9A 1CZVA 3RWNA 3WEZA 3GJBA 4Y1YA 1COV2 4NWVA 3TNPB 4S2DA 5A3TA 5JAXA 3NV1A 1JZ8A 5D8AC 4YM0A 2D3PA 3PIJA 3J9SA 3B5LB 2Z2SB 4YVSC 4XTMA 4ZXEA 3UK9A 2WNUB 3VL8A 4I0BA 1DQ6A 3DEMA 1FV3A 2DVFA 3NJYA 4M0NA 2PTMA 5EYXA 4FXGB 2IXJA 3ZX7A 1WGPA 2W1QA 1PK6C 1DQ0A 2VCAA 4NJ4A 4JAAA 4PBOA 4DY3A 2V72A 3D4KA 5T5JA 1PGW2 1F2NA 1ACCA 3VZMA 5C8CB 2ZXQA 4GMP1 4QDSA 5FZCA 1H9WA 3V0AB 2R49A 1L7LA 4BM8A 1FT9A 1PO11 3BPSA 2WWUA 3QOPA 1VR3A 2YZ4A 5AC92 1OKQA 3RZJA 5IK4A 4UI9L 5F37A 2AYHA 2AH2A 5FY1A 2GNBA 2VZ1A 4X6QB 2QDNA 3HPNA 4QX1A 1DFQA 4MGYE 5FBZA 5C9AB 1UOGA 1C8NA 3KF3A 3ZPOA 3ZFFC 1ENSA 3MIGA 2ZGKA 2IWGB 4DS0A 1LNSA 1LR5A 4Q4V1 4Y20A 2HWD3 1RUJ3 4LK6A 2HWF2 1W2TA 1NLQA 1W0OA 1XOYA 3L2HA 5B4XA 1RGSA 3LEIA 2WFF3 2OVUA 5FZOB 4BWOA 3D8CA 4OUSA 1FMD1 2QZ2A 3U4SA 1QXPA 1HIXA 2WNVB 3WG3A 4AWDA 1DQ1A 4W6WA 3ZYJB 1NCQA 1YUDA 2ZS6B 1CZTA 3BU7A 1VRH3 3GXUA 1AR81 3JXSA 4QQPA 3IBMA 1CQ9A 3MPPG 4ZONA 4QU1A 4WV8A 2RS52 2ES3A 2XJQA 4CXXA 4TWTA 5JXIA 5LA1A 4YFZA 1D0GA 1DYOA 3KS7A 3FZ3A 2A1XA 1ZRCA 4IEPA 1NUKA 1YCIA 4YWAA 5C6CA 1WZXA 1EAH3 1UOJA 1AL0G 4QD2A 4ZU4A 1ASJ2 3RGBA 4A7ZA 2ZPXA 2R062 5FK7A 1RUH1 2EXJA 5L19A 1OOPA 4ISRA 4GH4A 2VVEA 1NA1B 1R1A3 5IVEA 1Z7S3 4R4XA 3FE5A 3KF5A 4BIOA 1HB3A 3LB9A 1UKRA 1UOBA 4WVMA 4UFIA 3WDXA 2Q30A 3ITQA 3MPBA 4AAXA 1MPXA 4QX5A 4HK8A 5JLVA 5G04L 1S0FA 1JTZX 3IWZA 3TEYA 1CD3G 3KQ4B 1K5JA 4DY5A 1IQDC 3MO4A 2D98A 2XB6C 1Q8VA 4P02B 4Q4W3 3E1F1 5FPAA 1JI6A 2VG9A 5BNOB 4LBLA 1DHKB 5HBAA 2BRTA 1IQAA 1XNDA 1IG3A 1KJLA 2EF6A 2EIEA 5CB7A 1POV0 4XXPA 5KC5A 4V2WA 1GP4A 2XUEA 1AX0A 1DZTA 4LO6B 3WQ0A 1C5IA 4UW5A 4CPBA 1JYXA 4S2HA 2FCVA 4LIUA 1DGRN 1IPSA 3OF1A 4SBVA 3LA3A 3HD8B 3OGJA 2E53A 2CTVA 1V70A 1U5XA 4IUGA 1BK1A 2XJTA 4XUOA 3WCSA 2W0XA 3ACLA 4AEJA 4KWKA 1SLCA 5FXVA 4EROA 2ZKLA 1DZRA 3L9JT 5KHHA 1RMU1 4KWUA 5CKMA 5CFCB 1Q43A 4LK7A 3LCPA 5FWEA 3THCA 2A6YA 2EIBA 2D93A 1YIFA 1R091 2GNDA 4YYOA 4MOAA 4CYDA 4B4RA 2W87A 2YFZA 1K42A 1V0AA 3UGGA 4FP2A 1SDWA 4WBBA 2JJ6A 5H9PA 5LRRA 3VBUA 5FR3A 3AKTA 1ODNA 2JE8A 5IVVA 1UL9A 1NCQC 2KXLA 3KT4A 1OT5A 1KXGA 5GZCA 1IHMA 2H6CA 1S0EA 2Z4FA 3AKQA 1WCKA 4KBZA 4BMEA 1JN2P 2RJLA 2Q5TA 3IDCB 2OPWA 1HQWA 4H3WA 5K0UA 3TRSB 1CVNA 1NE6A 2WAAA 4FAGA 4XQ4A 3O5SA 1KDKA 2DFCA 4YARA 1VP6A 4CXWA 5LRSA 4JGZB 1FATA 2BNMA 1O4ZA 2DF7A 3CJIB 3Q8AA 4R9BA 4KNCA 4YW7A 2XL7A 1OOPC 2DCYA 4TLFA 3E6CC 2W1UA 2ZCWA 1D4M3 1CWPA 1XB9A 1XYOA 4CUBA 2VD7A 1UF2C 4XTPA 3RZMA 3KB5A 5JOYA 5GZGA 2O0OA 3QACA 4URAA 3W5MA 2ZGUA 3ZVXA 2JDUA 3ZYRA 1P8JA 2FQPA 4L11A 3ETPA 1VMHA 3HWJA 2XDVA 3JBG3 1RUD2 3PNAA 4NPRA 5JPMB 4LTAA 1ZZCA 1FOD1 1NLRA 4S2FA 3BODA 2GU9A 1LAJA 5JOWA 4YFWA 3FBYA 3QD6A 4EN8B 1BVVA 2VPVA 3OPTA 2BZDA 4KI5M 2FDGA 3ILRA 1QF3A 4CP1A 4GA9A 1EV12 2ARCA 4XF3A 2ZAHA 5FQ0A 5JWPA 2E33A 1XXNA 1BMV1 3QLQA 1AXZA 2HLEA 2ZTNA 4LKDA 4OMDA 3GJAA 3PJYA 5F9TA 4NIDA 2XR4A 4KWJA 4ATEA 1PM7A 4OHXA 2XVLA 4J25A 2BQPA 4AEDB 1QOOA 2J1RA 1TE1B 3POBA 4YGEA 2ILMA 2PXJA 2FMYA 2JXAA 5ACA2 3MV11 3P1IA 1W3VA 4KBBA 1GNYA 2ZOEB 5A7OA 4LHKA 4LBQD 1IPKA 2PLV1 4P9GA 5E1RA 3VBSA 2WBKA 1PM4A 1WLTA 3I2HA 1EYBA 2W91A 3OGRA 3WNMA 4BJ0A 2QKDA 1JYNA 3SKVA 2E63A 2Y6FA 3J7HA 4YW3A 4GKYA 4CSWA 1H1MA 1JYVA 3VBOB 1DGWX 3ASIA 5IWFA 5JOXA 1MACA 1JH5A 2D5FA 4NHMA 4UFLA 4COUA 1QQP3 2VQAA 2P3IA 1VAKA 2VM9A 3E5UA 2IFWA 4HANA 1S55A 3KCXA 3B00A 3H7JA 4D3WA 4ARYA 4GALA 1VB2A 2B39A 3WP4A 4ITCA 3S5QA 2CDPA 1WKYA 4XJAA 2ZMNA 4XJ9A 3JB4C 4FQ4A 2WZPP 2VCCA 3VBUC 1AYN3 3K3OA 5EJ1B 3VGIA 1GV9A 1FNYA 3ZMNA 5ABJA 4XFBA 4RR3B 4WVZA 4XOGA 3P3NA 4JQTA 3I3BA 3WDYA 2G4IA 2WRAA 2YPJA 4HPKB 1DQ5A 3T4VA 2JIJA 1N3OA 2A3YA 5DZFA 3DPRA 5K0UC 2V4VA 2WO7A 4CDWA 5HV0A 2Q8EA 1OXCA 1DYKA 3MBWA 1SDDB 2WJSA 2JDAA 5A7WA 2VOKA 1JMUB 5BNPA 4XHXA 5B4NA 2ZMLA 4QX7A 5C7GA 4CCCA 3DN7A 4XQDA 4Q4V2 3MGUA 1MZEA 4QDRA 1RL3A 5LATA 4XW3A 3O1OA 5FMOS 2IXKA 4EYUA 1S0BA 2ARAA 4QPGA 3T1MA 4FO9A 3MZHA 2I45A 4Q1RA 5FJKA 1H1IA 2WABA 2XOMA 1ENXA 5DUUA 1OUSA 1FMD2 1GSLA 1NQDA 1W8TA 2XJUA 1QHDA 2PQQA 4Q27A 3VHOA 3USUB 3WXPA 2VULA 5FYBA 4AG4A 1VLNA 1IOAA
chains in the Genus database with same CATH topology
1AR82 5KXDA 4Q0SA 3LGRA 2MEV2 3OY8B 1MS0A 1NG0A 2HWE1 1OA2A 3NV4A 5DDJ1 3UJQA 3N36A 3UJOA 1WMFA 2GMEA 2ZHNA 5GALA 2PN5A 4AVSA 2LTNA 4B8EA 3FWEA 1HW5A 4PF5A 1CX4A 4LBJA 4N53A 1CIWA 1VBC3 4Q8LA 4XJWA 3M7AA 4IETA 5DG1A 4PDWA 5KWRA 1K5MB 1RUG3 1SFNA 3RZZA 2Y0OA 2CGNA 1W6NB 2OUHA 2BVVA 4ZXKA 5K9YA 1HRV2 4FPHA 4P9LA 2OZJA 2JKBA 4UW4A 4LULA 3VBSC 3H3UA 2YGMA 2XHKA 1LHVA 1SBDA 2Z5WA 3W58A 1J59A 1GZWB 1M4WA 2MNGA 2RR13 4BOWA 1O3QA 2D3SA 1TMF3 4JRLA 1MQTA 2XLAA 1N1YA 4IXLA 1Z78A 2XKPA 1CONA 4CP0A 2RMU3 2VOVA 4XEZA 1AYM1 2QJVA 2ZGPA 3GNEA 5ABJC 5L7OB 1WMDA 5HCFA 5JMCA 3I59A 3N7MA 3AFGA 4BLJA 3S7EA 3OJBA 2IXHA 2CWSA 3H1MA 4COVA 2EAKA 4I0AA 4Q4X3 5LEJA 2YMZA 4ZKTB 1GBGA 3WW1A 4XYXA 3WP3A 1Q5OA 2PFWA 3VL9A 3VBHA 3O12A 2P37A 1QGLA 3GHNA 3UKTA 5BNPC 3NO8A 1AR92 4Y24A 2ZZJA 4XF0A 4LR4A 4AF9A 3V0BB 3IDEA 1N3PA 3SCFA 4YG6A 1YI7A 1ZZ6A 4AHZA 4B4QA 3O14A 3O0XA 2PA7A 2UYBA 2R073 4DZGA 2D6OX 4UBHA 1BEV3 4QQLA 1PO22 3E97A 4R4ZA 2CAVA 3LSEA 5JIUA 2DVDA 1IKPA 1QOSA 1RUF2 4Z8BA 2QDRA 1CPMA 1POV3 2WIIB 3LA7A 2R043 4XMIA 1RUE3 4RGAA 1ULFA 4YGCA 4N53C 3BOWA 5C4WA 3TBDA 1Q8QA 1W2UA 1VBB3 1SMVA 2WS91 3B01A 2DU0A 1DGRA 1UD1A 4PDWC 3I7DA 3PVNA 3AP6A 1I6XA 4EWAA 2G9GA 1AVBA 2JG8B 2VMIA 2HWB2 2VOXA 1S0JA 4PCRA 3NKTA 2RS13 4GMP0 3PVOA 4Q4Y1 4RHV1 1FOD2 1R083 4LUKA 4PIXA 3JD71 1H4GA 1VBD3 4N43A 1V6OA 2WZR2 1AXKA 3E6BA 3E6DA 2W52A 4WM7B 3VKOA 1AR72 4G3YC 1MQTC 1RITA 1UAIA 2A6VA 3WY6A 3THPA 4B7KA 1ZNPA 3ELNA 1REDA 3ZFEA 1MS3A 3TOJA 3RG0A 1MEC3 1RVF2 1N1TA 2EXKA 2VNGA 4HT1T 2VVDA 2JEMA 1COV3 1RIRA 4Q0VA 4LHNA 4HN1A 1PZ7A 3NAPA 3VZNA 3I2DA 3N3HA 5FREA 5BYNA 1FPN1 2EIGA 3MIEA 3VBHC 3ZMOA 3R4SA 1SLIA 2JDZA 2DCTA 1BQPA 1Z0HA 2YXSA 2WKKA 4COWA 3DL3A 1NYWA 1AL21 2HWC2 4YM2A 3ZYPA 4JGYA 3RJRA 4AQTA 4IEUA 4URTA 2XH6A 2UURA 1ND2A 2VQ0A 2X5IC 3MIHA 5AC93 1YFUA 5D8AB 5A32B 1AR61 1VBA2 4XFCA 4I0WB 2E7TA 3H1YA 5GZDA 5A33A 4YVSB 2QQPA 4LO7A 3ZPYA 5JR7B 4KG8A 2YDEA 3BB6A 1LKNA 4MLOA 4K40A 1MZ6A 3U11A 2PHRA 1PK6B 3PJQA 4D7SA 2HWF3 3PMSA 1MS9A 5JPNB 3WHTA 4BCUA 5C4WC 2GC3A 5D1IA 4YW4A 2CV6A 5GLTA 3VDDA 1QXRA 3VZOA 2R6QA 5GZFA 4LEJA 2MPFA 3M8LA 2RS53 3TN91 1O5LA 3IPVA 3FX3A 1W6OB 2E6VA 3UKVA 4I09A 3ZDSA 3ZFFB 4AEMA 2HWE2 5DDJ2 2X8KA 4FOQA 1U5ZA 2R063 1G9AA 1SEFA 4HETA 4IESA 1DGWA 1PZ9A 4EN0A 4KGGA 4GB31 1KFXL 2Z42A 4PIYA 1YWKA 1WLDA 4M01A 4JCKA 3AMMA 3MICA 3Q9OA 2AR6A 2D44A 4AI3A 4ATFA 3MI8A 4NOTA 1J1TA 2AREA 1FNZA 4LBQB 4YW2A 1VBE2 4BZ4A 4EN9B 1T6GC 4E2QA 3CNAA 1RUI1 3E5XA 4XJZA 4B4PA 3SLIA 2PHWA 2WA3A 1QJU1 2ZGNA 1TME3 2TBVA 1RHI2 4WVWA 3ZN5A 1N3QA 2VMGA 3B02A 5T55A 4OULA 5JOZA 1CAXA 3CU7A 3ZSEA 1H1AA 1M06G 1Q8OA 4JGYC 3CF6E 1CGPA 3RPQA 1W6QA 1WA4A 4N7IA 1HQNA 4Y1XA 1ND2C 4H7LA 4R9CA 2Q4SA 1AYM2 1ZBE2 3WT3A 1OHFA 2ETEA 1G9DA 2BUKA 3IMNA 1QH6A 2IFRA 4EN6B 1RUC2 4L8QA 3WNXA 3ROUA 5CIRA 5CG9A 3EJKA 3WG4A 2ZMKA 3RDIA 1EPWA 1JYCA 3A0KA 1A78A 4LBKA 1WCDJ 1CAWA 2F6BA 3ETQA 3ZFGB 3FLRA 2YYOA 3VDDC 4IEZA 2WT2A 3ATGA 5E88A 2FZ1A 2DCKA 3MF9A 4YG0A 4XIKA 4B29A 1MS1A 3ZIXA 3DGTA 4JDMA 1J3RA 3K51A 1DU3D 4OFGA 3SNMA 5J3UA 4C90A 4KH9A 1W6MA 4WM8A 1DQ2A 2EA7A 5KHIA 4IQPA 4AGVA 1GNHA 2Q1ZB 4RS5A 3RYPA 4XFHA 3NL1A 4CDQA 3CLPA 1BZWA 1VB4A 1Y3TA 3BTAA 4QU2A 1CR7A 4M3CA 4FXKB 1NCQB 4XMAA 2WS92 2XJSA 3JQWA 4KWLA 1V6IA 3M3CA 4MXVA 3WW3A 3OPZA 2XBO2 2HWD1 4HZFA 1RUJ1 5JIAA 1RINA 1IGOA 5JZGC 4NR1A 2FHRA 1H4HA 4Q4Y2 2B46X 4RHV2 3ZXAC 2XG3A 3FFQA 1EV13 4Y1ZA 3ZYGA 1OOPB 2WFF1 1FI2A 3JB8A 1J3QA 4M3CF 1VRH1 2P17A 4WVMB 1F9KA 5JCTA 2AENA 2YUEA 1YNAA 4RQPB 3VBFA 1QH7A 2CYFA 2D43A 3N7JA 1RC6A 4GWNA 1EAH1 4BH9A 5ACA3 2QZ3A 3EO6A 1PIV3 4K9SA 4P9JA 4A2UA 4HVOA 3THTA 1R1A1 1Z7S1 4I01A 1SLLA 3E5QA 2O8QA 4MGIE 3I8TA 2OUJA 3SH5A 2PAEA 5C33A 1DF0A 4DMIA 2GMPA 3VLBB 1FPN2 2XJVA 1ONAA 1U5YA 3B69A 1QJX2 1UMZA 3WG2A 3RMYA 4JTNA 2HKXA 4GULA 1AL22 4IV3A 4Q4W1 5FLHA 1CAUA 3X29B 1NXD1 2XGXA 4BA6A 5FO7B 3TNQA 4QQ2A 1APNA 1FAYA 4V1PA 5BNNC 1OQEA 1IZ3A 4Z82A 1XE7A 2K9ZA 2RJKA 2VUJA 2XWJB 1J3PA 1KS4A 3AZXA 3PVEA 1GZ9A 1VIWB 2PHXA 4OHWA 2GC0A 4QM9A 2VOWA 4W6YA 3WV6A 2QE3A 3FMGA 3KCYA 4WM8C 2JD4A 5H9RA 3NWKA 2UY8A 4CDQC 2MHFA 5FOJB 4XZPA 4PJYA 5C8CA 3VBUB 3V0AA 1S0IA 4AI0A 3TB0A 1URXA 4JQRA 1DLLA 3ZXEA 4E4DX 2BNOA 2XWBB 3ILNA 4KQ7A 4AHYA 1WW6A 2QCSB 1AXYA 3W9AA 1ULGA 4UW3A 3OTFA 1QDOA 2G9FA 2MEV3 1LHUA 1YRZA 1KRIA 4YW5A 4RFT0 4JTOA 1IKQA 1A6CA 2ZACA 3LZZA 4BYYA 4FPKA 1SACA 4YGBA 2HYKA 1A8DA 2WNVA 3HR9A 4AW7A 4FBFA 4A7KA 3WVJA 3VBFC 1QXJA 4MXWB 4Q0UA 4Y22A 2EALA 4AVAA 2GN7A 3AJZA 2PAMA 1HRV3 2W39A 1QKQA 4HKOA 1XU1A 4QGMA 1D4M1 1WCSA 3AYAA 3KD4A 3U4XA 1Q3EA 3RRDA 3SCGA 1O3RA 1F5FA 5FQ0B 2D6KA 1YI9A 1OLRA 1NA1A 3VKNA 3AMQA 1QJU2 3JBG1 1V00A 5AFEA 4LUMA 1PVC2 1OA4A 4PLOA 5CU1A 4AEKA 4JDNA 2ZGQA 4QQOA 1S0DA 4IV3C 1U12A 4BHPA 1BBT3 3RSJA 3H8UA 5A3LA 1N47A 5I91A 5BNOA 4GH4C 3J8F3 3VBSB 1XE8A 4FT8A 2O8OA 2ZX1A 3M4FA 1G9BA 4IV1A 2D7FA 4XF1A 4KGQA 4Y26A 4RL7A 1X50A 5GLZA 1ZBA3 3NSTA 3LOIA 4G4FA 2EVXA 4NWWA 4AVCA 5HCAA 5E89A 5E16A 2V5YA 1AR93 2B9UA 3AKSA 3I4IA 1UU6A 3VZLA 4INDA 1I1EA 3QCWA 4I2OA 4BE3A 3IDBB 4TYSA 5ABJB 1ZRDA 2UU8A 4EWEA 4IL7A 2Q0AA 4X8NA 1KD7A 2HEWF 1PO23 4NN0A 1KQRA 1QQP1 1GKBA 4LLOA 4NVPA 4YSFA 5J48A 1RUF3 1CJDA 5CVRA 3ZXLA 1QU0A 4CDUA 5BNPB 4Y1UA 5J37A 2VW2A 3ILFA 1S2BA 4K21A 1GANA 3UV9A 3JZVA 2XL9A 2TUNA 4S2GA 4J1WA 4W6XA 1IS4A 2R0FA 2PAKA 4AHXA 1SBFA 3HT2A 3PMEA 2RM23 2EAAA 4FOYA 2BGCA 2HWB3 3POYA 4R52A 2JENA 3USSA 1GR3A 1WMEA 3AXDA 1N1SA 1FOD3 1MVEA 1UPSA 1XQNA 1S0CA 1RUJ2 2P3JA 2UYAA 1I9RA 4AFCA 3CL1A 2DVBA 2B5HA 2WZR3 4EV0A 3O0WA 4N53B 4QMAA 3OBTA 3ALQA 4LE4A 5EZWA 4L97A 1AR73 3ZN4A 4COYA 1PO12 3GBWA 2H6BA 4PDWB 5K7PA 1C1LA 2D6NA 2E9QA 2OIIA 1RUNA 1RVF3 1TEIA 4LA2A 4FCAA 2CNAA 1GLHA 3KT1A 2WSUA 5DZEA 1EAH2 2CY6A 1SCRA 4Z2WA 5A3MA 2W68A 1VBC1 4IV1C 4H7MA 4XIOA 4Q0PA 3GZAA 1R1A2 3CJXA 1JXNA 1OPOA 4FOVA 2OA2A 1G7YA 1GNZA 1LOBA 2GDFA 3BALA 4E4SA 1MQTB 4HKLA 2JX9A 4XHBA 1RUG1 5FTTC 4CZSA 1YJKA 4D7YA 4B7EA 3GALA 2HWC3 2B8MA 2CAUA 4FPOB 2BWAA 5FAXA 2X29A 1O4YA 1GQGA 1OPMA 2UWBA 3VBRA 4O9EA 1QNWA 4QPIA 1LEDA 2V09A 1RUH2 4YZ2A 1D2SA 1VBA3 1WD3A 2B42B 2RR11 2PHUA 2XUMA 2EXHA 1TMF1 1PNFA 4GWMA 4LHLA 4N7UA 3VBHB 1JYIA 2RS33 4CDUC 2LUWA 2RMU1 5LK5A 3OD4A 3MEPA 3URFA 2JECA 2ENRA 1W39A 2O1QA 1H9PA 3QH7A 2DCJA 3KMHA 4Q4X1 4Q8KA 4RGGA 3WDWA 4MZUA 4M3CE 1HXS1 2X5IB 5BXXA 4LBOA 1WLCA 3FFZA 2TEPA 3AP4A 2GNMA 1OFNA 5JDBA 3QBQA 2AGSA 4FPCA 4IEWA 2R16A 2ZX4A 3N4MA 4FPYA 4OHVA 1C3HA 2A7AA 4MX3A 5C4WB 5KXCA 3M3OA 1EPZA 2R071 3NV2A 3WQ1A 4ASMB 2H0VA 1BEV1 1ZRRA 1EP0A 3U10A 4DOUA 2WNEA 3DPRC 4AK3A 4CDWC 5T52A 1B35A 2XKOA 2Q8OA 3MDPA 2A6ZA 3LAGA 4C0HA 4CDXA 1NZCA 1RMU2 4OHZA 1POV1 1SBEA 3DUIA 3LKJA 3B93A 4Z07A 3OY8A 1LOCA 3O7OA 2R041 1VBE3 4IEQA 1QDCA 1RUE1 4FAHA 1UZYA 3D5OA 4LO8A 4F83A 1R092 5TSWA 1LU2A 1Q8SA 1WUVA 2ZX3A 3AFKA 4QPGC 1VBB1 1SCSA 5T5LA 3T2TA 1RHI3 3HAGA 1PGSA 4QGLA 4QT6A 5T3NA 1S0GA 3MLLA 3AZZA 4YVWA 4C91A 1AX1A 1CESA 3MW2A 4ASLA 1V9U3 4HVQA 3A0NA 3VKMA 1JOJA 2DVGA 2RS11 1TNFA 4Y1VA 1R081 4LO4B 3MF6A 3HQXA 1VBD1 3MFAA 4A7YA 1ZBE3 5EJ3A 3VBRC 4QPIC 2JE7A 4CEWA 5E8AA 4N9HA 2ZGOA 1RUC3 4K20A 1PVXA 2OPKA 3AP5A 1UPIA 2ZZQA 2VH9A 4EWDA 1MEC1 1DBNA 4L9BA 1C8M3 1NY71 3FBMA 4JGYB 5CFDA 1O4TA 1COV1 1H2LA 1QOTA 3KLSA 1ND2B 2PHDA 1OSGA 1NCRA 2LALA 2FZ2A 4AI8A 3EBRA 1NLSA 2ZX0A 1F5JA 2GSYA 5A33B 3KM5A 1BMV2 5C8WA 2NN8A 2ZHLA 1U0AA 1AUYA 2JE9A 2K2SA 2RHPA 5L36A 1LECA 3KZ4C 4PBPA 1LOFA 3VV1A 1SLAA 1D2QA 3V0BA 4I3GA 3RI8A 3EXUA 1HRI1 3PHMA 2C9AA 3T1LA 5AC91 3ES1A 2PLV2 4FPGA 3VDDB 1AJKA 4LBMA 2QNKA 3AZWA 3ZSJA 1B35C 1UCXA 3ZXFA 2JG9A 4CDXC 3S0MA 5GZEA 3R4DB 3SCHA 2D5HA 2VW1A 2D6PA 1QWRA 4CRQA 2XBO3 4XFIA 3AP7A 1BXHA 4OI0A 1LRHA 2HWF1 4E9KA 3QH6A 3FC0A 4D69A 4XBQA 2BFUL