4B1LA

Carbohydrate binding module cbm66 from bacillus subtilis
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
162
structure length
162
Chain Sequence
TPFMSNMTGWTTVNGTWADTIEGKQGRSDGDSFILSSASGSDFTYESDITIKDGNGRGAGALMFRSDKDAKNGYLANVDAKHDLVKFFKFENGAASVIAEYKTPIDVNKKYHLKTEAEGDRFKIYLDDRLVIDAHDSVFSEGQFGLNVWDATAVFQNVTKES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LEVANASE
publication title How Nature Can Exploit Nonspecific Catalytic and Carbohydrate Binding Modules to Create Enzymatic Specificity
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 40
structure length 162
sequence length 162
ec nomenclature ec 3.2.1.80: Fructan beta-fructosidase.
pdb deposition date 2012-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 4b1lA00
1Y9GA 3UGFA 1Y4WA 2AC1A 5FKBA 3ZR5A 4UFJA 1ST8A 1Y9MA 2ADEA 3PIJA 4FFIA 3U1XA 3NMBA 3ZR6A 4UFMA 3LF7A 4FFHA 5FMDA 3KF5A 5FKCA 4CCDA 4HXCA 3LDKA 4UFIA 3PIGA 4CCCA 5FK8A 3HBKA 4CCEA 4FFGA 3OSDA 3H3LA 3UGGA 3S5QA 4UFKA 5FK7A 5FIXA 5FMBA 3RWKX 4AZZA 2QQUA 4EQVA 5FMCA 3UGHA 1W2TA 3LIHA 3KF3A 1UYPA 2AEYA 2XQRA 3LEMA 4B1LA 2QQVA 4QHZA 2OXBA 4UFHA 2ADDA 4B1MA 4JQTA 3LFIA 4UFLA 4FFFA 5ANNA 3U14A 3SC7X 3LDRA 3U75A 3IMMA 2QQWA 3LIGA 2AEZA
chains in the Genus database with same CATH superfamily
4CEWA 1PO22 2ZHKA 3AX4A 4OCTA 4Q4Y1 2UY8A 2R49A 4NWWA 1PIV1 3PHMA 2UYAA 1RUI3 1UX7A 5FZFA 3U1XA 5E6HA 3E6DA 5LATA 2P3YA 4CCLA 4Q4V2 2BDRA 2Y38A 3TNPB 2FMDA 1ENQA 1QKQA 5JWPA 3TWIA 5DABA 1N1TA 4ZU4A 1GV9A 5JZGB 1ODMA 4NN0A 1XQNA 1PVXA 2B42B 2W1WA 5F5IA 3VKMA 3I2KA 5T52A 5JIUA 2K2SA 2VG9A 4AFBA 4CUAA 1POV0 2OXBA 4BH9A 1NQDA 4R9DA 4CDUB 3H9AA 1W8UA 4ASMB 5LCWL 4OI2A 4QQLA 4W6YA 2RS33 5LB6A 1FNZA 2DUQA 4GMP3 3WP4A 4CYDA 4J1XA 3AJZA 3R6SA 4NVPA 1SLCA 4IEQA 1GOFA 2XJTA 1SEFA 2QDRA 1V6OA 2ZGUA 3MFCA 2Y6JA 4PJYA 2D6NA 1OOPC 1VBD1 4QT6A 4XJ9A 1O59A 5A7SA 3RGBA 4W65A 5LA2A 3AFKA 4GJZA 4HXCA 3N9QA 4DQAA 1CZTA 4LJHA 4N43A 5A3LA 1RUE2 2OS2A 4LHSA 4OHYA 3JU9A 1GQGA 2RV9A 1O5UA 5CYYA 1LNSA 2ZTNA 1TMF1 3VZNA 3ZFEC 4CEYA 5I91A 2Q8CA 3KCCA 5FMBA 5DDJ3 5C3RA 3QH6A 1RUH3 5FUPA 4B1LA 4DB5A 3RYKA 2XL9A 4UW5A 4QPYA 1LOFC 2PHTA 4RHV1 4TN7A 2JICA 3HQXA 2B46X 3O1PA 1XE8A 4L9BA 4YW6A 1RGSA 1DF0A 3RQ0A 1J83A 4BPZA 5FZKA 1AJKA 1AUYA 4XW3A 1VRBA 1SCSA 4Z1VA 1HRI1 2RDNA 2J22A 5IW0A 4CU6A 3CZUA 4RHV2 2ET7A 2RR11 2ZGKA 1PK6B 1UIKA 2CYFA 1SLBA 3LSEA 4QX0A 2ZMLA 3WD5A 1UXXX 4UFKA 1VBE3 3V56A 3RZKA 2WWUA 1H4GA 1VB4A 1UF2C 2PHXA 3LE0A 1G9BA 4GB32 2HWD2 3VDCA 1NX9A 1PGW2 3ETPA 3ZXFA 2PHRA 1XYPA 3KM5A 3POFA 5KXBA 4DEQA 3ZYIB 3SKJE 2P3IA 4QGNA 2A70A 3VD4A 3H1WA 4DMIA 4QPGB 1YC61 1DG6A 3GZUC 3K48A 4KBBA 5C3SA 1HB4A 1K42A 2OA2A 5A80A 4C0HA 5JI9A 2DYCA 1GWKA 3Q8BA 1UN1A 5EXOA 3AMPA 2DBIA 3ZN6A 2HWE3 3DPRC 3ENRA 4Q4X3 3N7LA 3WV6A 5AC91 1SBDA 2EXKA 2WNVC 4QM9A 4MXWA 2JDNA 2WR9A 4UW4A 2RS11 3OBAA 3H3ZA 4CSWA 1UZZA 1T6GC 4XXAA 1X50A 3SCGA 3O1OA 2GNTA 4YPJA 2VW1A 4AGVA 1IOAA 4D7TA 2BGCA 1W8HA 5FO7B 4RFRB 2QUOA 3USSA 1JOJA 2Q30A 3WNLA 2ZGNA 2WA3A 4QQ2A 4CXXA 1MZFA 4AQ2A 3ZX7A 4DEVA 1C8M2 2DURA 1PNGA 3PMEA 2VZRA 4MSVA 1ZVFA 2E31A 4N8MA 1KFXL 3O1MA 2ZGQA 2P17A 5FYMA 1ULOA 5HCFA 4QB6A 4IEWA 5FJHA 2XDVA 3AZVA 2EXHA 3OCPA 2ZAHA 1ZRDA 2ZABA 1PNFA 3MYXA 5TSWA 5SV8A 4WV8A 4BLIA 2QDNA 1LEDA 4QX7A 4WM8C 4AFAA 2O8OA 1RMU1 4NHLA 1XXNA 3HVDA 1Q8VA 4XPVA 4XZPA 1MACA 3OYWB 1KGYA 1RVF1 4BWOA 2W1SA 1A78A 2HWF1 5FTTC 1Y43B 4H2AA 1UQXA 2DDUA 2C24A 3USUA 1RXGA 3C7HA 3POGA 5APAA 2JE8A 2Y34A 3SEPA 3TEWA 3IIAA 3ZFEA 4OI0A 5FZ3A 3AP7A 3QCWA 4FFIA 4UFJA 1AR83 1QOOA 1Z7S1 4P9GA 4D69A 3KQ4B 1ND3C 1PZ9A 4F7ZA 5F8PA 4WM7C 4I3GA 3BU0A 3DUIA 4JHTA 1WA4A 5EPAA 5J1XA 1UU4A 3QH7A 2PN5A 4NRQA 3T2TA 5BNNC 4FQ4A 4SBVA 3WOGA 3ZYPA 2PMWB 1F5FA 1W05A 4LBNA 3PJQA 5K7PA 2HWB3 1HJFA 5FY4A 4COYA 2WIIB 4LBKA 4QX5A 1AF9A 3ZSKA 2O1QA 1COV3 1FOD3 1VBC1 2ORZA 1WW4A 3BYWA 2IC1A 2NMNA 1RUG2 2DVFA 1RINA 1SHWB 2SLIA 3I97A 4NO4A 3VBHB 3OYWA 5HV4A 5FZIA 1XYNA 3KCXA 5FDBA 4K1YA 2VOTA 1S0DA 2KR2A 1HIXA 4YG3A 2V09A 3OB8A 1W03A 1TE1B 1R093 3CBNA 4M0NA 1MEC1 2J7MA 3FL7A 5FPZA 5C8CA 5FMCA 4PHZA 3TN93 1SACA 3SHRA 4CCCA 5C4WC 3AMMA 5T55A 1QJX1 2JG9B 3PU3A 1PVC1 2GMMA 3WP6A 2WZR2 2XG3A 4UOJA 4XF3A 2ZS6B 3H7YA 2PAKA 2R063 1Y4WA 2E33A 2ZMKA 4L92A 4ASLA 3HOBA 3ROUA 5EFUA 2JXAA 1YJLA 2PHUA 3ZFFA 2WQ8A 5IVJA 1TNRA 5CG8A 1ALYA 4Y4RA 3VBRB 2R041 4JC1A 4LO8A 2JB8A 5FK8A 3AM2A 1DQ4A 5KC5A 4DO0A 1RUOA 1KEXA 4HPKB 4S2DA 5A7QA 3RWKX 2FDKA 2YGLA 2QQPA 2GALA 1NCQB 3N7JA 4M3CF 3PLQA 3N36A 3I2HA 1YCIA 2PLV3 4FQZA 1QJU3 5IK4A 2JB4A 3DKQA 4KH9A 4D3WA 3MPBA 4YG0A 3H8RA 2VZUA 4BE3A 5GLTA 3VD5A 3SC7X 4NHXA 2VE1A 4GXLA 1OF4A 3P1IA 5A6XA 5F3CA 4L97A 2H6BA 2VVFA 4OZOA 2GDFA 4E4SA 5JVVA 5FY0A 1WMXA 1MZEA 2DFBA 5DAXA 4HVRA 2OQ7A 3BIEA 5A6ZA 3W59A 2WAAA 5F5AA 4AI3A 5IVYA 1HN0A 5E16A 3POEA 1SBFA 4CPBA 2B39A 3AZWA 3FHIB 4XDPA 5FOBB 1W28A 4UBGA 2YC0A 1RUI2 5FYZA 3CL1A 1C3HA 3LEMA 3MI8A 4RS5B 1WMDA 5IK7A 2CTVA 1L3JA 1JUIA 1QDOA 3B9CA 1SFPA 4BISA 1BBT3 3O0VA 5BNOB 3WG3A 4OYUA 4NUBA 4RSUA 4YVWC 3NNGA 3P5BA 4Q0UA 3J26N 3RPQA 2RMU2 4FPGA 4IEYA 5FAXA 3RZMA 1OPMA 1MS1A 1DZQA 2AC1A 3HN1A 4KMQA 3VDDC 1HV1A 2X10A 2HBUA 1KJRA 4MGZE 1JYXA 4XUPA 4XACA 3ZSEA 4AFDA 3J7NA 1HRV3 5FREA 3S5AA 4CUBA 2RS32 2CY6A 2WT1A 1F15A 4ZHNA 4XTMA 3FE5A 4OVEA 5L7OC 4PQ9A 1A8DA 2JKXA 4UF0B 3SKVA 1SMVA 1SPPB 3E1F1 1OLQA 4HSJA 1WLDA 2JD9A 2YU2A 2BERA 4QX2A 4LLOA 1M06G 1VALA 2P34A 4JTNA 5EJZB 1NOVA 3TEYA 1ZBE1 2PHFA 4IE7A 2GAUA 1Q8QA 2XGXA 1RUH2 1SFYA 2JG8C 3U4SA 2JDUA 3ZDVA 3OD0A 4AQSA 4WVVA 1QGLA 2VQUA 4NIGA 2W94A 1ODNA 1Q8OA 1SZBA 3DF0A 5FZAA 1YHFA 2W0XA 3K2OA 3ABZA 5EJ3A 1RUC1 4FTSA 1RITA 4C1WA 3EB7A 2VCCA 4WZFA 1QJEA 3NJYA 1JOPA 3NKTA 4GWNA 4GH4B 1IPKA 1WW7A 3N35A 1R1A1 3N9LA 4XFCA 4IV3C 4IE0A 1G9FA 4LBQB 4WVMB 1EAH3 3IMMA 2GNMA 4XFBA 3NJZA 2BJSA 2ARCA 2FCUA 4W6XA 3H0OA 2L9LA 4ARYA 3OTFA 5FYCA 3FUQA 2O0OA 2VMCA 1CIWA 3T0AA 3V64A 1CWPA 2JE7A 1WCUA 5KXEA 1YIPA 3OGGA 3HBKA 3KT4A 5LY1A 1O3SA 3RZZA 1US3A 1Y3TA 3WLUA 3URFA 5AFEA 4Z8BA 5KXCA 1H2MA 4AWDA 4O65A 2GP3A 3A21A 2A75A 3RI8A 2HWE2 1J1TA 1W6OB 3LOIA 2QQVA 1WZXA 2D3PA 3CZJA 2HLEA 2VOXA 2VMFA 2X8KA 4UXAA 1H30A 3SEEA 1W3XA 1GP4A 1AR91 2HEVF 3MDPA 4IV1C 4XZUG 5ANNA 4C1XA 5KXDA 1XNKA 1GZCA 3KQRA 1GR3A 3NO8A 3LGRA 3WNNA 1S2EA 3M4FA 1G6NA 1CPMA 4GH4A 4LKEA 2Y0IA 4R4XA 1LULA 4XF0A 4NIHA 4X6QB 1H9WA 3D5OA 1NAEA 5JXGA 4WVMA 3VD3A 4AI9A 2BFUS 1XPWA 4N90A 2ET1A 3RJRA 1QQP1 4XBQA 2WUHA 1SCRA 3LCPA 3M70A 3MW4A 3HQRA 4AZZA 2UYBA 5DXDA 3PUIA 2DCKA 4NROA 3OPWA 3GDBA 3T08A 3V0BA 4MG2A 4LA3A 2VOKA 2BV4A 3K4DA 3N7KA 5DAWA 3EJKA 3VZOA 2GC1A 4ZONA 4AYUA 4C0BA 1V6LA 1F8VA 3U14A 1QNYA 1W9WA 3SH4A 1IS6A 1UD1A 2V72A 1RUD3 3HEIA 4YSFA 2R6QA 3PJYA 3WT3A 4BB3A 5BNPA 1AR63 4ZS2A 2RG4A 2RM23 2WN2A 2WQ4A 2WSVA 1ASJ3 2AH2A 2XQXA 1GLHA 3ILRA 4XBNA 3S7EA 4GQ7A 3MLJA 1LGCA 4B8EA 4B7KA 1BCXA 4I3PA 4N9IA 1C5HA 1QJY3 1RUF1 2CDPA 3M3QA 3VUOA 3OUIA 1RUJ1 3Q8AA 1AR82 3QLQA 1CGPA 3ZFGC 1UY1A 4AF9A 2E7QA 1UXZA 3PVEA 1ACCA 1UU6A 3NAPB 2QCSB 4W50A 2GC0A 4B4PA 1NCRC 4TWTA 4XQDA 1VRH1 3GGLA 3WG1A 1WUVA 2WS93 1VBB1 2XHNA 2WABA 3AK0A 4Q4Y3 3I3EA 1PIV3 4XJAA 4FXKB 2HYKA 3D3AA 1UIJA 3AZXA 2HWB2 3T4HB 4LR4A 1DU3D 3ZXLA 5FO8B 3TRSB 4MADA 1FOD2 1JZ2A 1VRH2 4XFHA 4CDXC 1Q8SA 1KDMA 5K0UC 2CGNA 2V73A 1DQ5A 1NE4A 1VB2A 1J59A 1WW6A 3KLSA 5F39A 5JOWA 1OSGA 4FPLA 4J6GA 3THPA 1R092 3K51A 4LOSA 3H3UA 5FYIA 2C0ZA 4EZ4A 2AYHA 4Q2FA 2TUNA 2VCAA 3D0SA 1O7FA 2D6PA 4LE4A 4XTPA 4Y5SA 1SQ4A 3OEBA 1C8NA 3ZXGA 2VY0A 1LU2A 1NZIA 1PZ8A 1PGL2 2ZGLA 1O3RA 1S55A 4KL1A 1E5IA 4Q26A 3DYOA 1TMF3 2BUKA 1OI6A 1H8TC 2R062 4Q0VA 3CJIC 1AR72 4XURA 5FK7A 3ZKYA 4LK6A 1CPNA 4Q4W3 3WXPA 4AXOA 5HV0A 2EIEA 1BYHA 4HK9A 4Y4YA 4L8QA 5F5QA 2FCTA 3CEWA 5FMOS 1ULFA 3B00A 2OVUA 3KZ4C 3UKTA 3UKNA 5FO9B 3ACGA 5A7WB 1ZRRA 1QJZA 1SLIA 4LLFA 5FZ8A 3GHMA 4MGSA 1K5MA 4XE9A 3D8CA 2ZA9A 1QMJA 2WZPP 3UGFA 3ZR5A 3U0ZA 1HRI3 1AL21 1JODA 5FFOC 1S2KA 4G4FA 1JOBA 5H9PA 1IS3A 2C26A 2RR13 4S2HA 3R4SA 5E89A 2PXJA 3FBYA 1ZRIA 4AVVA 4XFIA 2VH9A 4JKMA 5FZMA 1Z0HA 5IJRA 3WSOA 4AHWA 1DYPA 4M3CE 1W6PB 2HH9A 2XL7A 4EN0A 5DUUA 1UYPA 1ZRCA 1YQ2A 1DYKA 4KNCA 4L0PA 2EXJA 2XH6A 3LDBA 3WVJA 3ES1A 1CAWB 3HJRA 4XJWA 4X8PA 1I5ZA 2PHLA 2UWAA 5A3PA 3B7MA 4CDQA 1GKBA 4AVSA 3K4ZA 2VW0A 1PM7A 4IW3A 3E5UA 5A7WA 1GZ9A 2YYOA 1OFNA 1BBT2 5FYYA 3VZJA 3ZPYA 1W8NA 3BI3A 2RS13 5JCTA 4B4RA 2ZJCA 4GMP0 1A6CA 1S1AA 4CEWC 1C1FA 1NA1B 1Q56A 2OQ6A 3NNJA 3LWCA 4HONA 4RQPB 5FYSA 5H9SA 5F7UA 2CV6A 3NRUA 2OKXA 2YHJA 2W1UA 1LOGA 2F4LA 2GH2A 1ZA7A 2A6VA 2Q4SA 2VBDA 2WA4A 3POYA 4NE9A 5DN2A 3VBFA 5B4NA 2G9GA 1UPSA 2R072 2MNGA 2VNGA 3PTRB 1VP6A 4LEJA 1HB1A 5A3OA 3TNQA 4E2SA 4TZDA 2BGPA 3JB4C 3U75A 4MGIE 1QXPA 1W6PA 1S0FA 5A32B 1GZTA 3SLIA 3AYCA 4BK5A 4Q1RA 2E6VA 2YFZA 3ES4A 1JMUB 2P1BA 3UT0A 2Z69A 3N3HA 5K0UA 5LA1A 2ZEYA 4M0HA 1GICA 4YM1A 1OA4A 2R0HA 5FKCA 5L73A 1H4HA 5GALA 3T1MA 4GJYA 2E26A 1B35B 4F8AA 2XJQA 2ZEXA 1ONAA 3OY8B 2BVBA 5IT6A 3G7DA 3ITQA 3O1VA 2VL4A 1RMU3 4OUSA 2E7TA 4JKLA 1FV2A 4MLOA 4JDOA 1LOAA 1NKGA 3ZMNA 1RVF3 2GC3A 1YUDA 3IPVB 2HWF3 2VMGA 3WP5A 4N43C 3OBRA 1CQ9A 2Z5WA 4RL7A 2BBAA 3LEGA 4RQPA 1BEV1 2YC4A 1T2XA 4UYBA 1RB8G 2ATFA 3HT1A 4CEYC 1QF3A 4TTGA 3T0DA 1D4M3 3AKRA 1Y9MA 3QBQA 1OLRA 3RFRA 3NMBA 1EV12 3PVOA 2LM3A 5FP4A 4AI1A 4OHWA 5C5UA 1FMD1 4YGDA 3AVRA 3DL3A 1UMZA 5IWFA 5A32A 2D5FA 1OBNA 3K3NA 1W6NB 1LTEA 1W2UA 2JE9A 2WYFA 3VN4A 1OC1A 4CDUC 4META 3ZIXA 4ZU7A 3P3NA 2VZOA 2JDZA 3MIGA 4BK4A 3H8UA 1AYN3 4N7IA 5A70A 1RHI1 5CKMA 4CP2A 4PF1A 1REEA 1NLSA 4CA9A 5ACA1 5IVCA 4CP9B 2XLFA 2I74A 2D93A 3CO2A 2QQJA 3ON7A 1AVBA 1HJGA 1DCSA 4NHYA 5EHDA 1HXS1 2A6WA 2VNVA 1ZBA2 2H0BA 4ISQA 5C9AB 3RZLA 3OGVA 2W68A 1WD4A 1G9CA 5FOJB 1W0NA 5T3NA 3OJBA 1OURA 1MEC3 4UI9L 5FP8A 3MUZ1 3ACFA 4GAZA 3BTYA 1H8VA 4W6WA 2YMZA 4QPWA 5CFDB 5DQ0A 5A33A 1PO21 1GWLA 4YVSB 1GZWB 4JDMA 5FCCA 2W39A 4HKLA 4NAOA 5LBBA 3WDWA 4KWKA 4CCNA 1QJX3 5T5LA 2DU0A 1APNA 3H50A 4Q4V1 4FPFA 4JKKA 3GZTB 1NT0A 3CHXA 2DF7A 4I02A 4V2VA 2WFF2 3AXEA 3OEAA 5FV3A 2VQTA 5T5PA 4DY3A 2GN7A 1XNBA 1YFWA 4MHRA 1Y9GA 4DXRA 1MS0A 4AHZA 1PK6C 1PO13 1Y9QA 2ZAAA 4H55A 2GN3A 3WINE 3O1UA 5K8SA 1W2OA 2WC2A 4QPIB 5FZ1A 1AXKA 3VL8A 2K0GA 1D2QA 4Y5TA 4Y3OA 2RE9A 1RUD2 1DGWA 4HZFA 1PGSA 4XQWA 2JDAA 1XSRA 4HANA 4MZUA 2KD7A 2RM22 2BW8A 4R9CA 3WDXA 5KHIA 4QM8A 5LA9A 4A3XA 1LECA 1LODA 5GM0A 5FY1A 1QH7A 5I0UA 2WZEA 5AFBA 2IVJA 3BPZA 1WWYA 3LPFA 4XFFA 5DAPA 3AC0A 4ZZ8A 1YXWA 4OHZA 2R1DA 5D21A 3NQHA 1RUE1 2Y64A 1G9AA 3ECQA 3IDAA 2JECA 4YFWA 4ZZ5A 2RDSA 3PTYA 1DGRN 2BTVC 2IFRA 3IWZA 3NJXA 5LK5A 3JBG3 2VQAA 4ATEA 4H14A 4IEXA 4Y20B 4LBQD 2WS92 1NYWA 1OLME 1U5YA 3I7DA 1A3KA 3QD6A 2QQNA 1JN2P 3BU7A 4QPIA 2D43A 2X5IB 2FQPA 3LA3A 4XCAA 4A6SA 2OX0A 4OMDA 2OZ6A 3I2GA 1AYM3 3Q8EA 1K3IA 3H1MA 4Z2AA 4FO9A 2ZGTA 3TB0A 4Y1UA 3ZVXA 3S0MA 3CKHA 3H8OA 3KV4A 4OI1A 1VIWB 5JZGA 5FZEA 2X29A 3IT8A 3WF2A 2DWRA 4O9GA 1U12A 3HN3A 5FZGA 4EJRA 5CFCB 4FTBA 1J1LA 2ES3A 1XYOA 1N1VA 1CVNA 3VBSB 4J25A 5L9BA 4Z07A 1W8FA 5I0DA 4GB31 1KDKA 2HWD1 3DV8A 1PGW1 2MHFA 4CDUA 3OPTA 4HSLA 1KD7A 4XHBA 3HT2A 4F3JA 3MLKA 4OHXA 5F3IA 3ILFA 4H7MA 4RD7A 5FPVA 4EN6B 1JYIA 1UY3A 5JMOA 1WMFA 2RS52 3VKOA 1CAVB 2TNFA 2D44A 2NP0A 1UZVA 3AYEA 4XHXA 2FDIA 2HYXA 3M2MA 2X53S 1N1SA 4RGAA 5A3UA 4BYYA 4YZ5A 3NNFA 3U07A 3I2FA 5KWRA 4Q4W2 3PU8A 5C8CC 2A1XA 1J3QA 3IB3A 5EJ1B 2Q1MA 1XSQA 2ZGRA 3LF7A 4PIXA 1OF3A 2WWSA 1YFUA 4LK7A 4BQ2A 4CCDA 1W90A 5FQ0B 2VVDA 3VKLA 5T50A 2CGPA 1C8M1 1RUC3 2JEMA 2V5YA 3FFZA 4OUEA 1GNZA 3U37A 3WHTA 4BZ4A 2OPKA 2GNDA 3HNYM 4D7YA 2WT2A 1PK6A 3ZFFC 4MX3A 4GWMA 1H2KA 1R1A3 4LO5B 4XQ4A 3UK9A 4LA2A 4K6BA 3ZO0B 4PI0A 3MPPG 1LESA 1LHOA 2CL2A 5FZDA 4OQ9A 3VBHC 4Y1ZA 3JD73 4QHOA 4BHPA 5FZ0A 3VB9A 2MEV3 3Q8CA 1C57A 3AL6A 4IERA 4AVTA 4IESA 3VD9A 2D3RA 4EYUA 2WO1A 1XB9A 4I01A 4AGGA 1OOPB 5DAQA 2XVLA 2ZKLA 2QQLA 1G86A 3MGUA 2OUJA 4QPGA 4CCEA 3LOBA 3J7MA 5ABJB 2IZWA 4JRAA 1W39A 4RFT0 1SLAA 2XJRA 3OBZA 1DBNA 1I1EA 4COZA 2JG9C 1D0HA 3VZMA 5J36A 4XXPA 1H1IA 1BHGA 2W3JA 2WT0A 3MBWA 4PBOA 4CUGA 3GBWA 4IGOA 1O4TA 2DCJA 2VAUA 2WO3A 3CNAA 4XABA 2FDHA 1L7QA 4E2QA 5C8WA 3IMNA 2XBO2 1OVSA 2D6KA 3GBFA 3K3OA 5CEHA 5IVBA 3BB6A 3PMSA 1GUIA 2RDQA 1IKQA 4PDWB 1V6JA 4AOCA 2LALA 4RR3B 1B09A 2OUHA 4LIVA 2JD4A 2BFUL 3WNOA 1K45A 4ZXKA 1EUTA 3K46A 1OPOA 3I4IA 1QQP3 4E4ZA 3WF4A 1O6UA 3UV9A 4CCKA 2QQKA 1FPN3 3TAYA 1AXZA 2HWC3 3I2DA 1RUG1 5K9YA 4WZCA 3SITA 2DVDA 1ZRFA 4JGYB 3B69A 4YWAA 4BM8A 4XETA 4PI2A 1Q5OA 3WR0A 5CKNA 4AFMA 4NHMA 5ABJA 2CGOA 4INDA 2RDRA 1AXYA 1IKPA 2C9AA 3I3QA 2WSUA 5IYYA 1LKNA 2JKBA 3PUHA 4P9LA 2GH8A 4DS0A 1J3RA 1F2NA 1IQDC 3B94A 2FZ2A 2ETEA 3KCYA 1QNWA 3J8F2 2XKPA 1TNFA 3AKTA 3MIFA 3DEMA 3WZ1A 4XJ8A 1CR7A 3IN9A 1RUF3 5IK5A 2VW2A 2WNVB 3MF9A 4YYOA 1HDKA 2CWMA 2J1SA 2WZR1 3OD4A 1D4M2 4D7SA 3VDBA 4H3WA 4PDWA 3WF0A 3O12A 4OFGA 1P8JA 4RR3A 3UGHA 2IXKA 3K4AA 4RGGA 2VJXA 1VBA3 3MUY1 1DGRA 3IZOA 4Q0SA 5J98B 4CXWA 3SCHA 4E4HA 2CSGA 3FHAA 1X9TA 1TG7A 3T2OA 5FZCA 2WINB 1H0BA 1VBB3 1DIWA 1U5ZA 3ATGA 1PHMA 4FSJA 4WBBA 2Z42A 2O8QA 2J42A 2IVIB 3HQUA 5IAVA 1H2LA 5F2WA 1AYN2 4NAMA 4PIZA 5BY5A 4CTEA 4I2OA 1HB2A 1S0IA 2B9VA 2XUMA 1HW5A 2BVVA 5DG2A 4NHKA 2WQZC 4FAGA 3O0XA 4RYDA 4KWUA 3VBHA 1F4AA 2LW8A 2W91A 1OUSA 2Q1ZB 1JBCA 2A6ZA 2AEYA 4NR1A 5HXMA 3BOWA 4ORFA 4AEDB 2C9KA 4BJ0A 2FBEA 4IEZA 1YRZA 3WCSA 1GNHA 1MQTB 4LBMA 2BZDA 3OG2A 3BODA 5B2GB 4GALA 3SNMA 2G19A 1LGBA 3SH3A 3ZR6A 2D97A 1RUI1 1YQ5A 2VNRA 1DGLA 2DUPA 2JG9A 5EWSA 1JYCA 1ND3B 1UYYA 4LT5A 3BUCA 4UFIA 4XOGA 3BVCA 4QQPA 4PBPA 2JIGA 1OH4A 1XOYA 4SLIA 4GULA 1W6MB 1ZX5A 2RMU1 4GH4C 1PO12 1FX5A 3NNMA 1JU4A 4MXVA 4XUOA 4AE2A 3UNPA 5FMOL 5FBZA 4HOOA 4HN1A 3GNEA 5AVAA 5BNNB 3VBRA 2XKOA 5CIRA 1IZ3A 3ZSMA 4AI0A 4HVQA 3GALA 4LIUA 4B3NA 4EN8B 4HLTA 4HPKA 2RS31 3ZYHA 1WD3A 3AKQA 4FPEA 2VTXJ 1AL23 5F1RA 5FPLA 4AEDA 1NCQA 2ADEA 1IGOA 4Q27A 2A3XA 5F6KA 1MQTA 3K77A 1POQA 2BGOA 3WUDA 4NPRA 1N3QA 4R9BA 2P4EA 2X09A 3VGIA 4JCKA 1H6YA 2WAOA 3KT7A 4K40A 4Y24A 1BMV2 4MOAA 1UY4A 1XNTA 2E53A 3FZ3A 5BNPC 1JZ3A 1RUH1 1UNBA 2VUAA 3KF3A 5I0TA 3HPNA 3ZN4A 3O1SA 1G9DA 3C7GA 4KGQA 3GM8A 4BU2A 1HV0A 2VMEA 3BCWA 3JBG2 1OKQA 1JYVA 1YQ6A 2FD8A 3LFIA 3KMHA 3POBA 5A1FA 1UZYA 1PMJX 5KHHA 5CNAA 1UOJA 1DZTA 4ZPIA 5DDJ2 3JQXA 4A44A 1U5XA 4RS5A 4DXSA 2JDKA 1E5SA 1ULEA 4JAAA 4A3ZA 1V6KA 1AYM2 4ES8A 5BNOA 2EALA 2Y6GA 1I6XA 1LR5A 3MO4A 4CDWB 5FP3A 1R083 2D6MA 5FY7A 4LPLA 4XAEA 2DVGA 3POIA 4JZRA 3TEZA 5GJ6A 3KHCA 1LHWA 4PT6A 4LUKA 2YV8A 4M01A 4V1PA 3KHBA 3M3EA 4LNVA 1UYXA 5BNQA 4LHLA 5LY2A 1BQPA 2EVXA 3ZXAC 5A1LA 5JXHA 2PQSA 2GZWA 1IG3A 2W08A 5ISLA 1OD3A 1MVQA 3VDAA 1URXA 3LIGA 1VBE2 4UF0A 2ILMA 1SPPA 4KU7A 4UFMA 2I07B 3A22A 1UW8A 2EIBA 2HWE1 2IFWA 2Y6FA 1UOBA 3N9NA 1R1ZA 2B5HA 1CONA 5C6CA 2QZ2A 3FFQA 1UY0A 2JDHA 3C2UA 4YW4A 3WDUA 4YFZA 1BK0A 2EIDA 1XNCA 5KHGA 1G8WA 1V6NA 4G3YC 4N53B 3UESA 5JLVA 3KS7A 4GA9A 2WNOA 2WRAA 4FP2A 4QHZA 3W9AA 2CAUA 2Y60A 4Q4X2 4FOQA 3WQ0A 4D6RA 5D8AB 2WJSA 4AGRA 3HIFA 1BEV3 3ZXEA 4LBJA 3EMRA 2GC2A 1RJ7A 1NXMA 5DPNA 3PL0A 4YVWB 4EZHA 1O4ZA 3DYPA 2VUDA 4LITA 1JUHA 1W3VA 4QDQA 3ZYGA 2FDFA 3I2OA 3VDDB 1V9U3 2DVAA 1S0CA 2ENRA 3IBMA 2R30A 3IKWA 1FMD3 2DFCA 4Y26A 1SFNA 3C7OA 3O7OA 1GOHA 3CDZB 4LBQA 1MZ6A 5CISA 1K5MC 2V4VA 3JD72 4CU9A 4AAPA 2Z2SB 2MEV2 3QACA 5LRRA 1VE0A 3AXDA 1OH3A 3MLLA 4XC9A 5EZWA 5FBJA 2JDPA 3IDCB 4AVAA 5CG9A 4ZY9A 1LOBA 1W0PA 3IDBB 1S0GA 4YM2A 3RS6A 5A3MA 3S57A 4Q0PA 3NNLA 5CA6A 2VZTA 4N53A 5LW9A 4YRDA 5ACA3 3ZXDA 3BTXA 5FP7A 3SCFA 2W2IA 1TME3 3T30A 2Y8KA 4LTAA 1ZZ8A 5JI7A 1AR81 1W6OA 2XPJA 2JG8B 3U11A 4Q29A 1KXGA 2VU9A 2VULA 2IXJA 4KG0A 4AQ6A 2ZHMA 3VBUB 3EO6A 1POV1 4Y5Z0 3VZLA 4CDQC 3G6JB 1GNYA 3LD8A 2XJVA 3MFAA 1V00A 5E88A 1TVGA 2ZZJA 4U2AA 3IDEA 4QXBA 1UAIA 1EP0A 1RYYA 4Q4V3 2HWB1 4ES9A 4HKOA 2QBXA 2JJ6A 4R52A 1SG3A 1IPSA 4XIKA 4P00B 4YNIA 3RDIA 2ZX3A 1FOD1 3VHNA 1UMIA 3AB0A 5IHRA 3VHRA 4IV3B 2HWC2 1BVVA 2ZGMA 3BGAA 5A7PA 3KGLA 1C4RA 4CE8A 3AP6A 3ME2A 1LHNA 3PDQA 4UW3A 3VBFC 1PM4A 5FY9A 1LHVA 1E57A 1UZ0A 5DZFA 5C70A 3INAA 3KWVA 4LE3A 4M3CB 4O9EA 1R091 1COV2 3ELNA 4QX1A 4JVAA 4XAAA 4XF4A 1UWWA 4B29A 1UKRA 3I59B 4Y1XA 3BN6A 2ERFA 2WWJA 5JPMB 2VMIA 4JDNA 3TN91 3KV5A 5IUQA 2I2SA 4IDZA 3DECA 3HNBM 3H1YA 3LEKA 4IQPA 5GZEA 2PYTA 5I8SA 2CHHA 2YGMA 5FRAA 3M7AA 1D2SA 1PGL1 1S2BA 4IV1B 1GQPA 2WNUB 3W5NA 2B4KA 2R061 1W6QB 4P9YA 2BEOA 1AR71 3AZZA 3KVBA 2LUWA 4FPOB 3TN92 2AACA 1VBA2 4AEMA 4AK3A 3NAPA 1VBD3 1LJ7A 1JS9A 1UKGA 1FV3A 5HPOA 3GBGA 4MH0E 4HL0A 1NA1C 4RQPC 3BPSA 2YBKA 4JGZB 4ZU5A 2QQUA 2AENA 1W2TA 4BCUA 4OMCA 4YZ4A 3A7QA 4RHV3 5CB7A 3ZKUA 3R0RA 1OD5A 4KWLA 1WCDJ 2BNMA 3HD8B 3WW2A 3WNKA 3IAQA 1LOCA 2WFPA 3I59A 1VAVA 4A45A 2QQWA 2YG0A 3SMHA 4BQXA 1X8MA 2V4AA 3MV11 2QTWB 4YW3A 1ULDA 3FBMA 3R4UA 2HWD3 4GB33 1BJQA 1AZDA 2BBVA 5JXIA 2VBPA 2PLV2 1H6XA 1QJU2 2AGSA 3O1TA 1DP0A 4XYXA 1IHMA 4ARXA 5FY8A 4Y22B 2ID4A 3APBA 4EROA 1OFSA 1STMA 4EN7B 5IK8A 1MS9A 2NLRA 1HN1A 2XQRA 2UWCA 3WY6A 2R16A 1AX2A 1JZ8A 1BBT1 2F6BA 5L9VA 3S30A 2H0VA 4BMBA 1YEWA 4IETA 3ALQA 2LRPA 4OULA 4JGZA 4COVA 1LAJA 2WDBA 4XIOA 1ZZ9A 4NRPA 2A5ZA 2G9FA 2EA7A 2IXIA 1V0AA 4TLFA 5FXVA 4G9SB 2VOVA 5A6QA 4I0WB 1IS5A 4XMAA 5E8AA 3MIHA 3WQ1A 1E5HA 1VLNA 4LO7A 4Q1PA 5FZ6A 1JI6A 4XDQA 2NZ9A 3PURA 4QXCA 5AC93 3RYPA 1ZYBA 4OI4A 1A34A 2XVKA 2BNOA 3T1LA 1REFA 2R071 1C8M3 5T5OA 5KC6A 2XLGA 1QXJA 2DUOA 3LFMA 5A7NA 1BVP1 1YQ8A 2W87A 4WVZA 5BYNA 1ND2B 4CDXB 3VKFC 1NLQA 5CAZA 5J96B 4QXKA 3RI9A 3M8LA 2WYSA 2Z4FA 3BIWE 4MV2A 5DMYA 3UYJA 5I93A 2N7GA 3I3DA 4CXYA 1VR3A 2XR4A 5L19A 1HRV2 1WCQA 3ZYFA 4QX8A 5LEJA 2UURA 4BQ5A 1Q43A 3I2JA 1S0BA 2ARAA 5D2AA 5A1AA 2NMOA 1JYNA 3ORJA 3M3CA 3MEPA 5FPXA 4XUNA 2Y0OA 3T09A 4FI9A 4EWAA 1DYOA 1IS4A 2KM2A 1F9KA 4IGPA 3MIDA 1CAWA 2ZX1A 1WLWA 1MPXA 1QIQA 3PIGA 4O61A 4S2FA 5FZHA 3GYDA 1JYTA 5FLHA 1NY71 2ZX2A 2XMLA 3NL1A 5FY5A 4JRLA 3WNPA 4XEZA 1RIRA 3CJIB 1CD3G 3OGJA 3EXUA 1DQ0A 2VTFA 4K21A 4QD2A 1WA6X 4D8MA 2ZX4A 1EPWA 1V6IA 3MHZA 1LU1A 1MVEA 1EV11 4PLOA 4XBLA 4ZXEA 2Y33A 4QX3A 4YZ1A 1ND2A 3LA2A 1CAUB 1BK1A 1NA1A 1NY72 4GKXA 1QOTA 4NIIA 2UU8A 4QPIC 1Z7S3 1V70A 2D3SA 3FWEA 3KSCA 4FAHA 1RJ8A 4IEPA 4X6RB 4LMFA 3WCRA 3OGRA 2WZ8A 5CZKA 4A41A 5JZGC 1U0AA 1MZ5A 2R0FA 4ITCA 3NV3A 1EAH2 4KU8A 4AHYA 4EE2A 1RUG3 3MICA 2FDJA 2P6CA 1DHKB 2YY1A 2BYVE 3D82A 4K7JA 4AEJA 5KR7A 4Q0QA 3NV4A 1Y7BA 3JB8A 1RXFA 1ZBA1 3UKVA 2QKDA 1B35A 2VNOA 3OY8A 3T4VA 1MS4A 1VBC3 1DGWX 1NXD1 4GWJA 4BXFA 1GQHA 1HLCA 4HVOA 2AEZA 4BOWA 2VBBA 5GZFA 2JDYA 4CRQA 4M4PA 1NZCA 2DTYA 4DRVA 2VECA 3B9IA 2EAKA 3GJAA 3VV1A 4QGMA 3JCIA 5FUNA 3IPVA 4A7ZA 5I0RA 4PIYA 2XHKA 2ZGPA 5G04L 5IAXA 2D6OX 2VCBA 2W5FA 3RZJA 5GLZA 3C7FA 5FWEA 4H7LA 1XU2A 2WFF1 4CU8A 3Q8FA 4AAXA 2X5IC 4Q5OA 3B5LB 1HQNA 1XC6A 1W99A 3T3YA 5FLJA 1V9U2 1O3TA 5DZEA 4LUMA 3DYMA 2ADDA 2DTWA 2AR6A 3QOPA 5FYBA 5GLVA 5JAXA 1PVC3 1PX4A 3VLBB 4LBOA 1OUXA 2AUYA 1H1MA 1W6NA 1ZA4A 2J1VA 5LA0A 1RUD1 1XRUA 2ZXQA 2FMYA 3ZDSA 1I5PA 2RM21 2IWGB 1W9FA 3KF5A 1OKOA 1GYKA 2V5DA 3L2HA 2R043 1W8ZA 2O14A 1UYZA 4CP9A 5LK7B 1TME2 4QKFA 2XVGA 1QY4A 4IEOA 4CCOA 4AFCA 2HEYF 4KGGA 3AL5A 3GZAA 3RMXA 1AR62 3VZKA 1BXHA 1OLMA 5C9AA 1ASJ2 2UY9A 4YARA 1BKZA 4K8RB 4FT8A 3PVNA 1W9SA 4L99A 5ERLA 5H9RA 5A3NA 2VR4A 4QPGC 1I9RA 1QJY2 2X05A 1JZ6A 3RWNA 3H7JA 3ZOIA 4XFGA 2WS91 3OUHA 4QWNA 5CFDA 4FP3A 1BZWA 4AEKA 4CEYB 4YVSA 1GZWA 3CLPA 3POWA 3PIJA 2E9QA 4K1ZA 2DV9A 4A6OA 1J84A 4WVWA 3DCQA 3PVBB 3NKGA 1ZZ7A 1OHFA 1JZ4A 5FJKA 4CCMA 3RMYA 4HMZA 4ISRA 4KI5M 3BTZA 3KB5A 2A3WA 5F37A 3TYJA 4HK8A 5EYYA 2RMU3 4FPCA 4DIQA 4Q4Y2 2PQQA 2GP5A 1PIV2 1O91A 1UOGA 3AYDA 4AW7A 4BQ4A 1LCLA 5JMCA 1VJ2A 4YM3A 3M1HA 5DZGA 4C91A 2CU5A 5C71A 1O5LA 3VBOB 1C28A 5KBFA 1CIYA 4LOTA 3WUCA 4DUXA 4DNYA 2W52A 2RS51 2W47A 5JR7B 1FT9A 2AREA 3TBDA 4BIFA 5FYVA 5LBFA 5GLWA 3FN9A 3DGTA 3RRDA 2JDMA 4TLGA 1LENA 3JXSA 3M3OA 5ABJC 4CVUA 1CZVA 2VUJA 3S6PA 4D6QA 1WLTA 1UZWA 5T54A 1PMIA 1T6BX 2CAVA 4QGLA 3KV6A 4AHXA 1OQDA 4Q4W1 3NWKA 4Z92B 3PUSA 4I0BA 1W2AX 4AI8A 1VBD2 3SQOA 4LKFA 3GCWA 4XF1A 3ZN6B 1QU0A 1ZZBA 3FC0A 4ATFA 4Y20A 2D5HA 1TMF2 1ZBE3 1QJFA 2CDOA 4MXWB 5FR3A 2OIIA 4FXGB 4PDWC 3NJVA 3D4KA 4HN0A 1X33A 1ST8A 2E51A 2X5IA 3MIEA 3E97A 4M00A 4RR3C 5F3GA 2G1MA 3LKJA 3VBOA 4I09A 4BDVB 2ZKNA 5DAVA 1FATA 5CU1A 4D0QA 3POSA 4IUGA 3WNMA 1MR5A 2ARBA 1UOFA 1A8MA 2RJ2A 2XONA 4FFGA 1XNDA 5CFCA 3FLRA 3AZYA 3L2YA 3A4UA 2YXSA 4IE4A 4CZSA 4JGYC 3VBSA 1AL0G 1HRI2 3ZYJB 1OMIA 2LS6A 3LIHA 4IXLA 5F5CA 2RR12 2XLAA 4YG6A 4DPNA 4B1MA 1W2NA 2A73B 3LAGA 4P9JA 4GD4A 3WF1A 1LRHA 4NRMA 3T2PA 2KA3A 3CIHA 1CAVA 1JTZX 5H9QA 2WL1A 4QAWA 1JW6A 1ULCA 3V0AB 3Q9OA 3BTAA 1KQRA 4LKSA 4LHKA 1XU1A 4AVBA 3RZHA 1NE6A 2VZ3A 4COUA 5FZ9A 3USUB 5JOZA 1XE0A 2XBO1 4DUWA 5EQUA 5FPUA 3O1RA 2PHWA 1D0GA 3ZFEB 2H6CA 3LZZA 1WLCA 3OOXA 5AC92 1HB3A 1KFUL 1TQ5A 3HR9A 3FHQA 3BKZA 3WG2A 5FQ0A 2VXRA 4L11A 3ZSLA 1AR93 2RS12 1YO8A 4W4ZA 4QDRA 5LWBA 4JTOA 4ET7A 4QQOA 1DQ6A 5FKBA 5D1IA 5HCAA 4ASKA 3A0KA 1E5RA 3I54A 3KV9A 4FPKA 5L36A 2J1AA 3VBRC 5T5JA 3I3MA 2P37A 2P3JA 4QXHA 1DLLA 2R1BA 2E32A 1DQ2A 4C8DA 1VAKA 3W58A 3O0WA 3V0AA 4AEDC 1NCQC 1AX0A 2Y6HA 3J9SA 1S0EA 4FCAA 4YW1A 5LRSA 2Y6KA 1MQTC 2RVAA 3EYPA 1J3PA 1TEIA 1IQAA 1OOPA 3DXTA 1QH6A 3J8F1 2YROA 1PMHX 1ENRA 4CP1A 3JUUA 3ZN5A 2QZ3A 2YPDA 1UPIA 1GP5A 2HJIA 4ZKTB 2CWSA 4KWJA 2EIGA 4COWA 1XNAA 1D4M1 2VZSA 2C6SA 1RMU2 3FLTA 3THCA 1XBFA 4QKNA 4NJ4A 5C8CB 4F83A 5B4XA 1HKDA 4RGKA 1LOFA 1POV3 1RVF2 2OT7A 2HWF2 2VO5A 4GWIA 3DPRB 1AJOA 2VUCA 4XMIA 3MZHA 5IFPA 4MUVA 1D4VB 5F3EA 2BWAA 4LO6B 1RUJ3 4JV4A 4YGBA 3RJ2X 4EQVA 1Z7S2 4RS5C 1UY2A 5BNOC 1DZRA 2XOMA 1SLTA 2C1FA 4B7EA 3ZFFB 2J1TA 1AYN1 4YGEA 5JIAA 2KXLA 5CADA 1VRH3 1YI9A 3U10A 1UO9A 2WKKA 4R4ZA 1FNYA 3KGZA 1W06A 2VD7A 2NPIA 2VCMA 3SISA 2EICA 3P6BA 4JGYA 3ACIA 3HWJA 1H2NA 4NPLA 3KD4A 5C3OA 5JDBA 1VBC2 2F4PA 2IXHA 4LQRA 4R8HA 4XF9A 2IXLA 3ZM8A 2YC2A 4HBNA 4EV0A 2VC9A 3C7EA 4LORA 1HQWA 4N7UA 1CX1A 4A42A 2XB6C 3LSDA 4WM8B 2Y6LA 3DXUA 3DPRA 4NPMA 1D7PM 3MF6A 2WNVA 3ST7A 3AMQA 5JR2A 4KQ7A 4FFFA 1MEC2 3H8XA 3AKSA 2GSYA 1F35A 1AR73 1JH5A 1X82A 3A23A 4JQRA 4LHNA 2F17A 2QQMA 4RN5A 5GZDA 1PO11 1EUUA 3GXUA 3N9MA 4CDWC 3PUAA 3U4XA 1IG0A 4Q8LA 1GP6A 1REDA 1QJX2 1PVC2 2ZHNA 4UAPA 3FMGA 5JOYA 2RHPA 3ZXJA 4WM7B 1GOGA 5DUWA 2W9XA 5JUVA 4P08A 4JHZA 1LOEA 3DKWA 2LROA 3N9PA 2AZ5A 4AL9A 2ZGOA 4XCBA 3PNAA 4DRRA 4YGCA 4MGQA 3HMYA 2GMPA 5IATA 2R042 4MGKE 3ZIWA 4P9WA 4YLZA 4IE6A 4LXLA 1BMV1 2VM9A 4DFSA 2JWPA 4QU2A 4IE5A 2ZEWA 4GMP1 4WM8A 2J1RA 2DCYA 4XVHA 5FLIA 2VTXA 3R4DB 1N47A 1EYBA 1C5IA 1W0OA 1ZNPA 3T2QA 3CF6E 1I3HA 2G9ZA 1S0JA 4MYEA 3JBG1 5LEKA 1CJPA 4AQTA 1W8TA 4N53C 4ZS3A 4NIDA 1WMEA 2QNKA 3EBRA 1GMMA 4O7XA 2YDEA 4IGQA 2W95A 3WF3A 5A6YA 2PELA 3BOPA 4I0AA 4EWDA 5DDJ1 5C5TA 1JHNA 2Q5TA 3ACLA 5D8AC 1GSLA 1NG0A 2VOWA 1ND3A 4Z82A 1AYM1 4E8DA 4EN9B 2FZ1A 4WM7A 4UW6A 5C4WB 5CVRA 1JZ7A 3NV2A 4BQWA 4FPHA 1XJAA 2NQYA 1KITA 2W1QA 1AX1A 1W6MA 1LHUA 4AR2A 5HCBA 3AMHA 4XUQA 2PAEA 1OA3A 2BNNA 5BNNA 4GKYA 3LA7A 1H1AA 3SXWA 1FYUA 2NM1A 2P3KA 3WEZA 2J1EA 2R073 3LDKA 3VHPA 5JPNB 5KHJA 2WO7A 4JX0A 4YM0A 1QXRA 1DQ1A 1ULGA 1WBLA 3X29B 4AI2A 2BOIA 3B02A 5IVFA 1M4WA 3AP5A 1VBE1 3JZVA 3NW4A 1QHDA 4DXZA 5FZ7A 3ETQA 1UL9A 4QKDA 4PCRA 3S7IA 2DCZA 1ENXA 4FOVA 4NIAA 3H42B 2D98A 5HXVA 5FXXA 2VMHA 5M0TA 1N3PA 3FUOA 4OQ8A 3VBUC 2BOJA 4DOUA 1ULPA 1W8WA 3VL9A 1R64A 2YBPA 4V2WA 5C4WA 5J3UA 3O5SA 1Q8PA 2RJKA 2ZBJA 4Q4X1 4P5HA 2B8MA 1ZBE2 1VMHA 1OA2A 4YW7A 3OSDA 4MGTA 2I45A 3N7MA 2J1UA 5FIXA 3AKPA 5C3PA 1VAMA 1MS8A 1WCSA 2PTMA 4FPYA 4AVCA 4B4QA 4BMEA 3NAPC 1ZZCA 4OLLA 1EV13 4CDWA 5J48A 3MW3A 3KVAA 1QWRA 3OBTA 1X7NA 1C1LA 1YWKA 1YYNA 4UT5A 3EHKA 2Q8OA 3GJBA 2HKXA 4X8NA 1ENSA 1RUC2 1WKYA 3JD71 4Y1YA 3ZLIA 1UX6A 4D6SA 4BXSV 2MEV1 1FXZA 1GBGA 4OZXA 1CZSA 3V0BB 2C4XA 5F32A 3THDA 1HQLA 1R1A2 1H9PA 2VXJA 1X8EA 5J09A 2C5DA 4Y33A 1EPZA 2WN3A 2PFWA 2VMDA 4XUTA 4XJUA 1UCXA 3RG0A 5JXJA 3WP3A 1HX6A 2YU1A 4S2GA 5BNPB 3IAPA 1ZBA3 1K5JA 5L7OB 4KBZA 4P02B 3P3PA 1RUNA 1QEXA 5CBLA 5CKQA 2FDGA 4BIOA 2WNUC 1RHI3 2JENA 1WGPA 4A7YA 2XXZA 1YFYA 5C33A 1CAXB 2TBVA 1N1YA 5FP9A 4CU7A 2WO2A 4C90A 3D6EA 3RYRA 2BP6A 1NLRA 2XUEA 1HXS3 3LPGA 2A6YA 4IEUA 5D8AA 4FOYA 1GANA 1G7YA 1YLLA 2D6LX 2YUEA 2ZX0A 3I2IA 3MW2A 2IUWA 1AR92 1VPHA 2PAMA 2FCVA 2XJPA 4JGZC 4A7KA 4QDSA 1F4HA 2WFF3 3FLPA 4YVWA 4RA0A 5FYUA 2HBTA 3H3LA 5BXXA 3C3VA 1FPN1 3DN7A 1SLLA 3UJOA 2HWC1 2NYYA 1KRIA 4PF5A 1PO23 4Z2WA 5EYXA 2GNBA 2ZZQA 3VDDA 3ZYBA 2VZVA 5I0SA 4LULA 3POJA 3NV1A 3WW4A 2DCTA 1L7RA 3AP4A 4UFLA 5C3QA 1QQP2 3OGSA 4P9XA 5DUXA 1COV1 4DUVA 2B9UA 1KS5A 1FPN2 4OHVA 2XWJB 1O8SA 1LEMA 2D40A 2DBNA 2WNEA 4FVVA 4BA6A 1ZM1A 5L7OA 4BQYA 2A71A 4FFHA 2BPA2 4P5YA 3LQCA 1EY2A 1YNAA 3GCXA 3RVHA 1CAXA 5LBEA 2UWBA 2YPJA 4P9IA 1K12A 5AVPA 3ACHA 4Y1VA 4E4DX 2NN8A 2VZPA 2EXIA 5JSOA 5GZCA 2JG8A 3K75B 4Q8KA 2E7AA 3A0NA 4DXTA 3VBUA 1VBA1 5HI0A 1PZ7A 3AFGA 1NQJA 4MO3M 1RUF2 3LEIA 4K9SA 5FXWA 2P6HA 1RUE3 3S5QA 1RUJ2 2ZCWA 3ZPOA 5ANQA 4BLJA 3WDYA 3V65A 3M3IA 4XJZA 3UETA 5IVEA 2K9ZA 2W92A 1GU3A 3ZYRA 5F9TA 4A4AA 4FBFA 1ND2C 4HKWA 4HFSA 4IV3A 2A3YA 4FOWA 3WG4A 5J7MA 1VBB2 1K5MB 4DY5A 4NWVA 1Z78A 3R05A 3TEXA 3OUJA 1VMFA 1S4CA 5JOXA 3IIIA 3J7HA 4CUCA 1SDWA 4CP0A 4M3CA 2PLV1 1QJU1 4YW2A 5L9RA 2IXCA 1KJLA 4QQHA 4UWDA 5LASA 2LTNA 4I30A 4NMIA 1JHJA 2RS53 5BUVA 3GHNA 5DUVA 5F6LB 3THTA 2BWCA 5HCHA 4LO4B 3L9JT 3ZSJA 1PX3A 4E2GA 5I8YA 1SDDB 5EP9A 3HBZA 2BU9A 1B35C 1RTVA 1W9TA 1DFQA 4M4RA 3UL2A 3W20A 4A2UA 3B3QE 4IV1A 1GFF2 1JU3A 2WNUA 4QMAA 1W6QA 1GWMA 3J4UH 5C7GA 3F2ZA 1JZ5A 4CDQB 2ZEZA 3D0JA 1YJKA 2QFEA 3BALA 3WDTA 1JYWA 4P14A 3U78A 2PHDA 1W04A 2ORXA 5FWJA 3I49A 1QDCA 2W46A 4UBHA 5FPBA 1MS5A 5DG1A 3ZFGB 1CESA 2DVBA 3RSJA 2Y26A 5SV5A 1WBFA 5GLUA 3WW1A 4FTEA 1OVPA 1W8OA 1NCRB 3CQOA 3WHUA 3WNXA 5JSPA 4HT1T 4N9HA 1UU5A 4MHUA 5EIYB 3AYAA 3HNMA 4PLMA 5FMDA 5A3TA 3VBFB 3E6BA 3OF1A 4YW5A 4FPJA 1LB2A 1WW5A 1HRV1 3LB9A 2YFUA 4MVTA 5FZ4A 5BPXA 3I8TA 4QB1A 1AL22 4J1WA 5IVVA 5A7OA 2Q8EA 1Q3EA 1YI7A 5K0UB 5HBAA 2SBAA 2CNAA 1X9PA 3ILNA 2OPWA 1KS4A 5A3WA 2K46A 4Y22A 3GZEA 1U5IA 1YFXA 2VVEA 4UFHA 4E9KA 1OT5A 3W5MA 1YIFA 4GIQA 3B93A 3RZGA 4XILA 3RNSA 3ZFGA 4CCJA 5C9AC 1OQEA 1OXCA 2ZHLA 3VHOA 3WW3A 2QVSB 2WLPA 2QJVA 4MGYE 3AJYA 3WQ7A 2R7EB 3OPZA 4HG6B 2OYZA 1R081 2YB7A 1NCRA 1YQCA 2OW4A 3B01A 2Q0AA 2XBO3 5E1RA 3E5XA 2VPVA 2BQPA 1JXNA 1NUKA 4U36A 5CFDC 2A6XA 4YVSC 1AHSA 1ZREA 3ZXKA 2FHRA 2DU1A 1H8TB 4QHBA 1FAYA 2R32A 3HAGA 2VZQA 2ZACA 4QU1A 4K20A 5FZLA 5BV6A 4D94A 4YZ2A 3CMGA 4YZ3A 1QOSA 3WX5A 1R082 1O8PA 2D7FA 3EQEA 3O14A 4GZ9A 5FZBA 4URAA 1IPJA 3TOJA 3LDRA 4DINB 1MS3A 4BQ1A 4CDXA 5GZGA 1EAH1 2EAAA 3KT1A 5GKAC 3PUQA 4QB2A 1F31A 5G05L 3T0BA 3FJSA 2ZMNA 1RC6A 2XJUA 1US2A 2G4IA 3UJQA 2ZPXA 3E5QA 3FX3A 3WQBA 2XJSA 2JX9A 4CPBD 3F95A 2ARXA 1CJDA 1XE7A 5KHKA 4OUMA 1F5JA 3J7LA 1TZOA 1WCKA 2GMEA 2PA7A 1BLZA 3IM0A 1X36A 4DZGA 4W8JA 4IL7A 2ZOEB 3J8F3 2WBKA 4N43B 1L7LA 2OZJA 4JQTA 5LBCA 2GU9A 2VGDA 4TYSA 1VMJA 3C8XA 3CJXA 4K3UA 1H8TA 4PLNA 3CJIA 1UMHA 1OQ1A 2ZGSA 3JQWA 3W21A 3N4MA 4KG8A 4K8FA 5A33B 4ONUA 2QQIA 4IEVA 1V9U1 2RJLA 4LKDA 5FZOB 4E27A 2E63A 4XDOA 5I8TA 2Q8DA 1O4YA 1BEV2 5FPAA 1CAUA 2WZR3 4LBLA 2JIJA 3UGGA 5LZ6A 3GF6A 4EWEA 2QQOA 1DLCA 1W9YA 2QE3A 5JSRA 3VBOC 4E8CA 5EV7A 4CEWB 3E6CC 1CN1A 2VQ0A 4NOTA 2YZ4A 4L2NA 3VKNA 3VD7A 1FMD2 3SH5A 2P2KA 3ZMOA 5K4LA 5CFCC 2EF6A 4QKBA 4HETA 5FYTA 4URTA 5F2SA 1TME1 3NSTA 1FI2A 1V6MA 3VBSC 2VZ1A 1DDLA 3WDVA 1AR61 3MV01 4TSVA 3ASIA 2B45X 4PQQA 2Q1FA 1ASJ1 1CX4A 2P5BA 3AVSA 3AMNA 5FUIA 2WLQA 2YBSA 1O3QA 1RHI2 1ZZ6A 2BRTA 1SBEA 3NVCA 5ACA2 2HEWF 3N9OA 1LGNA 1QJY1 3AP9A 1RL3A 4BQ3A 1HXS2 5FZOA 5IFTA 5FXZA 4AG4A 2B7YA 3I3BA 4TXWA 1J58A 4R9AA 2A7AA 1N3OA 2MPFA 2Z79A 5FYHA 2XWBB 4XFAA 5J37A 3CU7A 3MIBA 2TEPA
chains in the Genus database with same CATH topology
1Y9GA 3UGFA 1Y4WA 2AC1A 5FKBA 3ZR5A 4UFJA 1ST8A 1Y9MA 2ADEA 3PIJA 4FFIA 3U1XA 3NMBA 3ZR6A 4UFMA 3LF7A 4FFHA 5FMDA 3KF5A 5FKCA 4CCDA 4HXCA 3LDKA 4UFIA 3PIGA 4CCCA 5FK8A 3HBKA 4CCEA 4FFGA 3OSDA 3H3LA 3UGGA 3S5QA 4UFKA 5FK7A 5FIXA 5FMBA 3RWKX 4AZZA 2QQUA 4EQVA 5FMCA 3UGHA 1W2TA 3LIHA 3KF3A 1UYPA 2AEYA 2XQRA 3LEMA 4B1LA 2QQVA 4QHZA 2OXBA 4UFHA 2ADDA 4B1MA 4JQTA 3LFIA 4UFLA 4FFFA 5ANNA 3U14A 3SC7X 3LDRA 3U75A 3IMMA 2QQWA 3LIGA 2AEZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y9G A;  3UGF A;  1Y4W A;  2AC1 A;  5FKB A;  3ZR5 A;  4UFJ A;  1ST8 A;  1Y9M A;  2ADE A;  3PIJ A;  4FFI A;  3U1X A;  3NMB A;  3ZR6 A;  4UFM A;  3LF7 A;  4FFH A;  5FMD A;  3KF5 A;  5FKC A;  4CCD A;  4HXC A;  3LDK A;  4UFI A;  3PIG A;  4CCC A;  5FK8 A;  3HBK A;  4CCE A;  4FFG A;  3OSD A;  3H3L A;  3UGG A;  3S5Q A;  4UFK A;  5FK7 A;  5FIX A;  5FMB A;  3RWK X;  4AZZ A;  2QQU A;  4EQV A;  5FMC A;  3UGH A;  1W2T A;  3LIH A;  3KF3 A;  1UYP A;  2AEY A;  2XQR A;  3LEM A;  4B1L A;  2QQV A;  4QHZ A;  2OXB A;  4UFH A;  2ADD A;  4B1M A;  4JQT A;  3LFI A;  4UFL A;  4FFF A;  5ANN A;  3U14 A;  3SC7 X;  3LDR A;  3U75 A;  3IMM A;  2QQW A;  3LIG A;  2AEZ A; 
#chains in the Genus database with same CATH topology
 4CEW A;  1PO2 2;  2ZHK A;  3AX4 A;  4OCT A;  4Q4Y 1;  2UY8 A;  2R49 A;  4NWW A;  1PIV 1;  3PHM A;  2UYA A;  1RUI 3;  1UX7 A;  5FZF A;  3U1X A;  5E6H A;  3E6D A;  5LAT A;  2P3Y A;  4CCL A;  4Q4V 2;  2BDR A;  2Y38 A;  3TNP B;  2FMD A;  1ENQ A;  1QKQ A;  5JWP A;  3TWI A;  5DAB A;  1N1T A;  4ZU4 A;  1GV9 A;  5JZG B;  1ODM A;  4NN0 A;  1XQN A;  1PVX A;  2B42 B;  2W1W A;  5F5I A;  3VKM A;  3I2K A;  5T52 A;  5JIU A;  2K2S A;  2VG9 A;  4AFB A;  4CUA A;  1POV 0;  2OXB A;  4BH9 A;  1NQD A;  4R9D A;  4CDU B;  3H9A A;  1W8U A;  4ASM B;  5LCW L;  4OI2 A;  4QQL A;  4W6Y A;  2RS3 3;  5LB6 A;  1FNZ A;  2DUQ A;  4GMP 3;  3WP4 A;  4CYD A;  4J1X A;  3AJZ A;  3R6S A;  4NVP A;  1SLC A;  4IEQ A;  1GOF A;  2XJT A;  1SEF A;  2QDR A;  1V6O A;  2ZGU A;  3MFC A;  2Y6J A;  4PJY A;  2D6N A;  1OOP C;  1VBD 1;  4QT6 A;  4XJ9 A;  1O59 A;  5A7S A;  3RGB A;  4W65 A;  5LA2 A;  3AFK A;  4GJZ A;  4HXC A;  3N9Q A;  4DQA A;  1CZT A;  4LJH A;  4N43 A;  5A3L A;  1RUE 2;  2OS2 A;  4LHS A;  4OHY A;  3JU9 A;  1GQG A;  2RV9 A;  1O5U A;  5CYY A;  1LNS A;  2ZTN A;  1TMF 1;  3VZN A;  3ZFE C;  4CEY A;  5I91 A;  2Q8C A;  3KCC A;  5FMB A;  5DDJ 3;  5C3R A;  3QH6 A;  1RUH 3;  5FUP A;  4B1L A;  4DB5 A;  3RYK A;  2XL9 A;  4UW5 A;  4QPY A;  1LOF C;  2PHT A;  4RHV 1;  4TN7 A;  2JIC A;  3HQX A;  2B46 X;  3O1P A;  1XE8 A;  4L9B A;  4YW6 A;  1RGS A;  1DF0 A;  3RQ0 A;  1J83 A;  4BPZ A;  5FZK A;  1AJK A;  1AUY A;  4XW3 A;  1VRB A;  1SCS A;  4Z1V A;  1HRI 1;  2RDN A;  2J22 A;  5IW0 A;  4CU6 A;  3CZU A;  4RHV 2;  2ET7 A;  2RR1 1;  2ZGK A;  1PK6 B;  1UIK A;  2CYF A;  1SLB A;  3LSE A;  4QX0 A;  2ZML A;  3WD5 A;  1UXX X;  4UFK A;  1VBE 3;  3V56 A;  3RZK A;  2WWU A;  1H4G A;  1VB4 A;  1UF2 C;  2PHX A;  3LE0 A;  1G9B A;  4GB3 2;  2HWD 2;  3VDC A;  1NX9 A;  1PGW 2;  3ETP A;  3ZXF A;  2PHR A;  1XYP A;  3KM5 A;  3POF A;  5KXB A;  4DEQ A;  3ZYI B;  3SKJ E;  2P3I A;  4QGN A;  2A70 A;  3VD4 A;  3H1W A;  4DMI A;  4QPG B;  1YC6 1;  1DG6 A;  3GZU C;  3K48 A;  4KBB A;  5C3S A;  1HB4 A;  1K42 A;  2OA2 A;  5A80 A;  4C0H A;  5JI9 A;  2DYC A;  1GWK A;  3Q8B A;  1UN1 A;  5EXO A;  3AMP A;  2DBI A;  3ZN6 A;  2HWE 3;  3DPR C;  3ENR A;  4Q4X 3;  3N7L A;  3WV6 A;  5AC9 1;  1SBD A;  2EXK A;  2WNV C;  4QM9 A;  4MXW A;  2JDN A;  2WR9 A;  4UW4 A;  2RS1 1;  3OBA A;  3H3Z A;  4CSW A;  1UZZ A;  1T6G C;  4XXA A;  1X50 A;  3SCG A;  3O1O A;  2GNT A;  4YPJ A;  2VW1 A;  4AGV A;  1IOA A;  4D7T A;  2BGC A;  1W8H A;  5FO7 B;  4RFR B;  2QUO A;  3USS A;  1JOJ A;  2Q30 A;  3WNL A;  2ZGN A;  2WA3 A;  4QQ2 A;  4CXX A;  1MZF A;  4AQ2 A;  3ZX7 A;  4DEV A;  1C8M 2;  2DUR A;  1PNG A;  3PME A;  2VZR A;  4MSV A;  1ZVF A;  2E31 A;  4N8M A;  1KFX L;  3O1M A;  2ZGQ A;  2P17 A;  5FYM A;  1ULO A;  5HCF A;  4QB6 A;  4IEW A;  5FJH A;  2XDV A;  3AZV A;  2EXH A;  3OCP A;  2ZAH A;  1ZRD A;  2ZAB A;  1PNF A;  3MYX A;  5TSW A;  5SV8 A;  4WV8 A;  4BLI A;  2QDN A;  1LED A;  4QX7 A;  4WM8 C;  4AFA A;  2O8O A;  1RMU 1;  4NHL A;  1XXN A;  3HVD A;  1Q8V A;  4XPV A;  4XZP A;  1MAC A;  3OYW B;  1KGY A;  1RVF 1;  4BWO A;  2W1S A;  1A78 A;  2HWF 1;  5FTT C;  1Y43 B;  4H2A A;  1UQX A;  2DDU A;  2C24 A;  3USU A;  1RXG A;  3C7H A;  3POG A;  5APA A;  2JE8 A;  2Y34 A;  3SEP A;  3TEW A;  3IIA A;  3ZFE A;  4OI0 A;  5FZ3 A;  3AP7 A;  3QCW A;  4FFI A;  4UFJ A;  1AR8 3;  1QOO A;  1Z7S 1;  4P9G A;  4D69 A;  3KQ4 B;  1ND3 C;  1PZ9 A;  4F7Z A;  5F8P A;  4WM7 C;  4I3G A;  3BU0 A;  3DUI A;  4JHT A;  1WA4 A;  5EPA A;  5J1X A;  1UU4 A;  3QH7 A;  2PN5 A;  4NRQ A;  3T2T A;  5BNN C;  4FQ4 A;  4SBV A;  3WOG A;  3ZYP A;  2PMW B;  1F5F A;  1W05 A;  4LBN A;  3PJQ A;  5K7P A;  2HWB 3;  1HJF A;  5FY4 A;  4COY A;  2WII B;  4LBK A;  4QX5 A;  1AF9 A;  3ZSK A;  2O1Q A;  1COV 3;  1FOD 3;  1VBC 1;  2ORZ A;  1WW4 A;  3BYW A;  2IC1 A;  2NMN A;  1RUG 2;  2DVF A;  1RIN A;  1SHW B;  2SLI A;  3I97 A;  4NO4 A;  3VBH B;  3OYW A;  5HV4 A;  5FZI A;  1XYN A;  3KCX A;  5FDB A;  4K1Y A;  2VOT A;  1S0D A;  2KR2 A;  1HIX A;  4YG3 A;  2V09 A;  3OB8 A;  1W03 A;  1TE1 B;  1R09 3;  3CBN A;  4M0N A;  1MEC 1;  2J7M A;  3FL7 A;  5FPZ A;  5C8C A;  5FMC A;  4PHZ A;  3TN9 3;  1SAC A;  3SHR A;  4CCC A;  5C4W C;  3AMM A;  5T55 A;  1QJX 1;  2JG9 B;  3PU3 A;  1PVC 1;  2GMM A;  3WP6 A;  2WZR 2;  2XG3 A;  4UOJ A;  4XF3 A;  2ZS6 B;  3H7Y A;  2PAK A;  2R06 3;  1Y4W A;  2E33 A;  2ZMK A;  4L92 A;  4ASL A;  3HOB A;  3ROU A;  5EFU A;  2JXA A;  1YJL A;  2PHU A;  3ZFF A;  2WQ8 A;  5IVJ A;  1TNR A;  5CG8 A;  1ALY A;  4Y4R A;  3VBR B;  2R04 1;  4JC1 A;  4LO8 A;  2JB8 A;  5FK8 A;  3AM2 A;  1DQ4 A;  5KC5 A;  4DO0 A;  1RUO A;  1KEX A;  4HPK B;  4S2D A;  5A7Q A;  3RWK X;  2FDK A;  2YGL A;  2QQP A;  2GAL A;  1NCQ B;  3N7J A;  4M3C F;  3PLQ A;  3N36 A;  3I2H A;  1YCI A;  2PLV 3;  4FQZ A;  1QJU 3;  5IK4 A;  2JB4 A;  3DKQ A;  4KH9 A;  4D3W A;  3MPB A;  4YG0 A;  3H8R A;  2VZU A;  4BE3 A;  5GLT A;  3VD5 A;  3SC7 X;  4NHX A;  2VE1 A;  4GXL A;  1OF4 A;  3P1I A;  5A6X A;  5F3C A;  4L97 A;  2H6B A;  2VVF A;  4OZO A;  2GDF A;  4E4S A;  5JVV A;  5FY0 A;  1WMX A;  1MZE A;  2DFB A;  5DAX A;  4HVR A;  2OQ7 A;  3BIE A;  5A6Z A;  3W59 A;  2WAA A;  5F5A A;  4AI3 A;  5IVY A;  1HN0 A;  5E16 A;  3POE A;  1SBF A;  4CPB A;  2B39 A;  3AZW A;  3FHI B;  4XDP A;  5FOB B;  1W28 A;  4UBG A;  2YC0 A;  1RUI 2;  5FYZ A;  3CL1 A;  1C3H A;  3LEM A;  3MI8 A;  4RS5 B;  1WMD A;  5IK7 A;  2CTV A;  1L3J A;  1JUI A;  1QDO A;  3B9C A;  1SFP A;  4BIS A;  1BBT 3;  3O0V A;  5BNO B;  3WG3 A;  4OYU A;  4NUB A;  4RSU A;  4YVW C;  3NNG A;  3P5B A;  4Q0U A;  3J26 N;  3RPQ A;  2RMU 2;  4FPG A;  4IEY A;  5FAX A;  3RZM A;  1OPM A;  1MS1 A;  1DZQ A;  2AC1 A;  3HN1 A;  4KMQ A;  3VDD C;  1HV1 A;  2X10 A;  2HBU A;  1KJR A;  4MGZ E;  1JYX A;  4XUP A;  4XAC A;  3ZSE A;  4AFD A;  3J7N A;  1HRV 3;  5FRE A;  3S5A A;  4CUB A;  2RS3 2;  2CY6 A;  2WT1 A;  1F15 A;  4ZHN A;  4XTM A;  3FE5 A;  4OVE A;  5L7O C;  4PQ9 A;  1A8D A;  2JKX A;  4UF0 B;  3SKV A;  1SMV A;  1SPP B;  3E1F 1;  1OLQ A;  4HSJ A;  1WLD A;  2JD9 A;  2YU2 A;  2BER A;  4QX2 A;  4LLO A;  1M06 G;  1VAL A;  2P34 A;  4JTN A;  5EJZ B;  1NOV A;  3TEY A;  1ZBE 1;  2PHF A;  4IE7 A;  2GAU A;  1Q8Q A;  2XGX A;  1RUH 2;  1SFY A;  2JG8 C;  3U4S A;  2JDU A;  3ZDV A;  3OD0 A;  4AQS A;  4WVV A;  1QGL A;  2VQU A;  4NIG A;  2W94 A;  1ODN A;  1Q8O A;  1SZB A;  3DF0 A;  5FZA A;  1YHF A;  2W0X A;  3K2O A;  3ABZ A;  5EJ3 A;  1RUC 1;  4FTS A;  1RIT A;  4C1W A;  3EB7 A;  2VCC A;  4WZF A;  1QJE A;  3NJY A;  1JOP A;  3NKT A;  4GWN A;  4GH4 B;  1IPK A;  1WW7 A;  3N35 A;  1R1A 1;  3N9L A;  4XFC A;  4IV3 C;  4IE0 A;  1G9F A;  4LBQ B;  4WVM B;  1EAH 3;  3IMM A;  2GNM A;  4XFB A;  3NJZ A;  2BJS A;  2ARC A;  2FCU A;  4W6X A;  3H0O A;  2L9L A;  4ARY A;  3OTF A;  5FYC A;  3FUQ A;  2O0O A;  2VMC A;  1CIW A;  3T0A A;  3V64 A;  1CWP A;  2JE7 A;  1WCU A;  5KXE A;  1YIP A;  3OGG A;  3HBK A;  3KT4 A;  5LY1 A;  1O3S A;  3RZZ A;  1US3 A;  1Y3T A;  3WLU A;  3URF A;  5AFE A;  4Z8B A;  5KXC A;  1H2M A;  4AWD A;  4O65 A;  2GP3 A;  3A21 A;  2A75 A;  3RI8 A;  2HWE 2;  1J1T A;  1W6O B;  3LOI A;  2QQV A;  1WZX A;  2D3P A;  3CZJ A;  2HLE A;  2VOX A;  2VMF A;  2X8K A;  4UXA A;  1H30 A;  3SEE A;  1W3X A;  1GP4 A;  1AR9 1;  2HEV F;  3MDP A;  4IV1 C;  4XZU G;  5ANN A;  4C1X A;  5KXD A;  1XNK A;  1GZC A;  3KQR A;  1GR3 A;  3NO8 A;  3LGR A;  3WNN A;  1S2E A;  3M4F A;  1G6N A;  1CPM A;  4GH4 A;  4LKE A;  2Y0I A;  4R4X A;  1LUL A;  4XF0 A;  4NIH A;  4X6Q B;  1H9W A;  3D5O A;  1NAE A;  5JXG A;  4WVM A;  3VD3 A;  4AI9 A;  2BFU S;  1XPW A;  4N90 A;  2ET1 A;  3RJR A;  1QQP 1;  4XBQ A;  2WUH A;  1SCR A;  3LCP A;  3M70 A;  3MW4 A;  3HQR A;  4AZZ A;  2UYB A;  5DXD A;  3PUI A;  2DCK A;  4NRO A;  3OPW A;  3GDB A;  3T08 A;  3V0B A;  4MG2 A;  4LA3 A;  2VOK A;  2BV4 A;  3K4D A;  3N7K A;  5DAW A;  3EJK A;  3VZO A;  2GC1 A;  4ZON A;  4AYU A;  4C0B A;  1V6L A;  1F8V A;  3U14 A;  1QNY A;  1W9W A;  3SH4 A;  1IS6 A;  1UD1 A;  2V72 A;  1RUD 3;  3HEI A;  4YSF A;  2R6Q A;  3PJY A;  3WT3 A;  4BB3 A;  5BNP A;  1AR6 3;  4ZS2 A;  2RG4 A;  2RM2 3;  2WN2 A;  2WQ4 A;  2WSV A;  1ASJ 3;  2AH2 A;  2XQX A;  1GLH A;  3ILR A;  4XBN A;  3S7E A;  4GQ7 A;  3MLJ A;  1LGC A;  4B8E A;  4B7K A;  1BCX A;  4I3P A;  4N9I A;  1C5H A;  1QJY 3;  1RUF 1;  2CDP A;  3M3Q A;  3VUO A;  3OUI A;  1RUJ 1;  3Q8A A;  1AR8 2;  3QLQ A;  1CGP A;  3ZFG C;  1UY1 A;  4AF9 A;  2E7Q A;  1UXZ A;  3PVE A;  1ACC A;  1UU6 A;  3NAP B;  2QCS B;  4W50 A;  2GC0 A;  4B4P A;  1NCR C;  4TWT A;  4XQD A;  1VRH 1;  3GGL A;  3WG1 A;  1WUV A;  2WS9 3;  1VBB 1;  2XHN A;  2WAB A;  3AK0 A;  4Q4Y 3;  3I3E A;  1PIV 3;  4XJA A;  4FXK B;  2HYK A;  3D3A A;  1UIJ A;  3AZX A;  2HWB 2;  3T4H B;  4LR4 A;  1DU3 D;  3ZXL A;  5FO8 B;  3TRS B;  4MAD A;  1FOD 2;  1JZ2 A;  1VRH 2;  4XFH A;  4CDX C;  1Q8S A;  1KDM A;  5K0U C;  2CGN A;  2V73 A;  1DQ5 A;  1NE4 A;  1VB2 A;  1J59 A;  1WW6 A;  3KLS A;  5F39 A;  5JOW A;  1OSG A;  4FPL A;  4J6G A;  3THP A;  1R09 2;  3K51 A;  4LOS A;  3H3U A;  5FYI A;  2C0Z A;  4EZ4 A;  2AYH A;  4Q2F A;  2TUN A;  2VCA A;  3D0S A;  1O7F A;  2D6P A;  4LE4 A;  4XTP A;  4Y5S A;  1SQ4 A;  3OEB A;  1C8N A;  3ZXG A;  2VY0 A;  1LU2 A;  1NZI A;  1PZ8 A;  1PGL 2;  2ZGL A;  1O3R A;  1S55 A;  4KL1 A;  1E5I A;  4Q26 A;  3DYO A;  1TMF 3;  2BUK A;  1OI6 A;  1H8T C;  2R06 2;  4Q0V A;  3CJI C;  1AR7 2;  4XUR A;  5FK7 A;  3ZKY A;  4LK6 A;  1CPN A;  4Q4W 3;  3WXP A;  4AXO A;  5HV0 A;  2EIE A;  1BYH A;  4HK9 A;  4Y4Y A;  4L8Q A;  5F5Q A;  2FCT A;  3CEW A;  5FMO S;  1ULF A;  3B00 A;  2OVU A;  3KZ4 C;  3UKT A;  3UKN A;  5FO9 B;  3ACG A;  5A7W B;  1ZRR A;  1QJZ A;  1SLI A;  4LLF A;  5FZ8 A;  3GHM A;  4MGS A;  1K5M A;  4XE9 A;  3D8C A;  2ZA9 A;  1QMJ A;  2WZP P;  3UGF A;  3ZR5 A;  3U0Z A;  1HRI 3;  1AL2 1;  1JOD A;  5FFO C;  1S2K A;  4G4F A;  1JOB A;  5H9P A;  1IS3 A;  2C26 A;  2RR1 3;  4S2H A;  3R4S A;  5E89 A;  2PXJ A;  3FBY A;  1ZRI A;  4AVV A;  4XFI A;  2VH9 A;  4JKM A;  5FZM A;  1Z0H A;  5IJR A;  3WSO A;  4AHW A;  1DYP A;  4M3C E;  1W6P B;  2HH9 A;  2XL7 A;  4EN0 A;  5DUU A;  1UYP A;  1ZRC A;  1YQ2 A;  1DYK A;  4KNC A;  4L0P A;  2EXJ A;  2XH6 A;  3LDB A;  3WVJ A;  3ES1 A;  1CAW B;  3HJR A;  4XJW A;  4X8P A;  1I5Z A;  2PHL A;  2UWA A;  5A3P A;  3B7M A;  4CDQ A;  1GKB A;  4AVS A;  3K4Z A;  2VW0 A;  1PM7 A;  4IW3 A;  3E5U A;  5A7W A;  1GZ9 A;  2YYO A;  1OFN A;  1BBT 2;  5FYY A;  3VZJ A;  3ZPY A;  1W8N A;  3BI3 A;  2RS1 3;  5JCT A;  4B4R A;  2ZJC A;  4GMP 0;  1A6C A;  1S1A A;  4CEW C;  1C1F A;  1NA1 B;  1Q56 A;  2OQ6 A;  3NNJ A;  3LWC A;  4HON A;  4RQP B;  5FYS A;  5H9S A;  5F7U A;  2CV6 A;  3NRU A;  2OKX A;  2YHJ A;  2W1U A;  1LOG A;  2F4L A;  2GH2 A;  1ZA7 A;  2A6V A;  2Q4S A;  2VBD A;  2WA4 A;  3POY A;  4NE9 A;  5DN2 A;  3VBF A;  5B4N A;  2G9G A;  1UPS A;  2R07 2;  2MNG A;  2VNG A;  3PTR B;  1VP6 A;  4LEJ A;  1HB1 A;  5A3O A;  3TNQ A;  4E2S A;  4TZD A;  2BGP A;  3JB4 C;  3U75 A;  4MGI E;  1QXP A;  1W6P A;  1S0F A;  5A32 B;  1GZT A;  3SLI A;  3AYC A;  4BK5 A;  4Q1R A;  2E6V A;  2YFZ A;  3ES4 A;  1JMU B;  2P1B A;  3UT0 A;  2Z69 A;  3N3H A;  5K0U A;  5LA1 A;  2ZEY A;  4M0H A;  1GIC A;  4YM1 A;  1OA4 A;  2R0H A;  5FKC A;  5L73 A;  1H4H A;  5GAL A;  3T1M A;  4GJY A;  2E26 A;  1B35 B;  4F8A A;  2XJQ A;  2ZEX A;  1ONA A;  3OY8 B;  2BVB A;  5IT6 A;  3G7D A;  3ITQ A;  3O1V A;  2VL4 A;  1RMU 3;  4OUS A;  2E7T A;  4JKL A;  1FV2 A;  4MLO A;  4JDO A;  1LOA A;  1NKG A;  3ZMN A;  1RVF 3;  2GC3 A;  1YUD A;  3IPV B;  2HWF 3;  2VMG A;  3WP5 A;  4N43 C;  3OBR A;  1CQ9 A;  2Z5W A;  4RL7 A;  2BBA A;  3LEG A;  4RQP A;  1BEV 1;  2YC4 A;  1T2X A;  4UYB A;  1RB8 G;  2ATF A;  3HT1 A;  4CEY C;  1QF3 A;  4TTG A;  3T0D A;  1D4M 3;  3AKR A;  1Y9M A;  3QBQ A;  1OLR A;  3RFR A;  3NMB A;  1EV1 2;  3PVO A;  2LM3 A;  5FP4 A;  4AI1 A;  4OHW A;  5C5U A;  1FMD 1;  4YGD A;  3AVR A;  3DL3 A;  1UMZ A;  5IWF A;  5A32 A;  2D5F A;  1OBN A;  3K3N A;  1W6N B;  1LTE A;  1W2U A;  2JE9 A;  2WYF A;  3VN4 A;  1OC1 A;  4CDU C;  4MET A;  3ZIX A;  4ZU7 A;  3P3N A;  2VZO A;  2JDZ A;  3MIG A;  4BK4 A;  3H8U A;  1AYN 3;  4N7I A;  5A70 A;  1RHI 1;  5CKM A;  4CP2 A;  4PF1 A;  1REE A;  1NLS A;  4CA9 A;  5ACA 1;  5IVC A;  4CP9 B;  2XLF A;  2I74 A;  2D93 A;  3CO2 A;  2QQJ A;  3ON7 A;  1AVB A;  1HJG A;  1DCS A;  4NHY A;  5EHD A;  1HXS 1;  2A6W A;  2VNV A;  1ZBA 2;  2H0B A;  4ISQ A;  5C9A B;  3RZL A;  3OGV A;  2W68 A;  1WD4 A;  1G9C A;  5FOJ B;  1W0N A;  5T3N A;  3OJB A;  1OUR A;  1MEC 3;  4UI9 L;  5FP8 A;  3MUZ 1;  3ACF A;  4GAZ A;  3BTY A;  1H8V A;  4W6W A;  2YMZ A;  4QPW A;  5CFD B;  5DQ0 A;  5A33 A;  1PO2 1;  1GWL A;  4YVS B;  1GZW B;  4JDM A;  5FCC A;  2W39 A;  4HKL A;  4NAO A;  5LBB A;  3WDW A;  4KWK A;  4CCN A;  1QJX 3;  5T5L A;  2DU0 A;  1APN A;  3H50 A;  4Q4V 1;  4FPF A;  4JKK A;  3GZT B;  1NT0 A;  3CHX A;  2DF7 A;  4I02 A;  4V2V A;  2WFF 2;  3AXE A;  3OEA A;  5FV3 A;  2VQT A;  5T5P A;  4DY3 A;  2GN7 A;  1XNB A;  1YFW A;  4MHR A;  1Y9G A;  4DXR A;  1MS0 A;  4AHZ A;  1PK6 C;  1PO1 3;  1Y9Q A;  2ZAA A;  4H55 A;  2GN3 A;  3WIN E;  3O1U A;  5K8S A;  1W2O A;  2WC2 A;  4QPI B;  5FZ1 A;  1AXK A;  3VL8 A;  2K0G A;  1D2Q A;  4Y5T A;  4Y3O A;  2RE9 A;  1RUD 2;  1DGW A;  4HZF A;  1PGS A;  4XQW A;  2JDA A;  1XSR A;  4HAN A;  4MZU A;  2KD7 A;  2RM2 2;  2BW8 A;  4R9C A;  3WDX A;  5KHI A;  4QM8 A;  5LA9 A;  4A3X A;  1LEC A;  1LOD A;  5GM0 A;  5FY1 A;  1QH7 A;  5I0U A;  2WZE A;  5AFB A;  2IVJ A;  3BPZ A;  1WWY A;  3LPF A;  4XFF A;  5DAP A;  3AC0 A;  4ZZ8 A;  1YXW A;  4OHZ A;  2R1D A;  5D21 A;  3NQH A;  1RUE 1;  2Y64 A;  1G9A A;  3ECQ A;  3IDA A;  2JEC A;  4YFW A;  4ZZ5 A;  2RDS A;  3PTY A;  1DGR N;  2BTV C;  2IFR A;  3IWZ A;  3NJX A;  5LK5 A;  3JBG 3;  2VQA A;  4ATE A;  4H14 A;  4IEX A;  4Y20 B;  4LBQ D;  2WS9 2;  1NYW A;  1OLM E;  1U5Y A;  3I7D A;  1A3K A;  3QD6 A;  2QQN A;  1JN2 P;  3BU7 A;  4QPI A;  2D43 A;  2X5I B;  2FQP A;  3LA3 A;  4XCA A;  4A6S A;  2OX0 A;  4OMD A;  2OZ6 A;  3I2G A;  1AYM 3;  3Q8E A;  1K3I A;  3H1M A;  4Z2A A;  4FO9 A;  2ZGT A;  3TB0 A;  4Y1U A;  3ZVX A;  3S0M A;  3CKH A;  3H8O A;  3KV4 A;  4OI1 A;  1VIW B;  5JZG A;  5FZE A;  2X29 A;  3IT8 A;  3WF2 A;  2DWR A;  4O9G A;  1U12 A;  3HN3 A;  5FZG A;  4EJR A;  5CFC B;  4FTB A;  1J1L A;  2ES3 A;  1XYO A;  1N1V A;  1CVN A;  3VBS B;  4J25 A;  5L9B A;  4Z07 A;  1W8F A;  5I0D A;  4GB3 1;  1KDK A;  2HWD 1;  3DV8 A;  1PGW 1;  2MHF A;  4CDU A;  3OPT A;  4HSL A;  1KD7 A;  4XHB A;  3HT2 A;  4F3J A;  3MLK A;  4OHX A;  5F3I A;  3ILF A;  4H7M A;  4RD7 A;  5FPV A;  4EN6 B;  1JYI A;  1UY3 A;  5JMO A;  1WMF A;  2RS5 2;  3VKO A;  1CAV B;  2TNF A;  2D44 A;  2NP0 A;  1UZV A;  3AYE A;  4XHX A;  2FDI A;  2HYX A;  3M2M A;  2X53 S;  1N1S A;  4RGA A;  5A3U A;  4BYY A;  4YZ5 A;  3NNF A;  3U07 A;  3I2F A;  5KWR A;  4Q4W 2;  3PU8 A;  5C8C C;  2A1X A;  1J3Q A;  3IB3 A;  5EJ1 B;  2Q1M A;  1XSQ A;  2ZGR A;  3LF7 A;  4PIX A;  1OF3 A;  2WWS A;  1YFU A;  4LK7 A;  4BQ2 A;  4CCD A;  1W90 A;  5FQ0 B;  2VVD A;  3VKL A;  5T50 A;  2CGP A;  1C8M 1;  1RUC 3;  2JEM A;  2V5Y A;  3FFZ A;  4OUE A;  1GNZ A;  3U37 A;  3WHT A;  4BZ4 A;  2OPK A;  2GND A;  3HNY M;  4D7Y A;  2WT2 A;  1PK6 A;  3ZFF C;  4MX3 A;  4GWM A;  1H2K A;  1R1A 3;  4LO5 B;  4XQ4 A;  3UK9 A;  4LA2 A;  4K6B A;  3ZO0 B;  4PI0 A;  3MPP G;  1LES A;  1LHO A;  2CL2 A;  5FZD A;  4OQ9 A;  3VBH C;  4Y1Z A;  3JD7 3;  4QHO A;  4BHP A;  5FZ0 A;  3VB9 A;  2MEV 3;  3Q8C A;  1C57 A;  3AL6 A;  4IER A;  4AVT A;  4IES A;  3VD9 A;  2D3R A;  4EYU A;  2WO1 A;  1XB9 A;  4I01 A;  4AGG A;  1OOP B;  5DAQ A;  2XVL A;  2ZKL A;  2QQL A;  1G86 A;  3MGU A;  2OUJ A;  4QPG A;  4CCE A;  3LOB A;  3J7M A;  5ABJ B;  2IZW A;  4JRA A;  1W39 A;  4RFT 0;  1SLA A;  2XJR A;  3OBZ A;  1DBN A;  1I1E A;  4COZ A;  2JG9 C;  1D0H A;  3VZM A;  5J36 A;  4XXP A;  1H1I A;  1BHG A;  2W3J A;  2WT0 A;  3MBW A;  4PBO A;  4CUG A;  3GBW A;  4IGO A;  1O4T A;  2DCJ A;  2VAU A;  2WO3 A;  3CNA A;  4XAB A;  2FDH A;  1L7Q A;  4E2Q A;  5C8W A;  3IMN A;  2XBO 2;  1OVS A;  2D6K A;  3GBF A;  3K3O A;  5CEH A;  5IVB A;  3BB6 A;  3PMS A;  1GUI A;  2RDQ A;  1IKQ A;  4PDW B;  1V6J A;  4AOC A;  2LAL A;  4RR3 B;  1B09 A;  2OUH A;  4LIV A;  2JD4 A;  2BFU L;  3WNO A;  1K45 A;  4ZXK A;  1EUT A;  3K46 A;  1OPO A;  3I4I A;  1QQP 3;  4E4Z A;  3WF4 A;  1O6U A;  3UV9 A;  4CCK A;  2QQK A;  1FPN 3;  3TAY A;  1AXZ A;  2HWC 3;  3I2D A;  1RUG 1;  5K9Y A;  4WZC A;  3SIT A;  2DVD A;  1ZRF A;  4JGY B;  3B69 A;  4YWA A;  4BM8 A;  4XET A;  4PI2 A;  1Q5O A;  3WR0 A;  5CKN A;  4AFM A;  4NHM A;  5ABJ A;  2CGO A;  4IND A;  2RDR A;  1AXY A;  1IKP A;  2C9A A;  3I3Q A;  2WSU A;  5IYY A;  1LKN A;  2JKB A;  3PUH A;  4P9L A;  2GH8 A;  4DS0 A;  1J3R A;  1F2N A;  1IQD C;  3B94 A;  2FZ2 A;  2ETE A;  3KCY A;  1QNW A;  3J8F 2;  2XKP A;  1TNF A;  3AKT A;  3MIF A;  3DEM A;  3WZ1 A;  4XJ8 A;  1CR7 A;  3IN9 A;  1RUF 3;  5IK5 A;  2VW2 A;  2WNV B;  3MF9 A;  4YYO A;  1HDK A;  2CWM A;  2J1S A;  2WZR 1;  3OD4 A;  1D4M 2;  4D7S A;  3VDB A;  4H3W A;  4PDW A;  3WF0 A;  3O12 A;  4OFG A;  1P8J A;  4RR3 A;  3UGH A;  2IXK A;  3K4A A;  4RGG A;  2VJX A;  1VBA 3;  3MUY 1;  1DGR A;  3IZO A;  4Q0S A;  5J98 B;  4CXW A;  3SCH A;  4E4H A;  2CSG A;  3FHA A;  1X9T A;  1TG7 A;  3T2O A;  5FZC A;  2WIN B;  1H0B A;  1VBB 3;  1DIW A;  1U5Z A;  3ATG A;  1PHM A;  4FSJ A;  4WBB A;  2Z42 A;  2O8Q A;  2J42 A;  2IVI B;  3HQU A;  5IAV A;  1H2L A;  5F2W A;  1AYN 2;  4NAM A;  4PIZ A;  5BY5 A;  4CTE A;  4I2O A;  1HB2 A;  1S0I A;  2B9V A;  2XUM A;  1HW5 A;  2BVV A;  5DG2 A;  4NHK A;  2WQZ C;  4FAG A;  3O0X A;  4RYD A;  4KWU A;  3VBH A;  1F4A A;  2LW8 A;  2W91 A;  1OUS A;  2Q1Z B;  1JBC A;  2A6Z A;  2AEY A;  4NR1 A;  5HXM A;  3BOW A;  4ORF A;  4AED B;  2C9K A;  4BJ0 A;  2FBE A;  4IEZ A;  1YRZ A;  3WCS A;  1GNH A;  1MQT B;  4LBM A;  2BZD A;  3OG2 A;  3BOD A;  5B2G B;  4GAL A;  3SNM A;  2G19 A;  1LGB A;  3SH3 A;  3ZR6 A;  2D97 A;  1RUI 1;  1YQ5 A;  2VNR A;  1DGL A;  2DUP A;  2JG9 A;  5EWS A;  1JYC A;  1ND3 B;  1UYY A;  4LT5 A;  3BUC A;  4UFI A;  4XOG A;  3BVC A;  4QQP A;  4PBP A;  2JIG A;  1OH4 A;  1XOY A;  4SLI A;  4GUL A;  1W6M B;  1ZX5 A;  2RMU 1;  4GH4 C;  1PO1 2;  1FX5 A;  3NNM A;  1JU4 A;  4MXV A;  4XUO A;  4AE2 A;  3UNP A;  5FMO L;  5FBZ A;  4HOO A;  4HN1 A;  3GNE A;  5AVA A;  5BNN B;  3VBR A;  2XKO A;  5CIR A;  1IZ3 A;  3ZSM A;  4AI0 A;  4HVQ A;  3GAL A;  4LIU A;  4B3N A;  4EN8 B;  4HLT A;  4HPK A;  2RS3 1;  3ZYH A;  1WD3 A;  3AKQ A;  4FPE A;  2VTX J;  1AL2 3;  5F1R A;  5FPL A;  4AED A;  1NCQ A;  2ADE A;  1IGO A;  4Q27 A;  2A3X A;  5F6K A;  1MQT A;  3K77 A;  1POQ A;  2BGO A;  3WUD A;  4NPR A;  1N3Q A;  4R9B A;  2P4E A;  2X09 A;  3VGI A;  4JCK A;  1H6Y A;  2WAO A;  3KT7 A;  4K40 A;  4Y24 A;  1BMV 2;  4MOA A;  1UY4 A;  1XNT A;  2E53 A;  3FZ3 A;  5BNP C;  1JZ3 A;  1RUH 1;  1UNB A;  2VUA A;  3KF3 A;  5I0T A;  3HPN A;  3ZN4 A;  3O1S A;  1G9D A;  3C7G A;  4KGQ A;  3GM8 A;  4BU2 A;  1HV0 A;  2VME A;  3BCW A;  3JBG 2;  1OKQ A;  1JYV A;  1YQ6 A;  2FD8 A;  3LFI A;  3KMH A;  3POB A;  5A1F A;  1UZY A;  1PMJ X;  5KHH A;  5CNA A;  1UOJ A;  1DZT A;  4ZPI A;  5DDJ 2;  3JQX A;  4A44 A;  1U5X A;  4RS5 A;  4DXS A;  2JDK A;  1E5S A;  1ULE A;  4JAA A;  4A3Z A;  1V6K A;  1AYM 2;  4ES8 A;  5BNO A;  2EAL A;  2Y6G A;  1I6X A;  1LR5 A;  3MO4 A;  4CDW B;  5FP3 A;  1R08 3;  2D6M A;  5FY7 A;  4LPL A;  4XAE A;  2DVG A;  3POI A;  4JZR A;  3TEZ A;  5GJ6 A;  3KHC A;  1LHW A;  4PT6 A;  4LUK A;  2YV8 A;  4M01 A;  4V1P A;  3KHB A;  3M3E A;  4LNV A;  1UYX A;  5BNQ A;  4LHL A;  5LY2 A;  1BQP A;  2EVX A;  3ZXA C;  5A1L A;  5JXH A;  2PQS A;  2GZW A;  1IG3 A;  2W08 A;  5ISL A;  1OD3 A;  1MVQ A;  3VDA A;  1URX A;  3LIG A;  1VBE 2;  4UF0 A;  2ILM A;  1SPP A;  4KU7 A;  4UFM A;  2I07 B;  3A22 A;  1UW8 A;  2EIB A;  2HWE 1;  2IFW A;  2Y6F A;  1UOB A;  3N9N A;  1R1Z A;  2B5H A;  1CON A;  5C6C A;  2QZ2 A;  3FFQ A;  1UY0 A;  2JDH A;  3C2U A;  4YW4 A;  3WDU A;  4YFZ A;  1BK0 A;  2EID A;  1XNC A;  5KHG A;  1G8W A;  1V6N A;  4G3Y C;  4N53 B;  3UES A;  5JLV A;  3KS7 A;  4GA9 A;  2WNO A;  2WRA A;  4FP2 A;  4QHZ A;  3W9A A;  2CAU A;  2Y60 A;  4Q4X 2;  4FOQ A;  3WQ0 A;  4D6R A;  5D8A B;  2WJS A;  4AGR A;  3HIF A;  1BEV 3;  3ZXE A;  4LBJ A;  3EMR A;  2GC2 A;  1RJ7 A;  1NXM A;  5DPN A;  3PL0 A;  4YVW B;  4EZH A;  1O4Z A;  3DYP A;  2VUD A;  4LIT A;  1JUH A;  1W3V A;  4QDQ A;  3ZYG A;  2FDF A;  3I2O A;  3VDD B;  1V9U 3;  2DVA A;  1S0C A;  2ENR A;  3IBM A;  2R30 A;  3IKW A;  1FMD 3;  2DFC A;  4Y26 A;  1SFN A;  3C7O A;  3O7O A;  1GOH A;  3CDZ B;  4LBQ A;  1MZ6 A;  5CIS A;  1K5M C;  2V4V A;  3JD7 2;  4CU9 A;  4AAP A;  2Z2S B;  2MEV 2;  3QAC A;  5LRR A;  1VE0 A;  3AXD A;  1OH3 A;  3MLL A;  4XC9 A;  5EZW A;  5FBJ A;  2JDP A;  3IDC B;  4AVA A;  5CG9 A;  4ZY9 A;  1LOB A;  1W0P A;  3IDB B;  1S0G A;  4YM2 A;  3RS6 A;  5A3M A;  3S57 A;  4Q0P A;  3NNL A;  5CA6 A;  2VZT A;  4N53 A;  5LW9 A;  4YRD A;  5ACA 3;  3ZXD A;  3BTX A;  5FP7 A;  3SCF A;  2W2I A;  1TME 3;  3T30 A;  2Y8K A;  4LTA A;  1ZZ8 A;  5JI7 A;  1AR8 1;  1W6O A;  2XPJ A;  2JG8 B;  3U11 A;  4Q29 A;  1KXG A;  2VU9 A;  2VUL A;  2IXJ A;  4KG0 A;  4AQ6 A;  2ZHM A;  3VBU B;  3EO6 A;  1POV 1;  4Y5Z 0;  3VZL A;  4CDQ C;  3G6J B;  1GNY A;  3LD8 A;  2XJV A;  3MFA A;  1V00 A;  5E88 A;  1TVG A;  2ZZJ A;  4U2A A;  3IDE A;  4QXB A;  1UAI A;  1EP0 A;  1RYY A;  4Q4V 3;  2HWB 1;  4ES9 A;  4HKO A;  2QBX A;  2JJ6 A;  4R52 A;  1SG3 A;  1IPS A;  4XIK A;  4P00 B;  4YNI A;  3RDI A;  2ZX3 A;  1FOD 1;  3VHN A;  1UMI A;  3AB0 A;  5IHR A;  3VHR A;  4IV3 B;  2HWC 2;  1BVV A;  2ZGM A;  3BGA A;  5A7P A;  3KGL A;  1C4R A;  4CE8 A;  3AP6 A;  3ME2 A;  1LHN A;  3PDQ A;  4UW3 A;  3VBF C;  1PM4 A;  5FY9 A;  1LHV A;  1E57 A;  1UZ0 A;  5DZF A;  5C70 A;  3INA A;  3KWV A;  4LE3 A;  4M3C B;  4O9E A;  1R09 1;  1COV 2;  3ELN A;  4QX1 A;  4JVA A;  4XAA A;  4XF4 A;  1UWW A;  4B29 A;  1UKR A;  3I59 B;  4Y1X A;  3BN6 A;  2ERF A;  2WWJ A;  5JPM B;  2VMI A;  4JDN A;  3TN9 1;  3KV5 A;  5IUQ A;  2I2S A;  4IDZ A;  3DEC A;  3HNB M;  3H1Y A;  3LEK A;  4IQP A;  5GZE A;  2PYT A;  5I8S A;  2CHH A;  2YGM A;  5FRA A;  3M7A A;  1D2S A;  1PGL 1;  1S2B A;  4IV1 B;  1GQP A;  2WNU B;  3W5N A;  2B4K A;  2R06 1;  1W6Q B;  4P9Y A;  2BEO A;  1AR7 1;  3AZZ A;  3KVB A;  2LUW A;  4FPO B;  3TN9 2;  2AAC A;  1VBA 2;  4AEM A;  4AK3 A;  3NAP A;  1VBD 3;  1LJ7 A;  1JS9 A;  1UKG A;  1FV3 A;  5HPO A;  3GBG A;  4MH0 E;  4HL0 A;  1NA1 C;  4RQP C;  3BPS A;  2YBK A;  4JGZ B;  4ZU5 A;  2QQU A;  2AEN A;  1W2T A;  4BCU A;  4OMC A;  4YZ4 A;  3A7Q A;  4RHV 3;  5CB7 A;  3ZKU A;  3R0R A;  1OD5 A;  4KWL A;  1WCD J;  2BNM A;  3HD8 B;  3WW2 A;  3WNK A;  3IAQ A;  1LOC A;  2WFP A;  3I59 A;  1VAV A;  4A45 A;  2QQW A;  2YG0 A;  3SMH A;  4BQX A;  1X8M A;  2V4A A;  3MV1 1;  2QTW B;  4YW3 A;  1ULD A;  3FBM A;  3R4U A;  2HWD 3;  4GB3 3;  1BJQ A;  1AZD A;  2BBV A;  5JXI A;  2VBP A;  2PLV 2;  1H6X A;  1QJU 2;  2AGS A;  3O1T A;  1DP0 A;  4XYX A;  1IHM A;  4ARX A;  5FY8 A;  4Y22 B;  2ID4 A;  3APB A;  4ERO A;  1OFS A;  1STM A;  4EN7 B;  5IK8 A;  1MS9 A;  2NLR A;  1HN1 A;  2XQR A;  2UWC A;  3WY6 A;  2R16 A;  1AX2 A;  1JZ8 A;  1BBT 1;  2F6B A;  5L9V A;  3S30 A;  2H0V A;  4BMB A;  1YEW A;  4IET A;  3ALQ A;  2LRP A;  4OUL A;  4JGZ A;  4COV A;  1LAJ A;  2WDB A;  4XIO A;  1ZZ9 A;  4NRP A;  2A5Z A;  2G9F A;  2EA7 A;  2IXI A;  1V0A A;  4TLF A;  5FXV A;  4G9S B;  2VOV A;  5A6Q A;  4I0W B;  1IS5 A;  4XMA A;  5E8A A;  3MIH A;  3WQ1 A;  1E5H A;  1VLN A;  4LO7 A;  4Q1P A;  5FZ6 A;  1JI6 A;  4XDQ A;  2NZ9 A;  3PUR A;  4QXC A;  5AC9 3;  3RYP A;  1ZYB A;  4OI4 A;  1A34 A;  2XVK A;  2BNO A;  3T1L A;  1REF A;  2R07 1;  1C8M 3;  5T5O A;  5KC6 A;  2XLG A;  1QXJ A;  2DUO A;  3LFM A;  5A7N A;  1BVP 1;  1YQ8 A;  2W87 A;  4WVZ A;  5BYN A;  1ND2 B;  4CDX B;  3VKF C;  1NLQ A;  5CAZ A;  5J96 B;  4QXK A;  3RI9 A;  3M8L A;  2WYS A;  2Z4F A;  3BIW E;  4MV2 A;  5DMY A;  3UYJ A;  5I93 A;  2N7G A;  3I3D A;  4CXY A;  1VR3 A;  2XR4 A;  5L19 A;  1HRV 2;  1WCQ A;  3ZYF A;  4QX8 A;  5LEJ A;  2UUR A;  4BQ5 A;  1Q43 A;  3I2J A;  1S0B A;  2ARA A;  5D2A A;  5A1A A;  2NMO A;  1JYN A;  3ORJ A;  3M3C A;  3MEP A;  5FPX A;  4XUN A;  2Y0O A;  3T09 A;  4FI9 A;  4EWA A;  1DYO A;  1IS4 A;  2KM2 A;  1F9K A;  4IGP A;  3MID A;  1CAW A;  2ZX1 A;  1WLW A;  1MPX A;  1QIQ A;  3PIG A;  4O61 A;  4S2F A;  5FZH A;  3GYD A;  1JYT A;  5FLH A;  1NY7 1;  2ZX2 A;  2XML A;  3NL1 A;  5FY5 A;  4JRL A;  3WNP A;  4XEZ A;  1RIR A;  3CJI B;  1CD3 G;  3OGJ A;  3EXU A;  1DQ0 A;  2VTF A;  4K21 A;  4QD2 A;  1WA6 X;  4D8M A;  2ZX4 A;  1EPW A;  1V6I A;  3MHZ A;  1LU1 A;  1MVE A;  1EV1 1;  4PLO A;  4XBL A;  4ZXE A;  2Y33 A;  4QX3 A;  4YZ1 A;  1ND2 A;  3LA2 A;  1CAU B;  1BK1 A;  1NA1 A;  1NY7 2;  4GKX A;  1QOT A;  4NII A;  2UU8 A;  4QPI C;  1Z7S 3;  1V70 A;  2D3S A;  3FWE A;  3KSC A;  4FAH A;  1RJ8 A;  4IEP A;  4X6R B;  4LMF A;  3WCR A;  3OGR A;  2WZ8 A;  5CZK A;  4A41 A;  5JZG C;  1U0A A;  1MZ5 A;  2R0F A;  4ITC A;  3NV3 A;  1EAH 2;  4KU8 A;  4AHY A;  4EE2 A;  1RUG 3;  3MIC A;  2FDJ A;  2P6C A;  1DHK B;  2YY1 A;  2BYV E;  3D82 A;  4K7J A;  4AEJ A;  5KR7 A;  4Q0Q A;  3NV4 A;  1Y7B A;  3JB8 A;  1RXF A;  1ZBA 1;  3UKV A;  2QKD A;  1B35 A;  2VNO A;  3OY8 A;  3T4V A;  1MS4 A;  1VBC 3;  1DGW X;  1NXD 1;  4GWJ A;  4BXF A;  1GQH A;  1HLC A;  4HVO A;  2AEZ A;  4BOW A;  2VBB A;  5GZF A;  2JDY A;  4CRQ A;  4M4P A;  1NZC A;  2DTY A;  4DRV A;  2VEC A;  3B9I A;  2EAK A;  3GJA A;  3VV1 A;  4QGM A;  3JCI A;  5FUN A;  3IPV A;  4A7Z A;  5I0R A;  4PIY A;  2XHK A;  2ZGP A;  5G04 L;  5IAX A;  2D6O X;  2VCB A;  2W5F A;  3RZJ A;  5GLZ A;  3C7F A;  5FWE A;  4H7L A;  1XU2 A;  2WFF 1;  4CU8 A;  3Q8F A;  4AAX A;  2X5I C;  4Q5O A;  3B5L B;  1HQN A;  1XC6 A;  1W99 A;  3T3Y A;  5FLJ A;  1V9U 2;  1O3T A;  5DZE A;  4LUM A;  3DYM A;  2ADD A;  2DTW A;  2AR6 A;  3QOP A;  5FYB A;  5GLV A;  5JAX A;  1PVC 3;  1PX4 A;  3VLB B;  4LBO A;  1OUX A;  2AUY A;  1H1M A;  1W6N A;  1ZA4 A;  2J1V A;  5LA0 A;  1RUD 1;  1XRU A;  2ZXQ A;  2FMY A;  3ZDS A;  1I5P A;  2RM2 1;  2IWG B;  1W9F A;  3KF5 A;  1OKO A;  1GYK A;  2V5D A;  3L2H A;  2R04 3;  1W8Z A;  2O14 A;  1UYZ A;  4CP9 A;  5LK7 B;  1TME 2;  4QKF A;  2XVG A;  1QY4 A;  4IEO A;  4CCO A;  4AFC A;  2HEY F;  4KGG A;  3AL5 A;  3GZA A;  3RMX A;  1AR6 2;  3VZK A;  1BXH A;  1OLM A;  5C9A A;  1ASJ 2;  2UY9 A;  4YAR A;  1BKZ A;  4K8R B;  4FT8 A;  3PVN A;  1W9S A;  4L99 A;  5ERL A;  5H9R A;  5A3N A;  2VR4 A;  4QPG C;  1I9R A;  1QJY 2;  2X05 A;  1JZ6 A;  3RWN A;  3H7J A;  3ZOI A;  4XFG A;  2WS9 1;  3OUH A;  4QWN A;  5CFD A;  4FP3 A;  1BZW A;  4AEK A;  4CEY B;  4YVS A;  1GZW A;  3CLP A;  3POW A;  3PIJ A;  2E9Q A;  4K1Z A;  2DV9 A;  4A6O A;  1J84 A;  4WVW A;  3DCQ A;  3PVB B;  3NKG A;  1ZZ7 A;  1OHF A;  1JZ4 A;  5FJK A;  4CCM A;  3RMY A;  4HMZ A;  4ISR A;  4KI5 M;  3BTZ A;  3KB5 A;  2A3W A;  5F37 A;  3TYJ A;  4HK8 A;  5EYY A;  2RMU 3;  4FPC A;  4DIQ A;  4Q4Y 2;  2PQQ A;  2GP5 A;  1PIV 2;  1O91 A;  1UOG A;  3AYD A;  4AW7 A;  4BQ4 A;  1LCL A;  5JMC A;  1VJ2 A;  4YM3 A;  3M1H A;  5DZG A;  4C91 A;  2CU5 A;  5C71 A;  1O5L A;  3VBO B;  1C28 A;  5KBF A;  1CIY A;  4LOT A;  3WUC A;  4DUX A;  4DNY A;  2W52 A;  2RS5 1;  2W47 A;  5JR7 B;  1FT9 A;  2ARE A;  3TBD A;  4BIF A;  5FYV A;  5LBF A;  5GLW A;  3FN9 A;  3DGT A;  3RRD A;  2JDM A;  4TLG A;  1LEN A;  3JXS A;  3M3O A;  5ABJ C;  4CVU A;  1CZV A;  2VUJ A;  3S6P A;  4D6Q A;  1WLT A;  1UZW A;  5T54 A;  1PMI A;  1T6B X;  2CAV A;  4QGL A;  3KV6 A;  4AHX A;  1OQD A;  4Q4W 1;  3NWK A;  4Z92 B;  3PUS A;  4I0B A;  1W2A X;  4AI8 A;  1VBD 2;  3SQO A;  4LKF A;  3GCW A;  4XF1 A;  3ZN6 B;  1QU0 A;  1ZZB A;  3FC0 A;  4ATF A;  4Y20 A;  2D5H A;  1TMF 2;  1ZBE 3;  1QJF A;  2CDO A;  4MXW B;  5FR3 A;  2OII A;  4FXG B;  4PDW C;  3NJV A;  3D4K A;  4HN0 A;  1X33 A;  1ST8 A;  2E51 A;  2X5I A;  3MIE A;  3E97 A;  4M00 A;  4RR3 C;  5F3G A;  2G1M A;  3LKJ A;  3VBO A;  4I09 A;  4BDV B;  2ZKN A;  5DAV A;  1FAT A;  5CU1 A;  4D0Q A;  3POS A;  4IUG A;  3WNM A;  1MR5 A;  2ARB A;  1UOF A;  1A8M A;  2RJ2 A;  2XON A;  4FFG A;  1XND A;  5CFC A;  3FLR A;  3AZY A;  3L2Y A;  3A4U A;  2YXS A;  4IE4 A;  4CZS A;  4JGY C;  3VBS A;  1AL0 G;  1HRI 2;  3ZYJ B;  1OMI A;  2LS6 A;  3LIH A;  4IXL A;  5F5C A;  2RR1 2;  2XLA A;  4YG6 A;  4DPN A;  4B1M A;  1W2N A;  2A73 B;  3LAG A;  4P9J A;  4GD4 A;  3WF1 A;  1LRH A;  4NRM A;  3T2P A;  2KA3 A;  3CIH A;  1CAV A;  1JTZ X;  5H9Q A;  2WL1 A;  4QAW A;  1JW6 A;  1ULC A;  3V0A B;  3Q9O A;  3BTA A;  1KQR A;  4LKS A;  4LHK A;  1XU1 A;  4AVB A;  3RZH A;  1NE6 A;  2VZ3 A;  4COU A;  5FZ9 A;  3USU B;  5JOZ A;  1XE0 A;  2XBO 1;  4DUW A;  5EQU A;  5FPU A;  3O1R A;  2PHW A;  1D0G A;  3ZFE B;  2H6C A;  3LZZ A;  1WLC A;  3OOX A;  5AC9 2;  1HB3 A;  1KFU L;  1TQ5 A;  3HR9 A;  3FHQ A;  3BKZ A;  3WG2 A;  5FQ0 A;  2VXR A;  4L11 A;  3ZSL A;  1AR9 3;  2RS1 2;  1YO8 A;  4W4Z A;  4QDR A;  5LWB A;  4JTO A;  4ET7 A;  4QQO A;  1DQ6 A;  5FKB A;  5D1I A;  5HCA A;  4ASK A;  3A0K A;  1E5R A;  3I54 A;  3KV9 A;  4FPK A;  5L36 A;  2J1A A;  3VBR C;  5T5J A;  3I3M A;  2P37 A;  2P3J A;  4QXH A;  1DLL A;  2R1B A;  2E32 A;  1DQ2 A;  4C8D A;  1VAK A;  3W58 A;  3O0W A;  3V0A A;  4AED C;  1NCQ C;  1AX0 A;  2Y6H A;  3J9S A;  1S0E A;  4FCA A;  4YW1 A;  5LRS A;  2Y6K A;  1MQT C;  2RVA A;  3EYP A;  1J3P A;  1TEI A;  1IQA A;  1OOP A;  3DXT A;  1QH6 A;  3J8F 1;  2YRO A;  1PMH X;  1ENR A;  4CP1 A;  3JUU A;  3ZN5 A;  2QZ3 A;  2YPD A;  1UPI A;  1GP5 A;  2HJI A;  4ZKT B;  2CWS A;  4KWJ A;  2EIG A;  4COW A;  1XNA A;  1D4M 1;  2VZS A;  2C6S A;  1RMU 2;  3FLT A;  3THC A;  1XBF A;  4QKN A;  4NJ4 A;  5C8C B;  4F83 A;  5B4X A;  1HKD A;  4RGK A;  1LOF A;  1POV 3;  1RVF 2;  2OT7 A;  2HWF 2;  2VO5 A;  4GWI A;  3DPR B;  1AJO A;  2VUC A;  4XMI A;  3MZH A;  5IFP A;  4MUV A;  1D4V B;  5F3E A;  2BWA A;  4LO6 B;  1RUJ 3;  4JV4 A;  4YGB A;  3RJ2 X;  4EQV A;  1Z7S 2;  4RS5 C;  1UY2 A;  5BNO C;  1DZR A;  2XOM A;  1SLT A;  2C1F A;  4B7E A;  3ZFF B;  2J1T A;  1AYN 1;  4YGE A;  5JIA A;  2KXL A;  5CAD A;  1VRH 3;  1YI9 A;  3U10 A;  1UO9 A;  2WKK A;  4R4Z A;  1FNY A;  3KGZ A;  1W06 A;  2VD7 A;  2NPI A;  2VCM A;  3SIS A;  2EIC A;  3P6B A;  4JGY A;  3ACI A;  3HWJ A;  1H2N A;  4NPL A;  3KD4 A;  5C3O A;  5JDB A;  1VBC 2;  2F4P A;  2IXH A;  4LQR A;  4R8H A;  4XF9 A;  2IXL A;  3ZM8 A;  2YC2 A;  4HBN A;  4EV0 A;  2VC9 A;  3C7E A;  4LOR A;  1HQW A;  4N7U A;  1CX1 A;  4A42 A;  2XB6 C;  3LSD A;  4WM8 B;  2Y6L A;  3DXU A;  3DPR A;  4NPM A;  1D7P M;  3MF6 A;  2WNV A;  3ST7 A;  3AMQ A;  5JR2 A;  4KQ7 A;  4FFF A;  1MEC 2;  3H8X A;  3AKS A;  2GSY A;  1F35 A;  1AR7 3;  1JH5 A;  1X82 A;  3A23 A;  4JQR A;  4LHN A;  2F17 A;  2QQM A;  4RN5 A;  5GZD A;  1PO1 1;  1EUU A;  3GXU A;  3N9M A;  4CDW C;  3PUA A;  3U4X A;  1IG0 A;  4Q8L A;  1GP6 A;  1RED A;  1QJX 2;  1PVC 2;  2ZHN A;  4UAP A;  3FMG A;  5JOY A;  2RHP A;  3ZXJ A;  4WM7 B;  1GOG A;  5DUW A;  2W9X A;  5JUV A;  4P08 A;  4JHZ A;  1LOE A;  3DKW A;  2LRO A;  3N9P A;  2AZ5 A;  4AL9 A;  2ZGO A;  4XCB A;  3PNA A;  4DRR A;  4YGC A;  4MGQ A;  3HMY A;  2GMP A;  5IAT A;  2R04 2;  4MGK E;  3ZIW A;  4P9W A;  4YLZ A;  4IE6 A;  4LXL A;  1BMV 1;  2VM9 A;  4DFS A;  2JWP A;  4QU2 A;  4IE5 A;  2ZEW A;  4GMP 1;  4WM8 A;  2J1R A;  2DCY A;  4XVH A;  5FLI A;  2VTX A;  3R4D B;  1N47 A;  1EYB A;  1C5I A;  1W0O A;  1ZNP A;  3T2Q A;  3CF6 E;  1I3H A;  2G9Z A;  1S0J A;  4MYE A;  3JBG 1;  5LEK A;  1CJP A;  4AQT A;  1W8T A;  4N53 C;  4ZS3 A;  4NID A;  1WME A;  2QNK A;  3EBR A;  1GMM A;  4O7X A;  2YDE A;  4IGQ A;  2W95 A;  3WF3 A;  5A6Y A;  2PEL A;  3BOP A;  4I0A A;  4EWD A;  5DDJ 1;  5C5T A;  1JHN A;  2Q5T A;  3ACL A;  5D8A C;  1GSL A;  1NG0 A;  2VOW A;  1ND3 A;  4Z82 A;  1AYM 1;  4E8D A;  4EN9 B;  2FZ1 A;  4WM7 A;  4UW6 A;  5C4W B;  5CVR A;  1JZ7 A;  3NV2 A;  4BQW A;  4FPH A;  1XJA A;  2NQY A;  1KIT A;  2W1Q A;  1AX1 A;  1W6M A;  1LHU A;  4AR2 A;  5HCB A;  3AMH A;  4XUQ A;  2PAE A;  1OA3 A;  2BNN A;  5BNN A;  4GKY A;  3LA7 A;  1H1A A;  3SXW A;  1FYU A;  2NM1 A;  2P3K A;  3WEZ A;  2J1E A;  2R07 3;  3LDK A;  3VHP A;  5JPN B;  5KHJ A;  2WO7 A;  4JX0 A;  4YM0 A;  1QXR A;  1DQ1 A;  1ULG A;  1WBL A;  3X29 B;  4AI2 A;  2BOI A;  3B02 A;  5IVF A;  1M4W A;  3AP5 A;  1VBE 1;  3JZV A;  3NW4 A;  1QHD A;  4DXZ A;  5FZ7 A;  3ETQ A;  1UL9 A;  4QKD A;  4PCR A;  3S7I A;  2DCZ A;  1ENX A;  4FOV A;  4NIA A;  3H42 B;  2D98 A;  5HXV A;  5FXX A;  2VMH A;  5M0T A;  1N3P A;  3FUO A;  4OQ8 A;  3VBU C;  2BOJ A;  4DOU A;  1ULP A;  1W8W A;  3VL9 A;  1R64 A;  2YBP A;  4V2W A;  5C4W A;  5J3U A;  3O5S A;  1Q8P A;  2RJK A;  2ZBJ A;  4Q4X 1;  4P5H A;  2B8M A;  1ZBE 2;  1VMH A;  1OA2 A;  4YW7 A;  3OSD A;  4MGT A;  2I45 A;  3N7M A;  2J1U A;  5FIX A;  3AKP A;  5C3P A;  1VAM A;  1MS8 A;  1WCS A;  2PTM A;  4FPY A;  4AVC A;  4B4Q A;  4BME A;  3NAP C;  1ZZC A;  4OLL A;  1EV1 3;  4CDW A;  5J48 A;  3MW3 A;  3KVA A;  1QWR A;  3OBT A;  1X7N A;  1C1L A;  1YWK A;  1YYN A;  4UT5 A;  3EHK A;  2Q8O A;  3GJB A;  2HKX A;  4X8N A;  1ENS A;  1RUC 2;  1WKY A;  3JD7 1;  4Y1Y A;  3ZLI A;  1UX6 A;  4D6S A;  4BXS V;  2MEV 1;  1FXZ A;  1GBG A;  4OZX A;  1CZS A;  3V0B B;  2C4X A;  5F32 A;  3THD A;  1HQL A;  1R1A 2;  1H9P A;  2VXJ A;  1X8E A;  5J09 A;  2C5D A;  4Y33 A;  1EPZ A;  2WN3 A;  2PFW A;  2VMD A;  4XUT A;  4XJU A;  1UCX A;  3RG0 A;  5JXJ A;  3WP3 A;  1HX6 A;  2YU1 A;  4S2G A;  5BNP B;  3IAP A;  1ZBA 3;  1K5J A;  5L7O B;  4KBZ A;  4P02 B;  3P3P A;  1RUN A;  1QEX A;  5CBL A;  5CKQ A;  2FDG A;  4BIO A;  2WNU C;  1RHI 3;  2JEN A;  1WGP A;  4A7Y A;  2XXZ A;  1YFY A;  5C33 A;  1CAX B;  2TBV A;  1N1Y A;  5FP9 A;  4CU7 A;  2WO2 A;  4C90 A;  3D6E A;  3RYR A;  2BP6 A;  1NLR A;  2XUE A;  1HXS 3;  3LPG A;  2A6Y A;  4IEU A;  5D8A A;  4FOY A;  1GAN A;  1G7Y A;  1YLL A;  2D6L X;  2YUE A;  2ZX0 A;  3I2I A;  3MW2 A;  2IUW A;  1AR9 2;  1VPH A;  2PAM A;  2FCV A;  2XJP A;  4JGZ C;  4A7K A;  4QDS A;  1F4H A;  2WFF 3;  3FLP A;  4YVW A;  4RA0 A;  5FYU A;  2HBT A;  3H3L A;  5BXX A;  3C3V A;  1FPN 1;  3DN7 A;  1SLL A;  3UJO A;  2HWC 1;  2NYY A;  1KRI A;  4PF5 A;  1PO2 3;  4Z2W A;  5EYX A;  2GNB A;  2ZZQ A;  3VDD A;  3ZYB A;  2VZV A;  5I0S A;  4LUL A;  3POJ A;  3NV1 A;  3WW4 A;  2DCT A;  1L7R A;  3AP4 A;  4UFL A;  5C3Q A;  1QQP 2;  3OGS A;  4P9X A;  5DUX A;  1COV 1;  4DUV A;  2B9U A;  1KS5 A;  1FPN 2;  4OHV A;  2XWJ B;  1O8S A;  1LEM A;  2D40 A;  2DBN A;  2WNE A;  4FVV A;  4BA6 A;  1ZM1 A;  5L7O A;  4BQY A;  2A71 A;  4FFH A;  2BPA 2;  4P5Y A;  3LQC A;  1EY2 A;  1YNA A;  3GCX A;  3RVH A;  1CAX A;  5LBE A;  2UWB A;  2YPJ A;  4P9I A;  1K12 A;  5AVP A;  3ACH A;  4Y1V A;  4E4D X;  2NN8 A;  2VZP A;  2EXI A;  5JSO A;  5GZC A;  2JG8 A;  3K75 B;  4Q8K A;  2E7A A;  3A0N A;  4DXT A;  3VBU A;  1VBA 1;  5HI0 A;  1PZ7 A;  3AFG A;  1NQJ A;  4MO3 M;  1RUF 2;  3LEI A;  4K9S A;  5FXW A;  2P6H A;  1RUE 3;  3S5Q A;  1RUJ 2;  2ZCW A;  3ZPO A;  5ANQ A;  4BLJ A;  3WDY A;  3V65 A;  3M3I A;  4XJZ A;  3UET A;  5IVE A;  2K9Z A;  2W92 A;  1GU3 A;  3ZYR A;  5F9T A;  4A4A A;  4FBF A;  1ND2 C;  4HKW A;  4HFS A;  4IV3 A;  2A3Y A;  4FOW A;  3WG4 A;  5J7M A;  1VBB 2;  1K5M B;  4DY5 A;  4NWV A;  1Z78 A;  3R05 A;  3TEX A;  3OUJ A;  1VMF A;  1S4C A;  5JOX A;  3III A;  3J7H A;  4CUC A;  1SDW A;  4CP0 A;  4M3C A;  2PLV 1;  1QJU 1;  4YW2 A;  5L9R A;  2IXC A;  1KJL A;  4QQH A;  4UWD A;  5LAS A;  2LTN A;  4I30 A;  4NMI A;  1JHJ A;  2RS5 3;  5BUV A;  3GHN A;  5DUV A;  5F6L B;  3THT A;  2BWC A;  5HCH A;  4LO4 B;  3L9J T;  3ZSJ A;  1PX3 A;  4E2G A;  5I8Y A;  1SDD B;  5EP9 A;  3HBZ A;  2BU9 A;  1B35 C;  1RTV A;  1W9T A;  1DFQ A;  4M4R A;  3UL2 A;  3W20 A;  4A2U A;  3B3Q E;  4IV1 A;  1GFF 2;  1JU3 A;  2WNU A;  4QMA A;  1W6Q A;  1GWM A;  3J4U H;  5C7G A;  3F2Z A;  1JZ5 A;  4CDQ B;  2ZEZ A;  3D0J A;  1YJK A;  2QFE A;  3BAL A;  3WDT A;  1JYW A;  4P14 A;  3U78 A;  2PHD A;  1W04 A;  2ORX A;  5FWJ A;  3I49 A;  1QDC A;  2W46 A;  4UBH A;  5FPB A;  1MS5 A;  5DG1 A;  3ZFG B;  1CES A;  2DVB A;  3RSJ A;  2Y26 A;  5SV5 A;  1WBF A;  5GLU A;  3WW1 A;  4FTE A;  1OVP A;  1W8O A;  1NCR B;  3CQO A;  3WHU A;  3WNX A;  5JSP A;  4HT1 T;  4N9H A;  1UU5 A;  4MHU A;  5EIY B;  3AYA A;  3HNM A;  4PLM A;  5FMD A;  5A3T A;  3VBF B;  3E6B A;  3OF1 A;  4YW5 A;  4FPJ A;  1LB2 A;  1WW5 A;  1HRV 1;  3LB9 A;  2YFU A;  4MVT A;  5FZ4 A;  5BPX A;  3I8T A;  4QB1 A;  1AL2 2;  4J1W A;  5IVV A;  5A7O A;  2Q8E A;  1Q3E A;  1YI7 A;  5K0U B;  5HBA A;  2SBA A;  2CNA A;  1X9P A;  3ILN A;  2OPW A;  1KS4 A;  5A3W A;  2K46 A;  4Y22 A;  3GZE A;  1U5I A;  1YFX A;  2VVE A;  4UFH A;  4E9K A;  1OT5 A;  3W5M A;  1YIF A;  4GIQ A;  3B93 A;  3RZG A;  4XIL A;  3RNS A;  3ZFG A;  4CCJ A;  5C9A C;  1OQE A;  1OXC A;  2ZHL A;  3VHO A;  3WW3 A;  2QVS B;  2WLP A;  2QJV A;  4MGY E;  3AJY A;  3WQ7 A;  2R7E B;  3OPZ A;  4HG6 B;  2OYZ A;  1R08 1;  2YB7 A;  1NCR A;  1YQC A;  2OW4 A;  3B01 A;  2Q0A A;  2XBO 3;  5E1R A;  3E5X A;  2VPV A;  2BQP A;  1JXN A;  1NUK A;  4U36 A;  5CFD C;  2A6X A;  4YVS C;  1AHS A;  1ZRE A;  3ZXK A;  2FHR A;  2DU1 A;  1H8T B;  4QHB A;  1FAY A;  2R32 A;  3HAG A;  2VZQ A;  2ZAC A;  4QU1 A;  4K20 A;  5FZL A;  5BV6 A;  4D94 A;  4YZ2 A;  3CMG A;  4YZ3 A;  1QOS A;  3WX5 A;  1R08 2;  1O8P A;  2D7F A;  3EQE A;  3O14 A;  4GZ9 A;  5FZB A;  4URA A;  1IPJ A;  3TOJ A;  3LDR A;  4DIN B;  1MS3 A;  4BQ1 A;  4CDX A;  5GZG A;  1EAH 1;  2EAA A;  3KT1 A;  5GKA C;  3PUQ A;  4QB2 A;  1F31 A;  5G05 L;  3T0B A;  3FJS A;  2ZMN A;  1RC6 A;  2XJU A;  1US2 A;  2G4I A;  3UJQ A;  2ZPX A;  3E5Q A;  3FX3 A;  3WQB A;  2XJS A;  2JX9 A;  4CPB D;  3F95 A;  2ARX A;  1CJD A;  1XE7 A;  5KHK A;  4OUM A;  1F5J A;  3J7L A;  1TZO A;  1WCK A;  2GME A;  2PA7 A;  1BLZ A;  3IM0 A;  1X36 A;  4DZG A;  4W8J A;  4IL7 A;  2ZOE B;  3J8F 3;  2WBK A;  4N43 B;  1L7L A;  2OZJ A;  4JQT A;  5LBC A;  2GU9 A;  2VGD A;  4TYS A;  1VMJ A;  3C8X A;  3CJX A;  4K3U A;  1H8T A;  4PLN A;  3CJI A;  1UMH A;  1OQ1 A;  2ZGS A;  3JQW A;  3W21 A;  3N4M A;  4KG8 A;  4K8F A;  5A33 B;  4ONU A;  2QQI A;  4IEV A;  1V9U 1;  2RJL A;  4LKD A;  5FZO B;  4E27 A;  2E63 A;  4XDO A;  5I8T A;  2Q8D A;  1O4Y A;  1BEV 2;  5FPA A;  1CAU A;  2WZR 3;  4LBL A;  2JIJ A;  3UGG A;  5LZ6 A;  3GF6 A;  4EWE A;  2QQO A;  1DLC A;  1W9Y A;  2QE3 A;  5JSR A;  3VBO C;  4E8C A;  5EV7 A;  4CEW B;  3E6C C;  1CN1 A;  2VQ0 A;  4NOT A;  2YZ4 A;  4L2N A;  3VKN A;  3VD7 A;  1FMD 2;  3SH5 A;  2P2K A;  3ZMO A;  5K4L A;  5CFC C;  2EF6 A;  4QKB A;  4HET A;  5FYT A;  4URT A;  5F2S A;  1TME 1;  3NST A;  1FI2 A;  1V6M A;  3VBS C;  2VZ1 A;  1DDL A;  3WDV A;  1AR6 1;  3MV0 1;  4TSV A;  3ASI A;  2B45 X;  4PQQ A;  2Q1F A;  1ASJ 1;  1CX4 A;  2P5B A;  3AVS A;  3AMN A;  5FUI A;  2WLQ A;  2YBS A;  1O3Q A;  1RHI 2;  1ZZ6 A;  2BRT A;  1SBE A;  3NVC A;  5ACA 2;  2HEW F;  3N9O A;  1LGN A;  1QJY 1;  3AP9 A;  1RL3 A;  4BQ3 A;  1HXS 2;  5FZO A;  5IFT A;  5FXZ A;  4AG4 A;  2B7Y A;  3I3B A;  4TXW A;  1J58 A;  4R9A A;  2A7A A;  1N3O A;  2MPF A;  2Z79 A;  5FYH A;  2XWB B;  4XFA A;  5J37 A;  3CU7 A;  3MIB A;  2TEP A; 
#chains in the Genus database with same CATH homology
 1Y9G A;  3UGF A;  1Y4W A;  2AC1 A;  5FKB A;  3ZR5 A;  4UFJ A;  1ST8 A;  1Y9M A;  2ADE A;  3PIJ A;  4FFI A;  3U1X A;  3NMB A;  3ZR6 A;  4UFM A;  3LF7 A;  4FFH A;  5FMD A;  3KF5 A;  5FKC A;  4CCD A;  4HXC A;  3LDK A;  4UFI A;  3PIG A;  4CCC A;  5FK8 A;  3HBK A;  4CCE A;  4FFG A;  3OSD A;  3H3L A;  3UGG A;  3S5Q A;  4UFK A;  5FK7 A;  5FIX A;  5FMB A;  3RWK X;  4AZZ A;  2QQU A;  4EQV A;  5FMC A;  3UGH A;  1W2T A;  3LIH A;  3KF3 A;  1UYP A;  2AEY A;  2XQR A;  3LEM A;  4B1L A;  2QQV A;  4QHZ A;  2OXB A;  4UFH A;  2ADD A;  4B1M A;  4JQT A;  3LFI A;  4UFL A;  4FFF A;  5ANN A;  3U14 A;  3SC7 X;  3LDR A;  3U75 A;  3IMM A;  2QQW A;  3LIG A;  2AEZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...