4B1LA

Carbohydrate binding module cbm66 from bacillus subtilis
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
162
structure length
162
Chain Sequence
TPFMSNMTGWTTVNGTWADTIEGKQGRSDGDSFILSSASGSDFTYESDITIKDGNGRGAGALMFRSDKDAKNGYLANVDAKHDLVKFFKFENGAASVIAEYKTPIDVNKKYHLKTEAEGDRFKIYLDDRLVIDAHDSVFSEGQFGLNVWDATAVFQNVTKES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords LEVANASE
publication title How Nature Can Exploit Nonspecific Catalytic and Carbohydrate Binding Modules to Create Enzymatic Specificity
pubmed doi rcsb
source organism Bacillus subtilis
total genus 40
structure length 162
sequence length 162
ec nomenclature ec 3.2.1.80: Fructan beta-fructosidase.
pdb deposition date 2012-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 4b1lA00
2QQVA 1Y4WA 3RWKX 2ADDA 3PIGA 1ST8A 1Y9GA 3UGGA 4AZZA 1UYPA 4FFFA 4UFHA 3LEMA 4CCDA 2OXBA 3KF5A 4JQTA 5FIXA 3OSDA 4FFIA 4UFLA 4UFIA 3LFIA 4UFMA 5FMCA 3ZR6A 2AEYA 2XQRA 2AEZA 4CCEA 2AC1A 3UGFA 4HXCA 3H3LA 4B1MA 2QQWA 3LDKA 1W2TA 2QQUA 3HBKA 3NMBA 3LDRA 4UFKA 5ANNA 5FK8A 3ZR5A 4B1LA 1Y9MA 3KF3A 3PIJA 4EQVA 3U1XA 5FK7A 3S5QA 3U75A 3UGHA 4QHZA 5FKCA 4FFGA 5FMDA 5FKBA 3LF7A 3SC7X 4CCCA 3LIGA 3LIHA 2ADEA 5FMBA 3U14A 4UFJA 4FFHA 3IMMA
chains in the Genus database with same CATH superfamily
4AQSA 1HKDA 1ZNPA 4ASLA 2FBEA 1Q5OA 1WLTA 3JB4C 3VDAA 4CCJA 2ZAAA 1EP0A 2E26A 2HWC2 5EWSA 3UETA 2Q8CA 5ISLA 2V4VA 1AYM1 1HB2A 1WD4A 1O7FA 4MGKE 4XW3A 3JXSA 3WF2A 5JI9A 5JXJA 4R9AA 2YY1A 2VMIA 3DKQA 4GJYA 4ES9A 1GZTA 5LWBA 5IK5A 3M3IA 3VZLA 4LKFA 3CZUA 2HKXA 1V9U2 2Y38A 1LU1A 5DDJ3 5FO8B 1N1YA 1X9PA 3Q8BA 5FFOC 3J7HA 3ORJA 5FXZA 5FZ3A 5FZ1A 4CXWA 5FY5A 1UPIA 1PO22 3VB9A 2C24A 1JUIA 1XPWA 2VUAA 3BCWA 4BZ4A 2VM9A 1UCXA 1EV13 3VBUC 3I3EA 3OJBA 4FXKB 3S57A 1CAWB 1PO12 2ZGUA 5A7WA 1RUC3 2RS31 1W03A 5CZKA 3ILFA 2A1XA 1XU1A 3MPPG 1W6QB 5LRSA 1AUYA 2JKBA 2JDMA 2JWPA 2ZKNA 1KJLA 2FDHA 1R1ZA 2D6OX 5FWEA 4Q29A 1VMJA 5F5CA 5GLWA 2DCYA 4JGYC 4AI1A 4B1MA 4V2WA 1TME2 5A32A 3MIBA 2DTWA 1NT0A 2NM1A 3JB8A 2PHFA 4CDWA 3JD73 3KV6A 1D2SA 5FK7A 4AE2A 1ENXA 1LENA 1QXRA 1IPSA 1VBA1 2P4EA 3WCSA 4Z2WA 1PVC3 2EIGA 5FYZA 2Z5WA 1MS1A 4GWJA 3KT4A 3IIIA 3J8F1 4CEWA 1OKOA 3FN9A 2WFPA 4YW1A 3GZAA 2RS52 3BYWA 1QJY2 4AEDC 1AZDA 1LJ7A 2VZVA 4DEVA 4EROA 4KU7A 5GZDA 2I2SA 3LA2A 1VBD1 3K3OA 1EAH1 1HRI1 3OCPA 3IM0A 4L92A 1A8DA 1GOGA 5BXXA 5L7OA 3D4KA 2QQWA 1ZBA2 1F4AA 5GZEA 4BQ1A 1XNDA 5JXIA 1RHI3 1W99A 3K2OA 3NJXA 3KF3A 3DPRB 3GHNA 4PBPA 2DVBA 3BTZA 4OHXA 1M06G 3O1MA 4QKNA 1JZ6A 5DXDA 4W6YA 4YM1A 1O59A 2RJLA 2ZZQA 4MXVA 2VCCA 3POEA 2ZMKA 3FL7A 5TSWA 1CIYA 1QQP3 4CVUA 3ZFEA 1W0OA 2MPFA 4P14A 1Y9GA 5DUXA 5FZ4A 2H6CA 1CN1A 1XYOA 1V6KA 1GZWA 1XYPA 3H3UA 4BQ4A 3ACFA 3E5UA 3WQ0A 2HWD1 3M2MA 4CP9A 1WW6A 2IWGB 4EZHA 2NLRA 4OI2A 3RZKA 1QH6A 1JN2P 4KU8A 1NLQA 4M3CA 1LHWA 3E6CC 1AYM2 5FKCA 4AHXA 4OZOA 4HOOA 4PI2A 4TLFA 1ZZ9A 4KWJA 1UL9A 1AVBA 4FPLA 4RR3B 4YFZA 1UKGA 3ZXLA 1QOTA 3BUCA 1GZ9A 1W9YA 2XDVA 4FO9A 1KFUL 4GMP3 1DIWA 1L7LA 4AOCA 2A71A 4YZ2A 4XQDA 1R092 4F83A 1NZIA 2HWF3 4MLOA 4Q2FA 5AVAA 3ZXEA 3HPNA 5FYUA 5BYNA 3AP7A 2PELA 3T1LA 3KQ4B 3TYJA 2C9KA 4GH4A 5BNNA 3VDBA 4COUA 5CFCB 2RS32 2YXSA 3EJKA 4X8NA 1NKGA 3MF6A 1GP5A 3UK9A 5BNPA 5C8WA 4LORA 4BIOA 1JHNA 3RZLA 5CEHA 3VKOA 2RDRA 3WUCA 5I8YA 4TTGA 4GQ7A 1A8MA 2ZHMA 1REFA 4LUMA 5FYMA 3VZOA 4L99A 4YLZA 4AVBA 3TNPB 1ULDA 2ZGRA 3MLJA 5FY0A 2VW2A 2XVKA 4RFRB 5FZ8A 4NVPA 1RUF3 2QBXA 3N35A 4IV1B 4S2HA 2LTNA 2P1BA 5FIXA 3N7MA 5DDJ1 2A7AA 1HN0A 3I2FA 4UT5A 1HLCA 2WFF3 4RGAA 3M4FA 2VU9A 1NCQC 3Q8AA 3WVJA 3HBKA 1C1FA 3PVEA 5FZDA 5A3LA 2JDNA 3J8F2 3H42B 2AUYA 3OTFA 5F5IA 1W6OA 2ET1A 4JHZA 1PMHX 3ZSKA 1EV11 4G3YC 1GU3A 5CKMA 4YW4A 5FZLA 1X82A 5LRRA 1VB2A 4AI3A 1HRI2 2D93A 3AP5A 4AGVA 4YSFA 1RUC1 2NN8A 4Z2AA 1LECA 3HJRA 4QMAA 2AZ5A 3THDA 3EO6A 4HKOA 2WN2A 5JIAA 4CU6A 4JDMA 2Q1FA 3AKTA 1PHMA 3IDBB 4AVAA 2D6LX 4KBZA 4QAWA 4WVMA 4O61A 2J1AA 3I3DA 2GZWA 2X5IB 1HB4A 4AQ2A 1DP0A 5FLIA 3JD71 4QPIB 1LOEA 4P9WA 1UXZA 2OZJA 3NV3A 3VD5A 1DBNA 1PVC1 2YC0A 5J7MA 4H7LA 1AF9A 1H2KA 2YPDA 4CU7A 5EIYB 1U5ZA 5I0SA 5F37A 3KB5A 3WQ7A 3QLQA 2AR6A 4P9LA 1FOD3 1QH7A 2J1RA 5FPUA 3ZFFB 2A6ZA 3I2HA 4KL1A 4FBFA 4M4RA 4FPOB 4LEJA 4E2QA 2LALA 4C1XA 1SDDB 3MIFA 1V6LA 3GJAA 4MG2A 2JD4A 4LITA 1OUXA 4AXOA 1RHI1 1PX4A 1D4M3 1UOFA 5IVYA 4ATEA 2PAMA 4BYYA 4IEZA 3ZN6B 4MXWB 1SLTA 3OUIA 1SQ4A 4TLGA 3ZIXA 1REEA 1QQP1 1UZ0A 1TQ5A 3WHUA 1ZBE2 2IVIB 3MV11 2WO3A 5FMBA 1FI2A 4LO5B 4Y20A 4MOAA 5IVEA 1OOPA 4JKLA 3N9QA 4OUEA 3QD6A 2FZ1A 4Z82A 2WWUA 1DGLA 1DCSA 4DNYA 4CDWC 2WKKA 4NHXA 2ZGSA 1ZZBA 2RE9A 4BXFA 1OD3A 1OVSA 1ZZCA 1GQGA 3KS7A 4K7JA 5FZKA 1WWYA 2XVLA 1S55A 2DDUA 3AZXA 1GSLA 4QM9A 1IS5A 4JRLA 1GP6A 3SH5A 1Y9MA 4CU8A 4JX0A 1V6OA 4EN0A 3WV6A 1U5XA 2VGDA 2Y6FA 5A80A 1FATA 4ZU4A 4EN7B 4XABA 2ENRA 5DG2A 3BTXA 2IZWA 4LQRA 4GMP1 3ZKYA 5JPMB 5L7OC 3U0ZA 1EUUA 4IE0A 2Y64A 1RINA 4EV0A 3ZVXA 3B3QE 2K0GA 4K1ZA 3U4SA 2YG0A 2HWF1 3WF4A 1RB8G 1Q43A 3LPGA 2A5ZA 4BPZA 4PJYA 2IVJA 1EV12 3JBG3 4I30A 4QX3A 1PVXA 1YFWA 3AB0A 4LBQB 2QE3A 3WDXA 4CCEA 2O8QA 4E2SA 4BJ0A 1HRV3 3ZFEC 3I49A 1PM7A 5JXGA 4IESA 1YWKA 3LQCA 2PHTA 5FO9B 1QGLA 1K5MA 1NOVA 2VZ3A 4QXCA 4TWTA 1WBLA 1LEDA 3MV01 1HIXA 4V1PA 3K48A 1HDKA 1OF4A 3CLPA 1O3SA 2ADEA 1SDWA 2W9XA 1RUF1 5F3CA 4R4XA 2GH8A 2J42A 4XFGA 4ZZ8A 2ZX2A 2ADDA 2XMLA 3NAPB 4BXSV 5FY1A 1JYTA 1ULCA 2V73A 5K4LA 1YXWA 3PHMA 2VOTA 1PVC2 4A7KA 1ACCA 2WFF1 2XLGA 4QM8A 3ROUA 2FDIA 1LCLA 4LKDA 1X9TA 1F4HA 3LPFA 4OHWA 5ACA1 5J09A 3ZXJA 3V0BA 5J98B 4NOTA 4XCBA 4PQQA 1UOGA 1Q8SA 4NO4A 3RMYA 4KI5M 2HLEA 5FBZA 2A73B 3SEPA 5C8CA 2WINB 3FBMA 1W8FA 4H7MA 4ZPIA 2ZMLA 2VNRA 3ZYPA 2D3PA 3VBSB 4DEQA 1UZZA 4QB2A 3VZNA 1RHI2 3D3AA 5FOBB 3WNXA 2TBVA 1ODMA 3P5BA 4A3XA 3KZ4C 5C7GA 1YQ5A 4GH4C 1OQDA 2W68A 5BNNC 1JODA 5GZGA 2GAUA 3UV9A 4AVCA 2A3WA 4QGLA 4NUBA 1H9PA 4XUNA 5FPBA 3VHOA 2BQPA 3O14A 3N7JA 2JG9A 1DQ6A 5BNPC 1FX5A 4HPKB 4AK3A 4DXSA 3RRDA 2CL2A 2VZPA 5F2SA 2CNAA 1OBNA 2JXAA 3KHCA 2D43A 3GYDA 3USUB 4EWEA 4COVA 4HETA 2XJUA 5AFEA 1YEWA 5FJKA 1CWPA 4WVZA 1WCSA 5ERLA 2WL1A 5IHRA 3HQUA 1RXGA 4A7ZA 1BXHA 2NMOA 1UY3A 5IK7A 2BYVE 4ZXEA 1CJPA 4OUMA 4PLOA 1LTEA 2A6WA 5DAXA 1YQ2A 2XONA 4P9JA 5LA2A 4D0QA 4D6SA 2PA7A 1D4M1 3H8XA 2GC2A 3WHTA 5T5PA 2DFCA 1OURA 2F4PA 4MH0E 1RUH3 2XJQA 5CISA 4YGEA 2WC2A 1YLLA 3M8LA 2P3IA 1DGWA 4M0NA 4QX5A 3QACA 4QX1A 2X05A 5I91A 4IGPA 1W2TA 4JRAA 4IV3A 1S1AA 3K75B 3PUQA 4N53B 3RS6A 3U78A 3PDQA 1OQ1A 2IFWA 3LA7A 4QHZA 5FZEA 2SBAA 3WNNA 5HI0A 2RJ2A 4WZFA 2P3YA 1VMHA 2BW8A 2D6MA 2ORZA 2Y6KA 5AC91 2PYTA 2WZPP 1UIJA 3GZTB 3AZVA 4M01A 3TAYA 4LO7A 1G8WA 1KQRA 2VQAA 5A3OA 5DAPA 2VQ0A 2RM23 1H6YA 3GDBA 1NXD1 4Z8BA 1PZ9A 4JGZA 4OZXA 5LEKA 1FMD3 2GC3A 4G4FA 2WO1A 5LW9A 4ASMB 1N3PA 1W8ZA 2P17A 3C8XA 3SNMA 1IQDC 5HBAA 3S5QA 4NIGA 2WFF2 5IVFA 3VBUB 4D3WA 4XBNA 4LIVA 3PTRB 5ACA2 5KBFA 1PO13 3H50A 3A0NA 1NY71 4XJAA 3OGSA 3LE0A 2OZ6A 3NNFA 4RGGA 1ND3B 4B3NA 3JBG1 2ZHLA 3MHZA 4ES8A 3AP9A 1W6NB 1A3KA 4P5YA 2VL4A 4FPYA 5LA1A 3BIEA 1GNHA 2WABA 1HRV1 2DTYA 1VAMA 4JGYB 5FRAA 4UFLA 2DVAA 3AXEA 3ON7A 4RGKA 5BPXA 5F8PA 1JOJA 4CCOA 1N47A 1OOPC 1NA1B 1D0HA 2WNVB 4UBHA 4FP2A 4QXKA 3NMBA 4RHV3 3TBDA 3M70A 4R9DA 4META 3ZYBA 5K9YA 1LRHA 3KGZA 1STMA 4N8MA 2BNOA 3NV1A 1UY1A 3E6BA 2VUJA 1GANA 3LEKA 5DAVA 3POSA 2RS53 1GNYA 4K8RB 1J1TA 4Y1VA 2DU0A 4Q5OA 1MS5A 2GP3A 1SZBA 5KXCA 3UL2A 2YYOA 2JICA 5FQ0B 4Y3OA 1CX1A 3BODA 3CNAA 1YJKA 2EICA 3TEYA 3ZYRA 2Z79A 2VOWA 1JXNA 1YC61 4NROA 1H2MA 2FDKA 1XC6A 5DZFA 3AM2A 3WP3A 2IXLA 1D4M2 2EXIA 2VC9A 5FPVA 1W05A 5FUNA 3VDCA 4OCTA 4A45A 5SV5A 1W6PB 1I6XA 2VZSA 1W9FA 3NJZA 4UFJA 4DUWA 2D3SA 1CIWA 2GNDA 2WWJA 3PIGA 3VV1A 1K5MC 3EYPA 1ND2A 3ZKUA 4OULA 2VMCA 5A7OA 4E8CA 3RYPA 4XJZA 1JMUB 2HWB3 2PMWB 1OUSA 2VO5A 1RUNA 2Q30A 3FHAA 4XHBA 1NE4A 1OLME 2GC1A 4ZU7A 5AC92 2GMPA 5JOYA 5JOWA 3GBWA 2EVXA 4XXPA 2JEMA 5G04L 3VDDB 4EN8B 4D6QA 1TMF2 4GXLA 4I01A 4WM8B 1FAYA 3O0XA 4LHKA 3RZGA 4X8PA 4FPKA 1ULFA 3MDPA 1PNGA 3VBHB 1VPHA 4Z1VA 1RUH1 2G9FA 1ULEA 3ZSLA 1R093 5C8CC 2XG3A 1OA4A 2XBO3 4UFHA 4XAAA 2D5HA 4SBVA 2WNUB 3HVDA 3ZXFA 5FMCA 3WDVA 4LUKA 4Q1PA 4Y1YA 1KFXL 4Q4V2 5DQ0A 3OYWB 3N36A 5JMOA 3KV4A 1RIRA 2NZ9A 4RQPA 4IEWA 4C0BA 4FOYA 2ZOEB 4YG6A 3JBG2 1BZWA 4DXTA 5F5QA 3AYEA 4Y22A 1AXYA 2JG9C 3IPVB 2W92A 4FAGA 5CG9A 2GNTA 2XQXA 1JZ7A 3N9NA 1OD5A 1UU5A 1YHFA 1RC6A 3U14A 2RM21 5B4NA 4NIHA 5KC5A 1POV0 5FZ6A 4LO6B 4XZPA 1HB1A 3LD8A 3ES4A 1G7YA 3H7YA 2BOJA 1FMD1 4CCDA 4DY5A 4QGMA 3POIA 4AR2A 1UY4A 1NCQB 4TN7A 5DZGA 2WNEA 3LFIA 4RHV2 2C26A 2EXHA 3VBRB 4AI2A 4YVSA 1NG0A 3MGUA 1QMJA 3KT1A 1O3TA 5FZ9A 4KWLA 2RS12 3R05A 5F3GA 5E88A 1PO11 4CTEA 1US3A 3FUQA 3J7NA 1XNTA 1UXXX 2F4LA 3CEWA 5GZFA 2H6BA 3KM5A 1NE6A 5M0TA 5K7PA 5JOZA 1HQNA 2JD9A 3POWA 4BQ5A 2E6VA 4IV3C 2EAKA 2V4AA 1XRUA 1VMFA 1V6IA 1VR3A 4HBNA 2A6YA 4QPGB 2V5YA 5FZCA 2YMZA 2ZEYA 3CMGA 4D7SA 5A6ZA 1FPN3 1CX4A 1NCRB 2OX0A 2Q1ZB 3ZSMA 5JXHA 4CEYB 2AEZA 2AC1A 3CU7A 5JIUA 3KSCA 3KVAA 5D1IA 4FPGA 1H4GA 1UZVA 2AREA 2TUNA 3FMGA 2VXRA 5FYBA 3BTAA 1RL3A 1BJQA 2RS51 3HN1A 4BCUA 2VJXA 3WNMA 2E33A 4JGZC 3R6SA 1I3HA 3WR0A 4E4ZA 5F3IA 4JAAA 3NJVA 2IFRA 1UOBA 3AKPA 5A3TA 4HKWA 2W47A 3UT0A 3IIAA 2K2SA 4D7YA 3FHQA 3MIHA 5FUIA 4CDXB 2JX9A 2VCMA 2EF6A 4HN0A 1CD3G 1QNWA 2OPKA 2WO2A 3FLRA 3KCYA 5JZGB 2XL7A 3I3BA 3P3NA 5FPAA 1DQ5A 1LU2A 5L73A 2V09A 3CBNA 2VW0A 2YV8A 3EXUA 3NL1A 3POJA 1RUH2 1ZZ8A 1W6MB 1WW5A 1ZBE3 3I8TA 4MGIE 2YBSA 3U75A 5A32B 1ZM1A 3VZMA 3NNJA 4MGTA 3N9LA 3PUAA 3PU3A 1CZVA 1GZCA 1EPWA 3SKVA 4XPVA 3HQRA 3D0SA 2WJSA 4NHKA 2JKXA 1X36A 2F6BA 3HT1A 4LLFA 2HWB1 1NLSA 1Y3TA 2PTMA 2WZ8A 1JZ3A 2OKXA 4GALA 4N9HA 1XJAA 2ZGMA 1UU6A 1SPPB 4CEWB 5ABJA 3UJQA 4FQ4A 1R083 4BK4A 3V0AB 3AX4A 4CUBA 2RM22 2DVGA 3D8CA 2E9QA 2GH2A 5GZCA 3ZYFA 2XB6C 2ORXA 2DUPA 1W9TA 5FMOS 1FMD2 3B5LB 1OMIA 1R091 4LKEA 3PTYA 3ZDSA 4AVTA 2XBO1 2XKPA 2J7MA 5FP9A 1FNZA 4INDA 1QJX1 2NMNA 5LATA 1YFUA 5EYXA 2HYKA 3EHKA 1UYPA 4QKBA 2EALA 2ZA9A 4Q4X3 5IK8A 2LM3A 1RXFA 1AR81 1QEXA 3M3OA 4AEJA 2D3RA 1UMIA 2C9AA 2XHNA 3AMPA 3GF6A 1W3VA 4XBQA 3ZYIB 4ISQA 4N43A 2WO7A 1LGCA 2CHHA 4TYSA 1B35A 5C6CA 3HBZA 1ND2C 5L9RA 4FTEA 1HV0A 5KR7A 3MLLA 2YBPA 4KH9A 4YARA 2B46X 1IZ3A 2C0ZA 2CDPA 2G4IA 2PHXA 2YGLA 1DGRN 1WCKA 1FT9A 3Q8CA 3A0KA 5I0RA 3BOPA 4LIUA 4FTSA 3ZPYA 1QWRA 4IGOA 3TNQA 3WP4A 4WZCA 4CDQB 4FVVA 3VHRA 5L19A 2JDAA 5KC6A 3W20A 1ALYA 4CP2A 3WG4A 4C0HA 3Q8FA 2Z2SB 4ZHNA 1CVNA 4P9XA 3RMXA 2VXJA 4UW4A 4EN6B 2XJRA 2JENA 5C4WB 4QKDA 3CJIB 1OVPA 4YM3A 3G6JB 4FPEA 5FZHA 2WS93 4QPWA 1UOJA 3RZMA 1W2NA 3RWNA 2ZAHA 4YGCA 2VZUA 1JYCA 2KA3A 1HW5A 1LOFA 3U10A 1W8NA 2PLV3 4GH4B 4OVEA 4WM7B 5FZAA 2DBIA 4RQPC 5A1FA 2ZMNA 3FX3A 4JCKA 1FPN1 5FO7B 3VUOA 4DOUA 2W3JA 5BNPB 4PI0A 3ZMNA 4OHVA 1J3QA 1GOHA 2IXIA 5GM0A 1G9DA 3C7EA 1DFQA 2VULA 1YFXA 2ZGOA 1U0AA 1JI6A 1JTZX 3D82A 2V5DA 3GXUA 3I54A 4UBGA 3I4IA 4YW7A 1TVGA 1K42A 2CWSA 2UU8A 1ZREA 1LULA 1BEV3 3I59A 4P9YA 5G05L 3ACLA 3AP6A 1ENRA 4IE4A 2HWB2 1QNYA 3A4UA 4JZRA 5IFTA 1Q8PA 2VNOA 3WX5A 4TZDA 5CB7A 2W0XA 4HK9A 4ZZ5A 4YVSC 4IEXA 1MQTB 2ARCA 2FZ2A 4XOGA 1ODNA 1W6QA 1W8UA 3MPBA 5GJ6A 1SLBA 4ITCA 4E4SA 3FUOA 2GDFA 1MS4A 2IC1A 2ZCWA 3SMHA 3ENRA 4OMDA 1ZBE1 4R9CA 1RUI3 1UU4A 2XBO2 2YZ4A 3T1MA 1XNAA 4HXCA 4URTA 4K40A 3LB9A 4DRRA 1QJX2 3ZR5A 4AI8A 4QQ2A 3H8RA 1RUOA 1QU0A 4N7IA 1LOGA 1W2OA 3JCIA 5LBCA 3ACIA 2B45X 1G9CA 3MICA 3NNLA 3UYJA 3VD9A 3ME2A 4PIXA 4UF0B 1BMV2 1AR82 5H9SA 5F1RA 2ERFA 3W58A 5JPNB 1O6UA 4E2GA 2D6PA 2VOVA 3U07A 2BTVC 1OKQA 1VBE1 1GQPA 4LPLA 3I7DA 4LKSA 2PHRA 1R081 2XL9A 4C8DA 2VECA 2WWSA 5C9AB 1UZYA 2Y8KA 2ATFA 5C3OA 2A6XA 2L9LA 2WYSA 2XQRA 3DPRA 3WLUA 2E51A 2VR4A 5LK5A 4RA0A 4EN9B 3DXTA 4ZXKA 1RUD1 3IAQA 4BH9A 3R4UA 1SCRA 5ACA3 5CG8A 2JDYA 2VZQA 1KS5A 4Q27A 2E31A 4LO8A 3RFRA 2XJVA 4NMIA 4YGDA 2EIEA 4BDVB 1LHVA 5A70A 1CAVA 4YZ3A 1H2LA 4Q1RA 4Q4X1 1H8TB 5A3PA 3AZWA 5H9RA 2JDZA 3WUDA 3ILNA 1XE7A 1OPMA 2IXJA 2W94A 4CXXA 4QDSA 2JG8B 4LA3A 1OOPB 1XBFA 1ENSA 2CY6A 2DCKA 2I07B 2R32A 5D8AA 2WR9A 1PNFA 2Y33A 3POFA 4Y4RA 3ZFGB 4IUGA 3WNOA 1MZEA 2JJ6A 3RQ0A 1ZRCA 5CKNA 5EJ3A 1FPN2 1WA4A 4Y5Z0 2ZZJA 2BOIA 1N3OA 1IS6A 1YRZA 1AR73 1UY2A 1WCQA 3DXUA 4FPJA 5IVVA 4RR3A 1GMMA 2RG4A 2RV9A 1GUIA 2K9ZA 4AVVA 4BMBA 5ABJC 4NPMA 5FPXA 1YO8A 2PAEA 2ZX3A 2G1MA 4HANA 4V2VA 2WN3A 2Y0OA 2VY0A 2YUEA 4Q0VA 1S0FA 1Z7S3 1BLZA 1SLAA 2A3YA 5A3NA 3AK0A 3OBAA 1S0CA 3BPSA 3MI8A 1D4VB 2QCSB 3L2YA 4UYBA 2AACA 4JVAA 3LSEA 4LOTA 4Q8LA 3HN3A 3UKVA 3ZM8A 3Q9OA 4OQ8A 2PAKA 5A3WA 2WS91 3OSDA 3AZYA 4GULA 3WF3A 2BV4A 1NYWA 1M4WA 1PK6B 2OA2A 2ZHKA 3I2JA 2PXJA 4IE7A 2OUJA 4ZY9A 2GMEA 2PLV1 1ENQA 3PIJA 1XU2A 2DCJA 2RMU3 4IEQA 3O1SA 2R0FA 4FPHA 1H0BA 3OGGA 2BVVA 4LE4A 1S2KA 4FPCA 5IAXA 1K5MB 4N43C 1OHFA 4LXLA 4IV1A 1JYVA 1B35C 4NIIA 3OD4A 3NKTA 4PIZA 4NPLA 4CZSA 3WD5A 3K77A 3I2KA 1XE0A 3ZN5A 1D2QA 3ZN4A 5AC93 3O1OA 1HQLA 1BEV1 1VJ2A 1YCIA 5APAA 3C7FA 3ZLIA 4CUAA 3LOIA 2ES3A 2DF7A 4UW6A 1TMF3 3J7LA 3WNKA 5FDBA 4WVWA 5KXBA 4ARYA 1QIQA 4FXGB 4HKLA 4CCLA 3J26N 1VBE2 3IDAA 5J37A 4XACA 1R082 3ASIA 1S0DA 4KG8A 1BK1A 1CZSA 4OMCA 2F17A 5HV0A 4PDWB 1H8VA 2WA4A 2YFZA 4XFFA 3WF1A 1PGW1 4XVHA 2C6SA 1SLCA 4J1XA 4LHLA 4BHPA 2DU1A 3PMSA 2G9GA 4XFAA 4Z07A 2PHWA 1RUD2 1YYNA 2VBBA 2X5IA 3HD8B 1QJU2 2YFUA 2QVSB 4QX8A 2E7AA 1RITA 3HWJA 1RUI1 4Q4V3 5FTTC 4QPIA 1LOFC 1MS9A 2Z69A 3PLQA 4BQWA 4AFMA 1EPZA 4Y1UA 1HB3A 3N9PA 5FXXA 5BNOA 4Q4X2 2N7GA 3LDKA 5L9VA 4Q26A 4AAXA 3VD3A 3F95A 4LA2A 4YYOA 3ZFFA 2TEPA 4E9KA 2J1VA 4D7TA 4EE2A 4ZS3A 3KV5A 4RS5A 2VTFA 1VAKA 4KGGA 2YBKA 1UAIA 4K3UA 5J48A 4MHUA 3VBFB 4HFSA 3ES1A 2GP5A 5FP4A 3TEWA 2E32A 1GQHA 1W8WA 2ZEWA 1LOAA 1QJZA 2ARBA 2E7QA 2B39A 2VVDA 3H9AA 2VMHA 4FCAA 3JUUA 5KHHA 3WW4A 4XMIA 1E5SA 2WRAA 2JE7A 1OLRA 3OPWA 1N1SA 2OQ7A 4M00A 5K0UB 2RS13 1RUJ1 3AL6A 3ZN6A 4MXWA 4A6SA 3NV4A 3VN4A 1BQPA 1S0BA 3WNPA 5JR2A 1ULOA 4XDQA 5GLUA 1DU3D 5ANNA 2XPJA 2HH9A 2PHDA 3GNEA 3ZDVA 3PU8A 4PQ9A 4YG3A 4AWDA 3Q8EA 1RTVA 5DMYA 4XUPA 5DAWA 2QNKA 4OHZA 4Z92B 2W1WA 2WS92 1GFF2 1ULPA 4NIAA 4AEMA 5A33B 5CYYA 5A7SA 5FAXA 1SEFA 4YFWA 3MW2A 5C5TA 5LB6A 5J3UA 1WD3A 3LEGA 2CU5A 4UW3A 3VBOB 3GZUC 1LHUA 1SMVA 1Q56A 2PLV2 2Q5TA 5KXDA 2OVUA 2W1SA 1IKQA 3MUY1 2XH6A 3OGVA 4HONA 4LBQD 3AYCA 4NRMA 3RVHA 5A6QA 1CPMA 1AX2A 3PUSA 1AX0A 1AR71 4BU2A 1XB9A 3RJRA 5JSPA 1BVVA 4YVWB 5FK8A 1MZ5A 4Y4YA 1DDLA 1SFNA 2AYHA 3KVBA 1FNYA 5A6XA 5FZOB 3RYRA 2G19A 2GMMA 5FOJB 1Z7S1 3SHRA 5C71A 1BEV2 2DWRA 1TEIA 3DPRC 4XFHA 5FREA 1KITA 3T08A 1CESA 3WQBA 1LKNA 5JDBA 1S0EA 3PUHA 1Y7BA 2I45A 3MF9A 2ETEA 3H0OA 4LBQA 2BP6A 4GZ9A 3URFA 3N7LA 1PZ8A 3ZO0B 1WGPA 1F5JA 4W4ZA 1WCUA 3PVNA 1Y43B 3USSA 5A6YA 5HXMA 1Q8VA 5J96B 5FPZA 3HOBA 1F8VA 1PGW2 2RMU1 4WVVA 1WA6X 4QDQA 3T0BA 5C3QA 1BVP1 4COYA 4XHXA 2FCVA 5CFDB 1OT5A 1RUI2 2DBNA 3OGRA 5D8AC 4IL7A 3H7JA 1WLDA 3NAPA 5F9TA 1GWMA 3LF7A 5IT6A 4MZUA 2JB8A 2YB7A 4LJHA 1IG3A 4R4ZA 4XTMA 2QDRA 3L2HA 3MBWA 4XYXA 2D6KA 3OB8A 4BQYA 3WOGA 4XIOA 1DLCA 2VAUA 3N4MA 5CA6A 4LMFA 4RR3C 3QOPA 3TN93 5E8AA 4AHZA 1TMF1 4IEVA 4I3PA 1J3RA 4YG0A 4GD4A 3GZEA 4AFBA 1C8M3 4UFMA 5IVJA 2VZTA 5EXOA 2ZBJA 1SACA 2JDHA 4MGQA 3VBSA 4B1LA 3RG0A 2VBPA 2Z42A 2ZX1A 1CZTA 3DEMA 4XCAA 5F7UA 3PVBB 4PBOA 1EUTA 3D0JA 1I1EA 3ZXKA 4AF9A 1RUJ2 3KWVA 5FYIA 4Q4V1 4OLLA 4EJRA 5JCTA 2KD7A 5A7QA 4AGGA 2VZ1A 3J7MA 2A3XA 2EA7A 5IVCA 1XNKA 2J1SA 4AQ6A 5EQUA 1K45A 5DG1A 2D6NA 1CJDA 1OA3A 1AR61 3USUA 2FCUA 5KXEA 5C3RA 1VB4A 2BRTA 4FFIA 1ND2B 1O3RA 4IQPA 4IV1C 1J3PA 2R1BA 3M3EA 4FTBA 5CAZA 2HEVF 4JKKA 5C5UA 1UYYA 2FQPA 5LBFA 2GN7A 2NQYA 5E6HA 1KRIA 2MNGA 2RHPA 3K46A 4HMZA 1WLWA 2I74A 4XE9A 3DGTA 2P2KA 1LGNA 4RHV1 3G7DA 5AFBA 1KD7A 1AR72 1OA2A 4BWOA 2QQNA 5JSRA 1LESA 4AEDB 2V72A 5JI7A 4M0HA 4XQ4A 2AGSA 2RS11 3ETQA 3OEBA 1ZX5A 2JB4A 4XXAA 3VKMA 1S0IA 1OH4A 1XSRA 1G9AA 3WY6A 3PNAA 1Z7S2 5LK7B 2ZTNA 4HK8A 3F2ZA 4N53A 5T55A 5F2WA 2ILMA 1XOYA 3WT3A 2PQQA 1JU4A 3NQHA 3V64A 4CDUC 2X5IC 1E5IA 2DCZA 3GBGA 4RFT0 1YQ8A 3TOJA 4QPIC 3HQXA 2B8MA 4I09A 2QZ2A 4IXLA 3AVRA 4YM2A 2VE1A 3THTA 1O91A 2MEV2 2WA3A 2Z4FA 3VKFC 5KHGA 4QXBA 1OFNA 5CU1A 3LIGA 3S30A 1NUKA 4FSJA 2D5FA 5BNOC 2RMU2 1MVEA 4DPNA 5BY5A 3PURA 3ZFFC 1CAXB 5A3MA 1LGBA 3ZXDA 1W8HA 3LGRA 3WP6A 4RS5C 1XE8A 2E63A 3AVSA 2OYZA 4XJWA 5CVRA 1C57A 4XF0A 4DB5A 1RMU3 4F8AA 3ZYHA 4P08A 3CL1A 3TEXA 4XAEA 2X53S 3UGFA 3NW4A 5DUVA 5FMOL 1ND3A 2VVEA 3D6EA 2XUMA 3RZJA 1OSGA 4OFGA 5FBJA 4OI0A 1HN1A 5FMDA 3LSDA 1QJFA 1W6NA 4CCCA 5GLZA 3LKJA 4I2OA 3OPTA 2IUWA 2AENA 2R49A 1MS3A 1TZOA 1VRH2 1CAUB 4QGNA 3UGGA 3ATGA 3DKWA 1BCXA 3S7EA 4IE5A 1NA1A 3ZSEA 2WNVA 3B94A 4NE9A 5FY4A 2GNMA 1QJX3 2AEYA 4BOWA 3E1F1 5FYCA 3V56A 1H1AA 2BZDA 4YGBA 2RDSA 2VG9A 3AJZA 2ZEZA 2ZX0A 1T2XA 3J9SA 4W6WA 3N7KA 3T2PA 5FXVA 1AR83 3AFGA 3ZYJB 3JU9A 5FZ7A 2WQ8A 1UYXA 4Y26A 4HZFA 2A75A 1DYPA 4L97A 2EXKA 2VPVA 1AR62 3A23A 3IBMA 5JOXA 3P1IA 1Z0HA 5BNQA 2QZ3A 2RDQA 1JYWA 2UY9A 1U12A 3TN91 4YW2A 1C8M1 1WBFA 2CGPA 2UY8A 4JHTA 4QB6A 3MYXA 3AKRA 4AI0A 2OUHA 2FDJA 3PUIA 4MSVA 3DCQA 5C3SA 2WLPA 3THPA 4BLIA 2BFUL 3J4UH 5DUUA 4P5HA 1CONA 3WF0A 4CDUA 3WXPA 4LOSA 1E5RA 3B01A 1GV9A 4R9BA 1W6PA 4FOQA 2FDGA 4QQLA 2ZGPA 4J1WA 5E89A 3U37A 2BWCA 3M7AA 2D44A 3MZHA 4NRPA 3O1VA 1ZRRA 3JQWA 4WBBA 4GWNA 1SLLA 4IEOA 4QXHA 5JWPA 3ST7A 3K4AA 1V0AA 3VLBB 1VLNA 1F35A 1KDMA 2WT2A 3BKZA 1DQ4A 1LEMA 2DCTA 4LE3A 2LS6A 3EMRA 1YIFA 4RYDA 3WQ1A 4O9GA 4IEUA 3DL3A 3FFQA 3NAPC 5EZWA 1ZYBA 4D6RA 5HV4A 2PN5A 4PCRA 4UFIA 3VDDA 3ZR6A 3LZZA 1JYIA 4XDOA 3FWEA 2VMFA 2Q0AA 3DN7A 3O7OA 2R063 1GYKA 2W95A 3B93A 4QD2A 2UWCA 4PT6A 4WM8A 1QXJA 2JECA 1QJEA 2CSGA 2D7FA 4LLOA 1RJ7A 5FZBA 3ZMOA 2R16A 2ARXA 3VBHA 2BU9A 3DYMA 3MIGA 4FPFA 1X33A 2BGCA 5FYHA 4A4AA 1DGWX 3S6PA 3H1MA 4YNIA 2OT7A 3JQXA 3OY8A 3EBRA 2ZGQA 3PL0A 1REDA 1I5PA 2A70A 3ACHA 2WNUA 1F15A 3VBSC 4W50A 4URAA 3UJOA 2Y60A 4Q8KA 5LA9A 2X10A 4LBLA 3LOBA 3N9MA 1ASJ2 3OYWA 2NPIA 4HVOA 3APBA 3DV8A 2ZACA 4LBNA 2QQOA 2W39A 2EIDA 4NWVA 5D21A 5FUPA 1F2NA 3C3VA 5F6LB 3VKLA 2W46A 2EAAA 2ZS6B 1JYNA 1FV3A 3WSOA 3KQRA 4P02B 4ET7A 5FR3A 1POV3 3IPVA 3P3PA 2LUWA 2VZRA 5A7WB 1AJOA 4GJZA 4GKXA 4H3WA 1OQEA 4QQHA 4XEZA 3ZXGA 3U4XA 5IW0A 4LK7A 5A7NA 4N43B 3LFMA 4R52A 2VMEA 4NIDA 1DYOA 2R1DA 1TNRA 5FKBA 1J1LA 2D98A 3MIEA 5T50A 3A7QA 4D69A 4CDWB 2WZR3 3IMMA 3T3YA 4BM8A 4CPBD 1HQWA 2Y0IA 2R7EB 1OF3A 3ACGA 3VBRA 5FV3A 1RMU1 1ST8A 3FLTA 3PJYA 4IEYA 3C7OA 4UAPA 3LEMA 2XHKA 1PMJX 4HVRA 5CKQA 1C4RA 5DN2A 5FY8A 1J58A 1MS8A 4B4PA 2QQPA 3OBRA 1GLHA 2CTVA 1VBE3 1LODA 3TN92 4UW5A 1C8NA 4BMEA 1VBB1 3CHXA 4GB32 1C3HA 5IVBA 3WEZA 1C8M2 2VZOA 2K46A 1SCSA 4KWKA 1HJGA 2QJVA 5T54A 3IDEA 4CE8A 1PM4A 5FY9A 4N53C 5L7OB 1RUD3 2P6HA 4QPGA 4CPBA 2QKDA 1QJU3 1F31A 3BTYA 4K6BA 4XFCA 1NCRA 3CF6E 4MGZE 5EJ1B 2P37A 5DUWA 4CEYA 1AR93 4EWDA 4I0WB 3CQOA 3IDCB 3KLSA 5LBEA 4MO3M 2NYYA 4M4PA 1POQA 4AVSA 5L36A 1BMV1 3S0MA 2YDEA 4LHSA 1H9WA 5I0UA 3ZFEB 5I93A 1OLMA 1YNAA 1U5YA 1MEC3 2OPWA 2ZABA 4N90A 2X8KA 1APNA 1GZWB 2XWBB 2ZGKA 3KCXA 1JOPA 4XF4A 4CP9B 1SBEA 2BJSA 2XJSA 3SKJE 2P34A 3I59B 3I2IA 4O7XA 4B4RA 1S2BA 4DY3A 1R1A3 1O5UA 4PF1A 1ZRFA 4CDXA 4M3CB 3POBA 5J36A 5JZGA 1ONAA 2ET7A 5FZMA 3FLPA 5FCCA 1T6BX 2WUHA 3E97A 1ND3C 3OEAA 3UKNA 4IGQA 1EYBA 3OGJA 2CGOA 1K12A 4JQTA 1W6MA 5LASA 5KHJA 3O5SA 2IXHA 1DQ1A 3B00A 3D5OA 4CCNA 2BFUS 3H3LA 3VKNA 4HL0A 5JUVA 1BHGA 2VVFA 1IOAA 1NA1C 2WNVC 5JAXA 1H2NA 5A1AA 4JQRA 3FE5A 4GMP0 4MV2A 4Q4Y1 3M3CA 5F5AA 3CJXA 1W8OA 3BB6A 5BNNB 4FFHA 4YW6A 3C2UA 1SPPA 4XZUG 5FZIA 1AL23 1UW8A 5IJRA 3IN9A 5FJHA 1KXGA 1W3XA 1DF0A 1YQ6A 1AHSA 4QPYA 4MADA 1JHJA 3UKTA 4DINB 3V0AA 1A34A 2R061 2B42B 4QHBA 2QFEA 4NN0A 2LROA 1FYUA 1LOCA 3KMHA 2QDNA 3I2GA 4A3ZA 1LOBA 2ZGNA 3MEPA 4L8QA 2H0VA 3INAA 3ZYGA 2GN3A 3IWZA 2Y6HA 1RMU2 2CV6A 4CCMA 2BNNA 3R4DB 3WG3A 5EJZB 4KNCA 1WMFA 3CO2A 1PGL1 1CAWA 1HJFA 1HXS2 1PIV1 2OIIA 4QX7A 1Q8OA 3AYAA 4DUVA 5ANQA 1W6OB 3GJBA 1JYXA 2FMYA 1COV1 3AMQA 1CGPA 3KD4A 1VBB2 4XQWA 1V6MA 1H1IA 2WSVA 2W5FA 1UKRA 1CAVB 1W90A 1POV1 1NXMA 5KHKA 3MIDA 1IQAA 3T2OA 1W0PA 4AFCA 1AYN3 5F39A 4C1WA 5JSOA 1OFSA 1RVF2 3RZHA 5FZGA 3B9CA 2E7TA 4O65A 4WVMB 5D8AB 1ZZ6A 1YI9A 2UWBA 3HT2A 3NNGA 2J22A 4ISRA 4PLNA 5LY2A 5K8SA 2FD8A 3K3NA 4JTNA 4LULA 5I0TA 5HXVA 2VNGA 1C1LA 3C7HA 3O12A 5A3UA 3ABZA 2WZR1 1V70A 1RJ8A 4CDQA 1J83A 3MFCA 3VDDC 4X6RB 1Y9QA 3IKWA 3T30A 4CU9A 1DHKB 1PGSA 2DUQA 4WM8C 5FLJA 2DYCA 3VD7A 1RGSA 1IHMA 1O4YA 2ZEXA 3POYA 1O8PA 2H0BA 1NX9A 1AX1A 5C4WA 3VBHC 1BKZA 1F9KA 3O1TA 3CJIA 2C4XA 5FYYA 2C1FA 4NRQA 3VZJA 2W1QA 1C28A 2FHRA 2R30A 1PZ7A 5EHDA 1QKQA 2Y6JA 5T5OA 1AXZA 2WNUC 4Q0SA 4U36A 4I0BA 2YU1A 4I02A 5EPAA 3ZSJA 5CADA 5KWRA 4WM7A 2BVBA 2WAAA 1VBC3 1RUJ3 1QJU1 2BWAA 2E53A 3LAGA 2DVFA 5FXWA 1AR91 4KWUA 1X50A 3V65A 2ZKLA 2G9ZA 3AMHA 1JBCA 4Y5SA 5LA0A 1H6XA 4M3CF 1IKPA 1W2AX 1JZ2A 1MS0A 1OXCA 4HT1T 1JUHA 1UQXA 3RYKA 4BA6A 4DMIA 4H2AA 4Y1XA 4AZZA 1OH3A 2XXZA 2XJTA 3IAPA 3NVCA 4MGYE 1MR5A 1MEC1 4BIFA 4Y20B 3QH7A 4Q4Y2 1VBA2 2VOXA 1H4HA 1H30A 4S2FA 3FHIB 4ZS2A 3VHNA 5A1LA 4CYDA 4OYUA 3NSTA 3W59A 4BQ3A 2QQUA 3VBRC 2X09A 4XUQA 1DZQA 1MQTA 1R1A1 2WT1A 1VALA 2GU9A 4KMQA 4CUGA 3KT7A 4DRVA 3QCWA 3SISA 2R062 2TNFA 4K21A 5FY7A 2BGPA 3VL8A 1VBD2 5T3NA 1EAH2 5HCBA 3GHMA 4AYUA 3O1PA 4RSUA 1IPKA 1G9FA 2OQ6A 3CKHA 1JZ4A 2WAOA 3GGLA 3CZJA 2QQVA 3RWKX 1A6CA 2J1EA 2VOKA 4FFFA 4YZ4A 1D0GA 2O1QA 4IEPA 1GKBA 3K4DA 4TXWA 3BU0A 4GWMA 5EFUA 4CCKA 1UD1A 4QPGC 5F3EA 4CDUB 1SBFA 3I3MA 1O8SA 2RDNA 4PHZA 1PGL2 3M3QA 1NCRC 3HNYM 1PIV2 3OF1A 4XJUA 1W0NA 2UURA 4UF0A 3T0AA 5CFCA 3MW3A 2BUKA 2MEV3 4CEYC 1COV2 2FCTA 3AC0A 2QQMA 5IK4A 1E57A 4JDOA 2DUOA 4Q0PA 5HCAA 3O0VA 2P5BA 1ZA7A 5BNOB 2BERA 2BPA2 1EY2A 1GP4A 4MVTA 1I9RA 3KV9A 2HWD2 4IERA 1AL21 4Y24A 1QDCA 2RR13 2WYFA 3AXDA 1RUE3 5E16A 5E1RA 4E27A 1C5IA 1W28A 4ONUA 2X29A 5C9AA 3TEZA 4RS5B 3AP4A 4FT8A 1QXPA 1SG3A 4H14A 5IYYA 1QOOA 2W2IA 2O14A 3S7IA 3ELNA 1W9SA 1WLCA 4KGQA 2WZR2 1JS9A 1N3QA 1CQ9A 4XF1A 1DGRA 4CDXC 2ID4A 1IGOA 2WBKA 2XLFA 3M1HA 4YW3A 5JZGC 3AJYA 4YPJA 4FP3A 3B02A 2WDBA 4LHNA 4C91A 3V0BB 1S2EA 4YW5A 3U1XA 1XSQA 4XF9A 1H8TA 2D40A 5FP3A 3ECQA 3VHPA 2VD7A 2Y6LA 1VRH3 3ZIWA 3MLKA 5C8CB 3VL9A 1UY0A 2JG8A 1YFYA 5FP7A 1JW6A 4AGRA 3OD0A 4QWNA 3AL5A 3K51A 4QKFA 4AG4A 4HG6B 1Z78A 1XNBA 3HAGA 3S5AA 4RN5A 3ZFGA 1UWWA 3W9AA 3BU7A 2VCAA 2VW1A 1AYN1 1KGYA 4XJ9A 3THCA 4RD7A 2BBVA 2DV9A 3KF5A 1GICA 2BBAA 5C33A 3H1WA 5D2AA 3ZX7A 2BEOA 4JC1A 1AR92 5FWJA 2FMDA 2JDKA 4QQOA 4A42A 4CEWC 2ZGLA 2RJKA 4R8HA 1AR63 2HBUA 2JG9B 2WQ4A 3H1YA 4S2GA 2Q8EA 1DYKA 3LEIA 4WV8A 5FPLA 1QY4A 4XETA 5H9PA 2QTWB 1MEC2 2EIBA 4AW7A 5LY1A 1LNSA 5DDJ2 1WMEA 1RUG3 3HIFA 4Q4W3 5IFPA 2PQSA 3GM8A 1D7PM 4IETA 1UPSA 4XF3A 4B29A 3W5MA 1YUDA 5AVPA 1VE0A 2VNVA 2XGXA 1JU3A 4NHLA 2QUOA 2VBDA 5GALA 4HLTA 1K3IA 1R1A2 4QHOA 1PK6A 2OXBA 1YIPA 1WKYA 4I3GA 3IMNA 3QBQA 1VBC1 5I8TA 4XC9A 5JMCA 4NJ4A 1RUC2 3SH4A 1VP6A 1V6NA 2R073 1O5LA 4AQTA 2R0HA 2MHFA 4A6OA 4Y5TA 3H8OA 3NJYA 2JDPA 4N7UA 1OC1A 2YC4A 1P8JA 2Q1MA 4Y33A 4BISA 2WIIB 1VRBA 2O8OA 4JV4A 3R4SA 3QH6A 3RJ2X 4IV3B 2CYFA 2XJPA 3LIHA 3HNMA 4OUSA 3GBFA 3JD72 2LRPA 4XJ8A 1XYNA 3N9OA 2KM2A 4A41A 2QQKA 3UNPA 3SCGA 4K9SA 4YWAA 4P00B 3I2OA 2VTXA 4CDQC 1L7RA 3DUIA 4PLMA 5DABA 5SV8A 1MACA 1KS4A 2IXKA 3T2QA 4BQ2A 1SFPA 3T4HB 1JZ8A 4QX2A 1JH5A 1WUVA 2P3JA 5BUVA 1AL22 2J1UA 2YPJA 5HCHA 2R043 2HWE3 3AYDA 5EYYA 4K20A 1W06A 3PJQA 1G6NA 4PDWA 3SQOA 2W08A 5C4WC 4D94A 2KXLA 1ZRDA 3CJIC 4JGZB 1N1VA 1W8TA 4F3JA 3MUZ1 4O9EA 4NAOA 3UGHA 1NQJA 4L11A 3KHBA 5EP9A 1E5HA 1W9WA 3DF0A 5DZEA 4LO4B 1ASJ3 4AHYA 3O0WA 4Y1ZA 1TNFA 4XURA 4WM7C 4GAZA 3WDWA 2C5DA 4YRDA 2W1UA 3PMEA 4A44A 2VH9A 3RZZA 3ILRA 1UMHA 4AFAA 3EB7A 4IE6A 4DZGA 2MEV1 1QQP2 4LBMA 1IS3A 4BLJA 4BQXA 3OPZA 2CAUA 2B9VA 1UX7A 4AEKA 1FOD1 2Q8OA 2RR11 3WDYA 4MX3A 1RUE1 5T52A 3VBFA 3IZOA 1URXA 1AYN2 1I5ZA 3OBTA 4XIKA 3POGA 5JLVA 4XMAA 1BK0A 4KBBA 4UI9L 2J1TA 4DFSA 4YZ5A 1ZRIA 2GC0A 3SEEA 2OW4A 3T4VA 3R0RA 2HEWF 4CRQA 4DQAA 1MQTC 5K0UA 4DXZA 2XR4A 1WMXA 1BBT3 3LWCA 4GB33 2WLQA 2CGNA 4S2DA 3WG2A 2A6VA 4FQZA 2WT0A 4NHYA 3EQEA 1FV2A 1QHDA 3B9IA 3BN6A 1AJKA 1QOSA 1UN1A 1VRH1 2HWF2 5A33A 2QQIA 3X29B 1O3QA 5CBLA 3RGBA 1G9BA 5IAVA 1LB2A 3AZZA 3B7MA 3VBOA 1XQNA 3WG1A 4U2AA 4W6XA 2YGMA 2HWC3 4NHMA 1VBC2 5CFCC 1HV1A 1J59A 2XVGA 3WW1A 2XUEA 1UX6A 1QDOA 1Y4WA 2HJIA 3NRUA 4OHYA 4TSVA 4HPKA 4XBLA 2BNMA 5FYSA 4HSLA 4YVWA 4DXRA 1V9U3 2ZJCA 3CDZB 3HMYA 4GA9A 4KG0A 3FJSA 3MW4A 4B7KA 3ZOIA 4NR1A 2ZX4A 4Q0QA 5FZOA 2YC2A 1IPJA 5C9AC 3DYOA 5T5LA 3C7GA 1QF3A 1WW7A 3WW2A 1RUF2 4G9SB 3SITA 5C70A 1YJLA 1PO23 2VMDA 2CDOA 4UFKA 2ZHNA 4CXYA 1MPXA 1RUG1 4Q4W1 2ARAA 2B9UA 5IWFA 1GOFA 4AFDA 2YHJA 1S4CA 3SXWA 1MVQA 3AKSA 3WW3A 1KJRA 4XFBA 4FFGA 5IATA 1C5HA 5GKAC 1OI6A 1KDKA 1VAVA 3E5QA 1X8MA 4MUVA 5HPOA 1T6GC 5CNAA 1OLQA 4X6QB 1PMIA 3FFZA 2B4KA 5I8SA 4OI1A 3K4ZA 3OUHA 4LTAA 1H8TC 4ZONA 5I0DA 3NO8A 1TME3 2R071 1TG7A 5LEJA 4HSJA 4EZ4A 5C3PA 2JG8C 5CFDA 3CIHA 2NP0A 1IS4A 1WMDA 1S0GA 4E8DA 4YZ1A 2UYBA 3WDTA 3ZFGC 2Y34A 3A21A 1MZ6A 5FZ0A 4RQPB 4QU2A 4B7EA 2QQLA 4P9GA 2JIGA 5FZFA 1N1TA 1QJY3 2JE9A 4OI4A 3MO4A 4Q0UA 2GALA 4Y22B 4BK5A 1LAJA 1SFYA 2HEYF 2IXCA 3RPQA 3RSJA 4K1YA 3NWKA 1FOD2 1LR5A 2RR12 3OG2A 4A2UA 4DS0A 1RUE2 2R041 2HWE1 4XTPA 1ZBA3 2B7YA 1DLLA 2PHUA 1NQDA 3I97A 4P9IA 3SCFA 3ETPA 3VGIA 5H9QA 3TWIA 4C90A 2DURA 3GCWA 1ZA4A 3ZPOA 1X7NA 3O1RA 3VBUA 1UYZA 4OQ9A 1DG6A 3UESA 3BI3A 1PK6C 4ASKA 1HXS3 1ASJ1 2CAVA 2PHLA 2WNOA 3A22A 3AMMA 3OUJA 1SHWB 4YVSB 4HVQA 1FXZA 1DZRA 1X8EA 4ORFA 1VBB3 1SBDA 4JKMA 3PVOA 2ZGTA 4XILA 3I2DA 3ZXAC 2QQJA 4J6GA 1ZVFA 1TE1B 5LBBA 1YI7A 3KGLA 2HBTA 1L3JA 4JGYA 4N9IA 1DQ2A 1LHNA 2YU2A 4LK6A 1G86A 4IW3A 2GSYA 4XUOA 4UWDA 3VD4A 1JOBA 2B5HA 4GKYA 1ZZ7A 1NZCA 1RVF3 1R64A 3BPZA 4LR4A 1W39A 1S0JA 2P3KA 5BV6A 1GWLA 4LT5A 3BIWE 3WZ1A 1V00A 2PFWA 3LA3A 4L2NA 4AI9A 3SCHA 2AH2A 1AYM3 2CWMA 4AHWA 3IT8A 5GLVA 3U11A 1DZTA 4K8FA 4XDPA 4YM0A 2UWAA 2KR2A 1GBGA 2WSUA 2ZXQA 4L0PA 3W21A 5LZ6A 5FYVA 1KEXA 4H55A 3TB0A 1HX6A 2XLAA 2GNBA 5FYTA 4AEDA 4E4HA 5F32A 3RNSA 1UNBA 5J1XA 4CSWA 3AMNA 5CIRA 5DAQA 1UO9A 4A7YA 1US2A 2HYXA 4QDRA 1BBT1 5L9BA 4PDWC 5FQ0A 3H8UA 2ZPXA 4CUCA 2VMGA 3FBYA 4L9BA 3OY8B 4SLIA 4GB31 4ZU5A 2JE8A 3N3HA 1RUG2 4LBJA 4Q4W2 5JR7B 1J84A 5DPNA 1CR7A 3BALA 2JDUA 3FZ3A 4CP0A 4D8MA 4COZA 1DQ0A 3FC0A 5A7PA 1OPOA 2UYAA 2DVDA 1NY72 1YQCA 2RS33 2EXJA 1W04A 4LBKA 1XNCA 1O4ZA 3IB3A 4EYUA 4NAMA 2HWC1 5JVVA 3AFKA 3E6DA 5FP8A 1HRV2 3VZKA 1A78A 2R072 4I0AA 3WP5A 1CAXA 1GWKA 4ARXA 4JDNA 3DECA 2Q4SA 3KCCA 1V9U1 1CPNA 1NAEA 3RDIA 4Q4Y3 1VBA3 1WZXA 1IG0A 5GLTA 5T5JA 3VBFC 1UF2C 3BGAA 1RYYA 2XWJB 1O4TA 1XXNA 1NLRA 4KQ7A 4DUXA 3I3QA 3T0DA 1AL0G 3MFAA 2VUDA 1PO21 3P6BA 1V6JA 1GR3A 4AL9A 3J8F3 1GNZA 5F6KA 2FDFA 3AKQA 4J25A 2WQZC 3GCXA 5IUQA 4COWA 4W65A 1UIKA 5K0UC 4LBOA 3WCRA 4FAHA 2D97A 3LDRA 4MHRA 1VBD3 1EAH3 1HRI3 2VUCA 4QB1A 3HEIA 5ABJB 1WCDJ 3HNBM 1SLIA 3T2TA 4B4QA 4BE3A 4UXAA 2P6CA 2R042 1VIWB 2HWE2 2RVAA 3WINE 4M3CE 1CAUA 1L7QA 3SC7X 4MGSA 2W91A 3OBZA 4QX0A 1MZFA 1F5FA 4UOJA 5KHIA 2VTXJ 3GALA 3B69A 3SLIA 3JZVA 2VQUA 1TME1 1Q3EA 2WZEA 4RL7A 2Q8DA 4W8JA 1WW4A 2Y26A 3W5NA 3OOXA 1PIV3 2BGOA 3NKGA 3VBOC 4FI9A 1BYHA 2R6QA 4FOVA 4JTOA 1COV3 1UMZA 1JZ5A 1K5JA 4LNVA 3ALQA 4QQPA 5HCFA 2HWD3 4HN1A 3O1UA 1Q8QA 4PF5A 3WDUA 4YVWC 1QJY1 2DFBA 3DYPA 3TRSB 4ATFA 1U5IA 3LCPA 3NV2A 4B8EA 1B35B 2YROA 4BB3A 4XFIA 1UZWA 4CP1A 3NNMA 1PX3A 3BVCA 1ZBA1 5EV7A 2XOMA 1W2UA 4F7ZA 4QU1A 1NCQA 2W87A 2VCBA 2BDRA 2XKOA 1LHOA 5LCWL 4QT6A 3H3ZA 4NPRA 4E4DX 4ZKTB 3ITQA 3HR9A 3SH3A 3RI8A 5B4XA 2O0OA 3E5XA 4GIQA 4NWWA 4PIYA 1HXS1 4DO0A 1ULGA 4EWAA 3BOWA 4GWIA 1BBT2 3T09A 2SLIA 5B2GB 1B09A 4IDZA 4XUTA 2LW8A 1AXKA 3RI9A 3WNLA 4EQVA 2Y6GA 2JIJA 4MYEA 4CA9A 4AAPA 2VQTA 1H1MA 4DIQA 5CFDC 2OS2A 2W52A 4FOWA 3LDBA 5FLHA 1RVF1 3L9JT
chains in the Genus database with same CATH topology
2QQVA 1Y4WA 3RWKX 2ADDA 3PIGA 1ST8A 1Y9GA 3UGGA 4AZZA 1UYPA 4FFFA 4UFHA 3LEMA 4CCDA 2OXBA 3KF5A 4JQTA 5FIXA 3OSDA 4FFIA 4UFLA 4UFIA 3LFIA 4UFMA 5FMCA 3ZR6A 2AEYA 2XQRA 2AEZA 4CCEA 2AC1A 3UGFA 4HXCA 3H3LA 4B1MA 2QQWA 3LDKA 1W2TA 2QQUA 3HBKA 3NMBA 3LDRA 4UFKA 5ANNA 5FK8A 3ZR5A 4B1LA 1Y9MA 3KF3A 3PIJA 4EQVA 3U1XA 5FK7A 3S5QA 3U75A 3UGHA 4QHZA 5FKCA 4FFGA 5FMDA 5FKBA 3LF7A 3SC7X 4CCCA 3LIGA 3LIHA 2ADEA 5FMBA 3U14A 4UFJA 4FFHA 3IMMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QQV A;  1Y4W A;  3RWK X;  2ADD A;  3PIG A;  1ST8 A;  1Y9G A;  3UGG A;  4AZZ A;  1UYP A;  4FFF A;  4UFH A;  3LEM A;  4CCD A;  2OXB A;  3KF5 A;  4JQT A;  5FIX A;  3OSD A;  4FFI A;  4UFL A;  4UFI A;  3LFI A;  4UFM A;  5FMC A;  3ZR6 A;  2AEY A;  2XQR A;  2AEZ A;  4CCE A;  2AC1 A;  3UGF A;  4HXC A;  3H3L A;  4B1M A;  2QQW A;  3LDK A;  1W2T A;  2QQU A;  3HBK A;  3NMB A;  3LDR A;  4UFK A;  5ANN A;  5FK8 A;  3ZR5 A;  4B1L A;  1Y9M A;  3KF3 A;  3PIJ A;  4EQV A;  3U1X A;  5FK7 A;  3S5Q A;  3U75 A;  3UGH A;  4QHZ A;  5FKC A;  4FFG A;  5FMD A;  5FKB A;  3LF7 A;  3SC7 X;  4CCC A;  3LIG A;  3LIH A;  2ADE A;  5FMB A;  3U14 A;  4UFJ A;  4FFH A;  3IMM A; 
#chains in the Genus database with same CATH topology
 4AQS A;  1HKD A;  1ZNP A;  4ASL A;  2FBE A;  1Q5O A;  1WLT A;  3JB4 C;  3VDA A;  4CCJ A;  2ZAA A;  1EP0 A;  2E26 A;  2HWC 2;  5EWS A;  3UET A;  2Q8C A;  5ISL A;  2V4V A;  1AYM 1;  1HB2 A;  1WD4 A;  1O7F A;  4MGK E;  4XW3 A;  3JXS A;  3WF2 A;  5JI9 A;  5JXJ A;  4R9A A;  2YY1 A;  2VMI A;  3DKQ A;  4GJY A;  4ES9 A;  1GZT A;  5LWB A;  5IK5 A;  3M3I A;  3VZL A;  4LKF A;  3CZU A;  2HKX A;  1V9U 2;  2Y38 A;  1LU1 A;  5DDJ 3;  5FO8 B;  1N1Y A;  1X9P A;  3Q8B A;  5FFO C;  3J7H A;  3ORJ A;  5FXZ A;  5FZ3 A;  5FZ1 A;  4CXW A;  5FY5 A;  1UPI A;  1PO2 2;  3VB9 A;  2C24 A;  1JUI A;  1XPW A;  2VUA A;  3BCW A;  4BZ4 A;  2VM9 A;  1UCX A;  1EV1 3;  3VBU C;  3I3E A;  3OJB A;  4FXK B;  3S57 A;  1CAW B;  1PO1 2;  2ZGU A;  5A7W A;  1RUC 3;  2RS3 1;  1W03 A;  5CZK A;  3ILF A;  2A1X A;  1XU1 A;  3MPP G;  1W6Q B;  5LRS A;  1AUY A;  2JKB A;  2JDM A;  2JWP A;  2ZKN A;  1KJL A;  2FDH A;  1R1Z A;  2D6O X;  5FWE A;  4Q29 A;  1VMJ A;  5F5C A;  5GLW A;  2DCY A;  4JGY C;  4AI1 A;  4B1M A;  4V2W A;  1TME 2;  5A32 A;  3MIB A;  2DTW A;  1NT0 A;  2NM1 A;  3JB8 A;  2PHF A;  4CDW A;  3JD7 3;  3KV6 A;  1D2S A;  5FK7 A;  4AE2 A;  1ENX A;  1LEN A;  1QXR A;  1IPS A;  1VBA 1;  2P4E A;  3WCS A;  4Z2W A;  1PVC 3;  2EIG A;  5FYZ A;  2Z5W A;  1MS1 A;  4GWJ A;  3KT4 A;  3III A;  3J8F 1;  4CEW A;  1OKO A;  3FN9 A;  2WFP A;  4YW1 A;  3GZA A;  2RS5 2;  3BYW A;  1QJY 2;  4AED C;  1AZD A;  1LJ7 A;  2VZV A;  4DEV A;  4ERO A;  4KU7 A;  5GZD A;  2I2S A;  3LA2 A;  1VBD 1;  3K3O A;  1EAH 1;  1HRI 1;  3OCP A;  3IM0 A;  4L92 A;  1A8D A;  1GOG A;  5BXX A;  5L7O A;  3D4K A;  2QQW A;  1ZBA 2;  1F4A A;  5GZE A;  4BQ1 A;  1XND A;  5JXI A;  1RHI 3;  1W99 A;  3K2O A;  3NJX A;  3KF3 A;  3DPR B;  3GHN A;  4PBP A;  2DVB A;  3BTZ A;  4OHX A;  1M06 G;  3O1M A;  4QKN A;  1JZ6 A;  5DXD A;  4W6Y A;  4YM1 A;  1O59 A;  2RJL A;  2ZZQ A;  4MXV A;  2VCC A;  3POE A;  2ZMK A;  3FL7 A;  5TSW A;  1CIY A;  1QQP 3;  4CVU A;  3ZFE A;  1W0O A;  2MPF A;  4P14 A;  1Y9G A;  5DUX A;  5FZ4 A;  2H6C A;  1CN1 A;  1XYO A;  1V6K A;  1GZW A;  1XYP A;  3H3U A;  4BQ4 A;  3ACF A;  3E5U A;  3WQ0 A;  2HWD 1;  3M2M A;  4CP9 A;  1WW6 A;  2IWG B;  4EZH A;  2NLR A;  4OI2 A;  3RZK A;  1QH6 A;  1JN2 P;  4KU8 A;  1NLQ A;  4M3C A;  1LHW A;  3E6C C;  1AYM 2;  5FKC A;  4AHX A;  4OZO A;  4HOO A;  4PI2 A;  4TLF A;  1ZZ9 A;  4KWJ A;  1UL9 A;  1AVB A;  4FPL A;  4RR3 B;  4YFZ A;  1UKG A;  3ZXL A;  1QOT A;  3BUC A;  1GZ9 A;  1W9Y A;  2XDV A;  4FO9 A;  1KFU L;  4GMP 3;  1DIW A;  1L7L A;  4AOC A;  2A71 A;  4YZ2 A;  4XQD A;  1R09 2;  4F83 A;  1NZI A;  2HWF 3;  4MLO A;  4Q2F A;  5AVA A;  3ZXE A;  3HPN A;  5FYU A;  5BYN A;  3AP7 A;  2PEL A;  3T1L A;  3KQ4 B;  3TYJ A;  2C9K A;  4GH4 A;  5BNN A;  3VDB A;  4COU A;  5CFC B;  2RS3 2;  2YXS A;  3EJK A;  4X8N A;  1NKG A;  3MF6 A;  1GP5 A;  3UK9 A;  5BNP A;  5C8W A;  4LOR A;  4BIO A;  1JHN A;  3RZL A;  5CEH A;  3VKO A;  2RDR A;  3WUC A;  5I8Y A;  4TTG A;  4GQ7 A;  1A8M A;  2ZHM A;  1REF A;  4LUM A;  5FYM A;  3VZO A;  4L99 A;  4YLZ A;  4AVB A;  3TNP B;  1ULD A;  2ZGR A;  3MLJ A;  5FY0 A;  2VW2 A;  2XVK A;  4RFR B;  5FZ8 A;  4NVP A;  1RUF 3;  2QBX A;  3N35 A;  4IV1 B;  4S2H A;  2LTN A;  2P1B A;  5FIX A;  3N7M A;  5DDJ 1;  2A7A A;  1HN0 A;  3I2F A;  4UT5 A;  1HLC A;  2WFF 3;  4RGA A;  3M4F A;  2VU9 A;  1NCQ C;  3Q8A A;  3WVJ A;  3HBK A;  1C1F A;  3PVE A;  5FZD A;  5A3L A;  2JDN A;  3J8F 2;  3H42 B;  2AUY A;  3OTF A;  5F5I A;  1W6O A;  2ET1 A;  4JHZ A;  1PMH X;  3ZSK A;  1EV1 1;  4G3Y C;  1GU3 A;  5CKM A;  4YW4 A;  5FZL A;  1X82 A;  5LRR A;  1VB2 A;  4AI3 A;  1HRI 2;  2D93 A;  3AP5 A;  4AGV A;  4YSF A;  1RUC 1;  2NN8 A;  4Z2A A;  1LEC A;  3HJR A;  4QMA A;  2AZ5 A;  3THD A;  3EO6 A;  4HKO A;  2WN2 A;  5JIA A;  4CU6 A;  4JDM A;  2Q1F A;  3AKT A;  1PHM A;  3IDB B;  4AVA A;  2D6L X;  4KBZ A;  4QAW A;  4WVM A;  4O61 A;  2J1A A;  3I3D A;  2GZW A;  2X5I B;  1HB4 A;  4AQ2 A;  1DP0 A;  5FLI A;  3JD7 1;  4QPI B;  1LOE A;  4P9W A;  1UXZ A;  2OZJ A;  3NV3 A;  3VD5 A;  1DBN A;  1PVC 1;  2YC0 A;  5J7M A;  4H7L A;  1AF9 A;  1H2K A;  2YPD A;  4CU7 A;  5EIY B;  1U5Z A;  5I0S A;  5F37 A;  3KB5 A;  3WQ7 A;  3QLQ A;  2AR6 A;  4P9L A;  1FOD 3;  1QH7 A;  2J1R A;  5FPU A;  3ZFF B;  2A6Z A;  3I2H A;  4KL1 A;  4FBF A;  4M4R A;  4FPO B;  4LEJ A;  4E2Q A;  2LAL A;  4C1X A;  1SDD B;  3MIF A;  1V6L A;  3GJA A;  4MG2 A;  2JD4 A;  4LIT A;  1OUX A;  4AXO A;  1RHI 1;  1PX4 A;  1D4M 3;  1UOF A;  5IVY A;  4ATE A;  2PAM A;  4BYY A;  4IEZ A;  3ZN6 B;  4MXW B;  1SLT A;  3OUI A;  1SQ4 A;  4TLG A;  3ZIX A;  1REE A;  1QQP 1;  1UZ0 A;  1TQ5 A;  3WHU A;  1ZBE 2;  2IVI B;  3MV1 1;  2WO3 A;  5FMB A;  1FI2 A;  4LO5 B;  4Y20 A;  4MOA A;  5IVE A;  1OOP A;  4JKL A;  3N9Q A;  4OUE A;  3QD6 A;  2FZ1 A;  4Z82 A;  2WWU A;  1DGL A;  1DCS A;  4DNY A;  4CDW C;  2WKK A;  4NHX A;  2ZGS A;  1ZZB A;  2RE9 A;  4BXF A;  1OD3 A;  1OVS A;  1ZZC A;  1GQG A;  3KS7 A;  4K7J A;  5FZK A;  1WWY A;  2XVL A;  1S55 A;  2DDU A;  3AZX A;  1GSL A;  4QM9 A;  1IS5 A;  4JRL A;  1GP6 A;  3SH5 A;  1Y9M A;  4CU8 A;  4JX0 A;  1V6O A;  4EN0 A;  3WV6 A;  1U5X A;  2VGD A;  2Y6F A;  5A80 A;  1FAT A;  4ZU4 A;  4EN7 B;  4XAB A;  2ENR A;  5DG2 A;  3BTX A;  2IZW A;  4LQR A;  4GMP 1;  3ZKY A;  5JPM B;  5L7O C;  3U0Z A;  1EUU A;  4IE0 A;  2Y64 A;  1RIN A;  4EV0 A;  3ZVX A;  3B3Q E;  2K0G A;  4K1Z A;  3U4S A;  2YG0 A;  2HWF 1;  3WF4 A;  1RB8 G;  1Q43 A;  3LPG A;  2A5Z A;  4BPZ A;  4PJY A;  2IVJ A;  1EV1 2;  3JBG 3;  4I30 A;  4QX3 A;  1PVX A;  1YFW A;  3AB0 A;  4LBQ B;  2QE3 A;  3WDX A;  4CCE A;  2O8Q A;  4E2S A;  4BJ0 A;  1HRV 3;  3ZFE C;  3I49 A;  1PM7 A;  5JXG A;  4IES A;  1YWK A;  3LQC A;  2PHT A;  5FO9 B;  1QGL A;  1K5M A;  1NOV A;  2VZ3 A;  4QXC A;  4TWT A;  1WBL A;  1LED A;  3MV0 1;  1HIX A;  4V1P A;  3K48 A;  1HDK A;  1OF4 A;  3CLP A;  1O3S A;  2ADE A;  1SDW A;  2W9X A;  1RUF 1;  5F3C A;  4R4X A;  2GH8 A;  2J42 A;  4XFG A;  4ZZ8 A;  2ZX2 A;  2ADD A;  2XML A;  3NAP B;  4BXS V;  5FY1 A;  1JYT A;  1ULC A;  2V73 A;  5K4L A;  1YXW A;  3PHM A;  2VOT A;  1PVC 2;  4A7K A;  1ACC A;  2WFF 1;  2XLG A;  4QM8 A;  3ROU A;  2FDI A;  1LCL A;  4LKD A;  1X9T A;  1F4H A;  3LPF A;  4OHW A;  5ACA 1;  5J09 A;  3ZXJ A;  3V0B A;  5J98 B;  4NOT A;  4XCB A;  4PQQ A;  1UOG A;  1Q8S A;  4NO4 A;  3RMY A;  4KI5 M;  2HLE A;  5FBZ A;  2A73 B;  3SEP A;  5C8C A;  2WIN B;  3FBM A;  1W8F A;  4H7M A;  4ZPI A;  2ZML A;  2VNR A;  3ZYP A;  2D3P A;  3VBS B;  4DEQ A;  1UZZ A;  4QB2 A;  3VZN A;  1RHI 2;  3D3A A;  5FOB B;  3WNX A;  2TBV A;  1ODM A;  3P5B A;  4A3X A;  3KZ4 C;  5C7G A;  1YQ5 A;  4GH4 C;  1OQD A;  2W68 A;  5BNN C;  1JOD A;  5GZG A;  2GAU A;  3UV9 A;  4AVC A;  2A3W A;  4QGL A;  4NUB A;  1H9P A;  4XUN A;  5FPB A;  3VHO A;  2BQP A;  3O14 A;  3N7J A;  2JG9 A;  1DQ6 A;  5BNP C;  1FX5 A;  4HPK B;  4AK3 A;  4DXS A;  3RRD A;  2CL2 A;  2VZP A;  5F2S A;  2CNA A;  1OBN A;  2JXA A;  3KHC A;  2D43 A;  3GYD A;  3USU B;  4EWE A;  4COV A;  4HET A;  2XJU A;  5AFE A;  1YEW A;  5FJK A;  1CWP A;  4WVZ A;  1WCS A;  5ERL A;  2WL1 A;  5IHR A;  3HQU A;  1RXG A;  4A7Z A;  1BXH A;  2NMO A;  1UY3 A;  5IK7 A;  2BYV E;  4ZXE A;  1CJP A;  4OUM A;  4PLO A;  1LTE A;  2A6W A;  5DAX A;  1YQ2 A;  2XON A;  4P9J A;  5LA2 A;  4D0Q A;  4D6S A;  2PA7 A;  1D4M 1;  3H8X A;  2GC2 A;  3WHT A;  5T5P A;  2DFC A;  1OUR A;  2F4P A;  4MH0 E;  1RUH 3;  2XJQ A;  5CIS A;  4YGE A;  2WC2 A;  1YLL A;  3M8L A;  2P3I A;  1DGW A;  4M0N A;  4QX5 A;  3QAC A;  4QX1 A;  2X05 A;  5I91 A;  4IGP A;  1W2T A;  4JRA A;  4IV3 A;  1S1A A;  3K75 B;  3PUQ A;  4N53 B;  3RS6 A;  3U78 A;  3PDQ A;  1OQ1 A;  2IFW A;  3LA7 A;  4QHZ A;  5FZE A;  2SBA A;  3WNN A;  5HI0 A;  2RJ2 A;  4WZF A;  2P3Y A;  1VMH A;  2BW8 A;  2D6M A;  2ORZ A;  2Y6K A;  5AC9 1;  2PYT A;  2WZP P;  1UIJ A;  3GZT B;  3AZV A;  4M01 A;  3TAY A;  4LO7 A;  1G8W A;  1KQR A;  2VQA A;  5A3O A;  5DAP A;  2VQ0 A;  2RM2 3;  1H6Y A;  3GDB A;  1NXD 1;  4Z8B A;  1PZ9 A;  4JGZ A;  4OZX A;  5LEK A;  1FMD 3;  2GC3 A;  4G4F A;  2WO1 A;  5LW9 A;  4ASM B;  1N3P A;  1W8Z A;  2P17 A;  3C8X A;  3SNM A;  1IQD C;  5HBA A;  3S5Q A;  4NIG A;  2WFF 2;  5IVF A;  3VBU B;  4D3W A;  4XBN A;  4LIV A;  3PTR B;  5ACA 2;  5KBF A;  1PO1 3;  3H50 A;  3A0N A;  1NY7 1;  4XJA A;  3OGS A;  3LE0 A;  2OZ6 A;  3NNF A;  4RGG A;  1ND3 B;  4B3N A;  3JBG 1;  2ZHL A;  3MHZ A;  4ES8 A;  3AP9 A;  1W6N B;  1A3K A;  4P5Y A;  2VL4 A;  4FPY A;  5LA1 A;  3BIE A;  1GNH A;  2WAB A;  1HRV 1;  2DTY A;  1VAM A;  4JGY B;  5FRA A;  4UFL A;  2DVA A;  3AXE A;  3ON7 A;  4RGK A;  5BPX A;  5F8P A;  1JOJ A;  4CCO A;  1N47 A;  1OOP C;  1NA1 B;  1D0H A;  2WNV B;  4UBH A;  4FP2 A;  4QXK A;  3NMB A;  4RHV 3;  3TBD A;  3M70 A;  4R9D A;  4MET A;  3ZYB A;  5K9Y A;  1LRH A;  3KGZ A;  1STM A;  4N8M A;  2BNO A;  3NV1 A;  1UY1 A;  3E6B A;  2VUJ A;  1GAN A;  3LEK A;  5DAV A;  3POS A;  2RS5 3;  1GNY A;  4K8R B;  1J1T A;  4Y1V A;  2DU0 A;  4Q5O A;  1MS5 A;  2GP3 A;  1SZB A;  5KXC A;  3UL2 A;  2YYO A;  2JIC A;  5FQ0 B;  4Y3O A;  1CX1 A;  3BOD A;  3CNA A;  1YJK A;  2EIC A;  3TEY A;  3ZYR A;  2Z79 A;  2VOW A;  1JXN A;  1YC6 1;  4NRO A;  1H2M A;  2FDK A;  1XC6 A;  5DZF A;  3AM2 A;  3WP3 A;  2IXL A;  1D4M 2;  2EXI A;  2VC9 A;  5FPV A;  1W05 A;  5FUN A;  3VDC A;  4OCT A;  4A45 A;  5SV5 A;  1W6P B;  1I6X A;  2VZS A;  1W9F A;  3NJZ A;  4UFJ A;  4DUW A;  2D3S A;  1CIW A;  2GND A;  2WWJ A;  3PIG A;  3VV1 A;  1K5M C;  3EYP A;  1ND2 A;  3ZKU A;  4OUL A;  2VMC A;  5A7O A;  4E8C A;  3RYP A;  4XJZ A;  1JMU B;  2HWB 3;  2PMW B;  1OUS A;  2VO5 A;  1RUN A;  2Q30 A;  3FHA A;  4XHB A;  1NE4 A;  1OLM E;  2GC1 A;  4ZU7 A;  5AC9 2;  2GMP A;  5JOY A;  5JOW A;  3GBW A;  2EVX A;  4XXP A;  2JEM A;  5G04 L;  3VDD B;  4EN8 B;  4D6Q A;  1TMF 2;  4GXL A;  4I01 A;  4WM8 B;  1FAY A;  3O0X A;  4LHK A;  3RZG A;  4X8P A;  4FPK A;  1ULF A;  3MDP A;  1PNG A;  3VBH B;  1VPH A;  4Z1V A;  1RUH 1;  2G9F A;  1ULE A;  3ZSL A;  1R09 3;  5C8C C;  2XG3 A;  1OA4 A;  2XBO 3;  4UFH A;  4XAA A;  2D5H A;  4SBV A;  2WNU B;  3HVD A;  3ZXF A;  5FMC A;  3WDV A;  4LUK A;  4Q1P A;  4Y1Y A;  1KFX L;  4Q4V 2;  5DQ0 A;  3OYW B;  3N36 A;  5JMO A;  3KV4 A;  1RIR A;  2NZ9 A;  4RQP A;  4IEW A;  4C0B A;  4FOY A;  2ZOE B;  4YG6 A;  3JBG 2;  1BZW A;  4DXT A;  5F5Q A;  3AYE A;  4Y22 A;  1AXY A;  2JG9 C;  3IPV B;  2W92 A;  4FAG A;  5CG9 A;  2GNT A;  2XQX A;  1JZ7 A;  3N9N A;  1OD5 A;  1UU5 A;  1YHF A;  1RC6 A;  3U14 A;  2RM2 1;  5B4N A;  4NIH A;  5KC5 A;  1POV 0;  5FZ6 A;  4LO6 B;  4XZP A;  1HB1 A;  3LD8 A;  3ES4 A;  1G7Y A;  3H7Y A;  2BOJ A;  1FMD 1;  4CCD A;  4DY5 A;  4QGM A;  3POI A;  4AR2 A;  1UY4 A;  1NCQ B;  4TN7 A;  5DZG A;  2WNE A;  3LFI A;  4RHV 2;  2C26 A;  2EXH A;  3VBR B;  4AI2 A;  4YVS A;  1NG0 A;  3MGU A;  1QMJ A;  3KT1 A;  1O3T A;  5FZ9 A;  4KWL A;  2RS1 2;  3R05 A;  5F3G A;  5E88 A;  1PO1 1;  4CTE A;  1US3 A;  3FUQ A;  3J7N A;  1XNT A;  1UXX X;  2F4L A;  3CEW A;  5GZF A;  2H6B A;  3KM5 A;  1NE6 A;  5M0T A;  5K7P A;  5JOZ A;  1HQN A;  2JD9 A;  3POW A;  4BQ5 A;  2E6V A;  4IV3 C;  2EAK A;  2V4A A;  1XRU A;  1VMF A;  1V6I A;  1VR3 A;  4HBN A;  2A6Y A;  4QPG B;  2V5Y A;  5FZC A;  2YMZ A;  2ZEY A;  3CMG A;  4D7S A;  5A6Z A;  1FPN 3;  1CX4 A;  1NCR B;  2OX0 A;  2Q1Z B;  3ZSM A;  5JXH A;  4CEY B;  2AEZ A;  2AC1 A;  3CU7 A;  5JIU A;  3KSC A;  3KVA A;  5D1I A;  4FPG A;  1H4G A;  1UZV A;  2ARE A;  2TUN A;  3FMG A;  2VXR A;  5FYB A;  3BTA A;  1RL3 A;  1BJQ A;  2RS5 1;  3HN1 A;  4BCU A;  2VJX A;  3WNM A;  2E33 A;  4JGZ C;  3R6S A;  1I3H A;  3WR0 A;  4E4Z A;  5F3I A;  4JAA A;  3NJV A;  2IFR A;  1UOB A;  3AKP A;  5A3T A;  4HKW A;  2W47 A;  3UT0 A;  3IIA A;  2K2S A;  4D7Y A;  3FHQ A;  3MIH A;  5FUI A;  4CDX B;  2JX9 A;  2VCM A;  2EF6 A;  4HN0 A;  1CD3 G;  1QNW A;  2OPK A;  2WO2 A;  3FLR A;  3KCY A;  5JZG B;  2XL7 A;  3I3B A;  3P3N A;  5FPA A;  1DQ5 A;  1LU2 A;  5L73 A;  2V09 A;  3CBN A;  2VW0 A;  2YV8 A;  3EXU A;  3NL1 A;  3POJ A;  1RUH 2;  1ZZ8 A;  1W6M B;  1WW5 A;  1ZBE 3;  3I8T A;  4MGI E;  2YBS A;  3U75 A;  5A32 B;  1ZM1 A;  3VZM A;  3NNJ A;  4MGT A;  3N9L A;  3PUA A;  3PU3 A;  1CZV A;  1GZC A;  1EPW A;  3SKV A;  4XPV A;  3HQR A;  3D0S A;  2WJS A;  4NHK A;  2JKX A;  1X36 A;  2F6B A;  3HT1 A;  4LLF A;  2HWB 1;  1NLS A;  1Y3T A;  2PTM A;  2WZ8 A;  1JZ3 A;  2OKX A;  4GAL A;  4N9H A;  1XJA A;  2ZGM A;  1UU6 A;  1SPP B;  4CEW B;  5ABJ A;  3UJQ A;  4FQ4 A;  1R08 3;  4BK4 A;  3V0A B;  3AX4 A;  4CUB A;  2RM2 2;  2DVG A;  3D8C A;  2E9Q A;  2GH2 A;  5GZC A;  3ZYF A;  2XB6 C;  2ORX A;  2DUP A;  1W9T A;  5FMO S;  1FMD 2;  3B5L B;  1OMI A;  1R09 1;  4LKE A;  3PTY A;  3ZDS A;  4AVT A;  2XBO 1;  2XKP A;  2J7M A;  5FP9 A;  1FNZ A;  4IND A;  1QJX 1;  2NMN A;  5LAT A;  1YFU A;  5EYX A;  2HYK A;  3EHK A;  1UYP A;  4QKB A;  2EAL A;  2ZA9 A;  4Q4X 3;  5IK8 A;  2LM3 A;  1RXF A;  1AR8 1;  1QEX A;  3M3O A;  4AEJ A;  2D3R A;  1UMI A;  2C9A A;  2XHN A;  3AMP A;  3GF6 A;  1W3V A;  4XBQ A;  3ZYI B;  4ISQ A;  4N43 A;  2WO7 A;  1LGC A;  2CHH A;  4TYS A;  1B35 A;  5C6C A;  3HBZ A;  1ND2 C;  5L9R A;  4FTE A;  1HV0 A;  5KR7 A;  3MLL A;  2YBP A;  4KH9 A;  4YAR A;  2B46 X;  1IZ3 A;  2C0Z A;  2CDP A;  2G4I A;  2PHX A;  2YGL A;  1DGR N;  1WCK A;  1FT9 A;  3Q8C A;  3A0K A;  5I0R A;  3BOP A;  4LIU A;  4FTS A;  3ZPY A;  1QWR A;  4IGO A;  3TNQ A;  3WP4 A;  4WZC A;  4CDQ B;  4FVV A;  3VHR A;  5L19 A;  2JDA A;  5KC6 A;  3W20 A;  1ALY A;  4CP2 A;  3WG4 A;  4C0H A;  3Q8F A;  2Z2S B;  4ZHN A;  1CVN A;  4P9X A;  3RMX A;  2VXJ A;  4UW4 A;  4EN6 B;  2XJR A;  2JEN A;  5C4W B;  4QKD A;  3CJI B;  1OVP A;  4YM3 A;  3G6J B;  4FPE A;  5FZH A;  2WS9 3;  4QPW A;  1UOJ A;  3RZM A;  1W2N A;  3RWN A;  2ZAH A;  4YGC A;  2VZU A;  1JYC A;  2KA3 A;  1HW5 A;  1LOF A;  3U10 A;  1W8N A;  2PLV 3;  4GH4 B;  4OVE A;  4WM7 B;  5FZA A;  2DBI A;  4RQP C;  5A1F A;  2ZMN A;  3FX3 A;  4JCK A;  1FPN 1;  5FO7 B;  3VUO A;  4DOU A;  2W3J A;  5BNP B;  4PI0 A;  3ZMN A;  4OHV A;  1J3Q A;  1GOH A;  2IXI A;  5GM0 A;  1G9D A;  3C7E A;  1DFQ A;  2VUL A;  1YFX A;  2ZGO A;  1U0A A;  1JI6 A;  1JTZ X;  3D82 A;  2V5D A;  3GXU A;  3I54 A;  4UBG A;  3I4I A;  4YW7 A;  1TVG A;  1K42 A;  2CWS A;  2UU8 A;  1ZRE A;  1LUL A;  1BEV 3;  3I59 A;  4P9Y A;  5G05 L;  3ACL A;  3AP6 A;  1ENR A;  4IE4 A;  2HWB 2;  1QNY A;  3A4U A;  4JZR A;  5IFT A;  1Q8P A;  2VNO A;  3WX5 A;  4TZD A;  5CB7 A;  2W0X A;  4HK9 A;  4ZZ5 A;  4YVS C;  4IEX A;  1MQT B;  2ARC A;  2FZ2 A;  4XOG A;  1ODN A;  1W6Q A;  1W8U A;  3MPB A;  5GJ6 A;  1SLB A;  4ITC A;  4E4S A;  3FUO A;  2GDF A;  1MS4 A;  2IC1 A;  2ZCW A;  3SMH A;  3ENR A;  4OMD A;  1ZBE 1;  4R9C A;  1RUI 3;  1UU4 A;  2XBO 2;  2YZ4 A;  3T1M A;  1XNA A;  4HXC A;  4URT A;  4K40 A;  3LB9 A;  4DRR A;  1QJX 2;  3ZR5 A;  4AI8 A;  4QQ2 A;  3H8R A;  1RUO A;  1QU0 A;  4N7I A;  1LOG A;  1W2O A;  3JCI A;  5LBC A;  3ACI A;  2B45 X;  1G9C A;  3MIC A;  3NNL A;  3UYJ A;  3VD9 A;  3ME2 A;  4PIX A;  4UF0 B;  1BMV 2;  1AR8 2;  5H9S A;  5F1R A;  2ERF A;  3W58 A;  5JPN B;  1O6U A;  4E2G A;  2D6P A;  2VOV A;  3U07 A;  2BTV C;  1OKQ A;  1VBE 1;  1GQP A;  4LPL A;  3I7D A;  4LKS A;  2PHR A;  1R08 1;  2XL9 A;  4C8D A;  2VEC A;  2WWS A;  5C9A B;  1UZY A;  2Y8K A;  2ATF A;  5C3O A;  2A6X A;  2L9L A;  2WYS A;  2XQR A;  3DPR A;  3WLU A;  2E51 A;  2VR4 A;  5LK5 A;  4RA0 A;  4EN9 B;  3DXT A;  4ZXK A;  1RUD 1;  3IAQ A;  4BH9 A;  3R4U A;  1SCR A;  5ACA 3;  5CG8 A;  2JDY A;  2VZQ A;  1KS5 A;  4Q27 A;  2E31 A;  4LO8 A;  3RFR A;  2XJV A;  4NMI A;  4YGD A;  2EIE A;  4BDV B;  1LHV A;  5A70 A;  1CAV A;  4YZ3 A;  1H2L A;  4Q1R A;  4Q4X 1;  1H8T B;  5A3P A;  3AZW A;  5H9R A;  2JDZ A;  3WUD A;  3ILN A;  1XE7 A;  1OPM A;  2IXJ A;  2W94 A;  4CXX A;  4QDS A;  2JG8 B;  4LA3 A;  1OOP B;  1XBF A;  1ENS A;  2CY6 A;  2DCK A;  2I07 B;  2R32 A;  5D8A A;  2WR9 A;  1PNF A;  2Y33 A;  3POF A;  4Y4R A;  3ZFG B;  4IUG A;  3WNO A;  1MZE A;  2JJ6 A;  3RQ0 A;  1ZRC A;  5CKN A;  5EJ3 A;  1FPN 2;  1WA4 A;  4Y5Z 0;  2ZZJ A;  2BOI A;  1N3O A;  1IS6 A;  1YRZ A;  1AR7 3;  1UY2 A;  1WCQ A;  3DXU A;  4FPJ A;  5IVV A;  4RR3 A;  1GMM A;  2RG4 A;  2RV9 A;  1GUI A;  2K9Z A;  4AVV A;  4BMB A;  5ABJ C;  4NPM A;  5FPX A;  1YO8 A;  2PAE A;  2ZX3 A;  2G1M A;  4HAN A;  4V2V A;  2WN3 A;  2Y0O A;  2VY0 A;  2YUE A;  4Q0V A;  1S0F A;  1Z7S 3;  1BLZ A;  1SLA A;  2A3Y A;  5A3N A;  3AK0 A;  3OBA A;  1S0C A;  3BPS A;  3MI8 A;  1D4V B;  2QCS B;  3L2Y A;  4UYB A;  2AAC A;  4JVA A;  3LSE A;  4LOT A;  4Q8L A;  3HN3 A;  3UKV A;  3ZM8 A;  3Q9O A;  4OQ8 A;  2PAK A;  5A3W A;  2WS9 1;  3OSD A;  3AZY A;  4GUL A;  3WF3 A;  2BV4 A;  1NYW A;  1M4W A;  1PK6 B;  2OA2 A;  2ZHK A;  3I2J A;  2PXJ A;  4IE7 A;  2OUJ A;  4ZY9 A;  2GME A;  2PLV 1;  1ENQ A;  3PIJ A;  1XU2 A;  2DCJ A;  2RMU 3;  4IEQ A;  3O1S A;  2R0F A;  4FPH A;  1H0B A;  3OGG A;  2BVV A;  4LE4 A;  1S2K A;  4FPC A;  5IAX A;  1K5M B;  4N43 C;  1OHF A;  4LXL A;  4IV1 A;  1JYV A;  1B35 C;  4NII A;  3OD4 A;  3NKT A;  4PIZ A;  4NPL A;  4CZS A;  3WD5 A;  3K77 A;  3I2K A;  1XE0 A;  3ZN5 A;  1D2Q A;  3ZN4 A;  5AC9 3;  3O1O A;  1HQL A;  1BEV 1;  1VJ2 A;  1YCI A;  5APA A;  3C7F A;  3ZLI A;  4CUA A;  3LOI A;  2ES3 A;  2DF7 A;  4UW6 A;  1TMF 3;  3J7L A;  3WNK A;  5FDB A;  4WVW A;  5KXB A;  4ARY A;  1QIQ A;  4FXG B;  4HKL A;  4CCL A;  3J26 N;  1VBE 2;  3IDA A;  5J37 A;  4XAC A;  1R08 2;  3ASI A;  1S0D A;  4KG8 A;  1BK1 A;  1CZS A;  4OMC A;  2F17 A;  5HV0 A;  4PDW B;  1H8V A;  2WA4 A;  2YFZ A;  4XFF A;  3WF1 A;  1PGW 1;  4XVH A;  2C6S A;  1SLC A;  4J1X A;  4LHL A;  4BHP A;  2DU1 A;  3PMS A;  2G9G A;  4XFA A;  4Z07 A;  2PHW A;  1RUD 2;  1YYN A;  2VBB A;  2X5I A;  3HD8 B;  1QJU 2;  2YFU A;  2QVS B;  4QX8 A;  2E7A A;  1RIT A;  3HWJ A;  1RUI 1;  4Q4V 3;  5FTT C;  4QPI A;  1LOF C;  1MS9 A;  2Z69 A;  3PLQ A;  4BQW A;  4AFM A;  1EPZ A;  4Y1U A;  1HB3 A;  3N9P A;  5FXX A;  5BNO A;  4Q4X 2;  2N7G A;  3LDK A;  5L9V A;  4Q26 A;  4AAX A;  3VD3 A;  3F95 A;  4LA2 A;  4YYO A;  3ZFF A;  2TEP A;  4E9K A;  2J1V A;  4D7T A;  4EE2 A;  4ZS3 A;  3KV5 A;  4RS5 A;  2VTF A;  1VAK A;  4KGG A;  2YBK A;  1UAI A;  4K3U A;  5J48 A;  4MHU A;  3VBF B;  4HFS A;  3ES1 A;  2GP5 A;  5FP4 A;  3TEW A;  2E32 A;  1GQH A;  1W8W A;  2ZEW A;  1LOA A;  1QJZ A;  2ARB A;  2E7Q A;  2B39 A;  2VVD A;  3H9A A;  2VMH A;  4FCA A;  3JUU A;  5KHH A;  3WW4 A;  4XMI A;  1E5S A;  2WRA A;  2JE7 A;  1OLR A;  3OPW A;  1N1S A;  2OQ7 A;  4M00 A;  5K0U B;  2RS1 3;  1RUJ 1;  3AL6 A;  3ZN6 A;  4MXW A;  4A6S A;  3NV4 A;  3VN4 A;  1BQP A;  1S0B A;  3WNP A;  5JR2 A;  1ULO A;  4XDQ A;  5GLU A;  1DU3 D;  5ANN A;  2XPJ A;  2HH9 A;  2PHD A;  3GNE A;  3ZDV A;  3PU8 A;  4PQ9 A;  4YG3 A;  4AWD A;  3Q8E A;  1RTV A;  5DMY A;  4XUP A;  5DAW A;  2QNK A;  4OHZ A;  4Z92 B;  2W1W A;  2WS9 2;  1GFF 2;  1ULP A;  4NIA A;  4AEM A;  5A33 B;  5CYY A;  5A7S A;  5FAX A;  1SEF A;  4YFW A;  3MW2 A;  5C5T A;  5LB6 A;  5J3U A;  1WD3 A;  3LEG A;  2CU5 A;  4UW3 A;  3VBO B;  3GZU C;  1LHU A;  1SMV A;  1Q56 A;  2PLV 2;  2Q5T A;  5KXD A;  2OVU A;  2W1S A;  1IKQ A;  3MUY 1;  2XH6 A;  3OGV A;  4HON A;  4LBQ D;  3AYC A;  4NRM A;  3RVH A;  5A6Q A;  1CPM A;  1AX2 A;  3PUS A;  1AX0 A;  1AR7 1;  4BU2 A;  1XB9 A;  3RJR A;  5JSP A;  1BVV A;  4YVW B;  5FK8 A;  1MZ5 A;  4Y4Y A;  1DDL A;  1SFN A;  2AYH A;  3KVB A;  1FNY A;  5A6X A;  5FZO B;  3RYR A;  2G19 A;  2GMM A;  5FOJ B;  1Z7S 1;  3SHR A;  5C71 A;  1BEV 2;  2DWR A;  1TEI A;  3DPR C;  4XFH A;  5FRE A;  1KIT A;  3T08 A;  1CES A;  3WQB A;  1LKN A;  5JDB A;  1S0E A;  3PUH A;  1Y7B A;  2I45 A;  3MF9 A;  2ETE A;  3H0O A;  4LBQ A;  2BP6 A;  4GZ9 A;  3URF A;  3N7L A;  1PZ8 A;  3ZO0 B;  1WGP A;  1F5J A;  4W4Z A;  1WCU A;  3PVN A;  1Y43 B;  3USS A;  5A6Y A;  5HXM A;  1Q8V A;  5J96 B;  5FPZ A;  3HOB A;  1F8V A;  1PGW 2;  2RMU 1;  4WVV A;  1WA6 X;  4QDQ A;  3T0B A;  5C3Q A;  1BVP 1;  4COY A;  4XHX A;  2FCV A;  5CFD B;  1OT5 A;  1RUI 2;  2DBN A;  3OGR A;  5D8A C;  4IL7 A;  3H7J A;  1WLD A;  3NAP A;  5F9T A;  1GWM A;  3LF7 A;  5IT6 A;  4MZU A;  2JB8 A;  2YB7 A;  4LJH A;  1IG3 A;  4R4Z A;  4XTM A;  2QDR A;  3L2H A;  3MBW A;  4XYX A;  2D6K A;  3OB8 A;  4BQY A;  3WOG A;  4XIO A;  1DLC A;  2VAU A;  3N4M A;  5CA6 A;  4LMF A;  4RR3 C;  3QOP A;  3TN9 3;  5E8A A;  4AHZ A;  1TMF 1;  4IEV A;  4I3P A;  1J3R A;  4YG0 A;  4GD4 A;  3GZE A;  4AFB A;  1C8M 3;  4UFM A;  5IVJ A;  2VZT A;  5EXO A;  2ZBJ A;  1SAC A;  2JDH A;  4MGQ A;  3VBS A;  4B1L A;  3RG0 A;  2VBP A;  2Z42 A;  2ZX1 A;  1CZT A;  3DEM A;  4XCA A;  5F7U A;  3PVB B;  4PBO A;  1EUT A;  3D0J A;  1I1E A;  3ZXK A;  4AF9 A;  1RUJ 2;  3KWV A;  5FYI A;  4Q4V 1;  4OLL A;  4EJR A;  5JCT A;  2KD7 A;  5A7Q A;  4AGG A;  2VZ1 A;  3J7M A;  2A3X A;  2EA7 A;  5IVC A;  1XNK A;  2J1S A;  4AQ6 A;  5EQU A;  1K45 A;  5DG1 A;  2D6N A;  1CJD A;  1OA3 A;  1AR6 1;  3USU A;  2FCU A;  5KXE A;  5C3R A;  1VB4 A;  2BRT A;  4FFI A;  1ND2 B;  1O3R A;  4IQP A;  4IV1 C;  1J3P A;  2R1B A;  3M3E A;  4FTB A;  5CAZ A;  2HEV F;  4JKK A;  5C5U A;  1UYY A;  2FQP A;  5LBF A;  2GN7 A;  2NQY A;  5E6H A;  1KRI A;  2MNG A;  2RHP A;  3K46 A;  4HMZ A;  1WLW A;  2I74 A;  4XE9 A;  3DGT A;  2P2K A;  1LGN A;  4RHV 1;  3G7D A;  5AFB A;  1KD7 A;  1AR7 2;  1OA2 A;  4BWO A;  2QQN A;  5JSR A;  1LES A;  4AED B;  2V72 A;  5JI7 A;  4M0H A;  4XQ4 A;  2AGS A;  2RS1 1;  3ETQ A;  3OEB A;  1ZX5 A;  2JB4 A;  4XXA A;  3VKM A;  1S0I A;  1OH4 A;  1XSR A;  1G9A A;  3WY6 A;  3PNA A;  1Z7S 2;  5LK7 B;  2ZTN A;  4HK8 A;  3F2Z A;  4N53 A;  5T55 A;  5F2W A;  2ILM A;  1XOY A;  3WT3 A;  2PQQ A;  1JU4 A;  3NQH A;  3V64 A;  4CDU C;  2X5I C;  1E5I A;  2DCZ A;  3GBG A;  4RFT 0;  1YQ8 A;  3TOJ A;  4QPI C;  3HQX A;  2B8M A;  4I09 A;  2QZ2 A;  4IXL A;  3AVR A;  4YM2 A;  2VE1 A;  3THT A;  1O91 A;  2MEV 2;  2WA3 A;  2Z4F A;  3VKF C;  5KHG A;  4QXB A;  1OFN A;  5CU1 A;  3LIG A;  3S30 A;  1NUK A;  4FSJ A;  2D5F A;  5BNO C;  2RMU 2;  1MVE A;  4DPN A;  5BY5 A;  3PUR A;  3ZFF C;  1CAX B;  5A3M A;  1LGB A;  3ZXD A;  1W8H A;  3LGR A;  3WP6 A;  4RS5 C;  1XE8 A;  2E63 A;  3AVS A;  2OYZ A;  4XJW A;  5CVR A;  1C57 A;  4XF0 A;  4DB5 A;  1RMU 3;  4F8A A;  3ZYH A;  4P08 A;  3CL1 A;  3TEX A;  4XAE A;  2X53 S;  3UGF A;  3NW4 A;  5DUV A;  5FMO L;  1ND3 A;  2VVE A;  3D6E A;  2XUM A;  3RZJ A;  1OSG A;  4OFG A;  5FBJ A;  4OI0 A;  1HN1 A;  5FMD A;  3LSD A;  1QJF A;  1W6N A;  4CCC A;  5GLZ A;  3LKJ A;  4I2O A;  3OPT A;  2IUW A;  2AEN A;  2R49 A;  1MS3 A;  1TZO A;  1VRH 2;  1CAU B;  4QGN A;  3UGG A;  3ATG A;  3DKW A;  1BCX A;  3S7E A;  4IE5 A;  1NA1 A;  3ZSE A;  2WNV A;  3B94 A;  4NE9 A;  5FY4 A;  2GNM A;  1QJX 3;  2AEY A;  4BOW A;  3E1F 1;  5FYC A;  3V56 A;  1H1A A;  2BZD A;  4YGB A;  2RDS A;  2VG9 A;  3AJZ A;  2ZEZ A;  2ZX0 A;  1T2X A;  3J9S A;  4W6W A;  3N7K A;  3T2P A;  5FXV A;  1AR8 3;  3AFG A;  3ZYJ B;  3JU9 A;  5FZ7 A;  2WQ8 A;  1UYX A;  4Y26 A;  4HZF A;  2A75 A;  1DYP A;  4L97 A;  2EXK A;  2VPV A;  1AR6 2;  3A23 A;  3IBM A;  5JOX A;  3P1I A;  1Z0H A;  5BNQ A;  2QZ3 A;  2RDQ A;  1JYW A;  2UY9 A;  1U12 A;  3TN9 1;  4YW2 A;  1C8M 1;  1WBF A;  2CGP A;  2UY8 A;  4JHT A;  4QB6 A;  3MYX A;  3AKR A;  4AI0 A;  2OUH A;  2FDJ A;  3PUI A;  4MSV A;  3DCQ A;  5C3S A;  2WLP A;  3THP A;  4BLI A;  2BFU L;  3J4U H;  5DUU A;  4P5H A;  1CON A;  3WF0 A;  4CDU A;  3WXP A;  4LOS A;  1E5R A;  3B01 A;  1GV9 A;  4R9B A;  1W6P A;  4FOQ A;  2FDG A;  4QQL A;  2ZGP A;  4J1W A;  5E89 A;  3U37 A;  2BWC A;  3M7A A;  2D44 A;  3MZH A;  4NRP A;  3O1V A;  1ZRR A;  3JQW A;  4WBB A;  4GWN A;  1SLL A;  4IEO A;  4QXH A;  5JWP A;  3ST7 A;  3K4A A;  1V0A A;  3VLB B;  1VLN A;  1F35 A;  1KDM A;  2WT2 A;  3BKZ A;  1DQ4 A;  1LEM A;  2DCT A;  4LE3 A;  2LS6 A;  3EMR A;  1YIF A;  4RYD A;  3WQ1 A;  4O9G A;  4IEU A;  3DL3 A;  3FFQ A;  3NAP C;  5EZW A;  1ZYB A;  4D6R A;  5HV4 A;  2PN5 A;  4PCR A;  4UFI A;  3VDD A;  3ZR6 A;  3LZZ A;  1JYI A;  4XDO A;  3FWE A;  2VMF A;  2Q0A A;  3DN7 A;  3O7O A;  2R06 3;  1GYK A;  2W95 A;  3B93 A;  4QD2 A;  2UWC A;  4PT6 A;  4WM8 A;  1QXJ A;  2JEC A;  1QJE A;  2CSG A;  2D7F A;  4LLO A;  1RJ7 A;  5FZB A;  3ZMO A;  2R16 A;  2ARX A;  3VBH A;  2BU9 A;  3DYM A;  3MIG A;  4FPF A;  1X33 A;  2BGC A;  5FYH A;  4A4A A;  1DGW X;  3S6P A;  3H1M A;  4YNI A;  2OT7 A;  3JQX A;  3OY8 A;  3EBR A;  2ZGQ A;  3PL0 A;  1RED A;  1I5P A;  2A70 A;  3ACH A;  2WNU A;  1F15 A;  3VBS C;  4W50 A;  4URA A;  3UJO A;  2Y60 A;  4Q8K A;  5LA9 A;  2X10 A;  4LBL A;  3LOB A;  3N9M A;  1ASJ 2;  3OYW A;  2NPI A;  4HVO A;  3APB A;  3DV8 A;  2ZAC A;  4LBN A;  2QQO A;  2W39 A;  2EID A;  4NWV A;  5D21 A;  5FUP A;  1F2N A;  3C3V A;  5F6L B;  3VKL A;  2W46 A;  2EAA A;  2ZS6 B;  1JYN A;  1FV3 A;  3WSO A;  3KQR A;  4P02 B;  4ET7 A;  5FR3 A;  1POV 3;  3IPV A;  3P3P A;  2LUW A;  2VZR A;  5A7W B;  1AJO A;  4GJZ A;  4GKX A;  4H3W A;  1OQE A;  4QQH A;  4XEZ A;  3ZXG A;  3U4X A;  5IW0 A;  4LK7 A;  5A7N A;  4N43 B;  3LFM A;  4R52 A;  2VME A;  4NID A;  1DYO A;  2R1D A;  1TNR A;  5FKB A;  1J1L A;  2D98 A;  3MIE A;  5T50 A;  3A7Q A;  4D69 A;  4CDW B;  2WZR 3;  3IMM A;  3T3Y A;  4BM8 A;  4CPB D;  1HQW A;  2Y0I A;  2R7E B;  1OF3 A;  3ACG A;  3VBR A;  5FV3 A;  1RMU 1;  1ST8 A;  3FLT A;  3PJY A;  4IEY A;  3C7O A;  4UAP A;  3LEM A;  2XHK A;  1PMJ X;  4HVR A;  5CKQ A;  1C4R A;  5DN2 A;  5FY8 A;  1J58 A;  1MS8 A;  4B4P A;  2QQP A;  3OBR A;  1GLH A;  2CTV A;  1VBE 3;  1LOD A;  3TN9 2;  4UW5 A;  1C8N A;  4BME A;  1VBB 1;  3CHX A;  4GB3 2;  1C3H A;  5IVB A;  3WEZ A;  1C8M 2;  2VZO A;  2K46 A;  1SCS A;  4KWK A;  1HJG A;  2QJV A;  5T54 A;  3IDE A;  4CE8 A;  1PM4 A;  5FY9 A;  4N53 C;  5L7O B;  1RUD 3;  2P6H A;  4QPG A;  4CPB A;  2QKD A;  1QJU 3;  1F31 A;  3BTY A;  4K6B A;  4XFC A;  1NCR A;  3CF6 E;  4MGZ E;  5EJ1 B;  2P37 A;  5DUW A;  4CEY A;  1AR9 3;  4EWD A;  4I0W B;  3CQO A;  3IDC B;  3KLS A;  5LBE A;  4MO3 M;  2NYY A;  4M4P A;  1POQ A;  4AVS A;  5L36 A;  1BMV 1;  3S0M A;  2YDE A;  4LHS A;  1H9W A;  5I0U A;  3ZFE B;  5I93 A;  1OLM A;  1YNA A;  1U5Y A;  1MEC 3;  2OPW A;  2ZAB A;  4N90 A;  2X8K A;  1APN A;  1GZW B;  2XWB B;  2ZGK A;  3KCX A;  1JOP A;  4XF4 A;  4CP9 B;  1SBE A;  2BJS A;  2XJS A;  3SKJ E;  2P34 A;  3I59 B;  3I2I A;  4O7X A;  4B4R A;  1S2B A;  4DY3 A;  1R1A 3;  1O5U A;  4PF1 A;  1ZRF A;  4CDX A;  4M3C B;  3POB A;  5J36 A;  5JZG A;  1ONA A;  2ET7 A;  5FZM A;  3FLP A;  5FCC A;  1T6B X;  2WUH A;  3E97 A;  1ND3 C;  3OEA A;  3UKN A;  4IGQ A;  1EYB A;  3OGJ A;  2CGO A;  1K12 A;  4JQT A;  1W6M A;  5LAS A;  5KHJ A;  3O5S A;  2IXH A;  1DQ1 A;  3B00 A;  3D5O A;  4CCN A;  2BFU S;  3H3L A;  3VKN A;  4HL0 A;  5JUV A;  1BHG A;  2VVF A;  1IOA A;  1NA1 C;  2WNV C;  5JAX A;  1H2N A;  5A1A A;  4JQR A;  3FE5 A;  4GMP 0;  4MV2 A;  4Q4Y 1;  3M3C A;  5F5A A;  3CJX A;  1W8O A;  3BB6 A;  5BNN B;  4FFH A;  4YW6 A;  3C2U A;  1SPP A;  4XZU G;  5FZI A;  1AL2 3;  1UW8 A;  5IJR A;  3IN9 A;  5FJH A;  1KXG A;  1W3X A;  1DF0 A;  1YQ6 A;  1AHS A;  4QPY A;  4MAD A;  1JHJ A;  3UKT A;  4DIN B;  3V0A A;  1A34 A;  2R06 1;  2B42 B;  4QHB A;  2QFE A;  4NN0 A;  2LRO A;  1FYU A;  1LOC A;  3KMH A;  2QDN A;  3I2G A;  4A3Z A;  1LOB A;  2ZGN A;  3MEP A;  4L8Q A;  2H0V A;  3INA A;  3ZYG A;  2GN3 A;  3IWZ A;  2Y6H A;  1RMU 2;  2CV6 A;  4CCM A;  2BNN A;  3R4D B;  3WG3 A;  5EJZ B;  4KNC A;  1WMF A;  3CO2 A;  1PGL 1;  1CAW A;  1HJF A;  1HXS 2;  1PIV 1;  2OII A;  4QX7 A;  1Q8O A;  3AYA A;  4DUV A;  5ANQ A;  1W6O B;  3GJB A;  1JYX A;  2FMY A;  1COV 1;  3AMQ A;  1CGP A;  3KD4 A;  1VBB 2;  4XQW A;  1V6M A;  1H1I A;  2WSV A;  2W5F A;  1UKR A;  1CAV B;  1W90 A;  1POV 1;  1NXM A;  5KHK A;  3MID A;  1IQA A;  3T2O A;  1W0P A;  4AFC A;  1AYN 3;  5F39 A;  4C1W A;  5JSO A;  1OFS A;  1RVF 2;  3RZH A;  5FZG A;  3B9C A;  2E7T A;  4O65 A;  4WVM B;  5D8A B;  1ZZ6 A;  1YI9 A;  2UWB A;  3HT2 A;  3NNG A;  2J22 A;  4ISR A;  4PLN A;  5LY2 A;  5K8S A;  2FD8 A;  3K3N A;  4JTN A;  4LUL A;  5I0T A;  5HXV A;  2VNG A;  1C1L A;  3C7H A;  3O12 A;  5A3U A;  3ABZ A;  2WZR 1;  1V70 A;  1RJ8 A;  4CDQ A;  1J83 A;  3MFC A;  3VDD C;  4X6R B;  1Y9Q A;  3IKW A;  3T30 A;  4CU9 A;  1DHK B;  1PGS A;  2DUQ A;  4WM8 C;  5FLJ A;  2DYC A;  3VD7 A;  1RGS A;  1IHM A;  1O4Y A;  2ZEX A;  3POY A;  1O8P A;  2H0B A;  1NX9 A;  1AX1 A;  5C4W A;  3VBH C;  1BKZ A;  1F9K A;  3O1T A;  3CJI A;  2C4X A;  5FYY A;  2C1F A;  4NRQ A;  3VZJ A;  2W1Q A;  1C28 A;  2FHR A;  2R30 A;  1PZ7 A;  5EHD A;  1QKQ A;  2Y6J A;  5T5O A;  1AXZ A;  2WNU C;  4Q0S A;  4U36 A;  4I0B A;  2YU1 A;  4I02 A;  5EPA A;  3ZSJ A;  5CAD A;  5KWR A;  4WM7 A;  2BVB A;  2WAA A;  1VBC 3;  1RUJ 3;  1QJU 1;  2BWA A;  2E53 A;  3LAG A;  2DVF A;  5FXW A;  1AR9 1;  4KWU A;  1X50 A;  3V65 A;  2ZKL A;  2G9Z A;  3AMH A;  1JBC A;  4Y5S A;  5LA0 A;  1H6X A;  4M3C F;  1IKP A;  1W2A X;  1JZ2 A;  1MS0 A;  1OXC A;  4HT1 T;  1JUH A;  1UQX A;  3RYK A;  4BA6 A;  4DMI A;  4H2A A;  4Y1X A;  4AZZ A;  1OH3 A;  2XXZ A;  2XJT A;  3IAP A;  3NVC A;  4MGY E;  1MR5 A;  1MEC 1;  4BIF A;  4Y20 B;  3QH7 A;  4Q4Y 2;  1VBA 2;  2VOX A;  1H4H A;  1H30 A;  4S2F A;  3FHI B;  4ZS2 A;  3VHN A;  5A1L A;  4CYD A;  4OYU A;  3NST A;  3W59 A;  4BQ3 A;  2QQU A;  3VBR C;  2X09 A;  4XUQ A;  1DZQ A;  1MQT A;  1R1A 1;  2WT1 A;  1VAL A;  2GU9 A;  4KMQ A;  4CUG A;  3KT7 A;  4DRV A;  3QCW A;  3SIS A;  2R06 2;  2TNF A;  4K21 A;  5FY7 A;  2BGP A;  3VL8 A;  1VBD 2;  5T3N A;  1EAH 2;  5HCB A;  3GHM A;  4AYU A;  3O1P A;  4RSU A;  1IPK A;  1G9F A;  2OQ6 A;  3CKH A;  1JZ4 A;  2WAO A;  3GGL A;  3CZJ A;  2QQV A;  3RWK X;  1A6C A;  2J1E A;  2VOK A;  4FFF A;  4YZ4 A;  1D0G A;  2O1Q A;  4IEP A;  1GKB A;  3K4D A;  4TXW A;  3BU0 A;  4GWM A;  5EFU A;  4CCK A;  1UD1 A;  4QPG C;  5F3E A;  4CDU B;  1SBF A;  3I3M A;  1O8S A;  2RDN A;  4PHZ A;  1PGL 2;  3M3Q A;  1NCR C;  3HNY M;  1PIV 2;  3OF1 A;  4XJU A;  1W0N A;  2UUR A;  4UF0 A;  3T0A A;  5CFC A;  3MW3 A;  2BUK A;  2MEV 3;  4CEY C;  1COV 2;  2FCT A;  3AC0 A;  2QQM A;  5IK4 A;  1E57 A;  4JDO A;  2DUO A;  4Q0P A;  5HCA A;  3O0V A;  2P5B A;  1ZA7 A;  5BNO B;  2BER A;  2BPA 2;  1EY2 A;  1GP4 A;  4MVT A;  1I9R A;  3KV9 A;  2HWD 2;  4IER A;  1AL2 1;  4Y24 A;  1QDC A;  2RR1 3;  2WYF A;  3AXD A;  1RUE 3;  5E16 A;  5E1R A;  4E27 A;  1C5I A;  1W28 A;  4ONU A;  2X29 A;  5C9A A;  3TEZ A;  4RS5 B;  3AP4 A;  4FT8 A;  1QXP A;  1SG3 A;  4H14 A;  5IYY A;  1QOO A;  2W2I A;  2O14 A;  3S7I A;  3ELN A;  1W9S A;  1WLC A;  4KGQ A;  2WZR 2;  1JS9 A;  1N3Q A;  1CQ9 A;  4XF1 A;  1DGR A;  4CDX C;  2ID4 A;  1IGO A;  2WBK A;  2XLF A;  3M1H A;  4YW3 A;  5JZG C;  3AJY A;  4YPJ A;  4FP3 A;  3B02 A;  2WDB A;  4LHN A;  4C91 A;  3V0B B;  1S2E A;  4YW5 A;  3U1X A;  1XSQ A;  4XF9 A;  1H8T A;  2D40 A;  5FP3 A;  3ECQ A;  3VHP A;  2VD7 A;  2Y6L A;  1VRH 3;  3ZIW A;  3MLK A;  5C8C B;  3VL9 A;  1UY0 A;  2JG8 A;  1YFY A;  5FP7 A;  1JW6 A;  4AGR A;  3OD0 A;  4QWN A;  3AL5 A;  3K51 A;  4QKF A;  4AG4 A;  4HG6 B;  1Z78 A;  1XNB A;  3HAG A;  3S5A A;  4RN5 A;  3ZFG A;  1UWW A;  3W9A A;  3BU7 A;  2VCA A;  2VW1 A;  1AYN 1;  1KGY A;  4XJ9 A;  3THC A;  4RD7 A;  2BBV A;  2DV9 A;  3KF5 A;  1GIC A;  2BBA A;  5C33 A;  3H1W A;  5D2A A;  3ZX7 A;  2BEO A;  4JC1 A;  1AR9 2;  5FWJ A;  2FMD A;  2JDK A;  4QQO A;  4A42 A;  4CEW C;  2ZGL A;  2RJK A;  4R8H A;  1AR6 3;  2HBU A;  2JG9 B;  2WQ4 A;  3H1Y A;  4S2G A;  2Q8E A;  1DYK A;  3LEI A;  4WV8 A;  5FPL A;  1QY4 A;  4XET A;  5H9P A;  2QTW B;  1MEC 2;  2EIB A;  4AW7 A;  5LY1 A;  1LNS A;  5DDJ 2;  1WME A;  1RUG 3;  3HIF A;  4Q4W 3;  5IFP A;  2PQS A;  3GM8 A;  1D7P M;  4IET A;  1UPS A;  4XF3 A;  4B29 A;  3W5M A;  1YUD A;  5AVP A;  1VE0 A;  2VNV A;  2XGX A;  1JU3 A;  4NHL A;  2QUO A;  2VBD A;  5GAL A;  4HLT A;  1K3I A;  1R1A 2;  4QHO A;  1PK6 A;  2OXB A;  1YIP A;  1WKY A;  4I3G A;  3IMN A;  3QBQ A;  1VBC 1;  5I8T A;  4XC9 A;  5JMC A;  4NJ4 A;  1RUC 2;  3SH4 A;  1VP6 A;  1V6N A;  2R07 3;  1O5L A;  4AQT A;  2R0H A;  2MHF A;  4A6O A;  4Y5T A;  3H8O A;  3NJY A;  2JDP A;  4N7U A;  1OC1 A;  2YC4 A;  1P8J A;  2Q1M A;  4Y33 A;  4BIS A;  2WII B;  1VRB A;  2O8O A;  4JV4 A;  3R4S A;  3QH6 A;  3RJ2 X;  4IV3 B;  2CYF A;  2XJP A;  3LIH A;  3HNM A;  4OUS A;  3GBF A;  3JD7 2;  2LRP A;  4XJ8 A;  1XYN A;  3N9O A;  2KM2 A;  4A41 A;  2QQK A;  3UNP A;  3SCG A;  4K9S A;  4YWA A;  4P00 B;  3I2O A;  2VTX A;  4CDQ C;  1L7R A;  3DUI A;  4PLM A;  5DAB A;  5SV8 A;  1MAC A;  1KS4 A;  2IXK A;  3T2Q A;  4BQ2 A;  1SFP A;  3T4H B;  1JZ8 A;  4QX2 A;  1JH5 A;  1WUV A;  2P3J A;  5BUV A;  1AL2 2;  2J1U A;  2YPJ A;  5HCH A;  2R04 3;  2HWE 3;  3AYD A;  5EYY A;  4K20 A;  1W06 A;  3PJQ A;  1G6N A;  4PDW A;  3SQO A;  2W08 A;  5C4W C;  4D94 A;  2KXL A;  1ZRD A;  3CJI C;  4JGZ B;  1N1V A;  1W8T A;  4F3J A;  3MUZ 1;  4O9E A;  4NAO A;  3UGH A;  1NQJ A;  4L11 A;  3KHB A;  5EP9 A;  1E5H A;  1W9W A;  3DF0 A;  5DZE A;  4LO4 B;  1ASJ 3;  4AHY A;  3O0W A;  4Y1Z A;  1TNF A;  4XUR A;  4WM7 C;  4GAZ A;  3WDW A;  2C5D A;  4YRD A;  2W1U A;  3PME A;  4A44 A;  2VH9 A;  3RZZ A;  3ILR A;  1UMH A;  4AFA A;  3EB7 A;  4IE6 A;  4DZG A;  2MEV 1;  1QQP 2;  4LBM A;  1IS3 A;  4BLJ A;  4BQX A;  3OPZ A;  2CAU A;  2B9V A;  1UX7 A;  4AEK A;  1FOD 1;  2Q8O A;  2RR1 1;  3WDY A;  4MX3 A;  1RUE 1;  5T52 A;  3VBF A;  3IZO A;  1URX A;  1AYN 2;  1I5Z A;  3OBT A;  4XIK A;  3POG A;  5JLV A;  4XMA A;  1BK0 A;  4KBB A;  4UI9 L;  2J1T A;  4DFS A;  4YZ5 A;  1ZRI A;  2GC0 A;  3SEE A;  2OW4 A;  3T4V A;  3R0R A;  2HEW F;  4CRQ A;  4DQA A;  1MQT C;  5K0U A;  4DXZ A;  2XR4 A;  1WMX A;  1BBT 3;  3LWC A;  4GB3 3;  2WLQ A;  2CGN A;  4S2D A;  3WG2 A;  2A6V A;  4FQZ A;  2WT0 A;  4NHY A;  3EQE A;  1FV2 A;  1QHD A;  3B9I A;  3BN6 A;  1AJK A;  1QOS A;  1UN1 A;  1VRH 1;  2HWF 2;  5A33 A;  2QQI A;  3X29 B;  1O3Q A;  5CBL A;  3RGB A;  1G9B A;  5IAV A;  1LB2 A;  3AZZ A;  3B7M A;  3VBO A;  1XQN A;  3WG1 A;  4U2A A;  4W6X A;  2YGM A;  2HWC 3;  4NHM A;  1VBC 2;  5CFC C;  1HV1 A;  1J59 A;  2XVG A;  3WW1 A;  2XUE A;  1UX6 A;  1QDO A;  1Y4W A;  2HJI A;  3NRU A;  4OHY A;  4TSV A;  4HPK A;  4XBL A;  2BNM A;  5FYS A;  4HSL A;  4YVW A;  4DXR A;  1V9U 3;  2ZJC A;  3CDZ B;  3HMY A;  4GA9 A;  4KG0 A;  3FJS A;  3MW4 A;  4B7K A;  3ZOI A;  4NR1 A;  2ZX4 A;  4Q0Q A;  5FZO A;  2YC2 A;  1IPJ A;  5C9A C;  3DYO A;  5T5L A;  3C7G A;  1QF3 A;  1WW7 A;  3WW2 A;  1RUF 2;  4G9S B;  3SIT A;  5C70 A;  1YJL A;  1PO2 3;  2VMD A;  2CDO A;  4UFK A;  2ZHN A;  4CXY A;  1MPX A;  1RUG 1;  4Q4W 1;  2ARA A;  2B9U A;  5IWF A;  1GOF A;  4AFD A;  2YHJ A;  1S4C A;  3SXW A;  1MVQ A;  3AKS A;  3WW3 A;  1KJR A;  4XFB A;  4FFG A;  5IAT A;  1C5H A;  5GKA C;  1OI6 A;  1KDK A;  1VAV A;  3E5Q A;  1X8M A;  4MUV A;  5HPO A;  1T6G C;  5CNA A;  1OLQ A;  4X6Q B;  1PMI A;  3FFZ A;  2B4K A;  5I8S A;  4OI1 A;  3K4Z A;  3OUH A;  4LTA A;  1H8T C;  4ZON A;  5I0D A;  3NO8 A;  1TME 3;  2R07 1;  1TG7 A;  5LEJ A;  4HSJ A;  4EZ4 A;  5C3P A;  2JG8 C;  5CFD A;  3CIH A;  2NP0 A;  1IS4 A;  1WMD A;  1S0G A;  4E8D A;  4YZ1 A;  2UYB A;  3WDT A;  3ZFG C;  2Y34 A;  3A21 A;  1MZ6 A;  5FZ0 A;  4RQP B;  4QU2 A;  4B7E A;  2QQL A;  4P9G A;  2JIG A;  5FZF A;  1N1T A;  1QJY 3;  2JE9 A;  4OI4 A;  3MO4 A;  4Q0U A;  2GAL A;  4Y22 B;  4BK5 A;  1LAJ A;  1SFY A;  2HEY F;  2IXC A;  3RPQ A;  3RSJ A;  4K1Y A;  3NWK A;  1FOD 2;  1LR5 A;  2RR1 2;  3OG2 A;  4A2U A;  4DS0 A;  1RUE 2;  2R04 1;  2HWE 1;  4XTP A;  1ZBA 3;  2B7Y A;  1DLL A;  2PHU A;  1NQD A;  3I97 A;  4P9I A;  3SCF A;  3ETP A;  3VGI A;  5H9Q A;  3TWI A;  4C90 A;  2DUR A;  3GCW A;  1ZA4 A;  3ZPO A;  1X7N A;  3O1R A;  3VBU A;  1UYZ A;  4OQ9 A;  1DG6 A;  3UES A;  3BI3 A;  1PK6 C;  4ASK A;  1HXS 3;  1ASJ 1;  2CAV A;  2PHL A;  2WNO A;  3A22 A;  3AMM A;  3OUJ A;  1SHW B;  4YVS B;  4HVQ A;  1FXZ A;  1DZR A;  1X8E A;  4ORF A;  1VBB 3;  1SBD A;  4JKM A;  3PVO A;  2ZGT A;  4XIL A;  3I2D A;  3ZXA C;  2QQJ A;  4J6G A;  1ZVF A;  1TE1 B;  5LBB A;  1YI7 A;  3KGL A;  2HBT A;  1L3J A;  4JGY A;  4N9I A;  1DQ2 A;  1LHN A;  2YU2 A;  4LK6 A;  1G86 A;  4IW3 A;  2GSY A;  4XUO A;  4UWD A;  3VD4 A;  1JOB A;  2B5H A;  4GKY A;  1ZZ7 A;  1NZC A;  1RVF 3;  1R64 A;  3BPZ A;  4LR4 A;  1W39 A;  1S0J A;  2P3K A;  5BV6 A;  1GWL A;  4LT5 A;  3BIW E;  3WZ1 A;  1V00 A;  2PFW A;  3LA3 A;  4L2N A;  4AI9 A;  3SCH A;  2AH2 A;  1AYM 3;  2CWM A;  4AHW A;  3IT8 A;  5GLV A;  3U11 A;  1DZT A;  4K8F A;  4XDP A;  4YM0 A;  2UWA A;  2KR2 A;  1GBG A;  2WSU A;  2ZXQ A;  4L0P A;  3W21 A;  5LZ6 A;  5FYV A;  1KEX A;  4H55 A;  3TB0 A;  1HX6 A;  2XLA A;  2GNB A;  5FYT A;  4AED A;  4E4H A;  5F32 A;  3RNS A;  1UNB A;  5J1X A;  4CSW A;  3AMN A;  5CIR A;  5DAQ A;  1UO9 A;  4A7Y A;  1US2 A;  2HYX A;  4QDR A;  1BBT 1;  5L9B A;  4PDW C;  5FQ0 A;  3H8U A;  2ZPX A;  4CUC A;  2VMG A;  3FBY A;  4L9B A;  3OY8 B;  4SLI A;  4GB3 1;  4ZU5 A;  2JE8 A;  3N3H A;  1RUG 2;  4LBJ A;  4Q4W 2;  5JR7 B;  1J84 A;  5DPN A;  1CR7 A;  3BAL A;  2JDU A;  3FZ3 A;  4CP0 A;  4D8M A;  4COZ A;  1DQ0 A;  3FC0 A;  5A7P A;  1OPO A;  2UYA A;  2DVD A;  1NY7 2;  1YQC A;  2RS3 3;  2EXJ A;  1W04 A;  4LBK A;  1XNC A;  1O4Z A;  3IB3 A;  4EYU A;  4NAM A;  2HWC 1;  5JVV A;  3AFK A;  3E6D A;  5FP8 A;  1HRV 2;  3VZK A;  1A78 A;  2R07 2;  4I0A A;  3WP5 A;  1CAX A;  1GWK A;  4ARX A;  4JDN A;  3DEC A;  2Q4S A;  3KCC A;  1V9U 1;  1CPN A;  1NAE A;  3RDI A;  4Q4Y 3;  1VBA 3;  1WZX A;  1IG0 A;  5GLT A;  5T5J A;  3VBF C;  1UF2 C;  3BGA A;  1RYY A;  2XWJ B;  1O4T A;  1XXN A;  1NLR A;  4KQ7 A;  4DUX A;  3I3Q A;  3T0D A;  1AL0 G;  3MFA A;  2VUD A;  1PO2 1;  3P6B A;  1V6J A;  1GR3 A;  4AL9 A;  3J8F 3;  1GNZ A;  5F6K A;  2FDF A;  3AKQ A;  4J25 A;  2WQZ C;  3GCX A;  5IUQ A;  4COW A;  4W65 A;  1UIK A;  5K0U C;  4LBO A;  3WCR A;  4FAH A;  2D97 A;  3LDR A;  4MHR A;  1VBD 3;  1EAH 3;  1HRI 3;  2VUC A;  4QB1 A;  3HEI A;  5ABJ B;  1WCD J;  3HNB M;  1SLI A;  3T2T A;  4B4Q A;  4BE3 A;  4UXA A;  2P6C A;  2R04 2;  1VIW B;  2HWE 2;  2RVA A;  3WIN E;  4M3C E;  1CAU A;  1L7Q A;  3SC7 X;  4MGS A;  2W91 A;  3OBZ A;  4QX0 A;  1MZF A;  1F5F A;  4UOJ A;  5KHI A;  2VTX J;  3GAL A;  3B69 A;  3SLI A;  3JZV A;  2VQU A;  1TME 1;  1Q3E A;  2WZE A;  4RL7 A;  2Q8D A;  4W8J A;  1WW4 A;  2Y26 A;  3W5N A;  3OOX A;  1PIV 3;  2BGO A;  3NKG A;  3VBO C;  4FI9 A;  1BYH A;  2R6Q A;  4FOV A;  4JTO A;  1COV 3;  1UMZ A;  1JZ5 A;  1K5J A;  4LNV A;  3ALQ A;  4QQP A;  5HCF A;  2HWD 3;  4HN1 A;  3O1U A;  1Q8Q A;  4PF5 A;  3WDU A;  4YVW C;  1QJY 1;  2DFB A;  3DYP A;  3TRS B;  4ATF A;  1U5I A;  3LCP A;  3NV2 A;  4B8E A;  1B35 B;  2YRO A;  4BB3 A;  4XFI A;  1UZW A;  4CP1 A;  3NNM A;  1PX3 A;  3BVC A;  1ZBA 1;  5EV7 A;  2XOM A;  1W2U A;  4F7Z A;  4QU1 A;  1NCQ A;  2W87 A;  2VCB A;  2BDR A;  2XKO A;  1LHO A;  5LCW L;  4QT6 A;  3H3Z A;  4NPR A;  4E4D X;  4ZKT B;  3ITQ A;  3HR9 A;  3SH3 A;  3RI8 A;  5B4X A;  2O0O A;  3E5X A;  4GIQ A;  4NWW A;  4PIY A;  1HXS 1;  4DO0 A;  1ULG A;  4EWA A;  3BOW A;  4GWI A;  1BBT 2;  3T09 A;  2SLI A;  5B2G B;  1B09 A;  4IDZ A;  4XUT A;  2LW8 A;  1AXK A;  3RI9 A;  3WNL A;  4EQV A;  2Y6G A;  2JIJ A;  4MYE A;  4CA9 A;  4AAP A;  2VQT A;  1H1M A;  4DIQ A;  5CFD C;  2OS2 A;  2W52 A;  4FOW A;  3LDB A;  5FLH A;  1RVF 1;  3L9J T; 
#chains in the Genus database with same CATH homology
 2QQV A;  1Y4W A;  3RWK X;  2ADD A;  3PIG A;  1ST8 A;  1Y9G A;  3UGG A;  4AZZ A;  1UYP A;  4FFF A;  4UFH A;  3LEM A;  4CCD A;  2OXB A;  3KF5 A;  4JQT A;  5FIX A;  3OSD A;  4FFI A;  4UFL A;  4UFI A;  3LFI A;  4UFM A;  5FMC A;  3ZR6 A;  2AEY A;  2XQR A;  2AEZ A;  4CCE A;  2AC1 A;  3UGF A;  4HXC A;  3H3L A;  4B1M A;  2QQW A;  3LDK A;  1W2T A;  2QQU A;  3HBK A;  3NMB A;  3LDR A;  4UFK A;  5ANN A;  5FK8 A;  3ZR5 A;  4B1L A;  1Y9M A;  3KF3 A;  3PIJ A;  4EQV A;  3U1X A;  5FK7 A;  3S5Q A;  3U75 A;  3UGH A;  4QHZ A;  5FKC A;  4FFG A;  5FMD A;  5FKB A;  3LF7 A;  3SC7 X;  4CCC A;  3LIG A;  3LIH A;  2ADE A;  5FMB A;  3U14 A;  4UFJ A;  4FFH A;  3IMM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...