4B1LA

Carbohydrate binding module cbm66 from bacillus subtilis
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
162
structure length
162
Chain Sequence
b'TPFMSNMTGWTTVNGTWADTIEGKQGRSDGDSFILSSASGSDFTYESDITIKDGNGRGAGALMFRSDKDAKNGYLANVDAKHDLVKFFKFENGAASVIAEYKTPIDVNKKYHLKTEAEGDRFKIYLDDRLVIDAHDSVFSEGQFGLNVWDATAVFQNVTKES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LEVANASE
publication title How Nature Can Exploit Nonspecific Catalytic and Carbohydrate Binding Modules to Create Enzymatic Specificity
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 40
structure length 162
sequence length 162
ec nomenclature ec 3.2.1.80: Fructan beta-fructosidase.
pdb deposition date 2012-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 4b1lA00
2QQUA 2OXBA 4JQTA 3UGGA 4FFHA 4QHZA 4CCEA 5FMBA 4HXCA 4CCCA 3H3LA 3UGFA 3ZR6A 3SC7X 2AEYA 3HBKA 1W2TA 1ST8A 3UGHA 2XQRA 3LF7A 3PIJA 3KF5A 3LIHA 3S5QA 1Y9GA 5FK8A 5FK7A 1Y9MA 4UFJA 4UFKA 3LEMA 4UFHA 4FFFA 4UFIA 2QQWA 3LDRA 5FMDA 4UFMA 3U1XA 3U75A 4AZZA 3LFIA 2AEZA 3PIGA 3U14A 4FFGA 5FKCA 4FFIA 3ZR5A 2AC1A 5FIXA 2QQVA 3OSDA 5ANNA 4B1LA 1UYPA 3KF3A 5FMCA 4EQVA 5FKBA 3RWKX 2ADEA 2ADDA 3LIGA 3NMBA 4UFLA 3LDKA 1Y4WA 4CCDA 4B1MA 3IMMA
chains in the Genus database with same CATH superfamily
4FOYA 1EYBA 3ZXFA 5LBFA 1BKZA 4ZZ8A 2YHJA 4YW4A 5A6YA 5F6KA 2WYSA 5C33A 1OKQA 4ET7A 1ZRCA 1KXGA 1MS9A 4IE5A 2P3YA 5LA1A 5A3TA 2J1EA 1G86A 2PA7A 3Q9OA 4LE4A 5DQ0A 4KMQA 2E33A 4LO5B 5LATA 2PELA 3TEZA 3H0OA 1W03A 1ZM1A 2A6YA 4XIKA 1XSQA 1LHWA 4WV8A 4BQYA 4YLZA 3TB0A 2RHPA 4L11A 4EN6B 4XF1A 1F4AA 2LROA 4IEXA 1V9U3 2EICA 3MLLA 2QUOA 3VD4A 3S6PA 5B4XA 2VOKA 5DAWA 4YVSB 4YARA 3SNMA 2HBUA 4BOWA 4FCAA 2PQQA 3CLPA 1SPPB 4OVEA 3VGIA 5B2GB 5C6CA 5FWEA 1WUVA 1YQ8A 4CUAA 5A32A 2VTXA 3SISA 4CVUA 3MYXA 1W8ZA 1W8OA 4CP9B 4NWVA 3POEA 4U36A 4FT8A 1C1FA 1V6KA 3GHNA 5FDBA 4H3WA 1XE8A 3I3EA 2JKXA 1DU3D 3D4KA 2WC2A 4FP2A 2H6BA 3N7MA 1SBFA 3WY6A 2K46A 1OH3A 4UFHA 2ZGTA 2D6OX 4XFBA 4FQ4A 5FZDA 4UW3A 4IEQA 2RS11 5ABJB 4XBLA 2Y0IA 4AFCA 2P6HA 3WNPA 3WF1A 1XYNA 3R4DB 4LK6A 1YNAA 2XOMA 2JG9B 2P3IA 1W2OA 1JW6A 5ACA3 2RR11 1NCQB 2V5DA 4NIIA 1IKPA 1HV0A 1QQP3 3MPPG 4YVWC 4XACA 2VNGA 4NJ4A 2XR4A 3W20A 2VJXA 1H8TA 1AR81 5KC5A 3UJOA 5C8CA 2XUMA 3M7AA 2C9KA 1UY2A 3AM2A 5FPAA 5GLZA 1OC1A 3EHKA 1S0JA 4Y4RA 2W08A 4FFIA 1BVVA 1EAH2 3DN7A 4AL9A 5FUNA 4L8QA 3ACIA 5A70A 1WBFA 2YY1A 2ZBJA 1YWKA 2D6NA 1DCSA 3LGRA 2E32A 1CD3G 5E16A 2IXLA 2D7FA 4RGGA 3USUA 3FLTA 5FZHA 3V0BA 3FE5A 3RSJA 2ZOEB 3UT0A 1F31A 1R1ZA 1UOGA 2D43A 1UKGA 3KHBA 1PNGA 2J1AA 1NLRA 4YM1A 3ES4A 4LE3A 4ES9A 2Y6GA 1LULA 1NLQA 2HWF3 5I0UA 4B3NA 3OD4A 1QXJA 1BBT1 5JI9A 4PBOA 3LEMA 2BU9A 2VZQA 1KS5A 2QVSB 3IPVA 4XJ8A 1PVC3 4Q0VA 3O1UA 1JODA 4EYUA 4PCRA 5KXCA 2JD9A 3GM8A 5JXIA 2UYAA 4Q29A 2DYCA 3LIGA 4PI0A 2LW8A 2KA3A 5LASA 4LO8A 5FCCA 4KNCA 2IVIB 5FPVA 4A41A 4NPRA 2JD4A 1FMD2 3N3HA 4LOTA 4DUVA 5DG2A 3LD8A 1CN1A 4CSWA 1AYN3 1AZDA 3MFAA 1R092 1HDKA 1N1TA 2HWE2 3VHNA 2VZVA 3Q8EA 2JDUA 2V72A 4BE3A 5FUPA 2JX9A 1STMA 4CDWA 4E2SA 5JMOA 4K1ZA 2JKBA 3RS6A 3VUOA 2K9ZA 5F5IA 3ZDVA 4P5HA 4QX1A 4XDOA 4FAHA 2IVJA 1PO12 3DCQA 4ZXEA 2XUEA 4FPYA 5FKCA 3ROUA 4EJRA 1WMXA 2FZ2A 1TEIA 3AK0A 3AMMA 2Y34A 1W9SA 5I91A 4PIZA 4V2VA 4UAPA 2Q5TA 1UYZA 1KS4A 1W6NB 1OA2A 2QTWB 3R05A 1VBD3 4PF1A 5FQ0B 1NA1A 3IB3A 1PO21 4MX3A 4YVWB 1N1SA 4M3CB 1XNCA 1UZWA 1IS6A 3OEAA 2PLV1 3JBG2 1AR91 5EJZB 4DRRA 1UOFA 1ZBA1 4FPFA 2XJUA 3AXDA 5L7OC 4RL7A 1W2NA 2Q8DA 2TNFA 4RYDA 3UETA 4FAGA 5J7MA 1H9PA 1QJZA 2JE8A 5FYIA 3KSCA 2RS52 3POYA 5I0DA 4FPEA 1TE1B 5LW9A 4Q1PA 1DYKA 5I8SA 1WD3A 4Q4W3 3HQUA 4IE7A 4R8HA 5DDJ2 1AYM3 4JDMA 1GP6A 2C4XA 1VB2A 2WKKA 4QAWA 5F5CA 5JR7B 5L9RA 1BVP1 1LRHA 4KWLA 2F4PA 2RDSA 2ENRA 5FMOS 4Q4X1 5T5PA 3C8XA 5KHGA 1V6MA 5FXWA 2OUHA 4Y22B 5D1IA 2RJ2A 3N9QA 3FZ3A 3A21A 1MZ6A 4LBKA 3ZFFA 4UW5A 5C3OA 4AGVA 2H0VA 3EB7A 2ARBA 2YV8A 3M3CA 4MLOA 5A7OA 5JXHA 5FXZA 4YZ3A 1NUKA 2EF6A 2CDPA 2HWB3 3URFA 3HN3A 1OH4A 3J7MA 5FFOC 4PHZA 3AYEA 3JB8A 3WG4A 1F35A 3DUIA 3LPFA 5JR2A 2VGDA 3ACLA 3LEIA 3VZOA 3LDKA 5H9PA 4AXOA 5C4WC 5FPZA 1SQ4A 4MHRA 4YM0A 1RUD2 1IS5A 4F83A 4R9DA 1ODNA 4I09A 4YVSA 2MNGA 3SCGA 3ZSJA 1SPPA 3J4UH 1YFXA 5A7QA 4MVTA 1RUE2 2QJVA 3UESA 5A1LA 4FPCA 5FY5A 3O1OA 3EXUA 2R0HA 4MGQA 2BVBA 2WAOA 1VMHA 2VUAA 3K77A 3NNLA 3N9MA 2D6LX 4H2AA 5EYYA 4BQ5A 1ENXA 3D0SA 4IXLA 2YBKA 3ZMNA 2FDKA 2YB7A 2RDRA 2XXZA 4B8EA 4ZU7A 1S55A 2DCZA 5IAVA 3QH6A 4RHV2 4CP0A 1V9U1 5IVCA 3QCWA 3ZVXA 4QQPA 2PYTA 5FZ8A 1AL0G 3KGLA 1PIV2 2A3YA 1J3PA 1WWYA 5ABJA 1LAJA 4IDZA 2P3KA 5L7OB 1DF0A 3FMGA 4Y1XA 4QX8A 5LK5A 1JZ5A 2O8OA 3BIWE 4QD2A 2R1BA 2JG9A 1G9CA 3AC0A 3AMNA 5JVVA 2WA4A 4Q2FA 3OGGA 3VD7A 3AMHA 4XUNA 3I2KA 5IVBA 1BCXA 2ZX4A 2Q1FA 1PNFA 1WLCA 4KWUA 5C9AC 3L9JT 1J83A 4IV3C 2WT2A 2ZMNA 3WINE 1JBCA 2DVDA 3SITA 4XAAA 2FD8A 2QBXA 5GLUA 5IJRA 2QZ3A 3I2IA 1YEWA 2NMOA 2WSUA 2HWC3 2WO1A 2KXLA 2IXKA 3PURA 1JMUB 3VBHC 5ACA1 1POQA 3NJXA 3JZVA 1V00A 1YC61 3LE0A 3G7DA 2F17A 2YROA 3GF6A 1QQP1 4AGGA 1I5PA 4N90A 2E31A 4LORA 3POSA 5FZMA 3ZYRA 4ASMB 3ECQA 4ATFA 1QOTA 2VZSA 1G9BA 1W8NA 4ORFA 1OHFA 2HJIA 5FYCA 1S2EA 3TRSB 3GALA 4XTPA 3DPRC 1W8UA 2E6VA 5K8SA 2XJQA 4WZCA 5C4WB 4IE4A 2JDPA 2OZ6A 1OUXA 2RM23 5DUXA 3O1VA 4GIQA 5CB7A 4RS5C 4CCOA 2FDJA 2B4KA 3T4VA 1QHDA 4Y33A 2VAUA 4GKXA 4NRPA 5E1RA 1FOD3 2XBO3 1QWRA 1U12A 3B00A 3VB9A 4NIHA 4YFWA 4D7YA 4DY3A 2GMEA 3ZXKA 2WUHA 2ZXQA 5GZCA 2QCSB 1ZBE1 2V09A 5DUWA 5FLJA 4QB1A 1W28A 2HWF1 3E6CC 4EN9B 2RE9A 3NRUA 1OVPA 4GWMA 1C5HA 4K1YA 5T5LA 3EYPA 1PVC1 2EXHA 4EWAA 1UU4A 2YDEA 5JXJA 5ANNA 1NG0A 3O1PA 3A4UA 1HXS3 1TZOA 4KG0A 3RWKX 1E5IA 4CCDA 3CMGA 2VG9A 4OCTA 2ET1A 3I8TA 3C7GA 4XIOA 5FP9A 3D5OA 1UX7A 3WCRA 2VTFA 3GBWA 4Y5Z0 1RINA 1SDWA 1XBFA 4CCJA 1W6NA 2Z69A 5FQ0A 4NHXA 3IAPA 4YVWA 1AYN1 4NN0A 4M3CA 5A7PA 3M2MA 1GQGA 5JIUA 4JVAA 3S0MA 1Z7S3 1J3QA 1ZVFA 4HK8A 5C9AB 3MV11 1CZTA 2ZGQA 4IV3B 3I2HA 4OMDA 1XNKA 4HKLA 3VD5A 4ZKTB 3O1MA 5HV4A 5FUIA 3JQXA 5J36A 4K3UA 4JV4A 2IUWA 3ZR5A 1L7LA 1W39A 4P14A 2XHNA 2PHRA 4FBFA 2VW0A 1SBDA 2VZ3A 3FHQA 1GWLA 4B7EA 1EV12 1OD5A 3VBHB 3RZGA 3TEXA 2WLPA 4UFLA 3HD8B 5A1FA 3K75B 3OG2A 4WVMB 4OI2A 4PQ9A 1LJ7A 3N36A 3CF6E 3RMYA 3VDDC 2HEWF 3SC7X 5IFPA 4XW3A 4E8DA 2VO5A 4MGYE 2C6SA 4J1XA 1R1A1 4CZSA 3PUIA 4BCUA 2D5FA 3P3PA 1DIWA 4Y22A 2PHLA 1RUJ2 3DPRB 4XJAA 1YI7A 4UI9L 5FZAA 4PQQA 4HMZA 5FLHA 1RMU2 3BTXA 2VBPA 2JENA 3U14A 3PMSA 4RS5B 3MUZ1 3JD73 2W9XA 1X9TA 1AYM1 3LA3A 2Q1ZB 4ONUA 1LOBA 1W6MB 4YG6A 3I49A 1DFQA 2RDNA 2ZMLA 5HCBA 4MSVA 5IATA 1OSGA 3WF2A 2GC2A 4N53C 4I01A 3SMHA 3ZFFC 3VBRA 5C71A 1UZZA 3HMYA 5KXEA 3U11A 3BVCA 1W2UA 2EAKA 5DN2A 5KHHA 4COUA 1RJ8A 5FYYA 1VBC3 4UFKA 2R16A 2PQSA 5KC6A 4XHXA 2VMCA 4N9IA 3AKPA 2ZCWA 3V0AB 1DQ6A 3KHCA 1AJOA 1ZBA2 1UY4A 2CWSA 2FDIA 1LU1A 1GICA 1AL23 2ADDA 2YPDA 2ZZQA 4YM2A 5ANQA 5F3EA 4LXLA 4YW2A 1GV9A 3LSEA 5CVRA 3OOXA 4S2HA 5FZEA 5KR7A 1B35C 3S57A 5HCAA 2GNDA 2Y6HA 1HB3A 1ZZ9A 1NYWA 3NAPC 3PTRB 1QU0A 4N7IA 1WW4A 1W06A 4BISA 1OKOA 2XQRA 3MDPA 5KHKA 4XE9A 3D6EA 1KDKA 4PT6A 1UKRA 3PJYA 1HB4A 5EV7A 4A45A 1OMIA 4W6WA 2DBIA 4XBQA 3O7OA 3A22A 4AVSA 4FOQA 2DCYA 4QPWA 3OF1A 1XNTA 4KWKA 4C1XA 5BY5A 1UMHA 4XF9A 5C3RA 1W2AX 3ASIA 4XZUG 5HCHA 2GDFA 2QQPA 3VDDB 2DCKA 4NAMA 2F6BA 3PUSA 3G6JB 2W5FA 3I54A 3RG0A 4XPVA 2VVEA 5AFBA 3K48A 3L2HA 3FFQA 1Q43A 1GOFA 3PDQA 1RUH3 1LHNA 1UZ0A 3HWJA 1XNDA 3I2JA 3BCWA 4QX0A 3WP4A 3GGLA 1WCDJ 3SH4A 2PFWA 4Q26A 5T5JA 3LDRA 1QF3A 4WVVA 2WA3A 3HT1A 1UU5A 3DL3A 4IERA 5HV0A 3RMXA 2XG3A 2XKPA 5LRSA 2WR9A 2CTVA 4P9XA 4K40A 1HRV1 1UZYA 2WZEA 5BPXA 5A3LA 3CDZB 1OF4A 3E5QA 3SXWA 4B29A 4NIGA 5K7PA 5BNQA 3ZOIA 4N53B 2AUYA 2XJSA 5GLTA 1GSLA 3AP4A 3ZFFB 2VE1A 2HWC1 5C4WA 1X36A 1DGRA 3MF9A 1LENA 5T3NA 3BU7A 2CGNA 1WA4A 3B7MA 4ISRA 4AAXA 4H7MA 4ARYA 3S5QA 5KHJA 4JHTA 3PVNA 5GLWA 3KM5A 4AGRA 5CBLA 2Y38A 3NJVA 1G9AA 4X8NA 3T1LA 2JDYA 1LEMA 3MUY1 1SZBA 4CXWA 3R6SA 1E5SA 4JCKA 4DUXA 2BDRA 3GHMA 3MIGA 4QX3A 3OBZA 5A7WA 5FZFA 3ETPA 4E4HA 1VE0A 1NE4A 1LGCA 1QXRA 1NKGA 5C7GA 4E9KA 3WHUA 1UW8A 2RM21 2B46X 1ULEA 2YYOA 3LA2A 3VKFC 2P4EA 3N7JA 4SBVA 3NNJA 2LUWA 3ZSKA 4CCEA 4GMP0 1VRBA 1QJFA 1FOD1 2XBO1 4C90A 3V65A 4NHKA 3KT1A 4BPZA 2BVVA 3T08A 1G6NA 1PGL1 4QQHA 1EUTA 1SLBA 2JDNA 3GZEA 2DU1A 1XNBA 3FBMA 2XVGA 5FZ3A 4TZDA 1DZQA 4GB31 2JEMA 5D21A 3I3BA 3O0VA 1SG3A 4H7LA 1ZRRA 5FPUA 1ALYA 1NX9A 5GZGA 5IVJA 1HN0A 4XURA 4IV3A 3B69A 2VU9A 3B93A 3GJBA 4QXKA 4XVHA 4EN7B 1RUG2 3IAQA 1HXS1 5HXVA 3WW1A 1TVGA 2ORXA 4KL1A 4RFT0 1MEC3 3SKJE 3TN92 3ZN5A 4G3YC 3FX3A 4F7ZA 4AFAA 5FY7A 1MACA 2OZJA 3J7HA 4XCAA 3VBHA 3GYDA 5CFDC 4QKBA 5I0RA 4WVMA 3GZUC 3X29B 1YQ2A 4DUWA 1XYPA 2W39A 3WX5A 2D98A 1RVF3 3KV4A 5JOWA 5CNAA 3IN9A 2BYVE 4DS0A 3M4FA 2BJSA 2VTXJ 1Z7S1 4X6QB 5IVFA 4L97A 5C3SA 4G9SB 2MEV3 2OUJA 2ZZJA 1VBA3 4BXSV 5JZGC 2XLGA 5EJ1B 3A7QA 2VNRA 4PDWC 1HRI2 2MPFA 3DPRA 4TYSA 2IXIA 1WMDA 3R4UA 3I2DA 4WVZA 1MS4A 1IGOA 1O3TA 3C7HA 3B3QE 1D0HA 4BK4A 4RS5A 4Y26A 1PO23 2XDVA 5FZ0A 5FY0A 2ZEXA 2BOIA 3ILFA 5D8AC 4BMEA 2PLV3 4CCMA 4FPLA 5DAXA 2BNMA 3UNPA 3OPZA 4R9CA 1HN1A 3H7YA 3ZN6B 1W6MA 2YBPA 5DAVA 2YGLA 1COV3 3KF5A 4HZFA 1SLAA 1VMJA 4OHVA 4XUQA 4Z07A 3GXUA 5J3UA 4S2DA 3VLBB 5IK7A 5JSRA 2GNMA 2PAEA 5TSWA 5G05L 2ZKNA 3T0DA 1OOPC 3ENRA 1Y3TA 4FFGA 2XONA 5F6LB 3N9OA 4JGZC 4D69A 5EWSA 1WLWA 3OEBA 1J3RA 4QKFA 1BQPA 1C8M2 2EAAA 2RS31 4QPYA 1I9RA 1QH7A 4I2OA 4DXZA 3C7OA 3NQHA 1AYN2 4AAPA 3I7DA 1N1YA 4PJYA 4BIFA 5DAQA 2R063 4FPJA 4TN7A 3T1MA 3V0AA 1H4GA 4AVVA 1LESA 1DGRN 5HXMA 1V6JA 1JOBA 1S2BA 3OPTA 4CUGA 2XQXA 3FLPA 3N35A 3D3AA 5CG8A 2YXSA 3W9AA 3TEWA 1T2XA 1W6OB 2BTVC 2YG0A 5FRAA 3AJYA 3SKVA 1T6BX 3PUHA 5AFEA 1MPXA 2OPWA 5IK5A 3RI9A 1C4RA 4XXAA 1JH5A 5FY1A 5B4NA 1ODMA 4XJ9A 1VBD2 3VZMA 2FMYA 1ZZ8A 1MR5A 1S0GA 1H2MA 1VBB2 4LA3A 3RYPA 3ZFGC 2ZGPA 5CFCC 1X33A 2ZAAA 3RVHA 3I2FA 1GQHA 1AL21 1HQWA 4CEYC 5CFDB 4XMIA 5BNNC 4HSLA 1QXPA 1KJRA 4L0PA 1RXGA 4CU9A 4FOWA 5LBEA 4B4QA 2OYZA 3H3UA 4Q4W2 5H9QA 2QQOA 5A7NA 3VDDA 3MPBA 4JTOA 1GOGA 2Q8OA 3T30A 2TEPA 4NIAA 5JZGB 1QKQA 1IPJA 2Y0OA 1UOJA 4ASKA 3RZHA 5L9BA 3ST7A 4ES8A 4PDWB 4OMCA 4NAOA 1QJY3 2ZGRA 4FP3A 5FZGA 4IEWA 1Q56A 3H9AA 4P9YA 5EHDA 1AXKA 1YHFA 2HEYF 2G9FA 2C9AA 2YC0A 1E5RA 5FIXA 1KRIA 1XU1A 5T50A 4MGTA 5HCFA 1FI2A 5D8AB 1JHNA 4FPGA 4MZUA 3IMMA 3PHMA 1X7NA 1LODA 2FBEA 1XJAA 1SLCA 4RSUA 4M3CF 4GQ7A 2DBNA 1PGW2 1RC6A 1ENSA 3DYPA 3OGSA 4XF4A 5A3WA 3WDUA 5E89A 1RUC1 3FJSA 4N53A 4CDXB 1G9DA 3VDBA 3AZVA 5FZ1A 1OI6A 2HWB2 1RHI3 2VOXA 3LWCA 4NR1A 2DDUA 4WVWA 1OLMA 1DLCA 3WNKA 4A7ZA 1VBE1 3EJKA 1OOPB 3K4ZA 2P2KA 4ZS2A 4CXYA 1RUH1 3WG3A 4JGZB 1AX1A 2FHRA 1J59A 4CEWC 5GKAC 3NKGA 3D82A 1REEA 1DG6A 2B8MA 4AVBA 4OI1A 5C5UA 1UMZA 3RZZA 3LSDA 1AVBA 2P37A 4J6GA 1FPN3 2VVDA 2JDMA 4EZ4A 1JYIA 3S30A 1Q5OA 3ZXDA 4CDQC 4FTBA 4HN0A 3OGRA 1UXXX 4F3JA 4RQPC 4DXSA 1IPKA 1VR3A 5I0TA 2C5DA 4XZPA 1K45A 2HLEA 4NHLA 3BTZA 4LJHA 2Q8EA 3FL7A 3NL1A 4JGYC 3F2ZA 4P02B 1UAIA 1YI9A 1YXWA 2WSVA 5F9TA 3J8F3 4GWIA 1MS5A 2OIIA 5F3GA 1SFYA 3ZFGB 5CFCB 2AENA 2D93A 4XDQA 1MVEA 4YWAA 4BHPA 1BJQA 1U5IA 4Y24A 4CEYB 1NY71 4DO0A 1OT5A 5BNNB 2ZGSA 4E4ZA 4Z82A 4XF0A 4AW7A 2J1SA 5FY4A 2G19A 2V4VA 1AR61 2VQUA 1URXA 2OVUA 1IHMA 4GWJA 4Q0QA 4JDOA 1RL3A 5FTTC 5A6QA 2J42A 2D44A 2GP5A 4YZ1A 2ARCA 2L9LA 3RPQA 2HWD2 3U0ZA 2ZMKA 1KFXL 1ZBE3 2GSYA 4QXHA 1Y9MA 1XU2A 5EJ3A 5L9VA 2FZ1A 1ZZBA 3BOPA 4NMIA 5F2SA 2G4IA 4MV2A 3ZDSA 5F2WA 2HWC2 1GZWB 3WG2A 2DUQA 1X9PA 5FZ7A 4GH4C 5IW0A 4TSVA 1KJLA 4Q4V2 4YGBA 3WF0A 4EROA 3NO8A 1EY2A 1UQXA 1VRH3 2VD7A 4AI8A 1GFF2 1Y43B 1MEC1 4Y20B 5T52A 4DEQA 2WDBA 4K9SA 4INDA 1W2TA 1GZCA 1ZNPA 2I2SA 1LNSA 1BMV1 1YFWA 2BGPA 4PI2A 1YQCA 4CEWB 5A3UA 4OUEA 1ULFA 1RUOA 5FK7A 3WW2A 1RVF1 4UFJA 2RM22 3SCFA 5LY1A 3ZN6A 3VKLA 3I2OA 3KQ4B 5JPMB 2C1FA 2WNUC 1OFNA 1WW7A 1CZVA 2MEV1 1MQTC 1VBA1 1VMFA 2VW1A 3VBOC 2NM1A 3AKSA 4CDQB 4XQ4A 4Y5SA 4ZU5A 4XUOA 5L36A 4I30A 1RJ7A 2VMHA 4RQPB 4NE9A 1V6NA 4YPJA 4B1MA 4DEVA 1I1EA 2WWJA 4JRLA 2IWGB 2BOJA 4NPMA 2VH9A 2WWSA 4BQ4A 4GAZA 4JGYB 4D6RA 1RUI1 1G9FA 5FZBA 1R1A3 5DUUA 1Y7BA 2DUOA 4XAEA 1COV1 1BK1A 1UXZA 4HBNA 4M01A 2WAAA 1YCIA 3ACFA 4JTNA 2R042 4V1PA 1L7RA 1BEV1 1QOOA 1XB9A 1SDDB 4E8CA 2RMU3 5BNPC 3ZN4A 4RGAA 1PMJX 4I0WB 4FOVA 5FYTA 1NXMA 5FXXA 4IV1C 1W6OA 3S7EA 2YFUA 1CAUB 3OUIA 4XABA 2WZR2 1QJEA 5EXOA 1OFSA 4JKLA 5F5AA 2P17A 4AQTA 1I5ZA 2YUEA 2X29A 1ND3C 1IQAA 1XE7A 2DFCA 4IGPA 4BK5A 1QNYA 5FMBA 1PMIA 1Z7S2 2R061 1I6XA 4HONA 3SEEA 4XDPA 3INAA 3SH5A 5CFDA 2PXJA 2YPJA 1NXD1 3NNFA 1JOPA 3BALA 3SHRA 1GMMA 4F8AA 2W1QA 3MEPA 3VDAA 3KGZA 2X53S 4CUCA 2LRPA 2Y33A 5JOYA 2PHDA 4AE2A 1FX5A 4LIUA 3OBRA 3L2YA 5JZGA 1PK6C 5FXVA 3MF6A 1NE6A 1PX4A 3QLQA 4PDWA 4BA6A 2ZHKA 2VMEA 1Y4WA 1MVQA 1IOAA 2ZJCA 1WLTA 1MZ5A 2CAVA 2OXBA 3VD3A 1D4M2 4XJWA 3EQEA 4CCCA 1GZTA 3DXTA 2VCBA 4EN8B 3AVRA 5I8YA 2IXJA 5D8AA 3BB6A 1FV2A 4YSFA 4GWNA 4NPLA 1RUF2 2DVAA 2R1DA 1R082 3OD0A 1SFNA 2ZGNA 1XNAA 3JD72 1O5LA 3ZXJA 4OFGA 4HG6B 2WNUB 4OHWA 3J7NA 4CDXA 1MQTB 3VBOB 4CP9A 4COYA 5J1XA 1O4TA 3OPWA 2QE3A 1QJY1 1A78A 1OOPA 3OY8B 3WDYA 3N4MA 1YQ5A 1SLIA 4JGZA 2FCTA 4KWJA 1XE0A 3LEGA 2J1UA 4D8MA 4BB3A 5DG1A 3OUHA 1H1MA 4AQ2A 1H6XA 1TNFA 2DFBA 1C3HA 1JU4A 1OBNA 1W8HA 2CSGA 2XJTA 3PVBB 1VBC2 2AEYA 4I0AA 4IESA 4Q4Y3 3TNQA 1JZ7A 1JYVA 2VUCA 4DIQA 4JQRA 2R072 3PUAA 4IEOA 2OKXA 1RHI1 2C26A 5BNPB 5FR3A 1DLLA 1E57A 1NCQA 4Y1YA 4IV1B 2DVGA 1GBGA 2VBDA 2JIJA 1AL22 4MOAA 2VZUA 3BTYA 1VP6A 4XFIA 1HQNA 3W59A 5F32A 4LBLA 1WCQA 3OTFA 1HRV3 1ND3B 3HJRA 2WN2A 4LUKA 5FOBB 2XKOA 3Q8FA 4QM8A 1FPN1 1NZIA 2WT0A 3ZFGA 3WNNA 5CFCA 4Q8LA 1KD7A 4DB5A 3W5MA 4CEYA 2Q0AA 4LQRA 4QX2A 5BNNA 1DDLA 1OLME 3NNMA 4QQ2A 5FAXA 3CKHA 2ZGKA 4I0BA 2W68A 3T2TA 3AP5A 4BQWA 1Y9QA 1F9KA 3BN6A 4CA9A 4JKKA 3AZXA 4NVPA 3KQRA 2ZTNA 1IG0A 1PX3A 2JB4A 3DGTA 1DBNA 3J8F1 1PK6B 2CYFA 1IKQA 2JJ6A 1CAVB 3A23A 3IWZA 3WVJA 1O7FA 2VCMA 2WS91 3FHAA 2HYKA 5DMYA 2XJPA 1HLCA 2DTYA 1UYPA 1HIXA 2N7GA 3DEMA 1E5HA 1Q3EA 2UY8A 5KBFA 3JUUA 1J58A 1JYWA 1W99A 3U4SA 1RB8G 3AL5A 1OQDA 1TME1 2PHWA 3AP6A 1S0EA 2ZX1A 4IEUA 3A0NA 3WNXA 1IZ3A 4QB6A 3SCHA 3LEKA 3LKJA 4MGKE 4ATEA 5FWJA 2OA2A 2QQLA 3POBA 4JKMA 4XTMA 5IWFA 3WP3A 4QU1A 1HJGA 3ETQA 1M06G 2WNVC 3ZM8A 2FDGA 2RS12 5FBZA 4NO4A 4TTGA 1OQ1A 1UYYA 1FMD3 3I59B 4Y20A 2A6WA 2Y6FA 1Q8PA 1WBLA 3MW4A 4K7JA 4MUVA 2E63A 4AEDC 4D0QA 5K0UC 2ZHLA 4QHBA 4YZ2A 2I74A 4K6BA 4GB33 3THCA 1R093 4GXLA 4NOTA 4Y4YA 1Q8SA 4HKWA 2ID4A 2FCUA 3WT3A 1H30A 1LEDA 1XSRA 4CEWA 4DXRA 5CG9A 4LBQB 4UW6A 2JXAA 2RR12 4YGEA 4A7KA 4Z8BA 1X8MA 4QDSA 3GCWA 3CO2A 1PO13 5F37A 2BUKA 4XILA 4DQAA 1JYTA 1VRH1 2W1UA 3WOGA 1AR82 2OQ7A 3THDA 1V0AA 1W9YA 2IFRA 1CR7A 4CDQA 5JI7A 5A33B 4YRDA 1SHWB 4RQPA 5FZCA 2Q8CA 2CHHA 3MICA 4ITCA 4ZONA 5FYVA 1MS1A 3RRDA 2O14A 2JICA 4UWDA 4XJUA 3JBG3 4GULA 1ASJ1 4A3ZA 3BPSA 2LTNA 5J96B 1G7YA 1HKDA 1VAVA 4UFMA 2ZX3A 4E4SA 2V4AA 4ZU4A 3TNPB 3ZLIA 4CUBA 2WFF1 3M3IA 4HL0A 4RA0A 2FDHA 2JG8C 3NNGA 5D2AA 1LB2A 2AREA 5DDJ3 1KEXA 1ACCA 2G9GA 4COWA 3KCXA 1WMEA 4OZXA 4AQ6A 5AC93 3KD4A 1CAUA 4HT1T 3M3QA 3RZLA 1RITA 1BBT2 4UBGA 3VL9A 5FYHA 2RDQA 2QQNA 1W8WA 3OGVA 4BQ1A 4EZHA 1A6CA 2WQZC 2A6ZA 4H14A 3LQCA 3POJA 1SEFA 1QEXA 2ETEA 3ZYBA 1UPIA 1U5YA 5DZEA 2RJKA 3UYJA 4UFIA 3U75A 4RN5A 2RMU1 2EIBA 3HN1A 1WA6X 2MHFA 4IGQA 4KH9A 1A3KA 4AEKA 1DQ2A 3K4AA 4OULA 4MGZE 4B1LA 4HVQA 5LWBA 1JZ3A 2RS33 1S2KA 3MIFA 5FMOL 4QPIC 3TWIA 3BKZA 1W6PB 2B45X 2UWBA 1SLLA 2KR2A 1LHUA 2YZ4A 4MH0E 4NRQA 4Z2AA 4JX0A 3AZYA 2GU9A 1TNRA 1DP0A 2K2SA 2UWAA 2WNVB 5A6ZA 1RVF2 1Z0HA 1Q8VA 1O4ZA 2WIIB 1OA4A 4W4ZA 3U37A 4Y1VA 4AI3A 2JE9A 5K0UB 2O8QA 4AEDB 2YU1A 1RUD3 4IL7A 3VBFC 4LO4B 1ENRA 4COVA 2VXJA 4LKFA 1GQPA 1POV1 1WW5A 3ORJA 1WGPA 4JDNA 5FYBA 3M8LA 2XLFA 3GCXA 3NKTA 1CZSA 1PO22 1WW6A 3UL2A 1NAEA 2WNUA 2PLV2 1MQTA 3VBOA 1AR92 1S0BA 2D3SA 4YG3A 5A3OA 1OLQA 2D40A 3E6BA 4HOOA 5A7SA 3VZNA 2XPJA 4YW3A 4OI4A 1COV2 3OY8A 2A75A 4IETA 1CONA 4HVRA 4RHV3 4Y3OA 3UGGA 3USSA 2QDRA 4GZ9A 4QKDA 3AB0A 4QKNA 2DWRA 2VNVA 4K8FA 2W95A 2A6XA 3N9LA 4WBBA 3WD5A 4KU7A 1LOGA 5L7OA 1HB1A 1FATA 4KGQA 1N47A 2JG8B 4UBHA 5FMDA 4AHWA 3AXEA 4Q4X2 4LBMA 5FO9B 5BNPA 1H4HA 5IUQA 1WCKA 4Y5TA 3H1YA 3JB4C 3LDBA 3QOPA 4IV1A 2W0XA 4N7UA 3M1HA 2WO3A 2BFUS 5JAXA 4NRMA 3RZKA 1VLNA 4XOGA 2BNOA 5FO7B 1H0BA 1BHGA 1TMF3 1G8WA 1ND3A 4W6YA 5FYSA 5GALA 2GALA 2VULA 3P1IA 4LOSA 5H9RA 4D6SA 1UN1A 2XVKA 5F3CA 1RUC3 3POGA 5JWPA 4Q4Y1 1CQ9A 5KXDA 4MXWB 2CWMA 4D7SA 4FXGB 4CU6A 2A7AA 1VBE3 2P1BA 2XJVA 4S2GA 4UYBA 2QFEA 3WZ1A 2DU0A 4QX7A 3T0BA 1CPMA 1GLHA 4W6XA 2QQWA 2JB8A 2BQPA 3JXSA 4RFRB 3LOBA 5T55A 4QPIB 5T54A 1DGWA 1CVNA 4HANA 4AFDA 4E4DX 4WM7C 3IDCB 2X09A 5K4LA 1GANA 2Y60A 1H1AA 4LHSA 3W58A 1H9WA 1CAVA 2YC2A 5LCWL 1EAH1 3GBGA 5IK8A 1DQ4A 2ZAHA 5IT6A 2GZWA 1GWMA 3VBFB 5CZKA 3HQRA 4UF0B 3QH7A 4YGCA 3WV6A 1UIKA 4DMIA 5BNOC 2Y8KA 2W46A 3ZPOA 2AZ5A 4QXBA 3ACGA 3ZYFA 2G1MA 4IE6A 4SLIA 4ZY9A 1V9U2 1LU2A 2R30A 4L2NA 4AZZA 2DCTA 2P5BA 4ZS3A 2WRAA 3WW4A 2VQ0A 3AVSA 1ULCA 1DGWX 1SACA 2IFWA 2WFPA 2E9QA 3I59A 1AX2A 1W0PA 2BWAA 5A32B 2UYBA 1W05A 5JDBA 3JCIA 2YBSA 4HN1A 4CRQA 2CL2A 4LHNA 1KQRA 3HPNA 4LR4A 4RR3C 5K9YA 4LUMA 4BLIA 1YJLA 1B35B 2B9UA 3S5AA 3CU7A 1AR63 1O59A 1LOAA 3NAPB 4KGGA 2EA7A 3I97A 1W0NA 4LBQA 4I3PA 3I3MA 3AJZA 2AACA 4Y1ZA 2O1QA 2VZ1A 2WLQA 3LZZA 1OXCA 1TQ5A 4FPHA 4WM8C 2WL1A 4KU8A 4AR2A 1UY3A 3AMPA 4QDQA 3AFKA 5A33A 1C57A 1FMD1 1OUSA 2LM3A 5FZ6A 4A6OA 5EFUA 1FPN2 3WCSA 4FFFA 1GR3A 4LBNA 1WD4A 2J22A 3BOWA 1R091 3AKTA 4EN0A 4GKYA 2HBTA 4K8RB 5ACA2 1IS3A 1QOSA 3AX4A 3BI3A 5C9AA 2CU5A 4OQ9A 3K4DA 1QQP2 1GWKA 3NMBA 4E2QA 1PO11 4M0NA 3PJQA 3WF3A 3MIBA 5JOXA 3HBZA 3WG1A 3WNLA 1EV13 3R4SA 3KLSA 3RQ0A 4BM8A 4MGIE 4HLTA 3PTYA 3FFZA 3J8F2 3WDVA 2E53A 2XL9A 2J1TA 4V2WA 5IVVA 2VXRA 3LIHA 1UIJA 1VIWB 3I2GA 4FPOB 4NHMA 1JYCA 1S4CA 1K3IA 3KB5A 5IK4A 1UF2C 3JBG1 2ZS6B 2I45A 3QD6A 2VR4A 1FXZA 4WM7B 1DQ0A 1REDA 4C91A 1MZEA 5LA0A 1LOCA 3AKRA 1RUJ3 1CESA 1WKYA 2WWUA 1N1VA 1S0DA 1W8FA 4YGDA 2BEOA 2JDKA 1S0FA 2W87A 2Z79A 5DDJ1 5LB6A 3VZKA 2CGPA 2WABA 2BP6A 2IZWA 3HNBM 5AC91 2JDHA 2EIEA 4QM9A 5BNOB 1ZBE2 5JCTA 5DPNA 3TYJA 3NV3A 1RUI3 1H2LA 2HWF2 3H8OA 1W6PA 3KVAA 3ILRA 1JS9A 1RXFA 1YJKA 2ARXA 4YW1A 3BGAA 2VZRA 3FWEA 4C1WA 3H8UA 3LF7A 1ENQA 2VZOA 5M0TA 2CNAA 1PVC2 4R9BA 1S0CA 2X5IC 1BEV3 4YZ5A 3BUCA 4AVAA 4GJYA 5K0UA 4AEDA 1W3VA 1ULDA 3N7KA 4RR3B 1OQEA 1NQDA 1QJX3 3KCCA 3KCYA 4Q5OA 2VMGA 5DZFA 1EPWA 3TBDA 1A34A 1FNYA 2VZTA 4CP2A 4XFCA 1K5MC 3RZMA 2PHUA 2WNOA 2QQUA 4W8JA 1VAKA 4WM8B 3NW4A 1FT9A 2W1WA 3UGFA 3Q8BA 3VHOA 1ZA7A 2GN7A 5JIAA 4HPKB 5A80A 3WQ0A 4TLFA 1HJFA 3KMHA 5LEKA 1R64A 4HSJA 1NZCA 2ES3A 3CZUA 4LLOA 1X50A 2A6VA 3AL6A 4Y1UA 1RUD1 1ND2C 3DECA 4W65A 2DVFA 2PTMA 5CYYA 3E97A 2LS6A 3AP7A 2VC9A 5I8TA 1VJ2A 3MO4A 3DYOA 3O1RA 2ZKLA 2BBAA 2HH9A 2JECA 4XMAA 4EV0A 1PMHX 2FDFA 2BGCA 2A1XA 1H6YA 3IKWA 3ZYIB 1D0GA 2JG8A 3BPZA 4X8PA 3K3OA 2EXIA 4AOCA 2WT1A 3WHTA 1JZ2A 2D97A 1JZ4A 1DZRA 1R1A2 4LULA 2A70A 2NYYA 3ZFEC 4A6SA 2ORZA 1GOHA 3MI8A 3K2OA 4RHV1 3NJYA 2WNEA 5CISA 1W3XA 4URAA 5AVPA 1QJU3 3VN4A 5JXGA 4JZRA 1PIV1 3IM0A 1CAWB 2NLRA 3DYMA 1UPSA 1IQDC 4YNIA 1AYM2 3WW3A 5EYXA 2Y6LA 4JAAA 4YG0A 3WUDA 3FC0A 2B39A 3OYWB 4MXWA 4QX5A 3ZYPA 2DF7A 1O91A 3OSDA 3ZPYA 2ZABA 4XUTA 1YRZA 2VQAA 5FYUA 3VKNA 5HBAA 4L9BA 2PN5A 1N3OA 4QPIA 2W92A 1D2QA 2RV9A 1N3PA 1QNWA 1BXHA 1U5ZA 1HX6A 1S1AA 2GH8A 5J09A 1JZ8A 1TMF1 4LKDA 4MADA 2D6KA 5BV6A 4P9WA 2X5IB 2VNOA 4LHKA 4LLFA 4OI0A 3RZJA 3D0JA 3AFGA 3VV1A 3CZJA 3VBFA 4UF0A 3OB8A 4EE2A 1SCSA 2OQ6A 1ULGA 1CIWA 2J7MA 3OBAA 5EPAA 3K46A 4CDUC 4XXPA 1K5MB 1PM7A 1WMFA 3FHIB 3N9PA 3HIFA 4KQ7A 4AHXA 4O7XA 3PUQA 1M4WA 2KM2A 3H3ZA 3CNAA 1ZA4A 4G4FA 4QGLA 2NQYA 4BDVB 4M4RA 3WR0A 4LKSA 1DQ5A 1O6UA 5FPLA 2QQKA 1ND2B 3HBKA 4P9JA 3CBNA 1HB2A 3SH3A 1B35A 1CAXB 1T6GC 4ZPIA 3NAPA 4P5YA 1Y9GA 2E7AA 3PU3A 2X8KA 3VDCA 2VMIA 1NCRC 4LPLA 1CPNA 1YUDA 3GJAA 4IEPA 2HKXA 2JDZA 2W2IA 4XQWA 2WS93 2XB6C 4KBZA 3LAGA 3NV4A 1CX4A 4CCNA 4OHXA 5F3IA 1K42A 2J1VA 5DUVA 3ZFEB 3AYDA 1X8EA 4Q4Y2 3RNSA 1J1LA 3HNYM 4HXCA 4BZ4A 1O8SA 1TME3 3BODA 2D6MA 4BQXA 1F15A 1V6OA 2ERFA 2Y6KA 5IVYA 3K51A 1CIYA 4IEVA 3RYRA 3VBUC 1RUG3 4YW5A 4XBNA 3E1F1 3TN93 2W47A 3WF4A 4TXWA 2BBVA 3KT4A 1H2KA 4Q0PA 1RGSA 4M4PA 3WQ1A 3QBQA 4O9GA 3P5BA 1HRV2 2VOVA 1FYUA 4AK3A 1PGSA 2J1RA 4HKOA 1NOVA 3MIDA 5FY8A 2R7EB 2AEZA 3J7LA 2PHXA 4C8DA 2B5HA 4O9EA 5KWRA 2QKDA 4IE0A 4LBOA 4J25A 2I07B 4AI2A 2NN8A 4WM7A 5F39A 3V56A 1XYOA 5FY9A 2WN3A 3A0KA 2ADEA 2GN3A 2ZEZA 4A7YA 3O12A 1VB4A 3PL0A 1XQNA 3VKMA 1AR73 1HRI3 1KITA 3H42B 2WYFA 2YGMA 4UXAA 5FJHA 2BNNA 1EV11 2EXKA 3ON7A 4GJZA 4AFBA 5C70A 3DKWA 1QIQA 5A3PA 1GNYA 1OA3A 3UV9A 3VBSC 3VKOA 5A1AA 5BNOA 4LT5A 1CJPA 4YZ4A 2W52A 3IIIA 1ASJ3 4CDUB 5ISLA 2AYHA 4E2GA 4D3WA 4Q27A 2A71A 2QQMA 3MFCA 4OLLA 1O8PA 4AHYA 4CE8A 2WFF3 5FREA 1FV3A 1UMIA 4XFGA 2GH2A 1AXYA 3PMEA 1RUJ1 3ME2A 4FO9A 3O0XA 2VBBA 1ZZCA 1FOD2 1ULOA 1LOFC 2XBO2 1RMU1 2DTWA 2GC0A 5DZGA 2P3JA 4RR3A 3WLUA 1IS4A 3VBRC 1C8M3 2PAMA 1PGL2 4QQOA 3CEWA 1YFYA 5EZWA 3T2OA 2JWPA 2Y64A 1NCRB 5FBJA 4GB32 1KDMA 5CKMA 4CTEA 2X05A 1JXNA 5LK7B 4E27A 1O3SA 2WJSA 4WM8A 5F5QA 2E51A 4DOUA 4C0HA 2W94A 4HPKA 2ET7A 1PVXA 1XRUA 3U1XA 5GM0A 1HXS2 1XPWA 3AZZA 3KV5A 3PIGA 3FN9A 1KFUL 2VMFA 4IEYA 1WCUA 3RWNA 1QJX1 1OURA 2VY0A 5SV5A 3WNOA 3AYCA 1ZZ6A 1BYHA 4IQPA 3ZSMA 4N43C 3ALQA 3VBUB 2Z4FA 4FTSA 4QQLA 3GZTB 3OUJA 1QMJA 1VBB3 1ZX5A 2VM9A 1ZYBA 4LIVA 1LKNA 1W9FA 4W50A 2ZA9A 3ILNA 4JHZA 5FP8A 3MIHA 4XYXA 5BUVA 5FYMA 3CHXA 2E7TA 1AHSA 2R49A 5F8PA 4GD4A 2HYXA 3MW2A 4YFZA 1POV3 3ZKUA 1YYNA 4GH4B 2ZGMA 2ZPXA 1VAMA 1CAWA 2HEVF 3UKVA 4AWDA 4BJ0A 1SLTA 2Z42A 4JRAA 2B7YA 4QMAA 1F5JA 4CPBA 4EWEA 4PIXA 3AMQA 3WDTA 3EO6A 3PLQA 5CA6A 3D8CA 3OYWA 2YC4A 4WZFA 2O0OA 3I4IA 4AI0A 4NUBA 5H9SA 5JMCA 1MZFA 4BH9A 2P34A 5C8WA 1ZRIA 4NIDA 3VBSB 2LALA 4BQ3A 4A44A 3H8RA 4AFMA 5LRRA 1LECA 1D2SA 3UGHA 3PIJA 1QJU1 4R9AA 3H7JA 3IT8A 4LITA 5A3MA 3NJZA 5LA2A 3ZXLA 1UY1A 1SFPA 2WO7A 1S0IA 2RS32 4RGKA 5GZFA 3ZYHA 4BWOA 5KHIA 2X5IA 1CX1A 1LR5A 2GC3A 4YYOA 2A5ZA 1L3JA 4D7TA 3MW3A 1W90A 3N7LA 3PU8A 4I02A 1OPMA 1H8VA 1F5FA 5L19A 1GKBA 5FZOB 3RFRA 2AR6A 1GYKA 3VBRB 5LA9A 4UOJA 1EUUA 4P08A 2ZACA 2PHTA 2V5YA 4OHYA 1QDCA 1K5MA 4FSJA 2WZPP 1U5XA 1X82A 3CJIC 1Q8OA 1FNZA 2FMDA 4IUGA 3THTA 3ZXGA 3KV6A 2D3RA 2A73B 4EWDA 3WUCA 4CXXA 2QNKA 5FK8A 5LBCA 1LTEA 3ES1A 1HV1A 4PIYA 1ND2A 2NP0A 1LGBA 2E7QA 3ACHA 5FLIA 1YQ6A 4ASLA 1CAXA 3LFIA 4AHZA 4META 4FVVA 4M00A 4N43B 2JIGA 2JDAA 4ZXKA 4QGMA 5I0SA 4XQDA 1XXNA 2WQ8A 5FZ4A 1EAH3 2CY6A 3WEZA 5JUVA 5JSOA 1DYPA 3KV9A 5J98B 3T3YA 1KGYA 3ZFEA 1D4VB 3C3VA 3SEPA 1RTVA 3IBMA 3RYKA 3WDWA 5A3NA 5A6XA 2UY9A 4K21A 4P00B 1REFA 2BV4A 1BLZA 1Q8QA 3EMRA 2DURA 3T2PA 2ZX2A 1YIPA 1GNZA 2HWD3 1VALA 2OX0A 1QY4A 4LK7A 1WCSA 3B9CA 4XUPA 1C1LA 1UU6A 4PLMA 1TMF2 1YIFA 2OS2A 5EP9A 3RGBA 4PLNA 4BYYA 5AVAA 2SLIA 5FKBA 3WQ7A 1RUC2 5FYZA 5JPNB 2ZGUA 1P8JA 1XOYA 1CWPA 1GZWA 1C8NA 4Q4V3 5F7UA 1VBE2 3P6BA 4MXVA 4BU2A 5CKNA 4DPNA 1POV0 1RUH2 1EPZA 1H1IA 1RUG1 2CV6A 1JU3A 2PAKA 3CIHA 4R4ZA 5BXXA 3U4XA 1W0OA 3DF0A 3TN91 4AI9A 5CEHA 2JE7A 4LBJA 4DNYA 3APBA 4LBQD 3RDIA 1B09A 2VMDA 1XC6A 3LA7A 3CJXA 3MGUA 2DV9A 2F4LA 3POIA 3ABZA 3WDXA 2HWE3 3TAYA 2EIGA 2EVXA 3WP5A 2VPVA 4CDUA 3H1MA 4RD7A 4XETA 4U2AA 3RJRA 3CL1A 3CJIB 2BPA2 1UCXA 2DCJA 4QPGC 4QWNA 4UT5A 4XF3A 4JQTA 3ITQA 3POWA 2P6CA 1AR71 1HRI1 4NROA 2ZX0A 3H3LA 4HFSA 5CU1A 2NMNA 2D5HA 3ELNA 4LO6B 4XCBA 2TUNA 3UKTA 4LNVA 5A7WB 1YO8A 3NWKA 1QDOA 2IXCA 3E5UA 3N9NA 2EXJA 4J1WA 1W9WA 4CU8A 5EIYB 4JGYA 1NY72 4HETA 1A8MA 1K5JA 1NCRA 1DZTA 1AR62 2XJRA 4NHYA 2R043 4YW7A 4AYUA 2RS53 2XMLA 1F8VA 2UURA 1W6QB 4OZOA 4QXCA 2H0BA 4YW6A 1GNHA 2R32A 2ZHMA 4KBBA 3E5XA 2WZR3 3MLKA 3Q8AA 4N9HA 3Q8CA 1SBEA 1C8M1 2GNBA 3ZIWA 4D94A 3ZR6A 2QZ2A 3CQOA 1ST8A 3U10A 4IW3A 1OLRA 4L92A 3VBUA 2BW8A 2ZEYA 4KG8A 3H1WA 3J9SA 1OF3A 3T4HB 1UZVA 3PVEA 1YFUA 3B94A 4OUSA 1J1TA 4Q1RA 4XFFA 4DFSA 4D6QA 2ILMA 2W91A 3OBTA 3DXUA 4KI5M 1JYXA 5IHRA 1DGLA 2W1SA 2OT7A 4AVCA 2VOTA 3I3QA 3OCPA 1PZ8A 1MEC2 5FP4A 3U07A 1GP4A 3IDEA 1Z78A 4GALA 5FMCA 1W8TA 2OPKA 3B5LB 2AH2A 4GH4A 2C0ZA 2R6QA 5IVEA 1BMV2 5LY2A 1VBD1 2A3WA 3UK9A 4CCKA 1C28A 2Q30A 2VCAA 1OD3A 1MS0A 3B9IA 3IDBB 4QHZA 1VBB1 3FBYA 3ZMOA 5IFTA 4A4AA 3FLRA 4ISQA 1ZREA 3WP6A 5LEJA 1O3RA 2BWCA 1MS3A 4AVTA 4DRVA 1D4M3 2Q1MA 4XEZA 1LHVA 4FPKA 5I93A 2MEV2 3BTAA 1PZ9A 1VBA2 3MBWA 3DKQA 3VBSA 4NWWA 3KZ4C 2VUDA 4Q0UA 2AGSA 5CIRA 4MG2A 1RUF3 1UY0A 4Q4W1 2UWCA 1JN2P 1R083 2EALA 5FO8B 4JC1A 5FZIA 3AKQA 3HOBA 3EBRA 3ZYGA 4CP1A 1RUE3 1ONAA 3MZHA 4QPGB 2B9VA 4ZZ5A 4DZGA 1RUI2 2PHFA 4XC9A 1US2A 2VCCA 3NVCA 3VHPA 2K0GA 4BIOA 1RYYA 5KXBA 1W9TA 2AC1A 1LOFA 1GUIA 4FFHA 2R0FA 2W3JA 4P9IA 5FZOA 1BZWA 3MIEA 1BEV2 3ZKYA 3IZOA 2VVFA 3B02A 4XFHA 1PZ7A 1PIV3 4LA2A 3E6DA 2V73A 3MV01 5FZLA 1QJX2 4GMP3 4AEJA 4B4RA 1CGPA 4UW4A 1PGW1 5JOZA 2XWBB 4A3XA 5E6HA 3BYWA 1H2NA 3I3DA 1GU3A 3W5NA 3IDAA 2BGOA 2R073 2WQ4A 2HWB1 1OVSA 3THPA 4CYDA 3RJ2X 5FOJB 1DQ1A 5IYYA 1K12A 3NV2A 2QQVA 2XGXA 3VL8A 1AUYA 5DXDA 2R062 2VOWA 1AX0A 3ATGA 4R52A 2CGOA 5FV3A 3ZO0B 4MGSA 3V64A 4IEZA 1DYOA 1LCLA 3JU9A 1TG7A 1RIRA 2NPIA 4N43A 4ZHNA 1US3A 2VZPA 1H8TC 1UYXA 4FQZA 4QGNA 2YU2A 1LOEA 5FP3A 2RJLA 3C7EA 5C8CC 1HQLA 5ERLA 3HQXA 3H8XA 3DV8A 3HT2A 4MYEA 3B01A 4DXTA 5GJ6A 5JLVA 2YFZA 3MLJA 5SV8A 1CJDA 3LCPA 2BERA 5C3QA 5CADA 3H50A 3VD9A 1DHKB 1PHMA 2E26A 3AZWA 4XFAA 2UU8A 4BQ2A 2VUJA 4HVOA 1APNA 3PVOA 3O1SA 1F2NA 1JI6A 1JTZX 1PK6A 1QJU2 4PBPA 5GZEA 3KVBA 2ZGOA 4LKEA 2QDNA 4OYUA 5E88A 3LFMA 4B4PA 2XH6A 1NT0A 4O61A 5FPBA 1A8DA 4I3GA 4AG4A 1QJY2 2XHKA 3J26N 2CAUA 1U0AA 3NV1A 2CDOA 1UO9A 1RUNA 2RS13 5L73A 3HNMA 2IXHA 3OJBA 2VQTA 2HWD1 5T5OA 2QQIA 5APAA 4FTEA 3T0AA 1UOBA 2ATFA 2WBKA 4R4XA 3POFA 5FZ9A 3ZX7A 4LHLA 2RR13 3K3NA 3BIEA 1D7PM 1RHI2 3R0RA 1PM4A 3M70A 3O5SA 4Q4V1 5HPOA 1W04A 3WSOA 3CJIA 3IMNA 1NLSA 1AR83 3IIAA 4CDWC 3GBFA 1FAYA 3T2QA 5FPXA 1LHOA 2NZ9A 2GMMA 4Q8KA 1F4HA 1YLLA 3U78A 1JUHA 5GZDA 4CU7A 3ZIXA 3LOIA 1JZ6A 1AJKA 3O1TA 5LZ6A 3M3OA 2HWE1 1ZRDA 2C24A 2IC1A 3W21A 1V70A 2GC1A 4Z92B 1NA1C 1UWWA 2GP3A 2RVAA 5IAXA 2D3PA 4LO7A 1HW5A 1H8TB 4A42A 1W6QA 5BYNA 5DABA 5C8CB 5E8AA 3JQWA 5LBBA 4AF9A 3HAGA 3BU0A 1C5IA 1V6IA 3TOJA 3HR9A 5FJKA 3WQBA 4PLOA 2Z5WA 3GDBA 4DY5A 5DAPA 1AXZA 4N8MA 4AI1A 3NSTA 2WS92 1BBT3 4MO3M 4AQSA 1WZXA 3UKNA 1ULPA 1ZRFA 4P9LA 3RI8A 4LEJA 3QACA 5CAZA 5FP7A 4AEMA 1JUIA 5J37A 1TME2 4LTAA 3USUB 1JYNA 2SBAA 1N3QA 3V0BB 1ZZ7A 2R041 2RS51 4K20A 3KT7A 3TEYA 4QU2A 1RMU3 2X10A 3PNAA 4TWTA 5FZKA 1QH6A 3VZLA 4OQ8A 2ZGLA 4CCLA 2GAUA 3P3NA 1MS8A 1V6LA 2WZR1 1I3HA 2XWJB 2XVLA 4QT6A 3ZYJB 4A2UA 4YM3A 4QB2A 2Z2SB 2WINB 4BXFA 2B42B 2A3XA 3IPVB 3LB9A 3SLIA 4X6RB 3WXPA 2VL4A 4S2FA 3KWVA 4L99A 2WNVA 2PMWB 4XJZA 2DVBA 4H55A 1SCRA 2DUPA 1GP5A 1O5UA 1VPHA 2XLAA 1VRH2 3M3EA 3MHZA 4COZA 1AR72 3AP9A 2WO2A 1QGLA 3KF3A 3UJQA 3ZXAC 5C3PA 3HEIA 4ARXA 2GMPA 2ZHNA 4YVSC 4QPGA 1AR93 1ASJ2 1BK0A 1J84A 1ZBA3 4OUMA 4CDWB 4M3CE 3GNEA 3S7IA 4M0HA 4P9GA 3WNMA 1L7QA 1NQJA 1GZ9A 4URTA 2RG4A 2Y26A 1IPSA 4Z2WA 2WFF2 4CDXC 3OGJA 2VW2A 1D4M1 5G04L 1UL9A 4DINB 1AF9A 3O0WA 1UD1A 3ZXEA 3ZSEA 4IGOA 2ARAA 2FQPA 2QQJA 3LPGA 5GLVA 4QHOA 1RUF1 4MHUA 4BLJA 3C2UA 1R081 3KS7A 1NA1B 2YMZA 3JD71 3FUQA 2Y6JA 1JHJA 1RUE1 1UNBA 5AC92 4B7KA 4EQVA 3C7FA 1UX6A 2VECA 4O65A 4Q4X3 5ABJC 4LMFA 2EIDA 3VHRA 2G9ZA 4Z1VA 3F95A 5HI0A 1OPOA 4C0BA 2TBVA 5F1RA 2KD7A 3O14A 3HVDA 2JG9C 2ZEWA 3ZSLA 4CPBD 1JOJA 1O4YA 2RMU2 1SMVA 5J48A 1NCQC 3FUOA 4Q0SA 5CKQA 3VZJA 2GNTA 5EQUA 4GMP1 3SQOA 1LGNA 1VBC1 1WLDA 4TLGA 1O3QA 1EP0A 4OHZA 2D6PA 2XL7A 3GZAA 2BRTA 4GA9A 2R071 5JSPA 4FXKB 4QDRA 2BFUL 2H6CA 4BMBA 2WZ8A 4XHBA 3AYAA 2Q4SA 4HK9A 1IG3A 2FCVA 2OW4A 4FI9A 4PF5A 3T09A 5C5TA 2BZDA
chains in the Genus database with same CATH topology
2QQUA 2OXBA 4JQTA 3UGGA 4FFHA 4QHZA 4CCEA 5FMBA 4HXCA 4CCCA 3H3LA 3UGFA 3ZR6A 3SC7X 2AEYA 3HBKA 1W2TA 1ST8A 3UGHA 2XQRA 3LF7A 3PIJA 3KF5A 3LIHA 3S5QA 1Y9GA 5FK8A 5FK7A 1Y9MA 4UFJA 4UFKA 3LEMA 4UFHA 4FFFA 4UFIA 2QQWA 3LDRA 5FMDA 4UFMA 3U1XA 3U75A 4AZZA 3LFIA 2AEZA 3PIGA 3U14A 4FFGA 5FKCA 4FFIA 3ZR5A 2AC1A 5FIXA 2QQVA 3OSDA 5ANNA 4B1LA 1UYPA 3KF3A 5FMCA 4EQVA 5FKBA 3RWKX 2ADEA 2ADDA 3LIGA 3NMBA 4UFLA 3LDKA 1Y4WA 4CCDA 4B1MA 3IMMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QQU A;  2OXB A;  4JQT A;  3UGG A;  4FFH A;  4QHZ A;  4CCE A;  5FMB A;  4HXC A;  4CCC A;  3H3L A;  3UGF A;  3ZR6 A;  3SC7 X;  2AEY A;  3HBK A;  1W2T A;  1ST8 A;  3UGH A;  2XQR A;  3LF7 A;  3PIJ A;  3KF5 A;  3LIH A;  3S5Q A;  1Y9G A;  5FK8 A;  5FK7 A;  1Y9M A;  4UFJ A;  4UFK A;  3LEM A;  4UFH A;  4FFF A;  4UFI A;  2QQW A;  3LDR A;  5FMD A;  4UFM A;  3U1X A;  3U75 A;  4AZZ A;  3LFI A;  2AEZ A;  3PIG A;  3U14 A;  4FFG A;  5FKC A;  4FFI A;  3ZR5 A;  2AC1 A;  5FIX A;  2QQV A;  3OSD A;  5ANN A;  4B1L A;  1UYP A;  3KF3 A;  5FMC A;  4EQV A;  5FKB A;  3RWK X;  2ADE A;  2ADD A;  3LIG A;  3NMB A;  4UFL A;  3LDK A;  1Y4W A;  4CCD A;  4B1M A;  3IMM A; 
#chains in the Genus database with same CATH topology
 4FOY A;  1EYB A;  3ZXF A;  5LBF A;  1BKZ A;  4ZZ8 A;  2YHJ A;  4YW4 A;  5A6Y A;  5F6K A;  2WYS A;  5C33 A;  1OKQ A;  4ET7 A;  1ZRC A;  1KXG A;  1MS9 A;  4IE5 A;  2P3Y A;  5LA1 A;  5A3T A;  2J1E A;  1G86 A;  2PA7 A;  3Q9O A;  4LE4 A;  5DQ0 A;  4KMQ A;  2E33 A;  4LO5 B;  5LAT A;  2PEL A;  3TEZ A;  3H0O A;  1W03 A;  1ZM1 A;  2A6Y A;  4XIK A;  1XSQ A;  1LHW A;  4WV8 A;  4BQY A;  4YLZ A;  3TB0 A;  2RHP A;  4L11 A;  4EN6 B;  4XF1 A;  1F4A A;  2LRO A;  4IEX A;  1V9U 3;  2EIC A;  3MLL A;  2QUO A;  3VD4 A;  3S6P A;  5B4X A;  2VOK A;  5DAW A;  4YVS B;  4YAR A;  3SNM A;  2HBU A;  4BOW A;  4FCA A;  2PQQ A;  3CLP A;  1SPP B;  4OVE A;  3VGI A;  5B2G B;  5C6C A;  5FWE A;  1WUV A;  1YQ8 A;  4CUA A;  5A32 A;  2VTX A;  3SIS A;  4CVU A;  3MYX A;  1W8Z A;  1W8O A;  4CP9 B;  4NWV A;  3POE A;  4U36 A;  4FT8 A;  1C1F A;  1V6K A;  3GHN A;  5FDB A;  4H3W A;  1XE8 A;  3I3E A;  2JKX A;  1DU3 D;  3D4K A;  2WC2 A;  4FP2 A;  2H6B A;  3N7M A;  1SBF A;  3WY6 A;  2K46 A;  1OH3 A;  4UFH A;  2ZGT A;  2D6O X;  4XFB A;  4FQ4 A;  5FZD A;  4UW3 A;  4IEQ A;  2RS1 1;  5ABJ B;  4XBL A;  2Y0I A;  4AFC A;  2P6H A;  3WNP A;  3WF1 A;  1XYN A;  3R4D B;  4LK6 A;  1YNA A;  2XOM A;  2JG9 B;  2P3I A;  1W2O A;  1JW6 A;  5ACA 3;  2RR1 1;  1NCQ B;  2V5D A;  4NII A;  1IKP A;  1HV0 A;  1QQP 3;  3MPP G;  4YVW C;  4XAC A;  2VNG A;  4NJ4 A;  2XR4 A;  3W20 A;  2VJX A;  1H8T A;  1AR8 1;  5KC5 A;  3UJO A;  5C8C A;  2XUM A;  3M7A A;  2C9K A;  1UY2 A;  3AM2 A;  5FPA A;  5GLZ A;  1OC1 A;  3EHK A;  1S0J A;  4Y4R A;  2W08 A;  4FFI A;  1BVV A;  1EAH 2;  3DN7 A;  4AL9 A;  5FUN A;  4L8Q A;  3ACI A;  5A70 A;  1WBF A;  2YY1 A;  2ZBJ A;  1YWK A;  2D6N A;  1DCS A;  3LGR A;  2E32 A;  1CD3 G;  5E16 A;  2IXL A;  2D7F A;  4RGG A;  3USU A;  3FLT A;  5FZH A;  3V0B A;  3FE5 A;  3RSJ A;  2ZOE B;  3UT0 A;  1F31 A;  1R1Z A;  1UOG A;  2D43 A;  1UKG A;  3KHB A;  1PNG A;  2J1A A;  1NLR A;  4YM1 A;  3ES4 A;  4LE3 A;  4ES9 A;  2Y6G A;  1LUL A;  1NLQ A;  2HWF 3;  5I0U A;  4B3N A;  3OD4 A;  1QXJ A;  1BBT 1;  5JI9 A;  4PBO A;  3LEM A;  2BU9 A;  2VZQ A;  1KS5 A;  2QVS B;  3IPV A;  4XJ8 A;  1PVC 3;  4Q0V A;  3O1U A;  1JOD A;  4EYU A;  4PCR A;  5KXC A;  2JD9 A;  3GM8 A;  5JXI A;  2UYA A;  4Q29 A;  2DYC A;  3LIG A;  4PI0 A;  2LW8 A;  2KA3 A;  5LAS A;  4LO8 A;  5FCC A;  4KNC A;  2IVI B;  5FPV A;  4A41 A;  4NPR A;  2JD4 A;  1FMD 2;  3N3H A;  4LOT A;  4DUV A;  5DG2 A;  3LD8 A;  1CN1 A;  4CSW A;  1AYN 3;  1AZD A;  3MFA A;  1R09 2;  1HDK A;  1N1T A;  2HWE 2;  3VHN A;  2VZV A;  3Q8E A;  2JDU A;  2V72 A;  4BE3 A;  5FUP A;  2JX9 A;  1STM A;  4CDW A;  4E2S A;  5JMO A;  4K1Z A;  2JKB A;  3RS6 A;  3VUO A;  2K9Z A;  5F5I A;  3ZDV A;  4P5H A;  4QX1 A;  4XDO A;  4FAH A;  2IVJ A;  1PO1 2;  3DCQ A;  4ZXE A;  2XUE A;  4FPY A;  5FKC A;  3ROU A;  4EJR A;  1WMX A;  2FZ2 A;  1TEI A;  3AK0 A;  3AMM A;  2Y34 A;  1W9S A;  5I91 A;  4PIZ A;  4V2V A;  4UAP A;  2Q5T A;  1UYZ A;  1KS4 A;  1W6N B;  1OA2 A;  2QTW B;  3R05 A;  1VBD 3;  4PF1 A;  5FQ0 B;  1NA1 A;  3IB3 A;  1PO2 1;  4MX3 A;  4YVW B;  1N1S A;  4M3C B;  1XNC A;  1UZW A;  1IS6 A;  3OEA A;  2PLV 1;  3JBG 2;  1AR9 1;  5EJZ B;  4DRR A;  1UOF A;  1ZBA 1;  4FPF A;  2XJU A;  3AXD A;  5L7O C;  4RL7 A;  1W2N A;  2Q8D A;  2TNF A;  4RYD A;  3UET A;  4FAG A;  5J7M A;  1H9P A;  1QJZ A;  2JE8 A;  5FYI A;  3KSC A;  2RS5 2;  3POY A;  5I0D A;  4FPE A;  1TE1 B;  5LW9 A;  4Q1P A;  1DYK A;  5I8S A;  1WD3 A;  4Q4W 3;  3HQU A;  4IE7 A;  4R8H A;  5DDJ 2;  1AYM 3;  4JDM A;  1GP6 A;  2C4X A;  1VB2 A;  2WKK A;  4QAW A;  5F5C A;  5JR7 B;  5L9R A;  1BVP 1;  1LRH A;  4KWL A;  2F4P A;  2RDS A;  2ENR A;  5FMO S;  4Q4X 1;  5T5P A;  3C8X A;  5KHG A;  1V6M A;  5FXW A;  2OUH A;  4Y22 B;  5D1I A;  2RJ2 A;  3N9Q A;  3FZ3 A;  3A21 A;  1MZ6 A;  4LBK A;  3ZFF A;  4UW5 A;  5C3O A;  4AGV A;  2H0V A;  3EB7 A;  2ARB A;  2YV8 A;  3M3C A;  4MLO A;  5A7O A;  5JXH A;  5FXZ A;  4YZ3 A;  1NUK A;  2EF6 A;  2CDP A;  2HWB 3;  3URF A;  3HN3 A;  1OH4 A;  3J7M A;  5FFO C;  4PHZ A;  3AYE A;  3JB8 A;  3WG4 A;  1F35 A;  3DUI A;  3LPF A;  5JR2 A;  2VGD A;  3ACL A;  3LEI A;  3VZO A;  3LDK A;  5H9P A;  4AXO A;  5C4W C;  5FPZ A;  1SQ4 A;  4MHR A;  4YM0 A;  1RUD 2;  1IS5 A;  4F83 A;  4R9D A;  1ODN A;  4I09 A;  4YVS A;  2MNG A;  3SCG A;  3ZSJ A;  1SPP A;  3J4U H;  1YFX A;  5A7Q A;  4MVT A;  1RUE 2;  2QJV A;  3UES A;  5A1L A;  4FPC A;  5FY5 A;  3O1O A;  3EXU A;  2R0H A;  4MGQ A;  2BVB A;  2WAO A;  1VMH A;  2VUA A;  3K77 A;  3NNL A;  3N9M A;  2D6L X;  4H2A A;  5EYY A;  4BQ5 A;  1ENX A;  3D0S A;  4IXL A;  2YBK A;  3ZMN A;  2FDK A;  2YB7 A;  2RDR A;  2XXZ A;  4B8E A;  4ZU7 A;  1S55 A;  2DCZ A;  5IAV A;  3QH6 A;  4RHV 2;  4CP0 A;  1V9U 1;  5IVC A;  3QCW A;  3ZVX A;  4QQP A;  2PYT A;  5FZ8 A;  1AL0 G;  3KGL A;  1PIV 2;  2A3Y A;  1J3P A;  1WWY A;  5ABJ A;  1LAJ A;  4IDZ A;  2P3K A;  5L7O B;  1DF0 A;  3FMG A;  4Y1X A;  4QX8 A;  5LK5 A;  1JZ5 A;  2O8O A;  3BIW E;  4QD2 A;  2R1B A;  2JG9 A;  1G9C A;  3AC0 A;  3AMN A;  5JVV A;  2WA4 A;  4Q2F A;  3OGG A;  3VD7 A;  3AMH A;  4XUN A;  3I2K A;  5IVB A;  1BCX A;  2ZX4 A;  2Q1F A;  1PNF A;  1WLC A;  4KWU A;  5C9A C;  3L9J T;  1J83 A;  4IV3 C;  2WT2 A;  2ZMN A;  3WIN E;  1JBC A;  2DVD A;  3SIT A;  4XAA A;  2FD8 A;  2QBX A;  5GLU A;  5IJR A;  2QZ3 A;  3I2I A;  1YEW A;  2NMO A;  2WSU A;  2HWC 3;  2WO1 A;  2KXL A;  2IXK A;  3PUR A;  1JMU B;  3VBH C;  5ACA 1;  1POQ A;  3NJX A;  3JZV A;  1V00 A;  1YC6 1;  3LE0 A;  3G7D A;  2F17 A;  2YRO A;  3GF6 A;  1QQP 1;  4AGG A;  1I5P A;  4N90 A;  2E31 A;  4LOR A;  3POS A;  5FZM A;  3ZYR A;  4ASM B;  3ECQ A;  4ATF A;  1QOT A;  2VZS A;  1G9B A;  1W8N A;  4ORF A;  1OHF A;  2HJI A;  5FYC A;  1S2E A;  3TRS B;  3GAL A;  4XTP A;  3DPR C;  1W8U A;  2E6V A;  5K8S A;  2XJQ A;  4WZC A;  5C4W B;  4IE4 A;  2JDP A;  2OZ6 A;  1OUX A;  2RM2 3;  5DUX A;  3O1V A;  4GIQ A;  5CB7 A;  4RS5 C;  4CCO A;  2FDJ A;  2B4K A;  3T4V A;  1QHD A;  4Y33 A;  2VAU A;  4GKX A;  4NRP A;  5E1R A;  1FOD 3;  2XBO 3;  1QWR A;  1U12 A;  3B00 A;  3VB9 A;  4NIH A;  4YFW A;  4D7Y A;  4DY3 A;  2GME A;  3ZXK A;  2WUH A;  2ZXQ A;  5GZC A;  2QCS B;  1ZBE 1;  2V09 A;  5DUW A;  5FLJ A;  4QB1 A;  1W28 A;  2HWF 1;  3E6C C;  4EN9 B;  2RE9 A;  3NRU A;  1OVP A;  4GWM A;  1C5H A;  4K1Y A;  5T5L A;  3EYP A;  1PVC 1;  2EXH A;  4EWA A;  1UU4 A;  2YDE A;  5JXJ A;  5ANN A;  1NG0 A;  3O1P A;  3A4U A;  1HXS 3;  1TZO A;  4KG0 A;  3RWK X;  1E5I A;  4CCD A;  3CMG A;  2VG9 A;  4OCT A;  2ET1 A;  3I8T A;  3C7G A;  4XIO A;  5FP9 A;  3D5O A;  1UX7 A;  3WCR A;  2VTF A;  3GBW A;  4Y5Z 0;  1RIN A;  1SDW A;  1XBF A;  4CCJ A;  1W6N A;  2Z69 A;  5FQ0 A;  4NHX A;  3IAP A;  4YVW A;  1AYN 1;  4NN0 A;  4M3C A;  5A7P A;  3M2M A;  1GQG A;  5JIU A;  4JVA A;  3S0M A;  1Z7S 3;  1J3Q A;  1ZVF A;  4HK8 A;  5C9A B;  3MV1 1;  1CZT A;  2ZGQ A;  4IV3 B;  3I2H A;  4OMD A;  1XNK A;  4HKL A;  3VD5 A;  4ZKT B;  3O1M A;  5HV4 A;  5FUI A;  3JQX A;  5J36 A;  4K3U A;  4JV4 A;  2IUW A;  3ZR5 A;  1L7L A;  1W39 A;  4P14 A;  2XHN A;  2PHR A;  4FBF A;  2VW0 A;  1SBD A;  2VZ3 A;  3FHQ A;  1GWL A;  4B7E A;  1EV1 2;  1OD5 A;  3VBH B;  3RZG A;  3TEX A;  2WLP A;  4UFL A;  3HD8 B;  5A1F A;  3K75 B;  3OG2 A;  4WVM B;  4OI2 A;  4PQ9 A;  1LJ7 A;  3N36 A;  3CF6 E;  3RMY A;  3VDD C;  2HEW F;  3SC7 X;  5IFP A;  4XW3 A;  4E8D A;  2VO5 A;  4MGY E;  2C6S A;  4J1X A;  1R1A 1;  4CZS A;  3PUI A;  4BCU A;  2D5F A;  3P3P A;  1DIW A;  4Y22 A;  2PHL A;  1RUJ 2;  3DPR B;  4XJA A;  1YI7 A;  4UI9 L;  5FZA A;  4PQQ A;  4HMZ A;  5FLH A;  1RMU 2;  3BTX A;  2VBP A;  2JEN A;  3U14 A;  3PMS A;  4RS5 B;  3MUZ 1;  3JD7 3;  2W9X A;  1X9T A;  1AYM 1;  3LA3 A;  2Q1Z B;  4ONU A;  1LOB A;  1W6M B;  4YG6 A;  3I49 A;  1DFQ A;  2RDN A;  2ZML A;  5HCB A;  4MSV A;  5IAT A;  1OSG A;  3WF2 A;  2GC2 A;  4N53 C;  4I01 A;  3SMH A;  3ZFF C;  3VBR A;  5C71 A;  1UZZ A;  3HMY A;  5KXE A;  3U11 A;  3BVC A;  1W2U A;  2EAK A;  5DN2 A;  5KHH A;  4COU A;  1RJ8 A;  5FYY A;  1VBC 3;  4UFK A;  2R16 A;  2PQS A;  5KC6 A;  4XHX A;  2VMC A;  4N9I A;  3AKP A;  2ZCW A;  3V0A B;  1DQ6 A;  3KHC A;  1AJO A;  1ZBA 2;  1UY4 A;  2CWS A;  2FDI A;  1LU1 A;  1GIC A;  1AL2 3;  2ADD A;  2YPD A;  2ZZQ A;  4YM2 A;  5ANQ A;  5F3E A;  4LXL A;  4YW2 A;  1GV9 A;  3LSE A;  5CVR A;  3OOX A;  4S2H A;  5FZE A;  5KR7 A;  1B35 C;  3S57 A;  5HCA A;  2GND A;  2Y6H A;  1HB3 A;  1ZZ9 A;  1NYW A;  3NAP C;  3PTR B;  1QU0 A;  4N7I A;  1WW4 A;  1W06 A;  4BIS A;  1OKO A;  2XQR A;  3MDP A;  5KHK A;  4XE9 A;  3D6E A;  1KDK A;  4PT6 A;  1UKR A;  3PJY A;  1HB4 A;  5EV7 A;  4A45 A;  1OMI A;  4W6W A;  2DBI A;  4XBQ A;  3O7O A;  3A22 A;  4AVS A;  4FOQ A;  2DCY A;  4QPW A;  3OF1 A;  1XNT A;  4KWK A;  4C1X A;  5BY5 A;  1UMH A;  4XF9 A;  5C3R A;  1W2A X;  3ASI A;  4XZU G;  5HCH A;  2GDF A;  2QQP A;  3VDD B;  2DCK A;  4NAM A;  2F6B A;  3PUS A;  3G6J B;  2W5F A;  3I54 A;  3RG0 A;  4XPV A;  2VVE A;  5AFB A;  3K48 A;  3L2H A;  3FFQ A;  1Q43 A;  1GOF A;  3PDQ A;  1RUH 3;  1LHN A;  1UZ0 A;  3HWJ A;  1XND A;  3I2J A;  3BCW A;  4QX0 A;  3WP4 A;  3GGL A;  1WCD J;  3SH4 A;  2PFW A;  4Q26 A;  5T5J A;  3LDR A;  1QF3 A;  4WVV A;  2WA3 A;  3HT1 A;  1UU5 A;  3DL3 A;  4IER A;  5HV0 A;  3RMX A;  2XG3 A;  2XKP A;  5LRS A;  2WR9 A;  2CTV A;  4P9X A;  4K40 A;  1HRV 1;  1UZY A;  2WZE A;  5BPX A;  5A3L A;  3CDZ B;  1OF4 A;  3E5Q A;  3SXW A;  4B29 A;  4NIG A;  5K7P A;  5BNQ A;  3ZOI A;  4N53 B;  2AUY A;  2XJS A;  5GLT A;  1GSL A;  3AP4 A;  3ZFF B;  2VE1 A;  2HWC 1;  5C4W A;  1X36 A;  1DGR A;  3MF9 A;  1LEN A;  5T3N A;  3BU7 A;  2CGN A;  1WA4 A;  3B7M A;  4ISR A;  4AAX A;  4H7M A;  4ARY A;  3S5Q A;  5KHJ A;  4JHT A;  3PVN A;  5GLW A;  3KM5 A;  4AGR A;  5CBL A;  2Y38 A;  3NJV A;  1G9A A;  4X8N A;  3T1L A;  2JDY A;  1LEM A;  3MUY 1;  1SZB A;  4CXW A;  3R6S A;  1E5S A;  4JCK A;  4DUX A;  2BDR A;  3GHM A;  3MIG A;  4QX3 A;  3OBZ A;  5A7W A;  5FZF A;  3ETP A;  4E4H A;  1VE0 A;  1NE4 A;  1LGC A;  1QXR A;  1NKG A;  5C7G A;  4E9K A;  3WHU A;  1UW8 A;  2RM2 1;  2B46 X;  1ULE A;  2YYO A;  3LA2 A;  3VKF C;  2P4E A;  3N7J A;  4SBV A;  3NNJ A;  2LUW A;  3ZSK A;  4CCE A;  4GMP 0;  1VRB A;  1QJF A;  1FOD 1;  2XBO 1;  4C90 A;  3V65 A;  4NHK A;  3KT1 A;  4BPZ A;  2BVV A;  3T08 A;  1G6N A;  1PGL 1;  4QQH A;  1EUT A;  1SLB A;  2JDN A;  3GZE A;  2DU1 A;  1XNB A;  3FBM A;  2XVG A;  5FZ3 A;  4TZD A;  1DZQ A;  4GB3 1;  2JEM A;  5D21 A;  3I3B A;  3O0V A;  1SG3 A;  4H7L A;  1ZRR A;  5FPU A;  1ALY A;  1NX9 A;  5GZG A;  5IVJ A;  1HN0 A;  4XUR A;  4IV3 A;  3B69 A;  2VU9 A;  3B93 A;  3GJB A;  4QXK A;  4XVH A;  4EN7 B;  1RUG 2;  3IAQ A;  1HXS 1;  5HXV A;  3WW1 A;  1TVG A;  2ORX A;  4KL1 A;  4RFT 0;  1MEC 3;  3SKJ E;  3TN9 2;  3ZN5 A;  4G3Y C;  3FX3 A;  4F7Z A;  4AFA A;  5FY7 A;  1MAC A;  2OZJ A;  3J7H A;  4XCA A;  3VBH A;  3GYD A;  5CFD C;  4QKB A;  5I0R A;  4WVM A;  3GZU C;  3X29 B;  1YQ2 A;  4DUW A;  1XYP A;  2W39 A;  3WX5 A;  2D98 A;  1RVF 3;  3KV4 A;  5JOW A;  5CNA A;  3IN9 A;  2BYV E;  4DS0 A;  3M4F A;  2BJS A;  2VTX J;  1Z7S 1;  4X6Q B;  5IVF A;  4L97 A;  5C3S A;  4G9S B;  2MEV 3;  2OUJ A;  2ZZJ A;  1VBA 3;  4BXS V;  5JZG C;  2XLG A;  5EJ1 B;  3A7Q A;  2VNR A;  4PDW C;  1HRI 2;  2MPF A;  3DPR A;  4TYS A;  2IXI A;  1WMD A;  3R4U A;  3I2D A;  4WVZ A;  1MS4 A;  1IGO A;  1O3T A;  3C7H A;  3B3Q E;  1D0H A;  4BK4 A;  4RS5 A;  4Y26 A;  1PO2 3;  2XDV A;  5FZ0 A;  5FY0 A;  2ZEX A;  2BOI A;  3ILF A;  5D8A C;  4BME A;  2PLV 3;  4CCM A;  4FPL A;  5DAX A;  2BNM A;  3UNP A;  3OPZ A;  4R9C A;  1HN1 A;  3H7Y A;  3ZN6 B;  1W6M A;  2YBP A;  5DAV A;  2YGL A;  1COV 3;  3KF5 A;  4HZF A;  1SLA A;  1VMJ A;  4OHV A;  4XUQ A;  4Z07 A;  3GXU A;  5J3U A;  4S2D A;  3VLB B;  5IK7 A;  5JSR A;  2GNM A;  2PAE A;  5TSW A;  5G05 L;  2ZKN A;  3T0D A;  1OOP C;  3ENR A;  1Y3T A;  4FFG A;  2XON A;  5F6L B;  3N9O A;  4JGZ C;  4D69 A;  5EWS A;  1WLW A;  3OEB A;  1J3R A;  4QKF A;  1BQP A;  1C8M 2;  2EAA A;  2RS3 1;  4QPY A;  1I9R A;  1QH7 A;  4I2O A;  4DXZ A;  3C7O A;  3NQH A;  1AYN 2;  4AAP A;  3I7D A;  1N1Y A;  4PJY A;  4BIF A;  5DAQ A;  2R06 3;  4FPJ A;  4TN7 A;  3T1M A;  3V0A A;  1H4G A;  4AVV A;  1LES A;  1DGR N;  5HXM A;  1V6J A;  1JOB A;  1S2B A;  3OPT A;  4CUG A;  2XQX A;  3FLP A;  3N35 A;  3D3A A;  5CG8 A;  2YXS A;  3W9A A;  3TEW A;  1T2X A;  1W6O B;  2BTV C;  2YG0 A;  5FRA A;  3AJY A;  3SKV A;  1T6B X;  3PUH A;  5AFE A;  1MPX A;  2OPW A;  5IK5 A;  3RI9 A;  1C4R A;  4XXA A;  1JH5 A;  5FY1 A;  5B4N A;  1ODM A;  4XJ9 A;  1VBD 2;  3VZM A;  2FMY A;  1ZZ8 A;  1MR5 A;  1S0G A;  1H2M A;  1VBB 2;  4LA3 A;  3RYP A;  3ZFG C;  2ZGP A;  5CFC C;  1X33 A;  2ZAA A;  3RVH A;  3I2F A;  1GQH A;  1AL2 1;  1HQW A;  4CEY C;  5CFD B;  4XMI A;  5BNN C;  4HSL A;  1QXP A;  1KJR A;  4L0P A;  1RXG A;  4CU9 A;  4FOW A;  5LBE A;  4B4Q A;  2OYZ A;  3H3U A;  4Q4W 2;  5H9Q A;  2QQO A;  5A7N A;  3VDD A;  3MPB A;  4JTO A;  1GOG A;  2Q8O A;  3T30 A;  2TEP A;  4NIA A;  5JZG B;  1QKQ A;  1IPJ A;  2Y0O A;  1UOJ A;  4ASK A;  3RZH A;  5L9B A;  3ST7 A;  4ES8 A;  4PDW B;  4OMC A;  4NAO A;  1QJY 3;  2ZGR A;  4FP3 A;  5FZG A;  4IEW A;  1Q56 A;  3H9A A;  4P9Y A;  5EHD A;  1AXK A;  1YHF A;  2HEY F;  2G9F A;  2C9A A;  2YC0 A;  1E5R A;  5FIX A;  1KRI A;  1XU1 A;  5T50 A;  4MGT A;  5HCF A;  1FI2 A;  5D8A B;  1JHN A;  4FPG A;  4MZU A;  3IMM A;  3PHM A;  1X7N A;  1LOD A;  2FBE A;  1XJA A;  1SLC A;  4RSU A;  4M3C F;  4GQ7 A;  2DBN A;  1PGW 2;  1RC6 A;  1ENS A;  3DYP A;  3OGS A;  4XF4 A;  5A3W A;  3WDU A;  5E89 A;  1RUC 1;  3FJS A;  4N53 A;  4CDX B;  1G9D A;  3VDB A;  3AZV A;  5FZ1 A;  1OI6 A;  2HWB 2;  1RHI 3;  2VOX A;  3LWC A;  4NR1 A;  2DDU A;  4WVW A;  1OLM A;  1DLC A;  3WNK A;  4A7Z A;  1VBE 1;  3EJK A;  1OOP B;  3K4Z A;  2P2K A;  4ZS2 A;  4CXY A;  1RUH 1;  3WG3 A;  4JGZ B;  1AX1 A;  2FHR A;  1J59 A;  4CEW C;  5GKA C;  3NKG A;  3D82 A;  1REE A;  1DG6 A;  2B8M A;  4AVB A;  4OI1 A;  5C5U A;  1UMZ A;  3RZZ A;  3LSD A;  1AVB A;  2P37 A;  4J6G A;  1FPN 3;  2VVD A;  2JDM A;  4EZ4 A;  1JYI A;  3S30 A;  1Q5O A;  3ZXD A;  4CDQ C;  4FTB A;  4HN0 A;  3OGR A;  1UXX X;  4F3J A;  4RQP C;  4DXS A;  1IPK A;  1VR3 A;  5I0T A;  2C5D A;  4XZP A;  1K45 A;  2HLE A;  4NHL A;  3BTZ A;  4LJH A;  2Q8E A;  3FL7 A;  3NL1 A;  4JGY C;  3F2Z A;  4P02 B;  1UAI A;  1YI9 A;  1YXW A;  2WSV A;  5F9T A;  3J8F 3;  4GWI A;  1MS5 A;  2OII A;  5F3G A;  1SFY A;  3ZFG B;  5CFC B;  2AEN A;  2D93 A;  4XDQ A;  1MVE A;  4YWA A;  4BHP A;  1BJQ A;  1U5I A;  4Y24 A;  4CEY B;  1NY7 1;  4DO0 A;  1OT5 A;  5BNN B;  2ZGS A;  4E4Z A;  4Z82 A;  4XF0 A;  4AW7 A;  2J1S A;  5FY4 A;  2G19 A;  2V4V A;  1AR6 1;  2VQU A;  1URX A;  2OVU A;  1IHM A;  4GWJ A;  4Q0Q A;  4JDO A;  1RL3 A;  5FTT C;  5A6Q A;  2J42 A;  2D44 A;  2GP5 A;  4YZ1 A;  2ARC A;  2L9L A;  3RPQ A;  2HWD 2;  3U0Z A;  2ZMK A;  1KFX L;  1ZBE 3;  2GSY A;  4QXH A;  1Y9M A;  1XU2 A;  5EJ3 A;  5L9V A;  2FZ1 A;  1ZZB A;  3BOP A;  4NMI A;  5F2S A;  2G4I A;  4MV2 A;  3ZDS A;  5F2W A;  2HWC 2;  1GZW B;  3WG2 A;  2DUQ A;  1X9P A;  5FZ7 A;  4GH4 C;  5IW0 A;  4TSV A;  1KJL A;  4Q4V 2;  4YGB A;  3WF0 A;  4ERO A;  3NO8 A;  1EY2 A;  1UQX A;  1VRH 3;  2VD7 A;  4AI8 A;  1GFF 2;  1Y43 B;  1MEC 1;  4Y20 B;  5T52 A;  4DEQ A;  2WDB A;  4K9S A;  4IND A;  1W2T A;  1GZC A;  1ZNP A;  2I2S A;  1LNS A;  1BMV 1;  1YFW A;  2BGP A;  4PI2 A;  1YQC A;  4CEW B;  5A3U A;  4OUE A;  1ULF A;  1RUO A;  5FK7 A;  3WW2 A;  1RVF 1;  4UFJ A;  2RM2 2;  3SCF A;  5LY1 A;  3ZN6 A;  3VKL A;  3I2O A;  3KQ4 B;  5JPM B;  2C1F A;  2WNU C;  1OFN A;  1WW7 A;  1CZV A;  2MEV 1;  1MQT C;  1VBA 1;  1VMF A;  2VW1 A;  3VBO C;  2NM1 A;  3AKS A;  4CDQ B;  4XQ4 A;  4Y5S A;  4ZU5 A;  4XUO A;  5L36 A;  4I30 A;  1RJ7 A;  2VMH A;  4RQP B;  4NE9 A;  1V6N A;  4YPJ A;  4B1M A;  4DEV A;  1I1E A;  2WWJ A;  4JRL A;  2IWG B;  2BOJ A;  4NPM A;  2VH9 A;  2WWS A;  4BQ4 A;  4GAZ A;  4JGY B;  4D6R A;  1RUI 1;  1G9F A;  5FZB A;  1R1A 3;  5DUU A;  1Y7B A;  2DUO A;  4XAE A;  1COV 1;  1BK1 A;  1UXZ A;  4HBN A;  4M01 A;  2WAA A;  1YCI A;  3ACF A;  4JTN A;  2R04 2;  4V1P A;  1L7R A;  1BEV 1;  1QOO A;  1XB9 A;  1SDD B;  4E8C A;  2RMU 3;  5BNP C;  3ZN4 A;  4RGA A;  1PMJ X;  4I0W B;  4FOV A;  5FYT A;  1NXM A;  5FXX A;  4IV1 C;  1W6O A;  3S7E A;  2YFU A;  1CAU B;  3OUI A;  4XAB A;  2WZR 2;  1QJE A;  5EXO A;  1OFS A;  4JKL A;  5F5A A;  2P17 A;  4AQT A;  1I5Z A;  2YUE A;  2X29 A;  1ND3 C;  1IQA A;  1XE7 A;  2DFC A;  4IGP A;  4BK5 A;  1QNY A;  5FMB A;  1PMI A;  1Z7S 2;  2R06 1;  1I6X A;  4HON A;  3SEE A;  4XDP A;  3INA A;  3SH5 A;  5CFD A;  2PXJ A;  2YPJ A;  1NXD 1;  3NNF A;  1JOP A;  3BAL A;  3SHR A;  1GMM A;  4F8A A;  2W1Q A;  3MEP A;  3VDA A;  3KGZ A;  2X53 S;  4CUC A;  2LRP A;  2Y33 A;  5JOY A;  2PHD A;  4AE2 A;  1FX5 A;  4LIU A;  3OBR A;  3L2Y A;  5JZG A;  1PK6 C;  5FXV A;  3MF6 A;  1NE6 A;  1PX4 A;  3QLQ A;  4PDW A;  4BA6 A;  2ZHK A;  2VME A;  1Y4W A;  1MVQ A;  1IOA A;  2ZJC A;  1WLT A;  1MZ5 A;  2CAV A;  2OXB A;  3VD3 A;  1D4M 2;  4XJW A;  3EQE A;  4CCC A;  1GZT A;  3DXT A;  2VCB A;  4EN8 B;  3AVR A;  5I8Y A;  2IXJ A;  5D8A A;  3BB6 A;  1FV2 A;  4YSF A;  4GWN A;  4NPL A;  1RUF 2;  2DVA A;  2R1D A;  1R08 2;  3OD0 A;  1SFN A;  2ZGN A;  1XNA A;  3JD7 2;  1O5L A;  3ZXJ A;  4OFG A;  4HG6 B;  2WNU B;  4OHW A;  3J7N A;  4CDX A;  1MQT B;  3VBO B;  4CP9 A;  4COY A;  5J1X A;  1O4T A;  3OPW A;  2QE3 A;  1QJY 1;  1A78 A;  1OOP A;  3OY8 B;  3WDY A;  3N4M A;  1YQ5 A;  1SLI A;  4JGZ A;  2FCT A;  4KWJ A;  1XE0 A;  3LEG A;  2J1U A;  4D8M A;  4BB3 A;  5DG1 A;  3OUH A;  1H1M A;  4AQ2 A;  1H6X A;  1TNF A;  2DFB A;  1C3H A;  1JU4 A;  1OBN A;  1W8H A;  2CSG A;  2XJT A;  3PVB B;  1VBC 2;  2AEY A;  4I0A A;  4IES A;  4Q4Y 3;  3TNQ A;  1JZ7 A;  1JYV A;  2VUC A;  4DIQ A;  4JQR A;  2R07 2;  3PUA A;  4IEO A;  2OKX A;  1RHI 1;  2C26 A;  5BNP B;  5FR3 A;  1DLL A;  1E57 A;  1NCQ A;  4Y1Y A;  4IV1 B;  2DVG A;  1GBG A;  2VBD A;  2JIJ A;  1AL2 2;  4MOA A;  2VZU A;  3BTY A;  1VP6 A;  4XFI A;  1HQN A;  3W59 A;  5F32 A;  4LBL A;  1WCQ A;  3OTF A;  1HRV 3;  1ND3 B;  3HJR A;  2WN2 A;  4LUK A;  5FOB B;  2XKO A;  3Q8F A;  4QM8 A;  1FPN 1;  1NZI A;  2WT0 A;  3ZFG A;  3WNN A;  5CFC A;  4Q8L A;  1KD7 A;  4DB5 A;  3W5M A;  4CEY A;  2Q0A A;  4LQR A;  4QX2 A;  5BNN A;  1DDL A;  1OLM E;  3NNM A;  4QQ2 A;  5FAX A;  3CKH A;  2ZGK A;  4I0B A;  2W68 A;  3T2T A;  3AP5 A;  4BQW A;  1Y9Q A;  1F9K A;  3BN6 A;  4CA9 A;  4JKK A;  3AZX A;  4NVP A;  3KQR A;  2ZTN A;  1IG0 A;  1PX3 A;  2JB4 A;  3DGT A;  1DBN A;  3J8F 1;  1PK6 B;  2CYF A;  1IKQ A;  2JJ6 A;  1CAV B;  3A23 A;  3IWZ A;  3WVJ A;  1O7F A;  2VCM A;  2WS9 1;  3FHA A;  2HYK A;  5DMY A;  2XJP A;  1HLC A;  2DTY A;  1UYP A;  1HIX A;  2N7G A;  3DEM A;  1E5H A;  1Q3E A;  2UY8 A;  5KBF A;  3JUU A;  1J58 A;  1JYW A;  1W99 A;  3U4S A;  1RB8 G;  3AL5 A;  1OQD A;  1TME 1;  2PHW A;  3AP6 A;  1S0E A;  2ZX1 A;  4IEU A;  3A0N A;  3WNX A;  1IZ3 A;  4QB6 A;  3SCH A;  3LEK A;  3LKJ A;  4MGK E;  4ATE A;  5FWJ A;  2OA2 A;  2QQL A;  3POB A;  4JKM A;  4XTM A;  5IWF A;  3WP3 A;  4QU1 A;  1HJG A;  3ETQ A;  1M06 G;  2WNV C;  3ZM8 A;  2FDG A;  2RS1 2;  5FBZ A;  4NO4 A;  4TTG A;  1OQ1 A;  1UYY A;  1FMD 3;  3I59 B;  4Y20 A;  2A6W A;  2Y6F A;  1Q8P A;  1WBL A;  3MW4 A;  4K7J A;  4MUV A;  2E63 A;  4AED C;  4D0Q A;  5K0U C;  2ZHL A;  4QHB A;  4YZ2 A;  2I74 A;  4K6B A;  4GB3 3;  3THC A;  1R09 3;  4GXL A;  4NOT A;  4Y4Y A;  1Q8S A;  4HKW A;  2ID4 A;  2FCU A;  3WT3 A;  1H30 A;  1LED A;  1XSR A;  4CEW A;  4DXR A;  5CG9 A;  4LBQ B;  4UW6 A;  2JXA A;  2RR1 2;  4YGE A;  4A7K A;  4Z8B A;  1X8M A;  4QDS A;  3GCW A;  3CO2 A;  1PO1 3;  5F37 A;  2BUK A;  4XIL A;  4DQA A;  1JYT A;  1VRH 1;  2W1U A;  3WOG A;  1AR8 2;  2OQ7 A;  3THD A;  1V0A A;  1W9Y A;  2IFR A;  1CR7 A;  4CDQ A;  5JI7 A;  5A33 B;  4YRD A;  1SHW B;  4RQP A;  5FZC A;  2Q8C A;  2CHH A;  3MIC A;  4ITC A;  4ZON A;  5FYV A;  1MS1 A;  3RRD A;  2O14 A;  2JIC A;  4UWD A;  4XJU A;  3JBG 3;  4GUL A;  1ASJ 1;  4A3Z A;  3BPS A;  2LTN A;  5J96 B;  1G7Y A;  1HKD A;  1VAV A;  4UFM A;  2ZX3 A;  4E4S A;  2V4A A;  4ZU4 A;  3TNP B;  3ZLI A;  4CUB A;  2WFF 1;  3M3I A;  4HL0 A;  4RA0 A;  2FDH A;  2JG8 C;  3NNG A;  5D2A A;  1LB2 A;  2ARE A;  5DDJ 3;  1KEX A;  1ACC A;  2G9G A;  4COW A;  3KCX A;  1WME A;  4OZX A;  4AQ6 A;  5AC9 3;  3KD4 A;  1CAU A;  4HT1 T;  3M3Q A;  3RZL A;  1RIT A;  1BBT 2;  4UBG A;  3VL9 A;  5FYH A;  2RDQ A;  2QQN A;  1W8W A;  3OGV A;  4BQ1 A;  4EZH A;  1A6C A;  2WQZ C;  2A6Z A;  4H14 A;  3LQC A;  3POJ A;  1SEF A;  1QEX A;  2ETE A;  3ZYB A;  1UPI A;  1U5Y A;  5DZE A;  2RJK A;  3UYJ A;  4UFI A;  3U75 A;  4RN5 A;  2RMU 1;  2EIB A;  3HN1 A;  1WA6 X;  2MHF A;  4IGQ A;  4KH9 A;  1A3K A;  4AEK A;  1DQ2 A;  3K4A A;  4OUL A;  4MGZ E;  4B1L A;  4HVQ A;  5LWB A;  1JZ3 A;  2RS3 3;  1S2K A;  3MIF A;  5FMO L;  4QPI C;  3TWI A;  3BKZ A;  1W6P B;  2B45 X;  2UWB A;  1SLL A;  2KR2 A;  1LHU A;  2YZ4 A;  4MH0 E;  4NRQ A;  4Z2A A;  4JX0 A;  3AZY A;  2GU9 A;  1TNR A;  1DP0 A;  2K2S A;  2UWA A;  2WNV B;  5A6Z A;  1RVF 2;  1Z0H A;  1Q8V A;  1O4Z A;  2WII B;  1OA4 A;  4W4Z A;  3U37 A;  4Y1V A;  4AI3 A;  2JE9 A;  5K0U B;  2O8Q A;  4AED B;  2YU1 A;  1RUD 3;  4IL7 A;  3VBF C;  4LO4 B;  1ENR A;  4COV A;  2VXJ A;  4LKF A;  1GQP A;  1POV 1;  1WW5 A;  3ORJ A;  1WGP A;  4JDN A;  5FYB A;  3M8L A;  2XLF A;  3GCX A;  3NKT A;  1CZS A;  1PO2 2;  1WW6 A;  3UL2 A;  1NAE A;  2WNU A;  2PLV 2;  1MQT A;  3VBO A;  1AR9 2;  1S0B A;  2D3S A;  4YG3 A;  5A3O A;  1OLQ A;  2D40 A;  3E6B A;  4HOO A;  5A7S A;  3VZN A;  2XPJ A;  4YW3 A;  4OI4 A;  1COV 2;  3OY8 A;  2A75 A;  4IET A;  1CON A;  4HVR A;  4RHV 3;  4Y3O A;  3UGG A;  3USS A;  2QDR A;  4GZ9 A;  4QKD A;  3AB0 A;  4QKN A;  2DWR A;  2VNV A;  4K8F A;  2W95 A;  2A6X A;  3N9L A;  4WBB A;  3WD5 A;  4KU7 A;  1LOG A;  5L7O A;  1HB1 A;  1FAT A;  4KGQ A;  1N47 A;  2JG8 B;  4UBH A;  5FMD A;  4AHW A;  3AXE A;  4Q4X 2;  4LBM A;  5FO9 B;  5BNP A;  1H4H A;  5IUQ A;  1WCK A;  4Y5T A;  3H1Y A;  3JB4 C;  3LDB A;  3QOP A;  4IV1 A;  2W0X A;  4N7U A;  3M1H A;  2WO3 A;  2BFU S;  5JAX A;  4NRM A;  3RZK A;  1VLN A;  4XOG A;  2BNO A;  5FO7 B;  1H0B A;  1BHG A;  1TMF 3;  1G8W A;  1ND3 A;  4W6Y A;  5FYS A;  5GAL A;  2GAL A;  2VUL A;  3P1I A;  4LOS A;  5H9R A;  4D6S A;  1UN1 A;  2XVK A;  5F3C A;  1RUC 3;  3POG A;  5JWP A;  4Q4Y 1;  1CQ9 A;  5KXD A;  4MXW B;  2CWM A;  4D7S A;  4FXG B;  4CU6 A;  2A7A A;  1VBE 3;  2P1B A;  2XJV A;  4S2G A;  4UYB A;  2QFE A;  3WZ1 A;  2DU0 A;  4QX7 A;  3T0B A;  1CPM A;  1GLH A;  4W6X A;  2QQW A;  2JB8 A;  2BQP A;  3JXS A;  4RFR B;  3LOB A;  5T55 A;  4QPI B;  5T54 A;  1DGW A;  1CVN A;  4HAN A;  4AFD A;  4E4D X;  4WM7 C;  3IDC B;  2X09 A;  5K4L A;  1GAN A;  2Y60 A;  1H1A A;  4LHS A;  3W58 A;  1H9W A;  1CAV A;  2YC2 A;  5LCW L;  1EAH 1;  3GBG A;  5IK8 A;  1DQ4 A;  2ZAH A;  5IT6 A;  2GZW A;  1GWM A;  3VBF B;  5CZK A;  3HQR A;  4UF0 B;  3QH7 A;  4YGC A;  3WV6 A;  1UIK A;  4DMI A;  5BNO C;  2Y8K A;  2W46 A;  3ZPO A;  2AZ5 A;  4QXB A;  3ACG A;  3ZYF A;  2G1M A;  4IE6 A;  4SLI A;  4ZY9 A;  1V9U 2;  1LU2 A;  2R30 A;  4L2N A;  4AZZ A;  2DCT A;  2P5B A;  4ZS3 A;  2WRA A;  3WW4 A;  2VQ0 A;  3AVS A;  1ULC A;  1DGW X;  1SAC A;  2IFW A;  2WFP A;  2E9Q A;  3I59 A;  1AX2 A;  1W0P A;  2BWA A;  5A32 B;  2UYB A;  1W05 A;  5JDB A;  3JCI A;  2YBS A;  4HN1 A;  4CRQ A;  2CL2 A;  4LHN A;  1KQR A;  3HPN A;  4LR4 A;  4RR3 C;  5K9Y A;  4LUM A;  4BLI A;  1YJL A;  1B35 B;  2B9U A;  3S5A A;  3CU7 A;  1AR6 3;  1O59 A;  1LOA A;  3NAP B;  4KGG A;  2EA7 A;  3I97 A;  1W0N A;  4LBQ A;  4I3P A;  3I3M A;  3AJZ A;  2AAC A;  4Y1Z A;  2O1Q A;  2VZ1 A;  2WLQ A;  3LZZ A;  1OXC A;  1TQ5 A;  4FPH A;  4WM8 C;  2WL1 A;  4KU8 A;  4AR2 A;  1UY3 A;  3AMP A;  4QDQ A;  3AFK A;  5A33 A;  1C57 A;  1FMD 1;  1OUS A;  2LM3 A;  5FZ6 A;  4A6O A;  5EFU A;  1FPN 2;  3WCS A;  4FFF A;  1GR3 A;  4LBN A;  1WD4 A;  2J22 A;  3BOW A;  1R09 1;  3AKT A;  4EN0 A;  4GKY A;  2HBT A;  4K8R B;  5ACA 2;  1IS3 A;  1QOS A;  3AX4 A;  3BI3 A;  5C9A A;  2CU5 A;  4OQ9 A;  3K4D A;  1QQP 2;  1GWK A;  3NMB A;  4E2Q A;  1PO1 1;  4M0N A;  3PJQ A;  3WF3 A;  3MIB A;  5JOX A;  3HBZ A;  3WG1 A;  3WNL A;  1EV1 3;  3R4S A;  3KLS A;  3RQ0 A;  4BM8 A;  4MGI E;  4HLT A;  3PTY A;  3FFZ A;  3J8F 2;  3WDV A;  2E53 A;  2XL9 A;  2J1T A;  4V2W A;  5IVV A;  2VXR A;  3LIH A;  1UIJ A;  1VIW B;  3I2G A;  4FPO B;  4NHM A;  1JYC A;  1S4C A;  1K3I A;  3KB5 A;  5IK4 A;  1UF2 C;  3JBG 1;  2ZS6 B;  2I45 A;  3QD6 A;  2VR4 A;  1FXZ A;  4WM7 B;  1DQ0 A;  1RED A;  4C91 A;  1MZE A;  5LA0 A;  1LOC A;  3AKR A;  1RUJ 3;  1CES A;  1WKY A;  2WWU A;  1N1V A;  1S0D A;  1W8F A;  4YGD A;  2BEO A;  2JDK A;  1S0F A;  2W87 A;  2Z79 A;  5DDJ 1;  5LB6 A;  3VZK A;  2CGP A;  2WAB A;  2BP6 A;  2IZW A;  3HNB M;  5AC9 1;  2JDH A;  2EIE A;  4QM9 A;  5BNO B;  1ZBE 2;  5JCT A;  5DPN A;  3TYJ A;  3NV3 A;  1RUI 3;  1H2L A;  2HWF 2;  3H8O A;  1W6P A;  3KVA A;  3ILR A;  1JS9 A;  1RXF A;  1YJK A;  2ARX A;  4YW1 A;  3BGA A;  2VZR A;  3FWE A;  4C1W A;  3H8U A;  3LF7 A;  1ENQ A;  2VZO A;  5M0T A;  2CNA A;  1PVC 2;  4R9B A;  1S0C A;  2X5I C;  1BEV 3;  4YZ5 A;  3BUC A;  4AVA A;  4GJY A;  5K0U A;  4AED A;  1W3V A;  1ULD A;  3N7K A;  4RR3 B;  1OQE A;  1NQD A;  1QJX 3;  3KCC A;  3KCY A;  4Q5O A;  2VMG A;  5DZF A;  1EPW A;  3TBD A;  1A34 A;  1FNY A;  2VZT A;  4CP2 A;  4XFC A;  1K5M C;  3RZM A;  2PHU A;  2WNO A;  2QQU A;  4W8J A;  1VAK A;  4WM8 B;  3NW4 A;  1FT9 A;  2W1W A;  3UGF A;  3Q8B A;  3VHO A;  1ZA7 A;  2GN7 A;  5JIA A;  4HPK B;  5A80 A;  3WQ0 A;  4TLF A;  1HJF A;  3KMH A;  5LEK A;  1R64 A;  4HSJ A;  1NZC A;  2ES3 A;  3CZU A;  4LLO A;  1X50 A;  2A6V A;  3AL6 A;  4Y1U A;  1RUD 1;  1ND2 C;  3DEC A;  4W65 A;  2DVF A;  2PTM A;  5CYY A;  3E97 A;  2LS6 A;  3AP7 A;  2VC9 A;  5I8T A;  1VJ2 A;  3MO4 A;  3DYO A;  3O1R A;  2ZKL A;  2BBA A;  2HH9 A;  2JEC A;  4XMA A;  4EV0 A;  1PMH X;  2FDF A;  2BGC A;  2A1X A;  1H6Y A;  3IKW A;  3ZYI B;  1D0G A;  2JG8 A;  3BPZ A;  4X8P A;  3K3O A;  2EXI A;  4AOC A;  2WT1 A;  3WHT A;  1JZ2 A;  2D97 A;  1JZ4 A;  1DZR A;  1R1A 2;  4LUL A;  2A70 A;  2NYY A;  3ZFE C;  4A6S A;  2ORZ A;  1GOH A;  3MI8 A;  3K2O A;  4RHV 1;  3NJY A;  2WNE A;  5CIS A;  1W3X A;  4URA A;  5AVP A;  1QJU 3;  3VN4 A;  5JXG A;  4JZR A;  1PIV 1;  3IM0 A;  1CAW B;  2NLR A;  3DYM A;  1UPS A;  1IQD C;  4YNI A;  1AYM 2;  3WW3 A;  5EYX A;  2Y6L A;  4JAA A;  4YG0 A;  3WUD A;  3FC0 A;  2B39 A;  3OYW B;  4MXW A;  4QX5 A;  3ZYP A;  2DF7 A;  1O91 A;  3OSD A;  3ZPY A;  2ZAB A;  4XUT A;  1YRZ A;  2VQA A;  5FYU A;  3VKN A;  5HBA A;  4L9B A;  2PN5 A;  1N3O A;  4QPI A;  2W92 A;  1D2Q A;  2RV9 A;  1N3P A;  1QNW A;  1BXH A;  1U5Z A;  1HX6 A;  1S1A A;  2GH8 A;  5J09 A;  1JZ8 A;  1TMF 1;  4LKD A;  4MAD A;  2D6K A;  5BV6 A;  4P9W A;  2X5I B;  2VNO A;  4LHK A;  4LLF A;  4OI0 A;  3RZJ A;  3D0J A;  3AFG A;  3VV1 A;  3CZJ A;  3VBF A;  4UF0 A;  3OB8 A;  4EE2 A;  1SCS A;  2OQ6 A;  1ULG A;  1CIW A;  2J7M A;  3OBA A;  5EPA A;  3K46 A;  4CDU C;  4XXP A;  1K5M B;  1PM7 A;  1WMF A;  3FHI B;  3N9P A;  3HIF A;  4KQ7 A;  4AHX A;  4O7X A;  3PUQ A;  1M4W A;  2KM2 A;  3H3Z A;  3CNA A;  1ZA4 A;  4G4F A;  4QGL A;  2NQY A;  4BDV B;  4M4R A;  3WR0 A;  4LKS A;  1DQ5 A;  1O6U A;  5FPL A;  2QQK A;  1ND2 B;  3HBK A;  4P9J A;  3CBN A;  1HB2 A;  3SH3 A;  1B35 A;  1CAX B;  1T6G C;  4ZPI A;  3NAP A;  4P5Y A;  1Y9G A;  2E7A A;  3PU3 A;  2X8K A;  3VDC A;  2VMI A;  1NCR C;  4LPL A;  1CPN A;  1YUD A;  3GJA A;  4IEP A;  2HKX A;  2JDZ A;  2W2I A;  4XQW A;  2WS9 3;  2XB6 C;  4KBZ A;  3LAG A;  3NV4 A;  1CX4 A;  4CCN A;  4OHX A;  5F3I A;  1K42 A;  2J1V A;  5DUV A;  3ZFE B;  3AYD A;  1X8E A;  4Q4Y 2;  3RNS A;  1J1L A;  3HNY M;  4HXC A;  4BZ4 A;  1O8S A;  1TME 3;  3BOD A;  2D6M A;  4BQX A;  1F15 A;  1V6O A;  2ERF A;  2Y6K A;  5IVY A;  3K51 A;  1CIY A;  4IEV A;  3RYR A;  3VBU C;  1RUG 3;  4YW5 A;  4XBN A;  3E1F 1;  3TN9 3;  2W47 A;  3WF4 A;  4TXW A;  2BBV A;  3KT4 A;  1H2K A;  4Q0P A;  1RGS A;  4M4P A;  3WQ1 A;  3QBQ A;  4O9G A;  3P5B A;  1HRV 2;  2VOV A;  1FYU A;  4AK3 A;  1PGS A;  2J1R A;  4HKO A;  1NOV A;  3MID A;  5FY8 A;  2R7E B;  2AEZ A;  3J7L A;  2PHX A;  4C8D A;  2B5H A;  4O9E A;  5KWR A;  2QKD A;  4IE0 A;  4LBO A;  4J25 A;  2I07 B;  4AI2 A;  2NN8 A;  4WM7 A;  5F39 A;  3V56 A;  1XYO A;  5FY9 A;  2WN3 A;  3A0K A;  2ADE A;  2GN3 A;  2ZEZ A;  4A7Y A;  3O12 A;  1VB4 A;  3PL0 A;  1XQN A;  3VKM A;  1AR7 3;  1HRI 3;  1KIT A;  3H42 B;  2WYF A;  2YGM A;  4UXA A;  5FJH A;  2BNN A;  1EV1 1;  2EXK A;  3ON7 A;  4GJZ A;  4AFB A;  5C70 A;  3DKW A;  1QIQ A;  5A3P A;  1GNY A;  1OA3 A;  3UV9 A;  3VBS C;  3VKO A;  5A1A A;  5BNO A;  4LT5 A;  1CJP A;  4YZ4 A;  2W52 A;  3III A;  1ASJ 3;  4CDU B;  5ISL A;  2AYH A;  4E2G A;  4D3W A;  4Q27 A;  2A71 A;  2QQM A;  3MFC A;  4OLL A;  1O8P A;  4AHY A;  4CE8 A;  2WFF 3;  5FRE A;  1FV3 A;  1UMI A;  4XFG A;  2GH2 A;  1AXY A;  3PME A;  1RUJ 1;  3ME2 A;  4FO9 A;  3O0X A;  2VBB A;  1ZZC A;  1FOD 2;  1ULO A;  1LOF C;  2XBO 2;  1RMU 1;  2DTW A;  2GC0 A;  5DZG A;  2P3J A;  4RR3 A;  3WLU A;  1IS4 A;  3VBR C;  1C8M 3;  2PAM A;  1PGL 2;  4QQO A;  3CEW A;  1YFY A;  5EZW A;  3T2O A;  2JWP A;  2Y64 A;  1NCR B;  5FBJ A;  4GB3 2;  1KDM A;  5CKM A;  4CTE A;  2X05 A;  1JXN A;  5LK7 B;  4E27 A;  1O3S A;  2WJS A;  4WM8 A;  5F5Q A;  2E51 A;  4DOU A;  4C0H A;  2W94 A;  4HPK A;  2ET7 A;  1PVX A;  1XRU A;  3U1X A;  5GM0 A;  1HXS 2;  1XPW A;  3AZZ A;  3KV5 A;  3PIG A;  3FN9 A;  1KFU L;  2VMF A;  4IEY A;  1WCU A;  3RWN A;  1QJX 1;  1OUR A;  2VY0 A;  5SV5 A;  3WNO A;  3AYC A;  1ZZ6 A;  1BYH A;  4IQP A;  3ZSM A;  4N43 C;  3ALQ A;  3VBU B;  2Z4F A;  4FTS A;  4QQL A;  3GZT B;  3OUJ A;  1QMJ A;  1VBB 3;  1ZX5 A;  2VM9 A;  1ZYB A;  4LIV A;  1LKN A;  1W9F A;  4W50 A;  2ZA9 A;  3ILN A;  4JHZ A;  5FP8 A;  3MIH A;  4XYX A;  5BUV A;  5FYM A;  3CHX A;  2E7T A;  1AHS A;  2R49 A;  5F8P A;  4GD4 A;  2HYX A;  3MW2 A;  4YFZ A;  1POV 3;  3ZKU A;  1YYN A;  4GH4 B;  2ZGM A;  2ZPX A;  1VAM A;  1CAW A;  2HEV F;  3UKV A;  4AWD A;  4BJ0 A;  1SLT A;  2Z42 A;  4JRA A;  2B7Y A;  4QMA A;  1F5J A;  4CPB A;  4EWE A;  4PIX A;  3AMQ A;  3WDT A;  3EO6 A;  3PLQ A;  5CA6 A;  3D8C A;  3OYW A;  2YC4 A;  4WZF A;  2O0O A;  3I4I A;  4AI0 A;  4NUB A;  5H9S A;  5JMC A;  1MZF A;  4BH9 A;  2P34 A;  5C8W A;  1ZRI A;  4NID A;  3VBS B;  2LAL A;  4BQ3 A;  4A44 A;  3H8R A;  4AFM A;  5LRR A;  1LEC A;  1D2S A;  3UGH A;  3PIJ A;  1QJU 1;  4R9A A;  3H7J A;  3IT8 A;  4LIT A;  5A3M A;  3NJZ A;  5LA2 A;  3ZXL A;  1UY1 A;  1SFP A;  2WO7 A;  1S0I A;  2RS3 2;  4RGK A;  5GZF A;  3ZYH A;  4BWO A;  5KHI A;  2X5I A;  1CX1 A;  1LR5 A;  2GC3 A;  4YYO A;  2A5Z A;  1L3J A;  4D7T A;  3MW3 A;  1W90 A;  3N7L A;  3PU8 A;  4I02 A;  1OPM A;  1H8V A;  1F5F A;  5L19 A;  1GKB A;  5FZO B;  3RFR A;  2AR6 A;  1GYK A;  3VBR B;  5LA9 A;  4UOJ A;  1EUU A;  4P08 A;  2ZAC A;  2PHT A;  2V5Y A;  4OHY A;  1QDC A;  1K5M A;  4FSJ A;  2WZP P;  1U5X A;  1X82 A;  3CJI C;  1Q8O A;  1FNZ A;  2FMD A;  4IUG A;  3THT A;  3ZXG A;  3KV6 A;  2D3R A;  2A73 B;  4EWD A;  3WUC A;  4CXX A;  2QNK A;  5FK8 A;  5LBC A;  1LTE A;  3ES1 A;  1HV1 A;  4PIY A;  1ND2 A;  2NP0 A;  1LGB A;  2E7Q A;  3ACH A;  5FLI A;  1YQ6 A;  4ASL A;  1CAX A;  3LFI A;  4AHZ A;  4MET A;  4FVV A;  4M00 A;  4N43 B;  2JIG A;  2JDA A;  4ZXK A;  4QGM A;  5I0S A;  4XQD A;  1XXN A;  2WQ8 A;  5FZ4 A;  1EAH 3;  2CY6 A;  3WEZ A;  5JUV A;  5JSO A;  1DYP A;  3KV9 A;  5J98 B;  3T3Y A;  1KGY A;  3ZFE A;  1D4V B;  3C3V A;  3SEP A;  1RTV A;  3IBM A;  3RYK A;  3WDW A;  5A3N A;  5A6X A;  2UY9 A;  4K21 A;  4P00 B;  1REF A;  2BV4 A;  1BLZ A;  1Q8Q A;  3EMR A;  2DUR A;  3T2P A;  2ZX2 A;  1YIP A;  1GNZ A;  2HWD 3;  1VAL A;  2OX0 A;  1QY4 A;  4LK7 A;  1WCS A;  3B9C A;  4XUP A;  1C1L A;  1UU6 A;  4PLM A;  1TMF 2;  1YIF A;  2OS2 A;  5EP9 A;  3RGB A;  4PLN A;  4BYY A;  5AVA A;  2SLI A;  5FKB A;  3WQ7 A;  1RUC 2;  5FYZ A;  5JPN B;  2ZGU A;  1P8J A;  1XOY A;  1CWP A;  1GZW A;  1C8N A;  4Q4V 3;  5F7U A;  1VBE 2;  3P6B A;  4MXV A;  4BU2 A;  5CKN A;  4DPN A;  1POV 0;  1RUH 2;  1EPZ A;  1H1I A;  1RUG 1;  2CV6 A;  1JU3 A;  2PAK A;  3CIH A;  4R4Z A;  5BXX A;  3U4X A;  1W0O A;  3DF0 A;  3TN9 1;  4AI9 A;  5CEH A;  2JE7 A;  4LBJ A;  4DNY A;  3APB A;  4LBQ D;  3RDI A;  1B09 A;  2VMD A;  1XC6 A;  3LA7 A;  3CJX A;  3MGU A;  2DV9 A;  2F4L A;  3POI A;  3ABZ A;  3WDX A;  2HWE 3;  3TAY A;  2EIG A;  2EVX A;  3WP5 A;  2VPV A;  4CDU A;  3H1M A;  4RD7 A;  4XET A;  4U2A A;  3RJR A;  3CL1 A;  3CJI B;  2BPA 2;  1UCX A;  2DCJ A;  4QPG C;  4QWN A;  4UT5 A;  4XF3 A;  4JQT A;  3ITQ A;  3POW A;  2P6C A;  1AR7 1;  1HRI 1;  4NRO A;  2ZX0 A;  3H3L A;  4HFS A;  5CU1 A;  2NMN A;  2D5H A;  3ELN A;  4LO6 B;  4XCB A;  2TUN A;  3UKT A;  4LNV A;  5A7W B;  1YO8 A;  3NWK A;  1QDO A;  2IXC A;  3E5U A;  3N9N A;  2EXJ A;  4J1W A;  1W9W A;  4CU8 A;  5EIY B;  4JGY A;  1NY7 2;  4HET A;  1A8M A;  1K5J A;  1NCR A;  1DZT A;  1AR6 2;  2XJR A;  4NHY A;  2R04 3;  4YW7 A;  4AYU A;  2RS5 3;  2XML A;  1F8V A;  2UUR A;  1W6Q B;  4OZO A;  4QXC A;  2H0B A;  4YW6 A;  1GNH A;  2R32 A;  2ZHM A;  4KBB A;  3E5X A;  2WZR 3;  3MLK A;  3Q8A A;  4N9H A;  3Q8C A;  1SBE A;  1C8M 1;  2GNB A;  3ZIW A;  4D94 A;  3ZR6 A;  2QZ2 A;  3CQO A;  1ST8 A;  3U10 A;  4IW3 A;  1OLR A;  4L92 A;  3VBU A;  2BW8 A;  2ZEY A;  4KG8 A;  3H1W A;  3J9S A;  1OF3 A;  3T4H B;  1UZV A;  3PVE A;  1YFU A;  3B94 A;  4OUS A;  1J1T A;  4Q1R A;  4XFF A;  4DFS A;  4D6Q A;  2ILM A;  2W91 A;  3OBT A;  3DXU A;  4KI5 M;  1JYX A;  5IHR A;  1DGL A;  2W1S A;  2OT7 A;  4AVC A;  2VOT A;  3I3Q A;  3OCP A;  1PZ8 A;  1MEC 2;  5FP4 A;  3U07 A;  1GP4 A;  3IDE A;  1Z78 A;  4GAL A;  5FMC A;  1W8T A;  2OPK A;  3B5L B;  2AH2 A;  4GH4 A;  2C0Z A;  2R6Q A;  5IVE A;  1BMV 2;  5LY2 A;  1VBD 1;  2A3W A;  3UK9 A;  4CCK A;  1C28 A;  2Q30 A;  2VCA A;  1OD3 A;  1MS0 A;  3B9I A;  3IDB B;  4QHZ A;  1VBB 1;  3FBY A;  3ZMO A;  5IFT A;  4A4A A;  3FLR A;  4ISQ A;  1ZRE A;  3WP6 A;  5LEJ A;  1O3R A;  2BWC A;  1MS3 A;  4AVT A;  4DRV A;  1D4M 3;  2Q1M A;  4XEZ A;  1LHV A;  4FPK A;  5I93 A;  2MEV 2;  3BTA A;  1PZ9 A;  1VBA 2;  3MBW A;  3DKQ A;  3VBS A;  4NWW A;  3KZ4 C;  2VUD A;  4Q0U A;  2AGS A;  5CIR A;  4MG2 A;  1RUF 3;  1UY0 A;  4Q4W 1;  2UWC A;  1JN2 P;  1R08 3;  2EAL A;  5FO8 B;  4JC1 A;  5FZI A;  3AKQ A;  3HOB A;  3EBR A;  3ZYG A;  4CP1 A;  1RUE 3;  1ONA A;  3MZH A;  4QPG B;  2B9V A;  4ZZ5 A;  4DZG A;  1RUI 2;  2PHF A;  4XC9 A;  1US2 A;  2VCC A;  3NVC A;  3VHP A;  2K0G A;  4BIO A;  1RYY A;  5KXB A;  1W9T A;  2AC1 A;  1LOF A;  1GUI A;  4FFH A;  2R0F A;  2W3J A;  4P9I A;  5FZO A;  1BZW A;  3MIE A;  1BEV 2;  3ZKY A;  3IZO A;  2VVF A;  3B02 A;  4XFH A;  1PZ7 A;  1PIV 3;  4LA2 A;  3E6D A;  2V73 A;  3MV0 1;  5FZL A;  1QJX 2;  4GMP 3;  4AEJ A;  4B4R A;  1CGP A;  4UW4 A;  1PGW 1;  5JOZ A;  2XWB B;  4A3X A;  5E6H A;  3BYW A;  1H2N A;  3I3D A;  1GU3 A;  3W5N A;  3IDA A;  2BGO A;  2R07 3;  2WQ4 A;  2HWB 1;  1OVS A;  3THP A;  4CYD A;  3RJ2 X;  5FOJ B;  1DQ1 A;  5IYY A;  1K12 A;  3NV2 A;  2QQV A;  2XGX A;  3VL8 A;  1AUY A;  5DXD A;  2R06 2;  2VOW A;  1AX0 A;  3ATG A;  4R52 A;  2CGO A;  5FV3 A;  3ZO0 B;  4MGS A;  3V64 A;  4IEZ A;  1DYO A;  1LCL A;  3JU9 A;  1TG7 A;  1RIR A;  2NPI A;  4N43 A;  4ZHN A;  1US3 A;  2VZP A;  1H8T C;  1UYX A;  4FQZ A;  4QGN A;  2YU2 A;  1LOE A;  5FP3 A;  2RJL A;  3C7E A;  5C8C C;  1HQL A;  5ERL A;  3HQX A;  3H8X A;  3DV8 A;  3HT2 A;  4MYE A;  3B01 A;  4DXT A;  5GJ6 A;  5JLV A;  2YFZ A;  3MLJ A;  5SV8 A;  1CJD A;  3LCP A;  2BER A;  5C3Q A;  5CAD A;  3H50 A;  3VD9 A;  1DHK B;  1PHM A;  2E26 A;  3AZW A;  4XFA A;  2UU8 A;  4BQ2 A;  2VUJ A;  4HVO A;  1APN A;  3PVO A;  3O1S A;  1F2N A;  1JI6 A;  1JTZ X;  1PK6 A;  1QJU 2;  4PBP A;  5GZE A;  3KVB A;  2ZGO A;  4LKE A;  2QDN A;  4OYU A;  5E88 A;  3LFM A;  4B4P A;  2XH6 A;  1NT0 A;  4O61 A;  5FPB A;  1A8D A;  4I3G A;  4AG4 A;  1QJY 2;  2XHK A;  3J26 N;  2CAU A;  1U0A A;  3NV1 A;  2CDO A;  1UO9 A;  1RUN A;  2RS1 3;  5L73 A;  3HNM A;  2IXH A;  3OJB A;  2VQT A;  2HWD 1;  5T5O A;  2QQI A;  5APA A;  4FTE A;  3T0A A;  1UOB A;  2ATF A;  2WBK A;  4R4X A;  3POF A;  5FZ9 A;  3ZX7 A;  4LHL A;  2RR1 3;  3K3N A;  3BIE A;  1D7P M;  1RHI 2;  3R0R A;  1PM4 A;  3M70 A;  3O5S A;  4Q4V 1;  5HPO A;  1W04 A;  3WSO A;  3CJI A;  3IMN A;  1NLS A;  1AR8 3;  3IIA A;  4CDW C;  3GBF A;  1FAY A;  3T2Q A;  5FPX A;  1LHO A;  2NZ9 A;  2GMM A;  4Q8K A;  1F4H A;  1YLL A;  3U78 A;  1JUH A;  5GZD A;  4CU7 A;  3ZIX A;  3LOI A;  1JZ6 A;  1AJK A;  3O1T A;  5LZ6 A;  3M3O A;  2HWE 1;  1ZRD A;  2C24 A;  2IC1 A;  3W21 A;  1V70 A;  2GC1 A;  4Z92 B;  1NA1 C;  1UWW A;  2GP3 A;  2RVA A;  5IAX A;  2D3P A;  4LO7 A;  1HW5 A;  1H8T B;  4A42 A;  1W6Q A;  5BYN A;  5DAB A;  5C8C B;  5E8A A;  3JQW A;  5LBB A;  4AF9 A;  3HAG A;  3BU0 A;  1C5I A;  1V6I A;  3TOJ A;  3HR9 A;  5FJK A;  3WQB A;  4PLO A;  2Z5W A;  3GDB A;  4DY5 A;  5DAP A;  1AXZ A;  4N8M A;  4AI1 A;  3NST A;  2WS9 2;  1BBT 3;  4MO3 M;  4AQS A;  1WZX A;  3UKN A;  1ULP A;  1ZRF A;  4P9L A;  3RI8 A;  4LEJ A;  3QAC A;  5CAZ A;  5FP7 A;  4AEM A;  1JUI A;  5J37 A;  1TME 2;  4LTA A;  3USU B;  1JYN A;  2SBA A;  1N3Q A;  3V0B B;  1ZZ7 A;  2R04 1;  2RS5 1;  4K20 A;  3KT7 A;  3TEY A;  4QU2 A;  1RMU 3;  2X10 A;  3PNA A;  4TWT A;  5FZK A;  1QH6 A;  3VZL A;  4OQ8 A;  2ZGL A;  4CCL A;  2GAU A;  3P3N A;  1MS8 A;  1V6L A;  2WZR 1;  1I3H A;  2XWJ B;  2XVL A;  4QT6 A;  3ZYJ B;  4A2U A;  4YM3 A;  4QB2 A;  2Z2S B;  2WIN B;  4BXF A;  2B42 B;  2A3X A;  3IPV B;  3LB9 A;  3SLI A;  4X6R B;  3WXP A;  2VL4 A;  4S2F A;  3KWV A;  4L99 A;  2WNV A;  2PMW B;  4XJZ A;  2DVB A;  4H55 A;  1SCR A;  2DUP A;  1GP5 A;  1O5U A;  1VPH A;  2XLA A;  1VRH 2;  3M3E A;  3MHZ A;  4COZ A;  1AR7 2;  3AP9 A;  2WO2 A;  1QGL A;  3KF3 A;  3UJQ A;  3ZXA C;  5C3P A;  3HEI A;  4ARX A;  2GMP A;  2ZHN A;  4YVS C;  4QPG A;  1AR9 3;  1ASJ 2;  1BK0 A;  1J84 A;  1ZBA 3;  4OUM A;  4CDW B;  4M3C E;  3GNE A;  3S7I A;  4M0H A;  4P9G A;  3WNM A;  1L7Q A;  1NQJ A;  1GZ9 A;  4URT A;  2RG4 A;  2Y26 A;  1IPS A;  4Z2W A;  2WFF 2;  4CDX C;  3OGJ A;  2VW2 A;  1D4M 1;  5G04 L;  1UL9 A;  4DIN B;  1AF9 A;  3O0W A;  1UD1 A;  3ZXE A;  3ZSE A;  4IGO A;  2ARA A;  2FQP A;  2QQJ A;  3LPG A;  5GLV A;  4QHO A;  1RUF 1;  4MHU A;  4BLJ A;  3C2U A;  1R08 1;  3KS7 A;  1NA1 B;  2YMZ A;  3JD7 1;  3FUQ A;  2Y6J A;  1JHJ A;  1RUE 1;  1UNB A;  5AC9 2;  4B7K A;  4EQV A;  3C7F A;  1UX6 A;  2VEC A;  4O65 A;  4Q4X 3;  5ABJ C;  4LMF A;  2EID A;  3VHR A;  2G9Z A;  4Z1V A;  3F95 A;  5HI0 A;  1OPO A;  4C0B A;  2TBV A;  5F1R A;  2KD7 A;  3O14 A;  3HVD A;  2JG9 C;  2ZEW A;  3ZSL A;  4CPB D;  1JOJ A;  1O4Y A;  2RMU 2;  1SMV A;  5J48 A;  1NCQ C;  3FUO A;  4Q0S A;  5CKQ A;  3VZJ A;  2GNT A;  5EQU A;  4GMP 1;  3SQO A;  1LGN A;  1VBC 1;  1WLD A;  4TLG A;  1O3Q A;  1EP0 A;  4OHZ A;  2D6P A;  2XL7 A;  3GZA A;  2BRT A;  4GA9 A;  2R07 1;  5JSP A;  4FXK B;  4QDR A;  2BFU L;  2H6C A;  4BMB A;  2WZ8 A;  4XHB A;  3AYA A;  2Q4S A;  4HK9 A;  1IG3 A;  2FCV A;  2OW4 A;  4FI9 A;  4PF5 A;  3T09 A;  5C5T A;  2BZD A; 
#chains in the Genus database with same CATH homology
 2QQU A;  2OXB A;  4JQT A;  3UGG A;  4FFH A;  4QHZ A;  4CCE A;  5FMB A;  4HXC A;  4CCC A;  3H3L A;  3UGF A;  3ZR6 A;  3SC7 X;  2AEY A;  3HBK A;  1W2T A;  1ST8 A;  3UGH A;  2XQR A;  3LF7 A;  3PIJ A;  3KF5 A;  3LIH A;  3S5Q A;  1Y9G A;  5FK8 A;  5FK7 A;  1Y9M A;  4UFJ A;  4UFK A;  3LEM A;  4UFH A;  4FFF A;  4UFI A;  2QQW A;  3LDR A;  5FMD A;  4UFM A;  3U1X A;  3U75 A;  4AZZ A;  3LFI A;  2AEZ A;  3PIG A;  3U14 A;  4FFG A;  5FKC A;  4FFI A;  3ZR5 A;  2AC1 A;  5FIX A;  2QQV A;  3OSD A;  5ANN A;  4B1L A;  1UYP A;  3KF3 A;  5FMC A;  4EQV A;  5FKB A;  3RWK X;  2ADE A;  2ADD A;  3LIG A;  3NMB A;  4UFL A;  3LDK A;  1Y4W A;  4CCD A;  4B1M A;  3IMM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...