4B1LA

Carbohydrate binding module cbm66 from bacillus subtilis
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
162
structure length
162
Chain Sequence
TPFMSNMTGWTTVNGTWADTIEGKQGRSDGDSFILSSASGSDFTYESDITIKDGNGRGAGALMFRSDKDAKNGYLANVDAKHDLVKFFKFENGAASVIAEYKTPIDVNKKYHLKTEAEGDRFKIYLDDRLVIDAHDSVFSEGQFGLNVWDATAVFQNVTKES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title How Nature Can Exploit Nonspecific Catalytic and Carbohydrate Binding Modules to Create Enzymatic Specificity
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords LEVANASE
total genus 40
structure length 162
sequence length 162
ec nomenclature ec 3.2.1.80: Fructan beta-fructosidase.
pdb deposition date 2012-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 4b1lA00
3RWKX 3LDKA 2AEZA 3LIHA 4UFJA 5FK7A 3S5QA 4FFHA 4FFGA 2OXBA 2AEYA 3U14A 3ZR6A 4FFIA 3UGHA 4FFFA 1UYPA 5FMCA 5FIXA 3LEMA 1ST8A 1Y4WA 3ZR5A 3KF3A 5FKBA 2XQRA 4CCDA 1Y9MA 4UFIA 2QQVA 3PIJA 4JQTA 3PIGA 3UGFA 5FMDA 2ADDA 3LFIA 3SC7X 3LF7A 4B1LA 4B1MA 1Y9GA 1W2TA 2QQWA 2ADEA 3U1XA 5ANNA 4CCCA 4EQVA 3UGGA 3HBKA 3LDRA 3U75A 2QQUA 4QHZA 3KF5A 4UFHA 2AC1A 4UFMA 5FK8A 3OSDA 3NMBA 4UFKA 4HXCA 5FKCA 3IMMA 5FMBA 3LIGA 4AZZA 4CCEA 3H3LA 4UFLA
chains in the Genus database with same CATH superfamily
1XBFA 4CUCA 3MIDA 1VRBA 3C8XA 4XHBA 4XAAA 5EWSA 3E1F1 1GOFA 4NHXA 1W6QA 1RUC3 2A1XA 5CFCC 4I2OA 1AYM3 1ENXA 1JW6A 2VCAA 4DB5A 4IV1B 2Y0OA 1US2A 4N8MA 1MVEA 4JDMA 3U37A 2V72A 4KWLA 2ZGRA 3B9CA 4XETA 2K0GA 2W08A 2JG8B 3DCQA 4PHZA 3ATGA 4PLNA 2WFF1 4QXHA 3WOGA 3OUHA 1YLLA 4V2WA 4DXRA 3WW2A 4QXKA 2VMDA 5JPNB 1SDWA 4UFHA 2VZQA 1SACA 4Y26A 2V73A 1SMVA 2XBO2 5T5OA 1G9DA 3O5SA 4Q2FA 3NAPA 1NA1B 3VDDC 4PI0A 1W0NA 4S2GA 5DXDA 1D0HA 2JB8A 3A0KA 4NPRA 4P5HA 1EP0A 2YPJA 4Y20B 5FXWA 4BWOA 5HBAA 5BPXA 5T5JA 3DF0A 4YM3A 4MGYE 3GZAA 5FY5A 1G8WA 3L2YA 4Q4V2 3WF0A 3JCIA 3AB0A 5IVYA 2RS13 1TVGA 4OCTA 2NMNA 5I0RA 4GMP3 2O8QA 3MO4A 1AR91 2BGOA 3P3NA 4IGOA 4YVWC 5FRAA 4CSWA 1W2UA 4E9KA 2W46A 1ND2A 2XVLA 3HPNA 3O0WA 3HIFA 1NQDA 1VB4A 5LATA 5FPXA 4W6WA 5F5IA 3INAA 5FP7A 3JB8A 2WA4A 1PMIA 1B35B 4XJUA 5FR3A 3A22A 2VXRA 4LQRA 4AL9A 4HSJA 1YWKA 3OPZA 3I2DA 3R6SA 1GYKA 3GNEA 4IGQA 4LBQD 4QKBA 3ZN6A 2QQMA 3OY8B 1SBDA 3PJYA 1TZOA 1C8M2 4R9AA 1HV1A 3V0BB 3KV9A 4CDQB 3T30A 3USUA 3ZYHA 2NP0A 2W2IA 3CIHA 2ZJCA 5CU1A 1B35C 2A6WA 1N3OA 2EIDA 3KSCA 5J48A 3TN92 5DDJ3 4Y1ZA 1UOFA 2HJIA 2VZVA 3N36A 4JGZB 4XF0A 1A34A 2P17A 3I3QA 3RWNA 1SLIA 1FMD3 2VBPA 5I91A 3BTXA 3RI9A 4BQ3A 4PQ9A 5A6ZA 3DYMA 2WYSA 3C7EA 2FD8A 3LIHA 4YPJA 1OXCA 1POV3 2RE9A 4MO3M 4CDQC 3KV6A 5L9RA 2A6VA 3NVCA 3KLSA 4ORFA 4YGDA 5FZFA 2ETEA 1JU4A 2IXCA 1JI6A 1UZ0A 1VRH3 4I0BA 1XNDA 4GQ7A 4NHMA 3D3AA 4AFCA 4KBBA 1AR81 3PUQA 3S57A 3UKTA 3H8UA 1PGW1 4QQPA 5DUWA 3I49A 4OUMA 2ZEXA 1ONAA 5KC6A 1V6IA 3BIEA 5EJZB 1RUF2 5FYIA 3E6BA 5IATA 1QQP3 3VL8A 5T3NA 4AR2A 1J58A 1TMF2 2UURA 2VUJA 2WIIB 2E31A 2FMYA 3T0DA 2OX0A 1N1SA 1EV13 2PHLA 4R4ZA 4R9BA 4C0BA 4NIIA 1CQ9A 3S7IA 1QJU1 3MUY1 1RUI1 1IS6A 1CAVB 4Q4X3 2DTYA 1FX5A 4EYUA 3T0AA 3SQOA 3X29B 3OBTA 5HV4A 3I2HA 1VBB2 2WSUA 1IPSA 1UZVA 5IK7A 5JAXA 4EZHA 1ZVFA 2E7AA 2ERFA 3MHZA 2WUHA 4LBNA 1NCQA 4CDWC 5ISLA 2D7FA 5A33B 1BMV2 1OVPA 1HRV2 3ZYFA 1CX1A 2X5IC 5CFDA 2HLEA 4CEYB 1MS0A 3B94A 3MI8A 1UQXA 4K8RB 4Q4V3 3ST7A 4MVTA 5C6CA 4NAMA 2UWCA 1W6MB 5A3LA 4QDRA 4CZSA 4Q4Y2 1PK6C 5FY0A 2XGXA 4LHLA 3M3OA 4ZS3A 3SH4A 4QWNA 4AQTA 4AI2A 1HIXA 2K2SA 4FPJA 1ZNPA 4O9GA 2VM9A 1COV2 1URXA 1DGWX 2WT2A 1MQTB 1BHGA 1XE0A 2XLAA 3OYWA 5FP4A 1NX9A 2QQWA 3WDWA 4CEWA 4OUSA 3GBGA 4IV3A 4LO6B 1CX4A 4K8FA 2XBO1 1CAUA 1O5UA 2FBEA 4Y1VA 3N3HA 4UFKA 2BWAA 2R1DA 1QMJA 1WLCA 4YVWB 1OT5A 4AAXA 1H8TC 1I3HA 4ATFA 2YGMA 3KV4A 4NROA 1CZSA 2D40A 3JZVA 1FYUA 2KXLA 3OJBA 3HNBM 1SDDB 4ZS2A 5BYNA 2YU2A 4OLLA 5E89A 3GM8A 1BCXA 5K0UA 4GJZA 2O1QA 3O7OA 4U36A 2D97A 3CEWA 1C28A 1BVP1 4FOVA 1HXS1 1D4M1 4ZXKA 3POBA 2Y8KA 2WAAA 3SEEA 3WDXA 4RN5A 1CZVA 1SBFA 2BQPA 4RHV3 1H4HA 1CGPA 4AHYA 3G7DA 4QPWA 1HRI2 5FZ7A 4KU8A 1XE8A 1CJDA 4META 5CYYA 2CGPA 5A80A 4QKFA 1XNTA 5FY8A 1NCRA 4ISRA 4Y5SA 2WWSA 4IEOA 1JZ5A 1G9AA 2VW0A 1DQ6A 4ITCA 3HJRA 4O61A 1AR82 4TYSA 1CPMA 5A3MA 5FPUA 1LECA 4LIVA 5JXGA 2WR9A 1C8M1 2QVSB 1MZ6A 3FUOA 3MICA 4FI9A 3VBRC 1KDKA 1SEFA 2QQNA 1IS3A 4DS0A 1RUJ3 1V9U2 1R64A 2IVIB 3I4IA 1RHI2 4UW5A 5DABA 3RS6A 3JXSA 3TAYA 4DXZA 1J59A 2ZHNA 2WWUA 5FP8A 1QJX1 4XDOA 5FO7B 3ZLIA 4MYEA 3ZN5A 1RUH1 4XUPA 4CXXA 2B46X 2A70A 3ABZA 2A71A 1ZRDA 4HL0A 2YPDA 2C9KA 1M06G 2DURA 4Y5TA 2XPJA 1UF2C 3K48A 2JD9A 1UU4A 4EN9B 3BVCA 4UT5A 4XUNA 3S0MA 1ENRA 2Y6GA 5BNPA 4D0QA 2PAMA 5C9AC 5A32B 2XHKA 3UYJA 2QDRA 2JXAA 2BBVA 2AUYA 2BV4A 3C2UA 3PHMA 1W2AX 4FT8A 3ZYBA 4N9IA 3POYA 1W8UA 4GMP0 4MGIE 2B5HA 2ZZJA 1A6CA 1GKBA 4L11A 4ZPIA 1PZ8A 3THDA 3ZDSA 2VZRA 4BMEA 4GALA 4KGGA 3GJBA 3WHUA 1KS4A 1W8HA 2W68A 3NV1A 2ZBJA 4NRPA 2ZABA 1VIWB 4PCRA 3MF6A 5F32A 2JKBA 1ND3C 2ZAHA 4MGKE 1LOAA 2R061 5A7WA 2X5IB 5JR2A 4MG2A 3LEMA 2QKDA 2XJRA 1N1TA 1FPN3 2VMEA 2Y6JA 4BOWA 3RGBA 1PIV3 3MPBA 4XILA 4A44A 3N9PA 5BV6A 3LPFA 2ORZA 3ZFEB 3IAQA 2DVDA 3FJSA 3MPPG 3PTRB 1ZBA1 4X6RB 1VBC1 5EIYB 2R0HA 3PU8A 4AFAA 3VGIA 4B7KA 3QBQA 2UY9A 3BOWA 2GAUA 2ZGLA 3DPRB 5BNPB 4NMIA 4Q5OA 5FPBA 2FDIA 3H1WA 3HVDA 4EROA 4M00A 2R30A 3VLBB 2QBXA 3LE0A 2ENRA 1F35A 1YQ5A 1OLQA 3FFQA 4LBMA 4QT6A 5BXXA 3POSA 1OOPC 3J8F3 2WZPP 5I8TA 4HVQA 4HANA 5CADA 1LOEA 4HVRA 1XC6A 2RJKA 5FJKA 4CP0A 3PLQA 2FDGA 2WRAA 3VB9A 1UPIA 5F8PA 4AYUA 5C8CB 1AJOA 1KEXA 1YQCA 1W28A 1RYYA 2OUHA 4P9LA 2BJSA 4XXPA 2I2SA 3R4DB 4JGZA 1HRV3 4K1YA 4LOTA 4OHWA 3VBSB 1I9RA 1TNRA 3WSOA 3JD71 1ULOA 1QJY1 1YQ2A 4HN0A 1V9U3 1RUJ2 4ZU7A 5IT6A 1YIFA 3RFRA 1H8VA 5LA2A 1UYYA 3QOPA 1H1AA 2B45X 3K46A 2EIEA 2HWC2 4Q0SA 3GZUC 3ZSKA 4RSUA 4AOCA 1CPNA 1LNSA 1W6OB 3AKTA 2QDNA 4AI9A 4Q4X2 1UN1A 3BU7A 4CEYC 3Q8EA 1AR83 1MR5A 3TRSB 5H9SA 5IFPA 4FFHA 5JOZA 4M0NA 1NCQB 2GMMA 4K1ZA 2XJQA 4CP1A 3POWA 5FMCA 3RJRA 3GJAA 1FMD1 2YG0A 4UFIA 5TSWA 4OUEA 3SNMA 4H2AA 1OLME 4DEVA 3O1UA 1POV1 2E7QA 1OQ1A 4O7XA 1MEC1 2EXHA 3N4MA 4D6QA 3I59B 1LGCA 3USSA 1F8VA 1QJEA 1WW6A 1OH4A 2XVGA 3CMGA 3VHOA 2WN3A 2IZWA 3DXTA 1RUI3 2D43A 2JDKA 1RUE3 2VD7A 4BB3A 2RS32 2A73B 4FXKB 4QB2A 4QU1A 2VL4A 1W9TA 2YBKA 1S4CA 1AL21 1H30A 3AMPA 3W21A 5KWRA 4JTOA 2YBPA 2DVFA 1BQPA 4M4RA 2JDZA 3ELNA 3MF9A 1FMD2 3ACIA 3BN6A 3T1MA 5FMDA 4HMZA 4HSLA 2R043 4XBLA 2WO3A 1JZ7A 4XZUG 2PLV1 4XCBA 1LOFA 1IS5A 1JBCA 1A8MA 2BBAA 2AR6A 4LULA 1MS9A 3AKSA 4XZPA 1AYN3 4FP3A 3AP9A 3ZYJB 1MQTC 1X82A 3VD3A 3OGRA 4YW1A 2DU0A 3VDAA 2XJVA 3ZPYA 2ZMKA 4D7TA 2JDAA 1YFWA 3IZOA 3AYAA 3QLQA 4WVWA 1STMA 2W3JA 3AMMA 1DU3D 3DECA 2VJXA 2EAAA 1CONA 1PO23 4YW3A 4TLGA 2TBVA 3OF1A 3QCWA 5JZGC 1VAMA 4CVUA 4OZOA 4FPEA 5AVPA 4K3UA 2ZA9A 2FHRA 3RI8A 1L3JA 3MV11 3T2PA 2CWMA 2RDSA 2Z69A 4NRMA 4DY5A 1UXXX 2CV6A 1WZXA 1PO12 2ZX1A 4LA3A 4E8DA 3WNPA 1AR62 1V6KA 1OMIA 3KB5A 2GZWA 2HWF2 5FZMA 5IVJA 4IEQA 2YU1A 2D6LX 1ZRIA 2ZPXA 3RYKA 2BOIA 3ZXFA 3C7HA 3ZFGA 4WVZA 1DQ0A 5FXVA 5BNOC 3PL0A 5CA6A 2QQPA 1W99A 5CEHA 1ZYBA 4WVVA 5FY1A 2WO7A 4DMIA 2DU1A 1ULDA 1DBNA 2J42A 2WFPA 4LT5A 5CKQA 5C3SA 3EBRA 5KXEA 4AGVA 2VO5A 1LJ7A 4Y4YA 4YFWA 1FV3A 3KQ4B 4GZ9A 3PIGA 4WM8C 4MGQA 2PHRA 2JEMA 4P5YA 5LK5A 4KQ7A 4XE9A 1C8NA 2VUAA 3DL3A 3U1XA 2CY6A 3EMRA 3ORJA 3AX4A 4O9EA 4DPNA 1ULFA 5F5QA 3K77A 3LDRA 2EXKA 5ACA3 5IAVA 1TMF1 5FZEA 1ZBE3 5KHGA 3OGJA 4XJ9A 4CDWA 3O1VA 1RIRA 4HK9A 1R093 3OY8A 4XDQA 2EF6A 5EYXA 1QEXA 1AF9A 3RG0A 4PIZA 5ABJC 2MEV3 3WF4A 3HWJA 4DFSA 2E51A 2WAOA 1VBB1 1WCDJ 4ONUA 4CEWB 4BXSV 3ACLA 4PI2A 3Q9OA 4XHXA 3V0AA 3L2HA 3MZHA 2VZTA 1AL0G 1DGWA 1NY71 5LBBA 5J36A 3FFZA 5JDBA 1H9WA 4Z82A 4Y24A 3HBZA 4H7MA 4KMQA 3VZMA 1AHSA 1OKQA 4A3XA 4AW7A 1C5IA 2J1VA 4Z8BA 4LR4A 5A7PA 4DUXA 5JI9A 4WM7A 1JN2P 1LRHA 4KH9A 4N53C 5ERLA 1C8M3 4YNIA 1LEMA 2LM3A 3RMYA 5I8YA 3O12A 1LR5A 1U5YA 2MPFA 3RZHA 1UKRA 2RMU3 3R4SA 5DG2A 3PMEA 2VOWA 4EN7B 3O1RA 2D5HA 3AVSA 3FBMA 3I2FA 4RR3A 1TME2 1YUDA 1W04A 2IXKA 2YBSA 3IPVA 4GD4A 4UWDA 2UWAA 5FP3A 2X05A 3MW2A 3UT0A 3ZYRA 2GMEA 4NOTA 2GN3A 5CFCA 2WN2A 3N9LA 3JB4C 5D1IA 4OHXA 1JOJA 3POFA 4XFGA 2KA3A 2R072 5FYYA 5GZDA 3LPGA 4GH4B 1FNYA 2IC1A 4A7KA 1ZZ6A 2R063 5FWJA 2RS12 1KRIA 4ZXEA 1XB9A 1MACA 3AL6A 1W8NA 4LO5B 3LD8A 2IFRA 4E4SA 4NWVA 4CPBD 1O4TA 4J1WA 1WLWA 2JG9B 1S0FA 1Y9QA 2WL1A 4MHUA 2RG4A 2W95A 1UYZA 3OEBA 3HQUA 1O6UA 4CCCA 5HCAA 5DZEA 4LE3A 2OYZA 4BQ1A 3AP4A 4UF0A 3I3DA 1O8SA 1IHMA 4QX3A 3H7YA 1EAH2 4COWA 4NR1A 4CPBA 3WEZA 3EO6A 4GB32 3MEPA 5AFEA 3WG3A 2JIJA 1LHOA 4J25A 1FPN1 5JPMB 2XWJB 4Q29A 3BCWA 5DZGA 2NPIA 1LU2A 2D6OX 4GIQA 2GSYA 3M3IA 3MW3A 3NJZA 1OPMA 3ZFFA 3PU3A 5T52A 5JR7B 3VKNA 2DFCA 3BUCA 2V4VA 5JSPA 4E2GA 1FOD1 1LHNA 2FCTA 1BMV1 1JS9A 1PVXA 2ET7A 1G6NA 5FY4A 3GBWA 1QJY3 1RJ8A 2A3YA 4EWEA 1X9PA 4LNVA 4P9XA 3N9MA 2BP6A 1DIWA 3JBG3 1OURA 5L19A 1HB1A 1AR73 2XXZA 3Q8BA 3ZSMA 3MGUA 5EJ1B 2XJPA 2X8KA 5J1XA 5FAXA 4LE4A 3EB7A 5LCWL 1JOPA 2E7TA 5JUVA 1D2QA 5KHIA 1QJU2 1QNWA 2P3IA 4S2FA 4W6XA 3ECQA 3K3NA 2AYHA 4GKYA 3G6JB 3GCXA 5FLIA 4ET7A 5KXBA 2B9UA 4L2NA 1NLRA 5LW9A 1XU2A 4XJAA 1O3QA 3PUAA 1KS5A 1ULGA 2Z42A 5H9QA 4SLIA 4WZCA 5KHKA 5C3QA 1AUYA 1A78A 1BBT3 1OSGA 1R1A2 1M4WA 2E53A 3LSEA 1YXWA 4XEZA 3WDTA 3LFIA 4XFAA 3PVNA 3O1PA 1MS8A 4BXFA 4MLOA 4FPYA 4HFSA 1QXJA 4IEWA 1W6NA 4BE3A 5DAXA 3WQBA 5F37A 3VBUB 1VRH1 1JU3A 3NAPC 3K51A 4RS5C 3DKWA 1G86A 5F39A 1AL23 4COVA 1E57A 2OS2A 1VBE1 4IUGA 1CAVA 1NLQA 3KD4A 5LRSA 4FPLA 4Q4W1 1W2OA 1D4M2 1NZIA 2D6PA 5J7MA 2PLV3 1UOJA 5F9TA 1EPZA 1RUE1 1ST8A 3VKLA 3WP4A 2TEPA 4HZFA 1Q43A 1IQAA 1R092 1R1ZA 1R1A1 5DAVA 4YW6A 5FZ4A 4NJ4A 1LCLA 3KCCA 5FP9A 1W9SA 1UIJA 2D6KA 2IXIA 3WNXA 2FMDA 3IDAA 5ACA2 4Q0PA 3E97A 1GSLA 4Q4X1 4JGZC 5J37A 3UK9A 4RL7A 1H1IA 2D6NA 1GANA 4DRVA 2PQSA 1PZ9A 4NRQA 3W5NA 1EPWA 4DXTA 2VG9A 4AFBA 4BIFA 5I93A 3H3LA 2BUKA 2JG8A 4FSJA 5F3CA 4XTMA 3B00A 4GH4C 1YI7A 3VKMA 1SFYA 1CN1A 4CEYA 2PMWB 5C3OA 5CFDB 2HWF1 3EJKA 1Q8SA 3HT2A 4OHZA 5A6XA 5ABJB 1EUUA 4AE2A 5FBJA 4QGNA 2H0VA 1DF0A 3NKGA 4HONA 1K5MB 3ASIA 2R062 1HB4A 4CU6A 4AEKA 5JZGA 3BTZA 2VMIA 3Q8AA 1S2BA 5ANNA 1WMFA 4PT6A 4Y20A 1RXFA 1AR63 1PO13 2W94A 2VOTA 2R1BA 3OYWB 4XJZA 4EN8B 3ON7A 5F6LB 3OCPA 3A7QA 4IEZA 1VBA3 2QFEA 2EICA 4JDNA 4AWDA 4FBFA 5IHRA 4LHKA 1TME3 3LA3A 5B4XA 4C1WA 4QPGB 1LHWA 4Z2AA 1YC61 2VBDA 3E6CC 1K42A 4IW3A 5FY9A 1H8TA 2Q8DA 1EAH1 3POGA 1RHI1 5JVVA 2RMU2 1W8TA 3KF3A 5DAPA 3T0BA 4IEUA 2Z4FA 1Y9MA 2DF7A 1ZZ7A 4JKMA 3S30A 3NRUA 4B1LA 1HX6A 4NIAA 4JRAA 1OUSA 3KVBA 1R091 4Q4Y1 1A3KA 2F4PA 3GGLA 3IB3A 3K3OA 4PF5A 4B7EA 4CU9A 1XYOA 1JZ4A 1O5LA 2YV8A 3ZSJA 4MGTA 1UZWA 2YGLA 4BK5A 2V4AA 5FV3A 5I0SA 1MZ5A 3IMNA 5FYTA 5KHJA 2GNMA 2WO1A 1K45A 1N1YA 5HXVA 4BDVB 1QOSA 1QY4A 2XUEA 2P5BA 4YVSA 3VBHB 1IKPA 1U5IA 3O1OA 1RUF1 2V09A 1XNCA 5IUQA 3E5QA 3UGHA 4LBQB 2ZGTA 2VZ3A 2BPA2 2JG9C 4QM9A 5A3UA 4WZFA 1AX0A 1SBEA 4LBLA 4RS5B 1NCRB 1UO9A 4JHZA 3OUIA 2F6BA 4AVSA 4BH9A 4M3CB 1WA4A 1GNHA 4TN7A 1WCQA 3FX3A 4WVMA 3RNSA 1GNZA 4EV0A 2Q1MA 3VBHC 3V65A 1DLLA 5EP9A 4XIKA 4C1XA 4D6SA 4UF0B 5JXHA 5K0UB 4RD7A 5JWPA 3DV8A 4QGLA 4BLJA 1WD4A 3RWKX 5F7UA 2VQ0A 4P9WA 5FIXA 1KITA 4LEJA 4S2HA 2DDUA 2VZSA 4OI1A 5A70A 3EHKA 3R05A 1BVVA 1ULCA 5C9AA 1PNFA 1DZRA 2WBKA 3AYDA 3WG4A 1ULPA 5ANQA 5E6HA 4HG6B 2AZ5A 3T2OA 2Q4SA 4P9JA 1BZWA 1OQDA 2B8MA 1RUG3 3FUQA 4N7IA 5CIRA 1X9TA 2QE3A 2VQAA 3W5MA 4L9BA 1HQNA 4IE6A 3RZMA 2ZHLA 5DQ0A 5JLVA 4Y22A 1VP6A 4DINB 2UWBA 3U4SA 4AEMA 1ND3A 2D93A 2YUEA 4XAEA 3BTYA 1VBA2 4OULA 2CNAA 3MLJA 4TXWA 3V64A 5L7OA 2XDVA 4ARYA 1LB2A 3MLLA 3NJYA 5FYBA 5JIUA 2BYVE 1D7PM 4AHWA 2X5IA 1L7QA 4YG0A 4YZ2A 5CFDC 1WMDA 2Y26A 2BOJA 3IKWA 1RUOA 4KGQA 2OZJA 3AVRA 4LBJA 4XBQA 3SHRA 5FK8A 5M0TA 3ZXLA 2A6ZA 4A7YA 2GALA 3JU9A 1QHDA 1SCSA 5E8AA 1SLBA 1NG0A 2BTVC 4CDUA 1ND2B 3B93A 1U12A 3VBSA 2WLPA 3CJIB 3IWZA 5AC92 4Q1RA 2CL2A 2VCBA 3KT7A 3M3EA 2W91A 4UW3A 5GALA 3PVOA 3VV1A 4BIOA 3HNYM 1E5IA 1DP0A 1Y4WA 4V2VA 2Z5WA 4IE5A 5GLZA 5IVEA 2W9XA 4Y5Z0 1RUE2 1DQ2A 3HD8B 4G4FA 1RUI2 4K20A 5T50A 2XLGA 3GZTB 4JX0A 3WF3A 2W52A 3H0OA 3LOBA 1PX4A 4XFIA 4W8JA 3HBKA 1DQ1A 3PVEA 4PQQA 2W1QA 2ZGOA 2PHFA 3DEMA 3TYJA 4D7YA 3JBG1 4JKLA 2JECA 1HRV1 3HN3A 3HNMA 3POIA 3JD73 4R8HA 5JXIA 2O0OA 4FPGA 4AVCA 1UY4A 4LMFA 1SQ4A 2K9ZA 4MHRA 1YO8A 4HVOA 3VDCA 3BI3A 2XVKA 3URFA 3WP3A 1QJX2 1HQLA 4QX0A 1CIYA 4AHZA 3BKZA 4PDWA 2HBUA 1ZRFA 4BQ2A 2WKKA 3RMXA 4FP2A 1NOVA 5LBCA 2WABA 4C8DA 4QQLA 3SLIA 2ZXQA 1YCIA 3KVAA 2JE9A 1MS3A 3U10A 3PUIA 4Z07A 1MZFA 1Z7S1 2ARXA 4Q4W2 4YW2A 3O0VA 1VPHA 4QQHA 3DYOA 5FUIA 1MPXA 1HJFA 5C8CA 3P6BA 4F8AA 4J1XA 4XMIA 5A3OA 3VUOA 1R1A3 4CDQA 4YSFA 2WNVB 2ZGMA 2Q0AA 4Q1PA 4RGKA 4LXLA 3RYRA 3KV5A 2EALA 3O0XA 1HLCA 3J8F2 5DUUA 4FAHA 1VBE3 1W2NA 3ACFA 4JCKA 1OLRA 4INDA 4IL7A 4CDUC 1N3QA 1NKGA 1OQEA 3ZM8A 5IVCA 3KWVA 1HRI3 1W06A 1CZTA 2VUDA 2J22A 2W1UA 5L36A 4BISA 3OGSA 4O65A 2WNEA 4YGBA 4JGYC 3H7JA 3QH6A 2ZEYA 1XQNA 4MXWA 1QJFA 3WW4A 2HWB2 5FQ0A 1AR72 1GNYA 2XKPA 4NUBA 5DPNA 3A4UA 4PIXA 4BA6A 3CU7A 2AGSA 2OW4A 2RR12 3I2OA 3RVHA 2KR2A 1VBC2 2VGDA 3N7JA 2VNOA 3LA2A 4LTAA 2YC4A 1PMJX 2ZGNA 3LSDA 2LUWA 1QH7A 2QNKA 2IXJA 2ZHKA 1OD5A 2BNOA 2JDUA 1DQ4A 1DZTA 2XQRA 3RSJA 1W3VA 2J1TA 3MIEA 4ZKTB 1PMHX 1G9BA 5DUXA 1F2NA 4DIQA 1IG3A 4ZZ8A 1JUHA 2WNVA 3WNOA 1W8FA 2D3RA 3WR0A 4DO0A 3J7NA 4R9DA 2OZ6A 2WINB 3ENRA 1COV3 1EAH3 2Q1ZB 1LHVA 4R52A 1PK6A 2CTVA 3ETPA 1PZ7A 2RS53 5FKCA 4URTA 3VBOC 4CU7A 2J1UA 1RUH2 5FZIA 5FXXA 4KU7A 2BDRA 4Q4Y3 2RDRA 3KQRA 4FFIA 5EYYA 2BZDA 1UY2A 3BPZA 2Y38A 3D0JA 3CL1A 2QQKA 1VBA1 2CDPA 2BW8A 5K4LA 5IK8A 4L97A 2QQVA 1QH6A 1QJZA 4MUVA 1V6JA 1AL22 5GM0A 3CJIC 2ZTNA 2R6QA 3SH3A 3T3YA 3U07A 2XL9A 2R073 2ET1A 3NKTA 4N53B 4OMDA 4WM8A 3D4KA 1RHI3 2DV9A 4P9IA 2HYKA 2Q5TA 3IDEA 3T1LA 4B3NA 1XNAA 2D44A 2B7YA 1NAEA 2FDJA 5C70A 2BERA 2QCSB 2XH6A 2YZ4A 1JXNA 3J7MA 3R4UA 3VD7A 3BB6A 3FLRA 1GOGA 5FY7A 5GLUA 4CCEA 2WZR2 1U5XA 4AVBA 3O1MA 3IIAA 1XSQA 3VBUA 5C4WA 3K4ZA 4OHVA 5J09A 5K0UC 2VUCA 5DAWA 4YFZA 2Y6HA 1NT0A 4YVSC 4CCDA 2Z2SB 3JUUA 3E6DA 4W4ZA 4Z92B 1N1VA 2D98A 4ZU5A 5L9BA 2MEV1 4AI8A 5LA0A 3BALA 1RUF3 1UMIA 1UU6A 4OHYA 3ZYIB 4BHPA 3NNFA 4LUMA 2P34A 2A6YA 3EQEA 2P1BA 2DVAA 4ZY9A 5FLJA 1RUC1 3IIIA 3JBG2 5CNAA 5FPVA 4XW3A 1DG6A 1H8TB 1IPJA 2DCKA 4QHOA 3M3QA 4QPIA 2JD4A 4UAPA 4UW6A 1VBD3 4AEDC 3B02A 2L9LA 5D8AB 2OPKA 4FTBA 3AP6A 4WM8B 3FHAA 4QM8A 3T08A 3IAPA 3AFGA 3ZFFB 2FQPA 3CJXA 5LA9A 4QQOA 4E4DX 4SBVA 4YZ4A 3W58A 1E5SA 2OT7A 1UY0A 4KWKA 1XJAA 1LESA 4XFCA 1JH5A 3HAGA 5FUPA 4AFDA 1ZBE2 3UJQA 4UW4A 1UOBA 2C26A 4XMAA 2PHDA 1ZM1A 5IFTA 1NXMA 1QU0A 4HOOA 4BM8A 4EQVA 3ZPOA 4PBOA 1R082 3POEA 5LK7B 4DQAA 1JMUB 4MGZE 2VNRA 3LEKA 1HKDA 5EPAA 4CCKA 2WFF3 1OA4A 3SKJE 5KXCA 1NE6A 4L8QA 2RS11 3A21A 4IXLA 4AHXA 3ZIXA 1Q5OA 2AEYA 4IE0A 5A1AA 1AR93 3B7MA 3AZWA 3VZLA 3H8XA 3HQXA 5HI0A 1H4GA 1NQJA 1FXZA 2QQJA 2K46A 3RPQA 4XOGA 1S0EA 4P9GA 4CCNA 1FT9A 2UU8A 2W1SA 4AFMA 3SCGA 5FMOS 1LEDA 4F7ZA 3OBZA 4Q27A 1NLSA 4V1PA 5JMCA 3EXUA 1UX7A 1PGSA 4FXGB 5SV8A 4XYXA 4ASMB 4PLMA 3RYPA 3TB0A 3T4VA 3WDYA 1OA2A 2H0BA 4GMP1 5A32A 3SITA 2ARCA 1LENA 1QDOA 2Y60A 1DYPA 5B4NA 5LEKA 4OVEA 3S7EA 3PNAA 1W6NB 4IGPA 2DBNA 4QXBA 3LKJA 1GP5A 2A3XA 3S5AA 5FYSA 5FZDA 1RMU2 2A6XA 4AEDA 3TEZA 1VR3A 1GP4A 2R7EB 4B8EA 2D5FA 4EE2A 5I0TA 5F1RA 2XB6C 4Q8LA 4YWAA 5JCTA 3CQOA 2NLRA 3GDBA 2A5ZA 1UX6A 1WGPA 3NAPB 4X6QB 2AH2A 1IZ3A 3ZO0B 4YW7A 3SXWA 3OPTA 1KFUL 1YFYA 2VBBA 4BQXA 3BIWE 4NIDA 3KZ4C 1WCUA 4JVAA 4BQWA 3TNQA 2C5DA 4LJHA 3VBFB 4A2UA 2WZR1 3WW1A 5BNNA 1OOPA 1ND3B 3I54A 1S0DA 4FQ4A 3JQXA 4AZZA 4AQSA 4RQPC 1ASJ3 3PUHA 2XUMA 3RZGA 2MEV2 1XSRA 5DDJ1 1ASJ2 1I5PA 1V6MA 5CISA 1U5ZA 4FFFA 2B42B 1GZWB 2Q30A 2VMCA 5EV7A 1X7NA 4WBBA 2IVJA 4LKSA 4DNYA 1OD3A 5DUVA 2V5DA 2LTNA 4PDWC 4BCUA 5L7OC 2VVEA 5IJRA 1J3QA 3IPVB 1S0GA 5EHDA 1UY1A 2ARBA 2LW8A 1YNAA 5LBEA 1T2XA 4OQ9A 2C0ZA 4HXCA 5BY5A 3J7HA 1Q8VA 4LIUA 1LAJA 3U4XA 1QNYA 5CB7A 4FOYA 3PUSA 1S1AA 2XR4A 3U78A 1HRI1 2XJSA 1NY72 2ZMNA 4TLFA 3TNPB 4CA9A 2ZGKA 3KM5A 1JYNA 5I0UA 4QX2A 1XNBA 1EYBA 2RJ2A 3I3MA 3VBSC 4NHLA 2C4XA 3S6PA 3EYPA 4Q8KA 2ID4A 2HWC3 4YM2A 4QXCA 5HCHA 3WW3A 2GC2A 5D8AC 1PK6B 1SZBA 1TG7A 2G1MA 2GP3A 4DEQA 4AVVA 1JZ6A 5GJ6A 1X50A 1DYOA 2WJSA 2QQLA 2YYOA 2BRTA 2GC1A 1JZ2A 3VL9A 2PAKA 3AJYA 3KF5A 3AYCA 3OB8A 5F3GA 3I2KA 4F3JA 2VTXJ 1GZWA 1O4ZA 1XOYA 1ZA7A 5FUNA 2C1FA 1OC1A 4EN0A 4TTGA 4NHKA 4UFLA 5B2GB 2WNUA 4GA9A 2IUWA 1HW5A 5E88A 3U14A 2VW2A 2FDKA 1WMXA 5F5CA 3FHIB 5FYMA 4A42A 4COUA 1VAKA 3WNKA 4GH4A 1JODA 2MHFA 1Q56A 3Q8CA 2TUNA 2XBO3 1LOCA 5E1RA 1AXZA 1COV1 4YGEA 5K8SA 1AYN2 5IW0A 3MIBA 1YJKA 1RUD2 3E5XA 1O59A 2HYXA 2XHNA 3AKQA 3LFMA 4Y22B 5FYCA 3RRDA 1ZZBA 2VXJA 3OEAA 3ZSLA 4JGYB 2R042 4FQZA 4PJYA 3IT8A 1PIV2 3SH5A 3ZIWA 3RJ2X 2AEZA 1UPSA 1GP6A 2HWE1 2G4IA 4XUOA 2IWGB 2W39A 1Y7BA 3F95A 3N7LA 2ZX0A 3BGAA 4M4PA 1PVC1 1UZYA 2PYTA 3E5UA 5I0DA 2LROA 1GQHA 2G9ZA 2NYYA 2WQZC 2CAVA 3I3BA 2GN7A 1TME1 2E6VA 1JYIA 1GZ9A 2RS51 3RZJA 4IV1C 5L9VA 1LTEA 4QPIB 5BNOB 5A6YA 3THCA 3WDVA 5BNQA 2BVBA 1Q8PA 1H0BA 1UD1A 3H8RA 2RHPA 2JDYA 1BEV1 4FPKA 3H1YA 4FAGA 2D6MA 1S0CA 1QXPA 1R081 4M3CF 3UKNA 2PFWA 2R071 1EY2A 1W0PA 2NZ9A 2VR4A 3KGLA 5FZAA 4LBKA 5JIAA 3VDDB 2DBIA 3KHCA 1WKYA 4XPVA 4D69A 2C9AA 1LOGA 5KHHA 4BPZA 3IBMA 4X8PA 1WWYA 1AXYA 2DUPA 4QAWA 1E5HA 4YW4A 2VCMA 4AQ6A 3B5LB 4Z1VA 1VLNA 1D2SA 2JG9A 5C5TA 4HT1T 5F5AA 2VOVA 2ZKNA 4JRLA 3HT1A 1NXD1 1Y43B 4CDXA 1VBD1 3UGGA 1Q8QA 1VB2A 1JYCA 4JTNA 1IS4A 4PLOA 2QZ3A 5L73A 3ZKYA 4C0HA 5AC91 3WP6A 1OH3A 5FWEA 1F5FA 2JG8C 3LOIA 4M3CA 4QB1A 1W6PB 1PX3A 5A3PA 1DCSA 1DZQA 3ZSEA 1QJX3 5G04L 5DZFA 2A3WA 1CR7A 3M1HA 1RUH3 3LGRA 3U0ZA 4W65A 2UY8A 3ZYGA 2LRPA 5F2WA 1ZZCA 2YDEA 4XF9A 3WF2A 3PTYA 2R16A 1LGBA 4Y1XA 3VKFC 5D2AA 3W9AA 2DVGA 3MFCA 4CU8A 3HR9A 4X8NA 4HN1A 4EWAA 4EN6B 4I3PA 3AXEA 3AFKA 4LK7A 1HB3A 3WG2A 3CJIA 1DQ5A 3I2GA 3DKQA 2JDNA 1AX2A 1H6YA 4LUKA 5FZKA 3ZMNA 3I8TA 4YG3A 4GXLA 1MS4A 3FZ3A 1FPN2 3ZXJA 4Z2WA 3B9IA 3M3CA 3CHXA 1GV9A 1HB2A 2YC0A 4QDSA 4Y1YA 5FK7A 4YYOA 3F2ZA 3DPRC 5BNPC 1J1LA 3DGTA 1VBC3 2IFWA 4RQPB 1GUIA 1XYNA 2O8OA 2RR13 4DUVA 1RUG1 1O4YA 5BNNB 4Y1UA 1CAWB 2MNGA 3LQCA 2OUJA 1KGYA 3OPWA 5GZGA 1I1EA 4A6SA 1ZZ8A 5FMOL 4A3ZA 3FL7A 2HWB3 1W6PA 2N7GA 3HEIA 3V56A 2ZOEB 1KFXL 1NZCA 3J8F1 3AMQA 3CDZB 4QPYA 1PIV1 5L7OB 2JDHA 1YI9A 5IVBA 2R32A 5ABJA 1A8DA 3WVJA 3Q8FA 3WQ1A 4KG8A 1UY3A 3M7AA 1G9FA 2VY0A 2GH2A 1K5MA 2YFUA 1VBE2 3ETQA 3FHQA 4S2DA 2D3SA 4LBOA 4XTPA 1W9FA 3ZN6B 5EFUA 3GYDA 3P3PA 1UL9A 3H50A 2G9FA 2VECA 1GFF2 1Z7S2 3UKVA 1V9U1 3PDQA 1RUG2 1C5HA 4AG4A 1FAYA 1WMEA 3SC7X 4BU2A 3VBFA 3N7MA 2W5FA 1NA1A 3IM0A 2H6BA 4GWIA 4QX7A 1UMHA 4LBQA 1XNKA 3A23A 4GWNA 1O3SA 2EVXA 2PTMA 5FZ6A 5FYZA 2SLIA 5A7WB 1QDCA 2JE7A 3PJQA 5EXOA 5T5LA 4D7SA 1H2KA 2SBAA 2EXIA 2ZEWA 5HXMA 2B9VA 1FV2A 1W03A 2D3PA 3FWEA 2HEYF 2XLFA 5IWFA 1W8WA 3ZFEA 3WHTA 2Q8OA 5JMOA 4XACA 4YLZA 1QGLA 5FPZA 1WLDA 4E27A 4QMAA 1QWRA 1NUKA 4B4PA 1DDLA 1XRUA 4E2QA 4FTEA 4Y3OA 2P37A 3DPRA 3HQRA 4UOJA 1Z0HA 1Z78A 2G19A 4H7LA 3T4HB 2FCVA 2VZ1A 2VNVA 1ALYA 3LA7A 2ZHMA 1W0OA 4XQWA 4RHV2 4CYDA 1HN0A 2DYCA 1YQ8A 2PA7A 1UZZA 2WYFA 2XG3A 1K3IA 4LHSA 5FYHA 1YFUA 4W50A 2ARAA 2VTFA 3SEPA 1O3TA 5K7PA 2DCJA 1SFNA 4RA0A 2WT0A 4JC1A 3VD4A 3WCRA 2XL7A 2ZACA 3KHBA 5C9AB 1GR3A 5JOXA 1WCSA 2HWC1 3H3ZA 1KQRA 1J3PA 1WUVA 4UXAA 3NV3A 5FZ3A 5JOYA 2O14A 2BEOA 1FNZA 2XKOA 3O14A 5JOWA 3FMGA 1ACCA 3AC0A 3FLPA 1O3RA 5F6KA 4JKKA 2ZS6B 4JQRA 4JQTA 3IDCB 1C57A 1HN1A 1OA3A 4QPGA 4ATEA 2CGNA 2RM23 3A0NA 3VZJA 4K21A 3TEXA 1OI6A 3NV2A 1PNGA 1JZ3A 5FYUA 1B09A 4NIHA 3FE5A 1QKQA 1RUD3 2Y33A 3W59A 3MIHA 1S0IA 2VVFA 4XABA 1I5ZA 2ORXA 5KR7A 2DCYA 2VMGA 2DTWA 1PO21 3AP7A 1F4AA 4COYA 2ZMLA 4N43B 2FDHA 3WINE 1RMU3 3MLKA 2AREA 3MYXA 4GWMA 1BYHA 4XF1A 2FDFA 2EIGA 1JZ8A 1AYN1 1YJLA 4HETA 5FZGA 4ZHNA 1GWMA 2ZGQA 1K5JA 4LKEA 1UYPA 4CUBA 5C33A 4XF4A 1ZRCA 3VZKA 2F17A 4IE7A 2VULA 5LY2A 2BGPA 1WW4A 2JX9A 1W90A 2W47A 4LHNA 2BNNA 2VMFA 4CDUB 1NYWA 1X8EA 1F5JA 2RV9A 3PURA 4ZU4A 4ES9A 1O7FA 4R4XA 5GLTA 3VZNA 1V70A 3UNPA 4XFHA 4MX3A 2YY1A 1OPOA 3BODA 3WNNA 1SG3A 1UNBA 4AEJA 3ACGA 1YIPA 4U2AA 1S2EA 3AYEA 3LZZA 1MS1A 1AR92 1VALA 1GWKA 5FBZA 5GZEA 1E5RA 1UXZA 5CKNA 5A1LA 4CE8A 1EV12 2GDFA 3D82A 3VBOA 1NCRC 3VHRA 2CYFA 2WFF2 2W0XA 4WV8A 2DWRA 1TMF3 1XXNA 2WZ8A 3BPSA 3IDBB 5HPOA 1C1LA 1J1TA 2HWD1 2I74A 2RDNA 1ODNA 1XPWA 3OG2A 4HBNA 4QX1A 2HWE3 4BLIA 1QQP2 1R083 4CP9B 1EUTA 2BVVA 4P9YA 3KCYA 4B29A 1PVC3 4RR3B 3VDBA 5D8AA 2Q8CA 4QPGC 1W6QB 1BK0A 4M01A 4OFGA 4XBNA 5H9RA 1RTVA 4FCAA 4CCMA 5C4WB 4NIGA 2YFZA 3C3VA 2FCUA 4XC9A 4GJYA 2J1RA 4OZXA 1VRH2 3BYWA 2IXHA 4L92A 2OKXA 2P6CA 1N3PA 2PHTA 4CCJA 1RGSA 2B4KA 1AYM2 5D21A 4P02B 1BEV3 5LWBA 1ZBE1 2NM1A 3OGGA 3UV9A 1HDKA 5T55A 4BQ4A 4IE4A 1VBD2 2Y6FA 4EWDA 4AGRA 1BJQA 1NE4A 2YC2A 4Y33A 2HWD2 5DDJ2 4CTEA 1DGRN 3ZFGB 4QHBA 1RC6A 3OD4A 4IERA 4KBZA 3TN93 5FTTC 4B4QA 2BWCA 1SFPA 4JZRA 4XQDA 2VH9A 3AJZA 1JOBA 3H8OA 2OIIA 4H14A 4A7ZA 5C8WA 3KS7A 2XJTA 2ATFA 1YFXA 2P4EA 1CAWA 5FMBA 4WVMB 1BBT2 3KMHA 1JHJA 4A6OA 4IEYA 5IK4A 3OGVA 2J1EA 2Z79A 1AJKA 1T6BX 4COZA 2UYBA 3ZR5A 1GQPA 1WCKA 2PELA 2JDPA 1HXS2 1DGLA 3AZVA 3GF6A 2RMU1 4D94A 1CD3G 5JI7A 4XFBA 2GC0A 2ZEZA 1RVF1 5C8CC 2WNUB 4YVSB 3VBHA 1J84A 2WS92 1JUIA 1WBLA 2BNMA 2VCCA 4IV1A 4KI5M 4XUQA 3IN9A 2YROA 3HN1A 3VDDA 5IK5A 2JIGA 4I3GA 3ZX7A 2X53S 2CSGA 3CO2A 4XF3A 3ZXAC 1GLHA 4XJWA 1WLTA 2AENA 1VJ2A 1LKNA 2RJLA 2FZ2A 3S5QA 1US3A 2PQQA 1S0BA 4K6BA 3HOBA 2XWBB 3K75B 1UOGA 3VZOA 2I45A 2RS52 3ITQA 1IOAA 1FATA 4KNCA 5T5PA 3PIJA 1O8PA 1LGNA 3CNAA 3N9OA 4YM0A 4HPKB 5F2SA 1QOOA 1GZTA 5CKMA 1V00A 4RGGA 3DUIA 4K7JA 4ASLA 3AKPA 1GBGA 3D8CA 1WD3A 2RR11 2VOKA 1F4HA 2KD7A 4GB33 3VD5A 3WNLA 4AVTA 1FOD3 1OFSA 4QHZA 3SCFA 5KXDA 2HEVF 2VZUA 2ZGSA 1LOFC 4YZ3A 3WZ1A 1LOBA 1HQWA 1OKOA 2E9QA 3WQ7A 2F4LA 2ZX3A 3LIGA 5IVFA 2JICA 3ALQA 1OF3A 2BFUS 4A41A 2VAUA 2ES3A 3J26N 1RUC2 5T54A 3I59A 4E2SA 3WD5A 3GBFA 2X10A 5C5UA 3T09A 3ZDVA 4KL1A 3O1TA 4MXVA 3ZVXA 2FZ1A 5A7SA 2XONA 3ES1A 2ZCWA 2GC3A 2WLQA 1F31A 1L7LA 3AMHA 4XCAA 3ZYPA 2JE8A 1CAXB 3J9SA 4LKDA 4AXOA 4K9SA 4UFMA 1AR71 1S0JA 2BU9A 3AK0A 4IV3C 4UI9L 3K2OA 1PGL2 2B39A 5GZCA 4MSVA 3TWIA 2W92A 4N43C 5CBLA 2E26A 4FPCA 4CDXB 2ZX4A 5FQ0B 5GKAC 4LO8A 4LK6A 5FZBA 3ZFGC 4BMBA 1SLTA 1VE0A 4DUWA 3MUZ1 4G3YC 3M8LA 5KC5A 2WZR3 1OOPB 5EJ3A 1W05A 2LALA 1UW8A 4XUTA 2JDMA 2KM2A 3UESA 1ASJ1 1UWWA 4NO4A 4YARA 2VE1A 2GNDA 3KT1A 5APAA 3ZN4A 1BLZA 2VZPA 4CUAA 1X33A 4NN0A 1LULA 3AM2A 1VMFA 2QTWB 4Q4W3 3UL2A 1BBT1 2Y34A 3NV4A 3K4AA 4BQ5A 2J1AA 2P2KA 2WSVA 4LA2A 5A1FA 1OHFA 2PN5A 5SV5A 1PGL1 2GH8A 2ZGUA 1OBNA 3WLUA 2ZX2A 4CCOA 1MEC2 3NL1A 3FN9A 3AP5A 4QD2A 5LZ6A 1BEV2 4A4AA 1POQA 1C4RA 1RUD1 1W8OA 4GULA 3JD72 2P6HA 1CVNA 2HH9A 4XDPA 4MGSA 5FXZA 3ZXEA 3M2MA 5J96B 2OQ7A 2ZKLA 5LY1A 5A3TA 4YW5A 1RMU1 3NO8A 3LAGA 4QPIC 4CXWA 5A7OA 2XOMA 4PDWB 4XVHA 4E4HA 1YHFA 2HWE2 3AL5A 2X29A 1V6NA 2RM21 4GKXA 3RQ0A 5F3EA 1UAIA 2E33A 3VHNA 2OPWA 1H2NA 4FPHA 4H3WA 4FOWA 4I01A 4CRQA 1LHUA 2EIBA 4IESA 3T2QA 5A33A 3R0RA 1RXGA 1Y3TA 4CP9A 1N47A 1YQ6A 3ROUA 4GWJA 1XE7A 1JYVA 3O1SA 1RL3A 3JQWA 4J6GA 5F3IA 4LITA 4OMCA 5FOJB 3CF6E 2A7AA 2JWPA 2YMZA 3I2IA 3KT4A 4B4RA 5FREA 3DN7A 4KWJA 2GMPA 1BKZA 2GP5A 3NQHA 3LB9A 4JGYA 1QIQA 1KD7A 1DGRA 3POJA 4N90A 4ZONA 4CEWC 4DXSA 3ZOIA 4TZDA 3VN4A 4CP2A 1AXKA 1SCRA 1UMZA 2TNFA 1TQ5A 2HWF3 4EJRA 5FZHA 5H9PA 3VBRB 2WS93 2DUOA 1ZA4A 1UYXA 1REDA 5JSRA 4I09A 5IYYA 2NMOA 5HCFA 1KXGA 5LRRA 3MW4A 1Q8OA 4G9SB 5FDBA 1AZDA 4P00B 2Q8EA 3GHNA 5FLHA 3ZXDA 4AI0A 1ZBA2 1AR61 1PO11 2LS6A 5FZOB 4M3CE 3APBA 4EZ4A 2AACA 2DCTA 5FPLA 2C6SA 3B69A 3CBNA 3ES4A 3MIFA 4XXAA 2NN8A 4I30A 1JYXA 4OQ8A 3LEIA 3UGFA 3DYPA 1QXRA 1W6MA 4K40A 1DLCA 1Y9GA 5GLWA 1G7YA 4JHTA 1KJRA 4KWUA 1IPKA 1ZREA 3P5BA 3P1IA 1F15A 2Y0IA 2AC1A 2HWD3 2JKXA 2XMLA 4FTSA 1GU3A 1WA6X 5FJHA 4AEDB 5IAXA 3VD9A 5DG1A 3GALA 1CIWA 5FZ0A 1GQGA 4N53A 4BYYA 2NQYA 3FLTA 3GXUA 3H3UA 2GNBA 3LDKA 1LODA 1LU1A 1PHMA 3D6EA 3BTAA 3USUB 1SLCA 4AK3A 1PGW2 1RUJ1 3DXUA 4M0HA 3FBYA 4IQPA 1ODMA 3WT3A 2RS33 4KG0A 3VBRA 4H55A 4L99A 1OFNA 3MFAA 5IVVA 2PHUA 2ILMA 4Q0VA 4YVWA 1MZEA 2ADDA 3OUJA 5FZLA 3N9NA 3NWKA 4TSVA 1L7RA 1TNFA 4LPLA 4D8MA 1V6OA 5A3NA 5BNNC 5CAZA 3M4FA 4PIYA 4IEXA 1PVC2 4YM1A 3L9JT 5FYVA 3GHMA 1V6LA 2HBTA 3KGZA 4Q0QA 4RQPA 5JSOA 2QZ2A 2P3KA 1REEA 1AYM1 3T2TA 3QD6A 2WT1A 2WNUC 4Q0UA 3VBOB 1YRZA 1QF3A 1V0AA 2VMHA 2JENA 3MBWA 4HK8A 3TN91 3RZLA 5C4WC 3H9AA 3UJOA 1BXHA 2P3JA 1ULEA 4UFJA 2J7MA 1RVF3 3B3QE 2OXBA 4FOQA 5AC93 5C71A 2VQTA 4ISQA 4FVVA 4L0PA 4AVAA 4D3WA 1POV0 1MVQA 4LLOA 4DRRA 3WXPA 2VNGA 5BUVA 5CG8A 3N9QA 4ASKA 5FCCA 2WNVC 2XQXA 4BZ4A 4F83A 5A6QA 3LF7A 3THPA 4B1MA 4YRDA 1QOTA 4LOSA 1C1FA 1UKGA 5FZ1A 5GZFA 1I6XA 4A45A 3RZKA 3NJXA 2HEWF 2R49A 1AX1A 4R9CA 4ZZ5A 4UBGA 2CWSA 1W3XA 2WZEA 4CCLA 3K4DA 3NW4A 2QQUA 1IKQA 1J83A 4ES8A 3ILFA 3MDPA 3ME2A 4N7UA 3OSDA 2QQIA 4JAAA 3WNMA 4C91A 1AVBA 2GNTA 5LA1A 3W20A 2VQUA 2I07B 4NHYA 2Y64A 3D0SA 1PO22 3OD0A 2OA2A 2PHXA 1ZBA3 5CVRA 5FPAA 2QQOA 2Q1FA 3C7GA 4BJ0A 2EA7A 3H1MA 3WV6A 1CAUB 4JDOA 2VZOA 3THTA 1K12A 3ILRA 1REFA 2WA3A 2WC2A 4AQ2A 1RB8G 3FC0A 5AVAA 2YXSA 1JYTA 1ND2C 1C3HA 1W2TA 3BU0A 2IXLA 2CAUA 3C7OA 1X36A 2RVAA 4IETA 3C7FA 3QACA 4YG6A 3VHPA 3NNGA 5CG9A 2H6CA 1KDMA 2HKXA 2WQ8A 2WWJA 3GZEA 2RM22 3I2JA 3M70A 3TOJA 5C3RA 3VBUC 1T6GC 1ZX5A 3IMMA 2HWB1 2UYAA 4I0AA 1MQTA 2DFBA 2W1WA 1XYPA 2BFUL 3AMNA 1PM4A 2CU5A 3OBRA 4GB31 1HV0A 1Q3EA 1JTZX 1RVF2 3OOXA 5A3WA 4DOUA 3ZXKA 2ZZQA 4IV3B 4RFT0 1CAXA 5FKBA 3HMYA 1B35A 4NAOA 2VU9A 4C90A 1SHWB 2W87A 5G05L 2QUOA 4GAZA 4CDXC 4RGAA 1OVSA 3UETA 2WQ4A 1IGOA 2E63A 5J98B 4FPFA 1GZCA 3B01A 4DY3A 4YZ5A 2OQ6A 1NA1C 3RDIA 4OI2A 4LO4B 5DMYA 2VW1A 3V0BA 3NMBA 1H1MA 1JHNA 5LEJA 1S55A 4AI1A 4AAPA 1S2KA 1UU5A 4MXWB 5FZ9A 2BGCA 3MIGA 4WM7C 4MADA 5BNOA 5FO8B 3KCXA 2PLV2 3ACHA 3LEGA 4OI4A 1MEC3 4UBHA 1DFQA 4MOAA 3ZFEC 4E8CA 5AFBA 3I97A 3LCPA 4NWWA 3J7LA 5A7NA 4AF9A 4QKDA 3WG1A 5LB6A 1ZRRA 4QX8A 1YEWA 2YHJA 3WY6A 1EV11 4XURA 1D0GA 3MV01 5CZKA 2DVBA 3PVBB 5CFCB 1VMHA 2JJ6A 5J3UA 1PM7A 2A75A 2ZGPA 4N9HA 5JXJA 3TEWA 4XQ4A 2VVDA 1OLMA 1Z7S3 1SPPA 1GMMA 2V5YA 4LO7A 4NE9A 5JZGB 2R041 2EAKA 4P08A 1QQP1 2G9GA 1WW5A 1YYNA 3OBAA 4LLFA 3VKOA 3WF1A 1D4VB 3TEYA 1SLAA 4W6YA 1G9CA 3NNMA 5K9YA 1NCQC 2QJVA 3N7KA 3WP5A 1CESA 1RINA 5I8SA 4NPLA 1QJU3 3LDBA 2RDQA 3RZZA 4Q4V1 3SKVA 5KBFA 2ADEA 4XJ8A 3ZMOA 4XFFA 5FOBB 3LWCA 1O91A 4BQYA 4IDZA 4PF1A 4CUGA 1X8MA 3U75A 1W9YA 2J1SA 2WDBA 1VMJA 5FZCA 2CHHA 3QH7A 2VTXA 4PBPA 1K5MC 4JV4A 1XU1A 2Y6LA 4YZ1A 3WQ0A 2PHWA 2VOXA 5GLVA 3SISA 1UIKA 4QDQA 3ILNA 5FFOC 5FZ8A 5HCBA 2CGOA 4DZGA 1QJY2 1IG0A 1GOHA 3NSTA 3ZKUA 4FFGA 3AZZA 3WUCA 1WW7A 4N43A 3NJVA 3ZFFC 2P3YA 3J4UH 1BK1A 3AZYA 3AXDA 5E16A 1FI2A 2JB4A 2PAEA 1W8ZA 4IEPA 4QGMA 4QX5A 1P8JA 4RR3C 5EZWA 1FOD2 1ENQA 1GICA 4LKFA 4UYBA 3WCSA 3BOPA 1RJ7A 2VPVA 3GCWA 4FO9A 1DYKA 1SPPB 4HKWA 1U0AA 5EQUA 4HKOA 3TBDA 4QB6A 5FZOA 3U11A 4TWTA 5FO9B 1ZZ9A 1TEIA 2X09A 3V0AB 4OYUA 4HPKA 2EXJA 1H2MA 2WS91 2DUQA 3H42B 4AGGA 5C3PA 1RUNA 1H9PA 1UCXA 3ZR6A 4Y4RA 3I3EA 1D4M3 1MS5A 4I0WB 4NVPA 4RFRB 4URAA 5ACA1 5HV0A 4I02A 4MV2A 4P14A 1OUXA 1RITA 1CJPA 4FPOB 1W6OA 1F9KA 4QU2A 4HLTA 4RYDA 4CXYA 4CDWB 3CLPA 1IQDC 4HKLA 4QQ2A 3AKRA 1H2LA 2Y6KA 4AI3A 2OVUA 1H6XA 5C7GA 1JYWA 4IEVA 3OTFA 2WNOA 3N35A 4D6RA 3WX5A 1W9WA 1VBB3 4LORA 1HXS3 4E4ZA 1OF4A 2E32A 2YB7A 3AZXA 1HJGA 2DCZA 2XJUA 4Q26A 4RS5A 3SMHA 4RHV1 3ZXGA 3D5OA 4YGCA 3I7DA 1TE1B 2WO2A 3VBFC 2C24A 1J3RA 4OI0A 4NPMA 1SLLA 4WM7B 4MZUA 3CKHA 3CZUA 3NNLA 4BK4A 1ENSA 5DN2A 1WBFA 3WDUA 5A7QA 3NNJA 4MH0E 2GU9A 2RS31 2PXJA 3WUDA 2VC9A 1CWPA 3SCHA 4QKNA 1APNA 4XIOA 2R0FA 5DAQA 2ZAAA 1DHKB 4ARXA 1VAVA 1GWLA 1W39A 5LASA 3PMSA 1KJLA 2CDOA 5LBFA 3CZJA
chains in the Genus database with same CATH topology
3RWKX 3LDKA 2AEZA 3LIHA 4UFJA 5FK7A 3S5QA 4FFHA 4FFGA 2OXBA 2AEYA 3U14A 3ZR6A 4FFIA 3UGHA 4FFFA 1UYPA 5FMCA 5FIXA 3LEMA 1ST8A 1Y4WA 3ZR5A 3KF3A 5FKBA 2XQRA 4CCDA 1Y9MA 4UFIA 2QQVA 3PIJA 4JQTA 3PIGA 3UGFA 5FMDA 2ADDA 3LFIA 3SC7X 3LF7A 4B1LA 4B1MA 1Y9GA 1W2TA 2QQWA 2ADEA 3U1XA 5ANNA 4CCCA 4EQVA 3UGGA 3HBKA 3LDRA 3U75A 2QQUA 4QHZA 3KF5A 4UFHA 2AC1A 4UFMA 5FK8A 3OSDA 3NMBA 4UFKA 4HXCA 5FKCA 3IMMA 5FMBA 3LIGA 4AZZA 4CCEA 3H3LA 4UFLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RWK X;  3LDK A;  2AEZ A;  3LIH A;  4UFJ A;  5FK7 A;  3S5Q A;  4FFH A;  4FFG A;  2OXB A;  2AEY A;  3U14 A;  3ZR6 A;  4FFI A;  3UGH A;  4FFF A;  1UYP A;  5FMC A;  5FIX A;  3LEM A;  1ST8 A;  1Y4W A;  3ZR5 A;  3KF3 A;  5FKB A;  2XQR A;  4CCD A;  1Y9M A;  4UFI A;  2QQV A;  3PIJ A;  4JQT A;  3PIG A;  3UGF A;  5FMD A;  2ADD A;  3LFI A;  3SC7 X;  3LF7 A;  4B1L A;  4B1M A;  1Y9G A;  1W2T A;  2QQW A;  2ADE A;  3U1X A;  5ANN A;  4CCC A;  4EQV A;  3UGG A;  3HBK A;  3LDR A;  3U75 A;  2QQU A;  4QHZ A;  3KF5 A;  4UFH A;  2AC1 A;  4UFM A;  5FK8 A;  3OSD A;  3NMB A;  4UFK A;  4HXC A;  5FKC A;  3IMM A;  5FMB A;  3LIG A;  4AZZ A;  4CCE A;  3H3L A;  4UFL A; 
#chains in the Genus database with same CATH topology
 1XBF A;  4CUC A;  3MID A;  1VRB A;  3C8X A;  4XHB A;  4XAA A;  5EWS A;  3E1F 1;  1GOF A;  4NHX A;  1W6Q A;  1RUC 3;  2A1X A;  5CFC C;  4I2O A;  1AYM 3;  1ENX A;  1JW6 A;  2VCA A;  4DB5 A;  4IV1 B;  2Y0O A;  1US2 A;  4N8M A;  1MVE A;  4JDM A;  3U37 A;  2V72 A;  4KWL A;  2ZGR A;  3B9C A;  4XET A;  2K0G A;  2W08 A;  2JG8 B;  3DCQ A;  4PHZ A;  3ATG A;  4PLN A;  2WFF 1;  4QXH A;  3WOG A;  3OUH A;  1YLL A;  4V2W A;  4DXR A;  3WW2 A;  4QXK A;  2VMD A;  5JPN B;  1SDW A;  4UFH A;  2VZQ A;  1SAC A;  4Y26 A;  2V73 A;  1SMV A;  2XBO 2;  5T5O A;  1G9D A;  3O5S A;  4Q2F A;  3NAP A;  1NA1 B;  3VDD C;  4PI0 A;  1W0N A;  4S2G A;  5DXD A;  1D0H A;  2JB8 A;  3A0K A;  4NPR A;  4P5H A;  1EP0 A;  2YPJ A;  4Y20 B;  5FXW A;  4BWO A;  5HBA A;  5BPX A;  5T5J A;  3DF0 A;  4YM3 A;  4MGY E;  3GZA A;  5FY5 A;  1G8W A;  3L2Y A;  4Q4V 2;  3WF0 A;  3JCI A;  3AB0 A;  5IVY A;  2RS1 3;  1TVG A;  4OCT A;  2NMN A;  5I0R A;  4GMP 3;  2O8Q A;  3MO4 A;  1AR9 1;  2BGO A;  3P3N A;  4IGO A;  4YVW C;  5FRA A;  4CSW A;  1W2U A;  4E9K A;  2W46 A;  1ND2 A;  2XVL A;  3HPN A;  3O0W A;  3HIF A;  1NQD A;  1VB4 A;  5LAT A;  5FPX A;  4W6W A;  5F5I A;  3INA A;  5FP7 A;  3JB8 A;  2WA4 A;  1PMI A;  1B35 B;  4XJU A;  5FR3 A;  3A22 A;  2VXR A;  4LQR A;  4AL9 A;  4HSJ A;  1YWK A;  3OPZ A;  3I2D A;  3R6S A;  1GYK A;  3GNE A;  4IGQ A;  4LBQ D;  4QKB A;  3ZN6 A;  2QQM A;  3OY8 B;  1SBD A;  3PJY A;  1TZO A;  1C8M 2;  4R9A A;  1HV1 A;  3V0B B;  3KV9 A;  4CDQ B;  3T30 A;  3USU A;  3ZYH A;  2NP0 A;  2W2I A;  3CIH A;  2ZJC A;  5CU1 A;  1B35 C;  2A6W A;  1N3O A;  2EID A;  3KSC A;  5J48 A;  3TN9 2;  5DDJ 3;  4Y1Z A;  1UOF A;  2HJI A;  2VZV A;  3N36 A;  4JGZ B;  4XF0 A;  1A34 A;  2P17 A;  3I3Q A;  3RWN A;  1SLI A;  1FMD 3;  2VBP A;  5I91 A;  3BTX A;  3RI9 A;  4BQ3 A;  4PQ9 A;  5A6Z A;  3DYM A;  2WYS A;  3C7E A;  2FD8 A;  3LIH A;  4YPJ A;  1OXC A;  1POV 3;  2RE9 A;  4MO3 M;  4CDQ C;  3KV6 A;  5L9R A;  2A6V A;  3NVC A;  3KLS A;  4ORF A;  4YGD A;  5FZF A;  2ETE A;  1JU4 A;  2IXC A;  1JI6 A;  1UZ0 A;  1VRH 3;  4I0B A;  1XND A;  4GQ7 A;  4NHM A;  3D3A A;  4AFC A;  4KBB A;  1AR8 1;  3PUQ A;  3S57 A;  3UKT A;  3H8U A;  1PGW 1;  4QQP A;  5DUW A;  3I49 A;  4OUM A;  2ZEX A;  1ONA A;  5KC6 A;  1V6I A;  3BIE A;  5EJZ B;  1RUF 2;  5FYI A;  3E6B A;  5IAT A;  1QQP 3;  3VL8 A;  5T3N A;  4AR2 A;  1J58 A;  1TMF 2;  2UUR A;  2VUJ A;  2WII B;  2E31 A;  2FMY A;  3T0D A;  2OX0 A;  1N1S A;  1EV1 3;  2PHL A;  4R4Z A;  4R9B A;  4C0B A;  4NII A;  1CQ9 A;  3S7I A;  1QJU 1;  3MUY 1;  1RUI 1;  1IS6 A;  1CAV B;  4Q4X 3;  2DTY A;  1FX5 A;  4EYU A;  3T0A A;  3SQO A;  3X29 B;  3OBT A;  5HV4 A;  3I2H A;  1VBB 2;  2WSU A;  1IPS A;  1UZV A;  5IK7 A;  5JAX A;  4EZH A;  1ZVF A;  2E7A A;  2ERF A;  3MHZ A;  2WUH A;  4LBN A;  1NCQ A;  4CDW C;  5ISL A;  2D7F A;  5A33 B;  1BMV 2;  1OVP A;  1HRV 2;  3ZYF A;  1CX1 A;  2X5I C;  5CFD A;  2HLE A;  4CEY B;  1MS0 A;  3B94 A;  3MI8 A;  1UQX A;  4K8R B;  4Q4V 3;  3ST7 A;  4MVT A;  5C6C A;  4NAM A;  2UWC A;  1W6M B;  5A3L A;  4QDR A;  4CZS A;  4Q4Y 2;  1PK6 C;  5FY0 A;  2XGX A;  4LHL A;  3M3O A;  4ZS3 A;  3SH4 A;  4QWN A;  4AQT A;  4AI2 A;  1HIX A;  2K2S A;  4FPJ A;  1ZNP A;  4O9G A;  2VM9 A;  1COV 2;  1URX A;  1DGW X;  2WT2 A;  1MQT B;  1BHG A;  1XE0 A;  2XLA A;  3OYW A;  5FP4 A;  1NX9 A;  2QQW A;  3WDW A;  4CEW A;  4OUS A;  3GBG A;  4IV3 A;  4LO6 B;  1CX4 A;  4K8F A;  2XBO 1;  1CAU A;  1O5U A;  2FBE A;  4Y1V A;  3N3H A;  4UFK A;  2BWA A;  2R1D A;  1QMJ A;  1WLC A;  4YVW B;  1OT5 A;  4AAX A;  1H8T C;  1I3H A;  4ATF A;  2YGM A;  3KV4 A;  4NRO A;  1CZS A;  2D40 A;  3JZV A;  1FYU A;  2KXL A;  3OJB A;  3HNB M;  1SDD B;  4ZS2 A;  5BYN A;  2YU2 A;  4OLL A;  5E89 A;  3GM8 A;  1BCX A;  5K0U A;  4GJZ A;  2O1Q A;  3O7O A;  4U36 A;  2D97 A;  3CEW A;  1C28 A;  1BVP 1;  4FOV A;  1HXS 1;  1D4M 1;  4ZXK A;  3POB A;  2Y8K A;  2WAA A;  3SEE A;  3WDX A;  4RN5 A;  1CZV A;  1SBF A;  2BQP A;  4RHV 3;  1H4H A;  1CGP A;  4AHY A;  3G7D A;  4QPW A;  1HRI 2;  5FZ7 A;  4KU8 A;  1XE8 A;  1CJD A;  4MET A;  5CYY A;  2CGP A;  5A80 A;  4QKF A;  1XNT A;  5FY8 A;  1NCR A;  4ISR A;  4Y5S A;  2WWS A;  4IEO A;  1JZ5 A;  1G9A A;  2VW0 A;  1DQ6 A;  4ITC A;  3HJR A;  4O61 A;  1AR8 2;  4TYS A;  1CPM A;  5A3M A;  5FPU A;  1LEC A;  4LIV A;  5JXG A;  2WR9 A;  1C8M 1;  2QVS B;  1MZ6 A;  3FUO A;  3MIC A;  4FI9 A;  3VBR C;  1KDK A;  1SEF A;  2QQN A;  1IS3 A;  4DS0 A;  1RUJ 3;  1V9U 2;  1R64 A;  2IVI B;  3I4I A;  1RHI 2;  4UW5 A;  5DAB A;  3RS6 A;  3JXS A;  3TAY A;  4DXZ A;  1J59 A;  2ZHN A;  2WWU A;  5FP8 A;  1QJX 1;  4XDO A;  5FO7 B;  3ZLI A;  4MYE A;  3ZN5 A;  1RUH 1;  4XUP A;  4CXX A;  2B46 X;  2A70 A;  3ABZ A;  2A71 A;  1ZRD A;  4HL0 A;  2YPD A;  2C9K A;  1M06 G;  2DUR A;  4Y5T A;  2XPJ A;  1UF2 C;  3K48 A;  2JD9 A;  1UU4 A;  4EN9 B;  3BVC A;  4UT5 A;  4XUN A;  3S0M A;  1ENR A;  2Y6G A;  5BNP A;  4D0Q A;  2PAM A;  5C9A C;  5A32 B;  2XHK A;  3UYJ A;  2QDR A;  2JXA A;  2BBV A;  2AUY A;  2BV4 A;  3C2U A;  3PHM A;  1W2A X;  4FT8 A;  3ZYB A;  4N9I A;  3POY A;  1W8U A;  4GMP 0;  4MGI E;  2B5H A;  2ZZJ A;  1A6C A;  1GKB A;  4L11 A;  4ZPI A;  1PZ8 A;  3THD A;  3ZDS A;  2VZR A;  4BME A;  4GAL A;  4KGG A;  3GJB A;  3WHU A;  1KS4 A;  1W8H A;  2W68 A;  3NV1 A;  2ZBJ A;  4NRP A;  2ZAB A;  1VIW B;  4PCR A;  3MF6 A;  5F32 A;  2JKB A;  1ND3 C;  2ZAH A;  4MGK E;  1LOA A;  2R06 1;  5A7W A;  2X5I B;  5JR2 A;  4MG2 A;  3LEM A;  2QKD A;  2XJR A;  1N1T A;  1FPN 3;  2VME A;  2Y6J A;  4BOW A;  3RGB A;  1PIV 3;  3MPB A;  4XIL A;  4A44 A;  3N9P A;  5BV6 A;  3LPF A;  2ORZ A;  3ZFE B;  3IAQ A;  2DVD A;  3FJS A;  3MPP G;  3PTR B;  1ZBA 1;  4X6R B;  1VBC 1;  5EIY B;  2R0H A;  3PU8 A;  4AFA A;  3VGI A;  4B7K A;  3QBQ A;  2UY9 A;  3BOW A;  2GAU A;  2ZGL A;  3DPR B;  5BNP B;  4NMI A;  4Q5O A;  5FPB A;  2FDI A;  3H1W A;  3HVD A;  4ERO A;  4M00 A;  2R30 A;  3VLB B;  2QBX A;  3LE0 A;  2ENR A;  1F35 A;  1YQ5 A;  1OLQ A;  3FFQ A;  4LBM A;  4QT6 A;  5BXX A;  3POS A;  1OOP C;  3J8F 3;  2WZP P;  5I8T A;  4HVQ A;  4HAN A;  5CAD A;  1LOE A;  4HVR A;  1XC6 A;  2RJK A;  5FJK A;  4CP0 A;  3PLQ A;  2FDG A;  2WRA A;  3VB9 A;  1UPI A;  5F8P A;  4AYU A;  5C8C B;  1AJO A;  1KEX A;  1YQC A;  1W28 A;  1RYY A;  2OUH A;  4P9L A;  2BJS A;  4XXP A;  2I2S A;  3R4D B;  4JGZ A;  1HRV 3;  4K1Y A;  4LOT A;  4OHW A;  3VBS B;  1I9R A;  1TNR A;  3WSO A;  3JD7 1;  1ULO A;  1QJY 1;  1YQ2 A;  4HN0 A;  1V9U 3;  1RUJ 2;  4ZU7 A;  5IT6 A;  1YIF A;  3RFR A;  1H8V A;  5LA2 A;  1UYY A;  3QOP A;  1H1A A;  2B45 X;  3K46 A;  2EIE A;  2HWC 2;  4Q0S A;  3GZU C;  3ZSK A;  4RSU A;  4AOC A;  1CPN A;  1LNS A;  1W6O B;  3AKT A;  2QDN A;  4AI9 A;  4Q4X 2;  1UN1 A;  3BU7 A;  4CEY C;  3Q8E A;  1AR8 3;  1MR5 A;  3TRS B;  5H9S A;  5IFP A;  4FFH A;  5JOZ A;  4M0N A;  1NCQ B;  2GMM A;  4K1Z A;  2XJQ A;  4CP1 A;  3POW A;  5FMC A;  3RJR A;  3GJA A;  1FMD 1;  2YG0 A;  4UFI A;  5TSW A;  4OUE A;  3SNM A;  4H2A A;  1OLM E;  4DEV A;  3O1U A;  1POV 1;  2E7Q A;  1OQ1 A;  4O7X A;  1MEC 1;  2EXH A;  3N4M A;  4D6Q A;  3I59 B;  1LGC A;  3USS A;  1F8V A;  1QJE A;  1WW6 A;  1OH4 A;  2XVG A;  3CMG A;  3VHO A;  2WN3 A;  2IZW A;  3DXT A;  1RUI 3;  2D43 A;  2JDK A;  1RUE 3;  2VD7 A;  4BB3 A;  2RS3 2;  2A73 B;  4FXK B;  4QB2 A;  4QU1 A;  2VL4 A;  1W9T A;  2YBK A;  1S4C A;  1AL2 1;  1H30 A;  3AMP A;  3W21 A;  5KWR A;  4JTO A;  2YBP A;  2DVF A;  1BQP A;  4M4R A;  2JDZ A;  3ELN A;  3MF9 A;  1FMD 2;  3ACI A;  3BN6 A;  3T1M A;  5FMD A;  4HMZ A;  4HSL A;  2R04 3;  4XBL A;  2WO3 A;  1JZ7 A;  4XZU G;  2PLV 1;  4XCB A;  1LOF A;  1IS5 A;  1JBC A;  1A8M A;  2BBA A;  2AR6 A;  4LUL A;  1MS9 A;  3AKS A;  4XZP A;  1AYN 3;  4FP3 A;  3AP9 A;  3ZYJ B;  1MQT C;  1X82 A;  3VD3 A;  3OGR A;  4YW1 A;  2DU0 A;  3VDA A;  2XJV A;  3ZPY A;  2ZMK A;  4D7T A;  2JDA A;  1YFW A;  3IZO A;  3AYA A;  3QLQ A;  4WVW A;  1STM A;  2W3J A;  3AMM A;  1DU3 D;  3DEC A;  2VJX A;  2EAA A;  1CON A;  1PO2 3;  4YW3 A;  4TLG A;  2TBV A;  3OF1 A;  3QCW A;  5JZG C;  1VAM A;  4CVU A;  4OZO A;  4FPE A;  5AVP A;  4K3U A;  2ZA9 A;  2FHR A;  3RI8 A;  1L3J A;  3MV1 1;  3T2P A;  2CWM A;  2RDS A;  2Z69 A;  4NRM A;  4DY5 A;  1UXX X;  2CV6 A;  1WZX A;  1PO1 2;  2ZX1 A;  4LA3 A;  4E8D A;  3WNP A;  1AR6 2;  1V6K A;  1OMI A;  3KB5 A;  2GZW A;  2HWF 2;  5FZM A;  5IVJ A;  4IEQ A;  2YU1 A;  2D6L X;  1ZRI A;  2ZPX A;  3RYK A;  2BOI A;  3ZXF A;  3C7H A;  3ZFG A;  4WVZ A;  1DQ0 A;  5FXV A;  5BNO C;  3PL0 A;  5CA6 A;  2QQP A;  1W99 A;  5CEH A;  1ZYB A;  4WVV A;  5FY1 A;  2WO7 A;  4DMI A;  2DU1 A;  1ULD A;  1DBN A;  2J42 A;  2WFP A;  4LT5 A;  5CKQ A;  5C3S A;  3EBR A;  5KXE A;  4AGV A;  2VO5 A;  1LJ7 A;  4Y4Y A;  4YFW A;  1FV3 A;  3KQ4 B;  4GZ9 A;  3PIG A;  4WM8 C;  4MGQ A;  2PHR A;  2JEM A;  4P5Y A;  5LK5 A;  4KQ7 A;  4XE9 A;  1C8N A;  2VUA A;  3DL3 A;  3U1X A;  2CY6 A;  3EMR A;  3ORJ A;  3AX4 A;  4O9E A;  4DPN A;  1ULF A;  5F5Q A;  3K77 A;  3LDR A;  2EXK A;  5ACA 3;  5IAV A;  1TMF 1;  5FZE A;  1ZBE 3;  5KHG A;  3OGJ A;  4XJ9 A;  4CDW A;  3O1V A;  1RIR A;  4HK9 A;  1R09 3;  3OY8 A;  4XDQ A;  2EF6 A;  5EYX A;  1QEX A;  1AF9 A;  3RG0 A;  4PIZ A;  5ABJ C;  2MEV 3;  3WF4 A;  3HWJ A;  4DFS A;  2E51 A;  2WAO A;  1VBB 1;  1WCD J;  4ONU A;  4CEW B;  4BXS V;  3ACL A;  4PI2 A;  3Q9O A;  4XHX A;  3V0A A;  3L2H A;  3MZH A;  2VZT A;  1AL0 G;  1DGW A;  1NY7 1;  5LBB A;  5J36 A;  3FFZ A;  5JDB A;  1H9W A;  4Z82 A;  4Y24 A;  3HBZ A;  4H7M A;  4KMQ A;  3VZM A;  1AHS A;  1OKQ A;  4A3X A;  4AW7 A;  1C5I A;  2J1V A;  4Z8B A;  4LR4 A;  5A7P A;  4DUX A;  5JI9 A;  4WM7 A;  1JN2 P;  1LRH A;  4KH9 A;  4N53 C;  5ERL A;  1C8M 3;  4YNI A;  1LEM A;  2LM3 A;  3RMY A;  5I8Y A;  3O12 A;  1LR5 A;  1U5Y A;  2MPF A;  3RZH A;  1UKR A;  2RMU 3;  3R4S A;  5DG2 A;  3PME A;  2VOW A;  4EN7 B;  3O1R A;  2D5H A;  3AVS A;  3FBM A;  3I2F A;  4RR3 A;  1TME 2;  1YUD A;  1W04 A;  2IXK A;  2YBS A;  3IPV A;  4GD4 A;  4UWD A;  2UWA A;  5FP3 A;  2X05 A;  3MW2 A;  3UT0 A;  3ZYR A;  2GME A;  4NOT A;  2GN3 A;  5CFC A;  2WN2 A;  3N9L A;  3JB4 C;  5D1I A;  4OHX A;  1JOJ A;  3POF A;  4XFG A;  2KA3 A;  2R07 2;  5FYY A;  5GZD A;  3LPG A;  4GH4 B;  1FNY A;  2IC1 A;  4A7K A;  1ZZ6 A;  2R06 3;  5FWJ A;  2RS1 2;  1KRI A;  4ZXE A;  1XB9 A;  1MAC A;  3AL6 A;  1W8N A;  4LO5 B;  3LD8 A;  2IFR A;  4E4S A;  4NWV A;  4CPB D;  1O4T A;  4J1W A;  1WLW A;  2JG9 B;  1S0F A;  1Y9Q A;  2WL1 A;  4MHU A;  2RG4 A;  2W95 A;  1UYZ A;  3OEB A;  3HQU A;  1O6U A;  4CCC A;  5HCA A;  5DZE A;  4LE3 A;  2OYZ A;  4BQ1 A;  3AP4 A;  4UF0 A;  3I3D A;  1O8S A;  1IHM A;  4QX3 A;  3H7Y A;  1EAH 2;  4COW A;  4NR1 A;  4CPB A;  3WEZ A;  3EO6 A;  4GB3 2;  3MEP A;  5AFE A;  3WG3 A;  2JIJ A;  1LHO A;  4J25 A;  1FPN 1;  5JPM B;  2XWJ B;  4Q29 A;  3BCW A;  5DZG A;  2NPI A;  1LU2 A;  2D6O X;  4GIQ A;  2GSY A;  3M3I A;  3MW3 A;  3NJZ A;  1OPM A;  3ZFF A;  3PU3 A;  5T52 A;  5JR7 B;  3VKN A;  2DFC A;  3BUC A;  2V4V A;  5JSP A;  4E2G A;  1FOD 1;  1LHN A;  2FCT A;  1BMV 1;  1JS9 A;  1PVX A;  2ET7 A;  1G6N A;  5FY4 A;  3GBW A;  1QJY 3;  1RJ8 A;  2A3Y A;  4EWE A;  1X9P A;  4LNV A;  4P9X A;  3N9M A;  2BP6 A;  1DIW A;  3JBG 3;  1OUR A;  5L19 A;  1HB1 A;  1AR7 3;  2XXZ A;  3Q8B A;  3ZSM A;  3MGU A;  5EJ1 B;  2XJP A;  2X8K A;  5J1X A;  5FAX A;  4LE4 A;  3EB7 A;  5LCW L;  1JOP A;  2E7T A;  5JUV A;  1D2Q A;  5KHI A;  1QJU 2;  1QNW A;  2P3I A;  4S2F A;  4W6X A;  3ECQ A;  3K3N A;  2AYH A;  4GKY A;  3G6J B;  3GCX A;  5FLI A;  4ET7 A;  5KXB A;  2B9U A;  4L2N A;  1NLR A;  5LW9 A;  1XU2 A;  4XJA A;  1O3Q A;  3PUA A;  1KS5 A;  1ULG A;  2Z42 A;  5H9Q A;  4SLI A;  4WZC A;  5KHK A;  5C3Q A;  1AUY A;  1A78 A;  1BBT 3;  1OSG A;  1R1A 2;  1M4W A;  2E53 A;  3LSE A;  1YXW A;  4XEZ A;  3WDT A;  3LFI A;  4XFA A;  3PVN A;  3O1P A;  1MS8 A;  4BXF A;  4MLO A;  4FPY A;  4HFS A;  1QXJ A;  4IEW A;  1W6N A;  4BE3 A;  5DAX A;  3WQB A;  5F37 A;  3VBU B;  1VRH 1;  1JU3 A;  3NAP C;  3K51 A;  4RS5 C;  3DKW A;  1G86 A;  5F39 A;  1AL2 3;  4COV A;  1E57 A;  2OS2 A;  1VBE 1;  4IUG A;  1CAV A;  1NLQ A;  3KD4 A;  5LRS A;  4FPL A;  4Q4W 1;  1W2O A;  1D4M 2;  1NZI A;  2D6P A;  5J7M A;  2PLV 3;  1UOJ A;  5F9T A;  1EPZ A;  1RUE 1;  1ST8 A;  3VKL A;  3WP4 A;  2TEP A;  4HZF A;  1Q43 A;  1IQA A;  1R09 2;  1R1Z A;  1R1A 1;  5DAV A;  4YW6 A;  5FZ4 A;  4NJ4 A;  1LCL A;  3KCC A;  5FP9 A;  1W9S A;  1UIJ A;  2D6K A;  2IXI A;  3WNX A;  2FMD A;  3IDA A;  5ACA 2;  4Q0P A;  3E97 A;  1GSL A;  4Q4X 1;  4JGZ C;  5J37 A;  3UK9 A;  4RL7 A;  1H1I A;  2D6N A;  1GAN A;  4DRV A;  2PQS A;  1PZ9 A;  4NRQ A;  3W5N A;  1EPW A;  4DXT A;  2VG9 A;  4AFB A;  4BIF A;  5I93 A;  3H3L A;  2BUK A;  2JG8 A;  4FSJ A;  5F3C A;  4XTM A;  3B00 A;  4GH4 C;  1YI7 A;  3VKM A;  1SFY A;  1CN1 A;  4CEY A;  2PMW B;  5C3O A;  5CFD B;  2HWF 1;  3EJK A;  1Q8S A;  3HT2 A;  4OHZ A;  5A6X A;  5ABJ B;  1EUU A;  4AE2 A;  5FBJ A;  4QGN A;  2H0V A;  1DF0 A;  3NKG A;  4HON A;  1K5M B;  3ASI A;  2R06 2;  1HB4 A;  4CU6 A;  4AEK A;  5JZG A;  3BTZ A;  2VMI A;  3Q8A A;  1S2B A;  5ANN A;  1WMF A;  4PT6 A;  4Y20 A;  1RXF A;  1AR6 3;  1PO1 3;  2W94 A;  2VOT A;  2R1B A;  3OYW B;  4XJZ A;  4EN8 B;  3ON7 A;  5F6L B;  3OCP A;  3A7Q A;  4IEZ A;  1VBA 3;  2QFE A;  2EIC A;  4JDN A;  4AWD A;  4FBF A;  5IHR A;  4LHK A;  1TME 3;  3LA3 A;  5B4X A;  4C1W A;  4QPG B;  1LHW A;  4Z2A A;  1YC6 1;  2VBD A;  3E6C C;  1K42 A;  4IW3 A;  5FY9 A;  1H8T A;  2Q8D A;  1EAH 1;  3POG A;  1RHI 1;  5JVV A;  2RMU 2;  1W8T A;  3KF3 A;  5DAP A;  3T0B A;  4IEU A;  2Z4F A;  1Y9M A;  2DF7 A;  1ZZ7 A;  4JKM A;  3S30 A;  3NRU A;  4B1L A;  1HX6 A;  4NIA A;  4JRA A;  1OUS A;  3KVB A;  1R09 1;  4Q4Y 1;  1A3K A;  2F4P A;  3GGL A;  3IB3 A;  3K3O A;  4PF5 A;  4B7E A;  4CU9 A;  1XYO A;  1JZ4 A;  1O5L A;  2YV8 A;  3ZSJ A;  4MGT A;  1UZW A;  2YGL A;  4BK5 A;  2V4A A;  5FV3 A;  5I0S A;  1MZ5 A;  3IMN A;  5FYT A;  5KHJ A;  2GNM A;  2WO1 A;  1K45 A;  1N1Y A;  5HXV A;  4BDV B;  1QOS A;  1QY4 A;  2XUE A;  2P5B A;  4YVS A;  3VBH B;  1IKP A;  1U5I A;  3O1O A;  1RUF 1;  2V09 A;  1XNC A;  5IUQ A;  3E5Q A;  3UGH A;  4LBQ B;  2ZGT A;  2VZ3 A;  2BPA 2;  2JG9 C;  4QM9 A;  5A3U A;  4WZF A;  1AX0 A;  1SBE A;  4LBL A;  4RS5 B;  1NCR B;  1UO9 A;  4JHZ A;  3OUI A;  2F6B A;  4AVS A;  4BH9 A;  4M3C B;  1WA4 A;  1GNH A;  4TN7 A;  1WCQ A;  3FX3 A;  4WVM A;  3RNS A;  1GNZ A;  4EV0 A;  2Q1M A;  3VBH C;  3V65 A;  1DLL A;  5EP9 A;  4XIK A;  4C1X A;  4D6S A;  4UF0 B;  5JXH A;  5K0U B;  4RD7 A;  5JWP A;  3DV8 A;  4QGL A;  4BLJ A;  1WD4 A;  3RWK X;  5F7U A;  2VQ0 A;  4P9W A;  5FIX A;  1KIT A;  4LEJ A;  4S2H A;  2DDU A;  2VZS A;  4OI1 A;  5A70 A;  3EHK A;  3R05 A;  1BVV A;  1ULC A;  5C9A A;  1PNF A;  1DZR A;  2WBK A;  3AYD A;  3WG4 A;  1ULP A;  5ANQ A;  5E6H A;  4HG6 B;  2AZ5 A;  3T2O A;  2Q4S A;  4P9J A;  1BZW A;  1OQD A;  2B8M A;  1RUG 3;  3FUQ A;  4N7I A;  5CIR A;  1X9T A;  2QE3 A;  2VQA A;  3W5M A;  4L9B A;  1HQN A;  4IE6 A;  3RZM A;  2ZHL A;  5DQ0 A;  5JLV A;  4Y22 A;  1VP6 A;  4DIN B;  2UWB A;  3U4S A;  4AEM A;  1ND3 A;  2D93 A;  2YUE A;  4XAE A;  3BTY A;  1VBA 2;  4OUL A;  2CNA A;  3MLJ A;  4TXW A;  3V64 A;  5L7O A;  2XDV A;  4ARY A;  1LB2 A;  3MLL A;  3NJY A;  5FYB A;  5JIU A;  2BYV E;  1D7P M;  4AHW A;  2X5I A;  1L7Q A;  4YG0 A;  4YZ2 A;  5CFD C;  1WMD A;  2Y26 A;  2BOJ A;  3IKW A;  1RUO A;  4KGQ A;  2OZJ A;  3AVR A;  4LBJ A;  4XBQ A;  3SHR A;  5FK8 A;  5M0T A;  3ZXL A;  2A6Z A;  4A7Y A;  2GAL A;  3JU9 A;  1QHD A;  1SCS A;  5E8A A;  1SLB A;  1NG0 A;  2BTV C;  4CDU A;  1ND2 B;  3B93 A;  1U12 A;  3VBS A;  2WLP A;  3CJI B;  3IWZ A;  5AC9 2;  4Q1R A;  2CL2 A;  2VCB A;  3KT7 A;  3M3E A;  2W91 A;  4UW3 A;  5GAL A;  3PVO A;  3VV1 A;  4BIO A;  3HNY M;  1E5I A;  1DP0 A;  1Y4W A;  4V2V A;  2Z5W A;  4IE5 A;  5GLZ A;  5IVE A;  2W9X A;  4Y5Z 0;  1RUE 2;  1DQ2 A;  3HD8 B;  4G4F A;  1RUI 2;  4K20 A;  5T50 A;  2XLG A;  3GZT B;  4JX0 A;  3WF3 A;  2W52 A;  3H0O A;  3LOB A;  1PX4 A;  4XFI A;  4W8J A;  3HBK A;  1DQ1 A;  3PVE A;  4PQQ A;  2W1Q A;  2ZGO A;  2PHF A;  3DEM A;  3TYJ A;  4D7Y A;  3JBG 1;  4JKL A;  2JEC A;  1HRV 1;  3HN3 A;  3HNM A;  3POI A;  3JD7 3;  4R8H A;  5JXI A;  2O0O A;  4FPG A;  4AVC A;  1UY4 A;  4LMF A;  1SQ4 A;  2K9Z A;  4MHR A;  1YO8 A;  4HVO A;  3VDC A;  3BI3 A;  2XVK A;  3URF A;  3WP3 A;  1QJX 2;  1HQL A;  4QX0 A;  1CIY A;  4AHZ A;  3BKZ A;  4PDW A;  2HBU A;  1ZRF A;  4BQ2 A;  2WKK A;  3RMX A;  4FP2 A;  1NOV A;  5LBC A;  2WAB A;  4C8D A;  4QQL A;  3SLI A;  2ZXQ A;  1YCI A;  3KVA A;  2JE9 A;  1MS3 A;  3U10 A;  3PUI A;  4Z07 A;  1MZF A;  1Z7S 1;  2ARX A;  4Q4W 2;  4YW2 A;  3O0V A;  1VPH A;  4QQH A;  3DYO A;  5FUI A;  1MPX A;  1HJF A;  5C8C A;  3P6B A;  4F8A A;  4J1X A;  4XMI A;  5A3O A;  3VUO A;  1R1A 3;  4CDQ A;  4YSF A;  2WNV B;  2ZGM A;  2Q0A A;  4Q1P A;  4RGK A;  4LXL A;  3RYR A;  3KV5 A;  2EAL A;  3O0X A;  1HLC A;  3J8F 2;  5DUU A;  4FAH A;  1VBE 3;  1W2N A;  3ACF A;  4JCK A;  1OLR A;  4IND A;  4IL7 A;  4CDU C;  1N3Q A;  1NKG A;  1OQE A;  3ZM8 A;  5IVC A;  3KWV A;  1HRI 3;  1W06 A;  1CZT A;  2VUD A;  2J22 A;  2W1U A;  5L36 A;  4BIS A;  3OGS A;  4O65 A;  2WNE A;  4YGB A;  4JGY C;  3H7J A;  3QH6 A;  2ZEY A;  1XQN A;  4MXW A;  1QJF A;  3WW4 A;  2HWB 2;  5FQ0 A;  1AR7 2;  1GNY A;  2XKP A;  4NUB A;  5DPN A;  3A4U A;  4PIX A;  4BA6 A;  3CU7 A;  2AGS A;  2OW4 A;  2RR1 2;  3I2O A;  3RVH A;  2KR2 A;  1VBC 2;  2VGD A;  3N7J A;  2VNO A;  3LA2 A;  4LTA A;  2YC4 A;  1PMJ X;  2ZGN A;  3LSD A;  2LUW A;  1QH7 A;  2QNK A;  2IXJ A;  2ZHK A;  1OD5 A;  2BNO A;  2JDU A;  1DQ4 A;  1DZT A;  2XQR A;  3RSJ A;  1W3V A;  2J1T A;  3MIE A;  4ZKT B;  1PMH X;  1G9B A;  5DUX A;  1F2N A;  4DIQ A;  1IG3 A;  4ZZ8 A;  1JUH A;  2WNV A;  3WNO A;  1W8F A;  2D3R A;  3WR0 A;  4DO0 A;  3J7N A;  4R9D A;  2OZ6 A;  2WIN B;  3ENR A;  1COV 3;  1EAH 3;  2Q1Z B;  1LHV A;  4R52 A;  1PK6 A;  2CTV A;  3ETP A;  1PZ7 A;  2RS5 3;  5FKC A;  4URT A;  3VBO C;  4CU7 A;  2J1U A;  1RUH 2;  5FZI A;  5FXX A;  4KU7 A;  2BDR A;  4Q4Y 3;  2RDR A;  3KQR A;  4FFI A;  5EYY A;  2BZD A;  1UY2 A;  3BPZ A;  2Y38 A;  3D0J A;  3CL1 A;  2QQK A;  1VBA 1;  2CDP A;  2BW8 A;  5K4L A;  5IK8 A;  4L97 A;  2QQV A;  1QH6 A;  1QJZ A;  4MUV A;  1V6J A;  1AL2 2;  5GM0 A;  3CJI C;  2ZTN A;  2R6Q A;  3SH3 A;  3T3Y A;  3U07 A;  2XL9 A;  2R07 3;  2ET1 A;  3NKT A;  4N53 B;  4OMD A;  4WM8 A;  3D4K A;  1RHI 3;  2DV9 A;  4P9I A;  2HYK A;  2Q5T A;  3IDE A;  3T1L A;  4B3N A;  1XNA A;  2D44 A;  2B7Y A;  1NAE A;  2FDJ A;  5C70 A;  2BER A;  2QCS B;  2XH6 A;  2YZ4 A;  1JXN A;  3J7M A;  3R4U A;  3VD7 A;  3BB6 A;  3FLR A;  1GOG A;  5FY7 A;  5GLU A;  4CCE A;  2WZR 2;  1U5X A;  4AVB A;  3O1M A;  3IIA A;  1XSQ A;  3VBU A;  5C4W A;  3K4Z A;  4OHV A;  5J09 A;  5K0U C;  2VUC A;  5DAW A;  4YFZ A;  2Y6H A;  1NT0 A;  4YVS C;  4CCD A;  2Z2S B;  3JUU A;  3E6D A;  4W4Z A;  4Z92 B;  1N1V A;  2D98 A;  4ZU5 A;  5L9B A;  2MEV 1;  4AI8 A;  5LA0 A;  3BAL A;  1RUF 3;  1UMI A;  1UU6 A;  4OHY A;  3ZYI B;  4BHP A;  3NNF A;  4LUM A;  2P34 A;  2A6Y A;  3EQE A;  2P1B A;  2DVA A;  4ZY9 A;  5FLJ A;  1RUC 1;  3III A;  3JBG 2;  5CNA A;  5FPV A;  4XW3 A;  1DG6 A;  1H8T B;  1IPJ A;  2DCK A;  4QHO A;  3M3Q A;  4QPI A;  2JD4 A;  4UAP A;  4UW6 A;  1VBD 3;  4AED C;  3B02 A;  2L9L A;  5D8A B;  2OPK A;  4FTB A;  3AP6 A;  4WM8 B;  3FHA A;  4QM8 A;  3T08 A;  3IAP A;  3AFG A;  3ZFF B;  2FQP A;  3CJX A;  5LA9 A;  4QQO A;  4E4D X;  4SBV A;  4YZ4 A;  3W58 A;  1E5S A;  2OT7 A;  1UY0 A;  4KWK A;  1XJA A;  1LES A;  4XFC A;  1JH5 A;  3HAG A;  5FUP A;  4AFD A;  1ZBE 2;  3UJQ A;  4UW4 A;  1UOB A;  2C26 A;  4XMA A;  2PHD A;  1ZM1 A;  5IFT A;  1NXM A;  1QU0 A;  4HOO A;  4BM8 A;  4EQV A;  3ZPO A;  4PBO A;  1R08 2;  3POE A;  5LK7 B;  4DQA A;  1JMU B;  4MGZ E;  2VNR A;  3LEK A;  1HKD A;  5EPA A;  4CCK A;  2WFF 3;  1OA4 A;  3SKJ E;  5KXC A;  1NE6 A;  4L8Q A;  2RS1 1;  3A21 A;  4IXL A;  4AHX A;  3ZIX A;  1Q5O A;  2AEY A;  4IE0 A;  5A1A A;  1AR9 3;  3B7M A;  3AZW A;  3VZL A;  3H8X A;  3HQX A;  5HI0 A;  1H4G A;  1NQJ A;  1FXZ A;  2QQJ A;  2K46 A;  3RPQ A;  4XOG A;  1S0E A;  4P9G A;  4CCN A;  1FT9 A;  2UU8 A;  2W1S A;  4AFM A;  3SCG A;  5FMO S;  1LED A;  4F7Z A;  3OBZ A;  4Q27 A;  1NLS A;  4V1P A;  5JMC A;  3EXU A;  1UX7 A;  1PGS A;  4FXG B;  5SV8 A;  4XYX A;  4ASM B;  4PLM A;  3RYP A;  3TB0 A;  3T4V A;  3WDY A;  1OA2 A;  2H0B A;  4GMP 1;  5A32 A;  3SIT A;  2ARC A;  1LEN A;  1QDO A;  2Y60 A;  1DYP A;  5B4N A;  5LEK A;  4OVE A;  3S7E A;  3PNA A;  1W6N B;  4IGP A;  2DBN A;  4QXB A;  3LKJ A;  1GP5 A;  2A3X A;  3S5A A;  5FYS A;  5FZD A;  1RMU 2;  2A6X A;  4AED A;  3TEZ A;  1VR3 A;  1GP4 A;  2R7E B;  4B8E A;  2D5F A;  4EE2 A;  5I0T A;  5F1R A;  2XB6 C;  4Q8L A;  4YWA A;  5JCT A;  3CQO A;  2NLR A;  3GDB A;  2A5Z A;  1UX6 A;  1WGP A;  3NAP B;  4X6Q B;  2AH2 A;  1IZ3 A;  3ZO0 B;  4YW7 A;  3SXW A;  3OPT A;  1KFU L;  1YFY A;  2VBB A;  4BQX A;  3BIW E;  4NID A;  3KZ4 C;  1WCU A;  4JVA A;  4BQW A;  3TNQ A;  2C5D A;  4LJH A;  3VBF B;  4A2U A;  2WZR 1;  3WW1 A;  5BNN A;  1OOP A;  1ND3 B;  3I54 A;  1S0D A;  4FQ4 A;  3JQX A;  4AZZ A;  4AQS A;  4RQP C;  1ASJ 3;  3PUH A;  2XUM A;  3RZG A;  2MEV 2;  1XSR A;  5DDJ 1;  1ASJ 2;  1I5P A;  1V6M A;  5CIS A;  1U5Z A;  4FFF A;  2B42 B;  1GZW B;  2Q30 A;  2VMC A;  5EV7 A;  1X7N A;  4WBB A;  2IVJ A;  4LKS A;  4DNY A;  1OD3 A;  5DUV A;  2V5D A;  2LTN A;  4PDW C;  4BCU A;  5L7O C;  2VVE A;  5IJR A;  1J3Q A;  3IPV B;  1S0G A;  5EHD A;  1UY1 A;  2ARB A;  2LW8 A;  1YNA A;  5LBE A;  1T2X A;  4OQ9 A;  2C0Z A;  4HXC A;  5BY5 A;  3J7H A;  1Q8V A;  4LIU A;  1LAJ A;  3U4X A;  1QNY A;  5CB7 A;  4FOY A;  3PUS A;  1S1A A;  2XR4 A;  3U78 A;  1HRI 1;  2XJS A;  1NY7 2;  2ZMN A;  4TLF A;  3TNP B;  4CA9 A;  2ZGK A;  3KM5 A;  1JYN A;  5I0U A;  4QX2 A;  1XNB A;  1EYB A;  2RJ2 A;  3I3M A;  3VBS C;  4NHL A;  2C4X A;  3S6P A;  3EYP A;  4Q8K A;  2ID4 A;  2HWC 3;  4YM2 A;  4QXC A;  5HCH A;  3WW3 A;  2GC2 A;  5D8A C;  1PK6 B;  1SZB A;  1TG7 A;  2G1M A;  2GP3 A;  4DEQ A;  4AVV A;  1JZ6 A;  5GJ6 A;  1X50 A;  1DYO A;  2WJS A;  2QQL A;  2YYO A;  2BRT A;  2GC1 A;  1JZ2 A;  3VL9 A;  2PAK A;  3AJY A;  3KF5 A;  3AYC A;  3OB8 A;  5F3G A;  3I2K A;  4F3J A;  2VTX J;  1GZW A;  1O4Z A;  1XOY A;  1ZA7 A;  5FUN A;  2C1F A;  1OC1 A;  4EN0 A;  4TTG A;  4NHK A;  4UFL A;  5B2G B;  2WNU A;  4GA9 A;  2IUW A;  1HW5 A;  5E88 A;  3U14 A;  2VW2 A;  2FDK A;  1WMX A;  5F5C A;  3FHI B;  5FYM A;  4A42 A;  4COU A;  1VAK A;  3WNK A;  4GH4 A;  1JOD A;  2MHF A;  1Q56 A;  3Q8C A;  2TUN A;  2XBO 3;  1LOC A;  5E1R A;  1AXZ A;  1COV 1;  4YGE A;  5K8S A;  1AYN 2;  5IW0 A;  3MIB A;  1YJK A;  1RUD 2;  3E5X A;  1O59 A;  2HYX A;  2XHN A;  3AKQ A;  3LFM A;  4Y22 B;  5FYC A;  3RRD A;  1ZZB A;  2VXJ A;  3OEA A;  3ZSL A;  4JGY B;  2R04 2;  4FQZ A;  4PJY A;  3IT8 A;  1PIV 2;  3SH5 A;  3ZIW A;  3RJ2 X;  2AEZ A;  1UPS A;  1GP6 A;  2HWE 1;  2G4I A;  4XUO A;  2IWG B;  2W39 A;  1Y7B A;  3F95 A;  3N7L A;  2ZX0 A;  3BGA A;  4M4P A;  1PVC 1;  1UZY A;  2PYT A;  3E5U A;  5I0D A;  2LRO A;  1GQH A;  2G9Z A;  2NYY A;  2WQZ C;  2CAV A;  3I3B A;  2GN7 A;  1TME 1;  2E6V A;  1JYI A;  1GZ9 A;  2RS5 1;  3RZJ A;  4IV1 C;  5L9V A;  1LTE A;  4QPI B;  5BNO B;  5A6Y A;  3THC A;  3WDV A;  5BNQ A;  2BVB A;  1Q8P A;  1H0B A;  1UD1 A;  3H8R A;  2RHP A;  2JDY A;  1BEV 1;  4FPK A;  3H1Y A;  4FAG A;  2D6M A;  1S0C A;  1QXP A;  1R08 1;  4M3C F;  3UKN A;  2PFW A;  2R07 1;  1EY2 A;  1W0P A;  2NZ9 A;  2VR4 A;  3KGL A;  5FZA A;  4LBK A;  5JIA A;  3VDD B;  2DBI A;  3KHC A;  1WKY A;  4XPV A;  4D69 A;  2C9A A;  1LOG A;  5KHH A;  4BPZ A;  3IBM A;  4X8P A;  1WWY A;  1AXY A;  2DUP A;  4QAW A;  1E5H A;  4YW4 A;  2VCM A;  4AQ6 A;  3B5L B;  4Z1V A;  1VLN A;  1D2S A;  2JG9 A;  5C5T A;  4HT1 T;  5F5A A;  2VOV A;  2ZKN A;  4JRL A;  3HT1 A;  1NXD 1;  1Y43 B;  4CDX A;  1VBD 1;  3UGG A;  1Q8Q A;  1VB2 A;  1JYC A;  4JTN A;  1IS4 A;  4PLO A;  2QZ3 A;  5L73 A;  3ZKY A;  4C0H A;  5AC9 1;  3WP6 A;  1OH3 A;  5FWE A;  1F5F A;  2JG8 C;  3LOI A;  4M3C A;  4QB1 A;  1W6P B;  1PX3 A;  5A3P A;  1DCS A;  1DZQ A;  3ZSE A;  1QJX 3;  5G04 L;  5DZF A;  2A3W A;  1CR7 A;  3M1H A;  1RUH 3;  3LGR A;  3U0Z A;  4W65 A;  2UY8 A;  3ZYG A;  2LRP A;  5F2W A;  1ZZC A;  2YDE A;  4XF9 A;  3WF2 A;  3PTY A;  2R16 A;  1LGB A;  4Y1X A;  3VKF C;  5D2A A;  3W9A A;  2DVG A;  3MFC A;  4CU8 A;  3HR9 A;  4X8N A;  4HN1 A;  4EWA A;  4EN6 B;  4I3P A;  3AXE A;  3AFK A;  4LK7 A;  1HB3 A;  3WG2 A;  3CJI A;  1DQ5 A;  3I2G A;  3DKQ A;  2JDN A;  1AX2 A;  1H6Y A;  4LUK A;  5FZK A;  3ZMN A;  3I8T A;  4YG3 A;  4GXL A;  1MS4 A;  3FZ3 A;  1FPN 2;  3ZXJ A;  4Z2W A;  3B9I A;  3M3C A;  3CHX A;  1GV9 A;  1HB2 A;  2YC0 A;  4QDS A;  4Y1Y A;  5FK7 A;  4YYO A;  3F2Z A;  3DPR C;  5BNP C;  1J1L A;  3DGT A;  1VBC 3;  2IFW A;  4RQP B;  1GUI A;  1XYN A;  2O8O A;  2RR1 3;  4DUV A;  1RUG 1;  1O4Y A;  5BNN B;  4Y1U A;  1CAW B;  2MNG A;  3LQC A;  2OUJ A;  1KGY A;  3OPW A;  5GZG A;  1I1E A;  4A6S A;  1ZZ8 A;  5FMO L;  4A3Z A;  3FL7 A;  2HWB 3;  1W6P A;  2N7G A;  3HEI A;  3V56 A;  2ZOE B;  1KFX L;  1NZC A;  3J8F 1;  3AMQ A;  3CDZ B;  4QPY A;  1PIV 1;  5L7O B;  2JDH A;  1YI9 A;  5IVB A;  2R32 A;  5ABJ A;  1A8D A;  3WVJ A;  3Q8F A;  3WQ1 A;  4KG8 A;  1UY3 A;  3M7A A;  1G9F A;  2VY0 A;  2GH2 A;  1K5M A;  2YFU A;  1VBE 2;  3ETQ A;  3FHQ A;  4S2D A;  2D3S A;  4LBO A;  4XTP A;  1W9F A;  3ZN6 B;  5EFU A;  3GYD A;  3P3P A;  1UL9 A;  3H50 A;  2G9F A;  2VEC A;  1GFF 2;  1Z7S 2;  3UKV A;  1V9U 1;  3PDQ A;  1RUG 2;  1C5H A;  4AG4 A;  1FAY A;  1WME A;  3SC7 X;  4BU2 A;  3VBF A;  3N7M A;  2W5F A;  1NA1 A;  3IM0 A;  2H6B A;  4GWI A;  4QX7 A;  1UMH A;  4LBQ A;  1XNK A;  3A23 A;  4GWN A;  1O3S A;  2EVX A;  2PTM A;  5FZ6 A;  5FYZ A;  2SLI A;  5A7W B;  1QDC A;  2JE7 A;  3PJQ A;  5EXO A;  5T5L A;  4D7S A;  1H2K A;  2SBA A;  2EXI A;  2ZEW A;  5HXM A;  2B9V A;  1FV2 A;  1W03 A;  2D3P A;  3FWE A;  2HEY F;  2XLF A;  5IWF A;  1W8W A;  3ZFE A;  3WHT A;  2Q8O A;  5JMO A;  4XAC A;  4YLZ A;  1QGL A;  5FPZ A;  1WLD A;  4E27 A;  4QMA A;  1QWR A;  1NUK A;  4B4P A;  1DDL A;  1XRU A;  4E2Q A;  4FTE A;  4Y3O A;  2P37 A;  3DPR A;  3HQR A;  4UOJ A;  1Z0H A;  1Z78 A;  2G19 A;  4H7L A;  3T4H B;  2FCV A;  2VZ1 A;  2VNV A;  1ALY A;  3LA7 A;  2ZHM A;  1W0O A;  4XQW A;  4RHV 2;  4CYD A;  1HN0 A;  2DYC A;  1YQ8 A;  2PA7 A;  1UZZ A;  2WYF A;  2XG3 A;  1K3I A;  4LHS A;  5FYH A;  1YFU A;  4W50 A;  2ARA A;  2VTF A;  3SEP A;  1O3T A;  5K7P A;  2DCJ A;  1SFN A;  4RA0 A;  2WT0 A;  4JC1 A;  3VD4 A;  3WCR A;  2XL7 A;  2ZAC A;  3KHB A;  5C9A B;  1GR3 A;  5JOX A;  1WCS A;  2HWC 1;  3H3Z A;  1KQR A;  1J3P A;  1WUV A;  4UXA A;  3NV3 A;  5FZ3 A;  5JOY A;  2O14 A;  2BEO A;  1FNZ A;  2XKO A;  3O14 A;  5JOW A;  3FMG A;  1ACC A;  3AC0 A;  3FLP A;  1O3R A;  5F6K A;  4JKK A;  2ZS6 B;  4JQR A;  4JQT A;  3IDC B;  1C57 A;  1HN1 A;  1OA3 A;  4QPG A;  4ATE A;  2CGN A;  2RM2 3;  3A0N A;  3VZJ A;  4K21 A;  3TEX A;  1OI6 A;  3NV2 A;  1PNG A;  1JZ3 A;  5FYU A;  1B09 A;  4NIH A;  3FE5 A;  1QKQ A;  1RUD 3;  2Y33 A;  3W59 A;  3MIH A;  1S0I A;  2VVF A;  4XAB A;  1I5Z A;  2ORX A;  5KR7 A;  2DCY A;  2VMG A;  2DTW A;  1PO2 1;  3AP7 A;  1F4A A;  4COY A;  2ZML A;  4N43 B;  2FDH A;  3WIN E;  1RMU 3;  3MLK A;  2ARE A;  3MYX A;  4GWM A;  1BYH A;  4XF1 A;  2FDF A;  2EIG A;  1JZ8 A;  1AYN 1;  1YJL A;  4HET A;  5FZG A;  4ZHN A;  1GWM A;  2ZGQ A;  1K5J A;  4LKE A;  1UYP A;  4CUB A;  5C33 A;  4XF4 A;  1ZRC A;  3VZK A;  2F17 A;  4IE7 A;  2VUL A;  5LY2 A;  2BGP A;  1WW4 A;  2JX9 A;  1W90 A;  2W47 A;  4LHN A;  2BNN A;  2VMF A;  4CDU B;  1NYW A;  1X8E A;  1F5J A;  2RV9 A;  3PUR A;  4ZU4 A;  4ES9 A;  1O7F A;  4R4X A;  5GLT A;  3VZN A;  1V70 A;  3UNP A;  4XFH A;  4MX3 A;  2YY1 A;  1OPO A;  3BOD A;  3WNN A;  1SG3 A;  1UNB A;  4AEJ A;  3ACG A;  1YIP A;  4U2A A;  1S2E A;  3AYE A;  3LZZ A;  1MS1 A;  1AR9 2;  1VAL A;  1GWK A;  5FBZ A;  5GZE A;  1E5R A;  1UXZ A;  5CKN A;  5A1L A;  4CE8 A;  1EV1 2;  2GDF A;  3D82 A;  3VBO A;  1NCR C;  3VHR A;  2CYF A;  2WFF 2;  2W0X A;  4WV8 A;  2DWR A;  1TMF 3;  1XXN A;  2WZ8 A;  3BPS A;  3IDB B;  5HPO A;  1C1L A;  1J1T A;  2HWD 1;  2I74 A;  2RDN A;  1ODN A;  1XPW A;  3OG2 A;  4HBN A;  4QX1 A;  2HWE 3;  4BLI A;  1QQP 2;  1R08 3;  4CP9 B;  1EUT A;  2BVV A;  4P9Y A;  3KCY A;  4B29 A;  1PVC 3;  4RR3 B;  3VDB A;  5D8A A;  2Q8C A;  4QPG C;  1W6Q B;  1BK0 A;  4M01 A;  4OFG A;  4XBN A;  5H9R A;  1RTV A;  4FCA A;  4CCM A;  5C4W B;  4NIG A;  2YFZ A;  3C3V A;  2FCU A;  4XC9 A;  4GJY A;  2J1R A;  4OZX A;  1VRH 2;  3BYW A;  2IXH A;  4L92 A;  2OKX A;  2P6C A;  1N3P A;  2PHT A;  4CCJ A;  1RGS A;  2B4K A;  1AYM 2;  5D21 A;  4P02 B;  1BEV 3;  5LWB A;  1ZBE 1;  2NM1 A;  3OGG A;  3UV9 A;  1HDK A;  5T55 A;  4BQ4 A;  4IE4 A;  1VBD 2;  2Y6F A;  4EWD A;  4AGR A;  1BJQ A;  1NE4 A;  2YC2 A;  4Y33 A;  2HWD 2;  5DDJ 2;  4CTE A;  1DGR N;  3ZFG B;  4QHB A;  1RC6 A;  3OD4 A;  4IER A;  4KBZ A;  3TN9 3;  5FTT C;  4B4Q A;  2BWC A;  1SFP A;  4JZR A;  4XQD A;  2VH9 A;  3AJZ A;  1JOB A;  3H8O A;  2OII A;  4H14 A;  4A7Z A;  5C8W A;  3KS7 A;  2XJT A;  2ATF A;  1YFX A;  2P4E A;  1CAW A;  5FMB A;  4WVM B;  1BBT 2;  3KMH A;  1JHJ A;  4A6O A;  4IEY A;  5IK4 A;  3OGV A;  2J1E A;  2Z79 A;  1AJK A;  1T6B X;  4COZ A;  2UYB A;  3ZR5 A;  1GQP A;  1WCK A;  2PEL A;  2JDP A;  1HXS 2;  1DGL A;  3AZV A;  3GF6 A;  2RMU 1;  4D94 A;  1CD3 G;  5JI7 A;  4XFB A;  2GC0 A;  2ZEZ A;  1RVF 1;  5C8C C;  2WNU B;  4YVS B;  3VBH A;  1J84 A;  2WS9 2;  1JUI A;  1WBL A;  2BNM A;  2VCC A;  4IV1 A;  4KI5 M;  4XUQ A;  3IN9 A;  2YRO A;  3HN1 A;  3VDD A;  5IK5 A;  2JIG A;  4I3G A;  3ZX7 A;  2X53 S;  2CSG A;  3CO2 A;  4XF3 A;  3ZXA C;  1GLH A;  4XJW A;  1WLT A;  2AEN A;  1VJ2 A;  1LKN A;  2RJL A;  2FZ2 A;  3S5Q A;  1US3 A;  2PQQ A;  1S0B A;  4K6B A;  3HOB A;  2XWB B;  3K75 B;  1UOG A;  3VZO A;  2I45 A;  2RS5 2;  3ITQ A;  1IOA A;  1FAT A;  4KNC A;  5T5P A;  3PIJ A;  1O8P A;  1LGN A;  3CNA A;  3N9O A;  4YM0 A;  4HPK B;  5F2S A;  1QOO A;  1GZT A;  5CKM A;  1V00 A;  4RGG A;  3DUI A;  4K7J A;  4ASL A;  3AKP A;  1GBG A;  3D8C A;  1WD3 A;  2RR1 1;  2VOK A;  1F4H A;  2KD7 A;  4GB3 3;  3VD5 A;  3WNL A;  4AVT A;  1FOD 3;  1OFS A;  4QHZ A;  3SCF A;  5KXD A;  2HEV F;  2VZU A;  2ZGS A;  1LOF C;  4YZ3 A;  3WZ1 A;  1LOB A;  1HQW A;  1OKO A;  2E9Q A;  3WQ7 A;  2F4L A;  2ZX3 A;  3LIG A;  5IVF A;  2JIC A;  3ALQ A;  1OF3 A;  2BFU S;  4A41 A;  2VAU A;  2ES3 A;  3J26 N;  1RUC 2;  5T54 A;  3I59 A;  4E2S A;  3WD5 A;  3GBF A;  2X10 A;  5C5U A;  3T09 A;  3ZDV A;  4KL1 A;  3O1T A;  4MXV A;  3ZVX A;  2FZ1 A;  5A7S A;  2XON A;  3ES1 A;  2ZCW A;  2GC3 A;  2WLQ A;  1F31 A;  1L7L A;  3AMH A;  4XCA A;  3ZYP A;  2JE8 A;  1CAX B;  3J9S A;  4LKD A;  4AXO A;  4K9S A;  4UFM A;  1AR7 1;  1S0J A;  2BU9 A;  3AK0 A;  4IV3 C;  4UI9 L;  3K2O A;  1PGL 2;  2B39 A;  5GZC A;  4MSV A;  3TWI A;  2W92 A;  4N43 C;  5CBL A;  2E26 A;  4FPC A;  4CDX B;  2ZX4 A;  5FQ0 B;  5GKA C;  4LO8 A;  4LK6 A;  5FZB A;  3ZFG C;  4BMB A;  1SLT A;  1VE0 A;  4DUW A;  3MUZ 1;  4G3Y C;  3M8L A;  5KC5 A;  2WZR 3;  1OOP B;  5EJ3 A;  1W05 A;  2LAL A;  1UW8 A;  4XUT A;  2JDM A;  2KM2 A;  3UES A;  1ASJ 1;  1UWW A;  4NO4 A;  4YAR A;  2VE1 A;  2GND A;  3KT1 A;  5APA A;  3ZN4 A;  1BLZ A;  2VZP A;  4CUA A;  1X33 A;  4NN0 A;  1LUL A;  3AM2 A;  1VMF A;  2QTW B;  4Q4W 3;  3UL2 A;  1BBT 1;  2Y34 A;  3NV4 A;  3K4A A;  4BQ5 A;  2J1A A;  2P2K A;  2WSV A;  4LA2 A;  5A1F A;  1OHF A;  2PN5 A;  5SV5 A;  1PGL 1;  2GH8 A;  2ZGU A;  1OBN A;  3WLU A;  2ZX2 A;  4CCO A;  1MEC 2;  3NL1 A;  3FN9 A;  3AP5 A;  4QD2 A;  5LZ6 A;  1BEV 2;  4A4A A;  1POQ A;  1C4R A;  1RUD 1;  1W8O A;  4GUL A;  3JD7 2;  2P6H A;  1CVN A;  2HH9 A;  4XDP A;  4MGS A;  5FXZ A;  3ZXE A;  3M2M A;  5J96 B;  2OQ7 A;  2ZKL A;  5LY1 A;  5A3T A;  4YW5 A;  1RMU 1;  3NO8 A;  3LAG A;  4QPI C;  4CXW A;  5A7O A;  2XOM A;  4PDW B;  4XVH A;  4E4H A;  1YHF A;  2HWE 2;  3AL5 A;  2X29 A;  1V6N A;  2RM2 1;  4GKX A;  3RQ0 A;  5F3E A;  1UAI A;  2E33 A;  3VHN A;  2OPW A;  1H2N A;  4FPH A;  4H3W A;  4FOW A;  4I01 A;  4CRQ A;  1LHU A;  2EIB A;  4IES A;  3T2Q A;  5A33 A;  3R0R A;  1RXG A;  1Y3T A;  4CP9 A;  1N47 A;  1YQ6 A;  3ROU A;  4GWJ A;  1XE7 A;  1JYV A;  3O1S A;  1RL3 A;  3JQW A;  4J6G A;  5F3I A;  4LIT A;  4OMC A;  5FOJ B;  3CF6 E;  2A7A A;  2JWP A;  2YMZ A;  3I2I A;  3KT4 A;  4B4R A;  5FRE A;  3DN7 A;  4KWJ A;  2GMP A;  1BKZ A;  2GP5 A;  3NQH A;  3LB9 A;  4JGY A;  1QIQ A;  1KD7 A;  1DGR A;  3POJ A;  4N90 A;  4ZON A;  4CEW C;  4DXS A;  3ZOI A;  4TZD A;  3VN4 A;  4CP2 A;  1AXK A;  1SCR A;  1UMZ A;  2TNF A;  1TQ5 A;  2HWF 3;  4EJR A;  5FZH A;  5H9P A;  3VBR B;  2WS9 3;  2DUO A;  1ZA4 A;  1UYX A;  1RED A;  5JSR A;  4I09 A;  5IYY A;  2NMO A;  5HCF A;  1KXG A;  5LRR A;  3MW4 A;  1Q8O A;  4G9S B;  5FDB A;  1AZD A;  4P00 B;  2Q8E A;  3GHN A;  5FLH A;  3ZXD A;  4AI0 A;  1ZBA 2;  1AR6 1;  1PO1 1;  2LS6 A;  5FZO B;  4M3C E;  3APB A;  4EZ4 A;  2AAC A;  2DCT A;  5FPL A;  2C6S A;  3B69 A;  3CBN A;  3ES4 A;  3MIF A;  4XXA A;  2NN8 A;  4I30 A;  1JYX A;  4OQ8 A;  3LEI A;  3UGF A;  3DYP A;  1QXR A;  1W6M A;  4K40 A;  1DLC A;  1Y9G A;  5GLW A;  1G7Y A;  4JHT A;  1KJR A;  4KWU A;  1IPK A;  1ZRE A;  3P5B A;  3P1I A;  1F15 A;  2Y0I A;  2AC1 A;  2HWD 3;  2JKX A;  2XML A;  4FTS A;  1GU3 A;  1WA6 X;  5FJH A;  4AED B;  5IAX A;  3VD9 A;  5DG1 A;  3GAL A;  1CIW A;  5FZ0 A;  1GQG A;  4N53 A;  4BYY A;  2NQY A;  3FLT A;  3GXU A;  3H3U A;  2GNB A;  3LDK A;  1LOD A;  1LU1 A;  1PHM A;  3D6E A;  3BTA A;  3USU B;  1SLC A;  4AK3 A;  1PGW 2;  1RUJ 1;  3DXU A;  4M0H A;  3FBY A;  4IQP A;  1ODM A;  3WT3 A;  2RS3 3;  4KG0 A;  3VBR A;  4H55 A;  4L99 A;  1OFN A;  3MFA A;  5IVV A;  2PHU A;  2ILM A;  4Q0V A;  4YVW A;  1MZE A;  2ADD A;  3OUJ A;  5FZL A;  3N9N A;  3NWK A;  4TSV A;  1L7R A;  1TNF A;  4LPL A;  4D8M A;  1V6O A;  5A3N A;  5BNN C;  5CAZ A;  3M4F A;  4PIY A;  4IEX A;  1PVC 2;  4YM1 A;  3L9J T;  5FYV A;  3GHM A;  1V6L A;  2HBT A;  3KGZ A;  4Q0Q A;  4RQP A;  5JSO A;  2QZ2 A;  2P3K A;  1REE A;  1AYM 1;  3T2T A;  3QD6 A;  2WT1 A;  2WNU C;  4Q0U A;  3VBO B;  1YRZ A;  1QF3 A;  1V0A A;  2VMH A;  2JEN A;  3MBW A;  4HK8 A;  3TN9 1;  3RZL A;  5C4W C;  3H9A A;  3UJO A;  1BXH A;  2P3J A;  1ULE A;  4UFJ A;  2J7M A;  1RVF 3;  3B3Q E;  2OXB A;  4FOQ A;  5AC9 3;  5C71 A;  2VQT A;  4ISQ A;  4FVV A;  4L0P A;  4AVA A;  4D3W A;  1POV 0;  1MVQ A;  4LLO A;  4DRR A;  3WXP A;  2VNG A;  5BUV A;  5CG8 A;  3N9Q A;  4ASK A;  5FCC A;  2WNV C;  2XQX A;  4BZ4 A;  4F83 A;  5A6Q A;  3LF7 A;  3THP A;  4B1M A;  4YRD A;  1QOT A;  4LOS A;  1C1F A;  1UKG A;  5FZ1 A;  5GZF A;  1I6X A;  4A45 A;  3RZK A;  3NJX A;  2HEW F;  2R49 A;  1AX1 A;  4R9C A;  4ZZ5 A;  4UBG A;  2CWS A;  1W3X A;  2WZE A;  4CCL A;  3K4D A;  3NW4 A;  2QQU A;  1IKQ A;  1J83 A;  4ES8 A;  3ILF A;  3MDP A;  3ME2 A;  4N7U A;  3OSD A;  2QQI A;  4JAA A;  3WNM A;  4C91 A;  1AVB A;  2GNT A;  5LA1 A;  3W20 A;  2VQU A;  2I07 B;  4NHY A;  2Y64 A;  3D0S A;  1PO2 2;  3OD0 A;  2OA2 A;  2PHX A;  1ZBA 3;  5CVR A;  5FPA A;  2QQO A;  2Q1F A;  3C7G A;  4BJ0 A;  2EA7 A;  3H1M A;  3WV6 A;  1CAU B;  4JDO A;  2VZO A;  3THT A;  1K12 A;  3ILR A;  1REF A;  2WA3 A;  2WC2 A;  4AQ2 A;  1RB8 G;  3FC0 A;  5AVA A;  2YXS A;  1JYT A;  1ND2 C;  1C3H A;  1W2T A;  3BU0 A;  2IXL A;  2CAU A;  3C7O A;  1X36 A;  2RVA A;  4IET A;  3C7F A;  3QAC A;  4YG6 A;  3VHP A;  3NNG A;  5CG9 A;  2H6C A;  1KDM A;  2HKX A;  2WQ8 A;  2WWJ A;  3GZE A;  2RM2 2;  3I2J A;  3M70 A;  3TOJ A;  5C3R A;  3VBU C;  1T6G C;  1ZX5 A;  3IMM A;  2HWB 1;  2UYA A;  4I0A A;  1MQT A;  2DFB A;  2W1W A;  1XYP A;  2BFU L;  3AMN A;  1PM4 A;  2CU5 A;  3OBR A;  4GB3 1;  1HV0 A;  1Q3E A;  1JTZ X;  1RVF 2;  3OOX A;  5A3W A;  4DOU A;  3ZXK A;  2ZZQ A;  4IV3 B;  4RFT 0;  1CAX A;  5FKB A;  3HMY A;  1B35 A;  4NAO A;  2VU9 A;  4C90 A;  1SHW B;  2W87 A;  5G05 L;  2QUO A;  4GAZ A;  4CDX C;  4RGA A;  1OVS A;  3UET A;  2WQ4 A;  1IGO A;  2E63 A;  5J98 B;  4FPF A;  1GZC A;  3B01 A;  4DY3 A;  4YZ5 A;  2OQ6 A;  1NA1 C;  3RDI A;  4OI2 A;  4LO4 B;  5DMY A;  2VW1 A;  3V0B A;  3NMB A;  1H1M A;  1JHN A;  5LEJ A;  1S55 A;  4AI1 A;  4AAP A;  1S2K A;  1UU5 A;  4MXW B;  5FZ9 A;  2BGC A;  3MIG A;  4WM7 C;  4MAD A;  5BNO A;  5FO8 B;  3KCX A;  2PLV 2;  3ACH A;  3LEG A;  4OI4 A;  1MEC 3;  4UBH A;  1DFQ A;  4MOA A;  3ZFE C;  4E8C A;  5AFB A;  3I97 A;  3LCP A;  4NWW A;  3J7L A;  5A7N A;  4AF9 A;  4QKD A;  3WG1 A;  5LB6 A;  1ZRR A;  4QX8 A;  1YEW A;  2YHJ A;  3WY6 A;  1EV1 1;  4XUR A;  1D0G A;  3MV0 1;  5CZK A;  2DVB A;  3PVB B;  5CFC B;  1VMH A;  2JJ6 A;  5J3U A;  1PM7 A;  2A75 A;  2ZGP A;  4N9H A;  5JXJ A;  3TEW A;  4XQ4 A;  2VVD A;  1OLM A;  1Z7S 3;  1SPP A;  1GMM A;  2V5Y A;  4LO7 A;  4NE9 A;  5JZG B;  2R04 1;  2EAK A;  4P08 A;  1QQP 1;  2G9G A;  1WW5 A;  1YYN A;  3OBA A;  4LLF A;  3VKO A;  3WF1 A;  1D4V B;  3TEY A;  1SLA A;  4W6Y A;  1G9C A;  3NNM A;  5K9Y A;  1NCQ C;  2QJV A;  3N7K A;  3WP5 A;  1CES A;  1RIN A;  5I8S A;  4NPL A;  1QJU 3;  3LDB A;  2RDQ A;  3RZZ A;  4Q4V 1;  3SKV A;  5KBF A;  2ADE A;  4XJ8 A;  3ZMO A;  4XFF A;  5FOB B;  3LWC A;  1O91 A;  4BQY A;  4IDZ A;  4PF1 A;  4CUG A;  1X8M A;  3U75 A;  1W9Y A;  2J1S A;  2WDB A;  1VMJ A;  5FZC A;  2CHH A;  3QH7 A;  2VTX A;  4PBP A;  1K5M C;  4JV4 A;  1XU1 A;  2Y6L A;  4YZ1 A;  3WQ0 A;  2PHW A;  2VOX A;  5GLV A;  3SIS A;  1UIK A;  4QDQ A;  3ILN A;  5FFO C;  5FZ8 A;  5HCB A;  2CGO A;  4DZG A;  1QJY 2;  1IG0 A;  1GOH A;  3NST A;  3ZKU A;  4FFG A;  3AZZ A;  3WUC A;  1WW7 A;  4N43 A;  3NJV A;  3ZFF C;  2P3Y A;  3J4U H;  1BK1 A;  3AZY A;  3AXD A;  5E16 A;  1FI2 A;  2JB4 A;  2PAE A;  1W8Z A;  4IEP A;  4QGM A;  4QX5 A;  1P8J A;  4RR3 C;  5EZW A;  1FOD 2;  1ENQ A;  1GIC A;  4LKF A;  4UYB A;  3WCS A;  3BOP A;  1RJ7 A;  2VPV A;  3GCW A;  4FO9 A;  1DYK A;  1SPP B;  4HKW A;  1U0A A;  5EQU A;  4HKO A;  3TBD A;  4QB6 A;  5FZO A;  3U11 A;  4TWT A;  5FO9 B;  1ZZ9 A;  1TEI A;  2X09 A;  3V0A B;  4OYU A;  4HPK A;  2EXJ A;  1H2M A;  2WS9 1;  2DUQ A;  3H42 B;  4AGG A;  5C3P A;  1RUN A;  1H9P A;  1UCX A;  3ZR6 A;  4Y4R A;  3I3E A;  1D4M 3;  1MS5 A;  4I0W B;  4NVP A;  4RFR B;  4URA A;  5ACA 1;  5HV0 A;  4I02 A;  4MV2 A;  4P14 A;  1OUX A;  1RIT A;  1CJP A;  4FPO B;  1W6O A;  1F9K A;  4QU2 A;  4HLT A;  4RYD A;  4CXY A;  4CDW B;  3CLP A;  1IQD C;  4HKL A;  4QQ2 A;  3AKR A;  1H2L A;  2Y6K A;  4AI3 A;  2OVU A;  1H6X A;  5C7G A;  1JYW A;  4IEV A;  3OTF A;  2WNO A;  3N35 A;  4D6R A;  3WX5 A;  1W9W A;  1VBB 3;  4LOR A;  1HXS 3;  4E4Z A;  1OF4 A;  2E32 A;  2YB7 A;  3AZX A;  1HJG A;  2DCZ A;  2XJU A;  4Q26 A;  4RS5 A;  3SMH A;  4RHV 1;  3ZXG A;  3D5O A;  4YGC A;  3I7D A;  1TE1 B;  2WO2 A;  3VBF C;  2C24 A;  1J3R A;  4OI0 A;  4NPM A;  1SLL A;  4WM7 B;  4MZU A;  3CKH A;  3CZU A;  3NNL A;  4BK4 A;  1ENS A;  5DN2 A;  1WBF A;  3WDU A;  5A7Q A;  3NNJ A;  4MH0 E;  2GU9 A;  2RS3 1;  2PXJ A;  3WUD A;  2VC9 A;  1CWP A;  3SCH A;  4QKN A;  1APN A;  4XIO A;  2R0F A;  5DAQ A;  2ZAA A;  1DHK B;  4ARX A;  1VAV A;  1GWL A;  1W39 A;  5LAS A;  3PMS A;  1KJL A;  2CDO A;  5LBF A;  3CZJ A; 
#chains in the Genus database with same CATH homology
 3RWK X;  3LDK A;  2AEZ A;  3LIH A;  4UFJ A;  5FK7 A;  3S5Q A;  4FFH A;  4FFG A;  2OXB A;  2AEY A;  3U14 A;  3ZR6 A;  4FFI A;  3UGH A;  4FFF A;  1UYP A;  5FMC A;  5FIX A;  3LEM A;  1ST8 A;  1Y4W A;  3ZR5 A;  3KF3 A;  5FKB A;  2XQR A;  4CCD A;  1Y9M A;  4UFI A;  2QQV A;  3PIJ A;  4JQT A;  3PIG A;  3UGF A;  5FMD A;  2ADD A;  3LFI A;  3SC7 X;  3LF7 A;  4B1L A;  4B1M A;  1Y9G A;  1W2T A;  2QQW A;  2ADE A;  3U1X A;  5ANN A;  4CCC A;  4EQV A;  3UGG A;  3HBK A;  3LDR A;  3U75 A;  2QQU A;  4QHZ A;  3KF5 A;  4UFH A;  2AC1 A;  4UFM A;  5FK8 A;  3OSD A;  3NMB A;  4UFK A;  4HXC A;  5FKC A;  3IMM A;  5FMB A;  3LIG A;  4AZZ A;  4CCE A;  3H3L A;  4UFL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...