2HWC2

A comparison of the anti-rhinoviral drug binding pocket in hrv14 and hrv1a
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
255
structure length
255
Chain Sequence
GYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVVYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPMCTEFSGIRSKSIVPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title A comparison of the anti-rhinoviral drug binding pocket in HRV14 and HRV1A.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 47
structure length 255
sequence length 255
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1994-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2hwc200
1COV3 1ASJ2 1RUH1 1AL22 4YVSC 1C8M3 1MQTC 5FMOL 1R082 2XBO1 4YVWC 1COV2 2WFF1 4QPIB 4GMP1 1OOPC 3CJIA 1QJU1 1E57A 1C8M2 1FOD3 1RHI3 1VBB2 5GKAC 3DPRC 2WZR3 1BEV1 4QPIC 5L7OA 3TN91 1FOD2 1RHI2 1VB4A 1RUI1 4FSJA 1H8TC 4CDQC 1PIV1 1RUC1 2PLV3 1QJX2 1AYM1 4RS5C 3ZFGB 1RMU3 1PGW2 2R063 4CEYA 4SBVA 5LK7B 1VBC2 3LOBA 1VBE1 1TME3 4Q4V1 1RMU2 2R062 2GSYA 1BMV1 4EJRA 4N43B 2TBVA 5D8AA 3VBUA 3VBRB 1AR92 1TME2 1EV13 1NCQC 1MEC1 5A33B 4N43C 3VBFC 5DDJ3 1PVC1 1AR73 1NG0A 1HXS3 4QPGA 3ZFEB 1PO11 4Q4X3 4RQPC 5CFDB 5J96B 4BCUA 4WM7A 1M06G 1F2NA 1HXS2 1HRI3 1X33A 1ASJ1 3S6PA 2HWE3 2ZTNA 2VQ0A 1VBD2 1ND3B 1HRI2 1QQP3 3VDDB 2QQPA 4IV3B 1VBB1 1RUF3 3JBG1 4CEWB 2WFF3 4WM8C 5C8CC 1QQP2 5JZGB 1EAH3 1SMVA 4AEDA 1AR63 1NA1C 3J8F1 3VDDC 3VBSB 3ZFGA 1RVF1 1VBA1 4PDWC 1RUF2 4CEWC 1BEV3 1D4M1 4GB33 1PO23 5JZGC 1AR62 1HRV1 2R073 4RHV3 4Y4YA 3HAGA 4CDUA 3NAPC 3JD73 1PGW1 5BNNB 2HWB1 1QJY1 4GB32 1PO22 3ZFFC 2WS92 1K5MB 4JGYB 1VBC1 2R072 4NWVA 4RHV2 5BNOB 3JD72 2MEV2 5A33A 1FMD3 5BNNC 1RUJ2 2RS53 2DF7A 2HWF1 4JGYC 1AR91 5C4WB 5C9AB 4N53A 1FMD2 4CDXC 2RS52 3ZFEA 1W39A 5CFDA 5ACA3 1MEC3 4GH4C 2GH8A 2R043 3IDEA 1MQTB 5ACA2 1OPOA 1OOPB 2RR13 1FPN3 4GMP0 1NCRC 1ND3A 2R042 1VRH3 3DPRB 1TMF1 2Y26A 4IV3A 3VBOC 5K0UC 2RR12 1ND2C 1FPN2 2BUKA 4RR3B 4FTSA 1VRH2 1H8TB 4CDQB 5FMOS 3VBSA 1RUE3 4CDWB 1DDLA 4RS5B 1ZBE1 4RR3C 2X5IC 1RUE2 2WZR2 4FTBA 1ZBA3 4CDWC 1K5MA 5BNOA 1V9U1 5BNPC 1RB8G 1RVF3 2PLV2 2HWC1 1ZBA2 4WM7C 1NCQB 1PGL1 1R091 2BFUL 5C4WA 5C9AA 1NY71 3VBFB 1R1A1 1RUD1 1AR83 2MEV1 1QJY3 2HWB3 5ABJB 5AC93 2XPJA 1OHFA 4YVSA 1AR82 4RQPB 1B35C 1EV12 1MQTA 4Q4Y3 2HWF3 2HWD1 4YVWA 5ABJC 5AC92 2RS31 1Z7S1 1AYN3 5DDJ2 1RUG3 4Q4Y2 3DPRA 1AR72 4Q4W3 2RMU3 2BBVA 4QPIA 1BBT3 2RS13 1AYN2 4CDUC 1AL21 2ZZQA 4Q4X2 4JGZB 1RUG2 2RM23 1H8TA 4Q4W2 4CDQA 5CFCB 2RMU2 4WM8B 3VBHC 5C8CB 1BBT2 1R081 1RUH3 1COV1 2RS12 1NA1B 4RS5A 1GFF2 2HWE2 4IV1C 1C8M1 2RM22 4JGZC 4PDWB 2XBO3 5CFCC 4GMP3 1RUH2 1QJU3 1CD3G 4N53C 3NAPB 1FOD1 1RHI1 5FOJB 2XBO2 2WFF2 3ZFFB 1VAKA 3ZXAC 1EAH2 1QJU2 3TN93 1RUI3 1NCQA 4NWWA 1QJX1 4N43A 1WCDJ 1NOVA 1PIV3 1BEV2 3VBFA 1RUC3 3VBRA 3TN92 1AYM3 1RUI2 1POV0 1RMU1 2R061 4CDXB 1IHMA 1PIV2 1RUC2 1POV1 1VBE3 4RQPA 1AYM2 5L7OB 4Q4V3 1TME1 3CJIC 1R093 4GH4B 2IZWA 1VB2A 1VBE2 5L7OC 2WLPA 1BMV2 2BPA2 1NCRB 4CEYB 3VBOB 5K0UB 1ND2B 5DDJ1 1PVC3 1MEC2 4FTEA 4WM8A 1AR71 5C8CA 4CEYC 1PO13 1NA1A 3VDDA 1HXS1 5A32B 1PVC2 4PDWA 4CEWA 1VBD1 2X5IB 1QJZA 5JZGA 1PO12 1ASJ3 5D8AC 1HRI1 3NAPA 3VBUC 1R083 3ZFFA 3JB4C 4QPGB 1QQP1 5BNPB 1VBB3 3JBG3 5BNNA 4WM7B 1RUF1 1A6CA 4JGYA 4RFT0 3J8F3 1EAH1 4QPGC 1AR61 1VBA3 1HQNA 3JBG2 4CDXA 1D4M3 1HRV3 3J8F2 4GB31 1PO21 2WS91 1QJX3 2R071 1RVF2 1VBA2 4GH4A 4RHV1 1HX6A 3JD71 1B35B 1D4M2 3JB8A 1HRV2 1RUJ1 2BFUS 1VBC3 4AEDB 1NCRA 1QJY2 2HWB2 1AL0G 1POV3 1FMD1 3VBOA 2RS51 5K0UA 1ND2A 1AR93 1OOPA 4AEDC 4CDUB 3ZFGC 1CJDA 2HWF2 5A32A 3VBHB 5ACA1 2WWSA 4RR3A 2X5IA 4IV1B 2R041 2ZAHA 2FZ2A 3VBRC 4CDWA 2RR11 4N53B 1FPN1 1TMF3 5BNPA 4LLFA 1VRH1 1VBD3 3M8LA 1TMF2 5J98B 3ZFEC 5CFDC 1RUE1 2WZR1 1ZBE3 1B35A 2PLV1 1ZBE2 4Z92B 3CJIB 1ZBA1 5ABJA 1ND3C 1V9U3 1C8NA 2HWC3 4IV3C 2FZ1A 1V9U2 2WS93 1R1A3 2HWC2 3VBSC 1RUD3 2MEV3 1AR81 4Q4V2 1PGL2 1R092 1RUJ3 1EV11 3VBHA 5AC91 1NY72 1R1A2 1RUD2 4IV1A 4JGZA 3FBMA 5CFCA 2HWD3 4Q4Y1 2RS33 1K5MC 1Z7S3 5BNOC 5D8AB 1AYN1 3VBUB 1AUYA 2HWD2 4Q4X1 1F8VA 1RUG1 4Q4W1 2RS32 2RMU1 1Z7S2 4Y5Z0 5C4WC 1BBT1 5C9AC 1AL23 2RS11 4YVSB 1X36A 2HWE1 2RM21 4YVWB
chains in the Genus database with same CATH superfamily
1Q5OA 2GNBA 1IZ3A 4PIYA 2GP5A 2JDHA 5EWSA 3PHMA 4YVSC 5FPVA 3PVBB 3T3YA 2VPVA 2XBO1 2JB4A 5IVFA 4QPIB 1ZA4A 1OOPC 1PZ8A 2WT1A 3CJIA 4B7EA 3WG2A 1JYVA 4EN7B 3R4UA 2VZTA 2QDNA 5LATA 4FBFA 1QOOA 5AFEA 1N1TA 2YUEA 4P02B 5GKAC 3C7HA 2LS6A 2CDOA 2D6OX 4QQHA 5HCFA 2VNOA 3I2OA 2XONA 5KHKA 2VOVA 3V0BA 5JOZA 2I07B 2A3WA 1DLCA 2VNRA 4OULA 3G6JB 3VD7A 2ET1A 4FP3A 4LIUA 4AGGA 1PIV1 3SISA 3E6DA 4PT6A 1UY3A 1JOPA 5F1RA 1QJX2 2V73A 2VCBA 1SFPA 4C0HA 1CPNA 1VR3A 2R063 2PHFA 2HEYF 3AKTA 1W8TA 4ZXEA 1Y7BA 1VBC2 2D98A 1VBE1 4OUSA 4NPLA 4QU2A 2R062 2GSYA 5CVRA 5IK7A 4EJRA 5FYIA 5DUWA 5D8AA 2Z5WA 4CUCA 2VL4A 2RV9A 3B00A 3U4SA 3IIAA 3R6SA 5DAVA 2VUJA 1PX4A 1UPIA 4N43C 1MS9A 2XVGA 2FQPA 3PDQA 1QY4A 1UMIA 4MYEA 3T1LA 5EIYB 3VKNA 1WMXA 3S57A 3P6BA 4D69A 3ZXKA 3MGUA 1SPPB 5IVEA 1JS9A 3ABZA 2FCVA 3E1F1 4Q4X3 2ORXA 2VE1A 1NXD1 3GBWA 1N1YA 4AZZA 4B4PA 1HB2A 5CISA 4KQ7A 1M06G 4QHZA 3MBWA 4QAWA 1I1EA 1KFUL 4WZCA 4CP2A 1SBDA 2ADDA 3S6PA 2HWE3 2Z2SB 2ZTNA 1O91A 4XOGA 1KFXL 2W91A 3T2QA 1Q8SA 1OQ1A 1HB3A 5FY5A 3URFA 4KNCA 1IQAA 1O7FA 1LOFC 3LQCA 3PUQA 4TYSA 4Y1XA 4Q27A 4C91A 5JSOA 2EICA 1GP4A 1RXFA 5K4LA 4XDOA 3QD6A 1LU2A 2ATFA 2D3SA 1RUF3 2YC2A 3JBG1 4LLOA 1W05A 4CSWA 4AEDA 3IDCB 1S2EA 3OBAA 1NA1C 1Y43B 1WLWA 2IXJA 3J8F1 4PLMA 4YM0A 2DTWA 3ZFGA 3O1TA 4FPFA 4PDWC 1RUF2 2DDUA 3HN3A 1RUOA 2Z42A 3CZUA 1JZ5A 4LITA 1XB9A 2G1MA 2PQSA 1D4M1 4B4QA 4GB33 1CVNA 5JZGC 3B02A 4ASKA 2VW1A 4BQ2A 1MPXA 3N36A 4Y4YA 3WDUA 4AAXA 4R9DA 3FBYA 3VHNA 4KMQA 1G9DA 3QCWA 2WINB 1JZ2A 2XJQA 3HPNA 4NHYA 2HWB1 2ILMA 2C24A 3C3VA 4GB32 4O7XA 4QQLA 4QXHA 4XQ4A 1K5MB 4JGYB 1LEMA 1VBC1 4NWVA 5BNOB 2PHUA 2Q1MA 2AEYA 2OIIA 4HKLA 1GMMA 4QKBA 3FL7A 2RDNA 5IVVA 4CXWA 1UX6A 3KT7A 5DAXA 2DF7A 2P6HA 2HWF1 3O0WA 1Q8OA 3POJA 2DCTA 2RDQA 3P1IA 4FFGA 2UWAA 2WO2A 3ALQA 3BALA 3LB9A 3N7KA 4I3PA 2B46X 1IGOA 5GZEA 3KWVA 3ZFEA 5LY2A 5FR3A 3VD9A 1W03A 1A8MA 3NV2A 4LT5A 5CFDA 5IAXA 2GC2A 2DBNA 1Q8PA 3KF3A 3MEPA 5FWJA 2GH8A 3BU7A 2BVBA 4AGRA 5L19A 1GLHA 2GC3A 2UWBA 4C8DA 1US2A 4AHWA 1W6MB 2WO1A 2GMMA 3CKHA 1OOPB 3K46A 2CL2A 3AKPA 3ORJA 1S55A 1X9TA 1CESA 2JICA 2XHNA 5FZHA 5KC5A 2IFWA 3I2JA 4YFZA 1VRH3 4R4ZA 3DCQA 1DGWX 3WNMA 5FZ0A 3V65A 3ZKUA 1W6OB 4NUBA 2X29A 2O1QA 4CZSA 1SBEA 2OA2A 5F6KA 4BQWA 3OGRA 1VRH2 5EJ1B 4HL0A 4YG6A 3VBSA 3HD8B 1JYTA 4Q0SA 2TNFA 2CDPA 4YW6A 3RRDA 1PNGA 2VW0A 3FLTA 1QMJA 5KHIA 1YFUA 4Q5OA 1GP5A 5DMYA 1QNWA 2J1AA 5FO7B 2X5IC 3JU9A 1IPKA 4MGZE 1U0AA 3AFKA 3AX4A 3HQUA 2OW4A 2ORZA 4CDWC 3RMXA 5A6ZA 4AVVA 1ZZ8A 2Y34A 4KG8A 3FLRA 4QPYA 2Y8KA 3V0AB 1YRZA 3KGLA 5LA2A 1UD1A 5F8PA 2JD9A 5C33A 1JHNA 2IC1A 4CUGA 1R091 3ECQA 2XG3A 5C4WA 2WSVA 3RYPA 1H30A 2VMIA 1RUD1 3E5QA 1AR83 5FJHA 4BIOA 1QJY3 4DXRA 5ABJB 2P4EA 5CKQA 2X10A 2XPJA 3LA3A 3MIEA 2VQAA 5IWFA 1W0OA 2PQQA 2D5HA 5FZ9A 1AR82 4XF1A 2VQTA 4LMFA 1QOTA 2CU5A 4XUPA 1EV12 2ZMLA 5D1IA 1JXNA 1WD4A 4XIKA 3VDAA 3JXSA 4I2OA 1X82A 2B8MA 4GXLA 4IE5A 4LEJA 4Z2WA 1Z7S1 3VZNA 1C1LA 3QH6A 1CAVA 2YGMA 1Y9GA 2JE8A 1YUDA 2R1DA 1XYNA 2ET7A 2RMU3 3B7MA 3IMNA 3ZIWA 1W6PB 1B09A 3WNLA 4HBNA 3WF1A 4CDUC 2EALA 1J1TA 2DUPA 1F31A 1UY2A 4JGZB 1FI2A 2RMU2 1OVPA 5CZKA 1YQ6A 1D7PM 2YROA 3VBHC 5LASA 4DRVA 1R081 2TUNA 5F5AA 2ARXA 4H55A 1XE0A 2WRAA 1NA1B 4LIVA 1LESA 3OY8B 3WNKA 1GSLA 4PDWB 1LRHA 1RYYA 5CFCC 2KXLA 4META 2NP0A 3E5XA 5JIUA 1E5IA 1MS0A 1MVEA 1OURA 1UNBA 1O3TA 4X6QB 3OGGA 1KQRA 4N53C 4I0AA 4GJZA 3OD4A 3CLPA 5FOJB 1XNCA 3AZZA 3H3UA 3I97A 2WFF2 2QZ2A 3LFIA 4IGPA 1EP0A 1ENXA 4XJAA 3ACGA 3ES4A 4Q0UA 5E6HA 2Q8EA 5T55A 1NCQA 4YW7A 4IL7A 2W3JA 4XFBA 5FFOC 5T5OA 4E4HA 1KGYA 1NOVA 1VMFA 1RUC3 4MGIE 4G9SB 5JOWA 4IEPA 2WA4A 3T2PA 3B94A 1POV0 3ES1A 4XDPA 1S2BA 5FP9A 2XL7A 2DV9A 1SLCA 5HXVA 3LKJA 1XBFA 4ZU7A 4LE4A 1HN0A 1YHFA 4XAAA 3MZHA 1RUC2 1TQ5A 3LDRA 2JG8B 2WR9A 3IT8A 5J37A 4CCMA 1S0GA 5DPNA 4QB1A 2BNOA 1N47A 4A4AA 4OCTA 3DXUA 3GYDA 4UXAA 3ZLIA 4EZHA 5E88A 4UT5A 5L7OC 5DQ0A 2J1SA 5FZLA 4AI1A 2JDZA 3CL1A 4FXGB 3ROUA 3TEZA 1U5ZA 5FUIA 1O4YA 1V6OA 2D97A 2QQWA 1GNYA 1J3RA 3RQ0A 4FPHA 4AI0A 2IWGB 1APNA 4LXLA 3VDCA 2QFEA 1MEC2 4KG0A 4WM8A 1VRBA 3ZYBA 4KWUA 1H1AA 2WWUA 4AXOA 1W8OA 2YU1A 1UL9A 3AB0A 1J3QA 4CTEA 2D6LX 4JCKA 3HWJA 4MLOA 1VBD1 5FREA 1Q43A 2X5IB 2VU9A 1L7RA 2ZHMA 4IEVA 4LO8A 5FZBA 1DYPA 3RMYA 3VBUC 3WDTA 1F15A 3I8TA 1ZRIA 3SQOA 1RINA 1RIRA 3JB4C 1QQP1 4A42A 1VBB3 2K0GA 5H9QA 3WP4A 3BTYA 1YWKA 5F5QA 2FDGA 1CIWA 1S2KA 5I0UA 4K8FA 3UESA 3VD3A 4LKFA 1RL3A 5CBLA 4QKNA 4RFT0 4DUVA 3VHOA 1GWMA 5CYYA 5DABA 2PTMA 2CSGA 1H6YA 3HOBA 1YC61 4YW2A 4CDXA 4EROA 4AQSA 4IEXA 4QHOA 2WS91 1RVF2 4LK6A 2P3IA 5CG9A 1HX6A 3NKGA 1LKNA 4XBQA 3C7OA 3SCGA 1UYZA 4JQTA 2FDHA 3HT1A 5FZ7A 1RUJ1 3FWEA 3WINE 1WW5A 1CAWA 1LCLA 1L3JA 1OQDA 2XLFA 4Y20A 3POGA 1OLRA 3WOGA 1W6QA 4J6GA 1QJFA 4NN0A 2B45X 3I2IA 5AFBA 1KS4A 4PF5A 3VBOA 5K0UA 1OKOA 2WAAA 1CAUB 1V00A 2VNGA 1UPSA 4GKXA 1YFXA 3J7HA 4CDUB 4F83A 3IBMA 2Q8CA 4M0HA 1JYCA 2P6CA 1JI6A 4MV2A 5FYUA 5A32A 5FZ1A 4C1XA 3VBHB 1W8WA 2WA3A 4MADA 4NIHA 2XMLA 3TB0A 1UF2C 2VOWA 2WWSA 3J7MA 3UGFA 2O8OA 3LSEA 4Q8KA 4FPKA 4EN6B 2IVJA 4L2NA 2CHHA 2VJXA 3J26N 4PLNA 2AZ5A 3VBRC 2WLQA 4BDVB 1JYIA 1LOBA 4WZFA 5JSRA 2XB6C 3QOPA 4N53B 2ZXQA 1DP0A 1CZTA 3S7EA 2GDFA 4ES8A 4XUQA 1VAMA 1XQNA 4BHPA 5C71A 1V6NA 2Y6GA 2AGSA 5FLJA 4COUA 3RYKA 2W47A 1C5IA 3RZKA 2VCCA 4LO6B 1XNBA 3M3EA 4XETA 1ALYA 4GQ7A 3ZSEA 3M8LA 4JDOA 2RVAA 4L97A 3PU8A 3NW4A 2LRPA 1X9PA 3EHKA 2BNMA 2ZPXA 2RJ2A 4QQPA 1LULA 2WNVA 3WF4A 3ZYFA 2WZR1 1FV2A 5I0DA 1VMJA 1ZBE3 2ERFA 3T4HB 4AVCA 2MNGA 3ACHA 4XILA 3HNMA 4GA9A 3ENRA 3NMBA 5LY1A 4XCAA 1GZWA 4XW3A 2X8KA 4HPKA 1N3PA 5F39A 1ZBE2 2XOMA 4BM8A 1W2TA 3WG3A 4M3CA 5FYZA 4F7ZA 4LNVA 1CR7A 4AI9A 5BUVA 4A7ZA 1XNAA 5GLVA 4KBBA 4LHSA 5JVVA 4EWDA 3WD5A 4YPJA 2YC4A 3KV9A 4KWJA 1PK6A 1W9FA 4TN7A 1ZZ6A 1J59A 2VH9A 3D3AA 1UW8A 4WVZA 1DQ2A 3NL1A 2IXHA 2VMDA 1OQEA 2A6YA 2VUDA 4Q4V2 3X29B 3H1YA 5C3OA 5I8TA 1JZ8A 3EYPA 2BZDA 3SEPA 4CE8A 3OBRA 2QNKA 1FATA 1NY72 5IFPA 5CG8A 3CNAA 2VR4A 3MLLA 5FYTA 2ADEA 5FY9A 2ZGLA 4IETA 4HKWA 4QDRA 4QB6A 4CUBA 1C3HA 3RZGA 4Q4Y1 2W0XA 2RS33 3W5NA 3I3QA 1VIWB 1SACA 3BN6A 5FYBA 4E4DX 5LBEA 4I01A 2FMYA 4QGLA 3WY6A 1AYN1 3VBUB 2OUHA 3KV6A 3THTA 2BTVC 4JZRA 4INDA 2W92A 4AI8A 2RS32 4S2DA 5FK7A 2CGOA 2XKPA 2AR6A 3CJXA 1N1SA 1C57A 1GV9A 4EN8B 5C9AC 3NNLA 3QACA 1AL23 2E26A 4X8PA 1YQ8A 1U5IA 2RM21 2BVVA 4YVWB 4YWAA 2YMZA 4GZ9A 1ASJ2 4A45A 1AL22 1GOHA 3RZJA 2BOIA 4FXKB 4GJYA 1O59A 3GZTB 3Q9OA 4ONUA 5LA1A 1UX7A 4TWTA 3GXUA 1NLRA 3IB3A 1MQTC 2EVXA 3W59A 2W1QA 2VVEA 3U4XA 5DN2A 4GMP1 3WW4A 3M1HA 3Q8FA 4M01A 3WDVA 4LOSA 1RHI3 2BERA 4O9EA 5JIAA 3OUIA 2Y38A 3ZO0B 3AL5A 3MI8A 5F2SA 5F7UA 4DS0A 3DPRC 4JAAA 1UWWA 1S0CA 1H9PA 3G7DA 4MGSA 4UF0A 1BEV1 4QPIC 3ZYGA 4DNYA 1RUNA 2FDKA 3BOPA 5FMDA 1RHI2 1VB4A 3I2DA 1RUI1 5J1XA 1DFQA 1ENRA 2AUYA 3T4VA 1H8TC 4MGYE 1HN1A 1OH3A 5LCWL 2PLV3 1DF0A 1REEA 2L9LA 3I59A 4YW3A 1AYM1 4K7JA 3SNMA 2B39A 4RS5C 2G9ZA 4QGMA 4D3WA 1PGW2 4CEYA 1V0AA 4XMIA 5DUXA 5BYNA 2LUWA 1W2AX 4A44A 1W28A 2P5BA 3BKZA 5T54A 5APAA 5LK7B 4CPBD 3WUDA 5FK8A 1LODA 3SCHA 4Q4V1 3UJQA 5EJ3A 1O3QA 3ZN6A 3WNOA 4OMDA 3UK9A 2WT2A 3VBRB 2RJLA 5C3PA 1AR92 2QQIA 2BWAA 2DTYA 2WFPA 3V56A 4OUEA 5EPAA 3B3QE 4AVSA 2Y6LA 4QQ2A 5IVBA 1DQ1A 1HV0A 1JYWA 4EN0A 4LOTA 3VBFC 1MS1A 5DDJ3 2YY1A 5LB6A 3MLJA 1PVC1 3HQXA 1GZ9A 1SBFA 1W8FA 2ES3A 3HNBM 1HXS3 1QWRA 4QPGA 5JUVA 2VMHA 3VZMA 1OUSA 4K21A 1WW7A 3BPSA 4L11A 3RWNA 4BCUA 4QHBA 2EA7A 3BTZA 2P1BA 5JMCA 1F2NA 2GAUA 1C4RA 1HXS2 2B7YA 5CIRA 2VVDA 4BXSV 2XLGA 1ASJ1 1AXZA 4OMCA 4BK4A 5KHGA 2VZRA 4FFIA 5GLZA 4XMAA 4K1ZA 1JOJA 1ZZ7A 4DY3A 2J1EA 5C3SA 4FVVA 3L9JT 1Q8QA 2JG9A 4LBJA 2UU8A 4UFMA 3GCWA 3VDDB 4XE9A 1FNZA 2QQVA 5JOYA 1O8SA 2QQPA 2NQYA 2EIGA 4PBPA 2LALA 4BXFA 4Y26A 4BZ4A 4CEWB 2ZZJA 1Y9MA 5C8CC 2GNTA 2BV4A 3WF2A 3ZXEA 1EAH3 4NAMA 3H0OA 4N90A 2ZS6B 2BRTA 2BYVE 2GC0A 2C4XA 2ZEWA 3EB7A 4I09A 4UYBA 4CCLA 3KCXA 5ANQA 4MGTA 4XQDA 3Q8CA 4YGEA 4LUKA 5SV5A 1HRV1 4RHV3 3GHNA 1PGW1 3BODA 5BNNB 4HSJA 1YI7A 3RG0A 4HK9A 3WHUA 2BW8A 4DZGA 2D7FA 5FZGA 3MF6A 4RHV2 4ISQA 1NUKA 3AL6A 3ZIXA 3DKWA 2AC1A 1T6GC 2Y33A 2ZJCA 3M7AA 2DURA 2RS53 4BWOA 3APBA 1W9YA 1X8EA 3N7JA 4P14A 4XBNA 1Y9QA 3TYJA 3VL8A 1OLQA 2GP3A 4JGYC 2AACA 1AR91 5C9AB 5F2WA 5BNQA 5EHDA 2VOTA 3PJQA 4Q29A 1SPPA 2QKDA 2RS52 3GJBA 3GZAA 1W39A 2ZGOA 2A70A 1S0EA 3OEAA 4L0PA 5CNAA 3WP6A 4JV4A 1FXZA 1W8UA 4BLIA 4ET7A 4BIFA 5ACA3 5LA9A 4LKSA 1AXKA 1YIPA 2R043 1DYKA 3M70A 3K2OA 5FLIA 2EF6A 1NLSA 1MQTB 4N9IA 5ACA2 4CCJA 2WZEA 3WW1A 4ASLA 5A7WA 2A6VA 2ZGSA 4GMP0 3AZYA 5SV8A 2B9VA 2R042 5FZ6A 2HEVF 2ZGMA 3WQ7A 4B4RA 1PVXA 5C6CA 2D40A 3W21A 3DPRB 1CGPA 1IPJA 2Y26A 2YU2A 4QX2A 3ZXLA 1UN1A 1KJRA 2VW2A 2C26A 4Y1UA 4RR3B 3MIBA 1GQHA 3GF6A 2PA7A 3AP5A 4FTSA 1QDOA 1H8TB 1AX1A 1JODA 1DQ6A 2VOKA 2NPIA 1S0DA 4FPGA 2MPFA 3K77A 3FUQA 4RS5B 1W2NA 2WABA 2BEOA 4RYDA 3S30A 5I0RA 2VZOA 2Y6HA 1WMEA 4L92A 4CCKA 5T52A 3CIHA 4K9SA 3KB5A 4Y22B 4YGBA 4L9BA 4Z82A 5IT6A 2W2IA 1K5MA 1FNYA 4XDQA 4Q0VA 5LRRA 5BNOA 1RB8G 4LQRA 4E2QA 1W6NA 4AR2A 2XR4A 2ZX0A 4JTNA 3TBDA 4AW7A 5T5JA 3I49A 1J58A 2BDRA 5AVPA 2OXBA 3J7NA 3PTRB 1KITA 3AYDA 2W87A 1PHMA 3VBFB 1R1A1 4B3NA 2ETEA 1F35A 4JX0A 2G9FA 3R4DB 3B01A 2R7EB 3WQ1A 5HV4A 3B5LB 2HWB3 1LECA 4OYUA 2B9UA 2KM2A 1JYXA 2XLAA 4HANA 2CWSA 4AEKA 2WYSA 5FY1A 5AC93 4FPOB 4QB2A 3GZUC 3MYXA 4YVSA 4XUTA 2P2KA 3BTAA 2HWF3 3M2MA 4EWAA 5ABJC 3ZMNA 5AC92 1D0GA 3KV4A 1IOAA 3SH5A 3FE5A 1OVSA 5AVAA 5FZ3A 2QDRA 1DIWA 5FZOB 4I0BA 1BVP1 3RWKX 4DMIA 2YZ4A 1QDCA 1RUG3 4Q4W3 4DRRA 1ZZCA 4MG2A 2OPKA 4ATEA 4OVEA 1W6OA 2IXIA 3AC0A 2RS13 3AZXA 4OFGA 4OI0A 1GBGA 4PI2A 4OZXA 4TSVA 1W04A 2ZZQA 4Q4X2 1RUG2 3JQWA 4Q4W2 3M3CA 4AK3A 3J7LA 4EQVA 1HLCA 2VZUA 5CA6A 1G6NA 1W90A 2VXRA 5C8CB 1RUH3 1IKQA 2RS12 2WAOA 3U11A 5F3IA 1O3RA 3GALA 2HWE2 3O1VA 2LW8A 2VMGA 4XJ8A 4JGZC 2VGDA 2ZCWA 4OHVA 5DXDA 3WUCA 3MV01 2R16A 1DBNA 1OI6A 1RUH2 2PYTA 4MZUA 5LA0A 4WVMA 1HDKA 1QJU3 1X50A 4YRDA 1CD3G 4C90A 4NO4A 5DZFA 3O14A 1ZRDA 1CPMA 2PMWB 2IFRA 1KRIA 2GH2A 3BIEA 1Y3TA 5ERLA 3V0AA 1QHDA 1VAKA 1YQ2A 3ZXAC 1QJU2 4LBKA 3TN93 2VECA 1J3PA 1GOFA 2JDUA 3DYPA 1QJX1 3ME2A 4PIZA 3MIGA 4N43A 4OI2A 1QH7A 4B29A 1WCDJ 2VMCA 5FY8A 2W1SA 2I45A 2VC9A 4N7IA 1NQJA 1O5UA 3TN92 3O1PA 1RITA 3H1WA 1W3VA 3I2FA 4AFCA 5DAPA 2E9QA 2R061 4Y1YA 5FZCA 2FHRA 1VMHA 5EJZB 5IHRA 2C9KA 3NV3A 1POV1 3OPWA 2ZKNA 3LFMA 1I6XA 3V0BB 5FBZA 3AZWA 5GJ6A 2BGCA 5IW0A 1R093 3AMQA 2D5FA 4URAA 1I9RA 2QJVA 5C70A 4M4PA 2LROA 3T0DA 3O5SA 4AFBA 2JG8C 4KL1A 4XUNA 3P3PA 5CKNA 4EE2A 1JHJA 2DUQA 1BMV2 4P9LA 1UY1A 4NIGA 4BQ3A 1XOYA 5KXBA 3FZ3A 1W6PA 1OUXA 4HVQA 2VBPA 4ORFA 1ZM1A 3OG2A 5JPNB 4ZS2A 2B5HA 1UY0A 4UFLA 4XFIA 5A3TA 3BUCA 3USUB 2QUOA 4WV8A 4WVVA 4FTEA 1UZZA 1QXPA 4XYXA 1PO13 2B4KA 1NA1A 1UZWA 4YZ2A 4RGAA 5C5UA 1DGRN 1UQXA 2PHWA 4LORA 4PDWA 1IS5A 1AJOA 1N3QA 2OS2A 2JX9A 2VAUA 3DYMA 4ZU5A 3VLBB 5IJRA 5JZGA 2YXSA 1PO12 2H6BA 5F6LB 3PJYA 2DCZA 4KGQA 5JI9A 1CZSA 2P17A 3K3OA 3A0NA 4I30A 5A3LA 1R083 5A6YA 1DG6A 2P37A 5L9VA 5T3NA 4AVBA 5CAZA 4R9AA 1SG3A 2IUWA 2G4IA 2OVUA 3N9MA 4HVOA 1RUF1 3D82A 1A6CA 3JZVA 4OI1A 4IESA 2QQOA 1SLAA 2W9XA 1A34A 1UOFA 4HETA 4QD2A 1A78A 1VBA3 2ZGQA 3NRUA 1OBNA 1POQA 5ANNA 5DAWA 4Q0QA 4E2GA 3T09A 3D6EA 1H4GA 1C5HA 3ZYIB 4GB31 3K4AA 3OGJA 4YZ3A 1VBA2 1GKBA 4Y33A 1NQDA 2HYKA 2VZSA 1XSQA 2WBKA 3M4FA 3HBZA 4JKLA 4KI5M 3VGIA 2PAEA 1W8HA 1CN1A 2WNUC 3RZHA 4AEDB 4AWDA 1JUHA 2UURA 2JDPA 2HEWF 1OA2A 4Z2AA 2FCTA 5JWPA 5H9RA 1QJY2 1H2MA 3F95A 3NNJA 4YM3A 1ULCA 1OD5A 4HSLA 3T0AA 3ON7A 2J7MA 3AZVA 2VTXJ 4GIQA 3VHRA 5FMCA 3D4KA 2VG9A 2XJVA 1OPMA 1H0BA 1O5LA 1PNFA 4Y4RA 3KM5A 3M3OA 4PBOA 5G04L 1BKZA 2X5IA 2ZAAA 2A73B 3NV1A 2QTWB 4A6OA 1SEFA 1G9CA 2FZ2A 4QDQA 4GAZA 2DFCA 5JR2A 3VDBA 4YW1A 4CDWA 3ZDSA 3DN7A 1JN2P 1SQ4A 5A7NA 5FAXA 5JOXA 1TMF3 4Q0PA 4UW3A 1VRH1 4NE9A 2FDFA 4YW5A 3FHAA 5GZDA 1VBD3 1YFWA 3K51A 3WF0A 1U5YA 4ITCA 4LHKA 5FYHA 4B1MA 4FFFA 1TMF2 1SFNA 4B8EA 5A3NA 4P9IA 3GDBA 1ENQA 3IMMA 3OCPA 3WNPA 4LK7A 3C8XA 2QQLA 1QGLA 1UZ0A 3GBFA 3EXUA 1K5JA 1CAXB 3A4UA 4A2UA 1OLME 2ZKLA 1BYHA 5FY4A 2D93A 4P5HA 4UBHA 5F3CA 3N9PA 5FYSA 5D21A 3ZYRA 3HR9A 4AL9A 1KS5A 4AE2A 1RTVA 1ND3C 2P3JA 2A6ZA 3OUHA 1V9U3 2E32A 3SITA 4D6RA 1LHUA 1J84A 1PZ7A 1W9TA 2HWC3 4IV3C 5C8WA 3INAA 4QDSA 2BNNA 1CWPA 2XVLA 3PUHA 4I02A 1SLBA 1T6BX 1V9U2 2DCKA 4JKMA 2WS93 4FOVA 5DZEA 1QF3A 2PELA 3WVJA 3I3MA 2HWC2 4K8RB 5FZMA 2MEV3 1VE0A 4GWNA 3THPA 4HVRA 1AR81 1TEIA 1LB2A 1PGL2 1MZ6A 1RUJ3 1EV11 3E5UA 3VBHA 4AVTA 3MF9A 4H2AA 3N35A 3WP5A 4XJZA 3W58A 2PXJA 3ZMOA 2ZGTA 3NSTA 1XPWA 2ZX4A 3OD0A 4XACA 5C3QA 5CFCA 1VJ2A 2HWD3 4M00A 3MPBA 1FYUA 1W8ZA 1XNKA 2F4LA 3AMHA 3FUOA 4GULA 4P9JA 4PQQA 1K45A 1YJLA 4YZ4A 3TRSB 4PCRA 4XJUA 4H14A 3GM8A 4XHXA 2GN3A 2HWD2 1DYOA 5JXIA 1ZX5A 2RMU1 1OMIA 2WNOA 4E8CA 2D3PA 1E5HA 2YBSA 5DZGA 1BXHA 3SC7X 1WD3A 4UOJA 5GZGA 3N4MA 3K4ZA 3M3QA 2P3KA 4L8QA 1VALA 4BMBA 4KU7A 3J4UH 3ZPYA 5FYYA 1COV3 3CBNA 4AYUA 4F8AA 5LEKA 2C6SA 2C9AA 4LJHA 1UAIA 4Y1VA 1CAVB 1C8M3 3VZLA 4XAEA 4QM8A 5FMOL 1W0PA 4QMAA 4YVWC 1UO9A 1COV2 1QKQA 1WW6A 2WFF1 4IE4A 1LJ7A 3AXDA 3MHZA 5FP7A 2KD7A 3OBTA 1E57A 1C8M2 1FOD3 1VBB2 2A3XA 2J42A 1EPZA 5L73A 4AFMA 2J1UA 2GMEA 5FPZA 1NLQA 3O1SA 1LHVA 3DKQA 3PUSA 3EO6A 2WZR3 2WNEA 2WNUB 2XH6A 5L7OA 1ULFA 3IPVB 1FOD2 2XHKA 2IXLA 3K3NA 4MXWB 4QKFA 4FSJA 4B1LA 2WZPP 2G9GA 3HBKA 2WL1A 4XFAA 4CDQC 5CU1A 3ILFA 4MSVA 1REDA 1RUC1 4CCEA 1SHWB 1EUTA 4E9KA 2UYAA 1IG0A 1RMU3 2J1RA 1LOAA 4HG6B 4NHXA 1CZVA 4D7TA 1QH6A 1X8MA 4BOWA 3WCSA 1SDWA 5TSWA 1TME3 3BYWA 3WDYA 1V6JA 4FPLA 1GQGA 3ZSJA 1RMU2 4CVUA 1DCSA 1MS8A 4CCCA 2W1UA 3AYEA 2DVAA 2ZX3A 2ZX1A 3LZZA 3OYWB 3VBUA 1LHNA 1TME2 1AF9A 4NAOA 3L2HA 2WQ8A 1SZBA 1NZIA 1MEC1 5A33B 4XIOA 4QX5A 3CMGA 2Q1ZB 3MIDA 4E4ZA 3H9AA 1UKRA 3EQEA 4IDZA 5M0TA 1AR73 2C1FA 1RC6A 3UKNA 5JSPA 1UIJA 3HJRA 2DU0A 4D6SA 1Q3EA 5F3EA 2N7GA 1WCKA 3WDXA 4BU2A 4UFJA 1NX9A 3HT2A 4RQPC 5J96B 3NJYA 2WJSA 3DGTA 4HONA 4WM7A 4AEMA 4RGKA 5A70A 1XSRA 1HB4A 1YQ5A 4YM1A 1PK6C 2NMOA 1HRI3 3JCIA 1X33A 4K40A 3P5BA 4HKOA 5T5PA 3SEEA 5J09A 5A7SA 2PHDA 4UFKA 2WKKA 4KBZA 3AMMA 4QX7A 2O8QA 1ND3B 1SCSA 5F37A 1BQPA 3WEZA 1HRI2 1ULEA 4W6XA 5FPUA 1WKYA 1K42A 4FCAA 4DXSA 2VUAA 4IV3B 3POEA 1VBB1 4AHZA 3W5MA 2VO5A 3TWIA 2OYZA 1UZVA 4XJ9A 1SMVA 1AR63 1I5ZA 3ACFA 3VDDC 4ZONA 1RVF1 2HBUA 2XJUA 4S2FA 4CEWC 1BEV3 4IEWA 1PO23 3UKVA 1GICA 1AR62 4LR4A 1GNZA 2R073 3ZXFA 4BPZA 4QX0A 3NAPC 3JD73 3TAYA 1QIQA 1TVGA 2HBTA 2SBAA 3ZN5A 2E33A 2Y6KA 3N9QA 1YEWA 2CAUA 4JDNA 4BJ0A 1PO22 4FPCA 3POWA 5G05L 5E1RA 3ZFFC 2R072 3AFGA 3JD72 3KCCA 4CYDA 2DVFA 1WWYA 3POFA 3LEIA 3MFCA 4YG0A 5FP3A 1FMD3 4QX3A 3ILRA 5BNNC 5FQ0B 2A1XA 3LIHA 4I3GA 4IE6A 3HMYA 3OGSA 5LWBA 3LIGA 4G3YC 1DGWA 1NXMA 2GMPA 2JB8A 4MH0E 1JW6A 4XFGA 2JIGA 5FPAA 1FMD2 5FPBA 2DVDA 4AQ6A 1H2NA 3S7IA 1PMJX 3I4IA 1GZCA 1WBFA 2R30A 3FX3A 2NZ9A 2R1BA 4Y20B 4GH4C 3ZYHA 2E7AA 1FT9A 2XWBB 3IDEA 4RFRB 5EQUA 1S0FA 4MO3M 4CPBA 1XYOA 3BU0A 5DG1A 1OPOA 2VZPA 2RR13 4EV0A 2E63A 2O0OA 1ULOA 2VUCA 2NMNA 2X53S 1RJ7A 4QU1A 1FPN3 4HMZA 1NCRC 1LU1A 3T30A 3S5AA 1TZOA 1GYKA 1MS3A 2ARAA 1X7NA 4GWIA 5CB7A 1SFYA 3O12A 5GZCA 2W5FA 3ZYJB 2RR12 1ND2C 2BP6A 2P34A 4OQ8A 2Q5TA 3OB8A 1FPN2 2VY0A 2R49A 4XQWA 1F5JA 1CX4A 5LK5A 3KV5A 3SKJE 3AP4A 4CDQB 3NNFA 4Q2FA 2VMEA 4W65A 5FMOS 5FY0A 1RUE3 4R9CA 5FXWA 2NYYA 4E2SA 1OXCA 3VD4A 2VZQA 4QKDA 1ZBE1 1OA4A 2BOJA 3AP7A 4RR3C 5E89A 5H9SA 2YFZA 4FQZA 5CKMA 2O14A 2FDIA 1IS4A 1RUE2 2ZGKA 5ISLA 4EWEA 1HV1A 1Q8VA 1ZBA3 1L7QA 2BJSA 4ZKTB 1PMHX 2YDEA 2YGLA 4XURA 5JI7A 5EP9A 5BNPC 1A8DA 4NIIA 2DBIA 1LNSA 2PLV2 1DGLA 4QXBA 4FQ4A 2WNVB 3DUIA 1ZBA2 3RGBA 1S0BA 4LHNA 4PQ9A 4NIAA 3HIFA 2AH2A 5FZ4A 5C9AA 2F4PA 4IEQA 1NY71 3KQ4B 3SXWA 3SHRA 5I91A 2QQMA 1DGRA 4BLJA 1ZREA 5JPMB 1HQWA 1O4TA 4FAHA 5GM0A 3E97A 4BMEA 4XC9A 2PAKA 3AP6A 2FDJA 1OHFA 3VV1A 2JDMA 2HLEA 3U0ZA 2DCJA 1G9FA 4B7KA 2QE3A 2HYXA 3LSDA 4RQPB 1B35C 1WCUA 3NO8A 4BYYA 1XNDA 1MQTA 3AJZA 4URTA 5A3UA 3N9NA 5IK5A 2CYFA 1NE4A 1PK6B 2RS31 4AI2A 2E31A 1STMA 1HIXA 1JUIA 3WG4A 5FRAA 5DDJ2 4FPJA 3DYOA 3A21A 3MICA 3DPRA 3RZLA 3O0XA 4D6QA 2AYHA 4MGKE 4QPIA 1G8WA 2V5YA 5IFTA 1JZ6A 1BBT3 4M0NA 1L7LA 4HN1A 1AL21 3ASIA 2V72A 3RJRA 4BK5A 4BQ5A 1H8TA 4LBQB 4UBGA 3RI8A 2BU9A 3UNPA 3RSJA 3H8XA 3ZXGA 1BBT2 1DZRA 1LENA 3LGRA 3ST7A 5HV0A 5HPOA 4RS5A 1M4WA 4WVWA 1E5SA 4IV1C 5FOBB 1S0JA 4D7SA 1MS4A 1E5RA 2XBO3 1JZ3A 5JXGA 3WCRA 2RE9A 2X09A 5FCCA 2HJIA 2ZEYA 3I2KA 4BQ4A 2DYCA 1OF4A 3NAPB 4H3WA 1EY2A 1RHI1 2H0VA 2ID4A 4EYUA 3W9AA 3A0KA 2XBO2 3Q8BA 3RI9A 2WIIB 3IZOA 2XQRA 5C5TA 4XABA 2EAAA 1PX3A 3ZFFB 1EAH2 3FN9A 2YV8A 3B93A 4NWWA 4YZ5A 3TEYA 1AXYA 1PIV3 4FOWA 3VBFA 4COZA 4HLTA 4R4XA 4E27A 3KLSA 1OSGA 3PVNA 5A3PA 5KXEA 2AREA 3AP9A 4UWDA 3KVBA 3R0RA 4JQRA 1PIV2 4UFHA 2ENRA 2NLRA 3UL2A 3OPZA 1VBE3 1LAJA 1JU4A 5FPXA 3CJIC 2D6KA 4GH4B 2W08A 2IZWA 5DAQA 1ZRRA 2EXKA 2JD4A 5FV3A 3IDAA 4XXAA 3AKQA 4AEJA 1VBE2 5FZOA 3VUOA 2CY6A 4CCDA 5JXHA 1G86A 4DINB 1C1FA 3I59B 2Y6FA 5FZ8A 3ZSKA 2BPA2 1DQ4A 1NCRB 5I0SA 4P00B 4CEYB 4YFWA 1VAVA 1OT5A 2FD8A 2ZHNA 3KVAA 2XJRA 1ND2B 1O4ZA 4KWKA 4K3UA 5DDJ1 4Y5SA 1GNHA 4Y3OA 5C8CA 3ZN6B 4FO9A 2DUOA 2WDBA 5A7QA 5L9BA 1HXS1 3WW3A 1LHOA 4LBMA 3U14A 4Z8BA 1I3HA 2QQJA 3MPPG 2QBXA 3RVHA 4FP2A 4Q1PA 2FMDA 4W6WA 3AYAA 4BE3A 5J36A 1QXRA 3D0SA 3LEGA 1IQDC 4AAPA 5FUNA 5D8AC 4IQPA 1IS3A 2YG0A 2CGNA 2XJTA 3TNPB 5J7MA 4LTAA 1TG7A 4HOOA 5LBFA 3PU3A 5FKBA 1GR3A 2PHRA 4DIQA 3WHTA 2A71A 3ZN4A 1OC1A 1XE8A 1G9AA 4DQAA 3BCWA 1XYPA 3PUIA 4LO4B 4QPGB 5BNPB 4A6SA 1UYXA 4CP9B 4I0WB 2GNDA 3TNQA 1ZA7A 3JBG3 2YBKA 4Q26A 2WQZC 2A3YA 2HH9A 4D0QA 1UCXA 3IWZA 5LEJA 3BPZA 3MDPA 4JGYA 3VKMA 5K9YA 3J8F3 1EAH1 1GQPA 3AMPA 3PURA 1OKQA 1W3XA 3MIFA 4M3CF 5KXDA 4OUMA 1AJKA 5A1AA 2JJ6A 3CF6E 3JBG2 4YGCA 5FO8B 1WMFA 1PMIA 2D6MA 1D4M3 1HB1A 3M3IA 2XUMA 2WQ4A 1HJFA 2GN7A 2JG9B 3ELNA 3J8F2 5B4XA 1EPWA 1QJX3 5BV6A 5FXXA 5A1LA 4RHV1 3R4SA 4MHUA 1B35B 1HJGA 4MHRA 1MZFA 2Q4SA 3AXEA 5EXOA 1D4M2 2ZGPA 2UYBA 4A7YA 1VBC3 2BBAA 3D5OA 1UXXX 2PAMA 4FOYA 4FI9A 2Y0OA 1JU3A 2HWB2 3LPFA 1AL0G 5A7OA 2XL9A 3UETA 2WT0A 1POV3 1BHGA 2RS51 1KDKA 1W6MA 3ETQA 4NPRA 3SH4A 1OOPA 5A1FA 1EUUA 5LRSA 4AEDC 2EIDA 1MR5A 5FY7A 3LF7A 4UW6A 2YFUA 1S1AA 5F5CA 3USUA 3ZFGC 4PIXA 1SLTA 4PJYA 4XCBA 3QBQA 3PIGA 4NR1A 1GANA 1CJDA 2R0FA 2HWF2 1BCXA 3EJKA 2OX0A 4NRMA 3ZKYA 5ACA1 2VTXA 2GC1A 1DZTA 4IV1B 2E51A 2R041 2YC0A 2ZAHA 3N9LA 2I74A 1HW5A 4IERA 2XDVA 2ARBA 2R6QA 1F4HA 3LWCA 4GALA 1DLLA 5FWEA 3PIJA 4LA3A 1XJAA 1PM7A 4YG3A 1FX5A 2PHTA 3I54A 4IUGA 3N9OA 4AF9A 2PN5A 3KF5A 5FXVA 2OT7A 4V2WA 1AX0A 2K9ZA 4RN5A 2VCAA 4XUOA 3I3EA 4UW5A 2GU9A 3Q8EA 5J98B 2Z69A 3ZFEC 1IG3A 3MUY1 1XU2A 2VZ1A 4DUWA 5C3RA 3DL3A 5CFDC 5A7WB 5JLVA 1VP6A 3B9CA 2OPWA 4COVA 2K2SA 2NM1A 2PFWA 3O0VA 4CU6A 4FOQA 3CJIB 4L99A 5EYYA 1ZZBA 5ABJA 2K46A 1WA4A 2VBBA 4PLOA 4CXXA 5J48A 3ZXJA 2VNVA 1C8NA 1GP6A 2WWJA 4YGDA 4C0BA 3NVCA 1TNRA 3DXTA 3ETPA 3W20A 4K1YA 1JZ7A 3ACIA 2JWPA 3KS7A 3KGZA 1WLDA 1ZVFA 3HEIA 2FZ1A 3WX5A 5T50A 3WZ1A 1QJEA 2W46A 3VBSC 1RUD3 1O8PA 2WN2A 4GKYA 2ZGUA 3LEKA 3VB9A 1VLNA 4FT8A 4U36A 5LBBA 1OH4A 1R092 3C7GA 1LOFA 1V6KA 2DWRA 2Q8OA 4N9HA 3WLUA 5AC91 1RUD2 1J83A 2KR2A 3VN4A 4CU7A 2WO3A 2VCMA 5BY5A 1W6NB 3FBMA 4JGZA 4KU8A 4Z07A 4CXYA 4IGQA 1K3IA 1ULPA 3UYJA 2Q8DA 1Z7S3 1R1ZA 3LEMA 3O1UA 3H8RA 5D8AB 1ENSA 1OFSA 3PMEA 5EV7A 3OY8A 1AUYA 3SH3A 4Q4X1 3IAQA 4DPNA 1F8VA 1RUG1 3E6BA 4CP0A 2V4VA 4Q4W1 4OHWA 1Z7S2 3GZEA 3AKRA 5C4WC 2VMFA 4QX1A 2RS11 4YVSB 3DF0A 5L9RA 2EIBA 3POBA 3H7YA 2HWE1 1F5FA 1WLCA 4HT1T 5FZEA 2KA3A 3T2OA 3ITQA 2XJPA 2ZABA 2Z79A 3BB6A 1RUH1 4MOAA 5GLTA 1PGSA 3Q8AA 4HK8A 3TOJA 4A3XA 5HXMA 1CAXA 4JRAA 1R082 1JYNA 4EN9B 5CADA 2DVGA 1IS6A 3AM2A 1QJU1 2EXIA 3LPGA 1W99A 4Y1ZA 2J22A 2ZACA 4CCOA 3V64A 5FKCA 4LA2A 3KMHA 2JG8A 5B4NA 2VZ3A 3MW3A 4RL7A 3TN91 3NNGA 3MFAA 3O1MA 3VKFC 2V5DA 3MW2A 2ZBJA 2VQUA 3T2TA 1WBLA 4OZOA 5FO9B 1W9SA 2XWJB 4YW4A 4DXZA 5A80A 4WVMB 3AVSA 1LHWA 3I7DA 3ZFGB 2ZGRA 3OUJA 3WG1A 3WQBA 3MIHA 4SBVA 4FFHA 3OBZA 1OA3A 2CTVA 2EAKA 1JBCA 2W95A 4NPMA 4V2VA 3UGHA 2JIJA 3LOBA 3F2ZA 4JKKA 4NIDA 3WDWA 4Y24A 2R32A 5HCBA 5FZAA 5D2AA 2EXJA 1BMV1 4JC1A 4N43B 1ODNA 1V6MA 2TBVA 4P9YA 1OFNA 4LO5B 4O9GA 2JKBA 1UMZA 3ZPOA 1UU5A 5FZDA 2X05A 2FCUA 4P9WA 2ZGNA 3QLQA 4OLLA 1EV13 3RNSA 1NCQC 1W9WA 3N7LA 3BIWE 3KT4A 1NE6A 4RD7A 1SLLA 3H7JA 1H1MA 1RJ8A 3N3HA 4KH9A 5HCAA 3PLQA 2YHJA 4SLIA 2ZMKA 2YYOA 1F9KA 1MVQA 2XXZA 4N7UA 1FAYA 3LCPA 4PI0A 2JE9A 1NG0A 4IEUA 4P5YA 1CIYA 3ZXDA 3POIA 1MACA 1PO11 2Q30A 1Z78A 3PMSA 3ZFEB 2J1TA 1PZ9A 3DV8A 4M3CE 5E16A 4AVAA 1WUVA 5CFDB 1MS5A 4J1XA 1I5PA 2YBPA 2DFBA 3MO4A 3WV6A 1YO8A 3LA7A 5DG2A 2GZWA 4DY5A 2ZHLA 2VQ0A 4KWLA 1VBD2 1GOGA 2LTNA 3BOWA 3AKSA 2WNUA 2RDRA 1SDDB 1QQP3 4OHZA 3D0JA 1W8NA 3IPVA 4UFIA 5A6XA 1JZ4A 3K75B 3BGAA 2EXHA 4MXWA 2GALA 3WT3A 2QQUA 2RJKA 4ISRA 4LE3A 4IXLA 1TNFA 3EMRA 4S2HA 1NT0A 2JDAA 2WFF3 4WM8C 4U2AA 1WLTA 1QQP2 2OZJA 4K20A 5JZGB 3HVDA 3RZMA 2D6NA 3SCFA 4HN0A 4LO7A 3VBSB 4R52A 1VBA1 3THDA 1LGCA 3PUAA 3AK0A 2UY8A 1ULDA 1KXGA 1WCQA 5A3OA 1CAUA 3H1MA 1XNTA 2VZVA 3PNAA 4OHYA 3HAGA 4XXPA 4YNIA 4CDUA 3GBGA 3OPTA 1LGBA 3U07A 1WW4A 2WZ8A 2F6BA 3I3BA 4FPYA 5I8SA 3AJYA 4XBLA 1QJY1 3OYWA 3A7QA 4GD4A 4HXCA 2WS92 4XHBA 4LHLA 4NOTA 4BISA 3CDZB 4UI9L 5JDBA 2MEV2 4E4SA 1IKPA 1UZYA 3KD4A 3LDKA 5A33A 5KHHA 1YFYA 4FAGA 5HBAA 2E6VA 4LULA 3NV4A 4ZHNA 1RUJ2 4QXKA 3DECA 4AGVA 4IW3A 1ZYBA 1GUIA 1F4AA 5C4WB 2HKXA 1JOBA 4H7LA 3OJBA 4IE7A 4N53A 4XEZA 3S0MA 2JENA 2A75A 3CO2A 3MUZ1 4JRLA 4CDXC 3ZYPA 4V1PA 1REFA 3ZSMA 3WQ0A 3OF1A 1XU1A 4OHXA 3T1MA 1QOSA 1MEC3 3HNYM 5I8YA 4W6YA 1LOCA 3SKVA 1N3OA 1MZ5A 3HN1A 3KHCA 1UYYA 4RSUA 3MV11 3I2GA 3ILNA 2Y0IA 1ND3A 1NAEA 1YCIA 3GHMA 3QH7A 4XFCA 4BB3A 3CU7A 1GWKA 5EFUA 3ACLA 2C0ZA 1DU3D 3RJ2X 1TMF1 4CU9A 4YARA 5C7GA 4IV3A 3VBOC 5K0UC 3PL0A 2ZOEB 1AVBA 1GWLA 2VXJA 2VVFA 4KGGA 2W39A 5GLUA 3C7EA 2BUKA 3CEWA 4XF3A 4JDMA 4MVTA 3FHQA 2JECA 1W06A 4Q1RA 2W52A 5F9TA 3VZJA 4A3ZA 5K7PA 1K12A 2R0HA 4NRPA 4DOUA 2WUHA 2JXAA 4Q8LA 4TLFA 4CDWB 1DDLA 1UOBA 3UGGA 2D3RA 1GZTA 4TZDA 2ZA9A 1UKGA 2IXCA 1ONAA 2VBDA 4UW4A 5FP8A 1G9BA 5GZFA 1URXA 2E7QA 2WZR2 1HKDA 2D6PA 2G19A 3OSDA 3GGLA 3UKTA 5IYYA 4FTBA 4ZZ5A 2VM9A 3SLIA 1ZNPA 3WNNA 4M4RA 2PHXA 1V9U1 1FV3A 1XRUA 4AHYA 5FIXA 1RVF3 2D43A 2RDSA 4NMIA 1GU3A 2HWC1 4QXCA 1UXZA 1S0IA 2C5DA 4LBOA 4WM7C 5FQ0A 2LM3A 3LD8A 1NCQB 5HI0A 5JAXA 1PGL1 1AX2A 2BFUL 2NN8A 2CGPA 3ZVXA 3THCA 4FPEA 2V4AA 2MEV1 4HZFA 2XJSA 5KXCA 2WNVC 4LBLA 1LR5A 1S4CA 5F5IA 4E8DA 3VZOA 5FDBA 2VOXA 3RPQA 4ZZ8A 4XJWA 5FYCA 1UY4A 3WF3A 1YNAA 5IK8A 1OF3A 4AQ2A 4QX8A 5FJKA 4YYOA 4TTGA 2TEPA 2ZEZA 3ZM8A 2W94A 2BGPA 2Y60A 4Q4Y3 2HWD1 2J1VA 4YVWA 5FPLA 4J25A 2XGXA 1HQLA 4WBBA 1G7YA 1AYN3 2SLIA 4QQOA 1CJPA 2RG4A 4ZS3A 2Y6JA 4BA6A 1ST8A 4YM2A 4Q4Y2 1O6UA 1AR72 3H8UA 3U1XA 2BBVA 5IK4A 1WZXA 1DQ5A 1DZQA 1UU6A 1BVVA 4CCNA 4F3JA 3T0BA 1AYN2 2QQKA 3H42B 5HCHA 2QCSB 2RM23 4CDQA 4ARXA 5CFCB 3ZR5A 3NNMA 1DHKB 4WM8B 4DO0A 5KBFA 4XF4A 4DXTA 4W4ZA 4C1WA 3NJZA 3FFZA 3NWKA 1COV1 3OGVA 1WGPA 4XTPA 3WP3A 3TEWA 3BI3A 2IXKA 4IEOA 1GFF2 3T08A 4AQTA 1ODMA 4DEQA 1C8M1 2RM22 2ZMNA 4D94A 4R8HA 5A3WA 2BGOA 1W2UA 2JEMA 4GMP3 4ZPIA 5DUVA 3U75A 1WA6X 3LOIA 3O1OA 2OKXA 1H6XA 5CEHA 1YI9A 5A7PA 1FOD1 4NRQA 3H50A 3H8OA 1QU0A 2OQ7A 3P3NA 4TXWA 3U10A 1UYPA 1OD3A 3DEMA 5JXJA 1UU4A 1KDMA 3S5QA 1BK1A 3WNXA 4ATFA 1C28A 4ARYA 3USSA 1RUI3 1Z0HA 4XF0A 2VD7A 2AENA 4NROA 3RZZA 1CONA 2JKXA 3H3ZA 5L36A 1BEV2 3VBRA 3A22A 4P9XA 5FYMA 3POYA 1AYM3 1LGNA 1H4HA 1RUI2 4RA0A 1LTEA 4LKEA 3LAGA 4QPWA 5IVJA 1ACCA 3RFRA 4COWA 2Y64A 1RMU1 2GNMA 3FFQA 2UY9A 4CDXB 1IHMA 1LOGA 5FUPA 3KQRA 4XZPA 5KHJA 2WYFA 1UOJA 4JTOA 4RQPA 1AYM2 1W2OA 4CA9A 5L7OB 1CX1A 2AEZA 1TME1 4Q4V3 5I0TA 2Q1FA 2V09A 4AOCA 5BXXA 1R64A 1VB2A 2IVIB 4XTMA 1H8VA 1KJLA 1RXGA 4XPVA 1KEXA 3WR0A 5B2GB 3HQRA 4OI4A 5FXZA 4OQ9A 5FZFA 3RYRA 3MW4A 4IEYA 3AYCA 4PHZA 1CAWB 1P8JA 3IIIA 3EBRA 1JMUB 5LW9A 2WLPA 5JR7B 3MLKA 1OLMA 3C2UA 3O7OA 3CQOA 2MHFA 1A3KA 1JTZX 1W6QB 2CWMA 4JHTA 4MUVA 1XXNA 2PHLA 3VBOB 4J1WA 3AVRA 5K0UB 4LBQA 1PVC3 2A6WA 4QGNA 4TLGA 1ULGA 2ARCA 1AR71 2OQ6A 4CEYC 3LDBA 5FLHA 3VDDA 4NHMA 5A32B 4COYA 5T5LA 4NVPA 5JMOA 3RDIA 1PVC2 1V6IA 4ES9A 3ATGA 4CEWA 1RGSA 1QJZA 1VPHA 5IATA 1ASJ3 1HRI1 3OEBA 3NAPA 2XUEA 2A6XA 4O61A 4AFAA 3OOXA 4CU8A 2H6CA 4DB5A 2YPJA 4RGGA 3LA2A 3ZFFA 4O65A 1ZRCA 3H3LA 1H9WA 4IE0A 2A7AA 4XVHA 3VZKA 1SLIA 3I3DA 1BLZA 5BNNA 1YLLA 4WM7B 2UWCA 2WO7A 4CUAA 1BZWA 4DEVA 3FC0A 1NYWA 2P3YA 5I93A 4XFHA 5GALA 3JUUA 4QPGC 1AR61 1T2XA 4ZU4A 4YSFA 1HQNA 5IVCA 1LOEA 1CQ9A 1D0HA 2JDNA 3VHPA 4G4FA 4Z1VA 1V6LA 4LBQD 3KCYA 3ZSLA 1EYBA 2BQPA 3TEXA 1HRV3 1V70A 3WXPA 1PO21 5A6QA 3NJVA 1GZWB 4H7MA 2R071 4GH4A 2WSUA 4AFDA 2E53A 5EYXA 2OZ6A 2YB7A 3JD71 1AZDA 1NZCA 2CV6A 3KHBA 4HPKB 5FBJA 5FMBA 3JB8A 1H1IA 1LEDA 4LBNA 1YIFA 4CRQA 1HRV2 2BFUS 5F3GA 2QZ3A 4M3CB 3FLPA 4NHLA 1SCRA 3PTYA 2JG9C 4XFFA 4PF1A 5FZKA 3U37A 4CP1A 1NCRA 3C7FA 2QQNA 4QWNA 1W0NA 4P08A 3UT0A 4JVAA 1U5XA 4DFSA 2EIEA 2CNAA 3CZJA 2Q0AA 1FMD1 4QM9A 4X8NA 1ND2A 1YYNA 1AR93 1BK0A 1QXJA 1PM4A 2WC2A 4MX3A 4BQXA 2XQXA 2ZEXA 4S2GA 1YQCA 1J1LA 2VULA 3VD5A 5EZWA 2FBEA 4XZUG 4W50A 3K48A 3IN9A 4BQ1A 5IUQA 4RR3A 5FZIA 3L2YA 5E8AA 4UAPA 4QT6A 5JCTA 2YPDA 1N1VA 3FHIB 2BWCA 3A23A 3POSA 1TE1B 5F32A 5GLWA 5IVYA 4D7YA 2H0BA 3GJAA 1QNYA 2RR11 2W68A 3BTXA 3E6CC 1UIKA 1FPN1 2D44A 3OTFA 1D4VB 4IEZA 5BNPA 4LLFA 4CP9A 4GWMA 4EZ4A 2OUJA 4LPLA 2DVBA 4Y22A 4YLZA 3SMHA 3K4DA 1U12A 1D2SA 3ZX7A 4MGQA 4X6RB 3J9SA 4LUMA 1ZRFA 3AMNA 1QEXA 3IM0A 2RHPA 3FMGA 1ZZ9A 2WN3A 2ZHKA 1RUE1 5A3MA 1WCSA 1XC6A 1H2LA 3UJOA 5BPXA 5K8SA 4W8JA 2W1WA 1H2KA 3VKLA 2F17A 4MXVA 5DUUA 2I2SA 3WW2A 3NQHA 5LBCA 3IAPA 3CHXA 2JE7A 3NJXA 1DQ0A 3RS6A 1B35A 1US3A 1XE7A 2PLV1 4BQYA 3ZDVA 4Z92B 1ZBA1 4XF9A 4GWJA 3O1RA 3D8CA 5IAVA 3NKTA 3R05A 4K6BA 2XVKA 1D2QA 4UF0B 5KR7A 1Y4WA 4IGOA 2Z4FA 4YZ1A 2VTFA 4NHKA 3ZR6A 4P9GA 1R1A3 2ZX2A 1KD7A 2DCYA 3IDBB 4DUXA 4R9BA 1Q56A 5FYVA 1YXWA 1MZEA 3BVCA 3FJSA 3N7MA 4ZY9A 3VKOA 1WMDA 4ZXKA 1BJQA 4JHZA 3ZOIA 5LZ6A 1R1A2 2QVSB 3KZ4C 4LKDA 4A41A 5FTTC 2XKOA 4IV1A 2A5ZA 3U78A 3GNEA 5KWRA 1O3SA 4N8MA 3UV9A 2DU1A 3IKWA 4AHXA 3I2HA 2E7TA 1K5MC 1JH5A 5BNOC 3B69A 1AHSA 4AG4A 2JDYA 4Y5TA 4D8MA 3JQXA 3GCXA 3PVEA 2JDKA 4HFSA 4A7KA 1UOGA 5J3UA 1NKGA 4Y5Z0 3B9IA 3KSCA 3LE0A 2CAVA 5KC6A 1BBT1 2B42B 3WSOA 1IPSA 1YJKA 3PVOA 3KT1A 4BH9A 1X36A 4NJ4A 1UMHA 3VL9A 4AI3A 4ASMB 5FP4A 5H9PA
chains in the Genus database with same CATH topology
1Q5OA 2GNBA 1IZ3A 4PIYA 5EWSA 3PHMA 4YVSC 3PVBB 2VPVA 2XBO1 4QPIB 1ZA4A 1OOPC 1PZ8A 2WT1A 3CJIA 4B7EA 3WG2A 4EN7B 3R4UA 2QDNA 4FBFA 1QOOA 5AFEA 1N1TA 2YUEA 5GKAC 2D6OX 5HCFA 4QQHA 2VNOA 5KHKA 2VOVA 3V0BA 5JOZA 2I07B 2A3WA 2VNRA 4OULA 3G6JB 4AGGA 2ET1A 4FP3A 1PIV1 3SISA 3E6DA 5F1RA 1QJX2 2V73A 4C0HA 1CPNA 1VR3A 2R063 2PHFA 2HEYF 3AKTA 1Y7BA 1VBC2 2D98A 1VBE1 4OUSA 4QU2A 2R062 2GSYA 5CVRA 5IK7A 4EJRA 5DUWA 5D8AA 2Z5WA 3B00A 3IIAA 3R6SA 2VUJA 1UPIA 4N43C 1MS9A 2XVGA 2FQPA 1QY4A 3T1LA 4MYEA 3VKNA 4D69A 3ZXKA 3MGUA 4Q4X3 3GBWA 1NXD1 1N1YA 4B4PA 4KQ7A 1M06G 1I1EA 1KFUL 4WZCA 4CP2A 1SBDA 3S6PA 2HWE3 2Z2SB 2ZTNA 1O91A 4XOGA 1KFXL 1Q8SA 1OQ1A 3URFA 4KNCA 1IQAA 1O7FA 1LOFC 4TYSA 4Y1XA 4Q27A 4C91A 5JSOA 3QD6A 1LU2A 2ATFA 2D3SA 1RUF3 3JBG1 4LLOA 4AEDA 3IDCB 4PLMA 1NA1C 1Y43B 1WLWA 2IXJA 3J8F1 4YM0A 3ZFGA 2DTWA 4FPFA 4PDWC 1RUF2 1RUOA 2Z42A 1D4M1 4B4QA 4GB33 1CVNA 5JZGC 3B02A 2VW1A 3N36A 4Y4YA 3WDUA 4R9DA 3FBYA 3VHNA 1G9DA 3QCWA 2WINB 2XJQA 2HWB1 2ILMA 3C3VA 4QQLA 4GB32 4XQ4A 1K5MB 4JGYB 1LEMA 1VBC1 4NWVA 5BNOB 2PHUA 2Q1MA 2OIIA 4HKLA 1UX6A 3KT7A 2DF7A 2HWF1 3O0WA 1Q8OA 2DCTA 2UWAA 3ALQA 3N7KA 3BALA 3LB9A 4I3PA 2B46X 1IGOA 5GZEA 3ZFEA 1A8MA 3NV2A 4LT5A 5CFDA 2GC2A 1Q8PA 3MEPA 2GH8A 3BU7A 2BVBA 4AGRA 5L19A 1GLHA 2GC3A 2UWBA 4AHWA 1W6MB 2GMMA 1OOPB 2CL2A 3AKPA 2JICA 1CESA 1S55A 5KC5A 2IFWA 4YFZA 1VRH3 4R4ZA 1DGWX 3V65A 1W6OB 2X29A 2O1QA 4CZSA 1SBEA 2OA2A 5F6KA 1VRH2 4HL0A 4YG6A 3VBSA 3HD8B 4Q0SA 2TNFA 3RRDA 1PNGA 2VW0A 3FLTA 1QMJA 5KHIA 1YFUA 1QNWA 5FO7B 2X5IC 3JU9A 1IPKA 4MGZE 1U0AA 3AFKA 3AX4A 2OW4A 4CDWC 3RMXA 4AVVA 1ZZ8A 4KG8A 3FLRA 4QPYA 3V0AB 1YRZA 3KGLA 1UD1A 5C33A 1JHNA 2IC1A 1R091 3ECQA 2XG3A 5C4WA 2WSVA 3RYPA 1H30A 2VMIA 1RUD1 3E5QA 1AR83 4BIOA 1QJY3 5ABJB 2XPJA 3LA3A 3MIEA 2VQAA 1W0OA 2PQQA 2D5HA 1AR82 4XF1A 1QOTA 1EV12 2ZMLA 5D1IA 1JXNA 1WD4A 4XIKA 4I2OA 1X82A 2B8MA 4GXLA 4Z2WA 4LEJA 1Z7S1 3VZNA 1C1LA 3QH6A 1CAVA 2YGMA 1YUDA 2R1DA 1XYNA 2ET7A 2RMU3 3B7MA 3IMNA 3ZIWA 1W6PB 1B09A 4HBNA 4CDUC 2EALA 1J1TA 2DUPA 1F31A 4JGZB 1FI2A 2RMU2 4DRVA 2YROA 3VBHC 1R081 2TUNA 2ARXA 4H55A 1NA1B 1LESA 3OY8B 1GSLA 4PDWB 1LRHA 5CFCC 2KXLA 4META 2NP0A 3E5XA 5JIUA 1MS0A 1MVEA 1O3TA 4X6QB 3OGGA 1KQRA 4N53C 4I0AA 3OD4A 3CLPA 5FOJB 1XNCA 3AZZA 3H3UA 2WFF2 2QZ2A 1EP0A 1ENXA 4XJAA 3ES4A 4Q0UA 5T55A 1NCQA 4IL7A 4XFBA 5T5OA 5FFOC 1NOVA 1RUC3 4MGIE 4G9SB 5JOWA 4IEPA 2WA4A 3B94A 1POV0 3ES1A 1S2BA 2XL7A 2DV9A 1SLCA 5HXVA 3LKJA 4ZU7A 3MZHA 4LE4A 1YHFA 1RUC2 1TQ5A 2JG8B 3IT8A 5J37A 1S0GA 2BNOA 1N47A 3GYDA 4UXAA 5E88A 5L7OC 4AI1A 2JDZA 3CL1A 4FXGB 3ROUA 1U5ZA 1O4YA 1V6OA 2D97A 1J3RA 3RQ0A 4FPHA 4AI0A 2IWGB 1APNA 2QFEA 1MEC2 4KG0A 4WM8A 1H1AA 4AXOA 1UL9A 3AB0A 1J3QA 4CTEA 2D6LX 4JCKA 3HWJA 4MLOA 1VBD1 5FREA 1Q43A 2X5IB 2VU9A 2ZHMA 4LO8A 4IEVA 1DYPA 3RMYA 3VBUC 3WDTA 3I8TA 1RINA 1RIRA 3JB4C 1QQP1 1VBB3 2K0GA 5H9QA 3WP4A 1YWKA 5F5QA 1CIWA 1S2KA 5I0UA 4K8FA 1RL3A 5CBLA 4RFT0 3VHOA 2PTMA 4YW2A 4CDXA 4EROA 4AQSA 4IEXA 2WS91 1RVF2 2P3IA 5CG9A 1HX6A 3NKGA 1LKNA 4XBQA 3SCGA 3HT1A 1RUJ1 3FWEA 3WINE 1WW5A 1CAWA 1LCLA 1L3JA 1OQDA 2XLFA 4Y20A 1OLRA 3WOGA 1W6QA 4J6GA 4NN0A 2B45X 5AFBA 1KS4A 4PF5A 3VBOA 5K0UA 1CAUB 1V00A 2VNGA 1UPSA 4GKXA 1YFXA 4CDUB 4F83A 3IBMA 4M0HA 1JYCA 4MV2A 5A32A 4C1XA 3VBHB 2WA3A 3TB0A 1UF2C 2VOWA 2WWSA 4Q8KA 2O8OA 3LSEA 4FPKA 4EN6B 4L2NA 3J26N 4PLNA 2AZ5A 3VBRC 2WLQA 1JYIA 1LOBA 4WZFA 5JSRA 2XB6C 3QOPA 4N53B 3S7EA 2GDFA 4ES8A 1VAMA 1XQNA 4BHPA 1V6NA 2AGSA 5FLJA 4COUA 3RYKA 1C5IA 4LO6B 1XNBA 3M3EA 4XETA 1ALYA 4GQ7A 3ZSEA 3M8LA 4JDOA 4L97A 3NW4A 3EHKA 2BNMA 2ZPXA 4QQPA 1LULA 2WNVA 2WZR1 1FV2A 1ZBE3 2ERFA 4AVCA 2MNGA 4XILA 4GA9A 3ENRA 1GZWA 4XW3A 2X8KA 4HPKA 1N3PA 1ZBE2 4BM8A 3WG3A 4M3CA 4F7ZA 4LNVA 1CR7A 5BUVA 4A7ZA 5GLVA 4KBBA 5JVVA 4EWDA 3WD5A 4KWJA 1PK6A 1ZZ6A 1J59A 2VH9A 1UW8A 4WVZA 1DQ2A 3NL1A 2IXHA 4Q4V2 1OQEA 2A6YA 3X29B 5I8TA 3H1YA 3OBRA 2QNKA 1FATA 1NY72 5CG8A 3CNAA 3MLLA 2ZGLA 4IETA 4HKWA 1C3HA 4Q4Y1 2W0XA 2RS33 1VIWB 1SACA 4E4DX 4I01A 2FMYA 4QGLA 3WY6A 1AYN1 3VBUB 2OUHA 3THTA 2BTVC 4INDA 4AI8A 2RS32 4S2DA 2CGOA 2XKPA 2AR6A 3CJXA 1N1SA 1C57A 1GV9A 4EN8B 5C9AC 3QACA 1AL23 4X8PA 1U5IA 2RM21 2BVVA 4YVWB 2YMZA 1ASJ2 1AL22 4FXKB 4ONUA 3GZTB 3Q9OA 4TWTA 3W59A 1NLRA 1MQTC 2EVXA 2VVEA 3U4XA 4GMP1 3WW4A 3M1HA 4M01A 3WDVA 1RHI3 4O9EA 5JIAA 3ZO0B 2Y38A 3MI8A 4DS0A 3DPRC 4JAAA 1S0CA 3G7DA 1H9PA 3ZYGA 1RUNA 1BEV1 4QPIC 4DNYA 3BOPA 1RHI2 1VB4A 3I2DA 1RUI1 1DFQA 1ENRA 2AUYA 1H8TC 4MGYE 2PLV3 1DF0A 1REEA 3I59A 4YW3A 1AYM1 4K7JA 3SNMA 2B39A 4RS5C 4QGMA 4D3WA 1PGW2 4CEYA 4XMIA 5DUXA 5BYNA 2LUWA 5T54A 5LK7B 3WUDA 1LODA 3SCHA 4Q4V1 3UJQA 5EJ3A 1O3QA 3ZN6A 3UK9A 2WT2A 3VBRB 2RJLA 1AR92 2BWAA 2DTYA 2WFPA 3V56A 3B3QE 4AVSA 4QQ2A 1DQ1A 1HV0A 4EN0A 3VBFC 1MS1A 5DDJ3 2YY1A 3MLJA 1PVC1 3HQXA 1GZ9A 1SBFA 2ES3A 1HXS3 1QWRA 4QPGA 2VMHA 3VZMA 4K21A 1WW7A 4L11A 3RWNA 4BCUA 4QHBA 2EA7A 5JMCA 1F2NA 2GAUA 1C4RA 1HXS2 2B7YA 5CIRA 2VVDA 2XLGA 1ASJ1 1AXZA 5KHGA 5GLZA 4XMAA 4K1ZA 1JOJA 1ZZ7A 4DY3A 4FVVA 3L9JT 1Q8QA 2JG9A 4LBJA 2UU8A 5JOYA 3VDDB 2QQPA 4XE9A 1FNZA 2NQYA 2EIGA 4PBPA 2LALA 4Y26A 4BZ4A 4CEWB 2ZZJA 5C8CC 2GNTA 3ZXEA 1EAH3 3H0OA 4N90A 2ZS6B 2BYVE 2GC0A 4I09A 3KCXA 4XQDA 4YGEA 4LUKA 5SV5A 1HRV1 4RHV3 3GHNA 1PGW1 3BODA 5BNNB 4HSJA 1YI7A 3RG0A 4HK9A 3WHUA 2BW8A 4DZGA 2D7FA 3MF6A 4RHV2 4ISQA 3ZIXA 3DKWA 1T6GC 2ZJCA 3M7AA 2DURA 2RS53 4BWOA 3APBA 3N7JA 1X8EA 3TYJA 4P14A 4XBNA 1Y9QA 3VL8A 1OLQA 4JGYC 1AR91 5C9AB 5BNQA 3PJQA 4Q29A 2QKDA 2RS52 3GZAA 1W39A 2ZGOA 2A70A 1S0EA 5CNAA 3WP6A 5ACA3 4JV4A 1FXZA 4BLIA 4BIFA 1AXKA 1YIPA 2R043 1DYKA 3M70A 5FLIA 2EF6A 1NLSA 1MQTB 4N9IA 5ACA2 3WW1A 4ASLA 2A6VA 2ZGSA 4GMP0 3AZYA 5SV8A 2R042 3WQ7A 2HEVF 2ZGMA 4B4RA 1PVXA 5C6CA 2D40A 3DPRB 1CGPA 1IPJA 2Y26A 3ZXLA 1UN1A 1KJRA 2VW2A 4Y1UA 4RR3B 3MIBA 1GQHA 3GF6A 2PA7A 3AP5A 4FTSA 1QDOA 1H8TB 1AX1A 1DQ6A 2VOKA 2NPIA 1S0DA 4FPGA 2MPFA 3FUQA 4RS5B 2BEOA 3S30A 5I0RA 1WMEA 4L92A 5T52A 4K9SA 3KB5A 4Y22B 4YGBA 4L9BA 4Z82A 5IT6A 1K5MA 1FNYA 4XDQA 4Q0VA 5LRRA 5BNOA 1RB8G 4E2QA 1W6NA 2ZX0A 4JTNA 3TBDA 4AW7A 5T5JA 1J58A 5AVPA 1KITA 3AYDA 4B3NA 1PHMA 3VBFB 1R1A1 4YZ1A 2ETEA 3WQ1A 2G9FA 3R4DB 3B01A 3B5LB 2HWB3 1LECA 2B9UA 2KM2A 2XLAA 4HANA 2CWSA 4AEKA 5AC93 4FPOB 3GZUC 3MYXA 4YVSA 2P2KA 3BTAA 2HWF3 3M2MA 4EWAA 5ABJC 3ZMNA 5AC92 1D0GA 1IOAA 3SH5A 3FE5A 5AVAA 4DMIA 2QDRA 1DIWA 4I0BA 1BVP1 2YZ4A 1QDCA 1RUG3 4Q4W3 4DRRA 1ZZCA 2OPKA 4ATEA 4OVEA 1W6OA 2IXIA 4OI0A 2RS13 3AZXA 4OFGA 1GBGA 4OZXA 4TSVA 2ZZQA 4Q4X2 1RUG2 3JQWA 4Q4W2 3M3CA 4AK3A 1HLCA 5CA6A 1G6NA 2VXRA 5C8CB 1RUH3 1IKQA 2RS12 3U11A 1O3RA 3GALA 2HWE2 2VMGA 4XJ8A 4JGZC 2VGDA 2ZCWA 4OHVA 5DXDA 3WUCA 2R16A 1DBNA 1OI6A 1RUH2 2PYTA 4MZUA 4WVMA 1HDKA 1QJU3 1X50A 4YRDA 1CD3G 4C90A 4NO4A 5DZFA 3O14A 1ZRDA 1CPMA 2IFRA 1KRIA 2GH2A 1Y3TA 3V0AA 1QHDA 1VAKA 3ZXAC 1QJU2 4LBKA 3TN93 2VECA 1J3PA 1QJX1 3ME2A 4PIZA 3MIGA 4N43A 4OI2A 1QH7A 4B29A 1WCDJ 2I45A 4N7IA 1NQJA 1O5UA 3TN92 1RITA 3H1WA 4AFCA 2E9QA 2R061 4Y1YA 2FHRA 3NV3A 1POV1 2ZKNA 1I6XA 3V0BB 5FBZA 3AZWA 5GJ6A 2BGCA 1R093 3AMQA 2D5FA 1I9RA 2QJVA 3O5SA 4AFBA 2JG8C 4KL1A 3P3PA 2DUQA 1BMV2 4P9LA 5KXBA 3FZ3A 1W6PA 4HVQA 4ORFA 1ZM1A 5JPNB 2B5HA 4XFIA 4FTEA 3USUB 2QUOA 4WV8A 4WVVA 1UZZA 1QXPA 4XYXA 1PO13 1NA1A 4YZ2A 4RGAA 1DGRN 2PHWA 4PDWA 1IS5A 1AJOA 1N3QA 2JX9A 4ZU5A 3VLBB 5JZGA 2YXSA 1PO12 2H6BA 5F6LB 3PJYA 2DCZA 4KGQA 5JI9A 2P17A 3A0NA 4I30A 5A3LA 1R083 1DG6A 2P37A 5T3NA 4AVBA 5CAZA 4R9AA 2G4IA 2OVUA 4HVOA 1RUF1 3D82A 1A6CA 3JZVA 4OI1A 4IESA 1SLAA 4HETA 4QD2A 1A78A 1VBA3 2ZGQA 4E2GA 4Q0QA 3D6EA 1H4GA 1C5HA 3ZYIB 4GB31 3OGJA 4YZ3A 1VBA2 1GKBA 1NQDA 2HYKA 3M4FA 3HBZA 3VGIA 2PAEA 1CN1A 2WNUC 4AEDB 4AWDA 1JUHA 2UURA 2HEWF 1OA2A 5JWPA 5H9RA 1QJY2 1H2MA 4YM3A 1ULCA 1OD5A 4HSLA 3AZVA 4GIQA 3VHRA 3D4KA 2VG9A 2XJVA 1OPMA 1H0BA 1O5LA 1PNFA 3KM5A 3M3OA 4PBOA 1BKZA 2X5IA 2ZAAA 2A73B 3NV1A 1SEFA 1G9CA 2FZ2A 2DFCA 4YW1A 4CDWA 3ZDSA 3DN7A 1JN2P 1SQ4A 5FAXA 5JOXA 1TMF3 4Q0PA 4UW3A 1VRH1 4YW5A 5GZDA 1VBD3 1YFWA 3K51A 1U5YA 4ITCA 4LHKA 4B8EA 1TMF2 1SFNA 4P9IA 1ENQA 3OCPA 1QGLA 3GBFA 3EXUA 1CAXB 3A4UA 4A2UA 2ZKLA 1BYHA 2D93A 4P5HA 4UBHA 3ZYRA 3HR9A 1KS5A 4AE2A 1RTVA 1ND3C 2P3JA 2A6ZA 1V9U3 3SITA 1LHUA 1PZ7A 2HWC3 5C8WA 4IV3C 3INAA 2BNNA 2XVLA 4I02A 1SLBA 1V9U2 3WVJA 2DCKA 5F9TA 2WS93 4FOVA 5DZEA 1QF3A 2PELA 2HWC2 2MEV3 4GWNA 3THPA 4HVRA 1AR81 1TEIA 1LB2A 1PGL2 1MZ6A 1RUJ3 1EV11 3E5UA 3VBHA 4AVTA 3MF9A 3WP5A 3N35A 4XJZA 3W58A 3ZMOA 2ZGTA 3NSTA 2ZX4A 3OD0A 5CFCA 1VJ2A 2HWD3 4M00A 3MPBA 1FYUA 1XNKA 3AMHA 4GULA 4P9JA 3FUOA 1YJLA 3TRSB 4YZ4A 4PCRA 4XJUA 4H14A 4XHXA 2GN3A 2HWD2 1ZX5A 2RMU1 1OMIA 2D3PA 5DZGA 1BXHA 5GZGA 1WD3A 3N4MA 3M3QA 2P3KA 4L8QA 1VALA 4BMBA 4KU7A 3J4UH 3ZPYA 1COV3 4AYUA 4F8AA 5LEKA 2C9AA 1UAIA 4Y1VA 1CAVB 1C8M3 3VZLA 4QM8A 5FMOL 1W0PA 4QMAA 4YVWC 1COV2 1QKQA 1WW6A 2WFF1 1LJ7A 3AXDA 3OBTA 1E57A 1C8M2 1FOD3 1VBB2 2A3XA 1EPZA 5L73A 4AFMA 5FPZA 2GMEA 1LHVA 3EO6A 2WZR3 2WNEA 2WNUB 2XH6A 5L7OA 1ULFA 3IPVB 1FOD2 2XHKA 2IXLA 4MXWB 4FSJA 2WZPP 2G9GA 2WL1A 4XFAA 4CDQC 5CU1A 3ILFA 4MSVA 1REDA 1RUC1 4E9KA 2UYAA 1RMU3 1LOAA 4D7TA 1QH6A 1X8MA 4BOWA 3WCSA 1SDWA 5TSWA 1TME3 3WDYA 1V6JA 4FPLA 1GQGA 3ZSJA 1RMU2 1MS8A 3AYEA 2DVAA 2ZX3A 2ZX1A 3LZZA 3OYWB 3VBUA 1LHNA 1TME2 1AF9A 3L2HA 1MEC1 5A33B 4XIOA 4QX5A 3MIDA 2Q1ZB 4E4ZA 3H9AA 1UKRA 3EQEA 1AR73 2C1FA 1RC6A 3UKNA 5JSPA 1UIJA 2DU0A 1Q3EA 2N7GA 1WCKA 3WDXA 3HT2A 4RQPC 5J96B 2WJSA 3DGTA 4WM7A 4AEMA 4YM1A 1PK6C 2NMOA 1HRI3 3JCIA 1X33A 4K40A 4HKOA 5T5PA 5J09A 2PHDA 2WKKA 3AMMA 2O8QA 1ND3B 1SCSA 1BQPA 1HRI2 1ULEA 4W6XA 4FCAA 2VUAA 4IV3B 1VBB1 4AHZA 3TWIA 2OYZA 4XJ9A 1SMVA 1AR63 1I5ZA 3VDDC 1RVF1 2XJUA 4S2FA 4CEWC 1BEV3 4IEWA 1PO23 3UKVA 1GICA 1AR62 4LR4A 1GNZA 2R073 3ZXFA 4BPZA 3NAPC 3JD73 3TAYA 3ZN5A 2SBAA 2CAUA 4JDNA 1PO22 4FPCA 3POWA 3ZFFC 5E1RA 2R072 3AFGA 3JD72 3KCCA 4CYDA 2DVFA 3MFCA 4YG0A 1FMD3 5BNNC 3ILRA 5FQ0B 4I3GA 3HMYA 4G3YC 1DGWA 1NXMA 2GMPA 4MH0E 4XFGA 1JW6A 1FMD2 2DVDA 4AQ6A 1H2NA 3S7IA 3I4IA 1GZCA 1WBFA 2R30A 3FX3A 2NZ9A 2R1BA 4Y20B 4GH4C 2E7AA 1FT9A 2XWBB 3IDEA 1S0FA 1XYOA 5DG1A 1OPOA 4EV0A 2RR13 2E63A 2O0OA 2NMNA 2X53S 1RJ7A 1FPN3 4HMZA 1NCRC 1LU1A 1GYKA 1MS3A 1X7NA 5CB7A 1SFYA 3O12A 5GZCA 3ZYJB 2RR12 1ND2C 2P34A 2Q5TA 1FPN2 2VY0A 2R49A 4XQWA 1F5JA 1CX4A 5LK5A 3AP4A 4CDQB 4Q2FA 5FMOS 4W65A 1RUE3 4R9CA 2NYYA 4E2SA 1ZBE1 1OA4A 4RR3C 3AP7A 5H9SA 5E89A 4FQZA 1IS4A 1RUE2 2ZGKA 4EWEA 1HV1A 1Q8VA 1ZBA3 4ZKTB 2YDEA 2YGLA