2HWC2

A comparison of the anti-rhinoviral drug binding pocket in hrv14 and hrv1a
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
255
structure length
255
Chain Sequence
GYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVVYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPMCTEFSGIRSKSIVPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title A comparison of the anti-rhinoviral drug binding pocket in HRV14 and HRV1A.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 47
structure length 255
sequence length 255
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1994-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2hwc200
4GMP1 1DDLA 2HWC2 4QPIB 4YVSB 2R072 3ZFFA 4Z92B 4Q4X3 1VBB3 4GB33 4AEDA 1GFF2 1RMU1 2R061 5GKAC 5BNPB 4EJRA 3ZXAC 3JD72 3NAPB 1RUF3 1RUJ3 1AUYA 4CDUB 1NOVA 4CEWB 1R092 5AC91 1BEV2 1PGL2 5K0UA 3VBUB 4CDWC 4FSJA 5D8AC 1RUH3 5C4WA 3VBHA 5DDJ3 1VRH2 1OOPB 1PIV3 3VBOC 1FMD3 1HRV3 2RS51 1RB8G 2HWB1 4Q4V3 1VBE1 1ASJ3 3VBFA 1BMV2 3VDDA 4N43A 1RUC1 4Y4YA 5BNOA 4Q4X2 1VBB2 4GB32 2WS93 4SBVA 1C8M1 2PLV1 3DPRC 1NCQB 1B35B 2MEV1 1QJX3 4QPGB 1W39A 4CDXB 1RUD1 1RUI3 2HWD1 1RUF2 1ZBE3 4WM7C 3VBRB 1NA1A 1RUJ2 4RS5C 1RVF1 1AR71 1NCRB 3M8LA 4PDWB 1V9U1 2X5IA 5CFDB 4Q4W1 1RUH2 1HXS1 1VB4A 2RM21 3JBG3 1PIV2 5BNNA 1FMD2 1HRV2 2HWF1 1MQTB 4Q4V2 1ASJ2 1H8TA 2R041 1MEC1 4YVWC 1AYM1 4N53A 3JB8A 1COV3 4RR3B 1HX6A 2WS92 1ND2A 4JGZC 4Q4Y1 5C8CA 1R081 3VBSC 4IV3A 1RUI2 1ZBE2 1RHI1 2FZ1A 5C9AC 2RS33 2RS13 4CEYC 3CJIA 1PO21 1TME3 2BFUS 1R1A1 2WZR3 1AL23 2ZTNA 5A32B 1POV1 1NY72 2IZWA 2RMU3 4CDWB 5D8AB 1K5MC 1BEV1 1WCDJ 5BNNC 3VBOB 1SMVA 1VRH1 1COV2 3ZFGC 1H8TC 2BUKA 1ND3C 1VBD3 1E57A 4IV1C 1ZBA1 5A33B 4QPIA 4YVSA 3DPRB 2RS32 2RS12 4GB31 5C8CC 5BNPA 1TME2 3NAPA 1PVC3 1VBC1 1AL22 4WM7B 1RMU3 2R063 5CFCC 4RS5B 5L7OC 1VBA3 1RUF1 2WWSA 2DF7A 3ZFEC 4RQPC 4CDUA 4CEWA 1Z7S3 2RMU2 4RHV1 5JZGC 3VBUA 5AC93 1RUH1 1OOPA 4WM8A 1AR61 2HWE3 1POV0 4GH4C 1C8NA 1VBD2 1QJU3 1ASJ1 4YVWB 2QQPA 4CDQC 1EAH1 2XBO3 2Y26A 4GMP0 3ZFFC 4JGZB 1TMF1 1RUC3 2WS91 1RUE1 1NCQA 4AEDC 4RFT0 1B35A 3VBSB 1PVC2 4QPGA 5J98B 2PLV3 3LOBA 2R062 5ACA1 1BBT3 5C9AB 2GH8A 3VBRA 1RUI1 1VBA2 4CEYB 1ZBE1 1EV13 4FTBA 1OHFA 1RUD3 1VAKA 5DDJ2 1NCRA 4JGYA 4PDWA 1Z7S2 1AYN3 1AR73 1FPN1 1X36A 5AC92 5K0UC 3VBHC 1V9U3 5C4WC 1OPOA 1FOD1 2HWE2 1NY71 1MQTA 3TN93 2RM23 1PO13 2RR11 1QJU2 1K5MB 1AR93 2HWF3 5BNNB 3VBFC 5ABJA 4WM8C 1HQNA 4FTEA 2XBO2 3VDDC 1RUG3 3ZFGB 3J8F3 1MEC3 1QQP3 1H8TB 4N43C 4RR3A 3IDEA 1ND3B 1COV1 1QJX2 5BNOC 2HWC1 1RUC2 4IV1B 1X33A 1F2NA 1M06G 2R071 2PLV2 1NG0A 1BBT2 4Y5Z0 4FTSA 5FMOS 1QJY3 1EV12 1R083 1NA1C 3JD71 1HRI3 1RUD2 5C8CB 3JBG2 2RS31 2RS11 1RHI3 3JB4C 2ZZQA 5CFCB 1AYN2 2GSYA 1AR72 2WFF3 2X5IC 5L7OB 5A32A 1PO23 1V9U2 3ZFEB 1R091 4RQPB 1A6CA 1R1A3 4JGYC 2BPA2 1PGL1 3TN92 2RM22 1PO12 1CJDA 1POV3 5JZGB 1AR92 2HWF2 4CDWA 2RMU1 1CD3G 1RUG2 1D4M3 1VB2A 3J8F2 1MEC2 1QQP2 4GH4B 3VBOA 4N53C 1AR83 1BMV1 5ABJC 4GMP3 4CDQB 1ND2C 4RR3C 4Q4X1 5A33A 1VBB1 1ZBA3 4IV3C 1QJY2 3ZFFB 2WZR2 1R082 3DPRA 1HRI2 4AEDB 3FBMA 1RHI2 2FZ2A 1F8VA 3CJIC 4NWVA 1RUJ1 2WFF2 4WM7A 1PVC1 5J96B 1PO22 4RS5A 1R1A2 1VBC3 1VBA1 5FMOL 2BFUL 4LLFA 5DDJ1 2ZAHA 5K0UB 1Z7S1 1PIV1 1FMD1 1HRV1 3VBHB 5C4WB 1D4M2 4Q4V1 2RS53 4RHV3 2HWB3 2HWE1 1AR82 1VBE3 1AR63 3VBFB 4WM8B 1PGW2 1QJU1 3VDDB 4YVWA 4N43B 3S6PA 2XBO1 4QPIC 1ZBA2 2BBVA 5FOJB 5BNOB 1EAH3 4YVSC 1C8M3 1QJX1 1RMU2 4JGZA 4CDXA 2MEV3 2XPJA 3VBSA 5BNPC 1TMF3 2HWD3 1RUE3 3NAPC 5C9AA 1BBT1 1NA1B 4CEYA 1VBC2 1RVF3 5CFDA 5ACA3 1EV11 5LK7B 4CDUC 3JBG1 4CEWC 4Q4W3 2TBVA 2X5IB 1IHMA 1HXS3 3HAGA 1AYN1 3VBUC 4JGYB 2RS52 4RHV2 1OOPC 2HWB2 1FPN3 1VBE2 2R043 3TN91 1FOD3 1AR62 1PO11 1K5MA 1AL0G 1AR91 2RR13 1AYM3 4N53B 3ZFGA 1RUG1 4NWWA 3J8F1 1QQP1 5ABJB 1EAH2 1ND3A 1C8M2 1ND2B 4IV1A 4Q4Y3 2MEV2 1NCQC 2HWC3 1TMF2 2HWD2 1B35C 1RUE2 4IV3B 4QPGC 2R073 4CDXC 1RVF2 1QJY1 1TME1 3VBRC 5ACA2 2WZR1 1AL21 1HRI1 3CJIB 1NCRC 4Q4W2 4PDWC 3JD73 1QJZA 1HXS2 5CFCA 5L7OA 5CFDC 2WFF1 3ZFEA 4RQPA 5D8AA 2WLPA 1FPN2 4BCUA 2VQ0A 2R042 1R093 1FOD2 1MQTC 5JZGA 1BEV3 2RR12 1AYM2 1VRH3 1VBD1 1D4M1 4GH4A 1AR81 4Q4Y2 4CDQA 1PGW1
chains in the Genus database with same CATH superfamily
4PI0A 1DDLA 4LNVA 2CNAA 3B3QE 1CJPA 1LRHA 3HD8B 2Y38A 3BTXA 5D21A 2B8MA 4YRDA 5C3QA 5JOYA 4Q27A 4D6RA 2WO2A 2EIGA 4D3WA 4D94A 5DAQA 1DQ5A 2LW8A 2W52A 1SLIA 1W8FA 4EJRA 2C9KA 5BNPB 2FCVA 5EV7A 4MVTA 4OI4A 3E6BA 4ISRA 4RGAA 2WN3A 4N9HA 2AC1A 1ULOA 1LNSA 2TUNA 1W8HA 4M00A 3TEWA 1EUTA 4META 3Q8BA 1MVQA 5FAXA 3WDUA 5LBFA 1QDOA 2BJSA 1US2A 1ZVFA 2CL2A 2WNVB 3OUHA 4YSFA 3FMGA 2WZ8A 3IBMA 3PLQA 3AC0A 4MOAA 2WSUA 5DZFA 1TZOA 3HMYA 2DVFA 3LAGA 3M3CA 2OZJA 3ZKYA 3USUA 1NXMA 2VNRA 4HOOA 1HRV3 3VBOC 4BJ0A 2YGMA 3MV11 4ES8A 1OA4A 3A4UA 3PUQA 1CIWA 1VBE1 2D6PA 4XF0A 1FV3A 4DS0A 4CXXA 4D6QA 4XW3A 4QPWA 3N3HA 4PCRA 1GQGA 4A6SA 1XXNA 4COZA 2EF6A 4GQ7A 4RL7A 1SBDA 2KR2A 3ILNA 3MW2A 4GWIA 4DEQA 2QQLA 1RUC1 1W3XA 4Y4YA 3D3AA 4TN7A 5BNOA 1XNAA 2DVBA 3WP6A 1VBB2 4B4PA 2QKDA 4MYEA 1OH3A 3UL2A 4HKLA 1KS4A 3DPRC 1NCQB 4V2WA 5HCAA 2RJKA 4CCEA 2VAUA 1B35B 1LEDA 1GU3A 2BNMA 2MEV1 2VTFA 4E2SA 3KT4A 3MLLA 3AX4A 3K75B 4XUPA 1KJRA 1LOEA 1LHVA 2EXJA 5CEHA 4QDSA 2P3YA 4GJYA 4WM7C 3VBRB 4LO8A 4L11A 4QKFA 1NA1A 3FZ3A 3V65A 1KJLA 3UKVA 4GJZA 4E4HA 1UN1A 3O0WA 4FFFA 3L2YA 4J25A 1XE0A 1DZQA 5FKCA 1CAWB 1IPSA 1Y4WA 4K6BA 4YM0A 2JD9A 1IS6A 1RUH2 1BYHA 1YRZA 2ZGPA 1HXS1 1JUHA 3JBG3 1VALA 1W04A 1W9TA 4GWMA 4JDOA 1OLQA 4FAGA 1PK6C 1PZ7A 5BNNA 1XB9A 2DURA 3B00A 5L9VA 1W6NB 1JYCA 2RJ2A 1A3KA 3WF2A 2DYCA 4DXTA 1HJGA 4R8HA 1H8TA 3B7MA 1KXGA 4EN9B 1DZRA 1H2LA 2ZMKA 3KQ4B 4JRLA 4UFIA 3C7GA 2D43A 3MPPG 2J1EA 2VZ3A 4CP9B 5FZCA 4BDVB 4Q26A 4E8DA 5ANQA 4X8PA 3WNMA 1FI2A 4HONA 4YZ3A 4BIFA 3EJKA 1APNA 2OUHA 4BXFA 1JZ3A 2WS92 4N9IA 1ND2A 2DFBA 4XEZA 3JU9A 1J3RA 4Q4Y1 3ZX7A 4AFBA 4A3ZA 1UCXA 2D98A 1DZTA 4H3WA 3U0ZA 5FTTC 2WZPP 1W3VA 4IV3A 5BUVA 4MUVA 1RUI2 3N4MA 3AP6A 5EJZB 1ZBE2 2YC0A 3AZXA 2PQSA 2W1SA 1RHI1 3FFQA 3FHIB 3GHNA 1IKQA 5IVBA 5JMCA 3I2HA 1SBEA 2RS33 2RS13 4CEYC 3ACIA 4CVUA 4X8NA 2BV4A 2QDRA 3K3OA 5FZ4A 2DCKA 3CJIA 2D5HA 2JENA 3CZUA 2WZR3 3IDBB 1HB4A 2ADEA 4FQZA 3MGUA 4Y5SA 2XHKA 3C7OA 4LMFA 1VJ2A 3I3QA 5FMCA 1JZ4A 3RZLA 5FZKA 4PQQA 4YFZA 3NVCA 1G9AA 3I2OA 5FP3A 3I59A 4QGMA 4LHLA 3NSTA 4OZOA 3KGZA 2Q4SA 4P00B 5E88A 3PUSA 2W94A 1KRIA 3I2FA 5D8AB 2KD7A 3VB9A 1BEV1 1Q5OA 2PQQA 3GZAA 3CO2A 3IPVA 2YBSA 3KD4A 4UAPA 5GZDA 5KC5A 3I49A 2VZ1A 3V0BB 5FYVA 1VRH1 1RJ7A 2VE1A 1U5IA 1YQ6A 4OI2A 5IT6A 5LEKA 3QCWA 4BK5A 2Y34A 1YQ8A 2WNOA 3LIHA 1VBD3 3ALQA 3MIFA 4QB2A 1K42A 1H8VA 2XR4A 4L0PA 4DO0A 2VZUA 1UPSA 1DYOA 1ZBA1 2PHWA 3ZSKA 1R64A 3BN6A 2W0XA 3OEBA 2YU2A 3NL1A 4K20A 5A6ZA 2WQ4A 4LBLA 3UJQA 2JDZA 5A3PA 4MGIE 2JDHA 3O0XA 2D93A 1E5IA 1OA3A 4GB31 5C8CC 3FHQA 2VMEA 4UFJA 4AEKA 5BNPA 1TME2 2PHFA 2OPKA 5JR7B 3AKPA 2K46A 2VCMA 5L7OC 1DQ1A 1OUSA 1RUF1 1VBA3 2WWSA 2Y33A 5F8PA 3ZFEC 4XBNA 4ZXEA 3G7DA 5JUVA 1SFYA 1UYXA 2WNVA 4FOWA 1LCLA 3H7YA 3RGBA 3WXPA 4GULA 1LU2A 1WW5A 2V5DA 3VL9A 2DVDA 5JZGC 4FXKB 3RWNA 5AC93 2GC1A 4QGLA 1AZDA 4NVPA 2ZHLA 1LJ7A 4LOSA 2ZX3A 5FKBA 3BODA 1POV0 1XQNA 3OPWA 1CWPA 4B1LA 1NLSA 2YBKA 5C3OA 4CCDA 2BOIA 3K4ZA 1UIJA 1SLBA 3JUUA 4UOJA 2GP3A 1XYNA 3OEAA 2XBO3 2JKBA 3B02A 3R05A 4QDQA 1W9WA 3B01A 4AI8A 2DTYA 4XURA 4LE3A 1XNBA 2JDPA 3AP7A 4GMP0 3ZFFC 2CGPA 5F32A 4JGZB 1XSQA 4XDQA 3W59A 1Y3TA 1RUE1 1NCQA 4DFSA 1I1EA 3CMGA 2CWMA 4N90A 1WLWA 2ARXA 4YPJA 3QOPA 1B35A 3VBSB 1IPKA 2JEMA 4Y1ZA 3ZYGA 2J1SA 4FFGA 4YM3A 4DY3A 2AEZA 1ZZBA 2GH8A 5AVPA 4L97A 2VGDA 3VBRA 5JVVA 5FP8A 1HLCA 1NQDA 1O8SA 4HT1T 1VAKA 2IFRA 5JPMB 1Z7S2 4GAZA 1CAWA 5HI0A 4BQ5A 1U0AA 5K0UC 4WV8A 2IFWA 1GMMA 3F2ZA 3KMHA 4FOVA 3AJZA 3ILFA 3PMEA 4H55A 1MS4A 2YG0A 4XFBA 3ABZA 4XBLA 4ITCA 3R4UA 1W6NA 2MHFA 3N9NA 1AR93 2HWF3 1UZYA 3VBFC 4FO9A 4CCCA 2VTXJ 4WM8C 4LBJA 4FTEA 4B3NA 2J7MA 2VR4A 1LR5A 4I30A 4CP9A 1S0EA 5JCTA 2WA4A 2RV9A 4XOGA 5KXEA 4AQ6A 1ULDA 1COV1 3WEZA 1O4TA 3EB7A 4U36A 4EZ4A 3LQCA 4IV1B 3CQOA 4K8RB 4JRAA 1X33A 4P9LA 5EPAA 5FXXA 1F2NA 1M06G 4ONUA 5A1FA 3H8RA 4GWJA 4COWA 4MGSA 2PLV2 3A21A 3K51A 1O91A 4QKNA 5T52A 1CAUA 1BBT2 1TG7A 4AVTA 1OF3A 4FTSA 1E5RA 2JX9A 1QJY3 4W6WA 4E8CA 5LASA 2P2KA 3I3DA 3LA3A 1IZ3A 3NJVA 4QB1A 4DOUA 2A3WA 1FV2A 2FDKA 1AYN2 2GSYA 2YC2A 3OBRA 1JOPA 1GBGA 2X5IC 4AHZA 4BMBA 1S2BA 1R1A3 1NXD1 4UBHA 2BWAA 2V5YA 3WVJA 1SFPA 1FXZA 1JZ8A 2GC0A 4BQ1A 5FYCA 4ZS2A 2KM2A 3RYRA 4GZ9A 4EN6B 2RMU1 3GGLA 4LHSA 5CB7A 4M01A 1CAVB 2UURA 1QQP2 4UT5A 5F5CA 4NMIA 4R52A 3V0BA 3PJQA 5GLWA 4KL1A 2E26A 1O6UA 4PF1A 1PNFA 2JE9A 2ZS6B 3AYAA 5GZFA 5CYYA 5K4LA 1WMXA 2ZJCA 3RZZA 2RDQA 4XDPA 5GJ6A 2Y60A 4I2OA 2WUHA 2DU0A 2VOXA 1XJAA 2WYSA 5IVEA 1VBB1 3E6CC 1PGSA 1QJFA 2CAVA 3N9PA 2NQYA 1QEXA 1PX3A 4OMCA 5H9QA 4AVSA 1UKGA 4AOCA 1JTZX 2QQUA 5G04L 2HEWF 1ULEA 1HW5A 1I9RA 4A6OA 1GNHA 1KDMA 1O7FA 2G9FA 1F8VA 5E1RA 4XACA 3IT8A 4H14A 3MIGA 1ZA7A 3PUIA 3DKWA 3WDYA 1D2QA 1STMA 3WP4A 3D0JA 1DYKA 1PO22 3AMNA 3QD6A 5FZAA 3TWIA 1GLHA 2A1XA 5EIYB 3KV5A 1F4AA 5FFOC 1W8NA 3LEGA 3SQOA 4DEVA 3RS6A 2ZAHA 3KSCA 3GM8A 3ELNA 3KM5A 3O1UA 3WP5A 4N8MA 1WBLA 3LGRA 5KXCA 3TAYA 4P14A 1SDDB 4A41A 3HVDA 4A44A 3B94A 1PMHX 3ZIWA 4V2VA 4LA2A 3ZN6B 2VW2A 2PFWA 5DAWA 5HXVA 3GBFA 3LDBA 2VVEA 3ZXFA 3VDDB 5IK8A 1YHFA 2WJSA 1BLZA 5T55A 4XE9A 2I45A 2QQKA 3GZEA 5F5IA 3WR0A 4BLIA 2FDFA 3ZYFA 4XAEA 4WZCA 4E2GA 1C3HA 5CG9A 1C8M3 2LM3A 1QJX1 3N9MA 4JGZA 5A7NA 1O3TA 1RXFA 1UOGA 2ZEXA 3U78A 3VBSA 3WG1A 2OT7A 1PMIA 4GWNA 3NNFA 4FPEA 4ZHNA 4TZDA 1ULFA 2GDFA 1VBC2 3KVAA 1LULA 1RVF3 4PT6A 4QQLA 4PLNA 2Q1MA 5A3OA 2D6KA 5ACA3 1EV11 5A7PA 3PUHA 5FK8A 2WZEA 1O3SA 5ERLA 2VZOA 2HEYF 3Q8EA 4RN5A 3DXTA 4CP0A 1RINA 4CEWC 5HV4A 2P3IA 4W65A 2R0HA 3VKOA 1K5JA 1S1AA 3T2TA 2ZEWA 4XFGA 1F5FA 3B93A 2E63A 2CHHA 5J09A 1VBE2 3T08A 2R043 4NOTA 4BA6A 3TN91 3HT2A 4WVMB 1AL0G 4RGGA 3ZYRA 1UY0A 1H9PA 1ZX5A 2L9LA 2XLGA 2X29A 2PHTA 3NQHA 2PHLA 1QNWA 4N53B 3C8XA 1UY4A 4NWWA 4DNYA 1YJKA 1OLRA 1RGSA 3W5NA 4F8AA 3H3ZA 1V00A 2FBEA 5I8YA 4K1ZA 2H6CA 3KHBA 3PJYA 2R32A 1YFXA 4IV1A 2NN8A 4Q0QA 2MEV2 4LHKA 4HPKB 4YLZA 3WUCA 2WT2A 4I09A 2XVLA 4BOWA 1TMF2 2RDRA 2WKKA 2XG3A 3CHXA 2VMIA 5DG2A 4HMZA 4XF3A 4UYBA 4K3UA 2VPVA 5FPLA 1TME1 1OSGA 1SQ4A 2WL1A 1UX6A 1G6NA 4COYA 4FPHA 2Z5WA 4QX0A 4AG4A 1HXS2 3LF7A 3GZTB 2HH9A 4OQ9A 1Q43A 4XJAA 3EYPA 4DUVA 3LPFA 2WLPA 4CU6A 1OQ1A 3VDBA 4NPLA 1W8WA 1JYVA 2XH6A 4E4ZA 3VGIA 3N7KA 4OCTA 2B9UA 3JQXA 4YW1A 3NJXA 4XILA 2RR12 4JTOA 4MGYE 5FZ3A 3D8CA 2QQIA 3N9LA 1CAVA 5JXJA 4BIOA 1PZ8A 1TEIA 1MS1A 4QPYA 4LO6B 1D4M1 4Y5TA 3VD7A 5JMOA 1ZRIA 4O65A 3WF3A 1GSLA 4J6GA 2B9VA 3I54A 4Q4Y2 4CU7A 4YGEA 4Q0SA 4GMP1 1S55A 3N7MA 1DBNA 4K9SA 4QPIB 2WRAA 1B09A 3PTRB 3S30A 3QBQA 3X29B 2ZMLA 2VNVA 4AGGA 4YVSB 1S0BA 4AQTA 5FYMA 4UWDA 4Q4X3 1W2UA 3FX3A 2XQXA 2ZX1A 1XNTA 4JC1A 1W6OB 4J1XA 1GFF2 2VBBA 1J58A 2Q8EA 2B46X 3E97A 4HVOA 1CQ9A 3ZXAC 3E5UA 3KWVA 1JYIA 3NAPB 2LALA 1H9WA 2OXBA 4KG0A 1JH5A 2VUCA 1WKYA 4LBOA 3UKNA 4AK3A 1O4YA 2XUMA 2BW8A 5FZ7A 1PM7A 1R092 4GKXA 4COUA 2W3JA 2OW4A 1WCSA 5FYIA 3N7JA 1BEV2 1CAXA 1JXNA 2BYVE 1CZTA 3W5MA 3VBUB 1LECA 1L7QA 2A70A 2VXJA 4QHBA 4IEOA 2DCZA 1VRH2 4DMIA 1OOPB 3H0OA 2Q1FA 1H6YA 3RJRA 2PAMA 3IB3A 1FMD3 3CNAA 1RB8G 2HWB1 1VRBA 5LATA 3I2IA 4LK7A 2LS6A 3H7JA 4IUGA 4Q4V3 5EYYA 5FPXA 1ASJ3 3O0VA 2XJRA 2VY0A 1BMV2 3VDDA 4AI0A 3WINE 5AC92 3SXWA 5HPOA 4I3PA 2EICA 2ZGSA 1QDCA 1G8WA 4OUMA 2VCAA 3AMQA 2XGXA 2W92A 5A80A 5IK4A 4OI0A 1WMDA 3ES1A 4GB32 5CKMA 4SBVA 3NKGA 3OBTA 1G9DA 2PLV1 4HETA 3RYKA 5C3RA 3B69A 4L9BA 1YEWA 1YO8A 1LOAA 4ISQA 3POBA 3DXUA 3R4SA 3SNMA 3WZ1A 1MZ6A 2VNGA 2B42B 1E5HA 2WNUB 1J1TA 1W39A 1FX5A 2VMFA 4CDXB 2ETEA 3MIBA 1RUF2 1N3PA 3P5BA 4R4ZA 5FBJA 4CPBD 2ZKNA 1RUJ2 4RS5C 1XU1A 5D1IA 4P9GA 3WX5A 4XTMA 1NCRB 3M8LA 3OGJA 1ZA4A 3OD4A 3HR9A 4PDWB 5J3UA 2NLRA 1RTVA 3T0AA 3AZYA 3WV6A 2QUOA 4MXVA 2V73A 1AJOA 4Q4W1 5FPVA 2RDSA 3AJYA 4NROA 5CFDB 2VOKA 4JQRA 4RA0A 4UFLA 5FPZA 4QHOA 1I5ZA 5IVYA 1HN0A 1PIV2 1ZRRA 4JDMA 1DQ2A 1F9KA 1M4WA 2QQJA 1OXCA 4AI3A 2V72A 3MI8A 4FFIA 1IS5A 2CYFA 3CBNA 4WVMA 3T30A 1UWWA 5C33A 3B5LB 5JOXA 4QXBA 1QU0A 3KT7A 1AYM1 4N53A 4YVWC 2A6WA 2XWBB 5GZCA 2Z4FA 1C1LA 1HB3A 3JB8A 4OULA 1SLCA 5LCWL 4E9KA 5EZWA 3VKNA 3M3QA 3LA7A 3PU8A 4BQWA 3TOJA 1LB2A 3CJXA 1Q3EA 1WLCA 4HPKA 3ZN5A 2WABA 2ZGRA 4QX7A 4COVA 1OLME 3LZZA 3ZYPA 4XF9A 2BP6A 4I0WB 5FUNA 2FZ1A 2VTXA 5C9AC 1WZXA 1QGLA 5IHRA 1YFWA 5JIUA 2VUDA 3B9IA 4HK8A 1JHNA 4KBBA 3POGA 1WWYA 4B29A 1PO21 3RFRA 2F4PA 1SACA 3OJBA 5IK7A 3O7OA 3OYWA 3GBWA 3U14A 3OD0A 3T4VA 1GR3A 4BHPA 3DKQA 3BTYA 3WCRA 4AFDA 3MW4A 4QM8A 1UU6A 5CU1A 1W9YA 3F95A 3OPTA 2VXRA 4NRPA 4QT6A 4YFWA 1LEMA 1JYWA 2B4KA 3POIA 5CFCC 1QXPA 2EALA 2BTVC 1K5MC 4IXLA 5BNQA 4WVWA 3FUQA 1UO9A 4MGKE 5BNNC 3JZVA 2ZXQA 1NUKA 1C1FA 1GYKA 3VBOB 1LHUA 4OZXA 5F1RA 1COV2 1VMJA 3VKMA 2VVFA 1H8TC 4WVZA 4PIZA 5FUPA 2BUKA 2UU8A 1ND3C 1E57A 1DQ4A 4DB5A 1ZRDA 1OT5A 5LBBA 4IE7A 1WD4A 5FZ6A 2BOJA 1JOBA 4IESA 1OI6A 4Q29A 1YFUA 4QPIA 2JG8C 1IS4A 1LHWA 2DCTA 1Y7BA 2HEVF 3USSA 4BQYA 4YVSA 3LEIA 2VCBA 2XDVA 4YNIA 2BVBA 5SV8A 3DPRB 4CUCA 5KBFA 2BDRA 2CWSA 4LHNA 4NRQA 1V6OA 1W6OA 4MGTA 1SPPB 3AFKA 3E6DA 3NAPA 1PVC3 1VBC1 1AL22 4WM7B 3KCCA 5F3CA 2ZZJA 1DGRA 2ZEZA 4HKWA 4IEVA 2X09A 3HQXA 4W4ZA 4EYUA 3TNQA 3UJOA 4LK6A 2WINB 2F6BA 2YC4A 3PVOA 1I3HA 1AHSA 2XJSA 4X6RB 3R6SA 1W9SA 2RJLA 1GOFA 1ZZ7A 2UY8A 5DZGA 1D0GA 3JCIA 4PJYA 3FL7A 4QQ2A 2RMU2 4XMAA 2BVVA 2D40A 1QJEA 3PMSA 3SHRA 4Y1YA 3VBUA 2PXJA 1O5UA 4GALA 3ZXLA 2J1TA 1PK6B 1V6JA 5F6LB 4CSWA 1OOPA 2HWE3 1Y9QA 2AENA 1LGCA 3H8OA 1ENQA 1LENA 3N36A 1X9TA 2CTVA 2D97A 1QJU3 2FMDA 5T50A 5DUWA 2BZDA 3OGVA 1J3PA 3UT0A 5FZFA 1PHMA 2CU5A 2DVAA 3KV4A 4CDQC 5EWSA 4DRRA 2ZX4A 3PURA 5C4WC 1UZWA 4QM9A 1C5HA 5CNAA 4JHZA 1JUIA 4JV4A 3WNXA 4PBOA 4D8MA 1JZ7A 1TMF1 1RUC3 3UETA 1RIRA 1V6LA 3ZOIA 4KGQA 4AEDC 2Y0OA 4G4FA 4CUBA 5A1AA 2QVSB 1DIWA 1SDWA 1PNGA 1TNRA 3LEKA 4RFT0 4BQ4A 2WNUA 5FZHA 2A71A 5LEJA 2R062 3WF0A 4CEYB 4QX3A 4UFHA 3MV01 4LKDA 2VO5A 5FZDA 3WSOA 1OHFA 1UQXA 1OVPA 2R49A 3RJ2X 5A3TA 1AXZA 5FY4A 2AREA 1H1IA 1NCRA 1ULGA 2E53A 3S5QA 4JGYA 4PDWA 3VUOA 2ARBA 1N1YA 1WA6X 3GYDA 3ZVXA 2WT1A 2ZA9A 3N7LA 5IATA 4BWOA 2XB6C 4CYDA 3IIAA 3VBHC 4Z2WA 2OA2A 3ITQA 2YROA 2NZ9A 4CPBA 5GM0A 3BVCA 1PO13 2RR11 5FRAA 5IFTA 2IXIA 3EBRA 4ORFA 4Q1RA 4E2QA 5C6CA 1O5LA 4OHVA 1SG3A 4ARXA 4LULA 2B45X 1GOHA 1HQNA 4JAAA 3QH6A 1RUG3 2A6ZA 3L2HA 3THDA 1H2MA 3FN9A 3J8F3 4W50A 4EZHA 2JB8A 4N43C 3H50A 3U10A 3MEPA 3ENRA 4FVVA 3IDEA 5A70A 1QJX2 2DCYA 1WLTA 4BYYA 2H6BA 3R4DB 1LKNA 3ZMNA 5GZGA 1ODMA 1U12A 3FBYA 4A7YA 1WLDA 3URFA 2WAAA 4KI5M 5F2WA 3U07A 4XZUG 2JECA 2WFPA 2ORXA 5FMOS 5HV0A 3ZYBA 3GCXA 1WD3A 1EV12 2OS2A 3VZKA 5C8CB 1HRI3 1RUD2 2RS31 1BVVA 1UX7A 2RS11 1TVGA 1RHI3 2AH2A 2VW0A 3LIGA 4QX5A 2K2SA 5E6HA 3PTYA 3VLBB 4AFCA 4CE8A 1SZBA 3JXSA 2GNDA 1AR72 2XWJB 2WFF3 2IC1A 4NAMA 5L7OB 1UOBA 1NT0A 1ZZ6A 2B39A 3UYJA 2DFCA 1V9U2 2ARCA 3WT3A 1R091 3ZFEB 5A7OA 2YGLA 1QKQA 3NV1A 3WNKA 5HBAA 3AL6A 3UGGA 3I3EA 1BK0A 2C4XA 2Y64A 4LO5B 2RM22 3TN92 2BPA2 5EXOA 1ZRCA 2VD7A 4XFIA 1GP5A 3HT1A 5JZGB 4XYXA 2QTWB 3DUIA 4BZ4A 3ZR5A 5FCCA 2W46A 2QFEA 1CD3G 2JJ6A 3L9JT 4P5HA 1VIWB 5FK7A 1XYPA 4D7TA 4XZPA 1MEC2 3VBOA 1W8ZA 2QNKA 1AR83 2VECA 2YXSA 4YWAA 1BMV1 4XABA 1HV1A 3H42B 1JU3A 1UZ0A 3AKTA 3KQRA 3I3MA 2RE9A 4KWJA 5JXHA 3BIWE 1JOJA 2A6VA 4BK4A 5KHKA 5LZ6A 1URXA 1YQ2A 5ABJC 4XJZA 3DCQA 4LT5A 2AZ5A 1SCRA 1ZBA3 2GNTA 4P9JA 3ZFFB 2C5DA 2KXLA 4B7KA 1R082 2UWBA 3DPRA 4NN0A 5FWEA 3FBMA 3ZYHA 4NIGA 5K9YA 1S0DA 4QKDA 1SPPA 1O3QA 3J7LA 4IE4A 5FPUA 1S0CA 5GZEA 1QIQA 2FQPA 4NWVA 4JHTA 2PHRA 3UKTA 1RUJ1 3AXDA 3ZXJA 3C7HA 4BQ2A 4WM7A 5KXDA 2CY6A 2DUOA 4XMIA 2PAEA 3D4KA 1G86A 1VBA1 2R1DA 2AR6A 5FYYA 5T5JA 1YFYA 1FNYA 3LEMA 1EYBA 4OMDA 4R9BA 1D0HA 3ILRA 5DDJ1 4YW5A 4ES9A 1I5PA 3PL0A 5K0UB 1PIV1 1DU3D 5C4WB 4XTPA 1AF9A 1D4M2 1A8MA 1PK6A 1QMJA 1VP6A 2HJIA 4RD7A 4Y1VA 2XXZA 2RS53 4FT8A 5JDBA 1X50A 2C9AA 3O1VA 5FYTA 3KB5A 4AVVA 5F2SA 3IIIA 5LRRA 5FBZA 4QGNA 1QWRA 3VBFB 1YYNA 4FPKA 4WM8B 3ETQA 2DU1A 2ZX0A 3WG4A 4Z1VA 5CAZA 1AXYA 5T5LA 1VR3A 2XBO1 5CZKA 3SISA 4AZZA 3LE0A 3NJYA 3RZKA 2ZGNA 3AMHA 4XBQA 4XJ9A 5FZ9A 4QMAA 4LQRA 4XHXA 4XVHA 2XPJA 3BI3A 4XJ8A 2RVAA 3APBA 2HWD3 4CP1A 1RUE3 1JU4A 3MBWA 4A7KA 4LTAA 1N1VA 1UYZA 2VQAA 4CEYA 3ZSJA 1AX2A 2AGSA 1DQ0A 1PZ9A 1RITA 5LK7B 2D6NA 4FOYA 4CDUC 5FZ0A 2ZKLA 4LUKA 2ILMA 2VBDA 2TBVA 2X5IB 4YW3A 3N9OA 5J7MA 3HAGA 4LXLA 2BERA 1UYYA 2A75A 5I0SA 4IE5A 1UF2C 2VZPA 3GF6A 4RHV2 2HWB2 1CPNA 1S0GA 3MUY1 2EXKA 3ETPA 3H1MA 4AQSA 1AR62 4XPVA 1U5XA 1MS5A 2YYOA 3ZYJB 1AR91 3KV6A 4IDZA 3BIEA 2ARAA 1N47A 1DGLA 5I0TA 3VZLA 3V56A 3VL8A 2FMYA 3ZSEA 4AI9A 4C91A 1QOTA 1X8EA 5ABJB 1EAH2 1KD7A 1ONAA 5L73A 1L7LA 3ZDVA 1OLMA 4P9YA 2J42A 1GP4A 1G9BA 4QD2A 2C1FA 4XFFA 5GLUA 3VHPA 3S7IA 4UF0B 1IOAA 1EY2A 4YW4A 2R30A 4CRQA 4QPGC 4PF5A 3U11A 4ZU5A 1V6MA 4NO4A 4XUNA 2F17A 5A3NA 5CADA 3O1RA 1QJY1 2Y0IA 4H2AA 4ASLA 3BALA 5FP9A 1AL21 3BOPA 2H0BA 3WF4A 2VZSA 4Q4W2 3J26N 2CSGA 1EPWA 3OOXA 3VHRA 4Q0PA 1Y9MA 2K9ZA 3AMMA 3OGRA 4AXOA 5L7OA 3RZGA 4KWLA 4FPLA 3LFIA 2ZCWA 3ZFEA 5F9TA 5D8AA 3LFMA 1FPN2 2ZAAA 1MZFA 3WW1A 4HBNA 1UAIA 1W0NA 2DUQA 3AYDA 1FOD2 1MQTC 4OYUA 4QX8A 5AVAA 5JZGA 3GBGA 5CIRA 2D3SA 1HV0A 5JPNB 1AYM2 1CR7A 3NJZA 5JI7A 3QH7A 2DCJA 4LEJA 4MHUA 1W6MB 3ZXKA 4IL7A 3HWJA 4F7ZA 2VVDA 3CKHA 1OMIA 1GWLA 4KG8A 3MYXA 3T1MA 5FO8B 4Q5OA 4AFMA 3P1IA 1PGW1 1JYNA 1QH7A 2R0FA 2HWC2 3LOIA 3B9CA 1CGPA 4DXRA 1U5YA 2NM1A 3KCYA 1W06A 3H8UA 2DVGA 2R072 3ZFFA 3NWKA 4DUXA 4Z92B 2D44A 1VBB3 2VMGA 5IJRA 2E33A 5FO7B 4Y20B 4AI2A 1RMU1 2R061 5GKAC 1CZVA 1X8MA 4Y4RA 1LOFA 1S0IA 5TSWA 2P17A 3JD72 4BQXA 1W6QB 2PN5A 3FWEA 2GNBA 5E89A 2OQ7A 3KGLA 2DBIA 4AVCA 4A45A 3WY6A 1X82A 5A6YA 1DQ6A 4CCOA 5A7WB 4C1WA 3I2GA 4CEWB 4CUGA 1ENRA 1HB1A 3ATGA 3GALA 5I8TA 3LSEA 1PGL2 5IAVA 5K0UA 4CDWC 4IEPA 3HOBA 3GDBA 1RUH3 3H3UA 2J1RA 3PIJA 4XQDA 5C4WA 3SH5A 4BISA 3GNEA 5A3MA 4QQOA 4W8JA 2Y6GA 1BQPA 3AZZA 1DP0A 4LBKA 4M3CE 4Q2FA 4NJ4A 1UL9A 4AL9A 4E27A 4KWUA 4Q8KA 3VBFA 2Q5TA 2XJPA 3W9AA 2N7GA 2NPIA 2QQOA 3RPQA 4A4AA 4LORA 1YC61 4RGKA 1W0PA 4XHBA 4LBMA 3RG0A 4I0AA 2IXHA 4ATEA 3VHNA 5FXZA 3J4UH 1ALYA 1F35A 2Q1ZB 5KHIA 3BTZA 3R0RA 5EQUA 2P3JA 5BPXA 3VD5A 2WS93 1YIPA 1C8M1 4EWDA 3CZJA 5FY0A 2BNNA 4HVRA 3EMRA 5FPAA 4XIKA 1QJX3 4AGVA 5IVVA 4P08A 4BQ3A 5BYNA 1OA2A 1V6NA 2WIIB 4LKSA 1RUD1 1RUI3 3H9AA 2MNGA 1MR5A 1ZBE3 4Y1UA 5LK5A 1LGNA 4NE9A 1D7PM 2A6YA 4TWTA 2Y6KA 1UOFA 1XSRA 4EN8B 2AEYA 5JOZA 3TNPB 1RVF1 1SCSA 5L9BA 3WOGA 1AR71 3DYMA 1W2NA 2HBTA 1V9U1 2DV9A 3UNPA 3NV3A 2X5IA 1DGWX 5ISLA 1CONA 1G7YA 2CAUA 4GXLA 2CGNA 3ACGA 3ZDSA 3U4XA 1VB4A 2RM21 4CA9A 3WW3A 3GXUA 4EROA 1YUDA 4N7IA 3AVSA 4UFKA 1HRV2 4Y22B 4YZ2A 2JG9C 3AYEA 1REDA 2UWAA 4QWNA 4YZ4A 1X9PA 3CU7A 2R041 4Q8LA 4ZKTB 1W05A 2VOWA 1MEC1 2Y6FA 3WDVA 2YBPA 4M4RA 4AHWA 1NLQA 3S0MA 3T3YA 3WF1A 4XFAA 3BUCA 2VZVA 3MF9A 3RYPA 4NHLA 2X05A 2XLFA 1KGYA 3CF6E 1H6XA 1UXXX 4RR3B 4AR2A 1UW8A 4J1WA 5APAA 2P37A 4AVBA 2JIJA 2D7FA 5A1LA 2OZ6A 5JI9A 4HXCA 3O1PA 2VBPA 2ZGTA 3M1HA 4UF0A 4UW4A 5FYSA 1VE0A 4B8EA 4LE4A 2XLAA 5C3PA 1CPMA 1R081 2P4EA 2IXJA 2FCTA 5CG8A 3N9QA 1SLLA 1U5ZA 1RXGA 3POSA 1YJLA 4FI9A 2J1VA 3HEIA 2A6XA 5LBEA 1ULCA 5DN2A 1X7NA 5I0RA 5IAXA 5KC6A 4OHYA 4YG6A 4MG2A 1TME3 1MS0A 1UZZA 3GCWA 3MF6A 2DBNA 1UKRA 3V0AB 5A32B 2VG9A 4HLTA 2BNOA 1POV1 3WNNA 1FAYA 4LOTA 3OBAA 2W47A 4LIUA 4OHXA 2IZWA 2B5HA 3IAQA 2A5ZA 5FJHA 1W90A 1ZREA 4IE6A 3AKQA 2NMOA 2WWUA 3THPA 1JODA 1QOOA 3UGFA 1F5JA 1Q8OA 3C2UA 3CDZB 3CIHA 1SMVA 5BY5A 1GQPA 1W6MA 3ZFGC 3O5SA 2GN7A 3HQUA 3POJA 4UXAA 4B4QA 1RL3A 3ZSLA 2LROA 2EIDA 2DWRA 3GHMA 2GC3A 3EXUA 2W2IA 3C7FA 4P9WA 4PI2A 4LJHA 1BXHA 1O4ZA 1T2XA 5DAXA 3TB0A 3MPBA 5FYZA 5A33B 3ZR6A 2XOMA 2YPJA 1LGBA 4IEUA 4UW5A 2G9ZA 1HB2A 2VZRA 4CXYA 3J9SA 3W20A 2RS32 2D6MA 2RS12 4MLOA 5A7SA 1GZWB 4PIYA 3VD4A 4A2UA 1HN1A 4Y20A 4AVAA 5IWFA 5GLZA 3WG3A 1US3A 5F7UA 2J1UA 1W6QA 4NR1A 1F31A 4RS5B 3SCHA 2DUPA 5CISA 2DF7A 1EPZA 4RQPC 3U75A 5JSOA 1NYWA 3VD3A 1ACCA 4YW2A 4CEWA 3D6EA 1Z7S3 4IGQA 4IEXA 2GNMA 3AM2A 4RHV1 5IVJA 4IEZA 4M3CB 1Q8QA 3WCSA 3KF5A 3ZN6A 2W1WA 1AR61 5FREA 4GH4C 3WQ0A 1WGPA 1GKBA 1GANA 1VBD2 1HQLA 1IQDC 1OPMA 2JDMA 3AL5A 2GN3A 4E4DX 4O9EA 3HNYM 3USUB 1ASJ1 3FLTA 3RDIA 4YG0A 4YVWB 4FXGB 1RUOA 5FY7A 1EAH1 2ID4A 1NE6A 3BU7A 4W6XA 3IKWA 5ANNA 4OHZA 3AP9A 4CCMA 3WNOA 1XRUA 4KNCA 4OFGA 2GU9A 1MACA 1OKOA 1K12A 4XQ4A 1OD3A 3OF1A 1QHDA 4QHZA 4YM2A 1IGOA 1DF0A 3K4DA 4NIAA 5B2GB 1JZ2A 3HNMA 2PLV3 3RI9A 1VPHA 4HL0A 5FMDA 3ZKUA 1BBT3 2A73B 4CCNA 4XJUA 5C9AB 1W8OA 4IETA 1VBA2 2YV8A 4R9AA 5FZ1A 3QACA 4BE3A 4QQHA 5DDJ2 2YU1A 1AXKA 3DV8A 4M4PA 5BV6A 5FIXA 5B4XA 2Q8CA 2UYBA 3ZIXA 4CP2A 1RUNA 3NO8A 1AYN3 3AZWA 1FPN1 1X36A 1KDKA 2VCCA 1ZZ8A 3LKJA 3P6BA 4O61A 4XXPA 1XYOA 2Q30A 3WNPA 4M0NA 1OPOA 1FOD1 3RVHA 1NZCA 4I02A 4LBQB 2JDKA 4Y22A 1NY71 2JDAA 1CN1A 3IMMA 1BCXA 1K5MB 3I2JA 1H1MA 5BNNB 3M3OA 2E31A 2XBO2 2NMNA 4C1XA 2OX0A 1YI7A 1OUXA 5F3EA 1QQP3 1H8TB 3AK0A 4RR3A 3M4FA 3WHTA 3PVEA 1ND3B 2G9GA 3WW4A 5BNOC 2HWC1 4BU2A 4P9IA 3BPSA 5DAVA 2YHJA 5HCFA 4EQVA 3I8TA 4MX3A 1W99A 3FLPA 2O14A 4XDOA 2JG8B 2R071 5L36A 4S2DA 3FJSA 1NG0A 1CIYA 3OUJA 4FPGA 4JDNA 4XCAA 4DINB 3GZUC 5EJ3A 4Y5Z0 5FY1A 3H8XA 1MZ5A 4IEQA 1UU5A 5FO9B 3M3EA 2G4IA 1NA1C 2J1AA 1FATA 2B7YA 3A23A 3JD71 2GALA 3MZHA 2FDHA 2IVIB 3LSDA 5CBLA 2QBXA 1VAMA 4ARYA 5CFCB 1YI9A 3IDAA 3UGHA 3V0AA 1QH6A 5A32A 1PO23 4XF1A 4OUSA 1A6CA 4M3CF 4XC9A 3T1LA 4JGYC 1PGL1 1UMZA 1RJ8A 1OBNA 2HBUA 1WBFA 3NW4A 2D6OX 3FLRA 3GJBA 1AR92 4Y33A 2HWF2 2VQUA 2ZX2A 1C5IA 2BGCA 2O8QA 1OF4A 5FZEA 4Y3OA 2W91A 1D4VB 3OUIA 1S4CA 5FMBA 3EHKA 2C0ZA 3ZXEA 1JZ6A 4XQWA 4YW7A 4K8FA 3KCXA 2Z69A 2ZHMA 4XFCA 2P5BA 1SBFA 3D0SA 2ORZA 2X10A 4K21A 1BK1A 3SCFA 5LBCA 1ND2C 3RWKX 4CDQB 1W2OA 2HKXA 1KFUL 1KEXA 4QAWA 4Z07A 1A34A 1OURA 5F5QA 5A33A 1XNDA 2LTNA 2WAOA 2WO3A 3E5QA 1JZ5A 3V64A 5DAPA 1BJQA 4IV3C 1QJY2 3SC7X 1WUVA 1YIFA 3O1TA 4AEDB 1GZWA 1J1LA 1BZWA 3W58A 2PHXA 5H9RA 4QX1A 4TSVA 4N7UA 3CJIC 4LIVA 4IW3A 4Y26A 3NMBA 5F3IA 1T6GC 2XJTA 1PVC1 1LESA 2XKPA 3FC0A 3LB9A 4MADA 1A78A 4RS5A 5FZLA 3RMXA 3IM0A 3A22A 4FFHA 4IQPA 1W28A 1R1A2 1VBC3 2WYFA 3DECA 2QE3A 3KF3A 4QKBA 5J48A 2QQNA 2PA7A 3NKTA 4LPLA 4AAXA 2BFUL 4LLFA 4PQ9A 4A7ZA 4YZ1A 4XUQA 3LDKA 2A7AA 4M3CA 4JCKA 5I8SA 4YARA 1HRV1 5GALA 3VBHB 2C26A 4EV0A 5C7GA 1G9CA 4WVVA 4H7MA 4O9GA 1WW7A 3D82A 4R9DA 1CESA 1TE1B 5KHGA 4P02B 2HWE1 4KU7A 4BPZA 3M2MA 1OVSA 1VBE3 1MVEA 1R1ZA 3N35A 4ASKA 3PVBB 1HKDA 4FPJA 3HNBM 1PGW2 1QJU1 4XJWA 1Z0HA 1YLLA 3E1F1 1PMJX 2G1MA 1O59A 2F4LA 4YVWA 4JX0A 1ULPA 2I74A 1ENXA 4MXWB 4N43B 3S6PA 3ZSMA 1V70A 1NX9A 1OQDA 2TNFA 5IYYA 1JS9A 1LTEA 1VMFA 5IVFA 3VKLA 1UOJA 5FR3A 2RHPA 4AAPA 5FV3A 3IDCB 1H4GA 1UPIA 2IXKA 4D6SA 1RMU2 4CDXA 4TYSA 3KT1A 1ZNPA 1TNFA 2MEV3 4L92A 2VJXA 3WD5A 2P1BA 2YMZA 5BNPC 1TMF3 4Y24A 1FNZA 5A3UA 4NPRA 2Q8DA 3RQ0A 2XJQA 1XPWA 2EVXA 1P8JA 5C9AA 4QU1A 3OGSA 5CFDA 5K7PA 2YZ4A 2CDOA 2EAKA 5DQ0A 1V0AA 2Z2SB 3U37A 3JBG1 4ET7A 4Y1XA 1L3JA 2VC9A 4OVEA 3JQWA 2WNVC 3SITA 4D7SA 1IHMA 1HXS3 3WP3A 2VQTA 2IWGB 2XVGA 4AHYA 3J7NA 3K77A 4C0BA 5T3NA 3WQ7A 1REFA 4AF9A 1OD5A 2NP0A 4PHZA 3OTFA 5CVRA 4UFMA 4HSJA 1DCSA 3IMNA 4LBQA 3FUOA 3MIHA 4QXHA 2XQRA 4F83A 1CX1A 2VZQA 2FD8A 1PO11 5FUIA 1K5MA 4GA9A 4MZUA 2Y8KA 4UBGA 4UW3A 3NV2A 2RR13 4FPOB 1WMEA 3E5XA 1QOSA 2FDGA 4EE2A 1RUG1 1VLNA 3J8F1 1Y43B 2GAUA 4DRVA 1ND3A 2JDUA 5FYBA 1C8M2 5A6XA 2ZGLA 3WDTA 5H9SA 3DYOA 4D0QA 4YM1A 4Q4Y3 5LW9A 2WT0A 1NCQC 2JG8A 1POQA 3KZ4C 3PHMA 1B35C 1WCQA 2XVKA 1QXRA 2PHDA 2ZABA 3VDCA 5FWJA 1MZEA 2VMCA 2IXLA 5L9RA 3SH3A 1RYYA 1WW4A 1RVF2 1NKGA 4K7JA 1SFNA 4M0HA 1W2TA 3VBRC 3GJAA 5ACA2 1YQ5A 2WZR1 2ZGKA 1CAUB 1HRI1 3BCWA 3UV9A 4KBZA 4XCBA 3OSDA 4ZZ8A 2MPFA 4Q0UA 1I6XA 5CFCA 2IUWA 4RFRB 4YZ5A 4YG3A 1PX4A 2WFF1 1IPJA 3VZNA 4CZSA 3ZYIB 4BCUA 4ZS3A 4Z2AA 1CX4A 2VQ0A 1XBFA 1GWMA 1L7RA 2R042 1R093 4AGRA 5A3WA 2P6CA 1UY2A 1BEV3 3FHAA 5I91A 4CCJA 2I2SA 4AEJA 5DUXA 5JSPA 2W95A 4GD4A 1VRH3 1VBD1 4KH9A 1XC6A 3ZN4A 2PYTA 4Q1PA 3T09A 4ZONA 3VHOA 2Y6JA 1AR81 2E7AA 3FFZA 3TEZA 3LCPA 2E32A 2YDEA 4CDQA 3H1WA 2FDIA 3U1XA 4WZFA 3T4HB 1KS5A 3ACLA 3H1YA 4NHMA 3LA2A 3KV9A 5FP7A 3AVRA 4C8DA 2GC2A 3AKRA 4YGBA 4GB33 2RDNA 1KFXL 4MHRA 4PBPA 4AEDA 3RZHA 2BGPA 4HN1A 3K2OA 5F6KA 3LWCA 2IVJA 3HN1A 1N1TA 2JDNA 4HN0A 4TLFA 2VOTA 1YQCA 3T2QA 1LHOA 3MO4A 1RUF3 5FY8A 4FPYA 4EWAA 3BPZA 1RUJ3 4P5YA 1AUYA 2YFZA 4CDUB 1ZZ9A 4I01A 4PLMA 1NOVA 1UIKA 5AC91 3WLUA 2QJVA 2E9QA 5DXDA 2UYAA 3KHCA 2W1QA 1K45A 4FSJA 1H2KA 5D8AC 3VBHA 4UI9L 5DDJ3 3Q8FA 5JSRA 1GZ9A 1K3IA 4AWDA 4JKKA 3ECQA 1PIV3 1IG0A 4CCLA 2XJUA 3MUZ1 2RS51 5DZEA 3ACFA 5DUVA 3S7EA 2WLQA 3C3VA 4NHYA 4IEWA 1IQAA 3TYJA 3PIGA 3AZVA 3EO6A 4INDA 1N1SA 4RYDA 4YGCA 1OFNA 5AFBA 3ASIA 3VKFC 5JWPA 2VUAA 4XETA 2ZOEB 3ZM8A 4FAHA 1QY4A 4MXWA 4N43A 2R16A 4BMEA 1MS9A 1PM4A 3M3IA 1W6PB 3PNAA 5T54A 3AP5A 3EQEA 4LO4B 5FY9A 4BM8A 5EYXA 4Q4X2 5J37A 2W87A 2AYHA 2Z79A 4JQTA 4FBFA 5B4NA 5HCHA 4PLOA 1G9FA 4KWKA 1KQRA 4W6YA 1SLAA 2EIEA 3SEPA 1JW6A 4URAA 4QPGB 2ZGQA 4HZFA 5K8SA 3SMHA 2EIBA 1LAJA 2HWD1 3WW2A 3WG2A 3ZXDA 4MH0E 3K4AA 4QXKA 1LOFC 4TLGA 3NRUA 5KHHA 4LO7A 2PMWB 4NHXA 3MIDA 4Z82A 2GP5A 3KVBA 2LRPA 3HPNA 5JR2A 5LA9A 2C6SA 2JIGA 3MIEA 4L99A 3OY8B 5CKQA 3VZOA 3S5AA 5D2AA 3VDAA 5E8AA 1FMD2 2HWF1 3ZPOA 1DHKB 1MQTB 2TEPA 4YYOA 4Q4V2 3RRDA 3MDPA 4Z8BA 1ASJ2 1S2KA 4QX2A 1QXJA 2WNEA 4P9XA 3OCPA 1BVP1 2QQMA 5DG1A 1LOBA 3IZOA 3HJRA 3J7MA 3VD9A 2H0VA 3MFCA 1N3QA 1COV3 3S57A 1W8TA 5LY1A 3CL1A 5LA2A 3QLQA 1HX6A 3WNLA 3A0NA 1ODNA 3ACHA 1MS3A 4JGZC 4U2AA 2YUEA 4CCKA 1H4HA 5IFPA 1AVBA 5C8CA 3AFGA 1J84A 5JIAA 3VBSC 3RZMA 4TXWA 3SLIA 3MFAA 1TQ5A 4H7LA 4HFSA 3HIFA 1YNAA 2Y6HA 5EHDA 1T6BX 1HQWA 1ZZCA 2RG4A 1NE4A 4GIQA 4NAOA 2BFUS 2WC2A 1R1A1 1AL23 2W39A 4R9CA 1W8UA 2ZTNA 3H3LA 3MICA 4YGDA 4BXSV 2ZHKA 4MGZE 1NY72 1Q56A 2QCSB 3RSJA 3D5OA 5FLJA 5FLIA 2O8OA 3SCGA 5A7QA 5JXGA 2EXHA 1CZSA 2JDYA 4AW7A 2D3PA 2LUWA 4JTNA 3FE5A 1NZIA 1UMHA 1YCIA 2RMU3 2W9XA 2X8KA 4LBNA 4CDWB 3ME2A 1UNBA 1WCDJ 2D5FA 3NNLA 2BGOA 3TEYA 5FPBA 2SBAA 4QQPA 1LODA 2YB7A 3J7HA 4RSUA 4GKYA 2OYZA 3SH4A 3RI8A 2IXCA 5LA0A 3O1OA 2PELA 2ATFA 4L8QA 5F39A 1UZVA 4ZU4A 2C24A 3LD8A 5LB6A 2AUYA 1JMUB 4IV1C 4CU8A 2GZWA 1GZCA 2BEOA 2PHUA 2W1UA 1OH4A 1F4HA 4G9SB 2BRTA 4DXZA 5JOWA 3O1SA 3HBZA 4QU2A 4QXCA 5I0UA 5LA1A 3RZJA 1GUIA 5FXWA 2CV6A 2ZHNA 3VZJA 1V6KA 2ZGUA 4NUBA 3ZO0B 4AE2A 2BBAA 4DIQA 4B1MA 3DGTA 2EAAA 3BB6A 4WBBA 2ZMNA 5DUUA 1UU4A 3HQRA 4NPMA 4PIXA 2W5FA 2WO1A 3ZMOA 1LHNA 1RMU3 2R063 2GMMA 1DLLA 3C7EA 1BHGA 3A7QA 3K46A 5FJKA 5FZGA 4A3XA 1QNYA 2WSVA 2WBKA 4CDUA 1W9FA 4XIOA 4DXSA 2SLIA 4Q0VA 3AKSA 4XAAA 3KS7A 5EFUA 5GLVA 1JI6A 1Z78A 1OC1A 1ZM1A 4ZXKA 2BQPA 2XMLA 3MLKA 1AX0A 2D3RA 4KMQA 4XUOA 1RUH1 2ADDA 4WM8A 2HLEA 3PU3A 2VULA 4JKLA 2JG9B 1CAXB 5T5OA 5C8WA 2VMDA 5FY5A 3G6JB 3TEXA 1C8NA 1GOGA 5FYHA 3WDWA 1ZRFA 1VAVA 2WO7A 4LUMA 4S2FA 1XE7A 3WQBA 3K3NA 3INAA 5CA6A 3IWZA 2A3YA 5G05L 2QZ3A 2VOVA 3SKVA 2QQPA 1DFQA 5FZ8A 4EWEA 4IERA 1UD1A 1W6PA 2FCUA 3T0DA 5T5PA 2Y26A 2PTMA 1GNYA 2QQWA 2WA3A 1J3QA 4JVAA 5FYUA 1C57A 3POFA 4HK9A 4DPNA 2ZACA 2WS91 3WDXA 2VL4A 3T2OA 2UY9A 4SLIA 2G19A 2ZGOA 5FOBB 5FLHA 1PVC2 3NV4A 4QPGA 5J98B 1DGRN 4XF4A 3LOBA 2V09A 2VNOA 5ACA1 4A42A 3POWA 4FP3A 5F5AA 3RMYA 1RUI1 1SEFA 3IN9A 1ZBE1 3Q8CA 1EV13 1QF3A 4LKFA 4OI1A 4FTBA 3Q9OA 1RUD3 5IW0A 1D2SA 5EJ1B 3I2DA 5IK5A 4XUTA 1IS3A 2O0OA 4S2GA 3BU0A 2WWJA 4JKMA 3POYA 4V1PA 3MHZA 4X6QB 4I0BA 1XU2A 1WCUA 3PVNA 1AR73 3TRSB 3WHUA 3OY8A 2AACA 5C5TA 1V9U3 3CLPA 4ZY9A 5IVCA 2HWE2 4DQAA 1HDKA 5JAXA 2XJVA 4IGOA 1MQTA 1UY1A 2EA7A 2RM23 3LPGA 5LY2A 3TN93 1QJU2 5H9PA 3LDRA 2JB4A 2X53S 2OIIA 3PDQA 4UW6A 1WW6A 3SKJE 1ZYBA 1NQJA 1S0JA 2XL9A 3AXEA 4K40A 5ABJA 5SV5A 3NNMA 5C70A 1N3OA 5KR7A 2VM9A 3VDDC 3ZFGB 1H30A 1J59A 4AQ2A 2JE8A 4FPCA 1MEC3 2D6LX 1GICA 1JYTA 2FDJA 4O7XA 2DTWA 5LRSA 2GMPA 1XNKA 5JLVA 2OPWA 3IAPA 2P34A 4QB6A 1RUC2 2VU9A 4OLLA 3ZPYA 1F15A 2JWPA 2Y6LA 3NNJA 3OGGA 1GP6A 3TBDA 4CUAA 2UWCA 2OQ6A 3ON7A 3K48A 2CGOA 3DEMA 3PUAA 3M70A 2VMHA 4XFHA 5HCBA 1W2AX 1R083 2QZ2A 2R7EB 3ST7A 3JBG2 1A8DA 3JB4C 1GV9A 2FHRA 4DZGA 2ZZQA 2WN2A 3THCA 5J1XA 1ENSA 1S0FA 1HIXA 5FQ0B 1NAEA 4KGGA 1GZTA 2ZPXA 1FT9A 3O12A 4IGPA 4RQPB 4CU9A 5FZIA 2OUJA 1LOGA 2JICA 1EUUA 5C5UA 1PO12 3OYWB 1CJDA 1POV3 3AMPA 3WUDA 5C3SA 5I93A 4CDWA 3BGAA 1Q8SA 2WR9A 3O1MA 4C90A 1LOCA 1RUG2 1D4M3 1VB2A 3J8F2 1WCKA 4GH4B 4NIIA 4N53C 1Q8VA 3POEA 4HVQA 3P3PA 2VW1A 5FZOB 4ZU7A 4EN7B 4GMP3 3CEWA 4E4SA 5KXBA 1OKQA 4Q4X1 4RR3C 2A3XA 3OB8A 2ENRA 3ZXGA 4YW6A 2QDNA 2DDUA 2J22A 5JXIA 2JXAA 2E7QA 1VMHA 1UMIA 2WZR2 1UY3A 1HRI2 1KITA 4HG6B 4LKEA 1RHI2 5M0TA 2BU9A 4AI1A 1O3RA 2FZ2A 5BXXA 1Q8PA 1C28A 3VV1A 4XXAA 5A7WA 1H2NA 2I07B 2WFF2 4K1YA 3M7AA 4MSVA 3UK9A 4ASMB 3I97A 5J96B 4OUEA 4R4XA 3O14A 1UYPA 3I4IA 1J83A 2HYKA 2QQVA 5A3LA 4DY5A 4G3YC 1SLTA 3DN7A 5FMOL 4FCAA 1RC6A 2VUJA 4C0HA 5F3GA 1LU1A 4D7YA 1Z7S1 3BTAA 2XUEA 5IUQA 1FMD1 5FXVA 1EP0A 4MGQA 2GMEA 3KLSA 3ROUA 3AYCA 4Q4V1 1S2EA 4RHV3 5I0DA 2JG9A 3ORJA 2HWB3 1AR82 2V4AA 2ES3A 4AFAA 2JE7A 1AR63 2E7TA 1C4RA 5GLTA 1AX1A 4LITA 2XONA 5J36A 4HKOA 4DUWA 4BH9A 4BB3A 5FZMA 2W68A 1Y9GA 4NRMA 3Q8AA 4AHXA 4QPIC 1ZBA2 2Z42A 2BBVA 2YY1A 5FOJB 5BNOB 1EAH3 4YVSC 4FQ4A 2VH9A 3AB0A 4OHWA 3T0BA 4AYUA 4NHKA 2E6VA 3ZLIA 2V4VA 4LBQD 4B7EA 2WQZC 2HYXA 2Q8OA 3ES4A 3BKZA 2R6QA 3NAPC 1XNCA 1ST8A 3HN3A 1BBT1 1NA1B 4CXWA 5AFEA 3DYPA 1O8PA 5FDBA 1DGWA 2JKXA 2R1BA 1V6IA 1W03A 3HBKA 4I3GA 4AEMA 2EXIA 4MO3M 4L2NA 4F3JA 2KA3A 3A0KA 1MPXA 4Q4W3 2PAKA 5FP4A 2GH2A 5L19A 1GNZA 3I2KA 5KWRA 2ZGMA 1AYN1 2YFUA 3VBUC 4ATFA 5LWBA 1WMFA 4JGYB 2RS52 1DG6A 1GWKA 1SHWB 1OOPC 5A6QA 1FPN3 3MLJA 3UESA 1JN2P 1XOYA 3VZMA 3RNSA 5EP9A 5DABA 5CKNA 1FOD3 3BOWA 1H1AA 1JHJA 4EN0A 5F37A 5KHJA 2Q0AA 5C71A 2BWCA 3U4SA 1DYPA 4IE0A 1AYM3 4KU8A 5E16A 4FPFA 2ERFA 1H0BA 1YWKA 4LLOA 2OKXA 3ZFGA 3OG2A 4JZRA 5HXMA 1NLRA 2P3KA 1QQP1 5DMYA 3OPZA 1CVNA 1OFSA 4LR4A 2ZEYA 1W0OA 2VZTA 1ND2B 2WQ8A 4MV2A 1FYUA 4ZZ5A 3W21A 1GQHA 2HWC3 2ET7A 2HWD2 3WQ1A 1RUE2 4IV3B 1AJKA 1YXWA 2WNUC 1IG3A 2R073 4CDXC 2YPDA 4KQ7A 3MW3A 1UXZA 2XKOA 3P3NA 4FP2A 3I7DA 3AP4A 3CJIB 1E5SA 2XHNA 2ZBJA 4BLJA 1NCRC 3I3BA 1IKPA 2K0GA 4PDWC 3JD73 3THTA 2O1QA 1QJZA 2NYYA 4LA3A 5FQ0A 1MS8A 3NNGA 5CFDC 1JYXA 1DLCA 4URTA 1OQEA 4RQPA 4TTGA 3I59B 4HANA 2WDBA 4QDRA 1BKZA 1REEA 1XE8A 2JD4A 2W08A 3SEEA 5DPNA 1HJFA 4S2HA 2P6HA 3DF0A 3BYWA 3IPVB 4NIHA 4ZPIA 1PVXA 3OBZA 1JBCA 5FZBA 4GH4A 4FOQA 3DL3A 2E51A 2CDPA 4IEYA 4D69A 5FZOA 4NIDA 2OVUA 4B4RA 3T2PA 1WA4A 3VN4A 4HSLA 2ET1A 4OQ8A 2XL7A 4CTEA
chains in the Genus database with same CATH topology
1DDLA 4LNVA 2CNAA 3B3QE 1CJPA 1LRHA 3HD8B 2Y38A 2B8MA 4YRDA 5JOYA 4Q27A 2EIGA 4D3WA 4D94A 1DQ5A 2W52A 4EJRA 1SLIA 5BNPB 5EV7A 4MVTA 4OI4A 3E6BA 4ISRA 4RGAA 4N9HA 2TUNA 4M00A 4META 5FAXA 1MVQA 3WDUA 1QDOA 1ZVFA 2CL2A 2WNVB 4YSFA 3FMGA 3IBMA 3PLQA 2WSUA 5DZFA 3HMYA 2DVFA 3LAGA 3M3CA 2OZJA 3USUA 1NXMA 2VNRA 3VBOC 1HRV3 2YGMA 4ES8A 1OA4A 3A4UA 1CIWA 1VBE1 2D6PA 4XF0A 1FV3A 4XW3A 3N3HA 4PCRA 1GQGA 1XXNA 4COZA 2EF6A 4GQ7A 4RL7A 1SBDA 3ILNA 3MW2A 1RUC1 4Y4YA 5BNOA 2DVBA 3WP6A 1VBB2 4B4PA 2QKDA 4MYEA 3UL2A 4HKLA 1KS4A 3DPRC 1NCQB 5HCAA 2RJKA 1B35B 1LEDA 2BNMA 2MEV1 4E2SA 3KT4A 3MLLA 3AX4A 1KJRA 1LOEA 1LHVA 2EXJA 4WM7C 3VBRB 4LO8A 4L11A 1NA1A 3FZ3A 3V65A 1KJLA 3UKVA 1UN1A 3O0WA 3L2YA 1DZQA 1CAWB 4K6BA 4YM0A 3WT3A 1IS6A 1RUH2 1BYHA 1YRZA 2ZGPA 1HXS1 1JUHA 3JBG3 1VALA 4GWMA 4JDOA 4FAGA 1OLQA 1PK6C 1PZ7A 5BNNA 2DURA 3B00A 1W6NB 1JYCA 1A3KA 2DYCA 4R8HA 1H8TA 3B7MA 1KXGA 4EN9B 1DZRA 1H2LA 2ZMKA 4JRLA 2D43A 3MPPG 4Q26A 4X8PA 1FI2A 4YZ3A 4BIFA 3EJKA 1APNA 2OUHA 2WS92 4N9IA 1ND2A 2DFBA 4XEZA 3JU9A 1J3RA 4Q4Y1 3ZX7A 4AFBA 1UCXA 2D98A 1DZTA 4H3WA 3U0ZA 5FTTC 2WZPP 5BUVA 4IV3A 3N4MA 4MUVA 1RUI2 3AP6A 1ZBE2 2YC0A 3AZXA 3FFQA 3FHIB 1RHI1 3GHNA 1IKQA 5JMCA 1SBEA 2RS33 2RS13 4CEYC 4X8NA 2QDRA 2DCKA 3CJIA 2D5HA 2JENA 2WZR3 3IDBB 4FQZA 3MGUA 2XHKA 1VJ2A 1G9AA 4YFZA 3NVCA 3I59A 4QGMA 4LHLA 3NSTA 3KGZA 2Q4SA 5E88A 1KRIA 5D8AB 1BEV1 1Q5OA 2PQQA 3GZAA 3CO2A 3IPVA 3KD4A 5GZDA 5KC5A 3V0BB 1VRH1 1RJ7A 1U5IA 5LEKA 4OI2A 5IT6A 3QCWA 3MIFA 1VBD3 3ALQA 1H8VA 1UPSA 1ZBA1 2PHWA 3ZSKA 4K20A 2W0XA 3NL1A 2WQ4A 4LBLA 3UJQA 2JDZA 4MGIE 3O0XA 2D93A 1OA3A 4GB31 5C8CC 4AEKA 5BNPA 1TME2 2PHFA 2OPKA 5JR7B 3AKPA 5L7OC 1DQ1A 1VBA3 1RUF1 2WWSA 3ZFEC 4XBNA 3G7DA 1SFYA 2WNVA 4FOWA 3WXPA 1LCLA 3H7YA 4GULA 1LU2A 1WW5A 5JZGC 3VL9A 2DVDA 4FXKB 3RWNA 5AC93 2GC1A 4QGLA 1AZDA 4NVPA 2ZHLA 1LJ7A 2ZX3A 3BODA 1POV0 1XQNA 1NLSA 1UIJA 1SLBA 3JUUA 1XYNA 2XBO3 2JKBA 3B02A 3R05A 4AI8A 3B01A 2DTYA 4LE3A 1XNBA 3AP7A 4GMP0 3ZFFC 2CGPA 4JGZB 4XDQA 3W59A 1Y3TA 1RUE1 1NCQA 4DFSA 1I1EA 4N90A 2CWMA 1WLWA 2ARXA 3QOPA 1B35A 3VBSB 1IPKA 2JEMA 4Y1ZA 3ZYGA 4YM3A 4DY3A 1ZZBA 2GH8A 5AVPA 4L97A 2VGDA 3VBRA 5JVVA 1HLCA 1NQDA 4HT1T 1VAKA 2IFRA 5JPMB 1Z7S2 1CAWA 5HI0A 5K0UC 1U0AA 4WV8A 2IFWA 5C4WC 4FOVA 3KMHA 4H55A 3AJZA 3ILFA 3PMEA 4XFBA 1MS4A 4XBLA 4ITCA 3R4UA 1W6NA 2MHFA 1AR93 2HWF3 1UZYA 3VBFC 4FO9A 4WM8C 4LBJA 4FTEA 4B3NA 1LR5A 4I30A 1S0EA 5JCTA 2WA4A 5KXEA 4AQ6A 1ULDA 1COV1 1O4TA 4U36A 4IV1B 4JRAA 1X33A 4P9LA 1F2NA 1M06G 4ONUA 4COWA 2PLV2 3K51A 5T52A 1O91A 1CAUA 1BBT2 4AVTA 4FTSA 2JX9A 1QJY3 4W6WA 2P2KA 3LA3A 1IZ3A 4DOUA 2A3WA 1FV2A 1AYN2 2GSYA 3OBRA 1GBGA 2X5IC 4AHZA 4BMBA 1S2BA 1R1A3 1NXD1 4UBHA 2BWAA 2V5YA 3WVJA 1FXZA 2GC0A 4BQ1A 2KM2A 3RYRA 4EN6B 2RMU1 5CB7A 4M01A 1CAVB 2UURA 1QQP2 3V0BA 4R52A 3PJQA 5GLWA 4KL1A 1PNFA 2JE9A 2ZS6B 3AYAA 5GZFA 5ABJC 2ZJCA 3RZZA 5GJ6A 4I2OA 2DU0A 2VOXA 1VBB1 3E6CC 1PGSA 2CAVA 2NQYA 5H9QA 4AVSA 1UKGA 1JTZX 2HEWF 1ULEA 1HW5A 1I9RA 1GNHA 1KDMA 1O7FA 2G9FA 1F8VA 5E1RA 3IT8A 4H14A 3MIGA 3DKWA 3WDYA 1D2QA 3WP4A 3D0JA 1DYKA 1PO22 3AMNA 3QD6A 3TWIA 1GLHA 5FFOC 3RS6A 2ZAHA 3KSCA 3ELNA 3KM5A 3WP5A 1WBLA 3LGRA 5KXCA 3TAYA 4P14A 3B94A 3ZIWA 4LA2A 3ZN6B 2VW2A 2PFWA 5HXVA 3ZXFA 3GBFA 2VVEA 3VDDB 5IK8A 1YHFA 2WJSA 5T55A 4XE9A 2I45A 3WR0A 4BLIA 4WZCA 4E2GA 1C3HA 5CG9A 1C8M3 2LM3A 1QJX1 4JGZA 1O3TA 3WG1A 3VBSA 4GWNA 1PMIA 4FPEA 4TZDA 1ULFA 2GDFA 1VBC2 1LULA 1RVF3 4QQLA 4PLNA 2Q1MA 5ACA3 2D6KA 1EV11 1O3SA 4CP0A 2HEYF 4CEWC 1RINA 2P3IA 4W65A 2R0HA 3VKOA 1S1AA 3T2TA 4XFGA 1F5FA 3B93A 2E63A 5J09A 1VBE2 2R043 4NOTA 4BA6A 3TN91 3HT2A 4WVMB 1AL0G 4RGGA 3ZYRA 1H9PA 1ZX5A 2XLGA 2X29A 2PHTA 2PHLA 1QNWA 4N53B 4NWWA 4DNYA 1YJKA 1OLRA 1RGSA 4F8AA 3H3ZA 1V00A 2FBEA 5I8YA 4K1ZA 2H6CA 3PJYA 2R32A 1YFXA 4IV1A 2NN8A 4Q0QA 2MEV2 4LHKA 4HPKB 4YLZA 3WUCA 2WT2A 4I09A 2XVLA 4BOWA 1TMF2 2WKKA 2XG3A 5DG2A 2VMIA 4HMZA 4XF3A 4K3UA 2VPVA 1TME1 1OSGA 1SQ4A 2WL1A 1UX6A 1G6NA 4COYA 4FPHA 2Z5WA 4AG4A 1HXS2 3GZTB 1Q43A 4XJAA 2WLPA 1OQ1A 2XH6A 4E4ZA 3VGIA 3N7KA 2B9UA 3JQXA 4YW1A 4XILA 2RR12 4JTOA 4MGYE 3D8CA 1CAVA 4BIOA 1PZ8A 1TEIA 1MS1A 4QPYA 4LO6B 1D4M1 1GSLA 4J6GA 3I54A 4Q4Y2 4YGEA 4Q0SA 4GMP1 1S55A 3N7MA 1DBNA 4K9SA 4QPIB 1B09A 3S30A 3X29B 3QBQA 4AGGA 2ZMLA 4YVSB 1S0BA 4AQTA 4Q4X3 1W2UA 3FX3A 2ZX1A 4JC1A 1W6OB 4J1XA 1GFF2 1J58A 2B46X 3E97A 4HVOA 1CQ9A 3ZXAC 3E5UA 1JYIA 3NAPB 2LALA 1H9WA 4KG0A 1JH5A 4LBOA 3UKNA 4AK3A 1O4YA 2XUMA 2BW8A 1PM7A 1R092 4GKXA 4COUA 2OW4A 1WCSA 3N7JA 1BEV2 1CAXA 1JXNA 2BYVE 3VBUB 1LECA 2A70A 4QHBA 4IEOA 2DCZA 1VRH2 4DMIA 1OOPB 3H0OA 3RJRA 2PAMA 1FMD3 3CNAA 1RB8G 2HWB1 4Q4V3 5EYYA 5FPXA 3H7JA 1ASJ3 3O0VA 2XJRA 2VY0A 1BMV2 3VDDA 4AI0A 3WINE 3SXWA 4I3PA 2ZGSA 1QDCA 1G8WA 4OUMA 3AMQA 2XGXA 4OI0A 5IK4A 1WMDA 3ES1A 4GB32 4SBVA 3NKGA 3OBTA 1G9DA 2PLV1 4HETA 3RYKA 3B69A 4L9BA 3SNMA 1YO8A 1LOAA 4ISQA 5BY5A 3R4SA 3WZ1A 1MZ6A 2VNGA 2B42B 2WNUB 1J1TA 1W39A 1FX5A 4CDXB 2ETEA 3MIBA 1RUF2 1N3PA 4R4ZA 2ZKNA 1RUJ2 4RS5C 1XU1A 5D1IA 4P9GA 3WX5A 4XTMA 1NCRB 3M8LA 3OGJA 1ZA4A 3OD4A 3HR9A 4PDWB 5J3UA 2NLRA 1RTVA 3AZYA 3WV6A 2QUOA 4MXVA 2V73A 1AJOA 4Q4W1 5CFDB 3AJYA 2VOKA 4JQRA 4RA0A 5FPZA 1I5ZA 1PIV2 1ZRRA 4JDMA 1DQ2A 1F9KA 1M4WA 4AI3A 3MI8A 1IS5A 2CYFA 4WVMA 5C33A 3B5LB 5JOXA 1QU0A 3KT7A 1AYM1 4N53A 4YVWC 2A6WA 2XWBB 5GZCA 1C1LA 3JB8A 4OULA 1SLCA 4E9KA 5EZWA 3VKNA 3M3QA 3LA7A 3TOJA 1LB2A 3CJXA 1Q3EA 1WLCA 4HPKA 3ZN5A 2ZGRA 4COVA 3LZZA 3ZYPA 4XF9A 4I0WB 2FZ1A 5C9AC 1QGLA 5JIUA 1YFWA 3B9IA 4HK8A 1JHNA 4KBBA 4B29A 1PO21 2F4PA 1SACA 3OJBA 5IK7A 3O7OA 3OYWA 3GBWA 3OD0A 1GR3A 4BHPA 3WCRA 4AFDA 3MW4A 4QM8A 1UU6A 5CU1A 2VXRA 4QT6A 4YFWA 1LEMA 1QXPA 2EALA 2BTVC 1K5MC 4IXLA 5BNQA 4WVWA 3FUQA 5BNNC 4MGKE 3JZVA 3VBOB 1C1FA 1GYKA 5F1RA 1LHUA 4OZXA 1COV2 3VKMA 2VVFA 1H8TC 4WVZA 4PIZA 2BUKA 2UU8A 1ND3C 1E57A 1DQ4A 4DB5A 1ZRDA 1WD4A 4IESA 1OI6A 4Q29A 1YFUA 4QPIA 2JG8C 1IS4A 1LHWA 2DCTA 1Y7BA 2HEVF 3USSA 4YVSA 4YNIA 2BVBA 5SV8A 3DPRB 5KBFA 2CWSA 4LHNA 1V6OA 1W6OA 3AFKA 3E6DA 3NAPA 1PVC3 1VBC1 1AL22 4WM7B 3KCCA 2ZZJA 1DGRA 4HKWA 4IEVA 5CFCC 3HQXA 3TNQA 3UJOA 2WINB 2F6BA 3PVOA 1I3HA 1AHSA 2XJSA 4X6RB 3R6SA 4DS0A 2RJLA 2UY8A 1ZZ7A 5DZGA 1D0GA 3JCIA 4PJYA 4QQ2A 2RMU2 4XMAA 2BVVA 2D40A 3PMSA 3SHRA 4Y1YA 3VBUA 4GALA 1O5UA 3ZXLA 1PK6B 1V6JA 5F6LB 1OOPA 2HWE3 1Y9QA 2AENA 1LGCA 1ENQA 1LENA 3N36A 2CTVA 2D97A 1QJU3 2FMDA 5T50A 5DUWA 1J3PA 1PHMA 2DVAA 4CDQC 5EWSA 4DRRA 2ZX4A 4QM9A 1C5HA 5CNAA 1JUIA 4JV4A 3WNXA 4PBOA 1TMF1 1RUC3 1RIRA 1V6LA 4KGQA 4AEDC 2Y0OA 4G4FA 2QVSB 1DIWA 1SDWA 1PNGA 1TNRA 4RFT0 2WNUA 2A71A 5LEJA 2R062 4CEYB 1OHFA 2R49A 3RJ2X 1AXZA 2AREA 1H1IA 1NCRA 1ULGA 2E53A 3VUOA 4JGYA 4PDWA 2ARBA 1N1YA 3GYDA 3ZVXA 2WT1A 2ZA9A 3N7LA 4BWOA 2XB6C 4CYDA 3IIAA 3VBHC 4Z2WA 2OA2A 2YROA 2NZ9A 5GM0A 1PO13 2RR11 5FRAA 2IXIA 3EBRA 4ORFA 4Q1RA 4E2QA 5C6CA 1O5LA 4OHVA 4LULA 2B45X 1HQNA 4JAAA 3QH6A 1RUG3 2A6ZA 3L2HA 1H2MA 3J8F3 4N43C 3H50A 3U10A 3MEPA 3ENRA 4FVVA 3IDEA 1QJX2 2DCYA 1WLTA 4BYYA 2H6BA 3R4DB 1LKNA 3ZMNA 5GZGA 1U12A 3FBYA 4A7YA 1WLDA 3URFA 3U07A 2JECA 2WFPA 5FMOS 1WD3A 1EV12 3VZKA 5C8CB 1HRI3 1RUD2 2RS31 1BVVA 2RS11 4QX5A 1RHI3 2AH2A 2VW0A 2K2SA 3PTYA 3VLBB 4AFCA 2GNDA 1AR72 2XWJB 2WFF3 2IC1A 5L7OB 1ZZ6A 2B39A 2DFCA 1V9U2 3ZFEB 1R091 2YGLA 1QKQA 3NV1A 5HBAA 2BPA2 3TN92 4LO5B 2RM22 5EXOA 1ZRCA 4XFIA 3HT1A 5JZGB 4XYXA 3DUIA 4BZ4A 5FCCA 2QFEA 1CD3G 2JJ6A 3L9JT 4P5HA 1VIWB 1XYPA 4D7TA 4XZPA 1MEC2 3VBOA 2QNKA 1AR83 2VECA 2YXSA 1BMV1 1HV1A 3AKTA 3KQRA 2RE9A 4KWJA 3BIWE 1JOJA 2A6VA 5KHKA 1URXA 4XJZA 4LT5A 2AZ5A 1SCRA 1ZBA3 2GNTA 4P9JA 3ZFFB 2C5DA 2KXLA 4B7KA 1R082 2UWBA 3DPRA 4NN0A 3FBMA 5K9YA 1S0DA 1O3QA 1S0CA 5GZEA 2FQPA 4NWVA 3ZXJA 2PHRA 3UKTA 1RUJ1 3AXDA 4WM7A 5KXDA 2CY6A 2DUOA 4XMIA 2PAEA 3D4KA 1G86A 1VBA1 2R1DA 2AR6A 5T5JA 1YFYA 1FNYA 4R9BA 1EYBA 1D0HA 3ILRA 5DDJ1 4YW5A 4ES9A 5K0UB 1PIV1 1DU3D 5C4WB 4XTPA 1AF9A 1D4M2 1A8MA 1PK6A 1QMJA 1VP6A 2HJIA 4RD7A 4Y1VA 2RS53 4FT8A 5JDBA 1X50A 2C9AA 3KB5A 4AVVA 5LRRA 5FBZA 4QGNA 1QWRA 3VBFB 1YYNA 4FPKA 4WM8B 3ETQA 2DU1A 2ZX0A 3WG4A 4Z1VA 5CAZA 1AXYA 5T5LA 1VR3A 2XBO1 3SISA 2ZGNA 3AMHA 4XBQA 4XJ9A 4QMAA 4XHXA 2XPJA 4XJ8A 3APBA 2HWD3 4CP1A 1RUE3 4A7KA 4LTAA 1N1VA 2VQAA 4CEYA 3ZSJA 1AX2A 2AGSA 1DQ0A 1PZ9A 1RITA 5LK7B 2D6NA 4FOYA 4CDUC 2ZKLA 4LUKA 2ILMA 2TBVA 2X5IB 4YW3A 5J7MA 3HAGA 5I0SA 2A75A 1UF2C 3GF6A 4RHV2 2HWB2 1CPNA 1S0GA 2EXKA 3H1MA 4AQSA 1AR62 4XPVA 1U5XA 1MS5A 2YYOA 3ZYJB 1AR91 1N47A 1DGLA 5I0TA 3VZLA 3V56A 3VL8A 2FMYA 3ZSEA 4C91A 1QOTA 1X8EA 5ABJB 1EAH2 1KD7A 1ONAA 5L73A 4P9YA 1G9BA 4QD2A 2C1FA 4XFFA 5GLUA 3VHPA 3S7IA 1IOAA 1EY2A 4YW4A 2R30A 4CRQA 4QPGC 4PF5A 3U11A 4ZU5A 1V6MA 4NO4A 5CADA 1QJY1 2Y0IA 4ASLA 3BALA 1AL21 3BOPA 2H0BA 4Q4W2 3J26N 1EPWA 4AXOA 3VHRA 4Q0PA 2K9ZA 3AMMA 5L7OA 4KWLA 4FPLA 5F9TA 2ZCWA 3ZFEA 5D8AA 1FPN2 2ZAAA 1MZFA 3WW1A 4HBNA 1UAIA 2DUQA 3AYDA 1FOD2 1MQTC 5AVAA 5JZGA 3GBGA 5CIRA 2D3SA 1HV0A 5JPNB 1AYM2 1CR7A 3NJZA 5JI7A 3QH7A 2DCJA 4LEJA 1W6MB 3ZXKA 4IL7A 3HWJA 4F7ZA 2VVDA 1OMIA 4KG8A 3MYXA 3T1MA 5FO8B 4AFMA 1PGW1 1QH7A 2R0FA 2HWC2 3LOIA 3B9CA 1CGPA 1U5YA 2NM1A 3KCYA 3H8UA 2DVGA 2R072 3ZFFA 3NWKA 4Z92B 2D44A 1VBB3 2VMGA 5FO7B 4Y20B 4AI2A 1RMU1 2R061 5GKAC 1X8MA 5TSWA 1LOFA 1S0IA 2P17A 3JD72 1W6QB 2PN5A 3FWEA 2GNBA 5E89A 3KGLA 4AVCA 3WY6A 1X82A 1DQ6A 4C1WA 4CEWB 1ENRA 3ATGA 3GALA 5I8TA 3LSEA 1PGL2 5K0UA 4CDWC 4IEPA 5C4WA 1RUH3 3H3UA 4XQDA 3SH5A 5A3MA 3GNEA 4QQOA 1BQPA 3AZZA 4LBKA 4M3CE 4Q2FA 1UL9A 4E27A 4Q8KA 3VBFA 2Q5TA 2XJPA 3W9AA 2N7GA 2NPIA 3RPQA 1W0PA 4XHBA 4LBMA 3RG0A 4I0AA 2IXHA 4ATEA 3VHNA 3J4UH 1ALYA 5KHIA 2Q1ZB 3R0RA 2P3JA 5BPXA 2WS93 1YIPA 1C8M1 4EWDA 2BNNA 4HVRA 4AGVA 4XIKA 1QJX3 5BYNA 1OA2A 1V6NA 2WIIB 1RUD1 1RUI3 3H9AA 2MNGA 1MR5A 1ZBE3 4Y1UA 5LK5A 1LGNA 2A6YA 4TWTA 4EN8B 5JOZA 3TNPB 1RVF1 1SCSA 3WOGA 1AR71 1V9U1 2DV9A 3NV3A 2X5IA 1DGWX 1CONA 1G7YA 2CAUA 4GXLA 2CGNA 3ZDSA 3U4XA 1VB4A 2RM21 3WW3A 4EROA 1YUDA 4N7IA 1HRV2 4Y22B 4YZ2A 2JG9C 3AYEA 1REDA 2UWAA 4YZ4A 4ZKTB 3CU7A 2R041 4Q8LA 2VOWA 1MEC1 3WDVA 4AHWA 3S0MA 4XFAA 3MF9A 3RYPA 4NHLA 2XLFA 3CF6E 4RR3B 1UW8A 4J1WA 2P37A 4AVBA 2D7FA 2OZ6A 5JI9A 2ZGTA 3M1HA 4UW4A 4B8EA 4LE4A 2XLAA 1CPMA 1R081 2IXJA 5CG8A 4XOGA 1SLLA 1U5ZA 3POSA 1YJLA 2A6XA 1ULCA 1X7NA 5I0RA 5KC6A 4OHYA 4YG6A 1TME3 1MS0A 1UZZA 3MF6A 1UKRA 3V0AB 5A32B 2VG9A 4HLTA 2BNOA 1POV1 1FAYA 4OHXA 2IZWA 2B5HA 2A5ZA 1ZREA 3AKQA 2NMOA 3THPA 1QOOA 1F5JA 1Q8OA 3C2UA 1SMVA 1W6MA 3ZFGC 3O5SA