4PJYA

Azide bound cysteine dioxygenase at ph 6.2
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
186
structure length
186
Chain Sequence
ELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Insights into the Role of the Cys-Tyr Crosslink and Inhibitor Recognition by Mammalian Cysteine Dioxygenase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
molecule keywords Cysteine dioxygenase type 1
total genus 55
structure length 186
sequence length 186
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2014-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4pjyA00
2QVSB 1CGPA 1VP6A 3D82A 4EWDA 3IDCB 1YUDA 4LULA 4QGLA 5FLIA 4KWLA 3WW4A 2Z69A 4YNIA 2GAUA 4FAHA 2H6CA 1ZZ7A 3EHKA 4Q0SA 4OFGA 1CAUB 4N9HA 1NXMA 1RL3A 3BCWA 5CADA 3CJXA 2O8QA 2QCSB 3D0JA 2PA7A 2IXCA 5LRSA 1Q43A 3RZZA 4YSFA 3ROUA 1EYBA 3VHRA 3RYPA 4AVAA 5J3UA 4UXAA 1O5LA 1GQHA 2PAKA 3UKNA 1FT9A 5I0UA 2Y0OA 4IEYA 1ZZ9A 4XFBA 5I91A 3UKTA 1QXJA 1LR5A 2XHKA 1CAWB 4O9GA 2MNGA 3S7IA 1PMIA 4E2SA 2GZWA 2IXLA 2DCTA 3PLQA 4EWEA 3KMHA 3H3UA 1NE4A 2WC2A 3MZHA 4HSJA 3SCHA 2Q1ZB 5LRRA 3OTFA 5LEJA 2OPKA 3KSCA 4KL1A 4QMAA 2V09A 4X6QB 1DGRA 2UYAA 3TNPB 1L3JA 4XETA 4YRDA 2CAVA 3CLPA 1X7NA 4FT8A 3QACA 4IEPA 2OA2A 4LA3A 4BYYA 3C3VA 1WA4A 2VECA 3LOIA 3SCGA 2OZJA 2UYBA 2K0GA 1LRHA 3H1YA 3RDIA 1JUHA 4HVOA 4A2UA 2MPFA 3NW4A 1RUOA 3U10A 5FLHA 5KBFA 2OZ6A 2BGCA 5JSRA 5KHJA 1CAXB 3E6DA 4AQ6A 1G6NA 4XFFA 1ZNPA 3L2HA 1YLLA 4XF3A 2B8MA 4MV2A 4BIFA 4TLFA 3TNQA 3DL3A 4N9IA 2D5HA 2XL7A 3USSA 2PFWA 3FX3A 5BY5A 1O3RA 4I02A 4PIZA 1VR3A 1RC6A 4ZU7A 1QWRA 2C0ZA 3HIFA 4PIXA 3FWEA 2XKOA 1YFXA 4XF1A 2GC1A 4JVAA 4K8FA 5K8SA 1YFUA 3SXWA 3ST7A 5BXXA 2GC3A 4AQ2A 1ZRCA 3HQXA 5I0TA 3S7EA 4IEOA 2QDRA 4OLLA 4JTOA 3EJKA 3HT1A 3GBFA 4L2NA 4META 1UIJA 1FI2A 4LA2A 3LWCA 3KGLA 4CYDA 3SHRA 1XE7A 2KXLA 4LLOA 3LA2A 3HT2A 5FQ0B 5F1RA 2D93A 1YFYA 2VPVA 3OF1A 2B9UA 2PAMA 1SEFA 3H1WA 4HN0A 3KGZA 5FLJA 5J7MA 1Y9QA 1YFWA 2IXIA 4MH0E 1SQ4A 1X8EA 2ZKLA 3ZDSA 2PHLA 5KHGA 3GYDA 1OFNA 4WBBA 3NVCA 5KHIA 1WGPA 3SMHA 3E6CC 3IBMA 2UY8A 3NSTA 2BNOA 4IESA 1QXRA 4QM9A 1IPJA 3CEWA 4KWKA 1SFNA 3H1MA 3IWZA 4XF0A 4Z82A 5I8TA 4E2GA 4Q0VA 4KU7A 2EVXA 1OI6A 2FQPA 1CAVB 1EY2A 3IDBB 3E97A 1UD1A 1XE8A 5JSPA 2XGXA 2OYZA 2VQAA 4JTNA 3FHIB 2HJIA 2HKXA 2FMYA 3CL1A 4LUMA 4HLTA 2ETEA 3KCCA 1UW8A 4L11A 2XLAA 3N4MA 4F8AA 3U11A 1OMIA 4H7LA 5FDBA 1QY4A 2PYTA 4Q0PA 1J3PA 3G7DA 3LZZA 1X8MA 3E5XA 1U12A 4QXKA 4J1XA 4DINB 3MPBA 2E9QA 3E6BA 4MUVA 3M3IA 5I0SA 1O5UA 2EAAA 2O1QA 1J1LA 4YYOA 1TQ5A 3I59B 1LKNA 3CF6E 4HVRA 4HZFA 3JZVA 5I8YA 1DZRA 1ZZ8A 5J48A 2ET7A 3ETQA 3NL1A 3LAGA 4XFHA 4HSLA 1RUNA 1J58A 4AVBA 2Z2SB 1YHFA 2Q0AA 4O9EA 4BHPA 4HMZA 1HW5A 3H50A 2I45A 3DN7A 3FJSA 3RYKA 1VJ2A 1UIKA 1NZCA 4LEJA 5BV6A 4JV4A 3R6SA 1V70A 4P9GA 3UKVA 5FPZA 4ONUA 4UBHA 2GU9A 1YWKA 1ZX5A 4I2OA 5D1IA 3ES4A 5T3NA 3RYRA 1O4TA 3WW2A 4D7TA 4LUKA 3ELNA 1IPKA 3H7JA 4I01A 1ZRRA 4E2QA 3E5UA 4B29A 4FBFA 4EWAA 1ZRFA 3DKWA 3IIAA 4BH9A 1J59A 1ZZ6A 3ES1A 1XRUA 3EO6A 1ZVFA 3FFQA 4PJYA 5JAXA 1ZRDA 4HBNA 1Y3TA 5BPXA 5E1RA 2IXJA 4YARA 3OGJA 1CAUA 3I54A 3SCFA 3U0ZA 4WZCA 5KHHA 4MGIE 4R8HA 4KWJA 4LTAA 2XLFA 4RD7A 5JSOA 4XEZA 1I5ZA 2ZCWA 1NE6A 2D5FA 1FXZA 4I3PA 4NVPA 4QX5A 1J3RA 1OD5A 3LA7A 4IETA 3RPQA 1ZZBA 2N7GA 5I0RA 3BPZA 1EPZA 2GH2A 4XFIA 3DV8A 2GC2A 2MHFA 4XF4A 5C8WA 1CX4A 3LA3A 2BEOA 4X6RB 2K9ZA 4QGMA 5CU1A 1DGWA 1DZTA 3S0MA 3EQEA 1CAVA 1O7FA 2BYVE 5FPXA 3H8UA 5I8SA 3FE5A 3PVBB 3NJZA 2Q4SA 2XLGA 2CAUA 5E16A 4WVZA 1PM7A 3MDPA 4GULA 2ET1A 2PAEA 4ZU4A 4AVCA 1H1MA 4EROA 2IXHA 2H0VA 4MX3A 1NYWA 4IEQA 2ATFA 2XKPA 3QOPA 5AVPA 1O3SA 3BB6A 3E5QA 4MGZE 1ZZCA 1RGSA 3EBRA 3PNAA 2BNMA 3BALA 2PTMA 3O14A 3RNSA 1Q5OA 1I6XA 2B5HA 4XFAA 4MGYE 1O3TA 4D7SA 4KU8A 3BU7A 4HN1A 2PHDA 3CO2A 2GC0A 2IXKA 3I7DA 4QM8A 4XF9A 4IERA 4IEWA 4IEVA 1RTVA 4MZUA 1Q3EA 2XL9A 4I0AA 4IEUA 4Q0QA 3WW1A 4Q29A 3B02A 3M70A 1CAXA 2EA7A 4Q0UA 1CAWA 4QGNA 1UCXA 3H3ZA 4EV0A 5JR7B 2CV6A 1WLTA 5EZWA 2IC1A 5EFUA 2P17A 4I09A 4HVQA 4R52A 4Z07A 5C6CA 4J1WA 5CVRA 5I93A 1H1IA 3ACLA 4MGKE 2QNKA 4PIYA 5FQ0A 4XFGA 4ZU5A 2BNNA 3OD0A 2Q30A 4UBGA 5BUVA 1ZREA 5KHKA 1UPIA 4F7ZA 3WW3A 1GQGA 3OCPA 5FCCA 1EP0A 3FZ3A 3I59A 2H6BA 1J3QA 4FAGA 3D0SA 2D40A 5LEKA 4ORFA 3MYXA 3NKTA 4I0BA 2PQQA 2QJVA 3H7YA 4IEXA 1LB2A 5JCTA 2CGPA 1X82A 2UY9A 4XFCA 2F4PA 4AXOA 3H9AA 4IEZA 1O3QA 5HI0A 2WFPA
chains in the Genus database with same CATH superfamily
2HWE2 3J7NA 3WG3A 5FY8A 4CDUC 1AHSA 1J84A 4NRQA 4BQWA 4BDVB 1RUJ1 1YC61 4D7YA 1B09A 4KWUA 4EWDA 3IDCB 2ZZQA 4N43B 5IVJA 4LULA 3Q8CA 4FP3A 5DZFA 5LA1A 2EXKA 3BIWE 1D4M3 4YNIA 2GNTA 4YM3A 5BNOC 2QQJA 2XDVA 1EAH3 3UGHA 1UY2A 1S0IA 2H6CA 1ZZ7A 3MIBA 4LBJA 5JI7A 1POQA 4OFGA 4WM7B 2CNAA 2JE8A 5ABJC 2VL4A 1RL3A 3BCWA 3BIEA 5CISA 2Y26A 1RVF2 1TVGA 1PHMA 5JPNB 4NOTA 4COZA 4JQTA 1OFSA 2QCSB 1RUC2 4IV3A 3D0JA 1CD3G 4S2DA 4AFCA 1WMEA 5FV3A 1H30A 3HR9A 1YIPA 3PVNA 2WWJA 4CRQA 1XU2A 4CE8A 3BN6A 4BXSV 3ZFFC 1GQPA 3GHMA 3AZXA 3UL2A 3JB4C 1QHDA 5L9RA 1DGLA 4AWDA 1ZBE1 4URTA 2ZGPA 2WAAA 3OY8B 1GQHA 1W04A 4FQ4A 5FP9A 1OLRA 5GJ6A 3VZMA 5LA2A 1ZA7A 4CDXB 5JOXA 2WA3A 4XJZA 2BVVA 1C3HA 3O1RA 2X10A 3O7OA 1LESA 2GH8A 4YGBA 2V5YA 4XFBA 1DGWX 5I91A 4XHXA 1IS4A 2Y0IA 2YYOA 3RJRA 3JQXA 1QJY3 1LULA 1WW4A 3WHUA 1FPN1 2I07B 1WA6X 1LU1A 2DVAA 3POFA 2W87A 4QT6A 4CU7A 1LECA 1NX9A 5JMCA 1NE4A 1WW7A 1ASJ2 1PGW2 5EXOA 5F2WA 2RMU1 2YU2A 3ZMNA 5FZDA 2DVGA 4PHZA 1V6MA 1AR83 4ZY9A 3X29B 1SLLA 5FKBA 4CCLA 4X6QB 1SHWB 1UMHA 1DGRA 2UYAA 1XYOA 3FBMA 4GIQA 1L3JA 3ZYGA 3DF0A 3I3EA 1JN2P 4UI9L 4YRDA 3JCIA 3VBFA 5FZAA 1X7NA 4FT8A 4KMQA 3ZN4A 3SEEA 5DUVA 1WLCA 1IZ3A 2WNVB 1WA4A 3QLQA 1COV2 1RUH2 1XBFA 2J1RA 2OZJA 3OY8A 4TZDA 2WNUC 1VPHA 2GP5A 2JX9A 2X8KA 1AR91 2K0GA 2YXSA 2XVGA 2Z42A 3ALQA 4UAPA 4CDWB 5KHJA 1JTZX 1JUHA 1T6BX 2CSGA 5EYXA 1RUE3 4WVWA 4KGQA 5FP7A 4BK5A 4Q1PA 3NW4A 5JUVA 1ACCA 2CDOA 3RMXA 2X53S 1ONAA 1H8VA 5JSRA 3WP4A 4RN5A 5HBAA 2FBEA 4XFFA 3IDAA 3SC7X 1HXS3 4MV2A 2IFWA 2P4EA 4TLFA 5IYYA 4N9IA 3ZSJA 5DDJ1 1GFF2 1US3A 1EV13 5FZMA 3DUIA 4XJWA 3A22A 4LBNA 1VR3A 4P14A 3V0AB 3DYMA 3SQOA 1QWRA 2C0ZA 4IV1C 2E7AA 3OGSA 3VBFC 1VBC3 4LOTA 2QE3A 1PVXA 4XJ9A 3FWEA 1RUG3 4EN9B 3J7HA 2ARBA 2ZHMA 4LO4B 3LOBA 2UWCA 1MS1A 2XKOA 3D5OA 4XF1A 2VNRA 4CPBD 2JE9A 2W46A 5FY1A 4S2FA 5CG9A 1UZVA 1YFUA 2A6WA 1Y7BA 5F5QA 3SXWA 3M3QA 5FZGA 5BXXA 4AQ2A 1ZRCA 3G6JB 1COV1 1Q8PA 1RUH1 3HQXA 4LK7A 5K0UA 5E88A 4O65A 4QPIB 5H9SA 1Y9GA 3M2MA 2WO2A 2ZEZA 5A32A 4M4PA 4AK3A 4Y5Z0 3DPRB 4OLLA 3K2OA 1VBE1 3ZLIA 2ID4A 3RVHA 1LTEA 2VBBA 1VMJA 1QJX2 1T2XA 2P6HA 4IGQA 4P9LA 3UT0A 1YNAA 4META 2PQSA 3R4DB 1ND3C 3I3DA 4AHYA 4CYDA 3T1LA 4PDWA 1NCQA 3AL6A 3DYPA 1DQ0A 3B7MA 4Z8BA 2IZWA 1PO22 2EAKA 2X09A 4NAOA 3ZYFA 1HJFA 4BPZA 1K12A 5FQ0B 5T5PA 5F1RA 2VY0A 2JDAA 2VPVA 4BMBA 1HDKA 3P1IA 2QQUA 4YZ4A 2PAMA 2WT0A 2QQIA 4YM1A 2WZ8A 2R1BA 3WF4A 1NUKA 3R4SA 5FZHA 5IVYA 1TZOA 3LDKA 3JBG2 2QQKA 2JXAA 4M01A 4G9SB 1LJ7A 3ZDSA 1SDWA 3KD4A 2XH6A 3GYDA 2PN5A 1OFNA 2IFRA 2CTVA 2HWF1 5FMCA 3KT7A 4P5YA 2L9LA 1W6NB 1MZEA 3I2IA 4UFJA 1IQDC 4DUVA 2OVUA 5F3CA 3IBMA 4GKXA 1CIYA 2ZGKA 2BNOA 4IESA 5A3OA 3CEWA 5FRAA 5C9AB 1LEDA 2F6BA 4AW7A 1SFNA 2E53A 4Z82A 1MS3A 3MEPA 4ZZ5A 4IE0A 5DDJ3 1DDLA 1BQPA 2EVXA 1D4M1 3LE0A 5A7SA 5HXVA 2B39A 4DXSA 4DZGA 1V6NA 4C90A 4QDQA 3B9IA 5A3TA 1EY2A 2HWC1 4A7YA 2CU5A 3E97A 5JOYA 4AHZA 1BK1A 1XE8A 3FLRA 4OMCA 4EYUA 3CBNA 2D43A 3PJQA 4JTNA 2DCJA 3OGGA 1JOPA 4AFBA 5FYHA 1V9U1 5D21A 5DZGA 3I2OA 1I1EA 5E8AA 1XU1A 3GGLA 2W92A 1GSLA 3CL1A 4GH4C 5E89A 3ZYPA 4BISA 4NROA 3ZXLA 5IVBA 1VBD2 4XUNA 3ZX7A 1Y4WA 5JVVA 1AVBA 1IPSA 2ZX2A 1J1TA 4L8QA 3ZOIA 4H7LA 3U1XA 5FYIA 4DEVA 5C8CB 2YROA 4Q0PA 1ZA4A 2P3KA 1FPN2 2RHPA 3LZZA 3ZXAC 2PELA 3L2YA 5FREA 3RRDA 3VD5A 4FTSA 1F8VA 4GMP3 2OS2A 4QU2A 4QXKA 4ET7A 3MPBA 1PZ8A 5FK8A 5LZ6A 2Q8EA 1ENXA 4QB2A 3KF5A 4MOAA 2QQOA 4FFHA 5I0SA 3RZHA 3LB9A 4FPFA 1HQLA 2NM1A 1HX6A 2EAAA 4OQ8A 1GP6A 4YYOA 2DBNA 4YW3A 4Q4W3 1WKYA 1LKNA 4IQPA 4PI0A 3WUCA 4EJRA 2ARCA 4UFMA 4HXCA 1VBB2 1O91A 2JKBA 2XONA 5JOZA 4IE7A 1G9CA 3LAGA 4MADA 1F9KA 1C8NA 1F5JA 1PGW1 1YHFA 5KXDA 3H50A 2I45A 2ZEYA 3LGRA 4RR3C 3PTRB 2ZTNA 1AX2A 3M3EA 3FJSA 4E8DA 5FYCA 1UIKA 3MPPG 1F5FA 2VMGA 1NZCA 3A21A 5FZIA 1HJGA 2DUPA 4OI1A 4Y3OA 4EN8B 4CTEA 1POV0 4CDQB 2W39A 5DZEA 1QJY2 3FUQA 2I2SA 1IS5A 1QEXA 1YWKA 4QD2A 4CU6A 1STMA 4NHLA 3USUB 4YVSC 1DQ5A 2R063 2B45X 1YYNA 2J1TA 3ELNA 4QXCA 4XTMA 3VZLA 4E9KA 2VNVA 2JB4A 2WLPA 4O61A 1POV3 3LFMA 4AEKA 1WCKA 4IV3B 4B7EA 5KC6A 2QQPA 1HV1A 3H7JA 2NLRA 4Y26A 5C71A 3CZUA 1ND3B 1JZ3A 1ZRRA 3T09A 1XNBA 3ZFGC 3VD9A 3NJVA 4GALA 1PIV1 4A7ZA 5C4WB 3DKWA 1GP5A 3MGUA 5K4LA 4MVTA 5J36A 4OI2A 3O1TA 3AYDA 1UO9A 1ZZ6A 4Y1YA 1GU3A 1WBLA 1BBT3 1UPSA 3ES1A 5JZGC 5A7NA 5L7OB 4CSWA 4PJYA 1LEMA 1V9U2 5L7OC 3VV1A 3ZYRA 3TEZA 4Y4YA 1CJPA 2HWB3 2Y6KA 4GMP1 4OI4A 2IXJA 2YHJA 1QNWA 1CAUA 2XR4A 3SCFA 3OGRA 3U0ZA 4WZCA 1QJX1 2HWD3 3PMSA 5CEHA 4XUQA 4KWJA 1FATA 2V72A 3WDVA 1C1LA 3WG1A 5A3UA 3OPWA 4QQ2A 5A70A 3JD72 4A4AA 4NN0A 1FXZA 1MQTC 4CUCA 1YEWA 5KXEA 1LNSA 1WCUA 4JKKA 1J3RA 4D8MA 1OD5A 3RPQA 2J1SA 4COWA 2ENRA 1BCXA 2BRTA 3JBG1 5I0RA 1RINA 3V0AA 3UESA 1AYN3 2GH2A 1U5XA 3DV8A 1O4YA 2XOMA 3O12A 4G3YC 2GC2A 2MHFA 4MGQA 1LOCA 4XF4A 3LA3A 2BEOA 4MSVA 4XJ8A 1ENQA 1SFPA 2HWF2 4QGMA 2XUMA 3VDAA 1DZTA 4CUBA 2K46A 4ARYA 4JKLA 4DB5A 4L99A 1O7FA 3BODA 5FPXA 1RIRA 1H1AA 1XNTA 1BJQA 1FPN3 1IKPA 1ULCA 2VAUA 3SKVA 4CXXA 1UN1A 2WNUB 3K48A 5JMOA 2Y38A 4X8NA 4HKLA 2A6XA 4GULA 2WABA 4EN0A 2WT1A 5JIUA 4L97A 4IEQA 2ATFA 4GZ9A 4Q4V1 1GKBA 3J8F3 3NKGA 3QOPA 4Y22B 5E6HA 3AJZA 2Y6HA 2W1QA 1H6XA 2YFZA 1OD3A 2RS31 5SV8A 4CP9B 2Z79A 3EBRA 4DXTA 3Q8AA 2BNMA 3WD5A 2Q5TA 1W8OA 1D2QA 2PTMA 2RM23 3M1HA 3O14A 2GMMA 1OH4A 1OOPC 2E31A 4R9AA 1HXS1 5HCBA 4QHBA 4WM8A 1PVC3 2DVDA 3BU7A 3KZ4C 3O1VA 3APBA 4YG3A 1GMMA 4C0HA 3AYAA 3I8TA 4CCOA 4QM8A 4YW4A 4XF9A 4LPLA 1BBT2 4NUBA 3WLUA 1PNFA 4D94A 5C3SA 5FUPA 4DS0A 1VLNA 3VBOC 1Q3EA 1RMU3 2P37A 2XL9A 1DBNA 2JDMA 4OUMA 1MEC1 2LM3A 3WW1A 4U2AA 4CP2A 1LENA 5F7UA 2EA7A 3N9NA 1MVEA 4KQ7A 4Q0UA 5DAWA 4ZKTB 5A3PA 4JHZA 1UCXA 1UOGA 2GALA 2W47A 1H2NA 2ZGLA 4DXZA 1GBGA 2W5FA 1M4WA 4CCDA 2WSUA 5EZWA 1H2MA 2IC1A 2OQ6A 1GZWB 2C9KA 1CJDA 1ZM1A 1OKOA 2P17A 4GB31 4QKBA 1NXD1 5EFUA 3GNEA 1KRIA 2BWCA 4FPOB 4YGEA 5F5CA 4HL0A 4XVHA 5EHDA 3WF1A 1UL9A 2A73B 2HBUA 4GKYA 4Q4Y2 1R64A 1U5YA 3ZFFB 1I5PA 4C8DA 5FPBA 5F37A 3KHCA 1OOPA 1C4RA 4JGYB 3MF9A 3A4UA 1PO13 1L7QA 2BDRA 3TOJA 2QQNA 3WCRA 2QNKA 5GZGA 3THCA 5FQ0A 1IQAA 2JIJA 1OUSA 1UZZA 4XFGA 4ZU5A 4UBGA 4WM7C 4RQPA 1REFA 5LK5A 1MS8A 4OVEA 1LGBA 1QH6A 3UK9A 4XE9A 4LO6B 1KJLA 5FCCA 3I59A 2H6BA 4E8CA 5A3MA 2FMDA 4CDQC 5LEKA 4XAEA 1A78A 2BFUS 2QJVA 3NKTA 1D0HA 1B35A 2VUCA 1KD7A 1FNYA 3I3QA 5FUIA 1NY71 2CGPA 2R1DA 2RS33 1NCQB 2F4PA 3AMHA 4HOOA 2VG9A 3ZPYA 2P1BA 1Q8OA 3O1SA 4FPLA 1CZVA 3EMRA 2YMZA 4IEZA 1H8TB 2ZGUA 1QJFA 2J22A 2ZX0A 3CJIA 5F5AA 4BK4A 3AP7A 3LEGA 4DFSA 5D8AC 1CGPA 4AZZA 1PM4A 1NA1C 1VALA 1ZRIA 5C3PA 1C8M2 3WUDA 3CMGA 1W2TA 3GZAA 4B3NA 4R9DA 2PHTA 1AR71 2D97A 3WG2A 3ITQA 4AOCA 5FXXA 2JEMA 4DXRA 2YBPA 1HIXA 1FX5A 5FLIA 4KWLA 3VKNA 1LCLA 1OOPB 2DCKA 2W3JA 2ZGRA 4M3CA 4YFZA 3BKZA 3UV9A 3OSDA 1RMU2 2KD7A 4H2AA 2E7QA 2R061 4Q0SA 5BNPB 3DYOA 5HCAA 1RUE2 1V00A 2IUWA 5LBFA 4N9HA 1NXMA 2YC0A 2EIBA 5F3EA 2VZRA 1X9TA 5DAXA 4XYXA 1VRH2 4QQOA 5T54A 3P3PA 3ZYJB 3O0XA 1SBFA 2PA7A 3LQCA 2EF6A 5GALA 5LRSA 5DUWA 4Q1RA 2J1EA 2YGLA 1Q43A 5FBJA 4XDQA 3O1MA 1VBB3 4COUA 2WDBA 3UETA 2OIIA 1FMD2 2ZX4A 3UJOA 1LGNA 1XE0A 2ZPXA 4AAPA 2SBAA 3AM2A 5KWRA 3VHRA 2W9XA 3N7JA 2WL1A 3VKMA 2WR9A 3T3YA 5KR7A 4N90A 4XIOA 1SG3A 3RYPA 4AVAA 3POEA 5J3UA 5AC92 4QPWA 3ZXDA 2ZGTA 3UKNA 2C9AA 1NA1A 1GV9A 4BQ1A 1FT9A 5CFCA 1PZ7A 2A3YA 2VULA 1CONA 1RUF3 4FPYA 2JDZA 5DQ0A 5IFPA 1GLHA 4RL7A 5CFDC 4LT5A 2ZXQA 4W4ZA 3T4HB 4D69A 4QAWA 4TXWA 3UKTA 1H0BA 3C7HA 1QXJA 2WWUA 3PU8A 4AGVA 5KXBA 3RWKX 1XJAA 4O9GA 2MNGA 2A75A 1PMIA 1S0FA 2B46X 4E2SA 2R073 4IE4A 2IXLA 4RGGA 3TEWA 1XYNA 3PLQA 1IG0A 1RUG1 1N1YA 1RXFA 5FXZA 4AFAA 5FMDA 3MZHA 1GICA 2MEV2 3SCHA 4ZZ8A 1QNYA 1PGL1 1UNBA 5GZCA 3MUY1 1OT5A 5BNOA 5LRRA 1EV11 4ZXKA 3OTFA 2OPKA 5FK7A 2RS13 1D0GA 4LE4A 5C4WA 3ZO0B 2PHUA 2V09A 4AEDA 1W6PB 5C7GA 4ASLA 5DPNA 2QDNA 4W6YA 5FO8B 3D8CA 1UQXA 3BYWA 1ODMA 4XETA 1R092 1HRV2 3W21A 5C4WC 3QACA 4LR4A 4SBVA 1PK6B 3V0BA 1HB4A 1W6QA 4AEDC 2VECA 2O8OA 3LOIA 3SCGA 1XNKA 1DQ1A 4Y33A 2UYBA 5F8PA 5CFCC 3SISA 1HRI3 1LRHA 1SACA 3QBQA 4M3CF 3LKJA 4E4ZA 5IK5A 2X5IC 4XTPA 3LCPA 3R0RA 4AE2A 5EQUA 1SMVA 2MPFA 4A3ZA 5IATA 3UGGA 5J98B 4TSVA 1UZWA 3IIIA 2BBVA 4FPCA 1CAXB 3E6DA 4W6XA 1R1A1 4OI0A 2R0HA 5FY0A 4OHZA 4JKMA 4YZ2A 4UFLA 4CCJA 4B4PA 1IS3A 1REEA 2B8MA 1UOFA 1FV3A 3HJRA 4JGZA 2UWBA 2HYKA 3TNQA 3DL3A 4PQ9A 1LOBA 2XL7A 2V4AA 2D6KA 1OURA 2PHXA 3NQHA 2PFWA 2VCBA 1LOAA 1GWLA 2C26A 4YLZA 2VMIA 1KQRA 4YW2A 4XJUA 3CNAA 2DU0A 3HQUA 3W58A 2V73A 1XSQA 1NOVA 5GLZA 1VIWB 4IGOA 1G9AA 4K20A 4Q4Y1 2JD9A 4M3CE 1HN1A 1KJRA 2SLIA 5C9AA 2GMPA 5FZ0A 1A3KA 1XB9A 3AK0A 3W5NA 4K8FA 1XNAA 2VQUA 2YZ4A 4N8MA 4OUEA 3T2OA 5K8SA 1JYVA 2ZHLA 3S6PA 4CP0A 3PURA 2RDQA 2Y34A 1VB2A 4W6WA 1JZ7A 3KM5A 4BCUA 3VDCA 1AR62 1VAMA 2XJRA 4Z2WA 3AXDA 4CEYC 4LO5B 4JTOA 2JECA 1CR7A 1LHWA 4DRRA 1WMXA 4RHV2 5CKMA 4CP1A 2FDFA 4PLNA 3LWCA 2XJQA 5L73A 1CWPA 1QXPA 3VKOA 2EIGA 1QJEA 3OEBA 3PDQA 4FOVA 1H2KA 2C1FA 3O1PA 4D6RA 3FHQA 3VD7A 1W0OA 2KXLA 4UW3A 2E51A 5FPAA 1DQ6A 1W3VA 3CQOA 3K77A 3C8XA 2DURA 2D93A 3JQWA 5JPMB 4NAMA 3NWKA 1C5IA 2B9UA 3AKRA 5FLJA 5AFEA 4LO7A 1YFWA 2ZGSA 2CDPA 4BZ4A 1BMV1 1OKQA 1SQ4A 4CXWA 5CFCB 1X8EA 1PIV3 4GH4B 1RYYA 5FOJB 1HRI2 1OLMA 2V5DA 2WS91 2EXJA 2WZR2 4NO4A 1GNYA 3VLBB 4OMDA 1ENRA 3NVCA 4LBQA 4QPGA 3VBSB 1EAH1 3GZTB 1ND3A 4PLOA 3SMHA 5ACA1 2OXBA 3E6CC 3ON7A 2UY8A 1NQDA 5LY2A 1IPJA 3I97A 4KG0A 4LKSA 3VBOB 1K5MA 1UY0A 3N7MA 4XZUG 5FXWA 2Q1FA 1ULDA 2ZMKA 4HK9A 2ZZJA 1V6OA 4IE5A 1D7PM 3WHTA 4UYBA 2FZ1A 2VZTA 2P3YA 3T2PA 4DUWA 2Z4FA 4Q0VA 2JG9A 4XIKA 5LB6A 2EIEA 4B1LA 2A5ZA 3ZVXA 4N43A 1CAVB 1W8TA 5KC5A 4UWDA 1ULOA 3S5QA 1ULFA 2W08A 1O59A 5FZ8A 2QZ2A 2WKKA 1F31A 4ZS3A 2JG9C 3MLJA 5HCFA 2WO1A 5A80A 5JSPA 3EB7A 2VQAA 2YC2A 2W91A 4XCAA 2HJIA 3VBUC 4R9CA 1H9WA 4JHTA 3ZXKA 2NYYA 4E4DX 1KS4A 5FYMA 5CIRA 1RVF3 2JIGA 1JUIA 2XJPA 4LUMA 1BKZA 4HLTA 1VRH3 5EJ3A 1JZ2A 3JB8A 2VCAA 3KCCA 5FZCA 5HXMA 3JXSA 4FPHA 3VBUA 2YGMA 1XSRA 4IGPA 1ZBE3 4YW6A 4LORA 4UT5A 3MIFA 1N1TA 4AVTA 1DYPA 2IVJA 2PHWA 2WQ4A 3AMPA 1ZYBA 5FDBA 3OD4A 4V2WA 2QFEA 2VQTA 1BK0A 1J3PA 4AQTA 4YW5A 2XBO3 5FUNA 2RDNA 1UMIA 4IL7A 5F32A 1DQ4A 1X8MA 3PIGA 2ADEA 4XQDA 4M0HA 2VZVA 4DINB 1NLSA 1M06G 2IVIB 3M8LA 2DVBA 2E9QA 3E6BA 2YPJA 1NCRA 1Z7S2 3M3IA 4MUVA 1JU4A 1ULGA 3NNLA 3MW3A 1O5UA 3AFKA 1ALYA 3LEKA 4MXWA 4ZPIA 4URAA 1SPPA 1PK6A 3POIA 1P8JA 3I59B 2VUJA 3V64A 3CF6E 1N3QA 4HVRA 2BVBA 5FZOA 3JZVA 3DECA 3K4ZA 1AF9A 4ATEA 4QHOA 4BB3A 1PK6C 4MXWB 1FOD3 2WRAA 4HSLA 1RUNA 5FWEA 1J58A 4P9IA 3MLLA 4UW6A 1RUC3 1RUE1 4EN7B 4EZHA 5D8AB 1HW5A 3KVAA 1Q56A 3NV1A 3FLTA 5GLVA 1RUD1 1WCQA 1NCQC 1VJ2A 3WOGA 4N53B 2BTVC 4BQXA 4CDXA 3C7GA 1W06A 1D4M2 1V70A 2CWMA 4G4FA 5GZFA 3O5SA 3VZNA 3NAPA 3ZFGB 5BYNA 4JX0A 3BTYA 2GU9A 1WCDJ 1BEV2 4FCAA 3KCXA 3VBUB 2R043 1VMHA 2WUHA 2BP6A 2VO5A 1K45A 1QOSA 5L9BA 3U07A 3WW2A 5FZFA 4CDWA 4D7TA 1EUTA 3ZR6A 3NNFA 1DG6A 1AL22 2WFF3 5M0TA 1OF4A 1HKDA 3ENRA 1WMFA 2DV9A 4RGAA 1OC1A 5SV5A 4Q4Y3 4CCNA 1S0CA 4LE3A 4QQLA 3TN93 1W6NA 2QQWA 3WDYA 4AEDB 5IK4A 3PJYA 1X50A 3PL0A 4YZ1A 1ZBA2 3R05A 1ZRFA 5A7QA 1N1VA 3HBKA 2FCTA 3MW2A 3IB3A 2XPJA 3H3LA 3ILRA 5JAXA 2AACA 5FYZA 1ST8A 4Y22A 1W2NA 3N36A 2DF7A 4FFFA 2VVEA 2ORZA 2VVFA 4H3WA 3LD8A 4KBZA 4MHUA 1POV1 4NJ4A 4XBQA 4YARA 3VBHC 2VZ3A 1LOGA 4K40A 1BVVA 4LBMA 4RHV1 4LHNA 3KT1A 4H55A 2JWPA 5T55A 1ULEA 5L9VA 4RD7A 2ADDA 4ITCA 1S0DA 1COV3 1ODNA 1RUH3 1U0AA 3O0VA 5DG1A 5FMOL 1KITA 5JSOA 3OG2A 3OOXA 1B35B 5A6XA 1AYM2 4GH4A 1I5ZA 4QX2A 1RUD3 4PBPA 4XEZA 4ISQA 1REDA 2BBAA 5F6LB 3AYEA 5CB7A 2VZOA 4AEJA 2J7MA 1C8M3 4YFWA 1KS5A 1ZZBA 3WDXA 3VUOA 2N7GA 3BPZA 4XQ4A 1VAVA 4XFIA 5A7PA 3VDDB 3GXUA 3TB0A 3OEAA 5A7OA 5FYBA 4NIHA 3VD4A 1MQTB 2K9ZA 5C8CC 5HCHA 4C1WA 2CHHA 1DGWA 3LF7A 4CEWB 2D3SA 2P6CA 5GLTA 1EAH2 3EQEA 2DFBA 4OZXA 2AC1A 3WNLA 4ZS2A 3ECQA 4AGRA 1FMD1 2FZ2A 1UKRA 4UF0B 4YG6A 3ZN5A 1OVSA 1OSGA 2C5DA 4BLIA 2ZABA 1OLME 4BU2A 4KBBA 3RZKA 1JHNA 2VXJA 1K3IA 1R1ZA 3NJZA 3KLSA 2CAUA 3OYWB 4WVZA 1MQTA 1PM7A 3IAQA 2RJLA 2HEVF 3VBHA 1GUIA 2ET1A 4FI9A 1JMUB 4ZU4A 2DCYA 4LOSA 2IXHA 5F9TA 2G9ZA 3OPZA 1W8WA 3BB6A 5JZGA 2JD4A 1XYPA 3AX4A 2O0OA 4MGZE 2QUOA 4TN7A 3RG0A 3BALA 1V0AA 3TN92 1I6XA 1GP4A 1ND2B 2B5HA 5BNOB 3O0WA 4MGYE 5FZ1A 3J26N 2H0BA 2YBSA 3U14A 3SNMA 4HN1A 1MVQA 4JC1A 3I7DA 1IGOA 1UU4A 4IV3C 2YBKA 2DBIA 3RMYA 1C28A 1PGL2 4IERA 2HLEA 2VOKA 1W9FA 4IEWA 4QQPA 4RSUA 1PNGA 5C9AC 5EV7A 1D2SA 1HB3A 1XOYA 5JDBA 2JDHA 1E5SA 3ME2A 5FJKA 1O8PA 3A23A 4YZ5A 3B00A 2OPWA 4W8JA 4HPKB 1CAXA 2AR6A 3VN4A 1CX1A 2VCMA 1CAWA 4D3WA 4QGNA 1YI7A 2BW8A 4WVVA 5C3OA 5FZEA 5FYSA 1WLTA 3MLKA 2FDGA 5JXHA 1TNFA 4I09A 5LBEA 4W65A 4M0NA 3KHBA 2Z5WA 3I2GA 5C6CA 3CZJA 3I2JA 4NHKA 1VBA3 5IAXA 2A70A 4YPJA 4DQAA 4ASKA 1UWWA 2RJ2A 5CVRA 5ERLA 3VHNA 3AP9A 5I93A 5FY5A 2WZR1 1PO23 4QB1A 5AVAA 1R082 2UWAA 1BHGA 1CZTA 2WYFA 3Q8EA 5L7OA 2PLV2 4FO9A 2JICA 1TME2 5G04L 1GZWA 2ZS6B 3KWVA 1RITA 2YFUA 2DFCA 4LITA 1RUI3 2BNNA 2Q30A 4R9BA 4QDSA 3ZDVA 4OHVA 3GCXA 3R4UA 1ZREA 5AFBA 5JXGA 3WW3A 4YVSB 1YI9A 2Q1MA 5FR3A 5FOBB 2W1SA 2FD8A 2D40A 1IS6A 3QH7A 5FTTC 4ORFA 5FZ9A 3MYXA 4EE2A 4XMIA 1RUC1 1DGRN 4Y20B 3HVDA 2FDIA 2MEV3 2RJKA 2ZAAA 5H9RA 2AEYA 3LIHA 1FOD1 1S2EA 1JI6A 4YGCA 4YVWA 3ZSLA 5JCTA 1LB2A 1X82A 2XJVA 2WQ8A 4Q27A 3VBOA 4AXOA 5F39A 3BTAA 3NJYA 3WQ1A 1AUYA 1QIQA 4P9XA 3H42B 3KQ4B 3OBAA 3I2DA 4NR1A 4K8RB 1V6JA 1OBNA 1VBD3 1YQ5A 2QVSB 5CKQA 4NIAA 4RQPC 4D6SA 5IVCA 1YJKA 4YWAA 4XZPA 4BQYA 4XXPA 3M3OA 5F3GA 4LLFA 2C24A 1PO11 3VL8A 4DOUA 5K0UC 4QGLA 2KR2A 5J37A 2HWF3 2Z69A 3AFGA 4INDA 4CDQA 2GAUA 4CEWA 4FAHA 5JI9A 1ZBA1 5DMYA 1B35C 2CYFA 4L0PA 1SDDB 2RR12 3GJBA 1R091 3VDDA 1APNA 1JYWA 3N9LA 4QHZA 5A32B 3UYJA 5CADA 1QKQA 4QKDA 3UGFA 1OA2A 1S0JA 2AH2A 2ES3A 2Y6JA 3CJXA 2G9GA 2VUAA 5FWJA 1DLLA 3NO8A 5CA6A 2VZPA 1VRH1 2UU8A 2ZEWA 1AZDA 1XNDA 1GZTA 2RDRA 4GB32 3RZZA 2FCVA 5A1LA 4AQSA 4M00A 1MZ5A 4NPRA 4F83A 2ZX3A 1SBDA 5C3RA 4YVWC 5IW0A 3ROUA 5CAZA 1UX6A 5CNAA 4LKDA 1H8TC 3RSJA 4P08A 4NHYA 4ISRA 4Y1VA 3SLIA 3VKLA 1JU3A 1NCRC 4A44A 3RZGA 1HB1A 2PAKA 3ZSEA 3EXUA 2P2KA 2LTNA 3T0AA 1V9U3 1Z7S3 5I0UA 5BNQA 1SLTA 3WZ1A 3ZYHA 1JHJA 3F2ZA 1JZ5A 4AI1A 2B9VA 2EXHA 3WP3A 1ULPA 3J9SA 5FBZA 2HWD2 1WWYA 1LR5A 2JE7A 2VXRA 1BEV3 5J1XA 1VBD1 2A1XA 2E7TA 3RI8A 1E5IA 2R042 4OHWA 3INAA 4HPKA 3ACGA 4U36A 2DCTA 1R081 2XWJB 1LGCA 4UOJA 3KMHA 3H3UA 1W9TA 2WC2A 3T4VA 4AVSA 4EWEA 1EPWA 3T08A 1K42A 4XHBA 2VBPA 2KA3A 4JRLA 1C5HA 2Q1ZB 3KV5A 4K1ZA 4JGYC 5LA9A 5BNPA 5FO7B 3CU7A 4DNYA 1NY72 5DXDA 3GHNA 2LUWA 5LCWL 3OBRA 1OA4A 4BIOA 2QQLA 1UX7A 3KSCA 2HWB2 4LHKA 4QMAA 4A7KA 1UOBA 3T1MA 2BGOA 3TNPB 4QPIA 1FAYA 2Y6LA 4LMFA 4M4RA 4YW1A 5HV4A 3W5MA 4BQ4A 2WINB 2CAVA 4J6GA 4LXLA 3PUAA 4BE3A 4QU1A 5FYTA 3AL5A 2OA2A 4RS5A 4BYYA 5J96B 3AMNA 2ERFA 2YPDA 1QJU3 3VHPA 4GJYA 3D4KA 4MO3M 2VW1A 2E26A 3H1YA 4XACA 4ES9A 3HD8B 4P9WA 3ZIWA 1W6PA 2P3IA 5AC91 2JENA 5DUXA 4OCTA 3ZN6B 4V1PA 3N9PA 3U10A 1WD4A 3AMQA 2OZ6A 1YQCA 2BGCA 2LRPA 3AP4A 3ZXGA 1ASJ1 4IE6A 5DAPA 4AQ6A 4BJ0A 1PGSA 3C7EA 4N7IA 5D2AA 4RYDA 5FZ7A 4AHXA 5IHRA 1RB8G 1ZNPA 3VBRC 1YLLA 4XF3A 4XMAA 4DPNA 2TNFA 5FP8A 2UURA 1JYIA 1NKGA 1UOJA 1KXGA 3TN91 3NAPB 1S2KA 1W8UA 1H9PA 4FP2A 3T2TA 4BM8A 5GLUA 4PIZA 1PVC2 4JDNA 3WNKA 2E32A 1RC6A 2BUKA 1QJY1 2D3RA 3OYWA 4HFSA 4JDOA 4AVVA 1NAEA 2W94A 4QPIC 1QDOA 4DMIA 2EXIA 3AVRA 4UF0A 4I30A 5KXCA 4QQHA 5EWSA 2XVLA 3CIHA 5C5UA 2WZPP 3NV2A 1RUF2 3NNMA 4IW3A 2GC1A 2WYSA 2A6ZA 4RS5C 3USUA 3WP5A 4LNVA 2HH9A 3KF3A 4JAAA 4Q8LA 4RR3A 5C5TA 3VDBA 1HRV1 1WMDA 1Y43B 4NE9A 3I4IA 2XJTA 4LBOA 4DIQA 2WLQA 1Q8SA 1V6LA 1W99A 2OW4A 4UW4A 4K1YA 1OVPA 2FDJA 1QH7A 2Q8CA 1AR61 3HT1A 3HEIA 4LQRA 2J1UA 3K3NA 3JUUA 5K0UB 4LA2A 1FI2A 1W03A 3KGLA 1W8FA 3DXTA 1C8M1 1AJKA 1N3OA 1W2OA 1W6MA 5LBCA 3T2QA 4AGGA 5IK8A 4AFMA 3THTA 3H8XA 4QPGB 1XE7A 2HWE1 2B7YA 3KV9A 4FOQA 4LLOA 3SHRA 2RE9A 3T0DA 3LPGA 1RUI1 5JWPA 1QJZA 1HRV3 3OF1A 4HN0A 1SEFA 3ZR5A 3KGZA 3RI9A 1S1AA 3MV11 4MYEA 1LHNA 1Y9QA 4LKFA 3ATGA 5LWBA 4JGZC 2YB7A 1VBE3 2PHLA 2R16A 3GZEA 3OPTA 3WNNA 2BU9A 4KNCA 4RFRB 3HQRA 4GWIA 1TG7A 4N53C 4PQQA 4WBBA 5KHIA 2WJSA 1ZBA3 3ILNA 1A6CA 4RFT0 3NSTA 1BXHA 5IUQA 4Z1VA 1S0EA 1QXRA 2Y6GA 4LJHA 4QM9A 2BERA 2ORXA 4UFIA 1RUJ3 1KDMA 1KGYA 1OQ1A 2CL2A 2EALA 3FLPA 3K46A 2RS32 4KWKA 5ISLA 3DEMA 5B2GB 3WEZA 3WT3A 3N7KA 4CCKA 5I8TA 2K2SA 2W1UA 4NHXA 5F2SA 3U78A 2B42B 3SKJE 4KU7A 1GNHA 2VMEA 2WNEA 3B3QE 3ZMOA 2XMLA 5FO9B 4PBOA 1UU6A 4CEYB 3IDBB 3MIGA 5LATA 1UYZA 5A1AA 3SH4A 4C91A 1PO12 1DP0A 1SPPB 1RXGA 3K4DA 5FFOC 1UD1A 2BGPA 2VVDA 1QU0A 3ZIXA 4BMEA 1X33A 1YRZA 2OYZA 3BGAA 3KV4A 3N9OA 4Y1XA 4WV8A 1WW5A 1QMJA 4BQ5A 1QJU2 5A6YA 1XXNA 2FMYA 3I2HA 2OX0A 1C1FA 3RS6A 3WVJA 1QQP1 2ETEA 5LW9A 2D6PA 2HWE3 4AAXA 4AI9A 5A33B 1VRBA 2V4VA 4F3JA 4NWWA 4CUAA 1TMF2 4IV1B 1BYHA 3ACHA 3WQ7A 3N4MA 4F8AA 1OMIA 1HQNA 1Q8QA 1U5IA 1BBT1 2RMU2 3PVOA 3ZXFA 1R083 4K21A 2JG8A 3WQBA 3W9AA 1LOEA 1W39A 3W59A 3OUJA 3POSA 3LFIA 3DKQA 4J1XA 5LASA 4Q4V3 2HWC2 1JODA 1BLZA 1UKGA 5ACA3 1E57A 4C0BA 1N1SA 2D6NA 2R071 4L9BA 2E63A 4TTGA 4NWVA 3H8OA 2Y6FA 4LHSA 4LIUA 1UAIA 2G4IA 3PUHA 2GMEA 1DZRA 5J48A 2ET7A 4Y1ZA 1CESA 3ETQA 1SFYA 1MZ6A 4N43C 4Y5SA 2F17A 3ZN6A 5IVFA 4E4SA 4CEYA 1JOJA 3UJQA 2Z2SB 1VE0A 2Q0AA 2WWSA 4CDUB 5CBLA 4BHPA 4XBLA 2VOXA 1AR82 2DTYA 3DN7A 3I3BA 4PCRA 1RHI2 4CEWC 1UZ0A 4YZ3A 1SLCA 3SEPA 3EYPA 5DDJ2 3TEYA 3POYA 4Q4W1 4JCKA 1LU2A 4GWNA 3R6SA 3V65A 1GWKA 4WVMA 4P9GA 3UKVA 5FPZA 2W68A 4ONUA 3WXPA 1RVF1 3WNMA 5LA0A 3T0BA 3TEXA 1IHMA 1CZSA 4S2HA 5DABA 3WCSA 4I2OA 3ES4A 4LK6A 5T3NA 3RYRA 1G9FA 3FBYA 3KT4A 2VH9A 3QD6A 4LUKA 3RGBA 3S57A 3J4UH 4WVMB 4Y5TA 4Q26A 4QPGC 5TSWA 1RJ7A 3KCYA 4AI8A 4NIGA 1H8TA 1O4ZA 3CJIB 4E2QA 3ORJA 4B29A 3D3AA 2TEPA 4FBFA 2KM2A 4QB6A 2WNVC 4EWAA 3IIAA 4BH9A 1CN1A 1QDCA 2ARAA 3WV6A 2O14A 5GZEA 1PMHX 1SLBA 1VBC1 2R041 1HV0A 4BA6A 4MG2A 4B7KA 1XRUA 3EO6A 3O1UA 1ZRDA 2GP3A 2WO3A 1DQ2A 2HEYF 5BPXA 4CCMA 1RMU1 4YM2A 4COYA 3AP6A 1F4AA 5JXIA 5FMOS 3I54A 4PF5A 4Y24A 2NP0A 3CDZB 4MGIE 4R8HA 2RS52 2QZ3A 4LTAA 2ZAHA 5FKCA 3AZZA 1GR3A 1JS9A 1UY3A 3OBTA 2VCCA 5LY1A 5EIYB 4KH9A 5ABJB 3OBZA 3OGVA 2VU9A 4P00B 4Y20A 3IMNA 3P5BA 2VC9A 5A6ZA 2QQMA 2ZCWA 3AP5A 1NE6A 2D5FA 1VBA2 1YJLA 4I3PA 2PXJA 3NAPC 3LA7A 1AR63 3A0NA 4GQ7A 3OJBA 4QX1A 5L36A 3BPSA 1W8HA 2VTFA 2R30A 2ZGMA 1DF0A 2WZEA 1JH5A 5C8WA 4RHV3 1NA1B 4X6RB 1ZBE2 3IZOA 4XABA 2XG3A 4M3CB 4R4XA 3PTYA 5IAVA 3QH6A 1CAVA 2BJSA 2BYVE 2VZSA 3IM0A 3IAPA 3MV01 3J7LA 3PVBB 1HB2A 1NLQA 3LEMA 1HQWA 2BOJA 2XLGA 2VMCA 3S5AA 5CZKA 2A6VA 1DHKB 2PAEA 2JJ6A 3AZWA 4AVCA 4A6SA 1H1MA 4RA0A 4MX3A 4P02B 3JBG3 4EROA 2R062 5AVPA 5DUUA 2J1VA 3JD71 3HWJA 1JYXA 5FJHA 5FY7A 3B5LB 3BOWA 3PNAA 4OYUA 3RNSA 1DYOA 4PI2A 5GKAC 4XFAA 4QDRA 5J09A 4HKOA 4I0WB 5FY9A 1RUJ2 2Q8OA 1O3TA 1SCSA 2D6MA 2JDPA 2NN8A 3ETPA 4ATFA 5BNNA 3UNPA 2F4LA 2VQ0A 1CPMA 2NZ9A 1Z78A 2PHDA 1LODA 1QJU1 1CIWA 2RDSA 4NHMA 2IXKA 3AZVA 1GZ9A 1S55A 3VL9A 3BTXA 2JG8B 4IEVA 4QPYA 5F3IA 3LDBA 4LBLA 3WNOA 2HWB1 3SITA 5BNNB 4O7XA 1YCIA 4I0AA 4XDOA 2VE1A 3FMGA 4IEUA 4Q0QA 4CDUA 5C70A 3B02A 3Q9OA 4CDWC 1X36A 2AUYA 4XW3A 1OHFA 2R6QA 3TYJA 1WCSA 2VW0A 4HT1T 1LOFC 2FHRA 2RS53 1AR73 2VNGA 3VB9A 1R1A2 4QXBA 3VZKA 3VKFC 4B4QA 2YU1A 1UXZA 3WDTA 2CV6A 4XBNA 2A3WA 4HVQA 5FP3A 1AYM3 4Z07A 1BZWA 2DWRA 1FMD3 4IDZA 1GOHA 5EP9A 1W6QB 4CZSA 4LBQB 3N35A 4J1WA 2RV9A 1AXKA 1GOFA 3RZLA 1G86A 5DAVA 4QXHA 3B01A 2XBO1 5FIXA 4EN6B 3MIDA 1IG3A 3BU0A 3FC0A 1CVNA 1H1IA 2X05A 3HNMA 2FDHA 4Q2FA 2AENA 3ZFGA 1JZ4A 1YXWA 1SCRA 3ZFFA 3OD0A 3CKHA 2DYCA 2R7EB 3AYCA 5K7PA 2YDEA 2BZDA 5KHKA 2A71A 4N53A 1AL0G 2AZ5A 5EPAA 5F6KA 1GQGA 5F5IA 3LSDA 3OCPA 4OUSA 4HETA 4QX0A 2VTXA 1EP0A 2AYHA 2VUDA 2R072 1FYUA 3TRSB 5CFDB 1J3QA 3JU9A 4FAGA 3O1OA 1BMV2 4FQZA 4Q4W2 2OKXA 1LOFA 2TBVA 4AFDA 4I0BA 1PZ9A 3H7YA 3F95A 3ZXJA 4LHLA 1JBCA 1F35A 1QOTA 4ES8A 4XC9A 2DCZA 2ZA9A 5FXVA 2UY9A 4A45A 4Z2AA 3PUQA 5ABJA 3H9AA 3NNJA 2AREA 1O3QA 1OF3A 1UY4A 2WFPA 2RM22 4AYUA 3K51A 4TLGA 1VP6A 1W9YA 1UZYA 5JR2A 5C8CA 1DFQA 3D82A 4AF9A 1Z0HA 3M4FA 2QBXA 2OQ7A 3K4AA 4XILA 5FY4A 1YUDA 1UU5A 4HONA 1MPXA 4FPJA 3AKPA 1N47A 2RMU3 1G7YA 1UY1A 5IJRA 5A7WB 3VBRB 4MGTA 3WW4A 4COVA 2VZQA 2WFF1 5EYYA 2JDYA 2WAOA 3EHKA 4PT6A 4Q4V2 1SLIA 3POWA 3M7AA 1CAUB 5EJZB 4CCEA 1AXZA 2C6SA 2VJXA 1A8DA 2VMFA 2XHNA 1J83A 3B9CA 4JDMA 3U4XA 1NQJA 1W0NA 1UYXA 2O8QA 4RGKA 3FHAA 1TME1 4P9JA 1R1A3 1LHVA 3HN3A 4ZONA 4CU8A 2IXCA 1TNRA 1DIWA 1TMF3 1W9SA 2WA4A 4IXLA 1C57A 4P9YA 4XOGA 5A33A 4YSFA 4DUXA 2MEV1 1NT0A 1OQEA 1QOOA 2WNUA 1H4HA 3NMBA 3MBWA 4NPLA 5JZGB 4UW5A 1EYBA 2XJUA 3TWIA 2AEZA 3GBWA 5T5OA 4UXAA 1O5LA 4PDWC 3IMMA 1VBC2 1OQDA 4Q4X3 4NIDA 5IFTA 2XUEA 3C2UA 3KQRA 4ARXA 1TME3 3B94A 3HPNA 4KGGA 2YG0A 2VTXJ 2Y0OA 1KFUL 4A3XA 2G1MA 2ZX1A 4BLJA 4IEYA 3BUCA 3GF6A 1ZZ9A 2G19A 1LHUA 1MR5A 2RG4A 2FCUA 4OZOA 1K5MC 3K75B 5T50A 2QTWB 4FSJA 4PLMA 1O8SA 3WINE 2XHKA 4YM0A 3ZSKA 5DN2A 5JOWA 5K9YA 4DY5A 1CAWB 3HNYM 3S7IA 3I3MA 1K5MB 2GZWA 1WLDA 4XJAA 5H9PA 1NLRA 3SH3A 3WF2A 2WN2A 2WS92 3ZM8A 2R32A 4HSJA 3RFRA 3OB8A 3A7QA 3ASIA 4CCCA 5GM0A 4A41A 5L19A 1ND2C 5LEJA 4OHYA 2XXZA 3RZJA 1QQP2 4KL1A 4LO8A 3DPRC 4ZXEA 1UXXX 4BQ3A 4PF1A 3AKSA 3PU3A 3GJAA 2ZGOA 3HNBM 5C33A 1A34A 5FPUA 1MS4A 1JZ8A 1ND2A 1LHOA 3HOBA 3CLPA 1IKQA 4AI3A 2G9FA 4HKWA 4L92A 2P5BA 4IEPA 4LA3A 4OQ9A 3S30A 1WW6A 3C3VA 2XVKA 1W0PA 3NJXA 3ZXEA 2JDKA 1VBE2 3CJIC 3BI3A 1VB4A 3RDIA 3B93A 4IV1A 4Y4RA 3VGIA 3DGTA 4HVOA 4JGYA 4HK8A 4NIIA 4E27A 4A2UA 1O6UA 1OLQA 1RUOA 3NV4A 4B4RA 2CWSA 5FLHA 3QCWA 5KBFA 1YQ2A 2BWAA 2OUHA 4Q4X1 3N7LA 1H6YA 1G6NA 3MW4A 1AXYA 1FV2A 2HYXA 3L2HA 3SH5A 4AI2A 4XCBA 3MO4A 4BIFA 1RUD2 2D5HA 3TBDA 3CHXA 2VOWA 3FFZA 5ANQA 2VZUA 3FX3A 3USSA 5BY5A 3MI8A 2BOIA 4I02A 1O3RA 2XWBB 1NCRB 2X29A 4ZU7A 1SBEA 2PLV1 3U4SA 4FTBA 2WN3A 4HG6B 4K7JA 1DYKA 1VBA1 3HIFA 3POJA 5FYVA 4PIXA 3IN9A 2YUEA 3IPVA 3MIEA 3U37A 3LEIA 4CPBA 3J8F2 2DDUA 4MXVA 1YFXA 4RS5B 2J42A 3AKQA 1DU3D 2JB8A 4JVAA 3J7MA 4FPGA 1XPWA 2WNOA 3I2KA 1W05A 3ST7A 3HMYA 3ZPOA 3KS7A 1HRI1 1SLAA 2GC3A 5FMBA 5I0TA 3LIGA 4HANA 3S7EA 1GOGA 3WDUA 3AMMA 3WDWA 4IEOA 3DXUA 1OXCA 5FZ3A 3WR0A 2QDRA 3C7FA 4XUPA 3RWNA 3ZKYA 1ASJ3 1RHI3 3MHZA 3ZFEC 1XQNA 2XJSA 3EJKA 3C7OA 2JDNA 3GBFA 4L2NA 1UIJA 3OUIA 1PO21 2P3JA 1QQP3 1F2NA 1L7LA 2WIIB 1TMF1 2HWC3 3ZYBA 4XAAA 3LA2A 1OPOA 3HT2A 3PUIA 3OUHA 5CKNA 4FFGA 1YFYA 2W95A 2LALA 3GM8A 5CG8A 3PHMA 4K6BA 1MS9A 1AR72 2DVFA 3H1WA 1TE1B 1X9PA 5FPLA 5J7MA 1FNZA 2WO7A 1RUI2 3VBRA 4FVVA 5FZ4A 2IXIA 4MH0E 4YVSA 2R0FA 3WNPA 2ZKLA 3GALA 4UFHA 5KHGA 3POBA 1AX0A 3L9JT 1VAKA 1AYN1 1CPNA 1D4VB 2EICA 3POGA 3WG4A 3WF0A 1G9BA 4FPKA 1WGPA 3Q8FA 2LS6A 2ZEXA 5BNNC 2NMOA 4RR3B 1A8MA 1V6IA 3AZYA 3N9MA 4YGDA 3PUSA 1S0BA 3H1MA 3FL7A 3HBZA 4FFIA 3IWZA 4XF0A 1JW6A 4GD4A 3ZFEA 3LSEA 4E2GA 3K3OA 1QF3A 2X5IA 2BQPA 1OI6A 1UYPA 4BXFA 2FQPA 1K5JA 4Y1UA 1F4HA 1BVP1 1VBB1 1W2AX 2BFUL 4S2GA 3P3NA 1UF2C 5IVVA 2OUJA 4UFKA 1S0GA 1W8ZA 3GBGA 4K3UA 3W20A 1YO8A 2XGXA 4LKEA 1JZ6A 3IKWA 1Y9MA 1AL23 2WFF2 2DUQA 1YQ8A 3FHIB 2HKXA 4DY3A 4KI5M 4OHXA 2A6YA 4AG4A 3KB5A 2C4XA 1DCSA 1MZFA 1YQ6A 5IVEA 1LAJA 1OA3A 4CP9A 1VMFA 3HAGA 5DAQA 5FZKA 1HLCA 1UW8A 3BVCA 2YC4A 3AC0A 4L11A 2W1WA 1JYNA 3GDBA 2XLAA 3KV6A 1L7RA 4LIVA 4DO0A 4AR2A 3U11A 2LROA 3NRUA 5JIAA 3THPA 3VBSA 4YVWB 5A3WA 2ILMA 5IK7A 1QY4A 2PYTA 2BPA2 4R4ZA 3RJ2X 1H2LA 3G7DA 3V56A 3HN1A 3IDEA 5ANNA 3E5XA 4CXYA 1U12A 2RR13 3VHOA 4WZFA 3ZYIB 1V6KA 2RS11 4XUTA 3ZFEB 4B8EA 3MICA 1BEV1 3D6EA 2O1QA 2PMWB 1J1LA 1CQ9A 3IT8A 4GXLA 5FP4A 3WX5A 1W90A 2HBTA 2YV8A 1TQ5A 5HPOA 2HEWF 2JKXA 3U75A 4TWTA 2VGDA 1AL21 4HZFA 1T6GC 5I8YA 1NZIA 1ZZ8A 1JOBA 3MFAA 2NQYA 3NL1A 5FYUA 3GZUC 3VZJA 4XFHA 2HWD1 2QQVA 2VOTA 3THDA 2B4KA 2WBKA 4Z92B 4AVBA 1JXNA 5AC93 4K9SA 5LBBA 5C3QA 2GNDA 4O9EA 2VOVA 3LPFA 4HMZA 4XUOA 5FZOB 3H8RA 5B4NA 2PHFA 2CGOA 1MEC3 5I0DA 4CVUA 2RVAA 1MS0A 4FXGB 5FYYA 3RYKA 2DU1A 3VBSC 3WQ0A 4XDPA 4EQVA 1H4GA 4E4HA 5T5LA 4GA9A 4LEJA 5BV6A 4JV4A 4TYSA 4ASMB 4C1XA 3VBFB 1RHI1 5IWFA 1URXA 3LDRA 4NPMA 4UBHA 2I74A 5FPVA 2VW2A 3TAYA 1ZX5A 4IUGA 5D1IA 1O4TA 2YY1A 4P5HA 4LBQD 3AJYA 2W0XA 4QX3A 1WZXA 1PMJX 4JZRA 1I3HA 2JG8C 1IPKA 1GANA 1MS5A 4FTEA 1AX1A 4NMIA 2VM9A 3P6BA 4I01A 1TEIA 3E5UA 3PMEA 4XXAA 1Q8VA 2DUOA 3VBHB 3N9QA 1AJOA 2PLV3 2ZBJA 2WS93 1SZBA 1J59A 4CU9A 3ZKUA 2QKDA 4AEMA 1AR92 5A1FA 5APAA 3FFQA 1ZVFA 4AL9A 2CGNA 4HBNA 4QWNA 1Y3TA 4FOYA 1S4CA 5E1RA 5JLVA 2RM21 2Y33A 3OGJA 5JXJA 4D0QA 4WM7A 4BOWA 4MHRA 2W2IA 3GCWA 1W6MB 2GDFA 2ZKNA 1PVC1 5KHHA 1RUG2 2AGSA 1UYYA 3ILFA 2D6LX 1W3XA 3J8F1 2XLFA 4XURA 5IT6A 4D6QA 3FUOA 5A3NA 4WM8B 1US2A 3ABZA 4CA9A 1DLCA 5FZLA 3MUZ1 4EZ4A 1HN0A 2A7AA 5LK7B 2PHRA 2XQRA 3I49A 4I3GA 2ZMLA 2LW8A 1MACA 4A6OA 3DPRA 5GZDA 2TUNA 4NVPA 2Y8KA 4NRPA 2NPIA 4QX5A 4DEQA 4IETA 2J1AA 2RS12 1FOD2 2VBDA 3NV3A 1EPZA 5GLWA 2ZGQA 1W8NA 4MGSA 2WT2A 4H14A 1QJX3 1CX4A 4AI0A 3I2FA 4XPVA 5CU1A 1R093 4GWJA 2WQZC 4PDWB 3S0MA 1AR81 3B69A 3N3HA 2GNMA 2VMHA 4GJZA 4JRAA 1WLWA 2X5IB 5FZBA 3VD3A 2JDUA 4WM8C 1U5ZA 2XBO2 3H8UA 5I8SA 3FE5A 1S2BA 4FOWA 2Q4SA 5FZ6A 5E16A 3ACFA 3H0OA 3MDPA 2D98A 4OULA 3WNXA 4FXKB 5DG2A 4GMP0 2H0VA 1ENSA 1NYWA 3AXEA 4SLIA 2RR11 2XKPA 1PX3A 4GB33 1PIV2 2DTWA 4GAZA 2IWGB 1O3SA 1AYM1 1W28A 2Q8DA 3E5QA 4J25A 1IOAA 1ZZCA 2XQXA 1QGLA 1HXS2 1RGSA 2VD7A 1F15A 4FPEA 2P34A 3DCQA 4NRMA 3AKTA 1Q5OA 2RS51 1I9RA 1PX4A 1UMZA 2VNOA 1EV12 3VDDC 4H7MA 4A42A 4D7SA 5A6QA 1G9DA 4KU8A 1KDKA 2GN3A 4Q8KA 1N3PA 3E1F1 3CO2A 2GC0A 1JYTA 4XQWA 5EJ1B 2W52A 2ARXA 4W50A 1AR93 1GZCA 1W9WA 4CUGA 3AVSA 3MIHA 3A0KA 4RQPB 2D7FA 1OPMA 2VR4A 3VZOA 2E33A 2R49A 4LBKA 1MEC2 1OH3A 1E5HA 4AHWA 1RTVA 4MZUA 4YG0A 4BWOA 2ZMNA 3WF3A 3BTZA 5CYYA 5CFDA 2WZR3 3PIJA 4KG8A 5D8AA 4Q29A 3M70A 3WY6A 3PVEA 5HV0A 5FAXA 3H3ZA 3MF6A 1W2UA 4CDXC 1YIFA 4EV0A 5JR7B 2NMNA 3ACIA 2BV4A 3NNGA 3Q8BA 1GNZA 3FN9A 4QKFA 4DRVA 3RQ0A 3JD73 2ZHNA 4JGZB 4R52A 2D6OX 1KEXA 3AB0A 2GSYA 4JQRA 2WNVA 2JG9B 3ZSMA 2ZGNA 2ZJCA 4QX8A 3WP6A 1DZQA 4V2VA 4ZHNA 5T52A 3IPVB 1GWMA 4B1MA 1AYN2 2E6VA 2CY6A 4Q4X2 1EUUA 4MLOA 1KFXL 5A7WA 1OUXA 1XC6A 4YW7A 3WSOA 1W6OA 3T30A 1Z7S1 1G8WA 3ACLA 4MGKE 4PIYA 1RUF1 1WD3A 2GN7A 3V0BB 2D44A 3BOPA 5BNPC 3M3CA 5BUVA 1WUVA 4QKNA 5G05L 2FDKA 2GNBA 2XB6C 1E5RA 1UPIA 2A3XA 3MFCA 4F7ZA 5ACA2 2EIDA 2ZOEB 2VZ1A 2VMDA 1W6OB 1GYKA 2Y64A 3FZ3A 5A3LA 2OT7A 1WBFA 4N7UA 3D0SA 4BQ2A 2WSVA 3KVBA 4X8PA 2ZHKA 5H9QA 3URFA 3RZMA 1XNCA 2PQQA 4IEXA 4QX7A 2D3PA 1RJ8A 1JYCA 4GWMA 4XFCA 2Y60A 4Q5OA 5T5JA 5HI0A 2ZACA 1NG0A 5B4XA
chains in the Genus database with same CATH topology
2HWE2 4CDUC 3WG3A 1AHSA 1RUJ1 4D7YA 1B09A 4EWDA 3IDCB 2ZZQA 4N43B 4LULA 4FP3A 5DZFA 2EXKA 3BIWE 1D4M3 4YNIA 2GNTA 4YM3A 5BNOC 1EAH3 2H6CA 1S0IA 1ZZ7A 3MIBA 4LBJA 5JI7A 4OFGA 4WM7B 2CNAA 5ABJC 1RL3A 3BCWA 2Y26A 1RVF2 1PHMA 5JPNB 4NOTA 4COZA 1OFSA 2QCSB 1RUC2 4IV3A 3D0JA 1CD3G 4S2DA 4AFCA 1WMEA 1H30A 3HR9A 1YIPA 3PVNA 4CRQA 1XU2A 3ZFFC 3GHMA 3AZXA 3UL2A 3JB4C 1QHDA 1DGLA 4AWDA 1ZBE1 4URTA 2ZGPA 3OY8B 4FQ4A 1GQHA 3VZMA 5GJ6A 1OLRA 4CDXB 5JOXA 2WA3A 4XJZA 2BVVA 1C3HA 3O7OA 1LESA 2GH8A 4YGBA 2V5YA 4XFBA 1DGWX 5I91A 4XHXA 1IS4A 2Y0IA 2YYOA 3RJRA 3JQXA 1QJY3 1LULA 1WW4A 3WHUA 1FPN1 2I07B 4QT6A 1LU1A 2DVAA 1LECA 5JMCA 1NE4A 1WW7A 1ASJ2 1PGW2 5EXOA 2RMU1 3ZMNA 2DVGA 1V6MA 1AR83 3X29B 1SLLA 4X6QB 4GIQA 1DGRA 2UYAA 1XYOA 3FBMA 1L3JA 3ZYGA 3DF0A 1JN2P 4YRDA 3JCIA 3VBFA 1X7NA 4FT8A 3ZN4A 5DUVA 1WLCA 1IZ3A 2WNVB 1WA4A 3QLQA 1COV2 1RUH2 2OZJA 3OY8A 4TZDA 2WNUC 2X8KA 2JX9A 4JGZB 4YGEA 1AR91 2K0GA 2YXSA 2XVGA 2Z42A 3ALQA 4CDWB 1JTZX 1JUHA 5EYXA 1RUE3 4WVWA 4KGQA 4Q1PA 3NW4A 3RMXA 2X53S 1ONAA 1H8VA 5JSRA 3WP4A 2FBEA 4XFFA 1HXS3 4MV2A 2IFWA 4TLFA 4N9IA 3ZSJA 5DDJ1 1GFF2 1EV13 3DUIA 4XJWA 4LBNA 1VR3A 4P14A 3V0AB 1QWRA 2C0ZA 4IV1C 2E7AA 1VBC3 2QE3A 1PVXA 4XJ9A 3FWEA 1RUG3 4EN9B 2ARBA 2ZHMA 4LO4B 3LOBA 2UWCA 1MS1A 2XKOA 3D5OA 4XF1A 2VNRA 2JE9A 4S2FA 5CG9A 1YFUA 2A6WA 1Y7BA 5F5QA 3SXWA 3M3QA 5BXXA 4AQ2A 1ZRCA 3G6JB 1COV1 1Q8PA 1RUH1 3HQXA 5K0UA 5E88A 4QPIB 5H9SA 3M2MA 5A32A 4AK3A 4Y5Z0 3DPRB 4OLLA 1VBE1 1LTEA 4P9LA 1QJX2 1YNAA 4META 3R4DB 1ND3C 4AHYA 4CYDA 3T1LA 4PDWA 1NCQA 3B7MA 1DQ0A 4Z8BA 2IZWA 1PO22 2EAKA 4BPZA 5FQ0B 5T5PA 5F1RA 2VY0A 2VPVA 4BMBA 1HDKA 4YZ4A 2PAMA 2WT0A 4YM1A 2R1BA 3R4SA 3JBG2 2JXAA 4M01A 4G9SB 1LJ7A 3ZDSA 1SDWA 3KD4A 2XH6A 3GYDA 2PN5A 1OFNA 2IFRA 2CTVA 2HWF1 3KT7A 1W6NB 1MZEA 5HBAA 2OVUA 3IBMA 4GKXA 2ZGKA 2BNOA 4IESA 3CEWA 5FRAA 5C9AB 1LEDA 2F6BA 4AW7A 1SFNA 2E53A 4Z82A 1MS3A 3MEPA 5DDJ3 1DDLA 1BQPA 2EVXA 1D4M1 5HXVA 2B39A 1V6NA 4C90A 3B9IA 1EY2A 2HWC1 4A7YA 3E97A 5JOYA 4AHZA 1BK1A 1XE8A 3FLRA 2D43A 3PJQA 4JTNA 2DCJA 3OGGA 4AFBA 1V9U1 5DZGA 1I1EA 5E8AA 1XU1A 1GSLA 3CL1A 4GH4C 5E89A 3ZYPA 3ZXLA 1VBD2 3ZX7A 5JVVA 1AVBA 2ZX2A 1J1TA 4L8QA 4H7LA 5C8CB 2YROA 4Q0PA 1ZA4A 2P3KA 1FPN2 2RHPA 3LZZA 3ZXAC 2PELA 3L2YA 5FREA 3RRDA 4FTSA 1F8VA 4GMP3 4QU2A 4QXKA 3MPBA 1PZ8A 1ENXA 5I0SA 3LB9A 4FPFA 1HQLA 1HX6A 2EAAA 2NM1A 4YYOA 4YW3A 4Q4W3 1LKNA 4IQPA 3WUCA 4EJRA 1VBB2 1O91A 2JKBA 5JOZA 1G9CA 3LAGA 1F9KA 1C8NA 1F5JA 1PGW1 1YHFA 5KXDA 3H50A 2I45A 3LGRA 4RR3C 2ZTNA 1AX2A 3M3EA 3FJSA 1UIKA 3MPPG 1F5FA 2VMGA 1NZCA 2DUPA 4OI1A 4EN8B 4CTEA 1POV0 4CDQB 2W39A 5DZEA 1QJY2 3FUQA 2I2SA 1IS5A 1YWKA 4QD2A 4NHLA 4YVSC 1DQ5A 2R063 2B45X 1YYNA 4XTMA 3ELNA 3VZLA 4E9KA 2WLPA 1POV3 4AEKA 1WCKA 4IV3B 4B7EA 5KC6A 2QQPA 1HV1A 3H7JA 2NLRA 4Y26A 1ND3B 1ZRRA 1XNBA 3ZFGC 4GALA 1PIV1 4A7ZA 5C4WB 3DKWA 3MGUA 5J36A 4MVTA 4OI2A 3AYDA 1ZZ6A 4Y1YA 1WBLA 1BBT3 1UPSA 3ES1A 5JZGC 5L7OB 4PJYA 1LEMA 1V9U2 5L7OC 3VV1A 3ZYRA 4Y4YA 1CJPA 2HWB3 4GMP1 4OI4A 2IXJA 2YHJA 1QNWA 1CAUA 3SCFA 3U0ZA 4WZCA 1QJX1 2HWD3 3PMSA 4KWJA 1FATA 3WDVA 1C1LA 3WG1A 4QQ2A 3JD72 4NN0A 1FXZA 1MQTC 5KXEA 1J3RA 1OD5A 3RPQA 4COWA 2ENRA 1BCXA 3JBG1 5I0RA 1RINA 3V0AA 1AYN3 2GH2A 1U5XA 3DV8A 1O4YA 3O12A 4G3YC 3VBFC 2GC2A 2MHFA 4XF4A 1LOCA 3LA3A 2BEOA 4MSVA 4XJ8A 1ENQA 2HWF2 4QGMA 4DZGA 2XUMA 1DZTA 4DB5A 4L99A 1O7FA 3BODA 5FPXA 1RIRA 1H1AA 1BJQA 1FPN3 1IKPA 1ULCA 1UN1A 2WNUB 3K48A 2Y38A 4X8NA 4HKLA 2A6XA 4GULA 4EN0A 2WT1A 5JIUA 4L97A 4IEQA 2ATFA 4Q4V1 1GKBA 3J8F3 3NKGA 3QOPA 4Y22B 3AJZA 2RS31 5SV8A 2Z79A 3EBRA 2BNMA 3WD5A 2Q5TA 1D2QA 2PTMA 2RM23 3M1HA 3O14A 2GMMA 1OOPC 4R9AA 1HXS1 5HCBA 4QHBA 4WM8A 1PVC3 2DVDA 3BU7A 3KZ4C 3APBA 4YG3A 4C0HA 3AYAA 3I8TA 4QM8A 4YW4A 4XF9A 1BBT2 3WLUA 1PNFA 4D94A 4DS0A 1VLNA 3VBOC 1Q3EA 1RMU3 2P37A 2XL9A 1DBNA 4OUMA 1MEC1 2LM3A 3WW1A 4U2AA 4CP2A 1LENA 2EA7A 4Q0UA 1MVEA 4KQ7A 4ZKTB 1UCXA 2GALA 1H2NA 2ZGLA 4DXZA 1GBGA 1M4WA 2WSUA 5EZWA 1H2MA 2IC1A 4GB31 1GZWB 5EFUA 1CJDA 1ZM1A 2P17A 1NXD1 3GNEA 1KRIA 2BWCA 4FPOB 4HL0A 1UL9A 2A73B 4GKYA 4Q4Y2 1U5YA 3ZFFB 1OOPA 1C4RA 4JGYB 3MF9A 3A4UA 1PO13 3TOJA 3WCRA 2QNKA 5GZGA 5FQ0A 1IQAA 1UZZA 4XFGA 4ZU5A 4UBGA 4WM7C 4RQPA 1REFA 5LK5A 1MS8A 4OVEA 1LGBA 1QH6A 3UK9A 4XE9A 4LO6B 1KJLA 5FCCA 3I59A 2H6BA 5A3MA 2FMDA 4CDQC 5LEKA 1A78A 2BFUS 2QJVA 3NKTA 1D0HA 1B35A 1KD7A 1FNYA 1NY71 2CGPA 2R1DA 2RS33 1NCQB 2F4PA 3AMHA 3ZPYA 2VG9A 1Q8OA 4FPLA 2YMZA 4IEZA 1H8TB 2ZGUA 2ZX0A 3CJIA 4DFSA 3AP7A 5D8AC 1CGPA 1NA1C 1VALA 1C8M2 3WUDA 3GZAA 4B3NA 4R9DA 2PHTA 1AR71 2D97A 3WG2A 2JEMA 1HIXA 1FX5A 5FLIA 4KWLA 3VKNA 1LCLA 1OOPB 2DCKA 2ZGRA 4M3CA 4YFZA 3UV9A 1RMU2 2E7QA 2R061 4Q0SA 5BNPB 5HCAA 1RUE2 1V00A 4N9HA 1NXMA 2YC0A 4XYXA 1VRH2 4QQOA 5T54A 3P3PA 3ZYJB 3O0XA 1SBFA 2PA7A 2EF6A 5GALA 5LRSA 5DUWA 4Q1RA 2YGLA 1Q43A 4XDQA 1VBB3 4COUA 2OIIA 1FMD2 2ZX4A 3UJOA 1LGNA 2ZPXA 2SBAA 3AM2A 5KWRA 3VHRA 3N7JA 3VKMA 2WL1A 4N90A 4XIOA 3RYPA 4AVAA 5J3UA 5AC92 3ZXDA 2ZGTA 3UKNA 2C9AA 1NA1A 1GV9A 4BQ1A 1FT9A 5CFCA 1PZ7A 2A3YA 2VULA 1CONA 1RUF3 4FPYA 2JDZA 1GLHA 4RL7A 5CFDC 4LT5A 4D69A 3UKTA 1H0BA 4AGVA 1QXJA 5KXBA 4O9GA 2MNGA 2A75A 1PMIA 1S0FA 2B46X 4E2SA 2R073 2IXLA 4RGGA 1XYNA 3PLQA 1RUG1 1N1YA 4AFAA 3MZHA 1GICA 2MEV2 3SCHA 1QNYA 1PGL1 5GZCA 5BNOA 5LRRA 1EV11 4ZXKA 3OTFA 2OPKA 2RS13 1D0GA 4LE4A 5C4WA 3ZO0B 2PHUA 2V09A 4AEDA 1W6PB 4ASLA 2QDNA 4W6YA 5FO8B 3D8CA 4XETA 1R092 1HRV2 5C4WC 3QACA 4LR4A 4SBVA 1PK6B 3V0BA 1W6QA 4AEDC 2VECA 2O8OA 3LOIA 3SCGA 1XNKA 1DQ1A 2UYBA 5CFCC 3SISA 1HRI3 1LRHA 1SACA 3QBQA 4M3CF 3LKJA 4E4ZA 5IK5A 2X5IC 4XTPA 3LCPA 3R0RA 4AE2A 1SMVA 2MPFA 5J98B 4TSVA 2BBVA 4FPCA 1CAXB 3E6DA 4W6XA 1R1A1 4OI0A 2R0HA 4OHZA 4YZ2A 4B4PA 1IS3A 1REEA 2B8MA 1FV3A 4JGZA 2UWBA 2HYKA 3TNQA 3DL3A 4PQ9A 1LOBA 2XL7A 2D6KA 2PHXA 2PFWA 1LOAA 4YLZA 2VMIA 1KQRA 4YW2A 4XJUA 3CNAA 2DU0A 3W58A 2V73A 1NOVA 5GLZA 1VIWB 1G9AA 4K20A 4Q4Y1 4M3CE 1KJRA 2SLIA 5C9AA 2GMPA 1A3KA 3AK0A 4K8FA 2YZ4A 5K8SA 2ZHLA 3S6PA 4CP0A 1VB2A 4W6WA 3KM5A 4BCUA 1AR62 1VAMA 2XJRA 4Z2WA 3AXDA 4CEYC 4LO5B 4JTOA 2JECA 1CR7A 1LHWA 4DRRA 4RHV2 4CP1A 4PLNA 3LWCA 2XJQA 5L73A 1QXPA 3VKOA 2EIGA 4FOVA 1H2KA 2C1FA 1W0OA 2KXLA 4UW3A 2E51A 1DQ6A 5JPMB 2DURA 2D93A 3JQWA 3NWKA 1C5IA 2B9UA 3AKRA 5FLJA 5AFEA 4LO7A 1YFWA 2ZGSA 4BZ4A 1BMV1 1OKQA 1SQ4A 5CFCB 1X8EA 1PIV3 4GH4B 5FOJB 1HRI2 2WS91 2EXJA 2WZR2 4NO4A 3VLBB 4QPGA 1ENRA 3NVCA 4LBQA 3VBSB 1EAH1 3GZTB 1ND3A 4PLOA 3SMHA 5ACA1 3E6CC 2UY8A 1NQDA 1IPJA 4KG0A 3VBOB 1K5MA 3N7MA 1ULDA 2ZMKA 4HK9A 2ZZJA 1V6OA 3WHTA 2FZ1A 4Q0VA 4XIKA 2JG9A 2A5ZA 3ZVXA 4N43A 1CAVB 5KC5A 1ULFA 2W08A 2QZ2A 2WKKA 1F31A 2JG9C 3MLJA 5HCFA 5JSPA 2VQAA 2HJIA 3VBUC 4R9CA 1H9WA 3ZXKA 2NYYA 4E4DX 1KS4A 5CIRA 1RVF3 1JUIA 2XJPA 4LUMA 1BKZA 4HLTA 1VRH3 5EJ3A 3JB8A 3KCCA 4FPHA 3VBUA 2YGMA 1ZBE3 3MIFA 1N1TA 4AVTA 1DYPA 2WQ4A 2PHWA 3AMPA 1ZYBA 5FDBA 3OD4A 2QFEA 1J3PA 4AQTA 4YW5A 2XBO3 4IL7A 1DQ4A 1X8MA 4XQDA 4M0HA 4DINB 1NLSA 1M06G 3M8LA 2DVBA 2E9QA 3E6BA 2YPJA 1NCRA 1Z7S2 3M3IA 4MUVA 1ULGA 3MW3A 1O5UA 3AFKA 1ALYA 4MXWA 1PK6A 3I59B 2VUJA 3V64A 3CF6E 1N3QA 4HVRA 2BVBA 3JZVA 1AF9A 4ATEA 1PK6C 4MXWB 1FOD3 4HSLA 1RUNA 1J58A 4P9IA 3MLLA 4UW6A 1RUC3 1RUE1 4EN7B 5D8AB 1HW5A 1Q56A 3NV1A 3FLTA 5GLVA 1RUD1 3WOGA 1NCQC 1VJ2A 4N53B 2BTVC 4CDXA 1D4M2 1V70A 2CWMA 4G4FA 5GZFA 3O5SA 3VZNA 3NAPA 3ZFGB 5BYNA 2GU9A 1WCDJ 1BEV2 4FCAA 3KCXA 3VBUB 2R043 3U07A 1QOSA 3WW2A 4CDWA 4D7TA 1DG6A 1AL22 2WFF3 1HKDA 3ENRA 1WMFA 2DV9A 4RGAA 5SV5A 4Q4Y3 1S0CA 4LE3A 4QQLA 3TN93 1W6NA 3WDYA 4AEDB 5IK4A 3PJYA 1X50A 4YZ1A 1ZBA2 3R05A 1ZRFA 1N1VA 3MW2A 2XPJA 3ILRA 5JAXA 4Y22A 3N36A 2DF7A 2VVEA 2VVFA 4H3WA 4YARA 1POV1 4XBQA 3VBHC 1LOGA 4K40A 1BVVA 4LBMA 4RHV1 4LHNA 3KT1A 4H55A 5T55A 1ULEA 4RD7A 4ITCA 1S0DA 1COV3 1RUH3 1U0AA 3O0VA 5DG1A 5FMOL 5JSOA 1KITA 1B35B 1AYM2 4GH4A 1I5ZA 4XEZA 1RUD3 4PBPA 4ISQA 1REDA 5F6LB 3AYEA 5CB7A 4AEJA 1C8M3 4YFWA 1KS5A 1ZZBA 3WDXA 3VUOA 2N7GA 3BPZA 4XQ4A 1VAVA 4XFIA 3VDDB 3TB0A 1MQTB 2K9ZA 5C8CC 4C1WA 1DGWA 4CEWB 2D3SA 5GLTA 1EAH2 3EQEA 2DFBA 4OZXA 4AGRA 3ECQA 1FMD1 2FZ2A 1UKRA 3ZN5A 4YG6A 1OSGA 2C5DA 4BLIA 2ZABA 4KBBA 1JHNA 3NJZA 1R1ZA 3OYWB 3KLSA 2CAUA 4WVZA 1MQTA 1PM7A 2RJLA 2HEVF 3VBHA 2ET1A 4ZU4A 2DCYA 2IXHA 5F9TA 3OPZA 3BB6A 5JZGA 2JD4A 1XYPA 3AX4A 2O0OA 4MGZE 2QUOA 3RG0A 3BALA 3TN92 1I6XA 2B5HA 1ND2B 5BNOB 3O0WA 4MGYE 3J26N 2H0BA 3SNMA 4HN1A 1MVQA 4JC1A 3I7DA 1IGOA 1UU4A 4IV3C 3RMYA 1PGL2 1C28A 4IERA 2VOKA 4IEWA 4QQPA 4RSUA 5C9AC 1PNGA 5EV7A 1D2SA 5JDBA 3ME2A 4YZ5A 3B00A 4HPKB 1CAXA 2AR6A 3VN4A 1CAWA 4D3WA 4QGNA 1YI7A 2BW8A 4WVVA 1WLTA 3MLKA 1TNFA 4I09A 4W65A 4M0NA 2Z5WA 5C6CA 4NHKA 1VBA3 2A70A 4DQAA 5CVRA 3VHNA 3AP9A 5I93A 2WZR1 1PO23 5AVAA 1R082 2UWAA 5L7OA 2PLV2 4FO9A 2JICA 1TME2 1GZWA 2ZS6B 1RITA 2DFCA 1RUI3 2BNNA 2Q30A 4R9BA 4OHVA 3R4UA 1ZREA 5AFBA 3WW3A 4YVSB 1YI9A 2Q1MA 5FOBB 2D40A 1IS6A 3QH7A 5FTTC 4ORFA 3MYXA 4XMIA 1RUC1 1DGRN 4Y20B 2RJKA 2ZAAA 2MEV3 5H9RA 3ZSLA 1FOD1 4YGCA 1LB2A 4YVWA 5JCTA 1X82A 2XJVA 4AXOA 4Q27A 3VBOA 3BTAA 3WQ1A 1AUYA 4P9XA 4NR1A 3I2DA 1V6JA 1VBD3 2QVSB 4RQPC 1YJKA 4XZPA 4XXPA 3M3OA 4LLFA 4DOUA 1PO11 3VL8A 5K0UC 4QGLA 5J37A 2HWF3 2Z69A 3AFGA 4INDA 4CDQA 2GAUA 4CEWA 4FAHA 5JI9A 1ZBA1 1B35C 2CYFA 2RR12 1R091 3VDDA 1APNA 5A32B 5CADA 1QKQA 1OA2A 1S0JA 2AH2A 2ES3A 3CJXA 2G9GA 2VUAA 1DLLA 3NO8A 5CA6A 1VRH1 2UU8A 1AZDA 1XNDA 4GB32 3RZZA 4AQSA 4M00A 1MZ5A 4NPRA 4F83A 2ZX3A 1SBDA 4YVWC 3ROUA 5CAZA 1UX6A 5CNAA 1H8TC 3RSJA 4ISRA 4Y1VA 3SLIA 3VKLA 1NCRC 2PAKA 3ZSEA 3EXUA 2P2KA 2LTNA 1V9U3 1Z7S3 5I0UA 5BNQA 1SLTA 3WZ1A 4AI1A 2EXHA 3WP3A 3J9SA 5FBZA 2HWD2 1LR5A 2JE7A 2VXRA 1BEV3 1VBD1 2E7TA 3RI8A 2R042 4OHWA 3INAA 4HPKA 4U36A 2DCTA 1R081 2XWJB 1LGCA 4AVSA 3KMHA 3H3UA 4EWEA 2WC2A 1EPWA 4XHBA 2KA3A 4JRLA 1C5HA 2Q1ZB 4K1ZA 4JGYC 5BNPA 5FO7B 3CU7A 4DNYA 1NY72 5DXDA 3GHNA 2LUWA 3OBRA 1OA4A 4BIOA 3KSCA 2HWB2 4LHKA 4QMAA 4A7KA 3T1MA 3TNPB 4QPIA 1FAYA 4YW1A 2WINB 2CAVA 4J6GA 4BE3A 2OA2A 4RS5A 4BYYA 5J96B 3AMNA 2ERFA 1QJU3 3VHPA 3D4KA 2VW1A 3H1YA 4ES9A 3HD8B 4P9WA 3ZIWA 1W6PA 2P3IA 5AC91 2JENA 5DUXA 3ZN6B 4V1PA 3U10A 1WD4A 3AMQA 2OZ6A 2BGCA 4BMEA 3AP4A 3ZXGA 5KHJA 1ASJ1 4AQ6A 1PGSA 4N7IA 4AHXA 1RB8G 1ZNPA