4PJYA

Azide bound cysteine dioxygenase at ph 6.2
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
186
structure length
186
Chain Sequence
ELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cysteine dioxygenase type 1
publication title Structure-Based Insights into the Role of the Cys-Tyr Crosslink and Inhibitor Recognition by Mammalian Cysteine Dioxygenase.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 55
structure length 186
sequence length 186
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2014-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4pjyA00
5LRRA 1VR3A 3CLPA 4UBHA 3GYDA 4IEVA 1YLLA 2FQPA 2OYZA 4I3PA 2IXKA 1UW8A 5I0RA 4MGYE 3SCGA 1EY2A 3EHKA 5I93A 1J3PA 4L11A 2DCTA 2IXJA 2PAMA 1QXJA 5KHKA 3BPZA 4E2QA 1CAUB 3H1WA 4KU8A 4F7ZA 2PQQA 5FPXA 5I91A 3FFQA 2XGXA 2Q30A 4AVBA 3UKVA 1NXMA 2MPFA 1O5LA 1OFNA 5I8SA 5JCTA 3NKTA 4WBBA 1QWRA 4MH0E 2QNKA 2OPKA 3QOPA 4JV4A 3PVBB 4D7TA 3G7DA 4DINB 3R6SA 3GBFA 4XFCA 5CVRA 3BALA 1O3RA 1NZCA 2GC0A 4XFGA 5EFUA 4EV0A 1CAUA 1SFNA 4NVPA 4LA2A 1XRUA 2IXCA 3N4MA 2EAAA 4XEZA 5C6CA 2XKOA 5K8SA 1TQ5A 4XFIA 1I6XA 1V70A 4XF0A 1U12A 1J3QA 2FMYA 1FI2A 1Q3EA 3ES1A 1ZZ7A 3ZDSA 2K9ZA 4JTOA 4ORFA 4MV2A 3RYKA 2UY9A 5EZWA 3QACA 3HQXA 3H1YA 4I09A 4XFFA 4LLOA 2PA7A 3B02A 1GQGA 5KHIA 4Z82A 2B5HA 4XF3A 1RL3A 3VHRA 4BHPA 4EROA 2PYTA 4A2UA 1LR5A 4LA3A 4D7SA 5I0UA 3U10A 2H0VA 4HVRA 5I0TA 3CJXA 3OGJA 1WGPA 4HN0A 2O1QA 2K0GA 4QGLA 1O7FA 5KHHA 3ROUA 3LAGA 4Z07A 4FBFA 3M3IA 3S0MA 1UCXA 1LB2A 2UYBA 3OTFA 4IETA 3WW1A 4AQ6A 1H1MA 5FLIA 4Q0PA 5T3NA 3LA2A 5BXXA 3NW4A 4HN1A 1ZRDA 3KCCA 2OA2A 2ZCWA 3RYRA 1ZRFA 1J58A 1YWKA 1YFWA 4B29A 3NJZA 1O3TA 4YNIA 1ZZ9A 4UBGA 4IEZA 1H1IA 3D82A 1Q5OA 1FXZA 3H9AA 1YFYA 4O9GA 1WA4A 3FZ3A 4O9EA 3ES4A 2CAUA 5LEJA 2EVXA 4IEOA 3D0JA 3PLQA 3FX3A 4ZU7A 1SEFA 2UYAA 5JAXA 4X6RB 2BGCA 3EO6A 1X7NA 3I54A 3OF1A 5CU1A 5BPXA 5BUVA 4Q0SA 4Q29A 4YRDA 4HSLA 4I0BA 3CF6E 1YHFA 4YARA 2H6BA 3KGLA 1OMIA 3LA7A 1VP6A 3IBMA 4IEQA 1QXRA 3KGZA 5BV6A 4MX3A 4RD7A 4QX5A 1OI6A 1YUDA 3LZZA 1J59A 4AXOA 3SCFA 2GC1A 2B8MA 4HLTA 1QY4A 1I5ZA 4FAGA 3TNQA 2BNMA 4TLFA 5KBFA 2E9QA 4K8FA 1DZRA 4LTAA 2HKXA 4XFHA 2XLFA 1EP0A 3E6CC 3SMHA 4HVQA 3RYPA 2Q0AA 3H8UA 4PIYA 1DGRA 2CV6A 3EJKA 4AQ2A 3I7DA 4XF1A 1EPZA 2PHDA 1UD1A 1VJ2A 4MGIE 3UKTA 3WW4A 1CAXB 2D5HA 4JTNA 5KHJA 2XKPA 2QDRA 2Z69A 3LWCA 1YFUA 4YYOA 4META 3L2HA 5J3UA 5C8WA 2ET1A 3H3UA 4OFGA 3E6DA 1L3JA 1IPKA 3FHIB 1J3RA 5BY5A 4ZU5A 5JSPA 4LULA 4YSFA 2GH2A 3DN7A 3H1MA 3S7EA 4WVZA 3E5XA 1ZVFA 3CO2A 3RPQA 2MNGA 1O3QA 1RUOA 3SHRA 1YFXA 4IEUA 2PTMA 3S7IA 3SXWA 3FJSA 2CAVA 3HIFA 2PAEA 3HT1A 4R8HA 3CL1A 5CADA 2BNOA 2Y0OA 3RNSA 3HT2A 4HSJA 2VPVA 3ELNA 4PJYA 5FLHA 2IXLA 3JZVA 4IEWA 4QM9A 5FLJA 4IEPA 5E1RA 3ACLA 1CAXA 3IDCB 1J1LA 4QGMA 4XF9A 3TNPB 4R52A 2D93A 4PIZA 4EWAA 4IESA 4UXAA 5J48A 1ZNPA 3IWZA 1CAVB 3KMHA 3E6BA 2Z2SB 4MGZE 4I0AA 1ZZBA 4H7LA 5J7MA 4L2NA 4KL1A 3E5QA 1ZRRA 3E97A 2BYVE 4BIFA 3RDIA 4XFBA 2QJVA 2VQAA 4MGKE 1PMIA 1DZTA 2IXHA 5FPZA 4OLLA 1IPJA 1UIKA 1ZX5A 1X82A 4P9GA 3H50A 1PM7A 2GC2A 3BU7A 1NYWA 2QCSB 4N9HA 2KXLA 3FWEA 5E16A 3NL1A 4QM8A 4E2SA 5I0SA 4WZCA 1Q43A 4GULA 3DKWA 4QXKA 3BB6A 1CAVA 1X8EA 2D40A 4JVAA 3NSTA 2WFPA 2OZJA 3KSCA 5D1IA 2HJIA 3E5UA 2P17A 3IDBB 3H7YA 2H6CA 3MPBA 3WW2A 4KWLA 1XE8A 4J1XA 4MZUA 3O14A 3NVCA 1CX4A 2VECA 4EWEA 2XL9A 4I2OA 4PIXA 3I59B 3M70A 3SCHA 1GQHA 4IEYA 4BH9A 2B9UA 2EA7A 4IERA 2PFWA 4IEXA 3D0SA 4I01A 2UY8A 3OD0A 1LRHA 4QMAA 4EWDA 2O8QA 5JSRA 4HVOA 3IIAA 3LA3A 4KWJA 3C3VA 5KHGA 4J1WA 3DV8A 4MUVA 4X6QB 4AVAA 2PAKA 4N9IA 5LRSA 1O4TA 4Q0UA 1ZZ6A 1Y9QA 1JUHA 2IC1A 2IXIA 1CAWB 3FE5A 1ZZCA 4HZFA 2GU9A 4FAHA 1NE6A 4F8AA 4LEJA 2WC2A 4KWKA 1UIJA 4LUKA 5FDBA 1LKNA 5JSOA 1ZRCA 1RUNA 3I59A 4QGNA 1XE7A 4LUMA 3CEWA 3EQEA 1O5UA 4BYYA 3MDPA 2ZKLA 2BEOA 2GC3A 3PNAA 4ONUA 3DL3A 3RZZA 1ZREA 5I8YA 2XLGA 2Q4SA 2XLAA 2XL7A 5FCCA 2PHLA 2XHKA 3U0ZA 4HMZA 2MHFA 3ETQA 3OCPA 3U11A 2CGPA 2V09A 2ATFA 1SQ4A 1ZZ8A 1CGPA 4CYDA 4ZU4A 2I45A 5FQ0B 4XETA 1RC6A 4XF4A 5I8TA 5JR7B 4E2GA 2C0ZA 1CAWA 3MYXA 1G6NA 4Q0VA 4Q0QA 2OZ6A 3LOIA 2ET7A 3H7JA 2F4PA 4HBNA 1UPIA 2QVSB 3MZHA 3UKNA 1FT9A 1RTVA 1X8MA 2D5FA 5LEKA 1WLTA 1EYBA 2GAUA 4AVCA 1O3SA 2ETEA 5F1RA 4XFAA 1Y3TA 2N7GA 1RGSA 2GZWA 4KU7A 1OD5A 3EBRA 3USSA 3WW3A 5AVPA 2Q1ZB 4I02A 5HI0A 1NE4A 3BCWA 3H3ZA 1DGWA 2BNNA 4FT8A 3ST7A 5FQ0A 1HW5A
chains in the Genus database with same CATH superfamily
1NA1A 1VR3A 2VUDA 2YGMA 1FX5A 4UBHA 5A7QA 1QOTA 2R062 1RUG1 4M3CA 4Y22B 1ZA7A 5JIAA 2AACA 4A3ZA 1YLLA 4BJ0A 1H2KA 1Y9MA 5H9QA 1HRV3 1SLCA 2IXKA 4LO6B 3WNOA 3SC7X 1QJX3 5B2GB 5LZ6A 1W9WA 2GP3A 4WV8A 2GSYA 4P9LA 3EHKA 2OPWA 5I93A 2HWF1 4QPIC 4CCNA 4L11A 4H3WA 2XJUA 2DCTA 5ERLA 3ZYBA 4CU9A 3N7KA 3MUZ1 1G9CA 2PAMA 1QXJA 4XCBA 3WCRA 3OBRA 1S55A 2ZXQA 4M3CF 3AZZA 3V65A 2DUQA 2ZX4A 3H42B 4YVSB 5A7OA 1W0PA 3VDAA 3POFA 2IFRA 4FP3A 1YQ5A 5JOYA 5C9AC 2VCCA 1JU4A 3FHAA 3VV1A 1D0GA 4G3YC 1UF2C 1O5LA 3LCPA 3MW2A 4YG0A 3AYCA 4EZHA 5I8SA 1GWLA 2W1WA 1RJ8A 3OY8A 4F83A 5JCTA 2VZVA 3TOJA 1PVC3 3NKTA 3U4XA 4CUCA 1IQDC 3ACHA 2QNKA 4RR3C 3VN4A 1RHI3 3QOPA 2XDVA 2EIDA 4QPWA 2DTYA 5C3QA 3V64A 4YW7A 5FPAA 4DINB 2HWB3 5D8AA 3R6SA 3APBA 4ZXKA 3BALA 2WNEA 3CBNA 5EFUA 3J7NA 4EV0A 2DU1A 3ORJA 3ZX7A 1QIQA 4XDOA 4L9BA 1SFNA 2A5ZA 1NCRA 4LA2A 4FI9A 2ADDA 1XU1A 3FC0A 1MVQA 4GKYA 3ZFGA 5C6CA 2XKOA 1E5IA 4Q1PA 5K8SA 2RS53 4TSVA 1UX7A 1VIWB 4XFIA 3BTZA 1V70A 3UJQA 3OGSA 1AVBA 1J3QA 2JG9C 4XVHA 3AKQA 1ZZ7A 2WO1A 2K9ZA 4GWIA 2BZDA 4JTOA 4ORFA 2RM23 4YM3A 1AJOA 2C4XA 1ULEA 2XWJB 1NG0A 3K75B 3KF5A 3PMEA 1GQGA 4HOOA 4Z82A 3ASIA 1LCLA 5C71A 1Y9GA 3MLJA 3H3LA 5L73A 4KNCA 4RS5C 2Y64A 1VBC3 4JHZA 4XF3A 5BNOC 3IAPA 1GZ9A 5C3OA 2PYTA 1K3IA 4A2UA 4QX1A 1PK6C 2WNOA 3T1LA 2AYHA 3T4HB 4AI1A 5DXDA 1KFXL 3VKNA 5I0UA 3M2MA 3MFAA 4YW2A 4O65A 3NJYA 3U10A 4CRQA 4MO3M 1Z78A 3NV4A 4WM7C 3ZYIB 1W8FA 1XBFA 1GICA 1HRI3 3CHXA 3CJXA 1AR71 3MF6A 3R4DB 2GMEA 2XOMA 4N90A 3ROUA 2WFF1 2ZTNA 1U5XA 4RQPA 4XJWA 4LOTA 4C1XA 1FYUA 2V4VA 3SH4A 3HBZA 4P00B 1UCXA 1OQDA 1B35C 1OSGA 2RR11 4EN9B 4XQ4A 2D6PA 2A6XA 2UYBA 3VBUB 2JDZA 1W8OA 4AQ6A 1H1MA 4W50A 4Q0PA 1LODA 1R1ZA 4XE9A 1S2BA 1CIWA 1KS5A 1UQXA 5T3NA 3U4SA 2MEV2 2C26A 1H8VA 2ID4A 4BK4A 2ERFA 5A3WA 1AX2A 5CA6A 3NNMA 3VBSC 1C8M3 4Z8BA 1U5IA 2OA2A 4FTEA 2JB8A 5GZFA 5A1FA 3NJZA 1DDLA 3AMMA 3AZYA 4BQYA 5IK8A 3DXTA 1GANA 5EJ3A 3LFIA 1GU3A 4P02B 3VBRC 3D82A 1Q5OA 3WHTA 4XTPA 1FXZA 2NYYA 3H9AA 1YFYA 1MVEA 1W05A 2WDBA 2XJRA 3AMNA 4S2HA 1W2NA 5F6LB 1FOD2 3GNEA 4CU7A 3OPZA 5FZKA 1G9BA 4PLNA 4BM8A 4O9EA 1ZBE3 3ZN6A 2E6VA 3MI8A 4CUAA 3ES4A 2EVXA 3OPTA 4DS0A 3D0JA 1UXZA 5FO7B 2BGPA 3FX3A 3S5QA 4HONA 3WG1A 1MS5A 4QB1A 5JAXA 4X6RB 2YY1A 4GMP0 4H7MA 2W47A 1JYCA 3I3QA 1Q56A 1W2TA 3I3BA 5FUNA 4ASKA 2X5IC 1TME1 4I0BA 3CF6E 3ZYHA 2JDMA 4HKLA 1UZWA 4N7IA 2EAKA 3KGLA 3MW4A 3UK9A 1AR81 1VP6A 2P6HA 3LA7A 1ENSA 1QXRA 4IEQA 4CVUA 5FK7A 4PT6A 4FQ4A 1XSRA 4RD7A 1OLRA 4V2WA 5FXVA 4QX5A 1QHDA 5IHRA 2RS13 1OI6A 2VOTA 1L7QA 1UU4A 3ALQA 3LZZA 1E5SA 4JHTA 4PI2A 1PIV1 4NJ4A 4QXBA 3SKVA 2I2SA 2JIGA 4TWTA 5E89A 1RMU1 2XONA 1LTEA 3C7OA 1NCQB 3TNQA 5J98B 2WYFA 5IVCA 1W6MB 3LEGA 3W21A 4BISA 3F2ZA 3PU8A 3AP9A 1ZBA2 1Q8SA 1EP0A 3E6CC 3ZOIA 2VOXA 4OCTA 3NNGA 5A33B 5JZGB 4JQTA 1H1AA 3A22A 2Q0AA 4N43A 4FOWA 4NIHA 4Q4Y3 4CE8A 4NHMA 2VNOA 4FXKB 2CV6A 3ENRA 3JBG1 2NZ9A 3SEEA 3OOXA 4QQHA 3GBGA 5DDJ2 5FYUA 1KGYA 4FOVA 2JWPA 5CFDC 1KFUL 2G9ZA 3B9IA 2QQJA 2R061 2WZR3 2ADEA 2Z69A 3NJVA 1V9U3 5L9RA 3VBOB 1KXGA 3DYPA 4META 4MOAA 4Q4V3 5FJKA 5BNNA 1H8TA 4OFGA 3E6DA 1IPKA 2XVGA 3AFGA 3FHIB 1C8NA 1US3A 3ACGA 5EHDA 2DUPA 5DG1A 3X29B 3D5OA 1R1A1 1VAKA 2P2KA 3IPVA 3VL9A 4BK5A 4DO0A 3SHRA 2NN8A 5C5UA 1COV1 4XW3A 3S7IA 1RUF2 1WMXA 2ZKNA 4E27A 3FJSA 1WCUA 2CAVA 1H9PA 2PAEA 5FZOA 4S2FA 1FNYA 3VHPA 4CUBA 4DRRA 2WNVA 1J1TA 1OURA 4AW7A 2A73B 2BNOA 2Y0OA 3RNSA 2VPVA 1EV12 1W8HA 2CGOA 1O59A 1XNBA 2HEVF 2AZ5A 4QXCA 3WNNA 1S0DA 4QXHA 1XOYA 3ACIA 4IEWA 1YJKA 4UW6A 1RUI2 3NAPC 5T52A 5F39A 5DUWA 2ORZA 1F4AA 3ACLA 4QGMA 2WYSA 4D6QA 4E4HA 2JD9A 5A6ZA 4AQTA 3T08A 4YW1A 4FFGA 2XPJA 1JOBA 5FPLA 1HB1A 1ZNPA 4JDMA 4CCDA 1YYNA 3UESA 2Z2SB 4WZFA 3OYWB 4Q26A 5F32A 4Z1VA 4H7LA 2FDGA 2YBSA 1XJAA 4LJHA 1D4M2 3LDKA 5A3OA 4DXSA 2UURA 1VBB2 1DQ4A 1TEIA 2WJSA 4KL1A 1MS1A 1YNAA 1GWMA 3K3NA 3MBWA 2VCBA 3T2QA 5C4WB 3MLKA 2LUWA 3ZYRA 4HPKA 1YRZA 3ZFFB 4DB5A 2YG0A 3WCSA 1UYPA 4AVTA 4OLLA 2NP0A 3PDQA 5C9AA 3H50A 3BIEA 1PM7A 1SCSA 2GC2A 3ME2A 2LROA 4I30A 1HRV2 2P4EA 1QJX2 5HCBA 4J25A 4YW6A 1IKPA 2YC4A 5TSWA 3WSOA 1HX6A 1SACA 4A6SA 4N9HA 2KXLA 5E6HA 4XUQA 5FKBA 4OHZA 1RIRA 1VBD2 4RR3A 5I0SA 2BU9A 1UMIA 1F31A 3T2PA 1VBE2 1HV0A 1KDMA 2GMMA 2YYOA 3ATGA 1OLMA 3VBUA 1QNWA 3ZXDA 1TZOA 1CAVA 5SV8A 1X8EA 4CDUC 2CY6A 4XJAA 2YV8A 1XNAA 4Q4X3 1VB2A 2G9GA 4OVEA 3HD8B 3NSTA 2RHPA 2OZJA 1BKZA 1I1EA 5D1IA 1EUUA 5F8PA 5FYYA 2ZEWA 1ASJ2 1UL9A 2BW8A 1R093 2P17A 3WLUA 3W5NA 1LHVA 5A7SA 2R0FA 3VZKA 1RVF3 4E9KA 4E8CA 5JXIA 2H6CA 1LAJA 1VRBA 1XE8A 4GMP1 4J1XA 4MZUA 4AOCA 4CEWB 3O14A 4CDQB 2EF6A 3VZJA 4JGYC 1HJFA 3UGGA 3GZEA 4CUGA 5FY9A 2PLV2 4K40A 2JG9A 4DQAA 4Q27A 3CMGA 4YZ5A 4Q1RA 5J36A 4XUTA 3AM2A 1S2KA 1LULA 3AKSA 2VGDA 2W1UA 2HBTA 2XL9A 2BQPA 2ZGMA 4PIXA 5FXZA 3GZAA 2V5DA 2VOKA 5FUPA 3DF0A 4CCMA 1OUSA 4NRPA 3U14A 3AK0A 4BH9A 5FBZA 2B9UA 3NWKA 4X8PA 4OZXA 4NIIA 4IERA 1YCIA 2RDNA 1XNKA 3A21A 2PFWA 4OHXA 5LY1A 4I01A 1EAH3 1AHSA 2KR2A 1PO21 4NN0A 2DVDA 3AJZA 1PVXA 4Y20A 5FIXA 1XYOA 3K46A 5CKMA 4QMAA 3AL5A 1PK6A 5EJ1B 5IK7A 1O4ZA 3QH7A 5C8CB 2W92A 3IIAA 5KHGA 4YVWC 2VZTA 3SLIA 3ZYFA 1UMZA 2WS93 4BB3A 5ISLA 3DV8A 2ZGPA 4FO9A 1OQ1A 1MPXA 5JIUA 4MUVA 4WM7A 4GB33 4X6QB 2G9FA 4NRMA 3VD5A 1OOPB 5IAVA 1WBFA 3IIIA 2Z42A 4N9IA 4Q0UA 3NJXA 3OEAA 2IXIA 1CAWB 3MHZA 2BOIA 1ZZCA 2JB4A 2QQWA 5FZAA 1CPNA 2X53S 3BODA 4LIVA 3VZNA 4XXPA 2ORXA 4UAPA 2WC2A 4KWKA 1UIJA 2GALA 5JSOA 1LKNA 3GJAA 1U0AA 1RUNA 4LT5A 4QGNA 1B35A 1W8TA 4IDZA 1E5RA 3POSA 2YROA 5JZGA 4A6OA 2HWE3 5FWEA 2QDNA 3N35A 3P6BA 3C7GA 4AR2A 2ZKLA 5CB7A 4BMBA 1DQ0A 2GC3A 3PNAA 4DXZA 2WQZC 3RZZA 5ACA2 1OBNA 4HKOA 1YXWA 2WKKA 2J1TA 3VBSA 3I49A 2XLGA 1HRI2 2XL7A 5D21A 2PHLA 1BCXA 3HN3A 2ZEZA 4L99A 1JZ5A 2MHFA 2JE7A 3ETQA 2V09A 1RUH1 1SDDB 4CPBD 2HEWF 2QQUA 4RN5A 2WNUC 3T0DA 1VRH1 3KV6A 4ZU4A 3VBRA 3DPRB 5F7UA 1LHUA 4JX0A 1KJLA 5I8TA 4I3GA 3KCXA 5JR7B 3KHBA 2Q5TA 3AYAA 4N53C 5L7OB 3B93A 1LGCA 1GQPA 4M3CB 3O1OA 1MR5A 3O0XA 3IZOA 4AVVA 5FZ6A 1ZBA1 2ET7A 1OUXA 4EZ4A 3TEXA 3AZWA 5FK8A 1G8WA 3ZO0B 1N47A 1UPIA 2QVSB 1LOFC 3B01A 3MZHA 5A6YA 3O1VA 2FCUA 5GZGA 1WLTA 5FYVA 1EYBA 3SH3A 2GAUA 1O3SA 1V6OA 3NV2A 4IGOA 4M01A 4XFAA 1W9SA 4KU7A 3ZXEA 3T2TA 2X5IA 1OD5A 2AUYA 5CFCC 4QX0A 3A0KA 2ARXA 3USSA 1MQTC 1XNTA 1SLIA 4OI2A 3WP5A 1AXKA 3CZUA 1OQEA 4BIOA 2Q1ZB 1A8MA 1DF0A 1SPPA 5HI0A 5FZ4A 3MICA 3ZM8A 4P5YA 1W8UA 1GOGA 2VMIA 2JG8C 3AYEA 3BCWA 5H9RA 3RWNA 1GFF2 3IMMA 2E31A 1DGWA 1NUKA 2X29A 4FT8A 2C24A 5LA2A 1AL23 2BWCA 3N9LA 4Y1XA 2P37A 3HNYM 2AEZA 3USUA 1TMF3 4YM2A 2ZGTA 1OMIA 4B7EA 3BN6A 3OY8B 4AFCA 2FCVA 1E5HA 2X05A 4IEVA 1SLLA 3MIFA 3VB9A 1ULFA 2FQPA 3N7MA 4KI5M 2Q1MA 2OYZA 3WF4A 4BLJA 1MS9A 3I2DA 1KEXA 4CU8A 5I0RA 3KCYA 1W90A 5D8AB 4C1WA 2QQLA 3ILRA 3PVOA 5GZCA 2JDPA 4TTGA 2ENRA 2PHWA 2DURA 1LECA 4QX3A 5C4WA 4PDWA 5A6XA 2UWBA 3GCXA 5DMYA 3RFRA 2JDYA 2PHUA 2TUNA 5HCAA 2IXJA 1S0IA 2JEMA 1NLSA 5KHKA 3BPZA 4LNVA 4JGZB 1EV11 5IUQA 2W3JA 4KU8A 4G4FA 1NCRB 1W3VA 3HQRA 1OKQA 5FMOL 3GZTB 3FFQA 5CFDA 5LB6A 3WUDA 1MS8A 1RUI1 2Q30A 3I2GA 3ZFGB 1BYHA 1UYYA 3UKVA 1OLQA 2VNRA 1REFA 1WMEA 1UU6A 2DYCA 2J1RA 2Y6JA 2ZABA 4L8QA 1CZTA 3QCWA 4QKFA 3H8OA 3VKLA 1VMJA 2VW2A 4CXYA 3WT3A 3EB7A 2NM1A 2QTWB 2WFF2 3AP5A 2D3RA 2CWSA 1PO13 4WBBA 1PGL2 1D4M1 1JOPA 3GF6A 1AR63 1VBB1 1YC61 1N1YA 2RR12 4YW5A 4BE3A 2BV4A 3J26N 3JD72 1VBA2 3G7DA 1V6MA 2RDSA 3BVCA 1OA3A 2B4KA 5J96B 2RJKA 3FMGA 3NMBA 4OZOA 1CX1A 1WUVA 3DGTA 3T1MA 3Q8AA 2GDFA 2R49A 3HAGA 3VD7A 1OT5A 4FCAA 2W1QA 1HRV1 1C4RA 2EAAA 5BNPA 1QJX1 4XEZA 5KXEA 3N4MA 1DQ2A 3NAPA 4AGVA 4K7JA 2C9KA 1I6XA 5T5OA 1HQWA 1RITA 1YQ8A 5FZMA 3KT4A 2Y33A 1DYKA 2YZ4A 4E8DA 4RQPB 4FPHA 1SLAA 1W06A 1YIFA 4FFIA 5KC6A 1YQCA 3QACA 1VB4A 3HQXA 4MHRA 1UU5A 2JDKA 1W99A 2PA7A 4OQ9A 2VXRA 3JU9A 1ASJ1 1X9PA 4QQPA 3GDBA 3LQCA 5A3MA 3RZMA 1RL3A 1H2LA 1W2OA 3FFZA 3VHRA 2BVBA 1TME2 4IE5A 4NR1A 1V00A 4V1PA 4FTBA 1LR5A 3W58A 5GZDA 3D3AA 3M1HA 2HWC3 3BYWA 3CNAA 3IDAA 3D8CA 1F15A 3H8XA 1AR82 1PVC1 2VMCA 3UGFA 1UNBA 2DCZA 3C7FA 3V56A 3CZJA 4JQRA 3O1RA 1RHI1 4Y1YA 5FYHA 4K9SA 4IGPA 1WLDA 4QPGC 2HWB1 3RI8A 1AYN2 3TN92 4NHYA 4XACA 4BZ4A 1NY72 1IPSA 3N36A 3ZN6B 1RMU2 2VC9A 5IYYA 4QGLA 3RS6A 1DYPA 4YGCA 5KHHA 4Z07A 3M3IA 2Y8KA 4CDXC 3WP4A 4CDUA 3MGUA 3OSDA 2QZ3A 3ZDVA 4ASMB 1OHFA 2XJQA 2WWUA 1VMFA 2ZMLA 3PIGA 4XUOA 2VMEA 1R082 2TEPA 2WSVA 2VUJA 1GNZA 1NLRA 4FQZA 5KXCA 3OTFA 1OH4A 3GHMA 4DUXA 1HXS2 1CD3G 1US2A 3K4ZA 2VMFA 1JU3A 4WVVA 3KCCA 3N9MA 1IG3A 2ZCWA 2RM21 2PHRA 1REEA 1V6LA 2FD8A 3URFA 4JGYA 3DPRA 3ZXKA 4B29A 4Y5Z0 2UU8A 2DVAA 1ZZ9A 5HBAA 1IG0A 5L7OA 4IEZA 5F5IA 3LD8A 1JUIA 4LO5B 1BBT3 5DN2A 2BWAA 3KQ4B 1V6KA 1PGSA 4OI0A 2IVIB 4ZHNA 2VZRA 4GXLA 1ULOA 3FZ3A 1RUC3 4GH4C 2WZ8A 5LEJA 3O1MA 3NV3A 3BGAA 1H2NA 2BJSA 2WZPP 2YFUA 3NRUA 3QBQA 4C0HA 1R1A2 5ACA1 5LBEA 4N43B 4AAPA 1JW6A 1COV2 1HRI1 1V6NA 2WBKA 3AYDA 1SFPA 4WVMA 3OF1A 5CU1A 2VCMA 3HVDA 4KWUA 4WM8C 5BPXA 4Q29A 3WNKA 4HSLA 2C1FA 1DGWX 1GNHA 2WQ4A 1IS3A 2B9VA 3BOWA 4RHV3 1ZYBA 4GIQA 1GV9A 4NWWA 1IS5A 3J4UH 3RJ2X 2WIIB 1RUJ3 2R6QA 4AEKA 2RMU2 2TBVA 2VW1A 2BOJA 2V72A 4UOJA 1YUDA 1J59A 4OUEA 4D3WA 4AXOA 2R043 2XVLA 2XG3A 1SBDA 4LOSA 5BNNB 1H8TB 3CJIC 4AFDA 2AC1A 3KV4A 5DUVA 2A70A 5SV5A 1FV3A 1BEV2 1PZ9A 1EUTA 5IVJA 2C9AA 3ILNA 1TE1B 2VO5A 2XJPA 1PZ8A 2RE9A 4DZGA 3EMRA 5EWSA 4ARXA 1JZ3A 1A6CA 4XMAA 3IPVB 2WS92 5DABA 5FYZA 1SDWA 1GZCA 1RINA 1VAVA 4GZ9A 3SMHA 2WA3A 3ZKUA 3N3HA 1S2EA 5FP8A 3RYPA 4JGZA 4QD2A 1N3OA 1TNRA 5FZOB 4AEJA 3TEZA 1FPN2 4FPFA 2WNVB 1POQA 3THPA 2W9XA 4IQPA 1SLBA 4E4DX 5F37A 4RFT0 5A3PA 1W6PA 2XBO3 1ZBE1 1ENQA 4Q4W3 1JYXA 2VW0A 1EPZA 2VULA 2Y6KA 3MPPG 1UD1A 2GN3A 3HMYA 1ND3C 5FZEA 1D4VB 3J9SA 3WNLA 3UKTA 3FUOA 1GP5A 5JI7A 3I2IA 2Y0IA 2HWD3 3WW4A 4N53A 5JDBA 2D5HA 2XKPA 2QDRA 2D98A 3RG0A 2YBPA 3GCWA 4QB2A 3LWCA 1VAMA 2CGNA 2VM9A 2P1BA 4M3CE 4ZZ5A 2A3XA 2CYFA 5C8WA 4CCJA 1L3JA 5IVBA 1CZSA 1SLTA 5T5LA 3ZR5A 1WCKA 4O7XA 1XYNA 2CSGA 3IB3A 4MXWB 4YSFA 3B00A 3H1MA 3S7EA 3AKTA 2XVKA 4Y4YA 4MYEA 1S1AA 3HNMA 4CP9A 4I0WB 1YI7A 1X9TA 2F6BA 3E5XA 3H0OA 3Q8BA 3BU0A 3NNLA 1RUOA 5L9BA 1YFXA 1MQTA 1GR3A 2B45X 2HBUA 2JECA 2PTMA 4HPKB 4IEUA 5A70A 2E53A 1DHKB 4NPMA 3M8LA 1H4GA 2V73A 3LIGA 4TYSA 5DAPA 3RSJA 5LATA 2FDFA 4ITCA 4HSJA 5C9AB 1JH5A 2VZ1A 3ELNA 1ULPA 2GH8A 3I2HA 1ODNA 2CTVA 2VMDA 4MADA 4R9DA 1DLCA 1LEDA 3D6EA 1PNGA 2P3IA 5FY8A 3F95A 3WG2A 1AR92 2LW8A 4UT5A 3VBFC 2CHHA 1G9FA 1OD3A 5A7PA 3I2JA 5E1RA 5F5CA 1OH3A 5F2WA 1J1LA 1JZ6A 3TNPB 3BUCA 1PGL1 1MEC3 1KS4A 1O4YA 2HWF3 4RR3B 4BQ3A 2D93A 4XJUA 4CEYC 1QGLA 4EWAA 2X8KA 3JD71 1MACA 1VBA1 2W68A 1CAVB 2OQ6A 3E6BA 4S2GA 3UV9A 2J1VA 3FLTA 2QE3A 3VKMA 1PO22 2ZGUA 4K1YA 4L2NA 4AEMA 5ANQA 2WAAA 3GHNA 2XUEA 3TAYA 3WF1A 4XHXA 1V9U1 2SLIA 4FPGA 2BYVE 2ZACA 4Q4V1 2WLPA 4XFBA 1KQRA 2BFUL 4Y5SA 2FBEA 2SBAA 1NLQA 2RV9A 2IXHA 3WP3A 1W8WA 1IPJA 5C3RA 5JVVA 3AB0A 5FZBA 3UJOA 1Z7S2 1X82A 2JG9B 1XNCA 2WO3A 3DCQA 4P9GA 4XHBA 5A1AA 3V0BA 5BYNA 1D7PM 3VGIA 5F3EA 4LO8A 1Q8VA 3Q8FA 1YIPA 4QKDA 5CKQA 3VBHC 1ODMA 3I97A 2YGLA 2RS32 2UWAA 3PUQA 4E2SA 1DQ6A 1WCDJ 2D7FA 4U36A 3ZFEC 2F17A 4CDWC 2W94A 4EN0A 3DKWA 3ZSLA 1T6GC 4QXKA 3JCIA 4BU2A 5FRAA 5BNOB 4M0HA 1WW4A 3IAQA 2RJLA 3A0NA 2G4IA 4Y20B 2W52A 5FY7A 4JVAA 1PK6B 1GKBA 2A3YA 2BBAA 4B4PA 2WFPA 2W5FA 5DAWA 5CAZA 2Y34A 5T55A 3E5UA 1JS9A 1OKOA 4WM7B 4JC1A 1RUH2 3WP6A 2ZA9A 3WW2A 2Q8CA 3U37A 5JMCA 4AZZA 2W0XA 2J1AA 1UY3A 1VRH2 3N9QA 1AYN1 3LDBA 4LBMA 3TN91 5AC92 4AK3A 1NY71 3NVCA 3OD4A 1CX4A 3WQ0A 1N1TA 4PF5A 1RUD2 1HN1A 1ACCA 4KG0A 1JMUB 4NMIA 3OB8A 4QDSA 3MW3A 3AKRA 5FZ0A 1XB9A 1ULCA 3OPWA 2XHNA 1NKGA 1B35B 1R081 2I74A 3SCHA 5B4XA 5FZIA 4IEYA 4AI2A 5JOXA 1IZ3A 2EA7A 5FFOC 1QDCA 1YJLA 2PN5A 5K0UC 4QX7A 2BDRA 1S0JA 4FP2A 1HXS1 4XIKA 3HEIA 4NIAA 3VKOA 1QJY2 1VMHA 3D0SA 2UY8A 5FR3A 3VBSB 4LITA 4MVTA 4P14A 3U78A 1R64A 4EWDA 4V2VA 2O8OA 4CCOA 4Q8LA 3LA3A 4W65A 1W8ZA 1QQP2 4K3UA 4D69A 1AR73 3WDWA 2AREA 2VZSA 3VBRB 4OHVA 2ZHNA 4M4RA 2A6YA 4GJYA 4K8RB 4QPGA 3T30A 5JXJA 5LRSA 4H55A 4B4RA 1NQDA 1T2XA 3FE5A 4FFHA 5IVEA 2VAUA 5E8AA 5FZDA 4KG8A 2GU9A 2Q8DA 1RUE2 2VE1A 5LASA 4IV3A 4CDXA 5KXBA 1BVP1 3OGGA 4LUKA 2OIIA 1ZRCA 4TZDA 1DBNA 3I59A 4QQOA 1XE7A 4ZPIA 1F4HA 4H14A 4UYBA 5F5AA 2FDHA 1O5UA 4BQXA 1A8DA 2X5IB 3LSEA 1K5JA 3KLSA 4A3XA 2W87A 1ZREA 3DL3A 3U07A 1SPPB 2XJTA 2WQ8A 5IVYA 1AYM3 3U75A 3HOBA 4OUSA 3PTYA 3WF3A 1BHGA 5FCCA 2RMU1 3MIEA 3MUY1 4NIGA 3SEPA 3OCPA 1W0NA 5HPOA 1CQ9A 2ATFA 5FWJA 4Y4RA 4OYUA 2BGOA 3ABZA 3PMSA 4CYDA 1CGPA 2B46X 4IV1C 3USUB 1YEWA 2VH9A 4G9SB 1BEV1 1VPHA 2GMPA 4XZPA 1HB4A 3HBKA 1F9KA 4Q0VA 1W03A 2J7MA 2YPDA 4GH4A 5A7WA 1RB8G 4MXWA 4QPIA 5IFPA 2WS91 4CDQC 1WW6A 4Y5TA 4HBNA 1UY1A 4GB31 5FZLA 2JDAA 1FT9A 2D5FA 1FPN1 4PDWB 1H4HA 5EYXA 5K4LA 4CU6A 5HXVA 2ETEA 3O1UA 4EE2A 5F1RA 1OC1A 2N7GA 1RGSA 3M3EA 4WM8A 3RJRA 3EBRA 1JYWA 2VZ3A 2GNBA 3K77A 3Q9OA 4COUA 3WW3A 3KT7A 4DMIA 3CDZB 4DFSA 4I02A 5CFDB 2JDHA 4NUBA 4ZXEA 4BWOA 2WN2A 3ZN5A 3RZGA 1I9RA 4XDPA 4QX2A 4RYDA 5C3SA 2L9LA 1AL0G 2DCYA 2BNNA 1UOBA 2HWE1 4YW3A 1N1VA 1UYZA 4LO7A 5JOWA 5HXMA 5FQ0A 1QF3A 3PUHA 4D0QA 2PELA 2P34A 3PUSA 4E4ZA 2WABA 2A6VA 1W6QA 5LRRA 2XB6C 4W6YA 3VLBB 1WMFA 1JHJA 2EICA 4UFHA 4AAXA 3GYDA 4A7YA 3ILFA 4A4AA 5C5TA 1C1LA 3KVBA 1U5YA 3LPFA 5IVVA 1UW8A 4YZ4A 1VALA 3WR0A 2QKDA 4MGYE 4W6WA 1A34A 4CP0A 1EY2A 5F5QA 5JMOA 1J83A 2JJ6A 1J3PA 3O0WA 1GNYA 3AVSA 3UNPA 1BJQA 1POV0 3AFKA 4LQRA 4YWAA 3AXEA 4E2QA 3W9AA 4IE4A 1HIXA 4AI8A 1GSLA 4FPJA 4LBQD 5APAA 2R063 5CISA 1QU0A 1PVC2 4HG6B 4F7ZA 1ND3A 1G86A 2PQQA 5A6QA 2R7EB 4O61A 3T4VA 5ABJC 5BNPB 4D8MA 1V6IA 1AR91 2PHTA 4XIOA 3NAPB 1RHI2 2QBXA 2R1BA 3I3DA 1UY0A 1AF9A 4D7YA 2HWB2 1AX0A 1LEMA 3Q8EA 3LEMA 4FPYA 1NXMA 3T09A 2QQPA 1OFNA 4D6SA 2ILMA 3KZ4C 2VXJA 1DIWA 3TB0A 3THTA 4RS5A 4XBNA 1WD4A 5FP9A 4EYUA 1YQ6A 4Y24A 2Q8OA 5BNOA 1QWRA 1OPMA 4FVVA 1K5MC 2W39A 5T5JA 1YO8A 5F9TA 1ZA4A 4JV4A 4C91A 1XU2A 1NA1C 5JLVA 3PVBB 4D7TA 3AMQA 2RS52 2CU5A 4UF0A 4AFMA 3GBFA 1AL21 1BZWA 4XJZA 3T0BA 4XFCA 5CVRA 1HB3A 1TMF1 3K51A 4QKNA 4CXWA 1NZCA 2GC0A 3PUIA 1W9YA 2FHRA 5T54A 4AQSA 4FPKA 2JKXA 2RM22 1CAUA 1Z7S1 4YM1A 5F2SA 4B3NA 4NROA 4NVPA 1XRUA 2FMDA 1FMD3 5IVFA 3VBFA 1B09A 4PF1A 4QHOA 1DP0A 1TQ5A 1WD3A 5LA1A 1SBFA 1IS4A 1VBC2 1PMJX 2RS31 4XF0A 1DCSA 2X10A 4YG3A 2FMYA 1FI2A 1Q3EA 3ES1A 3JQXA 4CEYA 4DNYA 5JUVA 3B7MA 2ZGOA 1ULDA 1AJKA 4CDUB 4PHZA 3VL8A 4JKLA 3RYKA 4QT6A 1GZTA 3LB9A 3POGA 2UY9A 1OLME 4J6GA 3WD5A 5FZ3A 5GLVA 1GBGA 4GWNA 4I09A 3ZVXA 4LLOA 3WX5A 4DXRA 1ND2C 1HJGA 3B02A 3R4SA 2IZWA 5L36A 2B5HA 4JAAA 4Z2WA 5FO8B 5LK7B 3LIHA 4D6RA 2WZEA 4IXLA 4AI3A 1MZEA 5H9PA 4YFWA 1OA2A 4TLGA 4TN7A 4JGYB 4JRLA 5AC91 5JXHA 5K7PA 3C7EA 4D7SA 1H2MA 1FAYA 1RUD1 2WRAA 1AR61 1G9DA 3P1IA 2H0VA 4HVRA 3ZLIA 3M3QA 1H9WA 2DDUA 2A6ZA 2LTNA 3Q8CA 4ZKTB 5CBLA 4FFFA 3NKGA 3S30A 2DCJA 1C57A 4PCRA 1WGPA 1NOVA 3VBHA 4AEDC 4BLIA 2Z4FA 1CPMA 3MEPA 3UGHA 2O1QA 1CWPA 1O7FA 1C8M2 2OVUA 3OUJA 2WT1A 4GD4A 4UWDA 3ZFEA 1QJU3 4FBFA 2ZZQA 3WG3A 3S0MA 4HK8A 4XUPA 3I2KA 1UZZA 1QJY1 1IHMA 1RXGA 1UXXX 2ZGRA 1V6JA 4RSUA 2J1UA 5FBJA 4COWA 3GALA 1X36A 5FMDA 4N8MA 4WVMB 2UWCA 5FY1A 4YVWB 1QQP1 2F4LA 4GMP3 4KH9A 3UT0A 4ES9A 1W3XA 2JICA 3QD6A 4LHKA 4ISRA 3SISA 4K6BA 5BXXA 1ZBE2 2WWSA 3J8F3 2YXSA 3NW4A 5FZ7A 3VDDC 1ZRDA 3KQRA 1WLCA 5EXOA 5T5PA 4QWNA 3W20A 1ZRFA 5FZ1A 5JXGA 3POJA 2XH6A 5EYYA 1GP6A 5FZFA 1RUE1 2VTFA 4PLOA 2E7AA 3RZJA 1H1IA 3RZHA 4YGBA 3V0AB 2JXAA 2D97A 4O9GA 2MEV3 3NQHA 1SG3A 3VZLA 1UAIA 2DUOA 4Y33A 5FP3A 5JR2A 4NHLA 2CAUA 3MIGA 2HWC1 4RFRB 4AHXA 5DAXA 4XJ9A 5K0UA 4IEOA 4CXXA 3THDA 2JDNA 1LU1A 1SEFA 4LK6A 2FZ1A 3ZXJA 4ZZ8A 2RS12 3NO8A 2BGCA 2WL1A 3EO6A 3IMNA 4HETA 2GNDA 2JE9A 3MIDA 2ZOEB 3CIHA 1W6PB 3L9JT 1FOD3 2QQKA 1QKQA 4Q0SA 4YRDA 4YFZA 2WNUB 4PQ9A 5DZEA 2WT0A 1JZ4A 4QDRA 3IBMA 1IOAA 4HFSA 1WZXA 3J7HA 4MX3A 4F3JA 1L7LA 1POV1 2VJXA 4N53B 2DV9A 4XCAA 4LKEA 4HT1T 4NE9A 4XAEA 1UY2A 4LHLA 5KXDA 4Q4Y2 1RJ7A 3KV9A 3SCFA 4NAMA 3BKZA 2B39A 1DQ1A 1PNFA 2GC1A 5H9SA 5B4NA 5FOJB 1UOJA 2B8MA 1PZ7A 3SH5A 1QY4A 4XAAA 2BBVA 1IS6A 1LGBA 4RGKA 2BNMA 5KBFA 5JWPA 5LK5A 2QUOA 3HNBM 4IGQA 1DZRA 1N3PA 5FREA 5FYCA 4CP9B 2D3PA 4XFHA 2XLFA 5CFCB 1DFQA 4OMDA 3OEBA 3C8XA 1MQTB 1XQNA 5FUIA 2YDEA 4HVQA 3P3NA 2CDOA 2WZR2 3ZN4A 4URTA 1D0HA 3JXSA 3LEIA 1V9U2 4R4XA 2OW4A 4PIYA 2A3WA 2VZQA 2W46A 1A3KA 4HANA 1DGRA 2QFEA 4Q4V2 2VTXJ 4AQ2A 2Y26A 3I7DA 4DY5A 4XF1A 4XJ8A 3KD4A 2ZGSA 1CVNA 2PHDA 2ZBJA 3ZXLA 1LGNA 1UOFA 4IV1A 2VVEA 5DAVA 5DUUA 4MGIE 3WQ7A 2ARBA 4DPNA 2DVGA 3WUCA 5FMBA 4JTNA 1W6OA 3AZXA 3KHCA 1W8NA 2ZAHA 2HYXA 3ZPYA 2DF7A 1MZFA 3L2HA 2DVBA 5J3UA 2ET1A 4CCKA 2WAOA 4RL7A 1YQ2A 5DDJ3 3CQOA 2VVDA 4XOGA 4LULA 2HEYF 2AENA 3WEZA 2GH2A 3DN7A 3O12A 3AMPA 3ZYJB 3BPSA 1GYKA 2VD7A 1RUJ1 4P9WA 4XPVA 4WVZA 5FTTC 4YW4A 3CO2A 5IK5A 3N9OA 1O3QA 1EPWA 1OF4A 3SXWA 2R041 1W2UA 2GN7A 5LBFA 3HT1A 5L9VA 2YB7A 4CPBA 4R8HA 2OXBA 3AP6A 3BTXA 1F2NA 1LESA 1Q8PA 3HT2A 2VOVA 1SBEA 3N7JA 4K20A 3NNJA 1ZRIA 2VZPA 4P9IA 1JYNA 4Q8KA 3V0BB 4LBJA 2V5YA 5FLHA 2IXLA 3LFMA 4YZ3A 5FY4A 2XJSA 4YVSC 4AI9A 1AUYA 4MLOA 4GALA 4AHZA 4QB6A 1BK0A 4IEPA 1GZWB 1CAXA 3HQUA 4DEVA 1RUF3 4XF9A 5FY5A 1UYXA 4R52A 3POBA 3UL2A 1O6UA 2KA3A 2YC0A 4PIZA 5J48A 4Q4W1 1GUIA 3IWZA 2RS51 3KMHA 4MGZE 4XQWA 4EJRA 1SMVA 2IVJA 5HCHA 5J7MA 3ZKYA 5BNNC 2R073 4P9JA 1WCSA 1HLCA 4GKXA 3E5QA 2BPA2 1MZ5A 5FOBB 2XJVA 1HQLA 1ZRRA 4NIDA 4BIFA 4AFBA 3DUIA 5ABJA 4NPLA 2XR4A 3AX4A 5FXWA 3PU3A 2HLEA 2WN3A 4URAA 4MGKE 1JZ8A 3K3OA 2VY0A 1JI6A 3AXDA 1DZTA 5FPZA 2GP5A 5GZEA 2ZEYA 1UIKA 1VBC1 2YU2A 1BMV2 1ZX5A 4R9AA 4Q4X2 1D4M3 2WNVC 2VG9A 2ZX2A 1PX3A 1VBB3 3BU7A 5CYYA 1CR7A 4NOTA 1NYWA 3AVRA 1LHWA 4NPRA 2EIGA 5FMOS 1DU3D 1RXFA 4BXSV 1DZQA 4FPLA 1OPOA 1R092 3GXUA 3INAA 4L97A 5E16A 3NL1A 1RVF2 1K5MA 4M0NA 1DG6A 4BMEA 1Q43A 4GULA 5F3IA 5GKAC 3TYJA 4JCKA 3BB6A 5CG8A 3RZKA 4YVWA 4BPZA 2WLQA 1DGLA 2CNAA 4SBVA 1H0BA 1MS0A 3KSCA 2G19A 4COZA 4COYA 2Y6LA 1Z0HA 4XUNA 1DYOA 1MEC1 3HN1A 5C7GA 2HJIA 3N9PA 5F3CA 1C5HA 3WZ1A 1VBD3 3H7YA 3ZXAC 2D6MA 2R16A 3MPBA 4QPGB 4LPLA 4KWLA 1VBE3 5EIYB 1LOGA 2E33A 3PTRB 4KGGA 2K46A 3DYOA 4LHSA 4BQ1A 2DBIA 5FY0A 3R05A 3V0AA 3O7OA 1EAH2 4P9XA 1C8M1 2K2SA 1UKRA 3RRDA 2FDJA 3J7MA 4IV3B 4CDXB 1QNYA 5D2AA 3MLLA 1WKYA 4AGGA 1ENRA 2ZX0A 4EWEA 2CWMA 1ASJ3 3FLRA 3I59B 3M70A 3M7AA 1GQHA 2V4AA 4GB32 5DZGA 2CDPA 1ND2A 1LU2A 1NXD1 2WUHA 4JKKA 3RWKX 3KF3A 3QLQA 2A71A 4QHBA 3O1TA 4DOUA 2FCTA 4DUVA 2EALA 1DQ5A 2PLV3 2ZGNA 3OBAA 1Y43B 3WQBA 5J09A 4FOYA 1LRHA 1K45A 1FMD2 2XQRA 1I3HA 4XC9A 3DKQA 2WNUA 5JSRA 2LRPA 3ZMNA 1CESA 2R32A 4HL0A 4HVOA 4OMCA 3M3CA 1E57A 4KWJA 1SZBA 3NNFA 4J1WA 3VBUC 4EN8B 4ES8A 5AVAA 5CZKA 1U5ZA 1S0CA 2EIEA 3KV5A 1W9FA 2VR4A 2QQOA 5C33A 1QOSA 2HWE2 4AVAA 2PAKA 5M0TA 1JZ7A 3R0RA 2IWGB 1O4TA 1ZZ6A 3WV6A 3C2UA 1PGW2 3S6PA 1JUHA 1CN1A 2IC1A 4QU2A 3ZSKA 4AEDA 3TEYA 1LOFA 3FBMA 4GH4B 5A7WB 2EIBA 3NV1A 3UETA 4QPIB 1NE6A 1HB2A 2LALA 3RGBA 2D3SA 3QH6A 4F8AA 4M00A 4C8DA 2A7AA 5FDBA 1O91A 2BVVA 1UN1A 2E26A 3ACFA 5CFCA 2RS11 2RDRA 1C5IA 1SHWB 5IAXA 2AH2A 4FPOB 4ET7A 3K2OA 1TNFA 4XQDA 1QH6A 1GP4A 2W08A 3AKPA 4BYYA 2DTWA 3A4UA 3ZXGA 4WM8B 3VZMA 2JG8A 3WDTA 1LOCA 1NT0A 2B42B 4ONUA 4EQVA 5CEHA 3O1SA 1XC6A 3VDDA 5I8YA 5DZFA 5A7NA 1M06G 1RUG3 1OVSA 1UX6A 1G9AA 2WR9A 1NQJA 2KM2A 4COVA 1Q8QA 2EXHA 2XHKA 4NHXA 3WDYA 3U11A 2CGPA 4W6XA 4Q5OA 4IW3A 1SQ4A 1O8PA 3POYA 1ZZ8A 4Q4Y1 4GA9A 1QJU2 2I45A 3CJIB 5FQ0B 4XF4A 5IW0A 2BTVC 2P5BA 4E2GA 1W6QB 4ISQA 4LKDA 4C90A 1G6NA 5ACA3 4JKMA 3VD9A 1BXHA 4FTSA 1XYPA 2OZ6A 3LOIA 2XMLA 3H7JA 3PL0A 3ZSJA 5I0DA 2QQVA 3ZIWA 1UWWA 3ECQA 3IM0A 3LDRA 4OQ8A 2WZR1 1K12A 3J8F2 3UKNA 1NCQC 1RTVA 1X8MA 5E88A 4XXAA 5LEKA 2DWRA 3W5MA 1I5PA 4P5HA 1AL22 3VHNA 3LPGA 2P3KA 1Y3TA 3D4KA 1XSQA 1TMF2 1MS3A 1ULGA 1A78A 2WO7A 3THCA 4XTMA 5JZGC 1ND3B 3RVHA 5LBBA 1WBLA 3B69A 2JE8A 2GNTA 2NMOA 4A41A 1NE4A 5FZCA 1W6NB 2ZEXA 3H3ZA 2ZHLA 3I2OA 5GJ6A 2VQTA 1GZWA 1WCQA 2E32A 3I3EA 4IL7A 2HH9A 2YFZA 4DUWA 4XABA 1QJZA 1HW5A 1ZM1A 3WDXA 5FPVA 2EXIA 1URXA 4RS5B 1Q8OA 3CLPA 1LOEA 4LE4A 3TWIA 1AYM1 1SCRA 2QQMA 1C28A 4I3PA 2ZMKA 3VBOC 3LKJA 1C1FA 5IFTA 3B5LB 5A80A 3SCGA 4UF0B 2JKBA 2EXKA 2YU1A 3A7QA 4FSJA 5HV4A 2XQXA 2ZGLA 4YZ1A 3N7LA 4M4PA 3ZSEA 2R0HA 3O1PA 3S5AA 2PQSA 4NRQA 4XMIA 1CAUB 5JI9A 1F35A 3H1WA 1PO12 4MXVA 4UI9L 4BQ5A 5FPXA 2AR6A 5I91A 1AR62 2XGXA 3VBFB 4QKBA 4AVBA 2TNFA 4XURA 4X8NA 4CTEA 3ZXFA 5LY2A 1CZVA 5EQUA 4LBOA 1KJRA 3RZLA 4R9CA 1GWKA 4AVSA 4CEYB 2ZHMA 2OX0A 2MPFA 3E1F1 4QHZA 3HWJA 3OGRA 2D43A 2D6NA 2DU0A 2W2IA 5DQ0A 4AG4A 1FV2A 3R4UA 4QAWA 4MH0E 1SFYA 2DFBA 3KT1A 4Y22A 2OPKA 1H30A 3MV01 4CP1A 4XBLA 1APNA 4PBOA 4UFJA 4YGEA 1W0OA 5FV3A 3FBYA 1OXCA 1AX1A 3BOPA 5HV0A 1F8VA 3GJBA 1WMDA 1JZ2A 3VZOA 3I4IA 4AI0A 4QU1A 3WY6A 1O3RA 5LW9A 2QQIA 4XFGA 1ONAA 1ST8A 2WFF3 1BMV1 3POWA 5C4WC 4PDWC 2IFWA 3AZVA 4Q4X1 2KD7A 1VE0A 2J1EA 5GM0A 3PUAA 1WW7A 2IXCA 2RR13 4YVSA 3ZFFC 5F6KA 1X33A 4AWDA 3U1XA 4INDA 3JD73 4GWJA 1VBA3 1JYIA 3WINE 2HYKA 3VBHB 1HV1A 3LOBA 1R091 3ZYPA 4UFLA 2RDQA 2YUEA 1RVF1 1U12A 3FN9A 5LWBA 3ZFEB 2WT2A 4CDWB 4OI1A 3ZDSA 3POIA 1OVPA 2YMZA 3SQOA 4BXFA 5EPAA 1D2SA 1TG7A 1QDOA 2HWC2 4XDQA 3OGVA 4MV2A 5T50A 4U2AA 5DPNA 1BQPA 5EZWA 4Z2AA 3PURA 2W91A 1OA4A 4JDNA 1T6BX 3H1YA 3K48A 4XFFA 3TBDA 4Z92B 2YC2A 5KHIA 2VMGA 4PQQA 3JQWA 2PHFA 3DYMA 3ON7A 5GLTA 1HDKA 3J7LA 3MF9A 2VBBA 4BHPA 4EROA 3WG4A 3UYJA 1W9TA 1W39A 2VQ0A 5A3LA 3VDCA 1LENA 4MG2A 3AMHA 4FXGB 1IKQA 4KBZA 4LA3A 1NX9A 2EXJA 1EAH1 1LHNA 5A3UA 5J1XA 1MS4A 4OHYA 2ARCA 4W4ZA 2G1MA 4BQWA 1FATA 5I0TA 3IDEA 4D94A 2E63A 5AFEA 4CEWC 2BFUS 3OGJA 5EJZB 3SNMA 3WNXA 5JPMB 4LK7A 3ZPOA 4HN0A 5FXXA 4LR4A 1TME3 2K0GA 2R072 5BNPC 1JYTA 1AZDA 1LNSA 5K0UB 3LAGA 3AJYA 2OT7A 3IT8A 1AR83 5C70A 3GM8A 4ZS3A 4ATEA 5FYBA 2ZX3A 2OUJA 1FMD1 4ARYA 1LB2A 4IETA 4CP2A 1PIV3 3WW1A 5FLIA 1BBT2 1AYN3 3TN93 3BI3A 3LA2A 4DIQA 1BVVA 4LBQB 1RMU3 2LS6A 4HN1A 4XILA 1RUC2 2JENA 5FKCA 3I3MA 3RYRA 5C8CC 4B1LA 1J58A 1CIYA 1PGW1 3CJIA 1YWKA 1YFWA 3M3OA 1UO9A 2ZGKA 1O3TA 1UZVA 1TVGA 2VVFA 1R083 4YNIA 3FLPA 5GLZA 1JN2P 4UBGA 2RJ2A 3CKHA 2DCKA 2CL2A 4H2AA 1OOPC 3EYPA 1HXS3 2A1XA 4YPJA 2C6SA 3JBG3 1LOBA 1WA4A 5G05L 1H6YA 1W28A 2XXZA 3T3YA 4MGSA 4RHV2 2VU9A 2R1DA 4A45A 2DBNA 5FYIA 5IJRA 2A6WA 1WWYA 4FPCA 3PLQA 1RUJ2 2C5DA 4ATFA 4B1MA 1GMMA 4ZU7A 4LE3A 1N3QA 2YHJA 4QQ2A 2UYAA 2ZPXA 1VLNA 3ZIXA 1X7NA 3WOGA 2R042 3I54A 1JBCA 2ZAAA 1XNDA 1IQAA 1QJEA 5IK4A 1YI9A 5BUVA 3LF7A 4Y1UA 1W6NA 1YHFA 1XE0A 3I8TA 4AE2A 1QJU1 4A7ZA 4IE6A 4IV1B 2H6BA 4YARA 4KBBA 2WINB 1ENXA 3KGZA 3VKFC 5BV6A 2P3JA 4LBNA 1AXZA 1R1A3 4QX8A 5GALA 1W6OB 4YGDA 3L2YA 1COV3 4KQ7A 4LHNA 1UOGA 2D44A 3BTAA 2J22A 5FP4A 3DPRC 5FYSA 4LORA 2J1SA 2WO2A 4HLTA 2JX9A 2OS2A 1I5ZA 2XBO2 2D6LX 2VQUA 3J8F1 4Q4W2 4UW5A 3OG2A 4TLFA 3WQ1A 2E9QA 4FAGA 5L7OC 4K8FA 4JRAA 4BA6A 4C0BA 2PMWB 4L0PA 3FL7A 4LTAA 2HKXA 3B9CA 4XZUG 3MV11 2JD4A 3BIWE 2RMU3 5JOZA 4AL9A 2GNMA 2HWD2 4DY3A 5L19A 3WF2A 3VDBA 2AEYA 1F5JA 3BTYA 2Q1FA 1GLHA 4LMFA 1BLZA 2J42A 2O14A 3H8UA 5GLUA 2MEV1 3RI9A 2E51A 3EJKA 1BEV3 5EV7A 4Y26A 3WNMA 2VUCA 1JYVA 4AFAA 2Y60A 2BP6A 1VJ2A 5FO9B 1L7RA 3K4AA 4CCCA 2NLRA 1KRIA 1CAXB 1LHOA 3WDVA 3VD4A 3AC0A 3PJYA 5KHJA 1QEXA 3LEKA 1FPN3 1HKDA 3C7HA 4AGRA 1Y7BA 1YFUA 2Y6GA 4YYOA 2NPIA 4IE7A 4KMQA 5FZ8A 1FOD1 2RVAA 3H3UA 4DEQA 2Q8EA 4XYXA 5KWRA 3O5SA 1J3RA 1Y4WA 5BY5A 5C3PA 4ZU5A 5IT6A 5JSPA 1NCQA 3FUQA 4Y1ZA 1RUG2 1QH7A 1GOFA 2JDUA 1W6MA 3ZSMA 2R30A 3HJRA 1ZVFA 1KDKA 2AGSA 2MNGA 3RPQA 1LOAA 1UY4A 5D8AC 2YBKA 3GBWA 1PO11 5A33A 2FZ2A 4TXWA 5ABJB 1MEC2 3HIFA 2HWF2 5EP9A 4SLIA 4W8JA 4B4QA 2YPJA 2OKXA 4XBQA 3WDUA 4I2OA 3CL1A 5CADA 5FJHA 2ZS6B 4PJYA 4EN6B 4JGZC 2ES3A 1UZYA 4YZ2A 1NCRC 2WSUA 1REDA 2XWBB 3CU7A 4LBKA 3JZVA 3KVAA 4QM9A 2WA4A 5A32B 1W04A 1S0BA 2BERA 5FLJA 4CDWA 3ZFGC 2PXJA 4ZONA 3IDCB 3LSDA 5AFBA 5FYMA 4OHWA 5FZHA 5FPUA 4JDOA 1K5MB 4A42A 3ETPA 4LKFA 1F5FA 3VBOA 4BDVB 1NA1B 4IESA 4HK9A 1HQNA 4UXAA 3RMYA 3WXPA 4MSVA 2E7TA 3SKJE 4I0AA 1ZZBA 2DVFA 4P08A 4B7KA 1QJFA 5LBCA 1HN0A 3KB5A 2Y38A 4RA0A 1AR93 3WVJA 2OUHA 4NWVA 3PIJA 4RGAA 1JOJA 1WA6X 4CCEA 3E97A 3RDIA 4AHWA 2QJVA 4OULA 2VQAA 5F3GA 5DDJ1 4UW4A 1PMIA 2ZJCA 3ZMOA 4BOWA 2VUAA 3M4FA 3GZUC 3B3QE 4CCLA 3T2OA 1PHMA 3ZYGA 1CJPA 1PO23 3PVEA 4AHYA 4Y3OA 3P3PA 5FAXA 5CIRA 3VD3A 5DAQA 1XPWA 4FPEA 1BK1A 2QCSB 3AL6A 3FWEA 3VHOA 1DGRN 1PM4A 1FNZA 1OF3A 1ND2B 1XXNA 4QPYA 2ZGQA 4IE0A 3HPNA 3PJQA 4QM8A 4R4ZA 4DRVA 4WZCA 3ZR6A 4RQPC 1PX4A 2ZX1A 1S0EA 3PHMA 3TRSB 3OYWA 1Z7S3 2D40A 1S0GA 1WW5A 4ASLA 4K1ZA 4PLMA 4LBQA 1NZIA 1STMA 2D6OX 3G6JB 4N7UA 1UMHA 2ARAA 1JODA 5DG2A 1RUF1 4PBPA 2OQ7A 1P8JA 2Y6FA 4CA9A 2NQYA 2RS33 3IDBB 5G04L 5ANNA 1WLWA 4ZS2A 2B7YA 3ZFFA 1NAEA 2ZHKA 2VMHA 2NMNA 3ITQA 3N9NA 4Y1VA 1KD7A 1S0FA 2P6CA 4AEDB 4HXCA 4NHKA 2BUKA 4NAOA 3W59A 3HR9A 2R071 5CG9A 4K21A 3O0VA 2VNGA 4LO4B 3KM5A 2VECA 5HCFA 4A7KA 5IATA 2FDIA 4R9BA 5J37A 1AR72 4OI4A 3KS7A 3EXUA 4LIUA 1D2QA 4UFKA 1RUH3 2QZ2A 3OJBA 2X09A 3JB4C 2D6KA 1PMHX 1V0AA 2VTXA 5KR7A 1JXNA 1BBT1 1VRH3 2VZOA 1X50A 2RG4A 4BCUA 5AC93 2WWJA 2JG8B 5GLWA 4IEXA 4JZRA 1RUD3 3LGRA 2W1SA 3OD0A 3VDDB 4P9YA 1RUC1 1S4CA 1KITA 1RYYA 2JIJA 1CONA 2O8QA 3OBTA 5A3TA 3C3VA 2IUWA 3MIBA 4YLZA 5FP7A 1ZBA3 3JUUA 4GWMA 3DECA 3RQ0A 3A23A 1LJ7A 3K4DA 4YM0A 1GOHA 4UFIA 4A44A 4GQ7A 4LXLA 1JHNA 5IWFA 3IKWA 1JTZX 2XUMA 3P5BA 4CDQA 1Y9QA 1QJY3 3OBZA 3JB8A 4AYUA 4CEWA 2E7QA 4HZFA 2VNVA 1O8SA 4RHV1 5A1LA 3B94A 4WVWA 4QDQA 4FAHA 1G7YA 1AYM2 1UKGA 4YG6A 2VBDA 4LEJA 1QQP3 4UFMA 3IN9A 5CKNA 2ZMNA 4S2DA 1VBD1 2FDKA 1ALYA 5CNAA 1VBE1 4LUMA 3CEWA 3EQEA 2P3YA 3WNPA 3MDPA 2O0OA 4LKSA 4AF9A 2BEOA 4HKWA 3LE0A 1CJDA 5FZGA 1W2AX 4UW3A 4B8EA 3OUIA 1MZ6A 2VCAA 4N43C 1RUE3 4LBLA 3TEWA 2Q4SA 3KWVA 2XLAA 4L92A 4PI0A 1QOOA 5C8CA 5JPNB 4MGQA 4NO4A 3T0AA 3AP7A 2Z5WA 5LCWL 5A3NA 3U0ZA 2LM3A 1UPSA 4HMZA 4BQ2A 5DUXA 4CZSA 4E4SA 4BQ4A 2I07B 4DXTA 4FOQA 4QQLA 3WHUA 5K9YA 4RGGA 2ZZJA 2Y6HA 2VOWA 1OOPA 4XETA 1RC6A 1QXPA 5FPBA 4OUMA 5KC5A 1IGOA 2PLV1 2XBO1 2C0ZA 3RMXA 1CAWA 3MYXA 1EV13 1M4WA 3DXUA 4Q0QA 1QMJA 1PIV2 3GGLA 4EN7B 3S57A 1K42A 5FZ9A 2F4PA 1H8TC 1DLLA 1UZ0A 2BRTA 1RUI3 2H0BA 5LA0A 2HWD1 3H8RA 3OUHA 3WF0A 2VL4A 3I2FA 4IV3C 3SITA 4AVCA 3MFCA 3FHQA 5LA9A 5BNQA 1J84A 2GZWA 2Z79A 2A75A 1POV3 4MGTA 1H6XA 2PHXA 2VZUA 3VUOA 1N1SA 5AVPA 2DFCA 4KGQA 4IUGA 5FMCA 2W95A 2QQNA 4ZY9A 3DEMA 4Q2FA 4CSWA 1C3HA 4GAZA 4GJZA 3JBG2 3MO4A 5A32A 4LLFA 5FYTA 3POEA 3AP4A 1AXYA 4MHUA 3MIHA 2VBPA 3ST7A 1OFSA 3PVNA
chains in the Genus database with same CATH topology
1NA1A 1VR3A 2YGMA 1FX5A 4UBHA 1QOTA 2R062 1RUG1 4M3CA 4Y22B 5JIAA 1YLLA 1H2KA 5H9QA 1HRV3 1SLCA 2IXKA 4LO6B 5B2GB 1QJX3 4WV8A 2GSYA 4P9LA 3EHKA 5I93A 2HWF1 4QPIC 4L11A 4H3WA 2XJUA 2DCTA 1G9CA 4FTSA 3N7KA 2PAMA 1QXJA 3WCRA 3OBRA 1S55A 4M3CF 3AZZA 3V65A 2DUQA 2ZX4A 4YVSB 1W0PA 2IFRA 4FP3A 5JOYA 5C9AC 3VV1A 1D0GA 4G3YC 1UF2C 1O5LA 3LCPA 3MW2A 4YG0A 3AYCA 5I8SA 1RJ8A 3OY8A 4F83A 5JCTA 3TOJA 1PVC3 3NKTA 3U4XA 2QNKA 4RR3C 3VN4A 1RHI3 3QOPA 2DTYA 3V64A 4DINB 2HWB3 5D8AA 3R6SA 3APBA 4ZXKA 3BALA 2WNEA 5EFUA 4EV0A 2DU1A 3ZX7A 4L9BA 1SFNA 2A5ZA 1NCRA 4LA2A 1XU1A 3FC0A 1MVQA 4GKYA 3ZFGA 5C6CA 2XKOA 4Q1PA 5K8SA 2RS53 4TSVA 1VIWB 4XFIA 1V70A 3UJQA 1AVBA 1J3QA 2JG9C 3AKQA 1ZZ7A 2K9ZA 4JTOA 4ORFA 2RM23 4YM3A 1AJOA 1ULEA 2XWJB 1NG0A 3PMEA 1GQGA 4Z82A 3ASIA 1LCLA 3MLJA 5L73A 4KNCA 4RS5C 1VBC3 4XF3A 5BNOC 1GZ9A 2PYTA 4A2UA 1PK6C 3T1LA 2AYHA 4AI1A 5DXDA 1KFXL 3VKNA 5I0UA 3M2MA 3MFAA 4YW2A 3U10A 4CRQA 1Z78A 3NV4A 4WM7C 3ZYIB 1GICA 1HRI3 3CJXA 1AR71 3MF6A 3R4DB 2GMEA 4N90A 3ROUA 2WFF1 2ZTNA 1U5XA 4RQPA 4XJWA 4C1XA 1FYUA 3SH4A 3HBZA 1UCXA 1OQDA 1B35C 1OSGA 2RR11 4EN9B 4XQ4A 2D6PA 2A6XA 2UYBA 3VBUB 2JDZA 4AQ6A 1H1MA 4Q0PA 1LODA 1R1ZA 4XE9A 1S2BA 1CIWA 1KS5A 5T3NA 2MEV2 1H8VA 2ERFA 5CA6A 1AX2A 4Z8BA 3VBSC 1C8M3 1U5IA 2OA2A 4FTEA 5GZFA 3NJZA 1DDLA 3AMMA 3AZYA 5IK8A 1GANA 5EJ3A 3VBRC 3D82A 1Q5OA 3WHTA 4XTPA 1FXZA 2NYYA 3H9AA 1YFYA 1MVEA 2XJRA 4S2HA 5F6LB 3AMNA 3VL9A 1G9BA 1FOD2 3GNEA 3OPZA 4PLNA 4BM8A 4O9EA 1ZBE3 3ZN6A 2E6VA 3MI8A 3ES4A 2EVXA 4DS0A 3D0JA 5FO7B 3FX3A 3WG1A 1MS5A 5JAXA 4X6RB 2YY1A 4GMP0 4H7MA 1JYCA 1Q56A 2X5IC 1TME1 4I0BA 3CF6E 4HKLA 4N7IA 2EAKA 3KGLA 3MW4A 3UK9A 1AR81 1VP6A 3LA7A 4IEQA 1ENSA 1QXRA 4RD7A 4FQ4A 1OLRA 4QX5A 1QHDA 2RS13 1OI6A 3ALQA 1UU4A 3LZZA 1PIV1 2I2SA 4TWTA 5E89A 1RMU1 1LTEA 1NCQB 3TNQA 5J98B 1W6MB 3AP9A 1ZBA2 1Q8SA 1EP0A 3E6CC 2VOXA 5A33B 5JZGB 1H1AA 2Q0AA 4N43A 4FOWA 4Q4Y3 4NHMA 2VNOA 4FXKB 2CV6A 3ENRA 3JBG1 2NZ9A 4QQHA 3GBGA 5DDJ2 4FOVA 5CFDC 1KFUL 3B9IA 2R061 2WZR3 2Z69A 1V9U3 3VBOB 1KXGA 4META 4Q4V3 5BNNA 1H8TA 4OFGA 3E6DA 1IPKA 2XVGA 3AFGA 3FHIB 1C8NA 2DUPA 5DG1A 3X29B 3D5OA 1R1A1 1VAKA 2P2KA 3IPVA 3SHRA 2NN8A 1COV1 4XW3A 3S7IA 1RUF2 2ZKNA 4E27A 3FJSA 2CAVA 1H9PA 2PAEA 3VHPA 4S2FA 1FNYA 4DRRA 2WNVA 1J1TA 4AW7A 2A73B 2BNOA 2Y0OA 3RNSA 2VPVA 1EV12 2CGOA 1XNBA 2HEVF 2AZ5A 1S0DA 4IEWA 1YJKA 4UW6A 1RUI2 3NAPC 5T52A 5DUWA 3ACLA 4QGMA 4AQTA 4YW1A 2XPJA 1ZNPA 4JDMA 1YYNA 2Z2SB 4WZFA 3OYWB 4Q26A 4Z1VA 4H7LA 1D4M2 2UURA 1VBB2 1DQ4A 1TEIA 2WJSA 4KL1A 1MS1A 1YNAA 5C4WB 3MLKA 2LUWA 3ZYRA 4HPKA 1YRZA 3ZFFB 4DB5A 3WCSA 4AVTA 4OLLA 2NP0A 5C9AA 3H50A 1PM7A 1SCSA 2GC2A 3ME2A 4I30A 1HRV2 1QJX2 5HCBA 1IKPA 5TSWA 1HX6A 1SACA 4N9HA 2KXLA 4OHZA 1RIRA 1VBD2 4RR3A 5I0SA 1F31A 1VBE2 1HV0A 1KDMA 2GMMA 2YYOA 3ATGA 3VBUA 3ZXDA 1QNWA 4CDUC 1CAVA 5SV8A 1X8EA 2CY6A 4XJAA 2YV8A 4Q4X3 1VB2A 2G9GA 4OVEA 3HD8B 3NSTA 2RHPA 2OZJA 1BKZA 1I1EA 5D1IA 1ASJ2 1UL9A 2BW8A 1R093 2P17A 3WLUA 1LHVA 2R0FA 3VZKA 1RVF3 4E9KA 2H6CA 1XE8A 4GMP1 4J1XA 4MZUA 4CEWB 3O14A 4CDQB 2EF6A 3VZJA 4JGYC 2PLV2 4K40A 2JG9A 4DQAA 4Q27A 4YZ5A 4Q1RA 5J36A 3AM2A 1S2KA 1LULA 3AKSA 2VGDA 2ZGMA 2XL9A 2BQPA 4I2OA 4PIXA 3GZAA 2VOKA 3DF0A 3AK0A 4BH9A 5FBZA 2B9UA 3NWKA 4X8PA 4OZXA 4IERA 1YCIA 1XNKA 2PFWA 4OHXA 4I01A 1EAH3 1AHSA 1PO21 4NN0A 2DVDA 3AJZA 1PVXA 4Y20A 1XYOA 4QMAA 1PK6A 5IK7A 1O4ZA 3QH7A 5C8CB 3IIAA 5KHGA 4YVWC 3SLIA 1UMZA 2WS93 3DV8A 2ZGPA 4FO9A 1OQ1A 5JIUA 4MUVA 4WM7A 4GB33 4X6QB 2G9FA 1OOPB 1WBFA 4N9IA 2Z42A 4Q0UA 2IXIA 1CAWB 1ZZCA 1CPNA 2X53S 3BODA 3VZNA 4XXPA 2WC2A 4KWKA 1UIJA 2GALA 5JSOA 1LKNA 1U0AA 1RUNA 4LT5A 4QGNA 1B35A 3POSA 2YROA 5JZGA 2HWE3 2QDNA 3N35A 2ZKLA 5CB7A 4BMBA 1DQ0A 2GC3A 3PNAA 4DXZA 2WQZC 3RZZA 5ACA2 4HKOA 1YXWA 2WKKA 3VBSA 2XLGA 1HRI2 2XL7A 2PHLA 1BCXA 4L99A 2MHFA 2JE7A 3ETQA 2V09A 1RUH1 2HEWF 2WNUC 1VRH1 4ZU4A 3VBRA 3DPRB 1LHUA 1KJLA 5I8TA 4I3GA 3KCXA 5JR7B 2Q5TA 3AYAA 4N53C 5L7OB 3B93A 1LGCA 4M3CB 1MR5A 3O0XA 4AVVA 1ZBA1 2ET7A 3AZWA 1G8WA 3ZO0B 1N47A 1UPIA 2QVSB 1LOFC 3B01A 3MZHA 5GZGA 1WLTA 3SH3A 1EYBA 2GAUA 1O3SA 1V6OA 3NV2A 4M01A 4XFAA 4KU7A 3ZXEA 3T2TA 2X5IA 1OD5A 2AUYA 5CFCC 3A0KA 2ARXA 3USSA 1MQTC 1SLIA 4OI2A 3WP5A 1AXKA 1OQEA 4BIOA 2Q1ZB 1A8MA 1DF0A 5HI0A 3MICA 2VMIA 2JG8C 3AYEA 3BCWA 5H9RA 3RWNA 1GFF2 1DGWA 2X29A 4FT8A 1AL23 2BWCA 4Y1XA 2P37A 3USUA 1TMF3 4YM2A 2ZGTA 1OMIA 4B7EA 3OY8B 4AFCA 4IEVA 1SLLA 3MIFA 1ULFA 2FQPA 3N7MA 2OYZA 2Q1MA 4BLJA 1MS9A 3I2DA 5I0RA 3KCYA 5D8AB 4C1WA 3ILRA 3PVOA 5GZCA 2ENRA 2PHWA 2DURA 1LECA 5C4WA 4PDWA 2UWBA 2PHUA 2TUNA 5HCAA 2IXJA 1S0IA 2JEMA 1NLSA 5KHKA 3BPZA 4LNVA 4JGZB 1EV11 5IUQA 4KU8A 4G4FA 1NCRB 1OKQA 5FMOL 3GZTB 3FFQA 5CFDA 3WUDA 1MS8A 1RUI1 2Q30A 3ZFGB 1BYHA 3UKVA 1OLQA 2VNRA 1REFA 1WMEA 1UU6A 2DYCA 2ZABA 4L8QA 3QCWA 3VKLA 2VW2A 3WT3A 2NM1A 2WFF2 3AP5A 2D3RA 2CWSA 1PO13 4WBBA 1PGL2 1D4M1 3GF6A 1AR63 1VBB1 2RR12 1N1YA 4YW5A 4BE3A 3J26N 3JD72 1VBA2 3G7DA 1V6MA 1OA3A 5J96B 2RJKA 3FMGA 1WUVA 3DGTA 3T1MA 2GDFA 2R49A 3HAGA 4FCAA 1HRV1 1C4RA 2EAAA 5BNPA 1QJX1 4XEZA 5KXEA 3N4MA 1DQ2A 3NAPA 4AGVA 4K7JA 1I6XA 5T5OA 1HQWA 1RITA 3KT4A 1DYKA 2YZ4A 4RQPB 4FPHA 1SLAA 1YIFA 5KC6A 3QACA 1VB4A 3HQXA 1UU5A 2PA7A 2VXRA 3JU9A 1ASJ1 5A3MA 4QQPA 1RL3A 1H2LA 3VHRA 3FFZA 2BVBA 1TME2 4NR1A 4FTBA 1V00A 4V1PA 1LR5A 3W58A 5GZDA 3M1HA 2HWC3 3CNAA 3D8CA 1AR82 1PVC1 2DCZA 3V56A 4JQRA 1RHI1 4Y1YA 4K9SA 1WLDA 4QPGC 2HWB1 3RI8A 1AYN2 3TN92 4BZ4A 1NY72 3N36A 3ZN6B 1RMU2 4QGLA 3RS6A 1DYPA 4YGCA 5KHHA 4Z07A 3M3IA 4CDXC 3WP4A 4CDUA 3MGUA 4ASMB 2QZ3A 1OHFA 2XJQA 2ZMLA 1R082 2TEPA 2WSVA 2VUJA 1GNZA 1NLRA 4FQZA 5KXCA 3OTFA 3GHMA 1HXS2 1CD3G 4WVVA 3KCCA 2ZCWA 2RM21 2PHRA 1REEA 1V6LA 3URFA 4JGYA 3DPRA 3ZXKA 4B29A 4Y5Z0 2UU8A 2DVAA 1ZZ9A 5HBAA 5L7OA 4IEZA 1JUIA 4LO5B 1BBT3 2BWAA 1V6KA 1PGSA 4OI0A 4GXLA 3FZ3A 1RUC3 4GH4C 5LEJA 3NV3A 1H2NA 2WZPP 3QBQA 4C0HA 1R1A2 5ACA1 4N43B 1JW6A 1COV2 1HRI1 1V6NA 3AYDA 4WVMA 3OF1A 5CU1A 5BPXA 4WM8C 4Q29A 4HSLA 2C1FA 1DGWX 1GNHA 2WQ4A 1IS3A 3BOWA 4RHV3 1ZYBA 4GIQA 1GV9A 4NWWA 1IS5A 3J4UH 3RJ2X 2WIIB 1RUJ3 2R6QA 4AEKA 2RMU2 2TBVA 2VW1A 1YUDA 1J59A 4D3WA 4AXOA 2R043 2XVLA 2XG3A 1SBDA 5BNNB 1H8TB 3CJIC 4AFDA 5DUVA 5SV5A 2A70A 1FV3A 1BEV2 1PZ9A 2C9AA 3ILNA 1TE1B 2XJPA 1PZ8A 2RE9A 5EWSA 1A6CA 4XMAA 3IPVB 2WS92 1SDWA 1GZCA 1RINA 1VAVA 3SMHA 2WA3A 3N3HA 3RYPA 4JGZA 4QD2A 1N3OA 1TNRA 4AEJA 1FPN2 4FPFA 2WNVB 3THPA 4IQPA 1SLBA 4E4DX 4RFT0 1W6PA 2XBO3 1ZBE1 1ENQA 4Q4W3 2VW0A 1EPZA 2VULA 3MPPG 1UD1A 2GN3A 3HMYA 1ND3C 1D4VB 3J9SA 3UKTA 3FUOA 5JI7A 3WW4A 2Y0IA 2HWD3 5JDBA 4N53A 2D5HA 2XKPA 2QDRA 2D98A 3RG0A 3LWCA 1VAMA 2CGNA 4M3CE 2A3XA 2CYFA 5C8WA 1L3JA 1SLTA 5T5LA 1WCKA 1XYNA 4MXWB 4YSFA 3B00A 3H1MA 3S7EA 3AKTA 2XVKA 4Y4YA 4MYEA 1S1AA 4I0WB 1YI7A 2F6BA 3E5XA 3H0OA 1RUOA 1YFXA 1MQTA 1GR3A 2B45X 2JECA 2PTMA 4HPKB 4IEUA 2E53A 1DHKB 3M8LA 1H4GA 2V73A 4TYSA 3RSJA 4ITCA 4HSJA 5C9AB 1JH5A 3ELNA 2GH8A 2CTVA 4R9DA 1LEDA 3D6EA 1PNGA 2P3IA 3WG2A 1AR92 3VBFC 1G9FA 5E1RA 1J1LA 3TNPB 1PGL1 1MEC3 1KS4A 1O4YA 2HWF3 4RR3B 2D93A 4XJUA 4CEYC 1QGLA 4EWAA 2X8KA 3JD71 1MACA 1VBA1 2W68A 1CAVB 4S2GA 3E6BA 3UV9A 3FLTA 2QE3A 3VKMA 1PO22 2ZGUA 4K1YA 4L2NA 4AEMA 3GHNA 3TAYA 4XHXA 1V9U1 2SLIA 4FPGA 2BYVE 2ZACA 4Q4V1 2WLPA 4XFBA 1KQRA 2BFUL 2FBEA 2SBAA 2IXHA 3WP3A 1IPJA 5JVVA 3AB0A 3UJOA 1Z7S2 1X82A 2JG9B 1XNCA 4P9GA 4XHBA 3V0BA 5BYNA 3VGIA 4LO8A 1Q8VA 1YIPA 3VBHC 2YGLA 2RS32 2UWAA 4E2SA 1DQ6A 1WCDJ 2D7FA 4U36A 3ZFEC 4CDWC 4EN0A 3DKWA 3ZSLA 1T6GC 4QXKA 3JCIA 5FRAA 5BNOB 4M0HA 1WW4A 2RJLA 3A0NA 2G4IA 4Y20B 2W52A 4JVAA 1PK6B 1GKBA 2A3YA 4B4PA 2WFPA 5CAZA 5T55A 3E5UA 4WM7B 4JC1A 1RUH2 3WP6A 2ZA9A 3WW2A 5JMCA 2W0XA 1VRH2 1AYN1 4LBMA 3TN91 5AC92 4AK3A 1NY71 3NVCA 3OD4A 1CX4A 3WQ0A 1N1TA 4PF5A 1RUD2 4KG0A 3MW3A 3AKRA 1ULCA 1B35B 1R081 2I74A 3SCHA 5JOXA 4AI2A 4IEYA 1IZ3A 2EA7A 5FFOC 2PN5A 1QDCA 1YJLA 5K0UC 4XIKA 1S0JA 4FP2A 1HXS1 3VKOA 1QJY2 3D0SA 2UY8A 3VBSB 4MVTA 4P14A 4EWDA 2O8OA 4Q8LA 3LA3A 4W65A 1QQP2 4K3UA 4D69A 1AR73 3WDWA 2AREA 3VBRB 4OHVA 2ZHNA 2A6YA 4QPGA 5LRSA 4H55A 4B4RA 1NQDA 3FE5A 5E8AA 4KG8A 2GU9A 1RUE2 4IV3A 4CDXA 5KXBA 1BVP1 3OGGA 4LUKA 2OIIA 1ZRCA 4TZDA 1DBNA 3I59A 4QQOA 1XE7A 4H14A 1O5UA 1A8DA 2X5IB 3LSEA 3KLSA 4A3XA 1ZREA 3DL3A 3U07A 2XJTA 1AYM3 4OUSA 3PTYA 5FCCA 2RMU1 3MIEA 3OCPA 1CQ9A 2ATFA 3PMSA 4CYDA 1CGPA 2B46X 4IV1C 3USUB 2VH9A 4G9SB 1BEV1 2GMPA 4XZPA 1F9KA 4Q0VA 1RB8G 4GH4A 4MXWA 4QPIA 2WS91 4CDQC 1WW6A 4HBNA 4GB31 1FT9A 2D5FA 1FPN1 4PDWB 1H4HA 5EYXA 5HXVA 2ETEA 5F1RA 3M3EA 2N7GA 1RGSA 4WM8A 3RJRA 3EBRA 3Q9OA 2GNBA 4COUA 3WW3A 3KT7A 4DMIA 4DFSA 4I02A 5CFDB 4BWOA 3ZN5A 1I9RA 1AL0G 2DCYA 2BNNA 2HWE1 4YW3A 1N1VA 4LO7A 5JOWA 5FQ0A 1QF3A 2PELA 2P34A 4E4ZA 5LRRA 2A6VA 1W6QA 3VLBB 2XB6C 4W6YA 1WMFA 3GYDA 4A7YA 3ILFA 1C1LA 1U5YA 1UW8A 4YZ4A 1VALA 3WR0A 2QKDA 4MGYE 4W6WA 4CP0A 1EY2A 5F5QA 2JJ6A 1J3PA 3O0WA 1BJQA 1POV0 3AFKA 3AXEA 4E2QA 3W9AA 1HIXA 4AI8A 1GSLA 4FPJA 4LBQD 2R063 1QU0A 1PVC2 4F7ZA 1ND3A 1G86A 2PQQA 5ABJC 5BNPB 1V6IA 1AR91 2PHTA 4XIOA 3NAPB 1RHI2 2R1BA 1AF9A 4D7YA 2HWB2 1AX0A 1LEMA 4FPYA 1NXMA 2QQPA 1OFNA 2ILMA 3KZ4C 1DIWA 3TB0A 3THTA 4RS5A 4XBNA 1WD4A 4Y24A 2Q8OA 5BNOA 1QWRA 1OPMA 4FVVA 1K5MC 2W39A 5T5JA 1YO8A 5F9TA 1ZA4A 4JV4A 4C91A 1XU2A 1NA1C 5JLVA 3PVBB 4D7TA 3AMQA 2RS52 4AFMA 3GBFA 1AL21 1BZWA 4XJZA 4XFCA 5CVRA 1TMF1 3K51A 1NZCA 2GC0A 2FHRA 5T54A 4AQSA 4FPKA 2RM22 1CAUA 1Z7S1 4YM1A 4B3NA 4NVPA 1XRUA 2FMDA 1FMD3 3VBFA 1B09A 1TQ5A 1WD3A 1SBFA 1IS4A 1VBC2 2RS31 4XF0A 4YG3A 2FMYA 1FI2A 1Q3EA 3ES1A 3JQXA 4CEYA 4DNYA 3B7MA 2ZGOA 1ULDA 1AJKA 4CDUB 3VL8A 3RYKA 4QT6A 3LB9A 4J6GA 2UY9A 3WD5A 5GLVA 1GBGA 4GWNA 4I09A 3ZVXA 4LLOA 3WX5A 5L36A 1ND2C 3B02A 3R4SA 2IZWA 2B5HA 4JAAA 4Z2WA 5FO8B 5LK7B 4IXLA 4AI3A 1MZEA 5H9PA 4YFWA 1OA2A 5AC91 5K7PA 4JGYB 4JRLA 4D7SA 1H2MA 1FAYA 1RUD1 1AR61 1G9DA 2H0VA 4HVRA 3M3QA 1H9WA 2A6ZA 2LTNA 5CBLA 4ZKTB 3NKGA 3S30A 2DCJA 1C57A 4PCRA 1WGPA 1NOVA 3VBHA 4AEDC 4BLIA 1CPMA 3MEPA 2O1QA 1O7FA 1C8M2 2OVUA 3ZFEA 2WT1A 4FBFA 1QJU3 2ZZQA 3WG3A 3S0MA 4HK8A 1UZZA 1QJY1 1IHMA 2ZGRA 1V6JA 4RSUA 4COWA 3GALA 1X36A 4WVMB 2UWCA 4YVWB 1QQP1 4KH9A 4GMP3 4ES9A 2JICA 3QD6A 4LHKA 4ISRA 3SISA 4K6BA 5BXXA 1ZBE2 2WWSA