4PJYA

Azide bound cysteine dioxygenase at ph 6.2
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
186
structure length
186
Chain Sequence
ELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Insights into the Role of the Cys-Tyr Crosslink and Inhibitor Recognition by Mammalian Cysteine Dioxygenase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
molecule keywords Cysteine dioxygenase type 1
total genus 55
structure length 186
sequence length 186
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2014-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4pjyA00
2DCTA 2PYTA 1FXZA 1ZVFA 3KSCA 3LWCA 2MNGA 3SCFA 3S0MA 4BYYA 5JSPA 5BY5A 3FWEA 3SHRA 4IEOA 2PAMA 4PIXA 5KHJA 2Q30A 3WW3A 1O5LA 2EVXA 3ELNA 5D1IA 4EROA 1NZCA 3BB6A 4BH9A 5FLJA 3E6CC 1ZREA 2IXKA 2HKXA 3HIFA 3HT1A 4AVBA 3KGZA 1ZZ9A 4E2SA 3UKNA 4QXKA 4HBNA 1RUOA 4PIZA 2VPVA 3NJZA 1QWRA 4IETA 4UBGA 1OD5A 4PJYA 4I3PA 5FQ0B 5HI0A 3E5QA 3H1WA 3LA2A 1J3QA 2IXLA 3RYPA 5T3NA 1QY4A 4XF9A 5C6CA 3ES4A 4YNIA 4XFGA 3FHIB 4OFGA 4D7TA 5FLIA 4MGZE 3QACA 1HW5A 2KXLA 4HMZA 5E16A 2GC2A 2CAVA 1EPZA 4RD7A 1PM7A 2VECA 4IEUA 4Q0QA 4I0BA 5C8WA 3TNQA 5JAXA 3CO2A 2Q0AA 1O3SA 2FMYA 4META 1EP0A 1X82A 2XKPA 3JZVA 2GC1A 3MYXA 1DGWA 5LEKA 4X6RB 4XF3A 2GAUA 4JTOA 1H1IA 1U12A 2H6CA 1ZNPA 4HSJA 1ZX5A 4MX3A 3CJXA 1CAVB 4FBFA 2PQQA 1ZZ7A 5J7MA 1LR5A 2BEOA 3NL1A 3WW2A 3SXWA 4ZU7A 3FE5A 4MGIE 5I0UA 2OPKA 5FQ0A 2BYVE 5I93A 1X8MA 4LEJA 3M70A 4A2UA 1I6XA 5FCCA 2GC3A 3H7YA 1WGPA 1Y3TA 2OA2A 1YHFA 4KL1A 1IPKA 2PAEA 5JR7B 5I8SA 4IESA 4KU7A 4H7LA 1IPJA 1YFWA 1NYWA 3D82A 3RYKA 4BIFA 5I91A 4R8HA 1O5UA 1RTVA 1GQGA 1TQ5A 3NW4A 1UCXA 1LB2A 4HVRA 3E5XA 4QMAA 1UW8A 1ZZBA 2GU9A 5KHKA 1ZRFA 4EWEA 5LRRA 2QDRA 4AQ6A 2FQPA 1YWKA 2PA7A 2UY8A 3H7JA 1YLLA 2MPFA 2IXHA 1YFYA 3U0ZA 3I59A 4YYOA 2F4PA 5CADA 1VJ2A 3IBMA 2CGPA 2WC2A 4QGMA 3DN7A 2D93A 4MUVA 4Q0VA 2PFWA 3CLPA 4I0AA 4HN1A 3FZ3A 4Q0UA 5J3UA 2HJIA 3N4MA 5KBFA 5I0RA 3UKVA 1CAWB 5JSOA 3CEWA 1WLTA 2OZJA 1CAXB 1OI6A 3IDCB 4MH0E 4WZCA 4IEYA 4XF1A 2QNKA 3WW1A 1O3RA 3PVBB 1X8EA 3RYRA 4AXOA 1CAUB 4KWKA 4AQ2A 3U10A 3D0SA 3VHRA 4O9GA 1J59A 5FDBA 1DZRA 5LEJA 1O3TA 2P17A 3I7DA 1H1MA 4L2NA 3S7IA 4X6QB 3USSA 4HLTA 1X7NA 2I45A 4MV2A 1ZZ6A 3NKTA 2N7GA 3DKWA 5KHIA 5FPZA 1O4TA 4Z07A 4YARA 3OF1A 1CGPA 4LA2A 1QXJA 4Q0PA 1UIJA 3BU7A 3RDIA 2CAUA 4I01A 5EZWA 1DGRA 4QGNA 1ZRCA 5CU1A 2XLFA 3EHKA 5KHGA 4XFIA 3RNSA 2K9ZA 3HT2A 3NSTA 5BXXA 4DINB 1PMIA 4J1XA 4I2OA 2PHLA 2QVSB 5I8TA 4IEWA 2K0GA 3IWZA 4F7ZA 5E1RA 4HVQA 2BNMA 3MDPA 3ETQA 1Q3EA 2XL7A 1RL3A 4TLFA 4JVAA 3GBFA 3OGJA 4FAGA 3GYDA 3EQEA 5FPXA 3E6BA 1UPIA 1CAXA 1Q43A 5F1RA 1J58A 3CF6E 4EWAA 2ATFA 1CAWA 2EAAA 2O8QA 1QXRA 2EA7A 5I8YA 1SFNA 3I54A 2OYZA 1FI2A 1J3RA 2H0VA 4AVCA 2WFPA 3LZZA 2XLAA 2MHFA 4O9EA 1YUDA 3EO6A 1RUNA 2IXCA 2Q1ZB 4YSFA 1WA4A 3H3UA 3B02A 4IEVA 5BV6A 3TNPB 4XFFA 4LUMA 4HN0A 3C3VA 4EWDA 1NE6A 1CX4A 4XF0A 5EFUA 4ZU4A 4J1WA 3LAGA 4QM8A 5JCTA 2XKOA 5KHHA 4UBHA 1XE8A 2Z2SB 3H9AA 4IEPA 1JUHA 1DZTA 1J1LA 3H1MA 3FFQA 3OD0A 4WBBA 2IC1A 4Q29A 4MGKE 4LLOA 4WVZA 4IEQA 4XFAA 4B29A 4LULA 2PAKA 3QOPA 5FLHA 1ZRRA 4YRDA 2Y0OA 2ZCWA 3FJSA 3ZDSA 4XFBA 4XETA 3LA3A 4EV0A 1VR3A 3IIAA 5BUVA 3PNAA 3NVCA 2B5HA 1LRHA 2UY9A 1G6NA 4I02A 1NXMA 4BHPA 5J48A 2CV6A 3HQXA 2ET1A 4ZU5A 3ES1A 1OFNA 4ORFA 2OZ6A 4XFHA 1LKNA 4E2GA 1Y9QA 2Q4SA 3UKTA 3S7EA 4LUKA 2UYAA 4R52A 5LRSA 4MZUA 2BNOA 4QX5A 1ZRDA 3L2HA 3BPZA 1XE7A 3LA7A 1CAUA 3SCHA 2XHKA 4CYDA 4UXAA 3PLQA 4QGLA 5BPXA 4HSLA 3MPBA 1I5ZA 4HVOA 2UYBA 3ST7A 4IEZA 4P9GA 2O1QA 3E97A 3IDBB 4QM9A 5JSRA 4N9HA 2D40A 4XEZA 1GQHA 4OLLA 2V09A 3BCWA 3D0JA 3DL3A 1UIKA 4IERA 2PHDA 4K8FA 4FAHA 5I0TA 3EJKA 3OTFA 3SCGA 3DV8A 1OMIA 3WW4A 3MZHA 1NE4A 5CVRA 3EBRA 1ZZCA 3SMHA 4NVPA 2C0ZA 3H3ZA 4LTAA 1Q5OA 1FT9A 2BNNA 5I0SA 1VP6A 3E6DA 4PIYA 3BALA 3H1YA 3CL1A 3R6SA 1XRUA 4IEXA 4HZFA 1YFXA 2PTMA 2ETEA 4AVAA 3ACLA 1YFUA 2H6BA 1UD1A 4E2QA 3ROUA 3KCCA 3KMHA 1SEFA 3H50A 4XF4A 2XGXA 5AVPA 3E5UA 2E9QA 3OCPA 4Z82A 1J3PA 1O7FA 4I09A 3RPQA 3RZZA 2XLGA 1RC6A 2D5HA 3LOIA 4ONUA 4FT8A 4JV4A 2B8MA 2GH2A 3U11A 4GULA 1RGSA 4N9IA 5K8SA 2IXIA 4D7SA 2XL9A 1CAVA 2GZWA 4L11A 3H8UA 1EY2A 1SQ4A 3G7DA 2ZKLA 3KGLA 4KWLA 2ET7A 2Z69A 3FX3A 2IXJA 2QJVA 4MGYE 1V70A 4LA3A 2QCSB 2GC0A 1O3QA 4JTNA 4KWJA 2B9UA 4XFCA 2BGCA 4KU8A 2D5FA 4F8AA 3I59B 3M3IA 4Q0SA 1ZZ8A 1L3JA 3O14A 2VQAA 1EYBA
chains in the Genus database with same CATH superfamily
2DCTA 4LT5A 4F83A 4GA9A 1LENA 3M2MA 1ND2B 5A3TA 3AX4A 4QQ2A 2ZGMA 3LWCA 3VBRA 2P6CA 3MI8A 4P02B 1LGBA 4Q4Y3 5C3SA 1UKGA 2YHJA 1RMU1 5A1AA 2X09A 5FY0A 1S0JA 5LK5A 1JZ2A 1W39A 5T5JA 1KFUL 4EN0A 1O5LA 1VBE3 2RDQA 5D1IA 4EROA 4B7EA 3UT0A 3WR0A 3BB6A 4CPBD 2XB6C 5FLJA 2CGOA 2DURA 2RS32 1H4HA 1VBB1 4Y4YA 2DFBA 2WO3A 4AVBA 2R32A 2I2SA 2EIEA 3KGZA 4AFAA 1GWMA 1RUOA 3VBOB 2WLQA 2W47A 1ZA4A 2EXIA 4JKMA 3I3MA 4IETA 2DCKA 1SDWA 2WNEA 3N9PA 4XUQA 5E6HA 4XJAA 1CD3G 3A0NA 5LA2A 3ZFEC 4I3PA 1JYXA 1JYIA 5FJHA 4HONA 5HI0A 3H1WA 4CUGA 3RYPA 4MYEA 4Y5SA 2DVGA 4DQAA 5FV3A 3MUZ1 1YQ5A 3T2TA 3VDDB 3APBA 4XJWA 1BYHA 2R30A 1OQDA 1RUD2 5IVVA 3CJIB 4GH4B 1AL22 2DTYA 4NMIA 4QWNA 4UFHA 5JXHA 3LDKA 4UOJA 3WG3A 4BMEA 1H2LA 2BWCA 4MGZE 2PHXA 3OB8A 4I30A 1LJ7A 1JUIA 4Y1UA 3I2KA 3BVCA 3KT7A 1R64A 4X8PA 1DQ2A 1HW5A 4BWOA 2ZX3A 1JZ5A 3NQHA 1IS3A 4LBMA 4B7KA 5I0DA 2CAVA 2WBKA 3KT1A 4UFJA 2D97A 4RD7A 2WWSA 1DGLA 1PO11 3I3EA 4IEUA 2A71A 3AZWA 4Q0QA 1HX6A 4ISQA 1Z7S1 2YFUA 5FP4A 3ZYIB 1EAH1 5K7PA 4PI2A 2RV9A 1VBB3 5E89A 4ASLA 4LE4A 5J1XA 4Y22B 4YVSC 1JHNA 4AGVA 1PZ8A 4GMP0 4HXCA 1PIV2 4YVWB 1UY2A 1H8TB 1QMJA 4HG6B 4CE8A 4YPJA 4OQ8A 4UF0A 2EF6A 3J4UH 2BU9A 2FDIA 3KCYA 4XCBA 5LEKA 4QB6A 3GJAA 4YM0A 3THCA 4Q2FA 1GNZA 4XJ9A 4XF3A 5CFCC 4QHZA 4JTOA 3U07A 4NE9A 2WT2A 5GKAC 4HSJA 3ZKYA 3AKTA 3ZFGB 1A34A 4MX3A 4OHYA 3OBZA 5H9QA 4P9JA 4KQ7A 2EIBA 3WCRA 1SLLA 1QJEA 5LBEA 3BPSA 2XQRA 3SXWA 4E4DX 1V6MA 1B35B 2ZGLA 2LUWA 2BGOA 4RR3A 5I0UA 3ACGA 5CKQA 1VE0A 2BYVE 3SISA 4BIOA 5FQ0A 5FMBA 5I93A 1WCQA 2R072 1OUSA 4PF5A 5ACA3 4LEJA 2WWJA 5EPAA 4BXSV 5GLTA 4DPNA 2YY1A 4GWIA 1QGLA 1ASJ2 1WGPA 2OA2A 2VQUA 5F3IA 5I8SA 3WQ0A 4KU7A 4NRQA 3B9CA 1IPJA 2WNUB 3NV4A 2HWD2 4E8CA 5I91A 3RYKA 1UU6A 4XZPA 4FPEA 5L9BA 1UCXA 2HWC1 2JWPA 3AMQA 4XYXA 1AYN3 2A6XA 2UURA 2WNVC 5FZKA 1AR61 3MW4A 5CB7A 3WNXA 2QQWA 3NV2A 3CMGA 3FLTA 2XJPA 4S2GA 4ES9A 1SBDA 2DVFA 5FXWA 2VQTA 4LO6B 4EWEA 4AQ6A 5J36A 1JODA 1S0GA 3JU9A 4HKLA 2K2SA 3WVJA 4QPGB 3VBFC 1HB3A 2UY8A 3H7JA 2E7AA 1UOFA 4B1LA 3ZM8A 1FAYA 2MPFA 1G9DA 2P5BA 2ZX1A 1UY1A 1SLTA 2DU1A 1WBFA 3MIEA 5DAWA 3W5NA 1H9WA 1RUE1 3U0ZA 4LKFA 3PU8A 4AEKA 1GBGA 4YYOA 1P8JA 1GZWA 4QB2A 5J96B 3RZLA 1U5XA 2HWE2 2P6HA 5A70A 3IBMA 1A8MA 1E5IA 2WC2A 4QGMA 5ABJA 4JGZB 1W06A 5L9VA 4MUVA 2X5IA 2PFWA 1ENQA 1UYYA 2JB4A 4HN1A 4HL0A 4I0AA 4P9IA 2PQSA 2W0XA 5J3UA 3M1HA 4QPIB 4K6BA 4D69A 3H8RA 1OPMA 5KBFA 3CHXA 1WD4A 3TN91 1DQ1A 1KITA 5I0RA 2K46A 4LBOA 1NAEA 4MLOA 2IWGB 2ZMNA 3WSOA 2AGSA 2GH8A 4B3NA 2CYFA 2VCAA 5LK7B 1AXKA 3OGSA 2QKDA 3CEWA 4DUVA 1GZTA 2TUNA 4LO7A 5JSOA 5L19A 3RI8A 3ZXEA 1LNSA 3CNAA 1BEV3 4A42A 2OVUA 4H7MA 5DPNA 1JYCA 4MH0E 1A6CA 4CCMA 2E32A 3IAQA 4X8NA 2W1QA 1W2AX 3H42B 3OEBA 3M8LA 4DNYA 2QQIA 5FOJB 3C7EA 3FL7A 1QJU2 2HEWF 1PGW2 4ZONA 5FMCA 3AVSA 5JXJA 3JUUA 1W8TA 5JDBA 2BPA2 1RUH2 4AFBA 3VUOA 4GZ9A 1DYOA 4EJRA 4O9GA 2RS31 1NLRA 2JE8A 1J59A 3IN9A 1UF2C 5CA6A 4ZXEA 4CXYA 1DZRA 1UXXX 4IV1C 4DXTA 5FZ8A 4WVMA 2ZEZA 3HQRA 2CY6A 4Y5TA 3MO4A 1H1MA 5BNOB 3M3EA 1GOHA 2XMLA 4XACA 3V64A 1MS3A 3USSA 5FY9A 2I45A 4MV2A 3POFA 2ZGOA 3CZUA 4NO4A 4KWUA 5FYYA 4LIUA 4XQ4A 1QDOA 1NZIA 3ZXLA 1OA4A 2AH2A 1RINA 3J8F2 4L99A 4LA2A 1QXJA 2JG9A 2D6KA 2GALA 1UIJA 3B01A 2Y33A 1MS5A 3RDIA 1UX6A 2NPIA 1W8NA 4DY3A 2CAUA 4I01A 5FZ3A 5GLWA 1DGRA 2W1SA 2VXRA 1J1TA 2ZHMA 3KHCA 3EHKA 4R9DA 5FAXA 1LECA 3KV5A 2VMIA 3NSTA 5I8TA 5IUQA 3OBRA 4Y20B 2K0GA 3I97A 4GB31 5E1RA 1UMIA 3P3NA 3VBUA 1JI6A 2XL7A 3LDBA 5IATA 3OGJA 4FAGA 5FPXA 2WFF3 4XBNA 1O91A 1COV1 1W6QB 3E6BA 1CAXA 4NIIA 1UMZA 3TRSB 5C71A 4JRLA 1UZYA 5C8CB 1VBA1 1UOGA 4QD2A 2EA7A 3WP5A 5I8YA 1WMEA 1ULOA 3I54A 5BNNA 5C3RA 4RFRB 3JD73 1DIWA 4ASKA 1L7RA 4NOTA 3VN4A 4BZ4A 3VZJA 4EZ4A 2J1AA 3TEYA 2HWC2 5CFDA 1V6JA 2RDRA 4CP0A 5LASA 4QDQA 3ZLIA 2Y64A 3WHTA 2Q1ZB 1CPNA 3I4IA 3O7OA 2DFCA 1ASJ1 1F4AA 5FWEA 3JQXA 4IV1B 4COYA 1GV9A 4HN0A 3C3VA 3GHNA 4EWDA 2J1TA 3OYWA 1IGOA 1V9U1 2NQYA 2W52A 2ZX4A 3HR9A 1HXS2 5FXVA 3ZXKA 3KQ4B 4CDXB 1RUG2 5JCTA 4UFIA 5HPOA 4AEDC 4G3YC 4LBQA 5C3PA 4BJ0A 2QQLA 4QQPA 3TOJA 1LESA 2EXJA 1EAH3 1I5PA 5DAQA 2VUAA 2RS12 2PELA 4MG2A 4ATFA 1AR63 4Q4Y2 2JEMA 4JGZC 4DFSA 1O8PA 3RZJA 1BXHA 3H1MA 2YU1A 3K4ZA 2KR2A 4UI9L 5L7OC 1AX1A 1XYNA 1AYM1 3POSA 3VHPA 1EV13 1H0BA 4Q29A 3ILFA 3DPRC 1PVXA 2LALA 2RVAA 2VW2A 3GNEA 4BLIA 2ZGPA 3HN3A 2LW8A 4ZS3A 5A3WA 2W2IA 4IEQA 4WM8B 3MPPG 3O0VA 2OUHA 2VZSA 4CUAA 4OUSA 1KQRA 4AGGA 4DIQA 4LULA 3B5LB 4BQWA 1AR72 2JB8A 1MQTA 2RJLA 3LGRA 5B4XA 3FHAA 2WT0A 4Y33A 1QNYA 3SC7X 3JB4C 3GM8A 4Q4W3 5FLHA 1ZRRA 2WQ4A 4AVTA 4IW3A 1VBE1 3GBGA 1DQ0A 1W3VA 2XUMA 1SBEA 2GDFA 4Q4V1 1RHI2 2ZZJA 5FZIA 3ZDSA 4AQTA 4XFBA 3WNKA 5K0UA 3W9AA 1TME3 3OUJA 4P9YA 3UJQA 4PLOA 3DCQA 3R05A 5BUVA 3PNAA 4CEWB 2DBIA 1N3QA 1LRHA 4LJHA 1OQ1A 1STMA 1H1AA 2P3IA 3POWA 1OA2A 5EQUA 2ET1A 3ES1A 3GCXA 4NWVA 1F35A 1HXS1 4RA0A 2D3PA 4XFHA 4AEDA 4E2GA 1Y9QA 2Q4SA 5LRSA 4R4XA 2UYAA 4RQPA 5FZ7A 5F3EA 3J7NA 2ZEXA 3RMYA 3WNPA 4D6RA 1TZOA 3GALA 4BXFA 5JIUA 4E9KA 4YW3A 3RMXA 4Y20A 2WNVB 3ACFA 2XHKA 1N3OA 3MUY1 3SCHA 3ZPOA 4UXAA 2X29A 4CYDA 2WABA 2JG8B 4QGLA 2X8KA 1I5ZA 4QKNA 4IEZA 2QZ3A 1ALYA 1QF3A 4WM8C 1WUVA 3ZOIA 1JW6A 3VZKA 5JSRA 2D40A 2XJSA 4K3UA 4CXWA 4PLMA 4YW4A 1H4GA 4M3CE 2R16A 5FZ9A 1VAMA 1YJLA 3KF5A 5D8AA 4OLLA 3POGA 4P00B 2V09A 1YQCA 2F6BA 1VBB2 1AR92 1VAVA 1VBD1 4YWAA 4AVSA 3AZXA 4DMIA 3BOWA 5IK5A 3BODA 4XQWA 4QHOA 1YO8A 4HANA 1CR7A 1BQPA 3VHOA 2FCVA 2WJSA 2XG3A 4HPKA 3WW4A 4M0HA 1MVQA 3P1IA 2C9KA 2BVBA 2BBAA 4FSJA 3Q8FA 2ZHLA 3SMHA 1SFPA 5D21A 1OT5A 1AVBA 1GR3A 5FRAA 5AC92 1WCKA 1C1LA 3P5BA 3M4FA 5F5AA 4LTAA 5IT6A 5FZOB 2VCMA 5APAA 5GLUA 1X36A 1K5MA 4H55A 3RGBA 3USUB 4ZKTB 1G9CA 1BMV2 3VZMA 4NRPA 4QB1A 2JIJA 1S1AA 3OGVA 3S5QA 2YFZA 1D0GA 1T6GC 5FZDA 1POV3 1BLZA 3LIHA 4B4QA 3KV4A 5AFEA 2B7YA 2PTMA 2ETEA 3AZZA 4NHYA 5LBFA 2HWB1 1SCSA 2W5FA 1UXZA 4NHKA 3WG2A 4CZSA 3RG0A 1HRI2 2VGDA 1SEFA 3KMHA 2JXAA 2JDKA 1QOSA 4JRAA 4ZS2A 2AACA 5LATA 5A7WA 2HWD3 2JDPA 3EB7A 5AC91 5AVAA 3E1F1 2CWMA 4D6SA 4TSVA 3C7FA 4GWMA 1R1ZA 1SBFA 2ZJCA 3QD6A 3OCPA 3RI9A 4WV8A 1LEDA 4QXHA 3J9SA 5ANQA 4FOYA 3ON7A 1J3PA 1O7FA 1OXCA 2GMEA 3B3QE 4O61A 1ULGA 1BVVA 2D5HA 3WQ7A 4IV3C 4QX2A 1W03A 3FBMA 3BIEA 2B8MA 5JR2A 2HWB2 3CZJA 3PDQA 3KWVA 4N9IA 5B4NA 5K8SA 1H6XA 3INAA 4RYDA 4M0NA 2XL9A 3AYAA 3O1TA 2YC0A 3AVRA 1C1FA 3OY8B 3JB8A 2DCZA 1S0FA 4BQYA 3AB0A 3MLJA 4GXLA 3VDDC 5L7OA 1DLLA 1QJZA 2OQ6A 2ET7A 1M4WA 2VZOA 2TBVA 2IXJA 4YG6A 4MHRA 3D3AA 1JU3A 3HBKA 3FHQA 1BK1A 2GC0A 2VJXA 3C2UA 1RMU3 1O3QA 3ABZA 1SLCA 2L9LA 3BKZA 1W99A 2D6PA 2WNUC 1WMDA 5FYHA 1ZYBA 3NJYA 2CL2A 5A32A 4HKWA 4Q0SA 1ZZ8A 1L3JA 1PGSA 3AM2A 1MZ5A 5JMCA 1OA3A 4AYUA 5LZ6A 1ZVFA 3VBHC 4XC9A 3KSCA 2PN5A 4L9BA 5FZ1A 1BCXA 2QQJA 4IXLA 3SCFA 2XJVA 4FQ4A 4FPJA 5FJKA 2VTXA 3IZOA 4L92A 5BY5A 1JOBA 3FWEA 2JX9A 2ZBJA 3ATGA 1RUC2 1R1A1 4WM7B 5KHJA 2X10A 1UN1A 2XJTA 3PTYA 2KD7A 1YQ8A 2X53S 1PK6B 4QAWA 3VBFB 1UL9A 4XOGA 5C3QA 1IG0A 3NRUA 2YU2A 2DTWA 3HNMA 3E6CC 2RM21 3BTAA 5J98B 4RGAA 5LB6A 2DV9A 1NLQA 3K77A 2WQZC 2E26A 3HIFA 3HT1A 4BCUA 1AXYA 2QTWB 3UETA 4AR2A 4LBNA 1OOPC 3OOXA 4M4PA 3NNMA 4CP2A 3UKNA 5LA0A 4QXKA 4MGTA 4HBNA 1PO12 2VPVA 4PIZA 4CSWA 3NJZA 2ZGRA 3C7OA 2D3RA 1PVC1 1NLSA 1Q56A 1YI9A 1OH4A 5LY2A 3MF9A 4V2VA 4AWDA 4QPIC 4YVSA 2XHNA 1DF0A 4IV3A 1UZ0A 3PURA 3Q8BA 3Q8AA 2IXLA 4FPFA 4PDWC 1U5YA 4RGGA 5T3NA 5CG8A 2OW4A 3W5MA 4XF9A 3L9JT 4W6XA 5C7GA 5DAVA 2C6SA 3WG1A 2ORZA 2YBKA 1LU1A 1VBE2 1SMVA 3WINE 2ZMLA 2ERFA 5DQ0A 1I9RA 1WCSA 2W3JA 4D7TA 1PK6A 4CDUA 3LFIA 2Y26A 4Q4X2 3EMRA 4OHVA 5FY5A 1W6NB 4AVVA 2VOVA 2GMPA 3ZYRA 4A7ZA 2W9XA 5LA1A 2VECA 3CJIA 4GH4A 2O0OA 3LF7A 3T4HB 2VTFA 4JAAA 5DMYA 1Z78A 1WLWA 3WF4A 4PQQA 1AYM2 3TNQA 4A3ZA 5KC5A 4BQ5A 2O14A 2XWBB 3BTYA 5GZDA 3IB3A 2VM9A 3CO2A 3K4AA 3THPA 2DYCA 3ZFEB 5FOBB 1TNFA 2WS93 3N7JA 2V72A 3VKMA 2NMOA 5FZOA 3ZSEA 5BNPC 1LHNA 4XIOA 3WV6A 1KS5A 1ASJ3 3JZVA 3MYXA 1IOAA 4XUNA 5BNNC 2FCTA 2BQPA 1QIQA 4COWA 4EN8B 4X6RB 1MS4A 5FZCA 5HV4A 4QX3A 4N43A 1ULCA 4L97A 1W8HA 4N43B 4BISA 1MS1A 1U12A 2H6CA 2JDHA 1ZNPA 4YGBA 1XPWA 5FY7A 3NWKA 1Z7S3 3OY8A 1V6NA 3DYPA 4UW6A 2PQQA 4YM1A 1JZ7A 1ZBA1 1JU4A 4JGYB 2YGMA 3R0RA 3NL1A 2V73A 2Z4FA 1AR82 4P9XA 5JOYA 1HXS3 2R043 1RUD1 2W68A 1SFYA 3FE5A 1HKDA 3J7MA 4TXWA 5IK4A 2Q5TA 3J8F1 4W65A 1QJX2 4XABA 3AP6A 1ZBE1 4IUGA 4A2UA 1I6XA 2KA3A 1TEIA 2ZGUA 1LEMA 5FREA 1IS5A 1HJFA 5L73A 3H7YA 2W91A 3AKPA 2ZXQA 1YHFA 2G9FA 2PAEA 4KL1A 4XILA 5JR7B 3VB9A 3AL5A 2LTNA 4P14A 2WR9A 2VH9A 1NYWA 4BIFA 1SDDB 1JHJA 5JXGA 1K12A 3ZYHA 1BVP1 1ENRA 4AEDB 3NW4A 4AEMA 4A3XA 2QBXA 4DXZA 2E63A 3GJBA 1G9BA 2HYKA 2WO2A 3ITQA 4GQ7A 4PLNA 1UW8A 1GLHA 1UZWA 2JDAA 1RUJ3 1VLNA 3LEMA 2PLV1 4MVTA 1ZRFA 3MBWA 2QDRA 5F7UA 4XHBA 1DU3D 4LOSA 5JI7A 2ZABA 1LCLA 1ZBA3 1YI7A 4YVSB 1PX4A 1YFYA 1JZ4A 1YNAA 3RZKA 3AXDA 2Y6HA 3I59A 4BM8A 2D6MA 2PHWA 4ATEA 5HV0A 1FPN1 2VOKA 5CADA 5CYYA 1CZVA 3J7HA 4Q8LA 3KD4A 2HBUA 4WM8A 5FWJA 1U5ZA 4UT5A 2D93A 3AYCA 4MGQA 1C8M1 1HRV1 2VZQA 3NNLA 4Q0UA 1NOVA 2VCCA 3AP9A 3BYWA 3WDTA 2A6ZA 1OVPA 2PHFA 3C7HA 3HOBA 3V0BB 5IVCA 4GKYA 1VALA 4PT6A 2OS2A 5DUWA 3ZSKA 2DCJA 2HWE1 1ZA7A 1C5HA 4M3CB 4LOTA 3VBFA 1CAWB 3ZDVA 3ZVXA 4CA9A 1R092 1SPPB 4PDWB 5FO7B 2DVAA 4WM7A 1WLTA 5D8AB 2E33A 4ZZ5A 5IHRA 2BOJA 4UW3A 4LBQB 4XDQA 1RITA 3D8CA 4BMBA 4Q1PA 1CN1A 4CDXA 2BUKA 3CU7A 3NO8A 4CVUA 3N9MA 3RYRA 4N7UA 1HRI1 2XXZA 1CAUB 4AXOA 2W46A 2ZX2A 3WT3A 2YG0A 5FPVA 4XUOA 4HT1T 4NPMA 4AQ2A 5JPMB 4OI0A 3D0SA 3VHRA 2ES3A 3OSDA 5HCBA 4OZOA 4G9SB 1GYKA 5LEJA 1TMF1 1F8VA 2J42A 1BK0A 1WMXA 5CFDB 1MZ6A 2ZOEB 1FPN3 4N53A 2ZZQA 5FFOC 1UU5A 3KZ4C 2HEYF 1WZXA 1D4VB 4X6QB 4FI9A 1ZZ6A 1AJKA 1LGNA 4BQXA 5BNNB 2Y6KA 2IFRA 4K21A 5FPZA 4LE3A 1X50A 3I2FA 1CGPA 2J1VA 3PTRB 4Q4V2 3ZXGA 4Y4RA 3ZSJA 3O0XA 3BU7A 3WF3A 1QJU3 1VB2A 1HJGA 5EZWA 3WP6A 3ZX7A 5CZKA 2RM23 1AL23 1GZCA 1UAIA 1EV11 3OBTA 5CU1A 5ERLA 2ZEWA 4DZGA 5F39A 4FPLA 4WM7C 1DBNA 5FZLA 4Z8BA 4D6QA 3M3CA 1VBD2 3AZYA 4XFIA 4XTPA 4YZ5A 2ID4A 1ENSA 2PHLA 1FOD1 1VRH1 2V5YA 4I2OA 1XE0A 1OBNA 4EQVA 4HVQA 1H8TC 2BNMA 3MDPA 3ETQA 3ASIA 1RL3A 1PVC3 3GBFA 1D4M2 4P9WA 1S0EA 2UWAA 5F5CA 4P5YA 3O1SA 5EJ1B 4PDWA 3N7MA 1RJ7A 4EWAA 1SPPA 2IVIB 2LRPA 3FFZA 4UAPA 1RUF2 1CAWA 2O8QA 4M3CA 5A3UA 4CDUB 3UYJA 3J8F3 2BZDA 4MGSA 2OYZA 1APNA 1J3RA 2RS11 1W9TA 4AVCA 1C5IA 1TMF3 3TN92 1PIV3 4AAPA 4CP1A 1PMJX 2ZAHA 4P5HA 4JHZA 5DZGA 4OVEA 3WDVA 2XLAA 4WVMB 3C7GA 5E8AA 4AGRA 4O9EA 1YUDA 3S6PA 4CDWB 3WZ1A 2CDPA 4YSFA 5A3PA 3H3UA 5BV6A 3B02A 1YJKA 3DXUA 5CFCA 4LBQD 1E5RA 4YGCA 3FBYA 1YXWA 2JG9C 2RS52 5T5OA 1US3A 1DQ4A 3VD9A 2EIDA 4BOWA 3LPFA 3RJRA 4CEYC 3ZN4A 4OI4A 4TLGA 3ZYBA 4ZU4A 2VXJA 4HPKB 3AK0A 3NNGA 4QM8A 3PJYA 4Z1VA 5KHHA 2CU5A 1AR71 1OKQA 2R073 4UYBA 3W58A 1KGYA 4M4RA 5FKCA 5LA9A 2WO7A 2HYXA 2Z2SB 1H9PA 3H9AA 3N7LA 4IEPA 2ARCA 1JUHA 1RUE3 1US2A 2ZMKA 3LE0A 4CCDA 2MEV3 4CU9A 4CP9B 4LO4B 5GZCA 2VG9A 3C8XA 1VAKA 4Y1YA 4NPRA 1HN0A 2IC1A 3QH6A 4ASMB 5F9TA 5EHDA 3RZMA 1H6YA 3N9LA 4K8RB 3O1MA 2ARAA 3R4DB 4YW6A 2VY0A 3BOPA 1E5SA 2AUYA 4B29A 4QXBA 3AFKA 4IDZA 3DKQA 2VZ1A 1GZWB 1OHFA 5FTTC 4GIQA 4CP9A 2PAKA 3LSDA 1RUG3 3PUSA 1NCQC 3ZKUA 3B00A 3QOPA 5C9AB 1Q8SA 2JKBA 4QDSA 4JGYA 2UU8A 4DRRA 5H9PA 2XR4A 2H0BA 1H2MA 1VBC3 2BV4A 1LTEA 1OKOA 2VMCA 2W1UA 2UWBA 2Y0OA 2ZCWA 3DECA 3HN1A 4XETA 2QQOA 5KXBA 1XSQA 1VR3A 5DDJ3 4CEWA 3I49A 2RMU2 3NAPC 1W0NA 2D6OX 2BGPA 1KJLA 4KG8A 2JIGA 1NXMA 5FO9B 5F8PA 3Q8CA 3BUCA 4DXRA 2CV6A 3HQXA 3JQWA 4ZU5A 3O14A 1OFNA 2G9GA 4ORFA 2YZ4A 1LOFA 1REEA 1LKNA 3UKTA 3S7EA 4LUKA 4R52A 5CFCB 1D2SA 3W21A 4QX5A 3LB9A 5J37A 2Y6LA 2VAUA 2JDUA 2X05A 1XE7A 3BPZA 4CDWA 3LA7A 3ZFEA 1CAUA 4QKFA 4PF1A 4Q4X3 5C3OA 5JMOA 2VBPA 4HVOA 1LOGA 2UYBA 1VBA2 2VBBA 4P9GA 1CWPA 2VO5A 3O0WA 3E97A 1HB2A 3GGLA 2WRAA 2YB7A 3BIWE 1Y43B 4XEZA 4QQLA 4YG0A 1RXGA 1GQHA 4DOUA 1MACA 4CPBA 4TWTA 1Y4WA 3PUAA 2B4KA 1MR5A 3BCWA 3D0JA 5T5PA 3SEEA 4FTSA 4JQTA 1RVF1 1HDKA 4N8MA 5I0TA 5FYZA 1XNAA 5A3OA 2R1DA 4W4ZA 3EJKA 3ZFGA 5F6KA 4IGQA 1RUH3 5IVEA 3UL2A 4B4PA 3PL0A 3MZHA 4GKXA 1W2TA 2OT7A 1DHKB 3ME2A 4HK8A 4NAMA 4DS0A 3EBRA 1MZFA 1QH6A 1ZZCA 3OUIA 4NVPA 4BPZA 1QQP1 4IV1A 5A7QA 1RVF2 3VGIA 4IV3B 1HIXA 1OQEA 1H8TA 2D6NA 1GUIA 2BNNA 5J09A 4OZXA 4AFDA 3PVNA 1OUXA 1VP6A 5DZEA 2FD8A 2YROA 4AFMA 3E6DA 5T55A 1JYNA 3BALA 3CL1A 1OF3A 2JG8C 1W0PA 1KFXL 5IAXA 1XRUA 5KXDA 1FOD3 3T0DA 4FVVA 4B4RA 1UMHA 1NUKA 1XNBA 1YFXA 3ZFFA 4CDWC 5IVBA 1MS9A 1RUF1 3WF0A 4AVAA 5IWFA 5IAVA 5C8CC 4HOOA 3HPNA 3MLKA 5DABA 1ODNA 1UD1A 5FYTA 1QJY2 1W6QA 3DYOA 2HWF1 5FPAA 4OHZA 5SV8A 1VRH2 4XBQA 5BNPB 4Q5OA 2VUDA 1LOFC 4AAXA 4AHWA 2A3YA 1YQ2A 3WLUA 1W8ZA 5EXOA 2W39A 2QQKA 4FCAA 5CEHA 2NLRA 1RUJ2 3AYEA 2DU0A 3NKGA 1POV0 3NV3A 2YUEA 3VBHB 3RZZA 4I09A 3QBQA 2XLGA 1RC6A 2WYSA 4K1YA 5FYCA 3LPGA 4COUA 3AKSA 3MIGA 1PZ9A 2GH2A 2W1WA 1I3HA 2RHPA 3HQUA 4GULA 3CQOA 3VKFC 2IXIA 3VL8A 2R061 4YM2A 4JZRA 4A6SA 1KJRA 1G86A 3WUCA 1K5MC 3H8UA 1RUC3 2VOXA 2BW8A 3V0BA 3T2QA 5FXXA 3ZYJB 2I07B 2DCYA 2VC9A 4NRMA 1Y9GA 5GALA 5JWPA 1R081 2XWJB 3FX3A 4MGYE 3IPVB 1BKZA 4RFT0 1XJAA 4OI1A 5CISA 3ZXDA 4KWJA 3D4KA 2B9UA 2R7EB 2Q8OA 5CBLA 4CCJA 4R4ZA 2BGCA 5FYMA 4P9LA 3U4SA 4YVWA 3AKRA 3I59B 4F8AA 1UO9A 3PVEA 1PO13 2FBEA 3GCWA 5GM0A 3VBRB 1PIV1 1TE1B 2WN3A 5JUVA 1VRBA 1EPWA 2MNGA 3ILNA 4MO3M 2WINB 3S0MA 1OLQA 2HH9A 1JOPA 1JOJA 4H2AA 4BYYA 4YM3A 5JSPA 1LODA 2AR6A 4XURA 3VZNA 5A7SA 1DDLA 1W6NA 4XW3A 4IEOA 1EV12 5FKBA 3OBAA 2PAMA 2FHRA 1OLMA 3JCIA 4PIXA 3IDAA 4SLIA 4XAAA 5SV5A 3WW3A 4IE4A 2EVXA 1QXPA 4UW4A 3L2YA 3WG4A 1NZCA 4BH9A 4JCKA 5JIAA 1SLBA 2FDKA 1ZREA 2GSYA 4QX0A 3MIBA 2AENA 4AHXA 3T1LA 3AYDA 3IKWA 5FYIA 1QJFA 2GN3A 1QNWA 2D98A 5DAPA 1GNHA 3VDDA 3TEXA 4URAA 1XNKA 2VNRA 5ABJB 1COV3 1FPN2 1DCSA 1V0AA 4FFHA 2VNVA 3USUA 3AC0A 3I2HA 2G9ZA 4QKBA 2C4XA 1NX9A 3RVHA 3VKOA 4G4FA 4TN7A 2SLIA 3HWJA 4C1WA 1AHSA 3D5OA 4N53C 1BBT2 4XTMA 2E7QA 5F37A 1AYM3 3MGUA 1F5JA 3E5QA 4MXWB 5F5QA 4IE0A 2EALA 2OUJA 1W8UA 4FPKA 1J3QA 3UESA 4CCLA 5IVJA 2Z5WA 3GZAA 2WS92 4XMIA 2E7TA 5C6CA 4YNIA 2HWF2 1IZ3A 1XQNA 4OMCA 1WLDA 2OPWA 1HQNA 3UNPA 1ZRIA 1FATA 2Q8DA 1GZ9A 5FLIA 2TNFA 1NCRC 3ACHA 3N3HA 4LMFA 4YZ2A 2DF7A 2BERA 4FOWA 2KXLA 3HNBM 4HMZA 2E51A 1W6PB 2GC2A 4NHLA 1Z7S2 1R082 1D4M3 4RN5A 2WA4A 2J1EA 3NV1A 3VD4A 4LO8A 3AZVA 3VBRC 1GOFA 1PO23 3OG2A 2RDSA 4RGKA 5ABJC 1ND2A 5C8WA 5CAZA 3N9OA 1QJX1 1FX5A 2JG8A 4AI2A 5JAXA 4QQHA 3WF1A 2Q0AA 1AR93 3RZHA 2FMYA 4KH9A 5A32B 1TMF2 3TN93 3ILRA 5A6XA 1X82A 2WLPA 3JD71 2VVDA 1WCUA 1NG0A 2W92A 4BB3A 1VMFA 4ARXA 4GAZA 1NT0A 4PI0A 4BQ3A 4JX0A 5F3GA 3GF6A 2W95A 4AFCA 1M06G 2RS53 3M3QA 2RR11 4LKDA 1FV3A 3AMNA 4BA6A 4ZZ8A 3AJZA 3NJVA 3B9IA 2VOWA 4YGDA 3PHMA 4COZA 3DF0A 3ZYGA 3VBOC 1YRZA 1ZZ7A 1A3KA 4XXPA 5DAXA 5J7MA 2HLEA 4JKKA 5A7PA 2BEOA 5D2AA 3B7MA 3WW2A 4FTEA 3MV01 2WN2A 4LHNA 4MGIE 4QU2A 3U75A 4CEYA 5FP7A 1X8MA 4C90A 4Y1ZA 4YGEA 2Z79A 1POV1 2F4LA 5A33A 3SH4A 2ZHKA 1RJ8A 5FCCA 2GC3A 3AKQA 5TSWA 1HB4A 4FPOB 1Y3TA 1FNZA 3DEMA 1IPKA 3MIDA 3WUDA 1OF4A 4IESA 4RL7A 3ZR5A 2IUWA 3MF6A 1LHOA 1NQJA 4H7LA 4GB33 1QH7A 5FR3A 4R8HA 1O5UA 5A7WB 4CCEA 2XBO2 5LY1A 1GQGA 3HMYA 4XVHA 3OEAA 3MW3A 2ZEYA 3E5XA 2VVEA 2XJRA 3PMSA 4V1PA 3T3YA 1QQP2 1S0DA 1ZZBA 2WZ8A 2AC1A 2GU9A 5C4WA 2DUOA 1O59A 3ZFFC 2WO1A 1JXNA 4M00A 1QHDA 1R093 2FQPA 1N1VA 4OCTA 3K75B 3SKVA 2PA7A 2HWB3 1V9U3 4KGQA 3PIJA 1YLLA 1VBC2 2ORXA 4CDXC 2CWSA 3T0AA 4AI9A 1A8DA 1RUI2 3WY6A 4AI3A 2ENRA 2VE1A 1W6MB 2RMU3 1LAJA 1SLAA 3ACIA 4NROA 1BEV1 3AJYA 1VJ2A 2CGPA 3P6BA 3MV11 1WCDJ 2VQ0A 2W87A 2Q8CA 1XNDA 3A21A 1VMJA 4Q0VA 3NAPA 4K20A 3CLPA 3ZXFA 3FZ3A 2W08A 4XUTA 3V0AB 1S2KA 3NMBA 3N4MA 5F2SA 4KMQA 1ZBE2 2WQ8A 2BVVA 4RR3C 2ZGTA 4LHSA 4XXAA 4IQPA 3LEIA 1PNGA 3FUQA 4O7XA 4XCAA 2V5DA 5C9AA 4JDNA 3WHUA 2A3WA 2OZJA 1CAXB 2WS91 3I2JA 3IMNA 5K4LA 1WW5A 2BRTA 1WMFA 1W04A 2WFF1 1WW7A 1ZBA2 3ETPA 2ARXA 5K9YA 4LQRA 4Q4Y1 1EUUA 4IEYA 4WZCA 3VBUB 4Y24A 1O3RA 2D43A 4JDOA 5C5TA 1SCRA 3PVBB 4Q4V3 1AXZA 2E31A 3O12A 2J1UA 5IVYA 4QPGC 4AZZA 5IYYA 1FV2A 4DB5A 2GNBA 2WNVA 3X29B 4CCCA 1JZ6A 4KWKA 2WT1A 1QEXA 5FZ6A 3U10A 1NA1B 3B69A 5GZGA 1WBLA 2P4EA 3AMHA 4LO5B 2D6LX 3POEA 4I3GA 1GKBA 2J1SA 3ENRA 3KV6A 5H9RA 2JG9B 3SH5A 3ECQA 5GLZA 3W20A 5CNAA 2IVJA 3WDUA 4YZ4A 1O3TA 2P17A 1ULPA 2TEPA 1CIWA 1JS9A 2VNOA 1PVC2 1LHVA 2BJSA 3SNMA 5CKMA 4L2NA 1XYPA 3UGGA 4LORA 2VULA 4DEQA 2FCUA 3D6EA 5L9RA 1RUF3 2P1BA 1FMD2 1H30A 4Z07A 1ND2C 3PVOA 3ZN6A 3OF1A 1PZ7A 1FOD2 4AL9A 3SEPA 1MEC2 4U2AA 2YC4A 2YBSA 4UW5A 3WQ1A 3BTXA 1UU4A 1OC1A 3DXTA 5ACA1 2BTVC 3K2OA 3H8OA 3Q8EA 3ZXJA 4Q4W1 1R1A2 4QGNA 1IS6A 1NQDA 1ZRCA 4ITCA 2VD7A 1W05A 2XLFA 4K7JA 2IZWA 1J84A 2ZA9A 4CU7A 1DYPA 1VMHA 2K9ZA 5BXXA 1PMIA 2QQNA 1ONAA 3F95A 1CESA 4PBPA 3IWZA 4URTA 4BQ2A 3LCPA 4TLFA 5FZAA 2A3XA 3GYDA 3A7QA 3PU3A 1Q43A 4D7YA 2IFWA 5F1RA 3ZYFA 2CGNA 3R4UA 4WVWA 1YEWA 1IHMA 2VU9A 1UY3A 1VIWB 4AOCA 4AEJA 4EZHA 1LULA 1JN2P 2DVBA 5BNOC 1FI2A 1QKQA 3LDRA 2H0VA 1W2NA 1F2NA 3LZZA 1F5FA 3N36A 4LK6A 4XMAA 3A22A 4DEVA 1BMV1 5KXEA 2RM22 4UFMA 1IPSA 2MHFA 1Q8PA 2ZHNA 3EO6A 2D3SA 4FPCA 2IXCA 5JZGA 1WA4A 4IEVA 1VBD3 1AZDA 3LD8A 4RQPB 3TNPB 2AREA 4XFFA 4E4ZA 2VL4A 1D4M1 1G9FA 3QH7A 4JHTA 4O65A 4RHV3 1RUC1 2GMMA 3RFRA 1IKPA 4LUMA 1DYKA 1RIRA 3P3PA 2ZGQA 5FY1A 4AQSA 1CX4A 2WWUA 1C8M3 1ODMA 4XF0A 4J1WA 2PMWB 1AR83 4AI8A 1FNYA 1RUH1 1W8FA 2XKOA 1R091 2A7AA 5FYSA 1AR91 3O1RA 4A7KA 4J6GA 4NIAA 1QJX3 4NHXA 2WDBA 3TB0A 1H2NA 3CDZB 1XE8A 4C8DA 3U14A 3O1PA 2DUQA 1HN1A 3N9QA 5DDJ2 1XOYA 2RG4A 1W9YA 4J25A 5EJ3A 3MW2A 4KBZA 1J1LA 1HRV2 1MQTB 2P3KA 3OD0A 3ZMOA 2C9AA 1UPSA 5A6ZA 2PHRA 1NXD1 2WNUA 3GXUA 4AW7A 4BK5A 4MGKE 5FUIA 2ADEA 5EIYB 2VW1A 1E57A 4EN7B 5BYNA 3VL9A 5IFTA 5FZGA 1GICA 4IE5A 4WVZA 5A80A 4E8DA 4EYUA 4XFAA 5FUNA 1OLRA 1WD3A 3K3NA 3S5AA 3VDCA 3NNJA 1JYTA 3PMEA 1CX1A 5JZGB 4BDVB 1B35A 1F15A 2QQPA 5DZFA 1G8WA 4Q27A 2MEV1 3ALQA 2Q1MA 5A3LA 3TYJA 1CZSA 1C57A 4NN0A 3VD5A 4FQZA 2R49A 1WW6A 3A0KA 4EV0A 1RUE2 3HJRA 5DDJ1 5FPUA 2XH6A 3MFAA 3NVCA 4D8MA 3ZN5A 2B5HA 1ND3A 1HQLA 4E27A 2DWRA 3OYWB 5BNOA 1Y7BA 1DGRN 4I02A 3VDBA 2JJ6A 3MFCA 4XE9A 3J26N 3JXSA 5A7OA 1RUD3 4Q26A 4XQDA 3MHZA 1C4RA 2VR4A 1YC61 3FUOA 1OPOA 3N35A 4AHYA 4MOAA 4MZUA 1NY72 2C5DA 2WZR1 3DPRB 1UYXA 4LPLA 3L2HA 4RS5B 1WKYA 4QKDA 4CTEA 2JE7A 3BU0A 3I3QA 2E53A 1RVF3 1FMD1 3JBG1 4IE6A 5EV7A 1GP6A 5FYVA 5BPXA 3MPBA 4HSLA 4COVA 4XJ8A 5KWRA 1BBT1 3VD3A 1W9SA 2P37A 4PCRA 3R4SA 2PHUA 2Y6JA 1W9FA 3KCXA 1MPXA 4ZXKA 3WDWA 4CU6A 4QM9A 3T0BA 5A6YA 2RMU1 4HKOA 2SBAA 3SITA 1WWYA 1XB9A 3AFGA 4TTGA 3ZN6B 2PHDA 2R063 3GHMA 2A6YA 4JQRA 4K8FA 5EP9A 3I8TA 3M7AA 2Q8EA 4CDUC 4FAHA 3TEZA 2XUEA 5FY4A 1C3HA 3OTFA 3T08A 4AI0A 4E4SA 1W28A 5GJ6A 4FTBA 2ZGNA 2X5IB 3VKLA 4HFSA 1L7QA 2ADDA 4QDRA 5C5UA 1VRH3 3WNLA 2R1BA 1AYN1 5DN2A 1IQDC 1GSLA 1KEXA 3WD5A 3H3ZA 2RJ2A 1VBA3 3VDAA 5LBBA 1Q5OA 1Y9MA 3TAYA 2DUPA 3KVBA 4AK3A 3IDEA 5I0SA 4L0PA 1G9AA 1V6OA 5DUVA 4ARYA 3AP5A 3LIGA 1S0IA 1C28A 2EXKA 2Y8KA 1HLCA 4PIYA 3VBOA 4QPGA 4UWDA 2GNDA 3R6SA 2F17A 3KT4A 5FUPA 4IEXA 4ZPIA 3OPWA 2JDMA 4HZFA 4JDMA 1YIFA 4YW5A 4RQPC 1AF9A 4N43C 2LROA 1W9WA 5KR7A 3O1OA 2RJKA 2ARBA 2VVFA 3VBSC 2ZS6B 3KCCA 1G7YA 3MEPA 3H0OA 4UFLA 4GB32 2XVGA 1XU1A 3K48A 4XIKA 3THDA 3ZYPA 5K0UC 3E5UA 2VNGA 1UYPA 5FMDA 3V0AA 2RS51 5ANNA 4YW2A 3SLIA 3ZR6A 1T2XA 4HETA 2E9QA 5EJZB 1ENXA 1XNTA 2C26A 4Z82A 2LS6A 3AP7A 1Q8VA 4M3CF 1RHI1 3RS6A 2P2KA 3RPQA 1QU0A 1C8NA 2NMNA 1J83A 5FK8A 2BFUS 2RE9A 1RUJ1 4FT8A 1FYUA 3IMMA 4ONUA 5F6LB 4CDQC 3GBWA 4D3WA 1PK6C 2VZ3A 3TBDA 3U4XA 4NPLA 4D7SA 1DP0A 2WL1A 4LITA 2YBPA 2VZVA 5HXMA 2GZWA 1S2BA 5FMOL 2BDRA 1NA1C 3T1MA 1GU3A 1HV1A 2Y6FA 4KWLA 2ZKLA 3KGLA 1IS4A 3CJIC 2X5IC 4GH4C 3S57A 4Q1RA 4JGZA 4LA3A 1D2QA 5FP9A 2OQ7A 3QLQA 2QCSB 4KBBA 3T30A 1GWLA 1NCRB 4FP2A 4JTNA 2OIIA 3W59A 4WZFA 4KU8A 1D7PM 1UWWA 2D5FA 4FPHA 3POYA 4Y22A 5FPBA 1N1YA 1PGW1 5A3NA 1OD3A 2P3JA 1COV2 1EYBA 2XVLA 4Y1VA 5EYXA 2PYTA 5FBZA 3GZTB 3IT8A 3RQ0A 1FXZA 3MLLA 1GQPA 5F5IA 1BBT3 1URXA 1QOOA 4YW1A 4M01A 2MEV2 2Q1FA 4QPYA 4NAOA 4PHZA 3SHRA 5C9AC 1I1EA 4EN9B 5FXZA 5DUXA 4RS5C 2PHTA 2ZPXA 2Q30A 1H8VA 5GZEA 5KXCA 4QX1A 5C33A 3ELNA 2DDUA 2XONA 5DXDA 4GD4A 4N7IA 2GP3A 4OUEA 3N9NA 2WZEA 1SACA 1ZM1A 1U0AA 2WA3A 3I2GA 5BNQA 2EXHA 4CRQA 2IXKA 2HKXA 1LU2A 5A7NA 3UJOA 1ZZ9A 2XBO1 4K1ZA 2NN8A 1TG7A 4E2SA 1NY71 2WZR2 2YMZA 5FK7A 4Z2WA 1LOBA 1SLIA 4MSVA 5LBCA 5KC6A 4FFFA 2AEYA 1QWRA 1OH3A 2QDNA 4YZ1A 1CJPA 1OD5A 4NR1A 4PQ9A 4UBGA 1W8OA 1O4ZA 4PJYA 4XHXA 3WNOA 3ZPYA 3POIA 5FQ0B 5EWSA 4AG4A 1O3SA 2FDFA 4SBVA 2P34A 1W6OA 3PUIA 1YIPA 3LA2A 3I3BA 2OX0A 5FZ0A 3I2OA 3HAGA 1KRIA 1QY4A 3ZSLA 1KDMA 2A5ZA 3ES4A 2VTXJ 1LHUA 2B45X 3THTA 4BLJA 3A23A 4XFGA 3LEKA 4UFKA 1CJDA 5L7OB 3FHIB 4OFGA 2C24A 4QX7A 1YYNA 3VBUC 3WXPA 3WX5A 3ORJA 2RS33 4LBKA 2RR12 5M0TA 1UNBA 1PMHX 3QACA 2DVDA 5C70A 5E16A 4AE2A 1EPZA 5EYYA 1PM7A 1BJQA 1IG3A 1Q8QA 2VCBA 4XJZA 1XSRA 3O1UA 4I0BA 3VLBB 4BQ4A 1QDCA 2XJUA 4LKSA 1F4HA 3MIHA 1JMUB 1UQXA 4KGGA 3JBG2 4MXWA 1OLME 3OJBA 3UK9A 4META 1TVGA 4B8EA 4DO0A 5CFDC 4W6WA 4S2FA 2HEVF 5DG1A 1EP0A 4OQ9A 1W90A 2XKPA 3IIIA 4RHV1 3U1XA 2GC1A 3I3DA 4FXKB 1PM4A 1DGWA 1W2UA 3J7LA 1KD7A 3VV1A 3VBSA 3RWNA 3FN9A 1AL0G 3H3LA 1OOPA 2GAUA 1V6KA 1QOTA 4OUMA 4CCNA 1H1IA 1OOPB 2A70A 4Z2AA 1ZX5A 1XNCA 3CJXA 1R083 1CAVB 3IAPA 4FBFA 5T5LA 1K5JA 3HEIA 1LR5A 2QE3A 4GMP1 4XDPA 1K5MB 5FPLA 2UWCA 4ZU7A 3KV9A 2I74A 4HK9A 2VMGA 2WKKA 1HQWA 2OPKA 4V2WA 4WVVA 3UGHA 1AUYA 2QQVA 1MS8A 1UYZA 3WNMA 4BU2A 1UOBA 1EAH2 5LW9A 4IGOA 2B42B 3BGAA 2VMHA 4ES8A 3M70A 1LGCA 1XXNA 5A1LA 4TZDA 4R9AA 2HWD1 4CUBA 4YFZA 1GFF2 2VMFA 1QJY3 2VW0A 3WF2A 4C1XA 1LOEA 2E6VA 3PJQA 3O5SA 5IFPA 3DPRA 1YFWA 3D82A 1H2KA 2WAAA 5DUUA 1W3XA 5GLVA 4FXGB 4ET7A 2QZ2A 1RTVA 2VZTA 3SKJE 1TQ5A 4L8QA 1CVNA 1LB2A 4HVRA 4QMAA 3WP3A 3IPVA 1OVSA 5FO8B 3K4DA 1GWKA 1UKRA 4MXVA 1ND3B 4CUCA 5KHKA 1MQTC 1REDA 1PHMA 2PLV3 4LBJA 1JBCA 2YPJA 3K3OA 5LRRA 3VZLA 3BI3A 2EIGA 1YWKA 4Q4W2 2JD4A 3VD7A 5F3CA 1KDKA 4GWNA 5ACA2 5F2WA 2IXHA 3I2DA 4YG3A 1W6OB 2JICA 3POJA 3Q9OA 4KG0A 1EUTA 1B35C 3RJ2X 2NP0A 4W50A 1SZBA 3T09A 2YGLA 4DUWA 3WP4A 4YLZA 2F4PA 3VBHA 3B93A 2CHHA 3DN7A 4QHBA 1NCQB 4CU8A 2ILMA 2XBO3 4Q4X1 2VOTA 1AYN2 4OMDA 1OURA 2Y0IA 3GDBA 2VUJA 2HJIA 1QQP3 2VUCA 1VB4A 3V56A 5K0UB 1DZQA 5BNPA 4A7YA 2B39A 4CEWC 1A78A 1K3IA 2Y38A 3KQRA 3UKVA 5FZHA 4DXSA 1JYVA 1IKQA 4GMP3 3LEGA 2R0FA 1BZWA 1YCIA 1V6LA 3VHNA 1V9U2 3LOBA 5H9SA 2OKXA 1OI6A 1PGL2 3IDCB 1N1SA 1N47A 5LCWL 3ZFFB 4XF1A 3A4UA 5A3MA 4Y26A 2QNKA 2YYOA 3WW1A 4D0QA 5FP8A 1D0HA 1X8EA 2W94A 1MEC3 2HWE3 5B2GB 1PGL1 1YQ6A 4Y1XA 5L36A 1RB8G 2A1XA 2V4AA 3CKHA 2CDOA 3LKJA 3WQBA 4ZHNA 2ZGSA 2JDZA 4QXCA 2CNAA 2A73B 5FZMA 5T50A 4E4HA 4MADA 2GNMA 4ZY9A 2BP6A 2YDEA 5FDBA 3AMPA 5FZBA 3F2ZA 3WDYA 3N7KA 1UZZA 3I7DA 4XPVA 5T52A 5AC93 4I0WB 4A41A 4D94A 1CIYA 3U37A 4BQ1A 3S7IA 1JZ3A 4EN6B 4AF9A 4HLTA 2JE9A 1X7NA 2WNOA 4ISRA 4QPWA 5FBJA 5T54A 3NKTA 2N7GA 3DKWA 1BEV2 5KHIA 5IJRA 2FZ2A 1S55A 1O4TA 4CCOA 4YARA 1XYOA 3V65A 1MVEA 1DG6A 4H3WA 3SQOA 4NIDA 4Q0PA 4F7ZA 2FMDA 5ISLA 3KHBA 2HWF3 1W8WA 1VBC1 4XUPA 2AZ5A 2HWC3 3FLRA 3NNFA 2GN7A 3RSJA 1L7LA 2NZ9A 4IL7A 1Z0HA 3MIFA 5F32A 4W8JA 2D7FA 5KHGA 2CTVA 2FZ1A 3RNSA 4DINB 2Y34A 3HT2A 2XOMA 1V6IA 4J1XA 4AHZA 2QVSB 1SHWB 4FOVA 4IEWA 1VPHA 1PX3A 3OGGA 4RSUA 3ZMNA 2NM1A 1Q3EA 2QQUA 4JVAA 2JD9A 4PBOA 3EQEA 1UPIA 3OPTA 1J58A 1UOJA 1OFSA 1PO22 2ATFA 3CF6E 3GZUC 3LFMA 5A1FA 5C8CA 3MICA 1U5IA 2EAAA 2R0HA 1GNYA 1QXRA 2A75A 2QQMA 2Z42A 2VMDA 1SFNA 4P08A 2VBDA 2B46X 3AL6A 2G4IA 2CSGA 4NIHA 1ULDA 2RS13 2WFPA 2G19A 1DQ5A 3IM0A 2WYFA 2XVKA 2ZX0A 4JGYC 2EAKA 1HRV3 3M3OA 3OD4A 3DGTA 4CDQA 2ZKNA 1BHGA 3HBZA 1R1A3 4Z92B 2WZPP 3O1VA 4QX8A 4QT6A 2O8OA 3UGFA 1RUNA 1K42A 1X9PA 3ZXAC 3AXEA 1CPMA 4Y3OA 1NA1A 2VZRA 5JLVA 4B1MA 5HBAA 2D44A 3FC0A 4Y5Z0 4LR4A 1DLCA 2Y6GA 2ZTNA 4QQOA 1RMU2 3WCSA 3WEZA 4CDQB 2KM2A 1NE6A 1UX7A 4OULA 2P3YA 5EFUA 3S30A 3URFA 3LAGA 4R9BA 3WNNA 3FLPA 1N3PA 3QCWA 4XBLA 4LLFA 4C91A 2YC2A 1PO21 2WSVA 5JOZA 3JD72 4UBHA 1RHI3 3KM5A 3G6JB 3WDXA 4R9CA 2XPJA 1N1TA 2QUOA 1RYYA 2GNTA 1DZTA 5JOXA 4C0HA 3FFQA 3CBNA 5HXVA 4WBBA 3HD8B 1UY0A 3OUHA 4XJUA 2BFUL 3CIHA 3ZSMA 5FIXA 3EXUA 4KNCA 4LXLA 4YVWC 3TWIA 5JI9A 4LLOA 4YZ3A 5CG9A 5IK8A 2ZGKA 5FMOS 3T2PA 5G05L 5FYUA 1IQAA 3LSEA 1GANA 4LNVA 4YW7A 3PUHA 2FDHA 5IW0A 3B94A 4GJYA 1MS0A 3NJXA 4MHUA 4EE2A 3KLSA 4RS5A 1OSGA 3DUIA 5D8AC 4OHWA 4LBLA 4H14A 3KVAA 1ULFA 1PNFA 2RDNA 2AEZA 2JDYA 2DBNA 2HBTA 2AYHA 4IE7A 4OHXA 3ZIXA 4YRDA 2JDNA 2YPDA 1MEC1 1QJU1 3FJSA 3HNYM 4A44A 3T2OA 1REFA 3LA3A 1RUI3 4F3JA 1AR62 1X33A 3IIAA 4QPIA 1UY4A 4LIVA 5FP3A 4A45A 1DFQA 4FPGA 5HCFA 4JC1A 2UY9A 4N90A 3AMMA 1POQA 1G6NA 4IGPA 4BHPA 1JTZX 5J48A 4FOQA 5IVFA 1F31A 4GALA 2YV8A 2VZUA 2OZ6A 4OYUA 4NWWA 1S2EA 2JENA 2BNOA 1WLCA 4NJ4A 3FMGA 2J7MA 1HB1A 2WSUA 1T6BX 1JZ8A 3VZOA 1DGWX 1ZBE3 2RR13 4GWJA 1F9KA 4YFWA 3PLQA 1AR73 2R071 4XAEA 3ST7A 1GP5A 5JOWA 5CKNA 1CONA 2O1QA 3IDBB 1SG3A 4FO9A 2R041 1HV0A 4N9HA 1V00A 2JKXA 4FFIA 1GOGA 1TME2 4A4AA 3BTZA 3PIGA 5GZFA 4LKEA 3DYMA 2J22A 1UIKA 3DL3A 4IERA 5AFBA 2ZAAA 3JBG3 1XU2A 3T4VA 3VKNA 4DRVA 4NHMA 5DG2A 1NKGA 3SCGA 2J1RA 5JVVA 3DV8A 1OMIA 4N53B 1GP4A 1NE4A 1JH5A 1KS4A 2WIIB 3NAPB 2VZPA 1MZEA 2NYYA 1NCQA 5CVRA 5FY8A 4LHLA 4Q8KA 3I2IA 2OXBA 1ND3C 2C1FA 4S2DA 4XZUG 5FZ4A 2C0ZA 5FZEA 1W2OA 5HCAA 5HCHA 1S4CA 1W0OA 4RR3B 1FT9A 1W6MA 1TME1 4W6YA 5A6QA 1AX0A 1FMD3 1CQ9A 1AX2A 2R042 2XJQA 3H1YA 1RUI1 3KF3A 1E5HA 4QU1A 2YXSA 3TEWA 2WUHA 4C0BA 3KB5A 1S0CA 2R062 4K40A 1S0BA 3SH3A 4DUXA 2BOIA 3POBA 2G1MA 1KXGA 3ACLA 1W6PA 2PXJA 5C4WB 4AI1A 4OI2A 5FZFA 1K45A 1YFUA 4U36A 1RUG1 1WW4A 3OPZA 5G04L 2H6BA 1AL21 1ST8A 4E2QA 3ROUA 4UF0B 1XC6A 3K51A 1RXFA 2BBVA 3H50A 4BE3A 4XF4A 2XGXA 5AVPA 1DQ6A 2VMEA 5IK7A 1JYWA 4GJZA 1LHWA 2ZACA 2A6WA 4BK4A 2XQXA 4CCKA 5FYBA 1O6UA 2WFF2 3WOGA 3LQCA 4JKLA 4FP3A 5A33B 1QJY1 1GMMA 2PLV2 3BN6A 1Q8OA 4FPYA 2V4VA 3LOIA 3PUQA 3H8XA 4JV4A 2JECA 1O8SA 4TYSA 4FFGA 5CIRA 1ULEA 5E88A 4A6OA 3U11A 4CEYB 4DY5A 3ZIWA 3U78A 1RGSA 2A6VA 3ZFGC 1NCRA 5LWBA 4LHKA 3K46A 1AJOA 1WA6X 3ZO0B 1CAVA 3UV9A 4L11A 4K9SA 2FDJA 2BWAA 5JXIA 1B09A 4KI5M 4LK7A 4NUBA 2Y60A 1EY2A 1HRI3 1SQ4A 2WAOA 3EYPA 3G7DA 2R6QA 4S2HA 5C4WC 3AP4A 2Z69A 1ZRDA 4RHV2 3RZGA 5JPNB 2QJVA 2B9VA 3VBSB 5JZGC 1LOAA 1V70A 2EICA 1UZVA 4INDA 4NIGA 1XBFA 2XDVA 1LOCA 3RRDA 3HVDA 1O4YA 4CXXA 2QFEA 1C8M2 3RWKX 4XFCA 4XDOA 1ACCA 3KS7A 2LM3A 3M3IA 3GZEA 2GP5A 2WZR3 1AR81 3OGRA 2FDGA 1TNRA 1X9TA 2VQAA 1CZTA
chains in the Genus database with same CATH topology
2DCTA 4LT5A 4F83A 4GA9A 1LENA 3M2MA 1ND2B 3AX4A 4QQ2A 2ZGMA 3LWCA 3VBRA 3MI8A 1LGBA 4Q4Y3 1UKGA 2YHJA 1RMU1 1S0JA 5LK5A 1W39A 5T5JA 1KFUL 4EN0A 1O5LA 1VBE3 5D1IA 4EROA 4B7EA 3WR0A 3BB6A 2XB6C 5FLJA 2CGOA 2DURA 2RS32 1H4HA 1VBB1 4Y4YA 2DFBA 4AVBA 2R32A 2I2SA 3KGZA 4AFAA 1RUOA 3VBOB 2WLQA 1ZA4A 2EXIA 4IETA 2DCKA 1SDWA 2WNEA 4XJAA 1CD3G 3A0NA 3ZFEC 4I3PA 1JYIA 5HI0A 3H1WA 3RYPA 4MYEA 4DQAA 2DVGA 3T2TA 3VDDB 3APBA 4XJWA 1BYHA 2R30A 1OQDA 1RUD2 3CJIB 4GH4B 1AL22 2DTYA 3WG3A 4BMEA 1H2LA 2BWCA 4MGZE 2PHXA 4I30A 1LJ7A 1JUIA 4Y1UA 4CDUB 3KT7A 4X8PA 4BWOA 1DQ2A 1HW5A 2ZX3A 1IS3A 4LBMA 4B7KA 2CAVA 3KT1A 2D97A 4RD7A 2WWSA 1DGLA 1PO11 4IEUA 2A71A 3AZWA 4Q0QA 1HX6A 4ISQA 1Z7S1 3ZYIB 1EAH1 5K7PA 1VBB3 5E89A 4ASLA 4LE4A 4Y22B 4YVSC 1JHNA 4AGVA 1PZ8A 4GMP0 1PIV2 4YVWB 1H8TB 1QMJA 2EF6A 3J4UH 3KCYA 5LEKA 4YM0A 4Q2FA 1GNZA 4XJ9A 4XF3A 5CFCC 4JTOA 3U07A 2WT2A 5GKAC 4HSJA 3AKTA 3ZFGB 4MX3A 4OHYA 5H9QA 4P9JA 4KQ7A 3WCRA 1SLLA 3SXWA 4E4DX 1V6MA 1B35B 2ZGLA 2LUWA 4RR3A 5I0UA 3SISA 4BIOA 2BYVE 5FQ0A 5I93A 2R072 4PF5A 5ACA3 4LEJA 5GLTA 4DPNA 2YY1A 1QGLA 1ASJ2 1WGPA 2OA2A 5I8SA 3WQ0A 4KU7A 3B9CA 1IPJA 2WNUB 3NV4A 2HWD2 5I91A 3RYKA 1UU6A 4XZPA 4FPEA 1UCXA 2HWC1 4XYXA 3AMQA 1AYN3 2A6XA 2UURA 2WNVC 1AR61 3MW4A 5CB7A 3WNXA 3NV2A 3FLTA 2XJPA 4S2GA 4ES9A 1SBDA 2DVFA 4LO6B 4EWEA 4AQ6A 5J36A 1S0GA 3JU9A 4HKLA 2K2SA 3WVJA 4QPGB 3VBFC 2UY8A 3H7JA 2E7AA 1FAYA 2MPFA 1G9DA 2ZX1A 1SLTA 2DU1A 1WBFA 3MIEA 1H9WA 1RUE1 3U0ZA 4AEKA 1GBGA 4YYOA 1GZWA 1U5XA 2HWE2 3IBMA 1A8MA 2WC2A 4QGMA 5ABJA 4JGZB 4MUVA 2X5IA 2PFWA 1ENQA 4I0AA 4P9IA 4HN1A 4HL0A 2W0XA 5J3UA 3M1HA 4QPIB 4K6BA 4D69A 1OPMA 5KBFA 1WD4A 3TN91 1DQ1A 1KITA 5I0RA 4LBOA 4MLOA 2IWGB 2ZMNA 2AGSA 2GH8A 4B3NA 2CYFA 5LK7B 1AXKA 2QKDA 3CEWA 5JSOA 2TUNA 4LO7A 5L19A 3RI8A 3ZXEA 3CNAA 1BEV3 2OVUA 4H7MA 1JYCA 4MH0E 1A6CA 4X8NA 4DNYA 3M8LA 5FOJB 1QJU2 2HEWF 1PGW2 2BPA2 3JUUA 5JDBA 1RUH2 4AFBA 3VUOA 4EJRA 4O9GA 2RS31 1NLRA 1J59A 3IN9A 1UF2C 5CA6A 1DZRA 4IV1C 4WVMA 2CY6A 1H1MA 5BNOB 3M3EA 3V64A 1MS3A 3USSA 2I45A 4MV2A 2ZGOA 4NO4A 4XQ4A 1QDOA 3ZXLA 1OA4A 2AH2A 1RINA 3J8F2 4L99A 4LA2A 1QXJA 2JG9A 2D6KA 2GALA 1UIJA 3B01A 3RDIA 1MS5A 1UX6A 2NPIA 4DY3A 2CAUA 4I01A 5GLWA 1DGRA 2VXRA 1J1TA 2ZHMA 3EHKA 4R9DA 5FAXA 1LECA 2VMIA 3NSTA 5I8TA 5IUQA 3OBRA 4Y20B 2K0GA 3VBUA 4GB31 5E1RA 3P3NA 4F7ZA 2XL7A 3OGJA 4FAGA 5FPXA 2WFF3 4XBNA 1O91A 1COV1 1W6QB 3E6BA 1CAXA 3TRSB 1UMZA 4JRLA 1UZYA 5C8CB 1VBA1 4QD2A 2EA7A 3WP5A 5I8YA 1WMEA 3I54A 5BNNA 3JD73 1DIWA 4NOTA 3VN4A 4BZ4A 3VZJA 2HWC2 5CFDA 1V6JA 4CP0A 3WHTA 2Q1ZB 1CPNA 3I4IA 3O7OA 2DFCA 1ASJ1 3JQXA 4IV1B 4COYA 1GV9A 4HN0A 3C3VA 3GHNA 4EWDA 3OYWA 1IGOA 1V9U1 2NQYA 2W52A 2ZX4A 3HR9A 1HXS2 3ZXKA 4CDXB 5JCTA 1RUG2 4AEDC 4G3YC 4LBQA 4QQPA 3TOJA 1LESA 2EXJA 1EAH3 2VUAA 2RS12 2PELA 4ATFA 1AR63 4Q4Y2 2JEMA 4JGZC 4DFSA 1BXHA 3H1MA 5L7OC 1AX1A 1XYNA 1AYM1 3POSA 3VHPA 1EV13 1H0BA 4Q29A 3ILFA 3DPRC 1PVXA 2LALA 2VW2A 3GNEA 4BLIA 2ZGPA 4WM8B 4IEQA 3MPPG 3O0VA 2OUHA 4OUSA 1KQRA 4AGGA 4LULA 3B5LB 1AR72 1MQTA 2RJLA 3LGRA 2WT0A 1QNYA 3JB4C 4Q4W3 5FLHA 1ZRRA 2WQ4A 4AVTA 1VBE1 3GBGA 1DQ0A 2XUMA 1SBEA 2GDFA 4Q4V1 2ZZJA 1RHI2 4AQTA 3ZDSA 1PGL2 4XFBA 5K0UA 3W9AA 1TME3 4P9YA 3UJQA 4PLOA 3R05A 5BUVA 3PNAA 4CEWB 1N3QA 1LRHA 1OQ1A 1H1AA 2P3IA 3POWA 1OA2A 2ET1A 3ES1A 4NWVA 1HXS1 4RA0A 2D3PA 4XFHA 4AEDA 4E2GA 1Y9QA 2Q4SA 5LRSA 4R4XA 2UYAA 4RQPA 1ZRDA 5JIUA 3RMYA 3GALA 4E9KA 4YW3A 3RMXA 4Y20A 2WNVB 3SCHA 2XHKA 1N3OA 4CYDA 4UXAA 2X29A 2JG8B 4QGLA 2X8KA 1I5ZA 4IEZA 2QZ3A 1ALYA 1QF3A 4WM8C 1WUVA 1JW6A 3VZKA 5JSRA 2D40A 2XJSA 4K3UA 4PLMA 4YW4A 1H4GA 4M3CE 2R16A 1VAMA 1YJLA 5D8AA 4OLLA 2V09A 2F6BA 1VBB2 1AR92 1VAVA 1VBD1 4AVSA 3AZXA 4DMIA 3BOWA 5IK5A 3BODA 4XQWA 1YO8A 4HANA 1CR7A 1BQPA 3VHOA 2WJSA 4HPKA 2XG3A 3WW4A 4M0HA 1MVQA 2BVBA 4FSJA 2ZHLA 3SMHA 1AVBA 1GR3A 5FRAA 5AC92 1WCKA 1C1LA 3M4FA 5IT6A 4LTAA 5GLUA 1X36A 1K5MA 4H55A 3USUB 4ZKTB 1G9CA 1BMV2 3VZMA 1S1AA 1D0GA 1T6GC 1POV3 4B4QA 5AFEA 2B7YA 2PTMA 2ETEA 3AZZA 2HWB1 1SCSA 4NHKA 3WG2A 4CZSA 3RG0A 1HRI2 2VGDA 1SEFA 3KMHA 2JXAA 4JRAA 1QOSA 5AC91 2HWD3 5AVAA 2CWMA 4TSVA 4GWMA 1R1ZA 1SBFA 2ZJCA 3QD6A 3OCPA 3RI9A 4WV8A 1LEDA 3J9SA 4FOYA 1J3PA 1O7FA 2GMEA 1ULGA 1BVVA 2D5HA 3WQ7A 4IV3C 3FBMA 2B8MA 2HWB2 4N9IA 5K8SA 3INAA 4M0NA 2XL9A 3AYAA 2YC0A 1C1FA 3OY8B 3JB8A 2DCZA 1S0FA 5L7OA 3AB0A 3MLJA 4GXLA 3VDDC 1DLLA 1QJZA 2ET7A 1M4WA 2TBVA 2IXJA 4YG6A 1BK1A 2GC0A 3C2UA 1RMU3 1O3QA 1SLCA 2WNUC 2D6PA 1WMDA 1ZYBA 2CL2A 5A32A 4HKWA 4Q0SA 1ZZ8A 1L3JA 3AM2A 1PGSA 1MZ5A 5JMCA 1OA3A 4AYUA 1ZVFA 3VBHC 3KSCA 2PN5A 4L9BA 1BCXA 3SCFA 4IXLA 2XJVA 4FQ4A 4FPJA 4L92A 5BY5A 3FWEA 2JX9A 2ZBJA 3ATGA 1RUC2 1R1A1 4WM7B 5KHJA 1UN1A 2XJTA 3PTYA 2X53S 3VBFB 1PK6B 1UL9A 4XOGA 2DTWA 3E6CC 2RM21 3BTAA 5J98B 4RGAA 2DV9A 2WQZC 3HIFA 3HT1A 4BCUA 1AXYA 4LBNA 1OOPC 4CP2A 3UKNA 4QXKA 4HBNA 1PO12 2VPVA 4PIZA 3NJZA 2ZGRA 2D3RA 1PVC1 1NLSA 1Q56A 1YI9A 3MF9A 4AWDA 4QPIC 4YVSA 1DF0A 4IV3A 5CG8A 2IXLA 4FPFA 4PDWC 1U5YA 4RGGA 5T3NA 2OW4A 4XF9A 3L9JT 4W6XA 3WG1A 1LU1A 1VBE2 1SMVA 3WINE 2ZMLA 2ERFA 1I9RA 1WCSA 4D7TA 1PK6A 4CDUA 2Y26A 4Q4X2 4OHVA 1W6NB 4AVVA 2VOVA 2GMPA 3ZYRA 4A7ZA 2VECA 3CJIA 4GH4A 2O0OA 4JAAA 1Z78A 1WLWA 1AYM2 3TNQA 5KC5A 2XWBB 5GZDA 3CO2A 3THPA 3ZFEB 2DYCA 5FOBB 1TNFA 2WS93 3N7JA 3VKMA 2NMOA 3ZSEA 5BNPC 1LHNA 4XIOA 3WV6A 1KS5A 1ASJ3 3JZVA 3MYXA 1IOAA 5BNNC 2BQPA 4COWA 4EN8B 4X6RB 1MS4A 4N43A 1ULCA 4L97A 4N43B 1MS1A 1U12A 2H6CA 1ZNPA 4YGBA 3NWKA 1Z7S3 3OY8A 1V6NA 4UW6A 2PQQA 4YM1A 1ZBA1 4JGYB 5JOYA 2YGMA 3R0RA 3NL1A 2V73A 4P9XA 1AR82 1HXS3 2R043 1RUD1 2W68A 1SFYA 3FE5A 1HKDA 5IK4A 2Q5TA 3J8F1 4W65A 1QJX2 3AP6A 1ZBE1 4A2UA 1I6XA 2KA3A 1TEIA 2ZGUA 1LEMA 5FREA 1IS5A 5L73A 3H7YA 3AKPA 1YHFA 2G9FA 2PAEA 4KL1A 4XILA 5JR7B 2LTNA 4P14A 2VH9A 1NYWA 4BIFA 4AEDB 1BVP1 1ENRA 4AEMA 3NW4A 4DXZA 4A3XA 2E63A 1G9BA 2HYKA 4GQ7A 4PLNA 1UW8A 1GLHA 1RUJ3 1VLNA 2PLV1 4MVTA 1ZRFA 2QDRA 4XHBA 1DU3D 5JI7A 2ZABA 1LCLA 1ZBA3 1YI7A 4YVSB 1YFYA 1YNAA 3AXDA 3I59A 4BM8A 2D6MA 2PHWA 4ATEA 1FPN1 2VOKA 5CADA 4Q8LA 3KD4A 4WM8A 1U5ZA 2D93A 3AYCA 1C8M1 1HRV1 4Q0UA 1NOVA 3WDTA 3AP9A 2A6ZA 2PHFA 3V0BB 4GKYA 1VALA 5DUWA 3ZSKA 2DCJA 2HWE1 4M3CB 1C5HA 3VBFA 3ZVXA 1CAWB 1R092 4PDWB 5FO7B 2DVAA 4WM7A 1WLTA 5D8AB 4UW3A 4LBQB 4XDQA 1RITA 3D8CA 4BMBA 4Q1PA 1CN1A 4CDXA 2BUKA 3CU7A 3NO8A 3RYRA 4N7UA 1HRI1 4AXOA 1CAUB 2ZX2A 3WT3A 5JPMB 4HT1T 4AQ2A 4OI0A 3D0SA 3VHRA 2ES3A 5HCBA 4G9SB 1GYKA 5LEJA 1TMF1 1F8VA 5CFDB 1MZ6A 2ZOEB 1FPN3 4N53A 2ZZQA 5FFOC 1UU5A 3KZ4C 2HEYF 4X6QB 1D4VB 1ZZ6A 1AJKA 1LGNA 5BNNB 2IFRA 4K21A 5FPZA 4LE3A 1X50A 1CGPA 4Q4V2 3ZXGA 3ZSJA 3O0XA 3BU7A 1QJU3 1VB2A 5EZWA 3WP6A 3ZX7A 2RM23 1AL23 1GZCA 1UAIA 1EV11 3OBTA 5CU1A 4DZGA 4FPLA 4WM7C 1DBNA 4Z8BA 3M3CA 1VBD2 3AZYA 4XFIA 4XTPA 4YZ5A 1ENSA 2PHLA 1FOD1 1VRH1 2V5YA 4I2OA 4HVQA 1H8TC 2BNMA 3MDPA 3ETQA 3ASIA 1RL3A 1PVC3 3GBFA 1D4M2 4P9WA 1S0EA 2UWAA 4PDWA 3N7MA 1RJ7A 4EWAA 3FFZA 1RUF2 1CAWA 2O8QA 4M3CA 3J8F3 2OYZA 1APNA 1J3RA 2RS11 4AVCA 1C5IA 1TMF3 3TN92 1PIV3 4CP1A 2ZAHA 4P5HA 5DZGA 4OVEA 3WDVA 2XLAA 4WVMB 4AGRA 5E8AA 4O9EA 1YUDA 3S6PA 4CDWB 3WZ1A 4YSFA 3H3UA 5BV6A 3B02A 1YJKA 5CFCA 4LBQD 4YGCA 3FBYA 1YXWA 2JG9C 2RS52 5T5OA 1DQ4A 4BOWA 4CEYC 3RJRA 3ZN4A 4OI4A 4ZU4A 4HPKB 3AK0A 4QM8A 3PJYA 4Z1VA 5KHHA 1AR71 1OKQA 2R073 3W58A 4IEPA 2Z2SB 1H9PA 3H9AA 3N7LA 1JUHA 1RUE3 2ZMKA 2MEV3 4LO4B 5GZCA 2VG9A 1VAKA 4Y1YA 4NPRA 2IC1A 3QH6A 4ASMB 5F9TA 3R4DB 2VY0A 3BOPA 2AUYA 4B29A 3AFKA 1GZWB 1OHFA 5FTTC 4GIQA 2PAKA 3LSDA 1RUG3 1NCQC 3B00A 3QOPA 5C9AB 1Q8SA 2JKBA 4JGYA 2UU8A 4DRRA 5H9PA 2Y0OA 1H2MA 2ZCWA 1VBC3 1LTEA 2H0BA 3B3QE 3HN1A 2UWBA 4XETA 5KXBA 5DDJ3 1VR3A 4CEWA 2RMU2 3NAPC 2D6OX 1KJLA 4KG8A 1NXMA 5FO9B 2CV6A 3HQXA 3JQWA 4ZU5A 1OFNA 2G9GA 4ORFA 2YZ4A 1LOFA 1REEA 1LKNA 3UKTA 3S7EA 4LUKA 4R52A 5CFCB 1D2SA 4QX5A 3LB9A 5J37A 1XE7A 3BPZA 4CDWA 3LA7A 3ZFEA 1CAUA 4Q4X3 4HVOA 1LOGA 2UYBA 1VBA2 4P9GA 3O0WA 3E97A 3BIWE 1Y43B 4XEZA 4QQLA 4YG0A 1GQHA 4DOUA 1MACA 4TWTA 1MR5A 3BCWA 3D0JA 5T5PA 4FTSA 1RVF1 1HDKA 5I0TA 2R1DA 3ZFGA 3EJKA 5F6KA 1RUH3 3UL2A 4B4PA 3MZHA 4GKXA 3ME2A 1DHKB 4DS0A 4HK8A 3EBRA 1MZFA 1QH6A 1ZZCA 4NVPA 4BPZA 1QQP1 4IV1A 1RVF2 3VGIA 4IV3B 1HIXA 1OQEA 1H8TA 2D6NA 2BNNA 5J09A 4OZXA 4AFDA 3PVNA 1VP6A 5DZEA 2YROA 4AFMA 3E6DA 5T55A 3BALA 3CL1A 2JG8C 1W0PA 1KFXL 1XRUA 5KXDA 1FOD3 4FVVA 4B4RA 1XNBA 3ZFFA 1YFXA 4CDWC 1MS9A 1RUF1 4AVAA 5C8CC 3MLKA 1UD1A 1QJY2 1W6QA 2HWF1 4OHZA 5SV8A 1VRH2 4XBQA 5BNPB 1LOFC 4AHWA 2A3YA 3WLUA 5EXOA 2W39A 4FCAA 2NLRA 1RUJ2 3AYEA 2DU0A 3NKGA 1POV0 3NV3A 2YUEA 3VBHB 3RZZA 4I09A 3QBQA 2XLGA 1RC6A 4K1YA 4COUA 3AKSA 3MIGA 1PZ9A 2GH2A 1I3HA 2RHPA 4GULA 3VKFC 2IXIA 3VL8A 2R061 4YM2A 1KJRA 1G86A 3WUCA 1K5MC 3H8UA 1RUC3 2VOXA 2BW8A 3V0BA 3ZYJB 2I07B 2DCYA 5JWPA 5GALA 1R081 2XWJB 3FX3A 4MGYE 3IPVB 1BKZA 4RFT0 4OI1A 3ZXDA 4KWJA 3D4KA 2B9UA 2Q8OA 5CBLA 4R4ZA 2BGCA 4P9LA 4F8AA 4YVWA 3AKRA 3I59B 3PVEA 1PO13 2FBEA 5GM0A 3VBRB 1PIV1 1TE1B 1EPWA 2MNGA 3ILNA 2WINB 3S0MA 1OLQA 4BYYA 4YM3A 1JOJA 5JSPA 1LODA 2AR6A 3VZNA 1DDLA 1W6NA 4XW3A 4IEOA 1EV12 2PAMA 2FHRA 3JCIA 4PIXA 5SV5A 4SLIA 3WW3A 2EVXA 1QXPA 4UW4A 3L2YA 3WG4A 1NZCA 4BH9A 4JCKA 5JIAA 1SLBA 1ZREA 2GSYA 3MIBA 2AENA 4AHXA 3T1LA 3AYDA 3IKWA 2GN3A 1QNWA 2D98A 3VDDA 1GNHA 1XNKA 2VNRA 5ABJB 1COV3 1FPN2 3USUA 3VKOA 4G4FA 4C1WA 2SLIA 3HWJA 1AHSA 3D5OA 4N53C 1BBT2 4XTMA 2E7QA 1AYM3 3MGUA 1F5JA 3E5QA 4MXWB 5F5QA 2EALA 2OUJA 4FPKA 1J3QA 2Z5WA 3GZAA 2WS92 4XMIA 2E7TA 5C6CA 4YNIA 2HWF2 1IZ3A 1XQNA 1WLDA 1HQNA 1FATA 1GZ9A 5FLIA 2TNFA 1NCRC 3N3HA 4YZ2A 2DF7A 4FOWA 2KXLA 4HMZA 2E51A 1W6PB 2GC2A 4NHLA 1Z7S2 1R082 1D4M3 2WA4A 3NV1A 4LO8A 3AZVA 3VBRC 1PO23 5ABJC 1ND2A 5C8WA 5CAZA 1QJX1 1FX5A 2JG8A 4AI2A 5JAXA 4QQHA 2Q0AA 1AR93 2FMYA 4KH9A 5A32B 1TMF2 3TN93 3ILRA 1X82A 2WLPA 3JD71 2VVDA 1NG0A 4AFCA 3GF6A 1M06G 2RS53 3M3QA 2RR11 4BA6A 1FV3A 3AMNA 3AJZA 4YGDA 3B9IA 2VOWA 4COZA 3PHMA 3DF0A 3ZYGA 3VBOC 1YRZA 1ZZ7A 1A3KA 4XXPA 5J7MA 2BEOA 3B7MA 3WW2A 4FTEA 4LHNA 4MGIE 4QU2A 4CEYA 1X8MA 4C90A 4Y1ZA 4YGEA 2Z79A 1POV1 5A33A 3SH4A 2ZHKA 1RJ8A 5FCCA 2GC3A 3AKQA 5TSWA 4FPOB 1Y3TA 1FNZA 3MIDA 1IPKA 3WUDA 4IESA 4RL7A 3MF6A 1LHOA 1NQJA 4H7LA 4GB33 1QH7A