4PJYA

Azide bound cysteine dioxygenase at ph 6.2
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
186
structure length
186
Chain Sequence
b'ELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine dioxygenase type 1
publication title Structure-Based Insights into the Role of the Cys-Tyr Crosslink and Inhibitor Recognition by Mammalian Cysteine Dioxygenase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 55
structure length 186
sequence length 186
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2014-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4pjyA00
3H50A 2N7GA 2IXIA 2FMYA 2XHKA 4I0BA 4HLTA 4ZU7A 1YFWA 2GC3A 2VPVA 1IPJA 1ZNPA 3H8UA 4HN0A 5BY5A 4BIFA 1CAWB 4QGNA 3GYDA 4HVRA 1XE7A 1YHFA 4IEYA 3EJKA 4QM9A 3H1YA 4XFCA 2MNGA 2ZKLA 3E5QA 2XGXA 1CAVA 4PIXA 4JV4A 4J1XA 1OFNA 3KMHA 1X8EA 4LA3A 2Z69A 1CAVB 2PA7A 3PVBB 1X7NA 5FLHA 4QGLA 4AQ2A 3DKWA 2VECA 4RD7A 1OD5A 4EWDA 3UKNA 4NVPA 3WW1A 1J59A 3EHKA 1DGWA 5E16A 5KHIA 1H1IA 2B5HA 2UYBA 3UKTA 3I59B 1O3SA 4F8AA 3RYPA 3ELNA 2GZWA 2XKOA 2XKPA 1ZRDA 2O8QA 1XE8A 4Q0VA 3SCGA 1LKNA 3TNQA 1FI2A 2D93A 5I8YA 1RTVA 5FPXA 2GAUA 1EP0A 3TNPB 1ZX5A 3I54A 1CAXA 3HT2A 3LWCA 1QWRA 3FHIB 1WGPA 4MUVA 4IERA 1DGRA 4PJYA 3SMHA 1DZTA 1ZZBA 2UYAA 3FE5A 2E9QA 3I7DA 2CAUA 5J7MA 2Y0OA 2V09A 3LOIA 3IDBB 2PQQA 3ST7A 4KWKA 4IEUA 2BNNA 1YFXA 4YARA 4E2QA 2PFWA 4TLFA 1RUNA 1FT9A 1O5UA 5D1IA 2QVSB 3QOPA 1NYWA 4MX3A 1J3QA 4IEVA 4BHPA 2ET1A 1UIJA 4HVQA 3SHRA 2PTMA 4XF4A 4J1WA 2FQPA 3OTFA 4OLLA 4JVAA 3H9AA 2K0GA 1ZRFA 3WW2A 4I01A 1UD1A 3D0SA 4N9IA 2XLAA 2QCSB 4YYOA 2O1QA 5I0RA 4N9HA 4AVCA 5KHGA 1OI6A 4KWJA 2PAMA 3EQEA 4BH9A 4LLOA 3SXWA 3KGZA 5I8TA 1ZRCA 4FBFA 1FXZA 4LULA 1CGPA 4F7ZA 3ES1A 1NZCA 4LUKA 2WC2A 4MGYE 3OCPA 4IEQA 1Q5OA 3EBRA 4ONUA 3H7JA 5FCCA 3NL1A 2XLFA 3LA7A 1UPIA 3D82A 4QXKA 3CO2A 5FPZA 2D5FA 2GU9A 5JSOA 1CAWA 3BCWA 3U10A 1WLTA 1O4TA 1GQGA 3U11A 3NKTA 3OF1A 2PYTA 4IEPA 3OD0A 1ZRRA 3H3ZA 4PIZA 4KWLA 2GC2A 3JZVA 1G6NA 1NXMA 3FX3A 4Q0PA 5E1RA 4K8FA 4LUMA 4IEXA 3H3UA 4D7TA 3KCCA 3M3IA 3USSA 1ZVFA 4I09A 4MZUA 4XF1A 1H1MA 1XRUA 3I59A 2MHFA 4OFGA 4EROA 2EAAA 3IBMA 4XETA 3E6CC 1ZZ8A 2QNKA 1QXJA 5CU1A 1Q43A 5I0UA 3DL3A 3CF6E 3B02A 4WVZA 2GC1A 1PM7A 3ETQA 4FT8A 1I5ZA 1UIKA 4IETA 1RC6A 4ZU4A 2B9UA 4LTAA 2ATFA 2IXHA 4Z82A 3KGLA 2PHLA 5LRRA 2H0VA 1SQ4A 5JSPA 3FWEA 4IEOA 4O9GA 2PAEA 3HQXA 5FQ0A 4X6RB 4XFBA 2HJIA 2I45A 5BV6A 5FQ0B 4H7LA 1TQ5A 1VJ2A 3RDIA 3RZZA 1Y9QA 4EV0A 1I6XA 3MPBA 3S7EA 4WZCA 4ZU5A 4XFAA 3VHRA 4Q29A 2BNOA 4XFIA 3SCFA 4XEZA 2CGPA 1LB2A 4HBNA 5EZWA 3D0JA 2Q1ZB 4Q0UA 1SFNA 3H7YA 3WW4A 2OZ6A 3FJSA 4FAGA 4BYYA 5KHKA 2F4PA 1ZREA 5KHJA 2IXCA 4IEWA 3C3VA 4DINB 3ES4A 3WW3A 4I02A 4PIYA 4XFGA 4AVBA 1JUHA 4P9GA 3HIFA 3E6BA 1J58A 3GBFA 3RNSA 2EVXA 2QDRA 1RL3A 1VR3A 5CVRA 3S7IA 5HI0A 3G7DA 1U12A 4ORFA 3OGJA 1NE4A 4R8HA 1OMIA 2KXLA 4QGMA 3NSTA 1UCXA 5FDBA 3EO6A 1X82A 5I91A 5BUVA 2XL7A 4HSJA 5F1RA 3O14A 1WA4A 4L2NA 2BGCA 5LEJA 1O3QA 4AQ6A 4Q0QA 1X8MA 4I3PA 1SEFA 1CX4A 3ACLA 3NJZA 4I2OA 3KSCA 5T3NA 4MV2A 2PAKA 2BNMA 4GULA 3MDPA 5J48A 2IXJA 3HT1A 5KHHA 2IC1A 2PHDA 1V70A 4B29A 2CV6A 1DZRA 3N4MA 1QXRA 4Q0SA 4UBGA 5C8WA 2BYVE 1Q3EA 2H6BA 4L11A 5KBFA 2HKXA 4KU7A 4D7SA 4EWEA 3SCHA 5JCTA 2IXKA 2DCTA 4XF9A 1EY2A 3M70A 3MYXA 1L3JA 1LRHA 2D5HA 2XL9A 4MGZE 2ET7A 3LA3A 3CJXA 1VP6A 3FFQA 2BEOA 2OYZA 1IPKA 3ZDSA 2K9ZA 3IDCB 3E97A 2Q30A 4IEZA 5FLJA 4YNIA 2C0ZA 4Z07A 1ZZ6A 4HSLA 3E6DA 4X6QB 5J3UA 2H6CA 5FLIA 1EPZA 2XLGA 1EYBA 5BXXA 3RYRA 3E5XA 4JTOA 4MGIE 1RUOA 2Q4SA 3LA2A 3LAGA 5JAXA 5JSRA 4AVAA 1CAUA 3BALA 3CL1A 2IXLA 5LEKA 4XF0A 4A2UA 1CAUB 1ZZ9A 4EWAA 1YWKA 2OZJA 3BPZA 1O5LA 2D40A 1J3PA 1O3RA 4LA2A 3H1MA 3L2HA 3MZHA 4XF3A 4IESA 3FZ3A 4META 3NW4A 1RGSA 3QACA 1CAXB 4HVOA 2OPKA 3PLQA 5I0TA 1ZZCA 4HMZA 4HZFA 2ETEA 3PNAA 4UBHA 4E2SA 2B8MA 3IWZA 4UXAA 1O7FA 4XFHA 4KU8A 5C6CA 1YFUA 4I0AA 3U0ZA 4WBBA 2UY9A 2GH2A 4O9EA 1NE6A 3RYKA 2VQAA 5CADA 4LEJA 4XFFA 2Q0AA 1GQHA 4KL1A 3NVCA 3BB6A 4CYDA 5K8SA 2CAVA 5AVPA 1HW5A 1LR5A 1YFYA 3RPQA 1PMIA 3ROUA 1Y3TA 5I0SA 1J3RA 3IIAA 5I8SA 5I93A 4MGKE 1J1LA 4JTNA 1YLLA 3CLPA 5EFUA 3CEWA 4QX5A 1UW8A 5LRSA 2EA7A 2WFPA 2UY8A 5BPXA 1QY4A 4FAHA 2GC0A 3H1WA 1YUDA 2QJVA 3DV8A 4QM8A 3LZZA 5JR7B 4YSFA 4E2GA 1ZZ7A 3S0MA 2P17A 2Z2SB 1O3TA 3DN7A 3E5UA 4MH0E 4R52A 2MPFA 4HN1A 3R6SA 3BU7A 3UKVA 2OA2A 2ZCWA 4AXOA 4YRDA 4QMAA
chains in the Genus database with same CATH superfamily
3MEPA 2N7GA 2WNUA 3VZKA 3WNKA 3GCWA 1HB2A 4CUAA 4ZU7A 1MS9A 1WW5A 2GC3A 5K0UB 4Y33A 3RJ2X 3VN4A 1IPJA 5IUQA 5DZGA 4DEVA 3SEEA 1GU3A 3J4UH 1VBE1 4QGNA 3GYDA 2DUQA 3I8TA 4HVRA 4P08A 4AVVA 2BERA 1CVNA 2D6OX 4IQPA 3WOGA 4PHZA 3WEZA 1AX2A 4ARXA 3NAPB 1DYPA 1CAVA 1TZOA 3RJRA 1LULA 3SEPA 1ZBE2 3PDQA 4B4PA 5HCHA 5FLHA 2PA7A 1XNCA 1Y9GA 3UL2A 2QZ2A 3ZVXA 1WW4A 4AEJA 2VECA 5CFCA 1VRBA 4AG4A 3HQRA 2ARXA 3UKNA 1MACA 3J26N 4CCEA 3MLKA 3NNLA 3TEZA 1PGW2 1FYUA 1V00A 3K3NA 2O0OA 3PTYA 5JPMB 4IV3C 1ZBE3 2E63A 4FXGB 2UYBA 2XUMA 4TLGA 4N43B 3PVOA 4SBVA 2RS51 5IYYA 2WYFA 4F8AA 5CKNA 2OT7A 4QPGC 1VBB1 1YIFA 2VMIA 1HN0A 2GZWA 1DQ4A 4RGAA 4DRVA 2WYSA 4PLOA 3WF2A 4CEYB 4Y1ZA 4FI9A 4QX8A 1LKNA 4OI1A 1FI2A 2D93A 1F8VA 3AVSA 3T30A 1S4CA 1RTVA 5FPXA 1PZ8A 1ZBA2 1AR91 1DYOA 2CL2A 3TNPB 1LEMA 5KXCA 1DZQA 1WUVA 2JXAA 1CAXA 4E27A 5FXZA 1H8TB 2BRTA 3M7AA 2ZACA 1B35C 2E53A 4XIOA 3POJA 2X5IA 2XDVA 2VUCA 4PJYA 3C2UA 5LA0A 1JZ2A 1JOJA 1RVF1 1W8OA 2E9QA 2RDQA 1DFQA 3I7DA 5CAZA 3DPRA 1GP6A 4G9SB 5J7MA 4LXLA 2W94A 3MFCA 5FYYA 3THDA 2VJXA 4KWKA 2VW2A 4MOAA 1RUI1 4XQ4A 1QEXA 3ZSLA 2BNNA 1YFXA 5SV8A 4YARA 4ASMB 1SCRA 3P3PA 4MO3M 1DBNA 3O1UA 4WVWA 4XABA 1JOPA 1FT9A 1H2MA 4CDWB 1R1A1 1C3HA 4F3JA 1BHGA 4DIQA 4WZFA 5DDJ2 4ISQA 3AP9A 4YW5A 2PN5A 2VC9A 4XF4A 4AGGA 1IQAA 4IV1B 2ZMNA 1D7PM 4AEDB 3F95A 1AR81 3CDZB 2VY0A 4JVAA 1G86A 1UYXA 3NJYA 2WO3A 1CZTA 4LBQD 1W0NA 1IGOA 5FY1A 2J22A 2VZOA 2NPIA 1I5PA 4PF5A 1S0DA 3D0SA 3BOWA 3MI8A 1A8MA 3MIEA 1URXA 1HXS1 4AE2A 2JECA 1UY0A 2YPJA 3CNAA 3WHTA 1MZ5A 4LBOA 3WD5A 4DY3A 5HPOA 1W9TA 2RMU3 3I3DA 4QAWA 1YI9A 3LCPA 4YZ2A 1BLZA 1OI6A 3K3OA 2J1AA 1RINA 2XONA 4KWJA 4UW3A 1ULEA 4BH9A 5A6QA 4LLOA 2FCTA 4QB1A 1OXCA 4FBFA 4LULA 5ABJC 3OUJA 2NZ9A 1UYYA 2YXSA 3N3HA 5ACA1 3ES1A 3N9QA 4PLMA 4C0HA 1NZCA 2C24A 2XJTA 3OCPA 5DPNA 2Y0IA 3WP4A 2C9KA 1UMHA 3O1MA 1Q5OA 5IAXA 1RMU3 1UZYA 1PMJX 3H42B 2YC0A 2WN3A 3POBA 1ULCA 2YZ4A 4P9WA 4YM1A 4GWIA 1HV0A 2WAAA 5FK7A 5FCCA 3I3EA 4JQRA 1C5HA 4GALA 5K0UA 5T5OA 3CO2A 1N1YA 4TZDA 1ULFA 5JSOA 5CISA 1GQGA 2VZ1A 4RFT0 1NA1C 2GNDA 3AKTA 4UF0B 1GNHA 5A1AA 1VRH1 3OF1A 2Y34A 4BK5A 2YU2A 3H3ZA 1S0EA 3H0OA 2GC2A 1NXMA 2JB4A 3MIHA 3VDAA 2R043 5FMOL 3QLQA 4KNCA 1K42A 5E1RA 3WNLA 4Z1VA 4CDXB 1QOSA 2R072 2Q8EA 1AUYA 1W9WA 1ASJ1 3LSDA 3T1LA 2GNTA 1QNYA 4R4XA 3USSA 1LOEA 5FPUA 4MADA 4ISRA 2VVDA 4ZXEA 2VW1A 5FZOA 5EJ3A 2EAAA 3IBMA 1JYXA 3E6CC 2VAUA 1QJFA 1AR61 1QXJA 1G9CA 5H9RA 3IAQA 1PNFA 5A32B 5LBFA 1EV12 1YO8A 1W6QB 2Z42A 3DL3A 4NIAA 4X8NA 3CF6E 3LD8A 4WVZA 1ZYBA 2DU1A 5CEHA 3WNMA 1JXNA 4CCKA 4FT8A 2OX0A 3WSOA 3K4DA 2ZMKA 1H8TA 1LHNA 1N47A 3KVBA 3BUCA 3RZMA 3PIGA 1OOPA 5IVEA 1AXYA 1PNGA 5FMCA 4ZU4A 2BPA2 4LTAA 5LA9A 3OBTA 1QJZA 2ARBA 1AJOA 3KCXA 2WNVA 5LRRA 4U2AA 1JBCA 5F32A 3S5AA 4LKDA 1SQ4A 2ERFA 5F2SA 1X33A 4BCUA 1ZBE1 2ZA9A 5FQ0A 3JXSA 4XFBA 2HYXA 3I2GA 3AP4A 5K4LA 3UT0A 3I3MA 2EIEA 3NNMA 5AFBA 3RDIA 1VJ2A 1WCUA 1ND3C 4FPKA 4EV0A 4YZ1A 4PT6A 1UKRA 1I6XA 5J36A 2CNAA 1YQ6A 2EALA 4WZCA 1PGW1 5JXIA 5KR7A 5E88A 1ENSA 4YVSC 3WG4A 1GZCA 1RUH2 1W2UA 2NN8A 3SCFA 4YVWA 1UPSA 4JHZA 4C1WA 4AI2A 3O1PA 4Q4Y1 5LATA 5FZ1A 1CX1A 1ONAA 1SACA 1NLSA 3BOPA 3G6JB 5GLVA 3FJSA 5LY1A 5IHRA 4FAGA 5FP9A 1GWKA 5FXXA 1RUH3 1GNYA 1ZBA1 3A0NA 4IEWA 3ZYBA 2WWSA 3ES4A 4XZPA 3WW3A 4BMEA 4DINB 4Q5OA 4S2GA 5DUUA 3ZX7A 1OT5A 3B01A 1KS4A 2XG3A 4P9GA 4DQAA 3P5BA 3W58A 2LRPA 1YQ8A 4PDWB 3HIFA 3RS6A 3AP6A 2JD9A 3E6BA 1J58A 3GBFA 2ARAA 4NN0A 2EVXA 5G04L 1RL3A 4Q4X2 5D21A 5J37A 3G7DA 4YGDA 2E32A 1U12A 1QH6A 2PHTA 5JIUA 4QX0A 4IE0A 5FZ9A 1ND2B 1NE4A 1NLRA 2VCCA 2JDYA 3BTAA 1HB4A 1WD3A 2KXLA 2HEYF 3ACHA 3GXUA 1UCXA 1YC61 1W39A 1TE1B 2HBTA 1W6PB 2VXJA 1BMV2 5JPNB 4AL9A 4CXXA 1R092 4Q4X3 3MV11 2XL7A 4HSJA 4UFIA 1WWYA 5FFOC 2RDNA 5F1RA 5T5JA 2VBDA 1YJLA 2VULA 2BGCA 1Q8PA 5DDJ1 4AI9A 2ZGNA 5ISLA 1SLAA 4XXAA 3VBRB 5FTTC 4B1LA 1SEFA 2WL1A 3HNYM 3MLLA 4JGZC 4MVTA 1R093 2QE3A 4XTPA 5BNNA 1ULPA 5F6KA 5T3NA 1KQRA 3UJQA 1JZ4A 1TEIA 4JCKA 2WUHA 4MV2A 1QJX1 3K48A 1DG6A 2ZMLA 5FWJA 3VBSA 3SLIA 5BNPB 4HK8A 5J48A 4M3CE 3OYWA 3O5SA 1REDA 4JQTA 1ULGA 3OGRA 1CJPA 2XXZA 4H3WA 5KHHA 2YGMA 3TRSB 1H8VA 2VNRA 5L9BA 3HBKA 2IFWA 1O91A 1OD3A 1OF3A 3PUIA 2NQYA 4GWNA 1DZRA 2JG9C 3RGBA 1F2NA 1XSQA 2CYFA 4YZ4A 2GMMA 1HQNA 1KGYA 2XJRA 4LKFA 4V2WA 3VGIA 4UBGA 3VD3A 2DFBA 3ZR5A 3AYEA 3WR0A 4YW1A 1LU1A 2ZGSA 4L11A 5IATA 1QKQA 4AK3A 3QD6A 1KS5A 2HEVF 4S2HA 2IXKA 2WNUC 1MZ6A 4XF9A 1CIYA 4DFSA 3LDRA 3AKQA 5A32A 2BP6A 2LW8A 3M70A 4N8MA 3GZAA 5FXVA 2W1WA 1GZTA 4MGZE 2BFUL 4JC1A 2W1QA 3FFQA 2R32A 2CU5A 5HXMA 1IG3A 1IPKA 2OQ7A 4SLIA 1GZWA 1QJU1 1HRI1 3IDCB 3E97A 2Q30A 4YZ5A 4IEZA 4CUCA 2WZR2 4JRAA 4Z07A 3ZSEA 4HSLA 4YWAA 4BOWA 2H6CA 3AZZA 2XJQA 1EPZA 5F3GA 1GBGA 3MIGA 1AF9A 2XLGA 1EYBA 2AC1A 1LOFA 5IW0A 5FOJB 3RYRA 1RUOA 3LA2A 4LO7A 1UL9A 5IK4A 1H6YA 4Y26A 4GMP3 1F4AA 2WZR3 4N53C 3LE0A 3PL0A 2R071 4QB2A 4HKOA 2MEV2 4P14A 2E51A 2Y6HA 2IXLA 1RUE1 3CL1A 3OY8A 4CZSA 1OLMA 3O12A 2XHNA 1ZZ9A 3FBYA 4XE9A 1BK1A 1YWKA 3K46A 2BV4A 4TYSA 4QXHA 2O8OA 5LB6A 2Q8DA 3BPZA 1O5LA 3NV2A 1J3PA 4ZY9A 3WV6A 3GBGA 3H1MA 1COV3 5FZCA 1W8UA 3Q8CA 3L2HA 1MQTB 2YBKA 1UX6A 2CDOA 3VD4A 5LASA 5F8PA 4Y5SA 4W4ZA 3QACA 1RGSA 2GMPA 1EUTA 1U0AA 2DCZA 4WVMB 3DUIA 2Q8CA 5G05L 1EV11 2JEMA 2A75A 3KV5A 4XCBA 1ODMA 1ULOA 1R082 4GH4B 4UBHA 3OEBA 4XCAA 2B8MA 1VB2A 2RE9A 3GHMA 4XAAA 4FTBA 3VBOC 2K46A 3HD8B 1CD3G 1O7FA 4XFHA 2LM3A 1S2EA 1UZVA 5FZ3A 1D4VB 1VBA2 3ZN6A 4A3XA 4YGBA 1R1ZA 4GXLA 4DXSA 1S55A 2ZBJA 2AREA 1R083 3U14A 2DURA 3AL6A 3THPA 3AKRA 2VQAA 2WS91 3RYKA 1FMD2 4XFFA 3AMQA 4K9SA 2Q0AA 5KXBA 4DY5A 5A6XA 2WZ8A 4ASLA 4GB33 2FMDA 2W1UA 4GMP0 4KL1A 4LOSA 2LROA 4BISA 1SLLA 1UO9A 1WMDA 5D8AB 3POSA 4FFIA 1HW5A 3M3EA 4AEMA 3RPQA 3NV4A 1RITA 3M2MA 4NIGA 4AFMA 1Y43B 3IDEA 1J3RA 1MPXA 5I8SA 5L7OA 4UWDA 4OZXA 4CA9A 2DBIA 5C4WB 3FBMA 1J1LA 2XWBB 5GKAC 5E8AA 3VBRA 1RUH1 3BGAA 3OUIA 2DYCA 2P5BA 4LBKA 3AZYA 4LBQA 4N7IA 4BQ5A 4BDVB 4RGGA 1OA3A 5FZIA 1XQNA 2VZVA 5LBEA 3VV1A 3KHBA 1OKOA 1IS5A 5FY0A 4YG6A 3POWA 4FAHA 2GC0A 5BNPA 5IVCA 3TN93 1JS9A 5KC5A 5JR7B 3KV9A 4ZONA 1UYZA 1WCSA 3PJQA 2ZGKA 4RSUA 4XJAA 5IJRA 3WDVA 4DS0A 1FNYA 3L9JT 2JKXA 5T52A 2GALA 2Z2SB 1MEC1 1AVBA 4MH0E 4HN1A 4IUGA 4CP0A 2A1XA 1W8FA 3UKVA 2OA2A 1PK6C 2D7FA 4XURA 3EYPA 4Q4X1 5B4XA 3ZXGA 1SMVA 5CYYA 2DUOA 4L97A 5FMOS 4B8EA 1KXGA 4HT1T 4LITA 3ZYPA 2QTWB 4I0BA 2ZTNA 1F9KA 4HKLA 2Y38A 1BMV1 4G4FA 4HN0A 2Q1MA 1PVC2 3AMPA 2ZGUA 1LTEA 2QQOA 3AMMA 1YHFA 2KD7A 5FK8A 4XFCA 4LIVA 2C1FA 2MNGA 4ZZ8A 2ZKLA 3NO8A 2XGXA 1AXZA 5FZEA 2X29A 5A33B 4J1XA 5FWEA 1OFNA 2YGLA 2UWCA 1X8EA 1PVC3 4KG0A 3NAPC 4LA3A 2IVIB 1CAVB 1TMF2 1ZRIA 1X7NA 3HQUA 3L2YA 4FPLA 4NPLA 1XSRA 4G3YC 4QQOA 2DV9A 4AFAA 2P6HA 2ZEYA 4JHTA 2WZEA 2JDPA 4RD7A 1OH4A 1OD5A 1JI6A 4EWDA 4NVPA 2W52A 1ACCA 2ORXA 2P4EA 3C7FA 3WW1A 1OUXA 1RHI2 2G9ZA 4HPKB 4NOTA 5CFCB 2ZGOA 1XNKA 2OUHA 4RR3A 1VMHA 4LHKA 4LNVA 4BZ4A 3UKTA 3T0DA 1LHUA 4FP3A 3S5QA 3NQHA 1JZ5A 5JI9A 3N9LA 2EXIA 3WDXA 4W65A 1GYKA 2ZEXA 1C28A 3KT7A 1A34A 1ZRDA 3J7HA 4N43C 1RHI3 4FTSA 3OUHA 3MPPG 4Q0VA 2W46A 1D4M2 2EXJA 2RVAA 4QQ2A 3VZMA 5HXVA 3PU3A 2BBVA 3CJIC 4EE2A 1GLHA 4CEYC 5FP3A 2GAUA 3HNMA 4DXTA 1DF0A 1EP0A 4JDOA 2BVVA 2PXJA 5H9SA 3VDCA 4M00A 3ZYFA 3I54A 4ES9A 3CZUA 1AXKA 2HEWF 3HT2A 4KBZA 4WVMA 3FHIB 3RWKX 1GQPA 1WZXA 5DAPA 3TEYA 5GLUA 2DVGA 3RI8A 1H8TC 3T08A 3UGHA 2UYAA 3QCWA 3FE5A 3WF0A 3OPTA 4QPIA 3HPNA 1W99A 4CE8A 1A6CA 2V09A 3I97A 3MO4A 2LS6A 4LBLA 5T55A 5FZ0A 4GMP1 2GSYA 5IT6A 2UWAA 2WZR1 3AZVA 3ST7A 5CG8A 3DPRB 4IEUA 4OMDA 4BQXA 3ILNA 4E2QA 2XH6A 3D6EA 5F5AA 3N7MA 4TLFA 1O5UA 4XTMA 5D1IA 2IZWA 5FZ8A 3MBWA 1I9RA 1TNRA 2P2KA 4B4RA 3W20A 4Z8BA 3FHQA 3GZTB 4Z2AA 1J3QA 3IPVB 1SLTA 2ET1A 4CCNA 4XYXA 4CDWC 1QQP2 2B39A 2PTMA 3SC7X 4J1WA 2MEV1 3SHRA 1SDDB 4HVQA 4E8CA 4N90A 1HB1A 2EIGA 4LE3A 1H9WA 4NAMA 5FUPA 5FXWA 5C4WA 1C8M2 1HQWA 2WSUA 3ITQA 4IV1C 4AEDC 2G19A 1POQA 3DECA 4NHXA 1LGNA 1ZRFA 1IPSA 1KDMA 3ECQA 4Y1XA 1POV3 1QQP3 1UD1A 5GLWA 3AP7A 3LKJA 2XLAA 1HKDA 1RUG2 2B42B 3AP5A 2ID4A 2BOIA 2O1QA 2R1BA 4P00B 2YYOA 4H55A 3VBFB 4N9HA 5FYUA 4CCOA 5C3OA 5JZGA 2CY6A 1YQ5A 4DZGA 3V0BA 2PAMA 2CGNA 1RUC2 2JDMA 5FZAA 1R081 3UNPA 1VAMA 4Q27A 5LY2A 5CKMA 5FZ7A 1SPPA 2DDUA 5I8TA 1ZRCA 4NIHA 3ILRA 1FXZA 2RS32 3AJZA 4RQPB 5FR3A 1RUG3 1W8TA 2ZXQA 4Q1RA 3WUCA 1WBFA 1AL23 4FVVA 1PO12 3POEA 1W9FA 1VBA1 4WM8C 1UOJA 3ZR6A 4KGQA 4KG8A 3VDDB 2YB7A 5FJKA 1RUC3 5FZDA 4UFJA 2R6QA 4BJ0A 1FMD1 3H8OA 1W2OA 2BQPA 3RZLA 3H7JA 4K8RB 3URFA 2RS33 2PMWB 2PELA 1RXGA 3Q8AA 3UGFA 5C8CB 3NL1A 1O6UA 2P3IA 1YRZA 3I3QA 1NKGA 2VZRA 3LA7A 1PO13 3D82A 5FPZA 1EPWA 4B3NA 2GU9A 4RGKA 3ACFA 1O4TA 4M3CF 2ZGPA 2YFZA 2J42A 4ATEA 4COZA 2PYTA 1CQ9A 3T2OA 4IEPA 3VKLA 3JB4C 2YC4A 4ZS3A 1K5JA 4B7KA 3IB3A 4QB6A 2ZX3A 4WVVA 3IT8A 5A33A 1POV0 3B00A 1ZM1A 4FPEA 4Y20A 2VE1A 3FX3A 3BYWA 3MW3A 1U5YA 2ILMA 5FJHA 2GNBA 1LAJA 2HWD2 3EMRA 3AC0A 3KV6A 3V0AA 4K8FA 4WM7A 4DUWA 4LE4A 4LUMA 2BFUS 4IEXA 1BK0A 1E5RA 1MS5A 3FMGA 4JRLA 1ZA7A 4PQ9A 3P1IA 4HPKA 3M3IA 2D3PA 1V6MA 4CDXC 2OS2A 4XBLA 1JUIA 5FBZA 1LJ7A 4I09A 4QPYA 1PO22 1VB4A 2HWD3 5IFTA 1Q8VA 1F15A 2CWSA 2WKKA 2XVKA 5BYNA 1TNFA 1VAKA 2MHFA 3CKHA 4INDA 4XETA 1UAIA 2V5DA 1ZZ8A 4UI9L 1XPWA 5FZOB 2QKDA 4LJHA 5FZGA 1ENQA 1PO23 2WAOA 4PI0A 2YC2A 3B02A 2ZGRA 1OVSA 3WHUA 3VHOA 1H2KA 4EN7B 3ETQA 2WT2A 5FYBA 1YJKA 2O14A 2P3YA 1PVC1 4Q8KA 3RWNA 3JBG2 4NHYA 1QGLA 2JDZA 3TEXA 4R9BA 5A70A 4XMIA 1JHJA 1OOPB 2HBUA 2Z5WA 4FQ4A 2WJSA 4LLFA 2VG9A 2PHLA 4XQDA 1FV2A 4Z82A 4COUA 3TB0A 2HWC2 4NE9A 2VMFA 1KJLA 5JSPA 4O9GA 4XQWA 4YW2A 2BDRA 1QHDA 3HWJA 3K4AA 2WNVB 1TMF1 5FKCA 2YY1A 1WD4A 2I2SA 4I30A 3INAA 3JBG3 5F3EA 1IKPA 5FQ0B 5BV6A 3OOXA 2D98A 3S7EA 4DUVA 4W6YA 2HWC3 1W0OA 3VHRA 5JR2A 3OBAA 4D6SA 3WZ1A 3I3BA 1AZDA 1JYCA 3A23A 5AFEA 1W6OB 3IPVA 4XACA 1ODNA 1Z78A 1LOCA 2QQNA 2VZPA 4XILA 2H0BA 4AF9A 3ACGA 2VUAA 4XEZA 5A3WA 3WNPA 1LB2A 2RG4A 5EZWA 3VKMA 1BZWA 2DU0A 3ZXJA 4K21A 3ZSJA 2BWCA 2JD4A 4YVWB 2EF6A 2RR13 2EIDA 2OZ6A 4OHYA 2XR4A 4NR1A 1D4M1 4COYA 4LR4A 3VBUB 5KHKA 1UMIA 1HIXA 2RMU2 2WWUA 3HAGA 3BN6A 2IXCA 2VM9A 3C3VA 4COWA 1PZ9A 3RQ0A 4UFHA 3ACIA 4I02A 4NWWA 4AVBA 3VBFA 2YMZA 2WZPP 4CDUA 1JOBA 1K12A 3LQCA 4OUSA 4RS5B 3ASIA 3S7IA 3IZOA 4MGTA 4YM2A 4ORFA 3MUY1 2AEZA 4PDWC 4RQPA 3K4ZA 4Y3OA 2G9FA 1RMU2 1VBD2 4P9XA 4LBJA 3VBHB 5JXJA 1QIQA 4MGQA 4QGMA 3NSTA 5FOBB 4LO8A 4RHV3 4QDQA 3VDDA 1KRIA 3WDWA 5A3TA 1ND2C 1WCDJ 2BW8A 4CP9A 2QDNA 2D97A 3LPGA 3LPFA 5C8CA 1LEDA 5JWPA 5EJZB 3O14A 1VBD3 3VUOA 3ZIXA 1GP5A 4L2NA 4L0PA 2BWAA 4CCJA 3ZFFC 4AHWA 1HV1A 2EICA 4Q0QA 3WG2A 1QQP1 1QDOA 2NYYA 3JU9A 4I3PA 4I2OA 3NJZA 4W8JA 3M8LA 2Y6JA 4O65A 1EAH2 1L7QA 3VBRC 4K1YA 2HWB2 1L7LA 2JIJA 2R042 4YPJA 4UW5A 2QQJA 2PAKA 3WP5A 1C8M1 2BNMA 3N7KA 1Z7S2 5BNNB 4E4ZA 3MDPA 2KR2A 3UK9A 2BTVC 1VAVA 3ZFEA 3I49A 4LO5B 3VBSB 5F6LB 2ADEA 5CB7A 2IC1A 4LK6A 1RUG1 5T50A 3OYWB 1EAH3 4FPFA 2CV6A 2HWB3 3ZKYA 4D8MA 1Z7S3 3I2JA 3ATGA 1RUC1 2R1DA 5M0TA 3DYPA 1WLDA 3N9NA 1QH7A 4KWUA 3GGLA 3OG2A 5IVJA 1NX9A 1WCKA 1U5IA 2H6BA 2HKXA 1J1TA 1PO11 3SCHA 3A21A 2E7TA 2RV9A 5JCTA 1Y9MA 1PIV3 2ZAHA 4BXFA 3B3QE 4FSJA 5F7UA 4GJYA 3S6PA 2VOWA 1AL0G 1UKGA 4FPGA 1FPN2 1L3JA 1W3XA 2D5HA 3R05A 5GM0A 2ET7A 3LA3A 3BIWE 4IXLA 2E7QA 1RB8G 1KJRA 2DVFA 3ZDSA 5IVVA 2CDPA 5FY9A 2YBSA 3EB7A 4ES8A 1STMA 3HJRA 4YNIA 5FLJA 1B09A 1ZZ6A 2ZHNA 1FPN3 1GZWB 2ZX0A 4X6QB 1CESA 2VVFA 3HOBA 1L7RA 2TUNA 4JDMA 2NMNA 2WDBA 5F39A 1IKQA 3IAPA 1GP4A 5BXXA 4LKSA 4Q2FA 4QHZA 2CTVA 1S0CA 1YEWA 4EQVA 1UY1A 1VIWB 3E5XA 4MGIE 4BQWA 1VALA 5GZFA 1DQ5A 3M1HA 4TTGA 3RZJA 4Y22A 1DGRN 1HJFA 5DAVA 3O1TA 4LHNA 4K3UA 1YYNA 2BU9A 2VUJA 4XOGA 3S30A 1MS4A 1S0IA 2JIGA 4AVAA 4ZKTB 5JSRA 1CAUA 1PZ7A 1AYN2 2W3JA 3LFIA 2W2IA 3U1XA 5LEKA 4XF0A 4GJZA 4YW3A 4L9BA 2RM23 2OZJA 5FP4A 1YIPA 1V6OA 1JMUB 1NCRA 1PO21 1W6OA 3OY8B 4LBMA 5EXOA 2OKXA 5FO8B 1O3RA 4R9CA 1W06A 2A3WA 4JAAA 1IZ3A 3VZOA 4HG6B 1AYN3 1CZVA 3FZ3A 4N7UA 1GNZA 1OUSA 5FMDA 1ZA4A 5FO7B 3ZXLA 3WDUA 5A3LA 2FDHA 1MQTC 3Q9OA 3K2OA 3VBUA 3CZJA 1APNA 3BIEA 4HMZA 5FY5A 1XJAA 2ZHMA 3FLPA 5J96B 4E2SA 1LHVA 5FY4A 2BGOA 3IWZA 3MV01 4UXAA 3TAYA 5C9AC 3JUUA 3MW2A 1YXWA 4GH4C 3ABZA 2FHRA 2ZGTA 2JDAA 3JBG1 2UY9A 2AACA 4ZPIA 3VL9A 3R4UA 4O9EA 4RS5A 1KD7A 4OULA 2JWPA 4E4SA 2YDEA 3ZN6B 2G9GA 4A3ZA 4AR2A 5CADA 4AWDA 4LEJA 2HWC1 2XBO2 3VKFC 2C5DA 5K9YA 2AGSA 3VBHA 5FKBA 3WCSA 2Q1FA 4A4AA 4Q1PA 5C3SA 1O8PA 2QQVA 4CRQA 2WA4A 4MHUA 5K8SA 4XUTA 5KXDA 3BODA 4TSVA 3RZGA 3D3AA 2XBO3 2PHXA 3IIAA 5D8AC 5I93A 2HWE2 2VW0A 3M4FA 4MGKE 4NJ4A 4EN6B 4XUNA 1UU5A 3WXPA 5FY7A 1X9PA 1V6JA 3CEWA 4OI4A 5L7OB 4QX5A 3FUOA 4XC9A 2D43A 3AYAA 5B2GB 5FAXA 4QHBA 5C4WC 2UY8A 3THTA 1NQDA 5H9PA 3GF6A 4TN7A 1VMFA 3WP6A 4DRRA 3O1OA 1U5ZA 1K5MA 2FCUA 4LBQB 2HWE3 2AUYA 2WRAA 2G1MA 2RMU1 3CHXA 3POIA 3USUB 4CDQC 4DXRA 3DV8A 3LZZA 1G7YA 4MHRA 3OGVA 4P5YA 4UOJA 4OMCA 3U78A 2RDSA 4YSFA 5FZKA 4LIUA 3AXEA 4E2GA 4OUMA 1H4GA 5CA6A 3B94A 4Q4W2 3W21A 4IGOA 5FUIA 2R16A 2MPFA 2YBPA 1QNWA 3ME2A 1JHNA 1RUF2 2YROA 3F2ZA 4AXOA 2WFF3 3H50A 1SLIA 4JKLA 2IXIA 2ZZJA 3FUQA 5CKQA 4AI3A 2FD8A 2OW4A 4YFZA 1NA1B 1O4YA 1RMU1 1VBD1 2FMYA 3D5OA 4HK9A 1JZ3A 1JYIA 4HLTA 2YUEA 1YFWA 1J84A 2B4KA 2D6NA 4DB5A 1YNAA 1HRV2 4Q4W3 4XPVA 4IW3A 4D0QA 2B7YA 2VBPA 3Q8FA 1M4WA 3H8UA 5BY5A 1NT0A 5DAXA 1V6LA 2VNVA 3FL7A 1RUF3 4A45A 2VZSA 3HEIA 3LIHA 1NXD1 4NRQA 3EJKA 1HLCA 4LO4B 4QM9A 5CZKA 3A22A 3WQ1A 3AMNA 3C8XA 2JJ6A 5F37A 1TME2 1W8ZA 1GANA 4PIXA 3KHCA 1HRV3 5HBAA 3JQXA 2WSVA 2VMCA 2VVEA 3GM8A 5CG9A 3W9AA 5FY8A 2Z69A 4IV3A 3VB9A 2D44A 3VD9A 1EAH1 4UAPA 3T09A 2HWB1 3PU8A 2R041 3WNNA 1XE0A 5L73A 2W47A 1T6BX 5FYMA 3WCRA 3H8RA 1TME3 1FV3A 1Z7S1 3B5LB 4A44A 4WV8A 3K77A 3LGRA 4A7YA 3GALA 2ZHKA 1DGWA 3O0WA 3KLSA 5E16A 3U75A 4CU9A 2JE9A 1W6MB 2KM2A 3NJXA 1W04A 4RR3B 4C91A 5CFCC 3NWKA 4IE5A 1SG3A 3WVJA 3AZWA 1COV2 1C5IA 4BXSV 4FQZA 4XJWA 4IL7A 4NPRA 3RMYA 1RJ8A 1B35A 2BZDA 3SCGA 4E4HA 1G9AA 4S2DA 2DCYA 5DABA 3DKQA 2WT0A 4XDQA 5L36A 4I0WB 2RS12 3C7EA 1G9DA 3BI3A 3AVRA 1OC1A 1HQLA 3HN1A 3LWCA 1C57A 1XB9A 1FPN1 4H7MA 4MUVA 4IERA 5A3NA 1QOOA 1S0GA 4XW3A 1DZTA 1N1TA 3AFKA 2WNOA 3IN9A 4B7EA 1WKYA 5FPBA 2RS13 3WF3A 4BM8A 2J1RA 3SITA 1JYNA 2J1VA 1QXPA 5FZMA 3POGA 4OZOA 2PQQA 4QPIB 3CU7A 2X5IC 5KWRA 4RFRB 4AAPA 4GB32 2DCKA 4P9YA 3WDTA 4BIOA 1DIWA 2QQKA 3MIDA 1UX7A 4ZZ5A 2PFWA 4FPHA 3BTYA 3MHZA 4XJZA 4NROA 3DPRC 1HX6A 1N3QA 1QDCA 3OPWA 4PF1A 5A7WB 1GSLA 3QOPA 1NYWA 2ZJCA 5T54A 4V1PA 4AI0A 4QQHA 4KI5M 3AL5A 2P34A 3NNGA 4BHPA 4RYDA 1AYN1 2WNEA 2FQPA 3ZIWA 3KF5A 3OTFA 2R30A 2PQSA 4CEWB 1UOGA 4F83A 2ZGMA 4JGYB 1W2TA 4LPLA 4IE6A 3AM2A 1UU6A 1XNBA 3H9AA 4YM0A 5AC92 3LOBA 4KH9A 1LODA 2SBAA 4I01A 4DXZA 4N9IA 3TN92 1YQ2A 2CGOA 1OBNA 4NUBA 3WY6A 4A41A 2A6ZA 1OA4A 2KA3A 3ILFA 4PCRA 2B46X 5ABJA 4EJRA 2QCSB 4R4ZA 5H9QA 2D3RA 5KXEA 4LOTA 4AQSA 1XXNA 4AVCA 3KT4A 1HN1A 3U4SA 3EQEA 4AOCA 3USUA 5AC93 5JZGB 2TEPA 1VLNA 3ZMOA 1DGWX 3KGZA 3SXWA 1QOTA 2PHRA 3V0BB 4PI2A 2P3KA 1CGPA 2ZEZA 1H9PA 2V4AA 3OPZA 2HLEA 2VZ3A 1SPPB 2NP0A 1SDWA 2WC2A 3KQRA 4MGYE 3RZHA 1VBE2 2J1SA 2W1SA 2VOTA 1OKQA 3AYCA 3ZKUA 1C8NA 4NRPA 4URAA 4Y4RA 4ONUA 5A6YA 3A7QA 2XBO1 3ZYGA 1NA1A 3JB8A 1WLWA 3AKSA 1IS6A 3O0XA 3WP3A 2VZTA 4KQ7A 5A3MA 2A5ZA 3B93A 2W0XA 1VBE3 4QXKA 4EZ4A 4P5HA 5C70A 1LOAA 2DTYA 2D6MA 2E33A 3Q8EA 5T5PA 3VKOA 1F5JA 5C8CC 3BCWA 2ES3A 4QKNA 1LNSA 2VMGA 5IAVA 1MVQA 4OUEA 5IK8A 3O1SA 2XPJA 2BVBA 2D3SA 2HWE1 1R091 3OGSA 3ZYJB 5K0UC 3OD0A 2FDFA 1SLBA 1ZRRA 1CZSA 2JDNA 1W03A 4PIZA 2VTXJ 3PUAA 3N7LA 4ITCA 2VL4A 3U07A 4XXPA 5FZFA 1CPMA 5EP9A 1VBB2 5FYIA 4AW7A 2D6LX 3GZUC 1X36A 4Y20B 2Y6LA 4UW4A 4CCLA 2DVAA 2SLIA 4BK4A 3KQ4B 2QQIA 3H3UA 2OVUA 3RFRA 2FDGA 3V64A 3V0AB 3KCCA 1XC6A 4WM7B 1ZVFA 2JG8B 1MS8A 2WBKA 5GZGA 1M06G 4NO4A 4AHZA 1W9YA 1W6MA 2RS53 4MZUA 5GJ6A 1UZWA 1VBB3 3B7MA 2VOKA 1XRUA 1GOHA 5EPAA 4OFGA 4Q4W1 3PIJA 1BEV2 5EQUA 2QNKA 5IFPA 5CU1A 1Q43A 1MS3A 4LO6B 3WT3A 4IE7A 1XYNA 3M3QA 2JICA 1AR93 2A6YA 5JXHA 1JTZX 2GC1A 1PM7A 4BU2A 4PLNA 1HRV1 2QQUA 1E5IA 1BEV3 1I5ZA 1NUKA 1UIKA 4GQ7A 2QQPA 5FPAA 2ZAAA 1RUD2 2GH8A 4IETA 2VTXA 5JI7A 1GUIA 3SH5A 4CCDA 4GWJA 2B9UA 3KWVA 2ATFA 3CQOA 3RI9A 1UU4A 4NPMA 5FYTA 1TME1 3KGLA 4XHBA 3ETPA 4KGGA 1BBT2 3ZLIA 3VD5A 3FWEA 4IEOA 4GWMA 2PAEA 3HQXA 1OOPC 1RUD3 2EIBA 4EN0A 1W90A 2J7MA 1OSGA 3ZFGB 1YI7A 3LDKA 4YVSA 2XB6C 2PHWA 2VUDA 2JX9A 2CWMA 3KV4A 4XBQA 2ZZQA 3HVDA 3RZZA 1SFYA 2WNVC 2ZX1A 3PTRB 5GZEA 3Q8BA 1BBT3 3MPBA 5A7WA 4ZU5A 2HYKA 5LA1A 2BJSA 5F5CA 2X05A 1OQ1A 1JN2P 2FCVA 4CXWA 2Y6GA 1AR83 1HXS2 4HANA 4XFIA 3JD72 3ORJA 4YGEA 3J8F2 1XBFA 2UWBA 4QT6A 4NIIA 3WQ7A 1COV1 3D0JA 5FO9B 2Q1ZB 5GLZA 5A7OA 4YZ3A 4CEWA 1H2NA 2PLV2 3H7YA 1W9SA 3R4SA 4JGYA 3WW4A 1W05A 3VLBB 2P6CA 5LBBA 1OFSA 1GR3A 2A3XA 2NMOA 2QZ3A 5GZDA 4BYYA 1LHWA 2A3YA 4QDRA 1G8WA 3KD4A 4UFLA 4YVWC 1HXS3 5T5LA 4CCCA 1S2KA 3JD73 2QQLA 4JZRA 3J8F3 5KC6A 2RS11 5ERLA 5A7NA 3T3YA 3VBUC 3POYA 2E26A 5A7QA 2VQUA 2PLV3 2W39A 3JQWA 3PUQA 4D3WA 2X09A 2UU8A 5A1LA 1GOFA 2W08A 1AL22 4C0BA 5B4NA 3RNSA 4CDUB 5HI0A 4BB3A 4OVEA 1C4RA 5EJ1B 5A7SA 4R8HA 4IGPA 4RS5C 4OYUA 4BQ2A 4J6GA 2VD7A 3MLJA 4QWNA 4C90A 1OQEA 3RRDA 2ZX4A 2E6VA 4GB31 3WG3A 5FDBA 3EO6A 1JYTA 4GIQA 2Y64A 4UFMA 1VRH2 3DCQA 5BUVA 1UF2C 5CIRA 4FPYA 4LBNA 1PM4A 5J1XA 1TG7A 2DBNA 4QKBA 1DQ0A 3DEMA 4CP9B 1WA4A 1W8NA 4AYUA 5LZ6A 4TWTA 3O7OA 1KDKA 5JOYA 1X8MA 1SHWB 3ACLA 2ZGLA 5DZFA 5FYCA 1VRH3 3ZDVA 5C3RA 5JOXA 5GLTA 1LENA 2GN3A 3GJBA 1S0FA 2E7AA 2Y60A 1XU1A 2ZX2A 5AC91 3LEGA 2IXJA 5FPVA 2VNOA 1ULDA 1PK6B 2YPDA 4OHXA 2C6SA 4XMAA 3TN91 2FBEA 2JE7A 4P9JA 4Y5TA 1U5XA 2ENRA 3ZXDA 5BNNC 1V70A 4B29A 3ZFEB 1AR62 1GICA 2AYHA 3W59A 3PUSA 1BKZA 3FC0A 1DLLA 1S2BA 3VBSC 5HV0A 1QXRA 4K7JA 3V65A 3ZM8A 4X8PA 2JG8A 4Q4V2 5C8WA 3OGGA 2BYVE 1Q3EA 3BVCA 4DEQA 4UW6A 4FOQA 3B69A 2VR4A 3MF6A 4QHOA 5KBFA 3BTXA 4KU7A 1AR63 4D7SA 4EWEA 1OQDA 2Y33A 4M0HA 3ZXEA 5LW9A 1NCQB 4M0NA 2DCTA 1UOFA 1EY2A 2XUEA 3OBRA 3GZEA 3VL8A 4Q4V3 1SLCA 4NIDA 2EAKA 3MYXA 3VHNA 5CFDB 3WNOA 2XL9A 2FDJA 1WMFA 2ARCA 5J09A 2BEOA 4P02B 1IG0A 2QUOA 4AGVA 2W68A 3OJBA 3LEMA 2VCBA 4QPWA 1JW6A 4FP2A 2A6WA 1XNDA 4ARYA 5J3UA 1DYKA 5SV5A 4N53A 2QQWA 3AMHA 4OHVA 5IK7A 4XUOA 2CHHA 5E89A 1T2XA 3POFA 4JTOA 3AXDA 1CN1A 1GKBA 4XVHA 1NY72 5C3QA 1SZBA 4GKXA 4FTEA 4MXWB 3ZFGA 2QFEA 1H0BA 2IUWA 4ZXKA 4Q4Y2 4D7YA 4Y5Z0 5DG1A 3CJIB 5F5QA 4Y22B 1LOFC 2WQ4A 3VD7A 5IVBA 1Y7BA 4OHZA 1K3IA 1N3PA 1IOAA 4A2UA 3HNBM 4UFKA 1CAUB 2Y6KA 2XJPA 5K7PA 1FOD2 4FOWA 2R0FA 2D40A 4QXCA 2FZ1A 1JU4A 1RHI1 5BNOB 2VMDA 2RR12 4LA2A 1RUJ2 4DOUA 1CJDA 4GD4A 4Q4Y3 1F5FA 1BJQA 5C5UA 1NCRB 1JYVA 3VBOA 1BEV1 3IMNA 3N7JA 2VQTA 1OHFA 1JU3A 4FOYA 1LGCA 4HVOA 4LORA 1UXXX 5LA2A 3ALQA 1FOD3 3A0KA 4AZZA 1ZBA3 4HZFA 4HXCA 3ZXAC 1RUJ3 2VMEA 3T1MA 2ZS6B 4K1ZA 2YFUA 4O7XA 3I4IA 4KBBA 1UQXA 2Z79A 3OBZA 3LEKA 2HWF2 3U37A 1LOBA 1NAEA 2B45X 1OLME 4OI0A 4KU8A 4B4QA 1RUD1 1W2AX 2NLRA 4FO9A 4GKYA 1YFUA 2YV8A 1AJKA 3ZSMA 5C6CA 3U0ZA 2F4LA 1R64A 4NMIA 3AX4A 1RJ7A 4RHV2 3MW4A 1AR72 1BBT1 4AFCA 3CBNA 2QBXA 2HWF3 1GQHA 1S1AA 3NVCA 1H30A 1WW7A 3BB6A 5A6ZA 4CYDA 1IQDC 3IIIA 1GFF2 1GOGA 4COVA 2WLQA 1CR7A 1QJX2 1YFYA 1PMIA 1Y3TA 3VZJA 1AR73 3PMSA 5I0SA 5DDJ3 3SQOA 5EV7A 3KVAA 3OD4A 3A4UA 4AFBA 1UY4A 4QU2A 1YLLA 2XVLA 3CLPA 5EFUA 5FP7A 2EXKA 3JD71 4BLJA 3J8F1 4R9AA 1SBFA 2XVGA 1QJX3 4HONA 2ZKNA 5BPXA 3VZNA 1BCXA 1POV1 5EIYB 5L7OC 4URTA 2RJLA 2PLV1 4ASKA 3C7OA 3D8CA 3FLRA 1QY4A 4MLOA 4WM8B 1C1FA 1K5MB 2DVDA 4LMFA 1PK6A 2QJVA 1AYM2 2GMEA 4QM8A 5GZCA 1ALYA 1D0HA 1US2A 1FX5A 5C33A 1OLQA 3OSDA 3BTZA 1V6IA 4BE3A 1NG0A 2P17A 3I2HA 4I3GA 3DN7A 1LESA 5BNPC 3E5UA 5JLVA 2BBAA 3X29B 5LK7B 1BQPA 1MS0A 1AL21 2NM1A 3FN9A 5LBCA 1O8SA 2ZCWA 1QJY2 1AYM3 1PIV2 4QMAA 5DUXA 4Q8LA 2YU1A 4GAZA 4AGRA 4XHXA 5JUVA 2XHKA 1QJU2 2A7AA 1HRI2 1GMMA 1NCQA 3T4HB 2L9LA 1A8DA 2RS31 2VPVA 2W87A 1ZNPA 1KFUL 2J1EA 3MGUA 1UY3A 2I07B 4NHLA 5AVAA 1PGL2 5EYYA 2HH9A 4BIFA 3KCYA 1CAWB 1BXHA 1QJY3 3NAPA 2FDKA 1XE7A 4TXWA 4IEYA 4V2VA 5CFDA 5DAQA 4JX0A 4CTEA 3H1YA 1Y4WA 1I3HA 3BU0A 1CIWA 2GNMA 2J1TA 4QKDA 1QJU3 3E5QA 2VCMA 1HRI3 1OA2A 2WO1A 4JV4A 4C1XA 5FMBA 2F17A 5DMYA 1LHOA 3KMHA 3PVBB 3OB8A 3ZYHA 4QGLA 4AQ2A 1RUE2 2R7EB 4ZS2A 4AI8A 3DKWA 1UZZA 2OIIA 2ZEWA 3T4VA 4IV3B 3FLTA 3ENRA 3ZOIA 4DUXA 2XOMA 1J59A 4XZUG 2G4IA 1CPNA 3NV1A 5IWFA 4CP2A 3P6BA 3EHKA 1S0BA 5EHDA 2JKBA 4N43A 1WBLA 4M4RA 4QPGB 1V6NA 4HL0A 4MXWA 5KHIA 1H1IA 2B5HA 3HR9A 2R073 1DU3D 4NHKA 2WO2A 2RM22 3ZXKA 4IDZA 1RUE3 3DGTA 3CJIA 3I59B 1KEXA 4HKWA 3ZXFA 4OI2A 1O3SA 4CEYA 1O4ZA 1A78A 2HWD1 4HFSA 3RYPA 3ELNA 4A7KA 5JMCA 2XKPA 1DP0A 1WCQA 2XKOA 2O8QA 4RL7A 5JVVA 1GWLA 4Q4V1 4RR3C 2A6VA 1XE8A 4M01A 3N36A 5HCBA 5BNOA 1FATA 5LK5A 1W8WA 2X53S 4HOOA 3TNQA 2DF7A 5I8YA 3QBQA 2WWJA 1B35B 1DDLA 3GCXA 5DAWA 4O61A 1XNAA 1V0AA 4ZHNA 2V72A 1ZX5A 4QD2A 1OH3A 1EV13 1OURA 1XYOA 1QWRA 2EXHA 1DCSA 2WS92 1WGPA 2XQRA 4W6WA 3VZLA 1JZ7A 1DGRA 3D4KA 3H8XA 2Y8KA 3PVEA 3SMHA 1ZZBA 5DUVA 3NNFA 4H2AA 2CAUA 4M4PA 2Y0OA 4NAOA 5JDBA 3M3CA 2AH2A 1GV9A 2WQ8A 3LOIA 1RIRA 4BQYA 5DZEA 1PMHX 3IDBB 2WN2A 2IVJA 1V9U2 2WS93 1DLCA 4PBPA 3WF1A 3SNMA 4CDWA 3WUDA 5FZ4A 3LFMA 1WA6X 1KFXL 4QPIC 3J7MA 5FRAA 1RUNA 4XUPA 5FYZA 5L9RA 1NY71 1LCLA 1UXZA 2QVSB 4NHMA 3I2DA 4A42A 4LQRA 4MX3A 4AVSA 4IV1A 2WINB 4AEDA 3SH3A 3N9OA 1V9U3 3H3LA 4IEVA 3R0RA 4CPBD 1JYWA 1UIJA 2X10A 2XMLA 3TYJA 1MS1A 5I0DA 5JMOA 3IDAA 4CVUA 2V5YA 2VOXA 4OLLA 3KB5A 4QX2A 5FZBA 1I1EA 2VOVA 1N3OA 2W91A 5F9TA 3GDBA 1FOD1 2Q5TA 2D6KA 4J25A 4AQTA 5FPLA 2RR11 2K0GA 1RUJ1 3K75B 5A80A 3ZMNA 4CEWC 2OPWA 3WW2A 2E31A 4LHLA 4U36A 4JGYC 4QDSA 1MEC2 3THCA 5APAA 2XJSA 3T0AA 4CUGA 1WLCA 2ADDA 4YYOA 2VXRA 5I0RA 2W5FA 3KF3A 5KHGA 4WM8A 5ABJB 3J7NA 3AB0A 4BQ1A 4DPNA 1UY2A 5A7PA 1UWWA 3KT1A 2DVBA 2JDHA 2JB8A 1F4HA 2HWF1 1MEC3 1REFA 2WFF2 4F7ZA 1E5HA 1FNZA 1NLQA 3NMBA 4EN8B 4K6BA 5FZ6A 3LEIA 5JZGC 2WO7A 4LUKA 2VO5A 4ATFA 4XJUA 5FYSA 4IEQA 3ZFFB 1XOYA 4PBOA 3EBRA 4RHV1 1JZ6A 2VH9A 1FAYA 1AR71 1VPHA 2ZHLA 5HCAA 3ZSKA 1YCIA 3LIGA 5FP8A 1REEA 2WIIB 2XLFA 1UPIA 4D69A 4AVTA 2D5FA 1TVGA 4QQPA 2DUPA 4UF0A 4D6RA 3RG0A 4W6XA 1CAWA 1OF4A 3NNJA 4DNYA 2VNGA 3U10A 1WLTA 3WINE 4BMBA 3DXUA 3TEWA 3U11A 2ZPXA 4XAEA 3ZYIB 3NKTA 3KM5A 4YW6A 5DG2A 4KWLA 1VBC2 4OQ9A 2UURA 3JZVA 1G6NA 4L92A 4XDPA 4CDXA 1CONA 3O0VA 2IFRA 2WLPA 4Q0PA 4CU7A 4EZHA 3I2IA 4JKKA 1PHMA 4QKFA 2D6PA 3MUZ1 4D7TA 2OQ6A 1VBC3 3VDBA 1AYM1 2R062 2F6BA 2VZQA 4QPGA 1NZIA 1RYYA 5FYVA 3KS7A 3FHAA 4FFGA 4AHXA 4XF1A 1H1MA 3SH4A 3I59A 2JE8A 4WM7C 4LKEA 2JG8C 1SFPA 1RXFA 2WR9A 5EWSA 5F3IA 5FZHA 4EROA 2ZGQA 4BWOA 4C8DA 4EN9B 1D0GA 1W6QA 1CWPA 3C7HA 4QXBA 3WNXA 3WQBA 1J83A 1QJY1 1PIV1 1UZ0A 2R063 3KZ4C 5I0UA 1JZ8A 4Y24A 1E5SA 3DYMA 4XBNA 4YGCA 3T2QA 4AHYA 4LK7A 4BQ3A 4MSVA 1OLRA 1F31A 5E6HA 1PGL1 1SCSA 4Y1UA 2WABA 4R9DA 4L8QA 2WA3A 4JDNA 5C7GA 5DQ0A 1RC6A 1DHKB 3I2KA 4QQLA 3PURA 5IVYA 3AK0A 3TBDA 2IXHA 1MR5A 4YW7A 4FPCA 2H0VA 1PX3A 1LU2A 2AR6A 1H4HA 1VMJA 1W2NA 3HMYA 4FPJA 1ND3B 3T0BA 4X6RB 1Z0HA 2XJVA 4Q26A 2HJIA 2I45A 4AAXA 3BKZA 4KMQA 4H7LA 1TQ5A 3VHPA 3ZN5A 3ZPYA 2VTFA 4Y4YA 1Y9QA 3P3NA 3FFZA 4YG3A 4YVSB 3ZFGC 4A6SA 3JCIA 4E8DA 1SBEA 3I2FA 4OCTA 4XFAA 3T2PA 1IS3A 4UYBA 4Q29A 1AX1A 2MEV3 4IGQA 2BNOA 1PGSA 2RM21 3U4XA 4Z92B 5C5TA 1DQ2A 4D6QA 2CGPA 2TNFA 3B9CA 3DF0A 4HBNA 2OUJA 3C7GA 2VGDA 3UGGA 4AFDA 2C26A 4Q0UA 4W50A 5JOZA 1SFNA 5C9AB 1W6NB 4RA0A 4QX1A 4FXKB 1GZ9A 3RSJA 3RMXA 4UT5A 3HN3A 2F4PA 1ZREA 5A3UA 5KHJA 4Y1VA 1UMZA 3MICA 1LGBA 1O59A 3DXTA 4PIYA 4XFGA 4PDWA 2V73A 1G9BA 4CCMA 4JKMA 1JH5A 3MF9A 3PMEA 4FFHA 1JUHA 5F3CA 2Y6FA 2DWRA 1H1AA 1YQCA 3TOJA 3K51A 5D2AA 4AEKA 2VCAA 2C4XA 1ND2A 2JENA 2QDRA 2RJKA 3WDYA 1VR3A 4FPOB 5CVRA 3NKGA 5IK5A 2P37A 1W6PA 1VBA3 3OGJA 3VBFC 2W92A 2VMHA 1Q8QA 1OMIA 3CMGA 3MIFA 1DQ6A 3R4DB 5DN2A 3GHNA 1D2QA 5DXDA 5J98B 4CDUC 1V9U1 1P8JA 3ZFFA 1X82A 1FMD3 4MG2A 4MGSA 5I91A 4Z2WA 4P9IA 3BPSA 4YG0A 1EUUA 5LCWL 1QJEA 4RQPC 4M3CB 4YW4A 3QH6A 1Q56A 5HCFA 5A1FA 2YG0A 5GALA 1WMXA 2Z4FA 4JGZB 3EXUA 4NWVA 5LEJA 4FOVA 2A70A 1O3QA 5BNQA 3VDDC 2A71A 1S0JA 2XQXA 4AQ6A 1XNTA 4CDQB 1CX4A 1G9FA 3GBWA 3KSCA 3GNEA 3UJOA 4CUBA 1E57A 1LOGA 1NQJA 1UYPA 2V4VA 5DUWA 1PVXA 3UYJA 3T2TA 4GULA 2R49A 4P9LA 3QH7A 1BVVA 3APBA 1SBDA 3HT1A 3HBZA 5FIXA 2B9VA 4YFWA 2JG9B 5F5IA 3AZXA 1Q8OA 2PHDA 3AKPA 4GZ9A 3ZYRA 2RS52 3W5NA 2OXBA 4K20A 3N4MA 2RDRA 3N35A 2XJUA 4Q0SA 2WQZC 3MFAA 3LSEA 3ZFEC 5CBLA 4LHSA 2W95A 2WNUB 4YLZA 3LDBA 4QU1A 3J9SA 2WFF1 3W5MA 4BQ4A 5ANQA 4QX3A 1AR92 4BA6A 2A6XA 5L9VA 2LUWA 3IMMA 1ENXA 1OPMA 1D2SA 1DGLA 1MZFA 4YM3A 1H6XA 4FFFA 3UESA 5IVFA 3I2OA 1WMEA 2YHJA 3SISA 1NCQC 2QQMA 3CIHA 1LRHA 1HB3A 1W28A 1RUF1 4LT5A 4L99A 2AENA 3PHMA 3WF4A 3CJXA 1VP6A 4CP1A 1RVF2 3M3OA 1XYPA 2OYZA 5CFDC 4XJ9A 5FREA 1IHMA 1K45A 2K9ZA 2W9XA 1N1VA 3WG1A 1MZEA 1ENRA 4NRMA 2C0ZA 2TBVA 4CSWA 3E6DA 2JDUA 5FLIA 1RUI2 3PUHA 4HETA 3AFGA 5JIAA 2XWJB 3DYOA 3ZPOA 1US3A 1JODA 2JDKA 2X8KA 3WX5A 1HJGA 1RVF3 4N53B 1TMF3 1VBC1 2Q4SA 5F2WA 1R1A2 3RZKA 1IS4A 1ND3A 2ZOEB 2AZ5A 3LAGA 1X50A 5JAXA 1KITA 1VE0A 3PVNA 1RUI3 2RJ2A 1MVEA 4S2FA 5FBJA 5FYHA 4CU6A 3BALA 1AR82 4H14A 1GWMA 2ZABA 5A3PA 1H2LA 3N9MA 1X9TA 3OEAA 2A73B 1WW6A 2CSGA 4EWAA 5JOWA 2I74A 2R061 1R1A3 1ST8A 1MQTA 2BUKA 1UNBA 5FUNA 4DMIA 2J1UA 2FZ2A 4CU8A 4OHWA 2PHUA 4BPZA 3MZHA 4XF3A 3B9IA 1LECA 4IESA 1QU0A 1OPOA 5BNOC 4META 3LF7A 1D4M3 3NW4A 1CAXB 5C9AA 5LWBA 1W6NA 3S57A 2OPKA 2R0HA 4GH4A 1NCRC 2C9AA 3PLQA 3IKWA 4QX7A 2VU9A 5TSWA 3VBOB 2DFCA 2X5IB 1ZZCA 3NRUA 4XDOA 4Y1YA 5I0TA 3O1VA 1AHSA 2ETEA 3PNAA 1XU2A 5L19A 1QF3A 3ON7A 4EYUA 1W8HA 1AX0A 1V6KA 3NV3A 2BGPA 5ACA2 4MYEA 5HV4A 1W3VA 4I0AA 3RVHA 4WBBA 3VKNA 3N9PA 4XIKA 1C1LA 2GH2A 4XUQA 4B1MA 1DQ1A 4A6OA 2FDIA 1NE6A 2PHFA 3ZN4A 4OQ8A 5EYXA 4A7ZA 2WT1A 1QMJA 4AI1A 3AJYA 4IE4A 5D8AA 5ACA3 4PQQA 4XJ8A 4DO0A 2Q8OA 1OVPA 3PJYA 2AEYA 5A3OA 2CAVA 3UETA 1BYHA 5AVPA 3E1F1 1UOBA 3WQ0A 1LR5A 3LB9A 3V56A 4E4DX 3ROUA 2DTWA 4M3CA 3IM0A 4FCAA 3AYDA 3VBHC 4CPBA 1A3KA 4JGZA 2GDFA 4JTNA 3SKVA 2LALA 5ANNA 1HDKA 2GP5A 3SKJE 1UW8A 2DCJA 4CDQA 4E9KA 2GN7A 3J7LA 2ORZA 2EA7A 5CNAA 2WFPA 5C71A 5LRSA 2GP3A 1T6GC 1C8M3 4BLIA 5FZLA 1UN1A 2BOJA 5C3PA 1Q8SA 1F35A 5JXGA 1W0PA 4MXVA 4K40A 3GJAA 1ASJ2 4RN5A 3H1WA 1YUDA 3UV9A 4GA9A 4ET7A 3WLUA 2RHPA 2JG9A 2K2SA 2VZUA 5FV3A 4D94A 4CXYA 1PX4A 1K5MC 3MIBA 1ZZ7A 2VBBA 2VQ0A 3TWIA 3S0MA 1N1SA 1O3TA 1BVP1 2P3JA 2P1BA 2Y26A 3ZO0B 2LTNA 3NJVA 4R52A 1ASJ3 3BU7A 3R6SA 3O1RA 1NOVA 2IWGB 4YRDA
chains in the Genus database with same CATH topology
3MEPA 2N7GA 2WNUA 3VZKA 4ZU7A 1MS9A 1WW5A 2GC3A 5K0UB 3VN4A 3RJ2X 1IPJA 5IUQA 5DZGA 3J4UH 1VBE1 4QGNA 3GYDA 2DUQA 3I8TA 4HVRA 4AVVA 1CVNA 2D6OX 4IQPA 3WOGA 1AX2A 3NAPB 1DYPA 1CAVA 3RJRA 1LULA 1ZBE2 4B4PA 5FLHA 2PA7A 1XNCA 3UL2A 2QZ2A 3ZVXA 1WW4A 4AEJA 2VECA 5CFCA 4AG4A 2ARXA 3UKNA 1MACA 3J26N 3MLKA 1PGW2 1FYUA 1V00A 2O0OA 3PTYA 5JPMB 4IV3C 1ZBE3 2E63A 4FXGB 2UYBA 2XUMA 4N43B 3PVOA 4SBVA 2RS51 4F8AA 4QPGC 1VBB1 1YIFA 2VMIA 2GZWA 1DQ4A 4RGAA 4DRVA 4PLOA 4CEYB 4Y1ZA 1LKNA 4OI1A 1FI2A 2D93A 1F8VA 1RTVA 5FPXA 1PZ8A 1ZBA2 1AR91 2CL2A 3TNPB 1LEMA 5KXCA 1DZQA 1WUVA 2JXAA 1CAXA 4E27A 1H8TB 3M7AA 2ZACA 1B35C 2E53A 4XIOA 2X5IA 4PJYA 3C2UA 1JOJA 1RVF1 2E9QA 3I7DA 5CAZA 1DFQA 5J7MA 3DPRA 4G9SB 3MFCA 4KWKA 2VW2A 4XQ4A 1RUI1 3ZSLA 2BNNA 1YFXA 5SV8A 4YARA 4ASMB 1SCRA 3P3PA 1DBNA 4WVWA 1FT9A 1H2MA 4CDWB 1R1A1 1C3HA 4F3JA 4WZFA 5DDJ2 4ISQA 3AP9A 4YW5A 2PN5A 4XF4A 4AGGA 1IQAA 4IV1B 2ZMNA 4AEDB 1AR81 4JVAA 2VY0A 1G86A 4LBQD 1IGOA 2NPIA 4PF5A 1S0DA 3D0SA 3BOWA 3MI8A 1A8MA 3MIEA 1URXA 1HXS1 4AE2A 2JECA 4DY3A 2YPJA 3CNAA 3WHTA 1MZ5A 4LBOA 3WD5A 2RMU3 1YI9A 3LCPA 4YZ2A 1OI6A 1RINA 4KWJA 4UW3A 1ULEA 4BH9A 4LLOA 4FBFA 4LULA 5ABJC 2NZ9A 5ACA1 2YXSA 3N3HA 3ES1A 4C0HA 4PLMA 1NZCA 2XJTA 3OCPA 2Y0IA 3WP4A 1Q5OA 1RMU3 1UZYA 2YC0A 4YM1A 1ULCA 2YZ4A 4P9WA 1HV0A 5FCCA 4JQRA 1C5HA 4GALA 5K0UA 5T5OA 3CO2A 1N1YA 4TZDA 1ULFA 5JSOA 1GQGA 4RFT0 1NA1C 2GNDA 3AKTA 1GNHA 1VRH1 3OF1A 3H3ZA 1S0EA 3H0OA 2GC2A 1NXMA 3MIHA 2R043 5FMOL 3QLQA 4KNCA 5E1RA 4Z1VA 4CDXB 1QOSA 2R072 1AUYA 3LSDA 1ASJ1 3T1LA 2GNTA 1QNYA 4R4XA 3USSA 1LOEA 4ISRA 2VVDA 2VW1A 5EJ3A 2EAAA 3IBMA 3E6CC 1AR61 1QXJA 1G9CA 5H9RA 1PNFA 5A32B 1EV12 1YO8A 1W6QB 2Z42A 3DL3A 4X8NA 3CF6E 4WVZA 1ZYBA 2DU1A 1JXNA 4FT8A 2ZMKA 1H8TA 1LHNA 1N47A 1OOPA 1AXYA 1PNGA 4ZU4A 2BPA2 4LTAA 3OBTA 1QJZA 2ARBA 1AJOA 3KCXA 2WNVA 5LRRA 4U2AA 1JBCA 1SQ4A 2ERFA 1X33A 4BCUA 1ZBE1 2ZA9A 5FQ0A 4XFBA 3AP4A 5AFBA 3RDIA 1VJ2A 1ND3C 4FPKA 4EV0A 4YZ1A 1UKRA 1I6XA 5J36A 2CNAA 2EALA 4WZCA 1PGW1 5E88A 1ENSA 4YVSC 3WG4A 1GZCA 1RUH2 1W2UA 2NN8A 3SCFA 4YVWA 1UPSA 4C1WA 4AI2A 4Q4Y1 1ONAA 1SACA 1NLSA 3BOPA 3G6JB 5GLVA 3FJSA 4FAGA 1RUH3 1ZBA1 3A0NA 4IEWA 4BMEA 2WWSA 3ES4A 4XZPA 3WW3A 4DINB 4S2GA 5DUUA 3ZX7A 3B01A 1KS4A 2XG3A 4P9GA 4DQAA 3W58A 3RS6A 4PDWB 3HIFA 3AP6A 3E6BA 1J58A 3GBFA 4NN0A 2EVXA 1RL3A 4Q4X2 5J37A 3G7DA 4YGDA 1U12A 1QH6A 2PHTA 5JIUA 1ND2B 1NE4A 1NLRA 3BTAA 1WD3A 2KXLA 2HEYF 1UCXA 1W39A 1TE1B 1W6PB 1BMV2 5JPNB 1R092 4Q4X3 2XL7A 4HSJA 5FFOC 5F1RA 5T5JA 1YJLA 2VULA 2BGCA 1Q8PA 5DDJ1 2ZGNA 1SLAA 4XXAA 3VBRB 5FTTC 1SEFA 2WL1A 3MLLA 4JGZC 4MVTA 1R093 2QE3A 4XTPA 5BNNA 5F6KA 5T3NA 3UJQA 1KQRA 4OI0A 1TEIA 4JCKA 4MV2A 1QJX1 3K48A 1DG6A 2ZMLA 3VBSA 3SLIA 5BNPB 4HK8A 5J48A 4M3CE 3OYWA 3O5SA 1REDA 1ULGA 1CJPA 4H3WA 5KHHA 2YGMA 3TRSB 1H8VA 2VNRA 2IFWA 1O91A 2NQYA 4GWNA 1DZRA 2JG9C 1F2NA 2CYFA 4YZ4A 2GMMA 1HQNA 2XJRA 3VGIA 4UBGA 2DFBA 3AYEA 3WR0A 4YW1A 1LU1A 2ZGSA 4L11A 1QKQA 4AK3A 3QD6A 1KS5A 2HEVF 4S2HA 2IXKA 2WNUC 1MZ6A 4XF9A 4DFSA 3AKQA 5A32A 3M70A 3GZAA 4MGZE 2BFUL 4JC1A 3FFQA 2R32A 4SLIA 1IPKA 1GZWA 1QJU1 1HRI1 3IDCB 3E97A 2Q30A 4YZ5A 4IEZA 2WZR2 4JRAA 4Z07A 3ZSEA 4HSLA 4BOWA 2H6CA 3AZZA 2XJQA 1EPZA 1GBGA 3MIGA 1AF9A 2XLGA 1EYBA 1LOFA 5FOJB 3RYRA 1RUOA 3LA2A 4LO7A 1UL9A 5IK4A 4Y26A 4GMP3 2WZR3 4N53C 2R071 4HKOA 2MEV2 4P14A 2E51A 3CL1A 2IXLA 1RUE1 3OY8A 4CZSA 3O12A 3FBYA 1ZZ9A 4XE9A 1BK1A 1YWKA 4TYSA 2O8OA 3WV6A 3BPZA 1O5LA 3NV2A 1J3PA 3GBGA 3H1MA 1COV3 3L2HA 1MQTB 1UX6A 3QACA 1RGSA 2GMPA 1U0AA 2DCZA 4WVMB 3DUIA 1EV11 2JEMA 2A75A 1R082 4GH4B 4UBHA 4FTBA 2B8MA 1VB2A 2RE9A 3GHMA 3VBOC 3HD8B 1CD3G 1O7FA 4XFHA 2LM3A 1D4VB 1VBA2 3ZN6A 4A3XA 4YGBA 1R1ZA 4GXLA 1S55A 2ZBJA 2AREA 1R083 2DURA 3THPA 3AKRA 2VQAA 2WS91 3RYKA 1FMD2 4XFFA 3AMQA 4K9SA 2Q0AA 5KXBA 4DY5A 4ASLA 4GB33 2FMDA 4GMP0 4KL1A 1SLLA 1WMDA 5D8AB 3POSA 1HW5A 3M3EA 4AEMA 3RPQA 3NV4A 1RITA 3M2MA 4AFMA 1Y43B 3IDEA 1J3RA 5L7OA 5I8SA 4OZXA 5C4WB 3FBMA 1J1LA 2XWBB 5GKAC 5E8AA 3VBRA 1RUH1 2DYCA 4LBKA 3AZYA 4LBQA 4N7IA 4RGGA 1OA3A 1XQNA 3VV1A 1IS5A 4YG6A 3POWA 4FAHA 2GC0A 5BNPA 3TN93 5KC5A 5JR7B 3PJQA 1WCSA 3WDVA 2ZGKA 4RSUA 4XJAA 4DS0A 1FNYA 3L9JT 5T52A 2GALA 2Z2SB 1MEC1 1AVBA 4MH0E 4HN1A 4CP0A 3UKVA 2OA2A 1PK6C 2D7FA 4Q4X1 3ZXGA 1SMVA 2DUOA 4L97A 5FMOS 4B8EA 1KXGA 4HT1T 3ZYPA 4I0BA 2ZTNA 1F9KA 4HKLA 2Y38A 1BMV1 4G4FA 4HN0A 2Q1MA 1PVC2 3AMPA 2ZGUA 1LTEA 3AMMA 1YHFA 4XFCA 2C1FA 2MNGA 2ZKLA 3NO8A 2XGXA 1AXZA 2X29A 5A33B 4J1XA 1OFNA 2YGLA 2UWCA 1X8EA 1PVC3 4KG0A 3NAPC 4LA3A 3L2YA 1CAVB 1TMF2 4FPLA 1X7NA 4G3YC 4QQOA 2DV9A 4AFAA 4RD7A 1OD5A 4EWDA 4NVPA 2W52A 3WW1A 1RHI2 4HPKB 5CFCB 4NOTA 2ZGOA 1XNKA 2OUHA 4RR3A 4LHKA 4BZ4A 4LNVA 3UKTA 1LHUA 4FP3A 5JI9A 2EXIA 3WDXA 4W65A 1GYKA 1C28A 3KT7A 1ZRDA 4N43C 1RHI3 4FTSA 3MPPG 4Q0VA 1D4M2 2EXJA 3VZMA 4QQ2A 5HXVA 2BBVA 3CJIC 1GLHA 4CEYC 2GAUA 1DF0A 1EP0A 4JDOA 2BVVA 5H9SA 4M00A 3I54A 4ES9A 1AXKA 2HEWF 3HT2A 4WVMA 3FHIB 5GLUA 2DVGA 3RI8A 1H8TC 2UYAA 3QCWA 3FE5A 4QPIA 1A6CA 2V09A 4LBLA 5T55A 4GMP1 2GSYA 5IT6A 2UWAA 2WZR1 3AZVA 3ST7A 5CG8A 3DPRB 4IEUA 3ILNA 4E2QA 2XH6A 3D6EA 3N7MA 4TLFA 1O5UA 4XTMA 5D1IA 2IZWA 1I9RA 1TNRA 2P2KA 4B4RA 4Z8BA 3GZTB 1J3QA 3IPVB 1SLTA 2ET1A 4XYXA 4CDWC 1QQP2 2B39A 2PTMA 3SHRA 4J1WA 2MEV1 4HVQA 4N90A 2EIGA 4LE3A 1H9WA 5C4WA 1C8M2 1HQWA 2WSUA 4IV1C 4AEDC 1LGNA 1ZRFA 1KDMA 3ECQA 4Y1XA 1POV3 1QQP3 1UD1A 5GLWA 3AP7A 3LKJA 2XLAA 1HKDA 1RUG2 2B42B 3AP5A 2O1QA 2R1BA 3VBFB 2YYOA 4H55A 4N9HA 5JZGA 2CY6A 4DZGA 3V0BA 2PAMA 2CGNA 1RUC2 1R081 1VAMA 4Q27A 5I8TA 1ZRCA 3ILRA 1FXZA 2RS32 3AJZA 4RQPB 1RUG3 4Q1RA 3WUCA 1WBFA 1AL23 4FVVA 1PO12 4WM8C 1VBA1 4KGQA 4KG8A 3VDDB 1RUC3 2R6QA 1FMD1 2BQPA 3H7JA 3URFA 2RS33 5C8CB 2PELA 3NL1A 2P3IA 1YRZA 3LA7A 1PO13 3D82A 5FPZA 1EPWA 4B3NA 2GU9A 1O4TA 4M3CF 2ZGPA 4ATEA 4COZA 2PYTA 1CQ9A 3VKLA 4IEPA 3JB4C 4B7KA 2ZX3A 4WVVA 3IT8A 5A33A 1POV0 3B00A 1ZM1A 4FPEA 4Y20A 3FX3A 3MW3A 1U5YA 2ILMA 2GNBA 2HWD2 3V0AA 4K8FA 4WM7A 4LE4A 4LUMA 2BFUS 4IEXA 4JRLA 1MS5A 3FMGA 4PQ9A 4HPKA 3M3IA 2D3PA 1V6MA 4CDXC 4XBLA 1JUIA 5FBZA 1LJ7A 4I09A 4QPYA 1PO22 1VB4A 2HWD3 1Q8VA 2CWSA 2WKKA 2XVKA 5BYNA 1TNFA 1VAKA 2MHFA 4INDA 4XETA 1UAIA 1ZZ8A 2QKDA 1ENQA 1PO23 3B02A 2ZGRA 3WHUA 3VHOA 1H2KA 4EN7B 3ETQA 2WT2A 1YJKA 1PVC1 4Q8KA 3RWNA 3JBG2 1QGLA 2JDZA 4R9BA 4XMIA 1OOPB 2Z5WA 4FQ4A 4LLFA 2WJSA 4Z82A 2VG9A 2PHLA 4XQDA 1FV2A 4COUA 3TB0A 2HWC2 1KJLA 5JSPA 4O9GA 4XQWA 4YW2A 1QHDA 3HWJA 2WNVB 1TMF1 2YY1A 1WD4A 2I2SA 4I30A 3INAA 3JBG3 1IKPA 5FQ0B 5BV6A 2D98A 3S7EA 4W6YA 2HWC3 1W0OA 3VHRA 3WZ1A 1AZDA 1JYCA 5AFEA 1W6OB 3IPVA 1Z78A 1LOCA 4XILA 2H0BA 4AF9A 2VUAA 4XEZA 1LB2A 5EZWA 3VKMA 1BZWA 2DU0A 3ZXJA 4K21A 3ZSJA 2BWCA 2JD4A 4YVWB 2EF6A 2RR13 2OZ6A 4OHYA 4NR1A 1D4M1 4COYA 4LR4A 3VBUB 5KHKA 1HIXA 2RMU2 3HAGA 2IXCA 3C3VA 4COWA 1PZ9A 3RQ0A 4NWWA 4I02A 4AVBA 3VBFA 2YMZA 2WZPP 4CDUA 4OUSA 4RS5B 3ASIA 3S7IA 4YM2A 4ORFA 4PDWC 4RQPA 2G9FA 1RMU2 1VBD2 4P9XA 4LBJA 3VBHB 4QGMA 3NSTA 5FOBB 4LO8A 4RHV3 3VDDA 1KRIA 3WDWA 1ND2C 1WCDJ 2BW8A 2QDNA 2D97A 5C8CA 1LEDA 5JWPA 3O14A 1VBD3 3VUOA 3ZIXA 4L2NA 2BWAA 3ZFFC 4AHWA 1HV1A 4Q0QA 3WG2A 1QQP1 1QDOA 2NYYA 3JU9A 4I3PA 4I2OA 3NJZA 3M8LA 1EAH2 3VBRC 4K1YA 2HWB2 2R042 4UW5A 2PAKA 3WP5A 1C8M1 2BNMA 3N7KA 1Z7S2 5BNNB 4E4ZA 3MDPA 3UK9A 2BTVC 1VAVA 3ZFEA 4LO5B 3VBSB 5F6LB 5CB7A 2IC1A 1RUG1 5T50A 3OYWB 1EAH3 4FPFA 2CV6A 2HWB3 1Z7S3 3ATGA 1RUC1 2R1DA 1WLDA 1QH7A 1WCKA 1U5IA 2H6BA 2HKXA 1J1TA 1PO11 3SCHA 2E7TA 5JCTA 2ZAHA 1PIV3 4FSJA 3B3QE 3S6PA 2VOWA 1AL0G 1UKGA 4FPGA 1FPN2 1L3JA 2D5HA 3R05A 5GM0A 2ET7A 3LA3A 3BIWE 4IXLA 2E7QA 1RB8G 1KJRA 2DVFA 3ZDSA 4ES8A 5FLJA 4YNIA 1B09A 1ZZ6A 2ZHNA 1FPN3 1GZWB 2ZX0A 4X6QB 1CESA 2VVFA 2TUNA 4JDMA 2NMNA 1IKQA 5BXXA 4Q2FA 2CTVA 1S0CA 1VIWB 3E5XA 4MGIE 1VALA 5GZFA 1DQ5A 3M1HA 4Y22A 1DGRN 4LHNA 4K3UA 1YYNA 4XOGA 2VUJA 3S30A 1MS4A 1S0IA 5JSRA 4AVAA 4ZKTB 1CAUA 1PZ7A 1AYN2 5LEKA 4XF0A 4YW3A 4L9BA 2RM23 2OZJA 1V6OA 1YIPA 3OY8B 1NCRA 1PO21 1W6OA 4LBMA 5EXOA 5FO8B 1O3RA 4R9CA 2A3WA 4JAAA 1IZ3A 3VZOA 1AYN3 3FZ3A 4N7UA 1GNZA 1ZA4A 5FO7B 3ZXLA 3WDUA 5A3LA 1MQTC 3Q9OA 3VBUA 1APNA 4HMZA 5J96B 2ZHMA 3FLPA 4E2SA 1LHVA 3IWZA 4UXAA 3TAYA 5C9AC 3JUUA 3MW2A 1YXWA 4GH4C 2FHRA 2ZGTA 3JBG1 3VL9A 2UY9A 3R4UA 4O9EA 4RS5A 1KD7A 4OULA 4E4SA 2YDEA 3ZN6B 2G9GA 5CADA 4AWDA 4LEJA 2HWC1 2XBO2 3VKFC 2C5DA 5K9YA 2AGSA 3VBHA 3WCSA 4Q1PA 4CRQA 2WA4A 5K8SA 5KXDA 3BODA 4TSVA 2XBO3 2PHXA 3IIAA 5D8AC 5I93A 2HWE2 2VW0A 3M4FA 4MGKE 4EN6B 1UU5A 3WXPA 3CEWA 1V6JA 4OI4A 5L7OB 4QX5A 3FUOA 2D43A 3AYAA 5B2GB 5FAXA 4QHBA 5C4WC 2UY8A 3THTA 1NQDA 5H9PA 3GF6A 4DRRA 3WP6A 1U5ZA 1K5MA 4LBQB 2HWE3 2AUYA 2RMU1 3USUB 4CDQC 3DV8A 3LZZA 1G7YA 4YSFA 3AXEA 4E2GA 4OUMA 1H4GA 5CA6A 3B94A 4Q4W2 2R16A 2MPFA 1QNWA 3ME2A 1JHNA 1RUF2 2YROA 4AXOA 2WFF3 3H50A 1SLIA 2IXIA 2ZZJA 3FUQA 4AI3A 2OW4A 4YFZA 1NA1B 1O4YA 1RMU1 1VBD1 2FMYA 3D5OA 4HK9A 1JYIA 4HLTA 2YUEA 1YFWA 2D6NA 4DB5A 1YNAA 1HRV2 4Q4W3 4XPVA 2B7YA 1M4WA 3H8UA 5BY5A 1V6LA 1RUF3 1NXD1 3EJKA 1HLCA 4LO4B 4QM9A 3WQ1A 3AMNA 2JJ6A 1TME2 1GANA 4PIXA 1HRV3 5HBAA 3JQXA 2WSVA 2VVEA 5CG9A 3W9AA 2Z69A 4IV3A 2D44A 1EAH1 2HWB1 2R041 5L73A 3WCRA 1TME3 1FV3A 1Z7S1 3B5LB 4WV8A 3LGRA 4A7YA 3GALA 2ZHKA 1DGWA 3O0WA 3KLSA 5E16A 2JE9A 1W6MB 2KM2A 4RR3B 4C91A 5CFCC 3NWKA 3WVJA 3AZWA 1COV2 1C5IA 4FQZA 4XJWA 4IL7A 4NPRA 3RMYA 1RJ8A 1B35A 3SCGA 1G9AA 4S2DA 2DCYA 2WT0A 4XDQA 5L36A 4I0WB 2RS12 1G9DA 1HQLA 3HN1A 3LWCA 1C57A 1FPN1 4H7MA 4MUVA 4IERA 1QOOA 1S0GA 4XW3A 1DZTA 1N1TA 3AFKA 4B7EA 3IN9A 2RS13 4BM8A 3SITA 1QXPA 2PQQA 4QPIB 3CU7A 2X5IC 5KWRA 4GB32 2DCKA 4P9YA 3WDTA 4BIOA 1DIWA 3MIDA 2PFWA 4FPHA 4XJZA 3DPRC 1HX6A 1N3QA 1QDCA 5T54A 1GSLA 3QOPA 1NYWA 2ZJCA 4V1PA 4AI0A 4QQHA 2P34A 4BHPA 1AYN1 2WNEA 2FQPA 3ZIWA 3OTFA 2R30A 4CEWB 4F83A 2ZGMA 4JGYB 3AM2A 1UU6A 1XNBA 3H9AA 4YM0A 5AC92 3LOBA 4KH9A 1LODA 2SBAA 4I01A 4DXZA 4N9IA 3TN92 2CGOA 3WY6A 2A6ZA 1OA4A 2KA3A 3ILFA 4PCRA 2B46X 5ABJA 4EJRA 2QCSB 4R4ZA 5H9QA 2D3RA 5KXEA 4AQSA 1XXNA 4AVCA 3KT4A 3EQEA 3USUA 5AC93 5JZGB 2TEPA 1VLNA 3ZMOA 1DGWX 3KGZA 3SXWA 1QOTA 2PHRA 3V0BB 2P3KA 1CGPA 1H9PA 3OPZA 2NP0A 1SDWA 2WC2A 3KQRA 4MGYE 1VBE2 1OKQA 3AYCA 1C8NA 4ONUA 2XBO1 3ZYGA 1NA1A