4PJYA

Azide bound cysteine dioxygenase at ph 6.2
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
186
structure length
186
Chain Sequence
ELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine dioxygenase type 1
publication title Structure-Based Insights into the Role of the Cys-Tyr Crosslink and Inhibitor Recognition by Mammalian Cysteine Dioxygenase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 55
structure length 186
sequence length 186
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2014-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4pjyA00
1SFNA 4I0AA 1YFXA 3E6DA 1IPJA 3IDCB 5D1IA 4JV4A 4BH9A 2PA7A 1VP6A 2ETEA 5FLIA 4YARA 1J58A 1YLLA 3D0SA 3R6SA 4J1WA 4YRDA 5JSRA 4I3PA 2QNKA 2O1QA 2K0GA 4IETA 5I8YA 4I09A 2K9ZA 4QXKA 4KWJA 2VECA 1RC6A 1Q3EA 5BPXA 2BYVE 4PIXA 5FQ0A 4QGMA 2GZWA 4Q0QA 4UBHA 4Q0UA 3H3ZA 3SCHA 1CAUB 4L2NA 5FPZA 3MDPA 1WGPA 4D7TA 4WBBA 5E16A 3SCFA 3U10A 4B29A 4HN0A 4XF4A 1ZZ7A 5CVRA 2V09A 4ZU4A 3H7YA 3BPZA 2WFPA 4FBFA 5C8WA 5FDBA 4FT8A 5E1RA 3IWZA 4MV2A 1YUDA 3QOPA 2HKXA 5LEJA 1H1MA 1LB2A 1DGRA 1GQGA 1CGPA 4MH0E 3H1WA 5JSOA 4JVAA 4IEWA 3EBRA 3TNPB 3S7EA 1H1IA 1V70A 4D7SA 1UD1A 4FAHA 2EA7A 3FWEA 2IXIA 3H1YA 1U12A 3E6BA 5KHIA 4KL1A 2WC2A 3LOIA 1EP0A 5FQ0B 1YFYA 3QACA 3RYKA 1QY4A 3RPQA 2QCSB 5J7MA 2IXKA 3EQEA 1I6XA 5LRSA 1UCXA 1ZRDA 4R8HA 4ZU5A 5J48A 2GH2A 1OI6A 1Q43A 1VJ2A 2F4PA 5F1RA 5J3UA 3RDIA 3BALA 1DGWA 3FHIB 4X6QB 1CAVA 2XLFA 2VPVA 1ZREA 4Q0VA 4HVRA 3NW4A 2GU9A 1JUHA 1PMIA 4A2UA 3ST7A 3E5UA 4WZCA 4IEYA 4PJYA 3HT1A 4Q0PA 2UY8A 4LUKA 4BYYA 4I0BA 4Z07A 2OPKA 2BNNA 2ET1A 5I93A 2B5HA 1CAUA 3ES4A 4UXAA 4RD7A 3SMHA 1NZCA 3SHRA 2MPFA 3E5XA 3JZVA 1UW8A 3KGLA 3E5QA 4KWKA 3DL3A 5CU1A 3MYXA 1X8MA 2XKOA 4KWLA 3LWCA 1RUOA 4KU7A 5KHHA 3I54A 2HJIA 2PHDA 3E6CC 4HMZA 4ZU7A 2IXHA 1ZZ6A 1CAVB 3FE5A 4XFGA 3I7DA 3CO2A 4AQ6A 3EO6A 3S7IA 4N9IA 4I01A 2QJVA 4LTAA 4O9EA 4Z82A 1CAWB 3E97A 3BB6A 2D5HA 2PAEA 3RYRA 1X7NA 2Z2SB 1NXMA 1DZTA 1CAXB 4XF1A 1J1LA 1EPZA 3NJZA 2OA2A 1O7FA 2Q4SA 5FLHA 5I0UA 4XFBA 4XFFA 4XF3A 4YSFA 3PVBB 4HSJA 4R52A 4MUVA 4QGNA 2UYBA 4JTNA 4MX3A 4AVBA 3OTFA 5FCCA 5FPXA 4QM9A 2PYTA 1ZRFA 3KGZA 3IDBB 4Q0SA 5JSPA 3LA3A 3RYPA 1ZVFA 3IBMA 3KSCA 5KBFA 1QXJA 1O5LA 4META 1IPKA 4EROA 2BNOA 3PLQA 2B8MA 3ROUA 1LRHA 2ZKLA 1O3RA 2CV6A 1YFUA 1WLTA 4E2QA 3L2HA 5HI0A 2IXJA 5KHKA 2CAVA 1SQ4A 3UKTA 2GC0A 1XE7A 4FAGA 4XETA 4YYOA 4NVPA 1X82A 3CL1A 5LRRA 4HVQA 3SXWA 1O3SA 1O3QA 4YNIA 5EFUA 1WA4A 3EJKA 2XHKA 3KMHA 3OGJA 4XEZA 1J59A 3HT2A 4HLTA 3D82A 4EWDA 2GC1A 4IERA 5I8SA 2H0VA 2H6CA 2Q30A 4HVOA 3U0ZA 1UIKA 1ZZBA 2H6BA 1ZRCA 4HZFA 2C0ZA 1CAWA 2QVSB 2CAUA 1QXRA 4WVZA 4LUMA 2UYAA 2OZJA 3FFQA 1YHFA 3U11A 5CADA 5KHGA 4HN1A 1O3TA 1CAXA 1FXZA 2PAMA 4BIFA 4KU8A 2XLAA 3OD0A 4UBGA 4HBNA 4MGKE 4I2OA 4AVCA 4L11A 4GULA 3WW4A 3DKWA 2BGCA 5LEKA 2B9UA 4LA3A 5T3NA 3HIFA 3C3VA 1EY2A 4JTOA 3ELNA 3LA2A 1J3QA 4ORFA 4IEOA 4F7ZA 2IXLA 4AQ2A 4OFGA 2D40A 1J3RA 5K8SA 1O4TA 1X8EA 3GBFA 2FQPA 3LAGA 4IEQA 4LEJA 4DINB 4OLLA 2PAKA 2UY9A 4J1XA 3CJXA 5KHJA 5JR7B 5BXXA 5I0RA 2KXLA 3HQXA 2ZCWA 4BHPA 3KCCA 4QGLA 4AXOA 4XFAA 4AVAA 4E2SA 4QMAA 3M3IA 4HSLA 4O9GA 3H3UA 3RZZA 2BNMA 1CX4A 2MHFA 4IESA 1ZZ8A 1TQ5A 3PNAA 2EVXA 3CEWA 4MGZE 2FMYA 1SEFA 2EAAA 4XFIA 3BCWA 4EV0A 4H7LA 3NKTA 2PFWA 4MGIE 4MGYE 1EYBA 4X6RB 5EZWA 2DCTA 3MPBA 4CYDA 1RUNA 1UIJA 3ES1A 1I5ZA 2XLGA 1YWKA 4QM8A 4XF0A 1ZX5A 3UKNA 3OF1A 1O5UA 4XFHA 3OCPA 1Y9QA 3WW3A 3N4MA 1XE8A 3H7JA 2E9QA 2GAUA 3ACLA 2BEOA 2CGPA 4IEVA 4N9HA 3BU7A 4EWEA 4LLOA 1J3PA 2PTMA 4Q29A 3B02A 4XF9A 1RTVA 1ZRRA 2ATFA 3UKVA 3LA7A 2OZ6A 3H8UA 3CLPA 4LA2A 1UPIA 3I59A 1PM7A 3H1MA 1GQHA 2XKPA 5JCTA 2Y0OA 2Z69A 2Q0AA 3TNQA 4IEUA 4LULA 4K8FA 5FLJA 1NE4A 4I02A 1Q5OA 3DV8A 1NE6A 3DN7A 2VQAA 3FJSA 1NYWA 1ZZCA 5AVPA 3IIAA 3NVCA 3O14A 4IEPA 2OYZA 3VHRA 1OMIA 1RGSA 4IEZA 2XL7A 3RNSA 1DZRA 5BV6A 1Y3TA 2MNGA 2IXCA 1YFWA 3GYDA 5BUVA 2GC2A 2I45A 2PQQA 1FT9A 3EHKA 3S0MA 1HW5A 3FZ3A 4P9GA 3H9AA 4PIZA 1L3JA 2PHLA 4TLFA 3M70A 1RL3A 5JAXA 1LR5A 1LKNA 4IEXA 3NL1A 1OD5A 1ZZ9A 3CF6E 5C6CA 1G6NA 4QX5A 3I59B 5I0TA 4F8AA 2D93A 4E2GA 2XGXA 3G7DA 2O8QA 1FI2A 5BY5A 1XRUA 5I91A 3SCGA 1OFNA 2ET7A 4MZUA 3H50A 2P17A 4PIYA 3MZHA 3USSA 4ONUA 1VR3A 5I0SA 2N7GA 3D0JA 3LZZA 3WW2A 2Q1ZB 2XL9A 5I8TA 1QWRA 2IC1A 4EWAA 3WW1A 2D5FA 3FX3A 3ZDSA 1ZNPA 2GC3A 3NSTA 3ETQA 2QDRA 4XFCA
chains in the Genus database with same CATH superfamily
4RGAA 3E6DA 5HPOA 1IPJA 1BCXA 4Y1XA 3ZFGA 2XJSA 1AL23 5F32A 1H6XA 4D0QA 2ES3A 1IS4A 1PO11 1VP6A 3D0SA 2K2SA 3AMPA 1W04A 4YRDA 4LJHA 1MZEA 4A3XA 4KBZA 3J8F2 4CUAA 2ZS6B 3GBWA 1N47A 3POJA 1HXS2 1SFYA 4PF1A 4OI1A 1AYN2 1HN0A 2VUJA 1PVC2 4IETA 3VKMA 3VL8A 5C3RA 2FDGA 4Q26A 4P9XA 1LCLA 2CNAA 4KWJA 1IS6A 3I2FA 1RC6A 2JIJA 2NLRA 3MIBA 3NO8A 4R9AA 3ZFGC 1CQ9A 3ZKUA 1GNYA 2YFZA 5J96B 1FPN3 4OI2A 2XJUA 4FQZA 4PCRA 5IFTA 3O1RA 4CDQB 1NCRA 4AVTA 2EAKA 2IUWA 1NAEA 2RDQA 5C71A 4JHTA 4Q0UA 3GCXA 3U4XA 1SLTA 3I2KA 4GMP1 4FTBA 3T1LA 5C5TA 5FPZA 4D7TA 4FPJA 2OIIA 2ZGSA 4WBBA 2EF6A 5E16A 1VBA2 4Y20A 1O91A 1OA4A 4CDUB 1DHKB 4RHV2 3AYCA 4NPLA 3VV1A 2VQ0A 4E4ZA 5JIAA 2V09A 3N35A 4QDQA 4ZU4A 1HB1A 1Q8PA 4LMFA 1NCRC 3PUSA 2ZMKA 5HV4A 4LO7A 1GWMA 2A6YA 2EIEA 3K4AA 4FT8A 4Q4W2 1W3XA 4I3GA 4MV2A 4ZONA 3AMMA 3QOPA 1KS4A 1ND2A 3MIFA 4XJAA 1H1MA 1Z78A 3QBQA 4IXLA 2W1UA 3RMYA 1GZCA 1GQGA 2XG3A 4RFT0 4E4SA 1DP0A 5JSOA 2CHHA 3HBZA 3EBRA 1BJQA 2AENA 1CD3G 2A70A 2YHJA 4XOGA 5LB6A 1TME2 3JUUA 4UT5A 1UZWA 4UYBA 4FSJA 1W8HA 1VIWB 2CYFA 2QE3A 2VZPA 1AR92 4NRMA 5T5LA 4D7SA 5FP4A 2EA7A 4FAHA 3FWEA 1EV13 1AJOA 3OY8B 1TMF3 2IXIA 1YJLA 3E6BA 1ND2C 5KHIA 2WC2A 4A6OA 2YC0A 1HQNA 5FQ0B 4W6WA 1HV1A 3BYWA 1ASJ1 2O0OA 4OUMA 4QWNA 1VBB3 4Y1VA 3NV3A 5APAA 3RYKA 2JDKA 1QY4A 4PT6A 3WD5A 4AFAA 2Y26A 3S5QA 2R041 4J6GA 1W9TA 4OHWA 1OT5A 1R1ZA 1VRH2 5C3QA 5LRSA 2K46A 1UCXA 5FZGA 5A6QA 1STMA 4XE9A 1SCRA 4AW7A 5IK8A 2WDBA 5A3OA 1OI6A 5A7WB 2UWCA 1UZ0A 3LEKA 5J3UA 3HN3A 4AFMA 1AXYA 1DGWA 2OXBA 2VH9A 4LKSA 4Q4V2 4XABA 1RHI2 3FC0A 5IVYA 2GN7A 4AFDA 2RM21 2D97A 4HVRA 1RUG2 3NW4A 2ARCA 3WEZA 4D7YA 1XNDA 1JUHA 1PMIA 2ZMLA 4A2UA 1NZIA 3N7LA 2WNUB 4XCAA 3BIEA 3MIDA 2G1MA 1CZTA 3ZXEA 5ACA1 3LQCA 1OQDA 5CYYA 3WDTA 4BB3A 2DV9A 1D0GA 3HT1A 5JXJA 4K21A 2UY8A 2RS31 1E5IA 2KA3A 5FMBA 3S57A 3UNPA 4JGZA 1AL0G 1XQNA 3GZUC 4CU8A 4CPBD 2P3JA 2OPKA 1BLZA 5C8CB 4FPEA 4CP2A 2F17A 1CAUA 4YVWA 1B35B 1LOBA 3BGAA 3NNLA 3RZGA 1A78A 2VZQA 3M7AA 4AEDB 1FMD1 3SHRA 1OUSA 4CDXA 3CQOA 3JZVA 4OQ8A 4QQLA 1IPSA 1OC1A 2D98A 1UYPA 5CU1A 4CXYA 1QNYA 4LBJA 5FY8A 1AZDA 3OSDA 1XNBA 4KWLA 2WNEA 2A3WA 4DEVA 4MG2A 3B93A 4YVWC 1YQ6A 4YGBA 3HAGA 1RXFA 1IG3A 3GM8A 2BZDA 3I97A 4GB32 4UFMA 3I54A 1VLNA 1PNFA 1WWYA 4LO6B 5FXWA 4CDXC 2B39A 3GBGA 1W90A 1RMU3 3T2OA 1RUD3 4ZZ8A 2IXHA 2Y64A 1CAVB 3FE5A 4A44A 1W6MA 2DCKA 3VBRB 4LT5A 2QFEA 3AKRA 3CO2A 4FPGA 4Y33A 1FNYA 2VBBA 5JI7A 3KV9A 3AMHA 5FWEA 3TEWA 1R1A3 5CZKA 2Z5WA 3I49A 1MEC1 4ATEA 5FMDA 1CAWB 3HNMA 4IE6A 3WNNA 1UO9A 3ZOIA 4CRQA 2D5HA 3BTAA 3ATGA 3GDBA 1X7NA 3OEBA 4IGQA 2VZ1A 3ABZA 4LHLA 1BZWA 3SKVA 3MEPA 2D6NA 3POWA 5C4WB 3O1VA 4AVVA 2WZR1 4LNVA 1I5PA 4S2GA 1HX6A 2JECA 2W1QA 3M4FA 5ERLA 1VBC2 2R072 1IOAA 5A3LA 1C8M1 1VMJA 4H3WA 1DBNA 1GZ9A 4A3ZA 3T2TA 1ULGA 4YWAA 4MUVA 3RJ2X 5LZ6A 3VZKA 4MX3A 4XAEA 4K40A 5D21A 3POYA 1UY3A 3OTFA 5FPXA 3VBSB 2RS11 5BNNB 3PUQA 1RUE2 1DGRN 1JS9A 4Y5SA 3AKPA 4ZU7A 1LU1A 2VGDA 3GNEA 3IDBB 2WL1A 2IFWA 2JENA 1PK6A 4LO5B 5K7PA 4HPKB 2YMZA 2QQIA 1AR71 5DG1A 2GNMA 2Y6LA 2E6VA 2ZA9A 4RGGA 1CVNA 1YI7A 2D6KA 2HLEA 4Q4Y2 4META 1QH7A 2VUDA 3P3NA 4UF0B 5C33A 2BNOA 1NLSA 1YIPA 1RUC2 4GWMA 2B8MA 2VR4A 3WP4A 5FZMA 4JDOA 1O3RA 1WBLA 2X53S 2XQXA 4DZGA 3T4HB 4ISRA 2CSGA 1H2NA 1G9DA 1GWLA 1PK6C 4NOTA 2XVGA 1ND3B 3POSA 3SEEA 2RHPA 1DZQA 3UKTA 1XE7A 3C7FA 2VM9A 4BIOA 5JOWA 3WDYA 3OBRA 1GP4A 3GXUA 3SXWA 4CU9A 4AHYA 4E4HA 5A3WA 1W6QB 1G9FA 3IAQA 4IGOA 4YNIA 2WT1A 1ZBA3 4BQWA 1VBD2 5CFDB 1OVSA 5FOBB 1K5MB 1PIV1 4DNYA 1UOGA 3HT2A 1QJX2 1AR83 1AHSA 2WNVA 3J7LA 3OEAA 3QLQA 4CEYA 1WLDA 3T0AA 4D3WA 4OUEA 1R082 1GICA 1Z0HA 2GSYA 1QJY3 1COV2 4YW2A 1BMV2 1US3A 2VOXA 4JQTA 1OOPA 2RJ2A 5AC92 1W6NB 4G3YC 3ACGA 3DPRB 3KV6A 1EAH1 3ZFFA 4TWTA 1W2OA 1ZRCA 4QX8A 2LALA 4FPHA 3IZOA 2JIGA 2Y8KA 5JXHA 1JU3A 2BOIA 2C0ZA 1PM4A 4COVA 4QQ2A 2WNVC 3M2MA 1RUI3 4WVZA 2VMEA 2ORXA 4LUMA 5LK5A 2DVAA 4CEYC 5C9AA 1Z7S2 4YZ5A 5LA0A 3U11A 2PQSA 5FXXA 5LBCA 1CAXA 2P6CA 1OOPC 1S2KA 5BYNA 3KV5A 4M01A 4LBMA 5K0UB 3WINE 2WQ8A 3ZFFC 4L11A 1PMHX 4GULA 5EJ3A 3DYPA 3OB8A 1JYIA 1VB2A 5DN2A 5D8AB 5LEKA 2WS93 5JIUA 2B42B 3MFCA 4B4PA 5K9YA 3B3QE 5IVFA 3HIFA 1UY2A 5C9AC 1PO13 3C3VA 3R05A 4AGVA 2YROA 2FDFA 1JOPA 2W52A 4AR2A 2AZ5A 4F7ZA 3V0AA 3O12A 1US2A 5G04L 3WNKA 3VHOA 4NHYA 1UF2C 1W6PB 1G9AA 1IZ3A 1SFPA 3O7OA 1E5SA 4LHSA 1JHNA 3OPTA 1OPOA 4OFGA 4ES9A 3CZJA 3VKOA 1AL22 1J3RA 3MHZA 5ANNA 1NCQA 1LOAA 4IEQA 4DINB 3VBHB 2R1BA 4OLLA 3AYAA 2RJLA 2YU2A 4EYUA 3LOBA 2DFBA 1WKYA 2JB8A 2ZEYA 1GZWA 3KF5A 2UY9A 3ON7A 4J1XA 3CJXA 1C5HA 3HOBA 2HWF1 4JHZA 5I0RA 4CSWA 2ERFA 5CNAA 4DXSA 2KXLA 3FHAA 2GMEA 2XJPA 1Y43B 1NOVA 1GOGA 4GXLA 2W9XA 4KG0A 3A21A 1NCQC 4QMAA 1U5YA 1DG6A 3OGSA 3ZXKA 2BNMA 4FOVA 2MHFA 1M4WA 5FUIA 4HOOA 1F35A 3NNJA 5BNPB 3WY6A 3BTYA 4JKLA 1TQ5A 2WAAA 3NJYA 5SV8A 5FJHA 5JZGA 2R1DA 3ACHA 4GWNA 3BCWA 1LECA 5DG2A 2WQZC 3SH3A 3PDQA 5FPVA 1RJ8A 2JE9A 2WBKA 2LTNA 4FQ4A 1W8UA 4OZXA 3IB3A 3LSDA 1JZ8A 1CX1A 3FUOA 3GJAA 4CXXA 4BK4A 5K4LA 3N7KA 1UIJA 3W20A 1NY72 2I2SA 3W5MA 4NN0A 1JYCA 2WLPA 2G4IA 1MQTB 1GANA 5JZGC 2V5DA 2WZEA 4CP9A 2WJSA 5IATA 5A6YA 1XE8A 3WOGA 1PVXA 1QH6A 4IE4A 1ASJ3 3VZOA 4XBQA 3WXPA 4Q27A 3BVCA 2WO7A 3JD71 4BWOA 1FPN1 2CGPA 2R043 5GM0A 3A0KA 4N9HA 1GU3A 1UWWA 1W6OA 4LLOA 1F15A 3P5BA 4MGQA 5IT6A 3WQ1A 4RN5A 2RR11 3I2OA 1VAKA 4L99A 1TMF2 5HCBA 5A1AA 3VKLA 4MLOA 4FFFA 2ATFA 3UKVA 1UYXA 3H8UA 4LE4A 1FOD1 4DFSA 2JE7A 2VW1A 1VBB2 2DVFA 3AP6A 4UW4A 1W9SA 3LF7A 2VNGA 3THCA 2XKPA 1NQJA 3NQHA 2Z69A 2RM23 4NJ4A 1DLLA 5IFPA 2Q0AA 3PVEA 3IMMA 4LULA 4K8FA 4Q5OA 1NE4A 3NWKA 4RQPA 4XIOA 5FYHA 5A70A 4P14A 3PJYA 4P9WA 5ACA3 2ZGOA 1H9WA 3FJSA 3PU8A 1NYWA 4XDOA 5DZEA 1GOHA 1T6BX 5F5IA 5FFOC 1RJ7A 4K7JA 4X8PA 2RS33 1LESA 2OYZA 3VHRA 1OMIA 5B4XA 1F5FA 4FPCA 3K75B 4K9SA 5BV6A 5E89A 4BMEA 1Y3TA 4Y5Z0 2MNGA 4FFGA 4FFHA 4Z2WA 3CIHA 3C7HA 5EHDA 1FMD3 4RQPC 5BUVA 2JEMA 1C3HA 3M1HA 1IS3A 2UURA 3TEZA 3C2UA 2E7TA 2C6SA 2J42A 1FATA 4Y5TA 1OUXA 3X29B 1GKBA 5CA6A 1XBFA 3D3AA 2DWRA 3M70A 3CBNA 1HB2A 2R49A 1GBGA 2QKDA 4B3NA 1LR5A 2YB7A 1ZZ9A 5GZEA 4GD4A 4COWA 3CF6E 5A3UA 2OT7A 3ILNA 3BODA 4HANA 4U2AA 3K3OA 2EIDA 4OHZA 4DB5A 1G6NA 4IQPA 1ND2B 1HIXA 2YC2A 1POV1 1UMZA 5I0TA 1D0HA 1LULA 2R7EB 5FY0A 4AZZA 2FDIA 3G7DA 4ASMB 1PGW1 2O8QA 4XJWA 4XQDA 4Y22B 2XR4A 3GALA 5I91A 3UL2A 4LBOA 1DFQA 1OFNA 1NQDA 3AZVA 1GMMA 3H50A 1MEC3 4K3UA 2P17A 3IDEA 3QCWA 1M06G 5FPBA 5FXVA 2BGPA 4ONUA 1RMU2 5J98B 1RUD2 1WCQA 4D69A 1ALYA 4P02B 5C7GA 2I07B 2ZGNA 2HEVF 5FZ8A 2WZR3 2RMU1 4Z8BA 1HKDA 3NRUA 1CPNA 5FZ7A 3N9NA 3PUAA 1F8VA 2JE8A 3ETQA 2NQYA 4PLMA 4OULA 4XVHA 4CDWB 1C8M3 1UY4A 1OKQA 4PLNA 5FZ0A 2QQPA 2YG0A 4FCAA 3WF1A 3HNBM 3AMQA 4L8QA 1V6MA 1ULPA 5D1IA 4JV4A 4XILA 1KDMA 1PZ9A 2RS13 3D8CA 4BH9A 5FMOL 1H0BA 5FLIA 3PU3A 1YIFA 1J58A 3Q8BA 2Q8CA 4YARA 4FPKA 4E8DA 4J1WA 3SEPA 1K3IA 1OLME 1UOJA 1W99A 4B7KA 2FDHA 2NM1A 4I3PA 1QHDA 4PHZA 1VAVA 4INDA 4RA0A 4WM7A 3OGVA 1E5RA 4QPWA 5DDJ1 1X33A 4Y1YA 4QXKA 5DAWA 2XJVA 4TSVA 3MF6A 4D6RA 5BPXA 2X05A 4PIXA 5IHRA 4CVUA 3FL7A 1HB3A 1RUJ1 2GZWA 2WINB 1W05A 2Y0IA 3PUIA 3MF9A 4GZ9A 4JGZB 4Q0QA 4UBHA 3J9SA 1CAUB 1QGLA 4YVWB 2WA4A 4K8RB 4WM7C 1D2QA 4L2NA 1VE0A 1WGPA 2YPJA 4OQ9A 2ID4A 4CDXB 4LK7A 4OI0A 4QD2A 3P1IA 5A6XA 4NRQA 3SCFA 3U10A 4B29A 3JBG3 4XF4A 5IW0A 4QT6A 3ZSEA 3M3OA 5JPNB 1PIV3 3H7YA 4RYDA 2AH2A 2E53A 5HCFA 3TEYA 1N3QA 2CTVA 1IKPA 1W8OA 2ADDA 2HBTA 3IWZA 1IG0A 4B7EA 2XXZA 3KQ4B 2VQTA 2WWUA 2ZGLA 1JXNA 2IFRA 3GHMA 4PBOA 4FXGB 4YZ1A 4XBLA 5A33A 4HG6B 1DGRA 2VXRA 3WNPA 3LPGA 3K51A 1CJPA 4EZ4A 1EAH3 1PNGA 1ZBA2 4NAOA 4OZOA 3WF4A 4XJZA 2P3IA 3ASIA 3WR0A 1TVGA 2VW2A 1AR82 1VMHA 4HKOA 1JODA 3QD6A 5FZEA 4WZFA 4OYUA 2W5FA 4QX2A 4BE3A 5JPMB 2Y33A 3WVJA 2PELA 3RI8A 1UQXA 2D7FA 2Y34A 2WSUA 4GIQA 1SPPA 3JCIA 4KL1A 3WDWA 5A7NA 4CCNA 3RWNA 1GR3A 4JAAA 5GKAC 1EP0A 4AWDA 2LUWA 4YM0A 1YFYA 4AEMA 5FO9B 4YPJA 2VMHA 1QU0A 3E1F1 2XONA 4DS0A 2ZEZA 2IXKA 1JYNA 3AZZA 3C7GA 2JG8C 1RUI2 1OKOA 2X10A 3SITA 1N1YA 1ZRDA 4FO9A 3PIJA 1AR62 2EICA 1APNA 2Q8EA 4R9BA 2F4PA 2B7YA 5F1RA 2VOKA 3DYMA 3OYWB 3BALA 2LRPA 4CE8A 2MEV1 1W8FA 3FHIB 3OUJA 1DQ6A 1UX7A 1A34A 2W95A 2XLFA 1POV0 3MO4A 1Y9MA 3VD3A 1MVEA 5EP9A 1RUF3 4XDPA 4Q0VA 4J25A 1ZA4A 4AGGA 1PO12 1A6CA 1ENRA 2JDPA 4R4ZA 3RZJA 3WX5A 4OHYA 3AZXA 1IGOA 3F95A 4GKYA 5GLWA 5CG8A 5DUWA 4QHZA 1VRBA 4E9KA 4IE5A 3ETPA 1PGL2 1GUIA 4Z07A 4B1LA 2HWF3 2XUMA 4A41A 4UXAA 1LHNA 1OH4A 2EXJA 3PJQA 4YW3A 4E8CA 1ULCA 5CKQA 2BPA2 2DF7A 3SMHA 3ECQA 2X29A 1UW8A 2UWBA 1U5ZA 4NIAA 1OLRA 4LHKA 1GWKA 3IPVA 3WDVA 3KGLA 4XUNA 3TRSB 4BMBA 4QQPA 1CIWA 3CJIA 4OHVA 3T2QA 2LS6A 2ADEA 2XKOA 5FBZA 1JI6A 2YDEA 3P3PA 2XQRA 4OMCA 1LHOA 5LBBA 4AQSA 2ZBJA 2BBAA 2WNVB 2WS91 2CWMA 4CEYB 3OBAA 5C70A 1OFSA 4HFSA 2UWAA 1D4M1 2HJIA 1OOPB 3K46A 4HMZA 4NWVA 2JDUA 2Y6KA 5HV0A 1PZ8A 3I7DA 3JB4C 3T4VA 4AQ6A 3CJIC 4DUWA 2TBVA 3EO6A 5FYVA 1AVBA 4I01A 3WCSA 1QQP3 2YXSA 4FOQA 3H8XA 4AAXA 1W06A 2FZ1A 4NIGA 4FVVA 3QH7A 1GQPA 4B4RA 5C9AB 2PAEA 3JD73 4IE0A 1WMDA 3T2PA 2Z2SB 1NXMA 1CAXB 1E5HA 3A0NA 3MBWA 5LY1A 1XNTA 5LY2A 1V9U1 4AG4A 5FZ3A 4P9JA 2RR13 2VMCA 2FMDA 4PDWB 5FLHA 4LITA 5F5CA 1BBT1 4RS5A 3ZFEA 1K45A 3MW4A 3MUZ1 4XFFA 5KR7A 1VBE3 1REDA 4XF3A 1WBFA 1K42A 1FOD3 2BTVC 4GKXA 5AFEA 3ZMNA 3I4IA 2VAUA 5JXGA 2EXIA 4RFRB 1SHWB 3NNFA 1W39A 2CGNA 3MIEA 2Y60A 2R042 3GZTB 4QM9A 2WAOA 1ZRFA 2W87A 1JUIA 4LO8A 1C28A 2W92A 3N9PA 4RL7A 1MZ5A 2FCVA 3V0AB 3LA3A 1ZVFA 4PQ9A 3IBMA 4IV3B 3AJYA 3WSOA 4RS5C 1Q8SA 1ZYBA 4W50A 5GJ6A 3ZFEC 3MIGA 4Q8KA 1MZFA 5KBFA 1O5LA 1O6UA 4YFZA 4XJ8A 1MVQA 1NCQB 4EROA 4Z1VA 2RM22 3ZIXA 2ZHKA 3A22A 5FY4A 1LRHA 3ROUA 3RGBA 3U4SA 3M3CA 5F2WA 1W0NA 1WLWA 2BDRA 2Y6GA 4LKFA 4E2QA 1UKGA 2BERA 3MW3A 4EE2A 4Q4X1 4L92A 5DAPA 5L36A 2CAVA 1SQ4A 2D3SA 3O1PA 4H55A 2HWE1 1JOBA 1TNRA 3THTA 4P9IA 5F3GA 3CL1A 4IUGA 3ZYRA 2ZHLA 4DY5A 4QB2A 3VBOA 1O3SA 1O3QA 1IQDC 2XJTA 5EFUA 1MR5A 3ZN6B 4COUA 3N3HA 2XHKA 4LPLA 1J59A 2VZVA 1FMD2 5F9TA 1O8SA 4HLTA 1MS0A 1CONA 4AHXA 3AFGA 3CHXA 5KXCA 1POV3 3HD8B 3WNXA 2H6CA 5A7PA 1DCSA 1Y4WA 4MXWB 2FHRA 3U0ZA 4B4QA 3MIHA 3KLSA 2WWJA 3LE0A 4TN7A 1GLHA 1SBDA 1H2KA 1QIQA 3VBOC 2YV8A 3HWJA 2R061 1I3HA 4MADA 4Y1ZA 2VD7A 2VXJA 4OCTA 5H9QA 5LCWL 4CP9B 2OZJA 2OQ6A 1XC6A 1MS9A 4C0HA 5GLZA 2WZPP 2Q8DA 1X9PA 4Q4W1 2WO3A 2RS51 4WM8C 2RMU3 3VLBB 3HMYA 1V6NA 4KU8A 2VNRA 2ZPXA 4S2HA 4UBGA 3PIGA 4MGKE 4R9CA 1AXZA 1MEC2 1W6OB 2OKXA 3SLIA 5FPUA 2JG9A 4NR1A 4CA9A 3DKWA 2BGCA 1ZRIA 5CFCB 2B9UA 4AE2A 2VCCA 5EWSA 3G6JB 1OF3A 2WZR2 5FV3A 2DURA 5I0DA 1BMV1 4JTOA 1BEV1 5FZBA 1H8VA 1J3QA 2W0XA 3LA2A 4Q1PA 3O1UA 1C8M2 4IEOA 2VZOA 1AJKA 1ULEA 5FZ4A 1LODA 2V73A 3UETA 2JG9C 5DDJ3 3AX4A 2RE9A 1PZ7A 5ABJA 3ZXFA 2YZ4A 3M8LA 1DYPA 2Y6HA 5FXZA 1JZ3A 5IVCA 1F4AA 2RS12 3MLLA 1RVF1 5EPAA 4EJRA 2IVIB 3GBFA 3LAGA 4YG6A 5FZDA 1W9YA 1RUJ3 2W2IA 2PAKA 1B09A 5FK7A 1YXWA 5C3SA 2VMIA 1AR72 2DUPA 2YU1A 4CEWB 2P3KA 4XUPA 3NAPB 4GWJA 3U75A 4QXHA 1IKQA 2GN3A 1XYPA 2G9ZA 4UWDA 4XPVA 5ABJC 3JU9A 3W5NA 1QXPA 2QBXA 2HYKA 2J1RA 2LW8A 4QX3A 4YM2A 1AUYA 2FCTA 3WF3A 2DFCA 5C3PA 4XFAA 1OD3A 1PMJX 3WHUA 1PX3A 4O9GA 1GNHA 3RZZA 2NZ9A 1CX4A 2Z42A 5L9RA 5H9SA 4LR4A 1ZZ8A 2EVXA 4QKNA 1QOSA 4AI1A 4DUXA 2ZACA 4N43A 1SEFA 2EAAA 2JWPA 3MLKA 4XFIA 4BQYA 3I2HA 1MACA 2PFWA 2JD9A 1HRV1 3RWKX 4X6RB 5EZWA 3HQUA 1PIV2 2CWSA 4YW4A 2J1TA 3WLUA 4CYDA 1KQRA 1A8DA 2BBVA 1GFF2 5HXVA 1I5ZA 1UX6A 2GP3A 2P3YA 3KT4A 1YWKA 3R0RA 2JDAA 5M0TA 4ITCA 5GLVA 3URFA 1DYKA 1O5UA 3OCPA 4IL7A 4CCOA 3WW3A 4N43C 3N4MA 1XXNA 3I3DA 4AF9A 3H7JA 1QJU1 4XHBA 2ZZJA 1BHGA 1EAH2 1WCSA 2E9QA 3B01A 3R4DB 4CP0A 5IVEA 2GAUA 4FPFA 3ACLA 3JB8A 1C1FA 2AYHA 4EWEA 3BU7A 1G86A 5CKMA 3PL0A 5IUQA 1XOYA 1J3PA 1UU6A 4NHKA 4ZXKA 5CB7A 1JU4A 4IV1A 3B02A 3VBFC 4Q2FA 2DTWA 4BJ0A 3UYJA 5EJ1B 3Q8CA 2MEV3 1NA1A 1VB4A 3TOJA 3MI8A 3I59A 1PM7A 2CDOA 3OPZA 3C7OA 1GQHA 3W21A 4AEJA 1JW6A 3JBG1 3O0WA 1ENSA 1URXA 3UV9A 5KC6A 3TNQA 1OLQA 2WABA 4M3CA 3HNYM 5CIRA 5FZAA 1Q5OA 4IV1C 4M3CE 5FZHA 1WCUA 3GGLA 3L9JT 3V0BB 1ZZCA 2KR2A 5FP3A 1JN2P 1NA1C 5FY7A 3O14A 3FLTA 4FOYA 4DXTA 2JX9A 3FUQA 2ARBA 3ZXLA 2V5YA 2BUKA 3RNSA 4ASKA 2A73B 4N90A 4ASLA 1C5IA 3GYDA 5F7UA 1RUE1 3T1MA 2X5IA 3S6PA 4CUGA 4KGQA 1SLBA 5FOJB 4C8DA 4HK8A 4KBBA 2RDSA 4ZZ5A 4YM1A 1RIRA 3FZ3A 2VTFA 4NPRA 3TN91 4Y4RA 1W8ZA 3AP4A 4O65A 2HWF2 2DYCA 2W39A 4WVMA 3VBUB 2DCJA 3S5AA 1RL3A 4BQ5A 1DYOA 3OGRA 4UFKA 3M3EA 2VZ3A 3ZSKA 4S2DA 5C6CA 1NLRA 1OH3A 3WG2A 1REEA 4CCEA 1KFUL 2TUNA 1D4M3 2X5IC 4QX5A 1W9FA 3BPSA 1REFA 4BLIA 1JOJA 4CCKA 4FFIA 5FTTC 4E2GA 2YBPA 3RQ0A 3R4UA 4OHXA 2XWJB 3KQRA 1XRUA 5GALA 1SLCA 3EB7A 4MHUA 4CDQA 3SCGA 4JDNA 2ET7A 5AVAA 4IW3A 2VCAA 4MZUA 3WP3A 3IMNA 4CXWA 1RUF1 2ARAA 3MZHA 5CG9A 1QF3A 3CDZB 3AK0A 1YEWA 1VR3A 1HRI1 1XNCA 2JDMA 2DBIA 3LZZA 1UU4A 5FPAA 1UXXX 2Q1ZB 2WO1A 4FXKB 4CDUA 2O14A 1V9U3 4EWAA 1GYKA 4MHRA 4N7UA 4UFIA 3SISA 3UGHA 3FX3A 3M3QA 3EYPA 4QPGA 4CDQC 1BBT3 1COV1 3K4ZA 3NSTA 4TXWA 2WFF1 1O8PA 4UI9L 3I2JA 3LIGA 4LIVA 3SH5A 4EN7B 1TNFA 2OPWA 4I0AA 2WIIB 1YFXA 4GH4A 4MGSA 3VN4A 1FPN2 1W28A 1WD4A 3U1XA 3UK9A 1XPWA 2GMPA 2WO2A 2EALA 2PA7A 4CDUC 2RR12 1YLLA 4WV8A 5DMYA 2W1WA 5BNOB 3LEMA 3K2OA 3PTYA 3PVOA 5JSRA 2AC1A 3H0OA 4QPGC 4BQ1A 3WQ0A 1FOD2 2O1QA 3NNMA 3VZJA 1OSGA 4KH9A 3UGGA 4D6QA 2P4EA 1WUVA 5I8YA 1H4HA 3AKQA 4PF5A 3MV11 5IJRA 4GH4C 2HWB1 1MS4A 2HYXA 2VECA 3V56A 1Q3EA 3GHNA 1R64A 5FQ0A 4QGMA 2VUCA 1W8TA 1DLCA 2JB4A 5F3EA 5FP9A 5J36A 2WZ8A 3S30A 4Q4X3 1NKGA 4Y24A 5JI9A 1QQP1 2C4XA 2I74A 2ZJCA 2ZX4A 5FKBA 2HWE3 2Z4FA 5DAVA 3J8F3 1Q56A 3MDPA 5JOXA 4FPLA 3LIHA 1WLCA 1AYN3 4KQ7A 1DDLA 1S55A 3J7MA 1OXCA 5A1LA 5FO7B 1WW7A 4K20A 2QZ3A 5CVRA 1ZZ7A 3KB5A 4GAZA 5LA9A 5IK5A 1JZ7A 2YYOA 3BPZA 4A7YA 1EV12 1DQ1A 5C8WA 3ORJA 5FDBA 4PBPA 2A5ZA 2BFUL 1W2TA 4BLJA 1VBE1 3ZKYA 1TG7A 5JOZA 2WNUA 2AREA 2HKXA 3ZFGB 1H30A 3VB9A 1GNZA 4CU7A 1LB2A 4LBKA 3ILFA 1S2EA 3K3NA 1CGPA 4LBQA 4MH0E 3UESA 4QKFA 1WMXA 4QQOA 4D6SA 4QPIA 1VAMA 2Q1FA 2R063 3CU7A 3B00A 3S7EA 4DXZA 2ZOEB 1H1IA 1G8WA 5C8CA 1X50A 2VULA 2RJKA 2E7AA 1XU1A 5LWBA 1W8NA 2R32A 3U37A 1HN1A 1PGW2 3H1YA 4MYEA 4Q4W3 2WNUC 5FMOS 1PO21 2RS53 1N1SA 1RUH1 1ST8A 3LOIA 5DABA 5FJKA 2VZTA 2ZGUA 4XDQA 2WQ4A 2O8OA 1NCRB 3LB9A 4QPIC 2QCSB 1S2BA 3ILRA 5LA2A 5J7MA 4YZ4A 1GSLA 3EQEA 1I6XA 2XBO1 2P6HA 5DUXA 1SLIA 5C8CC 1OBNA 3ZFEB 4ZU5A 1V6OA 1N3PA 1TME3 1WW4A 2P5BA 3AXEA 4NHXA 4FTSA 4Y20B 1VJ2A 2PLV1 4AEDC 2RMU2 5DQ0A 1BEV3 2J1UA 1UOFA 1IHMA 1CAVA 1S0CA 4M4PA 5FZCA 4HXCA 1OA3A 3H42B 3VBRA 2VPVA 4EN0A 3ZSLA 4CCJA 1ZREA 1S0JA 2NP0A 2VG9A 2QQUA 2GU9A 2CL2A 2BU9A 3ST7A 1C8NA 3KT1A 1RVF3 3E5UA 5J1XA 2PXJA 4PJYA 3VL9A 1BKZA 4PI2A 4UOJA 2J1SA 3J26N 2GH8A 1SBEA 2AEYA 4LORA 4U36A 1ACCA 3NJXA 3DXUA 2IZWA 4BYYA 4JGYA 1YNAA 3ZXJA 3KVBA 3ZIWA 5IK7A 5DDJ2 3T30A 3AZWA 2ET1A 5I93A 3VBRC 4RR3A 1K12A 1RHI3 4LKEA 1H6YA 2D3RA 2V4VA 4JCKA 4BOWA 2D43A 4TLGA 4UFJA 3E5XA 1RUJ2 1LEDA 3NJVA 2B46X 2ZXQA 3ALQA 1S0FA 2E7QA 3DYOA 5CKNA 3BKZA 1XU2A 2R0HA 4M0HA 3VBOB 3VBSA 5BNNA 3BUCA 4JGYC 1R1A2 2XH6A 3O5SA 5T54A 3VZMA 3LWCA 4COZA 4RR3C 1RUOA 3AL5A 2DU1A 4HPKA 5KHHA 3ZO0B 4Z2AA 5A7QA 4ES8A 2GNTA 1I1EA 3DECA 4UW6A 1HRV3 1NX9A 3CKHA 4X8NA 2B4KA 4JC1A 4CCLA 1SLAA 5DZFA 3PHMA 4YW7A 1W2AX 2PHDA 2WT0A 3KWVA 3E6CC 1CZVA 5DXDA 4A6SA 3ACIA 3RRDA 2RVAA 3MLJA 3VBSC 5BNNC 3AZYA 3TAYA 3IT8A 3S7IA 3OJBA 3EMRA 1HLCA 1W9WA 4LTAA 4HL0A 4Z82A 1QJU3 3E97A 4XJUA 2V72A 2WWSA 3BB6A 2XPJA 3WHTA 1NLQA 3WF2A 3T0BA 1F2NA 4XF1A 4W6YA 2PHTA 2OA2A 3NJZA 4ZS3A 5IWFA 5IYYA 3UJQA 3VD4A 2XMLA 2Q4SA 1TE1B 2ZTNA 1K5MA 1N1VA 5I0UA 4AL9A 4YSFA 1YYNA 4KNCA 4Z92B 4O61A 4XUQA 4HSJA 4R52A 1QDOA 2A75A 4QGNA 2UYBA 4LHNA 4AVBA 3OBTA 3WDXA 2E63A 5F2SA 5FZ6A 2PYTA 3HN1A 4JRAA 1W6NA 2Q1MA 3KGZA 2NN8A 2PHFA 2OUJA 5A3TA 5FR3A 1LEMA 1UAIA 3WQBA 4NIHA 5ABJB 2AACA 1K5MC 5J37A 3KSCA 4Y1UA 5FKCA 2MEV2 4AHWA 3LDBA 3PTRB 4ZKTB 1OHFA 4V2WA 3PLQA 4B8EA 1XYNA 4G4FA 1W6MB 2BRTA 2ZKLA 5JVVA 4BQXA 5GZCA 1YO8A 2JG8A 2OQ7A 2CV6A 5GZFA 5K0UA 3CZUA 5DPNA 2RG4A 2X8KA 1RUE3 3C7EA 3Q8EA 3V64A 1MS5A 5KHKA 1QJY2 1PHMA 3VDAA 4BDVB 2H0BA 2R0FA 3ZMOA 2YGMA 1BVP1 2JKXA 4XETA 4YYOA 2W47A 4NVPA 4XURA 3TN93 3B69A 5B2GB 1H2LA 1VMFA 3ITQA 2E31A 3KS7A 1JMUB 1UU5A 5JMCA 4XXAA 1QJFA 2HH9A 3KMHA 4XEZA 5K0UC 1ULOA 3TEXA 3DXTA 1V00A 1W6PA 3D82A 5F6LB 1MZ6A 1Q8VA 2GC1A 2HWD1 2Y6JA 4EWDA 1SDDB 4IERA 5AFBA 4ZXEA 2Q30A 4JDMA 4HVOA 3AC0A 4XIKA 3VBHA 3O1OA 1ZZBA 3OD4A 3P6BA 1LAJA 2WS92 4EQVA 1BK1A 1X9TA 3A4UA 1YQ8A 1PK6B 3DEMA 5A1FA 3T0DA 1UKRA 1D4M2 1KDKA 3FLRA 4HZFA 3U14A 2VNVA 1HRI3 1MS3A 2GALA 3MPPG 2UYAA 1S1AA 2Z79A 1R091 3V65A 1YHFA 2JXAA 4MVTA 1AYM1 1CN1A 5CADA 5L7OA 5A3MA 5EXOA 4HN1A 2A1XA 1O3TA 1FXZA 4G9SB 3K77A 1V0AA 2FCUA 4BIFA 2XLAA 3OD0A 1COV3 2WUHA 3VBHC 2EIBA 2ILMA 2WFF3 4AVCA 4C1XA 5J09A 5JR2A 4I2OA 2VO5A 1W8WA 1UYYA 2C5DA 3WW4A 5JOYA 3VKNA 3OOXA 4IV1B 2E32A 5T3NA 3ZYHA 1JYWA 3IM0A 1V9U2 3THPA 2JJ6A 3OBZA 3KF3A 5L7OC 3ZVXA 4QAWA 1EUTA 5GLUA 1BBT2 5FWJA 4QX0A 3VZNA 3LD8A 2QQJA 4M3CB 2IXLA 3RZHA 4AQ2A 1CR7A 3HVDA 2HWB3 4OUSA 4L9BA 4XACA 5FP7A 2D40A 4AVSA 4JRLA 2FQPA 2PHRA 4LEJA 4YZ2A 2ZX3A 3OG2A 3ZFFB 4BK5A 1L7LA 4QU2A 5F39A 1POQA 2J7MA 2VJXA 3PVNA 1DQ4A 1UPSA 1SBFA 5CEHA 4NWWA 5KHJA 5JR7B 4XUOA 2GNDA 5FY9A 3SNMA 3KZ4C 3B7MA 2X5IB 2VBDA 4OI4A 4BHPA 3N36A 3KCCA 1OURA 1XNAA 4PQQA 2LM3A 2CGOA 5KC5A 1UY1A 4AVAA 1LGCA 1UOBA 4BZ4A 2AGSA 2F4LA 2YC4A 2ZABA 4HSLA 3H3UA 3EXUA 5FZOA 5KXDA 5E8AA 4WVMB 1PGSA 4Q4X2 2J1EA 4L97A 4DUVA 2BV4A 2HWE2 3PNAA 3CEWA 4DRVA 3I2DA 3I3BA 2YBSA 1ASJ2 4YGCA 3MFAA 2D6OX 1PGL1 1XSQA 1QOTA 2PN5A 5FYIA 3VGIA 3RJRA 3FLPA 1EYBA 1UZVA 3MPBA 2HWC1 4LBNA 1ZBE1 4YVSA 1QOOA 4DY3A 1RUNA 3ZPYA 3ES1A 1OVPA 4P08A 4GQ7A 2XLGA 4BXSV 4EN9B 4LOTA 3UJOA 1QMJA 4QM8A 1QJZA 1FAYA 1L7QA 1N1TA 2VVFA 4HKWA 3OF1A 3UKNA 2D6MA 2QUOA 4XAAA 4ZPIA 1Y9QA 5FO8B 1G9BA 1PO23 1U5XA 1RUH3 3AXDA 4AI9A 1SDWA 3IDAA 2VW0A 1Q8QA 2R062 3AP9A 1ENQA 4AHZA 4DEQA 1BQPA 1GZWB 3U07A 4YVSC 4IEVA 1JZ4A 2XBO3 4GJZA 4QPGB 3MV01 1MPXA 2QZ2A 1QJEA 2ZKNA 4C91A 1NUKA 2PTMA 4Q29A 5ACA2 5SV5A 3VD9A 2BOJA 1ZRRA 2WN2A 4XF9A 4AI0A 2R16A 2R6QA 3AB0A 3CMGA 2RS52 2RS32 2PLV3 2J1VA 3J8F1 1NG0A 2OZ6A 3LA7A 4GH4B 4P9LA 2A6WA 3CLPA 1HXS1 4YW6A 3VZLA 3RZLA 1AYN1 1H1AA 4LA2A 1PVC1 5T55A 3H1MA 3ZYGA 3J7HA 3GZAA 4LQRA 3ZXDA 3PMSA 4M0NA 4NMIA 1W2NA 3WP5A 4CCCA 1KJRA 4Y22A 2JD4A 1KS5A 1S0BA 3HBKA 4K1YA 4NO4A 4IEUA 4ZHNA 1H2MA 5JZGB 3RS6A 3VDDA 3DN7A 2C9KA 3N7MA 3IKWA 1BEV2 4BQ4A 4KI5M 4WM8A 3NVCA 5IVBA 2QQNA 3AL6A 4AYUA 2P34A 1GOFA 4IEPA 4NRPA 3Q9OA 1UMIA 2FBEA 4XUTA 2BVBA 1DQ0A 1VBA1 1YI9A 1YRZA 2D3PA 2VL4A 1RGSA 2OUHA 2WKKA 3JQWA 4NPMA 4RHV1 3FHQA 2XL7A 3W58A 1YQ5A 1WZXA 2G9GA 1RVF2 2IXCA 2A6XA 4PI0A 4CDWA 3SKJE 2GC2A 4QX1A 2EXHA 3AYDA 2PQQA 3VDDC 1OQ1A 2VY0A 5GLTA 1UN1A 4CPBA 3RI9A 4LO4B 1V6JA 2BW8A 3B5LB 5D2AA 3H9AA 4ARXA 1L3JA 2SLIA 5A3PA 1J84A 1XSRA 2ARXA 1RYYA 5JAXA 4KGGA 5LK7B 3N9OA 5FK8A 4QPYA 3A7QA 1LKNA 4IEXA 3NL1A 2A3YA 3FFZA 4MSVA 2C1FA 1TME1 1DF0A 1N3OA 3N9MA 4CDWC 3K4DA 2A6ZA 4P5HA 1SLLA 1AR91 2F6BA 1W3VA 4YM3A 1BVVA 4JX0A 4YW1A 2D93A 2YUEA 4M3CF 4LBQB 5FREA 3AJZA 3AM2A 5FRAA 4QB1A 3WNMA 5FZKA 2WYFA 3ZXGA 2XJQA 5FYUA 4QPIB 5F3CA 4XHXA 3BOWA 1T2XA 1Y7BA 2CU5A 4F83A 4COYA 4H2AA 1WMEA 3AP7A 4R4XA 4RQPB 4UFLA 5DAXA 5FYTA 4ATFA 1XE0A 4YGDA 1HRV2 4K6BA 2YFUA 1JHJA 2A71A 4TTGA 3B9CA 1DQ2A 1VRH1 3ZX7A 3ZYPA 1CZSA 1ZA7A 5FYYA 5KWRA 5I0SA 3WF0A 1JTZX 2DVDA 5I8TA 3HPNA 4LLFA 3VDBA 2IC1A 4XMAA 1T6GC 2A7AA 4NIIA 2D5FA 5FP8A 4V2VA 2DCZA 3I3EA 4F3JA 3WUDA 3WV6A 2GC3A 5JUVA 5LASA 4JGZC 4Q4V1 3PUHA 3KD4A 1RHI1 1QJU2 4MO3M 5IAVA 3LFIA 4AI8A 4OMDA 3C8XA 3HJRA 1SFNA 5H9RA 1FYUA 4JZRA 1SG3A 3NKGA 3IDCB 1RUG1 3DKQA 2DTYA 5F5QA 3JXSA 4QKDA 2ETEA 3NV1A 3LKJA 2VZSA 4XBNA 3R6SA 4ET7A 5C3OA 2YBKA 3W59A 4UFHA 4W8JA 3ZLIA 4NHLA 1C4RA 2QQOA 3HEIA 2QNKA 5A32A 4QX7A 2K0GA 4HT1T 4CCDA 4NHMA 2P37A 5EIYB 3PMEA 4I09A 4QDSA 3ZN5A 2WA3A 4BISA 2K9ZA 4FPOB 3VHNA 2FD8A 2XB6C 4GALA 2OX0A 3JBG2 1AXKA 1TZOA 4KMQA 3USUA 2E26A 1XNKA 4GMP0 2BYVE 2JDYA 4K1ZA 4OVEA 4AGRA 3FMGA 2DU0A 4B1MA 4JGYB 1CIYA 2EIGA 2NMOA 4LE3A 3DF0A 4Y3OA 5B4NA 5IAXA 3VBFA 4NIDA 3H3ZA 4RR3B 3SCHA 1JH5A 1YC61 3L2YA 3AYEA 4L0PA 3WG3A 5T52A 1C1LA 2VC9A 1RITA 1GZTA 1H8TA 2FDKA 5FYSA 4I0WB 3OYWA 4GB31 2KD7A 4HN0A 4JKMA 2DCYA 4A45A 3N7JA 3W9AA 1LHUA 3KV4A 3HQRA 4AFBA 3R4SA 4GWIA 5FAXA 2WFPA 4FBFA 2HWD3 1S4CA 3K48A 2QTWB 1JZ6A 2ZZQA 5E1RA 3VD7A 2PHUA 5FYBA 4BQ3A 1YUDA 3TN92 5LEJA 1U5IA 1VALA 2WT2A 1Q8OA 1H8TC 3H1WA 3OPWA 4JVAA 4XQ4A 3APBA 4IEWA 3TNPB 5EYXA 2R30A 4N53A 4WVVA 4BM8A 5HBAA 3O1SA 3SC7X 4QHOA 1WW6A 5DAQA 4A4AA 1X36A 4CCMA 4AQTA 2QQKA 4WM7B 3LDRA 1IQAA 1V70A 4YGEA 4AOCA 1UD1A 3JQXA 4P9YA 2NMNA 5FZ1A 1CJDA 1R093 1LHVA 4DMIA 1AYM3 1I9RA 1VBC1 1U12A 5FUNA 5FZ9A 1KEXA 2R071 2BVVA 5FY1A 3SQOA 3WT3A 1PX4A 2J1AA 3THDA 3QACA 3WP6A 5CISA 1RUF2 1OA2A 3RPQA 5KXBA 1AX2A 4N53C 4XC9A 5F5AA 4XW3A 5EQUA 3TYJA 4BU2A 4IDZA 3H8RA 1HRI2 1WCDJ 1H4GA 4R8HA 5J48A 4BQ2A 4LKDA 2GH2A 1BK0A 1Q43A 1UL9A 1CPMA 5ANQA 4QXBA 5E6HA 4FTEA 4DPNA 3RDIA 5G05L 2WFF2 1LHWA 4Q4Y1 3ACFA 5EV7A 1SZBA 4X6QB 2QQLA 2KM2A 2BGOA 1RUC1 2PMWB 2VMGA 1HV0A 2ZGPA 3IIIA 3RG0A 4D94A 3LCPA 4A7KA 4FOWA 5E88A 5HCAA 4WZCA 4CU6A 5JDBA 4IEYA 2XWBB 1YCIA 5A33B 4R9DA 2FDJA 1JZ5A 4XTMA 1AR63 2W94A 3O0XA 4Q0PA 3ME2A 3AKTA 3MGUA 4LUKA 3RZMA 2QDNA 1KRIA 5EYYA 3TB0A 4I0BA 2Q5TA 4JKKA 2JG8B 2BFUS 5T5JA 3ZYBA 2BNNA 2B5HA 2VOTA 4PDWA 2HWB2 3I3QA 3ES4A 5FUPA 2WR9A 1VBD1 2E33A 5L9VA 4RD7A 1SPPB 1NZCA 1UY0A 2MPFA 1QJX1 3OGGA 5L19A 1MS8A 2DBNA 4FPYA 2QQWA 2W3JA 3E5QA 4KWKA 5HCHA 3DL3A 5LW9A 1F31A 1R081 1X8MA 1QQP2 2CY6A 2BJSA 2VCBA 2Y38A 3MYXA 4URTA 4XYXA 4ZS2A 4LXLA 3ZR6A 5LATA 2VUAA 3BI3A 1F9KA 5AC91 4MXVA 3Q8FA 5DZGA 4PDWC 4IV3A 4KU7A 3JD72 1LOGA 2BQPA 3LDKA 1ENXA 1A8MA 3NMBA 1D4VB 1QKQA 1WA6X 3FN9A 2D6PA 4H14A 2HWC3 1CESA 1UYZA 1ZBE3 1UZYA 2CDPA 1ZZ6A 1Z7S1 3I2GA 2XHNA 4LOSA 5H9PA 1KFXL 4XFGA 1O4YA 3WUCA 5LA1A 3B94A 1VBE2 1S0IA 3SH4A 2XVKA 4N9IA 4QDRA 1DGWX 5F37A 1CWPA 2QJVA 2YGLA 4GMP3 4O9EA 5A7OA 4CUCA 5EJZB 3OY8A 4IV3C 1HJFA 4URAA 2DUOA 4BCUA 5L7OB 4UW5A 3RYRA 2VQUA 2WLQA 4LIUA 1DZTA 2AR6A 4P00B 5FPLA 2ZEWA 5F8PA 1KJLA 2OW4A 5T5OA 3ZDVA 1J1LA 3ZN4A 1UMHA 1EPZA 1V6LA 4O7XA 4AI2A 5A6ZA 3ZN6A 4A42A 2A3XA 2ZHNA 1O7FA 1SMVA 4XTPA 5L9BA 3KCYA 4XFBA 1PO22 1K5JA 1RUH2 1HQLA 1HXS3 1V6KA 3LEIA 1G7YA 1MS1A 3PVBB 5A7WA 1PVC3 2G9FA 4GA9A 2W1SA 4WVWA 4JTNA 3IPVB 4MXWA 3I8TA 4Q1RA 4QQHA 5FCCA 1AL21 4D8MA 2XBO2 2DVGA 1LNSA 3CJIB 4YLZA 4XMIA 2VVEA 5DUUA 1ODNA 1ZM1A 3OUIA 4Q0SA 1OPMA 2JDZA 2QQVA 1QDCA 2DDUA 5JSPA 1L7RA 1DIWA 3RYPA 3KVAA 2PHXA 2PLV2 3ZSJA 4JQRA 5LBFA 4H7MA 3ZXAC 2BWAA 3ZR5A 4I30A 1V6IA 1QXJA 3ZM8A 1LENA 1YQCA 1IPKA 1W2UA 1VBA3 1W03A 4C0BA 4RHV3 2ZGQA 2WYSA 2VOWA 1QEXA 3RFRA 3T3YA 2OVUA 2WRAA 5JMOA 3QH6A 1XB9A 1WLTA 1YFUA 2ZGRA 5FYCA 2E51A 1B35A 3L2HA 5HI0A 3CNAA 4YG0A 2IXJA 1KXGA 5T50A 5CFCA 4AEDA 2GC0A 4YG3A 4AK3A 4FAGA 1X82A 4RGKA 5LRRA 4HVQA 1WMFA 5FZOB 2IVJA 4PLOA 1H9PA 4ISQA 3GCWA 1WA4A 4Q8LA 3EJKA 3Q8AA 4GJYA 4HK9A 3OGJA 1JYVA 1OQEA 4LBQD 4RS5B 2UU8A 1VPHA 1DGLA 4BPZA 3KHBA 3LEGA 4CP1A 1NY71 1B35C 4M00A 3UT0A 3O1MA 3FBMA 4CUBA 3IAPA 3POGA 5F6KA 3D6EA 4QU1A 5I8SA 2H0VA 1AR93 1KGYA 4NAMA 3KCXA 1KD7A 1RINA 4KWUA 4XCBA 2W91A 3D4KA 3VDCA 1UIKA 4HETA 4AAPA 5KXEA 4YVSB 1ULDA 3RVHA 2H6BA 5FZFA 1LGBA 2TEPA 1SACA 2ORZA 3U78A 1A3KA 3FBYA 4CEWA 4UAPA 1G9CA 2VZUA 3NAPA 1VRH3 3GJBA 2VMFA 3OUHA 3RZKA 1CAWA 2QVSB 2CAUA 1QXRA 1Y9GA 2ZX2A 4FI9A 3FFQA 1EV11 1TMF1 5CAZA 3MW2A 5KHGA 2ZGKA 4Y26A 4ARYA 5FYZA 2NPIA 1U0AA 2PAMA 5JWPA 2RV9A 3POIA 4DRRA 3I2IA 4E27A 5C4WA 4HBNA 1VBB1 4Q4V3 2VVDA 1JYXA 2SBAA 3BTXA 2YY1A 1JYTA 4EN6B 2P1BA 3WQ7A 1LOEA 3J4UH 4V1PA 3VUOA 4CEWC 4TZDA 3LGRA 1GP5A 4YFWA 3DCQA 3NAPC 4LA3A 1RUG3 1AX1A 3LSEA 4SBVA 4BXFA 5BNQA 5CFCC 4UW3A 2BP6A 2HEYF 4W4ZA 1RB8G 3RMXA 1EY2A 4AI3A 3VKFC 3WCRA 3ELNA 1SCSA 3LFMA 4ORFA 1ODMA 5C4WC 4W6XA 4E4DX 3AFKA 3INAA 4SLIA 5FBJA 1C57A 5A3NA 1DU3D 4CTEA 3BN6A 1O59A 3NV2A 3VDDB 5K8SA 1O4TA 4UF0A 4WM8B 2D44A 1X8EA 3WG1A 3I3MA 1FV2A 2WN3A 1YQ2A 2RDNA 1OF4A 3BOPA 1LGNA 2VTXJ 1O4ZA 4BA6A 3N9LA 2W08A 1QNWA 4DIQA 3RSJA 2GP5A 1HJGA 4A7ZA 2AUYA 2A6VA 5LBEA 5BXXA 3TBDA 3WG4A 1ND3A 1ULFA 3HQXA 4XQWA 2ZGMA 2ZCWA 2GNBA 2B45X 2JDNA 1DQ5A 4QGLA 5DUVA 4AFCA 4AXOA 1S0EA 4GB33 2L9LA 3KT7A 4E2SA 3UGFA 1NXD1 3M3IA 4QB6A 4XJ9A 3WZ1A 1W6QA 4HKLA 2WNOA 1OLMA 5T5PA 2ZAAA 2XUEA 2JG9B 2GDFA 2OS2A 1HDKA 5CFDA 4IESA 1BXHA 5GZGA 3ZSMA 4MGZE 4EN8B 5GZDA 1AR73 2FMYA 2ZMNA 5JXIA 2DUQA 2ZX0A 3ENRA 4EV0A 1KITA 1ND3C 2VTXA 1XYOA 4H7LA 1UXZA 3NKTA 2VU9A 4DQAA 4MGIE 4MGYE 3V0BA 1AF9A 1XJAA 2WSVA 4N7IA 1LTEA 2YPDA 3AVRA 2DCTA 4XXPA 3D5OA 2C26A 2TNFA 1TEIA 1RMU1 4LK6A 4XZUG 1RUD1 3DPRA 2P2KA 5FZIA 3ZYJB 4EZHA 3BU0A 2Y6FA 1IS5A 1WW5A 2RDRA 2HWD2 2VBPA 4W65A 4FP3A 5TSWA 5CFDC 3WNOA 4MGTA 2HEWF 4XF0A 1ZX5A 2AEZA 2VCMA 1VBC3 3PURA 4XFHA 1R1A1 2R073 3ZPOA 4S2FA 3BIWE 4KG8A 3AVSA 1LJ7A 2BWCA 3A23A 3MUY1 2EXKA 5FZLA 3H3LA 1F5JA 3BTZA 2BEOA 3KHCA 3TWIA 1LOCA 2D6LX 2Q8OA 3DUIA 3DPRC 1J1TA 3O1TA 3VBUA 4NROA 4YZ3A 2ZAHA 3WDUA 2V4AA 1P8JA 1R092 1W0OA 1S0GA 5D8AA 3VHPA 3POFA 1AYM2 5HXMA 1RTVA 2LROA 1AX0A 1LU2A 4C1WA 4FP2A 3GF6A 3LPFA 5IVVA 5FY5A 4MOAA 1UPIA 3WNLA 1FV3A 1WCKA 4Q4Y3 2QQMA 1GV9A 5JCTA 5A7SA 2Y0OA 2C24A 1FNZA 1RUC3 4YW5A 4IGPA 5FYMA 4DXRA 5JLVA 4DO0A 5C5UA 5FMCA 2W68A 4XZPA 1F4HA 2ZEXA 5FIXA 5FLJA 3VBUC 5A32B 4QHBA 4N43B 4I02A 1NT0A 5D8AC 2VZRA 2B9VA 3DV8A 1NE6A 2VQAA 2PHWA 3MICA 2GMMA 2JKBA 4LBLA 5AVPA 3AMNA 1GP6A 3IIAA 3USUB 5L73A 1JBCA 4QXCA 2ZX1A 1EPWA 1HQWA 1UZZA 3DGTA 3O0VA 4IEZA 1DZRA 4IE7A 5IVJA 2NYYA 3VBFB 2J22A 2JDHA 1VBD3 2DVBA 3N9QA 1YFWA 2IWGB 3POBA 1QJX3 2I45A 2ZGTA 3H8OA 2XOMA 1FT9A 2XVLA 2VOVA 3EHKA 3S0MA 1H8TB 4Y4YA 3F2ZA 4QKBA 1R083 1HW5A 4P9GA 2XDVA 4PIZA 2PHLA 4TLFA 2VMDA 1ONAA 5AC93 3AKSA 5BNOA 1W0PA 5BNPA 4HONA 4P5YA 1ZBA1 4N8MA 2FZ2A 4NUBA 1OD5A 3NV4A 1UNBA 3POEA 1JZ2A 2VE1A 1AR81 1YJKA 2C9AA 1LOFA 3T09A 1J83A 1NA1B 4AEKA 3GZEA 2X09A 3I59B 5ISLA 4F8AA 3ZYFA 1S0DA 1Z7S3 3NNGA 2G19A 1QJY1 2XGXA 1FI2A 5BY5A 3ZYIB 1WD3A 4N53B 3VD5A 5F3IA 2JICA 5BNOC 2ZHMA 1EUUA 5BNPC 3AP5A 1MQTA 4PIYA 3IN9A 4TYSA 1RXGA 3USSA 1BYHA 4DOUA 1D2SA 1FX5A 2HWC2 3KM5A 1ZBE2 5IK4A 1RUI1 1LOFC 2N7GA 3D0JA 2W46A 3T08A 3WW2A 2XJRA 2VNOA 2XL9A 1QWRA 1AR61 4RSUA 3J7NA 2ENRA 4C90A 3WW1A 4NE9A 1E57A 3B9IA 3ZDSA 1HB4A 1ZNPA 1D7PM 4CZSA 4ZY9A 5CBLA 4M4RA 2QDRA 2HBUA 5A80A 1MQTC 3HR9A 4XFCA
chains in the Genus database with same CATH topology
4RGAA 3E6DA 1IPJA 1BCXA 4Y1XA 3ZFGA 2XJSA 1AL23 2ES3A 1IS4A 1PO11 1VP6A 3D0SA 2K2SA 3AMPA 4YRDA 1MZEA 4A3XA 3J8F2 2ZS6B 3GBWA 1N47A 4OI1A 1HXS2 1SFYA 4YM3A 1AYN2 2VUJA 3VKMA 1PVC2 4IETA 3VL8A 4Q26A 4P9XA 1LCLA 2CNAA 4KWJA 1IS6A 1RC6A 2NLRA 3MIBA 3NO8A 3ZFGC 4R9AA 1CQ9A 5J96B 1FPN3 4OI2A 2XJUA 4FQZA 4PCRA 4CDQB 1NCRA 4AVTA 2EAKA 3U4XA 4Q0UA 1SLTA 4GMP1 4FTBA 3T1LA 5FPZA 4D7TA 4FPJA 2OIIA 2ZGSA 4WBBA 2EF6A 5E16A 1VBA2 4Y20A 1O91A 1OA4A 4CDUB 1DHKB 4RHV2 3AYCA 3VV1A 2VQ0A 4E4ZA 5JIAA 2V09A 3N35A 4ZU4A 1Q8PA 1NCRC 2ZMKA 4LO7A 2A6YA 4FT8A 4Q4W2 4I3GA 4MV2A 3AMMA 3QOPA 1KS4A 1ND2A 3MIFA 4XJAA 1H1MA 1Z78A 3QBQA 4IXLA 3RMYA 1GZCA 1GQGA 2XG3A 4RFT0 4E4SA 5JSOA 3HBZA 3EBRA 1BJQA 2AENA 1CD3G 2A70A 2YHJA 4XOGA 1TME2 3JUUA 4FSJA 1VIWB 2CYFA 2QE3A 4D7SA 1AR92 5T5LA 4FAHA 2EA7A 3FWEA 1EV13 1AJOA 3OY8B 1TMF3 2IXIA 1YJLA 3E6BA 1ND2C 5KHIA 2WC2A 2YC0A 1HQNA 5FQ0B 4W6WA 1HV1A 4OUMA 1ASJ1 2O0OA 4Y1VA 5FOJB 1VBB3 3NV3A 3RYKA 1QY4A 3WD5A 4AFAA 2Y26A 2R041 4J6GA 4OHWA 1R1ZA 1VRH2 5LRSA 1UCXA 4XE9A 1SCRA 4AW7A 5IK8A 1OI6A 2UWCA 5J3UA 4AFMA 1AXYA 1DGWA 2VH9A 4Q4V2 1RHI2 3FC0A 2GN7A 4AFDA 2RM21 2D97A 4HVRA 1RUG2 3NW4A 4D7YA 1XNDA 1JUHA 1PMIA 2ZMLA 4A2UA 3N7LA 2WNUB 3MIDA 3ZXEA 5ACA1 1OQDA 3WDTA 2DV9A 1D0GA 3HT1A 4K21A 2UY8A 2RS31 2KA3A 4JGZA 1AL0G 1XQNA 3GZUC 2P3JA 2OPKA 5C8CB 4FPEA 4CP2A 1CAUA 4YVWA 1B35B 1LOBA 1A78A 3M7AA 4AEDB 1FMD1 3SHRA 4CDXA 3JZVA 4QQLA 2D98A 5CU1A 1QNYA 4LBJA 1AZDA 1XNBA 4KWLA 2WNEA 2A3WA 3B93A 4YVWC 4YGBA 3HAGA 4GB32 3I54A 1VLNA 1PNFA 4LO6B 4CDXC 2B39A 3GBGA 1RMU3 1RUD3 2IXHA 3FE5A 1CAVB 1W6MA 2DCKA 3VBRB 4LT5A 2QFEA 3AKRA 3CO2A 4FPGA 1FNYA 5JI7A 3AMHA 1R1A3 2Z5WA 1MEC1 4ATEA 1CAWB 4CRQA 2D5HA 3BTAA 3ATGA 1X7NA 4LHLA 1BZWA 3MEPA 2D6NA 3POWA 5C4WB 4AVVA 2WZR1 4LNVA 4S2GA 1HX6A 2JECA 3M4FA 1VBC2 2R072 1IOAA 5A3LA 1C8M1 4H3WA 1DBNA 1GZ9A 3T2TA 1ULGA 4MUVA 3RJ2X 3VZKA 4MX3A 4K40A 3POYA 3OTFA 5FPXA 3VBSB 2RS11 5BNNB 1RUE2 1DGRN 3AKPA 1LU1A 2VGDA 3GNEA 3IDBB 2WL1A 2IFWA 2JENA 1PK6A 4LO5B 5K7PA 4HPKB 2YMZA 1AR71 5DG1A 2GNMA 2E6VA 2ZA9A 4RGGA 1CVNA 1YI7A 2D6KA 4Q4Y2 4META 1QH7A 3P3NA 5C33A 2BNOA 1NLSA 1YIPA 1RUC2 4GWMA 2B8MA 3WP4A 4JDOA 1O3RA 1WBLA 2X53S 4DZGA 4ISRA 1H2NA 1G9DA 1PK6C 4NOTA 2XVGA 1ND3B 3POSA 2RHPA 1DZQA 3UKTA 1XE7A 4BIOA 5JOWA 3WDYA 3OBRA 3SXWA 4AHYA 1W6QB 1G9FA 4YNIA 2WT1A 1ZBA3 1VBD2 5CFDB 5FOBB 1K5MB 1PIV1 4DNYA 3HT2A 1QJX2 1AR83 1AHSA 2WNVA 3QLQA 4CEYA 1WLDA 4D3WA 1R082 1GICA 1Z0HA 2GSYA 1QJY3 1COV2 4YW2A 1BMV2 2VOXA 1OOPA 5AC92 1W6NB 4G3YC 3DPRB 3ZFFA 1EAH1 4TWTA 1ZRCA 2LALA 4FPHA 2C0ZA 4COVA 4QQ2A 2WNVC 3M2MA 1RUI3 4WVZA 4LUMA 5LK5A 5C9AA 2DVAA 4CEYC 1Z7S2 4YZ5A 3U11A 1CAXA 1OOPC 1S2KA 5BYNA 4M01A 4LBMA 5K0UB 3WINE 3ZFFC 4L11A 4GULA 5EJ3A 1JYIA 1VB2A 5D8AB 5LEKA 2WS93 5JIUA 2B42B 3MFCA 4B4PA 5K9YA 3B3QE 3HIFA 5C9AC 1PO13 3C3VA 3R05A 4AGVA 2YROA 2W52A 2AZ5A 4F7ZA 3V0AA 3O12A 3VHOA 1G9AA 1UF2C 1W6PB 1IZ3A 3O7OA 4ES9A 1JHNA 4OFGA 1OPOA 3VKOA 1AL22 1J3RA 1NCQA 1LOAA 4IEQA 4DINB 3VBHB 2R1BA 4OLLA 3AYAA 2RJLA 3LOBA 2DFBA 1GZWA 2UY9A 4J1XA 3CJXA 1C5HA 2HWF1 5I0RA 2ERFA 5CNAA 2KXLA 2GMEA 2XJPA 1Y43B 1NOVA 4GXLA 4KG0A 1NCQC 4QMAA 1U5YA 1DG6A 3ZXKA 2BNMA 4FOVA 2MHFA 1M4WA 5BNPB 3WY6A 5SV8A 1TQ5A 5JZGA 2R1DA 4GWNA 3BCWA 1LECA 5DG2A 2WQZC 3SH3A 1RJ8A 2JE9A 2LTNA 4FQ4A 4OZXA 3LSDA 3FUOA 3N7KA 1UIJA 1NY72 2I2SA 4NN0A 1JYCA 2WLPA 2G4IA 1MQTB 1GANA 5JZGC 2WJSA 1XE8A 3WOGA 1PVXA 1QH6A 1ASJ3 3VZOA 4XBQA 3WXPA 4Q27A 3JD71 4BWOA 1FPN1 2CGPA 2R043 5GM0A 3A0KA 4N9HA 1W6OA 4LLOA 5IT6A 3WQ1A 2RR11 1VAKA 4L99A 1TMF2 5HCBA 3VKLA 4MLOA 2ATFA 3UKVA 3H8UA 4LE4A 1FOD1 4DFSA 2JE7A 2VW1A 1VBB2 2DVFA 3AP6A 4UW4A 2VNGA 2XKPA 1NQJA 2Z69A 2RM23 1DLLA 2Q0AA 3PVEA 4LULA 4K8FA 1NE4A 3NWKA 4RQPA 4XIOA 4P14A 3PJYA 4P9WA 5ACA3 2ZGOA 1H9WA 3FJSA 5FFOC 1NYWA 5DZEA 1RJ7A 4K7JA 4X8PA 2RS33 1LESA 2OYZA 3VHRA 1OMIA 1F5FA 4FPCA 4K9SA 5BV6A 5E89A 4BMEA 1Y3TA 4Y5Z0 2MNGA 4Z2WA 1FMD3 4RQPC 5BUVA 2JEMA 1C3HA 3M1HA 1IS3A 2UURA 3C2UA 2E7TA 1FATA 3X29B 1GKBA 5CA6A 2DWRA 3M70A 2R49A 1GBGA 2QKDA 4B3NA 1LR5A 1ZZ9A 5GZEA 4COWA 3CF6E 4HANA 3ILNA 3BODA 4OHZA 4U2AA 4DB5A 1G6NA 4IQPA 1ND2B 1HIXA 1POV1 1UMZA 5I0TA 1D0HA 1LULA 3G7DA 4ASMB 1PGW1 2O8QA 4XJWA 4XQDA 4Y22B 5I91A 3GALA 3UL2A 4LBOA 1DFQA 1OFNA 1NQDA 3AZVA 3H50A 1MEC3 4K3UA 2P17A 3IDEA 3QCWA 1M06G 4ONUA 1RMU2 5J98B 1RUD2 4D69A 1ALYA 2I07B 2ZGNA 2HEVF 2WZR3 2RMU1 4Z8BA 1HKDA 1CPNA 1F8VA 3ETQA 2NQYA 4PLMA 4OULA 4CDWB 1C8M3 2QQPA 1OKQA 4PLNA 4FCAA 3AMQA 4L8QA 1V6MA 5D1IA 4JV4A 4XILA 1KDMA 1PZ9A 2RS13 3D8CA 4BH9A 5FMOL 1H0BA 5FLIA 4YARA 1YIFA 1J58A 4FPKA 4J1WA 4B7KA 2NM1A 4I3PA 1QHDA 1VAVA 4INDA 4RA0A 4WM7A 5DDJ1 1X33A 4Y1YA 4QXKA 2XJVA 4TSVA 3MF6A 5BPXA 4PIXA 2GZWA 1RUJ1 2WINB 2Y0IA 4Q0QA 4JGZB 3MF9A 4UBHA 3J9SA 1CAUB 1QGLA 4YVWB 2WA4A 4WM7C 1D2QA 4L2NA 1WGPA 2YPJA 4CDXB 4OI0A 4QD2A 3SCFA 3U10A 4B29A 3JBG3 4XF4A 4QT6A 3ZSEA 3M3OA 5JPNB 1PIV3 3H7YA 2AH2A 2E53A 5HCFA 1N3QA 2CTVA 1IKPA 3IWZA 4B7EA 2ZGLA 1JXNA 2IFRA 3GHMA 4PBOA 4FXGB 4YZ1A 4XBLA 5A33A 1DGRA 2VXRA 3K51A 1CJPA 1EAH3 1PNGA 1ZBA2 4XJZA 2P3IA 3ASIA 3WR0A 2VW2A 1AR82 4HKOA 3QD6A 4WZFA 4BE3A 5JPMB 3WVJA 2PELA 3RI8A 2D7FA 2WSUA 4GIQA 3JCIA 4KL1A 3WDWA 3RWNA 1GR3A 4JAAA 5GKAC 1EP0A 4AWDA 2LUWA 4YM0A 1YFYA 4AEMA 5FO9B 2VMHA 1QU0A 4DS0A 2IXKA 3AZZA 2JG8C 1RUI2 1ZRDA 3SITA 1N1YA 4FO9A 1AR62 1APNA 4R9BA 2F4PA 2B7YA 5F1RA 2VOKA 3OYWB 3BALA 2MEV1 3FHIB 1DQ6A 2XLFA 1POV0 1MVEA 1RUF3 4Q0VA 1ZA4A 4AGGA 1PO12 1A6CA 1ENRA 4R4ZA 3WX5A 4OHYA 3AZXA 1IGOA 4GKYA 5GLWA 5CG8A 5DUWA 4E9KA 1PGL2 4Z07A 2HWF3 2XUMA 4UXAA 1LHNA 2EXJA 3PJQA 4YW3A 1ULCA 2BPA2 2DF7A 3SMHA 3ECQA 2X29A 1UW8A 2UWBA 1U5ZA 1OLRA 4LHKA 3IPVA 3WDVA 3KGLA 3TRSB 4BMBA 4QQPA 1CIWA 3CJIA 4OHVA 2XKOA 5FBZA 2YDEA 3P3PA 4AQSA 1LHOA 2ZBJA 2WNVB 2WS91 2CWMA 4CEYB 1OFSA 4HFSA 2UWAA 1D4M1 2HJIA 1OOPB 4NWVA 4HMZA 1PZ8A 3I7DA 3JB4C 4AQ6A 3CJIC 2TBVA 3EO6A 1AVBA 4I01A 3WCSA 1QQP3 2YXSA 4FOQA 2FZ1A 4FVVA 3QH7A 4B4RA 5C9AB 2PAEA 3JD73 1WMDA 2Z2SB 1NXMA 1CAXB 3A0NA 1V9U1 4AG4A 4P9JA 2RR13 2FMDA 4PDWB 5FLHA 1BBT1 4RS5A 3ZFEA 3MW4A 4XFFA 1VBE3 1REDA 4XF3A 1WBFA 1FOD3 2BTVC 4GKXA 5AFEA 3ZMNA 3I4IA 2EXIA 1W39A 2CGNA 3MIEA 2R042 3GZTB 4QM9A 1ZRFA 1JUIA 4LO8A 1C28A 4RL7A 1MZ5A 3V0AB 3LA3A 1ZVFA 4PQ9A 3IBMA 4IV3B 3AJYA 4RS5C 1Q8SA 1ZYBA 5GJ6A 3ZFEC 3MIGA 4Q8KA 1MZFA 5KBFA 1O5LA 4YFZA 4XJ8A 1MVQA 1NCQB 4EROA 4Z1VA 2RM22 3ZIXA 2ZHKA 3ROUA 1LRHA 3M3CA 1WLWA 4E2QA 1UKGA 3MW3A 4Q4X1 4L92A 5L36A 2CAVA 1SQ4A 2D3SA 4H55A 2HWE1 1TNRA 3THTA 4P9IA 3CL1A 3ZYRA 2ZHLA 4DY5A 3VBOA 1O3SA 1O3QA 5EFUA 2XJTA 3ZN6B 1MR5A 3N3HA 2XHKA 1J59A 1FMD2 5F9TA 4HLTA 1MS0A 1CONA 4AHXA 3AFGA 5KXCA 1POV3 3HD8B 3WNXA 2H6CA 4MXWB 2FHRA 3U0ZA 4B4QA 3MIHA 3KLSA 1GLHA 1SBDA 1H2KA 3VBOC 2YV8A 3HWJA 2R061 1I3HA 4Y1ZA 5H9QA 2OZJA 1MS9A 4C0HA 5GLZA 2WZPP 4Q4W1 2RS51 4WM8C 2RMU3 3VLBB 3HMYA 1V6NA 4KU8A 2VNRA 2ZPXA 4S2HA 4UBGA 4MGKE 4R9CA 1AXZA 1MEC2 1W6OB 3SLIA 2JG9A 4NR1A 3DKWA 2BGCA 5CFCB 2B9UA 4AE2A 5EWSA 3G6JB 2WZR2 2DURA 4JTOA 1BEV1 1H8VA 1J3QA 2W0XA 3LA2A 4Q1PA 1C8M2 4IEOA 1AJKA 1ULEA 1LODA 2V73A 2JG9C 5DDJ3 3AX4A 2RE9A 1PZ7A 5ABJA 3ZXFA 2YZ4A 3M8LA 1DYPA 2RS12 3MLLA 4EJRA 1RVF1 3GBFA 3LAGA 4YG6A 1RUJ3 2PAKA 1B09A 1YXWA 2VMIA 1AR72 2DUPA 4CEWB 2P3KA 3NAPB 1IKQA 2GN3A 1XYPA 5ABJC 4XPVA 3JU9A 1QXPA 2HYKA 4YM2A 1AUYA 2DFCA 4XFAA 3WHUA 4O9GA 1GNHA 3RZZA 2NZ9A 1CX4A 2Z42A 5H9SA 4LR4A 1ZZ8A 2EVXA 4AI1A 1QOSA 2ZACA 4N43A 1SEFA 2EAAA 3MLKA 4XFIA 1MACA 2PFWA 1HRV1 4X6RB 5EZWA 1PIV2 2CWSA 4YW4A 3WLUA 4CYDA 1KQRA 1A8DA 2BBVA 1GFF2 5HXVA 1I5ZA 1UX6A 3KT4A 3R0RA 1YWKA 4ITCA 5GLVA 3URFA 1DYKA 1O5UA 3OCPA 4IL7A 3WW3A 4N43C 3N4MA 1XXNA 4AF9A 3H7JA 1QJU1 4XHBA 2ZZJA 1EAH2 1WCSA 2E9QA 3B01A 3R4DB 4CP0A 2GAUA 4FPFA 3ACLA 3JB8A 1C1FA 2AYHA 4EWEA 3BU7A 1G86A 5IUQA 1J3PA 1UU6A 4NHKA 4ZXKA 5CB7A 4IV1A 3B02A 3VBFC 4Q2FA 2DTWA 2MEV3 1NA1A 1VB4A 3TOJA 3MI8A 3I59A 1PM7A 3OPZA 4AEJA 1GQHA 1JW6A 3JBG1 3O0WA 1ENSA 1URXA 3UV9A 5KC6A 3TNQA 1OLQA 4M3CA 5CIRA 1Q5OA 4IV1C 4M3CE 3L9JT 3V0BB 1ZZCA 1JN2P 1NA1C 3O14A 3FLTA 4FOYA 2JX9A 3FUQA 2ARBA 3ZXLA 2V5YA 2BUKA 3RNSA 2A73B 4N90A 4ASLA 1C5IA 3GYDA 1RUE1 3T1MA 2X5IA 3S6PA 4KGQA 1SLBA 4HK8A 4KBBA 4YM1A 1RIRA 3FZ3A 4NPRA 3TN91 4WVMA 3AP4A 2HWF2 2DYCA 2W39A 3VBUB 2DCJA 1RL3A 3M3EA 3ZSKA 4S2DA 5C6CA 1NLRA 3WG2A 1REEA 2TUNA 1KFUL 2X5IC 1D4M3 4QX5A 1REFA 4BLIA 1JOJA 5FTTC 4E2GA 3RQ0A 3R4UA 4OHXA 2XWJB 3KQRA 1XRUA 5GALA 1SLCA 4CDQA 3SCGA 4JDNA 2ET7A 5AVAA 4MZUA 3WP3A 3IMNA 1RUF1 3MZHA 5CG9A 1QF3A 3AK0A 1VR3A 1HRI1 1XNCA 3LZZA 1UU4A 4CDUA 4FXKB 2Q1ZB 1V9U3 4EWAA 1GYKA 4N7UA 3SISA 3FX3A 3M3QA 4QPGA 4CDQC 1BBT3 1COV1 4COUA 3NSTA 2WFF1 3SH5A 4EN7B 1TNFA 4I0AA 2WIIB 1YFXA 4GH4A 3VN4A 1FPN2 1WD4A 3UK9A 2GMPA 2EALA 2PA7A 4CDUC 2RR12 1YLLA 4WV8A 5BNOB 3PVOA 3PTYA 5JSRA 3H0OA 4QPGC 4BQ1A 3WQ0A 1FOD2 2O1QA 3VZJA 1OSGA 4KH9A 1WUVA 5I8YA 1H4HA 3AKQA 4PF5A 4GH4C 2HWB1 1MS4A 2VECA 3V56A 1Q3EA 3GHNA 5FQ0A 4QGMA 5J36A 3S30A 4Q4X3 4Y24A 5JI9A 1QQP1 2I74A 2ZJCA 2ZX4A 2HWE3 3J8F3 1Q56A 3MDPA 5JOXA 4FPLA 4KQ7A 1WLCA 1AYN3 1DDLA 1S55A 5FO7B 1WW7A 4K20A 2QZ3A 5CVRA 1ZZ7A 3KB5A 5IK5A 2YYOA 3BPZA 4A7YA 1EV12 1DQ1A 5C8WA 5FDBA 4PBPA 2A5ZA 2BFUL 4BLJA 1VBE1 5JOZA 2WNUA 2AREA 2HKXA 3ZFGB 1H30A 1GNZA 1LB2A 4LBKA 3ILFA 1CGPA 4LBQA 4MH0E 4QQOA 4QPIA 1VAMA 2R063 3CU7A 3B00A 3S7EA 4DXZA 2ZOEB 1H1IA 1G8WA 5C8CA 1X50A 2VULA 2RJKA 2E7AA 1XU1A 2R32A 1PGW2 3H1YA 4MYEA 4Q4W3 2WNUC 5FMOS 1PO21 2RS53 1N1SA 1RUH1 3LOIA 2ZGUA 4XDQA 2WQ4A 2O8OA 1NCRB 3LB9A 4QPIC 2QCSB 1S2BA 3ILRA 5J7MA 4YZ4A 1GSLA 3EQEA 1I6XA 2XBO1 5DUXA 1SLIA 5C8CC 3ZFEB 4ZU5A 1V6OA 1N3PA 1TME3 1WW4A 3AXEA 4FTSA 4Y20B 1VJ2A 2PLV1 4AEDC 2RMU2 1BEV3 1IHMA 1CAVA 1S0CA 1OA3A 4EN0A 3VBRA 2VPVA 1ZREA 3ZSLA 1S0JA 2NP0A 2VG9A 2GU9A 2CL2A 3ST7A 1C8NA 3KT1A 1RVF3 3E5UA 4PJYA 3VL9A 1BKZA 3J26N 2GH8A 1SBEA 4U36A 2IZWA 4BYYA 4JGYA 1YNAA 3ZXJA 3ZIWA 5IK7A 5DDJ2 3AZWA 2ET1A 5I93A 3VBRC 4RR3A 1RHI3 2D3RA 4JCKA 4BOWA 2D43A 3E5XA 1RUJ2 1LEDA 2B46X 3ALQA 1S0FA 2E7QA 1XU2A 2R0HA 4M0HA 3VBOB 3VBSA 5BNNA 4JGYC 1R1A2 2XH6A 3O5SA 5T54A 3VZMA 3LWCA 4COZA 4RR3C 1RUOA 2DU1A 4HPKA 5KHHA 3ZO0B 4ES8A 2GNTA 1I1EA 4UW6A 1HRV3 4X8NA 4JC1A 1SLAA 5DZFA 3PHMA