5ABJC

Structure of coxsackievirus a16 in complex with gpp3
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
242
structure length
242
Chain Sequence
b'GIPTELKPGTNQFLTTDDGVSAPILPGFHPTPPIHIPGEVHNLLEICRVETILEVNNLKTNETTPMQRLCFPVSVQSKTGELCAAFRADPGRDGPWQSTILGQLCRYYTQWSGSLEVTFMFAGSFMATGKMLIAYTPPGGNVPADRITAMLGTHVIWDFGLQSSVTLVVPWISNTHYRAHARAGYFDYYTTGIITIWYQTNYVVPIGAPTTAYIVALAAAQDNFTMKLCKDTEDIEQTANIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP1
publication title Structure Elucidation of Coxsackievirus A16 in Complex with Gpp3 Informs a Systematic Review of Highly Potent Capsid Binders to Enteroviruses.
pubmed doi rcsb
source organism Coxsackievirus a16
molecule tags Virus
total genus 44
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2015-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5abjC00
4QPIB 4CDWC 4CEWC 1ZBE3 4GB31 1QJY1 2XBO1 4Q4V3 2RM21 2R061 1PIV3 3ZXAC 1BEV2 5K0UA 1R092 4JGYC 4SBVA 4Y4YA 1EV12 1R082 1RVF1 1BBT2 1FOD2 2R041 3IDEA 3VBOA 1BMV2 1EAH3 1D4M1 2RS13 3ZFFA 4PDWB 5AC93 5A33B 4CEYC 5BNPB 1HRI2 5L7OB 1RUI3 1AR71 1AL21 1NCQA 2WZR2 4Q4Y3 4IV1B 4GH4B 5A32B 1RUD2 5J98B 3ZFGB 1PGW1 1Z7S3 5FMOS 4Q4V1 1QJX1 1HRV3 1OHFA 1ND2C 1ND3B 5CFCA 1VBA1 1MQTB 1R1A1 3VBFA 1VBD3 4IV3A 3J8F1 1C8M3 1IHMA 2WLPA 3JD73 1ZBA3 4Q4W2 1COV2 4FTBA 4JGZC 5JZGA 1B35C 2R071 1VBC3 4Q4Y1 4RQPC 4CDQB 1HXS1 1A6CA 3VBRC 2ZZQA 5BNPA 4N53C 5D8AC 4RHV2 4RS5A 1AYM1 4NWVA 2RMU2 1RUE3 1RUG1 1RMU2 1VRH3 2QQPA 5CFDC 4GH4A 5ABJC 1QQP3 4GB32 1QJY2 2HWF1 2XBO2 1RUF1 2RM22 2R062 5BNOC 5C8CB 5DDJ3 2RS33 1FMD3 4CDWB 4Z92B 2RS51 3HAGA 1PVC1 4CEWB 1ZBA1 2BFUL 1F2NA 1MQTA 2HWE3 4AEDC 3VBSC 1RVF2 1AR91 5C4WC 5LK7B 1VBC1 2R042 1E57A 1RUH1 1MEC1 1D4M2 4JGYB 4GMP1 2Y26A 4N43C 1AR72 1AL22 4CDQA 3VDDA 3VBUA 4CEYB 1X33A 1C8NA 2HWB1 1PGW2 3TN93 1QJX2 4CDUA 2WS93 1FMD1 3VBHA 1FPN3 5J96B 1NA1C 4QPGC 1K5MC 1VBA2 2HWD3 1R1A2 3J8F2 1ND2B 1POV0 2RR13 3JB8A 4RFT0 4CDWA 1NCRC 1X36A 4YVSC 1AYN2 1ASJ1 2MEV3 4YVWC 1AR83 1TME3 2PLV3 2R072 4Q4Y2 5BNNC 4Y5Z0 1OOPC 3LOBA 1HXS2 4JGZB 1NG0A 1PO11 1B35B 1AYM2 1H8TC 2GSYA 4WM7A 1RUG2 4RQPB 2X5IC 1VBB3 3VBRB 3VBOC 2FZ2A 4N53B 5D8AB 3ZFFC 1ZBE1 3CJIA 1VB2A 2HWF2 1PIV1 1RUF2 2RR11 1NCQC 5ACA3 5CFDB 1BEV3 4QPIA 1R093 2RS52 1AL0G 1PVC2 1ZBA2 1EV13 1R083 5ABJB 1ND2A 4LLFA 5BNOB 1AR92 1BBT3 1AR81 1DDLA 3JBG3 1VBC2 1EAH1 1RUH2 1RUJ3 2RS11 1MEC2 5CFCC 5AC91 4AEDB 3VBSB 2VQ0A 1PGL1 1RUI1 5C4WB 3VBFC 3DPRC 4IV3C 4FTSA 5FOJB 2WZR3 1NOVA 4PDWA 5A33A 1RUD3 4JGZA 4N43B 5L7OA 1Z7S1 2HWB2 2WFF3 1V9U3 1HRV1 4RQPA 1RHI3 3VBRA 5JZGC 1FMD2 5ACA1 4IV1A 4N53A 5D8AA 5C9AC 3S6PA 1EV11 5A32A 3ZFGA 1RB8G 1VBD1 2WWSA 1C8M1 1ND3A 3JBG1 4RS5C 4FSJA 1RUJ1 4Q4X3 1NA1B 4QPGB 1K5MB 5ABJA 3JD71 4Q4W3 1COV3 1NY71 1POV3 1ASJ2 2ZTNA 4RR3C 2BFUS 1NCRB 4EJRA 4AEDA 3VBSA 4YVSB 4RHV3 5C4WA 2WFF1 2XPJA 1V9U1 4YVWB 2RMU3 1PO12 1RUE1 1AR63 1RHI1 1RMU3 4CDXC 1VRH1 5BNNB 1OOPB 1VBE3 2GH8A 1ZBE2 1QJU3 1QQP1 4GB33 1QJY3 1H8TB 2XBO3 2ZAHA 3NAPC 4Q4V2 1PIV2 2RR12 2X5IB 5DDJ1 2RS31 3ZFEC 4Q4X1 2BBVA 3VBOB 3VDDC 3ZFFB 1COV1 3VBUC 2HWE1 4GMP0 1RVF3 3JB4C 5C8CA 4WM8C 1AR82 2DF7A 2R043 1NCQB 4CDUC 4QPGA 1EAH2 1W39A 1M06G 1TMF3 1D4M3 3VBHC 2RS12 4CEWA 4BCUA 5AC92 1VAKA 1PGL2 1RUI2 1AR61 1AL23 1VBE1 4JGYA 5CFCB 4YVSA 5K0UC 1QJU1 2HWC3 4YVWA 1Z7S2 1QJX3 3TN91 3VBFB 3DPRB 1RUC3 4IV3B 1HRV2 4FTEA 5BNNA 1OOPA 2WS91 1PO23 1FPN1 1HQNA 5ACA2 1WCDJ 4CEYA 1VBA3 2TBVA 1H8TA 1R1A3 2HWD1 3FBMA 1VBD2 3J8F3 2X5IA 1C8M2 3JBG2 5JZGB 4WM7C 1RUJ2 1TMF1 5C9AB 3JD72 1CJDA 1NY72 1AYN3 2MEV1 4RS5B 2BUKA 3CJIC 1FOD3 5FMOL 2R073 1TME1 2PLV1 1GFF2 1HXS3 1HX6A 4QPIC 2HWC1 2BPA2 1HRI3 2WFF2 1RUC1 1V9U2 5GKAC 1AYM3 1RUE2 1RUG3 1PO21 1RHI2 4RR3B 1VBB1 1VRH2 3M8LA 2FZ1A 3DPRA 1QQP2 1B35A 2HWF3 1RUF3 4CDXB 5DDJ2 2RS32 4Q4X2 1BEV1 1VB4A 2RS53 1R091 1PVC3 4PDWC 1R081 1AYN1 3NAPB 2HWE2 5BNPC 5L7OC 1AR93 1BBT1 1FOD1 3ZFEB 1F8VA 1OPOA 1BMV1 1RUH3 5CFDA 5C9AA 1MEC3 3VDDB 4IV1C 4GMP3 3VBUB 4GH4C 1HRI1 3ZFGC 5BNOA 4WM8B 1AR62 2WZR1 4CDUB 1ND3C 1VBE2 3VBHB 1RUD1 1QJU2 2HWB3 1MQTC 3TN92 4RR3A 2WS92 1FPN2 1CD3G 5K0UB 4N43A 2HWD2 4CDXA 2RM23 2R063 4NWWA 1TMF2 4CDQC 4Q4W1 3NAPA 1POV1 1SMVA 1ASJ3 3ZFEA 2MEV2 4WM7B 1TME2 2PLV2 2IZWA 1NA1A 1K5MA 1QJZA 1AUYA 2HWC2 4RHV1 4WM8A 3CJIB 1RUC2 1PO13 2RMU1 1AR73 1PO22 5C8CC 1RMU1 1VBB2 1NCRA
chains in the Genus database with same CATH superfamily
4CCDA 1ZZ9A 1LGCA 1V0AA 5FYVA 4ZZ8A 3LIGA 1CAXB 1JODA 4AK3A 3NW4A 4QGNA 1QJY1 4P9GA 1PIV3 1A34A 3HT1A 1WCSA 4COZA 5A3TA 1BEV2 2YROA 5K0UA 5T5PA 3ATGA 4Y4YA 3ECQA 5A3PA 2FDFA 3C7FA 1LOFC 2YDEA 4YW6A 3MHZA 3IDEA 1NLSA 3VBOA 4MGZE 3AZXA 5FY9A 1KDMA 4AFDA 3T0BA 2RS13 3ZFFA 1UN1A 1W8OA 4ZS2A 2ZX2A 3AXEA 2IUWA 4PBOA 4QX1A 5A33B 5BNPB 1WD3A 1UPIA 5F7UA 3O1PA 1XU2A 3D0SA 5FZ9A 2YUEA 1AL21 1NCQA 2MHFA 2IXHA 5DPNA 1KS5A 2WNOA 2WZR2 4QB1A 2JG8C 3PHMA 4FCAA 4IV1B 3BYWA 1H1AA 4KWKA 3OY8A 3HT2A 4LBOA 3AYCA 3ALQA 4FFGA 1DGLA 5JLVA 4LORA 4Q4V1 3MGUA 4FVVA 2RDQA 4CZSA 4KBBA 1ND3B 1X9PA 1IQDC 5I91A 4IQPA 1URXA 4OHZA 3Q8FA 3POGA 1OSGA 2AGSA 3WG1A 1VBA1 2OIIA 3LF7A 3RZZA 5JOWA 3OYWB 3VZJA 1BHGA 1ULCA 1X8MA 4CCJA 2BP6A 1VBD3 2ZX3A 5KXDA 1SPPB 1YLLA 1JYCA 2E63A 2Y6FA 3ACHA 1IHMA 5E89A 4YW7A 1GQGA 1BKZA 3H8RA 3OGVA 1H30A 1SLCA 2FDIA 4AI2A 3O1SA 2VTFA 1C4RA 1D2QA 5DZEA 4F83A 1IKPA 2ZHKA 4XDQA 5LY1A 1LRHA 2VOWA 3MEPA 1TE1B 4FTBA 4K7JA 5FTTC 1YUDA 2VMFA 2A6VA 2R071 2UY8A 4P9LA 2EICA 4Q5OA 2D6OX 3VBRC 1A6CA 2Q1ZB 4XAAA 5HPOA 1GMMA 2ZZQA 3L2HA 4FOVA 1CIYA 2VQTA 3N36A 4RHV2 2Z4FA 2XXZA 4NWVA 2Y6LA 4NHLA 4W4ZA 1RUG1 2VOVA 5C71A 1LU1A 5E1RA 2P4EA 2WRAA 4Y5SA 3ZMOA 4E8DA 5LZ6A 1VALA 3FMGA 5CFDC 4L0PA 4HSLA 1I9RA 2VBPA 3Q9OA 1UYZA 3VD5A 4B8EA 3M3EA 4AOCA 3VBFB 3GF6A 1BJQA 3B9IA 1UMZA 1A78A 2RM22 4AVVA 1S1AA 1V6OA 3IDBB 1Q43A 1UNBA 3CNAA 3GZAA 3WV6A 5FOBB 3HAGA 1PVC1 3HQRA 3R4UA 3MLLA 1MQTA 5D2AA 1W28A 4XIOA 1FNYA 1ZZBA 2BEOA 5IUQA 4AEDC 1RVF2 2KA3A 2RHPA 1AR91 2JDPA 5CNAA 1GZWA 4AHWA 2XJUA 3WQBA 5IWFA 1VBC1 1E57A 1GNYA 1SLIA 1UXXX 5CG9A 1D4M2 3KHCA 1YI7A 4JGYB 2WA3A 4ASMB 5I8TA 3KT4A 4LBLA 4AW7A 4DO0A 4TZDA 1WW5A 1YQCA 2RE9A 3UJOA 2JIJA 2A73B 1GQHA 2D3SA 1AR72 5FZCA 3AB0A 1PK6B 5C5UA 4CDQA 5CAZA 5CVRA 1OUXA 4AG4A 4LT5A 1SCRA 1V6JA 1EY2A 1UY0A 3BPZA 3VDDA 1V00A 2FDJA 4LULA 3NKGA 4COVA 2WR9A 1C8NA 1PGW2 4CE8A 5IK4A 5FXZA 1BVVA 3MDPA 3POSA 1UWWA 5LB6A 2GC2A 3VUOA 1SG3A 4AHYA 1FMD1 3VBHA 1GP4A 4A2UA 5JPMB 5JUVA 4IEPA 4N9IA 3T4VA 3WHTA 4CCLA 1VR3A 3IPVA 4LEJA 2HWD3 1G6NA 2JE8A 2J22A 2WN2A 1QMJA 3B94A 2QDRA 1CPMA 4Q0PA 4KG8A 3JB8A 1DF0A 4FT8A 4RFT0 5D1IA 4BB3A 1ZRFA 4QDSA 1G9FA 3NWKA 1X36A 4LBKA 1XE0A 3P1IA 4LO6B 4N7UA 3P6BA 1AYN2 1U0AA 2VBDA 1ASJ1 2YGLA 2V5YA 1CAUA 3FFZA 4FPFA 4P00B 5JAXA 1AR83 2WZPP 2GH2A 4YZ2A 1WW4A 3E5UA 3N35A 5CBLA 3LOBA 1IKQA 2ZCWA 4Y3OA 5EQUA 5FJKA 4NE9A 1IS6A 2XUMA 1DHKB 1GOGA 2IVJA 1QF3A 4I3PA 4E8CA 4DUXA 1XE8A 3FE5A 3THPA 4JGZB 4IE6A 4LTAA 3U07A 1H8TC 4AI3A 5HV4A 3WW3A 4COWA 2JXAA 2GU9A 3NMBA 5KHHA 2CGPA 1R1ZA 1Y4WA 2Q8EA 1MS9A 4PIZA 2Q1MA 2CV6A 3ZSJA 3CJIA 2OZ6A 2VVDA 3BU7A 2HWF2 3RZMA 1PIV1 1RUF2 5FPXA 4M01A 2WN3A 4NR1A 2WUHA 3TOJA 1BEV3 1M4WA 1ZRCA 4MG2A 1SLBA 5FWEA 1ZBA2 2VBBA 4M0HA 4K1ZA 4BK4A 2Z79A 1QOSA 2C9AA 4RGGA 2B46X 3WF1A 1W2NA 5FMDA 5BNOB 2VQAA 3LD8A 3JBG3 2W0XA 1ULFA 5DQ0A 3WF3A 4BA6A 1RUJ3 5ANNA 2RS11 1ALYA 2CGNA 1U5IA 4CUGA 4CUCA 1RIRA 4Y26A 5EWSA 1AF9A 1NZIA 4M3CF 1PGL1 1H0BA 5KWRA 3OPZA 4A6OA 3VBFC 1IG0A 3DPRC 2IVIB 4NO4A 2WZR3 1X7NA 2Z69A 4Q0UA 4NPMA 2E7QA 4PDWA 5I8YA 3VKMA 3THCA 1UAIA 4JDOA 5A3NA 3BTAA 4N43B 1XNDA 2HWB2 3T1LA 1IS4A 4X8PA 2P3IA 2PYTA 2Q4SA 2WO7A 4XABA 1S0CA 4MGYE 4OYUA 1O8PA 2RDNA 3VBRA 2XUEA 3POIA 4Q0SA 3PURA 4PF5A 3MV01 1DZRA 2WNUC 3WNMA 5F1RA 4P14A 3ZFGA 1LOEA 1D7PM 2K46A 5LY2A 3OEBA 4BQ3A 5GZFA 5B4XA 5FPLA 3LA3A 1VBD1 1CAVA 2E53A 3OOXA 3H7YA 1FXZA 4CXXA 1UU4A 2FCVA 1YIFA 5LCWL 4EYUA 4Y1UA 5LA0A 4DXSA 4FFFA 3N9QA 5JMCA 1UY1A 1H6YA 4N7IA 4HXCA 1EYBA 5EHDA 4EN8B 5FFOC 1SLAA 1QH6A 4LOTA 4YARA 5FY1A 5L9BA 1SBEA 1UOJA 2BFUS 5JXJA 1NCRB 2J1SA 4CSWA 1QH7A 3DYPA 2WSUA 5IFTA 5L9VA 4H3WA 4AEDA 2W91A 3PIGA 4EN6B 5A6QA 4RHV3 2XPJA 5LA9A 2FMDA 1OA2A 1V9U1 2MPFA 4YVWB 1PO12 4XHBA 1C1LA 3C7OA 4WVZA 4AFMA 4CDXC 4FP3A 4ZXKA 3HQXA 1KEXA 5GJ6A 4QD2A 2QQWA 2VVFA 3EJKA 4QGMA 4XE9A 4LUMA 5F5AA 4IEQA 3T4HB 3M3IA 1W05A 2GH8A 5FYTA 1HIXA 1ZBE2 3WF4A 4A45A 1HV1A 1QXRA 2ZAHA 3NAPC 4Q4V2 1FV3A 3EQEA 4IEOA 2RR12 4EWAA 5DABA 4OI2A 4NHKA 3ZFEC 2JDMA 2BBVA 3VBOB 5FZAA 4HZFA 3ILFA 4HKLA 2VZUA 3ZFFB 2RDSA 4LBQD 2P3JA 3MLKA 1JTZX 2BTVC 5JR7B 1RVF3 2EIEA 3RZLA 4XZUG 5C8CA 1KDKA 5JPNB 1QNYA 1QY4A 3WDWA 1NCQB 2ADDA 1EAH2 1D4M3 1OC1A 4BPZA 2WQ4A 4BCUA 1A8DA 2GAUA 3LPGA 1ZRRA 3OY8B 3MV11 4OUSA 4DMIA 1W8NA 4LMFA 2YV8A 3CBNA 4P9WA 4JTNA 3HQUA 2WT2A 1AR61 3J7LA 1S0IA 5FP4A 5GALA 3OGGA 4JRLA 2E7AA 4LBMA 4FPYA 4DUVA 1JZ6A 4CCKA 3MPPG 4BU2A 3CDZB 1GZCA 4S2DA 2R6QA 3DF0A 5FZEA 1F5FA 3ZLIA 5F5IA 4AVBA 3C3VA 1EUTA 1IS5A 2Y6KA 3ON7A 4IEXA 1SFPA 2QQMA 5C70A 1PO23 1SHWB 4WZCA 3RWKX 5ACA2 4Q26A 4UFMA 1TEIA 2ORZA 1HQLA 3W21A 5GLUA 1US2A 2RG4A 4UT5A 3WP4A 2A3XA 2F6BA 1H8TA 5FCCA 2HWD1 3FBMA 3AMNA 4PIXA 4Q2FA 5H9RA 3IIAA 3BTZA 4LHLA 3NJZA 1DGWA 5IK5A 4HOOA 3VDAA 4Y5TA 3RMXA 3AP4A 4UFKA 5C9AB 3ES4A 3VZNA 4NIIA 5LASA 2VZQA 4HBNA 1NY72 1AYN3 2CWMA 2ZABA 3BIWE 3MO4A 2BVVA 2IXLA 3E5XA 1MZEA 3CU7A 3BPSA 4P5YA 4NIHA 2DCZA 4BK5A 5FMOL 3ILNA 2BWCA 4IGPA 5GLVA 3GCWA 1G9CA 1CZTA 5EJ3A 3R6SA 4AAPA 4AEKA 4XZPA 4QPIC 2HWC1 3FJSA 4Q27A 2XG3A 3MUY1 2Q8OA 1HRI3 3GJBA 4OI1A 2WFF2 1G9BA 2VZPA 2YC0A 3GZTB 4IEUA 4QDQA 4QX5A 1CESA 2DTWA 1MPXA 3CQOA 4RR3B 5F5CA 1QHDA 4YM2A 3WCSA 5HCHA 2CNAA 3T1MA 3A0KA 3S7IA 3AKRA 3M8LA 4ARXA 1OQEA 1U5ZA 1WA6X 2FZ1A 3WP3A 3K48A 4S2HA 1JS9A 3H8OA 3DPRA 2CGOA 2HWF3 1RUF3 3ENRA 3NO8A 1WW7A 4K8FA 2BERA 3UKVA 3AL5A 1GZWB 1L7RA 4I0BA 4TLFA 1R64A 3O0VA 1OI6A 4Q4X2 1BEV1 1H6XA 2G4IA 4YWAA 4YG6A 3WR0A 1EPWA 2E9QA 2JG9A 1WBLA 2DVFA 5KXCA 2HWE2 3PUIA 4AHZA 5C33A 2A70A 5L7OC 3TNPB 3ZPOA 1OUSA 2J1UA 2VNOA 2JE9A 2CU5A 3AMPA 4AGRA 5IVBA 2VUDA 3VDDB 4BIFA 3P3NA 2V72A 5FZ1A 5JIUA 4GMP3 3WNXA 1HB3A 4GH4C 1OD3A 5ERLA 2B42B 5JSOA 1ZM1A 3NKTA 2BGCA 3CMGA 1IS3A 5SV5A 2WWJA 3KT7A 3NV1A 2WZR1 3H9AA 1NXD1 1AJOA 2J42A 3LKJA 3OBAA 4JVAA 4TLGA 3VBHB 2ZX1A 3B01A 2W52A 3HNYM 3OGSA 1LU2A 3IPVB 1WWYA 2YHJA 5AVPA 1QJU2 2HWB3 3UKTA 1UYPA 2VNVA 2JE7A 1X8EA 4HKOA 4URTA 1H1IA 1U12A 3PIJA 4QKNA 2R30A 2WS92 3LDKA 4CP9A 3RGBA 1BLZA 2Q8CA 1FPN2 3SNMA 1J1LA 3MW2A 2WKKA 5DAXA 2H6CA 5FP7A 1DQ6A 3KGLA 1IQAA 1W99A 5FZMA 2CTVA 1W0PA 4CDXA 1GU3A 1CAUB 1N1SA 1WCUA 1NQJA 3TWIA 1LOCA 4UF0A 3AXDA 1HQWA 3U75A 1WA4A 5F39A 2I2SA 3MLJA 4P9XA 1JXNA 3VN4A 1TNRA 3THDA 2PHFA 3SXWA 3NAPA 5KHJA 3ZPYA 3WUCA 2OKXA 1LOGA 3ZFEA 2OA2A 1S0JA 1JMUB 4LA2A 4E4HA 2E7TA 3I49A 1NA1A 2W68A 2ZOEB 4EQVA 2LS6A 3W59A 4AAXA 1Q8PA 2YZ4A 4ORFA 1UIJA 4RHV1 1OLRA 3CJIB 5C3QA 3GHMA 1J59A 1RUC2 1PO13 3FX3A 3HMYA 3HVDA 2GN7A 4PLOA 3LE0A 2VMHA 2A1XA 3NV3A 1VBB2 5FYZA 3DXUA 1T6GC 3THTA 2B39A 2CDPA 2JICA 3F2ZA 3FBYA 4LBNA 5FUIA 3PUAA 5FIXA 2DUQA 4CDWC 1ZBE3 4CEWC 2VC9A 3C7GA 1XQNA 3I59B 4Q4V3 2RM21 2W46A 2O8QA 1W8HA 5EP9A 3ZN4A 3CLPA 5F32A 5JIAA 4YZ3A 3ACLA 3J7HA 2ZGNA 5GLZA 1J84A 2VMEA 1WZXA 3ZN6A 2R16A 4FOYA 1LECA 1OMIA 2Q5TA 2YU2A 1R082 1T6BX 3N9LA 1RVF1 5FQ0B 4Q1RA 1POQA 2IC1A 1SZBA 2GDFA 2VNGA 1BBT2 1FOD2 3ROUA 2FDKA 4LHKA 2VE1A 1OPMA 1EAH3 1VE0A 4CA9A 3WNNA 1WKYA 1ODNA 1D4M1 1AZDA 1DQ0A 3IBMA 4PDWB 3RFRA 3T0DA 4CEYC 1MS4A 4K6BA 2R49A 4CVUA 4EZ4A 3CIHA 4OHXA 1AR71 2VAUA 1YFXA 1DZQA 1V6NA 2CY6A 2PA7A 2V73A 3CJXA 4AQTA 1FYUA 1F31A 1O4ZA 3UJQA 3ZM8A 4ZU5A 3Q8AA 4AGGA 4YPJA 5I0DA 4L99A 2XKPA 2VW0A 1QJEA 1PGW1 5J98B 3ZFGB 1JYIA 2D43A 2XOMA 4V1PA 4HT1T 5IK8A 1CAVB 1NCRA 4KU8A 5FUPA 2I45A 3KVAA 4N8MA 2PQSA 5CU1A 5FKCA 3SQOA 4BLJA 3K51A 2C24A 3OBRA 2VULA 3KF3A 4GD4A 3ZR6A 4DY5A 2W1WA 4LIVA 5LWBA 3U0ZA 1WD4A 4ISRA 3NJXA 3RS6A 1K45A 4EE2A 1LEMA 1F15A 2JDNA 3KCYA 4XEZA 4YGDA 3WDUA 3WSOA 1O3RA 3BODA 5FY4A 2K2SA 4Z2WA 4R8HA 5I0TA 2XJTA 5T3NA 2ZACA 5F3CA 2WLPA 1O8SA 3ME2A 3H0OA 4DEVA 5H9PA 4KWUA 2VW2A 4LO5B 1PGSA 1QIQA 3HJRA 5FZ4A 1W0OA 1HV0A 5JZGA 1B35C 4QM8A 1NT0A 1VBC3 4I02A 3WY6A 4WBBA 1GR3A 3N7LA 5DZFA 4AEJA 2VXRA 4G4FA 4YM1A 4DNYA 1WMFA 2W1SA 4META 3V0BA 4N53C 2Z5WA 2Y6JA 2DBIA 3PNAA 2VXJA 3IAPA 2G1MA 4UFLA 2C5DA 3USSA 2VJXA 2H0VA 4UW3A 5ISLA 2W08A 3QLQA 1S0GA 4QKDA 4E9KA 5EFUA 2QQPA 2NP0A 2ZX4A 4GH4A 1UU6A 3JZVA 5KHIA 3IN9A 3GNEA 5F3IA 5LATA 3ZXDA 1Q5OA 5T54A 5ABJC 4XUOA 2GC1A 3N9OA 3VGIA 2XBO2 2HWF1 4FOQA 1RUF1 2P6CA 2R062 4KWLA 3E6DA 1JZ4A 5C8CB 3PDQA 4ZKTB 1FMD3 5A80A 3JQXA 2EIGA 5F2SA 1ZBA1 2VCAA 2HWE3 4A7ZA 3VBSC 2ZS6B 3INAA 3R0RA 4UBGA 2KR2A 3B93A 1KS4A 5C4WC 5BY5A 3MIHA 5LK7B 4ZU4A 2VVEA 4QGLA 1RGSA 1W8TA 5FZ6A 1CX4A 2VZRA 5F8PA 1PNGA 1WUVA 2WAAA 3B9CA 2XB6C 1YC61 4GMP1 2DDUA 4YW4A 5FY8A 1I6XA 5APAA 4LLOA 3PUSA 3D5OA 2IXKA 1MS5A 3H8UA 2UYAA 2VR4A 3L2YA 3BOPA 1CWPA 1UKRA 4GKYA 3I2KA 5J3UA 3OTFA 2O8OA 2HWB1 1V6IA 2QUOA 2EALA 1OKQA 2WYSA 4MYEA 5FZDA 2ZHLA 2WS93 4LK7A 1FPN3 1UOFA 3ZN5A 5FRAA 4D6SA 5D21A 5J96B 5DUWA 1ZNPA 4FFIA 1K5MC 3DV8A 2IWGB 3NNJA 4B29A 3AYDA 3R4DB 3ZYJB 4ATEA 1R1A2 3J8F2 1ND2B 1POV0 1XB9A 1TZOA 2QZ2A 3LDRA 4QQ2A 4DXRA 4LBJA 4RD7A 1JI6A 1W04A 4CDWA 4IESA 1W0NA 4QQHA 2Z42A 4E4SA 1O4TA 4GALA 3LA2A 2IXCA 2E33A 3GCXA 1XRUA 5FPAA 1V6MA 2VZ1A 4YVSC 3AZZA 4SLIA 4BE3A 4QPYA 3ORJA 1ZZCA 3SMHA 3WG2A 1LTEA 3W58A 1HB4A 3HBZA 1JHNA 2ID4A 2VCBA 5GZGA 4Q4Y2 5IT6A 2WNVC 2RDRA 4E4ZA 4Y5Z0 1OOPC 1PVXA 5JXHA 5A7WA 2R7EB 1DCSA 4XMAA 2JDHA 1FX5A 4MO3M 3WDTA 4Q1PA 3M1HA 1I5PA 4JAAA 2LM3A 4ZPIA 2NN8A 1PO11 1WBFA 2GSYA 2QVSB 4GJYA 4AXOA 2CAVA 5J37A 4RQPB 3IT8A 4QX0A 1VBB3 1OXCA 2GN3A 3U10A 1JYTA 1W9YA 5A3LA 4FAHA 2DCYA 1QGLA 5D8AB 2FQPA 1ZBE1 2JG9B 4ES8A 3NV4A 2QQLA 1XNCA 4IGQA 2ZZJA 2RR11 2PQQA 3MIFA 5EJ1B 2GC0A 4ZY9A 3U11A 1YRZA 5IVYA 1AL0G 1R083 4FQ4A 3O1VA 3IM0A 1KJLA 1AXYA 1CN1A 1GKBA 1A8MA 2EF6A 2BRTA 1BBT3 2VCMA 5AVAA 3RWNA 3VKNA 1JYNA 1OLQA 1KFXL 1EAH1 3WW2A 1RTVA 5EIYB 4JZRA 4V2WA 3LEMA 4XF3A 5CFCC 5JDBA 2I07B 2OUHA 4QQLA 1LENA 1UY4A 2VQ0A 4NHXA 4XFGA 4ZU7A 4K3UA 2FCTA 1ACCA 1SFYA 2OX0A 4R9DA 2KD7A 3K2OA 3E5QA 2WWUA 3LGRA 4FTSA 4IV3C 5KC6A 3SEEA 1W9FA 4CPBD 2ZPXA 5CA6A 4B4QA 1WMDA 1JOBA 2OPKA 5GM0A 4CP0A 1V70A 4LKEA 3BI3A 1REFA 1KGYA 3NQHA 3NV2A 4ASKA 1LOBA 1V9U3 5FLHA 4XOGA 3WG3A 4N90A 5KXEA 4UF0B 2W1UA 5ACA1 1W2AX 5L36A 1BVP1 4FOWA 5FZ7A 3GJAA 3CF6E 4N53A 5DUXA 4I3GA 4X6QB 1EUUA 1N47A 4H2AA 5FPBA 3S6PA 1YYNA 5A32A 3M3OA 3LWCA 4R4ZA 3O1TA 1OVSA 2NMOA 2WWSA 3LSEA 4LHSA 4RS5C 4X6RB 3USUA 5GZDA 2R32A 1NA1B 3O14A 4QPGB 2DURA 3ZYBA 4D3WA 5ABJA 5JVVA 3U4XA 4MSVA 4XJ8A 3WNOA 3I2GA 1NY71 1ZA4A 1PMJX 1YNAA 5T50A 4C90A 2QTWB 3HNBM 4CPBA 3QCWA 1ZZ7A 5L19A 2VY0A 4N9HA 2OXBA 1QWRA 1DGRA 3KQ4B 1H4GA 1QJFA 4DXZA 3H42B 4NJ4A 4LJHA 2R1BA 3VBSA 2J1AA 4A6SA 2PAMA 5IHRA 1ST8A 5C4WA 2WFF1 1ULPA 1OH4A 1V6KA 4WZFA 2BWAA 2IXIA 1AR63 2HKXA 3N7JA 2YFZA 1GUIA 1W8ZA 3AM2A 5BNNB 1XYOA 5F6LB 5FMCA 4JHZA 1UZ0A 3ACFA 4NRQA 2Y38A 4K40A 3K4ZA 2OPWA 2Q8DA 2ZMNA 3ZN6B 4NAMA 3BTXA 1GOHA 2R0FA 2XBO3 5FJHA 3D8CA 3LCPA 5LRRA 3KLSA 2X5IB 4D94A 3AZYA 1LHWA 4QAWA 1YWKA 1LHUA 4DIQA 5FZ3A 3IMMA 1JOJA 4Q4X1 4XJUA 5FBJA 4XPVA 1VJ2A 4CU9A 3ZYHA 3U37A 1ZYBA 2ZEYA 3AP5A 4O9EA 1CZVA 2X53S 4RA0A 2HWE1 2D93A 3VBUC 4EN9B 2NM1A 5K8SA 4WM8C 3T2OA 1KITA 2P1BA 2AACA 3FHQA 2Y0IA 4PLMA 4CDUC 5JCTA 2AENA 4BLIA 4XF1A 2UURA 4NN0A 1YIPA 1PM4A 4XFAA 2P3YA 3Q8BA 5AC92 4MUVA 3SC7X 1O3TA 1RUI2 1PM7A 2JENA 3I97A 3OUHA 2WO3A 3D0JA 3VHOA 3OPTA 3I7DA 3I2FA 5C3RA 2NYYA 4YVSA 1YQ2A 1OURA 3ILRA 5FP3A 1RITA 2JJ6A 2HWC3 1DYPA 1QJU1 1U5YA 1LOFA 4XFFA 1SQ4A 4BQYA 5HXMA 4LOSA 1JZ5A 1JYVA 4QDRA 1HRV2 3AMHA 4DB5A 1UCXA 3BTYA 4D8MA 1OOPA 1VMFA 2WS91 1OD5A 3SH5A 4HSJA 1FPN1 2B9UA 4M3CA 3V65A 4A41A 4HL0A 4W50A 1O3SA 1OA3A 3WNPA 5FDBA 4WVWA 1R1A3 4XF9A 3SITA 3J8F3 4XXAA 4LKSA 3A22A 1C8M2 4TTGA 2OW4A 1UZWA 2JG8A 4WM7C 5JZGB 2XLFA 5FY0A 1QDOA 2JECA 5A7PA 1WLTA 3ASIA 1L7LA 4XCAA 1UW8A 2YG0A 3JD72 4S2GA 4UW6A 4XTPA 3V0BB 4XJAA 3RRDA 2WAOA 3ELNA 4NPRA 4QHZA 4PF1A 4RGAA 5F3EA 3R4SA 4XDPA 2BVBA 3VZOA 4IEVA 4OI4A 1ZA7A 5DZGA 3I2HA 4R52A 2OUJA 3WOGA 1UD1A 4LR4A 1W6OB 1W6QA 2PHUA 4ZXEA 2BPA2 1WMEA 3NJYA 2JDKA 5BV6A 1RUC1 1RUE2 1RHI2 1DGRN 1VAMA 3DYOA 1VBB1 5JWPA 1VRH2 1TNFA 4C0HA 2WO2A 3OBZA 5A3WA 2X09A 5LK5A 1BXHA 4EROA 2YBPA 3SH4A 3QH7A 1KRIA 2QKDA 1QQP2 1W3VA 4QHBA 5A70A 4DPNA 5A3MA 4M0NA 1HJGA 4IXLA 5A3UA 1GP5A 2PXJA 5DDJ2 4Z1VA 3J4UH 4YZ1A 2OVUA 2BBAA 3VDBA 4MGTA 3QOPA 5FZ8A 1VB4A 1HKDA 1R081 2BU9A 3HD8B 4FPOB 5BNPC 3N4MA 2VH9A 2J7MA 1BBT1 1FOD1 3D82A 1S2KA 1UOGA 1XE7A 5JI9A 1XBFA 1OPOA 3SCHA 5CFDA 2A7AA 2VUAA 2EVXA 1APNA 2PN5A 4IV1C 1XSRA 4A42A 3IKWA 4QB2A 5A1AA 1W06A 1CIWA 2HH9A 3FN9A 4QKFA 3A0NA 4NIGA 3NVCA 3KGZA 1ND3C 4O7XA 1VBE2 4XBNA 3ZX7A 2OQ6A 3OBTA 2FMYA 3BGAA 1EPZA 2YC4A 3EHKA 3GHNA 1E5HA 4URAA 2UWAA 3K3OA 4XAEA 1MVEA 3JXSA 4G9SB 1QKQA 2FCUA 3UYJA 3W5NA 5K0UB 2A71A 3KB5A 2VW1A 5KXBA 3OPWA 4BH9A 1DQ5A 4IEZA 1K3IA 4JDMA 4ASLA 4FQZA 1PNFA 3BVCA 2RM23 3T08A 1KXGA 5J36A 2V5DA 3MYXA 4GKXA 2W2IA 3RJRA 1XYPA 4AVAA 4CUAA 1TMF2 5FR3A 5DUVA 3AC0A 4OCTA 3JUUA 4BQ4A 2ET1A 2BW8A 4NVPA 5C3SA 2JKXA 5A1FA 1XPWA 4WVMA 2GP5A 3ZKUA 4CRQA 4XJZA 2C26A 4QT6A 1N3QA 2QCSB 1TME2 2IZWA 4RYDA 5DN2A 4FXGB 4CU8A 1QJZA 1GNZA 1XNTA 5T5JA 3RZJA 4CXYA 4XFBA 1WCQA 4NRMA 4WM8A 4Q29A 2BDRA 4XBQA 1AR73 1GBGA 4ZHNA 3D3AA 4OMDA 1CJPA 1HLCA 3AFGA 3PTYA 5FY5A 4C91A 1SBFA 5IVFA 2WQ8A 1IPKA 4KWJA 2ZEXA 3O1UA 1BYHA 1Y7BA 2XBO1 3OGRA 1QU0A 1J83A 2R061 4L97A 4QX2A 4RSUA 5TSWA 1C5HA 2FHRA 4XDOA 1RJ8A 4MHUA 1YFUA 3LDBA 1OF3A 3K75B 2YU1A 4XQWA 5DG1A 4BHPA 4ES9A 1ZREA 4M00A 5K9YA 3BU0A 4LBQA 2W95A 3MFAA 1AXKA 1R092 4JGYC 4SBVA 1YJKA 5FZHA 2O14A 1LCLA 3RYRA 2Y64A 2YPJA 2Y8KA 2VZ3A 4I0AA 3HN3A 1PK6C 1G9AA 3ZYFA 1BMV2 4F3JA 4EV0A 1YCIA 3WNLA 2XJVA 1PHMA 4Y24A 1YFYA 3H50A 1FNZA 3ZSMA 4BIOA 4EN0A 5AC93 5DMYA 3DGTA 4GWNA 5I0RA 3RYKA 1LGNA 4Z2AA 2DYCA 3C8XA 1RUI3 2UWCA 3QACA 4GA9A 1LHVA 1DP0A 1IPSA 3ZO0B 2HBTA 3KCCA 1F4AA 5FO7B 4EN7B 4MH0E 2EXHA 2NZ9A 1OQ1A 2V09A 3AJZA 5A32B 4IE7A 3ZYIB 1AVBA 5FMOS 1VPHA 1HRV3 4QB6A 2HBUA 3BKZA 4OUMA 1O7FA 2XL9A 3USUB 4KQ7A 3FZ3A 4UI9L 4LHNA 2QBXA 3ZKYA 1X82A 2BV4A 3H3UA 1PZ9A 4MGKE 4OZOA 3VKLA 3TBDA 2XLGA 3O5SA 2J1VA 1REDA 3VHPA 4CCOA 1QXJA 1MQTB 1R1A1 3AZWA 5LA2A 3VBFA 3J8F1 5B4NA 1C8M3 1O5UA 2Z2SB 3KMHA 4QX3A 5C6CA 2GNDA 1NAEA 2ZGMA 3EB7A 3BOWA 5GZEA 4E2QA 5JR2A 2DCTA 1BZWA 5C8WA 5J7MA 3JD73 1ZBA3 4Q4W2 5J1XA 5BXXA 4AFAA 4JGZC 3D6EA 2J1RA 2DU0A 2JWPA 4MXWA 4Q4Y1 4RFRB 4GWJA 4A3XA 4C8DA 1CR7A 2DVGA 3MBWA 2WNUA 2BOIA 3TYJA 4CDQB 3O1OA 5LRSA 1MS8A 4HVQA 2BNNA 5BNPA 5DG2A 1ZVFA 4QU1A 2XVLA 5E88A 4UBHA 3N3HA 4UFJA 3UGGA 4S2FA 1J58A 3TEWA 5GLTA 4XVHA 3HEIA 3AKSA 1RUE3 5A7NA 3OUJA 5LBBA 2EXKA 2RVAA 2D5HA 1O3QA 1VRH3 1Q3EA 4CCCA 1Y43B 1J3RA 4YGCA 4P9JA 4TXWA 2K9ZA 4D0QA 4BQ1A 4BXSV 2CSGA 4COUA 1H9WA 4ARYA 1QQP3 4GB32 1LHNA 1UMIA 3I4IA 5FBZA 2HLEA 1VIWB 5BNOC 5FZOA 5DDJ3 1U5XA 3LEKA 3ZVXA 2PAEA 1NQDA 3FL7A 2VU9A 4HK8A 5A7QA 3VL8A 3S0MA 1L3JA 3AFKA 3LQCA 3URFA 4Z92B 1L7QA 1RL3A 3ABZA 1H9PA 3WEZA 4G3YC 4BDVB 3PVEA 1NKGA 4M4PA 1AXZA 3GBWA 3KSCA 2R042 3G6JB 1HB2A 4XF0A 5JSPA 1LAJA 2CDOA 1NYWA 1GOFA 2ERFA 3WCRA 1KJRA 2W39A 1UIKA 2QFEA 3T2QA 1SBDA 1SDWA 2BNOA 4JQTA 1DG6A 4BOWA 2IFRA 3AKPA 4N43C 3T30A 1JZ3A 2ATFA 3FHIB 2WZEA 3I3MA 4GZ9A 4C0BA 1F5JA 1Q8SA 3FHAA 4AYUA 5JXGA 4W6WA 5CKMA 3VLBB 5FPVA 2FDGA 5HCBA 1X33A 2AEYA 5EXOA 2ADEA 4AQSA 1K12A 4RL7A 1O5LA 4BMEA 2W92A 1QJX2 5LEKA 5G05L 3FFQA 3KT1A 1O91A 4ISQA 1CAWA 2XJQA 2JG8B 1HJFA 3VL9A 5CKQA 4OHWA 4B1MA 2VCCA 2D5FA 3OUIA 1GYKA 1S4CA 3A23A 4OUEA 2DCKA 3ZXFA 4IW3A 2LUWA 4O61A 2VUJA 1KD7A 2TNFA 3AVSA 4XETA 4GWIA 1STMA 4XMIA 2RR13 4YM3A 2UYBA 2XWJB 3A4UA 3AK0A 3O0WA 2XJSA 4PQ9A 3HOBA 2QQKA 3KVBA 2D44A 4QMAA 1NCRC 1QOOA 4CCMA 1GSLA 1OQDA 2LRPA 5FXVA 5DAPA 1W6QB 4PLNA 4ONUA 5FAXA 3V64A 4KI5M 3POJA 5CKNA 4YVWC 5T5OA 5FO8B 3SCGA 1W9SA 1TME3 2Q1FA 2X05A 4MADA 4A7KA 4PCRA 2D3RA 3N7MA 4OFGA 1HXS2 1NLRA 2FBEA 1SLTA 2XLAA 3DKQA 2CHHA 3AKTA 1ZZ8A 2PHLA 1O4YA 4XQDA 1G8WA 3NNFA 1MACA 3LEGA 1AYM2 3MZHA 3TEYA 4HANA 4J1XA 2VMDA 4YRDA 3EO6A 1S2BA 4OQ9A 2Y34A 3VBRB 4AF9A 3VBOC 3S7EA 3ZFFC 2VUCA 4LKDA 3UGFA 3JCIA 3E1F1 5SV8A 1A3KA 3S30A 1W6PA 4JKKA 1E5RA 4XUQA 1NCQC 5ACA3 5CFDB 1J3PA 1LULA 2DBNA 1SCSA 4QPIA 1R093 2RS52 1DZTA 3UK9A 1G86A 4H7LA 1KFUL 1OF4A 4HLTA 4AFCA 4MZUA 4XYXA 2D98A 2A6YA 5A1LA 5FPUA 5IAXA 3UNPA 1WLDA 4LLFA 4HFSA 1TQ5A 2QZ3A 1Y9QA 1DDLA 4FAGA 1G7YA 1WGPA 4PI2A 4K9SA 1DQ2A 1H8VA 1RUH2 1I1EA 4HPKA 5FYMA 1MEC2 3MPBA 3FLTA 4ZZ5A 3FUQA 3MF6A 3KCXA 1UQXA 3K4AA 4CU6A 4AEDB 1D2SA 4FPJA 5DAWA 5AC91 2L9LA 2OS2A 1RUI1 3KF5A 4A3ZA 1IZ3A 2P5BA 2ZKLA 3OD4A 2GALA 3SCFA 2D6KA 3B5LB 5FKBA 5FOJB 1NOVA 4JV4A 2WC2A 5GLWA 3B02A 1I3HA 1W3XA 2EIBA 3MUZ1 4JGZA 3M70A 3Q8CA 5J09A 5L7OA 2ET7A 2VOTA 2WFF3 2EA7A 2F4PA 1NE6A 1HRV1 1LESA 1LGBA 1O6UA 1Q8QA 1VRBA 2GNMA 4DINB 4FFHA 3UGHA 2DVBA 3M2MA 5IATA 1IGOA 3PVNA 3JQWA 4P9YA 4BISA 5C9AC 1ZRDA 1EV11 2IFWA 5HI0A 1CQ9A 1Q56A 4NHMA 4LA3A 3B3QE 3DYMA 2ZEWA 2X8KA 1JZ7A 1C8M1 1ENQA 1YEWA 1S0BA 3EYPA 4WVMB 2F4LA 2PHRA 4BXFA 4FSJA 5FY7A 4Q4X3 5FLJA 4YSFA 2GMMA 4LO4B 2J1EA 3JD71 4Q4W3 3BIEA 2WLQA 2D6NA 1OFSA 1REEA 5JMOA 1UO9A 5DAQA 1XU1A 3SISA 4AR2A 4RR3C 5HCFA 2W1QA 4XFIA 3O7OA 1SFNA 4IDZA 1VMJA 4A44A 2VZOA 4NRPA 1D0GA 2VOXA 1LB2A 1JU3A 1T2XA 2CWSA 4INDA 3ZIWA 1QDCA 1RUE1 2LROA 1RHI1 3AMQA 1VRH1 4HMZA 1K5JA 2J1TA 4IEYA 5FYCA 2DFCA 4LBQB 4OVEA 1LODA 3M7AA 5IFPA 1QJU3 1QQP1 2VL4A 5FYBA 4GB33 2YPDA 1H8TB 2WBKA 4DY3A 4UYBA 1UXZA 3UT0A 5DDJ1 5ANQA 4AL9A 3LB9A 3DXTA 2A6ZA 2JDZA 2X10A 2AR6A 2ZMKA 3D4KA 4Y4RA 3VDDC 1CGPA 1COV1 4KG0A 4MLOA 4E27A 3WUDA 1XC6A 3ZYPA 4GMP0 3V0AA 4Q0QA 4W6XA 5IAVA 1ULGA 1CZSA 2C6SA 3F95A 1AR82 3UV9A 2R043 2LW8A 4CCEA 2XL7A 4D7SA 4L92A 1SDDB 1W39A 3VBHC 2C1FA 4CEWA 4GJZA 3ZSEA 1OA4A 1ODMA 4IL7A 2PELA 4NIDA 3RJ2X 4AGVA 4GWMA 1YXWA 1VAKA 3H1YA 4I09A 4LPLA 1C3HA 5LBFA 3SEPA 2RJ2A 2ZHMA 4AZZA 4PHZA 1VBE1 4C1WA 1PX4A 3DKWA 1ULOA 4I01A 2DCJA 3C7HA 2ES3A 2B5HA 4Q0VA 4NUBA 1Z7S2 1YQ6A 4YVWA 1N3OA 1QJX3 2VGDA 3DPRB 1RUC3 1W8FA 4H55A 1UF2C 1GWLA 1CONA 1H1MA 1RC6A 1F4HA 4KH9A 4O9GA 5DAVA 2XHNA 3PUQA 1GICA 4AHXA 3W5MA 3B00A 4CEYA 4D69A 2DUPA 2TBVA 1JHJA 1SEFA 1ENRA 2HEYF 2XQRA 5C3PA 3MFCA 1RUOA 5LEJA 4L2NA 2W5FA 2VPVA 3VHRA 3JBG2 2JKBA 4LUKA 2W87A 4XILA 4OQ8A 4MXWB 1ENXA 2ARBA 1RUJ2 2VQUA 1TMF1 2WNUB 4YG0A 4P08A 3B69A 2CL2A 4B4PA 4LE4A 4I0WB 1CJDA 4QXHA 5FP9A 2PAKA 4MOAA 3CJIC 3A21A 3GM8A 1FOD3 2BGOA 3RYPA 2OQ7A 1TME1 1QEXA 2QQOA 4JX0A 2XONA 3MIDA 2ZGKA 3KHBA 3RMYA 1HXS3 4E4DX 5LA1A 1RYYA 2NQYA 1HX6A 2P6HA 3OGJA 3WQ7A 5AFEA 2Y0OA 1W8UA 1VAVA 4ITCA 4B7KA 3W9AA 2JB4A 3KV4A 1AYM3 3NNMA 4Y1YA 5LBCA 5FZOB 3L9JT 3KV6A 3RI8A 3ITQA 4CP9B 2AYHA 4Y22A 5CG8A 2QQVA 5FZFA 3CKHA 3RSJA 3POBA 1H2MA 4M3CE 2AZ5A 4A4AA 1FATA 4OHYA 1C57A 3WW1A 5L73A 1B35A 2XVKA 2UU8A 1MR5A 4TN7A 3FWEA 3P5BA 5T55A 4XIKA 3WLUA 1QOTA 2JD9A 1VMHA 4GIQA 2RS32 4CDXB 5IYYA 4PI0A 2HYKA 3RZKA 4D6RA 4FI9A 3WDVA 1UZYA 1R091 2RS53 4IE0A 3DUIA 1OH3A 4MXVA 4IERA 4PDWC 4R9BA 1RUNA 2FD8A 4COYA 3NAPB 4UFHA 3WQ1A 4FPEA 4AI0A 3IWZA 4QX8A 3ZFEB 3S57A 1F8VA 2UWBA 1RUH3 4IETA 1BMV1 5C9AA 1MEC3 2AUYA 4AQ2A 1CPNA 1DIWA 3LFIA 3GALA 3HN1A 3K46A 1LEDA 3ZFGC 5F6KA 1XYNA 2P2KA 1GQPA 3UETA 4YG3A 5EJZB 3AP9A 1NX9A 1CAWB 2ZA9A 2W47A 2WNEA 4GULA 4I30A 4DRRA 4DOUA 1YQ8A 5LW9A 2Y60A 1JUIA 1NXMA 4QPWA 1OKOA 2VTXA 3SHRA 1E5SA 2ZJCA 3IB3A 1XJAA 2WABA 3FLPA 4QM9A 2Q30A 4XQ4A 3AJYA 3TN92 4RR3A 4P5HA 2XGXA 3OJBA 3ES1A 5FZBA 3T3YA 4CTEA 3X29B 1CD3G 1H4HA 4AWDA 3KWVA 2MNGA 2JEMA 2OT7A 4JKMA 3ETQA 3GZUC 3KM5A 4QXCA 5F3GA 1YHFA 4BWOA 3SKVA 2R063 3SKJE 3PVOA 1DQ4A 3OSDA 5I93A 1TG7A 4JC1A 3WZ1A 1Q8VA 2H6BA 4Q4W1 3RDIA 3H8XA 1SMVA 4JTOA 3HBKA 4J6GA 3P3PA 2MEV2 1N3PA 4B1LA 4UAPA 2ORXA 2P3KA 1YQ5A 4AVTA 2PLV2 4EWEA 2PHXA 2EXJA 2B8MA 1K5MA 1DBNA 2VOKA 4FXKB 1MVQA 4XC9A 5FZIA 2ZAAA 4D7YA 3ST7A 1AUYA 2E31A 4L11A 3KV9A 4YZ5A 2VECA 5K4LA 2QJVA 4P9IA 5FLIA 3AKQA 3T0AA 1JH5A 1PO22 1W6PB 4YW3A 5C8CC 2ZBJA 3CEWA 4MV2A 5JOZA 3I2OA 2WINB 5FZLA 5BPXA 2QQJA 4CU7A 1LNSA 3OD0A 4QPIB 3PJYA 1UL9A 4IE4A 3NRUA 4JHTA 1JW6A 4Z07A 1ULEA 4GB31 4F8AA 4KU7A 3VKFC 2ZGQA 3WNKA 2WNVA 1US3A 2K0GA 4Y1ZA 3WQ0A 1ZRIA 3HWJA 4Y20A 2V4AA 3ZXAC 2XR4A 3LIHA 4YGEA 2D6LX 2B9VA 4HPKB 3LFMA 1QNWA 2YXSA 4CP2A 2AREA 1EV12 4YFZA 1FV2A 4U36A 1XNAA 4YGBA 3RQ0A 1VLNA 2ZX0A 1Q8OA 1D4VB 2R041 4QHOA 4FPCA 2XQXA 1S55A 5FV3A 3WDYA 2WFPA 3DEMA 5CZKA 1HRI2 2BJSA 5L7OB 2C4XA 3RZHA 5DUUA 3EXUA 2D3PA 4HN0A 2BYVE 4Q4Y3 4XCBA 1CVNA 2BGPA 2XVGA 2ZGRA 2IXJA 5C7GA 5B2GB 4TYSA 5BUVA 4GH4B 1N1VA 4AE2A 1JZ8A 1RUD2 4H7MA 1Z7S3 1JN2P 2B45X 2YY1A 1QJX1 3GYDA 3C7EA 1HN0A 4AI8A 1OHFA 5AFBA 1ND2C 2A5ZA 2B7YA 2ENRA 2VM9A 3NSTA 5FK7A 4O65A 5CFCA 1W6MA 1JZ2A 2EAKA 1OVPA 4CUBA 4Y33A 4DUWA 3I59A 2YBKA 2AEZA 3BN6A 1WLCA 5FREA 3HPNA 1FI2A 4IV3A 4XURA 4XW3A 5FMBA 2WYFA 4UW4A 1S0DA 4R9CA 3WP5A 2YC2A 3TNQA 2VMIA 3ZXGA 4CYDA 4OZXA 1HDKA 2D6PA 2O1QA 1IOAA 1JYXA 4GQ7A 3TAYA 1OT5A 2TUNA 1OLME 1MZ5A 1OFNA 3PL0A 5KR7A 1COV2 5FQ0A 3E6CC 1RXGA 1LR5A 2WJSA 1WMXA 4EWDA 4AI1A 3H3ZA 3I2DA 2NMNA 4OULA 4RQPC 4LO8A 3N9PA 5FYIA 1HXS1 3CZUA 2A6WA 1W9WA 2EXIA 5IJRA 5BNQA 3OG2A 5D8AC 3ZIXA 2JX9A 3AL6A 1Y9GA 2JB8A 3NNGA 2JG9C 4RS5A 5C5TA 3CO2A 1AYM1 2G9FA 1S0FA 2RMU2 3C2UA 2ZGLA 5HCAA 5FYSA 3AX4A 1RMU2 2C0ZA 1MS3A 4NMIA 3ZXLA 2A3WA 4FBFA 2XJRA 5JOYA 1UPSA 1XXNA 2D97A 1Y9MA 1H2KA 5CIRA 2E32A 2DUOA 2LTNA 4J25A 3MW3A 3RVHA 3O1RA 1QJY2 3K3NA 3V0AB 4DFSA 1MS0A 3VD4A 2ETEA 2RS33 5IVEA 3PUHA 2D40A 4YNIA 1UMHA 5L9RA 4CDWB 2RS51 3VD9A 4CEWB 3UESA 3TEZA 2BFUL 2BOJA 3M3QA 1F2NA 2ZGPA 5FYYA 5HXVA 5E16A 4A7YA 4K20A 3N7KA 3RG0A 4CCNA 4DZGA 1XNKA 3U1XA 4E2GA 3VD7A 1UX6A 3VHNA 4AI9A 1RUH1 2BNMA 5I0UA 3RZGA 2ILMA 4I2OA 1MEC1 2YGMA 4D6QA 2PHTA 3ZOIA 5A7WB 5C3OA 5IVCA 5T52A 2Y26A 1UU5A 3N9MA 2HEVF 2BZDA 4IGOA 3WF2A 5A6ZA 1AL22 1I5ZA 3LSDA 1YJLA 4PIYA 4TWTA 3PU8A 5FK8A 2ARAA 2V4VA 5IVJA 2VZTA 3VBUA 4CEYB 1DLLA 4GAZA 2XJPA 1GWKA 3TN93 2C9KA 3WT3A 3BALA 2DV9A 1YFWA 1C28A 2Y33A 2GMEA 5A7OA 3U4SA 4CDUA 3MF9A 2VTXJ 1W6NA 4HK9A 4UOJA 3FUOA 3H1MA 4KNCA 4OI0A 4QXKA 1NA1C 1WW6A 2JD4A 1VBA2 4QPGC 1GLHA 2XMLA 5GZCA 4QX7A 3AVRA 1DLCA 3S5AA 1IG3A 1S2EA 4XFCA 5DXDA 5F5QA 3KZ4C 3PVBB 1X9TA 1K42A 4QQPA 1XNBA 4X8NA 2JIGA 2QNKA 2PTMA 2XKOA 3VZKA 1FT9A 3WF0A 2FDHA 1LKNA 4LO7A 3QD6A 3H7JA 3VZLA 1GZ9A 1DYKA 2ZMLA 5FZGA 1FAYA 2ZGTA 5M0TA 3IIIA 4ZONA 2MEV3 4W8JA 4Y1VA 4AVSA 2EAAA 2NPIA 2PLV3 2R072 4H14A 4UWDA 1OLMA 2RJLA 3HNMA 4KGGA 4YM0A 5BNNC 3H1WA 4DS0A 4Y22B 4Q8KA 5IVVA 3RPQA 4FPKA 2Y6GA 3EBRA 4NIAA 1NG0A 3AP7A 1DGWX 4WM7A 1B35B 1V6LA 3O12A 3U78A 4RGKA 2A75A 1RUG2 3KD4A 2X5IC 4YW2A 2VZVA 2Y6HA 3BB6A 3DCQA 4J1WA 1WLWA 1DU3D 4DQAA 2FZ2A 3MIEA 4LKFA 4N53B 4AFBA 2XHKA 3AYAA 3MI8A 5CYYA 3WP6A 1JU4A 1VB2A 2DVAA 4NAOA 2WT0A 3VD3A 3WHUA 1X50A 2WL1A 1B09A 2KM2A 2JDYA 3E6BA 1HW5A 1DFQA 1PVC2 5FYHA 4QXBA 4EZHA 1EV13 1CAXA 5ABJB 3N9NA 2DTYA 3MICA 2GNTA 4K21A 3IDAA 1F9KA 1ND2A 2QQIA 3ZYRA 4BQXA 4DXTA 1W03A 4XXPA 1AR92 1AR81 1NE4A 1MZFA 1VBC2 2DVDA 1JYWA 3AYEA 4HG6B 2PHDA 5G04L 3WX5A 3MIGA 4B3NA 3GXUA 4D7TA 4LXLA 3GDBA 2N7GA 1UY2A 3I8TA 1ZX5A 3VBSB 1PZ8A 5I0SA 2PMWB 5I8SA 2WQZC 3K4DA 1PX3A 5C4WB 3NL1A 3ZDSA 5F2WA 1DYOA 3ZDVA 5KHKA 1C5IA 5A3OA 4FP2A 3CHXA 1MZ6A 2XDVA 5A33A 1W2OA 1RUD3 3AZVA 3I3QA 1Z7S1 3IMNA 3MW4A 4RQPA 3UKNA 1UZZA 5KHGA 2YBSA 1LHOA 3WD5A 1RHI3 4R9AA 4JDNA 3W20A 4HKWA 5JZGC 1FMD2 1LOAA 1LJ7A 4IV1A 1GNHA 4Q8LA 1PZ7A 4B4RA 5D8AA 4R4XA 5FP8A 3Q8EA 2ARCA 5HV0A 1IPJA 2YYOA 3J7NA 4JRAA 2XWBB 3POYA 3RI9A 1RB8G 5KC5A 1CX1A 2QDNA 5IW0A 4AQ6A 1ND3A 1W9TA 1BQPA 3JBG1 3LA7A 3R05A 4XHXA 1HN1A 1RUJ1 2X29A 3ZSLA 3AP6A 4LK6A 4UFIA 1K5MB 1QXPA 1DQ1A 3OYWA 1N1YA 1COV3 3ZXJA 3KV5A 1POV3 3OCPA 5J48A 4GXLA 1ASJ2 1SPPA 2ZEZA 1XSQA 3LZZA 2D6MA 4LITA 4P02B 4W65A 4FPGA 3TRSB 1E5IA 3U14A 2ZTNA 3BUCA 2KXLA 2SBAA 4LIUA 2ZGUA 1G9DA 4EJRA 3ACGA 3A7QA 3T2TA 4YVSB 4RN5A 1KQRA 1D0HA 3ZSKA 2O0OA 2RMU3 2PHWA 5FZKA 4BQ2A 4XJWA 2HEWF 2WNVB 1SLLA 1RMU3 1AX1A 1OOPB 1VBE3 3PMSA 4Y20B 4M3CB 4IUGA 4XUNA 4YFWA 4B7EA 4YZ4A 3J7MA 3G7DA 4CP1A 4PQQA 1JUHA 2ZXQA 1QJY3 4BQ5A 1H2LA 4NOTA 4PJYA 3RNSA 1PIV2 3LAGA 1RINA 3T2PA 2WDBA 1J3QA 2RS31 3PMEA 4MGIE 4NHYA 3LOIA 1ULDA 1MS1A 4LNVA 4HVRA 2VD7A 4DRVA 1ONAA 2JDUA 3CZJA 4AEMA 5CISA 3POFA 4BZ4A 3TEXA 1UY3A 2PFWA 2YMZA 3T09A 1UX7A 3NNLA 1C1FA 4XTMA 3JB4C 2ARXA 5A6XA 2DF7A 1BK0A 1EP0A 4W6YA 3VB9A 4QPGA 5EV7A 1M06G 1TMF3 2XH6A 2RS12 4BYYA 2ZKNA 1WCKA 5EYXA 4C1XA 4DEQA 4XBLA 2OYZA 3O0XA 1YO8A 3GBFA 3IAQA 1PGL2 3LEIA 3OEAA 4TSVA 2A3YA 4WVVA 2WSVA 1HB1A 1ENSA 2F17A 2NLRA 1AL23 2QE3A 2Q0AA 3ZMNA 5H9SA 3VZMA 2ZGSA 3ACIA 1RXFA 1AJKA 2LALA 4JGYA 5CFCB 1W6MB 4YYOA 3EMRA 3M4FA 5JI7A 2VZSA 5K0UC 3V56A 1AX2A 1AHSA 2WT1A 3SLIA 2P34A 4BMBA 1F35A 3TN91 1GWMA 4IV3B 1PK6A 5LBEA 2G19A 4FTEA 5BNNA 3ZR5A 1RJ7A 3GZEA 1HQNA 2WA4A 1WCDJ 2QQUA 3ZYGA 2ZGOA 4U2AA 4Z8BA 1VBA3 2TEPA 4ET7A 4HONA 2WO1A 4OMCA 4PT6A 4XJ9A 5HBAA 3FC0A 1VBD2 2X5IA 4YW5A 4MHRA 5A6YA 1W90A 2RV9A 1OBNA 2B4KA 4KGQA 1UKGA 1VP6A 2ZHNA 2DWRA 1W2UA 5T5LA 5FXWA 2P17A 1SACA 4JQRA 1BK1A 2WIIB 4HVOA 3GGLA 4MX3A 5F37A 3WG4A 2MEV1 2AC1A 2QQNA 4RS5B 2BUKA 4XACA 4NROA 2R073 2A6XA 2AH2A 2D7FA 2PLV1 3VKOA 3LPFA 1Y3TA 4NPLA 3ETPA 2R0HA 1GFF2 2OZJA 3J9SA 2HJIA 3PU3A 3O1MA 5K7PA 1UZVA 3APBA 1W8WA 3QBQA 4IEWA 1V9U2 5GKAC 1RUG3 1J1TA 1PO21 3GBGA 5FUNA 1GANA 4HN1A 4YLZA 3SH3A 3VDCA 1JOPA 2BQPA 5CEHA 2E6VA 2GP3A 4IE5A 2GMPA 5FO9B 5IK7A 4FPHA 3PJQA 3JU9A 3FLRA 1UOBA 4BM8A 1AX0A 4Z82A 4V2VA 1Z0HA 3WVJA 3ZXEA 4LQRA 2GC3A 4KBZA 3WDXA 1PVC3 2G9GA 4ATFA 4MGQA 5JOXA 1AYN1 1NZCA 4QKBA 2G9ZA 3OB8A 3KS7A 1AR93 2P37A 3POWA 1PMHX 3K77A 4K1YA 2W3JA 4KMQA 4QWNA 1UYYA 4LE3A 3S5QA 4UXAA 3ZXKA 5CADA 5KBFA 3QH6A 2EIDA 2WZ8A 4AVCA 2E26A 3VBUB 3KQRA 1HRI1 2UY9A 3WW4A 3PTRB 5BNOA 2VMGA 3I2JA 4WM8B 3I3EA 3I3BA 1AR62 3DL3A 4JKLA 1GP6A 4CDUB 5FZ0A 2RJKA 3MIBA 4XUTA 4L9BA 5E6HA 1W6NB 3I2IA 1NLQA 1W6OA 1JBCA 4QQOA 5FPZA 1RUD1 4XF4A 5JXIA 2DU1A 1P8JA 2E51A 4E2SA 3I54A 1MQTC 5F9TA 1N1TA 4ZS3A 5FXXA 2YB7A 5EYYA 5JSRA 3UL2A 2JDAA 3H3LA 3WXPA 3WINE 2H0BA 5EZWA 4OHVA 4F7ZA 5BYNA 3AMMA 4MVTA 4N43A 2GZWA 4BQWA 4CXWA 2HWD2 4FO9A 4M4RA 5FYUA 1ZZ6A 4NWWA 2VNRA 3IDCB 4KL1A 4CDQC 3M3CA 1NUKA 4FPLA 2CYFA 1GV9A 2VMCA 3PLQA 2R1DA 4PBPA 4WV8A 5E8AA 5EPAA 1YI9A 4XUPA 1POV1 2HYXA 1ASJ3 2CAUA 2YFUA 5FWJA 3HIFA 1BCXA 4WM7B 4K8RB 3TB0A 1UYXA 4OLLA 1W2TA 3BCWA 1H2NA 3J26N 3DECA 4L8QA 1O59A 4XFHA 4YW1A 3VV1A 2W94A 2SLIA 1XOYA 4Y1XA 4MGSA 3B7MA 1PMIA 2HWC2 2W9XA 2VO5A 3E97A 5A7SA 3I3DA 5H9QA 2RMU1 1GZTA 4JCKA 5CB7A 2VG9A 1S0EA 1TVGA 3NJVA 2GNBA 2I74A 3CL1A 1RMU1 2DFBA 3IZOA 3POEA 4UW5A 4HETA 1Z78A 3DN7A 4BJ0A 3HR9A 3OF1A 4QU2A
chains in the Genus database with same CATH topology
1ZZ9A 1LGCA 1CAXB 4AK3A 3NW4A 4QGNA 1QJY1 4P9GA 1PIV3 3HT1A 1WCSA 4COZA 1BEV2 2YROA 5K0UA 5T5PA 3ATGA 4Y4YA 3ECQA 1LOFC 2YDEA 3IDEA 1NLSA 3VBOA 4MGZE 3AZXA 4AFDA 1KDMA 2RS13 3ZFFA 1UN1A 2ZX2A 3AXEA 5A33B 4PBOA 5BNPB 1WD3A 1UPIA 1XU2A 3D0SA 2YUEA 1AL21 1NCQA 2MHFA 2IXHA 1KS5A 2WZR2 2JG8C 3PHMA 4FCAA 4IV1B 1H1AA 4KWKA 3OY8A 3HT2A 4LBOA 3AYCA 3ALQA 1DGLA 5JLVA 4Q4V1 3MGUA 4FVVA 4CZSA 4KBBA 1ND3B 5I91A 4IQPA 1URXA 4OHZA 1OSGA 2AGSA 3WG1A 1VBA1 2OIIA 3RZZA 5JOWA 3OYWB 3VZJA 1ULCA 1X8MA 1VBD3 2ZX3A 5KXDA 1YLLA 1JYCA 2E63A 5E89A 1IHMA 1GQGA 1BKZA 1H30A 1SLCA 4AI2A 1C4RA 1D2QA 5DZEA 4F83A 1IKPA 2ZHKA 4XDQA 1LRHA 2VOWA 3MEPA 1TE1B 4FTBA 4K7JA 5FTTC 1YUDA 2A6VA 2R071 2UY8A 4P9LA 2D6OX 3VBRC 1A6CA 2Q1ZB 2ZZQA 3L2HA 4FOVA 3N36A 4RHV2 4NWVA 4NHLA 1RUG1 2VOVA 1LU1A 5E1RA 3ZMOA 1VALA 3FMGA 5CFDC 4HSLA 1I9RA 3Q9OA 4B8EA 3M3EA 3VBFB 3GF6A 1BJQA 3B9IA 1UMZA 1A78A 2RM22 4AVVA 1S1AA 1V6OA 3IDBB 1Q43A 3CNAA 3GZAA 3WV6A 5FOBB 3HAGA 1PVC1 3R4UA 3MLLA 1MQTA 4XIOA 1FNYA 1ZZBA 2BEOA 5IUQA 4AEDC 1RVF2 2KA3A 2RHPA 1AR91 5CNAA 1GZWA 4AHWA 2XJUA 1VBC1 1E57A 1SLIA 5CG9A 1D4M2 1YI7A 4JGYB 2WA3A 4ASMB 5I8TA 3KT4A 4LBLA 4AW7A 4TZDA 1WW5A 2RE9A 3UJOA 2A73B 1GQHA 2D3SA 1AR72 5CAZA 3AB0A 1PK6B 4CDQA 5CVRA 4AG4A 4LT5A 1SCRA 1V6JA 1EY2A 3BPZA 3VDDA 1V00A 4LULA 3NKGA 4COVA 1C8NA 1PGW2 5IK4A 1BVVA 3MDPA 3POSA 2GC2A 3VUOA 4AHYA 1FMD1 3VBHA 4A2UA 5JPMB 4IEPA 4N9IA 3WHTA 1VR3A 3IPVA 4LEJA 2HWD3 1G6NA 3B94A 1QMJA 2QDRA 1CPMA 4Q0PA 4KG8A 3JB8A 1DF0A 4FT8A 4RFT0 5D1IA 1ZRFA 1G9FA 3NWKA 1X36A 4LBKA 4LO6B 4N7UA 1AYN2 1U0AA 1ASJ1 2YGLA 2V5YA 1CAUA 3FFZA 4FPFA 5JAXA 1AR83 2WZPP 2GH2A 4YZ2A 1WW4A 3E5UA 3N35A 5CBLA 3LOBA 1IKQA 2ZCWA 1IS6A 2XUMA 1DHKB 4I3PA 1QF3A 1XE8A 3FE5A 3THPA 4JGZB 4LTAA 3U07A 1H8TC 4AI3A 3WW3A 4COWA 2JXAA 2GU9A 5KHHA 2CGPA 1R1ZA 1MS9A 4PIZA 2Q1MA 2CV6A 3ZSJA 3CJIA 2OZ6A 2VVDA 3BU7A 2HWF2 1PIV1 1RUF2 5FPXA 4M01A 4NR1A 3TOJA 1BEV3 1M4WA 1SLBA 1ZBA2 4M0HA 4K1ZA 2Z79A 1QOSA 2C9AA 4RGGA 2B46X 5BNOB 2VQAA 3JBG3 2W0XA 1ULFA 4BA6A 1RUJ3 2RS11 1ALYA 2CGNA 1U5IA 1RIRA 4Y26A 5EWSA 1AF9A 4M3CF 1PGL1 1H0BA 5KWRA 3OPZA 3VBFC 3DPRC 4NO4A 2WZR3 1X7NA 2Z69A 4Q0UA 2E7QA 4PDWA 5I8YA 3VKMA 1UAIA 4JDOA 3BTAA 4N43B 1XNDA 2HWB2 3T1LA 1IS4A 4X8PA 2P3IA 2PYTA 2Q4SA 1S0CA 4MGYE 3VBRA 4Q0SA 4PF5A 1DZRA 2WNUC 5F1RA 4P14A 3ZFGA 1LOEA 5GZFA 3LA3A 1VBD1 1CAVA 2E53A 3H7YA 1FXZA 1UU4A 1YIFA 4Y1UA 5JMCA 4N7IA 4EN8B 1EYBA 5FFOC 1SLAA 1QH6A 4YARA 1SBEA 2BFUS 1NCRB 1QH7A 2WSUA 4H3WA 4AEDA 4EN6B 4RHV3 2XPJA 2FMDA 1OA2A 1V9U1 2MPFA 4YVWB 1PO12 4XHBA 1C1LA 4WVZA 4AFMA 4CDXC 4FP3A 4ZXKA 3HQXA 5GJ6A 4QD2A 2VVFA 3EJKA 4QGMA 4XE9A 4LUMA 4IEQA 3M3IA 2GH8A 1HIXA 1ZBE2 1HV1A 1QXRA 2ZAHA 3NAPC 4Q4V2 1FV3A 3EQEA 4IEOA 2RR12 4EWAA 4OI2A 4NHKA 3ZFEC 2BBVA 3VBOB 4HZFA 3ILFA 4HKLA 3ZFFB 4LBQD 2P3JA 3MLKA 1JTZX 2BTVC 5JR7B 1RVF3 5C8CA 1KDKA 5JPNB 1QNYA 1QY4A 3WDWA 1NCQB 1EAH2 1D4M3 4BPZA 2WQ4A 4BCUA 1A8DA 2GAUA 1ZRRA 3OY8B 4OUSA 4DMIA 2YV8A 4P9WA 4JTNA 2WT2A 1AR61 1S0IA 5GALA 3OGGA 4JRLA 2E7AA 4LBMA 4FPYA 3MPPG 1GZCA 4S2DA 2R6QA 3DF0A 1F5FA 4AVBA 3C3VA 1IS5A 4IEXA 1PO23 4WZCA 5ACA2 4Q26A 1TEIA 1HQLA 5GLUA 3WP4A 2A3XA 2F6BA 1H8TA 5FCCA 2HWD1 3FBMA 3AMNA 4PIXA 4Q2FA 5H9RA 3IIAA 4LHLA 3NJZA 1DGWA 5IK5A 3RMXA 3AP4A 5C9AB 3ES4A 3VZNA 4HBNA 1NY72 1AYN3 2CWMA 2ZABA 3BIWE 2BVVA 2IXLA 3E5XA 1MZEA 3CU7A 2DCZA 5FMOL 3ILNA 2BWCA 5GLVA 1G9CA 3R6SA 5EJ3A 4AEKA 4XZPA 4QPIC 2HWC1 3FJSA 4Q27A 2XG3A 2Q8OA 1HRI3 4OI1A 2WFF2 1G9BA 2YC0A 3GZTB 4IEUA 4QX5A 1CESA 2DTWA 4RR3B 1QHDA 4YM2A 3WCSA 2CNAA 3T1MA 3A0KA 3S7IA 3AKRA 3M8LA 1OQEA 1U5ZA 2FZ1A 3WP3A 3K48A 4S2HA 3DPRA 2CGOA 2HWF3 1RUF3 3ENRA 3NO8A 1WW7A 4K8FA 3UKVA 1GZWB 4I0BA 4TLFA 3O0VA 1OI6A 4Q4X2 1BEV1 2G4IA 4YG6A 3WR0A 1EPWA 2E9QA 2JG9A 1WBLA 2DVFA 5KXCA 2HWE2 4AHZA 5C33A 2A70A 5L7OC 3TNPB 3AMPA 2VNOA 2JE9A 4AGRA 3VDDB 4BIFA 3P3NA 5JIUA 4GMP3 3WNXA 4GH4C 2B42B 5JSOA 1ZM1A 3NKTA 2BGCA 1IS3A 5SV5A 3KT7A 3NV1A 2WZR1 3H9AA 1NXD1 1AJOA 3LKJA 4JVAA 3VBHB 2ZX1A 3B01A 2W52A 1LU2A 3IPVB 2YHJA 5AVPA 1QJU2 2HWB3 3UKTA 2JE7A 1X8EA 4HKOA 4URTA 1H1IA 1U12A 2R30A 2WS92 1FPN2 3SNMA 1J1LA 3MW2A 2WKKA 2H6CA 1DQ6A 3KGLA 1IQAA 2CTVA 1W0PA 4CDXA 1N1SA 1CAUB 1NQJA 3TWIA 1LOCA 3AXDA 1HQWA 1WA4A 2I2SA 3MLJA 4P9XA 1JXNA 3VN4A 1TNRA 2PHFA 3SXWA 3NAPA 5KHJA 3ZPYA 3WUCA 1LOGA 3ZFEA 2OA2A 1S0JA 4LA2A 2E7TA 1NA1A 2W68A 2ZOEB 3W59A 1Q8PA 2YZ4A 4ORFA 1UIJA 4RHV1 1OLRA 3CJIB 3GHMA 1J59A 1RUC2 1PO13 3FX3A 3HMYA 4PLOA 2GN7A 2VMHA 3NV3A 1VBB2 1T6GC 3THTA 2B39A 3FBYA 2JICA 4LBNA 4CDWC 4CEWC 2DUQA 1ZBE3 1XQNA 3I59B 4Q4V3 2RM21 2O8QA 3ZN4A 3CLPA 5JIAA 4YZ3A 3ACLA 2ZGNA 5GLZA 3ZN6A 2R16A 4FOYA 1LECA 1OMIA 2Q5TA 1R082 1RVF1 5FQ0B 4Q1RA 2IC1A 2GDFA 2VNGA 1BBT2 1FOD2 3ROUA 4LHKA 1OPMA 1EAH3 1D4M1 1AZDA 1DQ0A 3IBMA 4PDWB 4CEYC 1MS4A 4K6BA 2R49A 4OHXA 1AR71 1YFXA 1DZQA 1V6NA 2CY6A 2PA7A 2V73A 3CJXA 4AQTA 1FYUA 1F31A 1O4ZA 3UJQA 4ZU5A 4AGGA 4L99A 2XKPA 2VW0A 5J98B 1PGW1 3ZFGB 1JYIA 2D43A 4V1PA 4HT1T 5IK8A 1CAVB 1NCRA 4KU8A 2I45A 5CU1A 4BLJA 3K51A 3OBRA 2VULA 4DY5A 3U0ZA 1WD4A 4ISRA 3RS6A 1LEMA 3KCYA 4YGDA 4XEZA 3WDUA 1O3RA 3BODA 2K2SA 4Z2WA 4R8HA 5I0TA 2XJTA 5T3NA 2ZACA 2WLPA 3ME2A 3H0OA 5H9PA 2VW2A 4LO5B 1PGSA 1W0OA 1HV0A 5JZGA 1B35C 4QM8A 1VBC3 4I02A 3WY6A 4WBBA 1GR3A 3N7LA 5DZFA 4AEJA 2VXRA 4G4FA 4YM1A 4DNYA 1WMFA 4META 3V0BA 4N53C 2Z5WA 3PNAA 2C5DA 3USSA 2H0VA 4UW3A 2W08A 3QLQA 1S0GA 4E9KA 5EFUA 2QQPA 2NP0A 2ZX4A 4GH4A 1UU6A 3JZVA 5KHIA 3IN9A 3GNEA 3ZXDA 1Q5OA 5T54A 5ABJC 2GC1A 3VGIA 2XBO2 2HWF1 4FOQA 1RUF1 4KWLA 2R062 3E6DA 5C8CB 4ZKTB 1FMD3 3JQXA 2EIGA 1ZBA1 2HWE3 4A7ZA 3VBSC 2ZS6B 3INAA 3R0RA 4UBGA 3B93A 1KS4A 5C4WC 5BY5A 3MIHA 5LK7B 4ZU4A 2VVEA 4QGLA 1RGSA 1CX4A 1PNGA 1WUVA 3B9CA 2XB6C 4GMP1 4YW4A 1I6XA 4LLOA 3D5OA 2IXKA 1MS5A 3H8UA 2UYAA 3L2YA 3BOPA 1UKRA 4GKYA 5J3UA 3OTFA 2O8OA 2HWB1 1V6IA 2QUOA 2EALA 1OKQA 4MYEA 2ZHLA 2WS93 1FPN3 3ZN5A 5FRAA 5J96B 5DUWA 1ZNPA 1K5MC 3DV8A 2IWGB 4B29A 3AYDA 3R4DB 3ZYJB 4ATEA 1R1A2 3J8F2 1ND2B 1POV0 2QZ2A 4QQ2A 4LBJA 4RD7A 4CDWA 4IESA 4QQHA 2Z42A 4E4SA 1O4TA 4GALA 3LA2A 2IXCA 1XRUA 1V6MA 4YVSC 3AZZA 4SLIA 4BE3A 4QPYA 3SMHA 1ZZCA 3WG2A 1LTEA 3W58A 3HBZA 1JHNA 5GZGA 4Q4Y2 5IT6A 2WNVC 4E4ZA 4Y5Z0 1OOPC 1PVXA 4XMAA 3WDTA 1FX5A 4Q1PA 3M1HA 4JAAA 2LM3A 4AXOA 2NN8A 1PO11 1WBFA 2GSYA 2QVSB 5J37A 2CAVA 4RQPB 3IT8A 3U10A 1VBB3 2GN3A 5A3LA 4FAHA 2DCYA 1QGLA 5D8AB 2FQPA 1ZBE1 2JG9B 4ES8A 3NV4A 1XNCA 2ZZJA 2RR11 2PQQA 3MIFA 2GC0A 3U11A 1YRZA 1AL0G 1R083 4FQ4A 3IM0A 1KJLA 1AXYA 1CN1A 1GKBA 1A8MA 2EF6A 5AVAA 1BBT3 3RWNA 3VKNA 1OLQA 1KFXL 1EAH1 3WW2A 1RTVA 4XF3A 5CFCC 5JDBA 2I07B 2OUHA 4QQLA 1LENA 4ZU7A 2VQ0A 4K3UA 1SFYA 4R9DA 3LGRA 3E5QA 4FTSA 4IV3C 5KC6A 2ZPXA 5CA6A 4B4QA 1WMDA 2OPKA 5GM0A 4CP0A 1V70A 1REFA 3NV2A 1LOBA 1V9U3 5FLHA 4XOGA 3WG3A 4N90A 5KXEA 5ACA1 5L36A 1BVP1 4FOWA 4N53A 3CF6E 5DUXA 4I3GA 4X6QB 1N47A 3S6PA 5A32A 1YYNA 3M3OA 3LWCA 4R4ZA 2NMOA 2WWSA 3LSEA 4RS5C 4X6RB 3USUA 5GZDA 2R32A 1NA1B 3O14A 4QPGB 2DURA 4D3WA 5ABJA 3U4XA 5JVVA 4MSVA 4XJ8A 1NY71 1ZA4A 1YNAA 5T50A 4C90A 3QCWA 1ZZ7A 5L19A 2VY0A 4N9HA 1QWRA 1DGRA 1H4GA 4DXZA 3VBSA 2R1BA 2PAMA 5C4WA 2WFF1 1V6KA 4WZFA 2BWAA 2IXIA 1AR63 2HKXA 3N7JA 3AM2A 5BNNB 1XYOA 5F6LB 2Y38A 4K40A 3ZN6B 2ZMNA 2R0FA 2XBO3 3D8CA 3LCPA 5LRRA 3KLSA 2X5IB 4D94A 3AZYA 1LHWA 1YWKA 1LHUA 1JOJA 4Q4X1 4XJUA 4XPVA 1VJ2A 1ZYBA 3AP5A 4O9EA 2X53S 3VBUC 4RA0A 2HWE1 2D93A 4EN9B 5K8SA 2NM1A 4WM8C 1KITA 2Y0IA 4PLMA 4CDUC 5JCTA 2AENA 4BLIA 4XF1A 2UURA 4NN0A 1YIPA 4XFAA 5AC92 4MUVA 1O3TA 1RUI2 1PM7A 2JENA 3D0JA 3VHOA 3I7DA 2NYYA 4YVSA 3ILRA 1RITA 2JJ6A 2HWC3 1DYPA 1QJU1 1U5YA 1LOFA 4XFFA 1SQ4A 1HRV2 3AMHA 4DB5A 1UCXA 1OOPA 2WS91 1OD5A 3SH5A 4HSJA 1FPN1 2B9UA 4M3CA 3V65A 4HL0A 1O3SA 1OA3A 5FDBA 4WVWA 1R1A3 4XF9A 3SITA 3J8F3 4XXAA 1C8M2 2OW4A 2JG8A 4WM7C 5JZGB 2XLFA 1QDOA 2JECA 1WLTA 3ASIA 1UW8A 4S2GA 3JD72 4UW6A 4XTPA 3V0BB 4XJAA 3RRDA 3ELNA 4NPRA 4RGAA 3R4SA 3VZOA 2BVBA 4IEVA 4OI4A 5DZGA 4R52A 2OUJA 3WOGA 1UD1A 4LR4A 1W6OB 1W6QA 2PHUA 2BPA2 1WMEA 5BV6A 1RUC1 1RUE2 1RHI2 1DGRN 1VAMA 1VBB1 5JWPA 1VRH2 1TNFA 4C0HA 5LK5A 1BXHA 4EROA 3SH4A 3QH7A 1KRIA 2QKDA 1QQP2 4QHBA 4DPNA 5A3MA 4M0NA 4IXLA 4Z1VA 5DDJ2 4YZ1A 3J4UH 2OVUA 3QOPA 1VB4A 1HKDA 1R081 3HD8B 4FPOB 5BNPC 3N4MA 2VH9A 1BBT1 1FOD1 3D82A 1S2KA 5JI9A 1XE7A 1OPOA 3SCHA 5CFDA 2A7AA 2VUAA 2EVXA 1APNA 2PN5A 4IV1C 3IKWA 1CIWA 3A0NA 3NVCA 3KGZA 1ND3C 1VBE2 4XBNA 3ZX7A 3OBTA 2FMYA 1EPZA 3EHKA 3GHNA 2UWAA 1MVEA 4G9SB 1QKQA 5K0UB 2A71A 3KB5A 2VW1A 5KXBA 4BH9A 1DQ5A 4IEZA 4JDMA 4ASLA 4FQZA 1PNFA 2RM23 1KXGA 5J36A 3MYXA 4GKXA 3RJRA 1XYPA 4AVAA 1TMF2 5DUVA 3JUUA 2ET1A 2BW8A 4NVPA 4WVMA 4CRQA 4XJZA 4QT6A 1N3QA 2QCSB 1TME2 2IZWA 4FXGB 1QJZA 1GNZA 5T5JA 4XFBA 4WM8A 4Q29A 4XBQA 1AR73 1GBGA 1CJPA 1HLCA 3AFGA 3PTYA 4C91A 1SBFA 1IPKA 4KWJA 1BYHA 1Y7BA 2XBO1 1QU0A 4L97A 2R061 4RSUA 5TSWA 1C5HA 2FHRA 1RJ8A 4XQWA 1YFUA 5DG1A 4ES9A 4BHPA 1ZREA 4M00A 5K9YA 4LBQA 3MFAA 1AXKA 1R092 4JGYC 4SBVA 1YJKA 1LCLA 3RYRA 2YPJA 4I0AA 1PK6C 1G9AA 1BMV2 4F3JA 4EV0A 1YCIA 2XJVA 1PHMA 4Y24A 1YFYA 3H50A 1FNZA 3ZSMA 4BIOA 4EN0A 5AC93 5I0RA 3DGTA 4GWNA 3RYKA 1LGNA 2DYCA 1RUI3 2UWCA 3QACA 4GA9A 1LHVA 3ZO0B 3KCCA 5FO7B 4EN7B 4MH0E 2EXHA 2NZ9A 1OQ1A 2V09A 3AJZA 5A32B 3ZYIB 1AVBA 5FMOS 1HRV3 4OUMA 1O7FA 2XL9A 3USUB 4KQ7A 3FZ3A 4LHNA 1X82A 3H3UA 4MGKE 1PZ9A 3VKLA 3TBDA 2XLGA 3O5SA 3VHPA 1REDA 1QXJA 1MQTB 1R1A1 3AZWA 3VBFA 3J8F1 1C8M3 1O5UA 2Z2SB 3KMHA 5C6CA 2GNDA 2ZGMA 3BOWA 5GZEA 4E2QA 2DCTA 1BZWA 5C8WA 5J7MA 3JD73 1ZBA3 4Q4W2 5BXXA 4AFAA 4JGZC 3D6EA 4MXWA 2DU0A 4Q4Y1 4A3XA 4CDQB 1CR7A 2DVGA 2WNUA 3TYJA 5LRSA 1MS8A 4HVQA 2BNNA 5BNPA 5DG2A 1ZVFA 2XVLA 5E88A 4UBHA 3N3HA 4S2FA 1J58A 5GLTA 3AKSA 1RUE3 2EXKA 2D5HA 1O3QA 1VRH3 1Q3EA 1Y43B 1J3RA 4YGCA 4P9JA 2K9ZA 4BQ1A 4COUA 1H9WA 1QQP3 4GB32 1LHNA 3I4IA 5FBZA 1VIWB 5BNOC 5DDJ3 1U5XA 2PAEA 1NQDA 3VL8A 2VU9A 4HK8A 3S0MA 1L3JA 3AFKA 4Z92B 3URFA 1RL3A 1H9PA 4G3YC 3PVEA 1AXZA 3GBWA 3KSCA 2R042 3G6JB 4XF0A 5JSPA 1NYWA 2ERFA 3WCRA 1KJRA 2W39A 1UIKA 2QFEA 1SBDA 1SDWA 2BNOA 1DG6A 4BOWA 2IFRA 3AKPA 4N43C 2ATFA 3FHIB 4C0BA 1F5JA 1Q8SA 4AYUA 4W6WA 3VLBB 5HCBA 1X33A 5EXOA 4AQSA 4RL7A 1O5LA 4BMEA 1QJX2 5LEKA 3FFQA 3KT1A 1O91A 4ISQA 1CAWA 2XJQA 2JG8B 3VL9A 4OHWA 2D5FA 1GYKA 2DCKA 3ZXFA 2LUWA 2VUJA 1KD7A 2TNFA 4XETA 4XMIA 4YM3A 2RR13 2UYBA 2XWJB 3A4UA 3AK0A 3O0WA 2XJSA 4PQ9A 2D44A 4QMAA 1NCRC 1QOOA 1GSLA 1OQDA 1W6QB 4PLNA 4ONUA 5FAXA 3V64A 4YVWC 5T5OA 5FO8B 3SCGA 1TME3 4A7KA 4PCRA