5ABJC

Structure of coxsackievirus a16 in complex with gpp3
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
242
structure length
242
Chain Sequence
GIPTELKPGTNQFLTTDDGVSAPILPGFHPTPPIHIPGEVHNLLEICRVETILEVNNLKTNETTPMQRLCFPVSVQSKTGELCAAFRADPGRDGPWQSTILGQLCRYYTQWSGSLEVTFMFAGSFMATGKMLIAYTPPGGNVPADRITAMLGTHVIWDFGLQSSVTLVVPWISNTHYRAHARAGYFDYYTTGIITIWYQTNYVVPIGAPTTAYIVALAAAQDNFTMKLCKDTEDIEQTANIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords VP1
publication title Structure Elucidation of Coxsackievirus A16 in Complex with Gpp3 Informs a Systematic Review of Highly Potent Capsid Binders to Enteroviruses.
pubmed doi rcsb
source organism Coxsackievirus a16
total genus 44
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2015-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5abjC00
2BFUL 1R1A3 5CFCC 3JB8A 5BNOC 1HRV3 1VBC2 5J96B 4CDUA 3VBFB 3VDDC 4FSJA 1AR73 4Y4YA 1AYM2 1B35A 3M8LA 3J8F3 4IV3B 4CDWA 1R1A1 1PO23 4Q4Y2 1HRV1 3VDDA 1AR93 2BBVA 1ND3C 3ZFFA 1AR71 1NOVA 3TN91 5ACA3 1MEC3 2RS13 3TN92 1AR63 3J8F1 4CDQA 4NWVA 4JGZB 5FMOL 1ND3A 1PVC2 4N53C 2PLV2 1AR91 3VBRB 1RUC3 3JBG2 1C8NA 1ND2B 1QJU2 1RUH3 5D8AC 2WLPA 5ACA1 2R062 1EAH3 1MEC1 1R082 4PDWB 4CEYB 3ZFGB 2RS11 1POV3 1AR61 1C8M3 1X33A 5BNPA 1VRH1 1RUD2 3ZFEA 1RVF2 1RUC1 1OOPA 1RUH1 1V9U3 1FOD3 1EAH1 1VBE2 1HRI3 1K5MA 1Z7S1 1FMD2 4SBVA 1ASJ2 4IV3C 2HWD3 4Q4W3 1QJX2 4Q4V2 4AEDC 4FTSA 4GMP0 1H8TA 1FOD1 1V9U1 3VBHA 4Q4X3 1HRI1 4QPGC 1RB8G 1BEV2 3VBUB 2HWD1 4Q4W1 4JGZC 3LOBA 1PGL1 4YVSB 1VBD3 4CDUB 4QPGA 4JGYC 1NA1C 1NG0A 2ZAHA 4Q4X1 3VBOC 2RR12 4EJRA 5CFCB 1DDLA 2RS51 2BFUS 1PIV3 4GH4A 4PDWC 4CEYC 5BNOB 2R041 1VBA3 5L7OC 3FBMA 2WZR2 3VDDB 4GMP1 1VBD1 1RMU3 2R042 2GH8A 3ZFFB 1NY71 1PIV1 2RM22 4CDQB 5ABJA 2FZ2A 4RHV1 5CFDC 1NY72 1HXS2 1ND3B 1FPN1 1RMU1 3NAPA 1CJDA 1VBB2 4IV1A 1FPN2 2HWE2 5FMOS 2XBO2 1RUE3 4N53B 5A32B 5BNNC 2RS32 5C8CA 2WFF3 5D8AB 1RUG3 1COV2 1OOPB 2WS92 4QPIA 5BNNA 4CEWC 1ZBE3 1F2NA 5LK7B 1RUE1 1B35C 1W39A 1AYN3 5JZGC 4FTEA 1TMF3 4CDWC 1OPOA 5DDJ1 1VB4A 4WM7A 1RUG1 5C9AC 4CEWA 1PGW1 1RUF3 1ZBE1 3ZFFC 3JD73 1RUI1 5JZGA 1M06G 1AYN1 4N43A 3VBSA 5C9AA 4CDQC 4AEDB 1RUI2 1TMF1 2IZWA 1R1A2 1AL23 4QPGB 1HRV2 3JD71 1AR72 3DPRA 1POV0 1PO21 3J8F2 5BNPC 4JGYB 1NA1B 4YVWA 1D4M3 3VBOB 3ZFEC 1AL21 1AR92 1OOPC 1IHMA 4RS5A 5ABJB 5ACA2 5L7OB 1MEC2 1K5MC 2RS12 1AR62 1D4M1 4GB33 4BCUA 1PO13 2BUKA 1VRH2 3JB4C 1RUC2 4IV1B 1POV1 4RQPA 1C8M1 2RMU3 1H8TC 3VBHC 1RUH2 5CFDB 1AR83 2HWF3 2R073 1EAH2 2X5IA 1C8M2 1SMVA 4GB31 1Z7S2 1NCRA 4WM8C 2HWC3 5A33A 1PO11 1QJX3 2ZTNA 2MEV3 4QPIB 5K0UC 4FTBA 2RMU1 5BNNB 1F8VA 1AR81 2HWF1 1V9U2 1FOD2 2R071 1TME3 1HRI2 4WM8A 4GH4C 4Y5Z0 5K0UA 2HWC1 1AL0G 4CEWB 2HWD2 2MEV1 1EV13 4Q4W2 4RR3C 1PGL2 4CDXC 1B35B 1RHI3 1X36A 1VB2A 3VBFA 4Q4X2 5JZGB 1TME1 1QQP3 4CDWB 5ABJC 5C9AB 2RS52 4RR3A 2WZR3 4CDXA 1EV11 1RHI1 1VBD2 3NAPC 1BBT3 4IV1C 1QQP1 1VBA1 1RUJ3 5AC93 1PIV2 2QQPA 4RHV2 5C8CC 1R093 2HWB3 1RMU2 2Y26A 1BBT1 3VBRA 4QPIC 5C4WC 3CJIC 5BNPB 1HQNA 1RUJ1 1ZBA3 3ZFEB 1R091 2HWB1 5C4WA 1MQTC 4WM7C 1HX6A 3CJIA 1K5MB 1QJY3 1ZBA1 2WFF1 1RUE2 1MQTA 4N43C 3VBSC 1CD3G 1NCRB 1VBC3 4LLFA 1H8TB 3VBHB 2WFF2 1BMV1 5DDJ2 1RUG2 1AYM3 1QJY1 1PGW2 1GFF2 1ZBE2 3DPRC 4WM8B 4Q4Y3 5K0UB 1AYN2 3VBUA 1VBC1 1TMF2 4YVWC 1RUF1 1AYM1 4YVSA 2VQ0A 4GH4B 1RUF2 3TN93 2DF7A 4RS5C 3JD72 5CFCA 1PVC3 4Q4Y1 4RR3B 2PLV3 5BNOA 4CDXB 1PO22 3JBG3 1QJU3 2R063 1AL22 1R083 5J98B 4RQPC 1WCDJ 2X5IC 1PVC1 1QJZA 3HAGA 2PLV1 1RUD3 1RVF3 3JBG1 3NAPB 1QJU1 1D4M2 1NCRC 1VRH3 2R061 1R081 1VBE3 4RFT0 1NCQC 1FMD3 5C8CB 1ASJ3 1RUD1 4N53A 1RVF1 5A32A 4Q4V3 1OHFA 1Z7S3 2ZZQA 4GB32 5C4WB 3CJIB 1VBE1 5D8AA 1NCQA 1PO12 2TBVA 1BEV3 1FMD1 2RMU2 3VBFC 1AR82 1ASJ1 2HWF2 2FZ1A 2R072 1MQTB 4WM7B 1QJX1 4Q4V1 2HWC2 4Z92B 2MEV2 5GKAC 2RR13 1VAKA 1BEV1 2GSYA 4N43B 3VBSB 1AUYA 1TME2 4IV3A 2RS53 2R043 4AEDA 1EV12 3DPRB 4GMP3 2RR11 1A6CA 2RM23 3VBRC 1RHI2 1ND2C 1HXS3 1QQP2 2WZR1 4YVWB 2BPA2 4JGZA 1VBA2 3ZFGC 4RHV3 1VBB3 4JGYA 1NA1A 4RS5B 1FPN3 3VBOA 1ND2A 5FOJB 2RM21 2HWE3 1BBT2 2XBO3 4PDWA 3ZFGA 4CEYA 5AC91 1HXS1 2RS33 5L7OA 1RUJ2 5AC92 1COV3 1VBB1 3ZXAC 2WS93 4RQPB 1R092 2HWB2 2HWE1 2X5IB 3IDEA 2XBO1 2RS31 5CFDA 4NWWA 5A33B 1ZBA2 1COV1 3S6PA 2WS91 2WWSA 3VBUC 5DDJ3 1NCQB 1BMV2 4YVSC 4CDUC 1QJY2 1RUI3 2XPJA 1E57A
chains in the Genus database with same CATH superfamily
3T0AA 1R1A3 4QMAA 2FCUA 3JB8A 5F5IA 2XMLA 1HRV3 1X9PA 3OGRA 1QY4A 2XR4A 5J96B 1REDA 2WBKA 3NNMA 4TWTA 2BZDA 5DAXA 5F3EA 3VDDC 3WDXA 1TZOA 4Y4YA 5FZ0A 4XZUG 3RG0A 3RJRA 1RUNA 2O0OA 5FJHA 3USSA 1U5ZA 5GZGA 1O3SA 3HQXA 4BH9A 5HBAA 4CCLA 2JB8A 2SLIA 4AQSA 2ERFA 3C7EA 5DZGA 2W87A 1ND3C 1H2LA 1AR71 1NOVA 3K4ZA 4NJ4A 3RWKX 2K9ZA 3RZHA 4PLOA 4SLIA 4OCTA 4IUGA 3T2QA 5LZ6A 5IK7A 5A1FA 2IXCA 4LQRA 4PIZA 4W50A 5LA0A 4ARXA 1UX7A 2BWCA 2OX0A 3H7JA 5FFOC 2PLV2 4QX1A 4LTAA 1L7RA 5FIXA 3U14A 1ND2B 2A75A 1O4YA 2B7YA 2BNNA 4K20A 3VZKA 2DURA 2VUCA 2WLPA 2ZGLA 3IZOA 2WSUA 1R082 4PDWB 5D8AC 4CEYB 5IVCA 1POV3 1YLLA 1AR61 3IIAA 3GGLA 3MF6A 3PIJA 4I3GA 1BLZA 3UETA 1E5HA 4GA9A 3MZHA 3FZ3A 1OVSA 3AL6A 1ONAA 1V00A 3WF0A 1GZTA 1IQAA 2AH2A 1LENA 1MS9A 1RVF2 5JOXA 4AG4A 4CCOA 3UESA 2KXLA 2WZPP 4L11A 1SHWB 5IFPA 4CP9B 1LRHA 3KCYA 1GZWA 1V9U3 4XXAA 1EAH1 5JAXA 4OI0A 4JAAA 1OT5A 3CMGA 3ROUA 3IAPA 1HRI3 1E5IA 4MVTA 5C33A 3B94A 2WO1A 1HB2A 5CA6A 5JSRA 2J1VA 2ZMKA 1ASJ2 4MGYE 1B09A 3SH4A 1XC6A 5A6XA 3OY8B 1DIWA 4IV3C 1HN1A 5F6LB 3LFMA 3WEZA 4Q4W3 1UL9A 1PMJX 4FPJA 2NMOA 4WVMB 4FTSA 3VKFC 4BQYA 3WDYA 4LR4A 2ZGKA 1GMMA 4C0HA 1XE8A 1FI2A 4FXGB 2HBUA 3IPVB 1ZRDA 3BVCA 4L97A 1PMHX 2Y0OA 3CQOA 3KQRA 4QQOA 1WCQA 4ZZ5A 3SC7X 2VUAA 2WIIB 2XG3A 1SBFA 4JGZC 3LOBA 1W8WA 1PGL1 3AZZA 5JXHA 1BXHA 4CDUB 4EN6B 5I8YA 1W6OB 5FV3A 2WNUC 1YRZA 5KHIA 3HPNA 3JU9A 1S0GA 2OXBA 2WKKA 2CGOA 4EJRA 2RS51 4GH4A 1PIV3 5IK8A 1UMHA 1J58A 2IFRA 1VBA3 2BNMA 3BOPA 3FBMA 2WJSA 1L3JA 2WZR2 3POJA 3WF3A 2R30A 1VBD1 1RMU3 1XXNA 3FLTA 5A3TA 1LOAA 3IDCB 4MV2A 2O1QA 4AI0A 4EN8B 3SEPA 4B8EA 2CL2A 4NRPA 1Y43B 3VD5A 1W9TA 4ZXEA 1ZRCA 2YGMA 4O65A 2RM22 5FY0A 2FZ2A 4RHV1 3WNLA 3DXUA 3A23A 4W4ZA 1HXS2 4IGPA 5A6ZA 3O0VA 5FYMA 2Y6FA 5DG2A 2W92A 4XE9A 1S4CA 4LULA 2I74A 5F8PA 2VBBA 4AXOA 2QQUA 1KJLA 1Y9MA 3NAPA 4LLOA 5IK5A 2BYVE 1CJDA 3FMGA 3O1PA 1Y3TA 1YO8A 4LIVA 4P5HA 1JOPA 3R4UA 2V5YA 4NAOA 5CISA 2ARXA 5CG8A 4CCMA 3H1MA 5DUWA 4RD7A 1JS9A 1UIJA 5FMOS 2XBO2 4TLFA 2VZ3A 1CAVA 3I2HA 4FP2A 4BLIA 1AZDA 1RIRA 2ZX1A 5C8CA 2PHUA 1GWMA 5FMBA 1EPWA 3QH6A 4P14A 4AFCA 2OS2A 2MHFA 2ZPXA 3LPFA 1WA4A 1OOPB 3UGHA 5FZBA 1PM7A 3POSA 3ZXLA 5BNNA 3U1XA 2JIGA 1F2NA 1H1MA 4NROA 5EXOA 2XLAA 2Y6KA 4BQXA 3RQ0A 1C28A 1RUG1 1DFQA 1XNTA 2ZGUA 5T3NA 1F4HA 4EZ4A 1DGLA 4NPMA 1RUF3 4YGBA 2W95A 1XQNA 4CXYA 4AR2A 4K8FA 4YZ2A 1AJOA 1GANA 5LEJA 1M06G 1NQJA 4AEJA 1AYN1 1WCSA 1OI6A 1RTVA 2WAOA 3OGVA 5C9AA 2E7AA 4AEDB 3TEWA 4Y4RA 3AKPA 1EYBA 1W0NA 4XTPA 3KGLA 4J6GA 3AYCA 3GJBA 3I3BA 1LGBA 3T4HB 2RJKA 1VAMA 2ZX0A 3ZYGA 3EMRA 5J7MA 3JD71 3PMSA 2FMYA 4BYYA 5J37A 2DCZA 4Y20B 3T2OA 4JDMA 4ZXKA 2VAUA 3LA2A 3ZSJA 4LBKA 4A4AA 4Y5TA 5CVRA 5GLUA 1NA1B 3AMMA 2A70A 2IFWA 4P9LA 5JXGA 4XBNA 3EB7A 1G9DA 1EUTA 4Q8LA 4LUKA 1W06A 4BQ2A 1LEDA 1IHMA 3JQWA 3KSCA 4KMQA 5ACA2 1D0GA 3BN6A 4ES8A 3MLKA 1XNDA 2PHXA 1OVPA 1TVGA 2Y38A 4OUMA 4UFKA 3OBTA 1CZVA 3VV1A 2BUKA 2F17A 5JMOA 4XC9A 2OPKA 3VKNA 3TB0A 1RUC2 1GICA 4IV1B 4Q0QA 5JIAA 3WG2A 4A45A 1QOTA 1C8M1 1S0JA 2RMU3 1SLIA 4ZPIA 5ERLA 5JR2A 3POWA 4P9YA 5FUIA 2X5IA 4UFHA 3ZYPA 4W6XA 4N90A 3DECA 2VZTA 5FPZA 2VUJA 1RJ8A 4GB31 1Z7S2 5F39A 4WM8C 3QACA 1S0IA 4XFCA 1PO11 2B8MA 3DEMA 1ENSA 1SPPB 1W8ZA 2PTMA 3B9CA 3T09A 3WT3A 5DAVA 5FZ1A 1JOJA 1N1VA 1XNAA 1F8VA 1MS5A 1YWKA 5IVJA 1FOD2 2V73A 3QBQA 2VW2A 4XQDA 1JUHA 2VVEA 5F32A 5FZGA 3PUAA 3O1TA 4GH4C 1KD7A 1KGYA 5BXXA 1VPHA 2YZ4A 4IETA 4Y5Z0 5FZ6A 1AL0G 3PVOA 2JDYA 4CEWB 2HWD2 2VCBA 4RR3C 1W05A 5FWJA 1FNYA 4AQ2A 2E32A 1DGWX 3H3LA 3ZYBA 5JOYA 1SCSA 1I9RA 1CAXA 1QQP3 1TME1 3AKTA 4LBJA 5FAXA 4CDWB 3P3NA 4IW3A 1ZX5A 2X8KA 5LA1A 5H9SA 3PJYA 4HVOA 1CJPA 2LALA 4NAMA 1UXXX 5G04L 1V6MA 3RJ2X 1KS5A 1HV1A 3ZIWA 1R1ZA 3MIEA 1DYOA 2BU9A 3PVNA 3WNKA 3NAPC 1LB2A 1PZ9A 3VKOA 4CUBA 5AC93 3I2OA 1V0AA 2ET7A 4A7KA 4AGVA 5A1LA 4KWUA 1YFXA 1QXRA 1Z78A 5C8CC 1ZM1A 1AHSA 4IEXA 4NHMA 1N3QA 1DGRA 1SDWA 1VE0A 2Y26A 2WNVA 1HB3A 3GZTB 3KVBA 5K4LA 1S55A 3ZDVA 4DZGA 1YXWA 5DUXA 5DMYA 1RUJ1 1LGNA 1OUSA 1ZBA3 5IYYA 4E4SA 1MR5A 4AQ6A 5DAQA 5B2GB 1W6MA 3ACHA 3W5NA 2WSVA 1YJLA 3CJIA 3CO2A 1CZSA 5J3UA 3OOXA 2YMZA 4H7MA 4XEZA 3H8UA 3FLRA 1QJY3 4LITA 2G9ZA 3O0XA 1OA3A 4XFFA 2ZGNA 3QLQA 2AREA 1SBDA 2WL1A 3F95A 1GOFA 1MQTA 1RUE2 2WT2A 4AE2A 2RG4A 1NE6A 1KXGA 4YPJA 5IATA 1VBC3 4RGGA 1H8TB 4N9HA 2WFF2 3MDPA 4RGAA 4RFRB 2A6YA 4YFWA 4FPYA 4MOAA 1GSLA 1AYM3 4YG3A 5F3GA 1FV3A 2AENA 2D6KA 2DFBA 4DPNA 3NNGA 1OFSA 2EF6A 4RA0A 3VGIA 2W1QA 2DBNA 2PAKA 4FO9A 1DLCA 3KMHA 5C70A 4TN7A 1UZZA 2VG9A 3KCXA 5K0UB 1ZREA 1F15A 5IVEA 4UFJA 3RZZA 3OBZA 2Y33A 4AQTA 1PNFA 2QQNA 3TOJA 1JU3A 2A73B 1F9KA 5I8TA 4OLLA 4YYOA 2ZCWA 3A0KA 3VL9A 1CAUB 1JYTA 4F7ZA 1PVC3 4YGCA 4A6OA 5FY4A 3N7JA 2CY6A 4E2QA 4CDXB 2WC2A 4Y1YA 4UFIA 3JBG3 1OSGA 1ENRA 3VHRA 3W58A 1XPWA 3D5OA 2P5BA 4R52A 2R063 1UOFA 2JE8A 4LKDA 1YI9A 1US3A 4IEQA 3S7IA 1OH4A 2EAKA 1V70A 3TWIA 3U10A 4M01A 2X5IC 5JUVA 2PLV1 4Y1XA 4MGZE 2OUHA 1UU5A 2J1RA 4Y26A 3WLUA 4CCJA 1D4M2 3I3DA 4AHXA 3USUA 4HSJA 4FFIA 1R081 2BNOA 3RPQA 4QQLA 4LBMA 1NCQC 1JI6A 1FMD3 4Y1VA 2CDOA 3CZJA 4GWIA 3ZKYA 1L7LA 3FUOA 4DFSA 4OVEA 1Q8PA 1RVF1 4LIUA 4Q4V3 5H9PA 2ZZQA 3H1YA 1PZ8A 2E7QA 4URAA 1RJ7A 2OW4A 1O3TA 1XRUA 3B3QE 5KR7A 1QGLA 3GALA 4OULA 2JX9A 4QGLA 5LY1A 3WW3A 2CSGA 2R0HA 1BEV3 2P34A 4Q0PA 1IOAA 5FY1A 1ASJ1 2XJVA 3NMBA 2R072 4CPBD 5KHGA 3RI8A 3UYJA 2QQVA 3Q8BA 1G9AA 5HCHA 4WM7B 2J22A 5C3QA 4Q0SA 4R9DA 4Q8KA 2HWC2 5H9QA 2G9FA 3SKVA 3RYKA 1SDDB 1OLRA 2MEV2 5GKAC 5JSPA 1DCSA 2GSYA 2VXRA 1SBEA 4NVPA 3VBSB 1Q3EA 1AUYA 4RGKA 4XF4A 2RS53 1YC61 4MSVA 2QQLA 1HV0A 2PN5A 1JXNA 2YXSA 1US2A 4XQ4A 4PHZA 1W6NB 1EV12 4OHYA 4GALA 5E88A 4X8PA 2WO7A 3WNNA 2WNVC 5AVPA 3UL2A 4BIFA 5CG9A 4LBQA 3ES4A 3WCSA 5JOWA 1FNZA 2D6LX 2WZR1 2VOKA 4P9IA 4YVWB 4EN7B 2D3RA 2ZBJA 1YIFA 3VUOA 4RHV3 4JTNA 3ACLA 2MNGA 1WCUA 3NNFA 1VBB3 3PUIA 4BU2A 2IWGB 1E5SA 3MW4A 4FOYA 4RS5B 3GZEA 3PU8A 2EVXA 3B9IA 5BPXA 2RM21 4JHTA 5LATA 1HXS1 3O1MA 5A6YA 2VUDA 1BQPA 5EFUA 2VPVA 1IG0A 4FQZA 4AHWA 3GM8A 3ZXAC 1OC1A 4LE3A 3BODA 3SQOA 5A3LA 1YJKA 4M4RA 3PDQA 3P5BA 4IEYA 2DU0A 1UOBA 2XBO1 3ENRA 4META 1DLLA 5FPBA 1DG6A 1MVQA 5CFDA 2P1BA 1STMA 4NWWA 5C71A 3WDVA 2O14A 3UNPA 2WWSA 1CAWB 2JE9A 3ACFA 3IT8A 4ASLA 2Q0AA 1W3XA 4Z2AA 3M3OA 3LA3A 1OMIA 3HQUA 3U11A 4A3XA 4BOWA 3PTYA 3SH5A 1G6NA 3U4SA 3V0BB 2BGPA 4LK7A 2ENRA 4P9WA 4AI1A 3WD5A 1OF3A 3IB3A 1O5LA 2BFUL 2NN8A 2PYTA 2VNVA 4PQ9A 5FZHA 3WNOA 5L9VA 1JYVA 2WT1A 4KQ7A 5A6QA 4XUPA 2C0ZA 4INDA 5FZLA 1C1LA 4GD4A 1EP0A 3ILNA 4O9GA 3VBFB 4Q0VA 5KXBA 5E16A 4J1WA 1XSRA 1OLMA 2JKXA 1LEMA 2OQ6A 3AP6A 3ETPA 3M8LA 3SHRA 3CHXA 4EZHA 3J8F3 3WQ1A 4IV3B 3BPZA 5KXEA 4KL1A 4CU6A 1XYPA 3RZKA 1UAIA 2RV9A 1Q8QA 4Q4Y2 2GNBA 3VDDA 4CU8A 1AR93 4UW3A 3ZN6A 1DF0A 2XDVA 1V6KA 2FDJA 4OMCA 1SEFA 4KG0A 1W9SA 1GWLA 3ZSEA 1MEC3 3I2IA 5I8SA 2RS13 2JDNA 3TN92 4Y1ZA 4AHYA 4M3CA 5FP7A 5FXXA 4DS0A 4JGZB 2WO2A 1ND3A 2I45A 2Z5WA 3EQEA 4Q26A 3VBRB 4M3CF 2CDPA 3VZOA 1A3KA 2JG9A 4HONA 1QJU2 1RUH3 1W90A 5APAA 5ACA1 1H30A 4Y33A 3ZFGB 2J1TA 2XVKA 1C8M3 5A7WB 3WW4A 4HBNA 4HVQA 2BW8A 1ZYBA 5BNPA 1WMEA 4IEOA 4IEVA 3A4UA 3UJQA 4XMIA 3ZFEA 1OFNA 2ADEA 1UQXA 5FK7A 5LK5A 1RUC1 1CX4A 4H7LA 3MICA 1F35A 2G4IA 3AK0A 4S2GA 5GZFA 3WG3A 4LHLA 4IGQA 3R6SA 3VL8A 5CKNA 5FPXA 4AFAA 1K5MA 2DUOA 3O1VA 3HN3A 2CWSA 1Z7S1 1LHNA 2C26A 1UPIA 4BQ5A 1GZCA 2VZPA 1UU6A 2VVFA 3T2PA 3KD4A 4ATFA 1SLCA 4BLJA 4OFGA 2ET1A 1LOEA 1RYYA 2R0FA 5ISLA 1FOD1 3S57A 4Q4X3 2XVLA 3M1HA 3NNLA 1RXFA 1SACA 4XPVA 5KWRA 4QPGC 1O5UA 1N3OA 3DKWA 4MADA 4ZU4A 4UBGA 1QWRA 3VBUB 2WWUA 3ZPOA 3N9NA 2HWD1 5FPVA 4NHLA 5FP9A 1UN1A 2W1UA 4MGSA 5FZAA 4XUOA 3AP4A 3R0RA 2A7AA 1ACCA 5FYIA 1U0AA 2ZHKA 1XNBA 3FFQA 4XYXA 3UKNA 3OPWA 2JDPA 1TNFA 5FWEA 3KV5A 5FYTA 4JKLA 4HANA 2WLQA 2F4PA 2HKXA 5CFCB 4NRQA 2VL4A 1UKGA 4YW2A 4XAEA 2FDIA 5BNOB 4Y3OA 4DY3A 1IPSA 2R041 3FL7A 3AKSA 2VTFA 3AMPA 4D6SA 4K40A 1GU3A 1J3QA 5DZFA 1FATA 4PBOA 2N7GA 4D94A 3POGA 3B5LB 5FP4A 3LA7A 5FP3A 4EROA 3WF1A 2J7MA 2E26A 3MO4A 3VDCA 1NY71 5IVYA 3AYAA 2E63A 3D0JA 3J7HA 4NPRA 3BU0A 2H0BA 1RGSA 3K48A 1ULOA 1BVVA 5JSOA 5CFDC 2WQZC 3NKGA 5EP9A 3WP4A 4CCCA 2WNOA 3MGUA 2JICA 3M70A 4JDNA 3PVBB 4ES9A 2UY9A 5T5OA 3ZXGA 4BISA 3QH7A 4F3JA 3CU7A 4QXKA 1FPN2 2VO5A 2DCYA 1IZ3A 2YU2A 2FDFA 5FYBA 2HWE2 4XQWA 1CIYA 4N53B 4XBLA 3WF4A 1JOBA 5A32B 2NMNA 2HJIA 1W2NA 2QDNA 4MLOA 2J1AA 3VDAA 3HNMA 1NX9A 5F6KA 1KQRA 4UW5A 1COV2 2OZ6A 4QB2A 3WG4A 1OUXA 4UF0B 3AYEA 3HOBA 4XUNA 1ZBE3 3N3HA 2PELA 4YM3A 5LK7B 1RUE1 3EJKA 2BEOA 1W39A 3E5UA 2RDNA 3GBFA 2YBKA 4AAXA 5GM0A 5JZGC 4FTEA 4FPEA 1TMF3 4NPLA 5LA9A 1G8WA 1DGRN 1OPOA 1VB4A 4W8JA 3SEEA 4AEKA 4FFFA 2D7FA 4L99A 4YWAA 5EPAA 1CPMA 1UWWA 3HR9A 1FAYA 4EN9B 1RUI1 4WZFA 2R16A 2B4KA 1YQ2A 1IKQA 5KHJA 1SFPA 5CZKA 5HI0A 2BVVA 5IAXA 4R4ZA 1Q8VA 1R1A2 2C24A 1GQPA 1LCLA 1V6JA 1AL23 1ENQA 1HRV2 3QOPA 5FO9B 2JG9C 2XUMA 4L8QA 5DG1A 4I2OA 3AVRA 4G4FA 3DPRA 2ZGQA 5I0DA 1ULCA 2NLRA 1NQDA 2KA3A 2Y0IA 4L9BA 5BNPC 4JGYB 1UY1A 4N7UA 5HXMA 3VBOB 3ZFEC 3ZR5A 1JODA 5E6HA 4QKDA 5FUPA 4QU2A 3WG1A 3WR0A 2I07B 2TNFA 4BE3A 2JE7A 2F4LA 1CVNA 4UW4A 1W8OA 5IFTA 2Y6JA 5L7OB 4YW1A 4HKOA 5GLTA 3ZR6A 4OZXA 1OKQA 5LBCA 4I0BA 4ATEA 1K5MC 5IVFA 2VQAA 3ACGA 3S0MA 1ULFA 1LU2A 1W6PB 3C8XA 5HCBA 4D0QA 5A1AA 1SLAA 1D4M1 1H2KA 5ANNA 3I54A 1S2EA 3NJZA 3WZ1A 2OKXA 1DU3D 1IS4A 1I6XA 2AGSA 1VRH2 2DCKA 2VTXJ 3GJAA 3JB4C 3M3IA 4K1YA 2ZGTA 1YHFA 4XDOA 3OCPA 2OPWA 4ZONA 4ZU5A 5SV8A 5T54A 4RQPA 3R4DB 1OD3A 4PIXA 1AR83 2HWF3 3MUZ1 4CCEA 3BTZA 1OURA 2VR4A 3GBWA 5JPNB 1CAVB 2QE3A 5GZEA 1ULPA 2A3YA 3ZYFA 1ST8A 4B4RA 3IN9A 1NCRA 1XU2A 4QM9A 2Z69A 5A33A 5EYXA 4QQ2A 1ALYA 5FQ0A 3NVCA 4PI0A 1A34A 5EZWA 5BNNB 4A42A 2AYHA 4LBQD 1DQ1A 1UYXA 2CTVA 2IUWA 3MYXA 1V9U2 2R071 1WWYA 4QX5A 1S2BA 3VHPA 3O7OA 1AX2A 5FXWA 4BMEA 3OG2A 5HV0A 1G9BA 1HRI2 4WM8A 1R64A 2D40A 1V6LA 5FLIA 3WP3A 2XONA 3PLQA 2VD7A 2HWC1 2QZ3A 2PAMA 4B4PA 4F83A 5A70A 3V0AB 2MEV1 1X9TA 4Q4W2 2K0GA 2W9XA 1B35B 3PJQA 1RHI3 1X36A 1KJRA 4FPLA 4BDVB 1CN1A 2VOTA 3NL1A 1HKDA 1QHDA 4CPBA 4DRVA 5C9AB 5FUNA 3H3UA 4OI4A 4Z07A 4OHZA 4Y1UA 4LA2A 4RR3A 4KH9A 4OYUA 1LGCA 2WZR3 3BOWA 3E1F1 1EV11 5I0RA 1X8MA 2WDBA 3E6CC 3BI3A 5BYNA 4NUBA 1BBT3 1PNGA 2BGOA 1ZVFA 3CL1A 4LHKA 1IKPA 4XZPA 2XHKA 1QF3A 1CR7A 3K3NA 3I59A 1MZ6A 1PIV2 4BMBA 3NWKA 5CAZA 4CE8A 2VZUA 1R093 2HEYF 5FKBA 4FPOB 1PHMA 1SZBA 2D3SA 2HWB3 3M4FA 3UK9A 2B45X 4PF1A 1RMU2 5KXDA 3BU7A 4D8MA 3NRUA 5C4WC 2ORZA 3RRDA 4BM8A 2CHHA 4A41A 1UYZA 1HQNA 4JDOA 5AFEA 2FCTA 5FXZA 1ULDA 3INAA 3B7MA 3C7FA 3TBDA 5HCAA 5EJZB 4FAGA 3FHAA 4AFMA 4CA9A 4G3YC 4OUSA 1HX6A 3NJYA 2C9AA 4EV0A 2AZ5A 3D3AA 4QDRA 5AVAA 5AFBA 1DZQA 5T5PA 3PIGA 2YGLA 2GNTA 2OUJA 1NLRA 4JRLA 1GKBA 2VZQA 1WLTA 2XUEA 2RDQA 3J4UH 3VD4A 3SH3A 4OI2A 3VKLA 1I1EA 4XFHA 5LBEA 2XKOA 3VBHB 3OY8A 4K6BA 5C7GA 1O3QA 5DDJ2 3VBFC 2WRAA 1LECA 2IXJA 3DPRC 2ZACA 3LFIA 1OLME 4XHXA 4AVVA 3OEAA 3ZO0B 3I3MA 5EV7A 4WVWA 1YQ6A 3UKVA 1XNKA 1GQHA 1WW7A 5KC5A 3WW1A 4IESA 1W03A 4XFAA 4E27A 1W6OA 1MPXA 4PT6A 1RUF2 1ZZ7A 2GMEA 1UO9A 3H3ZA 3OEBA 4HK9A 4AYUA 2WZ8A 5F5CA 1D4VB 4YRDA 3OF1A 1H6XA 1UY2A 4Q4Y1 3MLJA 4PI2A 4M3CE 5A3WA 1PO22 4K21A 3I2GA 2ZZJA 2EIDA 1LR5A 1QNWA 1UZWA 1XJAA 2XWBB 3VD7A 2WYSA 2ZX3A 1CONA 2DUPA 2JDMA 2LM3A 4DB5A 4TZDA 1O8SA 4XCAA 5FLJA 2E31A 2Q8EA 1AX1A 5C5TA 5GLWA 2OZJA 1ULGA 3D0SA 4RQPC 5FR3A 1NT0A 4BXFA 1EUUA 4UYBA 4D6RA 1K45A 1MZFA 1RUD3 1WA6X 3OSDA 4LBNA 1AF9A 3OJBA 4CXWA 2PFWA 2W1SA 4QM8A 2JDZA 4HKLA 1QJU1 1NCRC 1BJQA 5T50A 5A3OA 1VBE3 1SG3A 3KGZA 3OGGA 5FJKA 1G7YA 4IEPA 1JZ8A 2FMDA 2VNOA 3UT0A 4OQ8A 2UWAA 1VR3A 1GR3A 4C90A 1J84A 4LORA 1Z7S3 4R9CA 2V72A 1W2TA 3IKWA 4M0HA 2DWRA 2FQPA 4HG6B 2Y6HA 3CJIB 3FWEA 4QGNA 1NCQA 1YYNA 3C7GA 3ON7A 4HXCA 3P6BA 4MHRA 3W5MA 1TE1B 2RMU2 4MGKE 1W9YA 5FLHA 1QU0A 1VP6A 3AJYA 4AWDA 1MQTB 2PQQA 2PAEA 3RZJA 3MI8A 2QFEA 4QX0A 4XF3A 3VN4A 2NYYA 4DY5A 4COZA 2HYKA 3R05A 4BPZA 1O59A 3P1IA 3RYRA 3B02A 1HQWA 1G9CA 1H1AA 2RR13 3PHMA 3FJSA 3AZYA 4N43B 4R8HA 4JCKA 2CGNA 3ZN4A 5EYYA 3WNMA 2WN2A 4AK3A 3NQHA 5HCFA 4LNVA 1YQ5A 3T08A 4TSVA 4FOWA 1NZIA 4DIQA 2R043 1UW8A 2ZXQA 3L2YA 4AEDA 4HPKB 4HFSA 3GHMA 3W21A 4A44A 5EHDA 2D6PA 2GP3A 2QUOA 2WA4A 1OH3A 3MIFA 2A71A 4KBZA 4XDQA 5DZEA 1V6NA 4XDPA 3BKZA 2QBXA 4UI9L 5DUUA 4OZOA 1ND2C 3NJXA 2CGPA 3F2ZA 4AI3A 1QQP2 1QJEA 2ZAAA 3K46A 3K77A 1NLSA 4P08A 4Y20A 3CIHA 5CKMA 4NE9A 4KGGA 5FBZA 3TEYA 4XJZA 2V5DA 4L92A 3RMXA 3BPSA 3N9OA 1NA1A 3HNBM 4LA3A 3JZVA 1OQEA 3HQRA 3LGRA 3JXSA 2YV8A 1EPZA 4IE4A 3SCHA 1GQGA 4YM1A 1UZYA 3OB8A 2RS33 2ZOEB 3HN1A 3MUY1 2G19A 1KITA 1HQLA 3OPZA 4ZS3A 5AC92 4CXXA 2J1EA 2WS93 4XACA 4LPLA 3URFA 4K8RB 4BK4A 3BB6A 2VBDA 1LHVA 2KD7A 2LTNA 3A7QA 3PL0A 2ADDA 2HWE1 3MPPG 3T2TA 3AZXA 2Q30A 4LO8A 4LOTA 5FZFA 3H8XA 2JDKA 1AX0A 3B01A 4CRQA 1QMJA 1ZBA2 3AXEA 1COV1 1UD1A 4B3NA 1C3HA 2XOMA 3LQCA 3ZIXA 2ILMA 1SPPA 3O5SA 5D21A 4CP0A 5JI9A 5JXIA 4CDUC 2PHTA 3OBRA 1QJY2 3CNAA 5IAVA 3N9PA 3U07A 1RUI3 4XCBA 1GLHA 3ACIA 2YROA 3K4AA 4ZHNA 2EIGA 4NHXA 1VMHA 5FY8A 4EWEA 3LD8A 1HLCA 4CUAA 3T30A 1VBC2 4Y22B 2P4EA 3N9QA 4FSJA 1AR73 2GU9A 3UV9A 2IXKA 2JG8B 1JYXA 1AYM2 3MIHA 3FC0A 1GUIA 3ATGA 1OBNA 4I3PA 4QB1A 3KM5A 3PTRB 4E2SA 2ORXA 2IXLA 3KT7A 4CDWA 1ZZCA 2JB4A 1R1A1 4XMAA 1UYYA 3CLPA 1Q5OA 4AW7A 2QZ2A 4DUVA 4UBHA 3APBA 1HRV1 3MFAA 2R1DA 3VZJA 4BIOA 2BBVA 1NXD1 5J09A 1C1FA 3ZFFA 3AYDA 5FZOA 5LBBA 2R49A 1U5IA 3DKQA 2VMDA 3L2HA 1YCIA 4LBLA 1AR63 3H9AA 4Q1RA 4CDQA 4BQ3A 4I0WB 3OUHA 1NKGA 3GCWA 3IDBB 5FMOL 4XIOA 1PVC2 2A6XA 1WCKA 4XAAA 4JX0A 2PHLA 1JYCA 1LJ7A 3ORJA 4QXHA 3JBG2 3TAYA 1C8NA 1ZA7A 2A3WA 4Q29A 5FZ3A 1W04A 2LS6A 2Q8OA 1ZRFA 2R062 1EAH3 5FZ7A 3DYMA 2ZGRA 4AVSA 1CESA 1X33A 3C7OA 4AVCA 5T55A 2VW0A 2DYCA 1G86A 4R9AA 1XNCA 4BWOA 2ARCA 1VRH1 2ZJCA 5IW0A 4DEVA 4IERA 4I01A 1N3PA 1UX6A 3MEPA 3DGTA 3GDBA 3WHTA 2V4VA 3OYWB 4QKBA 2DBIA 5LBFA 3BCWA 1VMFA 3O1OA 3O12A 4XETA 2VY0A 3TEZA 1FMD2 4BQWA 4FFHA 4CCKA 3ZXEA 2VMFA 4QHOA 4QHZA 3KB5A 1IS5A 3ELNA 1QJX2 1L7QA 1W2OA 4Q4V2 4RYDA 1GP6A 4AEDC 2BV4A 1GBGA 4XJ8A 5F2WA 3H1WA 1H8TA 1V9U1 2VOWA 4FPHA 5IWFA 1C5IA 2XGXA 5TSWA 1HRI1 1WUVA 5FY7A 3DUIA 2VGDA 1BEV2 2XH6A 2BWAA 5FZ4A 1JMUB 1I5ZA 1XU1A 4GZ9A 1PGSA 4A6SA 2YUEA 4Q4W1 3ZYHA 1ZNPA 3BIEA 3DV8A 4YVSB 1VBD3 3KS7A 4AFBA 4QPGA 1NA1C 1A78A 2CU5A 2KR2A 2ZAHA 1VMJA 2EXIA 3BTYA 4LO5B 1X82A 1Z0HA 5I0UA 1DDLA 1ODNA 3WQ7A 5D2AA 4XJWA 5A3UA 1SFNA 2BBAA 4MXWB 3VDDB 1Y9GA 4O9EA 1WLWA 2JD9A 3ZN6B 3ZMNA 4EYUA 4CSWA 4K7JA 3LF7A 3QCWA 2J1SA 4YZ4A 4DINB 1PIV1 5ABJA 3RSJA 4GJZA 3ETQA 3IM0A 4HSLA 4HETA 4MO3M 3MF9A 1ND3B 3LEMA 4QGMA 2NZ9A 2WN3A 1WBFA 1RMU1 1QIQA 1QH6A 1WD3A 2FDHA 1OF4A 1VBB2 1WMDA 3WINE 3AKQA 1S1AA 1VAVA 1W8FA 4YGEA 4E9KA 3G7DA 4E8CA 1N1YA 4LKEA 1POQA 2XJPA 2VMIA 3HMYA 2BVBA 5LA2A 2XJTA 3AVSA 3KCCA 5KHHA 4FVVA 3I7DA 2XJQA 4JHZA 5D8AB 3MV01 1RUG3 5FZIA 4DUWA 4IGOA 4QPIA 1BCXA 4AVTA 5HV4A 2VCMA 1HB4A 1WLDA 1UYPA 3E6DA 1KEXA 4BXSV 4CEWC 4MHUA 2IC1A 2ZMLA 1QOSA 1AXZA 2K46A 3N9LA 1AYN3 5FRAA 3WNXA 4ZZ8A 1BK1A 3IDAA 3ILFA 3RWNA 4CTEA 4CDWC 5K9YA 3NNJA 5DDJ1 4WM7A 2YPDA 5FYZA 2BRTA 4BZ4A 2BJSA 4FI9A 4FT8A 1GOHA 1DQ0A 1KFUL 3HD8B 4QU1A 4HN1A 2YC4A 2XJRA 3ZFFC 3JD73 1GWKA 4OHVA 5J1XA 4QKFA 5JZGA 4FPKA 4B29A 2YPJA 3MIBA 1UY4A 4L2NA 3VBSA 4CDQC 3KHBA 3LEKA 2ARBA 4XBQA 4Q27A 5FTTC 1AJKA 4ASMB 4TLGA 2XB6C 4LMFA 2FBEA 4NHKA 1PM4A 5M0TA 1W6NA 2WQ4A 3J7MA 1PK6A 1UNBA 3THPA 1PO21 5I91A 3J8F2 1MS1A 3NJVA 1H1IA 2WNUB 4YVWA 2W68A 2H0VA 3I3EA 2ZEXA 3KLSA 4DUXA 2BOJA 2YHJA 3TRSB 5LW9A 1TQ5A 1AR92 2DFCA 2HH9A 3U4XA 4RS5A 5DQ0A 5LRSA 3WDUA 1GYKA 3LIGA 1ENXA 4FPGA 2GNDA 1XSQA 1MEC2 2ZX2A 3THCA 1OQDA 2H6CA 2MPFA 2RS12 1X50A 3KZ4C 4PQQA 1H2MA 1TNRA 4GB33 5SV5A 3WCRA 5I0SA 1PO13 4GAZA 4KBBA 3VZLA 4KI5M 2NP0A 2ZGPA 1H8TC 5FXVA 1RUH2 4XJ9A 5DN2A 1C8M2 4AGGA 1SMVA 5JDBA 4XF9A 3WP6A 3AC0A 1W0PA 2DTWA 1T6BX 1UOGA 2B9VA 2Y6GA 1K3IA 4RL7A 3RMYA 1JN2P 3NW4A 5K0UC 1CAWA 2YB7A 4ZY9A 2WYFA 2X05A 4NIAA 2RMU1 2XL9A 3DYPA 3A22A 3WX5A 3VB9A 4AOCA 1TME3 2P3YA 3K3OA 2Y6LA 4D7YA 3O1UA 3M2MA 4K1ZA 3E6BA 1U12A 2XLGA 2ZEZA 4HMZA 4J25A 3ZVXA 4BA6A 1QH7A 5HXVA 3H0OA 4YLZA 4CDXC 2DTYA 3AP9A 2CWMA 2W94A 4YGDA 4YARA 3VBFA 4Q4X2 1HB1A 2AC1A 5GZDA 3D6EA 1W9FA 3WUDA 2X09A 3I2KA 5ABJC 1N47A 2UWBA 2YBPA 3VZNA 1K5JA 3OBAA 1CQ9A 5DAPA 1W8NA 2GC0A 4C1WA 3ZYRA 1ODMA 3WQBA 1J59A 1SLLA 5JIUA 2RJLA 2AEYA 1GNHA 1QQP1 2YYOA 3FHIB 4EN0A 4MG2A 3WDTA 4LO6B 3MIDA 1RUJ3 1REEA 3PUHA 5KHKA 3O1SA 2QJVA 4OMDA 1LHWA 2VMHA 3S7EA 5KC6A 3T3YA 4XJAA 4BQ4A 2JDAA 5C6CA 3ASIA 3AXDA 2BERA 3VBRA 4QPIC 2E33A 3LDKA 3POEA 1HDKA 2IVIB 2UURA 2EXHA 1XOYA 1OLQA 1WLCA 1WW6A 2D44A 5A7OA 3AMQA 1JTZX 1Y4WA 1D2QA 1RINA 1NZCA 2YG0A 5E8AA 5A7WA 5K8SA 4UFMA 4YM0A 1RC6A 3MIGA 3PU3A 2P6HA 2RE9A 5C4WA 1GZWB 4WM7C 2VMEA 4KWKA 2WA3A 3N4MA 1I5PA 1O4ZA 1QDCA 1T6GC 3IMNA 3KV6A 3DCQA 3LCPA 4KG8A 4DXRA 2PHDA 2GDFA 4PIYA 1Y9QA 1ZBA1 2WFF1 2QQKA 5CNAA 4DXZA 1XB9A 2VCCA 3VBSC 1CD3G 1NCRB 4PLNA 3WF2A 1JBCA 2OA2A 1CWPA 1KDMA 2WWJA 3HBKA 4LE4A 4LLFA 1ZRRA 3G6JB 5IVVA 5FQ0B 4DMIA 2HLEA 3AZWA 1IG3A 3O14A 3SITA 3VHNA 1SQ4A 1QJY1 1PGW2 2VE1A 1CPNA 2W2IA 1GFF2 4LHSA 4ARYA 1ZBE2 3I49A 2GZWA 4WM8B 2SBAA 1PK6C 4GKYA 4AI8A 5FMDA 4YW3A 2UWCA 4HVRA 3GZAA 1H6YA 3VBUA 1VBC1 4CUGA 1UY3A 1TMF2 1UY0A 2YFZA 4GJYA 4YVWC 2DVGA 2C9KA 1AYM1 2WT0A 3RFRA 4GH4B 3VHOA 3ZSLA 2WQ8A 4QB6A 2DF7A 4RS5C 3ZKUA 4FAHA 2ETEA 5CFCA 3WHUA 5FY5A 4NHYA 4RR3B 2PLV3 3CJXA 4KU8A 5BNOA 4I0AA 2P37A 5FO8B 4W65A 2XWJB 1IPJA 1LOBA 1YUDA 2VOXA 4FXKB 4MYEA 1H9WA 2WABA 2CV6A 2ZX4A 1AL22 1R083 5JI7A 5JMCA 2VZVA 2I2SA 1JZ5A 2PHWA 1O6UA 2VZRA 3LEIA 1W6QA 4GXLA 3I59B 2BQPA 4D7TA 1WCDJ 3ILRA 1PVC1 1KRIA 1QJZA 2XJSA 5FZCA 3Q9OA 4E4HA 1QKQA 1NE4A 1RVF3 3JBG1 4UFLA 3NAPB 1ZZ6A 4BQ1A 4YG0A 1OD5A 1VRH3 2BTVC 2R061 3WNPA 2WINB 1BZWA 3WW2A 4QQPA 3ZYIB 2A6ZA 2IXIA 1BVP1 4JQTA 5LB6A 3KQ4B 3WQ0A 1ASJ3 5C8CB 3OGJA 2ZA9A 4N53A 1DYPA 1AXYA 3WSOA 5A32A 1DGWA 3H50A 1HJFA 1MS3A 3K51A 4NMIA 1X7NA 2P3JA 4CYDA 3J7LA 5EQUA 2JD4A 1SCRA 2TBVA 1J1LA 2VU9A 2EXKA 4B4QA 1FV2A 3JQXA 2UYAA 3LKJA 2W39A 4J1XA 4QKNA 3RI9A 4UF0A 4MX3A 1FMD1 4KWLA 4P9JA 3SCFA 2HWF2 1AR82 1JH5A 4IE0A 1DQ6A 1S0DA 2FZ1A 2GP5A 3E5QA 2FDGA 2AR6A 5F5AA 2HEWF 3H8RA 1W8UA 4YNIA 4Z8BA 1QJX1 4Q4V1 1JZ4A 2GN7A 5FDBA 2FHRA 4IE7A 3OGSA 2A6VA 2EICA 2ZKNA 3H7YA 4ISQA 4JKMA 2AEZA 2P2KA 1DQ4A 1V6OA 1WGPA 1MVEA 3FLPA 3MW2A 2QQMA 4FCAA 3N35A 4JKKA 5JWPA 4Z92B 5IT6A 4XABA 1W0OA 4M00A 4HZFA 1VAKA 1BEV1 4E4ZA 5LRRA 2LW8A 1SFYA 2C5DA 1PX3A 1Q8SA 3IMMA 3M7AA 3Q8EA 1LOCA 4WZCA 3KVAA 3I2DA 4QPYA 5E89A 3Q8AA 1QNYA 4NIHA 1S0BA 1KDKA 2R7EB 2PMWB 3POIA 4HL0A 4UWDA 1A6CA 2RM23 1OXCA 1RHI2 2W08A 3NV1A 4L0PA 3VBRC 5IK4A 1H8VA 1ZZ8A 2GAUA 1HXS3 5A3PA 3V65A 3VZMA 4H55A 1VBA2 3ZFGC 5J36A 4QX3A 3DYOA 1JYWA 4JRAA 1QEXA 3LE0A 4JGYA 5L19A 1H0BA 1OA4A 3MPBA 3AMNA 3VBOA 1ND2A 2D43A 4AI9A 4E4DX 3Q8CA 1MS0A 3BYWA 4BK5A 1CZTA 1BBT2 1F31A 2XBO3 1DZRA 2ZEYA 2Y64A 3JUUA 4HN0A 4PDWA 4QXBA 4CEYA 4N8MA 5F7UA 5FREA 3ZPYA 4RSUA 2DDUA 4O7XA 5L7OA 4LJHA 2EIBA 3ZYJB 5J48A 5LEKA 4XUQA 3JCIA 4P02B 1W6PA 1KS4A 1VBB1 4UAPA 4G9SB 3EO6A 1R092 4K3UA 2HWB2 4CCNA 3W20A 4XVHA 4CP9A 1LKNA 2LROA 2WAAA 2X5IB 4MGIE 3IDEA 5A7NA 1GNYA 4IEWA 3LB9A 3VKMA 4MH0E 3AKRA 1OPMA 1LULA 1TG7A 2K2SA 5CU1A 2TUNA 2QVSB 3ECQA 4P9GA 3D4KA 4Q0UA 5G05L 3S6PA 1JZ3A 4COWA 4H2AA 5FOBB 3QD6A 1WZXA 4CVUA 3VBUC 2QQWA 3KT1A 5DDJ3 1NCQB 1RITA 4LUMA 2W47A 4WVMA 2Z42A 1YQ8A 3NSTA 1BMV2 2UY8A 1J3PA 1UXZA 3N36A 3SLIA 4Z2WA 4Y24A 5C3OA 5T52A 5LCWL 3VDBA 2B42B 3IPVA 4W6YA 1PMIA 3ZXKA 4AVAA 2Q4SA 3FN9A 1E57A 3SKJE 3HT2A 5CFCC 3BIWE 1S2KA 1LHOA 3MW3A 4FOVA 1G9FA 5CKQA 5BNOC 3FX3A 2RHPA 1DYKA 4CDUA 5FCCA 1ZZBA 3ZXFA 3KV4A 4JV4A 2UU8A 4QHBA 3V0AA 1CAXB 1XYOA 1HN0A 5FZDA 4XJUA 1B35A 3U75A 5IVBA 1LHUA 2R32A 2D98A 1WW4A 2VULA 1P8JA 1RXGA 2VOVA 2D5FA 2A6WA 2XHNA 3TYJA 1PO23 4HKWA 4XFGA 5F2SA 3EHKA 3VLBB 5FPLA 3SNMA 2QNKA 2OVUA 2EIEA 3A21A 3AM2A 3IAQA 3LOIA 3TN91 4EQVA 4CP2A 3LWCA 3L9JT 4YZ3A 3OTFA 2ZS6B 2DCTA 5I0TA 5ACA3 4B7KA 1FT9A 3ZSKA 4YFZA 4XFBA 3J8F1 1UZ0A 4Q5OA 4NWVA 1UCXA 3C2UA 5CADA 2E9QA 5FYHA 3MFCA 5LY2A 4QXCA 4N53C 3M3CA 4GWJA 1AR91 4LHNA 5FPUA 4XF0A 2WNVB 1RUC3 3POYA 2Q1FA 4K9SA 4LEJA 1LODA 1PX4A 4GQ7A 4P00B 3THTA 5B4NA 4DNYA 2GC3A 3OUJA 3SISA 1MEC1 4D7SA 3B93A 2RS11 2KM2A 2PHFA 4Q2FA 3IIIA 2O8OA 2QDRA 1D0HA 1HIXA 3O1RA 4UW6A 1W6MB 1IPKA 3UJOA 3VD9A 1RUD2 4XHBA 4BJ0A 3THDA 2FD8A 1BHGA 1ZRIA 1U5XA 1J83A 1OOPA 1RUH1 3TNPB 1MS4A 1FOD3 3AFGA 4XXPA 4EWDA 1VBE2 1YFWA 2VECA 3CBNA 3EBRA 3HT1A 4R4XA 4NOTA 1DP0A 4XOGA 5FO7B 4B7EA 3U37A 1UMZA 4SBVA 3CKHA 4ORFA 4GWMA 5L36A 2CAVA 2HWD3 3MV11 3I97A 4M4PA 4COUA 4BB3A 2VJXA 2Y34A 4NN0A 3S5QA 1YEWA 1H4GA 4GMP0 5BUVA 3VBHA 2GALA 4ONUA 4X6QB 4HOOA 5A7QA 4GKXA 4O61A 1LNSA 3NV2A 1RB8G 1F5FA 3GHNA 4P9XA 1NYWA 4S2HA 2VQTA 3E5XA 2VTXA 5C5UA 3GNEA 3K75B 2NQYA 4FFGA 4LT5A 1UKRA 3ES1A 3A0NA 2BDRA 2YC0A 2HYXA 2WZEA 4Z82A 2ZHLA 4QPWA 3V64A 1XE7A 2BOIA 4JGYC 4XIKA 1NG0A 1HW5A 2VC9A 1V6IA 4Q4X1 4QX8A 4XUTA 5F5QA 3VBOC 1FX5A 2VMCA 5EJ3A 2RR12 2BFUS 4PDWC 2GMPA 3MLLA 4CEYC 1A8DA 2OYZA 4EE2A 2QKDA 3PVEA 5C8WA 5L7OC 1GNZA 1JU4A 1QXPA 1WMXA 2C6SA 2QQOA 4GMP1 5DXDA 2R042 3LEGA 2GH8A 3ZLIA 2XKPA 5FZOB 4YW5A 3ZFFB 4C1XA 5FYYA 1W99A 3SMHA 5E1RA 2QCSB 3T0DA 4NIDA 4D6QA 4LKSA 1LOFA 1XE0A 4CDQB 3OPTA 3U78A 4AI2A 1APNA 3BGAA 1NY72 1GV9A 3KF3A 2JDUA 2XQRA 5BV6A 2AUYA 1LESA 2Q8DA 3USUB 1FPN1 3ZM8A 2JECA 4IV1A 1UIKA 1X8EA 3MBWA 3RZLA 1LAJA 5F1RA 4QWNA 4YM2A 3LAGA 3PNAA 5FBJA 3DL3A 4V2WA 2D93A 5H9RA 4FOQA 4LO7A 1RUE3 2PQSA 5BNNC 1YIPA 2RS32 4IE5A 2RVAA 3DXTA 4XW3A 2ZGSA 3BALA 3KT4A 2WFF3 4TXWA 3S30A 3KWVA 3GF6A 4XF1A 3AB0A 2WS92 2VW1A 4AGRA 5B4XA 5L9BA 3RZGA 4NRMA 3RZMA 5GZCA 2G1MA 2O8QA 3CDZB 1B35C 3NV4A 4E2GA 2W3JA 4XTMA 5BNQA 2XJUA 4AHZA 4IXLA 4A7ZA 4F8AA 2VQUA 3OUIA 4QX7A 3WVJA 3ZSMA 3PMEA 4CEWA 1N1SA 3B00A 5C9AC 5I93A 1DBNA 5JPMB 1PGW1 2YY1A 4OUEA 1SLTA 1IGOA 1ZBE1 3LDBA 1O7FA 4DQAA 5JXJA 2D6NA 2HBTA 2D5HA 4C91A 2WR9A 4YSFA 2JXAA 5IHRA 4N43A 3Q8FA 1BK0A 1RUI2 1TMF1 2IZWA 3IWZA 4KWJA 2CNAA 4OHWA 4P5YA 5FZKA 5HPOA 3P3PA 1W8TA 3J9SA 4QPGB 4UT5A 4XILA 5F9TA 4HPKA 3J7NA 3ZN5A 4LBQB 3GCXA 2DVDA 1AR72 4OHXA 1POV0 3KF5A 4YZ1A 4A7YA 2VZSA 4QAWA 4YW7A 4D69A 3U0ZA 3AP7A 3C7HA 3PURA 3LSEA 1YFUA 5CB7A 1MZEA 1QXJA 4IEZA 1D4M3 3WXPA 4YW6A 3NV3A 1AL21 2WNEA 2ZHNA 3BUCA 5C3SA 1BKZA 2TEPA 3POBA 5L73A 1OQ1A 3ST7A 1OOPC 5A3NA 2JKBA 2V09A 1T2XA 3HWJA 4I30A 1D2SA 4QD2A 4MZUA 5ABJB 1Q8OA 1BYHA 1MS8A 4M0NA 2EXJA 3D8CA 4H14A 4N7IA 4B1MA 1UMIA 2RDSA 3T1LA 3SCGA 5K7PA 1AR62 4QDQA 3RNSA 1O91A 4GWNA 4BHPA 4BCUA 1W2UA 2JEMA 2WO3A 3I2FA 3POFA 1JZ7A 1CGPA 4HT1T 3M3EA 2JJ6A 3O0WA 1O3RA 2V4AA 1POV1 5T5LA 4ZU7A 3PUQA 3VBHC 5JLVA 5CFDB 4JVAA 3LDRA 1O4TA 2R073 1EAH2 1AXKA 4PLMA 1GP5A 1W9WA 2X53S 2Z4FA 4ZS2A 3RDIA 2B46X 2ATFA 1VLNA 2P3IA 2HWC3 1DZTA 5T5JA 1QJX3 1YFYA 4CZSA 4FBFA 2ZTNA 2CAUA 2MEV3 2ID4A 4QPIB 1JYIA 4OQ9A 4FTBA 4COVA 2QQJA 1ZA4A 3M3QA 2HWF1 1AR81 1M4WA 4AF9A 5GALA 2RDRA 4U2AA 1WW5A 1RL3A 3T0BA 1TEIA 4FPFA 4JQRA 1EY2A 4X8NA 4C0BA 4Z1VA 5LASA 3FBYA 5K0UA 4JC1A 2EA7A 5A7SA 4COYA 4DXTA 3H42B 1EV13 2C4XA 5CBLA 2PHRA 2Z2SB 2G9GA 2XQXA 3UKTA 1S0EA 1PGL2 1C5HA 4CU7A 1NAEA 1LOGA 4Y22A 2A1XA 1VB2A 4KU7A 4S2DA 2D97A 5JR7B 5ANQA 4AAPA 5JZGB 1JHJA 3SXWA 1FYUA 2ARAA 3GZUC 2JG8A 5F37A 5F3CA 1CAUA 1LOFC 2Q5TA 3TEXA 4AZZA 2L9LA 2E53A 2RS52 3ME2A 4IQPA 4LBOA 2ZABA 4CDXA 3WOGA 4N9IA 1S0FA 2R1BA 4MGTA 3D82A 1RHI1 1VBD2 3AJZA 3CZUA 5FYVA 4NIIA 1GOGA 1JUIA 4U36A 4Y5SA 1JHNA 3LSDA 4IV1C 3HNYM 4M3CB 5CIRA 1A8MA 1PK6B 2AACA 5FY9A 2W5FA 1VBA1 3ALQA 1C57A 2UYBA 3UGFA 5BY5A 2HEVF 2QQPA 1K42A 4RHV2 2DCJA 2DVBA 2ES3A 3PUSA 5FYCA 2D3PA 2CYFA 2JG9B 2W0XA 2WUHA 4Q1PA 3WV6A 2XXZA 4E8DA 4IL7A 3ZXDA 3OD4A 4TTGA 1ZZ9A 2W91A 1BBT1 1HJGA 3AX4A 4TYSA 1VRBA 2VXJA 3TNQA 1N1TA 3CJIC 5BNPB 2EAAA 4V2VA 4HLTA 4NR1A 2X10A 2BP6A 1DQ2A 2QQIA 4AL9A 3ZFEB 4DRRA 5JOZA 3T4VA 1FXZA 3I8TA 2OQ7A 3T1MA 3I2JA 1R091 1DHKB 2HWB1 4FQ4A 1MQTC 1S0CA 5JCTA 2VM9A 2XVGA 5L9RA 2ZMNA 1K5MB 3CEWA 4LOSA 1F4AA 1IQDC 3OYWA 4ITCA 4CP1A 2J1UA 4A3ZA 3X29B 2P17A 1W8HA 2GC1A 2C1FA 4N43C 2PXJA 2Q1ZB 2WFPA 2YU1A 1JZ2A 1D7PM 4V1PA 3ITQA 5EIYB 1BMV1 1E5RA 1RUG2 3UGGA 1MZ5A 4LO4B 5FYSA 1H2NA 2ZEWA 3FHQA 2FCVA 4ISRA 3N7KA 2ZGMA 4Q4Y3 1AYN2 2GMMA 4XURA 1WD4A 1XYNA 1W2AX 1RUF1 4KNCA 2GC2A 4D3WA 4WBBA 4ET7A 4HK8A 1MACA 1ULEA 1CX1A 5DABA 1WKYA 3RYPA 4YVSA 3EYPA 2VQ0A 1OKOA 1VIWB 2E51A 1Q56A 4S2FA 2YFUA 2BGCA 5F3IA 3TN93 3WP5A 1UU4A 2VZ1A 3BTAA 3JD72 4PCRA 2VNRA 2Z79A 2W1WA 4WV8A 5IJRA 2D6OX 2VBPA 4WVZA 1YQCA 4FP3A 4KGQA 4I09A 4MGQA 4WVVA 4ZKTB 1DQ5A 2Q1MA 4MXWA 1QJU3 4QQHA 3LZZA 5EWSA 5IUQA 3ZXJA 4DXSA 5C3PA 3EXUA 5J98B 2GNMA 1LU1A 4CUCA 3HEIA 1JZ6A 2OT7A 4IE6A 3HAGA 1QJFA 1NLQA 4MUVA 2Q8CA 1WBLA 4LXLA 3GXUA 5A80A 5DPNA 3WUCA 2XLFA 1QDOA 4PBPA 5FYUA 4XFIA 3H8OA 3GBGA 4UOJA 3R4SA 2DVAA 4PF5A 4RFT0 4DEQA 3K4DA 1NXMA 3RGBA 4LK6A 4EWAA 2P6CA 4GULA 1RUD1 2OIIA 3IBMA 1OHFA 2LRPA 2VVDA 1NUKA 2NM1A 4YG6A 4GB32 5C4WB 4AVBA 4OI1A 3DF0A 1O8PA 2VCAA 3DN7A 1Y7BA 1VBE1 2JIJA 1PO12 3N7LA 5D8AA 2B9UA 3LPGA 5CEHA 1WMFA 4CU9A 3HIFA 3NKTA 4AFDA 4NIGA 3V0BA 1H9PA 2IVJA 3AMHA 5GLZA 2DV9A 4C8DA 4X6RB 4QX2A 2A5ZA 1PZ7A 1PVXA 2JG8C 3CF6E 4MXVA 5GLVA 3KHCA 4H3WA 1H4HA 2FDKA 3FE5A 1CIWA 1UZVA 4RN5A 5D1IA 4R9BA 1UF2C 2W46A 2YDEA 1YNAA 2DUQA 5EJ1B 5FZMA 5KXCA 2JDHA 1AVBA 2ZGOA 2GN3A 3GYDA 4LKFA 2F6BA 1UOJA 1I3HA 2VNGA 3J26N 1C4RA 2H6BA 1VALA 2P3KA 2NPIA 4FPCA 4W6WA 5DAWA 3WDWA 3ZOIA 5KBFA 3BTXA 4JZRA 1TME2 2GH2A 5FKCA 4IV3A 2JENA 5JVVA 1J1TA 3W9AA 5FZ8A 2VH9A 2B39A 5FP8A 5FK8A 1RUOA 4I02A 2IXHA 1REFA 1QOOA 2E6VA 2ZHMA 3MHZA 1U5YA 5FZ9A 4NO4A 4GMP3 1URXA 3DPRB 1VJ2A 2RR11 2ZKLA 1OA2A 3B69A 3HBZA 3V56A 3NO8A 1JW6A 2B5HA 1J3RA 3E97A 3AP5A 4YW4A 1JYNA 2DVFA 3HJRA 1IS3A 1K12A 4DOUA 2BPA2 3I4IA 4JGZA 4IEUA 5DUVA 3AZVA 2J42A 3ZDSA 3KV9A 3N9MA 2DU1A 1LTEA 2VZOA 2WNUA 1FPN3 4QT6A 4CCDA 3K2OA 3RVHA 5FOJB 2HWE3 1W3VA 3C3VA 1Q43A 2PA7A 2R6QA 1W6QB 2EALA 2XL7A 3ZFGA 5AC91 3HVDA 2A3XA 5FPAA 2VMGA 3ZX7A 1YI7A 1IS6A 1RUJ2 4PJYA 1COV3 3AL5A 5FZEA 4B1LA 3WY6A 4QDSA 4IDZA 3RS6A 4RQPB 5C3RA 2LUWA 1GZ9A 4JTOA 2E7TA 1SLBA 2RJ2A 4URTA 1KFXL 3N7MA 1W28A 4A2UA 2RS31 5CYYA 2YBSA 4GIQA 4YZ5A 3FUQA 5A3MA 5LWBA 1GP4A 2YC2A 5A33B 4DO0A 5FMCA 3AFKA 2D6MA 5GJ6A 2WS91 2X29A 1F5JA 4ASKA 1XBFA 3FFZA 4UXAA 5A7PA 2W52A 3VD3A 2QTWB 3ABZA 3OD0A 3LIHA 3I3QA 4YVSC 2JWPA 3S5AA 2Y8KA 2Y60A 2XPJA 1UPSA 3W59A 4AEMA 3ZMOA
chains in the Genus database with same CATH topology
1R1A3 4QMAA 3JB8A 1HRV3 1QY4A 5J96B 1REDA 4TWTA 3VDDC 3WDXA 4Y4YA 3RG0A 3RJRA 1RUNA 2O0OA 3USSA 1U5ZA 5GZGA 1O3SA 3HQXA 4BH9A 5HBAA 2SLIA 4AQSA 2ERFA 5DZGA 1ND3C 1H2LA 1AR71 1NOVA 2K9ZA 4PLOA 4SLIA 5IK7A 2IXCA 4PIZA 2BWCA 5FFOC 3H7JA 2PLV2 4LTAA 1ND2B 2A75A 1O4YA 2B7YA 2BNNA 4K20A 3VZKA 2DURA 2WLPA 5D8AC 2ZGLA 4F8AA 2WSUA 1R082 4PDWB 4CEYB 1POV3 1YLLA 1AR61 3IIAA 3MF6A 4I3GA 3MZHA 4GA9A 3FZ3A 1ONAA 1V00A 1IQAA 2AH2A 1LENA 1MS9A 1RVF2 5JOXA 4AG4A 2KXLA 2WZPP 4L11A 1LRHA 3KCYA 1GZWA 1V9U3 4XXAA 1EAH1 5JAXA 4OI0A 4JAAA 3ROUA 1HRI3 4MVTA 5C33A 3B94A 5CA6A 5JSRA 4MGYE 2ZMKA 1ASJ2 1B09A 3SH4A 3OY8B 1DIWA 4IV3C 5F6LB 4Q4W3 1UL9A 4FPJA 2NMOA 4WVMB 4FTSA 3VKFC 3WDYA 4LR4A 2ZGKA 4C0HA 1XE8A 1FI2A 4FXGB 3IPVB 1ZRDA 4L97A 2Y0OA 4QQOA 3KQRA 2VUAA 2WIIB 2XG3A 1SBFA 4JGZC 3LOBA 1PGL1 3AZZA 1BXHA 4CDUB 4EN6B 5I8YA 1W6OB 2WNUC 1YRZA 5KHIA 3JU9A 1S0GA 2WKKA 2CGOA 4EJRA 2RS51 4GH4A 1PIV3 5IK8A 3BOPA 1J58A 2IFRA 1VBA3 2BNMA 3FBMA 2WJSA 1L3JA 2WZR2 2R30A 1VBD1 1RMU3 1XXNA 3FLTA 1LOAA 3IDCB 4MV2A 2O1QA 4AI0A 4EN8B 4B8EA 2CL2A 1Y43B 1ZRCA 2YGMA 2RM22 2FZ2A 4RHV1 1HXS2 3O0VA 5DG2A 4XE9A 4LULA 2I74A 4AXOA 1KJLA 4LLOA 3NAPA 5IK5A 2BYVE 1CJDA 3FMGA 1Y3TA 1YO8A 4P5HA 3R4UA 2V5YA 2ARXA 5CG8A 3H1MA 5DUWA 4RD7A 1UIJA 5FMOS 2XBO2 4TLFA 1CAVA 4FP2A 4BLIA 1AZDA 1RIRA 2ZX1A 5C8CA 2PHUA 4AFCA 1EPWA 3QH6A 4P14A 2MHFA 2ZPXA 1WA4A 1OOPB 1PM7A 3POSA 3ZXLA 5BNNA 1F2NA 1H1MA 5EXOA 2XLAA 3RQ0A 1C28A 1RUG1 1DFQA 2ZGUA 5T3NA 1DGLA 1RUF3 4YGBA 1XQNA 4K8FA 4YZ2A 1AJOA 1GANA 5LEJA 1M06G 1NQJA 4AEJA 1AYN1 1WCSA 1OI6A 1RTVA 5C9AA 2E7AA 4AEDB 3AKPA 1EYBA 4XTPA 3KGLA 4J6GA 3AYCA 1LGBA 2RJKA 1VAMA 2ZX0A 3ZYGA 5J7MA 3JD71 3PMSA 2FMYA 4BYYA 5J37A 2DCZA 4Y20B 4JDMA 4ZXKA 3LA2A 3ZSJA 4LBKA 5GLUA 5CVRA 1NA1B 3AMMA 2A70A 2IFWA 4P9LA 4XBNA 1G9DA 4Q8LA 4LUKA 1LEDA 1IHMA 3JQWA 3KSCA 5ACA2 1D0GA 4ES8A 3MLKA 1XNDA 2PHXA 2Y38A 4OUMA 3OBTA 3VV1A 2BUKA 2OPKA 3VKNA 3TB0A 1RUC2 1GICA 4IV1B 4Q0QA 5JIAA 3WG2A 1QOTA 1C8M1 1S0JA 2RMU3 1SLIA 3POWA 4P9YA 2X5IA 3ZYPA 4W6XA 4N90A 5FPZA 2VUJA 1RJ8A 4GB31 1Z7S2 4WM8C 3QACA 1S0IA 4XFCA 1PO11 2B8MA 1ENSA 2PTMA 3B9CA 3WT3A 1JOJA 1N1VA 1F8VA 1MS5A 1YWKA 1FOD2 2V73A 3QBQA 2VW2A 4XQDA 1JUHA 2VVEA 4GH4C 1KD7A 5BXXA 2YZ4A 4IETA 4Y5Z0 1AL0G 3PVOA 4CEWB 2HWD2 4RR3C 1FNYA 4AQ2A 1DGWX 5JOYA 1SCSA 1I9RA 1CAXA 1QQP3 1TME1 3AKTA 4LBJA 5FAXA 4CDWB 3P3NA 1ZX5A 2X8KA 5H9SA 3PJYA 4HVOA 1CJPA 2LALA 1V6MA 3RJ2X 1KS5A 1HV1A 3ZIWA 1R1ZA 3MIEA 3PVNA 3NAPC 1LB2A 1PZ9A 3VKOA 5AC93 2ET7A 4A7KA 4AGVA 1YFXA 1QXRA 1Z78A 5C8CC 1ZM1A 1AHSA 4IEXA 4NHMA 1N3QA 1DGRA 1SDWA 2Y26A 2WNVA 3GZTB 1S55A 4DZGA 1YXWA 5DUXA 1RUJ1 1LGNA 1ZBA3 4E4SA 1MR5A 4AQ6A 5B2GB 1W6MA 2WSVA 1YJLA 3CJIA 3CO2A 5J3UA 2YMZA 4H7MA 4XEZA 3H8UA 3FLRA 1QJY3 3O0XA 1OA3A 4XFFA 2ZGNA 3QLQA 2AREA 1SBDA 2WL1A 1RUE2 1MQTA 2WT2A 4AE2A 1NE6A 1KXGA 1VBC3 4RGGA 1H8TB 4N9HA 2WFF2 3MDPA 4RGAA 2A6YA 4YFWA 4FPYA 1GSLA 1AYM3 4YG3A 1FV3A 2AENA 2D6KA 2DFBA 4DPNA 1OFSA 2EF6A 4RA0A 3VGIA 2PAKA 4FO9A 3KMHA 1UZZA 2VG9A 3KCXA 5K0UB 1ZREA 3RZZA 4AQTA 1PNFA 3TOJA 2A73B 1F9KA 5I8TA 4OLLA 4YYOA 2ZCWA 3A0KA 3VL9A 1CAUB 4F7ZA 1PVC3 4YGCA 3N7JA 2CY6A 4E2QA 4CDXB 2WC2A 4Y1YA 3JBG3 1OSGA 1ENRA 3VHRA 3W58A 3D5OA 4R52A 2R063 1YI9A 4IEQA 3S7IA 2EAKA 1V70A 3TWIA 3U10A 4M01A 2X5IC 2PLV1 4Y1XA 4MGZE 2OUHA 1UU5A 4Y26A 3WLUA 1D4M2 4AHXA 3USUA 4HSJA 1R081 2BNOA 3RPQA 4QQLA 4LBMA 1NCQC 1FMD3 4Y1VA 4DFSA 3FUOA 4OVEA 1Q8PA 1RVF1 4Q4V3 5H9PA 2ZZQA 3H1YA 1PZ8A 2E7QA 1RJ7A 2OW4A 1O3TA 1XRUA 3B3QE 1QGLA 3GALA 4OULA 2JX9A 4QGLA 3WW3A 2R0HA 1BEV3 2P34A 4Q0PA 1IOAA 1ASJ1 2XJVA 2R072 5KHGA 3RI8A 1G9AA 4WM7B 4Q0SA 4R9DA 4Q8KA 2HWC2 5H9QA 2G9FA 3RYKA 1OLRA 2MEV2 5GKAC 5JSPA 2GSYA 2VXRA 1SBEA 4NVPA 3VBSB 1Q3EA 1AUYA 4XF4A 2RS53 4MSVA 1HV0A 2PN5A 1JXNA 2YXSA 4XQ4A 1W6NB 1EV12 4OHYA 4GALA 5E88A 4X8PA 4BIFA 5CG9A 2WNVC 5AVPA 3UL2A 4LBQA 3ES4A 3WCSA 5JOWA 1FNZA 2D6LX 2WZR1 2VOKA 4P9IA 4YVWB 4EN7B 2D3RA 2ZBJA 1YIFA 3VUOA 4RHV3 4JTNA 3ACLA 2MNGA 1VBB3 2IWGB 3MW4A 4FOYA 4RS5B 2EVXA 3B9IA 5BPXA 2RM21 1HXS1 1BQPA 5EFUA 2VPVA 4FQZA 4AHWA 3ZXAC 4LE3A 3BODA 5A3LA 1YJKA 4IEYA 2DU0A 2XBO1 3ENRA 4META 1DLLA 1DG6A 1MVQA 5CFDA 4NWWA 3WDVA 2WWSA 1CAWB 2JE9A 3IT8A 4ASLA 2Q0AA 3M3OA 3LA3A 1OMIA 3U11A 4A3XA 4BOWA 3PTYA 3SH5A 1G6NA 3V0BB 4P9WA 2ENRA 4AI1A 3WD5A 1O5LA 2BFUL 2NN8A 2PYTA 4PQ9A 2WT1A 4KQ7A 2C0ZA 4INDA 1C1LA 1EP0A 3ILNA 4O9GA 3VBFB 4Q0VA 5KXBA 5E16A 4J1WA 1LEMA 3AP6A 3SHRA 3M8LA 3J8F3 3WQ1A 4IV3B 3BPZA 5KXEA 4KL1A 1XYPA 1UAIA 1Q8QA 4Q4Y2 2GNBA 3VDDA 1AR93 4UW3A 3ZN6A 1DF0A 1V6KA 1SEFA 4KG0A 3ZSEA 1MEC3 5I8SA 2RS13 3TN92 4Y1ZA 4AHYA 4M3CA 4DS0A 4JGZB 1ND3A 2I45A 2Z5WA 3EQEA 4Q26A 3VBRB 4M3CF 3VZOA 1A3KA 2JG9A 1QJU2 1RUH3 5ACA1 1H30A 3ZFGB 2XVKA 3WW4A 1C8M3 4HBNA 4HVQA 2BW8A 1ZYBA 5BNPA 1WMEA 4IEOA 4IEVA 3A4UA 3UJQA 4XMIA 3ZFEA 1OFNA 5LK5A 1RUC1 1CX4A 4H7LA 3MICA 4S2GA 2G4IA 3AK0A 5GZFA 3WG3A 4LHLA 3R6SA 3VL8A 5FPXA 4AFAA 1K5MA 2DUOA 2CWSA 1Z7S1 1LHNA 1UPIA 1GZCA 1UU6A 2VVFA 3KD4A 4ATFA 1SLCA 4BLJA 4OFGA 2ET1A 1LOEA 2R0FA 1FOD1 4Q4X3 2XVLA 3M1HA 4XPVA 1SACA 5KWRA 4QPGC 1O5UA 1N3OA 3DKWA 4ZU4A 4UBGA 1QWRA 3VBUB 2HWD1 4NHLA 1UN1A 3AP4A 3R0RA 2A7AA 1U0AA 2ZHKA 1XNBA 3FFQA 4XYXA 3UKNA 1TNFA 4HANA 2WLQA 2F4PA 2HKXA 5CFCB 1UKGA 4YW2A 5BNOB 4DY3A 2R041 3AKSA 3AMPA 4K40A 1J3QA 5DZFA 1FATA 4PBOA 2N7GA 4D94A 3B5LB 4EROA 3LA7A 1NY71 3AYAA 2E63A 3D0JA 4NPRA 2H0BA 1RGSA 3K48A 1BVVA 5JSOA 5CFDC 2WQZC 3NKGA 3WP4A 3MGUA 2JICA 3M70A 4JDNA 3PVBB 4ES9A 2UY9A 5T5OA 3ZXGA 3QH7A 4F3JA 3CU7A 4QXKA 1FPN2 2DCYA 1IZ3A 2HWE2 4XQWA 4N53B 4XBLA 5A32B 2NMNA 2HJIA 2QDNA 4MLOA 5F6KA 1KQRA 4UW5A 1COV2 2OZ6A 3WG4A 3AYEA 1ZBE3 3N3HA 2PELA 4YM3A 5LK7B 1RUE1 3EJKA 2BEOA 1W39A 3E5UA 3GBFA 5GM0A 5JZGC 4FTEA 4FPEA 1TMF3 1G8WA 1DGRN 1OPOA 1VB4A 4AEKA 2D7FA 4L99A 1CPMA 3HR9A 1FAYA 4EN9B 1RUI1 4WZFA 2R16A 1IKQA 5KHJA 5HI0A 2BVVA 4R4ZA 1Q8VA 1R1A2 1LCLA 1V6JA 1AL23 1ENQA 1HRV2 3QOPA 5FO9B 2JG9C 2XUMA 4L8QA 5DG1A 4I2OA 4G4FA 3DPRA 2ZGQA 1ULCA 2NLRA 1NQDA 2KA3A 2Y0IA 4L9BA 5BNPC 4JGYB 4N7UA 3VBOB 3ZFEC 3WG1A 4BE3A 4QU2A 3WR0A 2I07B 2TNFA 2JE7A 4UW4A 1CVNA 5L7OB 4YW1A 4HKOA 5GLTA 4OZXA 1OKQA 4I0BA 4ATEA 1K5MC 2VQAA 3S0MA 1ULFA 1LU2A 1W6PB 5HCBA 1SLAA 1D4M1 1H2KA 3I54A 3NJZA 3WZ1A 1DU3D 1IS4A 1I6XA 2AGSA 1VRH2 2DCKA 3JB4C 3M3IA 4K1YA 2ZGTA 1YHFA 3OCPA 4ZU5A 5SV8A 5T54A 4RQPA 3R4DB 4PIXA 1AR83 2HWF3 3GBWA 5JPNB 1CAVB 2QE3A 5GZEA 2A3YA 4B4RA 3IN9A 1NCRA 1XU2A 4QM9A 2Z69A 5A33A 5EYXA 4QQ2A 1ALYA 5FQ0A 3NVCA 5EZWA 5BNNB 2AYHA 4LBQD 1DQ1A 2CTVA 3MYXA 1V9U2 2R071 4QX5A 3VHPA 1S2BA 3O7OA 1AX2A 4BMEA 1G9BA 1HRI2 4WM8A 2D40A 1V6LA 5FLIA 3WP3A 3PLQA 2HWC1 2QZ3A 2PAMA 4B4PA 4F83A 3V0AB 2MEV1 4Q4W2 2K0GA 1B35B 3PJQA 1RHI3 1X36A 1KJRA 4FPLA 1CN1A 3NL1A 1HKDA 1QHDA 4DRVA 5C9AB 3H3UA 4OI4A 4Z07A 4OHZA 4Y1UA 4LA2A 4RR3A 4KH9A 1LGCA 2WZR3 3BOWA 1EV11 5I0RA 1X8MA 3E6CC 5BYNA 1BBT3 1PNGA 1ZVFA 3CL1A 4LHKA 1IKPA 4XZPA 2XHKA 1QF3A 1CR7A 3I59A 1MZ6A 1PIV2 4BMBA 3NWKA 5CAZA 1R093 2HEYF 4FPOB 1PHMA 2D3SA 2HWB3 3M4FA 3UK9A 2B45X 1RMU2 5KXDA 3BU7A 5C4WC 3RRDA 4BM8A 4JDOA 1HQNA 5AFEA 1ULDA 3INAA 3B7MA 3TBDA 5HCAA 4FAGA 4AFMA 4G3YC 4OUSA 1HX6A 4EV0A 2C9AA 2AZ5A 5AVAA 5AFBA 1DZQA 5T5PA 2YGLA 2GNTA 2OUJA 1NLRA 4JRLA 1GKBA 1WLTA 3J4UH 3SH3A 4OI2A 3VKLA 1I1EA 4XFHA 2XKOA 3VBHB 3OY8A 4K6BA 1O3QA 5DDJ2 1LECA 2IXJA 3DPRC 2ZACA 4XHXA 4AVVA 3ZO0B 5EV7A 4WVWA 3UKVA 1XNKA 1GQHA 1WW7A 5KC5A 3WW1A 4IESA 4XFAA 4E27A 1W6OA 4AYUA 1RUF2 1ZZ7A 2GMEA 3H3ZA 4HK9A 1D4VB 4YRDA 3OF1A 4Q4Y1 3MLJA 4M3CE 1PO22 4K21A 2ZZJA 1LR5A 1QNWA 2XWBB 2ZX3A 1CONA 2DUPA 2LM3A 4DB5A 4TZDA 5FLJA 1AX1A 5GLWA 2OZJA 1ULGA 3D0SA 4RQPC 1MZFA 1RUD3 4LBNA 1AF9A 3OJBA 2PFWA 4QM8A 2JDZA 4HKLA 1QJU1 1NCRC 1BJQA 5T50A 1VBE3 3OGGA 3KGZA 1G7YA 4IEPA 2FMDA 2VNOA 2UWAA 1VR3A 1GR3A 4C90A 1Z7S3 4R9CA 3IKWA 4M0HA 2DWRA 2FQPA 3CJIB 3FWEA 4QGNA 1NCQA 1YYNA 1TE1B 2RMU2 4MGKE 5FLHA 1QU0A 1VP6A 3AJYA 4AWDA 1MQTB 2PQQA 2PAEA 3MI8A 2QFEA 4XF3A 3VN4A 4DY5A 2NYYA 4COZA 2HYKA 3R05A 4BPZA 3RYRA 3B02A 1HQWA 1G9CA 1H1AA 2RR13 3PHMA 3FJSA 3AZYA 4N43B 4R8HA 4JCKA 2CGNA 3ZN4A 5EYYA 4AK3A 5HCFA 4LNVA 4TSVA 4FOWA 2R043 1UW8A 4AEDA 3L2YA 4HPKB 4HFSA 3GHMA 2D6PA 2QUOA 2WA4A 4XDQA 3MIFA 5DZEA 2A71A 1V6NA 5DUUA 1ND2C 2CGPA 4AI3A 1QQP2 2ZAAA 4Y20A 1NLSA 4KGGA 5FBZA 4XJZA 3RMXA 4L92A 1NA1A 4LA3A 3JZVA 1OQEA 3LGRA 2YV8A 1EPZA 3SCHA 1GQGA 4YM1A 1UZYA 2RS33 2ZOEB 3HN1A 1KITA 1HQLA 3OPZA 5AC92 2WS93 3URFA 3BB6A 1LHVA 2LTNA 2HWE1 3MPPG 3T2TA 3AZXA 2Q30A 4LO8A 1AX0A 3B01A 4CRQA 1QMJA 1ZBA2 3AXEA 1COV1 1UD1A 4B3NA 1C3HA 3ZIXA 2ILMA 3O5SA 4CP0A 5JI9A 4CDUC 2PHTA 3OBRA 1QJY2 3CNAA 3U07A 1RUI3 1GLHA 2YROA 2EIGA 4EWEA 1HLCA 1VBC2 4Y22B 4FSJA 1AR73 2GU9A 3UV9A 2IXKA 2JG8B 1AYM2 3MIHA 3FC0A 3ATGA 4I3PA 3KM5A 4E2SA 2IXLA 3KT7A 4CDWA 1ZZCA 1R1A1 4XMAA 3CLPA 1Q5OA 4AW7A 2QZ2A 4UBHA 3APBA 1HRV1 3MFAA 2R1DA 3VZJA 4BIOA 2BBVA 1NXD1 5J09A 1C1FA 3ZFFA 3AYDA 2R49A 1U5IA 3L2HA 1YCIA 4LBLA 1AR63 3H9AA 4Q1RA 4CDQA 4I0WB 3IDBB 5FMOL 4XIOA 1PVC2 2A6XA 1WCKA 2PHLA 1JYCA 1LJ7A 3JBG2 3TAYA 1C8NA 2A3WA 4Q29A 2Q8OA 1ZRFA 2R062 1EAH3 2ZGRA 4AVSA 1CESA 1X33A 4AVCA 5T55A 2VW0A 2DYCA 1G86A 4R9AA 1XNCA 4BWOA 1VRH1 2ZJCA 4IERA 4I01A 1N3PA 1UX6A 3MEPA 3DGTA 3WHTA 3OYWB 3BCWA 3O12A 4XETA 2VY0A 1FMD2 3ZXEA 3KB5A 1IS5A 3ELNA 1QJX2 4Q4V2 4AEDC 1GBGA 4XJ8A 3H1WA 1H8TA 1V9U1 2VOWA 4FPHA 1C5IA 2XGXA 5TSWA 1HRI1 1WUVA 3DUIA 2VGDA 1BEV2 2XH6A 2BWAA 1I5ZA 1XU1A 1PGSA 2YUEA 4Q4W1 1ZNPA 3DV8A 4YVSB 1VBD3 3KS7A 4AFBA 4QPGA 1NA1C 1A78A 2ZAHA 2EXIA 4LO5B 1X82A 1Z0HA 5I0UA 1DDLA 3WQ7A 4XJWA 1SFNA 4MXWB 3VDDB 4O9EA 1WLWA 3ZN6B 3ZMNA 4K7JA 3QCWA 4YZ4A 4DINB 1PIV1 5ABJA 3RSJA 3ETQA 3IM0A 4HSLA 4HETA 3MF9A 1ND3B 4QGMA 2NZ9A 1WBFA 1RMU1 1QH6A 1WD3A 1VBB2 1WMDA 3WINE 3AKQA 1S1AA 1VAVA 4YGEA 4E9KA 3G7DA 1N1YA 2XJPA 2VMIA 3HMYA 2BVBA 2XJTA 3KCCA 5KHHA 4FVVA 3I7DA 2XJQA 5D8AB 1RUG3 4QPIA 1BCXA 4AVTA 4CEWC 1WLDA 3E6DA 2IC1A 2ZMLA 1QOSA 1AXZA 1AYN3 5FRAA 3WNXA 1BK1A 3ILFA 3RWNA 4CTEA 4CDWC 5K9YA 5DDJ1 4WM7A 4BZ4A 4FT8A 3HD8B 1DQ0A 1KFUL 4HN1A 2XJRA 3ZFFC 3JD73 4OHVA 5JZGA 4FPKA 4B29A 2YPJA 3MIBA 4L2NA 3VBSA 4CDQC 2ARBA 4XBQA 4Q27A 5FTTC 1AJKA 4ASMB 2XB6C 2FBEA 4NHKA 1W6NA 2WQ4A 1PK6A 3THPA 1PO21 5I91A 3J8F2 1MS1A 1H1IA 2WNUB 4YVWA 2W68A 2H0VA 3KLSA 3TRSB 2YHJA 1TQ5A 1AR92 2DFCA 3U4XA 4RS5A 5LRSA 3WDUA 1GYKA 1ENXA 4FPGA 2GNDA 1MEC2 2ZX2A 1OQDA 2H6CA 2MPFA 2RS12 1X50A 3KZ4C 1H2MA 1TNRA 4GB33 5SV5A 3WCRA 5I0SA 1PO13 4KBBA 3VZLA 2NP0A 2ZGPA 1H8TC 1RUH2