5ABJC

Structure of coxsackievirus a16 in complex with gpp3
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
242
structure length
242
Chain Sequence
GIPTELKPGTNQFLTTDDGVSAPILPGFHPTPPIHIPGEVHNLLEICRVETILEVNNLKTNETTPMQRLCFPVSVQSKTGELCAAFRADPGRDGPWQSTILGQLCRYYTQWSGSLEVTFMFAGSFMATGKMLIAYTPPGGNVPADRITAMLGTHVIWDFGLQSSVTLVVPWISNTHYRAHARAGYFDYYTTGIITIWYQTNYVVPIGAPTTAYIVALAAAQDNFTMKLCKDTEDIEQTANIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP1
publication title Structure Elucidation of Coxsackievirus A16 in Complex with Gpp3 Informs a Systematic Review of Highly Potent Capsid Binders to Enteroviruses.
pubmed doi rcsb
source organism Coxsackievirus a16
molecule tags Virus
total genus 44
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2015-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5abjC00
3HAGA 4Q4V2 1EAH1 5AC92 1E57A 3DPRA 2R071 4CDXB 2RMU1 2HWF1 3VBRA 1MEC2 3JB4C 4QPIB 1F8VA 4CEYA 4JGYA 1ZBA2 2WLPA 1BEV2 3ZFGB 1TME2 1RUE2 4Q4W1 2PLV1 3VBUC 1MQTA 3VBSC 1ZBE3 1OPOA 5CFCC 1HRV3 4RS5A 4GMP1 5A32B 1PO22 1R081 1RHI2 3CJIC 1VBD2 5D8AC 1K5MC 1HXS2 1OOPA 2R042 1EV13 1HRI2 1OHFA 1BMV1 1H8TB 1M06G 1AR72 1NY72 4WM7B 1C8NA 3VBFB 1RUF1 1PGW2 1AYN1 1AL21 1VBB3 1PO12 4GH4B 2X5IB 4RQPA 3IDEA 1BBT1 1C8M1 1AR62 1TMF3 1W39A 1COV1 1X36A 4CDQA 3VDDA 3ZFFB 4Q4Y1 3DPRB 1NOVA 2WS91 1R091 4CEYB 1B35C 2RS31 4JGYB 4CDUB 4NWWA 1Z7S1 2HWB3 5C9AC 4Y5Z0 4WM8A 4N43A 3ZFEC 1RUH1 1ZBE2 1VRH3 1HRV2 1FOD3 1POV1 4LLFA 2RS13 2MEV3 5L7OA 4RR3B 2HWD3 2HWE1 4FSJA 1V9U3 1OOPB 1ND3B 2R061 1EV12 3VBOC 3NAPA 1PVC3 2RS53 2GSYA 1VBA3 2WFF1 4CDXA 3TN93 2RM23 4Z92B 1RUD1 1NCRA 4QPIA 1VBB2 3VBHC 1RMU3 1CJDA 1VB2A 5C8CB 1TMF2 4CDQB 1QJX1 3VDDB 4Q4X3 5CFDB 4BCUA 5A32A 5DDJ3 1NCQC 2VQ0A 3JD73 1ASJ1 2HWB2 1NA1C 2FZ1A 1VBC3 4IV1C 4GB31 4WM8B 4N43B 1RUI3 4CDWA 1VRH2 1GFF2 1AYM1 2XPJA 1FOD2 4PDWC 1QQP1 1ND2B 2RS12 2MEV2 5ACA3 5L7OB 1FPN1 5J96B 3CJIA 4RHV3 2HWD2 5BNOC 1AR81 1NY71 1V9U2 2BBVA 3JBG3 2BFUL 2HWC3 3NAPB 1R1A3 1AR91 3ZFFA 1AL0G 1PVC2 5A33B 1PGL1 2RS52 1VBA2 3TN92 2RM22 1NCRB 4EJRA 1EAH3 2XBO1 4JGZC 4CDUA 1RUG1 1CD3G 5BNPC 1RMU2 5C4WC 4YVSA 3M8LA 2R073 4AEDA 4Y4YA 3ZFGC 2RMU3 2HWF3 2WZR1 4Q4X2 5ABJC 2ZTNA 5DDJ2 4Q4W3 2PLV3 4RR3A 3JD72 4GMP3 1VBC2 1ND3A 3VBSB 2RR11 5CFCB 4CDWB 1RUI2 2DF7A 4IV3A 5ACA2 2QQPA 3CJIB 4WM7C 1HX6A 5D8AB 4RHV2 5C8CA 3ZXAC 3JBG2 4GH4C 1RVF1 2X5IC 5JZGA 5BNNC 2HWC2 1AYN3 1R1A2 1AL23 5CFDA 1FMD1 1RUC1 1BBT3 1C8M3 2BPA2 1COV3 3DPRC 1EAH2 1SMVA 3VBRC 4Q4Y3 4YVSB 1D4M1 1VBE1 3LOBA 1QJU1 2R072 4AEDB 2WS93 4N53C 1R093 2HWF2 2RMU2 1QJY1 2RS33 1MQTC 5FMOS 1Z7S3 1ND2A 1B35B 1QJZA 4RS5C 4CEWC 1IHMA 4Q4W2 2PLV2 5C9AB 1RUH3 2ZAHA 3J8F3 5K0UA 1POV3 1DDLA 3ZFEB 1RUJ1 1F2NA 2HWE3 5A33A 4IV3B 1AUYA 4Q4V1 5AC91 4QPGA 4YVWC 2R063 1BMV2 2WFF3 4RQPC 5JZGB 1MEC1 1RUD3 1AYN2 1AL22 1ZBA1 1BEV1 4CDQC 1TME1 1BBT2 1C8M2 1RUE1 3VDDC 1COV2 1QJX3 3VBHB 4Q4X1 4Q4Y2 5LK7B 3VBUA 3VBSA 4FTSA 3JB8A 1PO21 1VB4A 5CFCA 2WS92 1RHI1 2RS32 4WM8C 1ASJ3 1VBD1 4N43C 1NCQB 1Z7S2 1HXS1 2R041 1HRI1 4GB33 1AR71 1NA1B 5D8AA 1RUH2 5K0UB 5FMOL 1K5MA 4IV1B 1PIV3 5L7OC 4GMP0 3J8F2 1AYM3 1PGW1 1QQP3 1FPN3 1PO11 4PDWB 1AR61 2HWE2 1AR83 1VAKA 2ZZQA 3NAPC 4QPGB 4CDXC 5BNOB 2R062 1NCRC 1AR93 4QPIC 4FTBA 2WFF2 1RUD2 2XBO3 3S6PA 1RUG3 1A6CA 1B35A 1NG0A 4JGZB 5GKAC 1QJX2 1ZBE1 5BNPB 2BUKA 1HRV1 2WWSA 2WZR3 5C4WB 5C9AA 3VBUB 1X33A 2IZWA 3ZFEA 4N53A 5ABJB 1R083 1H8TC 1ASJ2 4CEWA 4CDWC 5J98B 2RR13 1EV11 4GB32 3VBFC 1K5MB 1POV0 1PIV2 1AYM2 1WCDJ 3VBOA 1RUF3 1QQP2 3FBMA 2Y26A 1VBB1 1FPN2 4FTEA 1AR82 3ZFFC 1TMF1 4YVWA 1RVF3 3VBHA 4CEYC 1AR92 1FMD3 1RUC3 4JGYC 4CDUC 5BNNB 1PGL2 4YVSC 1RB8G 2XBO2 2TBVA 4SBVA 4AEDC 2HWB1 1RUG2 1NCQA 1D4M3 1VBE3 1QJU3 3VBRB 1NA1A 1VRH1 2WZR2 1QJY3 4IV1A 4RR3C 1FOD1 2RS11 2MEV1 4N53B 1OOPC 1MQTB 1ND3C 1R082 2HWD1 4PDWA 4RS5B 1V9U1 4CEWB 3J8F1 4RFT0 2RR12 5BNOA 4IV3C 2GH8A 1RUJ3 1PVC1 2BFUS 2RS51 1VBA1 3VBOB 3TN91 2RM21 5C8CC 4Q4V3 5AC93 1RUF2 5JZGC 1RMU1 5CFDC 4YVWB 4JGZA 1HQNA 1MEC3 1RVF2 5BNPA 5C4WA 1ZBA3 4RQPB 1BEV3 1FMD2 1RUC2 1TME3 3ZFGA 1RUE3 5DDJ1 1R092 5ABJA 3JD71 1VBC1 1D4M2 1VBE2 1QJU2 1PO23 1ND2C 1RUI1 1RHI3 1QJY2 1VBD3 1HXS3 5ACA1 2FZ2A 2R043 5K0UC 1HRI3 4RHV1 1AR73 1H8TA 1PIV1 5FOJB 3JBG1 4WM7A 2HWC1 3VBFA 1R1A1 4NWVA 1PO13 1RUJ2 4QPGC 4GH4A 2X5IA 1AR63 5BNNA
chains in the Genus database with same CATH superfamily
3HAGA 3WQ7A 4Q4V2 1OVPA 1D0GA 1MZ5A 2C9KA 4DNYA 3O14A 4CU6A 1KJLA 4YW1A 3S5AA 5JXIA 1JZ7A 1YIFA 1YXWA 5LRRA 3MI8A 1OC1A 3MDPA 2FMDA 2Z69A 2VMCA 2DWRA 1W99A 5H9PA 2PQQA 5HCHA 4H55A 1ZBA2 4YW4A 3ZFGB 4KWJA 4AVAA 4AI3A 2PLV1 2KD7A 5GLWA 5JOXA 3VBSC 4CPBA 5KHJA 5CFCC 2UU8A 4MXWA 4H14A 4RS5A 5IK7A 4IL7A 1OD5A 3WF0A 2QQNA 5JPMB 4AI9A 4D94A 3ST7A 5JR7B 3SCFA 4CRQA 1N1YA 2JG9B 4XUTA 3WR0A 1N3OA 3V56A 1OXCA 1R081 2JB4A 1XNTA 3GJBA 4AAXA 2VOWA 4CUBA 1ZM1A 1HXS2 3G7DA 1NKGA 2WUHA 2NM1A 2J1RA 3POBA 1PX3A 1AR72 4BQ3A 5KC5A 4X8NA 2JIGA 1JUIA 2PMWB 2XB6C 1RUF1 3HEIA 2JJ6A 4ISRA 1GYKA 1AL21 4GKYA 3SKJE 1VBB3 2VULA 1XYNA 3NNJA 4YZ4A 1LU2A 3TOJA 3IDEA 2HH9A 1GICA 3ACLA 1ZZBA 2A3XA 2WNVC 4UW5A 1RINA 1W39A 3A7QA 1X36A 3HT2A 4CZSA 2R1BA 1GUIA 2Q1MA 4TN7A 1ZNPA 4GD4A 4K7JA 4Q4Y1 3T2QA 3DPRB 2ZS6B 3C7FA 3LSEA 4XABA 5KHHA 2YGLA 1WMDA 4QM9A 3PHMA 4XDQA 3KT4A 5TSWA 3CKHA 2W94A 4ATEA 3WNPA 3FHQA 4NRQA 2Y6KA 5C9AC 4XCAA 1J3RA 3PUQA 2D6KA 3WXPA 3ZFEC 1NQDA 4YM0A 1VRH3 4ES8A 3LPFA 2EIEA 1POV1 1PNGA 4DFSA 1QHDA 1S0DA 2RS13 2MEV3 3PUSA 3AYAA 2W68A 1JYTA 4RR3B 1H1AA 1ZX5A 5A7QA 1NX9A 1SHWB 3AC0A 4UFMA 3AP6A 3KS7A 3RQ0A 3ZMNA 1R1ZA 2QCSB 2Z4FA 3ROUA 2DUOA 3M1HA 1OOPB 2ZGPA 2QDNA 1NAEA 3H7JA 1ND3B 1W2NA 4D7SA 3VBOC 4JTOA 2Q8CA 2OUHA 3B93A 1H0BA 1VBA3 2ZEYA 1CIWA 3GHMA 3TN93 5JOYA 2AYHA 4Z92B 1S0BA 5EWSA 3EMRA 4XFCA 4FCAA 1KDKA 5DAXA 1O5LA 1VBB2 4XURA 1CR7A 4LEJA 4XUNA 3VBHC 4A45A 1W90A 2Q1FA 3KM5A 3ZN5A 1OVSA 1ZA7A 4ZY9A 5JPNB 4I02A 1QKQA 4CXYA 3NJXA 2KA3A 5CFDB 1Q3EA 1H4GA 1QXPA 1XNBA 3CJXA 3FMGA 4BCUA 3IKWA 4UBGA 3OPZA 2VUCA 4YG0A 5DABA 3ON7A 2BRTA 2JG9A 4BIOA 5F37A 5FPXA 2VC9A 2YDEA 2IVIB 2XMLA 5GM0A 2P3YA 4V2VA 2EXIA 4E4HA 4MO3M 4NHMA 4HBNA 3GBWA 1V6KA 3AMNA 4IV1C 4AEMA 4GB31 4Q0PA 5DUUA 2WNUC 2XWBB 4AYUA 4CDWA 5FKBA 1VRH2 1CAWB 2XJSA 1O4YA 2C5DA 1H9WA 1YUDA 2JDUA 1PM4A 2CU5A 2FDJA 4LHKA 2RS12 2MEV2 5SV8A 5L7OB 3ZVXA 1FPN1 5J96B 4ORFA 4CCDA 4QXBA 4I3PA 4RGKA 4RHV3 4CXXA 1IS4A 3UGFA 4A7KA 2CYFA 4DXRA 4W4ZA 2B4KA 2BFUL 2HWC3 5FZ8A 1REEA 3NAPB 4WZFA 5FV3A 4W6YA 5F7UA 5IFPA 1OH3A 2AGSA 1UZZA 1AL0G 5A33B 4SLIA 4XQWA 3I2GA 3BYWA 1VBA2 1V6NA 5FYUA 3TN92 1NCRB 3U10A 3WHTA 4XXAA 4XFHA 1EAH3 2XBO1 3T09A 4JGZC 1EYBA 4U36A 3ZM8A 1RUG1 2GNMA 4QB6A 2WNVA 2Z2SB 3VD3A 1PZ7A 2DUQA 3ZDSA 1Q8QA 2A71A 3M8LA 3RWNA 4PBOA 3WDYA 4BLIA 1B09A 1UY1A 2WSVA 1SFPA 1DHKB 1ULCA 2HWF3 3BODA 1TG7A 4IETA 5A70A 2ZTNA 1H1IA 4DIQA 4CUGA 2XVLA 3N36A 4RR3A 3O12A 3HBKA 2EF6A 4J25A 4XW3A 4D3WA 1UKGA 1C1FA 2VTXJ 2VG9A 1QNYA 1MS0A 1DYPA 1UYPA 5DZFA 1C3HA 1ND3A 3D82A 5T5JA 1KXGA 4J1XA 2I07B 1C5IA 4IV3A 4XUQA 4HOOA 3JUUA 1LHVA 1HQWA 3POGA 5A3WA 4DO0A 2QQPA 5HBAA 4GXLA 1G9AA 1HX6A 5D8AB 4DUXA 4RHV2 1YFYA 2DCYA 2P5BA 3K3NA 4N8MA 5DAPA 1PK6B 2VUJA 3N7LA 4NPMA 4BISA 4UBHA 4J6GA 4GH4C 1RVF1 4JX0A 5L9RA 4BMBA 2QQIA 5JZGA 2HWC2 5JCTA 3H42B 4E4SA 5CFDA 1YLLA 1IG0A 4XZUG 4HG6B 2YG0A 4P9GA 1GP4A 1JYWA 2E7TA 1NLSA 2P4EA 3WX5A 1COV3 4QB2A 5L9BA 1EAH2 3UYJA 1X8MA 4G4FA 4UFLA 1SMVA 2BTVC 4FAGA 2AACA 3O1UA 3MO4A 2R7EB 3LEIA 3WP3A 4CP9B 2HWF2 4NHKA 2HLEA 4HVOA 5IWFA 3LEKA 4FPOB 5FMOS 2VR4A 2VCMA 4O7XA 3IWZA 5G05L 2ZJCA 1IHMA 1N47A 3NW4A 1XXNA 2KM2A 3MUY1 5GALA 3RZKA 4BE3A 3GM8A 3LWCA 2BGPA 2ZAHA 4FPYA 2EXKA 2K2SA 5J37A 2L9LA 2NMOA 4A6SA 3WDUA 1L7QA 1YYNA 3GGLA 2XQRA 4CP1A 2X05A 1YJLA 4YFZA 3KGLA 2BBAA 5LY2A 4PF1A 3ZIWA 1VMHA 3C8XA 3VD5A 5A33A 4EN8B 4Q5OA 5JOZA 3NKGA 3J7MA 2ETEA 1WW4A 4JKMA 1IS5A 1NYWA 3RI8A 1AJKA 2A6YA 3AL5A 1DGWA 2CAVA 4DXTA 3BTYA 1GNZA 3USUA 1BMV2 1L3JA 5AVAA 5FK7A 4O9GA 2VTXA 5A7WB 5IVYA 4YG3A 1OLRA 2FHRA 1O3SA 4DMIA 2YHJA 3CL1A 3OUJA 4CDQC 2OA2A 3OYWA 1RUE1 4LBKA 2WO3A 3KV6A 4XTMA 2OPWA 4FO9A 2BEOA 1COV2 1ZYBA 2P3JA 2XDVA 4HKWA 1PMJX 4TLFA 5DZEA 4LBQB 2DV9A 1DGRN 2VBPA 5GLUA 5J48A 3J7NA 2IXHA 3VBUA 3VHPA 3CU7A 4HN1A 2OIIA 5K8SA 3TAYA 1PO21 3MEPA 4JC1A 1RHI1 2TNFA 2WC2A 2XHNA 2VZVA 3MF9A 4WM8C 4CVUA 1VBD1 5HCAA 2VMGA 1RUOA 5KHIA 1LOFC 2OPKA 2R041 2WRAA 4ZZ8A 3UKVA 2YROA 4CP0A 1XSQA 5E88A 5D8AA 1W04A 5K0UB 4LKFA 1K5MA 2QVSB 4PBPA 4Q1RA 5L9VA 4QX0A 1PK6A 3VD4A 2HKXA 4MVTA 2WA3A 5F2WA 3OD0A 4LE4A 3RI9A 3H7YA 5FZ9A 4YPJA 4META 4URTA 5A3NA 2GDFA 3N9LA 1SLLA 1AR83 1FNYA 5I8SA 2CL2A 1MVEA 3A0NA 2VQUA 1XSRA 4OI2A 4CDXC 4IEWA 1KGYA 1LOGA 1O59A 5E8AA 5EFUA 4QPIC 1K3IA 1JYVA 5L73A 1PX4A 3HVDA 4TTGA 2Z79A 4OVEA 2ZHMA 3LA3A 5A7OA 3BB6A 5FFOC 2VUAA 5FYTA 3TEXA 3CZUA 2E26A 2R30A 2Y38A 2DCZA 1JZ5A 4Y1VA 3RG0A 4HSJA 4YFWA 2H6CA 2XG3A 4YARA 2GN3A 3E6BA 1QOTA 3B7MA 3T4VA 1NZCA 1ZBE1 2UWAA 3ZXLA 3ZXKA 2O0OA 2WWSA 1KEXA 2ZMNA 5FPAA 4W8JA 3WW2A 1Y9MA 1X33A 5FPVA 1OA4A 1HB2A 2WQ4A 4BDVB 1V00A 1XU1A 4TXWA 4XIKA 3WZ1A 1P8JA 4PJYA 2MNGA 4HT1T 2CDPA 1VE0A 5JI9A 4GJZA 4NHXA 2ID4A 3EBRA 3I2KA 4IEUA 5D2AA 2B9UA 5BV6A 5CADA 5FK8A 3KF3A 3KV9A 1X7NA 4B1LA 2UURA 4B4PA 4O9EA 4EQVA 4XHXA 5FMDA 5IFTA 3I59B 2VNVA 1KFUL 2A3WA 1GNHA 3WY6A 2B46X 4N9IA 1KRIA 1HLCA 1X9PA 5E1RA 1UX6A 1XNAA 2BERA 2Y26A 3RJRA 4DRRA 3LDKA 4FOYA 5FLJA 4CE8A 2XWJB 3LQCA 1XE7A 1AR82 5C3QA 1UN1A 5FZ7A 1UWWA 4AHXA 3W5MA 3AMQA 2JD4A 3LSDA 1GP5A 1JUHA 2D97A 4LBQA 3I2OA 5JLVA 4TLGA 1QDOA 1OFSA 4CDUC 3POSA 1J1TA 4HPKA 4YVSC 5A6QA 5GZEA 5H9SA 2HEVF 4JHZA 1RB8G 4AEDC 1DBNA 2DBNA 5FY9A 3NV4A 1QOSA 2LRPA 1IOAA 1VBE3 2ZX3A 4FFFA 5FUNA 3S57A 3VBRB 1TZOA 2PHUA 4AAPA 1WA4A 1FYUA 4N53B 4NIIA 4L2NA 2D44A 4UW3A 2W91A 1MQTB 3NV3A 3Q8EA 1V6IA 4AWDA 5IVCA 1YI9A 2VJXA 4OUEA 3TYJA 1V9U1 3ASIA 3J8F1 4RFT0 5FXVA 1GQGA 1O8PA 2Q5TA 2VQAA 4LXLA 2WZPP 3AMPA 3J26N 4COUA 4COZA 2WSUA 3WW1A 4IESA 4LE3A 2JB8A 3NNLA 3OGSA 5CISA 3VZOA 3E5UA 3WG1A 1J83A 1KFXL 2BOJA 4LMFA 4OMDA 5KXDA 5C8CC 4FFGA 1UY4A 3ILFA 4I30A 2RJLA 3ZR5A 2WO7A 4Y33A 4DOUA 4YVWB 3ZDVA 1NLRA 5I91A 5HXMA 4BXFA 1J3QA 4BQ4A 4D7YA 1LU1A 4GAZA 3HPNA 2GMMA 1SDWA 5A7SA 4CU7A 4AVSA 3THTA 4IGOA 3DCQA 3SH3A 1AJOA 3JD71 4OZXA 2FCVA 2FCUA 2V4VA 3TB0A 1VBC1 5FMCA 4KBZA 4A2UA 1G6NA 1VBE2 2Y33A 4F8AA 2QQJA 1SPPA 3I59A 3U11A 1GZTA 1Q8VA 3PURA 1DYKA 4L9BA 5ACA1 2J1TA 3MIGA 5FYCA 3VZLA 4AI2A 2RDRA 3FLPA 2FZ2A 1HRI3 2WLQA 2CV6A 2XJTA 3LOIA 2GC0A 4C1XA 1UU6A 2BNMA 3W5NA 3AL6A 3LGRA 1JU4A 3MLKA 2Y0OA 2VW2A 3JBG1 3PMSA 1C57A 3T0BA 4NHYA 5F5CA 3S7EA 4PCRA 3A21A 1PO13 1U5IA 4IEYA 5F5IA 5BY5A 2Q8OA 4ITCA 4QPGC 3MPBA 2J7MA 3BGAA 3EYPA 3RFRA 5IK4A 2RJ2A 5IW0A 4B4RA 1F5FA 2WT2A 2B7YA 1VRBA 3AKTA 3FC0A 1LRHA 2ZGQA 1E57A 3OGRA 5F1RA 5LBCA 3BVCA 1N1VA 1BHGA 2E9QA 2G9FA 4Y1ZA 3TEYA 4PIXA 3U14A 2R071 3FLRA 4LBJA 3UV9A 5EP9A 4AFBA 2RMU1 4H3WA 4HZFA 3JB4C 3VBRA 5B4NA 2J1UA 2BDRA 4WVMB 1BXHA 5APAA 1DGLA 3P6BA 4XAAA 2VH9A 1ENXA 3KCXA 4ZU4A 3VDAA 4DZGA 2BVVA 1MQTA 2CSGA 1XU2A 4F3JA 3BTZA 2AEYA 4FQ4A 4AZZA 2Y60A 5DG2A 2WL1A 1EP0A 3RGBA 3T0DA 2E53A 3WLUA 3CJIC 3TNPB 1HN0A 4LBLA 4LORA 1BKZA 3CDZB 3LEMA 4IE7A 3WF4A 4E2GA 1RJ8A 1S0CA 1HRI2 5C3SA 1H8TB 1W2UA 2CHHA 2Q0AA 4HMZA 1DGWX 4AFAA 4I0AA 2PFWA 4WM7B 1LB2A 2UY8A 3VBFB 5C3OA 3DF0A 2DVFA 1ACCA 1MS9A 1PGW2 3H0OA 3OTFA 1AYN1 3VHRA 1OMIA 3I2DA 1PO12 2X5IB 4OFGA 4CYDA 3FUOA 1BBT1 1FAYA 3MICA 4OCTA 4BZ4A 3WINE 1DZTA 2Y0IA 5B4XA 3ENRA 5F2SA 3VDDA 3ZFFB 3ATGA 3ZSKA 4ARXA 1PVXA 2O8OA 3KT1A 1E5SA 1O8SA 2WS91 1R091 1B35C 1WKYA 1A3KA 2HEYF 2RS31 1ENSA 5D21A 1CAVA 2A73B 3SQOA 1I1EA 3Q9OA 3K4ZA 2ZGKA 4NWWA 2HWB3 1GWLA 2AR6A 4Y5Z0 5FZEA 3NL1A 2HYKA 2ORXA 3PUIA 4N43A 4KL1A 2NP0A 5D1IA 4LJHA 1XOYA 3VV1A 4HETA 4S2DA 1FOD3 4QHBA 2V4AA 3LDRA 2D6LX 1VJ2A 2MHFA 4LLFA 3OEBA 3CMGA 3SLIA 5C5TA 2SBAA 2Y6HA 3QLQA 3MLLA 2RDQA 3KZ4C 2ZZJA 3WDTA 3HN3A 5CVRA 1BYHA 2YZ4A 3SMHA 3WUDA 2XH6A 4KGQA 4XFIA 5CB7A 4XF1A 1S4CA 1DP0A 2I45A 1FV3A 1MS4A 3FN9A 3I7DA 3R05A 4IERA 4KWUA 2W1WA 1HW5A 2XJUA 2R061 4LITA 4QAWA 2LALA 2B9VA 1JOBA 3L2HA 4XFBA 2RVAA 3WDVA 2RS53 3FFZA 1H2NA 2PHWA 1RYYA 5IJRA 1JS9A 3A4UA 5B2GB 1OQDA 1RUD1 3UJQA 3WQ1A 4OHYA 4IEOA 3LA7A 2GN7A 3R4DB 5EQUA 4XQ4A 3D3AA 2VZOA 4FPKA 4LO5B 1OT5A 4AQSA 4P00B 3ES4A 2PHTA 5FWEA 3LAGA 4Y5TA 1ULPA 4JKLA 2ZHNA 3GZTB 4FXGB 4Q8KA 2IXCA 4QHOA 1JYIA 4MG2A 5BNQA 1AHSA 1E5IA 3MV01 5DDJ3 1NCQC 1XYPA 2VZUA 2VQ0A 2DCTA 3AKRA 3LA2A 3ZYIB 4O61A 1SLBA 1O6UA 5FZHA 1ASJ1 5KXCA 3HNMA 3ILNA 2HWB2 1IQAA 4QKDA 3BPSA 4TSVA 1ZRCA 1RUI3 4XILA 1J58A 1GKBA 3VKMA 1WW5A 1AYM1 2XPJA 3I2FA 1FOD2 4BIFA 4PDWC 3ZYGA 5AFEA 1LOCA 1ND2B 4HONA 2YC2A 5LBEA 1OKQA 3CJIA 2Y6GA 4L0PA 2A7AA 3NO8A 5BNOC 2FDGA 5FPUA 4QU1A 3CZJA 4YG6A 3KV4A 2JEMA 3KB5A 1NXD1 1R1A3 3PTYA 2WNOA 3KCYA 1OH4A 3W9AA 3ZFFA 1AZDA 2VOVA 5FZ1A 2RS52 1EPWA 4XMAA 3FX3A 4LHSA 4XJWA 5C7GA 1PGSA 4AI8A 1G9CA 4P9YA 1WLTA 1CD3G 1TQ5A 3PLQA 1UZ0A 3LE0A 1SG3A 2DYCA 1W0OA 2WDBA 5IHRA 3ZX7A 4I0WB 4DPNA 1LNSA 2A6VA 1YRZA 3ZFGC 2WZR1 1AXKA 3D0JA 3UGGA 3QOPA 4BXSV 4B29A 3DXTA 5DDJ2 4YW2A 2PLV3 3VZKA 5ANQA 2PTMA 3AKPA 4FXKB 4AI1A 3PVEA 3RJ2X 2JG8C 1PHMA 3GNEA 5FY7A 1W9FA 2D3SA 1UF2C 1W8ZA 1MVQA 2JICA 2RR11 4FPFA 3FWEA 3KQRA 4IE5A 3VBSB 5CBLA 5CFCB 2C1FA 5LK5A 4Y26A 4CDWB 4FPEA 3VD7A 2XUEA 1RUI2 4JDMA 4HVQA 4XAEA 2OT7A 5LA1A 3U0ZA 1JOPA 1Z0HA 5FYYA 3RWKX 3NJVA 5LRSA 1W05A 3HMYA 4YW5A 3D8CA 5E6HA 4GZ9A 5EYYA 2VZRA 3MW3A 1LESA 4LBMA 3EHKA 4NRPA 5FP9A 1REFA 1URXA 4BH9A 1WMXA 4ASMB 2NQYA 4BQYA 5JXJA 2GH2A 1QOOA 2D6NA 3WNXA 2VMHA 5BNNC 2VECA 1R1A2 1AL23 3N9PA 1QEXA 1RUC1 5FYBA 2IC1A 4MSVA 2VD7A 3ACHA 3B02A 3WNLA 1XQNA 3K77A 2F4LA 2BPA2 3DPRC 2WNVB 1JOJA 3O5SA 3VDCA 4Q4Y3 4B7KA 1D4M1 4KNCA 4IE0A 4QDSA 2BU9A 2BQPA 5F39A 3IDCB 4LULA 4AG4A 3LPGA 1HIXA 3AP4A 3NV2A 3R0RA 4RSUA 4IW3A 1QJY1 2FMYA 4R9DA 3OBZA 1UQXA 3RRDA 1UIKA 1ND2A 1QJZA 3MFCA 2X10A 1F4AA 2PLV2 2VM9A 3ZYFA 1GOHA 4DUVA 3RZHA 1W6NA 5C9AB 1I5PA 3KWVA 5I93A 4MGQA 2ZGOA 1OUXA 3TWIA 3WF3A 1POV3 1UL9A 3E6CC 3UL2A 4AHWA 3ZFEB 5FZDA 5IVJA 3K48A 2XR4A 3C7HA 4A7YA 3VKNA 5J3UA 5LA2A 3ZIXA 4BQXA 2QBXA 4IV3B 4K8RB 1CGPA 3AYEA 2RDNA 1AUYA 2H0BA 5AC91 4A4AA 1HV1A 3U07A 4OUMA 4NE9A 1LTEA 1OQ1A 3ZXEA 2VXJA 3WNMA 4C91A 1YQCA 2IVJA 1CJPA 4RQPC 4XXPA 1LHNA 5JZGB 1MEC1 2JDNA 2Y6FA 1BQPA 1F5JA 4XFFA 5FBZA 2HEWF 1AL22 2K0GA 3TRSB 1ZRRA 1UU4A 1BEV1 3MW4A 3PU3A 4MUVA 2HYXA 2P2KA 3M70A 1WWYA 1TME1 2XOMA 4NO4A 4P02B 3ZYPA 4PIZA 5KHKA 2XKOA 3T1LA 4BB3A 1UMZA 3N7KA 2XJRA 2VZ1A 1QDCA 3VBHB 3SC7X 2C0ZA 2W1SA 5T5PA 1RIRA 3T1MA 5IVEA 4BU2A 4Q4Y2 1CQ9A 4PLOA 3ZKYA 4FBFA 1G9FA 3VBSA 4Y1UA 1EPZA 3P3NA 4AQTA 4QWNA 5CFCA 1FX5A 1QNWA 2D6PA 4FT8A 4M4RA 5CKNA 1LAJA 1CESA 5IVBA 2ZGMA 2IFWA 2WINB 4FQZA 4I01A 5BPXA 2WN2A 4CUAA 5A3TA 3LFIA 5FZKA 4GB33 1OFNA 2JG8A 2ET1A 3RZMA 5FP7A 1GANA 5L7OC 4IV1B 1PIV3 3EB7A 2ZCWA 4K1YA 4I0BA 3NWKA 4OZOA 4JRAA 4Y22B 5A6YA 1RL3A 3RDIA 1FPN3 2NPIA 2P34A 5HI0A 4HSLA 4OYUA 1AR61 2FQPA 1UNBA 3NAPC 4QPYA 1FXZA 3GZEA 2GNDA 4Q0UA 5GZFA 4RN5A 3AZXA 1AX0A 5LASA 3USUB 3BN6A 3O1TA 4COVA 1W28A 1NCRC 1UAIA 5EV7A 1G9DA 4QKBA 1ZZ6A 3ZOIA 2DCJA 2MPFA 3GDBA 1DF0A 1XPWA 1QWRA 2XBO3 3T0AA 2GNTA 1RUG3 3OYWB 1ZRDA 1IS6A 3MBWA 4COWA 3CIHA 2ZEXA 5IAVA 4JGZB 5L19A 5GKAC 1ZA4A 2J42A 3O1RA 5C9AA 4GKXA 1HRV1 2WJSA 3S7IA 2VOKA 3AZVA 4PQQA 2YUEA 3VBUB 3WNNA 1UMIA 1JTZX 1MR5A 4CPBD 1PMHX 3ZFEA 2IZWA 3AMMA 2WZEA 3ETPA 3E1F1 1IS3A 2W1QA 4DUWA 2CWSA 1NXMA 3KQ4B 1YQ8A 2BWCA 2XVKA 2NZ9A 4CCLA 5EPAA 5J98B 1EV11 4GB32 5DZGA 5C8WA 2G4IA 2WA4A 3C7EA 4BQ5A 1K5MB 1FNZA 1RJ7A 2ZMLA 4MGKE 1POV0 2C26A 4P9LA 4XTPA 2QZ2A 1PIV2 3DXUA 4XJZA 5FLIA 4A42A 4QQHA 5ISLA 3VBOA 1S0EA 1Q43A 4IGQA 5FBJA 4Y1XA 3W21A 1FPN2 1Q5OA 5DAVA 1QIQA 3HQXA 4HK8A 4QD2A 4YW6A 4AR2A 1JZ4A 4FTEA 4AXOA 1TMF1 3A23A 3T08A 2DTWA 5KR7A 1BLZA 3OJBA 1RVF3 3VBHA 5A1FA 3BIEA 4AFCA 1OA2A 1IG3A 1NE4A 5JMOA 2VL4A 4CEYC 5T55A 4JGYC 1BMV1 1J3PA 1I9RA 2ZGRA 3MHZA 1X50A 4CCKA 1DQ2A 3BOPA 4YNIA 3SCHA 4BHPA 1WCSA 1CWPA 3RSJA 3O1SA 4B4QA 2B45X 3ILRA 2XBO2 1RITA 4O65A 1ULDA 1GV9A 2P6HA 4XFGA 5FQ0B 2LTNA 2W87A 1RUG2 4DXSA 3GCWA 1OSGA 2UYAA 4FAHA 2NMNA 4QKNA 4ES9A 3QD6A 5A6XA 4C0HA 3IAPA 4HLTA 2X53S 3Q8AA 2DUPA 4P9IA 2WZ8A 4IV1A 5FZFA 1SFNA 3PDQA 1S2KA 2WNUA 4Y22A 3F2ZA 5FZBA 3OGVA 3OPWA 4MH0E 3HJRA 5GZGA 2D7FA 3INAA 4QX3A 3EJKA 3BU7A 4JQRA 2HWD1 2CGNA 3F95A 3LCPA 1YEWA 3J7LA 5FZOA 1G7YA 1LHOA 4Y1YA 5FZGA 1D4VB 4Z2AA 1O7FA 1LGCA 1WD4A 1JHNA 2WT0A 4UWDA 4J1WA 4RL7A 5LB6A 3TNQA 1S0IA 4HXCA 1PVC1 1QH6A 4M3CA 2RM21 3EQEA 2PHDA 4TZDA 1DYOA 1H2LA 2CGOA 1MZFA 1FV2A 3TBDA 5HV0A 1SZBA 3J9SA 1RMU1 3WT3A 2RJKA 1US2A 1VALA 4NIGA 4XPVA 4JGZA 3AXDA 4XYXA 1RVF2 4NIHA 2P3IA 2H6BA 2QJVA 2D98A 3UGHA 2WO1A 5GJ6A 1JYXA 4ET7A 4LO7A 2PQSA 2W2IA 1RUE3 2V09A 2YU1A 4HPKB 3ZYRA 4BLJA 1R64A 3U4SA 2BVBA 4IUGA 5E16A 5FY5A 3KD4A 1KS5A 1RXGA 3FZ3A 1PZ8A 2E6VA 1DLLA 4AFDA 3BPZA 1C4RA 1ODMA 2ADEA 2D93A 3S0MA 5LEJA 3M4FA 3B9IA 1EUUA 4CU8A 3V65A 1PO23 1Y43B 1RHI3 4TYSA 1W3VA 3B01A 1LR5A 1W3XA 1VBD3 5E89A 1ULEA 2PA7A 2D6MA 1IZ3A 2GALA 2R043 4HANA 4Y20A 3WF2A 5A7NA 4V2WA 5K0UC 4LKEA 4GWJA 3AP9A 1DCSA 3NNGA 4FPLA 5I0TA 3HR9A 3HT1A 3H1MA 2A1XA 1SCSA 1WGPA 1X82A 3AJZA 5EZWA 2P17A 2FBEA 4NWVA 3WF1A 4ZONA 1TVGA 5FUIA 4BQ1A 4GH4A 3LIGA 4KG0A 4IXLA 2IFRA 5JXHA 3M3QA 4XJ9A 4OQ9A 4ATFA 4K6BA 5FQ0A 2WWJA 1GBGA 3IN9A 1LOAA 4CCCA 2ET7A 3U75A 4CDXB 4U2AA 3MIBA 4DRVA 1W9SA 2D3RA 4V1PA 2ZX0A 1STMA 4QPIB 4CEYA 4JGYA 1AX1A 1DZRA 5DUWA 4IEZA 1HB1A 3H9AA 1XC6A 1FI2A 1RUE2 4Q4W1 4LO8A 5C3PA 2CGPA 3NVCA 1UXXX 2XL9A 3HQRA 1ZBE3 4AF9A 1W0PA 4Q27A 4CCJA 4W65A 4LA3A 5FREA 4GMP1 3THCA 2JE8A 1HDKA 1HV0A 2GP3A 3WUCA 1SPPB 2N7GA 1PO22 2D5FA 1JI6A 2C4XA 4YW7A 3W59A 3ZXGA 2JKBA 4XJUA 1RHI2 1NE6A 4K20A 4RGGA 2XJQA 5DPNA 5FY4A 4EWAA 5J7MA 1VBD2 3UKTA 2VXRA 4DINB 4E9KA 4UFIA 3N7MA 3ZPOA 2R042 2ARAA 1OHFA 4CUCA 4E4DX 3WQBA 3K4AA 1CZSA 1V6LA 1NY72 4QPWA 3FLTA 3VKOA 1SLAA 1DQ0A 1J59A 1S2BA 1SFYA 2PXJA 1YJKA 3LFMA 3RPQA 1CZVA 3OBTA 5M0TA 3FHIB 5FY1A 3URFA 1H2KA 4K1ZA 4LHLA 1AF9A 1C8M1 5CKMA 4CCMA 5A7PA 5K9YA 2ARXA 3I2HA 1ALYA 4BK4A 1UY2A 2FDKA 1SDDB 4CDQA 4Z1VA 3GJAA 2E51A 4INDA 3DEMA 3HNYM 1JXNA 4LK7A 4Q0SA 4BWOA 3VLBB 1LHUA 5KXBA 1NOVA 4E2SA 5GLZA 4E2QA 3A22A 4CDUB 3OUIA 1Z7S1 1ENQA 2P3KA 2VOXA 4M3CF 2BYVE 3NV1A 1CAUB 3PVNA 3ZXFA 1DQ1A 2Q8EA 4RYDA 4WM8A 4Q8LA 1D2SA 2JE7A 1MS8A 1RUH1 5JMCA 4KH9A 1ZBE2 5CAZA 1LOFA 2BWAA 5CG9A 3OBRA 3ZN4A 2Y34A 3MIHA 3SISA 4E27A 3I97A 2PAEA 4K21A 4ZS3A 4BOWA 4YW3A 2EIDA 2G1MA 5CIRA 2HWE1 3I3BA 3M3EA 4FSJA 3D6EA 4PI0A 2VMDA 1V9U3 1H2MA 4QX1A 3ZYHA 3EO6A 4W50A 1T6GC 2WN3A 1I3HA 1N1SA 4UXAA 2BW8A 3ORJA 4A7ZA 2GSYA 3BTAA 2WFF1 3NNMA 5F32A 2O1QA 4CDXA 4P9WA 4L92A 5C5UA 4QPIA 1MS3A 3AP5A 5IK8A 4D8MA 2XL7A 3GHNA 3H8UA 1Q8OA 3POWA 1BVVA 2RHPA 3MV11 1RXFA 5C8CB 2X8KA 1UYYA 2EAAA 5IT6A 2ZGUA 3PNAA 1C5HA 1QJX1 1UCXA 2J22A 2YBKA 4IDZA 1V6MA 5JDBA 5KC6A 2ZBJA 2B5HA 2DU1A 2PHRA 4GULA 3VDDB 5IVVA 4Q4X3 1KJRA 3H8OA 1O4TA 2E33A 2AUYA 5KWRA 4XDOA 4QQPA 2ZKLA 1CAVB 3JD73 3I3EA 5CEHA 1UD1A 5EJ3A 4R9CA 3IPVA 1U12A 1NA1C 2FZ1A 4LPLA 3WNOA 5JAXA 1VBC3 1SBEA 3MFAA 4N43B 4EWEA 5C71A 2VE1A 3DGTA 1A34A 4NIDA 3N9MA 1GFF2 1D0HA 1F31A 1ZZ7A 4AE2A 1QQP1 2VOTA 2XLFA 1E5RA 1POQA 5ACA3 4XACA 3GYDA 4XHBA 3VL9A 1KDMA 4IE6A 5FXWA 2PELA 1JMUB 2BNNA 3IT8A 4B8EA 1QMJA 1W8FA 1V9U2 2BBVA 1EY2A 3JBG3 1VR3A 2AC1A 5I8TA 2DTYA 1XYOA 1Y4WA 2VO5A 3WG4A 4FOVA 4DY5A 1L7LA 1AR91 3PJYA 4LTAA 4UT5A 1SCRA 2B8MA 4XVHA 3T2OA 1WW7A 5IVFA 4NJ4A 2PYTA 1PGL1 2R32A 5EHDA 3UJOA 4EN9B 3HNBM 4UW4A 5FYIA 4QMAA 5FIXA 3K2OA 4CDUA 2Y8KA 4F83A 5BNPC 5C4WC 4QDRA 4YVSA 3RMYA 2IXKA 1CAUA 2Z5WA 2VQTA 2R073 4UI9L 4AEDA 4Y4YA 2RMU3 1RUNA 4P14A 4AVVA 1WZXA 2EXJA 3CNAA 2DURA 4Q4X2 5ABJC 1H4HA 1DFQA 1OF3A 3ACFA 3KCCA 1YQ2A 4S2FA 1UPSA 2CAUA 5H9RA 2IUWA 3JD72 3VHOA 5K7PA 1LGBA 2A6WA 4YSFA 1QXJA 1VBC2 3GF6A 1IQDC 1S1AA 2ZHLA 4CU9A 2VZ3A 4IEPA 5JOWA 3I49A 1GLHA 4K3UA 3M3CA 4JZRA 2QDRA 1W2AX 1ZRFA 1LODA 4QXKA 3FBYA 2BOIA 1J1LA 4C90A 1VMFA 4OUSA 5ACA2 4X8PA 3CJIB 4WM7C 3WSOA 4CSWA 3ABZA 4A44A 2W3JA 2I74A 2XXZA 5C8CA 4QGNA 5CG8A 1UOGA 4D0QA 2ZHKA 5FXXA 2ARBA 5A3LA 3JBG2 2EICA 2X5IC 4XF3A 1AYN3 3R4SA 1LHWA 1FMD1 5FCCA 4COYA 1O5UA 2OVUA 1OLMA 1BBT3 3O0XA 2UYBA 4LBQD 2WBKA 5FZLA 3AM2A 2ZXQA 3OCPA 4ZU7A 2D6OX 5IUQA 3CHXA 1SLTA 2QQOA 4KI5M 2YGMA 3GBFA 2G9ZA 2UY9A 1WCKA 1QJU1 1QU0A 2R072 5H9QA 3UESA 3LOBA 1W8WA 4QDQA 3P3PA 2WS93 1R093 2RMU2 2YU2A 1JBCA 2RS33 1SEFA 1XNKA 2P1BA 4FI9A 3ZXDA 4BK5A 5LA0A 3RZGA 4PT6A 1ZZ9A 3U4XA 4CCNA 1B35B 3K75B 4JDNA 4RS5C 4ASLA 4ONUA 4XUOA 4CEWC 3RZLA 1UXZA 5A80A 1WCQA 3RZJA 2XONA 2WR9A 3DYMA 4N7IA 3I3DA 2PAKA 3PVBB 4XIOA 1ZZ8A 5JIAA 4FOWA 3LKJA 1CZTA 2WAAA 1RUJ1 4N90A 4R9AA 1XRUA 3C3VA 4UFJA 2ZEZA 3NMBA 5FLHA 1W8HA 3AVSA 1JH5A 1F9KA 3PUAA 2FDFA 2B39A 4IE4A 4Q4V1 2W47A 4A41A 4JRLA 4QPGA 1AVBA 5IATA 2R063 3UKNA 2QQWA 1YHFA 4XUPA 4IEQA 4NOTA 4QX5A 3OPTA 4ZS2A 5L36A 4LO4B 5EXOA 1PMIA 2YB7A 3QBQA 1RUD3 3OY8A 2W52A 3JQWA 1N3QA 1AYN2 2FD8A 1ZBA1 2YBPA 2C9AA 5FZ0A 5I0UA 2AH2A 4L99A 3L9JT 3HD8B 4QU2A 3ZLIA 1BBT2 4QB1A 2VVFA 2NLRA 1A8MA 1HN1A 4XMIA 2RG4A 3C2UA 2SLIA 3FHAA 1G8WA 1VLNA 1ZRIA 3PTRB 3ELNA 3WQ0A 1A8DA 5LK7B 2OYZA 1UYZA 4FP3A 4XBLA 2FDHA 4OI1A 1W8UA 4Z07A 4DS0A 2ZGTA 2W46A 2VMIA 3JB8A 1VB4A 3HBZA 5FMBA 2WS92 4JV4A 3ZPYA 1OF4A 4B1MA 3VL8A 3VUOA 2RS32 1GZWA 1YC61 1NZIA 1ASJ3 1DG6A 1ONAA 2CDOA 1NCQB 2GC1A 3OGGA 1HXS1 1MACA 4GQ7A 4LR4A 1LEDA 1W6NB 3ZN6B 5JSRA 1AR71 2D40A 3J7HA 3VD9A 4Y5SA 5LBFA 1UKRA 1AYM3 3MIEA 3OF1A 3WDWA 2P6CA 2OQ6A 2VCAA 4PI2A 3H8RA 2DVBA 5LEKA 2JE9A 4YLZA 2VZSA 4HFSA 5DQ0A 3DKQA 3ITQA 5T5OA 4PDWB 2ZGLA 3JXSA 3WCSA 4OI4A 1VAKA 2ZZQA 5A3OA 2WWUA 1V0AA 4D6RA 4DXZA 3IDAA 1FATA 3S5QA 4KWLA 4Q2FA 2VTFA 3IMNA 3N7JA 4LIVA 4X6QB 4D6QA 3LB9A 4Q0QA 5BNOB 3O1MA 2F6BA 2VW0A 2R062 2ZX4A 4R9BA 5F9TA 3DN7A 3MW2A 3WNKA 5EIYB 3BTXA 2VVEA 4AGGA 1W6QB 4AVTA 5HCBA 5BUVA 1RUD2 5JI7A 3S6PA 5T52A 3MPPG 3KGZA 3CO2A 1VPHA 5JXGA 1B35A 3WEZA 1RTVA 5IYYA 4ZHNA 2J1VA 3QH7A 1BCXA 2BUKA 2WZR3 3D0SA 3WW3A 1PZ9A 4C0BA 2JG9C 4LUMA 2BV4A 2DU0A 1J84A 4QX2A 5FYVA 3UK9A 2OS2A 4NPLA 1K5JA 1S2EA 2JDMA 1W2OA 1R083 2P37A 3AFKA 3O0WA 4NAOA 4CA9A 5ANNA 4PLNA 1ASJ2 4RA0A 4CEWA 4CDWC 2JG8B 2RR13 1VAVA 2W5FA 3WP6A 2BZDA 2A5ZA 3I2IA 2K9ZA 3BOWA 3VB9A 2YY1A 1AYM2 1WCDJ 1RUF3 1JHJA 3FBMA 1XE8A 2CY6A 3KHBA 4JAAA 1VBB1 4R52A 5JVVA 3JZVA 4Z8BA 1VAMA 1UZWA 5A3PA 5FP4A 2Y6JA 3AVRA 1TNFA 4M00A 4R4XA 5F3GA 1OD3A 1O91A 1W6OA 1JODA 4XBNA 3ZYJB 4JKKA 3H3ZA 4JCKA 3RZZA 1RUC3 2W08A 4FOQA 5BNNB 1FT9A 4DB5A 1W6MA 2RE9A 2YPJA 2XJPA 4WVVA 1W9TA 2DFCA 2VBDA 4XOGA 1XBFA 1N1TA 2OKXA 3WV6A 1SACA 4WBBA 1GZ9A 1NCQA 3AKQA 3AYCA 3E5XA 1D4M3 4Q26A 3OBAA 4XETA 4YGDA 5T3NA 3TEWA 1D2QA 1VP6A 3IM0A 3JQXA 3ZN6A 4UF0B 1JZ8A 1GNYA 2AEZA 1VRH1 2WZR2 3M3OA 1QJY3 1Z78A 3N4MA 2D43A 4IGPA 1XNCA 4RR3C 2OQ7A 5KXEA 2QUOA 2RS11 2MEV1 3E6DA 4IQPA 4DEQA 2R6QA 1C28A 1K12A 3R4UA 4UAPA 2AZ5A 2I2SA 1OOPC 2A6ZA 1XB9A 4QM8A 1ND3C 1R082 1TE1B 2LS6A 4PDWA 3SHRA 3POFA 3SKVA 1TNRA 4W6WA 4ARYA 4XQDA 4NAMA 1TEIA 1D7PM 2LROA 5FWJA 3BKZA 2RR12 5BNOA 4IV3C 2V73A 1H30A 4YGCA 2JWPA 4FPHA 4BYYA 1W8TA 4GALA 3AJYA 1VBA1 2F17A 3DL3A 3R6SA 2HJIA 3TN91 3VBOB 4MGTA 1W6QA 1OA3A 4AEJA 5AC93 4XJAA 1RUF2 1L7RA 3KSCA 2ZX2A 1OI6A 3ACIA 1A78A 1UPIA 3M3IA 5JZGC 3AB0A 2ZA9A 2HBTA 1ZZCA 3G6JB 4IEXA 4QT6A 4Y4RA 4MHUA 3LZZA 5CFDC 1GMMA 5HXVA 4K8FA 2C6SA 2GNBA 1MEC3 3IMMA 1JZ2A 2OUJA 4Y24A 4A3ZA 3I8TA 4QX8A 4LK6A 4DEVA 3O1PA 2YV8A 3AZWA 5GZDA 4RQPB 1BEV3 4KU8A 3CLPA 1RUC2 5FUPA 1TME3 5FZIA 3ZFGA 2QQVA 4HN0A 4OI0A 1BVP1 1IPJA 2ZKNA 1W0NA 3VZMA 2GP5A 2E31A 2ZGSA 3AP7A 2UWBA 1D4M2 1HB4A 3DKWA 4YRDA 2W0XA 3SCGA 4YZ1A 5C33A 1CAXB 4PLMA 4XEZA 3VKLA 2ARCA 3IZOA 4XF4A 5CA6A 1QJY2 2QQMA 1UU5A 2WNUB 4HKOA 2JDHA 4G9SB 2QQLA 3IDBB 5BXXA 2FCTA 5JUVA 1PM7A 1ULOA 3CBNA 1DU3D 4AHYA 3W20A 4RHV1 2W95A 1CPMA 1DQ5A 1WD3A 3HQUA 5FJKA 5FZOB 2YMZA 4XF9A 1T6BX 1PIV1 5FYZA 4D7TA 1ZVFA 2YFUA 2HWC1 4WZCA 3AFGA 1UIJA 1ULGA 2R1DA 3PIGA 4NVPA 4S2GA 1UYXA 3JCIA 4M3CB 3WW4A 1REDA 1AR63 3AKSA 5BNNA 4KGGA 5DAQA 2OXBA 5FR3A 2O8QA 3WG3A 1EAH1 5AC92 1EUTA 2RDSA 1YO8A 2LM3A 4WVWA 1CIYA 3DYOA 4YGEA 4Z2WA 2PHXA 3DPRA 5FPBA 4EROA 1DLCA 2VU9A 2A70A 1OBNA 4UF0A 3E5QA 2HWF1 1MEC2 1F8VA 5AFBA 1MS5A 4PQ9A 2WQZC 2WLPA 4MGIE 1BEV2 2ES3A 1TME2 2BGCA 2OZ6A 3BU0A 3MYXA 2VW1A 3VBUC 3D4KA 4H7MA 4D69A 4BQ2A 4CP2A 4UFHA 2YFZA 2DVGA 1OPOA 4XF0A 1HRV3 2NYYA 3AZZA 2OX0A 3CQOA 1SLCA 1IPKA 5A32B 4Q0VA 1RC6A 1BK0A 3ZXJA 4AQ2A 3PJQA 1UO9A 4XE9A 2ORZA 5ERLA 2Q8DA 5LZ6A 1GSLA 3T2PA 5D8AC 3ZR6A 3BCWA 1K5MC 1OOPA 1RGSA 3I54A 4Y20B 3O1OA 1PK6C 3AXEA 1N3PA 1OPMA 1EV13 3C7GA 2YC4A 2TUNA 1K45A 3H50A 4NR1A 4QX7A 1V6JA 1W9WA 3I2JA 5HCFA 3SH4A 3LIHA 3X29B 5KHGA 1M06G 1W8OA 4R4ZA 3ZSLA 1V6OA 3L2YA 3LDBA 4QGMA 1C8NA 5LATA 3VDBA 5EYXA 3V0BB 1WBFA 3B00A 4EN6B 1O3RA 2XUMA 4MADA 3WP5A 4EN7B 5A1AA 2B42B 4GH4B 4RQPA 2CWMA 2WAOA 4JTNA 1ENRA 2IWGB 3OSDA 1AR62 2JDYA 4E8CA 1TMF3 3A0KA 2VCBA 1COV1 2WIIB 4FFIA 4NHLA 5FRAA 4YYOA 3Q8CA 2J1EA 2VVDA 2GMEA 3WDXA 4AI0A 4AVCA 3T2TA 2EA7A 2IXJA 5FXZA 5C6CA 1WLDA 3AZYA 4HL0A 5SV5A 1G86A 4UW6A 4WV8A 1F4HA 1U0AA 4ZZ5A 3I3QA 1CAXA 3MF6A 4YM2A 5F3IA 4CEYB 3APBA 3N9OA 4JGYB 5CYYA 4Q29A 2JENA 1JYCA 1ST8A 1YFXA 3IIAA 1IGOA 3ETQA 4PIYA 3H1WA 1HB3A 3U1XA 1PNFA 2ZX1A 3ME2A 3C7OA 3OG2A 1CVNA 1LCLA 1HRV2 2YC0A 4KBBA 4CCEA 1CAWA 1OQEA 4PF5A 1DZQA 2EVXA 1F35A 2VNRA 4EZ4A 1BZWA 2TEPA 5L7OA 2OZJA 1QH7A 2JX9A 1LEMA 2RV9A 4XBQA 2CTVA 2VZPA 3HN1A 2HWD3 2GU9A 4GWIA 3ACGA 1JZ6A 5DUVA 5FPLA 2E7AA 1LJ7A 4HVRA 1Y9QA 4NRMA 3FJSA 1EV12 3NAPA 3IAQA 3KMHA 4XZPA 4WVZA 1PVC3 3UETA 2GZWA 4L97A 4EE2A 2CNAA 2RM23 5FZCA 3ZMOA 3USSA 4C1WA 3N9NA 1NCRA 1XNDA 2F4PA 4RD7A 4AQ6A 2QQUA 1HKDA 1RMU3 1CJDA 1VB2A 4BMEA 1GWMA 5DG1A 4LKDA 4OLLA 1TMF2 4CDQB 2ZGNA 3N35A 3SEEA 1WLWA 1YI7A 2KXLA 1K42A 5J36A 4M3CE 5FYMA 4A6OA 2BNOA 4ISQA 5JSOA 1YWKA 1W6PB 1JYNA 4BA6A 1CPNA 5A32A 1US3A 1GZCA 2G9GA 2LUWA 2W92A 3VKFC 4M01A 3FFQA 3PIJA 5FO9B 1YQ6A 2XGXA 3T3YA 4AFMA 2ZABA 3ZO0B 2ATFA 5J1XA 1GOGA 4MXVA 4WM8B 3M2MA 5CU1A 2Z42A 3ZSMA 1LENA 4LNVA 3GCXA 1S55A 3OD4A 4E8DA 2VZQA 5LCWL 3V0BA 1APNA 3NJYA 3PVOA 1CN1A 1UY0A 2VMFA 4LOSA 5GZCA 1OUSA 5FOBB 1CX4A 3KF5A 2J1SA 4JHTA 2HWD2 1AR81 2DVDA 2Y64A 1NY71 2VUDA 5DXDA 1H8VA 4YGBA 4ASKA 4BM8A 4OHZA 1W2TA 3SEPA 3FL7A 3T30A 5FO8B 3OUHA 3N9QA 2WYFA 3MUZ1 1JW6A 1PVC2 1Q56A 1Y9GA 2JXAA 1WLCA 4LA2A 3DYPA 4P9XA 3AX4A 4Q1PA 2RM22 4EJRA 4LHNA 1AXYA 1M4WA 5K4LA 2BJSA 1LECA 1ULFA 2QTWB 4H7LA 3KVBA 4D6SA 2JDKA 3M7AA 4PHZA 4QXCA 1RMU2 1I5ZA 2A75A 1H9PA 2E63A 1LGNA 1Q8SA 1S0FA 4LLOA 4QQLA 4I09A 4CP9A 1QXRA 3Q8FA 2XHKA 2G19A 3AK0A 4CXWA 5J09A 1GQHA 4URAA 4MV2A 1GWKA 4Q4W3 1YCIA 4E4ZA 3VN4A 3SNMA 4H2AA 5FP3A 3AMHA 1Q8PA 2DDUA 3IPVB 1H6YA 1UOJA 5C3RA 4GMP3 3NJZA 1LOEA 4KMQA 1GR3A 4HKLA 4KWKA 5IAXA 2BP6A 4KU7A 4X6RB 5F5QA 3U37A 2DF7A 3GALA 3S30A 2AENA 2EIGA 3B9CA 3QACA 4AGVA 2JECA 5I0DA 4RFRB 2V5DA 2DCKA 4HK9A 3U78A 2HBUA 3IIIA 1GU3A 3LF7A 4GJYA 4F7ZA 4CTEA 1S0GA 2WO2A 4G3YC 4LUKA 3ZXAC 4TWTA 1H1MA 2ZAAA 4GWMA 3KT7A 5A7WA 1T2XA 2YPDA 4CCOA 5FDBA 1QJEA 2Q4SA 1IPSA 2WKKA 4RGAA 1C8M3 1OKOA 1SLIA 1MZ6A 1W6PA 2A3YA 3IB3A 3N3HA 3PMEA 5FO7B 5T5LA 5I8YA 3TEZA 4FFHA 3GBGA 3K4DA 1NQJA 3HIFA 4KG8A 2QKDA 5FYHA 1HJGA 2VBBA 3K3OA 1Y7BA 3VBRC 4YVSB 4YWAA 2ZOEB 3WOGA 1VBE1 4AEDB 2ZEWA 3BUCA 3CF6E 4N53C 5G04L 5LW9A 1MQTC 2QZ3A 4N7UA 2D5HA 4EN0A 5IK5A 1Z7S3 1MZEA 4B3NA 3NSTA 5HPOA 4NPRA 4Q4W2 1VIWB 1VMJA 2W39A 2WT1A 3DUIA 4XJ8A 1RUH3 3B94A 2KR2A 2QFEA 2DVAA 3J8F3 5K0UA 5FZ6A 4BPZA 2QE3A 3KHCA 1DDLA 4M0NA 3GXUA 2ENRA 2R0FA 2XJVA 3I3MA 3ZYBA 4L8QA 4YM3A 1GP6A 5F6LB 3POYA 2XVGA 1F2NA 1HJFA 2HWE3 3ZSJA 1DGRA 3WHUA 1I6XA 5FZMA 4ZXEA 3OGJA 1WA6X 2EALA 1DIWA 2W9XA 4YVWC 2PHLA 3RYPA 1KD7A 1YQ5A 3WG2A 2X09A 3DV8A 4Z82A 3O1VA 2YXSA 2H0VA 3VGIA 2WFF3 5FPZA 3OOXA 4EV0A 2WABA 2X29A 1OLQA 4FVVA 1QF3A 3DECA 1IKQA 1C8M2 3QCWA 3VDDC 5A3UA 3E97A 2EIBA 3HWJA 1ZREA 1GQPA 1QJX3 1SBFA 2JDPA 3ECQA 1S0JA 1DQ6A 4Q4X1 1ODNA 3ES1A 3THPA 2LW8A 4MHRA 3POJA 3V64A 3KVAA 3MGUA 2QNKA 4FTSA 4LIUA 1NT0A 3ZKUA 1XJAA 4LOTA 2WYSA 4IEVA 3JU9A 1UZYA 2JKXA 4N43C 1JU3A 1KQRA 2K46A 1Z7S2 4M0HA 5HV4A 4MLOA 3OB8A 4M4PA 1HRI1 4L11A 4AVBA 4P5HA 1NA1B 1MS1A 1RUH2 5FMOL 5DAWA 1W9YA 1UY3A 4JQTA 4GMP0 3J8F2 3T4HB 4ZU5A 4YZ2A 2D3PA 2ZMKA 5FKCA 1PGW1 1QQP3 1YFUA 4Y3OA 3O0VA 1DQ4A 1PO11 1OURA 2IXIA 4N9HA 2HWE2 1LULA 1WCUA 3P5BA 5A1LA 5FTTC 2ZPXA 2V5YA 4QPGB 4MYEA 5CNAA 2GMPA 1SQ4A 2EAKA 3MLJA 1KITA 3VZJA 5F6KA 1JN2P 2PN5A 3NQHA 1AR93 1Y3TA 4QQOA 5A6ZA 3FUQA 3UT0A 3B3QE 4AEKA 2R16A 2XQXA 4FTBA 5T50A 1E5HA 2WFF2 4OHWA 2PHFA 3RNSA 3OY8B 4AW7A 1W06A 4NIAA 4LBNA 4S2HA 4LT5A 3RYKA 1GOFA 2OW4A 3GZAA 2VGDA 4BJ0A 1A6CA 2GC3A 4EWDA 4P9JA 3MZHA 5DN2A 3SH5A 2JDAA 1NG0A 5I0RA 1O4ZA 4MGZE 2JDZA 2WFPA 1QJX2 3CEWA 4NMIA 5A3MA 1H6XA 2Q1ZB 4ZKTB 5BNPB 5C4WB 2ADDA 3EXUA 3SITA 1NLQA 2VNGA 1F15A 4NROA 4N53A 1YIPA 4QGLA 3LD8A 4OHVA 4OULA 4ZPIA 4MGSA 1C1LA 5AVPA 1GZWB 5ABJB 2Q30A 1V70A 1H8TC 3POIA 4ZXKA 4NN0A 1YFWA 3IBMA 4P08A 5FY8A 2EXHA 2VY0A 2E32A 3VBFC 4OMCA 5LY1A 1AX2A 4LO6B 3PU8A 1QJFA 1QGLA 5EJ1B 5JWPA 1LOBA 4MZUA 1W03A 3WVJA 1QQP2 1MPXA 4AOCA 1U5ZA 3RMXA 3RVHA 3NKTA 4OHXA 1WMEA 1CX1A 4JDOA 4QHZA 3WD5A 4QQ2A 4MGYE 3ZFFC 3ALQA 3BIWE 4YVWA 3BALA 3ZSEA 1QY4A 1NUKA 2QQKA 3J4UH 5EJZB 3V0AB 1XE0A 2ILMA 3SXWA 5DMYA 2XLGA 1AR92 4FPGA 1FMD3 5KBFA 3HOBA 1IKPA 2R0HA 4I3GA 1PGL2 5T54A 2WQ8A 4GIQA 3KV5A 2VMEA 2YBSA 2TBVA 3MIFA 1HQLA 4SBVA 4K9SA 2HWB1 4FPCA 4XDPA 5BYNA 2BGOA 2Y6LA 5F3EA 1QJU3 5F3CA 3H3LA 3P1IA 1NA1A 2ZACA 2W1UA 3I4IA 1FOD1 1OLME 5FYSA 2IXLA 3RYRA 4DQAA 1U5YA 1W8NA 1BJQA 2VNOA 3O7OA 4AGRA 2VCCA 2WNEA 5CZKA 4MXWB 4RS5B 4CEWB 5LA9A 4LBOA 5FZ3A 5JR2A 4C8DA 2GH8A 3K46A 1G9BA 1O3TA 5FJHA 1RUJ3 3VHNA 3WCRA 1LKNA 4XCBA 1UX7A 2BFUS 2UWCA 2RS51 2VPVA 3QH6A 4GA9A 4EZHA 4YZ5A 4AL9A 1UMHA 3KLSA 4Q4V3 2XKPA 4UOJA 4BQWA 5I0SA 2AREA 4R8HA 4YZ3A 4KQ7A 5JIUA 1UZVA 1CONA 1WBLA 4FP2A 4XC9A 4EYUA 2GAUA 1WMFA 4K40A 4QKFA 4UYBA 5DUXA 3K51A 4AK3A 1HQNA 1W6OB 2JD9A 4MX3A 4P5YA 5F8PA 2DFBA 3Q8BA 5C4WA 5BNPA 1ZBA3 4WVMA 1X8EA 2VAUA 2V72A 1FMD2 2PAMA 4LKSA 4XFAA 4DY3A 1JZ3A 2ERFA 1W6MB 5DDJ1 1WW6A 3OEAA 5F5AA 3POEA 1YNAA 5FY0A 5FZAA 5LBBA 5LWBA 1R092 3BI3A 5ABJA 2FDIA 2C24A 4LQRA 1WUVA 4FPJA 3B5LB 1SBDA 4I2OA 2JIJA 4NUBA 2DBIA 5FAXA 1O3QA 4W6XA 3PUHA 4YM1A 2R49A 3D5OA 3W58A 3H8XA 3WP4A 1QJU2 4JVAA 3MIDA 5FP8A 3LEGA 1ND2C 1RUI1 1UW8A 1UOBA 2E7QA 5JSPA 4OQ8A 2O14A 2A6XA 2GC2A 3H3UA 1KS4A 3GZUC 1U5XA 1HXS3 1AXZA 3AYDA 2J1AA 3PL0A 5GLVA 1X9TA 3VZNA 4A3XA 1AR73 1H8TA 2YYOA 4AHZA 3B69A 2VZTA 1BK1A 4GWNA 5CKQA 3UNPA 5FOJB 2NN8A 4WM7A 4B7EA 3FE5A 5GLTA 3RS6A 3THDA 1UOFA 3H1YA 4UFKA 1R1A1 3NRUA 3VBFA 3V0AA 5FZ4A 3NNFA 1RUJ2 2XLAA 4MOAA 4QXHA 2X5IA 5C70A
chains in the Genus database with same CATH topology
3HAGA 3WQ7A 4Q4V2 1D0GA 1MZ5A 4DNYA 3O14A 1KJLA 4YW1A 1YIFA 1YXWA 5LRRA 3MI8A 3MDPA 2FMDA 2Z69A 2DWRA 5H9PA 2PQQA 4H55A 1ZBA2 4YW4A 3ZFGB 4KWJA 4AVAA 4AI3A 2PLV1 5GLWA 5JOXA 3VBSC 5KHJA 5CFCC 2UU8A 4MXWA 4H14A 4RS5A 5IK7A 4IL7A 1OD5A 5JPMB 4D94A 3ST7A 5JR7B 3SCFA 4CRQA 1N1YA 2JG9B 3WR0A 1N3OA 3V56A 1R081 2VOWA 1ZM1A 1HXS2 3G7DA 2NM1A 1AR72 5KC5A 4X8NA 2XB6C 1JUIA 1RUF1 2JJ6A 4ISRA 1GYKA 1AL21 4GKYA 1VBB3 2VULA 1XYNA 4YZ4A 1LU2A 3TOJA 3IDEA 1GICA 3ACLA 1ZZBA 2A3XA 2WNVC 4UW5A 1RINA 1W39A 1X36A 3HT2A 4CZSA 2R1BA 2Q1MA 1ZNPA 4K7JA 4Q4Y1 3DPRB 2ZS6B 3LSEA 5KHHA 2YGLA 1WMDA 4QM9A 3PHMA 4XDQA 3KT4A 5TSWA 4ATEA 5C9AC 1J3RA 3WXPA 2D6KA 3ZFEC 1NQDA 4YM0A 1VRH3 4ES8A 1POV1 1PNGA 4DFSA 1QHDA 1S0DA 2RS13 2MEV3 3AYAA 2W68A 4RR3B 1H1AA 1ZX5A 3AP6A 3KS7A 3RQ0A 3ZMNA 1R1ZA 2QCSB 3ROUA 2DUOA 3M1HA 1OOPB 2ZGPA 2QDNA 3H7JA 1ND3B 4D7SA 3VBOC 4JTOA 2OUHA 3B93A 1H0BA 1VBA3 3GHMA 1CIWA 3TN93 5JOYA 4Z92B 2AYHA 1S0BA 5EWSA 4XFCA 4FCAA 1KDKA 1O5LA 1VBB2 1CR7A 4LEJA 3VBHC 3ZN5A 3KM5A 5JPNB 4I02A 1QKQA 2KA3A 5CFDB 1Q3EA 1H4GA 1QXPA 1XNBA 3CJXA 3FMGA 4BCUA 3IKWA 4UBGA 3OPZA 4YG0A 2JG9A 4BIOA 5FPXA 2YDEA 5GM0A 2EXIA 4NHMA 4HBNA 3GBWA 1V6KA 3AMNA 4IV1C 4AEMA 4GB31 4Q0PA 5DUUA 2WNUC 2XWBB 4AYUA 4CDWA 1VRH2 2XJSA 1CAWB 1O4YA 2C5DA 1H9WA 1YUDA 4LHKA 2RS12 2MEV2 5SV8A 5L7OB 3ZVXA 1FPN1 5J96B 4ORFA 4RHV3 4I3PA 1IS4A 4A7KA 2CYFA 2BFUL 2HWC3 1REEA 3NAPB 4WZFA 4W6YA 2AGSA 1UZZA 1AL0G 5A33B 4SLIA 4XQWA 1VBA2 1V6NA 3TN92 1NCRB 3U10A 3WHTA 4XXAA 4XFHA 1EAH3 2XBO1 4JGZC 1EYBA 4U36A 1RUG1 2GNMA 2WNVA 2Z2SB 3ZDSA 1PZ7A 2DUQA 1Q8QA 2A71A 3M8LA 3RWNA 4PBOA 3WDYA 4BLIA 1B09A 2WSVA 1DHKB 1ULCA 2HWF3 3BODA 4IETA 2ZTNA 1H1IA 2XVLA 3N36A 4RR3A 3O12A 4XW3A 2EF6A 4D3WA 1UKGA 1C1FA 2VG9A 1QNYA 1MS0A 1DYPA 5DZFA 1C3HA 1ND3A 3D82A 5T5JA 1KXGA 4J1XA 2I07B 1C5IA 4IV3A 3JUUA 1LHVA 1HQWA 2QQPA 5HBAA 4GXLA 1G9AA 1HX6A 5D8AB 4RHV2 1YFYA 2DCYA 1PK6B 2VUJA 3N7LA 4UBHA 4J6GA 4GH4C 1RVF1 5JZGA 4BMBA 2HWC2 5JCTA 4E4SA 5CFDA 1YLLA 4P9GA 2E7TA 1NLSA 3WX5A 1COV3 1EAH2 1X8MA 4G4FA 1SMVA 2BTVC 4FAGA 3WP3A 2HWF2 4NHKA 4HVOA 4FPOB 5FMOS 3IWZA 2ZJCA 1IHMA 1N47A 3NW4A 1XXNA 2KM2A 5GALA 4BE3A 3LWCA 2ZAHA 4FPYA 2EXKA 2K2SA 5J37A 2NMOA 3WDUA 1YYNA 4CP1A 1YJLA 4YFZA 3KGLA 3ZIWA 5A33A 4EN8B 5JOZA 3NKGA 2ETEA 1WW4A 1IS5A 1NYWA 3RI8A 1AJKA 2A6YA 1DGWA 2CAVA 1GNZA 3USUA 1BMV2 1L3JA 5AVAA 4O9GA 4YG3A 1OLRA 2FHRA 1O3SA 4DMIA 2YHJA 3CL1A 4CDQC 2OA2A 3OYWA 1RUE1 4LBKA 4XTMA 4FO9A 2BEOA 1COV2 1ZYBA 2P3JA 4HKWA 4TLFA 5DZEA 4LBQB 2DV9A 1DGRN 5GLUA 5J48A 3VBUA 2IXHA 3VHPA 3CU7A 4HN1A 2OIIA 5K8SA 3TAYA 1PO21 3MEPA 4JC1A 1RHI1 2TNFA 2WC2A 3MF9A 4WM8C 1VBD1 5HCAA 2VMGA 1RUOA 5KHIA 1LOFC 2OPKA 2R041 3UKVA 2YROA 4CP0A 5E88A 5D8AA 5K0UB 1K5MA 2QVSB 4PBPA 4Q1RA 1PK6A 2HKXA 4MVTA 2WA3A 3OD0A 4LE4A 3RI9A 3H7YA 4META 4URTA 2GDFA 1SLLA 1AR83 1FNYA 5I8SA 2CL2A 1MVEA 3A0NA 4OI2A 4CDXC 4IEWA 1LOGA 5E8AA 5EFUA 4QPIC 5L73A 2Z79A 4OVEA 2ZHMA 3LA3A 3BB6A 5FFOC 2VUAA 2R30A 2Y38A 2DCZA 4Y1VA 3RG0A 4HSJA 4YFWA 2H6CA 2XG3A 2GN3A 3E6BA 1QOTA 3B7MA 1NZCA 1ZBE1 2UWAA 3ZXLA 3ZXKA 2O0OA 2WWSA 2ZMNA 3WW2A 1X33A 1OA4A 2WQ4A 1V00A 1XU1A 3WZ1A 4XIKA 4PJYA 2MNGA 4HT1T 5JI9A 5BV6A 3EBRA 4IEUA 5CADA 2B9UA 1X7NA 2UURA 4B4PA 4O9EA 4XHXA 3I59B 1KFUL 2A3WA 1GNHA 3WY6A 2B46X 4N9IA 1HLCA 5E1RA 1UX6A 2Y26A 3RJRA 4DRRA 4FOYA 5FLJA 2XWJB 1XE7A 1AR82 1UN1A 4AHXA 3AMQA 2JD4A 3LSDA 1JUHA 2D97A 4LBQA 5JLVA 1QDOA 1OFSA 4CDUC 3POSA 1J1TA 4HPKA 4YVSC 5GZEA 5H9SA 2HEVF 1RB8G 4AEDC 1DBNA 3NV4A 1QOSA 1IOAA 1VBE3 2ZX3A 3VBRB 2PHUA 1WA4A 1FYUA 4N53B 4L2NA 2D44A 4UW3A 1MQTB 3NV3A 1V6IA 4AWDA 1YI9A 3TYJA 1V9U1 3ASIA 3J8F1 4RFT0 4YARA 1GQGA 2Q5TA 2VQAA 2WZPP 4COUA 3AMPA 3J26N 4COZA 2WSUA 3WW1A 4IESA 4LE3A 3VZOA 3E5UA 3WG1A 1KFXL 5KXDA 5C8CC 3ILFA 4I30A 2RJLA 4DOUA 4YVWB 1NLRA 5I91A 1J3QA 4D7YA 1LU1A 2GMMA 1SDWA 4AVSA 3THTA 3SH3A 1AJOA 3JD71 4OZXA 3TB0A 1VBC1 4A2UA 1G6NA 1VBE2 4F8AA 3I59A 3U11A 1Q8VA 1DYKA 4L9BA 5ACA1 3VZLA 3MIGA 4AI2A 2FZ2A 3FLPA 1HRI3 2WLQA 2CV6A 2XJTA 3LOIA 2GC0A 4C1XA 1UU6A 2BNMA 3LGRA 3MLKA 2Y0OA 2VW2A 3JBG1 3PMSA 1C57A 3S7EA 4PCRA 4IEYA 1PO13 1U5IA 5BY5A 2Q8OA 4ITCA 4QPGC 3MPBA 5IK4A 4B4RA 1F5FA 2WT2A 2B7YA 3AKTA 3FC0A 1LRHA 2ZGQA 1E57A 5F1RA 1N1VA 2E9QA 4Y1ZA 2G9FA 4PIXA 2R071 3FLRA 4LBJA 3UV9A 4AFBA 2RMU1 4H3WA 4HZFA 3JB4C 3VBRA 4WVMB 1BXHA 1DGLA 2VH9A 1ENXA 3KCXA 4ZU4A 4DZGA 2BVVA 1MQTA 1XU2A 4F3JA 4FQ4A 5DG2A 2WL1A 1EP0A 2E53A 3WLUA 3CJIC 3TNPB 4LBLA 1BKZA 4E2GA 1RJ8A 1S0CA 1HRI2 1H8TB 1W2UA 2Q0AA 4HMZA 1DGWX 4AFAA 4I0AA 2PFWA 4WM7B 1LB2A 2UY8A 3VBFB 3DF0A 2DVFA 1MS9A 1PGW2 3H0OA 3OTFA 1AYN1 3VHRA 1OMIA 3I2DA 1PO12 2X5IB 4OFGA 4CYDA 3FUOA 1BBT1 1FAYA 3MICA 4BZ4A 3WINE 1DZTA 2Y0IA 3ENRA 3VDDA 3ZFFB 3ZSKA 3ATGA 1PVXA 2O8OA 3KT1A 2WS91 1R091 1B35C 2HEYF 1A3KA 2RS31 1I1EA 1ENSA 1CAVA 2A73B 3Q9OA 2ZGKA 4NWWA 2HWB3 4Y5Z0 2AR6A 3NL1A 2HYKA 4N43A 4KL1A 2NP0A 5D1IA 3VV1A 4HETA 4S2DA 1FOD3 4QHBA 2D6LX 1VJ2A 2MHFA 4LLFA 3SLIA 2SBAA 3QLQA 3MLLA 3KZ4C 2ZZJA 3WDTA 3SMHA 5CVRA 1BYHA 2YZ4A 3WUDA 2XH6A 4KGQA 4XFIA 5CB7A 4XF1A 2I45A 1FV3A 1MS4A 3I7DA 3R05A 4IERA 1HW5A 2XJUA 2R061 2LALA 3L2HA 4XFBA 3WDVA 2RS53 3FFZA 1H2NA 2PHWA 5B2GB 3A4UA 1OQDA 1RUD1 3UJQA 3WQ1A 4OHYA 4IEOA 3LA7A 2GN7A 3R4DB 4XQ4A 4FPKA 4LO5B 4AQSA 3ES4A 2PHTA 3LAGA 2ZHNA 3GZTB 4FXGB 4Q8KA 2IXCA 1JYIA 5BNQA 1AHSA 5DDJ3 1NCQC 1XYPA 2VQ0A 2DCTA 3AKRA 3LA2A 3ZYIB 1SLBA 1ASJ1 5KXCA 3ILNA 2HWB2 1IQAA 4TSVA 1ZRCA 1RUI3 4XILA 1J58A 1GKBA 3VKMA 1WW5A 1AYM1 2XPJA 1FOD2 4BIFA 4PDWC 3ZYGA 5AFEA 1LOCA 1ND2B 1OKQA 3CJIA 2A7AA 3NO8A 5BNOC 4YG6A 2JEMA 3KB5A 1NXD1 1R1A3 3PTYA 3W9AA 3KCYA 3ZFFA 1AZDA 2VOVA 2RS52 1EPWA 4XMAA 3FX3A 4XJWA 1PGSA 4AI8A 1G9CA 4P9YA 1WLTA 1CD3G 1TQ5A 3PLQA 2DYCA 1W0OA 3ZX7A 4I0WB 4DPNA 2A6VA 1YRZA 3ZFGC 2WZR1 1AXKA 3D0JA 3QOPA 4B29A 5DDJ2 4YW2A 2PLV3 3VZKA 2PTMA 3AKPA 4FXKB 4AI1A 3PVEA 3RJ2X 2JG8C 1PHMA 3GNEA 2D3SA 1UF2C 1MVQA 2JICA 2RR11 4FPFA 3FWEA 3KQRA 3VBSB 5CBLA 5CFCB 2C1FA 5LK5A 4Y26A 4CDWB 4FPEA 1RUI2 4JDMA 4HVQA 3U0ZA 5LRSA 1Z0HA 3HMYA 4YW5A 3D8CA 5EYYA 3MW3A 1LESA 4LBMA 3EHKA 4BH9A 1REFA 1URXA 4ASMB 2NQYA 2GH2A 1QOOA 2D6NA 3WNXA 2VMHA 5BNNC 2VECA 1R1A2 1AL23 1RUC1 2IC1A 4MSVA 3B02A 2BPA2 1XQNA 3DPRC 2WNVB 1JOJA 3O5SA 4Q4Y3 4B7KA 1D4M1 4KNCA 2BQPA 3IDCB 4LULA 4AG4A 1HIXA 3AP4A 3NV2A 3R0RA 4RSUA 1QJY1 2FMYA 4R9DA 3RRDA 1UIKA 1ND2A 1QJZA 3MFCA 2PLV2 1W6NA 5C9AB 5I93A 2ZGOA 3TWIA 1POV3 1UL9A 3E6CC 3UL2A 4AHWA 3ZFEB 3K48A 4A7YA 3VKNA 5J3UA 3ZIXA 4IV3B 1CGPA 3AYEA 1AUYA 2H0BA 5AC91 1HV1A 3U07A 4OUMA 1LTEA 1OQ1A 3ZXEA 4C91A 1CJPA 4RQPC 4XXPA 1LHNA 5JZGB 1MEC1 4XFFA 1BQPA 1F5JA 5FBZA 2HEWF 1AL22 2K0GA 3TRSB 1ZRRA 1UU4A 1BEV1 3MW4A 4MUVA 3ZYPA 2P2KA 3M70A 4NO4A 1TME1 5KHKA 4PIZA 2XKOA 3T1LA 1UMZA 3N7KA 2XJRA 1QDCA 3VBHB 2C0ZA 5T5PA 1RIRA 3T1MA 4Q4Y2 1CQ9A 4PLOA 4FBFA 1G9FA 3VBSA 4Y1UA 1EPZA 3P3NA 4AQTA 5CFCA 1FX5A 1QNWA 2D6PA 4FT8A 1CESA 2ZGMA 2IFWA 2WINB 4FQZA 4I01A 5BPXA 4GB33 1OFNA 2JG8A 2ET1A 1GANA 5L7OC 4IV1B 1PIV3 2ZCWA 4K1YA 4I0BA 3NWKA 4JRAA 4Y22B 1RL3A 3RDIA 1FPN3 2NPIA 2P34A 5HI0A 4HSLA 1AR61 2FQPA 3NAPC 4QPYA 1FXZA 2GNDA 4Q0UA 5GZFA 3AZXA 1AX0A 3USUB 4COVA 1NCRC 1UAIA 5EV7A 1G9DA 1ZZ6A 2DCJA 2MPFA 1DF0A 1QWRA 2XBO3 2GNTA 1RUG3 3OYWB 1ZRDA 1IS6A 4COWA 4JGZB 5L19A 5GKAC 1ZA4A 5C9AA 4GKXA 1HRV1 2WJSA 3S7IA 2VOKA 3AZVA 2YUEA 3VBUB 1JTZX 1MR5A 3ZFEA 2IZWA 3AMMA 1IS3A 2CWSA 1NXMA 2BWCA 2XVKA 2NZ9A 5J98B 1EV11 4GB32 5DZGA 5C8WA 2G4IA 2WA4A 1K5MB 1FNZA 1RJ7A 2ZMLA 4MGKE 1POV0 4XTPA 4P9LA 5FLIA 2QZ2A 1PIV2 4XJZA 4QQHA 3VBOA 1S0EA 1Q43A 4Y1XA 1FPN2 1Q5OA 3HQXA 4HK8A 4QD2A 4FTEA 4AXOA 1TMF1 2DTWA 3OJBA 1RVF3 3VBHA 4AFCA 1OA2A 1NE4A 4CEYC 5T55A 4JGYC 1J3PA 1I9RA 2ZGRA 1X50A 1DQ2A 3BOPA 4YNIA 3SCHA 4BHPA 1WCSA 3RSJA 4B4QA 2B45X 3ILRA 2XBO2 1RITA 4XFGA 1ULDA 1GV9A 5FQ0B 2LTNA 1RUG2 1OSGA 2UYAA 4FAHA 2NMNA 4ES9A 3QD6A 4C0HA 4HLTA 2X53S 2DUPA 4P9IA 4IV1A 1SFNA 2WNUA 1S2KA 4Y22A 5GZGA 4MH0E 2D7FA 3INAA 3EJKA 3BU7A 4JQRA 2HWD1 2CGNA 3LCPA 1G7YA 1LHOA 4Y1YA 1D4VB 1O7FA 1LGCA 1WD4A 1JHNA 2WT0A 3TNQA 4J1WA 4RL7A 1S0IA 1PVC1 1QH6A 4M3CA 2RM21 3EQEA 2PHDA 4TZDA 1H2LA 2CGOA 1MZFA 1FV2A 3TBDA 3J9SA 1RMU1 3WT3A 2RJKA 1VALA 4XPVA 4JGZA 3AXDA 4XYXA 1RVF2 2P3IA 2H6BA 2QJVA 2D98A 5GJ6A 4LO7A 1RUE3 2V09A 4HPKB 3ZYRA 4BLJA 2BVBA 5E16A 3KD4A 1KS5A 3FZ3A 1PZ8A 2E6VA 1DLLA 4AFDA 3BPZA 1C4RA 2D93A 3S0MA 5LEJA 3M4FA 3B9IA 3V65A 1PO23 1Y43B 1RHI3 4TYSA 3B01A 1LR5A 1VBD3 5E89A 1ULEA 2PA7A 2D6MA 1IZ3A 2GALA 2R043 4HANA 4Y20A 5K0UC 3AP9A 4FPLA 5I0TA 3HR9A 3HT1A 3H1MA 1SCSA 1WGPA 1X82A 3AJZA 5EZWA 2P17A 2FBEA 4NWVA 4BQ1A 4GH4A 4KG0A 4IXLA 2IFRA 3M3QA 4XJ9A 4ATFA 4K6BA 5FQ0A 1GBGA 3IN9A 1LOAA 2ET7A 4CDXB 4U2AA 3MIBA 4DRVA 2D3RA 4V1PA 2ZX0A 4QPIB 4CEYA 4JGYA 1AX1A 1DZRA 5DUWA 4IEZA 3H9AA 1FI2A 1RUE2 4Q4W1 4LO8A 2CGPA 3NVCA 2XL9A 1ZBE3 4AF9A 1W0PA 4Q27A 4W65A 4LA3A 5FREA 4GMP1 1HDKA 1HV0A 3WUCA 2N7GA 1PO22 2D5FA 3W59A 3ZXGA 2JKBA 4XJUA 1RHI2 1NE6A 4K20A 4RGGA 2XJQA 4EWAA 5J7MA 1VBD2 3UKTA 2VXRA 4DINB 4E9KA 3N7MA 2R042 1OHFA 4E4DX 1V6LA 1NY72 3FLTA 3VKOA 1SLAA 1DQ0A 1J59A 1S2BA 1SFYA 1YJKA 3RPQA 3OBTA 3FHIB 3URFA 1H2KA 4K1ZA 4LHLA 1AF9A 1C8M1 5K9YA 2ARXA 1ALYA 4CDQA 4Z1VA 2E51A 4INDA 1JXNA 4Q0SA 4BWOA 3VLBB 1LHUA 5KXBA 1NOVA 4E2SA 5GLZA 4E2QA 4CDUB 1Z7S1 1ENQA 2P3KA 2VOXA 4M3CF 2BYVE 3NV1A 1CAUB 3PVNA 3ZXFA 1DQ1A 4WM8A 4Q8LA 1D2SA 2JE7A 1MS8A 1RUH1 5JMCA 4KH9A 1ZBE2 5CAZA 1LOFA 2BWAA 5CG9A 3OBRA 3ZN4A 3MIHA 3SISA 4E27A 2PAEA 4K21A 4BOWA 4YW3A 5CIRA 2HWE1 3M3EA 4FSJA 3D6EA 1V9U3 1H2MA 3EO6A 1T6GC 1I3HA 1N1SA 4UXAA 2BW8A 4A7ZA 2GSYA 3BTAA 2WFF1 4CDXA 2O1QA 4P9WA 4L92A 4QPIA 1MS3A 3AP5A 5IK8A 2XL7A 3GHNA 3H8UA 1Q8OA 3POWA 1BVVA 2RHPA 5C8CB 2X8KA 2EAAA 5IT6A 2ZGUA 3PNAA 1C5HA 1QJX1 1UCXA 5JDBA 5KC6A 1V6MA 2ZBJA 2B5HA 2DU1A 2PHRA 4GULA 3VDDB 4Q4X3 1KJRA 1O4TA 2AUYA 5KWRA 4QQPA 2ZKLA 1CAVB 3JD73 1UD1A 5EJ3A 4R9CA 3IPVA 1U12A 1NA1C 2FZ1A 5JAXA 1VBC3 1SBEA 3MFAA 4N43B 4EWEA 3DGTA 1GFF2 1D0HA 1F31A 1ZZ7A 4AE2A 1QQP1 2XLFA 5ACA3 3GYDA 4XHBA 3VL9A 1KDMA 2PELA 2BNNA 3IT8A 4B8EA 1QMJA 1V9U2 2BBVA 1EY2A 3JBG3 1VR3A 5I8TA 2DTYA 1XYOA 4DY5A 3WG4A 4FOVA 1AR91 3PJYA 4LTAA 1SCRA 2B8MA 1PGL1 1WW7A 2PYTA 2R32A 3UJOA 4EN9B 4UW4A 4QMAA 4CDUA 4F83A 5BNPC 5C4WC 4YVSA 3RMYA 2IXKA 1CAUA 2Z5WA 2R073 4AEDA 4Y4YA 2RMU3 1RUNA 4P14A 4AVVA 2EXJA 3CNAA 2DURA 4Q4X2 5ABJC 1H4HA 1DFQA 3KCCA 4S2FA 1UPSA 2CAUA 5H9RA 3JD72 3VHOA 5K7PA 1LGBA 2A6WA 4YSFA 1QXJA 1VBC2 3GF6A 1S1AA 2ZHLA 4IEPA 5JOWA 1GLHA 4K3UA