5ABJC

Structure of coxsackievirus a16 in complex with gpp3
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
242
structure length
242
Chain Sequence
GIPTELKPGTNQFLTTDDGVSAPILPGFHPTPPIHIPGEVHNLLEICRVETILEVNNLKTNETTPMQRLCFPVSVQSKTGELCAAFRADPGRDGPWQSTILGQLCRYYTQWSGSLEVTFMFAGSFMATGKMLIAYTPPGGNVPADRITAMLGTHVIWDFGLQSSVTLVVPWISNTHYRAHARAGYFDYYTTGIITIWYQTNYVVPIGAPTTAYIVALAAAQDNFTMKLCKDTEDIEQTANIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP1
publication title Structure Elucidation of Coxsackievirus A16 in Complex with Gpp3 Informs a Systematic Review of Highly Potent Capsid Binders to Enteroviruses.
pubmed doi rcsb
source organism Coxsackievirus a16
molecule tags Virus
total genus 44
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2015-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5abjC00
1D4M2 1QQP2 3NAPB 2Y26A 4RR3C 4AEDA 4Q4Y2 4IV1B 5C4WC 1CD3G 5LK7B 5C8CA 4WM8B 1B35C 4CDWA 1VBC1 1ZBA2 5J96B 4CEYB 3VBSC 3VBOB 4JGZC 1ZBE2 2DF7A 2RM22 1X33A 1PO22 1NCQB 1VBE3 1E57A 1ASJ2 2BUKA 4SBVA 5ABJC 3VBUA 4GMP3 1RB8G 1AL23 1BEV2 4Q4Y1 5K0UA 2HWE2 3CJIB 5GKAC 4WM7A 2GH8A 1FPN3 1ZBA1 1BBT2 1TMF2 4JGYB 2TBVA 1RVF2 4Q4W3 1AR61 5ACA2 4YVWA 1ZBE1 1VRH2 5CFDC 4Q4X3 4NWVA 1AYM2 3TN93 4CEWB 1VBB3 2RS31 1IHMA 1HX6A 2MEV2 5C9AA 1RUG3 4N43C 2QQPA 3VDDC 1BEV1 1QJU3 1FOD3 1R083 1R1A3 2HWB2 3HAGA 1RUC2 2HWC3 5J98B 1NCRC 1TMF1 4AEDB 2ZAHA 1RUI1 5ACA1 1DDLA 4Q4V2 1AYM1 4QPGA 5DDJ2 4CDWB 5C8CB 3VBHA 3ZFEC 2MEV1 1VAKA 1FMD3 3JB8A 1RUE2 2HWB1 1RUF1 1PO12 3ZFFC 1EAH3 1HRI2 5BNPC 5K0UB 4N53A 5DDJ1 5JZGC 2R073 1TME2 5A32B 3ZFGC 1H8TA 3VBFA 2HWF3 4YVWB 2BFUL 5BNNC 2X5IA 1PVC1 1RUE1 1AR92 5C9AB 1OOPC 1PO11 1QJX2 1C8M2 1W39A 1EV11 3JD72 1R093 3NAPC 1TME1 4FTSA 3CJIA 4IV1C 1ND3A 4WM8C 2WWSA 1AR82 4QPGB 4GH4A 3VBHB 2BPA2 4RHV2 1VBC3 4CEYC 3JBG2 1COV1 3S6PA 2WS92 3VBRA 1C8M1 1AR72 1MQTA 1V9U1 1VBD3 1NA1B 4GB32 2BFUS 1RHI1 1RUH2 1PIV2 2GSYA 4RR3A 4N53B 4Q4Y3 1AR81 1RUJ2 5CFCC 1RUD1 1B35A 1H8TB 2WZR2 4JGYC 3VBFB 1QJZA 1ZBA3 2WS91 4RQPC 1AR63 1AR71 5BNOA 4CEWC 1ZBE3 2X5IB 2RS33 1MEC2 1D4M1 1VB2A 1QJY2 1QQP1 4RS5A 1BEV3 1GFF2 2VQ0A 4Z92B 4AEDC 2FZ2A 5D8AC 1TMF3 5A32A 1ND3B 1RUI3 5ACA3 4CDWC 1PGL2 4GH4B 4PDWB 2RR12 1MEC1 2MEV3 3J8F3 2RM21 1PO21 1ND2A 3VBRB 4IV3B 1QJY1 1ASJ1 2IZWA 4CDXA 2HWD2 1SMVA 1MQTB 1VBE2 3VBUC 2HWB3 1RUF3 2HWE1 1K5MA 2XBO2 4YVSA 4RR3B 1BBT1 4WM7C 5C4WB 5DDJ3 1RVF1 2RR11 1B35B 1FPN2 3DPRC 1VRH1 3ZFEA 2R042 4YVWC 3VBSB 5BNOB 4Q4X2 2HWD1 3TN92 4JGZB 1VBB2 1PGW2 1PVC3 1RUE3 1PO13 4QPIA 1RUG2 5L7OA 1NA1A 1EV13 1POV1 2XBO1 1NY72 1QJU2 1R082 1RUC1 4RS5B 5BNPA 3LOBA 5JZGA 4Q4V1 5L7OC 2WFF2 2R041 3JB4C 1VB4A 1VBA2 2R062 4Q4X1 3VBHC 1PGW1 4CDQC 1C8NA 2RMU2 1ND2B 1COV3 1RUG1 1OOPA 1C8M3 4CDXB 1NY71 2RS12 1V9U3 1HRI1 5AC92 1NOVA 1AYN2 1F2NA 1Z7S2 2WFF1 4N53C 1RHI3 1K5MB 1VBA1 4YVSB 4FTBA 2R061 2RS52 4CDUA 1AR83 1H8TC 1RUD3 3VBFC 3FBMA 3ZFEB 2RMU1 4PDWA 2WS93 1AR91 1AR73 3VBOC 1QJX1 2RS11 4IV3A 1HRV2 5AC91 1NCQC 1AYN1 3JD71 1OPOA 1Z7S1 4QPIB 1D4M3 5L7OB 1QQP3 1RMU2 3IDEA 1R092 5BNPB 2RS51 5CFCA 5JZGB 3CJIC 1ND3C 5C4WA 2PLV2 4RHV1 3JBG1 4GH4C 2ZZQA 4Y5Z0 1HXS2 1HRV1 3VBSA 4JGZA 2RM23 1PO23 1POV0 1BMV2 1OOPB 1MQTC 1QJY3 1ASJ3 1RMU1 4RFT0 5ABJA 1NG0A 4GB31 1VBD2 1RUH1 1PIV1 1RUJ1 2HWE3 5D8AA 2PLV1 2WZR1 1BBT3 4CDUB 5A33A 1HXS1 1RVF3 5C8CC 2RR13 1CJDA 1VRH3 1AYM3 5BNOC 5CFDA 1BMV1 1AR62 2HWD3 2RS32 1VBD1 4N43A 3VDDA 4RS5C 1POV3 2XBO3 1RUC3 5K0UC 1AL22 1NCRA 5CFCB 1M06G 4Q4V3 2XPJA 1PGL1 3DPRA 2R043 1RUI2 5FMOL 4RQPB 4Q4W2 3M8LA 1ND2C 3J8F2 1VBE1 4CDXC 5C9AC 5ABJB 3ZFFA 1HRI3 4GMP1 1AL21 1R1A2 1FOD2 1RUF2 1K5MC 4YVSC 2WFF3 2ZTNA 5D8AB 1TME3 1FPN1 1VBA3 2HWC2 2R063 3ZFGA 5A33B 4Q4W1 4QPGC 3J8F1 3TN91 1F8VA 1VBB1 2RMU3 4CDQA 5CFDB 5BNNA 1AR93 1QJX3 2RS13 4Y4YA 1PVC2 4QPIC 5AC93 1QJU1 1R081 1FOD1 1AYN3 1FMD2 1R1A1 3JD73 4N43B 1Z7S3 1NA1C 3VBUB 5FMOS 3VDDB 1A6CA 1EV12 2BBVA 2FZ1A 5FOJB 4FSJA 2HWC1 3NAPA 1EAH2 2RS53 1NCRB 4WM7B 4IV1A 4WM8A 2R072 3DPRB 4RHV3 1AL0G 3JBG3 4CEYA 2HWF2 3VBOA 4LLFA 1HRV3 1WCDJ 2X5IC 1AUYA 1FMD1 2WLPA 1COV2 1NCQA 1RMU3 1V9U2 1EAH1 3ZFFB 4GB33 4NWWA 4BCUA 1RUH3 1PIV3 4EJRA 1RUJ3 1RHI2 2R071 3ZXAC 4CDUC 2PLV3 1OHFA 2WZR3 1HQNA 3ZFGB 2HWF1 4JGYA 1RUD2 1HXS3 4PDWC 4RQPA 4CEWA 4CDQB 4FTEA 1VBC2 5BNNB 3VBRC 4IV3C 1MEC3 4GMP0 1X36A 1R091
chains in the Genus database with same CATH superfamily
1LB2A 1D4M2 4WZFA 1CR7A 2JICA 3POJA 1BVP1 2VG9A 2XWJB 4FQ4A 1UPSA 4RR3C 2BU9A 3RZMA 3CHXA 3HN3A 3MYXA 4AQ2A 2VPVA 1CD3G 1GSLA 5IHRA 2WL1A 4HVOA 1RYYA 3I3QA 5DUVA 4UI9L 5FCCA 5J3UA 2P3IA 3VB9A 3ZSEA 1DLLA 4LBLA 2XGXA 4PQ9A 4A42A 1UKGA 3VBSC 2WA4A 3FLTA 1MS0A 4WBBA 4EWDA 2DF7A 2XLFA 5FY7A 4ET7A 1OUSA 1NCQB 3MIBA 2EIDA 4LJHA 2G9ZA 3HNYM 5FYMA 5FY8A 3N9NA 4YW1A 3WHUA 4TWTA 1RITA 2WRAA 1ULPA 2LS6A 4IQPA 1SLLA 5K0UA 1IS4A 2A7AA 2CGOA 3DECA 4BQ4A 4LTAA 2HWE2 1UZVA 2WC2A 1O3QA 2VNRA 1C5IA 3H8XA 2ZAAA 4GWJA 3WD5A 5DPNA 1FPN3 1OSGA 2PN5A 5F2WA 3ZSKA 1XSRA 3VZJA 1RVF2 1LEMA 4Q4W3 3SH4A 4AI0A 4CXWA 2QKDA 3T0BA 4B4QA 4A7YA 5CFDC 1AYM2 3TN93 4CEWB 3NNLA 3AKQA 2ERFA 4FPCA 1UL9A 2RS31 4Q0SA 4QMAA 5FRAA 1HX6A 1QOSA 2MEV2 3KVBA 4WVMB 5C9AA 3UGFA 2Q8DA 4XJ8A 2GC1A 5K9YA 3JQXA 1R1A3 2VZOA 1MZ6A 2EALA 4HKWA 4EN9B 2YY1A 5EZWA 5I0SA 1QKQA 5JCTA 2HWB2 1WW6A 4QX0A 3OB8A 5FFOC 2VQUA 4MGZE 2JG8B 5J98B 1NCRC 4P9LA 4LA2A 5A3PA 4MO3M 3TEZA 2OVUA 3PIJA 5FZ9A 1ZRRA 1AYM1 4ASLA 1W06A 4CDWB 1WCUA 5FLJA 4CSWA 5DUXA 4BPZA 5F7UA 2MEV1 1NE6A 4ZXKA 4R9CA 2OS2A 3N9OA 3JU9A 1IG0A 3FWEA 5BXXA 3F2ZA 3J26N 4Z07A 2D6MA 3K48A 2HWB1 3NSTA 3OTFA 5FO9B 1RUF1 1GBGA 4N90A 4B8EA 4YARA 1Y7BA 3IDAA 4Y5TA 1EAH3 3AP4A 3LEIA 3WXPA 3GHMA 2C26A 3I2DA 4BMEA 2ZGTA 3LIHA 4M3CE 2ZMLA 1H8TA 4LK6A 4AFDA 2JB4A 3OD0A 3WCRA 2GMPA 4XOGA 3DUIA 4YVWB 1XXNA 5F3GA 5BNNC 5FKBA 2OZJA 5IVCA 4CP9A 1PVC1 4Y4RA 2ZMNA 1WUVA 2R16A 3NL1A 4D94A 3ALQA 1FYUA 3AM2A 4QM8A 4J1XA 4ZU4A 4NPMA 5IUQA 3BUCA 1EV11 2OW4A 3ZKYA 1KGYA 1JYCA 4IEPA 4DO0A 1UNBA 4FP3A 2RHPA 4EN0A 5CEHA 1O8SA 1S0FA 4AHYA 3WEZA 4IV1C 4CU9A 2QQOA 2X53S 4IETA 4LBQB 2WT1A 4BLIA 2WWSA 2IXLA 4LEJA 4FFHA 1DQ4A 5JI9A 1ZYBA 2F6BA 5GM0A 4FO9A 3PTRB 1ZX5A 3VBHB 4RHV2 3ZXKA 4YG0A 3O1RA 2CAUA 2WS92 4NAMA 3VBRA 1ZREA 4MGIE 4KMQA 3TB0A 4DOUA 1V9U1 2QQMA 1SHWB 1VRBA 2JEMA 2ZEYA 4OZOA 4QXBA 3O1VA 2J1UA 2Q5TA 1S0GA 2ATFA 5JR7B 4GB32 3CZJA 2BFUS 2X09A 2V09A 4Q5OA 1RUH2 5L19A 2XUEA 5IJRA 3SISA 4RR3A 2AENA 3OCPA 4IE4A 2VJXA 2VQAA 4LBNA 4N53B 5E1RA 5J36A 5CFCC 2OUHA 2KD7A 2ZEWA 5A7WA 1OQ1A 1UMIA 3HVDA 1MZ5A 3FC0A 4PI0A 2WS91 5F3CA 1RJ8A 1W9SA 3T2PA 4QDRA 1GWLA 1V6MA 1JUHA 4XQDA 3RMXA 2RS33 1YQ5A 3GNEA 1JXNA 3N9MA 1ZZCA 3FLRA 4FP2A 3VD5A 3K77A 3JXSA 5JWPA 1X82A 3UKTA 1PZ7A 3P3PA 3SXWA 1W6PB 1H1IA 1OKOA 1Y9GA 3UJOA 4OI0A 3RGBA 4YYOA 1QOOA 4XFHA 2R30A 5LBCA 3ZXEA 4E4DX 1G9BA 5D8AC 3WDUA 1NXMA 1SCRA 4QXCA 2AC1A 3UGHA 3D3AA 4OLLA 5A32A 1IKQA 3S5AA 4EYUA 3ZX7A 4QGMA 1L7RA 2P5BA 2ZGLA 1KFUL 5FUNA 2ZGUA 5HCFA 1MS8A 5KXEA 1QGLA 1DZTA 3N7LA 1CONA 5GLTA 2MEV3 1PX4A 2EAKA 3J8F3 3U11A 5T55A 1CZTA 1IS5A 4UFMA 4IV3B 4XVHA 5C33A 5FZ1A 3H3UA 1ASJ1 3P6BA 1QNWA 3S30A 1SMVA 1VBE2 3P3NA 1SFNA 5BY5A 3VBUC 1KJLA 3CLPA 1CN1A 1OMIA 2HWB3 3I3DA 2GP3A 1RUF3 1WMFA 3OEAA 4UFIA 3SITA 1YIFA 2A3YA 1K5MA 5LA2A 5J09A 1QNYA 1F5JA 1OLRA 4YVSA 5A7SA 2EIGA 3ZPOA 4BB3A 3PVBB 5C4WB 1G6NA 3AP6A 4LK7A 4HKLA 3LPFA 3DPRC 4KWJA 4CE8A 4LOSA 4W6XA 3POBA 4Q29A 3PJYA 3ZYBA 3MPPG 4IEVA 3QLQA 5FYYA 4XQ4A 5BNOB 1IGOA 2AEYA 3AP5A 1DGLA 3AK0A 4A4AA 2JKBA 4QKNA 3OEBA 1PVC3 2GC0A 1MACA 5IW0A 1K45A 2I74A 1RUG2 2WINB 4Y20A 1HIXA 1EV13 3WW2A 1H1AA 1QJU2 1R082 2JDPA 3CO2A 1F4HA 3FBYA 5GZDA 1VE0A 5DAQA 2K0GA 4EWAA 4QT6A 4B1LA 5APAA 5BPXA 1JYTA 1G7YA 4IE7A 2VZ3A 4K20A 2WSUA 4O9EA 5JXJA 4L8QA 4X6QB 4URAA 4PIYA 1VB4A 4C8DA 1OXCA 2OX0A 4YZ1A 4D7YA 2HEYF 4P14A 4R4ZA 4UXAA 3V56A 4UBGA 2LROA 2QBXA 1A3KA 5CADA 1LOAA 1XJAA 3IKWA 5F6KA 2XQRA 4CDQC 1HW5A 1ND2B 2FHRA 1RUG1 3ZYFA 5IYYA 1OD5A 1DZQA 1OLME 4AZZA 4AFBA 3KF3A 2W3JA 1WZXA 1PMJX 4AVSA 1V9U3 2Y33A 1BLZA 1HRI1 3H8UA 4YZ3A 1J1TA 5A1LA 3PVNA 4LBKA 4AAXA 4QX8A 4LO7A 4K3UA 1O3SA 4E8DA 3N7MA 2RDNA 2W92A 2NMNA 3ACLA 4XDQA 5FZFA 3VKLA 2WYSA 2E53A 3MICA 2RS52 4TN7A 2FDFA 3N3HA 4INDA 4ZS2A 1Y43B 4LQRA 3M70A 4COZA 1CJPA 2LW8A 2XB6C 2WS93 2Z69A 4LKFA 1JZ6A 1OD3A 3HQRA 5FXWA 3ZYIB 3WP3A 2ETEA 2F4PA 3G7DA 4M01A 5HCAA 3NV1A 4LBMA 2JKXA 1DQ1A 1YFYA 1NCQC 3OYWA 1W8NA 2JDNA 4Q8LA 1H0BA 5JOZA 1UXXX 3NJVA 3GZEA 4BZ4A 1Q56A 1W8HA 1A8DA 5FZLA 1OFSA 1ODMA 4KG8A 2XVKA 3ACFA 1GYKA 1MS5A 3ASIA 4UF0B 2X05A 3ZXJA 3E1F1 2RS51 2VCAA 4SLIA 5K4LA 3RDIA 4BLJA 3VKMA 5CFCA 5JZGB 4BK4A 2W0XA 2NZ9A 3BPSA 3AKRA 4P9IA 4XUTA 2WIIB 2I07B 4NHMA 4ZXEA 5ANNA 4GH4C 3I3MA 2NM1A 4CCCA 1S2KA 3M3CA 3POIA 3VD7A 1W03A 2GU9A 3B02A 5A1FA 2GH2A 4FFFA 3BTYA 4LE3A 5C7GA 2ES3A 4LIUA 4UOJA 3WG2A 1MQTC 5FLIA 1ASJ3 1MZEA 1US3A 4NE9A 1SBEA 4L9BA 4P9YA 3ZSMA 2Q4SA 4CCDA 1GLHA 1GOFA 1ONAA 1WMEA 2D43A 5GZEA 1CZSA 2D3SA 4R9BA 2UYAA 3AFGA 2JG8C 5D8AA 1AX0A 1QU0A 1Q8VA 2G1MA 1OI6A 2WZR1 4UW5A 4XBLA 4AXOA 3RI9A 3UETA 2GALA 5FPUA 1QXPA 3MV11 5A3NA 2CGPA 1OF3A 5I0UA 5D21A 3PMSA 4A6SA 1GZCA 2QVSB 4XF4A 4QQOA 4FPYA 1X8EA 1C4RA 1NT0A 2DVFA 1VLNA 2DDUA 3RYRA 5EJ3A 3LIGA 2HYKA 3W59A 5A70A 4N43A 4GJZA 3BIWE 5JIUA 3SLIA 4W8JA 1HB3A 3ATGA 3IT8A 3OD4A 3NNMA 1R1ZA 2OQ7A 2R6QA 2Y6FA 4QGLA 4NOTA 2A73B 1M06G 2VTXA 1H2NA 1PGL1 4HVQA 3DPRA 1W8ZA 4HETA 1UU4A 3C7OA 4AVBA 4IERA 1Y4WA 1FI2A 3LPGA 3KQRA 3WNKA 5HXMA 5HXVA 1APNA 4AI1A 4DEQA 4V2VA 1PK6B 1XNCA 3MHZA 4B3NA 1JH5A 1DGWX 4CDXC 3WT3A 1STMA 5DAPA 4IEOA 4W65A 3AKPA 2SBAA 3TEWA 4P5HA 1AHSA 2YU2A 3OGGA 2VTXJ 1HRI3 4GMP1 3B00A 5E6HA 3Q8CA 3VD3A 4XDPA 1UZZA 3THTA 3ETPA 4K8RB 4A3XA 4LR4A 3CEWA 3V64A 2ZTNA 4GALA 5C3PA 1LCLA 1TME3 1US2A 4JKMA 5I93A 4BJ0A 5JPMB 2QTWB 2Y0IA 5T5OA 1F8VA 3HPNA 4BQ3A 4CDQA 5DXDA 3B9CA 1SLCA 5FJHA 5CFDB 1ODNA 2WWJA 4LT5A 4HPKB 3VKNA 2J1EA 3WNLA 4GAZA 3IAPA 2WZ8A 3RZHA 4MGTA 2XJVA 1FMD2 5L7OC 1DF0A 4MXVA 4RGAA 4QM9A 4XF0A 2BBVA 5KXCA 5FOJB 1BJQA 1DG6A 3CL1A 1EP0A 4CUCA 5I0TA 2RS53 1W2UA 2GNTA 3I59B 1NCRB 1REEA 4QQLA 1WMXA 2C9AA 3NV3A 3ES4A 4XZUG 3GJBA 1GUIA 2E7TA 3A21A 3BYWA 4CCLA 3ZXDA 1AL0G 4KI5M 3I2OA 1LOEA 5FZ7A 3T0AA 2RE9A 4LLFA 3JZVA 4U2AA 1AUYA 4MGYE 1FMD1 1COV2 2D98A 1NCQA 1HLCA 2WNEA 2Y38A 4KU7A 3WF1A 4NHYA 2JB8A 4QGNA 4I2OA 1GP5A 2A6YA 4S2FA 2A6VA 1RINA 2YYOA 2VNOA 3THPA 1NXD1 2VL4A 5C6CA 5JAXA 3PUHA 4EJRA 4CP1A 2VCCA 2WYFA 1RHI2 1CWPA 2WJSA 4CDUC 4YM0A 2H0BA 2ZKLA 2WZR3 5F3EA 3RFRA 1NQJA 3WINE 3IDCB 1HV0A 1S0JA 3WF4A 2E51A 3T09A 3TRSB 2QQJA 4OI1A 2A3XA 5A7PA 3WV6A 4CEWA 2EAAA 3B94A 3ITQA 4E4SA 1JS9A 4FTEA 4W4ZA 2EVXA 1I5ZA 4Y22B 3USSA 3ZMNA 5BNNB 4IV3C 4WVMA 4GMP0 4XEZA 5BNQA 1XYNA 2BP6A 3HT1A 4TTGA 4L11A 3ZR6A 5JI7A 4ZZ5A 1R091 5FZ6A 2B8MA 5FP7A 4OHVA 1KRIA 4I0BA 2DU0A 4I30A 3WR0A 3LFIA 1JI6A 2JG8A 5FYTA 4YZ4A 1F15A 2NLRA 4H7MA 2YBKA 4AVAA 2C4XA 5FO7B 4IV1B 3GJAA 5C4WC 2IFRA 3S5QA 4IGQA 5LK7B 3WNXA 4CDWA 2OA2A 1ZBA2 2G9GA 2RJKA 3PU3A 3WNOA 4I09A 3AL6A 3SH5A 4A2UA 4HG6B 3INAA 3LD8A 4AGGA 5A3TA 3ZSJA 4MSVA 3WQ1A 1E57A 2ZMKA 4DS0A 1AJKA 2VH9A 1BZWA 4HN1A 5LY2A 1ENRA 2JDAA 4MX3A 1YRZA 2DVBA 4GMP3 1RB8G 4OFGA 4YGBA 1BEV2 3K75B 4HKOA 1H4HA 1RC6A 2CWMA 3B9IA 3PUQA 5GKAC 1YQ8A 4WM7A 5FZGA 4HZFA 1O4YA 2PYTA 2GH8A 2OQ6A 1ZBA1 3AP7A 4M3CB 3RS6A 1TMF2 2B7YA 4R4XA 2CL2A 1AR61 2WNUA 1GR3A 4YVWA 3QOPA 2IVJA 4MOAA 1SQ4A 2BBAA 2BWAA 5JSPA 4HT1T 2VULA 3K4AA 5C8WA 3QCWA 4GKYA 2Y6HA 3SCFA 4ZU7A 2XJRA 3EO6A 4IEWA 4ZHNA 1W2OA 1F9KA 1NQDA 2QQPA 1C57A 1BEV1 2QDNA 4XFGA 1GV9A 4XJUA 4A44A 1UWWA 4K40A 1E5HA 3LA3A 2QZ3A 3HAGA 4FFGA 5F5QA 1CAXA 2R1DA 1TMF1 5C3OA 1DGWA 2FBEA 3O5SA 1F5FA 1RUI1 4LBQA 5LK5A 2N7GA 3WW1A 3D82A 3RZZA 2GNMA 2J1VA 4E4HA 3VBHA 3RQ0A 2W1SA 2BQPA 1H30A 4PT6A 3ACIA 3RG0A 3E5UA 3H50A 4K1YA 4QKBA 3J4UH 3CU7A 4NHLA 2YMZA 4PCRA 1FMD3 4LBQD 1HQLA 1DFQA 1RUE2 5F39A 1N3PA 1PO12 4FVVA 3ZFFC 1NKGA 3KM5A 5LASA 1ZZBA 2PELA 1PMHX 1W04A 1D2QA 2PAMA 1SLIA 2LRPA 4LO5B 2G9FA 1G9AA 4N53A 3CKHA 4L0PA 4QHOA 4GJYA 5JZGC 1CGPA 5IVBA 1M4WA 1UY3A 1PZ8A 1I1EA 4H14A 3GBFA 2ZX2A 2QCSB 4RN5A 3RSJA 3VKFC 1W6OB 2VO5A 2XUMA 4FPOB 3AZVA 1YQ6A 4DUWA 3O1OA 5GLWA 3H1YA 2RJ2A 4W6WA 1RUE1 3L2HA 1AR92 5F6LB 1K3IA 5F32A 1PO11 5T52A 4CP2A 5CKQA 1KEXA 1QXJA 3D0JA 3N4MA 1UMHA 1POQA 3JD72 2VUDA 1R093 1JHJA 1FX5A 5FUPA 3KHCA 5DZEA 1W6PA 1WBLA 1GNYA 2VUJA 1IS6A 3NAPC 4DZGA 4AR2A 2ILMA 2O14A 1DQ5A 5CKNA 5H9RA 2FMDA 3CMGA 3CJIA 3CQOA 2KM2A 3KCYA 3IPVA 4L92A 1LULA 4WM8C 3B01A 2Q8OA 2PHLA 2YHJA 3V65A 3DF0A 3GF6A 3IIAA 1OF4A 4MGKE 4ZY9A 4CEYC 2ZGRA 2V4VA 3S6PA 2QQIA 2NQYA 1QJEA 5A3WA 3SCGA 2UY8A 3O1TA 1I6XA 4F8AA 4N9IA 1OQDA 5DN2A 2ZKNA 5A3OA 2XHKA 3THDA 1NA1B 3F95A 2VXRA 2WNVB 2HJIA 2WQZC 1ZZ9A 3ZYJB 1GWMA 3ORJA 3DEMA 3HMYA 3MLJA 1PIV2 1GU3A 1QDOA 5EHDA 4S2HA 1RUD1 2VC9A 4UW4A 3ZSLA 4LE4A 2VW0A 3AVRA 1ENXA 2DFCA 2IUWA 4GWMA 5G04L 4DUVA 1ZBA3 2RG4A 1HB4A 2PAEA 5DZFA 4AQTA 4KWLA 1D4VB 1O7FA 1ZNPA 1U5YA 1AR63 1GZTA 1N1YA 1PK6C 1SLTA 4GZ9A 4R8HA 1TNRA 3ES1A 4ZONA 5FY0A 5BNOA 1MS9A 2X5IB 3POWA 3RWNA 3WF2A 1OQEA 1UF2C 1D4M1 3N35A 4YW2A 3VDAA 3POSA 2WR9A 2ET1A 4CU6A 4AW7A 4Z2AA 1ULGA 1SDDB 1EUTA 2AACA 4GIQA 4IL7A 1BEV3 3M3EA 4LIVA 1A34A 3QBQA 1GP4A 1V6KA 4NHXA 1GFF2 3U1XA 2EXIA 2VQ0A 4QPYA 3VHPA 1BHGA 4XC9A 2C5DA 4AEDC 5IK7A 2VTFA 3BN6A 1TMF3 4ES8A 1DQ2A 3SNMA 1RUI3 3HJRA 5DUUA 1FNYA 2XOMA 4TSVA 3VGIA 2VZTA 3A0KA 3IMNA 1W05A 1AXZA 4GH4B 2BTVC 3AKTA 4QX3A 2VOWA 3ZN5A 1ND2A 4R52A 3U0ZA 3SKJE 2HYXA 1XYPA 1LODA 4B1MA 4BU2A 1VJ2A 2HWD2 2QQWA 5E8AA 4BE3A 1MQTB 1W99A 1XB9A 4XHBA 4ISRA 2GN7A 3VV1A 2GC2A 1UMZA 1B09A 3NO8A 5LY1A 1Q3EA 5FZOB 1H4GA 2AUYA 2D6LX 4IE5A 3VLBB 2HWE1 1I5PA 2XBO2 3ZO0B 5GZFA 2XLAA 4G9SB 3PJQA 1CAUB 4WV8A 4LKDA 3O1PA 1RXFA 1U5XA 4PLNA 1S2BA 1RVF1 3OPZA 2PHRA 1S2EA 1B35B 4ISQA 3VDBA 4XACA 4JHTA 4YSFA 2HBTA 4GXLA 4ZPIA 4UFHA 2BNMA 3SMHA 3PL0A 4GA9A 3N7KA 1DBNA 4Q4X2 2HWD1 2VMCA 4JGZB 2MHFA 2O0OA 1VBB2 4A6OA 5BYNA 4Q0PA 1CAVB 1RUE3 4RGGA 1XU1A 1PO13 2IVIB 1N1SA 4PHZA 5FPLA 2XBO1 1TQ5A 3HQXA 4A7KA 4UF0A 1SDWA 1L3JA 4FOVA 3T2TA 1ULCA 3KT4A 2W1WA 3GBWA 4BA6A 3LOBA 1MS4A 3MBWA 4HFSA 5JXHA 5JZGA 2WLQA 3DYOA 2WFPA 4X8NA 1W6MB 5A3LA 1J1LA 2W91A 2DWRA 1AXYA 3MF9A 1GNZA 3Q8BA 4XJ9A 3RPQA 2R062 1QH6A 3AL5A 4Q4X1 2OZ6A 5FIXA 4AE2A 4COUA 3KMHA 3EMRA 3GYDA 1SLBA 2VBBA 3KHBA 3LFMA 5CVRA 2AH2A 3FN9A 4M0NA 1K12A 4QU1A 3RJRA 4YFZA 1JU3A 2BW8A 5E88A 4CDXB 5JMCA 5FZEA 3PLQA 2RS12 3N9QA 1K5JA 1QMJA 3M4FA 4EZ4A 5AC92 1AYN2 2IFWA 4CXXA 2MPFA 1F2NA 2Q1FA 1JOJA 4MHRA 4FXGB 2QNKA 1LOFA 5FP4A 2DCZA 4NHKA 3WOGA 2R061 2VMEA 4P9XA 3NNFA 1RUD3 2E7AA 4NPLA 4Q26A 3VBFC 3FBMA 1GP6A 2DCKA 5FZMA 3SHRA 2TNFA 3WLUA 2LUWA 3ZFEB 4DUXA 2EA7A 3I7DA 4H55A 5A3MA 3CJXA 1LENA 4PDWA 4YFWA 1Y9QA 4JHZA 2YBSA 5F3IA 4FI9A 1OUXA 1PNFA 4M4RA 2RS11 4RSUA 1ENSA 3OG2A 5IFPA 3OUIA 3PVOA 5IVJA 5AC91 5CZKA 1AYN1 2AYHA 1OPOA 2JDZA 4KBBA 5IVEA 3MLLA 1YQCA 1D4M3 4YW5A 1C28A 3ZIXA 5K8SA 2DUPA 5L7OB 1UQXA 2WABA 1IS3A 5LATA 1GKBA 3I2IA 1LGNA 2WZEA 3POEA 4Y1ZA 3OBZA 4XFAA 3W9AA 4CRQA 4OUSA 3I2HA 3LEMA 1OA4A 1PVXA 2YPDA 3PUSA 1ND3C 2QQLA 3MIHA 3U75A 4PIXA 4C90A 4RHV1 2SLIA 2XKOA 3OPTA 1ZRCA 1J58A 2ENRA 5EP9A 3VBSA 2A3WA 1Y3TA 3OPWA 4I01A 4URTA 4BISA 1YFUA 1MS3A 1T6BX 2ARBA 4XIOA 1O3RA 1WWYA 1BMV2 1OOPB 1U0AA 4HN0A 5FTTC 3VL9A 5DG1A 1XSQA 3AX4A 3AZXA 1IG3A 5IFTA 5I8YA 1Q8QA 4AEKA 3OSDA 1LHOA 4GB31 1A78A 4Z1VA 1VBD2 4Q0UA 3I8TA 1RUH1 1W8WA 3AYDA 3S7IA 1O91A 1UCXA 2RDRA 2W47A 4RA0A 4AFMA 1EPWA 3KCCA 2ADDA 1I9RA 2HWE3 2JDUA 2XJTA 3WDTA 4R9AA 3H0OA 3KQ4B 1XRUA 3SH3A 4CDUB 1Q43A 1UIJA 2FDKA 4TLFA 3FL7A 4LKEA 1RVF3 3V0AB 4YGEA 3OGSA 1VPHA 3NJYA 1WD4A 2XJUA 3PUAA 1AYM3 5LA1A 1UO9A 2VVEA 5CFDA 1LOGA 1S0CA 2AZ5A 2QUOA 4E2SA 1BMV1 3VUOA 4PF1A 4NROA 4LO4B 2HWD3 3U14A 4HPKA 5IAXA 1WCKA 3GXUA 1VBD1 2JD4A 3NV2A 4HK9A 2Q0AA 5EYYA 2ZEZA 3DXTA 3WNPA 2DTWA 3N9LA 2GZWA 3WDYA 4QQ2A 5FYSA 1XBFA 4RS5C 3VHNA 5L9BA 3BCWA 4Q0VA 2IC1A 2XBO3 4EQVA 1KQRA 1S0DA 5FZDA 2Z5WA 3LAGA 4B4PA 5A1AA 4AHWA 1XE8A 3I59A 4RFRB 2EXJA 1NCRA 5F5CA 2VVFA 3ZDSA 5C3SA 3WUCA 4HOOA 1JOPA 3H9AA 2GDFA 5FMOL 4V1PA 1VP6A 1RGSA 2PFWA 2GNBA 4RQPB 2OUJA 2JG9C 3Q8EA 2R0FA 4XUNA 2JECA 2VZRA 2Y6GA 1VALA 4JKKA 2WSVA 5KXBA 3RMYA 5AFEA 1VBE1 2XJPA 3WY6A 1TEIA 2ZOEB 2E7QA 3BGAA 3OOXA 4MUVA 4XYXA 2VZQA 1H8VA 3D8CA 1FNZA 3LGRA 3MLKA 3AJZA 1Q8SA 5AFBA 2V4AA 2R32A 5EJZB 1FT9A 3GHNA 2VMDA 2HWC2 3AXEA 3GZAA 3MGUA 2R063 5FYCA 5A33B 1H2LA 5FBZA 5T54A 4GQ7A 4GULA 5LCWL 1UW8A 1WMDA 5BNNA 2BGOA 3W21A 5H9PA 3EQEA 4Q1RA 4DEVA 2RS13 2EIBA 1QDCA 2P3JA 3L9JT 4CVUA 1E5SA 4L2NA 2CSGA 4QPIC 5AC93 1QJU1 1R081 1AYN3 5FOBB 1G9CA 3OY8A 5DQ0A 4AGRA 1NA1C 5JLVA 2WNVC 4B29A 1A6CA 2ARXA 4P00B 2BERA 4XJZA 4QWNA 3USUA 5IVFA 2HWC1 3VZMA 3LA2A 4TXWA 1ZA7A 1V6LA 1C1FA 1WLWA 2ZGNA 3Q8AA 4FOWA 1L7QA 1JTZX 4IV1A 5FP9A 5CBLA 4CCJA 4LKSA 2UWBA 1X7NA 1JHNA 2BZDA 1WKYA 1WCSA 5KHIA 3FUOA 2CY6A 2LALA 3I2JA 1H2MA 3ZLIA 4AVCA 4RHV3 5JOWA 3DKQA 3TNQA 2ZCWA 2HWF2 1UY1A 3L2YA 1AVBA 4G3YC 2C9KA 3QH6A 4NPRA 5FMCA 5JOXA 3KSCA 4JRLA 4JQRA 5DUWA 4XUQA 2X5IC 5FZKA 2CAVA 1YHFA 1N3OA 3E5XA 2P34A 3BIEA 4HVRA 1GQPA 4LHSA 2B5HA 1GANA 1BK0A 1V6IA 2LTNA 4XUOA 3B7MA 2VXJA 3HT2A 1BK1A 4GB33 2D6OX 1IZ3A 3POGA 4IEXA 3KCXA 4NWWA 4UBHA 3T1LA 1RUH3 5FJKA 3VL8A 1GNHA 1YUDA 4HMZA 4F3JA 3CIHA 1UKRA 3KD4A 4RGKA 1LJ7A 4MGSA 1XE7A 3KLSA 5LBFA 3WW3A 2HWF1 2AEZA 2P6CA 5FPVA 2DFBA 3VKOA 2DCYA 3FE5A 3ZPYA 1KDMA 4H3WA 3KGZA 3PIGA 2FDJA 1BVVA 5FY4A 5JSRA 2OKXA 5LZ6A 4ORFA 5KWRA 2F17A 1YC61 2B4KA 2PHTA 1WBFA 1LTEA 2CWSA 5BV6A 1W28A 2GAUA 4JAAA 4K9SA 1VIWB 1QQP2 2YU1A 1UY2A 3NAPB 1OVPA 1H6YA 3ZFFB 1W2AX 1GICA 2P1BA 2E33A 2WBKA 2V72A 4PJYA 3VZOA 3U4XA 1YYNA 3RJ2X 4WM8B 1B35C 3IBMA 5ERLA 5KHJA 3PMEA 1EPZA 2OPWA 2VAUA 5J96B 4QD2A 4CEYB 3GZUC 2BJSA 4XMIA 3VBOB 4CP9B 4YG6A 4JGZC 1T6GC 5KXDA 4PIZA 1LEDA 2RM22 1X33A 4YGCA 1N1VA 1PO22 2H0VA 1VBE3 2K46A 5FQ0B 5H9SA 2BGCA 2ZEXA 2BUKA 4SBVA 5DMYA 5ABJC 2IXJA 3VBUA 3MW2A 3DKWA 4HBNA 1AF9A 1UX6A 3BU7A 3IIIA 5LRRA 3HN1A 5GZCA 3SEPA 1LESA 1C5HA 3LDRA 5DZGA 5FAXA 3THCA 3E6CC 2Y6KA 3EB7A 4QKDA 3BOPA 4D6QA 3MI8A 2JE8A 1UZWA 2BDRA 1LRHA 2Q1MA 4YM1A 5CAZA 1BBT2 1CX4A 1DHKB 1S55A 3FX3A 4OQ9A 2TBVA 2ZXQA 1DGRA 5ACA2 2O8OA 2J1SA 1W6OA 3AZYA 3MUZ1 1VRH2 4NWVA 2WO1A 3ZXGA 3E6BA 4DQAA 1G86A 1JYVA 1IHMA 4JQTA 3H42B 3C7GA 4JX0A 1RUG3 2VZUA 1LHNA 4ITCA 3K3NA 2ADEA 2VZPA 3VDDC 1QJU3 1R083 3LEGA 3SEEA 3FLPA 1QOTA 2DCTA 2GP5A 1SACA 4XQWA 1RUC2 4QB1A 1LECA 4AWDA 2HWC3 3T2QA 1W6QA 3SCHA 2JD9A 2WN3A 3D0SA 3PURA 4AEDB 2ZAHA 5KC6A 5ACA1 5FYUA 4CUAA 4Q4V2 1W9TA 2F4LA 4KBZA 5C8CB 2D3PA 2XLGA 2HLEA 3DV8A 2D40A 4OUMA 3ZFEC 4META 4NO4A 4COVA 4DXZA 4BMBA 4N8MA 5KHKA 1L7LA 2E26A 4X6RB 3ILFA 2B42B 4BK5A 1JUIA 3BTAA 5CU1A 2XVLA 4MGQA 4OHWA 1UN1A 2CU5A 1KS4A 1XYOA 4JDNA 2PHXA 4K6BA 1JZ7A 4P9JA 3VD9A 1HDKA 2JENA 4PBPA 4BIOA 1RL3A 3C2UA 1LGCA 1T2XA 4XXAA 2WZPP 5A32B 2GC3A 3ZFGC 2ZGPA 4A3ZA 5FZIA 3R6SA 3B93A 3J7HA 4ZKTB 1SBDA 2HWF3 4RYDA 5FBJA 2BWCA 2IXHA 3KV6A 2CNAA 4FQZA 2V73A 2X5IA 3VHOA 4C91A 4DPNA 4BQYA 4E9KA 3RZKA 4AHXA 1OOPC 1IPJA 1QJX2 2PQQA 2VZSA 2VMGA 2XL9A 2O8QA 1J3PA 1W39A 3O12A 2EIEA 3CF6E 3LSDA 4HSJA 4S2DA 2W1QA 4LHLA 2E31A 3HD8B 4Q1PA 3WSOA 4EN8B 3ZYGA 1NLQA 3DGTA 3V0BB 5JIAA 4XABA 4MXWB 4AVVA 3LWCA 4PQQA 4FTSA 4NRQA 2JJ6A 2ZX4A 3H1WA 1WA6X 3NRUA 4IUGA 1REDA 4XFBA 1TNFA 1JZ5A 4C0BA 4Y1YA 2WDBA 3BTZA 4QPGB 1JN2P 1QIQA 4GH4A 2BPA2 5EQUA 2NPIA 4OULA 3O7OA 2DURA 2ZGMA 3JBG2 4FXKB 5F9TA 1COV1 1JYWA 3AP9A 1YIPA 1LU1A 1VMHA 2PHDA 4UFLA 1AR72 1XE0A 3AMNA 4NVPA 1YFXA 3A22A 3OGVA 3ZYHA 1MQTA 1PM4A 2YUEA 2BYVE 4I3PA 2I2SA 4MLOA 4UW6A 4NIHA 2DUOA 1VMFA 3OF1A 5EYXA 5F5IA 1OPMA 3B69A 5FZOA 1RHI1 2VMHA 1MVQA 2YDEA 2P3YA 2VUAA 4I0WB 5GJ6A 4LOTA 1E5RA 1Q5OA 1RUJ2 4LHNA 3BTXA 3RWKX 2BV4A 4I3GA 4XE9A 1J59A 1B35A 1OBNA 3BODA 4JGYC 4UYBA 3VBFB 5FR3A 5HBAA 2K9ZA 3WP6A 2KA3A 4KH9A 2Z2SB 4RQPC 3FHIB 5J37A 3MZHA 1AR71 4N7IA 2W2IA 4YZ5A 3K4DA 1VAVA 4QXHA 5FMBA 4XUPA 2VMFA 1CAVA 1WD3A 1MEC2 5A7QA 2R0HA 5GLZA 4NIGA 2E6VA 1VB2A 1QJY2 3H7YA 4CYDA 3FHQA 3I3EA 3RZGA 3O1MA 1OKQA 1ACCA 4E2QA 4E8CA 1K42A 1HN1A 1GZWB 1WA4A 2RVAA 3A0NA 3E6DA 4KU8A 4Z92B 3HBKA 5KHHA 4HONA 3VN4A 5FYZA 3MFCA 1W6MA 2WT0A 2QQVA 1ND3B 1LKNA 4QKFA 1O5LA 3E5QA 4YW7A 5A6QA 5ACA3 1NLRA 3ZYPA 4Y1XA 5C3RA 2ARCA 3CZUA 1HN0A 2RR12 2W68A 1DQ6A 1MEC1 2VR4A 4B7EA 1PX3A 1XC6A 4AFCA 5B4NA 1QJY1 4CDXA 4AI3A 2Z42A 3H3ZA 4IXLA 5F8PA 1IQDC 3KF5A 3D4KA 4XF9A 5FZ0A 4AOCA 5FXXA 4OCTA 2A6WA 1JW6A 3HWJA 2D6PA 1Q8OA 4H2AA 5LBEA 4OI2A 4EWEA 4J1WA 1OLQA 4RL7A 4YG3A 3HR9A 1H6XA 3I2KA 1JMUB 2RR11 1FPN2 1YJLA 4QAWA 3ZFEA 3K46A 4BXFA 1HJGA 4OVEA 2R042 2W1UA 4C1WA 1YI7A 2YGMA 2YROA 4K21A 2YZ4A 1QJFA 1DYPA 2QQNA 3TN92 1NE4A 4IGPA 2BOIA 4NIAA 1LR5A 5L9RA 4AG4A 4W50A 3ZKUA 2B45X 4PF5A 2VBDA 1XNDA 2W52A 1XNTA 4OQ8A 4BH9A 2A70A 4K1ZA 4ES9A 5L7OA 1LGBA 1YQ2A 5I8SA 3W20A 5GZGA 3LDBA 3S57A 4RS5B 2XVGA 5GLVA 2L9LA 1ZA4A 4AK3A 2E32A 1S4CA 3M2MA 3AVSA 5LEKA 4QDSA 3R4UA 1V0AA 2QE3A 2E9QA 2VOVA 5I0DA 3PVEA 3TEYA 2R041 3NNJA 2NYYA 4P9WA 4KGGA 2UYBA 2UU8A 3TOJA 5JSOA 5LW9A 2R7EB 4FT8A 3S0MA 4NIDA 1UU6A 1OA2A 1REFA 2JG9B 4DNYA 4XZPA 5HCBA 2RMU2 1COV3 3UKVA 1OOPA 1UXZA 2ZHMA 3OJBA 4LLOA 4BIFA 3UGGA 4WVZA 2Y64A 3ZYRA 1XQNA 4XILA 5IT6A 1NOVA 2R49A 4KWUA 5FV3A 1CPMA 4LULA 4FOYA 1EY2A 1RHI3 1W2TA 3JQWA 4MZUA 2XKPA 2YV8A 3VDCA 2W94A 4CDUA 2UURA 1H8TC 3V0AA 4E4ZA 1W0OA 2H6BA 4CCNA 2C6SA 2RMU1 1UYYA 1PMIA 4LBOA 1RTVA 4QDQA 5FKCA 4ZZ8A 5M0TA 1AR73 1AR91 4JDOA 4O7XA 3VBOC 4IV3A 1OH3A 3B3QE 5B2GB 3KV4A 1UYXA 3RRDA 3ELNA 3GZTB 3JD71 5C3QA 4QPIB 2A6ZA 4EV0A 2BVBA 5IVVA 1CIYA 1RMU2 4PLMA 3IDEA 5BNPB 1S0IA 4OI4A 4F83A 1ULEA 1TZOA 2YFUA 5C5TA 1DP0A 1D2SA 1F31A 1ZVFA 3POFA 1KS5A 2D5HA 3MV01 4JZRA 5C4WA 2VD7A 1RUOA 3WQBA 4FAHA 2PLV2 2FQPA 2ZHNA 1PM7A 2GMMA 1O5UA 2P17A 3LB9A 4FBFA 4JV4A 2XONA 1N47A 5IATA 5A3UA 1F4AA 4C1XA 1IQAA 5KC5A 3ROUA 4Y1UA 3ST7A 3NKGA 4MG2A 4DFSA 3NNGA 3ZOIA 5K7PA 4I0AA 5AVPA 2GN3A 2C1FA 2JXAA 3KV9A 3UK9A 1QJY3 1RMU1 5JXGA 2PHWA 4RFT0 5I91A 3SC7X 4ARXA 2W95A 2EXKA 5HCHA 3TEXA 1PIV1 4D8MA 3ON7A 5JXIA 3A23A 4UFKA 4NAOA 2VU9A 2P6HA 2XWBB 1SCSA 2PLV1 1W3VA 2KXLA 4XTMA 3PDQA 1LU2A 3U78A 5A33A 2D97A 3AFKA 5C8CC 4WVWA 2RR13 1CJDA 3GCXA 3GM8A 5F5AA 1N3QA 5DG2A 4CCEA 1N1TA 3MIFA 2P2KA 4C0HA 3AMHA 2VE1A 5FWEA 1QF3A 5EV7A 1OA3A 4P9GA 2RS32 2WT2A 3JCIA 3HBZA 4WVVA 2JE7A 5CIRA 2Z4FA 4YPJA 2W87A 5HV4A 2G4IA 2Q8CA 1ULFA 3X29B 4FPEA 2BEOA 3T2OA 3BOWA 4QHBA 1HB1A 3WP5A 1AL22 3ZIWA 5FUIA 1FV3A 1NYWA 4HSLA 4AI2A 2XJSA 2XPJA 4CA9A 2R043 4AFAA 1XU2A 5L73A 3APBA 3O1SA 4CU8A 4ZS3A 2J22A 4BQXA 3C3VA 4LUKA 3LZZA 4D0QA 1UOJA 4HK8A 3J8F2 1VAMA 2XH6A 5CB7A 2DYCA 3UL2A 3WNNA 1UX7A 1X8MA 3EYPA 4XFIA 2FCTA 4Z82A 5EFUA 1HKDA 1FATA 4ATFA 3CNAA 5ABJB 5FK7A 4UAPA 4AHZA 3IZOA 3ZFFA 4DINB 5LBBA 1AL21 1RUF2 1FOD2 2UWCA 3E97A 4PBOA 4DY3A 1K5MC 5FZ8A 2VOKA 2WWUA 3EHKA 4OYUA 4YVSC 1ZRIA 4BQ2A 1CAWB 3WCSA 2ZABA 1V00A 4IEUA 4YW6A 3IMMA 1HQWA 2JDMA 3LQCA 3PU8A 4QPGC 1W9YA 2AGSA 2H6CA 1NUKA 2DBNA 3J8F1 4BDVB 4D3WA 1VBB1 1GMMA 2RMU3 2VVDA 1UYZA 2VECA 2FDGA 3M3QA 1AR93 1UOBA 3LE0A 4CUBA 4DXRA 1PVC2 4D6RA 3T0DA 1C3HA 3POYA 4AQ6A 1FOD1 3JD73 3LA7A 3FMGA 3K51A 4QX1A 1JYNA 3VDDB 4O65A 4YGDA 5FMOS 5TSWA 1OC1A 5JPNB 2D5FA 1EV12 4A45A 2FZ1A 4FSJA 3U37A 3NAPA 1JBCA 2DBIA 1XOYA 3AYCA 3OGRA 1OH4A 4MYEA 4WM7B 3BVCA 2Q1ZB 4J25A 4Q0QA 4MH0E 3PUIA 2R072 4WM8A 2YC0A 4XPVA 2Q8EA 3O1UA 2WNUB 2X29A 3HIFA 4YW3A 5H9QA 4CEYA 4QB2A 1W6NB 4MVTA 3WF3A 3VBOA 4S2GA 1YO8A 2JDHA 4QQHA 1WCDJ 1W2NA 4E2GA 3IWZA 5FQ0A 2W5FA 1UYPA 5CISA 2C0ZA 4IESA 1RMU3 2ZPXA 1I3HA 1V9U2 4DRRA 4AI9A 1W9FA 2ARAA 4BCUA 5KHGA 1PIV3 1URXA 3OBTA 1CAXB 3I97A 3UESA 3B5LB 3U07A 1SZBA 5IVYA 3M1HA 3ZN4A 4E27A 2ZA9A 2LM3A 2R071 5IK4A 5GALA 3ZXAC 4CU7A 2PLV3 3HEIA 1OHFA 4OUEA 1HQNA 3ZFGB 3OBAA 3DYMA 4YZ2A 4G4FA 2JIJA 2YBPA 4FCAA 4RD7A 4YRDA 1JU4A 3MIGA 1AXKA 4YNIA 1PK6A 2J1AA 4OMDA 4UWDA 4FPKA 1VBC2 3FHAA 4Y3OA 1YWKA 1HJFA 2QFEA 1MVEA 4P08A 2Y6JA 3SQOA 4CCMA 2YGLA 4EN6B 4XBQA 2ORZA 1X36A 2HBUA 1O4TA 4JCKA 2CGNA 5BUVA 3AKSA 2IXIA 5D1IA 2YPJA 4B4RA 3N7JA 1JZ8A 1ULOA 4Z8BA 1SEFA 2KR2A 2GNDA 2QZ2A 4LHKA 4M3CF 3AMMA 1EUUA 5A7NA 1BCXA 2Y26A 3FJSA 4QX7A 4AEDA 1UPIA 4HLTA 1AJOA 2DVAA 4Q4Y2 1YEWA 3KT7A 3S7EA 5FPZA 5C8CA 2CV6A 2XXZA 1LHWA 1VBC1 1TG7A 2EF6A 3AXDA 2ID4A 4NR1A 1UY4A 2EICA 2OXBA 3W5NA 2ZGKA 4BM8A 1ZBE2 3O0XA 3EBRA 3FZ3A 4GWIA 3TNPB 2YB7A 4NMIA 1ASJ2 2V5YA 3ZN6B 4JDMA 5IWFA 4LUMA 1AZDA 2OYZA 1AL23 3JUUA 4Q4Y1 1MZFA 1TE1B 3VZNA 2ZX1A 1AX2A 2FD8A 5ISLA 3CJIB 1G9FA 4GKXA 4XURA 3C7FA 3IPVB 2D7FA 2D6KA 5FYHA 1NZIA 4DB5A 2Z79A 4JGYB 1V70A 1O8PA 1ALYA 4FOQA 1RJ7A 4CPBA 4CP0A 1ZBE1 3I49A 4Q4X3 3T1MA 4XF1A 1SPPB 1VBB3 4B7KA 4QB6A 2WAAA 1O4ZA 4JRAA 1XNBA 3KVAA 4EE2A 5C70A 5F2SA 4QX5A 4R9DA 4N43C 4LBJA 4BOWA 3AZZA 1FOD3 4CPBD 3NW4A 3MUY1 3V0BA 3ACHA 2VOXA 2VW2A 3GDBA 1NLSA 4YM3A 4MXWA 2B9UA 4TZDA 2RDQA 1KITA 3W5MA 3WG1A 2ZZJA 3TWIA 1MS1A 3WVJA 1DDLA 5IK5A 4MV2A 4XW3A 4QPGA 1X50A 5DDJ2 3CBNA 1Y9MA 1CESA 4IE0A 3K4ZA 3RNSA 2D44A 2D6NA 2MNGA 1VAKA 4JVAA 3O0WA 1YLLA 2BVVA 4XF3A 3HQUA 4Y22A 5FO8B 3WG4A 1X9PA 2ORXA 5DABA 3BI3A 4CZSA 1PGSA 4UFJA 1UD1A 3JB8A 1YJKA 2YFZA 3MEPA 3UV9A 5CKMA 1G8WA 3AYAA 1HRI2 2VBPA 2IWGB 4Z2WA 1D7PM 5BNPC 5FK8A 5K0UB 4LA3A 1UZYA 3ZDVA 4FAGA 4XBNA 4LNVA 5DDJ1 3U10A 1W8FA 2R073 3T30A 1TME2 2B46X 1YFWA 2P4EA 3VBFA 4KWKA 5LEJA 1DYOA 1FV2A 2A6XA 1MR5A 2NP0A 4X8PA 2BFUL 3FFZA 5T5PA 1AX1A 4PI2A 4YWAA 4AYUA 1KFXL 4NRPA 1XNKA 1HB2A 4CTEA 5DAVA 2PTMA 3G6JB 5C9AB 3NMBA 3SKVA 5B4XA 3ZR5A 3H8OA 1CX1A 1C8M2 4K8FA 2X8KA 2VQTA 3AZWA 2ZGQA 3RYKA 3VZKA 3MDPA 5FYVA 5FPAA 1V6JA 5A6ZA 3J7NA 2XQXA 2DU1A 3J7MA 1GZWA 1TME1 2ZX3A 2CDOA 2ZHLA 4COWA 3OBRA 3PHMA 4LPLA 5EJ1B 5C71A 2I45A 4Y1VA 1ND3A 4XAAA 5EPAA 4M3CA 1YI9A 4UT5A 1AR82 3QH7A 4XCBA 2WUHA 1MPXA 4BYYA 1W8TA 3DL3A 1VBC3 2XMLA 2ZBJA 2ZACA 2ZX0A 3ILNA 4QPWA 4OHYA 4ARYA 2DCJA 1QWRA 4XAEA 1LOCA 3R0RA 1F35A 2XG3A 4KL1A 1C8M1 4Y33A 3NWKA 4M0HA 2UWAA 2VMIA 3RZLA 3ZMOA 4XMAA 4D6SA 3M7AA 3AJYA 1VBD3 5JR2A 2ZGOA 5LWBA 2QDRA 3KZ4C 3UJQA 3URFA 4IW3A 4L99A 3AC0A 5G05L 3R4SA 1KXGA 2GSYA 5FXZA 4Q4Y3 3N9PA 2XJQA 4BXSV 1AR81 4DXSA 3UKNA 1UY0A 2VY0A 3GGLA 2RJLA 2A5ZA 1H8TB 2WZR2 1QJZA 4KNCA 1QH7A 3I2GA 2XHNA 4CCKA 2AREA 3IN9A 5ANQA 2FDHA 4CEWC 1LAJA 1ZBE3 1CPNA 4ZU5A 2QQKA 3I54A 5LA9A 2O1QA 5JOYA 4WZCA 2K2SA 3WQ7A 5A80A 3VD4A 3M3IA 4Q8KA 3MIDA 4AF9A 2J42A 1ZZ6A 2W9XA 1QQP1 4A7ZA 4BQ1A 4AVTA 2XL7A 5FPXA 3LKJA 5LB6A 3ABZA 3GCWA 4RS5A 1V6NA 3DXUA 1CVNA 2W39A 3J7LA 2BRTA 4AI8A 2HEWF 3KS7A 4AL9A 2TUNA 3C7HA 3ENRA 1OVSA 1W8OA 2FZ2A 5JDBA 2WQ8A 3NJXA 3TYJA 5IK8A 3U4SA 4CDWC 2CTVA 3FFQA 4W6YA 3H1MA 1WW7A 1PGL2 3H7JA 3J9SA 4PDWB 1S0BA 1J83A 2DTYA 2JG9A 2JWPA 2RM21 2WKKA 2YXSA 1PO21 2VZVA 3VBRB 5J7MA 5JMOA 2VGDA 1YNAA 4DMIA 2IZWA 4DRVA 1ZRFA 2ET7A 5FY1A 4DXTA 1JZ3A 4IEQA 2PAKA 1QEXA 3CDZB 2OIIA 5L9VA 1SBFA 4L97A 3KV5A 1D0GA 5CA6A 1UAIA 1O6UA 3VZLA 1CZVA 3WQ0A 4RR3B 1GQHA 1BBT1 2YC4A 3NQHA 4QU2A 4WM7C 2FMYA 3MPBA 2A1XA 3O14A 5DDJ3 1IPKA 1FAYA 2VZ1A 2XDVA 5A7WB 3WDXA 3C8XA 1VRH1 1A8MA 2WNUC 4YVWC 2Y0OA 1PHMA 3IM0A 3PNAA 3VBSB 4IEZA 2IXKA 2WO3A 2QQUA 4XIKA 2P37A 1PGW2 5FZ3A 1J3RA 1LHUA 2AR6A 4XCAA 5CG9A 3WP4A 1QXRA 1U5IA 2VW1A 1E5IA 4QPIA 3ZVXA 1DIWA 1NA1A 1POV1 2WN2A 1NY72 1RUC1 2WNVA 3RYPA 1WLCA 1X9TA 1JZ2A 2DV9A 2E63A 4DIQA 5E16A 5BNPA 3I4IA 4LO6B 4NN0A 1W0PA 2C24A 4AEJA 1S0EA 4NRMA 4Q4V1 1KD7A 2WFF2 3DCQA 5A6YA 1RXGA 3JB4C 1VBA2 1IOAA 2PHFA 3T08A 4N7UA 4JC1A 5JVVA 4LITA 3LEKA 3LDKA 4QQPA 3VBHC 5HPOA 1PGW1 5FDBA 1R64A 4NIIA 1KDKA 3LOIA 1WCQA 2OT7A 1C8NA 2J1RA 4K7JA 2D3RA 4XHXA 5A7OA 3TBDA 1C8M3 5CNAA 2PMWB 4IGOA 1NY71 5CG8A 1ZRDA 4M4PA 5DAWA 5KR7A 2BGPA 5FY5A 1Z7S2 1LNSA 4MHUA 3P1IA 5FPBA 4CCOA 2WFF1 3QD6A 1J84A 4N53C 3WDWA 1K5MB 5A6XA 1ULDA 1VBA1 4LORA 2UY9A 4YVSB 5EXOA 4FTBA 1LOBA 1AR83 1WLTA 1GWKA 3WF0A 4OZXA 4NUBA 3UYJA 1GOHA 3A7QA 2B39A 3WHTA 2EXHA 4QXKA 5LRSA 4F7ZA 5D2AA 5FYIA 1JOBA 4FPJA 1XPWA 5HI0A 2Q30A 1QJX1 3TAYA 3K3OA 3AB0A 4HANA 4BWOA 1H1MA 1HRV2 2J7MA 4EROA 1BYHA 2Y34A 3EJKA 3IAQA 2NMOA 1OLMA 1W90A 1Z7S1 2X10A 2VOTA 3AYEA 3DYPA 2OPKA 4Y20B 4AAPA 1H9PA 1QQP3 2FCVA 1DU3D 1UOFA 3IB3A 3ACGA 1R092 5FWJA 2RV9A 3ETQA 3UNPA 1O3TA 4FPLA 4HXCA 3O0VA 4QX2A 5FP8A 3CJIC 4D7SA 1CAUA 5AVAA 3RVHA 2HKXA 1IKPA 5HV0A 4H7LA 2J1TA 4GWNA 3JBG1 1Z78A 2ZZQA 3N36A 4Y5Z0 5GLUA 4IE6A 3T4HB 2QJVA 4DY5A 2JDKA 1HXS2 2WAOA 1HRV1 1EYBA 2JX9A 4FFIA 2XR4A 2WQ4A 3NKTA 3ME2A 1O59A 3OUJA 4JGZA 2HH9A 2RM23 1NX9A 1PO23 1POV0 4COYA 5FXVA 2GMEA 4IDZA 1HV1A 2V5DA 2VCMA 1IPSA 3WG3A 1NAEA 4XTPA 3OY8B 4OHZA 5ABJA 1QHDA 1NG0A 2D93A 3KWVA 4ASKA 2CHHA 2JIGA 3USUB 1Z0HA 1RUJ1 2PXJA 3ZXLA 1W9WA 3A4UA 4XDOA 5SV8A 5FZ4A 1NZCA 1CAWA 4EN7B 4FPHA 1YCIA 1BBT3 1JZ4A 1LHVA 3R05A 1HXS1 1U5ZA 3M3OA 2NN8A 5JUVA 2P3KA 1VRH3 1DZRA 2VNGA 3AMPA 5BNOC 4UW3A 1AR62 2FCUA 4ASMB 2RDSA 3RI8A 3MFAA 2YG0A 4ONUA 5F1RA 5T5LA 3HNMA 4Y24A 1XNAA 4N9HA 1ZZ7A 1W8UA 1JODA 3OYWB 3EXUA 1UZ0A 4O61A 4HL0A 3VDDA 4V2WA 1TVGA 4TLGA 1POV3 4XETA 2FDIA 3MW3A 1RUC3 4XJAA 5FYBA 1VMJA 1YXWA 4IEYA 5C5UA 2PA7A 5KBFA 2PHUA 3IDBB 4XFCA 5K0UC 5T50A 4BQ5A 2HEVF 5CFCB 1GQGA 5FY9A 1W3XA 5J48A 4Q4V3 3BB6A 1RUI2 2PQSA 3NV4A 4CXYA 1OFNA 1WLDA 1W6NA 3GALA 3M8LA 1ZM1A 2JDYA 4KGQA 4Q4W2 2BNNA 4JTOA 1UU5A 4AQSA 4BHPA 3H8RA 1RUNA 1ND2C 1WW4A 5FP3A 1C1LA 1DQ0A 1PZ9A 5CYYA 5FZAA 4M00A 1BXHA 4AGVA 4BQWA 4XXPA 3AMQA 5C9AC 2B9VA 2ZHKA 5LA0A 2WO7A 5FLHA 5T5JA 4EZHA 4JKLA 2DVGA 2Y60A 2CYFA 2A71A 4LXLA 4Y5SA 1J3QA 1R1A2 1FXZA 3WZ1A 3D6EA 5SV5A 4CUGA 3BU0A 2WFF3 3HOBA 3OUHA 3ILRA 5D8AB 5IAVA 1FPN1 1VBA3 1BKZA 3ZFGA 2TEPA 4Q4W1 3W58A 5EIYB 4YLZA 2ZS6B 3H3LA 1OT5A 2VNVA 1GOGA 1BQPA 2IXCA 1SFYA 5EWSA 3QACA 3Q8FA 2ZGSA 1OURA 3NJZA 3TN91 3LSEA 3T3YA 3ZXFA 4AEMA 1DLCA 3MF6A 2W46A 5FZCA 1U12A 3LCPA 1Q8PA 3I3BA 1RIRA 4YM2A 4ATEA 5I8TA 1QJX3 5FZBA 1V6OA 2WO2A 3I2FA 4Y4YA 5F37A 2R1BA 3C7EA 4Q27A 2VUCA 1R1A1 3VBUB 1H9WA 2WA3A 4N43B 1GZ9A 1Z7S3 3P5BA 3VHRA 4NJ4A 1G9DA 2Y6LA 4A41A 3GBGA 3MW4A 1JYIA 3BALA 2VM9A 3MIEA 4MADA 1EAH2 1VR3A 2WNOA 1ENQA 3WW4A 3MO4A 4JTNA 4KG0A 2BOJA 1ZZ8A 5T3NA 1DYKA 1CIWA 3UT0A 4D69A 3DPRB 1SG3A 3WUDA 3WX5A 3D5OA 3LF7A 3RZJA 2A75A 4Y26A 4XJWA 1D0HA 3JBG3 2CDPA 5DAXA 1CQ9A 1H2KA 4FPFA 1HRV3 2ZJCA 4LO8A 4TYSA 1PNGA 3ECQA 5FMDA 4J6GA 5FREA 2Y8KA 2WLPA 3KGLA 3Q9OA 1KJRA 4PLOA 2BNOA 3FUQA 4OHXA 2YC2A 2DUQA 3OGJA 3T4VA 3BPZA 3ZN6A 3K2OA 1DGRN 1EAH1 1UOGA 1QY4A 1SLAA 1DCSA 4I02A 5FZHA 4LMFA 5L36A 2JE9A 2W08A 3HNBM 4XFFA 1W6QB 1RUJ3 1LOFC 3WDVA 4OMCA 1WW5A 3KT1A 4JGYA 1RUD2 4FPGA 4GD4A 1HXS3 4Q2FA 3WNMA 4O9GA 5E89A 1S1AA 3ZM8A 2VCBA 4PDWC 4RQPA 1UIKA 3PTYA 4KQ7A 4D7TA 4QHZA 1P8JA 1SPPA 4CDQB 1W0NA 4P5YA 4P02B 3BKZA 5I0RA 3VBRC 4YW4A 1WGPA 1SFPA 3DN7A 1MEC3 2G19A 4U36A 3NVCA 3R4DB 2DVDA 1ST8A 3KB5A 1JYXA 5J1XA
chains in the Genus database with same CATH topology
1LB2A 1D4M2 4WZFA 1CR7A 2JICA 1BVP1 2VG9A 2XWJB 4FQ4A 1UPSA 4RR3C 4AQ2A 3MYXA 2VPVA 1CD3G 1GSLA 2WL1A 4HVOA 5DUVA 5J3UA 5FCCA 2P3IA 3ZSEA 1DLLA 4LBLA 2XGXA 4PQ9A 1UKGA 3VBSC 2WA4A 3FLTA 1MS0A 4WBBA 4EWDA 2DF7A 2XLFA 1NCQB 3MIBA 4YW1A 3WHUA 4TWTA 1RITA 4IQPA 1SLLA 5K0UA 1IS4A 2A7AA 2CGOA 4LTAA 2HWE2 2WC2A 1O3QA 2VNRA 1C5IA 2ZAAA 3WD5A 1FPN3 1OSGA 2PN5A 3ZSKA 3VZJA 1RVF2 1LEMA 4Q4W3 3SH4A 4AI0A 2QKDA 4B4QA 4A7YA 5CFDC 1AYM2 3TN93 4CEWB 3AKQA 2ERFA 4FPCA 1UL9A 2RS31 4Q0SA 4QMAA 5FRAA 1HX6A 1QOSA 2MEV2 4WVMB 5C9AA 4XJ8A 2GC1A 5K9YA 3JQXA 1R1A3 4EN9B 1MZ6A 2EALA 4HKWA 2YY1A 5EZWA 5I0SA 1QKQA 5JCTA 2HWB2 1WW6A 5FFOC 4MGZE 2JG8B 5J98B 1NCRC 4P9LA 4LA2A 2OVUA 1ZRRA 1AYM1 4ASLA 4CDWB 5FLJA 5DUXA 4BPZA 2MEV1 1NE6A 4ZXKA 4R9CA 3JU9A 3FWEA 5BXXA 3J26N 4Z07A 2D6MA 3K48A 2HWB1 3NSTA 3OTFA 5FO9B 1RUF1 1GBGA 4N90A 4B8EA 4YARA 1Y7BA 1EAH3 3AP4A 3WXPA 3GHMA 3I2DA 4BMEA 2ZGTA 4M3CE 2ZMLA 1H8TA 4AFDA 3OD0A 3WCRA 2GMPA 4XOGA 3DUIA 4YVWB 1XXNA 5BNNC 2OZJA 1PVC1 2ZMNA 1WUVA 2R16A 3NL1A 4D94A 3ALQA 1FYUA 3AM2A 4QM8A 4J1XA 4ZU4A 5IUQA 1EV11 2OW4A 4IEPA 1JYCA 4FP3A 2RHPA 4EN0A 1S0FA 4AHYA 4IV1C 2X53S 4IETA 4LBQB 2WT1A 4BLIA 2WWSA 2IXLA 4LEJA 1DQ4A 5JI9A 1ZYBA 2F6BA 5GM0A 4FO9A 3VBHB 1ZX5A 3ZXKA 4RHV2 4YG0A 2CAUA 2WS92 3VBRA 1ZREA 4MGIE 4DOUA 3TB0A 1V9U1 2JEMA 2Q5TA 1S0GA 2ATFA 5JR7B 4GB32 2BFUS 2V09A 5L19A 1RUH2 3SISA 4RR3A 2AENA 3OCPA 4N53B 4LBNA 2VQAA 5E1RA 5J36A 5CFCC 2OUHA 1OQ1A 1MZ5A 3FC0A 2WS91 1RJ8A 1V6MA 1JUHA 4XQDA 3RMXA 2RS33 3GNEA 1JXNA 1ZZCA 3FLRA 4FP2A 5JWPA 1X82A 3UKTA 1PZ7A 3P3PA 3SXWA 1W6PB 1H1IA 3UJOA 4OI0A 4YYOA 1QOOA 4XFHA 2R30A 3ZXEA 4E4DX 1G9BA 5D8AC 3WDUA 1NXMA 1SCRA 5A32A 4OLLA 1IKQA 3ZX7A 4QGMA 2ZGLA 1KFUL 2ZGUA 5HCFA 1MS8A 5KXEA 1QGLA 1DZTA 3N7LA 1CONA 5GLTA 2MEV3 2EAKA 3J8F3 3U11A 5T55A 1IS5A 4IV3B 5C33A 3H3UA 1ASJ1 1QNWA 3S30A 1SMVA 1VBE2 3P3NA 1SFNA 5BY5A 3VBUC 1KJLA 3CLPA 1CN1A 1OMIA 2HWB3 1RUF3 1WMFA 3SITA 1YIFA 2A3YA 1K5MA 5J09A 1QNYA 1F5JA 1OLRA 4YVSA 2EIGA 3PVBB 5C4WB 1G6NA 3AP6A 4HKLA 4KWJA 3DPRC 4W6XA 4Q29A 3PJYA 3MPPG 4IEVA 3QLQA 4XQ4A 5BNOB 1IGOA 3AP5A 1DGLA 3AK0A 2JKBA 1PVC3 2GC0A 1MACA 2I74A 1RUG2 2WINB 4Y20A 1HIXA 1EV13 3WW2A 1H1AA 1QJU2 1R082 3FBYA 3CO2A 5GZDA 2K0GA 4EWAA 4QT6A 5BPXA 1G7YA 4K20A 2WSUA 4O9EA 4L8QA 4X6QB 4PIYA 1VB4A 4YZ1A 4D7YA 2HEYF 4P14A 4R4ZA 4UXAA 3V56A 4UBGA 1A3KA 5CADA 1LOAA 5F6KA 3IKWA 4CDQC 1HW5A 1ND2B 2FHRA 1RUG1 1OD5A 1DZQA 4AFBA 4AVSA 1V9U3 1HRI1 3H8UA 4YZ3A 1J1TA 3PVNA 4LBKA 4LO7A 4K3UA 1O3SA 3N7MA 2NMNA 3ACLA 4XDQA 3VKLA 2E53A 3MICA 2RS52 3N3HA 4INDA 1Y43B 3M70A 4COZA 1CJPA 2XB6C 2WS93 2Z69A 3ZYIB 3WP3A 2ETEA 2F4PA 3G7DA 4M01A 5HCAA 3NV1A 4LBMA 1DQ1A 1YFYA 1NCQC 3OYWA 4Q8LA 1H0BA 5JOZA 4BZ4A 1Q56A 1A8DA 1OFSA 4KG8A 4A2UA 2XVKA 3ASIA 1GYKA 1MS5A 3ZXJA 2RS51 4SLIA 3RDIA 4BLJA 3VKMA 5CFCA 5JZGB 2W0XA 2NZ9A 3AKRA 4P9IA 2WIIB 2I07B 4NHMA 4GH4C 2NM1A 1S2KA 3M3CA 2GU9A 3B02A 2GH2A 4LE3A 2ES3A 3WG2A 1MQTC 5FLIA 1ASJ3 1MZEA 1SBEA 4L9BA 4P9YA 3ZSMA 2Q4SA 1GLHA 1ONAA 1WMEA 2D43A 5GZEA 2D3SA 4R9BA 2UYAA 3AFGA 2JG8C 5D8AA 1AX0A 1QU0A 1Q8VA 1OI6A 2WZR1 4UW5A 4XBLA 4AXOA 3RI9A 2GALA 1QXPA 2CGPA 5I0UA 3PMSA 1GZCA 2QVSB 4XF4A 4QQOA 4FPYA 1X8EA 1C4RA 2DVFA 1VLNA 3RYRA 5EJ3A 2HYKA 3W59A 4N43A 3BIWE 5JIUA 3SLIA 3ATGA 3IT8A 3OD4A 1R1ZA 2R6QA 4QGLA 4NOTA 2A73B 1M06G 1H2NA 1PGL1 4HVQA 3DPRA 4HETA 1UU4A 4AVBA 4IERA 1FI2A 3KQRA 5HXVA 1APNA 4AI1A 1PK6B 1XNCA 4B3NA 1JH5A 1DGWX 4CDXC 3WT3A 4IEOA 4W65A 3AKPA 2SBAA 4P5HA 1AHSA 3OGGA 1HRI3 4GMP1 3B00A 1UZZA 3THTA 4A3XA 4LR4A 3CEWA 3V64A 2ZTNA 4GALA 1LCLA 1TME3 5I93A 5JPMB 2Y0IA 5T5OA 1F8VA 4CDQA 5DXDA 3B9CA 1SLCA 5CFDB 4LT5A 4HPKB 3VKNA 2XJVA 1FMD2 5L7OC 1DF0A 4MXVA 4RGAA 4QM9A 4XF0A 2BBVA 5KXCA 5FOJB 1BJQA 1DG6A 3CL1A 1EP0A 5I0TA 2RS53 1W2UA 2GNTA 3I59B 1NCRB 1REEA 4QQLA 2C9AA 3NV3A 3ES4A 2E7TA 3ZXDA 1AL0G 1LOEA 2RE9A 4LLFA 3JZVA 4U2AA 1AUYA 4MGYE 1FMD1 1COV2 2D98A 1NCQA 1HLCA 2WNEA 2Y38A 4KU7A 4I2OA 4QGNA 2A6YA 4S2FA 2A6VA 1RINA 2YYOA 2VNOA 3THPA 1NXD1 5C6CA 5JAXA 4EJRA 4CP1A 1RHI2 2WJSA 4CDUC 4YM0A 2H0BA 2ZKLA 2WZR3 1NQJA 3WINE 3IDCB 1HV0A 1S0JA 2E51A 3TRSB 4OI1A 2A3XA 4CEWA 3WV6A 2EAAA 3B94A 4E4SA 4FTEA 3USSA 2EVXA 1I5ZA 4Y22B 5BNNB 3ZMNA 4IV3C 4WVMA 4GMP0 4XEZA 5BNQA 1XYNA 3HT1A 4L11A 5JI7A 1R091 2B8MA 4OHVA 1KRIA 4I0BA 2DU0A 4I30A 3WR0A 2JG8A 4YZ4A 2NLRA 4H7MA 4AVAA 5FO7B 4IV1B 5C4WC 2IFRA 5LK7B 3WNXA 4CDWA 2OA2A 1ZBA2 2G9GA 2RJKA 4I09A 3SH5A 3INAA 4AGGA 3ZSJA 4MSVA 3WQ1A 1E57A 2ZMKA 4DS0A 1AJKA 2VH9A 1BZWA 4HN1A 1ENRA 4MX3A 1YRZA 2DVBA 4GMP3 1RB8G 4OFGA 4YGBA 1BEV2 4HKOA 1H4HA 1RC6A 2CWMA 3B9IA 5GKAC 4WM7A 3UKNA 4HZFA 1O4YA 2PYTA 2GH8A 3AP7A 1ZBA1 4M3CB 3RS6A 1TMF2 2B7YA 4R4XA 2CL2A 1AR61 2WNUA 1GR3A 4YVWA 3QOPA 1SQ4A 2BWAA 5JSPA 4HT1T 2VULA 5C8WA 3QCWA 4GKYA 3SCFA 4ZU7A 2XJRA 3EO6A 4IEWA 1F9KA 1NQDA 2QQPA 1C57A 1BEV1 2QDNA 4XFGA 1GV9A 4XJUA 4K40A 3LA3A 2QZ3A 3HAGA 5F5QA 1CAXA 2R1DA 1TMF1 1DGWA 2FBEA 3O5SA 1F5FA 1RUI1 4LBQA 5LK5A 2N7GA 3WW1A 3D82A 3RZZA 2GNMA 3VBHA 3RQ0A 2BQPA 1H30A 3RG0A 3E5UA 3H50A 4K1YA 3J4UH 3CU7A 4NHLA 2YMZA 4PCRA 1FMD3 4LBQD 1HQLA 1DFQA 1RUE2 1N3PA 1PO12 4FVVA 3ZFFC 3KM5A 1ZZBA 2PELA 2PAMA 1D2QA 1SLIA 1G9AA 4LO5B 2G9FA 4N53A 5JZGC 1CGPA 1M4WA 1PZ8A 1I1EA 4H14A 3GBFA 2ZX2A 2QCSB 3RSJA 3VKFC 1W6OB 4FPOB 2XUMA 3AZVA 5GLWA 3H1YA 4W6WA 1RUE1 3L2HA 1AR92 5F6LB 1PO11 5T52A 4CP2A 1QXJA 3D0JA 3N4MA 3JD72 1R093 1FX5A 5DZEA 1W6PA 1WBLA 2VUJA 1IS6A 3NAPC 4DZGA 2ILMA 1DQ5A 5H9RA 2FMDA 3CJIA 2KM2A 3KCYA 3IPVA 4L92A 1LULA 4WM8C 3B01A 2Q8OA 2PHLA 2YHJA 3V65A 3DF0A 3GF6A 3IIAA 4MGKE 4CEYC 2ZGRA 3S6PA 2NQYA 3SCGA 2UY8A 1I6XA 4F8AA 4N9IA 1OQDA 2ZKNA 2XHKA 1NA1B 2VXRA 2WNVB 2HJIA 2WQZC 1ZZ9A 3ZYJB 3HMYA 3MLJA 1PIV2 1QDOA 4S2HA 1RUD1 4UW4A 3ZSLA 4LE4A 2VW0A 1ENXA 2DFCA 4GWMA 1ZBA3 5DZFA 2PAEA 4AQTA 4KWLA 1D4VB 1O7FA 1ZNPA 1U5YA 1AR63 1SLTA 1N1YA 1PK6C 4R8HA 5BNOA 1TNRA 3ES1A 1MS9A 2X5IB 3POWA 3RWNA 1OQEA 1UF2C 1D4M1 3N35A 4YW2A 3POSA 2ET1A 4AW7A 1ULGA 4GIQA 4IL7A 1BEV3 3M3EA 3QBQA 1V6KA 1GFF2 2EXIA 2VQ0A 4QPYA 3VHPA 4AEDC 2C5DA 5IK7A 1TMF3 4ES8A 1DQ2A 3SNMA 1RUI3 5DUUA 1FNYA 4TSVA 3VGIA 3A0KA 3IMNA 4GH4B 1AXZA 2BTVC 3AKTA 2VOWA 3ZN5A 1ND2A 4R52A 3U0ZA 1XYPA 1LODA 1VJ2A 2HWD2 5E8AA 4BE3A 1MQTB 4XHBA 4ISRA 2GN7A 3VV1A 2GC2A 1UMZA 1B09A 3NO8A 1Q3EA 1H4GA 2AUYA 2D6LX 3VLBB 2HWE1 2XBO2 3ZO0B 5GZFA 2XLAA 4G9SB 3PJQA 1CAUB 4WV8A 1U5XA 4PLNA 1S2BA 1RVF1 3OPZA 2PHRA 1B35B 4ISQA 4YSFA 4GXLA 3SMHA 2BNMA 4GA9A 3N7KA 1DBNA 4Q4X2 2HWD1 4JGZB 2MHFA 2O0OA 1VBB2 5BYNA 4Q0PA 1CAVB 1RUE3 4RGGA 1XU1A 1PO13 1N1SA 2XBO1 1TQ5A 3HQXA 4A7KA 1SDWA 1L3JA 4FOVA 3T2TA 1ULCA 3KT4A 3GBWA 4BA6A 3LOBA 1MS4A 4HFSA 5JZGA 2WLQA 2WFPA 4X8NA 1W6MB 5A3LA 1J1LA 3MF9A 2DWRA 1AXYA 4XJ9A 1GNZA 3RPQA 4COUA 2R062 1QH6A 4Q4X1 4AE2A 2OZ6A 3KMHA 3GYDA 1SLBA 5CVRA 2AH2A 4M0NA 3RJRA 4YFZA 2BW8A 4CDXB 5E88A 5JMCA 3PLQA 2RS12 1QMJA 3M4FA 5AC92 1AYN2 2IFWA 2MPFA 1F2NA 1JOJA 4FXGB 2QNKA 1LOFA 2DCZA 4NHKA 3WOGA 2R061 4P9XA 4Q26A 1RUD3 2E7AA 3VBFC 3FBMA 2DCKA 3SHRA 3WLUA 2TNFA 2LUWA 3ZFEB 2EA7A 3I7DA 4H55A 5A3MA 3CJXA 1LENA 4PDWA 4YFWA 1Y9QA 1PNFA 4RSUA 2RS11 1ENSA 3PVOA 5AC91 1AYN1 2AYHA 1OPOA 2JDZA 4KBBA 3MLLA 1D4M3 4YW5A 1C28A 3ZIXA 5K8SA 2DUPA 5L7OB 1IS3A 1GKBA 1LGNA 4Y1ZA 3W9AA 4XFAA 4CRQA 4OUSA 1OA4A 1PVXA 1ND3C 3MIHA 4C90A 4PIXA 4RHV1 2SLIA 2XKOA 1ZRCA 1J58A 2ENRA 3VBSA 2A3WA 1Y3TA 4I01A 4URTA 1YFUA 1MS3A 2ARBA 1O3RA 4XIOA 1BMV2 1OOPB 1U0AA 4HN0A 5FTTC 3VL9A 5DG1A 3AX4A 3AZXA 5I8YA 1Q8QA 4AEKA 4GB31 1LHOA 1A78A 4Z1VA 1VBD2 4Q0UA 3I8TA 1RUH1 3AYDA 3S7IA 1O91A 1UCXA 4AFMA 4RA0A 1EPWA 3KCCA 2HWE3 1I9RA 2XJTA 3WDTA 4R9AA 3H0OA 1XRUA 3SH3A 4CDUB 1Q43A 1UIJA 4TLFA 1RVF3 3V0AB 4YGEA 1WD4A 2XJUA 1AYM3 2VVEA 5CFDA 1LOGA 1S0CA 2AZ5A 2QUOA 4E2SA 1BMV1 3VUOA 4LO4B 2HWD3 4HPKA 1WCKA 1VBD1 2JD4A 3NV2A 4HK9A 2Q0AA 5EYYA 2DTWA 3WDYA 2GZWA 4QQ2A 3VHNA 4RS5C 3BCWA 4Q0VA 2IC1A 2XBO3 1KQRA 1S0DA 2Z5WA 3LAGA 4B4PA 4AHWA 1XE8A 3I59A 2EXJA 1NCRA 2VVFA 3ZDSA 3WUCA 3H9AA 2GDFA 5FMOL 4V1PA 1VP6A 1RGSA 2PFWA 2GNBA 4RQPB 2OUJA 2JG9C 2R0FA 2JECA 1VALA 5KXBA 2WSVA 3RMYA 5AFEA 1VBE1 2XJPA 3WY6A 1TEIA 2ZOEB 2E7QA 4MUVA 4XYXA 1H8VA 3D8CA 1FNZA 3LGRA 3MLKA 3AJZA 1Q8SA 5AFBA 2R32A 1FT9A 3GHNA 2HWC2 3AXEA 3GZAA 3MGUA 2R063 5A33B 1H2LA 5FBZA 5T54A 4GQ7A 4GULA 1UW8A 1WMDA 5BNNA 5H9PA 3EQEA 4Q1RA 2RS13 3L9JT 1QDCA 2P3JA 4L2NA 4QPIC 5AC93 1QJU1 1R081 1AYN3 5FOBB 1G9CA 3OY8A 4AGRA 1NA1C 5JLVA 2WNVC 4B29A 1A6CA 2ARXA 4XJZA 3USUA 2HWC1 3VZMA 3LA2A 1V6LA 1C1FA 1WLWA 2ZGNA 4FOWA 1JTZX 4IV1A 5CBLA 2UWBA 1X7NA 1JHNA 1WCSA 5KHIA 3FUOA 2CY6A 2LALA 4AVCA 1H2MA 5JOWA 4RHV3 3TNQA 2ZCWA 2HWF2 3L2YA 4NPRA 1AVBA 4G3YC 5JOXA 3QH6A 3KSCA 4JRLA 4JQRA 5DUWA 2X5IC 2CAVA 1YHFA 1N3OA 3E5XA 2P34A 4HVRA 2LTNA 2B5HA 1GANA 1V6IA 3B7MA 3ZFFB 3HT2A 1BK1A 4GB33 2D6OX 1IZ3A 4IEXA 4NWWA 3KCXA 4UBHA 3T1LA 3VL8A 1RUH3 4AFAA 1GNHA 1YUDA 4HMZA 4F3JA 1UKRA 3KD4A 1LJ7A 1XE7A 3KLSA 3WW3A 2HWF1 2DFBA 3VKOA 2DCYA 3FE5A 3ZPYA 1KDMA 4H3WA 3KGZA 5JSRA 1BVVA 4ORFA 5KWRA 2PHTA 1WBFA 1LTEA 2CWSA 5BV6A 2GAUA 4JAAA 4K9SA 1VIWB 1QQP2 3NAPB 1GICA 4PJYA 3VZOA 3U4XA 1YYNA 3RJ2X 4WM8B 1B35C 3IBMA 5KHJA 3PMEA 1EPZA 5J96B 4QD2A 4CEYB 3GZUC 4XMIA 3VBOB 4YG6A 4JGZC 1T6GC 5KXDA 4PIZA 1LEDA 2RM22 1X33A 4YGCA 1N1VA 1PO22 2H0VA 1VBE3 5FQ0B 5H9SA 2BGCA 2BUKA 4SBVA 5ABJC 2IXJA 3VBUA 3MW2A 3DKWA 4HBNA 1AF9A 1UX6A 3BU7A 5LRRA 3HN1A 5GZCA 1LESA 1C5HA 5DZGA 5FAXA 3E6CC 3BOPA 3MI8A 1LRHA 2Q1MA 4YM1A 5CAZA 1BBT2 1CX4A 1DHKB 1S55A 3FX3A 2TBVA 1DGRA 5ACA2 2O8OA 1W6OA 3AZYA 1VRH2 4NWVA 3ZXGA 3E6BA 4DQAA 1G86A 1IHMA 1RUG3 4ITCA 1LHNA 3VDDC 1QJU3 1R083 3FLPA 1QOTA 2DCTA 1SACA 4XQWA 1RUC2 4AWDA 1LECA 2HWC3 1W6QA 3SCHA 3D0SA 5KC6A 4AEDB 2ZAHA 5ACA1 4Q4V2 5C8CB 2D3PA 2XLGA 3DV8A 2D40A 4OUMA 3ZFEC 4META 4NO4A 4COVA 4DXZA 4BMBA 5KHKA 4X6RB 3ILFA 2B42B 1JUIA 3BTAA 5CU1A 2XVLA 4OHWA 1UN1A 4JDNA 1KS4A 1XYOA 4K6BA 2PHXA 4P9JA 1HDKA 2JENA 4PBPA 4BIOA 1RL3A 3C2UA 1LGCA 4XXAA 2WZPP 5A32B 2GC3A 3ZFGC 2ZGPA 3R6SA 3B93A 4ZKTB 1SBDA 2HWF3 2BWCA 2IXHA 2CNAA 4FQZA 2V73A 2X5IA 3VHOA 4C91A 4DPNA 4E9KA 4AHXA 1OOPC 1IPJA 1QJX2 2PQQA 2XL9A 2VMGA 2O8QA 1J3PA 1W39A 3O12A 3CF6E 3LSDA 4HSJA 4S2DA 4LHLA 4Q1PA 3HD8B 4EN8B 3ZYGA 3DGTA 3V0BB 5JIAA 4MXWB 4AVVA 3LWCA 4FTSA 2JJ6A 2ZX4A 3H1WA 1REDA 4XFBA 1TNFA 4C0BA 4Y1YA 4QPGB 1JN2P 4GH4A 2BPA2 2NPIA 4OULA 3O7OA 2DURA 2ZGMA 3JBG2 4FXKB 5F9TA 1COV1 3AP9A 1YIPA 1LU1A 2PHDA 1AR72 3AMNA 4NVPA 1YFXA 1MQTA 2YUEA 2BYVE 4I3PA 2I2SA 4MLOA 4UW6A 2DUOA