5ABJC

Structure of coxsackievirus a16 in complex with gpp3
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
242
structure length
242
Chain Sequence
GIPTELKPGTNQFLTTDDGVSAPILPGFHPTPPIHIPGEVHNLLEICRVETILEVNNLKTNETTPMQRLCFPVSVQSKTGELCAAFRADPGRDGPWQSTILGQLCRYYTQWSGSLEVTFMFAGSFMATGKMLIAYTPPGGNVPADRITAMLGTHVIWDFGLQSSVTLVVPWISNTHYRAHARAGYFDYYTTGIITIWYQTNYVVPIGAPTTAYIVALAAAQDNFTMKLCKDTEDIEQTANIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure Elucidation of Coxsackievirus A16 in Complex with Gpp3 Informs a Systematic Review of Highly Potent Capsid Binders to Enteroviruses.
pubmed doi rcsb
source organism Coxsackievirus a16
molecule tags Virus
molecule keywords VP1
total genus 44
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2015-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5abjC00
1AUYA 1MEC3 1C8NA 1RHI3 3ZFGB 1RHI1 2RMU2 3VBUC 5BNNC 2RMU1 4IV1A 5BNPC 1ZBA3 1VBE2 4Q4W3 2RMU3 2RS52 2XPJA 4Q4X2 1VBC1 1E57A 5CFDA 1NY72 1QJZA 5L7OB 2R043 3JB8A 1PVC1 2R071 4GH4C 5ACA1 1V9U2 4JGYA 4N43C 1F8VA 1AR61 1FPN3 1RVF2 2WS92 3ZXAC 1AR63 1FPN1 1NCRB 5AC91 3VBSB 2Y26A 2HWF3 1HXS1 1RUI3 1SMVA 1RUF2 2R062 1WCDJ 2HWD3 4N43B 4RQPA 4NWWA 4CDUB 3JBG2 5C4WA 1RHI2 1OOPB 1RUC2 1MEC2 1Z7S2 1ZBE3 1Z7S3 1PO23 4Q4X1 4WM8B 1PO21 5C9AA 4RS5B 4QPIB 4CDUC 1IHMA 1QJU2 4PDWB 1ND3B 1HRV3 1OOPC 1NG0A 2BPA2 4Y5Z0 3ZFEB 1RUF1 1VBD3 2HWC2 5FOJB 3VDDA 1QJU3 2MEV1 1AYM2 2X5IA 1VBA1 1AR71 4YVWC 1PIV2 4IV3A 4CDWC 5CFCA 1TME2 4Q4V3 2RM22 1ASJ1 3ZFEA 4CDXC 1HRI3 1FMD3 1PVC2 2R072 1BEV1 3ZFFC 1RUG2 3VBHA 2PLV2 3VBRC 5CFDC 5BNOB 4YVWB 4JGYC 4N43A 4RR3C 1PGL2 1PO11 4CDUA 3DPRC 5FMOS 4Q4W1 4WM7B 1R082 4CDXB 5K0UA 4RS5C 1R081 1HXS2 1X33A 2VQ0A 1VB2A 3VBRB 5ACA3 1HRI2 1PGW1 1AYN1 1D4M2 1VRH3 1PO22 3DPRB 5ABJA 1W39A 1QJY1 1RUJ3 2HWD1 2RR12 3JD72 4IV1B 1TMF3 2ZAHA 1NCQC 3JBG3 1RMU1 4RHV2 1VBD2 5A32A 1H8TA 3ZFFA 1RUD1 1HQNA 1QJX2 1NA1A 2RS53 2ZZQA 1BBT3 4JGZC 4WM8C 1TME3 4FTEA 1V9U3 2HWC1 4PDWC 1EV13 1CD3G 1HRV1 4CDWA 1AR91 1AR92 1M06G 3CJIC 1MQTA 5FMOL 1K5MC 1FOD3 4GH4A 1ND2C 2WFF1 3TN92 2RR11 5BNOA 3VBUB 2R041 4PDWA 2RS32 2XBO3 1K5MB 5C8CB 2WZR1 4QPGA 4Z92B 4WM7A 1PO12 5BNNA 5LK7B 5L7OC 1AR62 4RQPB 1ASJ3 2DF7A 5JZGB 1ZBE2 1BEV3 2HWB1 1AR81 1ND3C 3JD73 5J98B 1NCRC 1OOPA 1AR72 1NOVA 4CDQA 2RM23 5C9AC 2RM21 4EJRA 4CEWA 5C4WB 1COV3 4GB31 3TN91 1R083 1ASJ2 1MQTC 1B35B 1POV0 3FBMA 1C8M3 4CDQC 1C8M1 3VDDB 3CJIB 4AEDC 1VBD1 1RUJ1 3JB4C 1VBE3 4Q4W2 1HRV2 1TMF1 4CEWB 1VAKA 3VBOA 5A33B 1PGW2 1R1A3 5D8AA 4CEYC 1QQP2 1R1A1 4JGYB 1F2NA 1VBB1 1VBB3 4GH4B 2X5IB 1VBC2 1R093 4Q4V1 1AYN2 3VDDC 1TME1 4AEDB 1V9U1 1K5MA 1EAH3 2WZR2 4YVSA 4QPGB 2HWC3 4GMP0 3VBFA 2R063 5K0UC 2R061 1C8M2 1RMU2 4RHV1 4Q4Y1 4RHV3 2BUKA 2ZTNA 2QQPA 1FOD1 1OPOA 1ZBA1 3ZFGA 4SBVA 1VBC3 2RS11 1DDLA 4YVSC 1PVC3 2R073 3VBHC 1ND2A 4N53A 5C8CC 1QQP3 3VBOC 1D4M3 4GMP1 1VRH1 5CFDB 4RR3A 1RUE2 1NCQA 2BFUS 1NY71 1QJY3 4CEWC 2HWB3 1AR83 1H8TC 1GFF2 5CFCC 4JGZA 1RMU3 1RVF3 2FZ2A 4WM8A 3J8F1 1RUD3 2R042 1ZBE1 2HWB2 5A33A 1COV1 4Q4X3 5AC92 1VBA2 2IZWA 3S6PA 1A6CA 4RFT0 1AR93 1POV1 4RS5A 1PIV3 1BEV2 5BNOC 1QJU1 5ACA2 2PLV1 2RS33 2HWF2 3J8F2 3NAPC 1FPN2 3ZFGC 5C4WC 3CJIA 4IV1C 5BNPA 1FMD1 1TMF2 1CJDA 3M8LA 1EAH1 1B35C 2RS12 2HWE1 2WLPA 1VBB2 5BNNB 4QPIA 1AR82 1MEC1 2BBVA 1X36A 4FSJA 1AYM1 4N53C 3ZFEC 4CDXA 3VBSC 1BBT2 4CEYB 1NCRA 2RS13 4JGZB 1ND3A 1RUI2 2WFF2 4CDWB 3VBUA 2WS91 5DDJ2 2WS93 1AL0G 1NA1C 4Q4Y2 1QJX1 2HWF1 1MQTB 1QJX3 3VBSA 3DPRA 1HX6A 2FZ1A 2GSYA 1H8TB 2MEV2 5GKAC 3ZFFB 2WWSA 3JBG1 1RUH3 1QJY2 1RUH1 1VB4A 4RQPC 3NAPB 4QPIC 4AEDA 1RUH2 1BBT1 1Z7S1 2RS51 1VRH2 1AL23 4GB32 1BMV1 1EV11 5C9AB 4IV3C 4Q4Y3 4YVSB 1RUF3 1PGL1 3NAPA 4IV3B 2WFF3 5C8CA 1RUJ2 2RR13 5CFCB 2PLV3 1B35A 1EAH2 2WZR3 1RUC3 2XBO1 1RUE1 1RUC1 1QQP1 1R1A2 5JZGA 1RUE3 4FTBA 1D4M1 4GMP3 5D8AC 4CEYA 5AC93 4Q4V2 5J96B 1NA1B 1HXS3 1RUI1 5JZGC 4YVWA 3JD71 2HWD2 4FTSA 2HWE3 4RR3B 5D8AB 2X5IC 1EV12 1AYM3 4WM7C 3VBHB 5L7OA 1RVF1 1OHFA 1PO13 3J8F3 2GH8A 4QPGC 1COV2 2BFUL 5ABJC 2HWE2 1AL22 4GB33 1FMD2 4NWVA 3TN93 1ZBA2 3HAGA 1RB8G 4BCUA 3VBFB 5K0UB 1AYN3 3VBRA 1ND2B 1POV3 3IDEA 1PIV1 4LLFA 4Y4YA 1BMV2 1VBE1 5A32B 5ABJB 2MEV3 1VBA3 1AR73 4N53B 2RS31 1RUG1 3VBOB 1RUD2 3VBFC 3LOBA 1RUG3 5BNPB 1NCQB 5DDJ3 1R091 1FOD2 5DDJ1 1HRI1 2TBVA 1R092 2XBO2 1AL21 4CDQB
chains in the Genus database with same CATH superfamily
1SLIA 1FV2A 1O8PA 2V4AA 3N9QA 2A3XA 1RHI1 1S2BA 2J1AA 2XLGA 4TLFA 2IVJA 4CUAA 1GOHA 1W2UA 3HMYA 4K3UA 4QXKA 4FPYA 3OPTA 1E57A 5FZDA 2EIDA 2WA3A 4E2GA 3UL2A 3WF4A 1IQDC 1ZZ6A 5CZKA 4KI5M 3MBWA 1PVC1 3DEMA 4B3NA 2H6CA 2QDNA 4N43C 4BWOA 2VUDA 1AR61 1ENRA 2WS92 1F5FA 3IT8A 5EQUA 4N9HA 3ZXAC 4URAA 3KQ4B 4NHKA 1BKZA 3LFIA 1RUI3 1SMVA 1RUF2 3IDCB 1WLWA 1IKPA 3ST7A 2WRAA 2HWD3 1O91A 3FZ3A 3FE5A 1DIWA 5BNQA 4JV4A 4WV8A 2ID4A 4YSFA 1C1FA 4XZUG 5DUUA 2GP5A 3MHZA 1C5IA 4A42A 5FDBA 3LQCA 4QWNA 1RHI2 2EA7A 3OBZA 4QHBA 2F4LA 4HSJA 4B7KA 1NXD1 1ZBE3 2QTWB 2DFCA 3H1YA 2VJXA 5JPMB 1PO23 4CP9A 4RL7A 2PTMA 3CMGA 4A3ZA 1W6PB 3MZHA 5DMYA 1WWYA 4QPIB 3O1OA 1U5YA 1VJ2A 1OOPC 4BQ2A 3E97A 2BWAA 1NG0A 3O1MA 1OBNA 1PVXA 1DGRN 1X8MA 2JB4A 2IUWA 2W39A 3O7OA 2P34A 3ZFEB 2GH2A 3AMQA 4WVZA 4NHYA 3IBMA 4W50A 1RUF1 4XUTA 4Q0QA 4BISA 2VPVA 1LOGA 1E5SA 1CESA 2OA2A 2K46A 4LBNA 3VZJA 1W04A 1J83A 1UKGA 3D82A 4IE7A 4R52A 4V2WA 3VHOA 4FXGB 4FAHA 4Q27A 2WNUA 5I8SA 1ZYBA 3PL0A 4KWLA 4ASLA 3ZFEA 3LCPA 3PUSA 1UKRA 3UGGA 2R072 5FREA 4Y26A 1D2SA 1TZOA 5FZEA 1RUG2 3KMHA 3VBHA 3ZYIB 3POFA 3ZMNA 2JG9A 3FN9A 3WF0A 5CFDC 2ILMA 3K77A 1WKYA 2QQJA 3RI9A 4C0HA 4YGBA 3GBFA 4JGYC 1G8WA 1IG3A 5HCBA 2K0GA 4ONUA 5J3UA 1V6OA 5FMOS 1QF3A 4Q4W1 5FUPA 5LA9A 1NYWA 2CYFA 2J22A 3R4UA 2UU8A 4NJ4A 3C2UA 3I2DA 1LULA 1Y3TA 4WM7B 4YGCA 3O1RA 4CDXB 4Q26A 4AE2A 4HVQA 4RS5C 1R081 1X33A 3I8TA 1VB2A 4W6XA 3FLTA 1QJEA 2Q8CA 1B09A 4MVTA 3MEPA 2BYVE 5KC6A 4KWJA 3B3QE 4YM2A 1WBLA 3DCQA 4HVRA 4IESA 3FUOA 1U5ZA 1KJRA 2DVBA 3T0DA 1QJY1 1KITA 4XC9A 1ENSA 2XUMA 4XF9A 4ZZ5A 2WN2A 5CKQA 2ZAHA 3AP9A 4ET7A 3SH4A 2JDHA 2LM3A 2PAMA 2PHFA 2E9QA 2NM1A 3VL9A 3VDCA 4DXTA 1MZEA 3JBG3 2DCKA 4DUWA 3RMXA 4GZ9A 2E6VA 1RMU1 5FZ1A 3QACA 5A32A 1XNTA 1E5HA 3K46A 3MO4A 4XXPA 2VBBA 1NZIA 1R1ZA 1QJX2 1WW5A 5EJ3A 3IDBB 3WUCA 2YC4A 1BBT3 4JGZC 4F7ZA 3ZPOA 3GXUA 3UK9A 4UBGA 2MPFA 4N8MA 2DWRA 2HWC1 2IFWA 5FYYA 1WA4A 1EV13 1IS5A 5IJRA 3WG4A 2E7TA 4CDWA 5FKCA 2Y6KA 2VOWA 2BW8A 1AR92 4XCBA 2DVAA 1SCSA 3OGSA 4C0BA 2OVUA 2VTXJ 3CJIC 4HN1A 1W6OB 1K5MC 4DINB 1DFQA 4Y33A 4YM3A 3ZSLA 3FFZA 2A3WA 1LR5A 3H0OA 3VBUB 3GDBA 4Y1ZA 2EF6A 2DCTA 4Q1PA 1H2LA 1MS5A 3PU8A 4LUKA 4Q0VA 1X50A 1PO12 3RMYA 5T5LA 3RS6A 5BNNA 2VL4A 2VBPA 1UAIA 4RQPB 5C7GA 5M0TA 3POEA 4PLNA 3VKFC 5FP8A 2HWB1 1ZBE2 4JZRA 1AR81 3JD73 3O12A 3BODA 5A6YA 5K9YA 1HB3A 1AR72 4OHVA 3AZXA 2B45X 5FXWA 1RJ8A 4NN0A 4UFJA 3VZMA 3J4UH 4PBPA 2RVAA 1CAWB 5TSWA 3ACHA 3VHNA 1LHNA 2JEMA 4HT1T 4MGTA 3MGUA 1XNDA 2QQWA 5FUIA 5A3MA 4AVTA 5A7QA 2FDKA 5FOBB 1OUXA 5FZ7A 4XUNA 3IKWA 5LK7B 4IXLA 2W2IA 2JWPA 2FDIA 1LRHA 4LORA 1SLCA 1C8M3 2P6HA 2O0OA 1F15A 3NJXA 2F6BA 4QDQA 1VBD1 1CAWA 1N3QA 1RUJ1 1VBE3 4AHXA 3WQ0A 3UJQA 4AHWA 1JYNA 3U14A 1REFA 4AQTA 3E5XA 2JD4A 4COYA 1VMHA 5C5TA 3GM8A 4XHBA 5D8AA 4KBBA 1CPNA 2JKBA 1F2NA 3KM5A 3W20A 4ASMB 1G9CA 1JYTA 2XGXA 1VBB3 4PF5A 2MNGA 3B93A 4GH4B 3BOWA 1R093 5FYIA 5BV6A 5F7UA 4HKWA 4Q4V1 3OBRA 3IAQA 1TME1 4IGOA 5FIXA 3URFA 2EALA 4XAAA 2P2KA 2QQVA 3LFMA 2WZR2 1GZTA 4YVSA 4QPGB 3ZR6A 5KXDA 1QXPA 4XFBA 5FZHA 1Q8VA 1S2KA 1H1MA 5F3EA 2ZGOA 1A3KA 1S0FA 2R1DA 2R061 5A3NA 1PMHX 3N9MA 1GZWA 2WABA 4Y5TA 4KL1A 3T2QA 4RHV3 5HBAA 2BNMA 1FNYA 3M3QA 1SZBA 2VOTA 1H9WA 2ZTNA 4XFFA 4P9YA 2BDRA 1JZ6A 4M01A 4SBVA 1F9KA 4OUEA 2JENA 1VE0A 2R073 5L9BA 3VBHC 4E2SA 4RA0A 3U75A 3VBOC 4GMP1 3FBYA 5FMCA 2XQRA 1JZ7A 4QAWA 2BOIA 3PVOA 2PAKA 5I0UA 5FCCA 1C57A 2Q1FA 1YLLA 3S5QA 1KS4A 2OXBA 4CCJA 4V2VA 3WLUA 1OD3A 4UI9L 3K48A 2RDSA 2QJVA 2WO1A 1UN1A 4HETA 5CFCC 2YHJA 4GIQA 3TEYA 2VOKA 5JIUA 2JICA 1VLNA 1O3TA 4W4ZA 2IFRA 3D5OA 4AG4A 4BHPA 1ZBE1 2HWB2 2PHUA 4MG2A 5FBJA 4QDRA 3THTA 2GP3A 4Y20B 2WFPA 3SQOA 3C7GA 1JZ4A 2ZJCA 4P9LA 4XILA 4I3GA 4DRRA 2LUWA 4QHOA 1XJAA 3S6PA 4CVUA 1AR93 1Q8PA 3TNPB 4LULA 1O7FA 3H8RA 4AF9A 5KWRA 5FK8A 2XHKA 3GCWA 1UF2C 3V0AA 2XOMA 3NVCA 4NIIA 4EN7B 1LENA 3ZXGA 1S0CA 3HR9A 3ZVXA 3AFKA 3POWA 2DTWA 5FZ8A 1QDOA 4Y1UA 4LLOA 4K21A 4AI1A 4AHYA 4TXWA 2XQXA 3P3NA 4JHZA 3LWCA 4BIFA 5ACA2 1UPSA 5F2WA 2YUEA 4XMIA 5HV4A 3WW2A 4AI3A 1VALA 5I93A 5BY5A 1W8UA 3BI3A 2XVLA 4KMQA 2TUNA 5FP3A 5FYZA 3ZKYA 1EY2A 5JIAA 5C4WC 2XJRA 2RDRA 3FHAA 5F3GA 2E63A 1CJDA 1W99A 3Q8AA 3IIIA 1YFYA 2HWE1 5BNNB 4GQ7A 4QPIA 5T5JA 3GZUC 3AB0A 1MEC1 4IGPA 3JCIA 5FPVA 4FSJA 2XJUA 3NRUA 1UU5A 2HKXA 2J1TA 3LOIA 4N53C 1NE4A 4CDXA 2XDVA 3KVBA 2EXIA 3ES1A 2YV8A 2O8QA 1OPMA 5KHHA 3VBSC 1JH5A 2GNMA 3ECQA 5C3PA 5EWSA 4CEYB 1O4ZA 4EZHA 3ILFA 4K8RB 1W8NA 1OFNA 2DVGA 3NV1A 5JR7B 3DGTA 1YEWA 4CA9A 3C3VA 2PYTA 3WDVA 2WS91 4L2NA 1TQ5A 2WO7A 3DKQA 3DL3A 4KWKA 2ZX3A 4BDVB 1XOYA 4Q4Y2 2HWF1 4NPRA 2C0ZA 1MPXA 1ZA4A 3ZYHA 1OA3A 3T4VA 4LO7A 3ZSMA 4BMEA 4FFFA 1RYYA 2WLQA 5H9PA 4CYDA 5E16A 4X8PA 1HX6A 5IK4A 3CZUA 1HV0A 1HB2A 1K3IA 5T3NA 3IWZA 3JBG1 4BJ0A 4MSVA 4ARXA 5CAZA 1XYNA 4EN0A 3AL6A 3MUY1 4RQPC 5JAXA 4AEDA 3DF0A 1UOJA 2UWAA 2VZQA 4OHWA 4RGKA 5CIRA 1W6QB 4YZ3A 4LITA 3CL1A 1PHMA 5DUWA 1Q8SA 3IB3A 2QQNA 2Q8EA 4DPNA 1POQA 1BMV1 4FPCA 1EV11 2R7EB 2WYSA 2WZ8A 5DZFA 1UWWA 3WQBA 1JOJA 1AVBA 1DBNA 4DFSA 3INAA 1AZDA 4O9GA 5F6KA 4FT8A 2VZPA 3DKWA 1ZA7A 5H9RA 5ANQA 4IV3B 4QM8A 4B29A 3DYOA 1JODA 4IE6A 2XL9A 1RUJ2 3KF5A 3N7JA 4Y1YA 2ES3A 5FZAA 1ZVFA 1LOFC 3BKZA 3BU7A 2VVFA 3B02A 1QIQA 2WZR3 2YPDA 3OPZA 4ZS2A 4HG6B 4FTBA 5JZGA 3ROUA 3RFRA 1D4M1 1W9SA 5FY9A 4QHZA 5LEKA 1LB2A 3NV3A 1ULFA 1YQCA 1XC6A 2JE8A 1GUIA 1NA1B 1HXS3 2DFBA 3RWKX 3DXUA 3O0WA 3WD5A 1AX0A 1N1SA 2O14A 4IDZA 3AP4A 4JDMA 5CKMA 2WUHA 1H2NA 4A2UA 2W94A 4FTSA 3UV9A 3WW3A 5D8AB 1EV12 1KEXA 2D93A 3GHNA 5T52A 2QQMA 2EAKA 4L0PA 3CO2A 4XUQA 4ZONA 1ZX5A 3PUQA 5FY4A 2HEYF 3APBA 1PK6C 3J8F3 1COV2 3T2TA 1W6OA 1OH4A 2HWE2 1HJGA 2R30A 1EPWA 1DG6A 1R64A 3KZ4C 2LS6A 3ZPYA 2P3IA 5A3TA 5HI0A 1G9BA 2B4KA 2MHFA 3HAGA 4Z82A 5JWPA 2CNAA 1UOBA 1I9RA 2V5DA 1HQLA 3LIGA 3WG3A 3KVAA 1LGBA 3NNMA 3VBRA 1CAVA 2G1MA 3HIFA 2G19A 4OMCA 4YFWA 4BM8A 1PIV1 1X9PA 2J42A 4Y22B 5F5AA 1UY3A 1N47A 1BVVA 1VBE1 4CTEA 5IAVA 1UD1A 4M0HA 5ABJB 4Z8BA 1WW4A 3UGHA 1AR73 2HEVF 3ZMOA 3WDTA 1PNFA 1NLRA 1OUSA 1UOGA 2YFUA 2Q1MA 1GNZA 3BGAA 1W6PA 3D0JA 4GWIA 2WZPP 1S1AA 3VBOB 3FX3A 1UX6A 5AVAA 4YARA 2JB8A 2WO2A 3H9AA 5DDJ3 1R091 4AZZA 1CIWA 2XR4A 2DVFA 4LKEA 3AKSA 5F5IA 1GZWB 4K1ZA 3HWJA 4UXAA 4YG0A 4OHZA 3HT1A 2RJ2A 1C8NA 4BQ1A 1RHI3 2ARBA 2ETEA 2VZTA 5FYVA 3PUHA 2VW2A 1IZ3A 2W08A 1H2MA 2E51A 2VW1A 5LRRA 1DGRA 2HYXA 3NJVA 4IV1A 1ZBA3 1VBE2 2Y38A 2DUPA 4LPLA 4QX2A 5BNPC 4IEZA 2P1BA 2WIIB 4AGGA 1SLLA 1VBC1 3AP5A 4LIUA 4R8HA 4X8NA 3U78A 5FYMA 2PQQA 5KHGA 3Q8BA 5L7OB 1QJZA 3LKJA 3KQRA 1YI7A 2R043 1US2A 2R071 4GH4C 5HV0A 5ACA1 1V9U2 4Q8KA 4LUMA 1RVF2 3B00A 2QFEA 2Z42A 5FXXA 3H1WA 5AC91 3VBSB 2VMGA 3JXSA 2Y26A 1D2QA 5A1LA 3LA3A 3O5SA 4FQ4A 1ODMA 1H4HA 5FTTC 2Q4SA 4G4FA 4RQPA 5JSOA 1FATA 1A78A 2ZHKA 5FYTA 5KHJA 2A5ZA 1XNAA 4J1XA 4Y3OA 3RRDA 1N3PA 3ACFA 1UYZA 4CXWA 1KRIA 2RG4A 1O3RA 1X9TA 5KXCA 1M4WA 2KR2A 1RUC2 1MEC2 1W9YA 2JE9A 1Z7S2 3FFQA 4JKKA 3SNMA 3SC7X 2WWJA 4HLTA 1ULDA 5FJKA 3OPWA 4A4AA 5I0RA 2K2SA 1Z7S3 4EYUA 3WHTA 3BU0A 2OS2A 1O59A 3MIEA 4LR4A 5FRAA 1MS9A 4DIQA 3VHPA 5A7OA 5A3UA 1PZ9A 3JUUA 1HRV3 1PZ8A 2AREA 1RXGA 3C8XA 2CDPA 1AJOA 4NUBA 2VUJA 4YW2A 1SDDB 3WDUA 1C5HA 3GJAA 4N90A 4XDQA 3ORJA 2Y64A 3HEIA 3R4DB 4LA3A 2NZ9A 3MV01 2XJQA 3QD6A 2HWC2 2QQKA 3KT4A 4NAOA 4XFAA 5FOJB 5I0SA 5C8WA 2MEV1 4AFAA 4LO5B 4EWEA 3WHUA 1CPMA 4JC1A 1MACA 3B9IA 1CZSA 3ZYBA 1SACA 3I97A 3THCA 3RDIA 5IK7A 4AVCA 1PIV2 3SH3A 1MS8A 3ZIXA 4IV3A 3CDZB 2B5HA 4M4PA 2JIGA 1SBFA 4K20A 1RJ7A 4N7IA 1TME2 3F95A 2RM22 1ASJ1 2H0VA 2VOVA 4XW3A 5F8PA 4CDXC 2YFZA 3GZEA 3WW4A 2O8OA 2BWCA 2W87A 2YGMA 3ME2A 3MYXA 4G3YC 1OXCA 4XMAA 5SV8A 5IVEA 4AVBA 3O1UA 3GNEA 5EJZB 3AKTA 3VBRC 4ZY9A 1A8DA 4HPKA 2WZEA 4AOCA 3LD8A 3U4XA 4CUGA 3Q9OA 4PBOA 2BVBA 3OD4A 1EUTA 1Y9GA 4QD2A 4RR3C 4CDUA 1G7YA 2VCCA 1ENXA 2WDBA 4N7UA 2WNEA 4P08A 4NOTA 5FZCA 3U37A 5IK5A 4DXZA 3A21A 3L2YA 4LO4B 3HNBM 1HXS2 3AK0A 3ZDSA 3USUA 3TOJA 3KHBA 1NUKA 4MGKE 4MHRA 1AYN1 2ZS6B 4PCRA 3HVDA 1JYWA 3BTXA 1VRH3 1J3RA 4A44A 3DPRB 1WD4A 1JW6A 3W5MA 2YBSA 2BVVA 2HWD1 2RR12 2WQ4A 4IGQA 4Q0PA 4CCKA 2V4VA 3MFAA 3K75B 3NNLA 3CNAA 5F32A 3VD3A 2D6LX 1JZ5A 1NCQC 3M7AA 1LOAA 1OT5A 3HQRA 3WP5A 1ZRFA 4EWDA 2NPIA 1Q56A 4CCNA 3ZX7A 2ZA9A 4NR1A 1CVNA 1VBD2 2ZGKA 3LA7A 1XSRA 2WNVC 4XACA 1CAXB 1RUD1 2WBKA 4IEOA 1NA1A 3N3HA 2ZZQA 2IXLA 4LBKA 4OLLA 2YXSA 2H0BA 3J7MA 4WVMB 3C7HA 4ASKA 2ADDA 4FTEA 5GZEA 1V9U3 1W3VA 2KA3A 4BXFA 1RITA 1CD3G 1DU3D 1N1YA 5FPZA 3E1F1 4FFIA 1XXNA 4HL0A 2VG9A 3C7FA 1LAJA 1M06G 1HDKA 2GC3A 3MUZ1 1XU1A 3MFCA 3WP4A 4ZZ8A 5JMCA 3AJYA 5L9VA 1SLAA 4QX1A 5DXDA 2ZPXA 3USSA 3G7DA 4GH4A 3SH5A 3BPSA 1W28A 4Q0SA 4QKFA 4MGZE 5GZGA 4FPEA 4E8CA 1JYVA 3TN92 3AMMA 1MVEA 4M4RA 4AQ2A 1GKBA 1S2EA 4PDWA 3THPA 1IGOA 5FAXA 5C8CB 2WZR1 2R6QA 3KCXA 4QPGA 3RPQA 3LEKA 2WO3A 5E89A 5CISA 3E6CC 2VNVA 3I3DA 3AXDA 4GKYA 3ZSKA 1SG3A 2XG3A 1GMMA 1QMJA 3EXUA 4M0NA 2OT7A 1LOCA 2CGPA 3DN7A 1J3QA 5C3RA 4NIGA 1GZCA 1ND3C 3GHMA 3OB8A 5EJ1B 2XLFA 1OOPA 1S4CA 1NOVA 2ZGQA 2ORZA 4H3WA 3NJYA 1OLMA 3A0NA 5IVYA 3HNYM 1UZZA 1YQ5A 2RM21 3PU3A 4WBBA 4EJRA 4QX0A 3P3PA 2DDUA 4HVOA 4QU1A 5GLWA 4XHXA 5I8TA 2H6BA 3K4DA 1YI9A 2CAUA 3CQOA 3O0VA 3K4ZA 1K12A 4PI0A 1OLME 3TN91 1R083 2W91A 4JKLA 5DUXA 3PIGA 3WNLA 4DRVA 1ASJ2 1MQTC 2W52A 4KBZA 1POV0 2BRTA 5J36A 1ZZ7A 3FBMA 2PELA 5JOWA 2XB6C 2DUOA 3LDKA 4Q5OA 4ZS3A 5J37A 2VCMA 1JYIA 4P9XA 1PZ7A 4D6SA 2YGLA 4MH0E 1Y43B 3VKNA 4DOUA 3S57A 4XCAA 5FK7A 1HRV2 1QOTA 2BGOA 3OJBA 1T6BX 3R4SA 3RWNA 3ZSEA 4OCTA 4PQ9A 3VBOA 2A6WA 5A33B 1XE0A 1R1A1 4OQ8A 3NV4A 4UW6A 4UWDA 2FQPA 1VBB1 1UZWA 3RZMA 1UIJA 5A3LA 1VRBA 4S2HA 4ZXEA 1QOSA 5IYYA 1XNCA 3I59A 3UNPA 4DZGA 2JG8A 1JOBA 4J6GA 1AYN2 3VDDC 1LESA 2ZCWA 4AEDB 1ZRRA 1K5MA 3GZTB 3HBZA 2BNOA 2HWC3 2ZX2A 3DXTA 5ISLA 4CRQA 3LSEA 3MIFA 4U36A 5FP9A 3WNOA 2R063 2DBIA 3SKVA 1QH7A 2ZABA 4RHV1 3OYWA 1UXXX 3ACIA 5HXMA 3ACGA 3ZN4A 4UFLA 1LCLA 4CCEA 1G9DA 1ZBA1 3ZFGA 4URTA 5FWEA 1GU3A 4XUPA 2HEWF 2C5DA 1VBC3 3P1IA 2JDMA 1DDLA 4NO4A 5F5CA 3RJ2X 2Z69A 4AAPA 3RGBA 1LOEA 1URXA 2VC9A 1ND2A 3KV9A 1QH6A 2VNGA 5C8CC 4XBNA 1QQP3 2ZBJA 4OI2A 5CFDB 5LY1A 4K9SA 1I5ZA 1WLCA 1V6JA 2ZMKA 4JCKA 1RUE2 4DQAA 5JXGA 1CONA 2VZ3A 4COWA 3N7LA 5JUVA 4CUBA 2Z2SB 5F6LB 1NY71 1RL3A 5FZBA 1Y4WA 1QJY3 3RYRA 3DYMA 2VUCA 1UY2A 2HWB3 2JXAA 1AR83 4XEZA 4CEWC 5EIYB 4M3CF 4XAEA 2IXHA 5FYSA 1GFF2 2EXHA 2VNOA 5C70A 1IPSA 1ZM1A 2Y6JA 4XF4A 2V09A 5A3PA 3FHQA 1PM4A 4AFMA 4JGZA 1RMU3 4CP9B 1O5UA 3LEGA 1ULCA 2X05A 3WF2A 5JSPA 1UO9A 3N35A 1NLQA 1ZREA 1KD7A 1QY4A 5K4LA 3N36A 5FPUA 3M70A 4PJYA 4YG6A 5A6ZA 2YY1A 3UKNA 1QNYA 5I0TA 3CZJA 3POGA 2JDPA 2AH2A 1A6CA 4RFT0 1OSGA 3IPVA 4ZU5A 5LEJA 2A7AA 3POSA 5FZ3A 4OHYA 4RS5A 1KXGA 4YG3A 3VGIA 1S0BA 1QJU1 1LHUA 1HB1A 4XF0A 4YW5A 1UXZA 2B42B 3J26N 4XOGA 2IXKA 2A6XA 3POJA 5FZ9A 2PLV1 3KCYA 3PJYA 5F2SA 5EZWA 5KXBA 5IVCA 3LAGA 4QX8A 4ZPIA 1AXZA 4WZFA 5JOYA 3SITA 3EO6A 3NAPC 3Q8EA 3H3UA 3T2PA 3VB9A 5FMBA 1DGWX 2JKXA 1TMF2 1U5XA 3H3ZA 3MF6A 1B35C 4XJAA 2Q8OA 5FZMA 1VBB2 5CYYA 1JZ8A 1OQ1A 2EIBA 2UWBA 3ZN6B 1DYPA 2VCBA 3FWEA 3POIA 5K8SA 2LALA 1AYM1 1QNWA 4QQ2A 3KF3A 4LBQB 4AI9A 5BXXA 1GP4A 1UZ0A 1O5LA 3OY8B 5FY1A 2YBPA 4IEXA 5A6XA 2WNUC 1QHDA 3PTYA 3E5QA 4YWAA 1JN2P 5A3WA 2PXJA 1YIPA 1NCRA 4XPVA 1WD3A 2A75A 1ND3A 2DUQA 4RSUA 2AGSA 3TB0A 1EPZA 4AQSA 2I45A 1K45A 4NHMA 3ES4A 5FZIA 1AL0G 4DUVA 1W6QA 3VDBA 3M3OA 3KV6A 4ARYA 5DAXA 1LOFA 2BNNA 3UGFA 1PNGA 2PHDA 5GJ6A 4IEYA 4GWNA 4XZPA 2FMDA 1V70A 4PHZA 3UT0A 2FZ1A 5LBBA 4XTMA 3TAYA 2WWSA 1H9PA 4NVPA 3L9JT 1OLRA 2GC2A 2VULA 4X6QB 1YC61 2XJPA 2R32A 1CX4A 1J84A 3TEZA 2ZEZA 1OA4A 1XNKA 1T2XA 4DB5A 2BQPA 1UYYA 2BJSA 4UT5A 1UU6A 3JZVA 2AC1A 3BIWE 4XFCA 2J1SA 2NMNA 4FOQA 2Q1ZB 2JG9B 3BVCA 4LE4A 5F9TA 4QQLA 3BTZA 1W03A 1W05A 2PQSA 2ZKLA 3B5LB 5FUNA 3U11A 3I2OA 2GN3A 4IV3C 1CZVA 3ATGA 2VQUA 3KWVA 3PHMA 4N9IA 1I5PA 4YVSB 4JTNA 3ZOIA 4NIAA 4V1PA 2A6VA 2VU9A 2DURA 3ALQA 3I49A 2WFF3 1BZWA 3I2HA 2UY9A 2EXJA 3S7IA 3SHRA 4AYUA 1GQHA 2D98A 4I0AA 1V6NA 2YPJA 5FPBA 5GM0A 4RYDA 4BB3A 1R1A2 1RUE3 2OIIA 4GMP3 3VZOA 5D8AC 3HOBA 2A71A 2WSUA 1AJKA 4HK9A 4S2DA 3H8OA 5JZGC 1DZTA 4CU6A 3LPGA 4YVWA 2Y6LA 3WP6A 4XVHA 2G4IA 3D3AA 2HWE3 3AVRA 3PJQA 2E7AA 3OG2A 2X5IC 3WOGA 3VD5A 1CAVB 1YHFA 4CP0A 5A70A 2R0HA 3BIEA 1JU3A 3KHCA 3VBHB 1V6KA 1TE1B 5T5OA 1ST8A 2BTVC 1G6NA 1OHFA 5L7OA 3V0BA 1PO13 4PT6A 2CGOA 2FDGA 4EWAA 3GYDA 3WINE 1UYPA 2BFUL 5ABJC 2G9ZA 2VR4A 2QQIA 4MZUA 5E1RA 1AL22 1PMIA 1WA6X 2PHLA 4YGDA 1FMD2 1UU4A 4JDNA 3S0MA 4NWVA 3TN93 1ZBA2 2CHHA 3OGRA 5C5UA 1GQPA 4DEQA 1G9AA 2GZWA 3H7JA 4BCUA 1V6IA 4YGEA 4ZKTB 3A4UA 4AVSA 2ERFA 3H1MA 4I09A 3D8CA 3AMHA 1D4VB 2VZRA 2W9XA 1ULGA 4AVAA 4LLFA 4YRDA 5JPNB 4YFZA 4Y4YA 4EN8B 1OKQA 3KCCA 1DP0A 2D43A 3I2IA 2RHPA 5CA6A 1H6XA 2IXCA 4FPOB 1VBA3 4QDSA 4COUA 3PMEA 2W46A 3VHRA 4UW3A 1YIFA 5GLTA 3UETA 1UCXA 1RUD2 1W9WA 2WQZC 5BNPB 3IMNA 1SFPA 3N7KA 2C4XA 1VMFA 1NCQB 1W3XA 2D6KA 4INDA 4AWDA 2OZ6A 5FKBA 5FYUA 5I8YA 4XYXA 2OX0A 1HRI1 1R092 2Y6FA 1GP5A 2XBO2 3NKGA 3OYWB 4P14A 4UBHA 3H3LA 1DQ5A 1KQRA 1W8HA 2DV9A 5DAQA 3LEMA 4O65A 4K1YA 5JOXA 2WKKA 5A7WA 1W8ZA 1MEC3 2AYHA 2B46X 1LJ7A 2ZXQA 4QX3A 4W65A 4BQXA 1PX4A 1WW6A 2RJKA 2WJSA 2RMU2 3AP7A 3VZKA 5AFEA 5BNNC 4Q8LA 4ZXKA 1IS6A 2DYCA 2RMU3 3LSDA 2RS52 2XPJA 1NXMA 2E31A 3PLQA 4Q4X2 3K3NA 3MIBA 3W9AA 5DUVA 5B2GB 4KQ7A 4JGYA 2DVDA 1Q5OA 4IE5A 2W1QA 2QKDA 1FPN1 1NCRB 1GYKA 2VQAA 4JVAA 4AEMA 1LKNA 4L99A 2HWF3 1HXS1 3M3IA 4GJZA 4XDPA 1PGSA 1WCDJ 2RJLA 2OUJA 4E8DA 1A34A 4DNYA 3JBG2 2B7YA 3VD9A 4CU8A 3VKOA 3CLPA 3OGJA 4S2FA 3BPZA 5DN2A 3AL5A 2I07B 5C4WA 1OOPB 4NRQA 4CP1A 3ETPA 5FV3A 4QM9A 5ERLA 3PNAA 5JR2A 1GOGA 3ITQA 1U5IA 1W8WA 1WMFA 2FCUA 2P37A 2R0FA 3ON7A 3ZXFA 5F5QA 2D6PA 4Q4X1 2CV6A 4WM8B 3EB7A 4XE9A 5C9AA 4RS5B 2EVXA 3IAPA 4QGLA 4BXSV 3ZN6A 4PLOA 3K3OA 2WYFA 2BPA2 4W6YA 3SMHA 1YUDA 3UESA 5FZ4A 1KFXL 3Q8FA 1S0DA 2VCAA 1K42A 2WN3A 5LY2A 4U2AA 4B7EA 5JOZA 4OQ9A 1QJU3 3BUCA 3CU7A 1AR71 1XBFA 2C26A 5GALA 4JHTA 1LTEA 2A6ZA 4LO8A 3ZYFA 4EROA 1L3JA 5HCHA 3KGLA 3AX4A 4FVVA 3N9OA 4ZU7A 2ZHLA 3FMGA 4LO6B 4QB1A 5FP7A 1RUNA 1UOFA 4QU2A 3U0ZA 5KHIA 1OVPA 3QBQA 1TG7A 4UFKA 1GZ9A 3WF3A 2QNKA 2ET1A 3I59B 3GALA 2FD8A 4LHKA 5D2AA 1BEV1 4WVWA 2WNVA 4JTOA 3M3CA 4LA2A 5CNAA 2PLV2 3KS7A 2G9GA 1DQ6A 1HN1A 4OYUA 3SLIA 5C3OA 2PHWA 2ZGSA 4LBJA 3QOPA 1VP6A 2AR6A 4N43A 4FOVA 5IATA 1PGL2 4GJYA 4PQQA 2AUYA 4Y20A 1UIKA 1O4YA 5CG8A 3THDA 2ZX1A 3QH7A 3A23A 1RUOA 1JYCA 2C6SA 5K0UA 4HKLA 4D7YA 2VQ0A 2Y33A 3GBWA 2CDOA 5ACA3 1HRI2 2WNVB 2FHRA 4MADA 2ZX0A 1LU2A 2E26A 2IVIB 4PI2A 5FY0A 3TBDA 5FO7B 1FAYA 1ZZ9A 3AJZA 3NMBA 5D21A 1PO22 2FMYA 3T1LA 2ADEA 4W8JA 2VMEA 1BYHA 4YLZA 3TYJA 2WQ8A 3ZXKA 5FYBA 1OMIA 3JD72 5EP9A 1TMF3 2ZMLA 3MIGA 4P00B 4Q2FA 4E2QA 3BYWA 3B69A 5FLHA 4BOWA 2J7MA 3J7NA 3I3EA 1OURA 5DQ0A 3KD4A 2X53S 1XRUA 1H8TA 4M3CA 1IOAA 2QQLA 3CIHA 1YRZA 1STMA 2NLRA 3ZFFA 2QQUA 4BQ3A 1UMIA 5CU1A 3AVSA 1HKDA 4P5YA 5FPAA 1GNHA 2OQ7A 4HANA 4DUXA 4WM8C 4OULA 2AEYA 3CHXA 1H1AA 1FXZA 2XONA 4BU2A 5HPOA 1HRV1 3H50A 1W2TA 4NROA 1QEXA 2WL1A 1I6XA 4TYSA 5HCFA 4CUCA 4PF1A 2W3JA 5FZOA 2PMWB 5DPNA 2O1QA 1MQTA 1SBEA 1X7NA 5FMOL 5LATA 3OF1A 4B4PA 1FOD3 2HH9A 1EYBA 2TNFA 1OQDA 1ND2C 2WFF1 4IERA 5H9SA 5LBEA 2B39A 3D6EA 4DXSA 4YW4A 2ORXA 4EV0A 4OMDA 5EPAA 3WR0A 5BNOA 3SEPA 3CKHA 2R041 2RS32 2XBO3 4RN5A 4XFGA 4LBOA 3UJOA 1I3HA 2NMOA 4QKDA 5F3IA 5H9QA 1CAUA 1DGWA 3SCGA 3C7EA 1DYKA 3LDRA 5L7OC 1ASJ3 4LNVA 1RXFA 3MLJA 3RJRA 2DF7A 4QX7A 2UURA 1WMXA 3VZLA 4NIHA 2GMPA 1JXNA 1F31A 1PMJX 1Q3EA 3AKPA 4UW5A 1GICA 3OGGA 3WDWA 2YROA 2FDJA 3FL7A 5FFOC 3O1PA 3V65A 4CDQA 2RM23 1MZ6A 4F8AA 1WMEA 1LECA 2ZHNA 4L11A 3HJRA 3T0BA 2XUEA 2WT0A 4QMAA 5C4WB 1COV3 2P3YA 1GWMA 3OEAA 3T08A 3SXWA 4CCMA 1UMZA 3RZKA 5DZGA 1WCUA 5A3OA 2RE9A 1DLLA 1OQEA 3NNJA 3N9NA 4H14A 1RINA 3U1XA 3EJKA 4DO0A 4M3CE 4P9WA 5IK8A 3AYEA 1WBFA 4XTPA 3VDDB 5HXVA 3E6BA 4CCCA 3CJIB 4PIYA 4AEDC 4Q4W2 2CGNA 1PK6A 2W92A 1SLTA 2ZMNA 2F4PA 4JX0A 1R1A3 4CEYC 5BUVA 4FXKB 1QQP2 4CU7A 4Y4RA 4R9CA 4JGYB 4HSLA 4LBQD 3AKRA 1RC6A 5APAA 5GZDA 4RGAA 4E4HA 1VBC2 4A7YA 2DCZA 3VD4A 4HFSA 1WCKA 3JU9A 4LIVA 1LEDA 4NMIA 1YJKA 1V9U1 3V0AB 3AC0A 2D97A 1EAH3 2Z79A 1UYXA 2ZEXA 1JS9A 3BTAA 3DECA 3FHIB 2YC0A 3OCPA 4IW3A 4B1MA 5LRSA 4OUSA 1YNAA 4BPZA 3TNQA 5K0UC 4XJ8A 1V6LA 4OI1A 1RMU2 4CPBA 4Q4Y1 1OA2A 4FPGA 4TWTA 1W90A 2GC1A 3ENRA 3VN4A 2QQPA 4UYBA 5LA0A 2R16A 1ODNA 4KWUA 3ZR5A 1C3HA 1VR3A 2BOJA 2BP6A 4KG8A 3RYPA 2D44A 2RS11 1CWPA 1XE8A 4YVSC 1C28A 2TEPA 4I01A 4AEJA 4AHZA 1US3A 2PAEA 2VD7A 1XU2A 2Y8KA 3ABZA 1AXKA 1VRH1 1DZRA 4B4QA 1JBCA 1NCQA 2DTYA 3HQXA 1OVSA 1QXJA 2BFUS 4SLIA 2Q8DA 1REEA 2GNBA 1W8TA 1YFWA 3A22A 4GAZA 3KT7A 1OF4A 3WF1A 1VIWB 1PM7A 1X8EA 2HBUA 3PMSA 5FMDA 4LMFA 4XUOA 2OYZA 2VMIA 5FWJA 5A7WB 4GALA 4MXWB 1Z0HA 1RVF3 2R49A 4IEQA 2FZ2A 4C1XA 1NQDA 1NZCA 2VNRA 2XWBB 4BQ5A 4XJUA 5FXZA 4A7KA 1HB4A 1RUD3 2R042 4NHXA 1IQAA 3WUDA 5GLVA 4UOJA 5T55A 2YG0A 3ZYJB 1DQ0A 4X6RB 2P6CA 3PUIA 2XVKA 4Q4X3 4Z07A 5FO8B 1VBA2 5JDBA 3AZVA 1LNSA 5ANNA 5KXEA 2QDRA 3W59A 1TVGA 2IZWA 4LBMA 2CL2A 1POV1 2E53A 2VXJA 2D3SA 2VTXA 5IW0A 2QBXA 1OC1A 3ZXEA 4C8DA 3A0KA 1GP6A 2J1EA 1FV3A 2PHRA 5BNOC 1W8OA 4HN0A 4AK3A 2ZGPA 1JU4A 4A3XA 3WSOA 4KU7A 4XURA 1XYOA 5KC5A 4UW4A 2OZJA 2JDKA 4MXVA 4XQ4A 2XHNA 4QGNA 1MS1A 4XF1A 1QKQA 2RS33 4OVEA 2HWF2 3WNKA 3WY6A 4HK8A 5JI9A 4UFHA 5LBCA 5FXVA 4LOTA 4UFIA 4BK5A 3POBA 1NKGA 2K9ZA 3ZFGC 1HV1A 1WGPA 2V5YA 1SHWB 1AHSA 3JQXA 1MS4A 4QKBA 2CWMA 5A7NA 1SFYA 2OKXA 3ZO0B 3ZYPA 3T30A 4BQYA 1YQ8A 3LA2A 3M8LA 3WNMA 5LA1A 2OQ6A 3LZZA 4P5HA 5T54A 1FX5A 5DAVA 4A41A 5T50A 2A1XA 3MW4A 5FR3A 3TEWA 5FZ0A 3ASIA 2LROA 1TEIA 4I3PA 3BALA 1GNYA 4BE3A 1F5JA 3V56A 1NLSA 1L7QA 4R4ZA 3B94A 4KU8A 1JI6A 3NNFA 4XJZA 1W06A 2ZEYA 1O4TA 1AX1A 3HBKA 5GZCA 3R0RA 4QPYA 5GLZA 1JUHA 4QPWA 3ZKUA 3BOPA 4QQPA 5B4NA 1W0NA 2X8KA 5IT6A 3AMNA 1DGLA 2WFF2 1CN1A 3VBUA 3VUOA 4MGIE 3SEEA 1DF0A 2CTVA 5JXJA 4CXYA 1MQTB 1QJX3 4L8QA 1BQPA 1L7RA 2I2SA 4AW7A 3VBSA 1NX9A 3MPPG 1YO8A 1AX2A 5LK5A 4P9IA 3OTFA 2VBDA 2PA7A 4KGGA 2MEV2 2XKOA 5CVRA 5A1FA 1F4HA 5E88A 3ZFFB 5D1IA 4ITCA 1LOBA 3SKJE 5JXIA 5KR7A 4E27A 3EBRA 3MIHA 2CSGA 4P9JA 2XLAA 2ZGNA 1REDA 4ORFA 1QJY2 1RUH1 2WC2A 3N9PA 2JG9C 3BN6A 4OUMA 1VB4A 2OW4A 1D7PM 4QPIC 3OBTA 1MS0A 4GWMA 4FPKA 3IZOA 3T09A 1VRH2 1WW7A 3DUIA 3PVBB 4CSWA 3M2MA 3ZSJA 4AFBA 1JYXA 4CCDA 5FZOB 2IC1A 2JDUA 1AL23 2UY8A 2EAAA 1UX7A 4AI0A 4BK4A 4O7XA 5FLJA 1ZZCA 3WZ1A 3VKMA 3KT1A 1RUF3 4XABA 1RTVA 4XIOA 5FY5A 1CIYA 1CZTA 5C8CA 5JXHA 2RR13 5CFCB 5FPXA 4FBFA 4DY5A 2VTFA 2PLV3 2ZZJA 1LHOA 4FP3A 4I02A 3FC0A 5DAPA 3NWKA 3IN9A 1DZQA 3PDQA 1EAH2 2OPWA 2VUAA 2ZX4A 2XBO1 1QWRA 1RUE1 1RUC1 3B9CA 1DCSA 1QQP1 4G9SB 3AZZA 3LIHA 3AFGA 3PUAA 4Q4V2 4CP2A 2VM9A 1ZZ8A 5F37A 2ZGTA 1RUI1 4AAXA 2ZHMA 2Q5TA 2PN5A 3S30A 4A7ZA 3BTYA 2GALA 1MZ5A 2HWD2 1MZFA 2X10A 5A7SA 3T3YA 1CJPA 4D7SA 5IHRA 1HIXA 4A45A 1GWLA 4ISQA 4MO3M 5IVFA 1AYM3 4WM7C 1YFXA 2JJ6A 2JG8C 4MGYE 4Y5SA 5FYCA 2VMDA 4FO9A 1J3PA 4YZ5A 4I0WB 4D3WA 5FPLA 4LBLA 3H7YA 2Q30A 4QPGC 4CCLA 1YQ2A 1BXHA 1FT9A 4GB33 1EP0A 2HLEA 2AEZA 2QE3A 2SLIA 5IWFA 5JI7A 1GSLA 3ZXJA 4DY3A 2JE7A 1TNFA 4AXOA 4ES8A 1RB8G 2PFWA 3WDYA 3FJSA 5K0UB 2J1RA 5DABA 2JD9A 5FY8A 2ZGUA 3H8XA 1PK6B 2ENRA 1H1IA 1NT0A 3IDEA 4FPLA 4AQ6A 5AFBA 4H7LA 5C3QA 3RZLA 1DQ1A 1WCQA 1G86A 1XE7A 4QXCA 3OY8A 4CU9A 1UW8A 3T1MA 3MF9A 4MLOA 1WMDA 1XYPA 4NAMA 5G05L 4UF0A 3FLRA 3Q8CA 5L36A 1OH3A 3E6DA 2XH6A 3LB9A 3AZYA 3NNGA 4KNCA 3WDXA 4N53B 1LEMA 5HCAA 2D6MA 1GWKA 3AYAA 1ULOA 3H8UA 1S0EA 3OSDA 4XBQA 1RUG3 3J7HA 5C71A 4COZA 4CZSA 5IAXA 2C1FA 4XETA 1DLCA 3QLQA 3JQWA 5EYYA 1FOD2 2XKPA 3IMMA 2TBVA 1HQWA 3KSCA 3KV4A 3NO8A 3PVNA 1C1LA 2SBAA 4YW6A 1D0HA 1QOOA 1KS5A 4EZ4A 1YJLA 3CF6E 1AUYA 1W6MB 1HW5A 3W5NA 4IL7A 4YZ2A 3B7MA 4IETA 3ZFGB 2X09A 4IEPA 3VBUC 4IEVA 2RMU1 4Q4W3 4K40A 1Z78A 2G9FA 4CDUC 5A6QA 2E32A 2JIJA 1ACCA 2PHTA 5FZLA 5A1AA 1ONAA 2NYYA 5CFDA 1NY72 2C9AA 3LDBA 1OD5A 2LW8A 3CBNA 4LK7A 1QJFA 1W8FA 1UMHA 2NQYA 3G6JB 3I4IA 3I54A 3JB8A 3MLLA 4C90A 4FAGA 4CPBD 3ZXDA 1F8VA 2XL7A 1FPN3 4MYEA 4EQVA 1YYNA 4ZHNA 1AR63 3M1HA 5IFTA 3B01A 3AXEA 3RYKA 3VDAA 2IWGB 1Q8QA 1XNBA 4FP2A 4JRAA 2R062 3AYDA 4P9GA 4N43B 4W6WA 2VY0A 2A73B 3WCSA 4NWWA 4CDUB 4TN7A 4GWJA 4NHLA 2VOXA 2GU9A 4D6RA 1IS4A 4MUVA 3I3QA 5DG2A 2RDNA 1T6GC 3CJXA 1J1LA 1YCIA 4MOAA 4YM1A 3CEWA 3IM0A 3WXPA 5LW9A 2Y0OA 4BIOA 2Y0IA 4OFGA 4Y24A 4B4RA 5LBFA 2VMHA 4LBQA 3RVHA 4S2GA 4O9EA 1W2OA 3J9SA 2WSVA 3SCHA 1PO21 2AACA 2BGPA 2CU5A 5SV5A 3BB6A 4H7MA 2ZGMA 4DS0A 5J09A 1ZZBA 2VAUA 1F4AA 1UY1A 1IHMA 1QJU2 4PDWB 1OKOA 1Q43A 1ND3B 2VO5A 4JKMA 4FPFA 4IQPA 5EYXA 2FCVA 4NIDA 5G04L 4HOOA 3VZNA 3LGRA 4Y5Z0 2NP0A 4R9DA 1NE6A 1YQ6A 3VL8A 4AI2A 2WR9A 2B9UA 4AFCA 5DAWA 1V6MA 2GNTA 1VBD3 2WAAA 3VDDA 2VE1A 4D94A 1W0OA 1F35A 2ZEWA 1UL9A 4GA9A 2YU2A 4AI8A 1AYM2 5BPXA 2X5IA 1SFNA 1VBA1 4MHUA 1SBDA 2BGCA 3WX5A 2Y6HA 5IVBA 3AMPA 1CQ9A 3I2KA 2P3JA 4YVWC 5DG1A 4A6SA 1GLHA 4TLGA 1GV9A 4H2AA 2FDFA 4CDWC 2P5BA 3FUQA 4YZ1A 5CFCA 3EYPA 2ARCA 2GMMA 2ZKNA 1UZYA 2W1SA 4Q4V3 4Y22A 1FI2A 1HRI3 1FMD3 4D6QA 1PVC2 2QQOA 2VMFA 5EV7A 1JHNA 4QB6A 3ZFFC 4TZDA 4LHLA 4MV2A 4MGQA 3TRSB 4ATFA 4JRLA 4XJWA 3I3BA 4J1WA 4GD4A 5BNOB 2JDYA 4YVWB 3NV2A 4D0QA 1AF9A 2RV9A 3ACLA 4Y1XA 4LE3A 1PO11 2V72A 2Q0AA 1JHJA 2WT2A 1WZXA 3DPRC 3H42B 2YYOA 4LJHA 4YW7A 3AKQA 3SISA 1R082 1UZVA 5EFUA 2D40A 4WZCA 4D69A 5B4XA 3VBRB 2VZVA 1XSQA 2QZ3A 4EN6B 1PGW1 1YFUA 1D4M2 2C24A 2CAVA 5LASA 1OI6A 4E4DX 4I30A 1W6NA 4META 4CE8A 2YDEA 4LKSA 4PIZA 2VVEA 3R6SA 1SPPA 2BU9A 3GCXA 3RZZA 1W39A 3ZYGA 5ABJA 5C3SA 2OUHA 5FO9B 1I1EA 1CX1A 1RUJ3 4IV1B 1JZ2A 5IVVA 2D6NA 4F3JA 4XXAA 1NQJA 3O1VA 4JDOA 2WWUA 2VQTA 4QB2A 1S55A 2AZ5A 3HD8B 4RHV2 5F39A 4MGSA 2DCJA 2HYKA 4F83A 2R1BA 4TTGA 1CR7A 1HQNA 1GR3A 2A3YA 3D4KA 4DMIA 1JZ3A 1Y9MA 2RS53 3WNNA 1W6NB 1QU0A 1Q8OA 1TME3 2Z5WA 2KD7A 4GKXA 5I91A 2E7QA 3GZAA 5LWBA 2X29A 5E6HA 3OUIA 1IPKA 4PDWC 3L2HA 2KXLA 2A6YA 1QXRA 4JAAA 3WQ7A 1AR91 1H6YA 5A80A 4XQDA 3ZYRA 5JLVA 1E5RA 2DCYA 4XQWA 5L19A 1UQXA 3IIAA 3M3EA 1LHWA 5GLUA 4NE9A 4XF3A 2A70A 2YU1A 1GQGA 4NPMA 4PLMA 1H30A 5F3CA 2Y60A 4Z2WA 5IVJA 1VMJA 4IUGA 2WAOA 4HPKB 1OFSA 3S5AA 2BZDA 2RR11 3WCRA 3QH6A 3TWIA 1X82A 5FP4A 2XJVA 5J1XA 1K5MB 5CADA 4Z92B 5CG9A 1K5JA 5CEHA 4WM7A 1LU1A 3OEBA 1H8VA 1MR5A 4BLJA 1AR62 2ZOEB 2XXZA 5J48A 4AGRA 3EQEA 3NSTA 4XFHA 3OOXA 3O14A 4AGVA 5J7MA 1Y9QA 4QGMA 5JZGB 4DEVA 3PTRB 4EE2A 3GJBA 3O1TA 1BEV3 1FNZA 2CY6A 1W2AX 5J98B 5I0DA 1NCRC 3VLBB 1ULEA 3DYPA 3FLPA 2QCSB 2D3RA 5CBLA 4ISRA 1KJLA 4C91A 2E33A 3WNPA 5C9AC 4CXXA 3QCWA 1LGNA 5L73A 2BV4A 1A8MA 4YYOA 1C4RA 4L9BA 4NRPA 4D7TA 3V64A 2EIEA 5K7PA 2DBNA 1S0JA 4CEWA 1U0AA 3VD7A 4IEUA 4E4SA 4RGGA 2UYAA 3AYCA 4OHXA 1GBGA 3MW3A 4GB31 3NJZA 3GGLA 2ZAAA 5FLIA 2YC2A 4YPJA 3WEZA 3K2OA 3OGVA 1B35B 4B8EA 1N1TA 2Y6GA 1N3OA 4GXLA 1HN0A 3S7EA 2W1WA 4CDQC 2ET7A 1C8M1 2D6OX 4WVMA 2OPKA 4LQRA 4RFRB 2I74A 2VW0A 3N7MA 3JB4C 1TMF1 1XPWA 4CEWB 1VAKA 4XBLA 3N9LA 1PGW2 3HN3A 2J1VA 3C7OA 3MV11 4B1LA 2WINB 4J25A 3WNXA 2ZGRA 1UPIA 3USUB 4AFDA 3NQHA 2JECA 3U4SA 2X5IB 2ZACA 5FZGA 5LCWL 5FJHA 4AR2A 1W9TA 4FPJA 1QGLA 5JCTA 5FZ6A 5CB7A 2VZ1A 3ELNA 4HKOA 1UY0A 4FOWA 2GAUA 1IG0A 4GMP0 3WG1A 4ATEA 3VBFA 2GNDA 1C8M2 1SLBA 1O6UA 1E5IA 1OF3A 1LODA 2BUKA 1IPJA 2VZOA 4FPHA 1CAXA 4COVA 2W95A 2ARXA 4DXRA 1FOD1 1LGCA 3ZDVA 1OPOA 4NPLA 2EICA 1GOFA 3AP6A 3MICA 3MW2A 2V73A 1SEFA 4FFGA 4XFIA 2PHXA 4MXWA 1ALYA 1WLTA 4H55A 5JSRA 1PVC3 4QKNA 1BLZA 4LEJA 3ETQA 4LKDA 4N53A 2Y34A 4UAPA 1D4M3 2N7GA 5A7PA 1GANA 4RR3A 1V0AA 4UFMA 3BCWA 5LA2A 3GF6A 2RDQA 3SCFA 1XQNA 4TSVA 4BYYA 3LE0A 1AXYA 3I2JA 1H8TC 4YW1A 1KDKA 4JQTA 2VXRA 1OLQA 4OI4A 3RG0A 4AEKA 2UWCA 3HN1A 4WM8A 4QX5A 3J8F1 1BHGA 2Z4FA 2EIGA 5LZ6A 2P17A 2LTNA 5A33A 2GN7A 2BEOA 3RZHA 3LPFA 1G9FA 2FBEA 1COV1 1W9FA 1CGPA 3WW1A 2VVDA 5E8AA 1VAVA 5AC92 4LHNA 2HJIA 3EHKA 2GMEA 4FOYA 4LKFA 2YMZA 1S0GA 3W21A 1ZRDA 3LEIA 3T2OA 2GC0A 2ATFA 3KLSA 4Y1VA 1PIV3 1IS3A 3U10A 3WP3A 4A6OA 5F1RA 1BEV2 2W0XA 2P4EA 1UNBA 4BH9A 4Z1VA 1MS3A 1BK1A 4FFHA 1RIRA 4C1WA 5C6CA 3OUHA 2VMCA 2BBAA 1APNA 2DU0A 5T5PA 4EN9B 3AZWA 3K51A 2CWSA 2YB7A 4KH9A 4FCAA 2YBKA 3RSJA 3J8F2 3RZGA 3O0XA 4E9KA 4ES9A 1FPN2 3N4MA 3RZJA 3CJIA 3PURA 4IV1C 5BNPA 1EUUA 2XJSA 5FBZA 4BA6A 1FMD1 2WNUB 4WVVA 1EAH1 3WVJA 4I2OA 1QDCA 1JMUB 2RS12 4IE4A 2WLPA 5LB6A 1W2NA 1AR82 1H0BA 1YXWA 4QT6A 2BBVA 1X36A 3ILRA 1ZNPA 3D0SA 4XIKA 3ZFEC 5EHDA 5KBFA 4BQWA 1V00A 1O3QA 3EMRA 1UY4A 4Q1RA 1BBT2 1JTZX 3HT2A 4OZOA 2WT1A 3T4HB 4L92A 2QZ2A 1BK0A 2RS13 4JGZB 1KGYA 4Q0UA 3A7QA 1RUI2 1P8JA 4CDWB 2IXIA 1O8SA 4R4XA 4HXCA 1DQ2A 1ENQA 1JUIA 2WS93 4LK6A 4QXBA 5DDJ2 2D5FA 1NA1C 2FCTA 2QVSB 3K4AA 2UYBA 1Y7BA 3O1SA 1QJX1 2AENA 3OUJA 4R9BA 1H4GA 3I2GA 2JDZA 3KGZA 5CKNA 1U12A 3V0BB 4K8FA 3UKTA 3VKLA 3P6BA 2VGDA 3DPRA 3HNMA 3IPVB 3X29B 1DYOA 1H8TB 2GSYA 2ARAA 1N1VA 4M3CB 4OZXA 5GKAC 4NRMA 4LXLA 4YW3A 1SDWA 5GZFA 2NN8A 5KHKA 4AL9A 1BJQA 1FYUA 3M4FA 1RUH3 1BVP1 2XVGA 4HBNA 4K6BA 3NAPB 4K7JA 4FQZA 3PIJA 1RUH2 3NKTA 4QQOA 1BBT1 2W5FA 1Z7S1 3E5UA 4LHSA 4LOSA 2RS51 5IUQA 5L9RA 4CCOA 1RGSA 1ZRIA 3POYA 2GDFA 3T0AA 3WT3A 3MI8A 4GB32 3TEXA 1KFUL 2LRPA 4OI0A 3F2ZA 3WG2A 4XJ9A 5C9AB 3I7DA 2JX9A 4QQHA 3VV1A 1D0GA 4Q4Y3 3UYJA 2P3KA 4LT5A 4BLIA 1JOPA 1SPPB 3KV5A 3J7LA 1WUVA 5FQ0B 1PGL1 4I0BA 3MDPA 3NAPA 1W0PA 2XMLA 2D7FA 1YWKA 1VAMA 3I2FA 5FZKA 1LHVA 2QUOA 1CAUB 1KDMA 1NAEA 1B35A 2ZGLA 3RQ0A 4L97A 3P5BA 3PVEA 3WQ1A 1RUC3 1J58A 3NL1A 5FY7A 4M00A 4IE0A 4CDQB 4Q29A 4BQ4A 1J59A 1SCRA 2XJTA 4XDOA 1VPHA 4CEYA 5AC93 2JDNA 4LTAA 4O61A 5J96B 4YNIA 2L9LA 1WLDA 3RNSA 2C9KA 2W47A 2JG8B 2D5HA 1DQ4A 4R9AA 3JD71 5BYNA 5FQ0A 3ZXLA 4RR3B 1O3SA 3W58A 1BCXA 1MVQA 2J1UA 3HPNA 1RVF1 4YM0A 3WV6A 4D8MA 5FYHA 2GH8A 4UF0B 4YZ4A 2FDHA 4P02B 4KGQA 3RI8A 5EXOA 4JQRA 1ULPA 3DV8A 1J1TA 1S0IA 3ZLIA 4ZU4A 5IFPA 3ZM8A 4HONA 2W68A 3AM2A 2B9VA 2WA4A 3VBFB 2WNOA 1AYN3 5JMOA 1TNRA 2BERA 2JDAA 1DHKB 1ND2B 3MLKA 1POV3 1HLCA 2D3PA 4GULA 4Z2AA 2VH9A 5JVVA 4HMZA 4IEWA 5C33A 1HJFA 3MPBA 3HQUA 2HBTA 4PIXA 1BMV2 2VZSA 4HZFA 5A32B 1PX3A 1SQ4A 2XWJB 2MEV3 1L7LA 3OD0A 1W6MA 4BMBA 3GBGA 3KB5A 3I3MA 4RD7A 2KM2A 2IXJA 4KG0A 1IKQA 1RUG1 2RS31 3ZN5A 3LF7A 2VZUA 2YZ4A 3ILNA 5FZFA 3VBFC 4BZ4A 1ZRCA 3LOBA 4QXHA 2VECA 2W1UA 3ZIWA 3R05A 5AVPA 5DDJ1 3IDAA 1XB9A 1H2KA 3U07A 3UKVA 4AVVA 2DU1A 4E4ZA 2EXKA 3MIDA 4FI9A 1AL21 4MX3A 3NW4A 3OBAA 2B8MA 2F17A 1WCSA 5DZEA
chains in the Genus database with same CATH topology
1SLIA 1FV2A 2A3XA 1RHI1 1S2BA 2XLGA 4TLFA 1W2UA 3HMYA 4K3UA 4QXKA 4FPYA 1E57A 2WA3A 4E2GA 3UL2A 1ZZ6A 1PVC1 4B3NA 2H6CA 2QDNA 4N43C 4BWOA 1AR61 1ENRA 2WS92 1F5FA 3IT8A 3ZXAC 4N9HA 4NHKA 1BKZA 1RUI3 1SMVA 1RUF2 3IDCB 1WLWA 1IKPA 3ST7A 2HWD3 1O91A 3FZ3A 3FE5A 1DIWA 5BNQA 4JV4A 4WV8A 4YSFA 1C1FA 5DUUA 1C5IA 5FDBA 1RHI2 2EA7A 4QHBA 4B7KA 4HSJA 1NXD1 1ZBE3 2DFCA 3H1YA 5JPMB 1PO23 4RL7A 2PTMA 1W6PB 3MZHA 4QPIB 1U5YA 1VJ2A 1OOPC 3E97A 2BWAA 1NG0A 1PVXA 1DGRN 1X8MA 2W39A 3O7OA 3ZFEB 5KWRA 2P34A 2GH2A 3AMQA 4WVZA 3IBMA 1RUF1 4Q0QA 2VPVA 1LOGA 1CESA 2OA2A 4LBNA 3VZJA 1UKGA 3D82A 4R52A 3VHOA 4FXGB 4FAHA 4Q27A 2WNUA 5I8SA 1ZYBA 4KWLA 4ASLA 3ZFEA 3LCPA 1UKRA 2R072 5FREA 4Y26A 1D2SA 1RUG2 3KMHA 3VBHA 3ZYIB 3ZMNA 2JG9A 5CFDC 2ILMA 4C0HA 4YGBA 3GBFA 4JGYC 1G8WA 5HCBA 2K0GA 4ONUA 5J3UA 1V6OA 5FMOS 1QF3A 4Q4W1 1NYWA 2CYFA 3R4UA 4WM7B 2UU8A 4YGCA 3C2UA 3I2DA 1LULA 1Y3TA 3RI9A 4CDXB 4Q26A 4AE2A 4HVQA 4RS5C 1R081 1X33A 3I8TA 1VB2A 4W6XA 3FLTA 1B09A 4MVTA 3MEPA 2BYVE 5KC6A 4KWJA 3B3QE 4YM2A 1WBLA 4HVRA 4IESA 3FUOA 1U5ZA 1KJRA 2DVBA 1QJY1 1KITA 1ENSA 2XUMA 4XF9A 2ZAHA 3AP9A 3SH4A 2LM3A 2PAMA 2PHFA 2E9QA 2NM1A 3VL9A 1MZEA 3JBG3 2DCKA 3RMXA 2E6VA 1RMU1 5A32A 3QACA 4XXPA 1R1ZA 1QJX2 1WW5A 5EJ3A 3IDBB 3WUCA 1BBT3 4JGZC 4F7ZA 3UK9A 4UBGA 2MPFA 2DWRA 2HWC1 2IFWA 1WA4A 1EV13 1IS5A 3WG4A 2E7TA 4CDWA 2VOWA 2BW8A 1AR92 2DVAA 1SCSA 4C0BA 2OVUA 3CJIC 4HN1A 1W6OB 1K5MC 4DINB 1DFQA 4YM3A 3ZSLA 3FFZA 2A3WA 1LR5A 3H0OA 3VBUB 4Y1ZA 2EF6A 2DCTA 4Q1PA 1H2LA 1MS5A 4LUKA 4Q0VA 1X50A 1PO12 3RMYA 5T5LA 3RS6A 5BNNA 4RQPB 5LK7B 1UAIA 4PLNA 3VKFC 2HWB1 1ZBE2 1AR81 3JD73 3O12A 3BODA 5K9YA 1AR72 4OHVA 3AZXA 2B45X 1RJ8A 4NN0A 3VZMA 3J4UH 4PBPA 1CAWB 5TSWA 3VHNA 1LHNA 2JEMA 4HT1T 3MGUA 1XNDA 5A3MA 4AVTA 5FOBB 3IKWA 4IXLA 1LRHA 1SLCA 1C8M3 2O0OA 2F6BA 1VBD1 1CAWA 1N3QA 1RUJ1 1VBE3 4AHXA 3WQ0A 3UJQA 4AHWA 1REFA 4AQTA 3E5XA 2JD4A 4COYA 4XHBA 5D8AA 4KBBA 1CPNA 2JKBA 1F2NA 3KM5A 4ASMB 1G9CA 2XGXA 1VBB3 4PF5A 2MNGA 3B93A 4GH4B 3BOWA 1R093 5BV6A 4HKWA 4Q4V1 3OBRA 3URFA 1TME1 2EALA 2P2KA 2WZR2 4YVSA 4QPGB 5KXDA 1QXPA 4XFBA 1Q8VA 1S2KA 1H1MA 2ZGOA 1A3KA 1S0FA 2R1DA 2R061 5HBAA 1GZWA 4KL1A 4RHV3 2BNMA 1FNYA 3M3QA 1H9WA 2ZTNA 4XFFA 4P9YA 4M01A 4SBVA 1F9KA 2JENA 4E2SA 2R073 3VBHC 4RA0A 3VBOC 4GMP1 3FBYA 3PVOA 5I0UA 2PAKA 5FCCA 1C57A 1YLLA 1KS4A 3WLUA 3K48A 2QJVA 1UN1A 4HETA 5CFCC 2YHJA 4GIQA 2VOKA 5JIUA 2JICA 1VLNA 1O3TA 2IFRA 3D5OA 4AG4A 4BHPA 1ZBE1 2HWB2 2PHUA 3THTA 4Y20B 2WFPA 2ZJCA 4P9LA 4XILA 4I3GA 4DRRA 2LUWA 3S6PA 1AR93 1Q8PA 3TNPB 4LULA 1O7FA 4AF9A 2XHKA 1UF2C 3V0AA 3NVCA 4EN7B 1LENA 3ZXGA 1S0CA 3HR9A 3ZVXA 3AFKA 3POWA 2DTWA 1QDOA 4Y1UA 4LLOA 4K21A 4AI1A 4AHYA 4BIFA 3P3NA 5ACA2 3LWCA 1UPSA 2YUEA 4XMIA 3WW2A 4AI3A 1VALA 5I93A 5BY5A 2XVLA 2TUNA 1EY2A 5JIAA 5C4WC 2XJRA 2E63A 1CJDA 1YFYA 2HWE1 5BNNB 4GQ7A 4QPIA 5T5JA 3GZUC 3AB0A 1MEC1 3JCIA 4FSJA 2XJUA 1UU5A 2HKXA 4N53C 3LOIA 1NE4A 4CDXA 2EXIA 3ES1A 2YV8A 2O8QA 1OPMA 5KHHA 3VBSC 1JH5A 2GNMA 3ECQA 5EWSA 4CEYB 1O4ZA 3ILFA 1OFNA 2DVGA 3NV1A 5JR7B 3DGTA 3C3VA 2PYTA 3WDVA 2WS91 4L2NA 1TQ5A 3DL3A 4KWKA 2ZX3A 4Q4Y2 2HWF1 4NPRA 2C0ZA 1ZA4A 4BMEA 1OA3A 3ZSMA 4LO7A 2WLQA 5H9PA 4CYDA 5E16A 4X8PA 1HX6A 5IK4A 1HV0A 5T3NA 3IWZA 3JBG1 4MSVA 5CAZA 1XYNA 4EN0A 4RQPC 5JAXA 4AEDA 3DF0A 2UWAA 4OHWA 5CIRA 1W6QB 4YZ3A 3CL1A 1PHMA 5DUWA 1Q8SA 4DPNA 1BMV1 4FPCA 1EV11 5DZFA 4DFSA 1JOJA 1AVBA 1DBNA 3INAA 1AZDA 4O9GA 5F6KA 4FT8A 3DKWA 5H9RA 4IV3B 4QM8A 4B29A 2XL9A 1RUJ2 3N7JA 4Y1YA 2ES3A 1ZVFA 1LOFC 3BU7A 2VVFA 3B02A 2WZR3 3OPZA 4FTBA 5JZGA 3ROUA 1D4M1 5LEKA 1LB2A 3NV3A 1ULFA 1NA1B 1HXS3 2DFBA 3WD5A 3O0WA 1AX0A 1N1SA 3AP4A 4JDMA 4A2UA 1H2NA 4FTSA 3UV9A 3WW3A 5D8AB 1EV12 2D93A 3GHNA 5T52A 2EAKA 3CO2A 1ZX5A 2HEYF 3APBA 1PK6C 3J8F3 1COV2 3T2TA 1W6OA 2HWE2 2R30A 1EPWA 1DG6A 3KZ4C 3ZPYA 2P3IA 5HI0A 1G9BA 2MHFA 3HAGA 4Z82A 5JWPA 2CNAA 1I9RA 1HQLA 3WG3A 3VBRA 1LGBA 1CAVA 3HIFA 4YFWA 4BM8A 1PIV1 4Y22B 1N47A 1BVVA 1VBE1 4CTEA 1UD1A 4M0HA 5ABJB 4Z8BA 1WW4A 1AR73 2HEVF 3ZMOA 3WDTA 1PNFA 1NLRA 2WZPP 3D0JA 2Q1MA 1GNZA 1W6PA 3VBOB 1S1AA 3FX3A 1UX6A 5AVAA 4YARA 3H9AA 5DDJ3 1R091 1CIWA 2DVFA 3AKSA 1GZWB 4K1ZA 3HWJA 4UXAA 4YG0A 4OHZA 3HT1A 1C8NA 4BQ1A 1RHI3 2ARBA 2ETEA 2VW2A 1IZ3A 2W08A 1H2MA 2E51A 2VW1A 5LRRA 1DGRA 4IV1A 5BNPC 1ZBA3 1VBE2 2Y38A 2DUPA 4IEZA 2WIIB 4AGGA 1SLLA 1VBC1 3AP5A 4R8HA 4X8NA 5KHGA 2PQQA 5L7OB 1QJZA 3LKJA 3KQRA 1YI7A 2R043 2R071 4GH4C 5ACA1 1V9U2 4Q8KA 4LUMA 1RVF2 3B00A 2QFEA 2Z42A 3H1WA 5AC91 3VBSB 2VMGA 2Y26A 1D2QA 3LA3A 3O5SA 4FQ4A 1H4HA 5FTTC 2Q4SA 4G4FA 4RQPA 5JSOA 1FATA 1A78A 2ZHKA 5KHJA 2A5ZA 4J1XA 3RRDA 1N3PA 1KRIA 1O3RA 5KXCA 1M4WA 3SNMA 1RUC2 1MEC2 2JE9A 1Z7S2 3FFQA 4HLTA 1ULDA 5I0RA 2K2SA 1Z7S3 3WHTA 3MIEA 4LR4A 5FRAA 1MS9A 3VHPA 1PZ9A 3JUUA 1HRV3 1PZ8A 2AREA 1AJOA 2VUJA 4YW2A 3WDUA 1C5HA 4N90A 4XDQA 3R4DB 4LA3A 2NZ9A 3QD6A 2XJQA 2HWC2 4XFAA 3KT4A 5FOJB 5I0SA 5C8WA 2MEV1 4AFAA 4LO5B 4EWEA 3WHUA 1CPMA 4JC1A 1MACA 3B9IA 1SACA 3RDIA 5IK7A 4AVCA 1PIV2 3SH3A 1MS8A 3ZIXA 4IV3A 2B5HA 1SBFA 4K20A 1RJ7A 4N7IA 1TME2 2RM22 1ASJ1 2H0VA 2VOVA 4XW3A 4CDXC 3WW4A 2O8OA 2BWCA 2YGMA 3ME2A 3MYXA 4G3YC 4XMAA 5SV8A 4AVBA 3GNEA 3AKTA 3VBRC 1A8DA 4HPKA 3U4XA 3Q9OA 4PBOA 2BVBA 3OD4A 4QD2A 4RR3C 4CDUA 1G7YA 1ENXA 4N7UA 2WNEA 4NOTA 5IK5A 4DXZA 4LO4B 3L2YA 1HXS2 3AK0A 3ZDSA 3USUA 3TOJA 4MGKE 4PCRA 1AYN1 2ZS6B 1VRH3 1J3RA 3DPRB 1WD4A 1JW6A 2BVVA 2HWD1 2RR12 2WQ4A 4Q0PA 3MFAA 3CNAA 2D6LX 1NCQC 3M7AA 1LOAA 3WP5A 1ZRFA 4EWDA 2NPIA 1Q56A 3ZX7A 2ZA9A 4NR1A 1CVNA 1VBD2 2ZGKA 3LA7A 2WNVC 1CAXB 1RUD1 4IEOA 1NA1A 3N3HA 2ZZQA 2IXLA 4LBKA 4OLLA 2YXSA 2H0BA 4WVMB 4FTEA 5GZEA 1V9U3 2KA3A 1RITA 1CD3G 1DU3D 1N1YA 5FPZA 1XXNA 4HL0A 2VG9A 1M06G 1HDKA 2GC3A 1XU1A 3MFCA 3WP4A 5JMCA 3AJYA 1SLAA 5DXDA 2ZPXA 3USSA 3G7DA 4GH4A 3SH5A 4Q0SA 4MGZE 5GZGA 4FPEA 3TN92 3AMMA 1MVEA 4AQ2A 1GKBA 4PDWA 3THPA 1IGOA 5FAXA 5C8CB 2WZR1 2R6QA 3KCXA 4QPGA 3RPQA 5E89A 3E6CC 3AXDA 4GKYA 3ZSKA 2XG3A 1QMJA 3EXUA 4M0NA 1LOCA 2CGPA 3DN7A 1J3QA 1GZCA 1ND3C 3GHMA 2XLFA 1OOPA 1NOVA 2ZGQA 4H3WA 3A0NA 1UZZA 2RM21 4WBBA 4EJRA 3P3PA 4HVOA 5GLWA 4XHXA 5I8TA 2H6BA 1YI9A 2CAUA 3O0VA 3TN91 1R083 5DUXA 1ASJ2 1MQTC 2W52A 1POV0 5J36A 1ZZ7A 3FBMA 2PELA 5JOWA 2XB6C 2DUOA 5J37A 1JYIA 4P9XA 1PZ7A 4DOUA 2YGLA 4MH0E 1Y43B 3VKNA 1HRV2 1QOTA 3OJBA 3R4SA 3RWNA 3ZSEA 3VBOA 4PQ9A 5A33B 2A6WA 1R1A1 3NV4A 4UW6A 2FQPA 1VBB1 1UIJA 5A3LA 4S2HA 1QOSA 1XNCA 3I59A 4DZGA 2JG8A 4J6GA 1AYN2 3VDDC 1LESA 2ZCWA 4AEDB 1ZRRA 1K5MA 3GZTB 3HBZA 2BNOA 2HWC3 2ZX2A 4CRQA 3LSEA 3MIFA 4U36A 2R063 1QH7A 2ZABA 4RHV1 3OYWA 3ZN4A 1LCLA 1G9DA 1ZBA1 3ZFGA 4URTA 2HEWF 2C5DA 1VBC3 1DDLA 4NO4A 3RJ2X 2Z69A 1LOEA 1URXA 1ND2A 1QH6A 2VNGA 5C8CC 4XBNA 1QQP3 2ZBJA 4OI2A 5CFDB 4K9SA 1I5ZA 1WLCA 1V6JA 2ZMKA 4JCKA 1RUE2 4DQAA 1CONA 4COWA 3N7LA 2Z2SB 5F6LB 1NY71 1RL3A 3RYRA 1QJY3 4CEWC 2HWB3 2JXAA 1AR83 4XEZA 4M3CF 2IXHA 1GFF2 2EXHA 2VNOA 1ZM1A 4XF4A 2V09A 4AFMA 4JGZA 1RMU3 1O5UA 1ULCA 5JSPA 1ZREA 3N35A 1KD7A 1QY4A 3N36A 3M70A 4PJYA 4YG6A 2YY1A 3UKNA 1QNYA 5I0TA 2AH2A 1A6CA 4RFT0 1OSGA 3IPVA 4ZU5A 5LEJA 2A7AA 3POSA 4OHYA 4RS5A 1KXGA 4YG3A 3VGIA 1S0BA 1QJU1 1LHUA 4XF0A 4YW5A 2B42B 3J26N 4XOGA 2IXKA 2A6XA 2PLV1 3KCYA 3PJYA 5EZWA 5KXBA 3LAGA 1AXZA 4WZFA 5JOYA 3SITA 3EO6A 3NAPC 3H3UA 1DGWX 1TMF2 3H3ZA 1U5XA 3MF6A 1B35C 4XJAA 2Q8OA 1VBB2 1OQ1A 2UWBA 3ZN6B 1DYPA 3FWEA 5K8SA 2LALA 1AYM1 1QNWA 4QQ2A 4LBQB 5BXXA 1O5LA 3OY8B 4IEXA 2WNUC 1QHDA 3PTYA 3E5QA 1JN2P 1YIPA 1NCRA 4XPVA 1WD3A 2A75A 1ND3A 2DUQA 4RSUA 2AGSA 3TB0A 1EPZA 2I45A 4NHMA 3ES4A 1AL0G 1W6QA 3M3OA 1LOFA 2BNNA 1PNGA 2PHDA 5GJ6A 4IEYA 4GWNA 4XZPA 2FMDA 1V70A 2FZ1A 4XTMA 3TAYA 2WWSA 1H9PA 4NVPA 3L9JT 1OLRA 2GC2A 2VULA 4X6QB 2XJPA 2R32A 1CX4A 1OA4A 1XNKA 4DB5A 2BQPA 1UU6A 3JZVA 3BIWE 4XFCA 2NMNA 4FOQA 2Q1ZB 2JG9B 4LE4A 5F9TA 4QQLA 2ZKLA 3U11A 3B5LB 2GN3A 4IV3C 3ATGA 3PHMA 4N9IA 4YVSB 4JTNA 4V1PA 2A6VA 2VU9A 2DURA 3ALQA 2WFF3 1BZWA 2UY9A 2EXJA 3S7IA 3SHRA 4AYUA 1GQHA 2D98A 4I0AA 1V6NA 2YPJA 5GM0A 1R1A2 1RUE3 2OIIA 4GMP3 3VZOA 5D8AC 2A71A 2WSUA 1AJKA 4HK9A 4S2DA 5JZGC 1DZTA 4YVWA 3WP6A 2G4IA 2HWE3 3PJQA 2E7AA 2X5IC 3WOGA 1CAVB 1YHFA 4CP0A 2R0HA 3VBHB 1V6KA 1TE1B 5T5OA 5L7OA 2BTVC 1G6NA 1OHFA 3V0BA 1PO13 2CGOA 4EWAA 3GYDA 3WINE 2BFUL 5ABJC 4MZUA 5E1RA 1AL22 1PMIA 2PHLA 4YGDA 1FMD2 1UU4A 4JDNA 3S0MA 4NWVA 3TN93 1ZBA2 1G9AA 2GZWA 3H7JA 4BCUA 1V6IA 4YGEA 4ZKTB 3A4UA 4AVSA 2ERFA 3H1MA 4I09A 3D8CA 3AMHA 1D4VB 1ULGA 4AVAA 4LLFA 4YRDA 5JPNB 4YFZA 4Y4YA 4EN8B 1OKQA 3KCCA 2D43A 2RHPA 5CA6A 2IXCA 4FPOB 1VBA3 4COUA 3PMEA 3VHRA 4UW3A 1YIFA 5GLTA 1UCXA 1RUD2 2WQZC 5BNPB 3IMNA 3N7KA 1NCQB 5I8YA 2D6KA 4INDA 4AWDA 2OZ6A 4XYXA 1HRI1 1R092 4UBHA 2XBO2 3NKGA 3OYWB 4P14A 1DQ5A 1KQRA 2DV9A 5JOXA 4K1YA 2WKKA 1MEC3 2AYHA 2B46X 1LJ7A 4W65A 1WW6A 2RJKA 2WJSA 2RMU2 3AP7A 3VZKA 5AFEA 5BNNC 4Q8LA 4ZXKA 1IS6A 2DYCA 2RMU3 3LSDA 2RS52 2XPJA 1NXMA 3PLQA 4Q4X2 3MIBA 3W9AA 5DUVA 5B2GB 4KQ7A 4JGYA 2DVDA 1Q5OA 2QKDA 1FPN1 1NCRB 1GYKA 2VQAA 4JVAA 4AEMA 1LKNA 4L99A 2HWF3 1HXS1 3M3IA 1PGSA 1WCDJ 2RJLA 2OUJA 4DNYA 3JBG2 2B7YA 3VKOA 3CLPA 3OGJA 4S2FA 3BPZA 5C4WA 4CP1A 2I07B 1OOPB 4QM9A 3PNAA 1U5IA 1WMFA 2P37A 2R0FA 3ZXFA 5F5QA 2D6PA 4Q4X1 2CV6A 4WM8B 4XE9A 5C9AA 4RS5B 2EVXA 4QGLA 3ZN6A 4PLOA 2BPA2 4W6YA 3SMHA 1YUDA 1KFXL 1S0DA 4U2AA 4B7EA 5JOZA 1QJU3 3CU7A 1AR71 1LTEA 2A6ZA 4LO8A 4EROA 1L3JA 3KGLA 3AX4A 4FVVA 4ZU7A 2ZHLA 3FMGA 4LO6B 1RUNA 4QU2A 3U0ZA 5KHIA 3QBQA 1GZ9A 2QNKA 2ET1A 3I59B 3GALA 4LHKA 1BEV1 4WVWA 2WNVA 4JTOA 3M3CA 4LA2A 5CNAA 2PLV2 3KS7A 2G9GA 1DQ6A 3SLIA 2PHWA 2ZGSA 4LBJA 3QOPA 1VP6A 2AR6A 4N43A 4FOVA 1PGL2 2AUYA 4Y20A 1UIKA 1O4YA 5CG8A 2ZX1A 3QH7A 1RUOA 1JYCA 5K0UA 4HKLA 4D7YA 2VQ0A 3GBWA 5ACA3 1HRI2 2WNVB 2FHRA 4AQSA 2ZX0A 1LU2A 3TBDA 3U07A 5FO7B 1FAYA 1ZZ9A 3AJZA 1PO22 2FMYA 3T1LA 1BYHA 4YLZA 3TYJA 3ZXKA 1OMIA 3JD72 1TMF3 2ZMLA 3MIGA 4Q2FA 4E2QA 3B69A 5FLHA 4BOWA 3KD4A 2X53S 1XRUA 1H8TA 4M3CA 1IOAA 3ZFFA 1YRZA 2NLRA 5CU1A 1HKDA 1GNHA 4HANA 4WM8C 4OULA 1H1AA 1FXZA 1HRV1 3H50A 2WL1A 1I6XA 4TYSA 5HCFA 2O1QA 1MQTA 1SBEA 1X7NA 5FMOL 3OF1A 4B4PA 1FOD3 2TNFA 1EYBA 1OQDA 1ND2C 2WFF1 4IERA 5H9SA 4EV0A 2B39A 3D6EA 4YW4A 5BNOA 3WR0A 2R041 2RS32 2XBO3 4XFGA 4LBOA 3UJOA 1I3HA 2NMOA 5H9QA 3SCGA 1CAUA 1DGWA 1DYKA 5L7OC 1ASJ3 4LNVA 3MLJA 3RJRA 2DF7A 2UURA 3VZLA 2GMPA 1JXNA 1F31A 1Q3EA 3AKPA 4UW5A 1GICA 3OGGA 3WDWA 2YROA 5FFOC 3V65A 4CDQA 2RM23 1MZ6A 4F8AA 1WMEA 1LECA 2ZHNA 4L11A 2WT0A 4QMAA 5C4WB 1COV3 3SXWA 1UMZA 5DZGA