5ABJC

Structure of coxsackievirus a16 in complex with gpp3
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
242
structure length
242
Chain Sequence
GIPTELKPGTNQFLTTDDGVSAPILPGFHPTPPIHIPGEVHNLLEICRVETILEVNNLKTNETTPMQRLCFPVSVQSKTGELCAAFRADPGRDGPWQSTILGQLCRYYTQWSGSLEVTFMFAGSFMATGKMLIAYTPPGGNVPADRITAMLGTHVIWDFGLQSSVTLVVPWISNTHYRAHARAGYFDYYTTGIITIWYQTNYVVPIGAPTTAYIVALAAAQDNFTMKLCKDTEDIEQTANIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure Elucidation of Coxsackievirus A16 in Complex with Gpp3 Informs a Systematic Review of Highly Potent Capsid Binders to Enteroviruses.
pubmed doi rcsb
source organism Coxsackievirus a16
molecule tags Virus
molecule keywords VP1
total genus 44
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2015-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5abjC00
1FMD1 1QJU1 2HWF3 4QPGA 4YVSB 3S6PA 5C8CA 1PGL2 1BEV3 1TME1 3VBRA 2WFF3 4RR3C 2XPJA 4AEDC 2PLV1 1RUG1 2RR11 5L7OB 4RS5C 2WS92 1ASJ2 3VBUC 2MEV1 1PVC1 5DDJ3 1RMU2 1PIV3 4CEYB 1B35B 2WZR2 4YVSC 1QJZA 5C4WA 4FTBA 2HWB2 2GSYA 1AR82 4CDWA 4AEDA 1NCRC 3HAGA 2RS13 4JGZA 1BBT1 4Q4Y1 1R091 3NAPC 1Z7S2 4CDUC 1AR81 3VBOC 5BNNB 2BFUS 2WWSA 1POV1 3IDEA 1FPN3 1VBB3 1RMU1 1NOVA 4IV1C 2R073 4Q4V1 1PGW1 1BBT2 3VBRC 4GB32 5CFDB 5JZGC 2PLV2 2RR12 4JGZC 3NAPA 5AC93 1RUC2 1VRH1 1TMF3 2ZTNA 1RMU3 2WS91 4JGZB 1RUC3 1RUG2 4AEDB 4CDWB 1RUF1 3ZFGA 4NWWA 1AR83 3DPRC 1HXS3 4N53B 2FZ2A 1EAH1 4N43B 1A6CA 1QJX2 4QPIC 2HWC2 1QJU2 1FMD2 1RVF2 4GMP0 1VBC3 1POV0 1TME3 3VBHA 3J8F1 1VB4A 2ZAHA 3FBMA 1IHMA 1ZBA1 4CDQA 5C9AC 1AL23 4Y5Z0 4Q4X2 1VB2A 1R092 4Q4Y2 3JD73 3JB8A 4CDXA 1D4M2 1RVF3 1AL21 1NCRB 3TN92 4RHV3 1MQTB 5ABJA 3CJIB 2X5IC 4CEWA 2RS33 3VBHB 4IV3A 2RS53 4JGYC 1AYM2 2VQ0A 4PDWC 4YVWC 3CJIC 4QPGC 3JB4C 3VBSC 4RQPB 2RS52 1D4M3 4IV1A 3VDDA 1VBE2 1EV13 2Y26A 1DDLA 1D4M1 2R072 2HWE1 2PLV3 2RR13 1QJY1 4PDWA 1AR63 4YVWA 1QQP3 1RUI1 1F2NA 1QJY3 1RB8G 1HRI2 1H8TC 2RS31 5K0UC 4CEYA 4EJRA 5DDJ1 2MEV3 1HQNA 2R063 1AYN3 1OOPB 1AR72 1OHFA 1RUD2 1RVF1 2HWE2 1RUG3 5A33A 1VBE1 1HX6A 4BCUA 3VBUA 2FZ1A 4JGYA 3JBG3 5FOJB 1NA1B 1HRV1 4QPGB 1VBD3 3VBFB 1VRH2 4CDQB 1F8VA 1AR73 1RUD3 1AUYA 2XBO3 5L7OC 1NY72 1NCQA 5D8AA 3VBSB 4WM8C 1VBD2 1C8M2 1ZBA3 1PVC3 2RMU2 1WCDJ 4CDQC 1Z7S3 4Q4X1 2X5IB 1MQTC 2XBO2 1ND3B 1AR92 4Z92B 1VRH3 4IV3C 5FMOS 1AR61 3VBRB 3VDDB 1VBB2 4CDUB 5C8CB 1ND3A 2R062 2BBVA 3ZXAC 2HWF1 1Z7S1 3ZFEB 1RUF3 2HWD2 1NG0A 1QJX1 4WM7B 2QQPA 3DPRA 5DDJ2 4CEWB 2HWB1 1NCQB 5D8AB 3VBSA 2WS93 5CFCC 3ZFEC 1HRI1 1RUJ1 2HWB3 1X36A 1AYN1 1FOD3 1POV3 1RUE2 5CFDA 1RHI3 1TMF2 4CDWC 3J8F2 1AL0G 4RQPC 3ZFFC 4Q4Y3 5LK7B 5ACA2 1QQP2 1NA1A 3JBG1 4CDUA 4FSJA 4JGYB 1RUI3 4QPIA 5J96B 5BNNA 5A33B 1BMV1 1PGL1 1RUH1 3M8LA 4GH4A 2BUKA 3VBHC 1RUC1 4RS5A 1PO22 2IZWA 1B35A 1PO12 3VBOB 5BNNC 2HWD1 5AC91 4Q4V2 5C8CC 1H8TB 1HRV3 5BNOB 4Y4YA 3ZFGC 1BEV2 4SBVA 5C9AB 4QPIB 1PO21 1AR62 1ASJ3 1HRI3 5BNOC 2XBO1 1VAKA 1PVC2 3NAPB 1K5MB 1OOPA 1COV1 1RUH2 1ND2C 4WM8B 1PO11 1MEC3 4IV3B 1R1A1 1R081 1VBD1 2BPA2 4LLFA 3CJIA 1X33A 1MQTA 1FMD3 1R1A3 2R042 1RUF2 1TME2 2HWD3 4GMP1 5C4WC 1QQP1 3JBG2 5ACA1 2WZR3 4CDXB 5BNOA 4Q4W3 1ASJ1 1GFF2 1EAH3 1RUE1 1BMV2 3VBOA 1CD3G 4CDXC 1ND2A 3TN93 1K5MC 1RUJ2 5C4WB 4IV1B 3VBFC 1E57A 1NCQC 1R082 1BBT3 5D8AC 3ZFFB 4Q4W2 2X5IA 4CEWC 2R043 5K0UA 1VBA2 4RR3A 1AR71 1COV2 1RUD1 5ACA3 2WFF1 1C8M3 5AC92 2WLPA 5K0UB 1AYN2 2HWE3 2RM22 1SMVA 4N53A 5GKAC 1EV11 1MEC1 1W39A 4GB33 1OOPC 1AR91 1RUI2 2RS12 4WM7C 3VBFA 1COV3 4YVSA 1QJY2 1VBE3 1CJDA 4NWVA 2HWF2 4GH4C 1HXS2 1PO23 2R061 4GMP3 1NY71 2BFUL 4RHV1 1PO13 4CEYC 2MEV2 3DPRB 1FOD1 1K5MA 3ZFEA 3ZFFA 4N43A 4Q4X3 5JZGB 1PIV1 3JD72 5A32A 1V9U1 3TN91 5C9AA 4RFT0 5J98B 1RUH3 1AL22 5CFCB 5CFCA 2RM23 2TBVA 1TMF1 1OPOA 1FPN2 1ZBA2 5BNPA 5JZGA 4RQPA 1QJU3 1AYM3 2DF7A 1RHI2 5ABJC 1V9U3 2R071 4Q4V3 1VBA1 1RUJ3 4Q4W1 1EAH2 1VBB1 1VBA3 1V9U2 3LOBA 1PIV2 2RS51 3VBUB 1NCRA 1ZBE1 5BNPC 1H8TA 1ND3C 1R093 1B35C 4N53C 2RMU1 1ZBE3 1C8M1 4RHV2 1VBC1 2ZZQA 2R041 4RS5B 3JD71 5BNPB 5CFDC 1VBC2 1HXS1 1R1A2 4PDWB 4YVWB 4GH4B 1QJX3 4GB31 2HWC3 4WM7A 4RR3B 1AYM1 1FOD2 1PGW2 1RUE3 5L7OA 1HRV2 2RS11 4FTSA 1ZBE2 3J8F3 1NA1C 1EV12 3ZFGB 5A32B 1ND2B 2RM21 1BEV1 4FTEA 1M06G 2GH8A 1R083 3VDDC 2HWC1 1RHI1 5FMOL 1C8NA 5ABJB 4N43C 1MEC2 2RS32 2WZR1 1FPN1 4WM8A 1AR93 2RMU3 2WFF2
chains in the Genus database with same CATH superfamily
1W8TA 2HWF3 4LR4A 4CRQA 1PGL2 2R1BA 3FHAA 1BEV3 2D97A 1ULPA 1N3PA 5FZMA 5FZFA 2YPDA 3M7AA 2WINB 2WFF3 4IEQA 4RR3C 3SCGA 2XPJA 3RI8A 4IDZA 1RIRA 2QQIA 3LKJA 1G9FA 4OI2A 5A1LA 2PLV1 1WCSA 2RR11 3HN3A 3VHOA 5EYYA 4Y1YA 1UYZA 2QDNA 2Y8KA 3VKLA 1ASJ2 3VBUC 2LTNA 5K8SA 2ZHKA 1PVC1 4XFHA 3K46A 1I5ZA 1XE8A 1YJKA 3HNBM 3DXUA 3R6SA 3W5NA 2WABA 1HV0A 2JG9A 4LO7A 3ZLIA 4AGRA 4CEYB 3U0ZA 5M0TA 4MGZE 2P1BA 2Q8CA 4OUMA 5C4WA 1GNYA 2B9VA 3F2ZA 2WO1A 3ZYRA 4LE4A 2J1AA 2PAKA 2JECA 2HKXA 2LW8A 4CDWA 4IE5A 4XF9A 2AACA 3B7MA 3HAGA 1W9TA 3WF4A 1DGRA 3FHQA 3PDQA 1BBT1 4JRLA 4LOTA 3KM5A 2PAEA 1HDKA 3NKGA 1O5LA 2FDIA 4DUXA 2OZJA 1WMEA 3NWKA 3OEBA 3CMGA 1C3HA 4COUA 3LPFA 2IC1A 4QKFA 3ROUA 3ZDVA 1RTVA 4W8JA 2HBUA 2P2KA 5CZKA 1EP0A 3ETPA 1QXRA 4FFIA 4GKXA 1RMU1 4JV4A 1Y3TA 3S57A 3OJBA 2FDGA 4GXLA 2WT1A 3NNLA 1KD7A 4IV1C 1V6LA 2B4KA 2R073 2VH9A 2DCKA 3RMYA 2VXJA 3EYPA 5FKCA 3RS6A 3VBRC 1HJGA 2VXRA 5JZGC 4GAZA 2DV9A 3RQ0A 2P34A 2N7GA 1PGSA 1W8ZA 2NMNA 1GWMA 3MEPA 5AC93 5CYYA 2XQXA 5EFUA 1EYBA 2NQYA 3FBYA 1RUC2 3H3ZA 1BCXA 3I4IA 1W6PB 4FCAA 4LIUA 4D0QA 4CXYA 2BWCA 1VLNA 4YGBA 2W46A 4LA3A 4JGZB 2Z79A 5F6LB 4IGPA 2JXAA 2WNUC 3PUSA 4MO3M 4Q1PA 3L2YA 3PJQA 1JHNA 4SLIA 4NWWA 5IFPA 2VPVA 1CIYA 3N9PA 4N53B 4IE7A 4ATEA 1W6NB 4N43B 4IUGA 5FP7A 3WP5A 4AFDA 3UGFA 1A6CA 2XJSA 1OFSA 3OUJA 4QPIC 2OZ6A 4GMP0 2CL2A 1VP6A 5IVBA 5LA0A 2DBNA 3KCXA 3BTAA 5KHGA 2KXLA 4L2NA 2Y33A 5IATA 1UIJA 5F3EA 3UK9A 4IE6A 4OVEA 2RHPA 3W58A 5FXXA 5DZGA 1GANA 2XLGA 1ZBA1 3EBRA 3T3YA 3MV11 1NE4A 2WLQA 1R092 4CYDA 2ZS6B 1Y9QA 1ZZ8A 2D7FA 4Q4Y2 3ZO0B 4ARXA 3POEA 4LPLA 2FQPA 3AVSA 3M2MA 4IEOA 1UPSA 4YRDA 5I8SA 4XE9A 2OW4A 1S1AA 5JIAA 2BNOA 3TN92 1HB2A 3WP6A 3OY8B 4JDMA 3V56A 1JODA 3HEIA 3VHNA 4AZZA 2JDUA 1WCKA 4YGEA 4KWUA 3SH3A 3TOJA 3VBHB 4IV3A 2HBTA 5JOXA 5JDBA 2IUWA 3WQ7A 5LEJA 1W6MB 1OKOA 4R9CA 3CJIC 5C7GA 4YZ3A 4PBOA 2QQOA 2C0ZA 2QQVA 3AZXA 4OHVA 1VPHA 3VB9A 5EZWA 5EXOA 4PLOA 2VC9A 4H14A 1ZRDA 5FBJA 4XDPA 2VJXA 1VBE2 2VCBA 5C8WA 1PK6C 1MS0A 4HG6B 4L99A 2J22A 2XJUA 4HETA 2BGOA 2C9KA 4K20A 3WF2A 4CP0A 1UMIA 2WR9A 1U5IA 4R4ZA 4NN0A 1FXZA 3O1PA 1JOJA 4JKMA 4FOWA 4LBNA 4Y5TA 5FLJA 3VD3A 4EQVA 1QJY3 1RB8G 3VDBA 3ZN4A 2VUCA 3J4UH 1D7PM 2RS31 3OUHA 5GZDA 4FPEA 4DXSA 1IS3A 1QXJA 2DVGA 1OFNA 5K0UC 1PM4A 1JZ8A 1LOEA 4XVHA 4BK5A 4XYXA 2I2SA 1XE0A 1ZZ7A 5EV7A 4JTOA 1AYN3 1SLBA 1QH7A 2GDFA 1RVF1 3E5XA 4JKLA 5A33A 3OEAA 3H8XA 1RUG3 3Q8AA 1QNYA 3GJBA 1DU3D 3SNMA 3MHZA 4PF1A 2VNVA 4WVVA 5LK5A 2X09A 5EJ3A 2HYXA 2FZ1A 1BVVA 1HV1A 4CA9A 2JDHA 2Q1ZB 4I0BA 3CEWA 3VKFC 4LHKA 4AFCA 1TVGA 3JBG3 5FOJB 3HQXA 3T1MA 4CSWA 2VU9A 3RZZA 4XW3A 2XL7A 5FPBA 5A6ZA 1DQ4A 3AZYA 3CO2A 5CBLA 4XJZA 4JHTA 1AUYA 1FI2A 2G9GA 5LASA 3O0VA 1OA3A 1KFUL 1MACA 3PTRB 1A8DA 5F5IA 4BMBA 5IVCA 5AVAA 4OYUA 1NY72 4Y1ZA 5D8AA 2EAAA 3FWEA 5BXXA 3AYDA 1C8M2 2ES3A 2ZGOA 4M4RA 4A7ZA 4BPZA 1BQPA 1WCDJ 1S0BA 4CDQC 1YQ2A 3C3VA 4FVVA 1Q3EA 3OGGA 5FZDA 2ENRA 4QX3A 4WV8A 2I45A 2WNUA 1VMFA 1XNKA 1XC6A 3IAQA 4TYSA 4QX0A 1AX2A 2VUAA 3W5MA 4LBJA 1VRH3 2ATFA 5LWBA 3D4KA 3AYEA 1QXPA 5DUVA 2BBVA 3TEWA 1Y7BA 2ZGLA 4QU2A 2HWF1 3ZYBA 1J3RA 4AVBA 3I59B 4UF0A 1JYXA 2JICA 5FY5A 4NIIA 3DPRA 1C1LA 4KU8A 5DDJ2 4IW3A 1UMZA 3IWZA 1OPMA 1QWRA 1NCQB 2WS93 2CGNA 3WXPA 3LSEA 1HRI1 3IPVA 4ZXEA 3ZVXA 2UYAA 1W99A 3OCPA 1AYN1 5FKBA 1POV3 5FK8A 1TMF2 4CDWC 3RZGA 5CKMA 5LA1A 2ADDA 2GZWA 2XLFA 4C0BA 5A80A 1GQHA 5JI7A 4COYA 2BRTA 4ATFA 2DTYA 3K75B 1YYNA 2XUMA 4CCNA 4CDUA 5HV4A 2JDNA 4XBLA 4XCBA 4JGYB 5FY7A 4F3JA 5J09A 5HCHA 3U07A 5FZGA 1FATA 1REDA 2JENA 1O3TA 4QPYA 5LRSA 1PZ8A 4JX0A 3E1F1 4MGTA 4IXLA 4QWNA 5A70A 5E89A 2Z69A 1AX1A 4YM1A 4ONUA 1OLQA 3BVCA 1YQ6A 2K9ZA 2TUNA 2SLIA 4I0AA 4C8DA 3WZ1A 2OVUA 2BUKA 4N7IA 3WY6A 1RUC1 3F95A 3TYJA 5LCWL 4AFMA 3WF3A 1IPJA 3T2PA 2KD7A 5C3RA 1IPSA 5BV6A 1PVXA 2VNRA 5CNAA 5FBZA 4E2GA 3T09A 1QOTA 3VBOB 5CKQA 5BNNC 1ACCA 2X10A 2B45X 4XIKA 4Q4V2 1H8TB 5FP3A 5BNOB 1KITA 3DUIA 3IDCB 2WQ4A 1BEV2 5HXMA 2YC2A 4FPLA 1RXFA 5FPXA 3S5AA 3WR0A 2UY9A 1PO21 4D8MA 5FWJA 4EROA 1SBFA 2YU2A 3WX5A 3QCWA 5BNOC 1KJLA 1PVC2 4GIQA 4QGNA 1PX3A 4C0HA 4EZ4A 4EZHA 2SBAA 5KC6A 4AI8A 1OOPA 1ND2C 1ZA4A 2NYYA 5BNQA 3FUOA 4IEWA 1PO11 4LLFA 3GCWA 1E5RA 1X33A 3CJIA 3N9OA 3LA2A 4W6YA 2JDKA 1FMD3 4MZUA 2OUHA 1R1A3 3VHRA 2P3IA 5FY1A 1ZNPA 2JIGA 3MLKA 4XQWA 2Q8EA 1F31A 3JBG2 4O65A 2OPWA 3N3HA 2EICA 3NSTA 4TXWA 2EXJA 2WZR3 2C9AA 3VKMA 4S2FA 4YM0A 3MZHA 1JU4A 4A44A 2XHKA 1ASJ1 1GFF2 1HIXA 4W6XA 1XU2A 4P14A 3U10A 4AOCA 2ARBA 2YV8A 2X05A 2FDFA 2B7YA 2VO5A 4NPLA 1I3HA 3GHMA 3KF5A 3IDBB 2WC2A 3VZOA 3TN93 1CX4A 3AP7A 1CIWA 1UL9A 3ASIA 4IV1B 2PXJA 3RYPA 3VBFC 5C4WB 3QLQA 4NO4A 5FYZA 3ZIXA 1IS5A 2L9LA 5KHHA 2R16A 4PHZA 4XABA 2X5IA 5DN2A 4CEWC 1OKQA 1VBA2 3WDWA 3OBZA 4C1WA 4RR3A 1AR71 1RUD1 2UWBA 3OUIA 3TNPB 5ACA3 1MS9A 5ISLA 1ULFA 2JKXA 2WLPA 2B42B 3RWNA 5K0UB 4NOTA 1XNAA 2CWMA 3WW2A 4LBLA 1ZZCA 2MHFA 4IEVA 4YG0A 1PNGA 3ELNA 3ZXKA 1NZCA 1QEXA 3E97A 4NHXA 1EV11 1W39A 3HMYA 3W9AA 4DB5A 4Y1XA 3USSA 1AR91 2DURA 3AMPA 2FMYA 5FXWA 3ZMNA 3VBFA 1PNFA 2XWJB 3BCWA 5C5TA 3ZMOA 2XGXA 1JZ6A 1RYYA 1CJDA 1CAXB 3I2GA 4KU7A 2YGMA 3MIHA 2MPFA 2D93A 2HWF2 2A3WA 3HNMA 3L2HA 3PTYA 4GH4C 4UW5A 4GMP3 2JB4A 1MPXA 4L0PA 4BH9A 1IG0A 1K5JA 4NJ4A 4QHOA 3VZLA 5FO8B 2FCUA 3WF1A 2YYOA 2JJ6A 4Y1VA 1JZ2A 3KSCA 4XFCA 3EMRA 4RHV1 4CEYC 5D1IA 2MEV2 2XHNA 3KT7A 2OX0A 3B3QE 3ZFFA 3UKVA 3ECQA 2QTWB 3AKRA 3WDYA 4Q4X3 4W4ZA 5JZGB 1PIV1 5A32A 2WWJA 4RN5A 3B01A 4UFMA 1V9U1 1Q8OA 3FMGA 4KQ7A 5C9AA 4LBKA 3RPQA 1H30A 2AUYA 1AL22 1OVPA 3I49A 3PMSA 4META 1DF0A 4OUEA 5CFCA 1W0PA 5FO9B 3ALQA 3AXEA 2Y6KA 5IAVA 1XNDA 4B4RA 3IBMA 3VL9A 1OPOA 3THTA 3SKVA 3OBTA 1DG6A 1ZRFA 5B4NA 2BU9A 2DFBA 4LKDA 1KGYA 5BNPA 1ODNA 2CY6A 1C4RA 3LFIA 1DZTA 4Z1VA 4QMAA 2DF7A 3WINE 3PNAA 2UU8A 4XJWA 1LU2A 4ZONA 1S0DA 3N9QA 5JSOA 2FMDA 3AMHA 3X29B 4OQ8A 1MZFA 2J1RA 3ACIA 1VBB1 3FN9A 4AVCA 3TNQA 3LOBA 3J7NA 2RS51 5L73A 3WP4A 4FQ4A 4AAXA 2R32A 1MZ6A 3M1HA 3IAPA 1GU3A 1B35C 4XJAA 3UNPA 1Q5OA 2BGPA 2RMU1 1H1IA 1LHWA 1PMHX 1ZBE3 2J7MA 2HYKA 2W94A 2Y6FA 3MPBA 3OYWB 1WW4A 3N35A 4XJ9A 2W95A 1F4HA 3K4AA 3LGRA 4CUAA 5K9YA 5BY5A 4R4XA 3NMBA 3ZIWA 1T6BX 5CFDC 4K40A 1HXS1 1H0BA 4P5HA 4Q2FA 1OF4A 4CUGA 1XNTA 4FPHA 4WVMB 1FYUA 2DVFA 3ST7A 1FX5A 1PHMA 4JRAA 3HJRA 4CXXA 5F1RA 1W8FA 1GV9A 1TE1B 2BERA 1LOAA 3PLQA 4AHYA 2VZQA 5DAVA 4YW7A 1FAYA 2RS11 5G04L 1ZBE2 3J8F3 1GZTA 3HIFA 3OSDA 4NIDA 4OHYA 2A70A 2CWSA 5FP9A 3WG3A 1WW7A 4Z2WA 5EWSA 3TWIA 3BYWA 1J1LA 4E2SA 2C1FA 1BXHA 3A7QA 2VUDA 2HWC1 4QDRA 4QKDA 4A7YA 3I2HA 3MI8A 2WUHA 1W8HA 2GMPA 3H1YA 4KG0A 5FMOL 3MLLA 4D6RA 1MEC2 4XDOA 2RS32 3B93A 3NQHA 3RNSA 3AXDA 4YPJA 3URFA 2WZR1 1W8NA 2LS6A 1WMXA 3EJKA 3PIJA 2VCAA 4WM8A 1UYXA 4LKSA 1YHFA 1B09A 3OYWA 2WFF2 4ORFA 3N36A 2E31A 4PF5A 4MGIE 1SCSA 4QPGA 4YVSB 3NNJA 4U2AA 3S5QA 4CP9A 2VD7A 2ZEXA 1LESA 4Y4RA 3H8RA 5FPUA 4BU2A 1Y4WA 4LTAA 2YBPA 3BOWA 1DGWX 2F4LA 2DTWA 4OULA 4AEDC 2WYSA 1SHWB 4D7SA 1US2A 4V2VA 5IVYA 2FDHA 1YO8A 4RS5C 2FBEA 1RXGA 4CP2A 2CGPA 1O4TA 4UYBA 5B2GB 3M3IA 3ES4A 1LULA 3N7MA 3Q8CA 2MEV1 4XTMA 5I93A 3V0BA 5CG8A 3O0XA 3V64A 5A1AA 5HI0A 1PIV3 2GAUA 1B35B 2WZR2 1JYWA 3U1XA 4LUMA 4YVSC 1NYWA 3O5SA 3T4VA 2HWB2 3AC0A 3NW4A 5FY8A 1DQ0A 1AR82 2DCJA 2GNTA 3T0DA 2VW2A 4MYEA 1XE7A 4D69A 1UN1A 2RS13 3K77A 4JAAA 4Q5OA 3WCRA 1XB9A 1GNZA 2P6CA 3OD0A 3GGLA 5T5OA 3H3LA 1LTEA 4UBGA 5DZEA 3CIHA 3VBOC 5BNNB 4Q27A 4A3ZA 2FHRA 4EV0A 4KGGA 2Y64A 3SITA 2A75A 3UT0A 1MS3A 4N90A 4N7UA 2ZZJA 4Y26A 3SHRA 3WOGA 1HB3A 5L36A 4AEKA 4XAEA 1HB1A 4XUQA 4Y22A 4HVQA 3AYAA 5DUUA 2YDEA 1UU6A 1RUOA 1SBDA 3TEYA 1J83A 3KCCA 4J1XA 1BBT2 1WMFA 1NX9A 1AXYA 4CCCA 4GB32 4CCKA 1YNAA 4AE2A 2VTFA 1A78A 3NAPA 3CDZB 3J7MA 4XFBA 4COVA 4K7JA 4KWLA 2VQUA 4E4HA 1XNCA 4Z2AA 1W9SA 3B00A 2RG4A 2HEVF 1OT5A 3AP9A 4BOWA 4DXZA 3VZMA 2DUQA 5GZCA 1OLRA 1RMU3 4RA0A 3DYPA 5FZ1A 5KXCA 5LBEA 2E7TA 1JYTA 3AP6A 5JOWA 3WDTA 4QX1A 3UKTA 2ILMA 5JVVA 3KD4A 3PHMA 3KVAA 1W3XA 1AR83 3DPRC 5FUIA 1V6IA 4Q8LA 3H1MA 4XUNA 3B9CA 2VOXA 5JR2A 5FK7A 5FMDA 1QJX2 2HWC2 1I9RA 1FMD2 2A6ZA 4PQ9A 1VBC3 1POV0 4DY5A 3O1SA 3WNOA 4NUBA 2WBKA 1ULEA 4K8RB 1ZZ6A 4TZDA 4S2DA 2OUJA 1OURA 1JW6A 3FBMA 3CU7A 3RSJA 5FJHA 1U5YA 2RDSA 2PAMA 1A34A 3KVBA 5JOYA 1D2SA 1O5UA 4ASMB 4CDQA 5C71A 2O14A 1AL23 4K1YA 4Y5Z0 2B46X 5A3LA 4BQYA 5JMOA 3JD73 5APAA 1QOOA 1W0OA 4DUVA 5BPXA 1K3IA 1KJRA 1RVF3 1XYNA 4UOJA 1UW8A 5FY0A 4CUCA 5A6QA 3O1UA 1APNA 5JI9A 3BGAA 3INAA 3NRUA 1JMUB 4CVUA 3ZKUA 1WLCA 5JXHA 3CJIB 1NUKA 2R49A 4QX2A 3ZPOA 2RS33 2WT0A 1QHDA 5FYHA 3USUB 2VQ0A 1VMHA 5DPNA 4GWIA 4YVWC 1SG3A 1OBNA 5LY2A 5A3NA 4QPGC 2W1UA 5A3MA 3VBSC 4BXFA 4QQHA 4UAPA 1IG3A 3POWA 2RS52 4I30A 1D4M3 4XEZA 5FUPA 4IV1A 4XFFA 2ZGRA 1FV3A 1W90A 5C3OA 2P3JA 2WA4A 3S0MA 3ZYIB 1EV13 3V0AB 3Q8BA 4NVPA 4AFBA 1D4M1 1O8SA 1DDLA 3N9NA 2H6BA 4MVTA 2HWE1 1DBNA 5FREA 1MS4A 1SPPA 2C4XA 4IE4A 1VMJA 1QJY1 4IEUA 4E9KA 3ORJA 4LK7A 3OPZA 1KS5A 4M3CE 5JUVA 2ARAA 2BTVC 3DECA 2BNNA 4QDSA 3V65A 3WNXA 4GD4A 1AJKA 4FOQA 1FNYA 2ZMLA 5T3NA 4BISA 4CZSA 1REFA 3ZSEA 4PLMA 4UI9L 3MIDA 4XBNA 2XMLA 3M4FA 2WN3A 4DINB 3I2JA 2WAOA 1JXNA 4I01A 3VZJA 1W8WA 1OOPB 2HWE2 1AR72 1RUD2 3AFGA 3UL2A 2ORXA 2O1QA 4TSVA 4P9GA 5FZEA 1X9TA 1GNHA 1CAUA 1H1AA 3LF7A 1HX6A 4IE0A 1J3QA 1N3QA 2P6HA 4M3CB 1JOBA 4Z07A 3AK0A 5GLUA 3JCIA 1OMIA 4JGYA 2D44A 4COZA 4LHSA 2OKXA 1VJ2A 1HRV1 1QU0A 2R0HA 4XQDA 4BM8A 5GM0A 1OUXA 3ZSJA 2WFPA 1RJ7A 4BQ1A 3DF0A 2FDKA 1VRH2 1YI7A 2ZKNA 4JZRA 3AYCA 2ZHLA 2XBO3 3IPVB 1WBLA 5FYSA 4ES9A 1QGLA 1S2EA 3BU7A 1NCQA 2IXKA 4IETA 4WM8C 5JPMB 1YJLA 2YMZA 2V5YA 4JKKA 3VHPA 1ZBA3 2NZ9A 1PVC3 3B02A 3DN7A 4AGGA 1W04A 3AMQA 1W2NA 3PURA 4UF0B 4MGSA 4RGKA 5KHIA 3NV3A 4Q4X1 5E6HA 5GLTA 1PMJX 4LO5B 1DCSA 4ES8A 1VALA 4Z92B 1AR92 1WZXA 3WHTA 3WQ0A 3ZDSA 1AR61 2A6YA 3CZJA 3VBRB 5LBCA 1S0IA 3T08A 1I1EA 2J1EA 4CDUB 5C8CB 1V6MA 2R062 2VQAA 5EJ1B 2P37A 2W68A 4XOGA 1WWYA 1UQXA 2GC0A 3KV9A 4H2AA 2BGCA 4WM7B 1NG0A 1QJX1 1S0JA 4W6WA 4ZY9A 2E33A 1GWKA 4BQWA 2QQPA 1POQA 4X8NA 3ZR5A 5CFCC 5D8AB 4YM2A 1X50A 4P5YA 5TSWA 3FUQA 3VZKA 5JSPA 3MF9A 4Q0QA 2WQZC 2DU1A 3P6BA 5DG1A 1YFUA 5CFDA 4BZ4A 1RHI3 4CTEA 3ZX7A 4QQOA 4CP1A 3ZFFC 4LQRA 1EPZA 2WZEA 2ZOEB 1YWKA 2PN5A 4OUSA 4PQQA 1XQNA 1GUIA 1R1ZA 4ZPIA 2WSUA 4W50A 2Y6GA 2CNAA 4I3GA 1YIFA 4LHNA 3D8CA 1EY2A 5AFBA 3SC7X 2JDPA 1LU1A 3BIWE 4HANA 4CPBD 1DYPA 4DNYA 1BMV1 1PGL1 2XDVA 4ZXKA 2BOJA 5FZ6A 1F5JA 1PX4A 4GH4A 5I0SA 4HK9A 4BMEA 2ZCWA 3SCFA 5L9RA 2Q5TA 3C7EA 5EPAA 2JG8B 2VTXJ 2JG8A 2K2SA 1KDKA 5L9BA 3OB8A 2DCYA 3KQ4B 2PHRA 3SH5A 5D2AA 3GZTB 2VMEA 1GYKA 5IK4A 2WJSA 1OQ1A 2QKDA 1MS5A 2ZGNA 3WDVA 3NNMA 1G7YA 2J1UA 1DIWA 5LBFA 1HRV3 2ZJCA 4AF9A 5GALA 3ZFGC 4P9LA 1D2QA 4Q0UA 3FZ3A 3MPPG 3NKTA 1UY2A 5H9SA 2ZABA 1IS6A 1UWWA 1UY3A 3OGRA 3SEPA 4EN0A 2V72A 1TQ5A 2XBO1 4XHBA 2ZHNA 4LBQA 4UFKA 1K5MB 1YQ5A 1UZZA 1YXWA 1D0HA 5F37A 1ZREA 1M4WA 1SDDB 2DBIA 3CF6E 3U14A 2B39A 4IV3B 5B4XA 4DFSA 1RUNA 1IQDC 2KA3A 3A0KA 4HXCA 1U0AA 3FC0A 2YXSA 1BYHA 2R042 3OY8A 1TME2 2VOKA 3Q8EA 4H7MA 2Q8OA 1H2LA 4QD2A 4A4AA 3JU9A 4W65A 5ACA1 1JZ3A 5BNOA 2B9UA 4Q4W3 1UZ0A 3ZPYA 3WP3A 5J37A 3DKQA 3NJVA 1JUIA 2CTVA 4LUKA 1BMV2 3VBOA 4PIYA 4PBPA 2WL1A 4CDXC 1ND2A 1SFNA 1SFPA 2NN8A 1NKGA 4A3XA 4DO0A 4Z82A 1PM7A 3AL6A 3AX4A 1HQWA 2W3JA 5LB6A 4O7XA 1NQDA 2VNGA 3OGSA 1NCQC 1R082 1IKQA 1XU1A 5FQ0A 1KEXA 2R043 3BODA 5JR7B 5F39A 4YFWA 2VNOA 3I3EA 2QQLA 2GU9A 5AC92 1U5XA 1DGLA 4JVAA 2HWE3 1K12A 4FFFA 4AVTA 4DUWA 1SMVA 1W2OA 4N53A 3SXWA 5IVJA 4BK4A 5GKAC 5I91A 2VMHA 5DQ0A 2Y0OA 4PT6A 3WG4A 1A8MA 1OOPC 2Q30A 3WVJA 1RUI2 1VRBA 1V00A 2UWCA 3GM8A 4O61A 5IK5A 3ZYFA 5H9QA 2D5FA 1UXXX 1VBE3 1LR5A 5A3UA 1UOGA 3DYOA 1V70A 1AZDA 1HXS2 2R061 5DG2A 5FPAA 1RC6A 3HT1A 2XJQA 4B29A 5JAXA 3N9LA 3LOIA 4M3CA 4OI1A 1BJQA 4GJYA 2H0BA 4BYYA 3WNLA 1WCQA 5KXBA 1PO13 5IK7A 4K1ZA 3T4HB 3PU8A 4A41A 2W39A 3DPRB 2VW1A 4NIHA 5EJZB 3LEIA 5FZ3A 5FP8A 2NM1A 1K5MA 5KXEA 4AQTA 1W0NA 4XC9A 4LBQB 4N43A 3ZOIA 1PMIA 1D0GA 4UFIA 3I2OA 4LOSA 3K48A 2JX9A 4FXKB 5FZ8A 1JU3A 2E7AA 4Q8KA 1SDWA 2IFWA 3T2QA 3C7FA 1UX7A 4RFT0 2D3SA 3CL1A 5DUXA 2W1WA 1V0AA 1SPPB 4D7TA 4R9DA 5ANNA 4HPKA 3GYDA 4P9XA 1CWPA 4YYOA 2FCTA 3FFQA 3PUQA 5FYMA 1CGPA 5CG9A 1JUHA 4IEXA 2XWBB 1CZVA 3WW1A 4I3PA 3ACGA 4XIOA 1N1VA 1H6YA 4JC1A 4KWKA 4D7YA 3U78A 1HKDA 3C7OA 3OTFA 4FPJA 5ABJC 4MG2A 3I3QA 1V9U3 4CXWA 3R4UA 3K3OA 4MUVA 1QDOA 2R071 2XVKA 2RVAA 1W2AX 1GQGA 4Q4W1 1ENXA 4EN9B 2W2IA 2OA2A 3IKWA 5IVFA 4XUTA 2ZX3A 3WNNA 4QB2A 1K45A 3WD5A 4E27A 2HJIA 3PUIA 2VMGA 3D5OA 1LKNA 2ZEWA 1GR3A 5IJRA 3SH4A 1LNSA 1T2XA 1Z0HA 3I8TA 3T1LA 4XJUA 5EQUA 2BDRA 3RJRA 1MVQA 1WBFA 3APBA 3LDRA 3GF6A 2WYFA 1WMDA 3VV1A 5HCAA 4MLOA 1VBC2 2C5DA 3NO8A 5A3OA 5JMCA 1GLHA 4GH4B 1QJX3 4WM7A 2W5FA 3OBRA 2RJ2A 1PGW2 4XF0A 2NP0A 4IEYA 1CJPA 5J7MA 4FTSA 4DOUA 3NV2A 2VG9A 4ITCA 1UXZA 2D6KA 4P02B 3QD6A 5DUWA 4AFAA 4COWA 1O3SA 4XUOA 4CU9A 2YBKA 1H1MA 1GQPA 3GBFA 1SLCA 4AQ6A 1F5FA 4FTEA 4PJYA 5E8AA 2VTXA 1UOBA 3H9AA 3NNGA 4Q0SA 2HLEA 4U36A 5EP9A 5IUQA 3POGA 1R083 3CBNA 1G8WA 3ZYHA 1HN1A 2OXBA 2R30A 2VE1A 4XHXA 5T54A 2WNVB 3J9SA 5FR3A 3MDPA 5CKNA 2OT7A 1LOBA 1Q8QA 2GMMA 5J1XA 2XL9A 2XQRA 4M3CF 1WA4A 2YZ4A 4KBZA 1OD3A 2PHLA 3W20A 1UOJA 3LZZA 4Z8BA 2IFRA 3BOPA 2AC1A 4OQ9A 3RVHA 1FMD1 4FAHA 1QJU1 3ILRA 3LEKA 3LDKA 5E16A 3MFCA 4JCKA 2ZX2A 4Y22B 2A73B 1WKYA 5C8CA 3SMHA 1OC1A 1X8MA 5KC5A 3VBRA 4FPFA 3H1WA 3N9MA 3GBWA 2BNMA 1NXMA 3HT2A 1DGRN 2A3YA 2QZ2A 4FFGA 1L7QA 5E1RA 2H0VA 1JYNA 4A45A 1A3KA 1CAUB 2K46A 3E5QA 4CCMA 3KHCA 1RUG1 4I02A 5JWPA 5L7OB 5DAXA 3HQUA 3WUCA 5JXJA 1ODMA 3LCPA 4P08A 4RGGA 3VGIA 2W0XA 4HK8A 4LBOA 1RMU2 3NV1A 4A2UA 4C90A 4ZU7A 3WNMA 5CA6A 3PU3A 3AB0A 4MOAA 1XNBA 1QJZA 3BB6A 3C8XA 2YU1A 5GLVA 1Q8PA 3I2IA 2BVVA 2YFUA 2WAAA 3W21A 1VIWB 4RFRB 3AKTA 2VZ1A 4JGZA 2DU0A 5SV8A 4K6BA 3IMNA 2W87A 4B7EA 3NAPC 3OPTA 4FO9A 4OHWA 4CDUC 1WD3A 5FXVA 2BEOA 5FYIA 1ULGA 1POV1 3IDEA 1FPN3 4QGLA 5C3SA 1LCLA 3ON7A 1VBB3 2EIDA 1URXA 1Y9MA 4EN7B 2JD4A 3ZSMA 4QQLA 4Q4V1 1PGW1 1CAWB 3SISA 2OS2A 2PLV2 2RR12 2VY0A 4HL0A 4URTA 3S30A 3UJOA 5F7UA 1OH3A 3VLBB 1CVNA 4AWDA 2NPIA 2VGDA 4ZS2A 3ETQA 3HBZA 3CKHA 4FOYA 5FJKA 4B7KA 1JZ5A 1X8EA 4INDA 1MVEA 4HMZA 3D6EA 1O7FA 2ZXQA 1OA4A 2AEYA 1VRH1 4NE9A 2BW8A 3RGBA 3KGLA 2Y6LA 2WS91 4LXLA 1JOPA 2E53A 1BKZA 1GOHA 1RUC3 4HT1T 2ERFA 2BYVE 2W92A 3V0AA 3I3MA 1ZRCA 4CDWB 5JLVA 1QY4A 5DAQA 1RUF1 3TEZA 1O4ZA 3KZ4C 4YW5A 2FZ2A 3BI3A 1EAH1 4DEVA 1LB2A 5CB7A 2VZ3A 3R4DB 5KR7A 2CDPA 2ZGMA 5FOBB 4Y20B 2V73A 3CZUA 4AGVA 1UAIA 1W06A 1V6JA 1FNZA 1AVBA 1TME3 1FV2A 2ZBJA 4OHXA 1VB4A 4NHMA 4E8CA 4CU8A 2C6SA 2YHJA 2ZAHA 1QKQA 2FDJA 4PLNA 4FAGA 1VAMA 4AAPA 2QQKA 2WRAA 3AKSA 1LGNA 4YARA 3EHKA 1CPNA 4O9GA 1HQLA 4AHZA 1W9FA 3KCYA 4WBBA 3ZXLA 5C9AC 5C3PA 4XTPA 2K0GA 3HVDA 5GJ6A 2JG9C 3DCQA 2JDYA 5A6XA 4AHWA 3JB8A 1D4M2 4B1MA 3RZLA 4A6SA 1XBFA 1BK0A 2VOTA 3THPA 4Q0VA 3BPSA 4LO6B 4RHV3 4URAA 3HWJA 3NJZA 4MXVA 1JN2P 1MQTB 5FP4A 4KH9A 1UZVA 5ABJA 2X5IC 4CEWA 3H42B 2VMIA 4TLGA 3D3AA 5I0RA 4BJ0A 1JI6A 4PI2A 1LJ7A 1NLRA 3G7DA 4PDWC 1ST8A 4YW1A 2G9ZA 2Z5WA 3JB4C 5I8TA 5F5AA 5J48A 2JE9A 3J26N 2PA7A 3VDDA 1DQ6A 3RI9A 1UZYA 4R9AA 4LKFA 1OXCA 2CAVA 2LROA 2A6WA 1W6QA 4KMQA 3AL5A 4X6RB 2ARXA 3BTZA 2IVJA 2Y26A 5IVEA 1QF3A 1Z78A 2ORZA 2R072 3AKPA 2PLV3 2RR13 2OYZA 1ULOA 2J1SA 1WGPA 3RFRA 1SBEA 4YZ1A 5GLWA 5LY1A 1E5IA 1WD4A 4PDWA 1AR63 3OGVA 2P4EA 1RUI1 1F2NA 4UW3A 4XETA 2VVDA 1H8TC 1RINA 1H9WA 3LFMA 5IWFA 1W28A 1YQCA 2ZACA 2QNKA 4M0HA 4HKLA 4EJRA 3I54A 3UKNA 2ZGUA 1C28A 2MEV3 2W91A 2XOMA 3AMMA 4CPBA 4BLIA 5A7OA 1OHFA 3LIHA 2YFZA 4LE3A 2UYBA 4HSLA 4YGCA 2DDUA 2D5HA 1VBE1 3KV5A 2RDNA 4FXGB 2IXJA 4H55A 4J1WA 4LK6A 3ABZA 3JXSA 3VBUA 4BCUA 5A6YA 4GKYA 3MUZ1 1SLLA 3HOBA 3POBA 1H6XA 3DXTA 3C7HA 1NA1B 4MGQA 2ZGKA 1W03A 2ZAAA 3WUDA 4RL7A 3LDBA 2VZUA 3A23A 4QPGB 1SACA 4XBQA 1VBD3 4BQ5A 2E51A 1V6OA 2QQUA 4EN8B 2WIIB 3VBFB 3BIEA 5IFTA 4YFZA 3LA3A 3S7EA 2OQ6A 4UWDA 2RJKA 2XKPA 1H4HA 2XR4A 2AR6A 2XJPA 3WW4A 4XPVA 5L7OC 3VBSB 5FYTA 4DEQA 3UGHA 5FY9A 4P00B 1VBD2 5I0TA 3V0BB 5LEKA 2JDAA 2RMU2 5T5LA 4E2QA 4YZ5A 4MV2A 5HV0A 1Z7S3 3O0WA 2X5IB 4QQPA 2XBO2 1STMA 1C1FA 1ND3B 3THCA 3ZXFA 3ZM8A 1WW5A 5FTTC 3VDDB 3WDXA 3ZXGA 1VBB2 3VD7A 2D6NA 1U5ZA 3ZSLA 2ZGSA 2C26A 1GOGA 4Y5SA 3ME2A 4M00A 1Z7S1 3ZKYA 3ZXAC 1TG7A 1F35A 3KLSA 2GNMA 2AENA 1YIPA 2DUPA 4JDNA 1YFWA 4BB3A 1JS9A 1S0CA 4CEWB 2E7QA 4OZOA 3I2DA 3PIGA 2HWB1 3ZSKA 4J6GA 1J84A 3FJSA 3SEEA 4MSVA 4F8AA 1RUJ1 4XDQA 5EYXA 1X7NA 2UY8A 1YFXA 4IEPA 4DPNA 1FOD3 1UZWA 2TEPA 5CU1A 4RGAA 1QH6A 1AL0G 3PUHA 4MX3A 4DIQA 5KWRA 4RQPC 2ZX1A 5A7PA 1CQ9A 3KWVA 3MUY1 4Q4Y3 1UYPA 1QQP2 1HJFA 3A0NA 3CLPA 4Q29A 4Y24A 5ACA2 4FSJA 3AZVA 3HD8B 3HNYM 4HVOA 3GBGA 4PI0A 5J96B 4QM9A 3U4SA 1UCXA 5FDBA 3AZWA 1OQDA 4OI4A 4CCLA 2JB8A 4GWMA 5JCTA 1ZA7A 3O1RA 4GQ7A 4Y33A 3M8LA 4Y20A 1GKBA 4JTNA 3GALA 5FXZA 4NAMA 3JQXA 2IXLA 5CIRA 5J3UA 2PTMA 2XJTA 1EUTA 1EPWA 5ERLA 5F8PA 2IZWA 4MHUA 3VZNA 4EYUA 3N4MA 4FPKA 3NJXA 4QKBA 1RGSA 2CDOA 2LUWA 2DUOA 1PO12 2A3XA 1YLLA 4DMIA 2HWD1 4N9HA 4LNVA 1UPIA 1YRZA 5D21A 5FFOC 5CISA 3QBQA 5C8CC 2RDRA 1S0FA 3VKNA 4NR1A 3JQWA 4ZZ5A 2WKKA 3B94A 4QB6A 2EIGA 5C9AB 3O12A 2NLRA 1W9YA 1N47A 5GZFA 1AR62 2Y34A 3B5LB 4B4QA 4BQXA 3AP4A 4B1LA 3UV9A 3WT3A 3MW4A 4F7ZA 2RDQA 1RUH2 2B5HA 3RZHA 2ID4A 1XJAA 3GZEA 3MBWA 2ZGPA 3T0AA 4LIVA 5CADA 2XB6C 4QB1A 4AVSA 4BQ4A 1DLCA 1K42A 1UKGA 3M3CA 4NHKA 2OIIA 4AW7A 3JZVA 2Q1MA 5F2SA 5FZOA 5LZ6A 5HCBA 4DZGA 2JWPA 4GMP1 3D0JA 4K21A 4LBQD 1U12A 2YC4A 3ENRA 2QJVA 1UOFA 4XACA 1ULCA 3ZXJA 1ZVFA 1GZ9A 4NAOA 5FPLA 4CDXB 1X82A 4KGQA 1YUDA 1CAXA 3HBKA 1TEIA 1N1YA 1UMHA 3RDIA 1RUE1 1CD3G 2YGLA 3JUUA 4E4DX 4F83A 1H8VA 1SCRA 1O4YA 5F32A 2XH6A 1K5MC 4FPGA 4H7LA 4V2WA 5DABA 4L92A 3FX3A 1GP5A 2LM3A 5D8AC 2V4AA 3WV6A 3ZFFB 3DEMA 4B4PA 1J59A 5K0UA 1AJOA 3GNEA 4JHZA 3ZXDA 4AI0A 2W9XA 4XUPA 2X53S 4CUBA 4P9YA 4HSJA 1RITA 4N9IA 3RZKA 5FZAA 1AYN2 2QFEA 5FV3A 1GP6A 3RYRA 1LOGA 3MW2A 3LD8A 4TN7A 2WSVA 5FZBA 5LA9A 4TTGA 2DFCA 1UYYA 1ENSA 1GZCA 3NJYA 5E88A 1IS4A 4GB33 1TZOA 2ET1A 1PK6A 5T5PA 3C2UA 5A7QA 4BQ2A 1COV3 2VZPA 1QJY2 2XONA 2P3KA 1H2NA 2GP5A 5LBBA 1Q56A 2ZA9A 3LPGA 5F2WA 5H9PA 1PO23 2ZMNA 3ILFA 5IAXA 3MYXA 5LA2A 4UFJA 4EWEA 2VVEA 2VUJA 4D6SA 4FI9A 2WO7A 1W8UA 4GJZA 4BA6A 4QHZA 4Y1UA 2JDZA 5FRAA 4LULA 3K2OA 1FOD1 5T50A 2QBXA 4OFGA 4B3NA 3AVRA 3FLRA 4LT5A 1P8JA 4GA9A 3ZFEA 1IGOA 3VD4A 2D3PA 1YEWA 3AKQA 2VR4A 3I97A 4DXTA 2RV9A 5KBFA 1ZRRA 4EWAA 4GULA 2VVFA 4AI1A 3PJYA 2CAUA 3IT8A 3KHBA 1KXGA 5FCCA 2ZGTA 2PFWA 4NPMA 5LRRA 3ZYGA 4WVWA 5I8YA 1LODA 4HPKB 5A7NA 3IMMA 4XXAA 1WA6X 2TBVA 1E5SA 2PHTA 3H0OA 1TMF1 1LHOA 3ZYPA 1QDCA 2LALA 2Q4SA 1FPN2 1VE0A 2ZEYA 4YG3A 3O1MA 1NQJA 1R64A 4FFHA 4WZFA 1IOAA 3IN9A 4XFAA 1YFYA 3NNFA 1G9BA 1QJU3 3MICA 3VD5A 1RHI2 2Z4FA 3AFKA 4XF1A 3POYA 3WLUA 2J1VA 4QHBA 2QCSB 3PL0A 3RZJA 2AZ5A 3LEMA 2VZSA 4J25A 1VBA1 4QM8A 1DQ5A 2KM2A 1KS4A 4WZCA 2P17A 4DRRA 4Q0PA 2BOIA 3I2FA 4ASKA 4OI0A 4C1XA 3FL7A 1QJFA 2VBBA 4MHRA 2D40A 1ZBE1 1I5PA 5SV5A 3LA7A 5BNPC 1H8TA 1ND3C 1G9AA 3BKZA 4CCJA 2Q8DA 1C8M1 4Q26A 3UETA 2EIEA 2EXKA 2GALA 2ZZQA 2VCCA 1AXZA 4ZZ8A 3WEZA 2VL4A 1RL3A 2H6CA 3JD71 3PVBB 3FLTA 1J3PA 2XKOA 4OZXA 1LAJA 4YW3A 4YVWB 4KBBA 1SLTA 4GB31 2HWC3 1OF3A 2VOVA 5F3CA 1DLLA 1RUE3 2TNFA 4UBHA 5FZKA 1GZWA 1XYOA 2WQ8A 5L9VA 4HZFA 3K51A 4KL1A 2QQNA 3D0SA 1AF9A 3R4SA 1CAVB 1NA1C 3KV6A 5T5JA 3J7HA 3WW3A 5H9RA 4NRPA 1ND2B 2RM21 1BEV1 1HB4A 2LRPA 3OGJA 4UXAA 3TBDA 4AI9A 2PQSA 1M06G 2GH8A 3OOXA 1YI9A 2W1SA 3VDDC 4QAWA 5KHKA 1J58A 1IKPA 2IVIB 2YY1A 1RHI1 1WW6A 1Y9GA 2GC2A 2BWAA 1W3VA 4NPRA 5DAWA 1S4CA 4N43C 1HLCA 2AEZA 4NHYA 4XZPA 1DHKB 1NZIA 4ET7A 1DQ2A 1CX1A 2QDRA 1FPN1 1IPKA 2VQTA 1Q8VA 2WO3A 3MW3A 4BWOA 2YBSA 4WVZA 1AR93 4X6QB 2JKBA 3I59A 4YW4A 5AC91 3EB7A 2D6OX 1OQEA 3ITQA 3DL3A 4NMIA 4IGOA 1H9PA 2F4PA 2E32A 3S6PA 1V6NA 4JDOA 3I7DA 4AK3A 3IB3A 4UW6A 3H50A 4R8HA 1DYOA 1TME1 2DWRA 5GZGA 3PVEA 1E5HA 1Y43B 3POFA 1BVP1 2PHXA 3FHIB 3LEGA 1CAVA 5F6KA 3O1TA 4IERA 1V6KA 4YW2A 2KR2A 4GALA 4HLTA 2WNUB 4YGDA 2D3RA 2J1TA 4E4SA 4Q1RA 4MGKE 3CJXA 2W08A 4FPYA 1JTZX 2GH2A 2O0OA 2VAUA 2WS92 5IK8A 1CZSA 5IW0A 4E8DA 4AL9A 2YC0A 5DDJ3 1G9CA 1S2KA 3TEXA 5C5UA 4QQ2A 1NT0A 3DYMA 4HN0A 5FQ0B 3T2OA 1C57A 4XZUG 5C6CA 3N7KA 2EAKA 4B8EA 1XPWA 4FTBA 2GSYA 1LOFC 3R05A 4L8QA 3QH7A 1O3RA 1S0EA 4AEDA 1NCRC 2F17A 2ET7A 4Q4Y1 1R091 3CNAA 1Z7S2 1AR81 5HCFA 2EA7A 2I74A 2BFUS 3GZUC 4M4PA 3W59A 4AR2A 1O8PA 2WWSA 1C5HA 5JPNB 4G4FA 5F3IA 2GN7A 5DAPA 5DXDA 3EO6A 1BHGA 1NOVA 2BZDA 5JOZA 4KWJA 5LATA 5GZEA 3GXUA 3KV4A 4HVRA 4BLJA 1OLMA 4XCAA 5IHRA 4BXSV 3VN4A 5CFDB 3K4ZA 3B9IA 4IESA 4CE8A 4JGZC 1MS1A 2DVDA 3UGGA 5KXDA 5BUVA 3S7IA 2RJLA 4YWAA 4ZS3A 5BYNA 1LEDA 2JIJA 2BV4A 1O6UA 2JD9A 3ACFA 1TMF3 4LA2A 3BTXA 2ZTNA 2YROA 4LLOA 2XLAA 2DVAA 1OUSA 2VBDA 3UJQA 5FZLA 1RUG2 4AEDB 5FZ9A 2FD8A 3ZFGA 2BP6A 3U75A 1YCIA 4KI5M 4RSUA 1HXS3 4NRMA 1XSQA 2ARCA 2G1MA 3ATGA 5GLZA 4AQ2A 5HBAA 3GCXA 5FYCA 2ZX4A 3GZAA 1UF2C 4K8FA 1G9DA 3U4XA 1W6MA 2PHWA 1CPMA 1QJU2 4K9SA 1DGWA 1RVF2 2BVBA 4OMDA 4UT5A 3UYJA 2RE9A 4AG4A 3MO4A 2QE3A 1JZ7A 2A6XA 1S0GA 3J8F1 3VBHA 2PYTA 1XYPA 2HEYF 1ENQA 2R0FA 3OPWA 1W6NA 4S2GA 4TWTA 4AI3A 3P3PA 4FQZA 2GNBA 3RRDA 4KG8A 1IHMA 2AH2A 1CONA 1WLWA 3A21A 5A3TA 1TNFA 4Q4X2 1VB2A 2JG8C 3DGTA 2WZPP 4FT8A 2YPJA 3SQOA 2A1XA 4CDXA 1AL21 3N7JA 1NCRB 2E63A 3O1OA 3R0RA 4QXHA 1WLTA 1W6PA 4DRVA 4BDVB 2V09A 2YG0A 3WNPA 2WWUA 5FZOB 2ETEA 2W1QA 3BN6A 3BUCA 3HPNA 4LO4B 2OQ7A 1DFQA 4QT6A 1LOFA 2RS53 3LSDA 4HFSA 2VMCA 4JGYC 3WSOA 1AYM2 1UU4A 1N1TA 2D6PA 1L3JA 4KNCA 4DXRA 5EIYB 4XMIA 5FZ0A 4RQPB 3WG2A 1UD1A 1CZTA 4LKEA 4A6OA 5FYYA 2CYFA 5C3QA 2QZ3A 4AHXA 3WF0A 4OCTA 5K4LA 2VMDA 2E9QA 2Y60A 5FZCA 3E6CC 1DP0A 2DYCA 4NROA 1O3QA 1GZWB 4YLZA 3K3NA 4QU1A 2JDMA 1YQ8A 5FMBA 1ZX5A 1O59A 2JE8A 5FY4A 1NLSA 3LIGA 4YVWA 2E26A 1PZ9A 1QQP3 5K7PA 4UW4A 1HRI2 3WCSA 4HKOA 2P3YA 2ZKLA 3AJYA 4YG6A 2JG9B 3ES1A 1GWLA 4CEYA 3ZYJB 5DDJ1 2XJRA 3SLIA 2PELA 3OG2A 3PVNA 1GMMA 1HQNA 5AFEA 2R063 3USUA 4HN1A 2CGOA 3FLPA 2V4VA 2BQPA 2XJVA 3I3DA 4N8MA 1UO9A 2VM9A 3B69A 1NAEA 2IXCA 2VECA 3M70A 1JYCA 3WNKA 3NVCA 4GWNA 4R9BA 4CCOA 1GICA 4S2HA 3T30A 2IWGB 2O8QA 2Y6HA 3MF6A 4XURA 4NIAA 2Y0IA 3RWKX 4D6QA 4FP2A 1G86A 1SEFA 3RG0A 2ZEZA 1AXKA 4LO8A 4XFIA 1XOYA 2X29A 4CDQB 4CCEA 1F8VA 1LHUA 1AR73 1RUD3 1ULDA 1SLIA 4FPCA 4NRQA 2AYHA 1CN1A 3BALA 1VAVA 2FCVA 3O7OA 4M01A 1NXD1 1W2UA 1QOSA 4XF4A 1RJ8A 3N7LA 4XILA 3U11A 1JYVA 4CCDA 3ZN5A 2EF6A 1IQAA 2AGSA 3MIFA 3M3OA 3OBAA 5IT6A 2VW0A 4MXWA 4C91A 2DCZA 3MLJA 2BBAA 5F5QA 2QQWA 2PMWB 2G9FA 3QH6A 1MQTC 1F15A 3MIEA 3BPZA 3CHXA 4M0NA 2XXZA 1HN0A 2Q0AA 4IV3C 5FMOS 2A6VA 3IZOA 3RYKA 4AQSA 3AP5A 1Q8SA 3KS7A 2EXHA 2GC3A 2Y38A 1ND3A 2VZVA 3H8UA 3P3NA 5IYYA 3TB0A 3ZFEB 1UY1A 2QUOA 4ARYA 1WUVA 2J42A 2YUEA 5FPZA 4XMAA 2HWD2 1RUF3 1LHVA 3LQCA 4EN6B 2XVGA 5A7WA 2XG3A 1LHNA 2JEMA 3VBSA 3KF3A 5FZHA 3SCHA 1F9KA 4AI2A 3ZFEC 4MGYE 2WDBA 1QMJA 2HWB3 2X8KA 5CEHA 4IL7A 1X36A 1RUE2 2Z42A 1OI6A 3HN1A 1WLDA 3ACHA 2B8MA 3J8F2 3QOPA 2W47A 3RJ2X 4LORA 5KHJA 3FE5A 4TLFA 2VBPA 2MNGA 3IIAA 2PQQA 2VZTA 3AM2A 3GDBA 3MIBA 4HKWA 4EWDA 1ZRIA 5LK7B 3JBG1 1NA1A 4LBMA 3H8OA 2NMOA 1PK6B 1RUI3 4QPIA 4QX8A 4BIOA 1H2KA 5BNNA 4XAAA 4CU7A 5A33B 3E5UA 1CESA 4BE3A 1RUH1 1L7RA 1OVSA 2R6QA 4JQTA 4E4ZA 1GP4A 1W6OB 3DV8A 4QPWA 3VBHC 4RS5A 1PO22 2EALA 1XSRA 1B35A 3A4UA 3DKWA 1ZYBA 1MZEA 1W6OA 2XVLA 1OD5A 4QXKA 1SFYA 1T6GC 4I2OA 5F5CA 2A5ZA 3T0BA 4DY3A 2IXHA 1W9WA 1UU5A 4Y4YA 3KB5A 3ZXEA 3KMHA 3Q9OA 4QDQA 2PHDA 1W6QB 3EXUA 4SBVA 3TAYA 3EQEA 3P1IA 3P5BA 4QXBA 4YW6A 3ZN6B 2WZ8A 4QPIB 4PCRA 1Q43A 3VL8A 1GSLA 1ASJ3 3WQ1A 1HRI3 1UKRA 1VAKA 1W2TA 2WO2A 3NAPB 4P9WA 4R52A 3L9JT 5FZIA 4AEMA 4AXOA 4DS0A 1COV1 3C7GA 2D6MA 3MGUA 1LENA 4L11A 1ZZBA 3CQOA 4WM8B 1MEC3 1R1A1 1R081 1VBD1 3IDAA 2BPA2 1UX6A 1MS8A 3KQRA 4YNIA 4ZU4A 1MQTA 1ALYA 4BQ3A 5T52A 3PVOA 3THDA 5FYUA 3T2TA 1RUF2 2HWD3 1QIQA 1KDMA 5A1FA 4L9BA 1QQP1 5C4WC 1YC61 2VMFA 3I3BA 1LEMA 2R7EB 5G05L 3D82A 3GHNA 4IGQA 5EHDA 1BK1A 3WQBA 5I0DA 2V5DA 2ZX0A 4QXCA 1EAH3 2D6LX 2IXIA 2GNDA 4EE2A 3POJA 1ONAA 3RZMA 3WDUA 3ZR6A 2VOWA 3FFZA 1AHSA 4YM3A 1QJEA 1PZ7A 1RUJ2 1W05A 3E6DA 5FUNA 3LE0A 4BHPA 1JHJA 2CU5A 3OD4A 1E57A 1BBT3 2PHUA 4IEZA 4G3YC 4Q4W2 4A42A 4FPOB 4OMCA 4PIXA 1LECA 5FPVA 1UY0A 1COV2 1TNRA 1C8M3 2WFF1 4WVMA 3G6JB 3ILNA 2I07B 4XF3A 4I0WB 1J1TA 1QNWA 1ZZ9A 5FLHA 4D3WA 4CU6A 3M3EA 2RM22 4ZU5A 4YSFA 4ISQA 3AMNA 2EIBA 2O8OA 1EUUA 1SQ4A 3PUAA 1BLZA 1MEC1 3NL1A 4MADA 4UFHA 1H4GA 2WNVC 3H7YA 2D98A 4LHLA 2RS12 4CP9B 5ANQA 1WCUA 4P9JA 4WM7C 1S2BA 2AREA 3M3QA 5FO7B 4D94A 1DZRA 1OSGA 3KGZA 4GWJA 4YVSA 5A3WA 4NHLA 5I0UA 2UWAA 4NWVA 3HR9A 5J36A 4QGMA 1JH5A 4V1PA 2Y6JA 4PIZA 1LRHA 2F6BA 3WHUA 1NY71 1VR3A 2OPKA 5FYBA 5DZFA 3LWCA 4A7KA 2BFUL 2DCTA 4XJ8A 3WG1A 3MV01 1I6XA 1LGCA 3A22A 3NV4A 2UURA 4XXPA 1DZQA 1LOCA 2CHHA 2WN2A 4HOOA 5F9TA 4OHZA 4I09A 1CAWA 4P9IA 1CR7A 5CVRA 4YZ4A 5HXVA 4FOVA 5C70A 4ISRA 4XFGA 1FT9A 1IZ3A 5T55A 3VKOA 4FP3A 4XQ4A 3JD72 3IIIA 3Q8FA 5FMCA 2QQMA 3POSA 4MH0E 1UIKA 4JQRA 3TN91 2HEWF 3ZN6A 3VUOA 5A3PA 5J98B 1N3OA 1RUH3 1W8OA 1N1SA 2GP3A 3I2KA 2C24A 1OA2A 4ZKTB 5CFCB 4RD7A 1JZ4A 2BJSA 2RM23 1D4VB 1AX0A 2ZGQA 4Y3OA 4YZ2A 1UNBA 4BIFA 1BZWA 4O9EA 2G19A 3O1VA 1ZBA2 5AVPA 2WA3A 1S55A 4GZ9A 4N53C 5JZGA 2D43A 1JYIA 4ASLA 2GMEA 4RQPA 2ADEA 3H7JA 5FLIA 5CAZA 1AYM3 2Q1FA 2DVBA 2WT2A 4OLLA 5FYVA 1MR5A 2EVXA 3TRSB 1US3A 2VZRA 4IQPA 4Q4V3 1DQ1A 2E6VA 5L19A 1RUJ3 1KRIA 1F4AA 4AVAA 2JE7A 4AVVA 1EAH2 2Z2SB 5JIUA 1VBA3 1V9U2 1LGBA 1KQRA 4ZHNA 3UESA 1PIV2 2CSGA 3VBUB 5DMYA 2WNOA 2XUEA 1NCRA 1SZBA 2CV6A 2P5BA 5C33A 4LMFA 2EXIA 5FZ4A 2ZPXA 5F3GA 3E6BA 1R093 1G6NA 1O91A 3VDCA 3HQRA 4RHV2 3PMEA 1VBC1 3RMXA 2VZOA 5HPOA 5JXIA 5JXGA 3LAGA 4QX5A 4X8PA 3U37A 4FBFA 2R041 2A71A 3POIA 1ENRA 4RS5B 1XXNA 5BNPB 1GBGA 4RYDA 1MZ5A 5A7WB 1R1A2 4PDWB 1UY4A 1OH4A 5FWEA 5LW9A 3BU0A 4RR3B 1X9PA 1HW5A 1NLQA 1AYM1 3J7LA 1FOD2 1C5IA 4H3WA 4QKNA 1HRV2 5L7OA 3QACA 1KFXL 2GN3A 3IM0A 3AZZA 3VD9A 4LITA 3MIGA 3VDAA 5IVVA 1NE6A 3KT4A 5A7SA 1EV12 5JSRA 2GC1A 3GJAA 4LEJA 3ZFGB 5A32B 4K3UA 1JBCA 1GOFA 1XRUA 3O14A 4LJHA 1ZM1A 3AJZA 1OLME 5FAXA 2R1DA 4QX7A 4NIGA 4AYUA 2WNEA 2ZHMA 4G9SB 2ZMKA 4L97A 4MXWB 4DQAA 4AEJA 3KT1A 2VULA 2QQJA 1C8NA 2G4IA 3LB9A 3OF1A 4HBNA 5FZ7A 2HH9A 3MFAA 2QVSB 5ABJB 2PHFA 2VCMA 1H2MA 2W52A 2WNVA 3ACLA 3SKJE 1REEA 3H3UA 4HONA 1L7LA 3BTYA 1SLAA 1DYKA 2A7AA 2RMU3 2YB7A 3K4DA 4UFLA 5FIXA
chains in the Genus database with same CATH topology
2HWF3 4LR4A 4CRQA 1PGL2 2R1BA 1BEV3 2D97A 4AFDA 1N3PA 3M7AA 2WINB 2WFF3 4IEQA 4RR3C 3SCGA 2XPJA 3RI8A 1RIRA 3LKJA 1G9FA 4OI2A 2PLV1 1WCSA 2RR11 3VHOA 5EYYA 4Y1YA 3VKLA 2QDNA 1ASJ2 3VBUC 2LTNA 5K8SA 2ZHKA 1PVC1 4XFHA 1I5ZA 1XE8A 1YJKA 3R6SA 4CEYB 1HV0A 2JG9A 4LO7A 4AGRA 3U0ZA 4MGZE 4OUMA 5C4WA 3ZYRA 4LE4A 2PAKA 2JECA 2HKXA 4CDWA 4XF9A 3B7MA 3HAGA 1DGRA 1BBT1 4JRLA 3KM5A 2PAEA 1HDKA 3NKGA 1O5LA 2OZJA 1WMEA 3NWKA 1C3HA 4COUA 3ROUA 2IC1A 1RTVA 2P2KA 1EP0A 1QXRA 4GKXA 4JV4A 1RMU1 1Y3TA 3OJBA 2WT1A 1KD7A 4IV1C 1V6LA 2R073 2VH9A 2DCKA 3RMYA 3RS6A 3VBRC 2VXRA 5JZGC 2DV9A 3RQ0A 2P34A 2N7GA 1PGSA 3MEPA 2NMNA 5AC93 5EFUA 1EYBA 2NQYA 3FBYA 1RUC2 3H3ZA 1BCXA 3I4IA 1W6PB 4FCAA 2BWCA 1VLNA 4YGBA 4LA3A 4JGZB 2Z79A 5F6LB 2JXAA 2WNUC 4Q1PA 3L2YA 3PJQA 1JHNA 4SLIA 4NWWA 2VPVA 4N53B 4ATEA 1W6NB 4N43B 3WP5A 1A6CA 2XJSA 1OFSA 4QPIC 2OZ6A 4GMP0 2CL2A 1VP6A 3KCXA 3BTAA 5KHGA 2KXLA 4L2NA 1UIJA 3UK9A 4OVEA 2RHPA 3W58A 5DZGA 1GANA 2XLGA 1ZBA1 3EBRA 1NE4A 2WLQA 1R092 4CYDA 2ZS6B 1Y9QA 1ZZ8A 2D7FA 4Q4Y2 3ZO0B 2FQPA 3M2MA 4IEOA 1UPSA 4YRDA 5I8SA 4XE9A 2OW4A 1S1AA 5JIAA 2BNOA 3TN92 3WP6A 3OY8B 4JDMA 3V56A 3VHNA 1WCKA 4YGEA 3SH3A 3TOJA 3VBHB 4IV3A 5JOXA 5JDBA 3WQ7A 5LEJA 1W6MB 4R9CA 3CJIC 4YZ3A 4PBOA 2C0ZA 3AZXA 4OHVA 5EZWA 5EXOA 4PLOA 4H14A 1ZRDA 1VBE2 5C8WA 1PK6C 1MS0A 4L99A 2XJUA 4HETA 4K20A 4CP0A 1U5IA 4R4ZA 4NN0A 1FXZA 1JOJA 4LBNA 4FOWA 5FLJA 1QJY3 1RB8G 3ZN4A 3J4UH 2RS31 5GZDA 4FPEA 1IS3A 1QXJA 2DVGA 1OFNA 5K0UC 1LOEA 4XYXA 2I2SA 1ZZ7A 5EV7A 4JTOA 1AYN3 1SLBA 1QH7A 2GDFA 1RVF1 3E5XA 1RUG3 1QNYA 1DU3D 3SNMA 4WVVA 5LK5A 5EJ3A 2FZ1A 1BVVA 1HV1A 2Q1ZB 4I0BA 3CEWA 3VKFC 4LHKA 4AFCA 3JBG3 5FOJB 3HQXA 3T1MA 2VU9A 3RZZA 4XW3A 2XL7A 1DQ4A 3AZYA 3CO2A 5CBLA 4XJZA 1AUYA 1FI2A 2G9GA 3O0VA 1OA3A 1KFUL 1MACA 1A8DA 4BMBA 5AVAA 4Y1ZA 1NY72 5D8AA 2EAAA 3FWEA 5BXXA 3AYDA 1C8M2 2ES3A 2ZGOA 4A7ZA 4BPZA 1BQPA 1WCDJ 1S0BA 4CDQC 3C3VA 4FVVA 1Q3EA 3OGGA 2ENRA 4WV8A 2I45A 2WNUA 1XNKA 4TYSA 1AX2A 2VUAA 4LBJA 1VRH3 2ATFA 3D4KA 3AYEA 1QXPA 5DUVA 2BBVA 1Y7BA 2ZGLA 4QU2A 2HWF1 1J3RA 4AVBA 3I59B 2JICA 3DPRA 1C1LA 4KU8A 5DDJ2 1UMZA 3IWZA 1OPMA 1QWRA 1NCQB 2WS93 2CGNA 3WXPA 3LSEA 1HRI1 3IPVA 3ZVXA 2UYAA 3OCPA 1AYN1 1POV3 1TMF2 4CDWC 2GZWA 2XLFA 4C0BA 1GQHA 5JI7A 4COYA 4ATFA 2DTYA 1YYNA 2XUMA 4CDUA 4XBLA 4JGYB 4F3JA 5J09A 3U07A 1FATA 1REDA 2JENA 1O3TA 4QPYA 5LRSA 1PZ8A 4IXLA 5E89A 2Z69A 1AX1A 4YM1A 4ONUA 1OLQA 2K9ZA 2TUNA 2SLIA 4I0AA 3WZ1A 2OVUA 2BUKA 4N7IA 3WY6A 1RUC1 3TYJA 4AFMA 1IPJA 5BV6A 1PVXA 2VNRA 5CNAA 5FBZA 4E2GA 1QOTA 3VBOB 5BNNC 2B45X 4XIKA 4Q4V2 1H8TB 5BNOB 1KITA 3DUIA 3IDCB 2WQ4A 1BEV2 4FPLA 5FPXA 3WR0A 2UY9A 1PO21 4EROA 1SBFA 3WX5A 3QCWA 5BNOC 1KJLA 1PVC2 4GIQA 4QGNA 4C0HA 5KC6A 2SBAA 4AI8A 1OOPA 1ND2C 1ZA4A 2NYYA 5BNQA 3FUOA 4IEWA 1PO11 4LLFA 3CJIA 1X33A 4W6YA 3LA2A 4MZUA 1FMD3 2OUHA 1R1A3 3VHRA 2P3IA 1ZNPA 3MLKA 4XQWA 1F31A 3JBG2 3N3HA 3NSTA 3VKMA 2EXJA 2WZR3 2C9AA 3MZHA 4S2FA 4YM0A 2XHKA 1ASJ1 1GFF2 1HIXA 4W6XA 1XU2A 4P14A 3U10A 2ARBA 2YV8A 2B7YA 1I3HA 3GHMA 3IDBB 2WC2A 3VZOA 3TN93 1CX4A 3AP7A 1CIWA 1UL9A 3ASIA 4IV1B 3RYPA 3VBFC 5C4WB 3QLQA 4NO4A 3ZIXA 1IS5A 5KHHA 2R16A 2X5IA 4CEWC 1OKQA 1VBA2 3WDWA 4C1WA 4RR3A 1AR71 1RUD1 2UWBA 5ACA3 3TNPB 1MS9A 1ULFA 2WLPA 2B42B 3RWNA 5K0UB 4NOTA 2CWMA 3WW2A 4LBLA 1ZZCA 2MHFA 4IEVA 4YG0A 1PNGA 3ELNA 3ZXKA 1NZCA 3E97A 3W9AA 1EV11 1W39A 3HMYA 4DB5A 4Y1XA 3USSA 1AR91 2DURA 3AMPA 2FMYA 3ZMNA 3VBFA 1PNFA 2XWJB 3BCWA 3ZMOA 2XGXA 1CJDA 1CAXB 4KU7A 2YGMA 3MIHA 2MPFA 2D93A 2HWF2 2A3WA 3L2HA 3PTYA 4GH4C 4UW5A 4GMP3 4BH9A 3VZLA 5FO8B 2YYOA 2JJ6A 4Y1VA 3KSCA 4XFCA 4RHV1 4CEYC 5D1IA 2MEV2 3KT7A 3B3QE 3ZFFA 3UKVA 3ECQA 3AKRA 3WDYA 4Q4X3 5JZGB 1PIV1 5A32A 3B01A 1V9U1 1Q8OA 3FMGA 4KQ7A 5C9AA 4LBKA 3RPQA 1H30A 2AUYA 1AL22 3PMSA 4META 1DF0A 5CFCA 1W0PA 5FO9B 3ALQA 3AXEA 1XNDA 4B4RA 3IBMA 3VL9A 1OPOA 3THTA 3OBTA 1DG6A 1ZRFA 2DFBA 5BNPA 2CY6A 1C4RA 4Z1VA 1DZTA 4QMAA 2DF7A 3WINE 3PNAA 2UU8A 4XJWA 1LU2A 1S0DA 5JSOA 2FMDA 3AMHA 3X29B 1MZFA 1VBB1 4AVCA 3TNQA 3LOBA 5L73A 2RS51 3WP4A 4FQ4A 2R32A 1MZ6A 3M1HA 4XJAA 1B35C 1Q5OA 4N53C 2RMU1 1H1IA 1LHWA 1ZBE3 3MPBA 3OYWB 2HYKA 4TWTA 4XJ9A 1WW4A 3N35A 3LGRA 5K9YA 5BY5A 4R4XA 3ZIWA 5CFDC 4K40A 1HXS1 1H0BA 4P5HA 4Q2FA 4FPHA 4WVMB 1FYUA 2DVFA 3ST7A 1FX5A 1PHMA 4JRAA 5F1RA 1GV9A 1TE1B 3PLQA 1LOAA 4AHYA 1FAYA 2RS11 1ZBE2 3J8F3 3HIFA 4OHYA 2A70A 2CWSA 3WG3A 1WW7A 4Z2WA 5EWSA 3TWIA 1J1LA 4E2SA 2C1FA 1BXHA 2HWC1 4A7YA 3MI8A 2GMPA 3H1YA 4KG0A 5FMOL 3MLLA 1MEC2 2RS32 3B93A 3RNSA 3AXDA 3URFA 2WZR1 3EJKA 4WM8A 1YHFA 1B09A 3OYWA 2WFF2 4ORFA 3N36A 4PF5A 4MGIE 1SCSA 4QPGA 4YVSB 4U2AA 1LESA 4LTAA 3BOWA 1DGWX 4OULA 2DTWA 4AEDC 4D7SA 1YO8A 4RS5C 2FBEA 4CP2A 2CGPA 1O4TA 5B2GB 3M3IA 3ES4A 1LULA 3N7MA 5I93A 2MEV1 4XTMA 3V0BA 5CG8A 3O0XA 3V64A 5HI0A 1PIV3 2GAUA 1B35B 2WZR2 4LUMA 4YVSC 1NYWA 3O5SA 2HWB2 3NW4A 1DQ0A 1AR82 2DCJA 2GNTA 2VW2A 4MYEA 1XE7A 4D69A 1UN1A 2RS13 4JAAA 3WCRA 1GNZA 3OD0A 5T5OA 4UBGA 1LTEA 5DZEA 3VBOC 5BNNB 4Q27A 2FHRA 4EV0A 4KGGA 3SITA 2A75A 1MS3A 4N90A 4N7UA 2ZZJA 4Y26A 3SHRA 3WOGA 5L36A 4AEKA 4Y22A 4HVQA 3AYAA 5DUUA 2YDEA 1UU6A 1RUOA 1SBDA 3KCCA 4J1XA 1BBT2 1WMFA 1AXYA 4GB32 1YNAA 4AE2A 1A78A 3NAPA 4XFBA 4COVA 4K7JA 4KWLA 1XNCA 3B00A 2HEVF 3AP9A 4BOWA 4DXZA 3VZMA 2DUQA 5GZCA 1OLRA 1RMU3 4RA0A 5KXCA 2E7TA 3AP6A 5JOWA 3WDTA 3UKTA 2ILMA 5JVVA 3KD4A 3PHMA 1AR83 3DPRC 1V6IA 4Q8LA 3H1MA 3B9CA 2VOXA 1QJX2 2HWC2 1I9RA 1FMD2 2A6ZA 4PQ9A 1VBC3 1POV0 4DY5A 1ULEA 1ZZ6A 4TZDA 4S2DA 2OUJA 1JW6A 3FBMA 3CU7A 3RSJA 1U5YA 2PAMA 5JOYA 1D2SA 1O5UA 4ASMB 4CDQA 4K1YA 1AL23 4Y5Z0 2B46X 5A3LA 3JD73 1QOOA 1W0OA 5BPXA 1XYNA 1KJRA 1RVF3 1UW8A 1APNA 5JI9A 3INAA 1WLCA 3CJIB 2R49A 2RS33 2WT0A 1QHDA 3USUB 2VQ0A 4YVWC 4QPGC 5A3MA 3VBSC 4QQHA 3POWA 2RS52 4I30A 1D4M3 4XEZA 4IV1A 4XFFA 2ZGRA 1FV3A 2P3JA 2WA4A 3S0MA 3ZYIB 1EV13 3V0AB 4NVPA 4AFBA 1D4M1 1DDLA 2H6BA 4MVTA 2HWE1 1DBNA 5FREA 1MS4A 1QJY1 4IEUA 4E9KA 3OPZA 1KS5A 4M3CE 2BTVC 2BNNA 3WNXA 3V65A 5BYNA 1AJKA 4FOQA 1FNYA 2ZMLA 5T3NA 4CZSA 1REFA 3ZSEA 4PLMA 3MIDA 4XBNA 3M4FA 4DINB 1JXNA 4I01A 3VZJA 1OOPB 2HWE2 1AR72 1RUD2 3AFGA 3UL2A 2O1QA 4TSVA 4P9GA 1GNHA 1CAUA 1H1AA 1HX6A 1J3QA 1N3QA 4Z07A 4M3CB 3AK0A 5GLUA 3JCIA 1OMIA 4JGYA 2D44A 4COZA 1VJ2A 1HRV1 1QU0A 2R0HA 4XQDA 4BM8A 5GM0A 3ZSJA 2WFPA 1RJ7A 4BQ1A 3DF0A 1VRH2 1YI7A 2ZKNA 3AYCA 2ZHLA 2XBO3 3IPVB 1WBLA 4ES9A 1QGLA 3BU7A 1NCQA 2IXKA 4IETA 4WM8C 5JPMB 1YJLA 2YMZA 2V5YA 3VHPA 1ZBA3 2NZ9A 1PVC3 3DN7A 3B02A 4AGGA 3AMQA 5KHIA 3NV3A 4Q4X1 5GLTA 4LO5B 4ES8A 1VALA 4Z92B 1AR92 3WHTA 3WQ0A 3ZDSA 1AR61 2A6YA 3VBRB 1S0IA 1I1EA 4CDUB 5C8CB 1V6MA 2R062 2VQAA 2P37A 2W68A 4XOGA 2GC0A 2BGCA 4WM7B 1NG0A 1QJX1 1S0JA 4W6WA 2QQPA 4X8NA 5CFCC 5D8AB 4YM2A 1X50A 5TSWA 3VZKA 3FUQA 5JSPA 3MF9A 4Q0QA 2WQZC 2DU1A 5DG1A 1YFUA 5CFDA 4BZ4A 1RHI3 4CTEA 3ZX7A 4QQOA 4CP1A 3ZFFC 1EPZA 2ZOEB 1YWKA 2PN5A 4OUSA 1XQNA 1R1ZA 2WSUA 2CNAA 4I3GA 1YIFA 4LHNA 3D8CA 1EY2A 5AFBA 3BIWE 1LU1A 4HANA 4DNYA 1BMV1 1DYPA 1PGL1 4ZXKA 1F5JA 4GH4A 5I0SA 4HK9A 4BMEA 2ZCWA 3SCFA 2Q5TA 2JG8B 2JG8A 2K2SA 1KDKA 2DCYA 2PHRA 3SH5A 3GZTB 1GYKA 5IK4A 2WJSA 1OQ1A 2QKDA 1MS5A 2ZGNA 3WDVA 1G7YA 1DIWA 1HRV3 2ZJCA 4AF9A 5GALA 3ZFGC 4P9LA 1D2QA 4Q0UA 3FZ3A 3MPPG 3NKTA 5H9SA 2ZABA 1IS6A 4EN0A 1TQ5A 2XBO1 4XHBA 2ZHNA 4LBQA 1K5MB 1YXWA 1UZZA 1ZREA 1D0HA 1M4WA 3CF6E 2B39A 4IV3B 4DFSA 1RUNA 2KA3A 3A0KA 1U0AA 3FC0A 2YXSA 1BYHA 2R042 3OY8A 1TME2 2VOKA 4H7MA 2Q8OA 1H2LA 4QD2A 3JU9A 4W65A 5ACA1 5BNOA 2B9UA 4Q4W3 5J37A 3ZPYA 3WP3A 1JUIA 2CTVA 4LUKA 1BMV2 3VBOA 4PIYA 4PBPA 2WL1A 4CDXC 1ND2A 1SFNA 2NN8A 4A3XA 4Z82A 1PM7A 3AX4A 1HQWA 1NQDA 2VNGA 1NCQC 1R082 1IKQA 1XU1A 5FQ0A 2R043 3BODA 5JR7B 4YFWA 2VNOA 2GU9A 5AC92 1U5XA 1DGLA 4JVAA 2HWE3 4AVTA 1SMVA 4N53A 3SXWA 5GKAC 5I91A 2VMHA 2Y0OA 3WG4A 1A8MA 1OOPC 2Q30A 3WVJA 1RUI2 1V00A 2UWCA 5IK5A 5H9QA 2D5FA 1VBE3 1LR5A 1V70A 1AZDA 1HXS2 2R061 5DG2A 1RC6A 3HT1A 2XJQA 4B29A 5JAXA 3LOIA 4M3CA 4OI1A 1BJQA 2H0BA 4BYYA 5KXBA 1PO13 4K1ZA 2W39A 3DPRB 2VW1A 2NM1A 1K5MA 5KXEA 4AQTA 4LBQB 4N43A 1PMIA 1D0GA 3K48A 2JX9A 4FXKB 2E7AA 4Q8KA 1SDWA 2IFWA 4RFT0 2D3SA 3CL1A 5DUXA 4D7TA 4R9DA 4HPKA 3GYDA 4P9XA 4YYOA 3FFQA 1CGPA 5CG9A 1JUHA 4IEXA 2XWBB 3WW1A 4I3PA 4XIOA 1N1VA 4JC1A 4KWKA 4D7YA 1HKDA 3OTFA 4FPJA 5ABJC 1V9U3 3R4UA 4MUVA 1QDOA 2R071 2XVKA 1GQGA 4Q4W1 1ENXA 4EN9B 3IKWA 2OA2A 2ZX3A 3WD5A 4E27A 2HJIA 2VMGA 3D5OA 1LKNA 1GR3A 3SH4A 1Z0HA 3I8TA 3T1LA 4XJUA 3RJRA 1MVQA 1WBFA 3APBA 3GF6A 1WMDA 3VV1A 5HCAA 4MLOA 1VBC2 2C5DA 3NO8A 5JMCA 1GLHA 4GH4B 1QJX3 4WM7A 3OBRA 1PGW2 4XF0A 2NP0A 4IEYA 1CJPA 5J7MA 4FTSA 4DOUA 3NV2A 2VG9A 4ITCA 4AFAA 2D6KA 5DUWA 3QD6A 1O3SA 4COWA 1H1MA 3GBFA 1SLCA 4AQ6A 1F5FA 4FTEA 4PJYA 5E8AA 4U36A 3H9AA 4Q0SA 5IUQA 1R083 1G8WA 2R30A 4XHXA 5T54A 2WNVB 3J9SA 3MDPA 1LOBA 1Q8QA 2GMMA 2XL9A 4M3CF 1WA4A 2YZ4A 2PHLA 3LZZA 4Z8BA 2IFRA 3BOPA 4FAHA 1FMD1 1QJU1 3ILRA 5E16A 3MFCA 4JCKA 2ZX2A 4Y22B 2A73B 5C8CA 3SMHA 1X8MA 5KC5A 3VBRA 4FPFA 3H1WA 3GBWA 2BNMA 1NXMA 3HT2A 1DGRN 2A3YA 2QZ2A 5E1RA 2H0VA 1A3KA 1CAUB 3E5QA 1RUG1 4I02A 5JWPA 5L7OB 3WUCA 3VGIA 3LCPA 4RGGA 2W0XA 4HK8A 4LBOA 1RMU2 3NV1A 4A2UA 4C90A 4ZU7A 5CA6A 3AB0A 1XNBA 1QJZA 3BB6A 5GLVA 1Q8PA 2BVVA 1VIWB 3AKTA 4JGZA 5SV8A 2DU0A 4K6BA 3IMNA 4B7EA 3NAPC 4FO9A 4OHWA 4CDUC 1WD3A 2BEOA 1ULGA 1POV1 3IDEA 1FPN3 4QGLA 1LCLA 1VBB3 1URXA 4EN7B 2JD4A 3ZSMA 4QQLA 4Q4V1 1PGW1 1CAWB 3SISA 2PLV2 2RR12 2VY0A 4HL0A 4URTA 3S30A 3UJOA 3VLBB 1CVNA 4AWDA 2NPIA 2VGDA 3ETQA 3HBZA 4FOYA 4B7KA 1X8EA 4INDA 1MVEA 4HMZA 3D6EA 1O7FA 1OA4A 1VRH1 2BW8A 3KGLA 2WS91 2E53A 1BKZA 1RUC3 4HT1T 2ERFA 2BYVE 3V0AA 1ZRCA 4CDWB 5JLVA 1QY4A 1RUF1 1O4ZA 3KZ4C 4YW5A 2FZ2A 1EAH1 1LB2A 5CB7A 3R4DB 2ZGMA 5FOBB 4Y20B 2V73A 4AGVA 1UAIA 1V6JA 1FNZA 1AVBA 1TME3 1FV2A 2ZBJA 4OHXA 1VB4A 4NHMA 2YHJA 2ZAHA 1QKQA 4PLNA 4FAGA 1VAMA 3AKSA 1LGNA 4YARA 3EHKA 1CPNA 4O9GA 1HQLA 4AHZA 3KCYA 4WBBA 3ZXLA 5C9AC 4XTPA 2K0GA 5GJ6A 2JG9C 4AHWA 3JB8A 1D4M2 3THPA 4Q0VA 4LO6B 4RHV3 3HWJA 3NJZA 4MXVA 1JN2P 1MQTB 4KH9A 5ABJA 2X5IC 4CEWA 2VMIA 5I0RA 1LJ7A 1NLRA 3G7DA 4PDWC 4YW1A 2Z5WA 3JB4C 5I8TA 5J48A 2JE9A 3J26N 2PA7A 3VDDA 1DQ6A 3RI9A 1UZYA 4R9AA 2CAVA 4X6RB 2A6WA 1W6QA 2ARXA 2Y26A 1QF3A 1Z78A 2R072 3AKPA 2PLV3 2RR13 2OYZA 1WGPA 1SBEA 4YZ1A 5GLWA 1WD4A 4PDWA 1AR63 4UW3A 1RUI1 1F2NA 4XETA 2VVDA 1H8TC 1RINA 1H9WA 2ZACA 2QNKA 4M0HA 4HKLA 4EJRA 3I54A 3UKNA 2ZGUA 1C28A 2MEV3 3AMMA 4BLIA 1OHFA 4LE3A 2UYBA 4HSLA 4YGCA 4FXGB 2D5HA 1VBE1 4H55A 5A33A 2IXJA