1ND2A

The structure of rhinovirus 16
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
285
structure length
285
Chain Sequence
NPVERYVDEVLNEVLVVPNINQSHPTTSNAAPVLDAAETGHTNKIQPEDTIETRYVQSSQTLDEMSVESFLGRSGCIHESVLDIVDNYNDQSFTKWNINLQEMAQIRRKFEMFTYARFDSEITMVPSVAAKDGHIGHIVMQYMYVPPGAPIPTTRDDYAWQSGTNASVFWQHGQPFPRFSLPFLSIASAYYMFYDGYDGDTYKSRYGTVVTNDMGTLCSRIVTSEQLHKVKVVTRIYHKAKHTKAWCPRPPRAVQYSHTHTTNYKLSSEVHNDVAIRPRTNLTTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords coat protein VP1
publication title Structural and virological studies of the stages of virus replication that are affected by antirhinovirus compounds
pubmed doi rcsb
total genus 61
structure length 285
sequence length 285
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2002-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1nd2A00
4NWWA 1ND3B 1VBE2 3CJIA 5ACA1 2IZWA 3DPRC 5C4WA 4LLFA 2ZTNA 4QPGC 1R093 5C8CB 5CFDA 4YVSB 3ZFGA 2HWF3 4WM8A 1VBE1 1HXS3 1D4M3 1PVC2 1MQTB 2WWSA 4Q4V3 1NOVA 2RR12 3VBUB 2RS12 4CDQC 2GH8A 1PVC1 5ACA3 4AEDA 1ASJ3 2HWB2 2RR11 2RS11 4Y4YA 1VBE3 4CEWA 5BNNC 1B35B 2HWB1 4RQPC 1SMVA 2X5IA 4CEYA 1PVC3 1AUYA 3VBRB 5GKAC 1ZBA3 1NCRB 2RR13 1RB8G 2RS13 3VBSA 4SBVA 1AL0G 1VRH3 1MQTC 5BNOC 4CDXA 4JGYB 4FSJA 3VBFA 5K0UB 2HWD3 5C9AA 1AYM3 3S6PA 4EJRA 4CDWA 1AYN2 4GH4A 1RMU2 1AR72 1K5MB 2RS32 4YVWB 1POV1 1NCQB 2WLPA 3VBHB 1DDLA 1OOPC 1AYN1 3NAPC 1RMU1 1AR71 5L7OA 2RS31 4CDUB 4IV3B 2BUKA 1V9U2 5FMOS 1HRI2 3IDEA 1RHI2 3ZFEB 4N53C 4RR3B 5FOJB 4PDWB 2WFF2 1V9U1 1HRI1 1CJDA 1AYN3 1RMU3 1AR73 1RHI1 1VBD2 3VDDB 2RS33 5BNPC 1QJX2 4Q4Y2 1EAH2 2WFF1 1PO22 5JZGB 1VBD1 2R062 4BCUA 1QJX1 3JB4C 4Q4Y1 1EAH1 5J96B 1PO21 4GMP3 1V9U3 3DPRB 1HRI3 4QPGB 2R043 2GSYA 1RHI3 1M06G 2R061 2RS52 5ABJA 2WFF3 5A33B 4Q4X2 1R1A3 1X36A 5CFCC 1PIV3 1VBD3 3VBSC 1ZBE3 1QJX3 1PGL2 3ZXAC 1EAH3 2RS51 1RUF3 4CDQB 1PO23 4Q4X1 2XBO3 3J8F2 1A6CA 1C8M3 2R063 1F2NA 1PGL1 1VBA3 4QPIA 2PLV3 1MEC2 1ND3A 1RUG2 5BNNB 3J8F1 5C8CA 4RQPB 4YVSA 2XPJA 2RS53 4Z92B 1MEC1 1RUH3 1RUG1 1AL22 4RS5C 1FPN2 3VBUA 1AL21 3J8F3 5D8AC 5BNOB 1AR63 1BEV2 1FPN1 2HWC2 1RUG3 1QQP2 1B35A 5DDJ2 1BEV1 1RUE2 1QJY2 2HWC1 4IV1C 1RUD2 1RUI2 1QQP1 1AL23 1H8TA 1OOPB 3NAPB 5DDJ1 1FOD1 4RHV2 2RM22 1CD3G 1RUE1 1NCRA 1QJY1 3VBRA 1RUD1 1FPN3 1RUI1 3JD72 2ZZQA 4NWVA 4JGZC 3HAGA 4RHV1 4N43A 5A32B 2RM21 2BPA2 4N53B 1ND2C 4WM7C 4FTEA 1VBC2 3JD71 1NA1C 5DDJ3 2HWB3 1QJY3 5BNPB 1PGW2 1VBC1 1RUI3 4YVWA 3FBMA 1NCQA 2FZ2A 3VBHA 2RM23 1PGW1 1QJU2 5AC92 4CDUA 1NG0A 1QJU1 3ZFEA 1VBC3 5AC91 3CJIC 1VBB2 5C4WC 4Q4W2 4PDWA 5CFDC 1VAKA 3ZFGC 3M8LA 5CFCB 4WM8C 3VBSB 3VDDA 1VBB1 1POV3 4Q4W1 1TME2 3ZFFA 5JZGA 1W39A 1QJU3 5AC93 1RVF2 1TME1 4AEDC 2QQPA 2TBVA 3DPRA 4QPGA 1OPOA 4CEWC 1RVF1 1H8TC 1VBB3 1RUJ2 4Q4W3 5J98B 1F8VA 5A33A 2WZR2 1NY72 2WS92 2X5IC 4RS5B 1GFF2 4CEYC 2BFUL 1RUJ1 1TME3 2WZR1 4N43C 1NY71 2WS91 5D8AB 3VBOA 1RVF3 2ZAHA 4Q4Y3 1COV2 5BNNA 4CDXC 3VBFC 4RQPA 5C9AC 4IV1B 1BMV2 1RUJ3 1COV1 4CDWC 2WZR3 4GH4C 2WS93 2RMU2 1BMV1 1WCDJ 4JGZB 1HRV2 4Q4X3 2DF7A 2RMU1 1MQTA 3TN92 5L7OC 5BNOA 4WM7B 1ND2B 1COV3 1HXS2 1D4M2 1HRV1 1Z7S2 4Q4V2 4GMP0 3TN91 1NA1B 3ZFFC 1AR92 1HXS1 1D4M1 1PO12 1MEC3 1ASJ2 1Z7S1 4Q4V1 2RMU3 1OOPA 3NAPA 1FOD2 1AR91 1PO11 1RUC2 1ASJ1 1HRV3 3TN93 5A32A 4N53A 1RUC1 3CJIB 5C4WB 1Z7S3 5CFDB 3ZFGB 1ZBA2 4WM8B 4JGYA 5ABJC 1AR93 1BEV3 1PO13 3JB8A 2HWC3 5K0UA 5BNPA 1QQP3 1VRH2 3VBOC 1ZBA1 2HWD2 4Y5Z0 1FOD3 1AYM2 1RUC3 1K5MA 1RUE3 1RUD3 4AEDB 1VRH1 2HWD1 5FMOL 4QPIC 4RHV3 1AYM1 4CEWB 1EV12 1ND3C 1H8TB 2R072 3JD73 4IV3A 5C8CC 4YVSC 2X5IB 1QJZA 5CFCA 4CEYB 1EV11 1AR82 4RR3A 2R071 1VB2A 1FMD2 4N43B 1TMF2 1VB4A 3LOBA 1IHMA 3VBUC 4FTBA 1AR81 2MEV2 1FMD1 1HQNA 1TMF1 2Y26A 4CDXB 3VBFB 4GB32 5C9AB 1EV13 2BBVA 2MEV1 2R073 1B35C 4CDWB 4GH4B 4GB31 4RS5A 3JBG2 4FTSA 1AR83 1FMD3 2R042 1TMF3 5D8AA 1OHFA 3VBRC 5L7OB 1NCRC 1R082 1BBT2 3JBG1 2MEV3 4GMP1 2R041 2HWE2 1R1A2 4CDQA 1PIV2 4JGYC 4GB33 1ZBE2 5K0UC 1R081 1BBT1 3ZFFB 4IV1A 1RUF2 2XBO2 2HWE1 1R1A1 1PIV1 1C8M2 1ZBE1 1K5MC 1VBA2 3JBG3 2PLV2 4YVWC 1RUF1 1NCQC 2XBO1 3VBHC 2VQ0A 4JGZA 1POV0 1C8M1 4RFT0 1VBA1 1R083 2PLV1 1BBT3 4CDUC 1RUH2 4WM7A 1ND2A 4IV3C 2HWE3 1R092 1NA1A 2HWF2 3ZFEC 4RR3C 1C8NA 1RUH1 5ABJB 2FZ1A 4PDWC 1X33A 1R091 3VBOB 2BFUS 1AR62 3VDDC 2HWF1 1HX6A 5ACA2 5JZGC 5LK7B 1AR61 1E57A 4QPIB
chains in the Genus database with same CATH superfamily
4NWWA 4IEYA 4X6QB 1UZYA 5ACA1 1LHVA 2IZWA 3Q8EA 3ZSMA 4LLFA 4XW3A 4Q2FA 1J84A 1SEFA 2QCSB 1R093 3CKHA 3LZZA 4Y3OA 5CFDA 4YVSB 3ZFGA 4PLOA 3GXUA 1NYWA 2VVDA 4HG6B 3QH6A 2JE7A 4XBNA 4BHPA 3HPNA 1S0JA 3LAGA 1ZZ7A 1G9DA 1AXZA 1D4M3 2ZABA 5GJ6A 3UJOA 2DVAA 2WWSA 1UNBA 2RG4A 2D43A 3NNLA 4XQWA 1BYHA 3DL3A 2CDOA 2RR12 3K75B 2GU9A 4EN7B 1F5JA 2RS12 5ACA3 5FIXA 4R9DA 2VOKA 3C3VA 3WF0A 3LFMA 3A22A 3KT7A 1W28A 1BLZA 1ZX5A 2WO3A 5C33A 2W92A 4K6BA 3N3HA 3VDAA 4U36A 2EICA 3AMNA 5C3RA 4XUQA 3OGJA 1SZBA 1DZTA 2DCKA 3IDCB 1RINA 4LBQB 3MF6A 2HH9A 5HBAA 4EQVA 3WR0A 3I2IA 3PNAA 3K51A 5G04L 4ASKA 3LQCA 5L36A 4HN1A 3VBRB 3TOJA 1ZBA3 2GMMA 4ZZ5A 1JZ3A 4AF9A 4NIGA 2VOTA 1RB8G 4P9YA 1V00A 2B9UA 3VBSA 2OIIA 3JU9A 3E5XA 3ATGA 3USSA 1IGOA 1WW4A 2WN3A 4OMDA 5FZ6A 1GR3A 4CCNA 4QX8A 4JGYB 4XIOA 5K0UB 3RNSA 2ZXQA 5C9AA 1AYM3 3PTYA 4M3CF 3S6PA 2CWMA 5FY1A 1UY1A 2JG8C 5IFPA 1K5MB 4CRQA 4ARXA 4D6QA 1F15A 2LS6A 1POV1 3AKSA 2GNTA 5C5UA 1ODMA 1YJKA 2B39A 3BOWA 2CDPA 2WLPA 1SLAA 4X8PA 3VBHB 1GWLA 1DDLA 3NAPC 3VUOA 1X9TA 5JMCA 3E97A 1UOBA 4UOJA 4Y1UA 3ZR5A 1W8NA 5L7OA 3BTYA 1CAXB 3HIFA 4GA9A 3FHQA 3X29B 5A1AA 2XL7A 1W6NB 1SLBA 4FAGA 5IATA 2H0VA 1JYIA 2DFBA 3HJRA 3JQWA 3R4UA 4YM3A 3CF6E 3SCGA 2Y8KA 1YHFA 2BBAA 2VZOA 4FQ4A 5E88A 1T6BX 4IW3A 4PDWB 1C5IA 1HRI1 2W2IA 4BQ4A 1CJDA 2VTFA 4NMIA 5FP8A 2BVBA 4LJHA 4MGTA 3T2TA 4R8HA 3VDDB 5FUNA 1ULDA 4BZ4A 1PK6C 1V6NA 2ATFA 1EAH2 4GIQA 4OI4A 5DUVA 3S30A 4EV0A 5JOYA 1PO22 4QX1A 4AVVA 2VECA 4A45A 5A3UA 3LEMA 3I2OA 2N7GA 3PU8A 4QKNA 1QJX1 3BCWA 1J83A 4QB2A 4PQQA 4XMAA 4I3PA 4LKEA 1HRI3 1CAWA 2Y0OA 2VM9A 2DWRA 1QJEA 1Y9QA 2GMEA 4AQTA 1J3RA 2ARAA 1IKPA 4B7EA 1H30A 5FP4A 2RS52 1XE0A 5C3SA 3QACA 4JTOA 2BGPA 5KXBA 2GMPA 1EPWA 3RMXA 3O1MA 3WW2A 3HQRA 2YG0A 3S7IA 3SEPA 2B45X 2FCTA 1AX0A 1GP6A 3K77A 2C4XA 3VBSC 1QJX3 2ZJCA 3B3QE 4IQPA 3D82A 2PXJA 2ZACA 1ENXA 1Q56A 4BXSV 4Q4X1 4DZGA 4YLZA 5EJ1B 3ZXFA 3UETA 5K7PA 1H9WA 3RYPA 4MXWB 4QXHA 4OCTA 5L73A 1PGL1 3B9IA 3RVHA 1D4VB 2Z42A 4UF0A 2PLV3 2KM2A 1CAUA 1ND3A 1MZEA 5DZEA 3T2QA 1VR3A 2YBSA 4AE2A 3B00A 1W8FA 3FJSA 3J8F1 4Q8KA 2UYAA 1I3HA 3H1MA 4P9LA 4Z92B 4P9XA 1RUH3 4FPJA 4UBHA 4QGNA 5DG2A 3J7MA 4IGOA 2FD8A 2K2SA 3POJA 2WNEA 2AEZA 2YROA 4E2GA 2YMZA 4NE9A 5LBFA 4J25A 3I2GA 4JCKA 3MDPA 5FZLA 2W3JA 2E31A 3J7LA 3VKMA 5HPOA 3J8F3 1QXRA 5EWSA 1JXNA 4HETA 5DAWA 3B9CA 3H1YA 3AX4A 3DN7A 3CMGA 1OF3A 1IOAA 2YY1A 3NKGA 4MGQA 3KLSA 1OURA 1B35A 2JG8B 5FJHA 3UKTA 1LOAA 2QDRA 2VMEA 3MFAA 4KG0A 3WDWA 2HWC1 3OGVA 1RUI2 2YU1A 3POWA 4V2WA 1C57A 3RZMA 4IE6A 5IYYA 4DXSA 1ZZCA 1GZ9A 3NAPB 1O6UA 3ECQA 1YC61 5DDJ1 4RHV2 1HQWA 4PF1A 1QJY1 1IS6A 2RDSA 1RUD1 3WDTA 4LT5A 3O1UA 3VD3A 3JD72 2UWAA 2WYFA 4JGZC 1FNYA 5FZBA 2VMIA 3VD4A 4N43A 3PURA 1YXWA 2A3XA 1LAJA 4Y22A 4CCCA 1VBC2 2JD4A 2WT1A 5FQ0A 5FUIA 5HV4A 3KSCA 3UGHA 1CX1A 1O7FA 2GP3A 2DCJA 3KGZA 3AZXA 2BNNA 2HWB3 4J1WA 4XUTA 1CQ9A 5DDJ3 1QJY3 1MVQA 1PK6B 3IPVA 3PMSA 4XDOA 1T6GC 1STMA 3B69A 5DUUA 5FPXA 2PAMA 3THCA 3ZXEA 2GAUA 1WBFA 5T3NA 1NXMA 3THPA 2NPIA 1WA6X 4N9IA 1NKGA 1PGW1 4QDQA 4Z2AA 1EPZA 4CU8A 4PLMA 4XCAA 4AGVA 3FBYA 1NG0A 5FKBA 3H8OA 1TZOA 2W95A 1H4GA 1REFA 1W6QA 4UW3A 3HT2A 3POYA 1WD3A 4JRAA 4LO5B 3IN9A 1QJU1 3ZFEA 5CYYA 4OQ9A 2BQPA 3CJIC 1VBB2 3APBA 3ST7A 3P3PA 1ULPA 4XJUA 3RYRA 4GWJA 3M8LA 3KMHA 2IFRA 3VBSB 2YC4A 3N9LA 3BPZA 4CUAA 1CESA 5F9TA 1KFUL 3DYPA 4LIVA 2RV9A 1V0AA 3D8CA 3D4KA 3P6BA 5K4LA 3TRSB 4XJ9A 2VUJA 2ZS6B 3FN9A 1LHNA 1AZDA 1QJU3 2JG9A 3VD5A 2XG3A 1KXGA 1I5PA 3N35A 2ZEZA 4XEZA 5FP9A 1RXGA 2ZX3A 3GBFA 4QPGA 1UX7A 1VALA 3AKTA 4W50A 2NQYA 4D7SA 3FHAA 4FPHA 1W0OA 3BODA 3CO2A 4Y1YA 4DRRA 4D6RA 3O1PA 1UZ0A 3KQRA 3P5BA 3R4SA 5APAA 5JSPA 2CWSA 1AVBA 1UXZA 3UT0A 4CEYC 1GZWB 1X7NA 5HCHA 5IVJA 2UWBA 5EJ3A 2MHFA 2UU8A 5DZGA 4N43C 1NY71 4DUXA 4XJ8A 3ZYIB 3FLTA 2XHKA 3OUJA 5I8SA 1S0EA 4INDA 1BVP1 2ZAHA 4UW4A 4XIKA 2C9KA 4Q4Y3 4CCDA 2IUWA 1J1TA 4RGKA 5FK7A 2ZGSA 5I0UA 5SV5A 3IDBB 4CDXC 1W6PA 2R32A 2D6LX 3PUAA 1L7QA 1EY2A 1OQEA 4RQPA 2OPKA 2XWBB 3IMNA 1BMV2 4FAHA 1FT9A 1LU1A 2Q8EA 5A7WB 4FFGA 4YW3A 3MLKA 4OUMA 2Z4FA 4GH4C 4PF5A 3K3NA 4HVOA 1MZFA 3W20A 5LEKA 5FZDA 4H7MA 5KXCA 2BNMA 1W9FA 4CPBA 4CUBA 2KR2A 1R64A 4JGZB 1HRV2 5LBCA 1DYOA 1WKYA 2DF7A 5FPVA 5KHHA 1JOJA 4QDSA 1MQTA 3TN92 1BJQA 4S2FA 5FXWA 4TN7A 3ZVXA 5BNOA 3IAQA 1G86A 5LWBA 1QOSA 4JRLA 4F83A 1XU2A 3K4DA 1BKZA 3WVJA 1VAVA 4D3WA 4PBOA 4Q4V2 3HT1A 5K8SA 4Z1VA 4XUNA 4M4PA 1UKRA 2AEYA 2VMCA 5DPNA 2B4KA 3TB0A 1MEC3 1NZCA 1YQ2A 3GBGA 3LPGA 4GJYA 2PHDA 4ZPIA 3V56A 3DYMA 2VW0A 4COUA 4Z8BA 3N9MA 4GWIA 3OF1A 1OOPA 1AHSA 4RSUA 4GALA 2YYOA 4BQWA 4Q5OA 3SC7X 4I3GA 4CSWA 1CVNA 3TEYA 4MOAA 1UW8A 2CAVA 3DYOA 1WW6A 4M3CA 4A41A 5C7GA 1ASJ1 3HBZA 4CP9B 1ULOA 5FJKA 4OI1A 4KBZA 1BZWA 1JZ7A 4N7UA 3LB9A 2J1VA 1RUC1 3CJIB 2PQSA 3O0XA 1DQ0A 3FFQA 4EYUA 1XU1A 2NYYA 5ABJC 5BNPA 1BEV3 1W6MB 5AVAA 3JB8A 4KG8A 5FPLA 1JN2P 3DKWA 1QQP3 4S2HA 1DCSA 1DYPA 2YBPA 1REEA 3V0AA 4A3ZA 2FDGA 4I02A 1HV0A 4A4AA 1RUC3 1UY0A 2QBXA 5FZ1A 4KU7A 3HWJA 5FLIA 1GP5A 1O8PA 2XJQA 1VRH1 4NJ4A 3ZOIA 2Y6KA 4GKXA 2A3WA 4Q0QA 3VZMA 4LEJA 3WG3A 1LEDA 1T2XA 1G9FA 2R49A 4UYBA 3M4FA 2R072 3POBA 5F1RA 3WF1A 5LA9A 2CHHA 1I6XA 2GH2A 4IV3A 5C8CC 3ACGA 4P08A 2BOIA 1E5RA 4CEYB 5BV6A 1BXHA 2UY8A 5FZEA 1EV11 4UFLA 4Y5SA 5BPXA 3T1MA 4A2UA 3NNMA 1CR7A 3KB5A 4NO4A 2CU5A 2VGDA 4N43B 5F5QA 4XJWA 5EXOA 2XJSA 3R0RA 4K8FA 1PGSA 1AR81 5A3LA 3KCXA 3GM8A 3J7NA 4C91A 1ULGA 4LKSA 1GICA 4Y33A 3GJAA 5CKQA 4CDXB 3AMQA 3L2YA 5JMOA 2R0HA 3H50A 2G19A 3OBTA 5HXVA 3EMRA 3VHPA 1EV13 2W47A 4P00B 3WDYA 3VGIA 4D69A 1Q5OA 3CIHA 4IXLA 4KNCA 4NOTA 5DABA 3U11A 5I8TA 4GH4B 1V6JA 1DBNA 4DS0A 4DXRA 2Q5TA 3BVCA 2BVVA 4GB31 2XUMA 4ZXEA 3FZ3A 1W8OA 4HVRA 1YRZA 3ME2A 4Y20B 4LO4B 4Q0PA 3WX5A 1AR83 3E6BA 5IFTA 1GWMA 3NNJA 2Q8OA 3UYJA 2FDJA 5FY5A 4FXGB 3KCCA 1DGLA 4TLFA 5GLTA 1NCRC 2VNRA 4OYUA 3GCWA 2VAUA 3WINE 4QXCA 2WQ8A 2R041 4QGLA 4XF3A 4Q0UA 5JCTA 5FRAA 1CN1A 4GB33 2XLAA 4M0HA 1BBT1 3NMBA 2VBBA 4MYEA 1SPPA 2XJPA 4YGDA 1JOPA 1NE6A 1R1A1 4TSVA 5T50A 1XYNA 2DBIA 4LHLA 1PIV1 3H42B 1ZBE1 3M2MA 1VBA2 3MIFA 3WP4A 4D7TA 3NQHA 2KXLA 3AJYA 1O3TA 2JDNA 1NCQC 1UZWA 2BWAA 2CAUA 1H1AA 2D6PA 1F31A 1LEMA 2H6BA 1C8M1 2SBAA 5LZ6A 1JYNA 3KD4A 1BBT3 4CDUC 2WNUA 4WM7A 2LM3A 4IV3C 1N3PA 2XL9A 1H6XA 5FY7A 1MPXA 1OD5A 3EO6A 3KQ4B 4JAAA 3WUDA 1RUNA 1NLRA 1NA1A 2HWF2 4K7JA 4NAMA 5FO7B 1C8NA 3M3QA 1CIYA 2GNBA 3ACHA 3USUA 2FZ1A 5ABJB 4AEJA 3H1WA 4MGZE 3WXPA 4P9WA 2Y0IA 3NNFA 4N7IA 4UI9L 1W05A 4KGQA 3O5SA 4XILA 3D6EA 4XUPA 5TSWA 3WD5A 3ZIXA 2JDUA 5A6XA 5ERLA 3K4ZA 4ASLA 3G6JB 2B7YA 3JUUA 1ZA7A 1S4CA 1DLCA 4FOQA 5JZGC 3OGRA 1DYKA 1JBCA 4G4FA 1AR61 4DNYA 2VZ3A 3HOBA 2GNMA 1AR62 4FOVA 1VBE2 2WABA 4O7XA 3DPRC 5A6QA 2ZTNA 4QAWA 3LF7A 1OXCA 5C8CB 1XNTA 4OZXA 3MICA 4QXKA 3O12A 1ZRDA 1TVGA 1HXS3 5GZDA 2VZUA 4QX0A 2AGSA 1MQTB 3SXWA 4BQ3A 5IVFA 3ZYJB 4LMFA 4CCMA 4LPLA 5A3NA 5LRSA 3MW4A 5I8YA 3CBNA 4YW4A 1Q8QA 4AFAA 3ZXDA 4JHTA 2AZ5A 1F9KA 3I2JA 4XQDA 1VRBA 1PZ8A 3LWCA 2QJVA 2C0ZA 4Y24A 4CUGA 4DINB 4JKKA 2RR11 1C5HA 2PELA 4FPEA 2RS11 3RS6A 4CEWA 4CE8A 1JUIA 1PX4A 2K9ZA 1X8EA 4I30A 3AL6A 3I54A 3B93A 1GQHA 2VMGA 4YZ3A 2X5IA 4BWOA 1ONAA 5IK4A 3WG4A 1MVEA 3INAA 2PHXA 4H7LA 2QE3A 4TYSA 4E2SA 4BPZA 4CCJA 3OB8A 1H2KA 2WNUC 1WCSA 1ZZ9A 1ALYA 1NCRB 2RR13 4COZA 3AYEA 5IK8A 2V5DA 2RS13 3AKQA 3U07A 1DQ4A 2C26A 2ZOEB 1JTZX 3IB3A 2X09A 3I2FA 4AHXA 4DEQA 4E4DX 1RUOA 1SLTA 1LENA 2HJIA 2DYCA 3AP7A 3CEWA 3NJZA 2HWD3 5L9RA 5T5LA 4JQTA 3K46A 4KWJA 2ARCA 4FFHA 2D3SA 3MFCA 5FYIA 5I91A 5IHRA 4QQPA 2DVBA 5I0RA 3V0AB 4CDWA 1W3VA 3ZYHA 1UOFA 5AFEA 2WNOA 1CIWA 3KZ4C 4XJAA 4MG2A 2RS32 4OMCA 5IAVA 1QMJA 3MW3A 4YM0A 1JU4A 3MBWA 3S5AA 1NCQB 3WNPA 1QU0A 4XE9A 1WW5A 3ORJA 3V64A 3AZYA 4KQ7A 1F5FA 1G7YA 4F3JA 1LCLA 2CSGA 3FWEA 2JDAA 4CDUB 4IV3B 5LATA 1DGWX 2BUKA 5F8PA 2OS2A 2TUNA 4C0BA 3I7DA 3LIHA 2EVXA 4D94A 5LBEA 5L19A 2E33A 2VMFA 4NRQA 2XDVA 3LEKA 1G9BA 4N53C 3ZN5A 2RJLA 3HVDA 3WV6A 2FDFA 3AYAA 4YW1A 2WFF2 2WRAA 3RJ2X 3VZJA 4CP0A 1OVSA 1UIJA 2EALA 3JZVA 3AKPA 5FZHA 4ISQA 1VBD2 1KITA 4B1LA 1IKQA 4BA6A 1IQAA 3CZUA 3ZXGA 3JQXA 3NRUA 1O5UA 4P5HA 3U14A 4AQ6A 5JZGB 2YZ4A 5H9RA 2WT2A 2NMNA 4GQ7A 4BCUA 4URAA 1UXXX 1EAH1 1HN0A 4DUWA 5B4NA 3E6CC 1PO21 2V4AA 3BGAA 3AP4A 3DPRB 4CA9A 4Y1XA 4OQ8A 5GZGA 1M06G 1U5ZA 5FZ0A 4NHKA 2G1MA 1FV2A 3E1F1 5A33B 4XTMA 4JKLA 5FY0A 5AVPA 5A3TA 2UWCA 4ARYA 1L3JA 2C9AA 2ZKNA 4MGKE 3NO8A 2XJUA 1EAH3 2G9ZA 2RS51 1OMIA 1RUF3 1PO23 1MS1A 2XBO3 2BYVE 1IS5A 4LULA 2WWUA 1MR5A 2W0XA 3T30A 3O1RA 1LODA 3KHCA 4UW6A 2BZDA 3GZEA 4JQRA 3HR9A 2JDKA 1OPMA 3S0MA 4UFHA 3EB7A 4DO0A 4GXLA 3I3EA 2RS53 1GQPA 5F6KA 2TEPA 3LD8A 2PMWB 4Y4RA 3QBQA 4NIIA 5JXGA 3MF9A 1QNWA 1HB2A 2WNUB 2ZGUA 2ZHNA 3I3DA 4RD7A 4RS5C 3VHRA 2Q4SA 4LBQD 1FPN2 3P3NA 3VBUA 4Q29A 1ACCA 3MZHA 2I07B 3ZYRA 3QLQA 1N1VA 2ZEYA 3B5LB 5D8AC 4QX3A 1XYPA 5FPBA 3N7MA 4BU2A 5J37A 1OQDA 3UNPA 1WMDA 4XZUG 4E8CA 4LBLA 2ZPXA 1JZ5A 3PJQA 5FTTC 1H0BA 2VBDA 3FL7A 2JIJA 3ZYBA 1DGRA 3GHNA 4CUCA 1RUE2 1WMFA 1H1MA 1W04A 2HKXA 3RZZA 5FYTA 1H8TA 1LOEA 3TEZA 5I0SA 2CGPA 3ITQA 4BK5A 5FYMA 2G9GA 4BH9A 3MLLA 4PBPA 4PQ9A 4D8MA 1RUI1 1UX6A 2GN3A 1TNFA 4AR2A 5T5OA 3AFKA 1SFYA 2ZZQA 1PMJX 1LKNA 4WVWA 4DY5A 5J48A 4RHV1 1A78A 2I2SA 3E6DA 2BPA2 4N53B 1UQXA 2ADDA 4IE0A 1LHWA 1XNDA 1SBDA 3JD71 4IE5A 4I0WB 2EIEA 4M00A 1ZA4A 5E16A 5DMYA 1VBC1 2WNVA 1RUI3 1XBFA 4YVWA 4AQSA 2FMDA 2W39A 4XUOA 1JYCA 1PM4A 5JWPA 1HJGA 2D44A 3RPQA 4AAPA 3PDQA 4EZHA 3EXUA 2YPDA 4PIYA 3MUY1 2EA7A 4BJ0A 1W8WA 3HD8B 1F4HA 3K4AA 5KBFA 4XXAA 5KHJA 2JE9A 3H3LA 5KXDA 4IL7A 1CZSA 1VBC3 4R9BA 4XOGA 5JLVA 4WBBA 1PHMA 4QM9A 4YW7A 3M3EA 3SCFA 2A6WA 3WDXA 1G8WA 5CFDC 3ZFGC 1YI7A 2J1RA 5C3QA 3OD0A 2FCVA 3WUCA 2FQPA 3IKWA 1VBB1 5IUQA 4CP1A 1POV3 3GJBA 3FFZA 4PI0A 5FR3A 4CXWA 3EJKA 3C2UA 3PIJA 5FZIA 1U5IA 4XACA 3M7AA 1RVF2 2GDFA 3MIDA 2EXKA 4FFIA 4UXAA 3AZWA 4BB3A 2GC2A 1SLCA 2EIDA 4W4ZA 1W03A 4LO7A 4A6SA 4AFDA 2OX0A 5A3PA 3PVOA 1QNYA 3OPWA 4NIAA 4OI2A 1H8TC 1VBB3 5F2SA 3V0BA 1RUJ2 2P6HA 5J98B 4LR4A 5KHKA 2WZR2 2PAKA 5EZWA 1LRHA 1Y7BA 2QZ2A 3POEA 3OYWA 4RS5B 1GFF2 1O4YA 1Y4WA 2JDMA 1GV9A 3BU7A 2BFUL 3H3UA 3LDKA 3LEGA 4FPOB 4HPKB 4LUKA 4TXWA 4U2AA 1K45A 2Y6FA 3GZUC 2X29A 3IAPA 3T2PA 4AVSA 2BU9A 3AYCA 5D8AB 4CCEA 4META 2R30A 2B8MA 4QKFA 3FUOA 5D2AA 1IS3A 1COV2 4KI5M 4LBMA 4E9KA 2ZGNA 3UGGA 4QT6A 1L7LA 5BNNA 4C90A 2DVDA 2H6CA 5I93A 1ULCA 4AXOA 3WNLA 5AFBA 5C9AC 3LA2A 4A7KA 3ZXKA 3AFGA 3LPFA 1SFPA 1CJPA 3L2HA 3M3IA 1D2SA 4HFSA 2QQJA 1OBNA 1WLTA 2RMU2 4L92A 4I0AA 4ES9A 1FAYA 4IGPA 4R4XA 4LUMA 1BMV1 4AI9A 4MH0E 3I49A 2XKOA 3ZYPA 1OKQA 1YO8A 1Y9MA 2LALA 2GN7A 3ACFA 2Y6JA 4Q4X3 2IXJA 2JJ6A 3ZN6A 1IG3A 5L7OC 4LA2A 5KR7A 2ZX2A 2Q8DA 4EN0A 4RL7A 3NL1A 1D4M2 3CHXA 2WZPP 4FPCA 2K0GA 1HRV1 1BQPA 1JYVA 2B42B 5FY4A 1IPKA 3TN91 3WW4A 5EQUA 3ON7A 1KQRA 4E4HA 5K9YA 2VXJA 5FZKA 3EYPA 3DEMA 4MX3A 4XHBA 4NR1A 4V2VA 2ORZA 4AFBA 2JICA 5GZCA 1NZIA 2QNKA 1PM7A 4Q4V1 4XTPA 1GU3A 2R0FA 4AG4A 5GZFA 1AJOA 5A7OA 4FPYA 3M70A 4YNIA 5FZOB 2VOVA 4L2NA 4V1PA 5E8AA 1UF2C 2OZJA 3OCPA 4UFMA 5A3WA 4AAXA 1HRV3 2OVUA 1N47A 4OHWA 4XJZA 2WC2A 3TN93 3O14A 4MZUA 5C5TA 1QOOA 5A32A 3AB0A 1REDA 4DQAA 1UPIA 2OQ6A 3G7DA 3RMYA 3RWNA 2J1EA 2QKDA 2VUAA 3GZTB 2ZHKA 5CFDB 3ZFGB 4QMAA 3SNMA 1ZBA2 4H55A 5A3MA 3PUIA 2H0BA 2BP6A 2F4LA 3AVRA 4YYOA 2Y33A 2HWC3 4LITA 4TZDA 1UU5A 1V6LA 1POQA 2RDQA 2WAAA 4QKBA 1S1AA 2JENA 4YM1A 1S2KA 2XVLA 1AYM2 4GZ9A 1RUD3 5SV8A 1UYYA 4FP2A 1FXZA 5F2WA 1X9PA 5ISLA 1WGPA 3AXEA 3MUZ1 2J7MA 2BGCA 3WNOA 3THTA 3CJXA 3OY8A 1ND3C 5C70A 1H8TB 3ZX7A 4P02B 5ANQA 4QU1A 2VH9A 3DXUA 2IXIA 5C71A 1QHDA 3CZJA 1J1LA 3IIIA 3WT3A 5CBLA 3AVSA 3UGFA 5CFCA 1Q8PA 1X8MA 4HK9A 2GNDA 3DCQA 4KGGA 3C7OA 1O4ZA 1K12A 2R071 4XFCA 1VB2A 2CL2A 3OOXA 2ZX0A 1FMD2 5FP7A 1TMF2 1U12A 2JIGA 3D0SA 2P37A 5EP9A 1BVVA 1X50A 2WO1A 1BHGA 3AL5A 5FYHA 1YQCA 2B9VA 4L99A 3VN4A 2HBTA 1HQNA 1TEIA 4XF9A 3MEPA 4K21A 2Z69A 4WVMA 3WNNA 1UMZA 3I59A 2EXHA 2W1UA 2Y34A 4MO3M 3RQ0A 5C9AB 4AEMA 5CB7A 4XF4A 4BQ5A 2R073 3UESA 4LNVA 1B35C 3MHZA 5DN2A 3AZZA 3IBMA 2Y60A 4ZU5A 4ES8A 1ZRFA 4XPVA 1S2BA 1S0FA 2D93A 2VNGA 4IEPA 1O3SA 1CAVA 2I74A 3HQXA 3I3BA 3NKTA 3O0VA 1XNAA 1J3QA 3B02A 1C1LA 5L7OB 3WW3A 5F3EA 5EIYB 4DMIA 2FDIA 4ATFA 4D0QA 4GMP1 2JE8A 2LROA 4IETA 4BMEA 1ZZ8A 3W21A 2Q0AA 2HWE2 1UOGA 4L97A 1GUIA 5G05L 4ZU7A 3CNAA 2O0OA 4XCBA 4AVCA 2F17A 1VPHA 2LTNA 4IV1A 4L0PA 5F5IA 3LSDA 3BTXA 2NM1A 4LA3A 5E6HA 5EHDA 1QJFA 5IW0A 3WG2A 4OI0A 3DECA 4KMQA 5FZ8A 2PLV2 3OG2A 5FK8A 3WLUA 5JOZA 1O8SA 4B4PA 1W6OA 2VQ0A 4MADA 1POV0 1YEWA 2E26A 2VCMA 3HN1A 3U37A 3ENRA 4OVEA 1VBA1 1RUH2 1ND2A 3WZ1A 1U5XA 1KJLA 1DQ6A 1W9YA 4ISRA 1CAWB 2D6OX 2XJTA 4A44A 4AEKA 4NHYA 3GYDA 3PU3A 2WUHA 3O1TA 2IWGB 2O14A 2ZEXA 4XFFA 3ZFEC 3N7LA 5FPAA 4HOOA 4EN6B 1QWRA 3KWVA 3RDIA 3ACIA 4IEXA 3POSA 1X33A 4LO8A 4QPWA 5IT6A 4W6WA 5FOBB 2P4EA 2PFWA 2HWF1 1YJLA 3ZMNA 2BJSA 3I97A 2XH6A 4J1XA 1HX6A 3I3QA 4O61A 5CA6A 1W9SA 4YW6A 3PL0A 5LK7B 3IMMA 2E9QA 2JG9C 4IEZA 4UF0B 1CAUB 1ND3B 4AVBA 1WMEA 3N36A 5C4WA 3U75A 4QPGC 1C3HA 4JHZA 5IVCA 1H1IA 1KJRA 3FX3A 3PJYA 2HWF3 4IEWA 4WM8A 2JDHA 4MGYE 1VP6A 1YQ8A 1VBE1 1PVC2 4NPMA 1U0AA 2VZTA 4RYDA 4FI9A 3WCRA 2QQLA 4QX5A 2D3PA 2ES3A 1NUKA 3VD7A 2VD7A 5A6ZA 2PHFA 2QQIA 1UN1A 2QUOA 3GZAA 2A1XA 3POGA 4XQ4A 2SLIA 3LOIA 4JDOA 1WD4A 1S2EA 4AEDA 1ASJ3 2BW8A 4KWUA 5JIUA 1LHUA 2HWB2 2WA3A 3POIA 4RFRB 4XMIA 3GF6A 3BALA 5FO8B 4NVPA 1VBE3 4Y4YA 5DZFA 1B35B 2WLQA 3D0JA 3KF3A 4FCAA 3GALA 4RQPC 2DVFA 1HN1A 4AFCA 1HB3A 1SMVA 4CCLA 1QY4A 1A3KA 4HANA 4PIXA 2DCZA 3BIEA 1ZYBA 4COYA 1WCKA 2HLEA 4YRDA 2E6VA 2TNFA 3URFA 5GKAC 2IXHA 3ZXLA 5KHIA 2A6YA 2XXZA 3TAYA 5D1IA 5JXHA 2BDRA 3PVEA 4WVVA 4E2QA 1X82A 2P3IA 2XUEA 1VRH3 1BK0A 4BM8A 5CEHA 1MQTC 3SH3A 1QIQA 2OPWA 5BNOC 4FSJA 4Y22B 3VBFA 2O1QA 3T4HB 2YHJA 3N7KA 2L9LA 5FQ0B 3SKJE 3BN6A 3KV5A 2BRTA 1AYN2 3SHRA 1RMU2 1ZZBA 3C7FA 4CYDA 1AR72 4J6GA 1QXPA 3IPVB 2E7QA 2BOJA 2E7AA 1RGSA 1VIWB 4S2DA 3AP9A 4CCKA 4LIUA 1C1FA 2CGNA 3A7QA 5FXXA 4LBOA 1OOPC 2CNAA 1TQ5A 1W2TA 5T54A 2EIGA 1WWYA 3I8TA 4KWKA 4QQLA 1UY2A 4W8JA 3KT1A 2RS31 4URTA 4YW2A 1JS9A 4N90A 2DU1A 5CZKA 2GALA 3U4XA 2AC1A 1JU3A 1V9U2 2C24A 5FMOS 1H9PA 4E8DA 3IDEA 4ASMB 1W6QB 4F8AA 3HN3A 2P5BA 3V65A 4MSVA 1RHI2 5JOWA 3ZFEB 3WNMA 2QQOA 3U10A 4ONUA 1P8JA 5LY1A 4LTAA 4QM8A 3N9QA 3KM5A 1NQJA 3RFRA 1WBLA 1DF0A 2RS33 3VDCA 1APNA 4GKYA 5BNPC 2HBUA 4Q4Y2 5FZ9A 4C1XA 5JSOA 5CG8A 2WFF1 4XYXA 3I59B 2QFEA 4LKDA 2J1UA 1VBD1 4GWNA 2R062 1ULEA 2JG9B 2IVIB 3GNEA 4YFWA 5J96B 5C3PA 2ZMLA 3LIGA 4QPGB 2HEWF 2VQAA 3BPSA 5FLHA 5GLUA 1GBGA 2R043 3EHKA 4FO9A 4LO6B 4IEQA 2RDRA 3VHOA 5DAPA 1DFQA 3BYWA 5FXZA 3H7JA 4LOTA 4CXYA 2WFF3 3I2KA 5JR2A 1H4HA 3R05A 4X6RB 1R1A3 4RN5A 5FP3A 4AI3A 3SISA 1PIV3 1VBD3 5GM0A 1ZBE3 1XC6A 3BB6A 3ZXAC 3LKJA 2JXAA 3RZGA 1UCXA 2WL1A 2XKPA 4O65A 5FZAA 2IVJA 3ES1A 1SBFA 4FPKA 1C8M3 1H6YA 5FMCA 1F2NA 1SACA 2YGLA 3SKVA 4QPIA 1XPWA 1MEC2 3THDA 4MVTA 4BIOA 1RUG2 3HMYA 4CCOA 1R1ZA 2A70A 4UFIA 2DCYA 1W6PB 4O9GA 5A7PA 4RQPB 4HKLA 4YVSA 4HKWA 4W6YA 3I3MA 2W91A 5FBZA 3RI9A 2VNVA 4BOWA 4M3CE 1UY3A 1V6IA 1W6OB 4NPLA 1UL9A 3T0AA 1AL22 1WA4A 2EF6A 3OGSA 4QD2A 3BTZA 4A42A 4I09A 1Z0HA 5JSRA 2VCBA 4Y1ZA 4KBBA 1UMIA 1YNAA 2PQQA 4NIDA 4NRMA 3T0DA 1GOGA 2QQMA 5BNOB 2VZQA 5B2GB 5F3IA 1AR63 1BEV2 1EUUA 3W5MA 1FPN1 2P3YA 1D0HA 2R6QA 3N9PA 1QQP2 3VLBB 4IGQA 4JX0A 1BCXA 5IVBA 1Q3EA 3Q8BA 5CAZA 2CYFA 2Q1ZB 1LB2A 2AENA 4LBQA 5LCWL 1YCIA 4BISA 2E63A 4Q8LA 1O59A 3AMHA 4H14A 3HNBM 1OOPB 4AI2A 2WZEA 1FOD1 2RM22 1CD3G 1RUE1 1V6KA 3CQOA 3VBRA 3VD9A 1FPN3 4M3CB 2C6SA 1OUSA 4YG3A 3MPPG 4QQ2A 5A70A 2DBNA 3LSEA 2RHPA 4FXKB 3HAGA 1XNKA 2JWPA 5F3CA 3F2ZA 3JCIA 3LGRA 4I2OA 4NAOA 4UBGA 4WM7C 4FTEA 1B09A 1OA2A 4PLNA 4B4RA 4WZFA 5E89A 1K3IA 3OPTA 4IE7A 1OLQA 2YPJA 4D7YA 1JH5A 5FWJA 1LOFA 4OULA 3PMEA 2X05A 1NA1C 2Y6HA 1OLME 3MLJA 3WF2A 2A73B 5BNPB 2VTXJ 5JAXA 1Q8OA 2J1TA 2PN5A 3F95A 1ODNA 4DXTA 4YZ1A 2ORXA 4QHBA 5DAXA 5LASA 2VXRA 3SH4A 3VBHA 2VNOA 4LKFA 4QWNA 2ARXA 1ZM1A 4LQRA 3ELNA 3TEXA 5AC92 4OZOA 1CAXA 2VW2A 3Q8CA 3PVNA 3N4MA 1FV3A 2ARBA 1W6NA 1SLIA 4B8EA 1O91A 2ZGLA 1YFWA 4XZPA 1VAMA 4BE3A 2QDNA 3LA7A 1AXKA 3TBDA 2VW1A 4Q4W2 3H8RA 4PDWA 3VKFC 4RA0A 3VKLA 1VAKA 1LR5A 3HNMA 3VV1A 2W1SA 1Y43B 3LCPA 3VDDA 1W0PA 1K5JA 5DXDA 5HCBA 1NQDA 3KV4A 3POFA 2QZ3A 1W2AX 1SDWA 1TME2 1E5IA 3MIHA 5ANNA 3W58A 4YM2A 3ZFFA 5FZCA 2HEYF 5A1FA 2J42A 2ZGTA 1HW5A 2NP0A 1RYYA 4UFJA 3ZPYA 5FO9B 3AXDA 2MNGA 3SCHA 4BQ1A 1ST8A 1ULFA 2XMLA 2QQPA 3RG0A 4SLIA 1SCSA 2VQUA 3PUQA 5F3GA 2X53S 3FMGA 4QX2A 4OHVA 2Q1MA 5A7QA 3WP6A 2JDYA 3O7OA 1RVF1 3OBZA 4CEWC 5HV0A 2WT0A 1SDDB 4AYUA 1KRIA 1GNYA 3C8XA 2DU0A 2WS92 3HEIA 4W65A 2X5IC 4LHNA 5J09A 1PMIA 2IXCA 5FYSA 1UMHA 1YQ6A 5D21A 1GP4A 2PHLA 1NAEA 1RUJ1 4HKOA 4DIQA 4COWA 2WZR1 2JKXA 1ZRRA 3I4IA 4AHZA 1XOYA 3NJXA 4ITCA 4XETA 1YIPA 1W06A 4MXWA 1PVXA 1RVF3 4YGBA 1WCUA 4QQHA 2A6XA 1LGCA 3SLIA 4QB6A 1DGWA 1E5HA 3PIGA 2ZHLA 1DHKB 5JI9A 1LGNA 1BK1A 1SPPB 1ZREA 1RUJ3 1COV1 2P34A 4EN8B 3K48A 4AI1A 2WIIB 4C1WA 4KWLA 4I01A 4CDWC 2WZR3 3BIWE 2OUHA 1L7RA 2P17A 4MXVA 5EYXA 1OI6A 1DG6A 4FPGA 4Z82A 2VCCA 1MS8A 1OH4A 1V70A 3AMMA 4N8MA 1NLQA 4B3NA 1WCDJ 1ENRA 1CGPA 2VL4A 1OSGA 4OFGA 3WF4A 3UKVA 4QDRA 4MHUA 2RMU1 4F7ZA 5LB6A 3MIBA 3T09A 4YG0A 4WM7B 1W2OA 4YFZA 1COV3 1HXS2 1JODA 5FYUA 3UK9A 4BXFA 1YI9A 4B29A 1HV1A 4DY3A 1Z7S2 2DUOA 3MO4A 2JG8A 2XHNA 1VMJA 1NA1B 2C5DA 2XLFA 3C7GA 5A80A 3USUB 2VOWA 5DUWA 3VL9A 3KV6A 2XQXA 1W0NA 2XJVA 3A0KA 1AR92 1PO12 1D4M1 3ETPA 3VZKA 3D5OA 4BQ2A 3FLRA 4DFSA 1XE8A 1HDKA 4XFHA 3ZKYA 3DXTA 4CXXA 2RMU3 3NAPA 4AOCA 3GCXA 2WN2A 3J9SA 3FE5A 5FREA 1GNZA 3LE0A 3WDUA 4TTGA 1FOD2 4ZXKA 1XB9A 2YU2A 1XNBA 4M01A 4MHRA 5CG9A 3OJBA 3BU0A 1DLLA 2Y64A 2A75A 1YIFA 3ZR6A 1JW6A 5GZEA 5KC6A 5FZ7A 1MZ5A 3CU7A 1A8MA 1W8ZA 2JECA 3ETQA 1JHJA 3T2OA 4CU9A 2ZGQA 1YFYA 4XFIA 1GNHA 3FLPA 1NXD1 1PK6A 4OHXA 1QKQA 2W68A 2XONA 1J59A 1OKOA 1IQDC 1KD7A 4NHMA 1ZBA1 1XSQA 2P2KA 1US2A 2HWD2 3ZIWA 1JYTA 1MS9A 1OA4A 5FDBA 1IPJA 1LTEA 1WCQA 2FCUA 2G4IA 5CVRA 2XLGA 4C8DA 2GC0A 1WUVA 4R4ZA 4RHV3 1AYM1 1RJ8A 2A71A 2BNOA 3N7JA 4CEWB 1XNCA 2DV9A 1RXFA 3JD73 1S0IA 3WOGA 4GULA 3WQBA 2X5IB 3MV11 1QJZA 3FC0A 2ZA9A 4R9CA 2P3KA 4FVVA 1I5ZA 4G3YC 4RR3A 1YLLA 4XBLA 1Z78A 3T3YA 4Q0SA 1DGRN 1UPSA 1ZNPA 3VZNA 1VB4A 2WKKA 5CADA 1YWKA 3ZYFA 4AHWA 1IHMA 2ZAAA 3VBUC 4FTBA 3IWZA 2MEV2 3MIGA 4YZ5A 2QVSB 1FMD1 1TMF1 1W90A 2BERA 4FFFA 2W94A 1FATA 3L9JT 2WINB 2VVEA 1DU3D 4K8RB 1E5SA 4COVA 2BBVA 3MYXA 2ET1A 1SHWB 2K46A 3VKNA 4D6SA 2ZMKA 4CDWB 2GP5A 2VZRA 4EROA 3GGLA 1F35A 2ZEWA 3ZYGA 2ADEA 1IZ3A 2RJ2A 3RWKX 1NE4A 1XYOA 4AZZA 3JBG2 1GZWA 1UO9A 1QOTA 5F37A 3K3OA 3H7YA 4YWAA 1FMD3 1DZQA 1TMF3 3LFIA 4K1YA 4IESA 1J58A 1OHFA 3J7HA 3R4DB 4Z2WA 3OPZA 4HONA 4QU2A 1GQGA 3ACLA 3S5QA 1R082 2RDNA 4XFGA 3VZOA 1S0CA 1GMMA 2V09A 3ALQA 3OBAA 3WDVA 1H2LA 1SQ4A 1TG7A 3H0OA 4GWMA 4P9JA 2A7AA 2WJSA 4GJZA 4CDQA 4P9GA 4BQYA 1W8HA 2AACA 1W8TA 2NLRA 2R1BA 2ZZJA 3VZLA 1K42A 3ZFFB 1HB1A 4P5YA 1RUF2 3PLQA 1AXYA 2XBO2 2ET7A 2HWE1 5A7WA 1O3RA 5BY5A 3CDZB 2DTWA 1OQ1A 2VC9A 4O9EA 1LJ7A 2WNVC 5CNAA 5HCFA 1NLSA 4K1ZA 4YVWC 5FFOC 5JVVA 3WHUA 1UYZA 1UY4A 5LA2A 5L9VA 1KEXA 4CP2A 1RJ7A 4JGZA 3LDRA 3AYDA 4HSJA 5BYNA 2B46X 1WW7A 3WHTA 2PLV1 3MW2A 4WV8A 2WYSA 2AREA 2Y38A 2J1SA 5FZGA 2HWE3 4CU7A 2W52A 3RYKA 5KXEA 1JOBA 1OD3A 1R092 2D97A 5JXJA 1JMUB 3BTAA 4RR3C 1CPNA 4H3WA 1GSLA 1RUH1 1S55A 1I9RA 5GLZA 3GBWA 3RZKA 3TNQA 3WP3A 2UYBA 5A6YA 4XC9A 4YZ4A 4XHXA 3IM0A 2FBEA 4LHKA 2F4PA 5ACA2 5BNQA 4R9AA 4OLLA 5EYYA 4IERA 1LGBA 2ZGOA 4CP9A 3TEWA 1UD1A 1UZVA 2JDPA 4LBNA 3AP5A 3N9NA 3TWIA 3BOPA 1OT5A 3E5UA 1OLRA 4P9IA 4AGGA 3CJIA 1PNFA 4Y1VA 3I2DA 4UT5A 1UKGA 1QH6A 1ZRIA 4HSLA 2DTYA 3QH7A 3SQOA 3OEAA 5JR7B 2AR6A 2WSUA 4Q27A 1W6MA 1URXA 1GLHA 4M4RA 2W1QA 1WMXA 1ZRCA 4EE2A 1MS4A 3WNKA 4PHZA 4Q4V3 3SMHA 1LULA 2A5ZA 3A4UA 1NOVA 3WF3A 3Q8AA 2VBPA 3IIAA 3VBUB 3VHNA 1W9TA 5F5AA 3LEIA 5FMBA 4CDQC 2GH8A 1PVC1 3EBRA 4JTNA 2LRPA 4X8NA 3W5NA 1XE7A 3AMPA 4BLIA 1HB4A 4B7KA 5IAXA 1V6OA 5FYYA 4LXLA 4NIHA 2YDEA 4LBJA 2DURA 2Q8CA 5JI7A 5HI0A 5BNNC 3DF0A 4UAPA 4B4QA 1Q8VA 2HWB1 2XVGA 4JDMA 5IVYA 2RJKA 4CEYA 1GKBA 3UV9A 1PNGA 1PVC3 3CL1A 5KC5A 4CZSA 2VUDA 1AUYA 2E53A 1N3QA 3KS7A 1XQNA 4E4ZA 3OGGA 1HQLA 4RGGA 2EIBA 4NRPA 5FY9A 5LEJA 5LW9A 2VULA 3AM2A 4HXCA 4SBVA 1AL0G 5B4XA 4ET7A 2J22A 3WY6A 1CZTA 4CDXA 4M0NA 3BKZA 1OC1A 1HKDA 1MACA 1AJKA 2VO5A 1O3QA 4EJRA 1GOFA 5L9BA 2VZPA 4GH4A 2XGXA 3A23A 4Q26A 4BQXA 2WNVB 3NV4A 4YVWB 3ZM8A 4Y20A 2Z2SB 3PTRB 2CTVA 1H2NA 4HT1T 1W3XA 3UKNA 5JDBA 1AYN1 3AK0A 3KF5A 1RMU1 3VDBA 3P1IA 5IK5A 1AR71 4YPJA 4MGSA 1S0BA 3UL2A 1KFXL 1XJAA 2WQ4A 1Y9GA 1ENSA 2OUJA 2ZGPA 4EWAA 1HRI2 4AVAA 4XAEA 3D3AA 4YSFA 4ORFA 4AI0A 1OF4A 4RR3B 2XOMA 3N9OA 3W9AA 5FOJB 5H9QA 1UWWA 2V73A 5GLVA 5LA0A 1V9U1 4NPRA 3ZPOA 4HK8A 1AYN3 1SFNA 1RMU3 2IXLA 4ZONA 1AR73 1RHI1 2VOXA 3H8XA 1UIKA 1QJX2 2WO7A 3SEEA 1WLDA 5C6CA 5FAXA 4FQZA 1FX5A 4QHZA 4YG6A 1KS5A 2P3JA 1QEXA 1QDOA 2VUCA 2VZSA 3NW4A 1A8DA 4A7ZA 2D3RA 2DUQA 2Y6GA 3FHIB 3KV9A 4IE4A 3JB4C 4Q4Y1 5LY2A 3RRDA 5A7NA 4GAZA 3OEBA 5FCCA 1DQ5A 1AX1A 4GMP3 1V9U3 1D0GA 4EWEA 1AF9A 1N1YA 2GSYA 1RHI3 2R061 1DZRA 2ID4A 3V0BB 3ZLIA 5ABJA 4QHOA 5HXMA 4Q4X2 1UZZA 2JD9A 2D40A 2ERFA 3OYWB 2BEOA 1X36A 5CFCC 4XURA 2P6CA 2VZVA 3M1HA 1OH3A 1PGL2 1US3A 3IZOA 1N1SA 4K20A 2XB6C 4LK7A 3ZN4A 4CDQB 1MS3A 4LLOA 5J7MA 1JYXA 3QOPA 5M0TA 1JZ8A 1QDCA 3J8F2 3EQEA 1A6CA 2R063 2XWJB 1VBA3 2YFUA 3H8UA 3AZVA 3HBKA 3NVCA 2W08A 4ZS3A 3U0ZA 1GYKA 4HBNA 5BNNB 5EJZB 1ENQA 1YQ5A 4DPNA 4BIFA 2DUPA 5C8CA 5IVEA 2XPJA 5T5JA 3OBRA 4XFAA 2VE1A 1MEC1 4FP3A 3S57A 1NX9A 1RUG1 3ZSJA 3OSDA 2R16A 4YW5A 1EUTA 3JXSA 3M3CA 5IJRA 3WEZA 1VMFA 3ILFA 4MUVA 4XXPA 5LRRA 5C3OA 3NJVA 1UYPA 4OUSA 5T52A 3RSJA 2W5FA 2D6MA 1AL21 2PHUA 4GD4A 5EV7A 3O1SA 3J4UH 3KGLA 3ZN6B 3ZO0B 2HYKA 1LOBA 2EXJA 5J1XA 2R1DA 1RC6A 2HWC2 5CIRA 5EFUA 5FPZA 1RUG3 1ZZ6A 2D7FA 3T1LA 4UW5A 1W2NA 1U5YA 2WSVA 2KA3A 2EXIA 5DDJ2 1O5LA 3ZSKA 2O8QA 1BEV1 2W46A 4IV1C 1QJY2 5CKNA 3RZLA 1RUD2 5FV3A 3ROUA 1S0GA 4XVHA 1QQP1 1AL23 1CONA 1NT0A 4L9BA 2ZMNA 2D98A 1JUHA 2OQ7A 5HCAA 2X10A 2ZGMA 1JZ4A 2VPVA 1CZVA 1NCRA 2QTWB 1RTVA 1A34A 4QXBA 4Z07A 2UY9A 4NWVA 5F32A 4AI8A 1FYUA 5FPUA 1AX2A 2A3YA 1I1EA 5A32B 2RM21 4EN9B 1ND2C 5IK7A 2ZCWA 1HIXA 2ZGKA 3ZFFC 2WDBA 1JHNA 1RIRA 2VJXA 3IT8A 5H9SA 1PZ9A 2BTVC 3MGUA 4HMZA 1LOGA 4LK6A 5I0DA 2JB4A 4YZ2A 4A7YA 1PGW2 4FT8A 1UU6A 5DG1A 4BYYA 3FBMA 5LA1A 4I0BA 1NCQA 4PJYA 2FZ2A 4BK4A 2Q1FA 1HJFA 3VKOA 5KWRA 4HL0A 3ZXJA 3WQ0A 2RM23 2WO2A 1EP0A 1QJU2 4FPLA 3ILRA 4CDUA 2RE9A 2FHRA 3ZSEA 4HN0A 3K2OA 4IEUA 3O1OA 1IG0A 4HLTA 4TWTA 2Q30A 2J1AA 3B94A 3H9AA 1H8VA 3OY8B 4DOUA 3PUHA 1CPMA 4CVUA 3WNXA 3RZHA 1MS0A 1SG3A 5AC91 1WLCA 5C4WC 3HQUA 2ZBJA 2XVKA 3B01A 5IWFA 4IDZA 2W87A 1UYXA 2OXBA 2VMHA 3ASIA 3DV8A 3MI8A 3HNYM 1OLMA 4WM8C 3VB9A 1Y3TA 4C0HA 5FYVA 5CFCB 4LBKA 1Q43A 1CX4A 2W9XA 3GDBA 4XDPA 2EAAA 4Q1PA 4Q4W1 3TNPB 1JZ6A 2YGMA 3TYJA 2PAEA 2VR4A 1M4WA 2A6VA 4EZ4A 4LOSA 4MGIE 5JZGA 1W39A 1YUDA 2IXKA 3ZDSA 2HYXA 3WSOA 4FOWA 2GC3A 2LW8A 2WAOA 5J3UA 4ZKTB 5AC93 3C7HA 2E32A 1TME1 4AEDC 4G9SB 3NJYA 4WVMB 2TBVA 1SLLA 3DPRA 5BXXA 5T5PA 4N9HA 4DXZA 5JXIA 2VZ1A 1OPOA 1LU2A 2OZ6A 2YC0A 5DAQA 3RJRA 1RL3A 2JX9A 2PYTA 3RI8A 5CISA 4Q4W3 2A6ZA 3KHBA 1FI2A 3AKRA 4LORA 5A33A 1F8VA 1D2QA 4P14A 3ZKUA 2V4VA 3NV3A 1NY72 4AWDA 1XSRA 1MS5A 3T0BA 2PHWA 5JUVA 4UWDA 3KVBA 3KCYA 5JPNB 1CAVB 1TME3 4NHLA 5DUXA 2AYHA 2DDUA 2JB8A 2WS91 1DQ2A 2ZGRA 4NUBA 1LESA 3VBOA 2Y6LA 1UU4A 3GHMA 4NROA 3M3OA 4LE3A 4QPYA 4CPBD 2R7EB 4QGMA 2E51A 4YGEA 5F39A 5FZ4A 1YFXA 1SCRA 2DFCA 2VU9A 1SBEA 3H3ZA 2WWJA 3VBFC 1QGLA 2Z5WA 2PHTA 3OUIA 1DIWA 4IV1B 3S7EA 2YC2A 1LHOA 3NWKA 2D5HA 4K3UA 4AFMA 3Q8FA 4RGAA 4CU6A 2NN8A 2W1WA 1KGYA 2WS93 3W59A 2PHRA 1DP0A 5I0TA 1WLWA 3QD6A 4BMBA 2ILMA 4OUEA 1TE1B 3T4VA 3DGTA 4AHYA 1JZ2A 2YFZA 2WQZC 3ABZA 3R6SA 3UJQA 1V6MA 2ZX4A 1GOHA 1VJ2A 2X8KA 2YB7A 2ZX1A 2WZ8A 3PUSA 1ND2B 4PIZA 1KDMA 2WFPA 3WW1A 5C8WA 2B5HA 3KVAA 3NV2A 1QH7A 4KL1A 4QX7A 4JVAA 4DB5A 5JOXA 2VY0A 2YXSA 3WQ1A 2QQNA 5DAVA 4GMP0 4LE4A 1GANA 3MIEA 4DUVA 4XFBA 1W99A 2NMOA 3LA3A 4ZHNA 1RITA 4Y5TA 5FYZA 1HXS1 4XABA 1KS4A 1ASJ2 1Z7S1 2OW4A 4A3XA 1CWPA 2BWCA 1Q8SA 2V5YA 2ETEA 4DRVA 1AR91 1PO11 1RUC2 2WA4A 2ENRA 4JZRA 4S2GA 5CKMA 4AVTA 1JI6A 1G9AA 1C28A 1N1TA 1EYBA 5DQ0A 4Q0VA 4YGCA 3U78A 1LOCA 3ILNA 2ZHMA 5FXVA 4N53A 5J36A 1PX3A 5C4WB 3NV1A 2CY6A 2FMYA 4A6OA 1Z7S3 2O8OA 3SITA 4WZCA 1N3OA 1GZTA 2IFWA 2WBKA 4WM8B 1J3PA 5FWEA 5FZFA 4NHXA 4JGYA 2G9FA 1AR93 1PO13 2DVGA 4IUGA 5K0UA 1W9WA 5H9PA 4QKDA 3ZMOA 1VRH2 4E27A 5FZMA 1HLCA 3AP6A 1OVPA 3QCWA 4IEOA 3VBOC 1G9CA 4K40A 4JV4A 2QQWA 4Y5Z0 5GALA 1FOD3 1RUE3 1K5MA 1XXNA 3NNGA 4BLJA 3BI3A 4AEDB 1C4RA 2RVAA 2VTXA 3U1XA 1VLNA 3T08A 5CU1A 5JIAA 4R52A 4FOYA 2HWD1 4MV2A 5FMOL 5FKCA 2MPFA 4QPIC 3O0WA 4Q1RA 4AGRA 1EV12 2F6BA 2Z79A 2UURA 3CLPA 3MPBA 4E4SA 1O4TA 1W8UA 2PA7A 4YVSC 1H2MA 3DUIA 1MZ6A 2IC1A 2PTMA 2FDKA 1KDKA 5LK5A 1AR82 3MV01 4WVZA 3AJZA 4XAAA 2VQTA 4FPFA 3WG1A 1QXJA 1XRUA 4ZU4A 1GWKA 4XF1A 3LOBA 5FUPA 2GC1A 4JC1A 3RGBA 1LNSA 4QQOA 2JEMA 4NN0A 2Y26A 5FZ3A 1GZCA 3B7MA 4ATEA 4BDVB 3VBFB 3BUCA 3E5QA 2BV4A 1OA3A 4GB32 2QQVA 4IEVA 4PI2A 4H2AA 4DEVA 4YARA 4ZZ8A 1YFUA 2MEV1 3DKQA 4TLGA 1UAIA 2JDZA 2LUWA 3ZSLA 4B1MA 4EWDA 3OD4A 3IDAA 2C1FA 4RS5A 5FMDA 4OHYA 3LDBA 5BUVA 5FBJA 2XR4A 1PMHX 2NZ9A 4HPKA 4FTSA 4L8QA 1OUXA 3VL8A 5T55A 2BGOA 4KH9A 4UFKA 2R042 4XDQA 5EPAA 5FYBA 4W6XA 4OHZA 2VMDA 1S0DA 5D8AA 3VBRC 2QQKA 1PZ7A 3Q9OA 1QF3A 3JBG1 1BBT2 2KD7A 2MEV3 4MLOA 4HVQA 5A1LA 4PT6A 5JPMB 4ZY9A 3PHMA 1R1A2 2JKBA 5F5CA 1PIV2 2XQRA 4JGYC 3OTFA 1ZBE2 2AH2A 5K0UC 1R081 1FNZA 4AQ2A 1IPSA 2CGOA 1TNRA 5E1RA 4XF0A 4ZS2A 2HEVF 1LOFC 1VE0A 1WZXA 2ZKLA 2OT7A 1C8M2 1K5MC 3JBG3 2DCTA 2D6NA 2EAKA 1RUF1 4XBQA 4PCRA 2E7TA 4JKMA 2D6KA 3C7EA 2XBO1 3VBHC 1LECA 1D7PM 3ES4A 3SH5A 4RFT0 2P1BA 5F7UA 4KU8A 1R083 4HZFA 2YV8A 3WCSA 2D5FA 3J26N 5F6LB 4AL9A 3O1VA 2OA2A 1JYWA 5GLWA 4CTEA 1OFNA 3I2HA 4QB1A 2QQUA 1UOJA 4AW7A 2VVFA 4JDNA 2V72A 5FYCA 2OYZA 1ZVFA 3WQ7A 2OKXA 1OFSA 2GZWA 4L11A 4AK3A 4K9SA 1IS4A 2YUEA 3A0NA 4PDWC 5KHGA 3PVBB 5FLJA 1R091 3VBOB 1F4AA 3RZJA 2BFUS 2XJRA 2WR9A 1YYNA 3VDDC 1W2UA 1DQ1A 1G6NA 2VCAA 5FY8A 1VMHA 5FZOA 3A21A 5A7SA 5LBBA 4FBFA 4LHSA 2AUYA 2CV6A 3ZDVA 3KT4A 3FUQA 2FDHA 4Y26A 2VG9A 3WP5A 2YBKA 3AC0A 3NSTA 5IVVA 3OUHA 3U4SA 5A3OA 1E57A 2I45A 4QPIB
chains in the Genus database with same CATH topology
4NWWA 4IEYA 4X6QB 1UZYA 5ACA1 1LHVA 2IZWA 3ZSMA 4LLFA 4XW3A 4Q2FA 1SEFA 2QCSB 3LZZA 1R093 5CFDA 4YVSB 3ZFGA 4PLOA 1NYWA 2VVDA 4XBNA 3QH6A 2JE7A 4BHPA 1S0JA 3LAGA 1ZZ7A 1G9DA 1AXZA 1D4M3 2ZABA 5GJ6A 3UJOA 2DVAA 2WWSA 2D43A 4XQWA 1BYHA 3DL3A 2RR12 4EN7B 2GU9A 1F5JA 2RS12 5ACA3 4R9DA 2VOKA 3C3VA 3KT7A 1ZX5A 5C33A 4K6BA 3N3HA 4U36A 3AMNA 3OGJA 1DZTA 2DCKA 3IDCB 1RINA 4LBQB 3MF6A 5HBAA 3WR0A 3PNAA 3K51A 5L36A 4HN1A 3VBRB 3TOJA 1ZBA3 2GMMA 4AF9A 1RB8G 4P9YA 1V00A 2B9UA 3VBSA 2OIIA 3JU9A 3E5XA 3ATGA 3USSA 1IGOA 1WW4A 1GR3A 4JGYB 4XIOA 5K0UB 3RNSA 5C9AA 1AYM3 3PTYA 4M3CF 3S6PA 2CWMA 2JG8C 1K5MB 4CRQA 3AKSA 1POV1 2GNTA 1YJKA 2B39A 3BOWA 2WLPA 1SLAA 4X8PA 3VBHB 1DDLA 3NAPC 3VUOA 5JMCA 3E97A 4Y1UA 5L7OA 1CAXB 3HIFA 4GA9A 3X29B 2XL7A 1W6NB 1SLBA 4FAGA 2H0VA 1JYIA 2DFBA 3JQWA 3R4UA 4YM3A 3CF6E 3SCGA 1YHFA 4FQ4A 5E88A 4PDWB 1C5IA 1HRI1 1CJDA 2BVBA 3T2TA 4R8HA 3VDDB 1ULDA 4BZ4A 1PK6C 1V6NA 2ATFA 1EAH2 4GIQA 4OI4A 5DUVA 3S30A 4EV0A 5JOYA 1PO22 4AVVA 2VECA 2N7GA 1QJX1 3BCWA 4XMAA 4I3PA 1HRI3 1CAWA 2Y0OA 2DWRA 1Y9QA 2GMEA 4AQTA 1J3RA 4B7EA 1IKPA 1H30A 2RS52 5KXBA 3QACA 4JTOA 2GMPA 1EPWA 3RMXA 3WW2A 3S7IA 2B45X 1AX0A 3VBSC 1QJX3 2ZJCA 3B3QE 4IQPA 3D82A 2ZACA 1ENXA 1Q56A 4Q4X1 4DZGA 4YLZA 3ZXFA 5K7PA 1H9WA 3RYPA 4MXWB 5L73A 1PGL1 3B9IA 1D4VB 2Z42A 2PLV3 2KM2A 1CAUA 1ND3A 1MZEA 5DZEA 1VR3A 4AE2A 3B00A 3FJSA 3J8F1 4Q8KA 2UYAA 1I3HA 3H1MA 4P9LA 4Z92B 4P9XA 1RUH3 4FPJA 4UBHA 4QGNA 5DG2A 2K2SA 2WNEA 2YROA 4E2GA 2YMZA 4JCKA 3MDPA 3VKMA 3J8F3 1QXRA 5EWSA 1JXNA 4HETA 3B9CA 3H1YA 3AX4A 3DN7A 1IOAA 2YY1A 3NKGA 3KLSA 1B35A 2JG8B 3UKTA 1LOAA 2QDRA 3MFAA 4KG0A 3WDWA 2HWC1 1RUI2 3POWA 1C57A 1ZZCA 1GZ9A 3NAPB 3ECQA 5DDJ1 4RHV2 1HQWA 1QJY1 1IS6A 1RUD1 3WDTA 4LT5A 3JD72 2UWAA 4JGZC 1FNYA 2VMIA 4N43A 1YXWA 2A3XA 4Y22A 1VBC2 2JD4A 2WT1A 5FQ0A 3KSCA 1O7FA 2DCJA 3KGZA 3AZXA 2BNNA 2HWB3 4J1WA 5DDJ3 1CQ9A 4YZ2A 1QJY3 1MVQA 1PK6B 3IPVA 3PMSA 1T6GC 3B69A 5DUUA 5FPXA 2PAMA 3ZXEA 2GAUA 1WBFA 5T3NA 1NXMA 3THPA 2NPIA 4N9IA 1PGW1 1EPZA 4PLMA 4AGVA 3FBYA 1NG0A 1H4GA 1REFA 1W6QA 4UW3A 3HT2A 3POYA 1WD3A 4JRAA 4LO5B 3IN9A 1QJU1 3ZFEA 2BQPA 3CJIC 1VBB2 3APBA 3ST7A 3P3PA 4XJUA 3RYRA 3M8LA 3KMHA 2IFRA 3VBSB 3BPZA 1CESA 5F9TA 1KFUL 3D8CA 3D4KA 3TRSB 4XJ9A 2VUJA 2ZS6B 1LHNA 1AZDA 1QJU3 2JG9A 2XG3A 1KXGA 4XEZA 3N35A 2ZX3A 3GBFA 4QPGA 1VALA 3AKTA 4D7SA 2NQYA 4FPHA 1W0OA 3BODA 3CO2A 4Y1YA 4DRRA 3KQRA 3R4SA 5JSPA 2CWSA 1AVBA 4CEYC 1GZWB 1X7NA 2UWBA 5EJ3A 2MHFA 2UU8A 5DZGA 4N43C 1NY71 4XJ8A 3ZYIB 3FLTA 2XHKA 5I8SA 1S0EA 4INDA 1BVP1 2ZAHA 4UW4A 4XIKA 4Q4Y3 1J1TA 2ZGSA 5I0UA 5SV5A 3IDBB 4CDXC 1W6PA 2R32A 2D6LX 1OQEA 1EY2A 4RQPA 2OPKA 2XWBB 3IMNA 1BMV2 4FAHA 1FT9A 1LU1A 4YW3A 3MLKA 4OUMA 4GH4C 4PF5A 4HVOA 1MZFA 5LEKA 4H7MA 5KXCA 2BNMA 4JGZB 1HRV2 2DF7A 5KHHA 1JOJA 1MQTA 3TN92 1BJQA 4S2FA 3ZVXA 5BNOA 1G86A 1QOSA 4JRLA 4F83A 1XU2A 1BKZA 3WVJA 1VAVA 4D3WA 4PBOA 4Q4V2 3HT1A 5K8SA 4Z1VA 1UKRA 3TB0A 1MEC3 1NZCA 3GBGA 4Z8BA 2PHDA 3V56A 4COUA 2VW0A 4RSUA 3OF1A 1OOPA 1AHSA 4GALA 2YYOA 4I3GA 1CVNA 1UW8A 2CAVA 4M3CA 1WW6A 1ASJ1 3HBZA 4OI1A 1BZWA 4N7UA 3LB9A 1RUC1 3CJIB 3O0XA 1DQ0A 3FFQA 1XU1A 2NYYA 5ABJC 5BNPA 1BEV3 1W6MB 5AVAA 3JB8A 4KG8A 1JN2P 3DKWA 1QQP3 4S2HA 1DYPA 1REEA 3V0AA 4I02A 1HV0A 1RUC3 4KU7A 3HWJA 5FLIA 2XJQA 1VRH1 4GKXA 2A3WA 4Q0QA 3VZMA 4LEJA 3WG3A 1LEDA 2R49A 1G9FA 3M4FA 2R072 5F1RA 4IV3A 1I6XA 2GH2A 5C8CC 4CEYB 5BV6A 1BXHA 2UY8A 1EV11 5BPXA 3T1MA 4A2UA 1CR7A 3KB5A 4NO4A 2VGDA 4N43B 5F5QA 4XJWA 5EXOA 2XJSA 3R0RA 4K8FA 1PGSA 1AR81 5A3LA 3KCXA 4C91A 1ULGA 1GICA 4CDXB 3AMQA 3L2YA 2R0HA 3H50A 3OBTA 5HXVA 3WDYA 3VHPA 1EV13 3VGIA 4D69A 1Q5OA 4IXLA 4KNCA 4NOTA 3U11A 5I8TA 4GH4B 1V6JA 1DBNA 4DS0A 2Q5TA 4GB31 2BVVA 2XUMA 3FZ3A 4HVRA 4Y20B 1YRZA 3ME2A 3WX5A 4LO4B 4Q0PA 1AR83 3E6BA 2Q8OA 4FXGB 3KCCA 1DGLA 4TLFA 5GLTA 1NCRC 2VNRA 3WINE 2R041 4QGLA 4XF3A 4Q0UA 5JCTA 5FRAA 1CN1A 4GB33 2XLAA 4M0HA 1BBT1 4MYEA 2XJPA 4YGDA 1NE6A 1R1A1 4TSVA 5T50A 1XYNA 4LHLA 1PIV1 1ZBE1 3M2MA 1VBA2 3MIFA 3WP4A 4D7TA 2KXLA 3AJYA 1O3TA 1NCQC 2BWAA 2CAUA 1H1AA 2D6PA 1F31A 1LEMA 2H6BA 1C8M1 2SBAA 3KD4A 1BBT3 4CDUC 2WNUA 4WM7A 2LM3A 4IV3C 1N3PA 2XL9A 1OD5A 3EO6A 4JAAA 3WUDA 1RUNA 1NLRA 1NA1A 2HWF2 4K7JA 5FO7B 1C8NA 3M3QA 3USUA 2GNBA 5ABJB 2FZ1A 4AEJA 3H1WA 4MGZE 3WXPA 4P9WA 2Y0IA 4N7IA 4KGQA 3O5SA 4XILA 3D6EA 5TSWA 3WD5A 3ZIXA 4ASLA 3G6JB 2B7YA 3JUUA 5JZGC 4FOQA 1DYKA 1JBCA 4G4FA 1AR61 4DNYA 2GNMA 4FOVA 1VBE2 3DPRC 2ZTNA 5C8CB 4OZXA 3MICA 4QXKA 3O12A 1ZRDA 1HXS3 5GZDA 2AGSA 1MQTB 3SXWA 3ZYJB 5LRSA 3MW4A 5I8YA 4YW4A 1Q8QA 4AFAA 3ZXDA 4XQDA 2AZ5A 1F9KA 1PZ8A 3LWCA 2QJVA 2C0ZA 4Y24A 4DINB 2RR11 1C5HA 2PELA 4FPEA 2RS11 3RS6A 4CEWA 1JUIA 2K9ZA 1X8EA 4I30A 3I54A 3B93A 1GQHA 2VMGA 4YZ3A 2X5IA 4BWOA 1ONAA 5IK4A 3WG4A 1MVEA 3INAA 2PHXA 4H7LA 2QE3A 4TYSA 4E2SA 4BPZA 1H2KA 2WNUC 1WCSA 1ZZ9A 1ALYA 1NCRB 2RR13 4COZA 3AYEA 5IK8A 3AKQA 2RS13 3U07A 1DQ4A 2ZOEB 1JTZX 4AHXA 4E4DX 1RUOA 1SLTA 1LENA 2HJIA 2DYCA 3AP7A 3CEWA 3NJZA 2HWD3 5T5LA 4KWJA 2D3SA 3MFCA 5I91A 4QQPA 2DVBA 5I0RA 3V0AB 4CDWA 5AFEA 1CIWA 3KZ4C 4XJAA 2RS32 1QMJA 3MW3A 4YM0A 1NCQB 1QU0A 4XE9A 1WW5A 3V64A 3AZYA 4KQ7A 1F5FA 1G7YA 4F3JA 1LCLA 3FWEA 4CDUB 4IV3B 1DGWX 2BUKA 2TUNA 4C0BA 3I7DA 2EVXA 4D94A 5L19A 1G9BA 4N53C 3ZN5A 2RJLA 3WV6A 3AYAA 4YW1A 2WFF2 3RJ2X 3VZJA 4CP0A 1UIJA 2EALA 3JZVA 3AKPA 4ISQA 1VBD2 1KITA 1IKQA 4BA6A 1IQAA 3ZXGA 3JQXA 1O5UA 4P5HA 4AQ6A 5JZGB 2YZ4A 5H9RA 2WT2A 2NMNA 4GQ7A 4BCUA 1EAH1 3E6CC 1PO21 3AP4A 3DPRB 4Y1XA 5GZGA 1M06G 1U5ZA 4NHKA 1FV2A 5A33B 4XTMA 5AVPA 2UWCA 1L3JA 2C9AA 2ZKNA 4MGKE 3NO8A 2XJUA 1EAH3 2RS51 1OMIA 1RUF3 1PO23 1MS1A 2XBO3 2BYVE 1IS5A 4LULA 1MR5A 2W0XA 1LODA 4UW6A 4JQRA 3HR9A 1OPMA 3S0MA 4GXLA 2RS53 5F6KA 2TEPA 3QBQA 3MF9A 1QNWA 2ZGUA 2WNUB 4RD7A 2ZHNA 4RS5C 3VHRA 2Q4SA 4LBQD 1FPN2 3P3NA 3VBUA 4Q29A 3MZHA 2I07B 3ZYRA 3QLQA 1N1VA 3B5LB 5D8AC 1XYPA 3N7MA 5J37A 1OQDA 1WMDA 4LBLA 2ZPXA 3PJQA 5FTTC 1H0BA 1DGRA 3GHNA 1RUE2 1WMFA 1H1MA 2HKXA 3RZZA 1H8TA 1LOEA 5I0SA 2CGPA 2G9GA 4BH9A 3MLLA 4PBPA 4PQ9A 1RUI1 1UX6A 2GN3A 1TNFA 5T5OA 3AFKA 1SFYA 2ZZQA 1LKNA 4WVWA 4DY5A 5J48A 4RHV1 1A78A 2I2SA 3E6DA 2BPA2 4N53B 1LHWA 1XNDA 1SBDA 3JD71 4I0WB 4M00A 1ZA4A 5E16A 1VBC1 2WNVA 1RUI3 4YVWA 4AQSA 2FMDA 2W39A 1JYCA 5JWPA 2D44A 3RPQA 3EXUA 4PIYA 2EA7A 3HD8B 5KBFA 4XXAA 5KHJA 2JE9A 5KXDA 4IL7A 1VBC3 4R9BA 4XOGA 5JLVA 4WBBA 1PHMA 4QM9A 3M3EA 3SCFA 2A6WA 3WDXA 1G8WA 5CFDC 3ZFGC 1YI7A 3OD0A 3WUCA 2FQPA 3IKWA 1VBB1 5IUQA 4CP1A 1POV3 3FFZA 3EJKA 3C2UA 1U5IA 3M7AA 1RVF2 2GDFA 3MIDA 2EXKA 4UXAA 3AZWA 2GC2A 1SLCA 4AFDA 4LO7A 3PVOA 1QNYA 4OI2A 1H8TC 1VBB3 3V0BA 1RUJ2 5J98B 4LR4A 5KHKA 2WZR2 2PAKA 5EZWA 1LRHA 1Y7BA 2QZ2A 4RS5B 3OYWA 1GFF2 1O4YA 3BU7A 3H3UA 1GV9A 4FPOB 2BFUL 4HPKB 4U2AA 4LUKA 3GZUC 2X29A 4AVSA 3AYCA 5D8AB 4META 2R30A 2B8MA 3FUOA 1IS3A 1COV2 4LBMA 4E9KA 2ZGNA 4QT6A 5BNNA 4C90A 2DVDA 2H6CA 5I93A 1ULCA 4AXOA 5AFBA 5C9AC 3LA2A 4A7KA 3ZXKA 3AFGA 1CJPA 3L2HA 3M3IA 1D2SA 4HFSA 4L92A 2RMU2 1WLTA 4ES9A 4I0AA 1FAYA 4R4XA 4LUMA 1BMV1 4MH0E 2XKOA 3ZYPA 1OKQA 1YO8A 2LALA 2GN7A 4Q4X3 2IXJA 2JJ6A 3ZN6A 5L7OC 4LA2A 2ZX2A 4EN0A 4RL7A 3NL1A 1D4M2 2WZPP 4FPCA 2K0GA 1HRV1 1BQPA 2B42B 1IPKA 3TN91 3WW4A 1KQRA 5K9YA 4MX3A 4XHBA 4NR1A 5GZCA 4AFBA 2JICA 2QNKA 1PM7A 4Q4V1 4XTPA 2R0FA 4AG4A 5GZFA 1AJOA 4FPYA 3M70A 4YNIA 2VOVA 4L2NA 4V1PA 5E8AA 1UF2C 2OZJA 3OCPA 1HRV3 2OVUA 1N47A 4OHWA 4XJZA 2WC2A 3TN93 3O14A 4MZUA 1QOOA 5A32A 3AB0A 1REDA 4DQAA 1UPIA 3G7DA 3RMYA 3RWNA 2QKDA 3GZTB 2VUAA 2ZHKA 5CFDB 3ZFGB 4QMAA 3SNMA 1ZBA2 4H55A 5A3MA 2H0BA 4YYOA 2HWC3 4TZDA 1UU5A 1V6LA 1S1AA 2JENA 4YM1A 1S2KA 2XVLA 1AYM2 1RUD3 5SV8A 4FP2A 1FXZA 1WGPA 3AXEA 2BGCA 3THTA 3CJXA 3OY8A 1ND3C 1H8TB 3ZX7A 2VH9A 2IXIA 1QHDA 1J1LA 3WT3A 5CBLA 5CFCA 1Q8PA 1X8MA 4HK9A 2GNDA 4KGGA 1O4ZA 2R071 4XFCA 1VB2A 2CL2A 2ZX0A 1FMD2 1TMF2 1U12A 3D0SA 2P37A 1BVVA 1X50A 3VN4A 4L99A 1HQNA 1TEIA 4XF9A 3MEPA 4K21A 2Z69A 4WVMA 1UMZA 3I59A 2EXHA 3RQ0A 5C9AB 4AEMA 5CB7A 4XF4A 2R073 4LNVA 1B35C 3AZZA 3IBMA 4ZU5A 4ES8A 1ZRFA 4XPVA 1S2BA 1S0FA 2D93A 2VNGA 4IEPA 1O3SA 1CAVA 2I74A 3HQXA 3NKTA 3O0VA 3B02A 1J3QA 1C1LA 5L7OB 3WW3A 4DMIA 4ATFA 4GMP1 4IETA 4BMEA 1ZZ8A 2Q0AA 2HWE2 4L97A 4ZU7A 3CNAA 2O0OA 4AVCA 2LTNA 4IV1A 3LSDA 2NM1A 4LA3A 3WG2A 4OI0A 2PLV2 3WLUA 5JOZA 4B4PA 1W6OA 2VQ0A 1POV0 3HN1A 3ENRA 4OVEA 1VBA1 1RUH2 1ND2A 3WZ1A 1U5XA 1KJLA 1DQ6A 4ISRA 1CAWB 2D6OX 2XJTA 4AEKA 3GYDA 2IWGB 3ZFEC 4EN6B 4XFFA 3N7LA 1QWRA 3RDIA 4IEXA 3POSA 1X33A 4LO8A 5IT6A 4W6WA 5FOBB 2PFWA 2HWF1 1YJLA 3ZMNA 2XH6A 4J1XA 1HX6A 5CA6A 5LK7B 2JG9C 2E9QA 4IEZA 1CAUB 1ND3B 4AVBA 1WMEA 3N36A 5C4WA 4QPGC 1C3HA 1H1IA 1KJRA 3FX3A 3PJYA 2HWF3 4IEWA 4WM8A 4MGYE 1VP6A 1VBE1 1PVC2 1U0AA 3WCRA 4QX5A 2D3PA 2ES3A 2PHFA 1UN1A 2QUOA 3GZAA 4XQ4A 2SLIA 3LOIA 4JDOA 1WD4A 4AEDA 1ASJ3 2BW8A 5JIUA 1LHUA 2HWB2 2WA3A 4XMIA 3GF6A 3BALA 5FO8B 4NVPA 1VBE3 4Y4YA 5DZFA 1B35B 2WLQA 3D0JA 4FCAA 3GALA 4RQPC 2DVFA 4AFCA 1SMVA 1QY4A 1A3KA 4HANA 4PIXA 2DCZA 1ZYBA 4COYA 1WCKA 4YRDA 3URFA 2E6VA 2TNFA 5GKAC 2IXHA 3ZXLA 5KHIA 2A6YA 3TAYA 5D1IA 3PVEA 4WVVA 4E2QA 1X82A 2P3IA 1VRH3 4BM8A 1MQTC 3SH3A 5BNOC 4FSJA 4Y22B 3VBFA 2O1QA 2YHJA 3N7KA 5FQ0B 1AYN2 3SHRA 1RMU2 1ZZBA 4CYDA 1AR72 4J6GA 1QXPA 3IPVB 2E7QA 2E7AA 1RGSA 1VIWB 4S2DA 3AP9A 1C1FA 2CGNA 4LBOA 1OOPC 2CNAA 1TQ5A 5T54A 2EIGA 4KWKA 3I8TA 4QQLA 4YW2A 3KT1A 2RS31 4URTA 4N90A 2DU1A 2GALA 3U4XA 1V9U2 5FMOS 1H9PA 3IDEA 4ASMB 1W6QB 4F8AA 3V65A 4MSVA 1RHI2 5JOWA 3ZFEB 3U10A 4ONUA 4LTAA 4QM8A 3KM5A 1NQJA 1WBLA 1DF0A 2RS33 5BNPC 1APNA 4GKYA 5CG8A 4C1XA 4Q4Y2 5JSOA 2WFF1 4XYXA 3I59B 2QFEA 1VBD1 4GWNA 2R062 1ULEA 2JG9B 3GNEA 4YFWA 5J96B 2ZMLA 4QPGB 2HEWF 2VQAA 5FLHA 5GLUA 1GBGA 2R043 3EHKA 4FO9A 4LO6B 4IEQA 3VHOA 1DFQA 3H7JA 2WFF3 1H4HA 3R05A 4X6RB 1R1A3 4AI3A 3SISA 1PIV3 1VBD3 5GM0A 1ZBE3 3BB6A 3ZXAC 3LKJA 2JXAA 1UCXA 2WL1A 2XKPA 3ES1A 1SBFA 4FPKA 1C8M3 1F2NA 1SACA 2YGLA 4QPIA 1MEC2 4BIOA 4MVTA 1RUG2 3HMYA 1R1ZA 2A70A 2DCYA 1W6PB 4O9GA 4RQPB 4HKLA 4YVSA 4HKWA 4W6YA 3RI9A 5FBZA 4BOWA 4M3CE 1V6IA 1W6OB 1UL9A 1AL22 1WA4A 2EF6A 4QD2A 4I09A 1Z0HA 5JSRA 4Y1ZA 4KBBA 1YNAA 2PQQA 5BNOB 5B2GB 1AR63 1BEV2 1FPN1 1D0HA 2R6QA 1QQP2 3VLBB 1BCXA 1Q3EA 5CAZA 2CYFA 2Q1ZB 1LB2A 2AENA 4LBQA 1YCIA 2E63A 4Q8LA 3AMHA 4H14A 1OOPB 4AI2A 1FOD1 2RM22 1CD3G 1RUE1 1V6KA 3VBRA 1FPN3 4M3CB 4YG3A 3MPPG 4QQ2A 3LSEA 2RHPA 4FXKB 3HAGA 1XNKA 3JCIA 3LGRA 4I2OA 4UBGA 4WM7C 4FTEA 1B09A 1OA2A 4PLNA 4B4RA 4WZFA 5E89A 1OLQA 2YPJA 4D7YA 1JH5A