1ND2A

The structure of rhinovirus 16
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
285
structure length
285
Chain Sequence
b'NPVERYVDEVLNEVLVVPNINQSHPTTSNAAPVLDAAETGHTNKIQPEDTIETRYVQSSQTLDEMSVESFLGRSGCIHESVLDIVDNYNDQSFTKWNINLQEMAQIRRKFEMFTYARFDSEITMVPSVAAKDGHIGHIVMQYMYVPPGAPIPTTRDDYAWQSGTNASVFWQHGQPFPRFSLPFLSIASAYYMFYDGYDGDTYKSRYGTVVTNDMGTLCSRIVTSEQLHKVKVVTRIYHKAKHTKAWCPRPPRAVQYSHTHTTNYKLSSEVHNDVAIRPRTNLTTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords coat protein VP1
publication title Structural and virological studies of the stages of virus replication that are affected by antirhinovirus compounds
pubmed doi rcsb
molecule tags Virus
total genus 61
structure length 285
sequence length 285
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2002-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1nd2A00
1AR61 1M06G 1RUC1 1NY71 1QJX3 1QJU1 2WZR1 5BNNA 4N53B 4Q4V3 4AEDB 1PGW2 4GH4B 1VBB3 4PDWA 5A33A 3ZFFA 1ND3C 1QJY1 4QPIA 5K0UB 2X5IB 1ASJ3 1RHI3 1R081 2PLV2 5ABJC 1AR62 1AYN3 3DPRC 1MQTB 1HXS1 1AUYA 3VDDA 5L7OA 1RUC2 1NCRA 2XBO3 1NY72 3JB4C 4RS5A 4JGYA 1VBA1 1QJU2 2HWF1 2WZR2 1ZBA3 1RUE3 2WS91 1X33A 1GFF2 4RFT0 1H8TB 1QJY2 1R1A1 3VBSA 4CEYB 1R082 5JZGA 3VBUB 1W39A 1HXS2 5J96B 4CDWA 1VBA2 2RR13 1RB8G 5CFCA 4IV3B 2RM21 5C4WA 4N43A 4IV1A 1AR83 1VRH3 1R1A2 3JBG3 4GB33 4GMP3 3LOBA 4Q4V1 5C9AA 1AL22 4QPIC 5AC93 1VBB1 4CDQB 1C8M3 1AL0G 1RUI3 5A32A 1ASJ1 4Z92B 4SBVA 1Z7S1 4JGZB 4CEWB 2HWB3 1QJZA 5BNOB 3ZFEB 4CDUA 2XBO1 1NCQB 1QJX2 1FPN1 4YVWC 3ZFGC 1ZBA1 4Q4V2 1RUE1 3CJIC 1IHMA 4LLFA 1C8NA 1VBB2 5JZGC 2HWD3 1EV11 3VBFA 1OHFA 1ASJ2 1QJY3 1RHI2 4CDXC 2Y26A 2RMU3 1NG0A 1NA1B 1AYN2 3VBHC 2XBO2 1FPN2 2RR11 1EAH1 3VBOA 1ZBA2 4WM7B 1RUE2 2HWF3 1AR81 4Y4YA 2WS93 1OOPC 3VBRC 1ND3B 4FTBA 3JBG1 4GB31 4GMP1 3HAGA 1COV3 1AYM3 5ABJB 1CD3G 3DPRB 4NWWA 5AC91 1RMU3 1RUF1 1C8M1 1POV0 1VBD3 2RR12 4WM8C 1VB4A 4QPGB 1RUI1 1QQP3 1PGL1 4CDUC 1ND2A 1AR82 1MEC1 2RS13 2RM23 1VRH2 1CJDA 4Q4Y3 5LK7B 1TMF3 5D8AA 1RUG1 3JBG2 2RS33 4GB32 1F2NA 3NAPA 5FMOS 1FMD1 1ZBE3 5AC92 1RUF2 5BNPC 2HWD1 1C8M2 1B35C 2DF7A 4NWVA 1RUI2 1E57A 1WCDJ 1PGL2 4N53A 1MEC2 4AEDA 2RMU1 2VQ0A 2HWB2 1Z7S3 4GH4A 5K0UA 1FPN3 4RHV3 4RR3C 1V9U1 2BUKA 1MQTA 4YVSC 1BBT3 5CFDC 2HWD2 4FTEA 5DDJ3 1EV13 3IDEA 2RMU2 1COV1 1AYM1 1HRI3 1HQNA 4RQPC 1K5MC 1RMU1 1H8TA 1DDLA 5ACA1 1VBD1 4YVWB 5C8CB 3ZFGB 4CEYA 2HWC1 3VBUA 1EAH3 1QQP1 2HWF2 2R073 2RS11 2RS53 4Q4Y1 2WS92 1TMF1 1RVF1 5JZGB 2GH8A 2ZTNA 2RS31 5BNNC 4CDXB 4IV3A 3J8F3 2IZWA 1COV2 1AYM2 4PDWC 4Y5Z0 3ZFFC 3TN93 1ZBE1 2TBVA 1RMU2 3VBHB 5ACA2 1VBD2 1RUF3 1QQP2 2RM22 2RS12 4Q4Y2 4FSJA 3VDDC 5L7OC 2WWSA 1NCRC 1MEC3 1TMF2 2FZ1A 1OOPB 4RS5C 3VBRB 4JGYC 4CDQA 1D4M1 2RS32 1RUJ3 1RUG3 1FOD3 1MQTC 4RHV1 4JGZA 1ZBE2 4CEWA 5BNOA 3ZFEA 1BBT1 1TME1 1FMD3 1NCQA 3VBSC 4WM8B 5DDJ1 1PIV3 1HRI1 3CJIB 1Z7S2 4CDWC 3VBUC 5CFCC 5FOJB 1D4M2 5C4WC 4N43C 4BCUA 4RHV2 4IV1C 1NA1A 1V9U3 2R071 2RS51 2FZ2A 1BBT2 5BNPB 2MEV3 5DDJ2 1B35B 1EV12 4WM7A 5C9AC 3J8F1 1BMV1 1HRI2 3TN91 1ND3A 5ACA3 4RR3B 1EAH2 2HWC3 1AR73 2R072 2RS52 5ABJA 3DPRA 4YVSB 5CFDB 1RVF3 4QPGA 1RUJ1 3J8F2 1FOD1 1BMV2 2R041 3ZFEC 1POV3 2WFF3 3TN92 3ZXAC 4RQPB 3VBFC 1K5MB 2ZZQA 2R061 1PIV1 3JD73 1X36A 2XPJA 1RUD3 2BFUL 3VBOC 2PLV1 1RUJ2 1NA1C 5BNNB 1RUG2 1FOD2 2R042 1D4M3 2X5IA 4PDWB 3ZFFB 5A33B 4QPIB 4WM7C 1FMD2 2MEV1 2R062 1PIV2 1TME3 1HX6A 3JB8A 1BEV3 3VDDB 5L7OB 1NCRB 4RS5B 2QQPA 2HWE3 4JGYB 1HRV3 1PO13 4Q4X3 1ND2C 1A6CA 1V9U2 1AR71 5D8AC 1PVC3 4QPGC 2MEV2 3VBSB 1RUH3 4YVWA 5C8CA 3ZFGA 3NAPC 1POV1 2WFF1 1VBC3 1VBE3 4CDWB 1R093 5CFCB 1AL21 5C4WB 4Q4W3 3JD71 4N43B 1NOVA 4N53C 4CDXA 4IV1B 4AEDC 2HWC2 1AR72 1OPOA 1PO23 4EJRA 2BBVA 4GH4C 4GMP0 5K0UC 3VBHA 2X5IC 1AR93 1RUD1 1RVF2 2BPA2 5C9AB 2BFUS 1VB2A 2WFF2 2R043 1QJX1 1OOPA 3VBRA 3FBMA 5A32B 3JD72 1SMVA 2R063 5GKAC 1BEV1 4CDUB 1H8TC 1VAKA 1RHI1 1RUD2 2GSYA 2HWE1 1HRV1 1PO11 4CEYC 4WM8A 4Q4X1 1AYN1 2PLV3 1AR63 1PVC1 1RUC3 3CJIA 5C8CC 3VBFB 1F8VA 5FMOL 1QJU3 4IV3C 1RUH1 1TME2 2WZR3 1BEV2 1VBC1 1VBE1 5BNPA 1R091 2HWE2 3S6PA 1HRV2 1PO12 3VBOB 1B35A 1R083 4Q4X2 4Q4W1 4FTSA 1HXS3 1PO21 1PVC2 2WLPA 4CDQC 1VBA3 1AR91 1RUH2 2ZAHA 1VRH1 4RR3A 4JGZC 4CEWC 5BNOC 1VBC2 1VBE2 1R1A3 1R092 4YVSA 5CFDA 1NCQC 5J98B 4Q4W2 1ND2B 1AL23 3M8LA 1PO22 1PGW1 5D8AB 4RQPA 1K5MA 1AR92 2HWB1 3NAPB
chains in the Genus database with same CATH superfamily
3AZWA 1AJOA 3OYWB 4JTNA 1PMJX 3SMHA 4LPLA 3ZPOA 1QNYA 4M01A 2I07B 1QJX3 4N90A 1W9YA 2SBAA 1PNGA 4TTGA 4IESA 1OC1A 3K51A 5FY5A 4N53B 1NQJA 4QPYA 4YGBA 5HXVA 2D43A 2W87A 4IEUA 4XFAA 1PGW2 3AXEA 1C57A 4PDWA 5A33A 3MUZ1 4LO8A 1ND3C 4NOTA 3TYJA 3ZFFA 4XAAA 1QJY1 1G6NA 5DZGA 3AFKA 2X5IB 5LA1A 1GWKA 3MIDA 4N7UA 1DIWA 3R4UA 1U0AA 5IT6A 1JW6A 1X50A 1MR5A 1IPKA 2PLV2 4YG6A 2WR9A 5IAXA 3A21A 1HXS1 2VMGA 4AQ6A 1RUC2 4DOUA 2XBO3 1NY72 1ENQA 1YIPA 3MF9A 3O1OA 5DAWA 1SACA 2WZR2 4A3XA 3PU3A 1Y9QA 4XUQA 1RUE3 1LOFA 3DV8A 5LY2A 4XFBA 4FQ4A 4DRRA 5FLJA 3OGGA 1H8TB 1RIRA 1UX7A 1PK6B 3CL1A 4DQAA 3VBSA 4CEYB 3T08A 5F8PA 3K4DA 3VBUB 4LOTA 1W39A 1SFPA 2VU9A 4IXLA 2BW8A 5FKBA 5LA0A 1W90A 3LWCA 4D3WA 3MZHA 1XYOA 2JIJA 2PFWA 1KQRA 3N9PA 5F3GA 4DXRA 1VBA2 3O0XA 3BODA 2R0FA 2ZGTA 5F2WA 4DZGA 5CFCA 4IV3B 3KHCA 4AQ2A 4PQ9A 3SC7X 3D3AA 5LBFA 4MOAA 4B7EA 2XJSA 1LESA 3IM0A 4XVHA 2VZQA 4CA9A 5JI7A 2J22A 1WWYA 3MW3A 1UZYA 2EAAA 2WSVA 4UF0B 1WBFA 4XF0A 4ZKTB 4GMP3 1UXXX 4XBQA 1GZCA 1AL22 2AREA 2X10A 2YC4A 2UWCA 2K0GA 3IKWA 1UF2C 4J1WA 1VBB1 4LKEA 2DCTA 1SFYA 2VZPA 4OQ9A 3ACGA 1WCSA 1XNDA 3I59B 4YW5A 1RUI3 2OYZA 1ASJ1 4OZOA 4WVMB 2JWPA 4INDA 5ERLA 1ST8A 1JYIA 1Z7S1 3TEWA 2GNTA 4ISRA 1PVXA 2HWB3 4AVCA 1OLQA 1XNTA 1QJX2 3I2IA 4I3PA 3VB9A 5CYYA 4FAGA 1GLHA 1ZBA1 1JZ6A 5DABA 4NHLA 1RUOA 2ZZJA 4L8QA 2ZX3A 4LLFA 3T1LA 2R1BA 2VOXA 2YPJA 3EYPA 1H6YA 4I0BA 3VDAA 2VR4A 3SCHA 4ASLA 3H8XA 4H7MA 2ETEA 3W9AA 2HWD3 3I2OA 3PHMA 3WDYA 2ZX0A 4OULA 2FDIA 4XFCA 1OHFA 4AE2A 3ROUA 2VMEA 2YU2A 4CCEA 4CDXC 5IATA 5LW9A 3WNPA 3RMXA 2VMCA 3LKJA 3KQ4B 2NMOA 1S0JA 3ETQA 1QXPA 4ZU5A 2EALA 1VRBA 1K45A 1OFNA 1CAWA 3BU7A 4Y1XA 5JWPA 1JZ3A 4XEZA 2WWUA 2XBO2 2RHPA 3LA7A 1YI7A 2FCTA 3NO8A 1EAH1 4WM7B 1GNYA 4ARYA 1RUE2 1NLSA 3MIFA 4TWTA 4CXWA 2KR2A 2CV6A 2N7GA 2XJTA 2VTXA 5BYNA 2YY1A 1JMUB 1H9WA 5FY7A 3VBRC 4BQYA 4KNCA 1CAXB 1RUNA 4FTBA 2ENRA 2P6HA 1LGBA 4K8RB 5IVYA 3H42B 2UYAA 2P2KA 4LHKA 4M4RA 5EFUA 2EXJA 3FUOA 4CUBA 1MS4A 3WNLA 1MACA 4YW7A 5JOZA 3W5MA 1JHJA 1AYM3 1P8JA 3NJZA 4NWWA 5FYMA 2QQNA 1RUF1 2D6NA 1C8M1 1VBD3 4LITA 4WM8C 4XXPA 3SQOA 4QPGB 3VHOA 1BCXA 1QH7A 2FHRA 5JOYA 3NRUA 1PGL1 3BPZA 4LUKA 3ENRA 1ND2A 5BXXA 1MEC1 2WQZC 3SH3A 2OW4A 2VCAA 3KGLA 5JXIA 4HVRA 1GP5A 1RUG1 3KM5A 4RYDA 1SLIA 2H0BA 2XGXA 4PI2A 2VNGA 4XDQA 3ACFA 3U10A 4A7YA 1DLLA 5FZ6A 4QDRA 5FZCA 4CP9A 1B09A 3GJAA 1WMFA 5FZ4A 1EPWA 1OQEA 1G9BA 5AC92 4NHYA 1D0GA 1WCUA 2FD8A 4UFLA 2DF7A 1ZA4A 2KM2A 1RUI2 4JDMA 4NWVA 3BOWA 4IEPA 3WLUA 2WYFA 3W59A 2WDBA 4HMZA 1QKQA 2OQ6A 4AEDA 1GZWB 4BQ5A 4C90A 2HWB2 1XE8A 2DV9A 2A6YA 2EA7A 5K0UA 1IS5A 5DAXA 5LZ6A 3OSDA 4M3CE 2RG4A 4QXKA 1ZYBA 2PAEA 1FPN3 3ZM8A 4MSVA 5C6CA 1CN1A 2EAKA 1CESA 5FZIA 2BUKA 4S2DA 4BWOA 3M3EA 2R30A 4L99A 2HWD2 3Q8AA 4FTEA 3RQ0A 3CHXA 3KMHA 1EV13 3HIFA 3IDEA 4P9XA 3HT1A 3ZYIB 1KD7A 4LIUA 4BIFA 5E6HA 1O3RA 5FUIA 4O61A 2NMNA 1COV1 3WDTA 2W9XA 4B4QA 2I74A 1AF9A 1LKNA 3FHIB 1JS9A 4M3CF 3TNPB 1RMU1 2BEOA 3HN1A 4QU1A 3USUA 3O1SA 5A3TA 1DYPA 4XJAA 5C8CB 2HWC1 4MLOA 1V0AA 1QQP1 2B4KA 3CLPA 1ULCA 4Q4Y1 2ZGLA 1NUKA 1IZ3A 1Q8VA 1S2BA 2J1RA 2WBKA 1GSLA 4FXGB 1DQ4A 1AXYA 1DHKB 4A7KA 4WVZA 3KVAA 1KS5A 4QHBA 5HCHA 1O91A 4QAWA 4NRQA 4R9DA 4NIHA 2IZWA 5F6KA 4COZA 1AYM2 4Y5Z0 4AAPA 3TN93 1YFUA 3FHAA 1NXMA 1BZWA 4MZUA 4Q0SA 1VBD2 4L0PA 3LFIA 2IFWA 2DDUA 1PM7A 3DXTA 3ES4A 4UFMA 4LTAA 3S7EA 1X82A 2WWSA 2WO3A 3PL0A 4FCAA 1OOPB 4XJWA 4Y22B 4QX7A 1YHFA 4QGLA 4ZZ8A 2AZ5A 2ZKLA 2B9VA 5CAZA 2JG9B 4MXWA 1WGPA 4FQZA 3MLKA 3E6CC 4Q29A 4L2NA 1QU0A 4Y5SA 3FE5A 3OGRA 4ZS2A 3POSA 1YFXA 4JGZA 5FZLA 5A3WA 4AI2A 4D7SA 1Q8OA 2ZX2A 3ZFEA 1BBT1 1TME1 3LDRA 3WHTA 4AHYA 3GCXA 1NCQA 3WDXA 1W6OB 1YWKA 5DDJ1 2B5HA 3BCWA 4BQ1A 5DG2A 4AI1A 1GOHA 4P00B 2J1UA 3RPQA 2ZBJA 4Z2WA 2VZSA 3J9SA 4M0HA 5FPLA 1HRI1 5C3RA 5HBAA 4CDWC 5JXGA 1LENA 4OMCA 5IHRA 2DU1A 1IQAA 4IGQA 1IQDC 3DYPA 1YC61 5JSOA 5CIRA 4M0NA 4DMIA 4S2HA 5J09A 5C5TA 4IV1C 2ATFA 1O5LA 2ARAA 2IFRA 1IS4A 2O14A 3AYAA 3VZKA 3NNJA 2R071 1H2MA 1YEWA 2RS51 5BNPB 1BXHA 1O8SA 2C4XA 3ZVXA 2CSGA 1B35B 1EV12 1SPPA 2JB4A 2ZS6B 3NJYA 4Y1UA 2YZ4A 4YYOA 3UGHA 1UOJA 1BMV1 3AZXA 2W47A 3DUIA 4UFKA 2DUOA 2ZX4A 3NSTA 5FZAA 2IXIA 1GICA 4B8EA 5I93A 2ZXQA 1N3PA 5JCTA 5H9PA 1C5HA 4CCCA 3U14A 5ACA3 4R9CA 5FO7B 4RR3B 1JUIA 3HVDA 3DPRA 4YVSB 2AYHA 3TEXA 4E8DA 4LBQB 5EJ3A 3AKPA 2NM1A 1RVF3 3OCPA 1I5PA 4AI8A 4HPKA 3BYWA 2DFCA 4P9WA 2Q1FA 1WCQA 4XF1A 3ZFEC 1POV3 3QCWA 3TN92 3VBFC 1WUVA 3WG2A 4CCLA 1W6QB 1UZWA 3MPPG 3N36A 3JD73 1PIV1 1AXZA 4MGTA 3O1VA 2WNOA 1HV1A 1LCLA 5FPAA 4KGQA 3UKTA 1EP0A 2XL7A 1BYHA 4BPZA 1SLLA 2UWBA 5EIYB 2NPIA 4FFHA 4PJYA 4D0QA 3VBOC 4TYSA 2PLV1 3ZYJB 3JQXA 3CF6E 2JIGA 2E7AA 1D4M3 2X5IA 3A4UA 3J7LA 2YB7A 3EBRA 4ONUA 5L36A 1WBLA 4HKWA 5DG1A 5HCFA 1X9TA 3AXDA 3OGJA 1MS3A 3PUIA 4PDWB 3I3BA 4W4ZA 4ZU4A 3ZFFB 2WLQA 4BYYA 5IVVA 2AGSA 1H2KA 4NAMA 3AL6A 3VN4A 1SCRA 2WWJA 3JB8A 3V64A 2ZCWA 1UY3A 1FT9A 2Y6FA 2R16A 2ZHLA 5FMBA 2XLAA 4HG6B 4CRQA 3NKTA 3BVCA 1J3QA 2C9AA 1PMIA 3CKHA 5F3EA 2NYYA 4AVTA 1IGOA 3K75B 4UW6A 1WD3A 2B7YA 4EN7B 1DZQA 2JDHA 2X53S 4S2FA 2YYOA 3SHRA 2XHNA 3HT2A 3RJRA 4AWDA 1AXKA 5IK5A 1LOAA 4HONA 3PDQA 2A71A 5EV7A 4RA0A 4KQ7A 3VBSB 4YVWA 4YZ2A 4QX3A 3MIHA 3NAPC 1OLME 3AFGA 4DS0A 4BLIA 1JZ2A 1UKGA 2WFF1 1YJKA 4GKYA 2WN2A 1R093 1SCSA 1W05A 3AMHA 1MPXA 2ARCA 4K7JA 5CFCB 2A3WA 1DYKA 1AL21 1W8HA 1D2SA 2P3IA 1NOVA 3EO6A 4N53C 4BQWA 3F95A 1OPOA 3D0SA 4FOVA 3VKOA 1TE1B 4EJRA 2QFEA 4YZ3A 4GMP0 2D93A 5FPZA 3M2MA 3FLTA 1OA3A 5FBJA 2X5IC 3WP4A 3SNMA 1RUD1 3ZXLA 4E27A 1RVF2 2VCMA 2WT0A 3NWKA 3CZUA 1ENRA 2XL9A 4DUXA 3LSEA 2BPA2 4MGZE 1IS6A 4TSVA 2BFUS 2W1UA 4D6RA 2HEWF 1RL3A 1VB2A 1QJX1 1YIFA 4YM3A 3VKFC 2OA2A 4NIIA 3FBMA 2BVVA 2DUPA 3JD72 5T5OA 1SMVA 1U5XA 3FFQA 4E4ZA 1JYVA 3BU0A 2DFBA 1EUUA 2R063 2VH9A 4WZFA 3H0OA 5B4XA 3RZGA 1Q56A 1SLAA 5GKAC 3VHNA 4Z8BA 4BQ2A 2MNGA 3DKWA 1H8TC 1PK6C 4JQTA 2GNDA 1PO11 3OUIA 4PLOA 4ZPIA 1VLNA 5FYVA 4CEYC 4Q4X1 1NE4A 4HN1A 1VAMA 2WNEA 3CJXA 3MV11 1AR63 5FZ7A 3VLBB 1DQ0A 1YNAA 4YG0A 5HXMA 5I8TA 1QJU3 1IPSA 4FPKA 1RUH1 2JDYA 3KS7A 1AX2A 4IV3C 3WDUA 2ZGMA 5JMOA 1HV0A 3J7NA 1I6XA 4QQOA 1WCKA 1KDMA 4QKNA 1CAWB 4FAHA 3G6JB 4XHBA 3PIGA 4MGKE 2YG0A 2Y6HA 2PHFA 2A70A 3B00A 4L9BA 4XMIA 4BB3A 1R083 1VMJA 1HB1A 2CL2A 4KU8A 4KWJA 5FYZA 5E8AA 3FC0A 3HQXA 1GP4A 5KHGA 2KD7A 4P5HA 1QNWA 1QJEA 2CU5A 3OD4A 3P1IA 4KWKA 2BDRA 4H2AA 2HEYF 4AQTA 4LT5A 1H4GA 4OUSA 1ALYA 3IIIA 5JR2A 2YFZA 1W6NB 1R092 1O6UA 3DGTA 5JIUA 2D7FA 2EVXA 3ZSMA 1HJFA 3WDWA 3KT4A 3WNKA 3K3NA 5FXXA 2R1DA 1ND2B 3LQCA 3ES1A 5DPNA 4CVUA 5A3OA 3VKNA 2R6QA 4Y33A 4MH0E 1R64A 4F8AA 1K5MA 2D6KA 2JD4A 2WO7A 4B4RA 4F7ZA 3H7JA 3OBTA 4K40A 1OLRA 2F17A 2VC9A 3B94A 5FP7A 4JKMA 2VMDA 2HWB1 4KH9A 5GM0A 4QQHA 4GA9A 4DY5A 3O1TA 4AI9A 1LGNA 1NYWA 1QEXA 4E4SA 5C3PA 5FPBA 1US2A 4QHZA 3O0VA 5J7MA 4FXKB 2W3JA 3SH4A 4LIVA 3VD3A 4ASMB 4GALA 5BNNA 2A3XA 1ZZBA 1W8ZA 4AEDB 2WT1A 1F35A 5E1RA 3RZMA 1OSGA 2JE8A 5FZKA 5FXVA 4A3ZA 3WCRA 2JE7A 3LEIA 2R0HA 5K0UB 1I1EA 1PZ9A 3SITA 3LAGA 1RHI3 4CCOA 1ZA7A 4FPGA 1ENSA 2P17A 4HVOA 3FLRA 3J7HA 5K9YA 1ZZCA 2BVBA 1AR62 1WMDA 2QBXA 2YBKA 5L7OA 1QOTA 1NCRA 4YGCA 3JB4C 5CVRA 1GZ9A 1H9PA 4JGYA 5AVAA 1U5YA 2CAVA 1QJU2 2GNBA 5A3PA 3MW4A 3AZVA 4R52A 5LASA 4NHXA 4OLLA 1GFF2 1O59A 5B4NA 4IEYA 4BQ3A 1XRUA 2YUEA 3T0DA 4EWAA 3WVJA 1R1A1 2XONA 2PQSA 2JDNA 4XF4A 3USUB 2XDVA 3VZMA 3NNMA 1QHDA 4JCKA 1R082 3N9NA 4FPOB 1AJKA 4WVVA 4KMQA 2VZRA 2YXSA 4NIAA 2Y33A 2OVUA 1FI2A 3CQOA 5EP9A 1NZCA 1UNBA 3R4DB 2RJLA 2OQ7A 4JX0A 3QACA 2ZAAA 4GZ9A 1RB8G 4GQ7A 5C4WA 3OG2A 2VOTA 1JU3A 1AR83 5FZ9A 3RZHA 4XBNA 3IWZA 3ZSJA 4UWDA 4I0AA 4D94A 5IVCA 2FDJA 5FKCA 3MI8A 2UYBA 4GB33 3AYDA 4YARA 1C3HA 2QCSB 5FK7A 4AFAA 3LOBA 3UT0A 1H1IA 4Q4V1 4WBBA 2W92A 1LHUA 4FP2A 5FXWA 3LPGA 4ZHNA 3A7QA 4XCBA 2GALA 5GLVA 5EYYA 4QPWA 4MXWB 2Z5WA 3TEYA 4C8DA 3O14A 5JVVA 1DU3D 1DP0A 4K3UA 2W91A 3MFAA 3LEGA 4JGZB 4EZ4A 4EZHA 1MZ5A 2VW0A 4FOYA 4FPHA 2RDSA 3ZFEB 1OBNA 2W5FA 5IK4A 1UYYA 3A22A 4UOJA 2D6MA 1NCQB 1OVPA 5FP9A 4D69A 1FPN1 3IMNA 4XJ9A 2X8KA 2EICA 1WA6X 3E1F1 3KHBA 4IEOA 5F1RA 4W6XA 1G7YA 5FYTA 3T0AA 2WA3A 1UW8A 2LALA 1EV11 3I2FA 2W39A 3MHZA 2ZMLA 5BUVA 3OOXA 2A7AA 3HEIA 1RHI2 3OBRA 2Z69A 2OX0A 1JYTA 4XHXA 2W68A 2CGOA 4XETA 2WABA 3LD8A 1UQXA 4IEQA 4AVAA 1NT0A 5FZ8A 4Q8KA 5K8SA 2JECA 5FYHA 1HB4A 3GZUC 1GZTA 3SISA 4DO0A 1V6KA 2RR11 1SPPB 2VE1A 2XJPA 2Y64A 4HK9A 2ZMNA 2VVDA 1T2XA 5IVEA 1TG7A 2HWF3 4QT6A 1YLLA 2CAUA 4D6QA 1Q5OA 2ERFA 4J6GA 1HQLA 1OOPC 4RSUA 3POIA 2ET7A 4L97A 5JI9A 4XCAA 4LO4B 3JBG1 2X29A 3PUSA 2C5DA 2EF6A 2JDMA 1J84A 4XW3A 3DPRB 1PNFA 1NX9A 4UT5A 2VW1A 3RYRA 5FO8B 1POV0 2KXLA 2EIBA 4HPKB 4RGGA 2XKOA 2Q8DA 3FJSA 5FR3A 1I5ZA 1E5RA 2VVFA 2VNVA 1AR82 2ZGKA 4J1XA 5LK7B 2VXRA 1TMF3 4YNIA 2AUYA 1IKPA 1H1MA 1UU4A 5A1LA 4LA2A 4AR2A 4OYUA 4IW3A 4GB32 4EWEA 1F2NA 2VZOA 1W8UA 2YMZA 4UYBA 5M0TA 3R4SA 3IAPA 1F5FA 2WZPP 2XVGA 2QQKA 4HL0A 3WNXA 2Z42A 2Y60A 4IE7A 1KJLA 2Y34A 2G4IA 4XZPA 3RS6A 5BNPC 1B35C 1VAVA 4AOCA 5C71A 1JOBA 4COUA 3NQHA 4DEVA 1UU5A 4NO4A 4HZFA 4MUVA 2RMU1 3I2DA 1MS5A 2VECA 4J25A 4GH4A 2Y0IA 1NLRA 4BK4A 5JAXA 3UJOA 3M7AA 2WNUA 3U78A 4OHYA 4RR3C 3NV3A 5I8YA 3LEMA 4Q0PA 1WZXA 5FAXA 5FQ0A 3T1MA 1GANA 1VALA 1OF3A 4YVSC 2V73A 3POFA 4H55A 4XBLA 3I49A 1XU1A 3WQBA 4PCRA 1KEXA 3W58A 3PUAA 2YC2A 3MPBA 2VPVA 5AFBA 1US3A 4FI9A 4HKOA 4PT6A 5FZGA 4C1WA 2GMEA 2LM3A 1PM4A 1XPWA 2VBBA 3PNAA 2QNKA 2W46A 3FFZA 5FZEA 5KHIA 1RITA 3U4SA 5ACA1 3AP9A 3NV4A 4YVWB 4OQ8A 3T4VA 2ZGSA 3T2TA 2HWF2 2VTFA 1IPJA 2LTNA 3WR0A 2RS11 1O7FA 1FX5A 3E6DA 1PX4A 1ULDA 3JZVA 1RVF1 4E8CA 3LA3A 5JZGB 2ZTNA 3R0RA 4COVA 4KG0A 3IB3A 5DAPA 2RS31 2F4LA 2QDRA 2K46A 3J8F3 1TEIA 1YFWA 1VP6A 2G9FA 2GAUA 2RDNA 2ZPXA 4DUWA 4QX5A 1ZVFA 3E5QA 1ULGA 4PDWC 3ZFFC 3O1RA 1ZBE1 2TBVA 1T6BX 3FMGA 1JYWA 3ZDSA 4R4ZA 2JKXA 4LKFA 5H9SA 3A23A 3CMGA 2BV4A 3ZLIA 2VUJA 4FPYA 4I30A 3I3EA 4FSJA 2CTVA 2FZ1A 1TMF2 1HN0A 4NPLA 5EQUA 2B8MA 2Q1ZB 3GBGA 2BWAA 4MHUA 3ILRA 4ITCA 4D8MA 1D4M1 2E26A 1RUJ3 5DUUA 4LULA 1CWPA 2DURA 1FOD3 1LOFC 4RHV1 4OVEA 2FCVA 3WZ1A 3KCCA 5T50A 3DXUA 3O5SA 1NAEA 1VMHA 4FPFA 3VBSC 2BRTA 2JICA 3RYPA 3FL7A 2BNMA 3M3IA 1LOGA 3N4MA 4MGSA 4C0BA 4QDQA 2ID4A 1I3HA 4RGKA 3P3NA 5CU1A 4CP1A 3BI3A 1OKQA 1ULFA 3N9QA 4JRAA 5FMDA 3WW1A 5CEHA 5CFCC 2VQAA 4XUTA 3ZR5A 4QXHA 1UIKA 2PYTA 2P3KA 5ISLA 4OHVA 1X8EA 3LIHA 4KGGA 4ARXA 3LEKA 1V9U3 4QHOA 3NV1A 1J1TA 1QIQA 3L9JT 2Q0AA 4V2VA 5I91A 1WMXA 2MEV3 3UL2A 2B39A 4CXXA 1K3IA 2A6XA 4CE8A 4CP2A 2W1WA 2WRAA 3BTAA 4NMIA 2AR6A 5FP8A 4LKSA 1ZRFA 2D6PA 4ET7A 4PLNA 2VCBA 1A8DA 4DB5A 1OH4A 3H3UA 3B02A 2W95A 3AKSA 3CO2A 3IN9A 4I0WB 3ASIA 5FYCA 1JUHA 1W6NA 3PIJA 2XJRA 2YPDA 3PVNA 5EYXA 4MHRA 5A7PA 4IERA 3H3ZA 1FATA 1AR73 1UAIA 4A41A 1STMA 1EPZA 4IUGA 4AL9A 5FLIA 5ABJA 5IVFA 2GN7A 4LORA 5JIAA 4M4PA 3I54A 3O12A 3OUHA 4XURA 3TBDA 5EZWA 4UXAA 3AK0A 3RZZA 2W2IA 1F9KA 3J8F2 2BBAA 4FFGA 2WQ8A 1C1FA 4NRMA 2PA7A 3B3QE 1NZIA 1UD1A 4GIQA 1M4WA 3ZYFA 1I9RA 3B7MA 3PJYA 1K5MB 2XR4A 4HKLA 4UAPA 5D1IA 1O4YA 1SDDB 3INAA 3M70A 3U07A 2ZZQA 4CU9A 1U12A 2R061 4FPCA 4XIKA 5DXDA 4EN9B 4GJZA 1J3RA 1X36A 5FJHA 1W06A 3I3QA 5A6QA 1AVBA 4FPLA 2FMYA 1LOEA 2BFUL 4HVQA 1RUJ2 1JYCA 2WKKA 4AEJA 5EXOA 1FOD2 5BNNB 2R042 5FY0A 2VM9A 5FIXA 5FZMA 5GLUA 3ZMOA 3AKQA 1OA2A 4O9EA 2XB6C 3QBQA 3BALA 1OPMA 1HW5A 2G9GA 2Q30A 3POYA 2F4PA 4P9GA 3UK9A 3H8UA 1O3SA 4MG2A 2VG9A 2P37A 3C7HA 1V6MA 2IXKA 3SEEA 1K5JA 1Y43B 3AX4A 2ZACA 3V56A 3M1HA 1ULOA 4W6WA 5L7OB 1NCRB 4W65A 2DYCA 4Z2AA 5LBCA 4W50A 3HJRA 4JGYB 1HRV3 1RC6A 1JXNA 5KR7A 2IVIB 1N47A 2CY6A 1FV3A 2HBUA 5ANNA 1ND2C 1A6CA 3FHQA 3FUQA 3QLQA 5CKMA 4ES8A 2A6WA 3SKVA 3ZOIA 1JODA 1UY0A 1RTVA 1V9U2 1S55A 3AM2A 4CPBD 5I0DA 4UBGA 1DZTA 1A8MA 4Q0UA 5H9QA 1ZM1A 1LULA 1FV2A 2MEV2 2H6BA 1IG0A 2WJSA 4CCKA 5FUNA 1WW7A 2J1AA 3ZFGA 1VMFA 4LR4A 3HR9A 4AFBA 5C3SA 4EROA 3WX5A 4PIYA 4CCJA 1VBC3 1QOSA 1VBE3 3C2UA 2IXJA 3SCFA 5J36A 4KBZA 4COYA 1UZ0A 5FBZA 3ALQA 5C4WB 2WZ8A 1NE6A 2A1XA 4AEDC 1SDWA 4CU6A 4YGEA 1AR72 1JTZX 1PO23 2BP6A 5FTTC 3BGAA 1JI6A 1WW5A 2ZJCA 5CG8A 2D44A 3MIGA 3VBHA 5K0UC 2CGPA 1AR93 4OHXA 4RGAA 2ZHNA 3ZYHA 2XHKA 4GD4A 4CDQA 2VZ1A 3NV2A 3DN7A 1X8MA 2WC2A 3I2KA 1DGWX 4Q27A 3UKNA 2ZX1A 4QQPA 1W8NA 2QQUA 2WAOA 3BB6A 4UFIA 5FYSA 1QH6A 5LEKA 2PXJA 2XOMA 1CAUA 3Q9OA 5DAQA 1YYNA 5IVBA 1C1LA 3ACIA 1ODMA 1WLCA 1XC6A 1W0OA 5FV3A 1UPIA 3EHKA 3GYDA 1BEV1 3ZYRA 2ARBA 3B9IA 1V6IA 3ST7A 4K1YA 1RHI1 4HANA 4QKDA 1LRHA 2HWE1 3KZ4C 3QH7A 4OHZA 3CNAA 4FOWA 5A7QA 1Q8PA 2JG8A 3GM8A 4NROA 4YG3A 1PVC1 1ONAA 1S0EA 3IIAA 4I3GA 1YXWA 4QQ2A 4ZXKA 2D98A 3C3VA 5FMOL 5JPMB 1F8VA 3NNGA 2XLFA 4IE5A 4RFRB 1F5JA 5T5LA 4F3JA 3ZKUA 3I2GA 1WW6A 1KFXL 2ZHMA 5FZBA 3RWKX 4XFFA 3AP6A 5J37A 2VAUA 1HRV2 1S0DA 1V6NA 1IS3A 2D5FA 2XJUA 1KDKA 2A6VA 4IEXA 1HN1A 5HCBA 4Q4W1 3HD8B 2VQUA 2XH6A 3H1MA 1O3TA 4FTSA 1U5IA 1DLCA 1F15A 1HXS3 2C0ZA 3WQ7A 3DYOA 4HT1T 3HQUA 4D7TA 3ECQA 5IFPA 5LB6A 4AG4A 5CADA 1F4HA 2A73B 2O0OA 3AP5A 3B01A 4RD7A 2V09A 5F7UA 4R9BA 3MF6A 1SLTA 1BLZA 1MS9A 4JGZC 4Q8LA 4XQ4A 1VBC2 2NLRA 1VBE2 2HH9A 3ZXGA 1OQ1A 2KA3A 1IOAA 2IC1A 1NCQC 1JOJA 2XXZA 2HKXA 2VZ3A 4Q5OA 5CFDA 2ZEZA 4BHPA 3FWEA 4QX2A 2UWAA 1OD5A 4HSJA 5ANQA 5F5AA 5I0TA 2PQQA 3FZ3A 2DVAA 4XC9A 2HBTA 1PO22 1PGW1 2OUHA 1LEDA 4UFHA 3RI8A 1HJGA 3VD9A 4RQPA 1XE0A 1AR92 5HPOA 2JKBA 4XABA 4Z1VA 4OZXA 1Y9GA 4QX8A 4EYUA 2BTVC 2EXKA 1XXNA 3T2PA 2AACA 5I0UA 4B3NA 1L7LA 2V72A 3JQWA 4LKDA 4DRVA 5A33B 1M06G 4QM8A 1RUC1 5DUVA 2ADEA 1NY71 2B45X 1JBCA 3LIGA 4P5YA 2BGPA 4GXLA 3TEZA 3CIHA 2WZR1 4RN5A 2JDUA 2Q8OA 1D0HA 1N3QA 5CBLA 2E6VA 1YCIA 1W9WA 2Z4FA 4YW3A 4X8PA 4XF3A 4BM8A 5HV4A 5IVJA 4A4AA 1W2NA 4GH4B 1VBB3 3N7KA 1ZNPA 2DTWA 5FJKA 2YBPA 4UBHA 2WAAA 2PHWA 3U1XA 1ASJ3 3KWVA 2WNUB 1YFYA 4PQQA 3ILNA 2VO5A 3HOBA 4MGYE 3HNYM 4AGGA 5A6ZA 3CDZB 5FK8A 5FQ0B 4O9GA 4ASKA 1AYN3 3DPRC 4IDZA 4NPMA 4I09A 2DVFA 3VDDA 3K48A 3ZDVA 4RS5A 1VBA1 2PN5A 4UW3A 4V1PA 3R6SA 1E5HA 2DCZA 2HWF1 1ZBA3 2QQVA 3UV9A 4V2WA 2DVBA 2ORZA 2VULA 4N9HA 1X33A 2RDRA 1WLTA 4XZUG 3EXUA 4NIDA 2XQXA 3T3YA 4JDOA 5LCWL 1QJY2 4LJHA 4TLGA 5KXCA 2Y8KA 3LF7A 1KRIA 2Y6GA 5JZGA 4K6BA 1V00A 4FFFA 4BMEA 5C7GA 4URTA 1MZFA 5B2GB 3WUDA 1HXS2 3ZN6B 1UMHA 2VZUA 2ET1A 2VD7A 4K20A 1UY4A 4LBLA 4A6OA 1X9PA 1N1SA 1S2EA 5C3OA 4MGIE 3VGIA 1MZEA 4N43A 4LO7A 4Q0QA 3H8RA 2YGLA 4IEVA 1W8WA 3KF3A 3VKMA 4LE4A 5DQ0A 5FXZA 2AH2A 3QOPA 1UOGA 2PHRA 4AK3A 3OEAA 1DGLA 1VR3A 4JAAA 4LMFA 2IWGB 1V6LA 5C9AA 1R1ZA 2J7MA 2JJ6A 1PHMA 2XVKA 4TXWA 4A7ZA 4OUEA 3GBWA 2X05A 3EMRA 1C8M3 1W8OA 4XOGA 5FPVA 3WCSA 5CKQA 5L9RA 1GYKA 5IJRA 1GQHA 2W1QA 5A32A 4Z92B 4AAXA 4DIQA 4DPNA 2O8OA 1NQDA 1APNA 3TAYA 3ZN5A 1QJZA 2DBNA 1UOBA 2PMWB 2P3YA 4LK7A 4CSWA 1NKGA 3GZTB 5CISA 2XBO1 5L9VA 4QQLA 1LAJA 2QJVA 4YVWC 3HN3A 1DF0A 1LU2A 3VHRA 3IDCB 1RUE1 1OXCA 3UGGA 1IHMA 4IEWA 4IE0A 1C8NA 1ODNA 2DTYA 1HIXA 2EIGA 1W8TA 4XAEA 5FP4A 1VBB2 3KGZA 5FDBA 5JZGC 5FPUA 4ZONA 1XNAA 2D6OX 1TQ5A 3FN9A 4HFSA 3WOGA 1ASJ2 1WA4A 4LK6A 2Y26A 1NG0A 5FFOC 4URAA 3LB9A 1AYN2 4JKKA 1DGRN 1X7NA 1LEMA 2VMFA 1O4ZA 4GULA 1TVGA 3LOIA 5F5IA 3WP6A 2VBPA 1W03A 3ELNA 5A7WA 1XOYA 1ZBA2 3ACHA 1W3VA 2R49A 5A70A 2Y38A 5KHHA 3WG3A 3D4KA 1UKRA 5I0SA 4Y4YA 1YJLA 4XE9A 1SEFA 2WS93 4COWA 3GXUA 4Y1ZA 4MV2A 4QX1A 4HBNA 4OI2A 4PF1A 5FY8A 2Q8EA 4PLMA 1YUDA 4A6SA 5C70A 3S57A 4Y5TA 2WIIB 1RYYA 1UY2A 2ZEWA 2LRPA 4GMP1 2RDQA 2ORXA 3WNNA 1COV3 5GALA 5ABJB 1CD3G 2PHXA 4XFIA 4DFSA 1GKBA 1AX0A 1RMU3 4BMBA 2XG3A 4AHXA 5AC91 3U0ZA 2Y6LA 3N9OA 1GNZA 4IL7A 5LBBA 4P02B 4QKBA 1QXRA 1RUI1 4W6YA 1QQP3 1KXGA 1RJ7A 3MBWA 2RM23 4Q4Y3 2VNOA 5EHDA 1WLDA 4GWNA 3J4UH 4PBOA 5D8AA 3OUJA 2V5YA 5DAVA 3V0AA 4I02A 4LOSA 1F31A 2WO2A 4XFHA 5CB7A 1JN2P 5FMOS 1CPMA 2QTWB 3DEMA 1RUF2 4MYEA 3I97A 4XUPA 3ZSKA 2HWD1 1C8M2 2CWMA 2ZGUA 3AP7A 3X29B 4YW1A 1GNHA 3I2HA 2L9LA 3U4XA 4BJ0A 1E57A 1WCDJ 1PGL2 1MEC2 3AZZA 4CU7A 2VQ0A 1W9TA 5FZOB 4OI0A 4I01A 3S0MA 2QQOA 4IGPA 5CZKA 5T54A 4BA6A 3NNLA 2EXIA 2VW2A 4QX0A 1KGYA 3UKVA 3OBAA 1QDOA 4OHWA 5GLWA 1V9U1 1PZ7A 4X8NA 3JCIA 1TNFA 1W9SA 3HBZA 2WNVB 2DU0A 2DWRA 3MGUA 1MQTA 1C28A 4X6RB 3D0JA 1BBT3 2VY0A 4AZZA 5L19A 5DDJ3 3WF4A 1Y7BA 2XVLA 4BK5A 1GQGA 2PHUA 4TZDA 3AKTA 3S5AA 2LROA 3B93A 4FVVA 1AYM1 1HRI3 1SHWB 1IG3A 1HQNA 4OI1A 4AEKA 1K5MC 1DDLA 1L7QA 1JZ4A 2VOVA 1ULPA 1VBD1 4ZY9A 2ADDA 3M3QA 4XQWA 3TOJA 4HSLA 1N1YA 3ZFGB 1W2TA 2B46X 4NE9A 3KV5A 2R073 2RS53 2WS92 2ZA9A 1KJRA 3GJBA 1W99A 5KXEA 4CZSA 2DBIA 3LDBA 4DNYA 2IXLA 3RRDA 5BNNC 3MLJA 3FBYA 2E7QA 4MX3A 4NPRA 3RFRA 2CYFA 2XLGA 3JUUA 4PBPA 4UI9L 1COV2 4DXTA 2ZABA 4N7IA 1RJ8A 1RMU2 3VBHB 3NJXA 4EN8B 3VDBA 1GMMA 2HYKA 2MPFA 2VZVA 5LK5A 2E33A 1QQP2 3D8CA 3IPVA 4FFIA 3PUHA 3ZX7A 4U2AA 4BOWA 2BOJA 2RM22 4Q4Y2 5A1AA 2J1TA 1W8FA 4Y1YA 5L7OC 1NCRC 1GWMA 5K4LA 3WINE 3KD4A 4JGYC 2ZEYA 4AEMA 1CAUB 4QM9A 1YQCA 4XYXA 1S4CA 5FP3A 5IK7A 1Z78A 2VGDA 4D6SA 2OIIA 1H2NA 1YO8A 1MQTC 1FNYA 5KBFA 5C3QA 1DQ1A 2O1QA 1JU4A 5LEJA 4CEWA 1QMJA 4Q1RA 3AYEA 5BNOA 1FMD3 3RJ2X 1OT5A 2FQPA 3O1MA 5A1FA 4GWIA 1PIV3 2JX9A 3C8XA 4HK8A 3E6BA 4DUVA 2JG8B 3WDVA 3V0BA 4IEZA 5E88A 1VJ2A 3N9LA 3LE0A 4QB6A 4CUCA 1E5SA 1H30A 5FWJA 5FOJB 1GV9A 5C4WC 1DYOA 2V4VA 4E4DX 5J3UA 4Q26A 4BCUA 1SBEA 2GDFA 1S0BA 5FO9B 2WN3A 3H1YA 1NA1A 3I3DA 1G9DA 1C4RA 3W20A 5DN2A 1BBT2 4AFMA 4K8FA 2UU8A 5FUPA 5DDJ2 2VUDA 5FZFA 1DZRA 1XBFA 2BERA 4UW5A 2JDZA 5A80A 4QKFA 2NQYA 1HRI2 4QXCA 3OPWA 2XQRA 1A3KA 1CPNA 1J1LA 5F6LB 3TN91 1S1AA 1ND3A 2BGCA 3E5UA 3HWJA 1BQPA 1G86A 2DVDA 1IKQA 3WF3A 2CDOA 3R05A 4Y20A 5KC6A 4LBNA 5GZDA 2R072 2RS52 1UYXA 4R4XA 4AF9A 4CXYA 2ILMA 1J59A 2Y6JA 1BVVA 1CZTA 3AKRA 5CFDB 2TNFA 2CWSA 3GGLA 2DCYA 1ENXA 3U37A 3ITQA 2IUWA 4QGNA 4B29A 5KC5A 1H0BA 4WVWA 1BMV2 1LU1A 4B1LA 2WFF3 1KS4A 3H8OA 2QUOA 3ZXAC 3FLPA 4RQPB 5F3CA 4GKXA 4ZS3A 3K46A 1UZVA 2ES3A 4AVSA 4EV0A 5A3NA 3WV6A 1OA4A 1OH3A 1Y3TA 5JDBA 2G9ZA 1W2OA 3ZXDA 1UMIA 1BK1A 3VZNA 5GZEA 3HNBM 4Y26A 3N7MA 3DF0A 1W2AX 1RUD3 3PLQA 3TRSB 2R7EB 3KLSA 3AP4A 4OCTA 1NA1C 4KBBA 1L7RA 4YFZA 4C0HA 4M3CA 4P9LA 1N1VA 1REEA 2UY8A 3ETPA 3ZKYA 2G1MA 3T4HB 2CGNA 3NL1A 4QMAA 4C91A 1MVQA 1FMD2 2D40A 3D5OA 4MGQA 1PIV2 1HX6A 2QQIA 1UCXA 4GAZA 2QE3A 5F9TA 5IAVA 4E4HA 1DGWA 5BV6A 1H8VA 5JXJA 5D21A 3KB5A 4H7LA 5F3IA 3VDDB 4BIOA 3OTFA 4RS5B 1V6OA 3PU8A 1PO13 3THCA 4DEQA 3ZSLA 4Q4X3 5C5UA 2NP0A 1VE0A 2BOIA 4A2UA 2YGMA 1LOBA 3THDA 1LJ7A 1UYPA 1ZZ9A 4M00A 2W0XA 2GC2A 4YZ4A 4U36A 4XACA 2A6ZA 1UO9A 3NVCA 2BZDA 3O0WA 3ZN6A 1RUH3 3KT1A 5FYBA 3WG1A 3NMBA 3QH6A 5JXHA 4S2GA 4XF9A 1XSQA 1ZREA 1POV1 5KHJA 3PVBB 4AXOA 1XE7A 2Q5TA 2EIDA 1MZ6A 1XYNA 2AEZA 2XJQA 2Z2SB 3GZEA 3MIEA 4FPEA 4JZRA 3UJQA 1XU2A 3A0KA 3MDPA 3JD71 4N43B 4CDXA 1H4HA 2JXAA 3N7LA 4Q0VA 5IUQA 4FBFA 3UETA 3VZOA 2GMPA 4GH4C 4B4PA 1ZRDA 4G9SB 3UYJA 2E32A 3WW4A 1XQNA 3I8TA 2WNUC 3RYKA 2VTXJ 5C9AB 3ZYGA 1URXA 2WFF2 4AHZA 2R043 4AW7A 4YZ5A 3LDKA 3OD0A 2MHFA 3EB7A 4C1XA 3OB8A 4CPBA 3VBRA 1LNSA 2WSUA 5A32B 4FOQA 3RI9A 4EN0A 1CONA 4KWLA 4AHWA 1ULEA 4K21A 3U75A 1O4TA 3VL9A 1JYNA 1YRZA 1EYBA 1UL9A 1RUD2 2GSYA 5L9BA 4WM8A 1FXZA 4G3YC 5JSPA 1AYN1 1GOFA 3NJVA 3PURA 2BQPA 2W52A 2LW8A 3OPZA 5CNAA 5LA2A 3CJIA 4LBQD 3MW2A 4ES9A 3RZLA 3ATGA 3SEPA 1GOGA 1H1AA 1XSRA 4META 1UMZA 1Y4WA 1DGRA 1G9FA 5LY1A 3PMEA 3I3MA 2E31A 1CAVA 3IT8A 1R091 3S6PA 4QU2A 1CVNA 1PO12 1HB2A 1UWWA 4NJ4A 5A7WB 3WW3A 4Q4X2 1RXGA 4NR1A 1XB9A 3Q8FA 1HLCA 3KF5A 1MS1A 1F4AA 4YRDA 4DXSA 3KT7A 1ZRCA 5KXBA 1ZZ6A 2WLPA 4K9SA 5FZ1A 1Y9MA 4EQVA 1RUH2 3WP5A 3AJYA 1JH5A 3PUQA 5K7PA 1QY4A 1UU6A 1BJQA 1OI6A 3G7DA 1UY1A 1QGLA 4LLOA 4ZU7A 2J1VA 1R1A3 2RJKA 5T5JA 3AMNA 2YDEA 1CGPA 4YGDA 2QVSB 3K3OA 3C7GA 5FLHA 1LB2A 5IFTA 2RJ2A 2RVAA 3DCQA 2E9QA 2WFPA 4XJ8A 5EWSA 3ZIWA 1DCSA 3CZJA 2TEPA 2QZ2A 3ORJA 3ZSEA 3M8LA 3POEA 5T5PA 5D8AB 3VZJA 5F37A 1LHNA 5FZ3A 2Q1MA 1Z0HA 3V0AB 1Q3EA 1SLBA 1OVSA 3I7DA 1S0IA 3L2HA 5F39A 2BNNA 2ZKNA 2P34A 4IQPA 1WD4A 3CJIC 1YI9A 4AYUA 2P5BA 4D7YA 3UESA 1AR61 2HJIA 4YM1A 5FYYA 1G9CA 1CZVA 2Y0OA 3AJZA 4QDSA 5FZOA 2HEVF 1NLQA 3RVHA 3WY6A 1QJU1 4CP0A 5GZGA 4OI4A 4Q4V3 4CUGA 5F2SA 2W94A 4Z82A 3T2OA 4I2OA 1KFUL 2QZ3A 3ABZA 2WUHA 4LE3A 2C6SA 4QPIA 2VQTA 4B1MA 3RZKA 2WNVA 4LQRA 4H14A 4W8JA 3JXSA 1R081 4EE2A 1OFSA 5LWBA 2B9UA 4YFWA 2XUMA 3AYCA 1L3JA 3VHPA 3WF0A 4FP3A 5T52A 5ABJC 5CG9A 1MQTB 2C1FA 1AUYA 2QKDA 2ZGOA 3H7YA 3K4AA 5I8SA 5JR7B 2X09A 1CIWA 2BU9A 1PZ8A 3DKQA 1MS0A 3WW2A 2WS91 3OY8A 5EPAA 3OBZA 4AI3A 5CA6A 3K77A 4RFT0 4E2QA 4ISQA 4YLZA 2OT7A 1OLMA 2JB8A 4KWUA 4FO9A 1OMIA 2GP5A 2VUAA 5LRSA 5KXDA 1W3XA 3VD7A 1ZZ7A 1VPHA 2PAMA 4EWDA 5J96B 5A7SA 5DZEA 5IW0A 4YWAA 4Y3OA 2RE9A 4CDWA 2J1EA 3HMYA 1QJFA 2RR13 4QB2A 4XILA 4GWJA 4QD2A 1OQDA 2I2SA 2RM21 3ME2A 2WQ4A 4IV1A 1OUXA 1VRH3 1DQ2A 1LGCA 5G04L 5GLZA 3GF6A 3OGSA 4CUAA 1R1A2 4R8HA 2C26A 1A78A 3GCWA 2GN3A 5FY9A 3PMSA 5E89A 3JBG3 4RL7A 4JV4A 2FDGA 4ATEA 1Q43A 5JPNB 3IPVB 4B7KA 2PHDA 4QPIC 2WNVC 3H3LA 5JUVA 4A45A 5A3MA 3BN6A 4CDQB 2BNOA 1AL0G 3GNEA 2GZWA 1SQ4A 1UN1A 1JYXA 2C9KA 3USSA 1W6PA 3OPTA 4SBVA 5GJ6A 5DMYA 1W0PA 4XTPA 3MV01 4CEWB 2G19A 3SLIA 5BNOB 3BIEA 4JHZA 5A7OA 4CDUA 5C8WA 2JENA 3GALA 1BK0A 2P1BA 2ARXA 2JDKA 5BY5A 1WKYA 5JLVA 2B42B 3ZFGC 1GWLA 3H9AA 4Q4V2 1W04A 1REDA 3B5LB 3V0BB 3THPA 3AVRA 2YFUA 3VBFA 5HV0A 1WW4A 1BHGA 1OD3A 1CX1A 1GQPA 1QJY3 1TZOA 3T30A 4E2SA 3RSJA 3N9MA 2PTMA 5SV8A 4P14A 2RMU3 2IXHA 5C33A 1NA1B 3KCYA 2YBSA 2YHJA 2GMMA 2OPWA 2PELA 4LNVA 3VBHC 1FPN2 2GC1A 1YQ8A 4KI5M 4OFGA 2QQWA 3B69A 1JHNA 4GWMA 5TSWA 3VBOA 4QB1A 1V6JA 2RV9A 5H9RA 5GZCA 4Z07A 2AEYA 1AR81 1QXJA 3HPNA 4JVAA 4MVTA 4XDPA 3Q8CA 1ND3B 3RNSA 3O1UA 1S0CA 3WHUA 3H1WA 4NRPA 4TLFA 3ZXKA 3MYXA 4GB31 4LBOA 1UZZA 4Y20B 3ZR6A 3HAGA 1G8WA 1JOPA 4XJZA 5GZFA 2QQPA 3LA2A 1K12A 2RR12 2VMIA 3AMMA 1VB4A 1LOCA 3I2JA 3OJBA 4CDUC 3SKJE 2JG8C 1CJPA 2RS13 4JC1A 1O5UA 1CJDA 1SG3A 1VRH2 1XJAA 2TUNA 2YV8A 3C7EA 2VNRA 5BPXA 1RINA 3LFMA 2SLIA 3AB0A 1W6MA 1UIJA 2A5ZA 1LHWA 2C24A 2RS33 3AL5A 3JBG2 3QD6A 4MADA 4P9JA 3ZPYA 1JZ5A 2OS2A 2WYSA 1D4VB 3NAPA 3O7OA 4PF5A 5GLTA 3IDAA 3P6BA 2OZJA 3WG4A 1FMD1 1ZBE3 1YQ6A 3K4ZA 3OYWA 4WV8A 4DINB 5FPXA 5HCAA 3T09A 5F5QA 5FCCA 2EXHA 4LHLA 3GBFA 3OF1A 2WINB 1PMHX 4M3CB 4N53A 2GH2A 2VOWA 1LTEA 2GP3A 4WZCA 3WNMA 2JD9A 3J26N 2PHLA 2BWCA 2GC0A 1Z7S3 5A3UA 5FRAA 4YPJA 2FBEA 2JE9A 3KSCA 5SV5A 4ZZ5A 4RHV3 1HKDA 4LBMA 5FMCA 4FPJA 1GBGA 4GJYA 4XFGA 3OEBA 5CFDC 3URFA 1QWRA 2H0VA 3NW4A 2Z79A 4HOOA 4JDNA 5FYIA 2ZOEB 3BTXA 2D3PA 3C7OA 3POBA 3AC0A 3D6EA 3Q8EA 1W28A 3VDCA 4JHTA 4A42A 1G9AA 2RMU2 1OUSA 2E7TA 4YW2A 3WNOA 2WT2A 5DZFA 2I45A 4RQPC 5DUXA 4DXZA 1H8TA 3POJA 1PK6A 2CDPA 3N35A 3WP3A 5A7NA 3BPSA 4O65A 2OZ6A 4CEYA 4NIGA 3IZOA 4BE3A 4KU7A 1EAH3 1SBDA 4IE6A 3VBUA 2PHTA 1UX6A 5FREA 2VMHA 1DG6A 4HLTA 3A0NA 4XPVA 2E53A 1TMF1 2ZEXA 3N3HA 2BJSA 2GH8A 1A34A 1PGSA 4Y24A 4SLIA 3VL8A 4JTOA 4CDXB 3DL3A 4IV3A 3ON7A 5A6YA 2HLEA 3CU7A 1OF4A 1WMEA 4N9IA 3POGA 1AZDA 1S0FA 4BH9A 5ACA2 3POWA 1RUF3 4UF0A 5J1XA 1S0GA 4UFJA 4YZ1A 2ZGPA 1C5IA 3BOPA 3I4IA 1D2QA 4YW4A 2P4EA 2RS12 3RMYA 2H6CA 1DQ6A 3VDDC 1LHVA 3FX3A 2D97A 1CX4A 1MEC3 3PJQA 2VUCA 4RS5C 2OPKA 3KV9A 3VBRB 3WXPA 2WA4A 2GC3A 3I59A 3B9CA 2RS32 5E16A 2WZEA 1JZ8A 1RUG3 1Q8SA 3F2ZA 4LUMA 4ZXEA 2EIEA 4Q2FA 2LUWA 1HQWA 2BYVE 3L2YA 4WVMA 4XUNA 5D2AA 5L73A 1E5IA 2ZGNA 3EJKA 1TNRA 1ZBE2 4QWNA 3ZIXA 1UYZA 4CU8A 2QDNA 2OUJA 2VL4A 2F6BA 3NNFA 3Q8BA 4Q1PA 3KV4A 5FZDA 1XNBA 4CYDA 2XJVA 4FT8A 4WM8B 5AVPA 4BLJA 3IDBB 3IMMA 1U5ZA 1ZRIA 2P3JA 3LSDA 2K9ZA 2VJXA 2XWBB 3AMQA 4NHMA 1QF3A 3VZLA 4O7XA 1N3OA 4PIZA 3RDIA 4XXAA 3ZN4A 4AFDA 3CJIB 5A3LA 1Z7S2 4BDVB 1CQ9A 2W08A 2E63A 2VOKA 3VBUC 1D4M2 3V65A 4AGVA 5G05L 3WQ0A 1CR7A 1ACCA 4N43C 1VIWB 4RHV2 1SLCA 3WEZA 1J3PA 4PI0A 1W0NA 2J1SA 4R9AA 2FZ2A 1LR5A 4YM2A 1CAVB 3P5BA 1WLWA 2FDKA 2Y6KA 2A75A 2D6LX 4CCNA 4CCMA 3KV6A 1GR3A 1O8PA 3MLLA 4WM7A 5C9AC 1MS8A 3H50A 3J8F1 4G4FA 3WT3A 1QOOA 2IXCA 2NN8A 4F83A 2OKXA 4XJUA 1YQ2A 1LHOA 5LATA 1CAXA 2LS6A 4JKLA 2V5DA 4OMDA 5JMCA 4KG8A 5LA9A 3GZAA 1EAH2 3C7FA 3S30A 2XKPA 4BQXA 4E2GA 2HWC3 3KCXA 3SXWA 4IETA 3AVSA 1EUTA 2QQJA 1XYPA 3LZZA 4L11A 3PVOA 3MEPA 4QPGA 4XUOA 1RUJ1 2AENA 1FOD1 1POQA 1QDCA 1S2KA 2R041 4JRLA 5LRRA 3GHNA 4ORFA 1REFA 1ZX5A 4YM0A 3ZMNA 1XNKA 4BXSV 2GU9A 4LA3A 3WUCA 4OUMA 4XDOA 4JQRA 3ZO0B 2DUQA 1EY2A 4LO5B 3RG0A 2XPJA 2QQLA 3KQRA 2JDPA 3S5QA 1H6XA 2P6CA 3APBA 5FWEA 4CP9B 1RUG2 1GP6A 2ZGQA 1AX1A 3ZXFA 5EJ1B 3E97A 2Q8CA 2YU1A 1GZWA 2PAKA 3WQ1A 3ACLA 2ZGRA 3TB0A 4QPIB 4WM7C 5F5CA 2MEV1 4XQDA 2R062 4UW4A 3TNQA 1TME3 3LGRA 1FAYA 5J48A 2ZHKA 2FDFA 3EQEA 5T55A 3N7JA 2W1SA 2K2SA 1BEV3 1D7PM 1YQ5A 3GHMA 3BUCA 2R32A 2V4AA 4EN6B 2HWE3 3PVEA 3BKZA 3THTA 2Q4SA 2D3RA 3BIWE 3AMPA 4PHZA 3SH5A 3UGFA 2D3SA 4NAOA 3ZYBA 5JOXA 3OY8B 1O3QA 2VCCA 5AFEA 1DQ5A 1XNCA 1N1TA 1AR71 4AI0A 5D8AC 4BZ4A 1PVC3 1DFQA 2VBDA 4QPGC 4K1ZA 2DCKA 3ZYPA 3VD4A 3M3OA 1SZBA 5EJZB 5LBEA 2CNAA 5A6XA 4QXBA 1MVEA 3IAQA 5C8CA 1J58A 5APAA 3TWIA 2UURA 4MO3M 4LHNA 4LHSA 4X6QB 1HB3A 1BKZA 2XUEA 4CDWB 3HQRA 1Q8QA 2CHHA 1FNZA 4CTEA 2DCJA 1SFNA 3RZJA 2O8QA 3DYMA 3IBMA 1LECA 4Q4W3 3VD5A 4AVVA 5I0RA 2YC0A 3M3CA 4IV1B 4NVPA 4IGOA 1V70A 3ZXEA 3DECA 2HWC2 3J7MA 4QGMA 1FYUA 2BBVA 1GUIA 5KHKA 4LO6B 3WSOA 4PIXA 3T0BA 3BTZA 1KITA 4H3WA 4YSFA 4LBJA 3E5XA 4NN0A 5HI0A 2J42A 3PTYA 3RGBA 3MFCA 5CKNA 4LXLA 1UXZA 3MO4A 2QQMA 1OOPA 2UY9A 4P9IA 5IWFA 4Y22A 2IVJA 3WD5A 3RWNA 2JG9A 1W6PB 4CCDA 3CBNA 4LBKA 2JEMA 1LODA 4P9YA 4Y4RA 2FDHA 2FCUA 5FY4A 5DUWA 4HXCA 1UOFA 2BGOA 4AVBA 1NXD1 4CDUB 1RGSA 1VAKA 1W9FA 4ATFA 3U11A 4NUBA 1AHSA 1T6GC 1HRV1 2XMLA 2XWJB 4Y1VA 5JOWA 1W6OA 2GNMA 4XMAA 3ZXJA 3VUOA 3MICA 2PLV3 2WL1A 2D5HA 5FY1A 1W2UA 3LCPA 4HETA 1RXFA 2VVEA 1RUC3 2FMDA 5F32A 5C8CC 3VBFB 1DBNA 3M4FA 2AC1A 3KVBA 2HYXA 3W21A 5KWRA 1TME2 2WZR3 5IK8A 4TN7A 4N8MA 2ZMKA 3LPFA 4BU2A 5FYUA 1ZRRA 2NZ9A 1BEV2 3HBKA 3K2OA 1VBC1 1VBE1 3W5NA 5BNPA 3BTYA 2HWE2 3T2QA 1K42A 4HN0A 4IE4A 4XTMA 2E51A 3VBOB 1B35A 2DVGA 4LEJA 3VKLA 2A3YA 1HDKA 1CZSA 4L92A 4BISA 3S7IA 3D82A 5JSRA 2WO1A 3P3PA 4KL1A 1PO21 3GDBA 1PVC2 5AC93 1JZ7A 3VV1A 4CDQC 1GU3A 2VZTA 3WF2A 1VBA3 2VXJA 4AFCA 1AR91 1SBFA 1UPSA 2YROA 2OXBA 4P08A 3CEWA 2ZAHA 3OGVA 1VRH1 1ZZ8A 4RR3A 1J83A 1OKOA 3SCGA 1H2LA 4YW6A 5BNOC 4CEWC 3JU9A 4NHKA 2JG9C 4YVSA 3HNMA 1PX3A 3UNPA 3WF1A 4E9KA 5J98B 4LBQA 4BQ4A 3O1PA 1CIYA 4XIOA 4Q4W2 3MIBA 4A44A 5FZ0A 3ILFA 4BXFA 1AL23 4AQSA 3NKGA 5BNQA 2JDAA 5FOBB 5IYYA 5FZHA 3AZYA 1OURA 3MUY1 4AGRA 3PTRB 1W6MB 1W6QA 4MXVA 4DY3A 5T3NA 1BVP1 3NAPB
chains in the Genus database with same CATH topology
3AZWA 1AJOA 3OYWB 4JTNA 3SMHA 1QNYA 4M01A 2I07B 1QJX3 4N90A 2SBAA 1PNGA 4IESA 3K51A 4N53B 1NQJA 4QPYA 4YGBA 5HXVA 2D43A 4IEUA 4XFAA 1PGW2 3AXEA 1C57A 4PDWA 5A33A 4LO8A 3TYJA 1ND3C 4NOTA 3ZFFA 1O3RA 1QJY1 1G6NA 5DZGA 3AFKA 2X5IB 3MIDA 4N7UA 1DIWA 3R4UA 1U0AA 5IT6A 1JW6A 1X50A 1MR5A 1IPKA 2PLV2 4YG6A 1HXS1 2VMGA 4AQ6A 1RUC2 4DOUA 2XBO3 1NY72 1ENQA 1YIPA 3MF9A 1SACA 2WZR2 4A3XA 1Y9QA 1RUE3 1LOFA 3DV8A 4XFBA 4FQ4A 4DRRA 5FLJA 3OGGA 1H8TB 1RIRA 1PK6B 3CL1A 4DQAA 3VBSA 4CEYB 3VBUB 1W39A 2VU9A 4IXLA 2BW8A 3LWCA 4D3WA 3MZHA 1XYOA 2PFWA 1KQRA 1VBA2 3O0XA 3BODA 2R0FA 2ZGTA 5CFCA 4IV3B 4AQ2A 4PQ9A 4B7EA 2XJSA 1LESA 3IM0A 5JI7A 3MW3A 1UZYA 2EAAA 2WSVA 1WBFA 4ZKTB 4GMP3 4XBQA 1GZCA 1AL22 2AREA 2UWCA 2K0GA 3IKWA 1UF2C 4J1WA 1VBB1 5AC93 2DCTA 1SFYA 1WCSA 1XNDA 3I59B 4YW5A 1RUI3 2OYZA 1ASJ1 4WVMB 4INDA 1JYIA 1Z7S1 2GNTA 4ISRA 1PVXA 2HWB3 4AVCA 1OLQA 1QJX2 4I3PA 4FAGA 1GLHA 1ZBA1 1RUOA 4NHLA 2ZZJA 4L8QA 2ZX3A 4LLFA 3T1LA 2R1BA 2VOXA 2YPJA 4I0BA 4DFSA 3SCHA 4ASLA 4H7MA 2ETEA 3W9AA 2HWD3 3PHMA 3WDYA 2ZX0A 4OULA 4XFCA 1OHFA 4AE2A 3ROUA 4CDXC 3RMXA 3LKJA 4ZU5A 2NMOA 1S0JA 3ETQA 1QXPA 2EALA 1OFNA 1CAWA 3BU7A 4Y1XA 5JWPA 4XEZA 2XBO2 2RHPA 3LA7A 1YI7A 3NO8A 1EAH1 4WM7B 1RUE2 1NLSA 3MIFA 4TWTA 2CV6A 2N7GA 2XJTA 5BYNA 2YY1A 1H9WA 3VBRC 4KNCA 1CAXB 1RUNA 4FTBA 2ENRA 1LGBA 2UYAA 2P2KA 4LHKA 5EFUA 2EXJA 3FUOA 1MS4A 5JOZA 1MACA 1AYM3 3NJZA 4NWWA 1RUF1 2D6NA 1C8M1 1VBD3 4XXPA 4WM8C 3VHOA 4QPGB 1BCXA 1QH7A 2FHRA 5JOYA 1PGL1 3BPZA 4LUKA 3ENRA 1ND2A 5BXXA 1MEC1 2WQZC 3SH3A 2OW4A 3KGLA 4HVRA 1RUG1 3KM5A 1SLIA 2H0BA 2XGXA 4XDQA 2VNGA 4A7YA 3U10A 1DLLA 1B09A 1WMFA 1EPWA 1OQEA 1G9BA 5AC92 1D0GA 2DF7A 1ZA4A 2KM2A 1RUI2 4JDMA 4NWVA 3BOWA 4IEPA 3WLUA 3W59A 4HMZA 1QKQA 4AEDA 1GZWB 4C90A 2HWB2 1XE8A 2DV9A 2A6YA 2EA7A 5K0UA 1IS5A 4M3CE 4QXKA 1ZYBA 2PAEA 1FPN3 5C6CA 4MSVA 1CN1A 2EAKA 1CESA 2BUKA 4S2DA 4BWOA 3M3EA 2R30A 4L99A 2HWD2 4FTEA 3RQ0A 3KMHA 1EV13 3HIFA 3IDEA 4P9XA 3HT1A 3ZYIB 1KD7A 4BIFA 2NMNA 1COV1 3WDTA 4B4QA 2I74A 1AF9A 1LKNA 3FHIB 4M3CF 3TNPB 1RMU1 2BEOA 3HN1A 3USUA 1DYPA 4XJAA 5C8CB 2HWC1 4MLOA 3CLPA 1QQP1 1ULCA 4Q4Y1 2ZGLA 1IZ3A 1Q8VA 1S2BA 4FXGB 1GSLA 1DQ4A 1AXYA 1DHKB 4A7KA 4WVZA 1KS5A 4QHBA 1O91A 4R9DA 2IZWA 5F6KA 4COZA 1AYM2 4Y5Z0 3TN93 1YFUA 1NXMA 1BZWA 4MZUA 4Q0SA 1VBD2 2IFWA 1PM7A 3ES4A 4LTAA 3S7EA 1X82A 2WWSA 4FCAA 1OOPB 4XJWA 4Y22B 1YHFA 4QGLA 5CAZA 2AZ5A 2ZKLA 2JG9B 4MXWA 1WGPA 4FQZA 3MLKA 3E6CC 4Q29A 4L2NA 1QU0A 3FE5A 3POSA 1YFXA 4JGZA 4D7SA 4AI2A 1Q8OA 2ZX2A 3ZFEA 1BBT1 1TME1 3WHTA 4AHYA 1NCQA 3WDXA 1W6OB 1YWKA 5DDJ1 2B5HA 3BCWA 4BQ1A 5DG2A 4AI1A 4Z2WA 3RPQA 2ZBJA 3J9SA 4M0HA 5HBAA 1HRI1 4CDWC 1LENA 2DU1A 1IQAA 5JSOA 5CIRA 4M0NA 4DMIA 4S2HA 5J09A 4IV1C 2ATFA 1O5LA 2IFRA 1IS4A 3AYAA 3VZKA 2R071 1H2MA 2RS51 5BNPB 1BXHA 3ZVXA 1B35B 1EV12 2ZS6B 4YYOA 4Y1UA 2YZ4A 1BMV1 3AZXA 3DUIA 2DUOA 2ZX4A 3NSTA 2IXIA 1GICA 4B8EA 5I93A 5JCTA 1N3PA 5H9PA 1C5HA 5ACA3 4R9CA 5FO7B 4RR3B 1JUIA 3DPRA 4YVSB 2AYHA 4LBQB 5EJ3A 3AKPA 2NM1A 1RVF3 3OCPA 4AI8A 4HPKA 2DFCA 4P9WA 4XF1A 3ZFEC 1POV3 3QCWA 3TN92 3VBFC 1WUVA 3WG2A 1W6QB 3MPPG 3N36A 3JD73 1PIV1 1AXZA 1HV1A 1LCLA 3UKTA 4KGQA 1EP0A 2XL7A 1BYHA 4BPZA 1SLLA 2UWBA 2NPIA 4PJYA 3VBOC 4TYSA 2PLV1 3ZYJB 3JQXA 3CF6E 4ONUA 2E7AA 1D4M3 2X5IA 3A4UA 3EBRA 5L36A 1WBLA 4HKWA 5DG1A 5HCFA 3AXDA 4PDWB 3OGJA 1MS3A 4ZU4A 3ZFFB 5A33B 2WLQA 4BYYA 2AGSA 1H2KA 3VN4A 1SCRA 3JB8A 3V64A 2ZCWA 1FT9A 2R16A 2ZHLA 2XLAA 4CRQA 3NKTA 1J3QA 2C9AA 1PMIA 4AVTA 2QQPA 2NYYA 4EN7B 1IGOA 4UW6A 1WD3A 2B7YA 1DZQA 2X53S 4S2FA 2YYOA 3SHRA 3HT2A 3RJRA 4AWDA 1AXKA 5IK5A 1LOAA 5EV7A 2A71A 4RA0A 4KQ7A 3VBSB 4YVWA 4YZ2A 3MIHA 3NAPC 3AFGA 4DS0A 4BLIA 1UKGA 2WFF1 1YJKA 4GKYA 3AMHA 1R093 1SCSA 4K7JA 5CFCB 2A3WA 1DYKA 1AL21 1D2SA 2P3IA 1NOVA 3EO6A 4N53C 1OPOA 3D0SA 4FOVA 3VKOA 1TE1B 4EJRA 2QFEA 4YZ3A 4GMP0 2D93A 5FPZA 3M2MA 3FLTA 1OA3A 3WP4A 2X5IC 3ZXLA 3SNMA 1RUD1 4E27A 1RVF2 2WT0A 3NWKA 1ENRA 2XL9A 3LSEA 2BPA2 4MGZE 1IS6A 4TSVA 2BFUS 2HEWF 1RL3A 1VB2A 1QJX1 1YIFA 4YM3A 3VKFC 2OA2A 3FBMA 2BVVA 2DUPA 3JD72 5T5OA 1SMVA 1U5XA 3FFQA 4E4ZA 2DFBA 2R063 2VH9A 4WZFA 3H0OA 1Q56A 1SLAA 5GKAC 3VHNA 4Z8BA 2MNGA 3DKWA 1H8TC 1PK6C 2GNDA 1PO11 4PLOA 4CEYC 1VLNA 4Q4X1 1NE4A 4HN1A 1VAMA 2WNEA 3CJXA 1AR63 3VLBB 1DQ0A 1YNAA 4YG0A 5I8TA 1QJU3 3WDUA 4FPKA 1RUH1 3KS7A 4IV3C 1AX2A 1ZRFA 2ZGMA 1HV0A 1I6XA 4QQOA 1WCKA 1KDMA 1CAWB 3G6JB 4XHBA 4MGKE 2PHFA 2A70A 3B00A 4L9BA 4XMIA 1R083 4KWJA 2CL2A 4KU8A 5E8AA 3FC0A 3HQXA 5KHGA 4P5HA 1QNWA 3OD4A 4KWKA 2HEYF 4AQTA 4LT5A 1H4GA 4OUSA 1ALYA 1W6NB 1R092 3DGTA 5JIUA 2D7FA 2EVXA 3ZSMA 3WDWA 3KT4A 2R1DA 1ND2B 3ES1A 3VKNA 2R6QA 4MH0E 4F8AA 1K5MA 2D6KA 2JD4A 4B4RA 4F7ZA 3H7JA 3OBTA 4K40A 1OLRA 3B94A 5GM0A 4E4SA 4KH9A 2HWB1 4DY5A 4QQHA 4GA9A 1LGNA 1NYWA 3O0VA 5J7MA 4FXKB 3SH4A 4ASMB 4GALA 5BNNA 2A3XA 1ZZBA 4AEDB 2WT1A 5E1RA 1OSGA 3WCRA 2JE7A 5K0UB 2R0HA 1I1EA 1PZ9A 3SITA 3LAGA 1RHI3 4FPGA 1ENSA 2P17A 4HVOA 3FLRA 5K9YA 1ZZCA 2BVBA 1AR62 1WMDA 5L7OA 1QOTA 1NCRA 4YGCA 3JB4C 5CVRA 1GZ9A 1H9PA 4JGYA 5AVAA 1U5YA 2CAVA 1QJU2 2GNBA 3MW4A 3AZVA 4R52A 4OLLA 1GFF2 4IEYA 1XRUA 2YUEA 4EWAA 3WVJA 1R1A1 4XF4A 3USUB 3VZMA 4JCKA 1QHDA 1R082 4FPOB 1AJKA 4WVVA 2YXSA 2OVUA 1FI2A 1NZCA 3R4DB 2RJLA 1RB8G 3QACA 2ZAAA 4GQ7A 5C4WA 1AR83 4XBNA 3IWZA 3ZSJA 4I0AA 4D94A 3MI8A 2UYBA 4GB33 3AYDA 4YARA 1C3HA 2QCSB 4AFAA 3LOBA 1H1IA 4Q4V1 4WBBA 4FP2A 1LHUA 2GALA 5GLVA 5EYYA 4MXWB 2Z5WA 3O14A 5JVVA 1DU3D 4K3UA 3MFAA 4JGZB 1MZ5A 2VW0A 4FOYA 4FPHA 3ZFEB 5IK4A 4D69A 2D6MA 1NCQB 1FPN1 3IMNA 4XJ9A 2X8KA 4IEOA 5F1RA 4W6XA 1G7YA 2WA3A 1UW8A 2LALA 1EV11 5BUVA 2W39A 2ZMLA 2A7AA 3OBRA 1RHI2 2Z69A 4XHXA 2W68A 2CGOA 4XETA 4IEQA 4AVAA 4Q8KA 5K8SA 2JECA 3GZUC 3SISA 1V6KA 2RR11 2XJPA 4HK9A 2ZMNA 2VVDA 2HWF3 4QT6A 1YLLA 2CAUA 1Q5OA 2ERFA 4J6GA 1HQLA 1OOPC 4RSUA 2ET7A 4L97A 5JI9A 4LO4B 3JBG1 2X29A 2C5DA 2EF6A 4XW3A 3DPRB 1PNFA 2VW1A 3RYRA 5FO8B 1POV0 2KXLA 4HPKB 4RGGA 2XKOA 3FJSA 1I5ZA 2VVFA 2ZGKA 1AR82 4J1XA 5LK7B 2VXRA 1TMF3 4YNIA 2AUYA 1IKPA 1H1MA 1UU4A 4LA2A 4GB32 4EWEA 1F2NA 2YMZA 3R4SA 2WZPP 1F5FA 2XVGA 4HL0A 3WNXA 2Z42A 4XZPA 5BNPC 1KJLA 2G4IA 1B35C 1VAVA 4COUA 1UU5A 4NO4A 4HZFA 4MUVA 2RMU1 3I2DA 1MS5A 2VECA 4GH4A 2Y0IA 1NLRA 5JAXA 3UJOA 3M7AA 2WNUA 4OHYA 4RR3C 3NV3A 5I8YA 4Q0PA 5FAXA 5FQ0A 3T1MA 1GANA 1VALA 4YVSC 2V73A 4H55A 4XBLA 1XU1A 4PCRA 3W58A 3MPBA 2VPVA 5AFBA 4HKOA 4C1WA 2GMEA 2LM3A 3PNAA 2QNKA 3FFZA 5KHIA 1RITA 5ACA1 3AP9A 3NV4A 4YVWB 2ZGSA 3T2TA 2HWF2 1IPJA 2LTNA 3WR0A 2RS11 1O7FA 1FX5A 3E6DA 1ULDA 3JZVA 1RVF1 5JZGB 3LA3A 2ZTNA 3R0RA 4COVA 4KG0A 2RS31 2QDRA 3J8F3 1TEIA 1YFWA 1VP6A 2G9FA 2GAUA 2ZPXA 4QX5A 1ZVFA 3E5QA 1ULGA 4PDWC 3ZFFC 1ZBE1 2TBVA 3FMGA 3ZDSA 4R4ZA 5H9SA 2VUJA 4FPYA 4I30A 4FSJA 2CTVA 2FZ1A 1TMF2 2B8MA 2Q1ZB 3GBGA 2BWAA 3ILRA 4ITCA 1D4M1 1RUJ3 5DUUA 4LULA 2DURA 1FOD3 1LOFC 4RHV1 4OVEA 3WZ1A 3KCCA 5T50A 3O5SA 4FPFA 3VBSC 2JICA 3RYPA 2BNMA 3M3IA 1LOGA 3N4MA 4C0BA 1I3HA 3P3NA 5CU1A 4CP1A 1OKQA 1ULFA 4JRAA 3WW1A 5CFCC 2VQAA 1UIKA 2PYTA 2P3KA 4OHVA 1X8EA 4KGGA 1V9U3 3NV1A 1J1TA 3L9JT 2Q0AA 5I91A 2MEV3 3UL2A 2B39A 2A6XA 4CP2A 3BTAA 2AR6A 2D6PA 4PLNA 1A8DA 4DB5A 3H3UA 3B02A 3AKSA 3CO2A 3IN9A 4I0WB 3ASIA 1JUHA 1W6NA 2XJRA 3PVNA 5EYXA 4IERA 3H3ZA 1FATA 1AR73 1UAIA 5ABJA 1EPZA 5FLIA 2GN7A 5JIAA 3I54A 3O12A 3TBDA 5EZWA 4UXAA 3AK0A 3RZZA 1F9KA 3J8F2 1C1FA 2PA7A 3B3QE 1UD1A 4GIQA 1M4WA 1I9RA 3B7MA 3PJYA 1K5MB 4HKLA 5D1IA 1O4YA 3INAA 3M70A 3U07A 2ZZQA 1U12A 2R061 4FPCA 4XIKA 5DXDA 4EN9B 1J3RA 1X36A 1AVBA 4FPLA 2FMYA 1LOEA 2BFUL 4HVQA 1RUJ2 1JYCA 2WKKA 4AEJA 5EXOA 1FOD2 5BNNB 2R042 5GLUA 3ZMOA 3AKQA 1OA2A 4O9EA 2XB6C 3QBQA 3BALA 1OPMA 1HW5A 2G9GA 2Q30A 3POYA 2F4PA 4P9GA 3UK9A 3H8UA 1O3SA 2VG9A 2P37A 1V6MA 2IXKA 1Y43B 3AX4A 2ZACA 3V56A 3M1HA 4W6WA 5L7OB 1NCRB 4W65A 2DYCA 4JGYB 1HRV3 1RC6A 1JXNA 1N47A 2CY6A 1FV3A 4ES8A 1ND2C 1A6CA 3FUQA 3QLQA 2A6WA 1RTVA 1V9U2 1S55A 3AM2A 4UBGA 1DZTA 1A8MA 4Q0UA 5H9QA 1ZM1A 1LULA 1FV2A 2MEV2 2H6BA 2WJSA 1WW7A 3ZFGA 4LR4A 3HR9A 4AFBA 4EROA 3WX5A 4PIYA 1VBC3 1QOSA 1VBE3 3C2UA 2IXJA 3SCFA 5J36A 4COYA 5FBZA 3ALQA 5C4WB 1NE6A 4AEDC 1SDWA 4YGEA 1AR72 1JTZX 1PO23 5FTTC 1WW5A 2ZJCA 5CG8A 2D44A 3MIGA 3VBHA 5K0UC 2CGPA 1AR93 4OHXA 4RGAA 2ZHNA 2XHKA 3NV2A 3DN7A 1X8MA 2WC2A 1DGWX 4Q27A 3UKNA 2ZX1A 4QQPA 3BB6A 1QH6A 5LEKA 1CAUA 3Q9OA 1YYNA 1C1LA 1WLCA 1W0OA 1UPIA 3EHKA 3GYDA 1BEV1 3ZYRA 2ARBA 3B9IA 1V6IA 3ST7A 4K1YA 1RHI1 4HANA 1LRHA 2HWE1 3KZ4C 3QH7A 4OHZA 3CNAA 4FOWA 1Q8PA 2JG8A 4YG3A 1PVC1 1ONAA 1S0EA 3IIAA 4I3GA 1YXWA 4QQ2A 4ZXKA 2D98A 3C3VA 5FMOL 5JPMB 1F8VA 2XLFA 1F5JA 5T5LA 4F3JA 1WW6A 1KFXL 2ZHMA 4XFFA 3AP6A 5J37A 1HRV2 1S0DA 1V6NA 2XJUA 1IS3A 2D5FA 1KDKA 2A6VA 4IEXA 5HCBA 4Q4W1 3HD8B 2XH6A 3H1MA 1O3TA 4FTSA 1U5IA 1HXS3 2C0ZA 3WQ7A 4HT1T 4D7TA 3ECQA 4AG4A 5CADA 2A73B 2O0OA 3AP5A 3B01A 4RD7A 2V09A 4R9BA 3MF6A 1SLTA 4JGZC 1MS9A 4Q8LA 4XQ4A 1VBC2 2NLRA 1VBE2 3ZXGA 1OQ1A 2KA3A 1IOAA 2IC1A 1NCQC 1JOJA 5CFDA 2HKXA 4BHPA 3FWEA 2UWAA 1OD5A 4HSJA 5I0TA 2PQQA 3FZ3A 2DVAA 1PO22 1PGW1 2OUHA 1LEDA 3RI8A 4RQPA 1AR92 2JKBA 4Z1VA 4OZXA 2BTVC 2EXKA 1XXNA 5I0UA 4B3NA 3JQWA 4DRVA 1M06G 4QM8A 1RUC1 5DUVA 1NY71 2B45X 1JBCA 4GXLA 2WZR1 2Q8OA 5CBLA 1D0HA 1N3QA 2E6VA 1YCIA 4YW3A 4BM8A 4X8PA 4XF3A 4GH4B 1VBB3 3N7KA 1ZNPA 2DTWA 4UBHA 2PHWA 1ASJ3 2WNUB 1YFYA 3ILNA 4MGYE 4AGGA 5FQ0B 4O9GA 1AYN3 3DPRC 4I09A 2DVFA 3VDDA 3K48A 4RS5A 1VBA1 2PN5A 4UW3A 4V1PA 3R6SA 2HWF1 2DCZA 1ZBA3 3UV9A 2DVBA 2VULA 4N9HA 1X33A 1WLTA 3EXUA 4JDOA 1QJY2 5KXCA 1KRIA 5JZGA 4K6BA 1V00A 4BMEA 4URTA 1MZFA 5B2GB 3WUDA 1HXS2 3ZN6B 2ET1A 4K20A 4LBLA 1N1SA 4MGIE 3VGIA 1MZEA 4N43A 4LO7A 4Q0QA 2YGLA 4IEVA 3VKMA 4LE4A 2AH2A 3QOPA 2PHRA 4AK3A 1DGLA 1VR3A 4JAAA 2IWGB 1V6LA 5C9AA 1R1ZA 2JJ6A 2XVKA 1PHMA 4A7ZA 3GBWA 1C8M3 4XOGA 3WCSA 1GYKA 5A32A 1GQHA 4Z92B 4DPNA 2O8OA 1NQDA 1APNA 3TAYA 3ZN5A 1QJZA 3GZTB 2XBO1 4QQLA 2QJVA 4YVWC 1DF0A 1LU2A 3VHRA 3IDCB 1RUE1 1IHMA 4IEWA 1C8NA 2DTYA 1HIXA 2EIGA 5FDBA 1VBB2 3KGZA 5JZGC 2D6OX 1TQ5A 4HFSA 3WOGA 1ASJ2 1WA4A 2Y26A 1NG0A 5FFOC 3LB9A 1AYN2 1DGRN 1X7NA 1LEMA 1O4ZA 4GULA 3LOIA 3WP6A 3ELNA 1ZBA2 2R49A 2Y38A 5KHHA 3WG3A 3D4KA 1UKRA 5I0SA 4Y4YA 1YJLA 4XE9A 1SEFA 2WS93 4COWA 4Y1ZA 4MV2A 4HBNA 4OI2A 4PLMA 1YUDA 2WIIB 4GMP1 1COV3 5GALA 5ABJB 1CD3G 2PHXA 4XFIA 1GKBA 1AX0A 1RMU3 4BMBA 2XG3A 4AHXA 5AC91 3U0ZA 1GNZA 4IL7A 1QXRA 1RUI1 4W6YA 1QQP3 1KXGA 1RJ7A 2RM23 4Q4Y3 2VNOA 1WLDA 4GWNA 3J4UH 4PBOA 5D8AA 2V5YA 3V0AA 4I02A 1F31A 4XFHA 5CB7A 1JN2P