2HWF3

A comparison of the anti-rhinoviral drug binding pocket in hrv14 and hrv1a
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
238
structure length
238
Chain Sequence
GLPVYITPGSGQFMTTDDMQSPCALPWYHPTKEISIPGEVKNLIEMCQVDTLIPVNNVGNNVGNVSMYTVQLGNQTGMAQKVFSIKVDITSTPLATTLIGEIASYYTHWTGSLRFSFMFCGTANTTLKLLLAYTPPGIDEPTTRKDAMLGTHVVWDVGLQSTISLVVPWVSASHFRLTADNKYSMAGYITCWYQTNLVVPPSTPQTADMLCFVSACKDFCLRMARDTDLHIQSGPIEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 1A COAT PROTEIN (SUBUNIT VP1)
publication title A comparison of the anti-rhinoviral drug binding pocket in HRV14 and HRV1A.
pubmed doi rcsb
source organism Human rhinovirus 1a
molecule tags Virus
total genus 33
structure length 238
sequence length 238
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1994-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2hwf300
4CEYB 1RB8G 1RVF2 1RUE1 1RUH3 2PLV3 5BNNB 1QQP1 2ZZQA 1VRH1 1VBE3 2HWF3 4CDWA 4JGYB 4RS5C 1AR91 5C4WB 3VDDC 1RUG1 1H8TA 1NY72 1AL21 1ND2A 5CFDB 1RUI3 1EV13 4CEYC 4GB32 2R062 3CJIC 4CDQA 4CDXA 4RR3A 2R041 2TBVA 4N43B 1RHI2 1WCDJ 1TMF2 4GH4C 3ZFFB 4IV3B 4CDUC 3DPRB 5C4WC 1R1A2 4JGZC 4BCUA 4LLFA 2FZ1A 2XBO3 1RUJ1 2HWB1 1BBT3 1NCRA 1VBC1 1ND3C 1PVC1 4Q4W3 5ABJA 4GMP0 1VBD1 3JBG3 2BPA2 1BEV3 4CDWB 4N43C 1R091 3JD72 1TME1 4Q4Y3 4FTBA 4GMP3 3ZFFC 4IV3C 2WS92 1RUF1 1PGW1 3VBSA 5L7OC 3NAPA 1H8TB 1AR81 1PGL2 1MQTA 5AC91 5J96B 1AR73 2XPJA 1ND2B 1ZBA1 4AEDB 1QJY3 1ZBE2 4CDQB 2RS52 4RR3B 2MEV1 1OHFA 4N53A 3M8LA 4QPIA 1RUD1 1RVF1 4RQPB 4CDWC 1K5MB 1C8M2 1PO13 1R082 1H8TC 1ND2C 2HWC3 5ABJB 2X5IB 1BBT2 5JZGB 3VBRA 4CDXC 1ASJ3 1NY71 4RR3C 1PIV2 4JGYA 5D8AB 1OPOA 2MEV3 4GB31 2R061 4YVWB 2RR12 1RUD3 3S6PA 5ACA2 1RHI1 1V9U2 3VBSB 2QQPA 1HXS3 1QJU3 1MQTB 1VBB2 5FMOS 4Y4YA 3TN93 1NCRC 2R072 2BFUS 1D4M3 1QJZA 1R1A1 5ABJC 1C8NA 4EJRA 2RS12 4FTEA 2RS32 3ZFEA 5A33A 3DPRA 5CFCB 1NG0A 3J8F3 2GH8A 2Y26A 2HWE3 3JB4C 4Q4V2 1VAKA 3VBSC 3ZFGA 3NAPC 3JD71 1MQTC 1AL0G 2BBVA 1HRV3 1EAH2 3VBRB 1PGL1 1AUYA 1QJX3 1Z7S1 4N53C 4QPIC 1COV2 2IZWA 1AYN3 1ZBE1 4Y5Z0 2RS51 2WZR3 4NWWA 4Q4X1 1RMU3 1FPN3 1AR63 2WLPA 1RUC2 1VB4A 4RHV3 1VBA2 2DF7A 1HRI1 5DDJ3 1C8M1 3VBFB 4PDWA 4AEDA 1AYM2 1R081 3VBOB 3VBHB 1B35B 4FSJA 2HWD3 3VBUA 1MEC3 5FOJB 1E57A 5C8CB 1PO22 5BNNC 1D4M2 2RMU2 1RUE3 4RQPA 4JGYC 1QQP3 5J98B 1K5MA 1VRH3 1IHMA 3ZFEB 3ZXAC 5A33B 1Z7S3 2RM22 5K0UB 1PIV1 3ZFGB 1AR93 4Q4X3 2WFF2 5FMOL 2RR11 2BFUL 5ACA1 1X36A 5CFDC 1V9U1 2X5IA 1RUG3 1HRI3 1FOD2 1NCQA 5JZGA 1AL23 1VBB1 3FBMA 4QPGA 1RUH2 2PLV2 2R071 5D8AA 2R043 4YVWA 1VBE2 2HWF2 3DPRC 3HAGA 2RS11 1W39A 2RS31 4SBVA 4PDWB 4CEWA 4RFT0 1RUJ3 2HWB3 3VBUB 4Q4V1 1FMD1 1VBC3 5BNPA 1RUI2 1EV12 2BUKA 1PVC3 2HWD2 1VBD3 1EAH1 5BNOA 1X33A 1A6CA 2GSYA 5CFCA 1OOPA 1R093 1CD3G 4YVSB 1TME3 1HX6A 1F2NA 1RUF3 4PDWC 4AEDC 2XBO2 1M06G 1RUC1 1AR83 1NCQB 4CDQC 5AC93 1NA1B 1VBA1 1ZBA3 4QPGB 3VBUC 5C9AB 4Z92B 4Q4W2 1AYM1 4WM7B 3JBG2 1BEV2 4RQPC 4WM8B 1HQNA 1K5MC 3VDDA 1PO21 1RVF3 2RMU1 4Q4Y2 1TMF1 3VBFA 2RM21 3VBOA 4CEWB 3VBHA 1B35A 5BNPB 1AR72 2X5IC 1QJY2 5C8CA 5JZGC 2WFF1 4QPGC 5A32B 2VQ0A 2ZAHA 5D8AC 5BNOB 1FOD1 4YVWC 1OOPB 1RUH1 1POV1 2PLV1 5K0UA 4GB33 1PO12 2R063 2FZ2A 1DDLA 4FTSA 4IV1A 1RHI3 1VBE1 2WS91 4CEWC 5BNPC 2HWC2 1R1A3 4RS5B 4NWVA 1ASJ2 1ZBA2 3VDDB 1POV0 5BNOC 5L7OA 5CFCC 1RUI1 1EV11 3LOBA 1GFF2 2MEV2 1RUD2 3CJIB 1POV3 1HXS2 1QJU2 3JD73 3TN92 3VBRC 2WS93 3IDEA 4GH4B 4CDUB 2WWSA 2XBO1 1BBT1 4JGZB 1ZBE3 4Q4W1 4YVSA 2RS53 3JBG1 1BEV1 1ND3B 3J8F2 4IV1B 2HWE2 3VBFC 3VBOC 4Q4Y1 3VBHC 1B35C 1C8M3 1NA1A 4GMP1 1R083 5C8CC 5C9AA 1HRV2 4WM7A 4WM8A 1QJX2 1AR71 5L7OB 1QJY1 1AYN2 3ZFEC 1CJDA 2WZR2 1NOVA 5K0UC 1RMU2 1FPN2 3ZFGC 1AR62 4IV1C 1PIV3 4RHV2 5DDJ2 1PO11 2RR13 1BMV2 5ACA3 1V9U3 5A32A 1MEC2 1VBB3 1RUE2 2R073 2HWC1 1COV1 1QQP2 1VRH2 1Z7S2 1ASJ1 1AR92 2RS13 4Q4X2 4CDXB 2RS33 4RS5A 1RUG2 1HRI2 1HXS1 1QJU1 4Q4V3 1FMD3 1AL22 3TN91 1D4M1 2R042 1EAH3 1NCRB 3JB8A 4YVSC 4CEYA 1VB2A 3CJIA 1COV3 5BNNA 1NCQC 1NA1C 3J8F1 4GH4A 2HWE1 1RUJ2 1RUC3 2HWB2 5C9AC 4CDUA 1VBC2 4WM7C 1VBA3 5C4WA 4JGZA 4WM8C 1PVC2 1AYM3 3NAPB 1VBD2 1HRV1 1F8VA 1ND3A 1PO23 1QJX1 1R092 5CFDA 2RMU3 2HWF1 1AYN1 1TME2 1TMF3 4N53B 2WZR1 4QPIB 1RUF2 1PGW2 4N43A 1RMU1 1FPN1 2RM23 1AR61 1AR82 3ZFFA 5AC92 4RHV1 4IV3A 5DDJ1 5GKAC 1SMVA 2WFF3 5LK7B 2ZTNA 1BMV1 1OOPC 1FMD2 2HWD1 1FOD3 1MEC1
chains in the Genus database with same CATH superfamily
4QX5A 4CEYB 2D93A 2VZSA 3I2KA 5T52A 1RUH3 4KU7A 4HVQA 3QCWA 3POYA 1JYCA 3JZVA 5IT6A 2VMIA 1S0EA 2YYOA 2P4EA 2Y60A 3JCIA 4IESA 3T0AA 4D0QA 4XXAA 2HWF3 4AI9A 4JGYB 4CDWA 1O91A 5A6QA 3SXWA 1ALYA 2OW4A 2F6BA 3H42B 1HW5A 1U12A 3L2HA 4KQ7A 5FYUA 1ZRFA 4UFHA 2RDQA 4YFZA 1XQNA 2A7AA 3PUSA 3LSDA 1RUG1 5HCBA 2XXZA 4XQDA 2G4IA 5IVFA 5CFDB 2E51A 4CEYC 3KWVA 1SBEA 5FY1A 3TRSB 4KWKA 5GZCA 2IVIB 1UZZA 5KXDA 1QNYA 1RHI2 5FYMA 3SKVA 4QDSA 1YIFA 3MW2A 2GH2A 1TMF2 3W5NA 1H2LA 1LHOA 3CZJA 1GOFA 4QQPA 3OYWB 2YUEA 4BIOA 4DXRA 2W1WA 5FZHA 3CDZB 4EV0A 3KZ4C 4YLZA 2A3YA 5KWRA 5HV4A 2XBO3 5DAWA 3NKGA 2FCVA 2MNGA 4MSVA 1C1FA 2DU1A 2R1BA 4K21A 3OGVA 2DCYA 4S2HA 1ND3C 5GZGA 1CR7A 4Z1VA 1J1TA 5ABJA 1QOSA 1H2KA 4NIHA 4XQ4A 4BK5A 2HBUA 1YLLA 4CVUA 2R0HA 2E7AA 1C28A 4UWDA 3UL2A 1UU5A 2XQXA 3USUA 3J7LA 2XR4A 4Q2FA 4AYUA 1G9DA 1JOBA 4Z82A 1PZ8A 3JD72 3LE0A 4NHKA 2ENRA 3EB7A 2B46X 2WS92 3K4AA 5T5LA 3O1UA 4AI3A 1RUF1 3UV9A 5C5UA 2D5HA 2Z4FA 4B7KA 5DUVA 5A7PA 5LBBA 2FDIA 2VBDA 3HIFA 1MQTA 3ACIA 5J96B 1AR73 2XPJA 1QJY3 2DUQA 2ZMNA 4RR3B 2MEV1 4Q0PA 4FT8A 5FZBA 1CAWB 3KT1A 1LU1A 1ST8A 2E26A 1RC6A 4R8HA 3UYJA 4OHYA 1K5MB 4EE2A 1C8M2 4C8DA 3EJKA 5SV5A 2GC3A 4FPKA 3T30A 3VLBB 1IKQA 2JB4A 3PUHA 1UX6A 3OUJA 1T6GC 1UPIA 1XNBA 3FLTA 1HIXA 4CPBA 4ZZ5A 4RA0A 2QNKA 3WNPA 3NNFA 2X5IB 1YJLA 3HEIA 3O1RA 5A3OA 4X8NA 4Q0QA 4CDXC 2MHFA 1ASJ3 1NY71 2JIJA 3D0JA 3D0SA 4RR3C 2EIBA 4BHPA 4P14A 4JTOA 4E4HA 3JUUA 2Z2SB 4I0BA 1JZ4A 2MEV3 4GB31 3H3ZA 5LRRA 1ZREA 4IEYA 5JSPA 5IVJA 2ZGRA 4IDZA 4IEWA 3ABZA 2BRTA 2C6SA 1I6XA 2VULA 1HXS3 4AF9A 4CU7A 1PK6C 3M3IA 4CCNA 4IGOA 1VBB2 4PIYA 4QU1A 5GALA 1GOGA 2Q1ZB 1SG3A 2WNUB 4B1LA 1QDOA 4BXFA 3WW2A 1D4M3 5JIUA 4V2WA 5LA1A 4Z8BA 1QJZA 1R1A1 1GWMA 1X9PA 4PI0A 5T5JA 4D3WA 2Q4SA 4FPGA 2DUPA 2QTWB 1SFPA 1CQ9A 1OQDA 1Y9GA 3LSEA 4CYDA 2FDKA 4BQYA 3IMMA 1IPSA 2XUMA 4JRAA 4FTEA 4HKLA 3KV6A 3MF6A 2RS32 1YRZA 2CDOA 4IETA 2PFWA 4O9GA 3T2OA 2OQ6A 1OVPA 5A33A 1LHVA 1NT0A 1SFNA 3B02A 1YFWA 2WNVB 3DPRA 5CFCB 2Y26A 2HWE3 4Q4V2 2P6HA 4YZ1A 5F3IA 4HVOA 1UYXA 3CLPA 3R05A 1NX9A 2HH9A 1EAH2 4ATFA 5JPNB 1CZTA 2PHXA 5CAZA 4W4ZA 1H0BA 3AYEA 1PGL1 1AUYA 1QJX3 1Z7S1 3OEBA 2YZ4A 3PVBB 1ZBE1 1OD3A 1MS4A 1NLQA 3LPFA 5FY8A 4Y5Z0 3SCFA 2FDJA 5JAXA 1RITA 5CZKA 2Q0AA 1RMU3 5DMYA 3SHRA 1AR63 2IVJA 4JDMA 4LO5B 4XAAA 4XUQA 1RGSA 4XOGA 2WQZC 4S2GA 2WNVC 2ZEZA 2ORZA 4XMIA 4C91A 1VB4A 3K48A 2FD8A 3FHAA 3NJZA 4PDWA 1F5FA 2XJSA 4AEDA 1LTEA 2ZEWA 3CEWA 4MLOA 4XIOA 4CU6A 3I2DA 4XJUA 1MEC3 1UIKA 4Y22A 1E57A 3M7AA 2WN3A 1W04A 1D4M2 1Q8VA 3R6SA 1RUE3 2VJXA 2ZX3A 2JX9A 1DGWX 4H2AA 1GYKA 3OF1A 4HZFA 1YIPA 1Z7S3 1WUVA 4IE5A 5FJKA 4IEUA 3UJOA 3ZFGB 4HLTA 2WFF2 4XEZA 5CKMA 4LITA 2RR11 3CO2A 4XMAA 3CJXA 1XNDA 4GJZA 2WYFA 2YU1A 4D94A 1QWRA 2IXCA 5DN2A 3O1MA 4IXLA 1XC6A 4OVEA 5JZGA 3A4UA 1AZDA 5LBFA 4QPGA 3VHPA 4EWDA 2OUJA 2PLV2 2XL9A 4WBBA 2DWRA 3BPZA 3PU8A 1HB1A 3WINE 3LOIA 2AC1A 4LO4B 4M01A 4YVWA 3I2GA 2ZX1A 4S2FA 2WT1A 5A80A 1YXWA 2IXIA 4HONA 1SLAA 3T09A 5FYBA 4RN5A 2LALA 4AQSA 2G9ZA 5IFTA 3HAGA 1UYYA 2RS11 3LEMA 5D2AA 5FXXA 3T08A 4XFCA 1AX1A 2BOIA 4AR2A 5FLJA 4BK4A 4XDPA 3ZN5A 2AUYA 2DVGA 3P5BA 4BQ4A 4RFT0 5EJ1B 3VBUB 3WHTA 4BMBA 5BNPA 3BTXA 2XMLA 2QUOA 2VMEA 3EO6A 3R4DB 1XSQA 3HWJA 1PVC3 1H30A 4K6BA 1VBD3 1XU1A 1TZOA 3FL7A 1UY3A 4JQTA 4E4DX 1TNRA 2JICA 5FPAA 2VZ3A 3DGTA 3HVDA 1PM7A 2ZGNA 4OI2A 4YVSB 5F39A 2BOJA 4LBOA 1H9PA 1FI2A 4MXWB 1X9TA 2GN7A 3NVCA 1LGBA 1PGSA 2ADDA 3POFA 3AMHA 4TN7A 4AAPA 1IQAA 2Q5TA 3CBNA 2ZABA 2ZKLA 1NA1B 4XF1A 5DAQA 1ZBA3 3VBUC 5F1RA 1BXHA 3NJYA 3JQXA 5C9AB 5CVRA 2ZKNA 5HXVA 3RQ0A 4ARXA 1AYM1 1K45A 1VJ2A 3JBG2 1ZRDA 1PZ9A 1G9CA 4B7EA 2Y64A 1JH5A 2J1EA 4C90A 3ZMOA 2V4VA 3CZUA 2QVSB 4Q4Y2 5FZIA 5I0SA 2OYZA 1OI6A 3H3LA 1U5IA 1US3A 2Q1FA 2BYVE 4UW5A 2Q1MA 4YW7A 1DFQA 4WVZA 4LBKA 3OBZA 3BGAA 1K42A 3VBHA 5JSRA 3F2ZA 3G6JB 1APNA 2Q8EA 2EAKA 3H8UA 4OUSA 1KDKA 4SLIA 4QX1A 4HANA 2FCUA 2XWJB 1S0FA 1WW4A 4LBNA 2JDYA 2VQ0A 4Q26A 4QB6A 3IBMA 3OB8A 1OBNA 4AHZA 1DZTA 3O14A 4QMAA 4DFSA 3PIJA 5CEHA 1UKRA 1IS5A 1WMDA 3K51A 3RWNA 4OUMA 4DUXA 5IATA 2KXLA 2BV4A 2PHTA 4ZONA 5JLVA 5LB6A 3LDRA 5K0UA 2FZ2A 2R063 1MS9A 4LKFA 5I0TA 4A3XA 1DDLA 2I07B 2XJUA 4XJ8A 4FTSA 3SITA 4ITCA 4L2NA 3INAA 4A6OA 1YCIA 3O5SA 2E32A 3N7LA 4MGSA 1RL3A 5FPBA 4KNCA 1VALA 3NJVA 3T4HB 4NR1A 1PHMA 4X6RB 3WEZA 1HN1A 3PTYA 2HWC2 4YW4A 2GAUA 1W6OA 4LBLA 4MO3M 4RS5B 4S2DA 5FYZA 2YC4A 3MI8A 3NW4A 1G6NA 4A44A 3I59A 4AVVA 1ZBA2 3VDDB 3M2MA 4KGQA 2VNGA 2J7MA 1I5PA 3WNKA 4HBNA 2HBTA 2D5FA 4JKKA 2GNMA 4Y1XA 3DCQA 2EXKA 1DQ2A 4WZFA 2C1FA 1DQ0A 2GC0A 1VR3A 1RTVA 1QJU2 1RXFA 2XDVA 4FCAA 3BALA 2Q8OA 1WZXA 4QXBA 5FZ4A 2WRAA 2NM1A 2JG9A 2C24A 3HNBM 4MGQA 3T1MA 4G4FA 2B4KA 3NL1A 1UOBA 1Y3TA 1I3HA 1K5JA 1P8JA 4QKBA 4NRQA 4XFAA 2OA2A 3FJSA 5JWPA 1LECA 2QKDA 2XONA 4HSLA 4NHXA 4IUGA 5GZFA 5JIAA 1BEV1 1U0AA 5BXXA 3MV11 2ARBA 2X8KA 4OZXA 2JG8B 2JD4A 3VBFC 4R9AA 1WLWA 2ZCWA 4FAHA 2WR9A 1UIJA 4E4SA 4FXGB 4GMP1 3MFAA 4YG0A 2VCCA 3LFMA 5C8CC 5GLWA 3BN6A 4R9DA 4NN0A 4BB3A 2NN8A 2EIDA 3BPSA 2EVXA 5T55A 1IG3A 2GN3A 4WM8A 4DPNA 1LB2A 3MPBA 4ZY9A 4IEPA 4BZ4A 1QHDA 2IWGB 1W6NA 3ZFEC 4I0AA 1GQGA 1W9TA 1FNYA 1XE7A 5F6KA 4AQ6A 1EP0A 4LXLA 4BCUA 3N9NA 5A3NA 3PTRB 3ZN4A 3ZR5A 3K77A 3BU0A 1PIV3 3OY8A 2JG8C 5AVAA 3QOPA 3MW4A 1JBCA 2BJSA 1PO11 2J42A 2H0BA 2VVFA 3RZKA 1ZRCA 4I01A 2JDPA 3AB0A 4XQWA 5ACA3 5JOXA 4FQ4A 5FYYA 5A32A 5F9TA 4P9IA 5JMOA 4P5YA 3PVOA 4ORFA 1FYUA 2YXSA 2ZBJA 4LBMA 1BQPA 4NJ4A 4A7ZA 4XYXA 2VY0A 2WZEA 1GQHA 1QQP2 5JI7A 2Y8KA 2BTVC 2XLFA 1LRHA 5FYIA 1S0JA 1UZVA 5EQUA 1IG0A 4CCOA 1AR92 1POQA 3BOWA 5FPVA 3TEYA 4BQ1A 4J1WA 1JMUB 4QXKA 2QQNA 1TNFA 5DZGA 1CGPA 1GP5A 3LA2A 1YQ2A 1W8UA 2AREA 3W5MA 5DAXA 3UK9A 1AL22 2WYSA 4F7ZA 5I0RA 3VHOA 1ENSA 1W2OA 4GALA 5DQ0A 5FP9A 5JDBA 4C0HA 3O12A 2R042 2XQRA 1UMHA 5A1LA 1G9AA 3WQBA 3DV8A 3M3OA 2YDEA 3CJIA 5I93A 1ZM1A 2XVLA 3IIAA 1HQLA 3EXUA 1NCQC 1O59A 1ULFA 2W3JA 2VO5A 3E5XA 4GH4A 4YNIA 4RD7A 1AF9A 3VD5A 1RUJ2 1RUC3 1QU0A 2HWB2 4NMIA 3BTYA 2UURA 1VBC2 2A1XA 3I3BA 4BA6A 4QHBA 2YROA 1VBA3 1JTZX 3POGA 2CDPA 4FPCA 1V70A 2JEMA 3ES4A 5L73A 5FY7A 4LT5A 4N7UA 5H9RA 2VTXA 4XAEA 2ERFA 3PDQA 1PNGA 2ARCA 2E53A 4QX0A 4TZDA 3EBRA 3AL6A 3N7KA 5HBAA 1HV0A 1R092 4AGRA 1BJQA 2VM9A 3ZPOA 1AYN1 1TME2 1U5YA 1TG7A 4QQOA 1UY4A 1AXKA 1U5XA 1WLDA 3FHIB 4QQHA 3P6BA 2WZR1 4AXOA 2OIIA 2VMCA 2E7QA 1PX3A 2NLRA 5LBCA 1IPJA 2H6CA 5E1RA 3LD8A 5AC92 5DDJ1 3OGSA 3ZYPA 2A6ZA 4E2QA 5GKAC 4HSJA 2CSGA 5IYYA 2KR2A 3V0AB 1MZEA 3NNMA 5LK7B 3H8XA 3GCWA 3W20A 3W58A 4YFWA 1BMV1 3HT2A 3OEAA 1OOPC 3MEPA 2O0OA 3WP5A 4LBQA 1YUDA 1FOD3 2QQOA 3K4ZA 4J1XA 3RRDA 3VGIA 1RB8G 1RVF2 3DEMA 4BU2A 5A3WA 3WSOA 1WD3A 4LA3A 1YQCA 2VNOA 3AYDA 3LPGA 4YSFA 3POSA 2B42B 1VRH1 2ZZQA 4XFHA 5JSOA 5FY9A 4HPKA 1VBE3 4YG3A 3NMBA 1BVP1 4AFBA 2RDSA 4DINB 4LKSA 3ZYHA 1QH7A 1J58A 2D3RA 2P3IA 3FC0A 3RYPA 2Q30A 4YW6A 4CPBD 4DQAA 4N90A 1N3PA 4UAPA 1OH3A 3W21A 4QXHA 2VW1A 2VECA 4YYOA 2CYFA 3LIGA 3POJA 1UZ0A 3FUOA 1RUI3 1EV13 1GNYA 1XE8A 4J6GA 5L19A 1DQ5A 2P17A 5FO9B 2OT7A 3M3QA 4QDRA 4Y24A 4N43B 2CWSA 3MIFA 3QD6A 1WCDJ 2V73A 2WFPA 2R49A 4AK3A 3EQEA 4EQVA 1H4HA 5IAVA 3ZFFB 4IV3B 3J7NA 4CDUC 5E16A 1O3RA 2K46A 3DPRB 1J3RA 4HG6B 3BOPA 5DZEA 5FP4A 3U14A 1OA2A 4JGZC 4YZ3A 1UO9A 1KQRA 2Y6LA 1S0GA 3IDBB 4LHSA 2VOTA 3ZX7A 1NCRA 1W8WA 3DL3A 1S0BA 3B00A 5FMCA 1Y43B 4PIXA 1V6KA 4Q4W3 3ZR6A 4XE9A 5A1FA 1V6OA 2BPA2 3FMGA 1W8HA 1NE4A 1LR5A 5LEKA 2VUJA 4N43C 4OHVA 3CNAA 4L97A 2D43A 5FZMA 5C6CA 5FYVA 3U75A 3GBGA 3WF3A 3RS6A 1V6NA 3ZFFC 1O8SA 4IV3C 5HI0A 5JOWA 4ZZ8A 1PGW1 1WKYA 2BGCA 1XPWA 3E97A 1DYKA 3KM5A 3NAPA 4E4ZA 5LASA 3HQXA 3HPNA 1H8TB 1AR81 4EN0A 2EXJA 3NNGA 3U4XA 3ACHA 3MIHA 5DXDA 1ND2B 4AEDB 3ZN6A 1L3JA 1JUHA 4M0NA 1PNFA 2RS52 4CDQB 5FK7A 3S7IA 1BYHA 3WOGA 2FQPA 1IPKA 3GYDA 4R4XA 4EN9B 3I3DA 2DTWA 2OS2A 1HJGA 5CG9A 3KCCA 2Y6FA 2VD7A 2XKPA 4CA9A 3U0ZA 4Y33A 1ODNA 5A7WA 2B7YA 2GMPA 2PN5A 1R082 1D4VB 2GMMA 1WW6A 4K9SA 1XNCA 4WVVA 4LORA 1MZ6A 2ZGQA 1CESA 4AEKA 5KHHA 3SNMA 5A1AA 1JS9A 4NHLA 5FXVA 1H8TC 2YV8A 4COZA 1OVSA 2ZGTA 5KHJA 1ND2C 3AX4A 3QACA 2CGNA 1JZ5A 1PMHX 2J22A 2LM3A 4P08A 5JZGB 1SZBA 2J1AA 3IN9A 4MXVA 3POBA 3FLRA 5E8AA 2CGOA 1VLNA 1DQ1A 3GZAA 4K8RB 3B01A 3DXUA 4JTNA 5F6LB 3O1VA 1XNTA 2VCAA 4OMCA 4YVWB 2W92A 4L11A 2YU2A 3J26N 1RHI1 1V9U2 4C1WA 3VBSB 2WNEA 2GDFA 3P1IA 4OULA 5LBEA 2O8OA 2VG9A 1J59A 2Y0OA 4UW3A 2VTFA 3G7DA 4YGDA 5FMOS 1QF3A 4CUGA 3TN93 3IDCB 4MX3A 4Y20B 2R072 3BKZA 3WDVA 2AZ5A 3E1F1 2H0VA 3OD0A 4IGQA 4BQXA 3WDUA 3GDBA 1H2NA 4FFIA 4EJRA 5EIYB 5LA0A 5ANNA 5L9RA 4XTMA 2ARXA 5IVBA 1Y4WA 2ZHLA 4Y1ZA 3MDPA 5A7OA 1CX4A 3ZFEA 4QM9A 3J4UH 4PF5A 2EXIA 3J8F3 1ZZCA 1JUIA 2GH8A 2VQAA 3QH6A 3U10A 2JXAA 1S0CA 3VBSC 2VQUA 2DFCA 3JD71 3N9LA 1R1ZA 3RZLA 1YWKA 4ZS3A 1JYNA 3AMQA 4RFRB 1UMIA 1C1LA 1HRV3 2D97A 2DVDA 2NMNA 2ET7A 5DAVA 3VBRB 4AAXA 4PQ9A 1CPMA 2RDRA 4N53C 2PAMA 4QPIC 1COV2 1JU3A 3LDKA 3RI9A 5FYCA 2Z5WA 3N9MA 4DRRA 1MVEA 2ZHKA 1G9FA 1REDA 2GP3A 4Q4X1 1TE1B 1Y7BA 1BK1A 1FPN3 2AEYA 1ULGA 1UF2C 2VCBA 2WLPA 3AMMA 1GNZA 3HJRA 2X05A 4RHV3 1OLQA 2J1SA 1E5IA 2GNDA 2K9ZA 4OI1A 1C8M1 4XFGA 3OGRA 4XDOA 3GALA 3RG0A 2JE8A 1WBLA 2P34A 5IVYA 3VBHB 1WCUA 3UT0A 3GJAA 5A70A 1LGCA 2HWD3 3MO4A 3ZPYA 1PO22 1W0OA 3OOXA 4YZ4A 2RMU2 5FR3A 2V4AA 4LEJA 4LIVA 1YQ8A 1OD5A 4RQPA 4B1MA 3C7EA 4JGYC 3WVJA 5EFUA 5J98B 4CCLA 1CAUA 4COYA 2VZ1A 4KWJA 2RM22 4QX8A 4RSUA 1VE0A 1F5JA 3ZXKA 2VZOA 5IW0A 2JKXA 5K0UB 3IZOA 1W6QB 2IXLA 4CP1A 4UW4A 4Q4X3 1OT5A 1BK0A 2R1DA 3I54A 4FP3A 5E89A 3WG3A 4XBNA 2FMDA 3WF2A 1O3QA 1E5SA 1X36A 2V5YA 5CFDC 3IMNA 2A5ZA 1RUG3 1NCQA 1W6PB 4B4PA 1WCSA 3NRUA 4HT1T 4AWDA 4YM0A 1VBB1 4XFFA 5F5CA 4URTA 1RUH2 1XBFA 4X8PA 3MFCA 4FQZA 5D8AA 2CHHA 4PCRA 3U11A 5T5PA 2HWF2 1CAVA 1JOPA 5DUXA 5F5AA 1HV1A 5GLZA 1HDKA 3OBRA 3AP6A 3BTZA 2RS31 4SBVA 3ON7A 3T0BA 1S0DA 3UKNA 3LA3A 5IVVA 3ZYGA 1KXGA 3TNQA 4COVA 4Q4V1 5F8PA 2JG9B 4WZCA 1Q8QA 1AX0A 2Q8DA 1KFUL 2HWD2 3EMRA 3RVHA 1EAH1 5FBZA 4JAAA 5GJ6A 3ECQA 5FCCA 2D6OX 2ZGSA 3RI8A 3TNPB 2GSYA 4K1YA 1N1VA 3O0WA 1OOPA 4UFMA 2A3WA 3T3YA 2VXRA 4CU9A 2K2SA 1LHWA 5F2SA 1OURA 3OPZA 2WAAA 2BVBA 3K4DA 3VKMA 1RUF3 1N1TA 1I9RA 2W0XA 3H50A 4CP9A 4F8AA 1JHNA 2XBO2 3LEIA 1M06G 4KGGA 1UY0A 2JECA 4UOJA 1DBNA 3WF1A 4ES8A 5APAA 3ZYFA 3E6BA 2RVAA 2BNOA 2ZXQA 1WMEA 2GZWA 4Z92B 3O1OA 1QJFA 4LTAA 4H14A 3F95A 1UYPA 3UJQA 4WM8B 1K5MC 1OLRA 2BVVA 1W6NB 3H3UA 3KVBA 4FXKB 5T50A 1ULEA 1RXGA 1QY4A 4YW2A 2R32A 3K3OA 1WBFA 4TSVA 4UFLA 1CAXB 3LA7A 1KDMA 3OCPA 4NUBA 3MGUA 4M3CB 4BE3A 4OQ9A 4EZ4A 1JHJA 2WNOA 1EPWA 5J48A 4BXSV 2VUAA 2E33A 1XE0A 1CVNA 2BNMA 2C0ZA 3OY8B 3VBOA 4CEWB 1B35A 4ARYA 3LAGA 5KC5A 4NIDA 1AR72 2X5IC 2EICA 4BOWA 3GZEA 1QJY2 2XJQA 3PIGA 5IVCA 2WFF1 3RYKA 2PYTA 4OFGA 5ERLA 1MS3A 4XCAA 2R16A 4QKDA 5A32B 1JYTA 3ZKUA 3WDYA 2RDNA 3IPVA 2RG4A 4CUAA 5BNOB 2XJRA 1W2NA 1QGLA 3WCRA 4AVSA 1BVVA 2PLV1 2YC2A 3HQUA 4GB33 5F2WA 4QX2A 1X8MA 1DP0A 4P9GA 3VZJA 4QKFA 4UFKA 2WNUC 3IAQA 4HL0A 3RGBA 2AENA 3ZIWA 2XGXA 4ZU4A 4CEWC 1QH6A 3H0OA 3DXTA 3N7JA 5FQ0A 5ISLA 3H1MA 3MUY1 1ENXA 3WQ1A 1R1A3 1F4AA 4NWVA 2LTNA 1ASJ2 1QKQA 2ZAAA 2XKOA 5FZAA 1DHKB 1DYPA 5BNOC 2W39A 5CFCC 3LOBA 1CIWA 2MEV2 4LA2A 4A7KA 1SPPA 3AKSA 5BYNA 3L2YA 3WG2A 1NUKA 4E8CA 1G8WA 3NSTA 2IUWA 4BH9A 1QXRA 3B69A 3CJIB 3HBZA 4UXAA 1HXS2 3I2FA 1IOAA 5FP8A 5I8YA 4B4RA 1MS5A 4YW5A 3MHZA 4GH4B 1GV9A 3ST7A 1DQ4A 1WMFA 1OA3A 2P3JA 4ISQA 1IS6A 1UY1A 4HOOA 4M3CE 2F4LA 4BWOA 3OD4A 1BBT1 5FP7A 1ZBE3 1MR5A 3IAPA 4LULA 1S2BA 3AP5A 1YFYA 1UZYA 3WG1A 3WNXA 3AXEA 3JBG1 4PF1A 3WY6A 3BI3A 5C8WA 5FO7B 4IV1B 1JZ6A 2FDGA 2V09A 2HWE2 3CL1A 4JQRA 3CKHA 4O65A 4QU2A 4XF3A 4O61A 5KXCA 1M4WA 4CXYA 3K46A 1MS0A 4Q4Y1 2QZ3A 2RJ2A 2BU9A 3ELNA 4YM3A 5IK4A 5IHRA 1LOBA 3MIGA 4WM7A 1QOTA 1W3XA 4CCJA 1S1AA 3PUQA 5HCFA 4Y3OA 5A6ZA 1VRBA 1QJX2 3K2OA 5C3SA 5FWEA 5BUVA 1VAMA 5L7OB 1OQEA 1I5ZA 3ZOIA 2DVAA 3AZVA 1F9KA 3AZXA 1NE6A 1NOVA 1RMU2 5FWJA 2VPVA 3TOJA 1UOGA 3VL9A 3ZFGC 1AR62 1JZ8A 2E7TA 2A6YA 3D8CA 4W6YA 1YQ5A 4IV1C 3PMSA 3LEKA 1X7NA 3WNLA 4GULA 4KWUA 4XACA 4DUWA 2RR13 4XIKA 4OHZA 1LAJA 4J25A 1MEC2 2P6CA 5D21A 1ZA4A 1LEDA 3I2HA 1EUTA 4LBQD 1RUE2 3I7DA 4P5HA 1UXZA 5FZ3A 4BLJA 2P1BA 2HWC1 1KEXA 3I97A 2ZGOA 3NJXA 4HXCA 1LGNA 4LKDA 1Z7S2 1ZZBA 3WF0A 4IE7A 4MGIE 3WF4A 3E5QA 4PT6A 3NKTA 4P02B 4PHZA 3ZSJA 4AG4A 4EN8B 4D7YA 1WCQA 1AX2A 1C57A 2RS13 4JCKA 4AI2A 1G86A 2ZHNA 3PJQA 3ZIXA 4Q8LA 2WINB 2QFEA 5FPXA 2VE1A 4L9BA 3PURA 1GMMA 3ETQA 3V0BB 1VP6A 1QJU1 4RGAA 5F32A 3B3QE 2P37A 4JC1A 3VD3A 5H9PA 4H3WA 4GIQA 4DO0A 4ET7A 5LEJA 2JKBA 3UNPA 3C7FA 4JKMA 3I4IA 1A34A 2ZEXA 4DUVA 2WO7A 1NCRB 4YVSC 3RSJA 4YZ5A 2CNAA 4TLGA 5A3LA 4CEYA 3SCHA 1HB2A 5JR2A 2W87A 3TEXA 1CPNA 2OKXA 4YW1A 2YMZA 2GNBA 4IEXA 3WNNA 1LHNA 2VZTA 1DQ6A 4W65A 4KBBA 5C71A 2D3PA 1CZSA 1W6MA 1NA1C 2WA3A 4UF0A 4AQTA 5C9AC 2QBXA 4Q0UA 4LOSA 3M3CA 3VDAA 2DCKA 1LOGA 1PVC2 2WIIB 4XPVA 3JXSA 1AYM3 1NLRA 1VPHA 1VBD2 3NAPB 1RUOA 1MZFA 1ND3A 1W0NA 1SLIA 5GZDA 1QXPA 5CFDA 3ZN6B 2DBIA 3DYPA 1FV3A 3MF9A 4G9SB 1US2A 3AKQA 2RHPA 3A0KA 3X29B 1JI6A 4P9JA 4QGLA 1Q8SA 4BJ0A 1XYPA 3UGHA 1EY2A 2W5FA 5F5IA 5A7WB 3A0NA 3CQOA 3IT8A 5E88A 5FJHA 1H9WA 1BZWA 4IERA 4I3PA 3VDBA 3RZZA 1YEWA 4A3ZA 4A41A 1JZ3A 2CV6A 3TYJA 3WD5A 4DOUA 3KHBA 3WUCA 3AZWA 3AP4A 1GZ9A 5FUPA 1ENQA 1MACA 2VAUA 3PNAA 3TB0A 5BNNB 1QQP1 2NZ9A 3CMGA 4LMFA 3ZSMA 3ATGA 2CY6A 3KMHA 3ZDVA 5KR7A 1CJPA 5GZEA 5M0TA 4AHXA 1JXNA 2YG0A 4RS5C 4U36A 1YFXA 1AR91 1KD7A 1F31A 3ACLA 4C0BA 4DIQA 5C4WB 2ZMLA 1DZQA 3VZNA 3LCPA 3VDDC 1IZ3A 3MLLA 1HLCA 1SCRA 4GWMA 3TAYA 1LEMA 1XU2A 1AL21 1OF3A 2BBAA 2CU5A 2R062 2GMEA 2VBBA 4CDXA 4CP2A 4RR3A 2R041 2TBVA 4AL9A 1YI7A 2YPJA 2D98A 2ZOEB 3C3VA 1NAEA 3OPTA 2A73B 4XFIA 4GZ9A 1GP4A 4PBOA 2F4PA 1GZCA 3VD7A 1FATA 2J1VA 4R9CA 5C4WC 2A6XA 1NZCA 1PK6A 3K3NA 1RINA 4MGKE 4LLFA 1WW5A 3GBFA 3LEGA 5FYHA 4NIIA 4QGMA 2DYCA 1RUJ1 1YJKA 2HWB1 4CUBA 3ILFA 3KGLA 2CL2A 1VBC1 2JB8A 4QD2A 4P9XA 2GC2A 5T5OA 4AFMA 1LOFC 3WDTA 1GKBA 3VDCA 4YW3A 5FZ7A 4GMP0 4CRQA 4DRVA 1BEV3 3Q8BA 1BHGA 2KD7A 4FI9A 4YZ2A 1LU2A 4YGBA 4CDWB 2LW8A 1R091 3KS7A 2BW8A 1TME1 4LQRA 3SKJE 5I8SA 4GMP3 3GHNA 4N7IA 4AE2A 2CAUA 1QMJA 5IFPA 1IKPA 2A6VA 2G9GA 1OUSA 4IQPA 4QAWA 5AC91 2OPWA 5DPNA 3OUIA 5CADA 1Y9QA 2QJVA 3BIWE 3CHXA 2W94A 3WDXA 4CP0A 4KU8A 2NPIA 5LWBA 4FSJA 3VKNA 1UCXA 3IB3A 1SACA 2BP6A 2ES3A 4PLNA 4XUPA 1S2KA 1RYYA 1PMIA 1RUD1 2GP5A 1XJAA 1RVF1 3KD4A 5FV3A 4PBPA 1F4HA 4RQPB 4TWTA 4CDWC 5A3UA 1PO13 2W1UA 2Y33A 1O4YA 2WT2A 1LENA 1Q5OA 3RMXA 3GJBA 3GM8A 5KC6A 2DFBA 1V6JA 2WNVA 4W50A 1H1IA 3WW3A 2SLIA 2ZS6B 2XJVA 3VB9A 4AFAA 4NVPA 5HPOA 4NPRA 1WWYA 1F15A 1W8FA 3SH5A 4YGCA 1SLTA 4FBFA 3HN1A 2UY8A 2DDUA 3JU9A 2Q8CA 1N3QA 1O8PA 2W9XA 1ODMA 3CU7A 2ZJCA 5FUIA 5ABJB 3USUB 2OX0A 4CU8A 1J3PA 4LNVA 3RJRA 1XYOA 4A42A 1PIV2 5D8AB 5J09A 2JE9A 1ZZ8A 3LDBA 1RUD3 2WABA 3S6PA 5A6XA 5ACA2 3SEEA 4K8FA 4AVCA 1CAVB 3D4KA 4I3GA 5C7GA 1EPZA 3KB5A 2QQPA 2ATFA 1MQTB 5F5QA 1VMJA 2WN2A 2BFUS 3WDWA 4TYSA 1GANA 1Q43A 1W8OA 3UKTA 5ABJC 1ENRA 3ZXFA 4OQ8A 2R6QA 4MGYE 1S4CA 2PA7A 1V00A 1ZRIA 1AXYA 3HNMA 5FZEA 5JXJA 3PUIA 3S57A 3KQ4B 1EUUA 1OKOA 1DG6A 3ACGA 5IK5A 4QDQA 4Y5TA 1H1MA 3AKTA 4LHLA 5IK8A 1NG0A 3MUZ1 3T2TA 3O1PA 3R0RA 4YPJA 1XNKA 3ILRA 3DKWA 3WQ0A 4M0HA 1TQ5A 4FAGA 3R4UA 1XB9A 3ZFGA 3EYPA 4IEVA 1MQTC 1AL0G 5FZ6A 4Y26A 1N3OA 3U07A 1CN1A 1YI9A 2I2SA 3Q9OA 1DLCA 4CP9B 4DXSA 3T0DA 4IL7A 1V6IA 1MVQA 2YC0A 2BWCA 1PX4A 3WW1A 2TUNA 2PMWB 2IZWA 1AYN3 1OLMA 3NNLA 2YHJA 5CKNA 5LRSA 1GZWA 2W2IA 2RS51 2VZVA 2P3KA 2WZR3 1LESA 2ZEYA 4NWWA 2C5DA 2WUHA 5FKCA 2O1QA 4UFJA 4QX3A 5F3CA 1UU6A 2W68A 1RUC2 4HN1A 2J1UA 5DDJ3 1VBA2 5KXEA 1HRI1 1VAVA 1H1AA 1QXJA 2F17A 2WQ4A 4WVMA 5ANQA 1IQDC 4E9KA 4X6QB 5K8SA 1R081 3RZGA 4LE3A 3HQRA 3VBOB 1B35B 3A23A 3ZM8A 4AHWA 3VBUA 2KA3A 5FOJB 3VHRA 5T3NA 2LS6A 4COWA 2D6MA 3L9JT 2NP0A 3N35A 3ALQA 3PVNA 4DZGA 1GWLA 3IPVB 4BLIA 1VRH3 4BPZA 1IHMA 1TVGA 4Z2AA 5A33B 3FX3A 4LUMA 3FFQA 1FXZA 3VV1A 3WUDA 3AP9A 1B09A 3USSA 3V65A 4V1PA 4F3JA 3AYCA 5FZ1A 3O1TA 1O5UA 5FMOL 1UXXX 1L7RA 1UN1A 5FZFA 3J9SA 1MS1A 4Q8KA 1V9U1 2W1SA 3SCGA 3KHCA 3O0XA 1FOD2 1HRI3 3WLUA 3M70A 5FQ0B 5CG8A 1WCKA 3FBMA 2VC9A 4M4PA 2ZA9A 4LUKA 2R071 3WCSA 3WG4A 5C3OA 1H4GA 1O4TA 3D3AA 1KJRA 5FZCA 3DYMA 1VBE2 2WDBA 3BCWA 3MIDA 4LLOA 4QKNA 5EHDA 2WWJA 4CSWA 3DPRC 2ET1A 4UBHA 2XH6A 2UWBA 1SPPB 4BDVB 1OH4A 1W39A 3LKJA 4PDWB 4CCDA 1JU4A 5FZDA 3KVAA 5TSWA 4QQLA 1FMD1 4Y22B 2D6LX 4PI2A 2P3YA 4V2VA 5FPZA 3MBWA 1QDCA 1EV12 1RUI2 4XF4A 1W9FA 5LA9A 4FVVA 2OZ6A 1DGRA 2HEVF 3WXPA 3PUAA 2ZX4A 3FLPA 4G3YC 5FZ0A 4AFCA 1X33A 3M1HA 3MLJA 4HVRA 4DB5A 2Z79A 2YBSA 1CD3G 2YGMA 3SLIA 3BUCA 1KRIA 1HX6A 2A71A 4NRMA 4ES9A 2WZPP 1F2NA 4PDWC 2XHKA 2RJLA 4AEDC 1A8MA 3IDAA 4R4ZA 1AR83 4CDQC 2ZMKA 4Q1PA 4QPGB 4XW3A 5FZOA 5CU1A 2JJ6A 1JYVA 4Q4W2 3NV3A 2AACA 2W47A 2WSVA 4WM7B 3ORJA 5LY1A 1W28A 1HQNA 2NQYA 5FYTA 3VDDA 1XRUA 4WVWA 1PO21 2Y34A 4MVTA 3B94A 2RMU1 5J36A 5FY0A 3I49A 4GAZA 1TMF1 2BGOA 2ZGKA 2WT0A 4ASKA 4JHTA 2W52A 3DF0A 1ULPA 4YM2A 3VBFA 1NYWA 5IJRA 4H55A 3ZYJB 2RM21 1BLZA 3WP4A 1ZA7A 3UKVA 1GUIA 5JI9A 3DKQA 1UZWA 5BNPB 4QHZA 2KM2A 5EZWA 3RDIA 5C8CA 5JZGC 4CCMA 4QPGC 2XLGA 2R30A 4Q1RA 2O14A 3M4FA 5HV0A 5DAPA 3ZSLA 3FBYA 4AI0A 1CX1A 3ILNA 1G7YA 5DUUA 4YVWC 3CIHA 1GWKA 1OXCA 1POV1 1RUH1 2JDUA 4BM8A 3I3MA 4Q5OA 2CGPA 4D6QA 3FWEA 1GZTA 5G05L 1ZZ9A 3AM2A 1W90A 2BEOA 4LIUA 1RHI3 3SQOA 2WS91 3ZYIB 2JG8A 5H9QA 2HYKA 2HYXA 4XDQA 5AFBA 1KITA 2VW0A 4DEVA 5FO8B 4H7MA 2VMHA 5BNPC 3N36A 2FDHA 4Y1YA 3H8RA 5C3QA 2WA4A 4Q0SA 2PHUA 3RZHA 1HN0A 3U78A 2CTVA 2ZGPA 4URAA 1POV0 1XXNA 4QB1A 4QXCA 2ZGMA 4HFSA 2OVUA 5I0UA 1GFF2 4XC9A 2XHNA 5FP3A 5JOYA 4NO4A 3VZLA 1CWPA 4AOCA 1UX7A 3VN4A 4PLMA 1POV3 1E5HA 4QWNA 5HXMA 2X53S 1REEA 4FFFA 3JD73 4CXWA 3TN92 5HCAA 4XBQA 1SLLA 1W6MB 2SBAA 3VBRC 2WS93 4UF0B 4QX7A 3CF6E 3SH3A 4ASMB 3AJYA 1UW8A 4ZXEA 1IS4A 2WWSA 2XBO1 5JVVA 4AZZA 1O4ZA 3UESA 1DIWA 5L9BA 3UGFA 3ACFA 4LE4A 3NO8A 4EROA 3AC0A 5C70A 3BODA 1PMJX 2QDNA 2PHLA 3GXUA 5FAXA 3LQCA 5CB7A 4CZSA 4JZRA 1GLHA 3UGGA 1ND3B 3LWCA 2VVEA 4QQ2A 2VVDA 3J8F2 5JXGA 1YC61 1SQ4A 4MGZE 5BV6A 1WW7A 5GLUA 3VBHC 5F37A 3OTFA 1C8M3 2PQQA 1DF0A 2JENA 4GKYA 1W6OB 1HRV2 2C4XA 1OC1A 2WKKA 4H7LA 5I0DA 3RZJA 2VL4A 2UYAA 3I59B 1SBFA 4NROA 4Z07A 3KSCA 5C3RA 1A8DA 1AR71 4CE8A 3RZMA 4IEOA 1VIWB 1QJY1 2QDRA 3OJBA 1CJDA 3BIEA 1W2UA 1X50A 5K0UC 1FPN2 4XJ9A 2YY1A 1ACCA 1WMXA 1SLCA 1W2TA 1N1YA 1PM4A 1W3VA 3KLSA 5CA6A 1OMIA 1LHUA 3HT1A 4RHV2 3OBAA 4OHXA 2FBEA 3KGZA 5L36A 3GGLA 2GU9A 3AJZA 2ETEA 4XBLA 2EXHA 2OPKA 4MHRA 2VOVA 2VMFA 4E2GA 4QPWA 1AVBA 4A2UA 3I2JA 4I0WB 1VBB3 4KH9A 1AXZA 4F83A 3IKWA 3ITQA 1BCXA 2OQ7A 4QGNA 3U1XA 4Y5SA 3ETPA 4AW7A 5FPLA 1ASJ1 1E5RA 3PHMA 5J3UA 1W8TA 5FXWA 2JWPA 4NRPA 4CDXB 4Q4X2 4MH0E 5FRAA 4OHWA 1UOFA 2RS33 4FPYA 2EF6A 3THCA 3SEPA 2JG9C 1Q8OA 3VKLA 1Z0HA 3RYRA 1RUG2 3SISA 1SFYA 1HXS1 1S2EA 2HLEA 2X29A 4Q4V3 5GLTA 3BTAA 4LPLA 4NHYA 3P3PA 2UYBA 4FPFA 2HEWF 3S5QA 2VNRA 4QHOA 1PK6B 1D4M1 1W9YA 4I09A 3V0AA 4LK6A 2ARAA 4MZUA 1QEXA 1EAH3 4A4AA 3JB8A 4D69A 1W03A 4XURA 1AJKA 3NV1A 4MYEA 2VZUA 1D0GA 3ENRA 3GCXA 1VB2A 5A3MA 2P2KA 3QLQA 1UWWA 4B8EA 3E6CC 4N9HA 2PHRA 1GOHA 3BU7A 4W6XA 4M4RA 5FFOC 1DGWA 5FYSA 5LCWL 2RJKA 3MICA 3VKOA 2HWE1 2WBKA 1HQWA 4JV4A 4RYDA 4DS0A 4Q29A 4CDUA 3B9IA 1X8EA 5B2GB 4HN0A 4CXXA 5JUVA 1D0HA 3LF7A 4JGZA 4LJHA 1Q56A 4WM8C 2BWAA 3OBTA 4QB2A 3KT4A 5JCTA 2VZRA 4L8QA 4UW6A 1T6BX 1JYWA 3O7OA 2ADEA 4IW3A 1F8VA 4MADA 3C8XA 3KT7A 1L7QA 1QJX1 2DCZA 1F35A 3NV2A 2HJIA 3VKFC 2WL1A 1DLLA 4FOYA 2PHFA 1V6MA 2XWBB 3RFRA 3S7EA 4DXZA 1RUF2 2DUOA 1RMU1 4N43A 4BISA 1AR61 1W2AX 3VD9A 5IK7A 4AGGA 5AVPA 2AR6A 4GQ7A 3ZFFA 2XB6C 2EALA 4IV3A 4UT5A 4LK7A 2WFF3 2D44A 4AI1A 3T2PA 2JDKA 3LFIA 2ZTNA 3WZ1A 4OCTA 3ZMNA 3I3QA 1MEC1 4LHKA 2G19A 3B7MA 1JYIA 2EIGA 3MYXA 1WD4A 4INDA 1RUE1 2DTYA 5C3PA 2PLV3 1DGRN 1SLBA 1XNAA 4Y4RA 2VZQA 1ZX5A 3NV4A 1K12A 1W8ZA 1FAYA 2QQVA 4JVAA 4XUOA 2C9AA 2EAAA 2QQIA 3ZKYA 4U2AA 4Y1VA 2NYYA 1VMFA 4N8MA 5I8TA 5EYYA 4BQ5A 4I2OA 3AFKA 4UYBA 1D2QA 2IXKA 4K3UA 4LOTA 3W9AA 3ZXJA 4AQ2A 1O3SA 1TEIA 1H8TA 1NY72 1PVXA 2XVGA 4GWJA 2VQTA 1KJLA 5DABA 4CUCA 5IAXA 4XHXA 1ND2A 4OLLA 1XOYA 4GB32 1LOEA 3CJIC 5FZLA 4CDQA 4FFHA 2BERA 2I45A 1R64A 3ES1A 4HKOA 3ME2A 1WA4A 4GH4C 3APBA 2B39A 5GM0A 4LHNA 5HCHA 1W06A 2ZGUA 1OA4A 2X09A 4LKEA 5K4LA 4L0PA 1R1A2 2PXJA 2VCMA 5GLVA 3UETA 1SEFA 2FZ1A 2AYHA 4LBQB 5LK5A 1BBT3 3AMNA 2BQPA 2WO1A 5CYYA 3WNMA 2VOKA 3S5AA 2WO2A 1GBGA 1NXD1 1PVC1 3GHMA 1UQXA 1YHFA 1VBD1 2AGSA 1UKGA 3FHQA 3JBG3 3V56A 3HN3A 4HPKB 2W95A 1ULOA 4E2SA 3ZYRA 3A7QA 1ZRRA 3PL0A 5EYXA 2EA7A 1C3HA 1GZWB 3AXDA 1URXA 2WZ8A 3FUQA 4NAMA 1DGLA 4Q4Y3 4YWAA 5LY2A 2UWAA 4FTBA 2DV9A 3WP6A 5FKBA 3I3EA 3WNOA 4TTGA 3N9OA 4LR4A 1LOAA 3VBSA 5L7OC 1C5IA 2V5DA 5FOBB 3BB6A 1PGL2 4WVMB 2EIEA 1ZBA1 5LA2A 1QJEA 4Y20A 1ZBE2 4BYYA 4A45A 3S0MA 1UL9A 2BBVA 2G1MA 2XG3A 1HB4A 1MZ5A 1OHFA 4OYUA 5JOZA 4N53A 2N7GA 4QPYA 2VXJA 3M8LA 4QPIA 2LRPA 1WLTA 1OUXA 2ZX0A 4D8MA 3H7JA 2GALA 5DG2A 2HEYF 5DUWA 1A3KA 3NNJA 1GSLA 2ORXA 2PQSA 4AVTA 3AVSA 2QCSB 5BY5A 5KHIA 1ONAA 2C9KA 2W46A 5FIXA 4ZU7A 5BPXA 3MIBA 4GWIA 2XUEA 1RIRA 3VUOA 3NQHA 4I30A 3KCYA 2A75A 4A6SA 2YBPA 4N9IA 4YGEA 4YG6A 2ILMA 3AKPA 3PLQA 1X82A 4XZPA 3VZKA 4AI8A 5BNQA 3HMYA 2DU0A 2HWC3 2B8MA 4META 2E9QA 1BBT2 3KQRA 4P00B 3THDA 2YFUA 4ZS2A 3VBRA 4R52A 3THPA 3VZOA 1BKZA 3ZXLA 3U4SA 4JGYA 1OPOA 1JZ2A 2I74A 4K20A 4E27A 1ZZ6A 2R061 2YPDA 1UU4A 2VOXA 3ASIA 2RR12 4K1ZA 5FY4A 3U37A 2D6PA 3PVEA 4XABA 1GNHA 2Z42A 4YARA 1GR3A 3MLKA 2ZX2A 2A70A 4PIZA 3BYWA 1UPSA 3AZYA 2YB7A 3HNYM 4FOQA 1LULA 1QJU3 1Q3EA 3V64A 2IC1A 1GU3A 1U5ZA 4Y4YA 3RPQA 5JMCA 4XXPA 1NCRC 4AHYA 5EXOA 4B3NA 1XSRA 1OLME 3VHNA 1GICA 1J1LA 3H9AA 3MIEA 5F3EA 3WQ7A 1VMHA 2TNFA 4KG8A 1C8NA 1OKQA 4XF0A 4ZKTB 4XHBA 3POWA 3QBQA 1STMA 3Q8EA 2B9VA 1Z78A 2PAKA 2D40A 2JIGA 2RS12 2Z69A 2DCJA 5A3TA 1O6UA 4D6RA 3H7YA 4EN7B 3OYWA 4NIAA 3ZSKA 3DYOA 1WA6X 5LW9A 5DG1A 4FFGA 3HR9A 3JB4C 4QM8A 1VAKA 1W6QA 3AZZA 3IIIA 3A22A 3NAPC 1NXMA 4HMZA 3I8TA 3MW3A 2L9LA 2JD9A 5K7PA 5K9YA 3O0VA 4D7TA 1CONA 2WO3A 3T4VA 1AHSA 4KL1A 2JDMA 4PLOA 2NMOA 2O8QA 3TWIA 1W6PA 5FZOB 1PZ7A 2ZPXA 2E6VA 1GP6A 1W05A 5EV7A 1YNAA 4P9YA 2W08A 1OF4A 2FMYA 4XCBA 2YGLA 5F3GA 2WJSA 5FZ8A 3GNEA 5FZGA 4HKWA 4MHUA 4OI4A 1UY2A 1WLCA 3H8OA 4OUEA 3AMPA 4GWNA 3KCXA 1NQJA 2K0GA 2VZPA 2DF7A 1N47A 3ZXGA 4FPLA 1LCLA 5FREA 1MPXA 1KGYA 2DVBA 4FPOB 3VBFB 4AVAA 1O3TA 5FUNA 1AYM2 4RL7A 4B4QA 4ASLA 3WW4A 1FNZA 1SDDB 1RJ7A 2VNVA 5A6YA 5KHGA 2QQMA 4DY5A 3B5LB 3PJYA 5C8CB 1S55A 1NLSA 1CAWA 2VH9A 3AYAA 5EP9A 5BNNC 1QQP3 2J1RA 2UWCA 1K5MA 2G9FA 2VGDA 3ZFEB 3ZXAC 4GXLA 1J83A 1JN2P 5A7QA 4E8DA 3EHKA 3N9QA 4IEQA 3VL8A 3Q8AA 3GZTB 1PIV1 3SC7X 1AR93 2QQWA 2ZACA 4YM1A 5LATA 2JDZA 3SMHA 1SCSA 4P9WA 5FY5A 2QE3A 2BFUL 5T54A 4K7JA 5ACA1 4COUA 5FPUA 3ZYBA 1N1SA 2X5IA 5B4NA 3ZSEA 1JYXA 3DUIA 1AL23 5FDBA 2TEPA 1RJ8A 4XJWA 4EWEA 4EYUA 1RUNA 2DURA 3URFA 4XTPA 4C1XA 3OG2A 4CCKA 4D7SA 2WSUA 3KV5A 2R043 1DU3D 1DYOA 2DBNA 4LBJA 3LZZA 1I1EA 1CAXA 3OGGA 3LIHA 2LUWA 4M3CA 3MV01 3WHUA 5JPMB 2BDRA 2WNUA 3K75B 4D6SA 4DY3A 2MPFA 4CEWA 1RUJ3 2HWB3 3GF6A 2XOMA 2AEZA 4IGPA 4FPJA 1VBC3 3ZXDA 3I2OA 1HB3A 4YRDA 2QQJA 3W59A 3ZLIA 2JDNA 3D6EA 3Q8FA 3QH7A 1HJFA 4UI9L 2BUKA 2B5HA 3O1SA 1CIYA 1CAUB 1OPMA 4JDNA 5D1IA 2OXBA 5JR7B 5BNOA 2C26A 1A6CA 2JDHA 5CNAA 1JW6A 4EN6B 1W9WA 5CFCA 1J84A 3FFZA 1R093 2RV9A 3HOBA 2A6WA 5A7NA 4EWAA 4JX0A 1TME3 5FMBA 2H6BA 3KV9A 1ZVFA 3POIA 3IWZA 4DEQA 5FMDA 5IVEA 4XJZA 2VOWA 2YBKA 2ID4A 4MG2A 1ULDA 1YYNA 2HKXA 4CCCA 3ZVXA 4CCEA 1RUC1 4XZUG 4LO8A 1NCQB 5A3PA 2VUDA 5AC93 4L92A 3C7GA 1VBA1 3PMEA 1H2MA 4PQQA 3DN7A 4KG0A 4RGKA 2AH2A 4ONUA 4QT6A 1REFA 1YO8A 1BEV2 3GBWA 4RQPC 1AJOA 1LODA 1JZ7A 3AK0A 2XL7A 3SH4A 2OUHA 1RVF3 3WX5A 4NAOA 3AP7A 5EJZB 1G9BA 4GJYA 3AFGA 2XVKA 1D7PM 4DMIA 1LNSA 1QOOA 2R0FA 4AEMA 3C7OA 4JDOA 3DECA 1CZVA 2Y6HA 3LGRA 4ZU5A 4Q27A 2BZDA 2D7FA 4UBGA 1LJ7A 4GKXA 5SV8A 5IUQA 2UU8A 2FDFA 2ZAHA 3H1WA 5D8AC 2BGPA 3B93A 1K3IA 1FOD1 5C5TA 1LKNA 1O7FA 3KV4A 4BMEA 5A7SA 1OOPB 2W1QA 4FPHA 1MS8A 3A21A 2QQKA 3N3HA 4MGTA 1PO12 2A3XA 3MPPG 4LO7A 3VZMA 3PU3A 1OFNA 3POEA 4CTEA 2XLAA 4IV1A 3TEWA 1VBE1 2IFRA 2WQ8A 3RNSA 4I02A 4K40A 2QQLA 4NPLA 2X10A 1SBDA 3D82A 1J3QA 4NPMA 2VMGA 4Y1UA 5KHKA 1V0AA 4KMQA 4IE4A 4RGGA 4FOWA 1C4RA 3N4MA 5CKQA 1JOJA 1ZZ7A 5L7OA 2JDAA 1RUI1 1EV11 1SDWA 1XYNA 3NWKA 3OGJA 1ULCA 1RUD2 1UYZA 2IXJA 4ATEA 5AFEA 1QIQA 2BNNA 3GZUC 1OQ1A 4KI5M 5J37A 4HK8A 2P5BA 2Y38A 3AVRA 5CISA 1LOCA 2VU9A 3FE5A 2LROA 2W91A 4O9EA 3IDEA 1ZYBA 3KF5A 1KFXL 2XJPA 1FT9A 3P3NA 4HK9A 4XJAA 4CDUB 2VBPA 4JGZB 3LB9A 4LO6B 3TEZA 5F7UA 5LZ6A 1DCSA 1JODA 3OSDA 2UY9A 4Q4W1 4YVSA 1W8NA 2OZJA 2PHDA 2RS53 5JXIA 5DZFA 5H9SA 4DNYA 5J1XA 4KBZA 4MXWA 3RWKX 4MUVA 4W6WA 4AEJA 3VBOC 4IE0A 1IGOA 5FLHA 1B35C 2VR4A 1NA1A 2Y6GA 4FP2A 1NKGA 4WV8A 1R083 5C9AA 3V0BA 4M00A 2FCTA 1NZIA 2VTXJ 2PAEA 4L99A 3N7MA 5IWFA 3S30A 2B9UA 1AYN2 4XUTA 3AL5A 1OFSA 2PHWA 4HETA 2WZR2 2YFZA 5EWSA 1UAIA 1UNBA 2PTMA 1S0IA 4Z2WA 4NHMA 1WGPA 3ZXEA 4A7YA 4FOVA 4BQWA 3C7HA 4ZPIA 5B4XA 2Y6JA 4B29A 5DDJ2 5C33A 2FHRA 4OZOA 4OI0A 5KBFA 4R9BA 1KS4A 5L9VA 1BMV2 2D3SA 1V9U3 4ZHNA 3FN9A 1EYBA 1HKDA 3E5UA 5CIRA 3ZDSA 3N9PA 1YFUA 2VUCA 3KF3A 1H6YA 2R073 2D6KA 3TBDA 4AVBA 1COV1 1V6LA 4ISRA 4P9LA 1L7LA 1VRH2 2J1TA 2ZGLA 4NOTA 1A78A 3J7MA 2E31A 3RJ2X 5FXZA 3OUHA 4XETA 1ZNPA 2WWUA 5EJ3A 2JE7A 3B9CA 5JXHA 5CBLA 4JHZA 4BIFA 3ZO0B 1SHWB 1UMZA 3MZHA 4RS5A 1HRI2 4AGVA 4XVHA 1FMD3 2RE9A 4NIGA 3J7HA 2PELA 1KS5A 4M3CF 3TN91 3IM0A 4AFDA 1YQ6A 2DVFA 2QZ2A 1OSGA 4OMDA 4O7XA 4GA9A 5E6HA 3C2UA 3T2QA 1DZRA 2Y0IA 1C5HA 3Q8CA 4IEZA 4XFBA 3H1YA 1W9SA 1H8VA 2B45X 5FZ9A 1Q8PA 4JRLA 2ZZJA 4GD4A 5FK8A 4FPEA 1COV3 4UFIA 3WV6A 4W8JA 3OPWA 3I2IA 4BQ3A 2WC2A 5BNNA 3ROUA 3FZ3A 4MOAA 5EPAA 2CAVA 3J8F1 2CWMA 4KWLA 3JQWA 1D2SA 3HD8B 4ZXKA 3WR0A 4DXTA 4EZHA 5I91A 1Y9MA 5J7MA 4WM7C 3E6DA 5C4WA 1FX5A 1GQPA 3BVCA 5FBJA 3T1LA 1QNWA 4TXWA 5FLIA 2VMDA 2GNTA 2IFWA 4XILA 2WAOA 4XUNA 1HRV1 2R7EB 4BQ2A 4MV2A 4JKLA 2XJTA 2Y6KA 3THTA 1O5LA 1IS3A 1LOFA 3VD4A 1PO23 3RMYA 2RMU3 2HWF1 2ZHMA 5FZKA 3WP3A 3HBKA 4NE9A 1TMF3 4N53B 2IXHA 4QPIB 5KXBA 3AKRA 1PGW2 1FPN1 2D6NA 2RM23 2VW2A 1FV2A 1H6XA 1AR82 2GC1A 2V72A 3M3EA 5FTTC 4Q0VA 1UOJA 4IE6A 4RHV1 1UD1A 1W99A 1T2XA 3WT3A 2E63A 1SMVA 2QQUA 4FO9A 1W0PA 5G04L 3D5OA 2WLQA 3R4SA 1FMD2 4PJYA 1NQDA 4TLFA 2HWD1 4XF9A 2DCTA
chains in the Genus database with same CATH topology
4QX5A 4CEYB 2D93A 5T52A 1RUH3 4KU7A 4HVQA 3QCWA 3POYA 1JYCA 3JZVA 5IT6A 2VMIA 1S0EA 2YYOA 3JCIA 4IESA 4XXAA 2HWF3 4CDWA 4JGYB 1O91A 3SXWA 1ALYA 2OW4A 2F6BA 1HW5A 1U12A 3L2HA 4KQ7A 1ZRFA 4YFZA 1XQNA 2A7AA 3LSDA 1RUG1 5HCBA 4XQDA 2G4IA 5CFDB 2E51A 4CEYC 1SBEA 3TRSB 4KWKA 5GZCA 1UZZA 5KXDA 1QNYA 1RHI2 1YIFA 3MW2A 2GH2A 1TMF2 1H2LA 1LHOA 4QQPA 3OYWB 2YUEA 4BIOA 4EV0A 3KZ4C 4YLZA 2A3YA 5KWRA 2XBO3 3NKGA 4MSVA 2MNGA 1C1FA 2DU1A 2R1BA 4K21A 2DCYA 4S2HA 1ND3C 1CR7A 4Z1VA 1J1TA 5ABJA 1QOSA 1H2KA 4XQ4A 1YLLA 2R0HA 2E7AA 1C28A 3UL2A 3USUA 1UU5A 4Q2FA 4AYUA 1G9DA 4Z82A 1PZ8A 3JD72 4NHKA 2ENRA 2B46X 2WS92 5T5LA 4AI3A 1RUF1 3UV9A 2D5HA 4B7KA 5DUVA 3HIFA 1MQTA 5J96B 1AR73 2XPJA 1QJY3 2DUQA 2ZMNA 4RR3B 2MEV1 4Q0PA 4FT8A 1CAWB 3KT1A 1LU1A 4R8HA 1RC6A 4OHYA 1K5MB 1C8M2 3EJKA 5SV5A 2GC3A 4FPKA 3VLBB 1IKQA 1UX6A 1T6GC 1UPIA 1XNBA 3FLTA 1HIXA 4RA0A 2QNKA 2X5IB 1YJLA 4X8NA 4Q0QA 4CDXC 2MHFA 1ASJ3 1NY71 3D0JA 3D0SA 4RR3C 4BHPA 4P14A 4JTOA 3JUUA 2Z2SB 4I0BA 2MEV3 4GB31 3H3ZA 5LRRA 1ZREA 4IEYA 5JSPA 2ZGRA 4IEWA 1I6XA 2VULA 1HXS3 4AF9A 1PK6C 3M3IA 1VBB2 4PIYA 5GALA 2Q1ZB 2WNUB 5JIUA 1QDOA 3WW2A 1D4M3 4Z8BA 1QJZA 1R1A1 4D3WA 5T5JA 2Q4SA 4FPGA 2DUPA 1CQ9A 1OQDA 3LSEA 4CYDA 4JRAA 2XUMA 4FTEA 4HKLA 3MF6A 2RS32 1YRZA 4IETA 4O9GA 2PFWA 5A33A 1LHVA 3B02A 1SFNA 3DPRA 1YFWA 2WNVB 5CFCB 2Y26A 2HWE3 4Q4V2 4YZ1A 4HVOA 3CLPA 3R05A 1EAH2 4ATFA 5JPNB 2PHXA 5CAZA 1H0BA 3AYEA 1PGL1 1AUYA 1QJX3 1Z7S1 2YZ4A 3PVBB 1ZBE1 1MS4A 4Y5Z0 3SCFA 5JAXA 1RITA 2Q0AA 1RMU3 3SHRA 1AR63 4JDMA 4LO5B 1RGSA 4XOGA 2WQZC 4S2GA 2WNVC 4XMIA 4C91A 1VB4A 3K48A 3NJZA 4PDWA 1F5FA 2XJSA 4AEDA 1LTEA 3CEWA 4MLOA 4XIOA 4FSJA 3I2DA 4XJUA 1MEC3 1UIKA 4Y22A 1E57A 3M7AA 1D4M2 1Q8VA 3R6SA 1RUE3 2ZX3A 2JX9A 1DGWX 1GYKA 3OF1A 4HZFA 1YIPA 1Z7S3 1WUVA 4IEUA 3UJOA 3ZFGB 4HLTA 2WFF2 4XEZA 2RR11 3CO2A 4XMAA 3CJXA 1XNDA 4D94A 1QWRA 2IXCA 4IXLA 4OVEA 5JZGA 3A4UA 1AZDA 3VHPA 4QPGA 4EWDA 2OUJA 2PLV2 2XL9A 4WBBA 2DWRA 3BPZA 3WINE 3LOIA 4LO4B 4M01A 4YVWA 2ZX1A 4S2FA 2WT1A 1YXWA 2IXIA 1SLAA 2LALA 4AQSA 3HAGA 2RS11 4XFCA 1AX1A 5FLJA 3ZN5A 2AUYA 2DVGA 4RFT0 3VBUB 3WHTA 4BMBA 5BNPA 2QUOA 3EO6A 3R4DB 3HWJA 1PVC3 1H30A 4K6BA 1VBD3 1XU1A 4E4DX 1TNRA 2JICA 3DGTA 1PM7A 2ZGNA 4OI2A 4YVSB 4LBOA 1H9PA 1FI2A 4MXWB 2GN7A 3NVCA 1LGBA 1PGSA 3AMHA 1IQAA 2Q5TA 2ZABA 2ZKLA 1NA1B 4XF1A 1ZBA3 3VBUC 5F1RA 1BXHA 3JQXA 5C9AB 5CVRA 2ZKNA 5HXVA 3RQ0A 1AYM1 3JBG2 1VJ2A 1ZRDA 1PZ9A 1G9CA 4B7EA 1JH5A 4C90A 3ZMOA 2QVSB 4Q4Y2 5I0SA 2OYZA 1OI6A 1U5IA 4UW5A 2BYVE 2Q1MA 1DFQA 4WVZA 4LBKA 3VBHA 5JSRA 3G6JB 1APNA 2EAKA 3H8UA 4OUSA 1KDKA 4SLIA 4HANA 2XWJB 1S0FA 1WW4A 4LBNA 4Q26A 2VQ0A 3IBMA 4AHZA 1DZTA 3O14A 4QMAA 4DFSA 1UKRA 1IS5A 1WMDA 3K51A 3RWNA 4OUMA 2KXLA 2PHTA 5JLVA 5K0UA 2FZ2A 2R063 1MS9A 5I0TA 4A3XA 1DDLA 4FTSA 2I07B 2XJUA 4XJ8A 3SITA 4ITCA 4L2NA 3INAA 1YCIA 3O5SA 3N7LA 1RL3A 4KNCA 1VALA 4NR1A 1PHMA 4X6RB 3PTYA 4YW4A 2HWC2 2GAUA 1W6OA 4LBLA 4RS5B 4S2DA 3MI8A 3NW4A 1G6NA 3I59A 4AVVA 1ZBA2 3VDDB 3M2MA 4KGQA 2VNGA 4HBNA 2D5FA 2GNMA 4Y1XA 2EXKA 1DQ2A 4WZFA 2C1FA 1DQ0A 2GC0A 1VR3A 1RTVA 1QJU2 4FCAA 3BALA 2Q8OA 2NM1A 2JG9A 3T1MA 4G4FA 3NL1A 1Y3TA 1I3HA 4XFAA 2OA2A 3FJSA 5JWPA 1LECA 2QKDA 4HSLA 5GZFA 5JIAA 1BEV1 1U0AA 5BXXA 2ARBA 2X8KA 4OZXA 2JG8B 2JD4A 3VBFC 4R9AA 1WLWA 2ZCWA 4FAHA 1UIJA 4E4SA 4FXGB 4GMP1 3MFAA 4YG0A 5C8CC 5GLWA 4R9DA 4NN0A 2NN8A 2EVXA 5T55A 2GN3A 4WM8A 4DPNA 1LB2A 3MPBA 4BZ4A 4IEPA 1QHDA 2IWGB 1W6NA 3ZFEC 4I0AA 1GQGA 1XE7A 1FNYA 5F6KA 4AQ6A 1EP0A 3ZN4A 1PIV3 3OY8A 2JG8C 5AVAA 3QOPA 3MW4A 1JBCA 1ZRCA 1PO11 2VVFA 2H0BA 4I01A 3AB0A 4XQWA 5ACA3 5JOXA 4FQ4A 5A32A 5F9TA 4P9IA 3PVOA 4ORFA 1FYUA 2YXSA 2ZBJA 4LBMA 1BQPA 4A7ZA 4XYXA 2VY0A 1GQHA 1QQP2 5JI7A 2BTVC 2XLFA 1LRHA 1S0JA 1AR92 3BOWA 4BQ1A 4J1WA 4QXKA 5DZGA 1TNFA 1CGPA 3LA2A 2AREA 3UK9A 1AL22 5I0RA 3VHOA 1ENSA 4GALA 5JDBA 4C0HA 3O12A 2R042 1G9AA 3DV8A 3M3OA 2YDEA 3CJIA 5I93A 1ZM1A 2XVLA 3IIAA 1HQLA 3EXUA 1NCQC 1ULFA 3E5XA 4GH4A 4YNIA 4RD7A 1AF9A 1RUJ2 1RUC3 1QU0A 2HWB2 2UURA 1VBC2 4BA6A 4QHBA 2YROA 1VBA3 1JTZX 4FPCA 1V70A 2JEMA 3ES4A 5L73A 4LT5A 4N7UA 5H9RA 2ERFA 4TZDA 1PNGA 2E53A 3EBRA 5HBAA 3N7KA 1HV0A 1R092 4AGRA 1BJQA 1AYN1 1TME2 1U5YA 4QQOA 1AXKA 1U5XA 1WLDA 3FHIB 4QQHA 2WZR1 4AXOA 2OIIA 2E7QA 2NLRA 1IPJA 2H6CA 5E1RA 5AC92 5DDJ1 3ZYPA 2A6ZA 4E2QA 5GKAC 4HSJA 3V0AB 1MZEA 5LK7B 3W58A 4YFWA 1BMV1 3HT2A 1OOPC 3MEPA 2O0OA 3WP5A 4LBQA 1YUDA 1FOD3 4J1XA 3RRDA 3VGIA 1RB8G 1RVF2 1WD3A 4LA3A 2VNOA 3AYDA 4YSFA 3POSA 2B42B 1VRH1 2ZZQA 4XFHA 5JSOA 4HPKA 1VBE3 4YG3A 1BVP1 4AFBA 4DINB 1QH7A 1J58A 2D3RA 2P3IA 3FC0A 3RYPA 2Q30A 4DQAA 4N90A 1N3PA 2VW1A 2VECA 4YYOA 2CYFA 3FUOA 1RUI3 1EV13 1XE8A 4J6GA 5L19A 1DQ5A 2P17A 5FO9B 3M3QA 4Y24A 4N43B 2CWSA 3MIFA 3QD6A 1WCDJ 2V73A 2WFPA 2R49A 4AK3A 3EQEA 1H4HA 3ZFFB 4IV3B 4CDUC 5E16A 1O3RA 3DPRB 1J3RA 3BOPA 5DZEA 1OA2A 4JGZC 4YZ3A 1KQRA 1S0GA 3IDBB 3ZX7A 1NCRA 3DL3A 1S0BA 3B00A 1Y43B 4PIXA 1V6KA 4Q4W3 4XE9A 1V6OA 2BPA2 3FMGA 1NE4A 1LR5A 5LEKA 2VUJA 4N43C 4OHVA 3CNAA 4L97A 2D43A 5C6CA 3GBGA 3ZFFC 3RS6A 1V6NA 4IV3C 5HI0A 5JOWA 1PGW1 2BGCA 3E97A 1DYKA 3KM5A 3NAPA 4E4ZA 3HQXA 1H8TB 1AR81 4EN0A 2EXJA 3U4XA 3MIHA 5DXDA 1ND2B 4AEDB 3ZN6A 1L3JA 1JUHA 4M0NA 1PNFA 2RS52 4CDQB 3S7IA 1BYHA 3WOGA 2FQPA 1IPKA 3GYDA 4R4XA 4EN9B 2DTWA 5CG9A 3KCCA 2XKPA 3U0ZA 2B7YA 2GMPA 2PN5A 1R082 1D4VB 2GMMA 1WW6A 4K9SA 1XNCA 4WVVA 1MZ6A 2ZGQA 1CESA 4AEKA 5KHHA 3SNMA 4NHLA 1H8TC 2YV8A 4COZA 2ZGTA 5KHJA 1ND2C 3AX4A 3QACA 2CGNA 2LM3A 5JZGB 3IN9A 4MXVA 3FLRA 5E8AA 2CGOA 1VLNA 1DQ1A 3GZAA 3B01A 4JTNA 5F6LB 4YVWB 4L11A 3J26N 1RHI1 1V9U2 4C1WA 3VBSB 2WNEA 2GDFA 4OULA 1J59A 2O8OA 2VG9A 2Y0OA 4UW3A 3G7DA 4YGDA 5FMOS 1QF3A 3TN93 3IDCB 4MX3A 4Y20B 2R072 3WDVA 2AZ5A 2H0VA 3OD0A 3WDUA 1H2NA 4EJRA 4XTMA 2ARXA 2ZHLA 4Y1ZA 3MDPA 1CX4A 3ZFEA 4QM9A 3J4UH 4PF5A 2EXIA 3J8F3 1ZZCA 1JUIA 2GH8A 2VQAA 3QH6A 3U10A 2JXAA 1S0CA 3VBSC 2DFCA 3JD71 1R1ZA 1YWKA 3AMQA 1C1LA 1HRV3 2D97A 2DVDA 2NMNA 2ET7A 3VBRB 4PQ9A 1CPMA 4N53C 2PAMA 4QPIC 1COV2 3RI9A 2Z5WA 4DRRA 1MVEA 2ZHKA 1G9FA 1REDA 4Q4X1 1TE1B 1Y7BA 1BK1A 1FPN3 1ULGA 1UF2C 2WLPA 3AMMA 1GNZA 4RHV3 1OLQA 2GNDA 2K9ZA 4OI1A 1C8M1 4XFGA 3GALA 3RG0A 1WBLA 2P34A 3VBHB 1LGCA 2HWD3 3ZPYA 1PO22 1W0OA 4YZ4A 2RMU2 4LEJA 1OD5A 4RQPA 4JGYC 3WVJA 5EFUA 5J98B 1CAUA 4COYA 4KWJA 2RM22 4RSUA 3ZXKA 1F5JA 5K0UB 1W6QB 2IXLA 4CP1A 4UW4A 4Q4X3 2R1DA 3I54A 4FP3A 5E89A 3WG3A 4XBNA 2FMDA 1O3QA 2V5YA 1X36A 5CFDC 3IMNA 2A5ZA 1RUG3 1NCQA 1W6PB 4B4PA 1WCSA 4HT1T 4AWDA 4YM0A 1VBB1 4XFFA 4URTA 1RUH2 4X8PA 3MFCA 4FQZA 5D8AA 3U11A 4PCRA 5T5PA 2HWF2 1CAVA 5DUXA 1HV1A 5GLZA 1HDKA 3OBRA 3AP6A 2RS31 4SBVA 1S0DA 3UKNA 3LA3A 3ZYGA 1KXGA 3TNQA 4COVA 4Q4V1 2JG9B 4WZCA 1Q8QA 1AX0A 1KFUL 2HWD2 1EAH1 5FBZA 4JAAA 5GJ6A 3ECQA 5FCCA 2D6OX 2ZGSA 3RI8A 3TNPB 2GSYA 4K1YA 1N1VA 3O0WA 1OOPA 2A3WA 2VXRA 2K2SA 1LHWA 3OPZA 2BVBA 3VKMA 1RUF3 1N1TA 1I9RA 2W0XA 3H50A 4F8AA 1JHNA 2XBO2 1M06G 4KGGA 2JECA 1DBNA 4ES8A 3E6BA 2BNOA 4Z92B 1WMEA 2GZWA 4LTAA 4H14A 3UJQA 4WM8B 1K5MC 1OLRA 2BVVA 1W6NB 3H3UA 4FXKB 5T50A 1ULEA 4F7ZA 1QY4A 4YW2A 2R32A 4TSVA 1WBFA 1CAXB 3LA7A 1KDMA 3OCPA 3MGUA 4M3CB 4BE3A 5J48A 1EPWA 2VUAA 1CVNA 2BNMA 2C0ZA 3OY8B 3VBOA 4CEWB 1B35A 3LAGA 5KC5A 1AR72 2X5IC 4BOWA 1QJY2 2XJQA 2WFF1 3RYKA 2PYTA 4OFGA 1MS3A 2R16A 5A32B 3WDYA 3IPVA 5BNOB 2XJRA 1QGLA 3WCRA 4AVSA 1BVVA 2PLV1 4GB33 1X8MA 4P9GA 3VZJA 2WNUC 4HL0A 3ZIWA 2AENA 2XGXA 4ZU4A 4CEWC 1QH6A 3H0OA 3N7JA 5FQ0A 3H1MA 1ENXA 3WQ1A 1R1A3 4NWVA 2LTNA 1ASJ2 1QKQA 2ZAAA 2XKOA 1DHKB 1DYPA 5BNOC 2W39A 5CFCC 3LOBA 1CIWA 2MEV2 4LA2A 4A7KA 5BYNA 3AKSA 3L2YA 3WG2A 1G8WA 3NSTA 4BH9A 1QXRA 3B69A 3CJIB 3HBZA 4UXAA 1HXS2 1IOAA 5I8YA 4B4RA 1MS5A 4YW5A 4GH4B 1GV9A 3ST7A 1DQ4A 1WMFA 1OA3A 2P3JA 4ISQA 1IS6A 4BWOA 4M3CE 3OD4A 1BBT1 1ZBE3 1MR5A 4LULA 1S2BA 3AP5A 1YFYA 1UZYA 3WG1A 3WNXA 3AXEA 3JBG1 3WY6A 5C8WA 5FO7B 4IV1B 2V09A 2HWE2 3CL1A 4JQRA 4QU2A 4XF3A 5KXCA 1M4WA 1MS0A 4Q4Y1 2QZ3A 3ELNA 4YM3A 5IK4A 1LOBA 3MIGA 4WM7A 1QOTA 1S1AA 5HCFA 1QJX2 5BUVA 1VAMA 5L7OB 1OQEA 1I5ZA 2DVAA 3AZVA 1F9KA 3AZXA 1NE6A 1NOVA 1RMU2 2VPVA 3TOJA 3VL9A 3ZFGC 1AR62 2E7TA 2A6YA 3D8CA 4W6YA 4IV1C 3PMSA 1X7NA 4GULA 2RR13 4XIKA 4OHZA 1MEC2 1ZA4A 1LEDA 4LBQD 4BLJA 1RUE2 3I7DA 4P5HA 2HWC1 2ZGOA 1LGNA 1Z7S2 1ZZBA 4MGIE 3E5QA 3NKTA 4AG4A 3ZSJA 4EN8B 4D7YA 1AX2A 1C57A 2RS13 4JCKA 4AI2A 1G86A 2ZHNA 3PJQA 3ZIXA 4Q8LA 2WINB 2QFEA 5FPXA 4L9BA 3V0BB 3ETQA 1VP6A 1QJU1 4RGAA 3B3QE 2P37A 4JC1A 5LEJA 5H9PA 4H3WA 4GIQA 2JKBA 3I4IA 1NCRB 4YVSC 3RSJA 4YZ5A 2CNAA 5A3LA 4CEYA 3SCHA 1CPNA 4YW1A 2YMZA 2GNBA 4IEXA 1LHNA 1DQ6A 4W65A 4KBBA 2D3PA 1W6MA 1NA1C 2WA3A 4AQTA 5C9AC 4Q0UA 3M3CA 2DCKA 1LOGA 1PVC2 2WIIB 4XPVA 1AYM3 1NLRA 3NAPB 1VBD2 1RUOA 1MZFA 1ND3A 1SLIA 5GZDA 1QXPA 5CFDA 3ZN6B 1FV3A 3MF9A 4G9SB 3AKQA 2RHPA 3A0KA 3X29B 4P9JA 4QGLA 1Q8SA 1XYPA 1EY2A 3A0NA 3IT8A 5E88A 1H9WA 1BZWA 4IERA 4I3PA 3RZZA 2CV6A 3TYJA 3WD5A 4DOUA 3WUCA 3AZWA 3AP4A 1GZ9A 1ENQA 1MACA 3PNAA 3TB0A 5BNNB 1QQP1 2NZ9A 3ZSMA 3ATGA 2CY6A 3KMHA 1CJPA 5GZEA 4AHXA 1JXNA 4RS5C 4U36A 1YFXA 1AR91 1KD7A 1F31A 3ACLA 4C0BA 5C4WB 2ZMLA 1DZQA 3VZNA 3LCPA 3VDDC 1IZ3A 3MLLA 1HLCA 1SCRA 4GWMA 3TAYA 1LEMA 1XU2A 1AL21 2R062 2GMEA 4CDXA 4CP2A 4RR3A 2R041 2TBVA 1YI7A 2YPJA 2D98A 2ZOEB 3C3VA 2A73B 4XFIA 4PBOA 2F4PA 1GZCA 1FATA 5C4WC 4R9CA 2A6XA 1NZCA 1PK6A 4MGKE 1RINA 4BCUA 4LLFA 1WW5A 3GBFA 4QGMA 2DYCA 1RUJ1 1YJKA 2HWB1 3ILFA 3KGLA 2CL2A 1VBC1 4QD2A 4P9XA 2GC2A 5T5OA 4AFMA 1LOFC 3WDTA 1GKBA 4YW3A 4GMP0 4CRQA 4DRVA 1BEV3 4YZ2A 1LU2A 4YGBA 4CDWB 1R091 3KS7A 2BW8A 1TME1 5I8SA 4GMP3 3GHNA 4N7IA 4AE2A 2CAUA 1QMJA 1IKPA 2A6VA 2G9GA 4IQPA 5AC91 5CADA 1Y9QA 2QJVA 3BIWE 3WDXA 4CP0A 4KU8A 2NPIA 3VKNA 1UCXA 1SACA 2ES3A 4PLNA 1S2KA 1PMIA 1RUD1 3KD4A 1RVF1 4PBPA 4RQPB 4TWTA 4CDWC 1PO13 1O4YA 2WT2A 1LENA 1Q5OA 3RMXA 5KC6A 2DFBA 1V6JA 2WNVA 3WW3A 1H1IA 2SLIA 2ZS6B 2XJVA 4AFAA 4NVPA 4NPRA 3SH5A 4YGCA 1SLTA 4FBFA 3HN1A 2UY8A 3JU9A 1N3QA 3CU7A 5ABJB 2ZJCA 3USUB 1J3PA 4LNVA 3RJRA 1XYOA 1PIV2 5D8AB 5J09A 2JE9A 1ZZ8A 1RUD3 3S6PA 5ACA2 4K8FA 4AVCA 1CAVB 3D4KA 4I3GA 2QQPA 1EPZA 3KB5A 2ATFA 1MQTB 5F5QA 2BFUS 3WDWA 4TYSA 1GANA 1Q43A 3UKTA 5ABJC 1ENRA 3ZXFA 2R6QA 4MGYE 2PA7A 1V00A 1AXYA 1DG6A 5IK5A 1H1MA 3AKTA 4LHLA 5IK8A 1NG0A 3T2TA 3R0RA 1XNKA 3ILRA 3DKWA 3WQ0A 4M0HA 1TQ5A 4FAGA 3R4UA 3ZFGA 4IEVA 1MQTC 1AL0G 3U07A 4Y26A 1N3OA 2BBVA 1CN1A 1YI9A 2I2SA 3Q9OA 4IL7A 1V6IA 1MVQA 2YC0A 2BWCA 3WW1A 2TUNA 2IZWA 1AYN3 5LRSA 2YHJA 1GZWA 2RS51