2HWF3

A comparison of the anti-rhinoviral drug binding pocket in hrv14 and hrv1a
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
238
structure length
238
Chain Sequence
GLPVYITPGSGQFMTTDDMQSPCALPWYHPTKEISIPGEVKNLIEMCQVDTLIPVNNVGNNVGNVSMYTVQLGNQTGMAQKVFSIKVDITSTPLATTLIGEIASYYTHWTGSLRFSFMFCGTANTTLKLLLAYTPPGIDEPTTRKDAMLGTHVVWDVGLQSTISLVVPWVSASHFRLTADNKYSMAGYITCWYQTNLVVPPSTPQTADMLCFVSACKDFCLRMARDTDLHIQSGPIEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 1A COAT PROTEIN (SUBUNIT VP1)
publication title A comparison of the anti-rhinoviral drug binding pocket in HRV14 and HRV1A.
pubmed doi rcsb
source organism Human rhinovirus 1a
total genus 33
structure length 238
sequence length 238
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1994-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2hwf300
4Q4V3 3VBUA 1B35A 4GMP3 4QPIA 1PVC1 2X5IC 1PIV2 5DDJ3 5ABJC 1BBT3 1RUF3 4NWVA 5C4WA 5CFCC 1HXS3 1NA1A 1NG0A 5CFDC 1VAKA 3NAPC 5A33A 4YVWB 1VBC3 2RS53 2HWE1 5A32A 2MEV3 2ZAHA 2R071 2RM21 1R092 4YVSB 1COV2 3ZXAC 4Q4X3 4CDXB 4RS5A 2X5IB 3ZFGB 5ABJB 2R061 5BNNC 5CFCB 2HWB2 5CFDB 1HRI1 3JBG2 3NAPB 4RHV3 1CJDA 1NCRA 1ZBA1 4PDWB 5J98B 4GH4B 2WS91 1POV0 5JZGC 1HX6A 3VBRA 4WM7A 4CDUC 2HWC1 1HQNA 3S6PA 5D8AC 5L7OC 4CEYC 1A6CA 2RM22 4JGZC 1FPN1 4N53B 1VBB1 4FTEA 3VBUB 4QPIB 4RR3A 1QQP3 1R081 1RUE3 2R062 1EAH2 1FMD2 2Y26A 1NA1B 1PVC3 2RS11 1MEC1 1R1A2 1NCQC 1AR92 1VBA2 1IHMA 1ZBA2 5K0UC 1BMV1 1WCDJ 1RVF3 1TME1 1EV12 1AYM1 1E57A 4YVWA 2GSYA 1VB4A 5D8AB 4FTSA 5L7OB 4CEYB 1QJU1 1VRH1 4WM7C 2HWE3 4JGZB 2RMU1 1DDLA 4YVSA 2R073 2PLV2 2R042 3DPRA 4RS5B 1VBB2 2HWD2 4Y4YA 2HWF2 3JD72 1PIV1 2WLPA 2BPA2 2R063 5CFCA 1F2NA 3VBOC 2BFUS 1SMVA 1MEC2 5K0UB 1RUG2 3NAPA 5AC92 1RUC2 1AR82 1HRI3 2XBO2 1BMV2 1ZBA3 1TME2 3VBRB 4WM7B 2WZR2 2WS93 1R091 1QJU2 1X33A 1COV1 1K5MC 1W39A 2HWC3 2RMU2 3JB8A 5ACA2 4RR3B 3DPRC 1FPN3 4GMP0 5BNNA 2HWB1 1POV1 3VBOB 1ZBE2 3J8F2 1R083 3JBG1 3VBFA 4CDWC 2XPJA 4GB32 1VB2A 3ZFFC 1AR72 2RS13 3LOBA 1TMF2 5JZGA 4CDUA 1AYN2 1TME3 1AYM3 5D8AA 5C8CC 4AEDC 5L7OA 4CEYA 1C8M2 5C9AC 1QJY1 4JGZA 1QJU3 1VRH3 2ZZQA 3DPRB 2RMU3 2RR12 1RHI2 3HAGA 4CEWC 1FOD1 1EAH1 4CDWB 1FMD1 3ZFFB 1M06G 1R1A1 1NCQA 1PIV3 1AR91 3VBFC 1VBA1 4CDQA 1Z7S2 1AR62 5K0UA 1BEV2 4IV3C 4QPGC 5J96B 1EV11 1AL22 5C8CB 1MQTC 4AEDB 4RQPA 5C9AB 2RS32 1QJX2 1QJY2 1R093 2PLV1 2R041 1COV3 1VBE1 2HWD1 4RFT0 5BNNB 1RUD2 2HWF1 2WFF2 3JD71 1RUI2 1FOD2 3VBFB 1HRV2 3VBOA 2BFUL 2FZ1A 1POV3 2HWB3 1RUG1 4IV3B 5AC91 5BNPC 1RUC1 1AR81 3JBG3 1RMU2 2XBO1 1MQTB 4JGYA 5JZGB 2IZWA 4CDUB 1NY71 2WZR1 4RQPC 1AUYA 1K5MA 1PGW2 1RUF1 3ZFEC 5ACA1 1D4M2 2RM23 3IDEA 1QJY3 1VBE2 1V9U2 3JB4C 1ZBE1 4Q4Y1 3J8F1 1NCQB 4CDWA 2MEV1 4GB31 3ZFFA 1RUJ2 5LK7B 1EAH3 1FMD3 1AR71 1R1A3 1TMF1 1AR93 1VBA3 4Q4X1 4IV1C 4JGYC 1RUH1 1AYN1 4RQPB 2FZ2A 3VBHC 1H8TA 1NY72 1EV13 4Q4V2 5C8CA 4N43C 4AEDA 4Q4W1 1C8M1 2BBVA 5C9AA 1X36A 5DDJ2 5FMOS 1BBT2 2RR11 1RUF2 1HXS2 1RHI1 2WWSA 1ASJ1 2PLV3 2R043 4CEWA 3VBSA 1VBB3 2HWD3 3VDDC 1VBC2 1ND2A 1OPOA 2HWF3 3JD73 3FBMA 4BCUA 4Q4Y2 2MEV2 1Z7S1 1AR61 1BEV1 4IV3A 4QPGA 1MEC3 4JGYB 1RUG3 5AC93 1RUC3 1AR83 1AL21 1OOPC 2XBO3 1MQTA 4Q4X2 1RUH2 2RS31 4NWWA 1H8TC 1K5MB 4Y5Z0 2WZR3 4CDXC 4Q4W2 1QJX1 5BNOA 3ZFGC 1PO11 4RHV2 5ACA3 1RUD1 1ASJ2 3TN91 3VDDB 2WFF1 2VQ0A 1VBD1 1RVF1 3VBSC 1RUI1 1HRV1 4PDWC 1C8NA 1ND2C 4EJRA 1ZBE3 5BNPA 4GH4C 1ND3C 3J8F3 4Q4Y3 1RMU1 4GB33 1PGL1 1OOPB 3CJIC 4WM8A 1AR73 1TMF3 1H8TB 4LLFA 1RUH3 4N53C 1QQP2 1AYN3 1PGW1 4CDQC 1RUE2 4SBVA 3ZFEA 4Z92B 3VBUC 1B35C 4QPIC 1D4M1 5GKAC 2TBVA 4Q4W3 1C8M3 1PVC2 5BNOC 1PO12 4CEWB 2RR13 3VBSB 5C4WC 1V9U1 1NA1C 3TN92 1RHI3 1ASJ3 1CD3G 3M8LA 1VBD2 1RVF2 1ND2B 1ND3B 1RUJ1 5FOJB 3CJIB 1F8VA 1PO21 4QPGB 2HWE2 1PGL2 1Z7S3 1AR63 4IV1A 4WM8C 2R072 1BEV3 3VBHA 4CDQB 4Q4V1 4N43A 1AL23 4GMP1 1B35B 4RS5C 5DDJ1 5BNOB 2RS33 5FMOL 1BBT1 1HXS1 5C4WB 1QJX3 2ZTNA 1HRI2 1PO13 4FSJA 1AL0G 3VDDA 2BUKA 5A33B 1NCRC 1RUD3 3TN93 1VBC1 2WFF3 2RS51 1VBD3 5BNPB 1RUI3 1FOD3 5A32B 1HRV3 2WS92 4WM8B 3VBRC 1PO22 2HWC2 1RMU3 1OOPA 1GFF2 1FPN2 3ZFEB 4FTBA 4CDXA 4RR3C 2X5IA 3ZFGA 5ABJA 1R082 4RHV1 1RB8G 1D4M3 2RS12 1NCRB 2GH8A 5CFDA 2QQPA 1VBE3 1QJZA 1V9U3 4PDWA 1NOVA 2RS52 4GH4A 1ND3A 1AYM2 1RUJ3 3CJIA 4YVWC 4IV1B 2DF7A 1VRH2 1OHFA 1PO23 3VBHB 4N43B 4YVSC 4N53A 1QQP1 1RUE1
chains in the Genus database with same CATH superfamily
2VMCA 1SPPB 3WW1A 2QUOA 1AX0A 2IFWA 1B35A 2V5YA 4QPIA 3VBUA 5FXXA 3ZO0B 2W1UA 1F5JA 1PIV2 3RYRA 4AI1A 2JG8C 3P1IA 1WLDA 1DYPA 5DZEA 2MNGA 5CFCC 1HXS3 1M4WA 1AZDA 3ZN4A 4DINB 5T55A 5CFDC 4B29A 3NAPC 3PTRB 4AI3A 4X6QB 4W6YA 3GCXA 5I8TA 1N3QA 3UK9A 4A6SA 2X10A 3OPTA 4QX0A 1Q8VA 2GDFA 3IAPA 5GLUA 2RS53 2P6CA 5A32A 5C5UA 2BTVC 5FYYA 4ET7A 1W6QB 4LIVA 5KHIA 2ZEYA 1ZVFA 3N9MA 1V6JA 3LFIA 1PZ8A 2A7AA 3BPZA 5FR3A 2DTWA 1HJFA 3MIHA 4Q4X3 2V72A 3R6SA 4RS5A 4CDXB 1JMUB 3PVEA 3ZN6A 2VZRA 1ULPA 4COYA 2CHHA 2JXAA 5EWSA 4AXOA 3HN1A 3TAYA 4JAAA 1UMIA 1OI6A 2HEVF 5IVYA 4GWNA 4GJYA 4CZSA 3ZDSA 4BQXA 1NXD1 5CG9A 3OB8A 1SACA 1WGPA 4QM9A 1OLMA 1KGYA 1MS4A 4QX3A 2KR2A 2PFWA 2XJTA 4XUOA 4QXKA 4WZCA 1HLCA 1D0GA 2BOIA 3WP6A 4YWAA 1ZRDA 3H8RA 4CXYA 2C6SA 1P8JA 1POV0 1ZRIA 5CAZA 1BHGA 1SFPA 2VTXJ 1WCSA 3D0JA 1UZZA 1OVPA 3WW2A 3W5MA 1O4TA 3S6PA 3RPQA 1O3RA 1XB9A 3WW3A 1WCQA 2VGDA 2VQUA 3URFA 4CEYC 5L7OC 1OFSA 1UYYA 5GLZA 4C8DA 4JGZC 4XUQA 3I3DA 3AM2A 3IDAA 4N53B 3AJZA 3WG3A 1ACCA 4QPIB 2LS6A 2UYAA 5F5AA 4YW1A 3VBUB 5DZFA 3SXWA 3ZXEA 1QQP3 2JD9A 3DV8A 3HT2A 1UOFA 2P1BA 4QKDA 4QX7A 2VZ3A 3TBDA 1FMD2 4ES9A 2RS11 4PIXA 4UOJA 1R1A2 4XDQA 1NCQC 2G1MA 1L7LA 2ENRA 4D94A 4XVHA 2FDHA 2Y0OA 4YPJA 3TYJA 1IHMA 5F5IA 1ZBA2 3WQ7A 5K0UC 5A70A 4O65A 1CIYA 1DGWX 1QIQA 1WCDJ 2DU0A 2BVVA 2VNVA 4M3CA 4N90A 2JDKA 4LO6B 4XJZA 5FDBA 4Y4RA 4OHVA 4TXWA 1G7YA 1E57A 5FZEA 4YVWA 4FTSA 1VB4A 1W3XA 3HNYM 5D8AB 1VLNA 1VRH1 3APBA 3BOPA 4WM7C 2F4PA 1A8DA 1C5IA 3ZKYA 1S0CA 3OY8A 1YRZA 3LWCA 5FZ7A 4YVSA 2ZMKA 5IAVA 3T09A 2D43A 2BNMA 3DPRA 3IMNA 4RS5B 3ZN6B 1VBB2 4IGPA 4OYUA 1W6NA 2CDOA 5DXDA 3EJKA 2KD7A 5FZDA 4JHTA 2D3PA 4BMBA 4J25A 1PIV1 2WLPA 5IAXA 2ZXQA 5IVCA 1C5HA 3RGBA 2PQQA 1L7RA 3KV9A 5ISLA 3FHAA 2CU5A 4M00A 1RUG2 1GWMA 5AC92 4GWIA 3ZIXA 2AGSA 4JTOA 1LECA 3KF3A 4L97A 2PA7A 4HVOA 5JXJA 5F37A 1US3A 1TG7A 3WXPA 5IVFA 1BVVA 1S0BA 3HIFA 4ES8A 1CR7A 3ATGA 1YI9A 3ILFA 4QQPA 3MBWA 5JXHA 1IS4A 5BPXA 4FFIA 1YQ6A 2E26A 1QMJA 3U75A 1X33A 4LO8A 5FZBA 1EYBA 3POWA 1LJ7A 4QT6A 5CEHA 5FYHA 3EYPA 1AF9A 1IG3A 4XXPA 3OBTA 3MGUA 3HEIA 4YGDA 2ZX4A 2AREA 3B00A 2VNGA 5BNNA 1ZZ6A 1YLLA 5DUXA 3VD9A 4YW5A 3J7NA 2GH2A 3J8F2 3VBFA 2XPJA 3WP3A 4LK6A 5JUVA 2IXIA 2J42A 1MZ6A 3IDCB 5IW0A 5EJ1B 4ZXEA 2C9KA 2RS13 4YM2A 5F3IA 1TMF2 1WCUA 4M3CB 2EICA 4LE4A 4BPZA 4I0BA 2ZKLA 4QB6A 1W8TA 3WDTA 3LA7A 5FZFA 3ZSLA 4CDUA 1S4CA 1AYN2 2WNEA 1GANA 4DMIA 4MADA 5C8CC 1QH7A 2W46A 3OGRA 4C1XA 3OY8B 3PIJA 4W4ZA 5A7WA 3ZXFA 2XOMA 1QJY1 2VUDA 5C9AC 1K3IA 1VRH3 1O3TA 1BK0A 3DPRB 4IGQA 5FZAA 1YNAA 3C7GA 5GZFA 2ZGRA 3A4UA 2D6NA 4Z2WA 1W6NB 1VJ2A 4NHMA 1JUIA 3BALA 1HB1A 3RWNA 5APAA 3AXDA 1RYYA 5K9YA 1DFQA 1N3OA 2MHFA 2RDQA 3E97A 1FMD1 3DYMA 4QB2A 4AI2A 3NKTA 5FYIA 1R1A1 1PIV3 1LOBA 5JAXA 1U5XA 3MF6A 3N36A 3VKLA 4LBKA 2JE8A 1JYTA 4JCKA 4P02B 4QPGC 1YEWA 4DRRA 3T2OA 5J96B 4KU7A 2JG9A 1PMHX 1MZFA 4EYUA 3C2UA 4IDZA 5FY7A 1QWRA 2XVKA 5HXVA 5FJHA 5FZIA 3NO8A 2RS32 4E9KA 4CCOA 4EQVA 4ASMB 4CP9A 4M01A 1S2EA 4OZOA 1OQDA 2VCAA 1RXFA 1UY0A 4C0BA 4CUBA 1GOFA 2BWCA 2RVAA 2YPJA 5BNNB 3D4KA 1A34A 2DUQA 3WDYA 1QOOA 2EXIA 2WFF2 4K7JA 3GGLA 4ATFA 4BJ0A 3NMBA 1N1VA 1RUI2 1FOD2 2VOKA 2Y6LA 3H9AA 4G9SB 4V2VA 5D2AA 3VBFB 3WV6A 2OQ6A 3MW2A 1GU3A 1RUG1 4IV3B 5AC91 3GBWA 3VGIA 1X50A 1J1LA 1TE1B 2AYHA 3W9AA 4D7YA 4NIHA 5FMCA 5FP7A 3ZXGA 1DQ4A 1MQTB 2LROA 2PAEA 3ACLA 3FUOA 3ZXJA 3VD5A 1Q8OA 1A3KA 3MFAA 2FCVA 1IG0A 3P5BA 4CDUB 5CKMA 5EP9A 2ZMLA 3MDPA 4A6OA 5L19A 3MPBA 1GYKA 4RQPC 3K3NA 4Q0VA 4AQ6A 1K5MA 3UKNA 3WDVA 4ONUA 4OUEA 4A7YA 3EXUA 5CBLA 3HQRA 1QJY3 2DYCA 4B1LA 4EZ4A 4QDSA 3POBA 1L3JA 2UYBA 3ZXLA 3E5XA 1V9U2 2WUHA 4K6BA 5LWBA 3JB4C 3BYWA 2P5BA 2JDUA 4XXAA 1KRIA 2OKXA 4Q4Y1 3J8F1 4QAWA 4CDWA 2MEV1 3FMGA 3ZFFA 3A0KA 1BXHA 1FMD3 4LBQD 4KGQA 2W91A 4FO9A 3LA2A 5KC6A 2W94A 3O1RA 1JOJA 1LOEA 2BV4A 3ZYJB 1R1A3 1TMF1 5C3RA 4Q26A 4COWA 2ES3A 2WLQA 2VW2A 3EHKA 3AX4A 1NUKA 1UCXA 2JDMA 3OBZA 3SH5A 2VCBA 3QBQA 5C8WA 2XB6C 4FPJA 2XL7A 4DEQA 3SLIA 1AYN1 4A3XA 1JZ5A 3O5SA 5DAVA 5CKQA 3A23A 3B02A 1QXRA 3M3IA 4Q4V2 4QGMA 3WVJA 2J22A 4PLNA 1FXZA 1GUIA 2R32A 1UD1A 5T50A 1YFWA 3LIGA 4B7KA 2W08A 5CIRA 1UY1A 3WDUA 3T2TA 4CCMA 2AEZA 5DDJ2 1JOBA 5FMOS 4XFGA 3KHCA 2D40A 3FX3A 3EO6A 4O9GA 1ASJ1 1DLLA 1X7NA 2WWSA 4QKNA 4CUCA 4HKWA 4J1WA 4LXLA 4FCAA 4B4QA 5C6CA 5JSRA 5FREA 3WHUA 1VBB3 4IEVA 5IK8A 2XKOA 1MS8A 2QTWB 3A0NA 4GALA 1VBC2 4KWUA 2XQRA 5DUVA 3FBMA 3O7OA 2NN8A 2XH6A 3MIEA 5FWEA 2B9VA 1GWKA 5EYYA 1S0GA 3B9IA 3LF7A 4XCBA 4XF9A 5FZKA 5FK7A 5EXOA 1CX1A 4KQ7A 2IVJA 3M2MA 5JIAA 1RUG3 5AFBA 5AC93 1VE0A 5E1RA 3RI9A 1OOPC 1V0AA 2A6YA 2V4VA 2OVUA 3OD0A 4IL7A 5FPZA 3ST7A 2WIIB 1TZOA 3RQ0A 4MHUA 1OKOA 4AI0A 5FBZA 2RS31 2XLGA 4U2AA 1K5MB 2XQXA 2VBDA 5JI9A 2N7GA 3WF3A 4CDXC 4Q4W2 5BNOA 3GZAA 2AZ5A 4Q0SA 2NQYA 5SV5A 2VOWA 3GM8A 2I2SA 3FL7A 5BXXA 3WF0A 3MIDA 3TN91 3IKWA 3SHRA 4MG2A 2WFF1 3LCPA 3U0ZA 1VBD1 1RVF1 5FP3A 5HI0A 3N7LA 4H7LA 3VBSC 1RUI1 4ZY9A 1J1TA 3IZOA 3ZMNA 1LODA 3OF1A 2VO5A 1OMIA 2VZOA 4HPKA 5A1FA 1ND2C 4L99A 1H1AA 1H2KA 1MS9A 1EUUA 2ZX0A 2ZGNA 3H8UA 1ND3C 3J8F3 2VJXA 4Q4Y3 4YG6A 5F6KA 3W58A 2IXHA 3WY6A 1PGL1 4DRVA 1GZWA 3FBYA 4YM3A 1SBDA 2VMIA 4KH9A 4LJHA 5FPBA 1K42A 1UOJA 4WZFA 2Y33A 1LHVA 1TMF3 5F6LB 3NV2A 4DUVA 3UGHA 3ZM8A 4CCKA 2W47A 4N53C 1AYN3 1NZCA 4N8MA 3RJRA 1RUE2 2D3RA 2W87A 3ZFEA 1OBNA 3RZZA 1B35C 4QPIC 2VMEA 3THCA 3VBUC 3J4UH 4IEZA 2VULA 3N3HA 3V0BB 1W6OB 2WWJA 4XPVA 5FAXA 3RDIA 1PO12 3KGLA 2FHRA 3WG2A 1ZRRA 3H3LA 4CCEA 1V9U1 2EIEA 3B9CA 1ASJ3 2NP0A 3HPNA 2QBXA 4I0WB 4IE4A 2XJVA 2PYTA 1UU5A 3BVCA 4CXXA 1H9PA 3POFA 3PUAA 5F5CA 2VQAA 4QB1A 1JZ3A 4NROA 4Q5OA 4B8EA 5FOJB 4XE9A 3D6EA 3CJIB 3I2DA 3OEAA 4Z1VA 2DVFA 3WF2A 4LORA 1GP4A 1E5HA 3PHMA 3SNMA 2ARAA 5FKCA 1K12A 5FZ9A 5M0TA 5FY8A 3SH3A 4YZ2A 2Z2SB 1X8EA 1KITA 3KT7A 4QWNA 3VBHA 4Y22A 4CDQB 2XLAA 3MZHA 4Q4V1 1WMFA 3GF6A 4N43A 3UJOA 3BUCA 4LBLA 1UXZA 4RS5C 3AP7A 4D8MA 3JUUA 3AYEA 2B9UA 5DDJ1 5JR7B 4XQWA 2RS33 2P37A 5BNOB 4ORFA 3AKRA 4K20A 4E4DX 2AEYA 5C4WB 1G86A 4M3CF 1PM4A 4M4PA 3I49A 2J1TA 2ZTNA 2RJ2A 3AKTA 1IOAA 1QH6A 1AJKA 4TYSA 3E1F1 3W20A 3TN93 3PTYA 1GZTA 1VBC1 4WVZA 2WFF3 3AKPA 4P14A 1VBD3 3PUHA 1JH5A 1RUI3 1FOD3 1VMHA 2K46A 2WNVA 2WNUA 4DQAA 1GZWB 2VZ1A 4HOOA 5LRRA 4NHKA 2WT0A 4RFRB 1CN1A 3O0WA 3E6BA 5T3NA 1GICA 1WW5A 4Y1XA 3FHQA 2JB8A 2A3YA 2OQ7A 3ZFEB 4FTBA 1F15A 4LQRA 3BIWE 3LDKA 5FY4A 2W92A 2X5IA 4TLGA 4XTPA 4S2GA 4I0AA 3LDBA 3UESA 3AMMA 5LZ6A 1RJ7A 2YC2A 3WR0A 5FZ6A 4A7KA 1NCRB 1PVXA 2XONA 4FQ4A 4GZ9A 2R1BA 1OLRA 3ACIA 4I30A 4MV2A 2DVAA 2WAOA 1QJZA 4META 4DUXA 1V9U3 4NHLA 3VDCA 1DQ1A 2PHDA 2RS52 4MYEA 2YU1A 4GH4A 1HV1A 4FXGB 2ZOEB 2E6VA 3M3EA 3NNLA 4YVWC 4DXSA 5A3UA 2P3IA 3S5AA 5K8SA 5E88A 4K1ZA 1JU4A 2BWAA 2PHFA 2Z69A 5FO9B 3HD8B 3VBHB 5JR2A 2DCZA 3VZMA 3N4MA 4N43B 4Y20A 1YUDA 4NO4A 4YVSC 4A2UA 2QQUA 2VUJA 4IW3A 1G9BA 2IXJA 1F31A 4H2AA 1V70A 4BXSV 2VCCA 1RUE1 1OUSA 4Q4V3 1NAEA 4YARA 3ES4A 1U5YA 2K0GA 3LFMA 5DDJ3 4YZ5A 1V00A 5ABJC 1R64A 4LKFA 3VZNA 2O0OA 1JUHA 4HT1T 4NWVA 1GNZA 5LA9A 1V6MA 2NPIA 4AHYA 1VMJA 1NG0A 2C24A 3MLLA 1IPSA 5GM0A 1REFA 4AI8A 4JTNA 1JZ2A 4COZA 2VNRA 2OIIA 5A3OA 2JIJA 3D0SA 1IS3A 1GQHA 4ZU5A 4OI2A 2WNVB 2WNUB 4J1XA 1VBC3 4FAHA 4P9YA 3O1UA 4NRPA 3NL1A 2DURA 2WO1A 3CMGA 1RUOA 5FY5A 2DBIA 4G4FA 1IKQA 2Y38A 2RM21 4XJ9A 3T4HB 1U5IA 3P6BA 1LKNA 4MSVA 1O3SA 4K8RB 3AP5A 5IYYA 3ZXAC 2G19A 1HB4A 5IFPA 5FZOA 1JYCA 1ULOA 3N9QA 1DYKA 4INDA 1GBGA 3PL0A 4A45A 2FDGA 2UU8A 2X5IB 5KXBA 3ON7A 4P9JA 5F8PA 3SCGA 5BNNC 3U11A 1W03A 1AXZA 4E2QA 1W6PA 4Y5TA 4GJZA 1O91A 3AJYA 1S2KA 3IWZA 4Q29A 4HK9A 5F2WA 4HXCA 1CJDA 2Q8CA 1WA4A 3M7AA 1JHNA 2E7AA 3FFQA 3PIGA 5J98B 2A6WA 3CO2A 3KQRA 1OH3A 3PNAA 3I4IA 3PUSA 4GH4B 4KU8A 5I8YA 1W2AX 4N9HA 5JLVA 1HX6A 5CVRA 1PNGA 2CNAA 4CDUC 5A7SA 3KQ4B 5FZLA 2LTNA 3CIHA 3PDQA 3RG0A 3AP9A 1A6CA 1MPXA 3POGA 4Y20B 5FTTC 5JOXA 5CKNA 2QQKA 4L11A 4DOUA 2RHPA 3NNGA 1DQ5A 1WBFA 3CL1A 3GBGA 4Q2FA 3VHOA 3ZX7A 4XILA 4FTEA 1W2NA 5FZHA 1C3HA 5DAWA 4C91A 1SPPA 2CYFA 1RUE3 2QQJA 5A7OA 1W9FA 2QZ3A 4PHZA 3MLJA 4XF0A 1EAH2 4XJWA 3RS6A 4CTEA 1DCSA 4OI0A 3VL9A 3LEKA 3X29B 1REEA 4Y1YA 1UYZA 1MEC1 2IXKA 2WAAA 5FPVA 1MS0A 4JC1A 3ZSJA 3O1SA 3EB7A 1W8HA 3L2HA 4MOAA 4LBQA 4B4RA 5JPMB 1UZVA 5GLVA 3T1MA 1BMV1 3ZPOA 1MVEA 5BUVA 3A22A 1ENSA 2JG9C 3V0AA 2ZEXA 2HJIA 1G9AA 2C1FA 1RJ8A 2DFCA 2GSYA 3GALA 4Y3OA 3O1OA 4JKMA 5HV0A 2A1XA 1YFYA 4KGGA 4XBNA 5EPAA 3FE5A 5FY9A 2VECA 3BTXA 2XLFA 1I3HA 2RMU1 1W6QA 3R05A 5FZOB 2BU9A 5CADA 5JWPA 2X8KA 4QX2A 4LULA 4XFBA 5EYXA 4BWOA 2BGCA 4AQ2A 4BU2A 4UFLA 5IK4A 4IESA 5FUNA 4AG4A 4PT6A 2ZEWA 3BPSA 2XXZA 5DAQA 4Y1ZA 2PXJA 1W6PB 2ZX2A 2YU2A 1ZYBA 2VMHA 1S0IA 2YY1A 3UKTA 4XFAA 1DHKB 5FO8B 5J09A 3THTA 4N9IA 1AR82 4Y26A 1D7PM 4NIDA 4GAZA 2XBO2 2Q4SA 5T5OA 5T5PA 1OXCA 3U07A 1OUXA 4XMIA 2XWJB 2GNBA 4RGAA 4DXTA 3TNPB 3W59A 4QX1A 1JW6A 1TNFA 3SEPA 4XAEA 4YM0A 1IQDC 1GSLA 3UETA 1K5MC 1Y43B 3DXTA 2UURA 1MACA 4X8NA 4PJYA 2A3XA 5IUQA 5ACA2 2DBNA 2VUCA 5FRAA 5FY1A 2JDAA 2DCKA 3UKVA 3H1YA 2Y0IA 3RJ2X 3VN4A 4AVTA 4E2GA 2OYZA 4QU1A 3UT0A 1NZIA 1BKZA 3AP4A 3L2YA 2JENA 2WQZC 5T5LA 4YGEA 2WNOA 1POV1 1FT9A 3VBOB 2DCJA 3B93A 4LMFA 2VUAA 5FZ8A 3KF5A 4XF4A 4C1WA 2V09A 4CDWC 1O3QA 1VB2A 1W90A 3ZFFC 3MW4A 4FPFA 4YM1A 2EAKA 4LE3A 2A6XA 5FZGA 4R52A 2DVGA 4LBQB 1RL3A 4XUPA 4D6QA 2VPVA 1REDA 4N7UA 3V0AB 1S0FA 4P00B 1NYWA 4BLIA 3CNAA 3CU7A 5JSOA 5FZMA 4M0NA 2D6MA 1NQDA 2P17A 1NLRA 2GN7A 3L9JT 5D8AA 1J58A 4XTMA 2W2IA 2FMYA 3WG4A 4NIIA 3S5QA 1H2NA 2FDJA 2RMU3 4BYYA 1LHOA 3U1XA 5C3SA 2W0XA 1V6IA 1G8WA 1RHI2 1RXGA 3DCQA 3F95A 3M3OA 3NNJA 1O8PA 4UW3A 3HAGA 2ZABA 3P3PA 3NWKA 3OG2A 5JMCA 4P9XA 5FZ1A 4DUWA 3K46A 3BU0A 1EAH1 5LA1A 1T6BX 3VD3A 3K3OA 5B4NA 2VM9A 3OBRA 3Q8CA 5AFEA 1Z0HA 2QDNA 3WHTA 1WLTA 1Z7S2 1VMFA 4CCDA 1VAMA 2EIGA 4MVTA 4GQ7A 4NRMA 4QHOA 5EZWA 2D7FA 2K9ZA 4FPGA 2WL1A 1X9TA 3LPFA 4LOTA 3ALQA 4BXFA 2B39A 5FQ0A 1AL22 4LUMA 4KBBA 3NVCA 2GNTA 1OLQA 4AEDB 2FQPA 1NLSA 5DUUA 4YZ4A 3U4SA 1IPJA 2J1UA 5F9TA 2XHKA 4AAPA 3WNPA 5C7GA 1NQJA 2J1AA 3O0XA 4I3PA 2WO3A 4K1YA 4YSFA 1JYWA 3CBNA 1QJX2 3O12A 1QJY2 1KQRA 2ZCWA 1SDWA 2JDHA 1QXPA 3BB6A 4AVBA 4E4SA 1WW6A 1VP6A 1CAWA 3RNSA 3VKNA 4BISA 2QE3A 1J83A 2X05A 5I91A 1U5ZA 3I2OA 4D6RA 4W8JA 1CZTA 2BFUL 4CCNA 1POV3 2C5DA 1U0AA 1T6GC 3N7JA 1BK1A 4W6XA 2ID4A 1AR81 1S0EA 3E5UA 2JDYA 3E6DA 4RN5A 5E16A 4AR2A 2XBO1 3CZUA 1PZ9A 1WLWA 4JGYA 5E89A 4BZ4A 1JYIA 4LO5B 1GZCA 2IC1A 2IZWA 2Y6JA 4MXVA 2VBPA 4P5YA 4QPWA 5LY1A 4FPOB 1QDCA 5EQUA 4YNIA 4AFDA 3K51A 2A75A 3IIIA 4XCAA 4AEJA 1SLIA 1RUF1 4JRAA 2BDRA 3U10A 3ZFEC 2J1VA 1WMDA 5ACA1 2ZGUA 2CY6A 3S7EA 1J3PA 3FC0A 4P5HA 4QQLA 3WQ1A 3H7YA 4R9BA 3AYAA 4AZZA 3PUIA 2P3KA 1Q8PA 3O1VA 3SITA 4D69A 3RYKA 4R4XA 1OT5A 1PK6A 2DVBA 1RUJ2 3EQEA 1EAH3 4ASKA 5LK7B 4K9SA 5LCWL 2VW1A 1AHSA 3KSCA 4MGYE 1O4ZA 1UX6A 1I5PA 2PAMA 1H2MA 2XJPA 3D5OA 1PHMA 1AX1A 4IERA 4A4AA 5C71A 5FQ0B 4BQ3A 4QHZA 2OT7A 2W95A 5IWFA 4CPBA 5DMYA 2VZTA 1JOPA 1DBNA 5EFUA 3VBHC 5HV4A 4IE0A 4N43C 2HBUA 1CGPA 1XOYA 5FOBB 4Y5SA 1TQ5A 1X36A 1E5IA 3LKJA 4DNYA 2AC1A 4NOTA 1OSGA 4XDOA 3OOXA 3I3MA 1A78A 1LHWA 1ULEA 1K5JA 3USSA 3WDXA 1AX2A 2B7YA 1RHI1 3LSEA 3VZKA 3G7DA 2ET7A 5FYSA 4TTGA 1KFXL 1CAWB 2XMLA 1VR3A 5EJ3A 3ZSEA 1LGBA 1LR5A 3AK0A 4J6GA 1OPOA 2ZHNA 4Q4Y2 4XJAA 4BCUA 4D6SA 2MEV2 4URAA 4UBHA 1UIKA 4XABA 4DY5A 1Z7S1 4PBOA 2TEPA 2WNUC 2WNVC 2CTVA 4EN7B 1HKDA 1WWYA 4IV3A 2LW8A 2QZ2A 4MGKE 3ME2A 4JGYB 5FPXA 1S0DA 2VZSA 4JKLA 1AR83 2JDPA 3KHBA 1STMA 1AL21 5CB7A 2XBO3 1JXNA 1MQTA 2YZ4A 4CCLA 4QKBA 5J48A 3HNBM 4W50A 4AAXA 1F4HA 3LEIA 4NWWA 1H8TC 2G9FA 4XZPA 1WW7A 2VVDA 1JS9A 1MS5A 4Y5Z0 4LBOA 4MH0E 5ERLA 4AW7A 3M70A 4WVMB 4AGRA 1QJX1 1DZQA 1YJKA 3ZLIA 4HN0A 4QQ2A 4PF5A 5ACA3 3C8XA 3VDDB 1ASJ2 2XVGA 4AFMA 2WZEA 2D44A 2R0HA 4L92A 4LITA 1PK6B 3WUDA 5L9RA 4S2DA 2H0BA 4EJRA 1DQ6A 4R9DA 1S2BA 4QQOA 1MR5A 4GH4C 5EJZB 2DVDA 5A7PA 3INAA 3BCWA 4BA6A 2ZGKA 1APNA 3FFZA 2WINB 1XSQA 1AXYA 1GV9A 5KR7A 5C3OA 2ZHMA 5HCBA 4CRQA 1PMJX 2UWCA 3N9PA 3ZVXA 2GP3A 4P9WA 1UAIA 4JV4A 5CISA 4SBVA 3AVRA 3AXEA 3WP5A 1UZWA 3NRUA 1UU6A 2R16A 2SBAA 3B69A 4E8DA 3FWEA 3O1PA 5AVAA 2MPFA 5G05L 2CGNA 3FJSA 1OURA 1V6KA 4BIOA 2D6LX 4KG8A 2CWSA 5L9BA 3MEPA 3NSTA 1RHI3 3TN92 3TWIA 2ILMA 5J1XA 3M8LA 2J1EA 1OQEA 1VBD2 1RVF2 4MUVA 3UYJA 3AZYA 4F8AA 5BYNA 1RUJ1 3WNLA 4HBNA 3ELNA 1FNYA 1CJPA 3DKQA 2BJSA 5FFOC 2E9QA 2WO2A 3SCHA 2CWMA 1Q3EA 2HWE2 2ZX1A 4HLTA 5FBJA 1PGL2 1WMXA 5HBAA 1Z7S3 3I2FA 4IEXA 1Y4WA 2G9GA 4IV1A 1UXXX 4WM8C 3ZYGA 5GZDA 3H1MA 3H7JA 3Q8BA 4OUSA 3K75B 3VKFC 1AL23 4GMP1 4KWLA 5ANQA 3RMXA 4DO0A 2V4AA 4BM8A 2V73A 1WW4A 4W6WA 1DIWA 3FLTA 1OA4A 3GHNA 1MS1A 4OQ9A 3E6CC 4KMQA 4MGTA 1QDOA 2ZEZA 3PJYA 1UOBA 1QJX3 4WV8A 1FX5A 1VAVA 2H6BA 4KL1A 1OPMA 1V6LA 2IUWA 2WKKA 3AMQA 4GULA 1SHWB 1HRI2 4AYUA 4FSJA 2OZJA 4QMAA 4UBGA 5FYUA 5FYCA 3SKVA 5A33B 1Q5OA 1DU3D 1UKGA 1C28A 1YQ8A 4PQQA 4R9AA 3WDWA 4AVVA 3PJQA 2F4LA 4HZFA 1LNSA 4IEUA 4ISRA 1CAVA 4Q0UA 4QKFA 5DG1A 3MIGA 2WA4A 2YGMA 1TNRA 2ARCA 3MV11 2BQPA 1Y9MA 3GDBA 4COUA 4Z8BA 1W0OA 2YUEA 2YYOA 2J1SA 4LKSA 4NJ4A 3SCFA 3BOWA 2FDFA 2WJSA 4OMCA 2W1SA 5IHRA 2CGOA 4CUAA 1FPN2 4N7IA 1HN0A 4LUKA 3WNKA 4XJ8A 4XOGA 4CP0A 2FCTA 3HVDA 1XQNA 1ZA7A 4MGQA 1LRHA 4I01A 2P3YA 1XYPA 3FN9A 4Y24A 5LK5A 1N1YA 4PIZA 3MICA 2ZKNA 2A70A 1E5SA 2BZDA 2D6OX 2YB7A 2ZGLA 4UAPA 3V0BA 2GH8A 1KDKA 1QNWA 1W2TA 1W6OA 5CFDA 3THPA 1QJFA 3VKOA 2EA7A 2QQPA 3RZKA 4P9GA 4EN9B 3DL3A 2NMOA 4ZS3A 4U36A 5FP8A 3ES1A 3I7DA 4Q1PA 2PHUA 3RYPA 4KNCA 1Q8SA 1WKYA 4FPKA 1AYM2 1RUJ3 1J3QA 3CJIA 5FYZA 3OGJA 1HJGA 2DF7A 4IV1B 1ULGA 4Q0PA 4UWDA 2VC9A 1O5LA 3JU9A 3OGVA 4AFCA 3WINE 4FP3A 4AGGA 2CAVA 4AGVA 5FZ3A 4JDOA 4YZ1A 4CDQA 3TEZA 4LR4A 5FWJA 1WLCA 1XE8A 1GNYA 2VCMA 5IVBA 5HXMA 4Q8KA 4GMP3 4ZU7A 5EIYB 4L8QA 1QOSA 5KXEA 3DN7A 4YFWA 4K3UA 5C4WA 2RDSA 2QFEA 1LHUA 1N3PA 1H9WA 1PGSA 1FAYA 3ACHA 2WC2A 4HVQA 4MX3A 5A6XA 2QCSB 4QHBA 5L36A 3JQXA 1OFNA 1LENA 1CAVB 3NV3A 2XHNA 5DZGA 3RZHA 2XG3A 5A7NA 4QM8A 2HWE1 4XHXA 4CU8A 5F5QA 5CNAA 2MEV3 2B8MA 4JQTA 2E33A 2W1QA 4OUMA 3VUOA 2ZAHA 5F3CA 2CL2A 1CAUA 1VIWB 4FPLA 1XNKA 1W9SA 2BERA 1SLTA 3PVNA 3PLQA 5E6HA 3IBMA 3WX5A 2R061 4EN8B 2JG8B 1GR3A 4XQ4A 3I97A 5CFCB 2HWB2 2LM3A 4GD4A 2VOVA 2XUEA 2WZPP 1YYNA 5CFDB 2BRTA 1HRI1 2DTYA 1CAXB 1W3VA 3NAPB 1NCRA 1SEFA 2WWUA 3AL5A 1ODNA 4XFHA 3T30A 4MGZE 3VL8A 3MPPG 1LU2A 3LB9A 4E4HA 3MIFA 5J36A 1J3RA 1KJRA 2KA3A 5A6QA 1WBLA 2BVBA 3PU3A 1YFXA 1XSRA 3LDRA 1KS5A 4WM7A 1HQNA 1W0NA 3CHXA 3R4SA 3NNMA 5D8AC 4BDVB 4OVEA 2RM22 1XNDA 2P4EA 1KD7A 4NR1A 2I07B 3ASIA 1FPN1 1UYPA 2W9XA 3N7KA 3KWVA 4AHZA 2JKXA 1IZ3A 2QKDA 5J7MA 5FPAA 1W2UA 1NX9A 4JDNA 4RR3A 4W65A 1KFUL 2JECA 4HSLA 2VZPA 4PLMA 5FMDA 3AVSA 3ZMOA 4AHXA 2A6ZA 5HCFA 3O0VA 4OHWA 3SQOA 3HR9A 1JBCA 2F17A 5A1AA 4QU2A 4AQSA 3ZKUA 3MO4A 2OUJA 2W3JA 3U14A 1RC6A 1W9WA 4IE6A 4WVVA 1RVF3 3RWKX 1TME1 1V6OA 4HKOA 5IATA 1IS6A 4ZZ5A 1AYM1 2Z5WA 4LEJA 5CG8A 3ILRA 5L7OB 1ZRFA 4CEYB 1JZ8A 1QJU1 5JI7A 4LKDA 2HWE3 4JGZB 1W8OA 4XF3A 4AWDA 1QOTA 2O8OA 3MUY1 1CAUB 2ARXA 1UN1A 4WVWA 1NKGA 5CU1A 4OI1A 3M3QA 1VRBA 2R042 3U37A 2Y60A 1ZRCA 2EVXA 2P34A 2XJQA 2XKPA 2HWD2 4A3ZA 1DZRA 1OD5A 2JWPA 1R1ZA 1ZA4A 3CLPA 2I45A 5J3UA 3KZ4C 2VR4A 4BK5A 5LA2A 5EV7A 2R063 4F83A 4NHYA 2J7MA 2Q5TA 3C3VA 2BFUS 1US2A 1MEC2 5K0UB 1D4VB 1RUC2 4BE3A 2E7TA 1HRI3 1UKRA 3H1WA 1YQCA 3VV1A 1BMV2 4RSUA 5T5JA 5IJRA 1PM7A 1LEDA 3N35A 4AEMA 2JE9A 4LHKA 4UW5A 4P9IA 4WM7B 4DXRA 3OUHA 2JEMA 1DGWA 2WZR2 4GWMA 3WNOA 2R7EB 1H1MA 3TEYA 3TB0A 2RMU2 1W6MB 2YBKA 2ORXA 2ZACA 2YMZA 5H9RA 5JDBA 1OQ1A 5HCAA 1SQ4A 4RR3B 3DPRC 1FPN3 1JI6A 5H9PA 5A80A 3RSJA 2K2SA 4NIAA 5FKBA 4OHZA 3FUQA 3OUJA 5ANNA 2YC4A 2HWB1 3HQUA 1ZBE2 4GB32 4NN0A 4PLOA 2P2KA 4JRLA 1JU3A 2Y8KA 4FVVA 1B09A 1AR72 3J7LA 3KV5A 4XUNA 2XUMA 2DDUA 3AZVA 2E32A 1ZZ7A 5C3QA 3ZN5A 1F9KA 1ODMA 5JZGA 2EXKA 1KDMA 2GC3A 4KBZA 4LA2A 3NKGA 1FI2A 4LK7A 1YO8A 5FIXA 2VOXA 1TME3 1DYOA 4AFAA 4XETA 4MGSA 1AYM3 3GCWA 2LALA 2XVLA 4KG0A 1C8M2 3OPWA 3FLRA 1JYXA 4HETA 3T0BA 1QJU3 2RE9A 2PMWB 3NNFA 2ZZQA 2VTXA 3ZYRA 2VG9A 1H0BA 3ACGA 2QQNA 2RR12 4AVCA 4BQ5A 4CXWA 4BQ1A 2QQVA 3VDAA 1UZ0A 2ATFA 2ZHLA 4XJUA 1ZZ9A 4ISQA 4L2NA 1SZBA 2B5HA 1GQGA 4S2FA 5FYTA 3BU7A 3MUZ1 4XDPA 5A3WA 1YIPA 2VNOA 1M06G 2RDRA 2HBTA 4AE2A 3VBFC 3GBFA 3SKJE 5IVVA 3I3QA 4XZUG 1AR62 2VMFA 2ZAAA 4IV3C 4UXAA 4CYDA 5LA0A 5GLWA 2WN3A 3AYDA 2D98A 3B3QE 3B5LB 3OGSA 1UL9A 4DXZA 5I8SA 3M4FA 1MQTC 2QDRA 3AMHA 3TOJA 3ZYIB 3D3AA 5C8CB 4DZGA 5JPNB 4RQPA 5C9AB 5CZKA 3UNPA 4EROA 3Q9OA 2HEYF 1YC61 2A6VA 2YBSA 3DYPA 3HMYA 1W8ZA 4QX5A 3QH7A 2NLRA 3T3YA 2R041 1UPIA 2GNDA 1VBE1 3WF1A 2HWD1 4XURA 4RFT0 1W8WA 2BEOA 5A6ZA 3VHPA 1PMIA 3O1TA 1XPWA 3MYXA 4K40A 2PHWA 4LKEA 4B1MA 4CU6A 2GNMA 2R1DA 3RZJA 1HRV2 3KT4A 4CP2A 3VBOA 4YFZA 2FZ1A 2HWB3 3RMYA 3N9LA 1RUC1 4IEOA 3ACFA 1KS4A 2TUNA 4NAMA 4XHBA 3B7MA 1LGNA 1UO9A 1UOGA 1KJLA 2GMPA 5LY2A 4FFGA 3BODA 4FBFA 3AZWA 5A3LA 4BMEA 5JZGB 2Y34A 2W5FA 2D5FA 4YG3A 3WCSA 1NY71 1ULCA 2PN5A 3OPZA 5IVEA 5A1LA 2WZR1 2QVSB 1JYNA 4YG0A 3MV01 1AUYA 1WD4A 5K4LA 4NHXA 2VZQA 2OPWA 4FOQA 3K2OA 1QXJA 5JMOA 1D4M2 3TEXA 2RM23 3DECA 5AVPA 2VQTA 4ITCA 5DQ0A 2BBAA 2Z4FA 3I8TA 5JOYA 2EIBA 2VOTA 3JQWA 1UIJA 1Z78A 4XC9A 1ZBE1 4D0QA 3I59A 2XL9A 2HEWF 3OEBA 3HT1A 4GB31 4CU7A 4ZONA 2WRAA 2FCUA 1Q43A 3KCYA 1W05A 1AR71 4R4ZA 4ZXKA 4JDMA 1WD3A 2DUOA 5FLHA 4QXCA 2E7QA 2RJLA 3KV6A 2YG0A 1JZ7A 2ZPXA 4HONA 1XYNA 4Q4X1 4ZKTB 4IV1C 2VU9A 1RUH1 2WABA 4IETA 4KWKA 1UU4A 4RQPB 1NE6A 3ZXKA 5GALA 4UFIA 3ZXDA 1URXA 2DCTA 2WSVA 4AEDA 3VZOA 4H7MA 3LPGA 1SLCA 1C8M1 1JYVA 2BBVA 3I3BA 4XFFA 1SLLA 1OA3A 1BBT2 4HN1A 2RR11 1RUF2 3ETPA 4P9LA 4PQ9A 4HL0A 1QNYA 1UF2C 2V5DA 4V1PA 5KBFA 2R043 3EMRA 5F39A 3OSDA 4CEWA 1T2XA 2E53A 3RVHA 3VBSA 2DU1A 1GP5A 2HWD3 3AKQA 3I2GA 3M3CA 3PMSA 5FZ4A 1X82A 1XNBA 3OYWB 4AHWA 3Q8EA 1DZTA 1ND2A 2WDBA 3R0RA 4O61A 1LOAA 2ZX3A 4Y1UA 5T54A 4ZS2A 3VZLA 5C5TA 1UY3A 2BNOA 3LOIA 3GNEA 2A73B 2GP5A 5JCTA 1AR61 4DIQA 2ZGSA 3ZSMA 4BQ4A 3ETQA 4GXLA 2PHTA 1MEC3 2YROA 3UGFA 3N9NA 4A44A 3NJXA 1RUC3 1GWLA 1UYXA 2R30A 4IEYA 5TSWA 1ZZBA 1LB2A 2GC0A 2VW0A 3PURA 1GKBA 1ZNPA 2WZ8A 2ZZJA 4IEPA 4AVSA 4QXBA 1BZWA 3ABZA 1GOGA 4H3WA 3A21A 2WZR3 2YBPA 4MZUA 4YRDA 2Q30A 4OZXA 4LO4B 1O8SA 3CJXA 4QD2A 4RHV2 5D21A 1D2QA 4EV0A 5FCCA 1W0PA 1W8NA 2VQ0A 2YHJA 4IE7A 4UFKA 2C26A 3W21A 4YLZA 3I59B 4CP1A 1HRV1 2IVIB 2D5HA 4QDQA 3PVOA 5FP9A 1OVSA 1LEMA 1ZBE3 3AFKA 5BNPA 3DF0A 4AOCA 1LAJA 3V64A 1K45A 4GB33 4Y33A 1DGLA 3POSA 1OOPB 3CJIC 5C70A 4XFCA 1AR73 2JIGA 1W2OA 5JXGA 4UW4A 1CESA 4Z2AA 3IM0A 1ONAA 5FYBA 1AVBA 3NQHA 2FMDA 3B01A 4RGGA 3USUB 4LLFA 1RUH3 1S55A 2VY0A 3E5QA 4RYDA 3U78A 3OD4A 2H0VA 2VE1A 4CDQC 3LE0A 4HG6B 1LOCA 3TRSB 5B2GB 1YQ5A 1D4M1 2TBVA 3LZZA 3ZDVA 1C8M3 1PVC2 5BNOC 5I93A 5J37A 5IK5A 4TSVA 3JZVA 4RL7A 4CEWB 1ZZCA 3AYCA 2RR13 3K4AA 3VZJA 3VBSB 4AVAA 4OULA 4FAGA 5C4WC 3W5NA 2Y6KA 3AP6A 4V2WA 4MHRA 1ND2B 5A3NA 2VMGA 2WYFA 5IFTA 4FPHA 1ND3B 2JB4A 4URTA 2XR4A 4OFGA 4DFSA 5FYVA 2EALA 1KEXA 3I3EA 1PO21 4R8HA 2HYKA 3MHZA 5KHHA 4EWAA 2VD7A 4CU9A 4NRQA 4YGBA 3OUIA 5DPNA 1AR63 1NLQA 2R072 4EWEA 3KB5A 2YFUA 2GZWA 4UT5A 1SFNA 5K7PA 4XBQA 1B35B 4L0PA 2EF6A 2Y6HA 3T1LA 2YDEA 1BBT1 1BJQA 3GZUC 3H0OA 4KWJA 4WVMA 5FY0A 5JOZA 3LD8A 1LTEA 4TZDA 1RTVA 2IWGB 1QHDA 2TNFA 3IIAA 2YXSA 1LCLA 3RRDA 1AL0G 3VDDA 2PQSA 2BUKA 1WZXA 1IPKA 1NCRC 4WBBA 2LUWA 5F7UA 5BNPB 5C33A 1XRUA 5A32B 1HRV3 4DS0A 2WS92 5C3PA 1NT0A 1IQAA 1D2SA 3UJQA 2ZA9A 2HWC2 1OF3A 5GZEA 5JIUA 3QOPA 3I2JA 4UF0A 5FO7B 3WEZA 2DCYA 1UY2A 2PTMA 1F35A 3B94A 3KMHA 4FOWA 4HVRA 2WQ8A 2DFBA 5L9VA 3GJAA 1PX4A 5GJ6A 3SC7X 3GZTB 1HDKA 1VALA 3K48A 4C90A 4RR3C 5JVVA 1POQA 2W1WA 3ZFGA 5ABJA 1R082 3HJRA 4RHV1 3JXSA 4SLIA 1C1LA 5FUPA 1RB8G 3KVAA 4BIFA 1D4M3 2ZGQA 3K77A 4FP2A 5FYMA 3WLUA 1XNAA 2VXJA 2W68A 5LATA 5H9SA 2DWRA 3HOBA 2WFPA 3ENRA 3WF4A 2EXJA 1Y9GA 1RGSA 4PDWA 1NOVA 1BCXA 2QQIA 3NV1A 4IGOA 4BLJA 1XU2A 2JKBA 3AFGA 2ETEA 1GLHA 1RITA 4NPRA 1FNZA 2VMDA 3N7MA 1LOFA 2AR6A 4H55A 4OMDA 4A7ZA 1LHNA 4ZHNA 3QACA 4AF9A 4XUTA 1OHFA 1PO23 3H50A 5LBEA 2JE7A 4I3GA 4ASLA 3NJZA 4TWTA 3ZYFA 3BTYA 4YW2A 1H4HA 3V65A 4BQYA 2F6BA 2QQWA 1H6YA 1AXKA 2Q8OA 3RFRA 3WG1A 2ADDA 5FMBA 4FOYA 5KHGA 2O8QA 3VLBB 5SV8A 1PVC1 1YI7A 3ZR6A 2X5IC 1N1SA 1UY4A 4UI9L 1AJOA 1BBT3 1Q8QA 1RUNA 1H8VA 1RUF3 3CDZB 3KCCA 1NA1A 4PCRA 5I0DA 1ZREA 4RGKA 5D1IA 5KWRA 1VAKA 2D97A 5JXIA 2Q8EA 5IVJA 2W39A 2ADEA 3NW4A 5A33A 1QEXA 4K8FA 3HBKA 2EXHA 3OTFA 2RG4A 4F7ZA 2Q8DA 4YVWB 1S0JA 3VHNA 1QU0A 4PI0A 2GMEA 1QJEA 1N47A 2P6HA 4E2SA 1YQ2A 2QNKA 4UF0B 2Z42A 4LBNA 4A41A 3Q8AA 4BK4A 2R071 4I02A 1R092 4YVSB 5FPUA 1XNCA 2QQOA 1COV2 3C7HA 3VD7A 2UWAA 4LIUA 2A5ZA 2GU9A 3FZ3A 1W04A 3WQBA 1ENXA 3ZFGB 2XWBB 5FUIA 4CE8A 5ABJB 1YJLA 4JHZA 3WNXA 1MS3A 4QGNA 4MO3M 4XQDA 3JBG2 1A8MA 4RHV3 3POJA 4UYBA 1ZBA1 4PDWB 5T52A 3POIA 1NE4A 1V6NA 1YFUA 5FJKA 3A7QA 5A3TA 1H1IA 4LHSA 1GOHA 3CQOA 2WS91 4XIKA 5JZGC 3ORJA 3GYDA 1SLBA 4Z07A 5FXWA 4NE9A 3VBRA 4K21A 2HWC1 3P3NA 3J7HA 4BQ2A 4LLOA 3J26N 1UNBA 1GNHA 1H4GA 1KXGA 1Q56A 4PI2A 4NIGA 2C9AA 1VBB1 4XAAA 2BGPA 1O6UA 4TN7A 3LSDA 1RIRA 1FV3A 4CCJA 4JVAA 5GZGA 1PNFA 1R081 4GKXA 2R062 4YZ3A 1UW8A 3DEMA 2Y26A 1NA1B 1PVC3 3H8XA 1O59A 1U12A 2C4XA 5DAXA 3SEEA 1AR92 5FK8A 2HLEA 1VBA2 3K4ZA 2A3WA 1F5FA 1GMMA 4FXKB 2WSUA 2AUYA 1MZEA 2ZJCA 4BH9A 4LHNA 2OS2A 3H8OA 2R0FA 2Q1FA 3CF6E 3VKMA 2Q0AA 1EV12 1UZYA 3LEGA 4NAOA 4ZU4A 5FP4A 3IMMA 1C4RA 2AACA 3AC0A 4FOVA 2WQ4A 3T0DA 1ZX5A 2ZBJA 3AL6A 3MFCA 4YW3A 3KS7A 1HQLA 5A7WB 1DP0A 2HYXA 2NZ9A 3F2ZA 3SMHA 1DDLA 3LAGA 4XBLA 4FI9A 2R073 2QJVA 2PLV2 2NMNA 3J7MA 3WD5A 2KM2A 4XFIA 1PZ7A 2VAUA 1HIXA 4D3WA 2QQMA 4S2HA 3AB0A 1YWKA 2ZHKA 4Y4YA 2HWF2 3JD72 5F2SA 3MLKA 1XJAA 2EAAA 2BPA2 4D7TA 2JG8A 5CFCA 2ORZA 1F2NA 2PELA 2OA2A 4OI4A 4JKKA 3VBOC 1SMVA 2FDKA 3NAPA 4XEZA 1CAXA 2JG9B 2Q1ZB 3BN6A 4I2OA 1ZBA3 4PBPA 1OLME 2UY9A 4YW4A 3ZIWA 1TME2 3C7OA 2YPDA 3QCWA 3H3ZA 4OHXA 4QPYA 3POYA 3VBRB 2AENA 4OHYA 2VVEA 3S30A 4Q8LA 2WS93 2PHRA 1NXMA 1R091 2Q1MA 3EBRA 1QJU2 3V56A 5DUWA 4XMAA 1UPSA 1XC6A 2HWC3 1COV1 1W39A 3JB8A 2FBEA 4TLFA 5KC5A 3MI8A 3S0MA 3AMNA 3WCRA 1SFYA 5F1RA 5CA6A 2Y6GA 2I74A 2VZUA 3ILNA 5KHKA 1YHFA 1XXNA 5L73A 1MVQA 4DY3A 4BOWA 3S7IA 3DUIA 4GMP0 1JTZX 3WZ1A 3PUQA 3TEWA 3DXUA 5BY5A 3AZZA 1SBFA 1OF4A 2VL4A 1SCRA 5JOWA 4UW6A 4YW7A 1R083 3JBG1 5I0UA 3D82A 4HSJA 1CPMA 4AK3A 3OGGA 5EHDA 3LOBA 1UMHA 1ZZ8A 2X53S 1LULA 4HMZA 1HN1A 4EN0A 3LGRA 4IE5A 2CGPA 1I9RA 4E8CA 4M3CE 5BNQA 2ZGMA 2Z79A 5LBBA 4NMIA 1DG6A 1UMZA 5CYYA 4EE2A 4AEDC 5A6YA 1G9FA 4CEYA 5L7OA 2OX0A 1IKPA 4H14A 4JGZA 5KXCA 4LPLA 1ENRA 2CV6A 2ET1A 1ULDA 3WP4A 3D8CA 3UGGA 2WO7A 5FLIA 1S1AA 4CEWC 1EPZA 4IQPA 2ZGTA 4YGCA 4QDRA 1FOD1 1HV0A 3OBAA 4CDWB 1W28A 1DGRA 2UWBA 3ZFFB 1BLZA 4JQRA 2WYSA 3SH4A 3WQ0A 2RDNA 1EP0A 3UV9A 1NCQA 5KXDA 2ZS6B 1AR91 3GXUA 4O7XA 1VBA1 4F3JA 1CPNA 4BHPA 5E8AA 5K0UA 1DGRN 1BEV2 4DB5A 2YC0A 1OD3A 2ZMNA 3I54A 1EV11 4LOSA 3FLPA 3HNMA 3ZR5A 1CZSA 3BGAA 4Z82A 2O14A 4ARXA 2PHLA 1DQ2A 2HH9A 2AH2A 5LEJA 2YFZA 4B7EA 3GZEA 2BOJA 4Q1RA 1R093 4DEVA 2PLV1 2QQLA 1W6MA 2X29A 4FPCA 1COV3 1WA6X 3BIEA 3BTZA 3VB9A 3DYOA 1RUD2 1I6XA 1SCSA 5A3PA 2HWF1 2VXRA 3JD71 4XIOA 4OLLA 2VTFA 3OCPA 2B46X 3ZOIA 3PMEA 2CAUA 1BYHA 3WUCA 3HWJA 1LGCA 1QY4A 4M4RA 5BNPC 3ECQA 4MLOA 2O1QA 2R49A 4FPEA 3GHMA 1RMU2 2E31A 3JBG3 1TVGA 1G6NA 2YGLA 2FD8A 3LIHA 2JX9A 5LRSA 2XGXA 4C0HA 1HB3A 3THDA 4CSWA 2VBBA 3LEMA 1W8UA 1YIFA 4Q0QA 2PHXA 1O4YA 3T08A 1UX7A 1DLCA 3T0AA 1PGW2 3MF9A 2ZGPA 2CDPA 2NM1A 5FZ0A 3IDEA 4GA9A 1TEIA 3DGTA 1PX3A 2G9ZA 1VBE2 2OW4A 4Q27A 3C7FA 2GC1A 3S57A 5BV6A 2WA3A 3G6JB 4LNVA 4HPKB 1BVP1 1NCQB 1VPHA 1J59A 4XYXA 3RZLA 4GKYA 1OH4A 1EPWA 4AI9A 4DPNA 2ERFA 5DN2A 1IGOA 3IPVA 4QQHA 4QXHA 5I0RA 1AR93 4UFHA 1VBA3 2R6QA 3C7EA 4JGYC 1E5RA 3T4VA 1EUTA 2FZ2A 1H8TA 1NY72 3FHIB 1EV13 1BQPA 5FXZA 3WNMA 5C8CA 1O7FA 2SLIA 3KD4A 4Q4W1 4RD7A 1H30A 1LESA 1W9YA 3J9SA 3QH6A 5H9QA 5C9AA 1YXWA 1UQXA 4ATEA 3GJBA 5IK7A 1OC1A 4AL9A 1HXS2 1W8FA 2IXLA 3KV4A 3OJBA 4COVA 2OUHA 2JDZA 5FPLA 3ZYBA 3QD6A 2PLV3 1XYOA 4E4ZA 4NUBA 1LOGA 3VDDC 3CKHA 1OKQA 2XDVA 4PF1A 4GIQA 3RZGA 5F3EA 3AMPA 3HN3A 2HWF3 2H6CA 2OPKA 3JD73 3NJVA 1PK6C 3UL2A 2JICA 3N9OA 3O14A 4CVUA 4FPYA 4AQTA 3WW4A 2L9LA 2ZGOA 1QGLA 1W06A 2Y64A 4EN6B 1BEV1 4MGIE 4CPBD 1J84A 3BTAA 1N1TA 4QPGA 2P3JA 5GZCA 3BI3A 1DQ0A 3PVBB 1JHJA 5DABA 4X8PA 2C0ZA 2E63A 4NVPA 4Y22B 3WT3A 4CP9B 1FATA 4EWDA 2HKXA 4Q4X2 4HFSA 1GQPA 2BGOA 1RUH2 5KHJA 2VZVA 3I2IA 2CSGA 2GN3A 1F4AA 4M0HA 1Y3TA 4E27A 3KVBA 2NYYA 1I1EA 4FT8A 2B45X 3IDBB 3HQXA 4D7SA 3R4UA 5F32A 2VH9A 2YV8A 3ZFGC 3ZSKA 1PO11 4FFHA 5FXVA 3IT8A 4MXWA 1RUD1 3I2HA 5LEKA 2PAKA 3ZPYA 3KLSA 5FLJA 2GALA 4XF1A 4EZHA 2XJUA 3WOGA 2JD4A 4OCTA 5A3MA 2FDIA 1HB2A 3MW3A 3RI8A 4R9CA 1CVNA 2G4IA 4PDWC 1C8NA 2VVFA 1CIWA 2D6KA 2W52A 4NPMA 2BNNA 5FV3A 1JZ4A 3VD4A 4IEWA 3IPVB 1HW5A 4LBMA 2OXBA 3ROUA 1RMU1 1UWWA 1ST8A 1WCKA 3ITQA 4LT5A 4FFFA 1I5ZA 1EY2A 2DUPA 5HPOA 3Q8FA 4WM8A 1W99A 1LOFC 2Y6FA 1JZ6A 3VHRA 4GWJA 3O1MA 1H6XA 1H8TB 4Y1VA 3QLQA 1ENQA 2GC2A 2RV9A 4HK8A 3NJYA 3KM5A 1G9DA 1QQP2 3IAQA 1PGW1 2A71A 2BW8A 3DKWA 4PIYA 1XE7A 4JX0A 1SLAA 4Z92B 5HCHA 4CUGA 4BQWA 4IEQA 3ZYHA 4NPLA 5GKAC 1FYUA 1MZ5A 4Q4W3 4FQZA 4CCCA 4IXLA 3LA3A 5F3GA 1HQWA 1O5UA 2WR9A 4I09A 3BKZA 1NA1C 2WBKA 1C57A 3TNQA 1CD3G 1ULFA 3H42B 2GMMA 3CEWA 4LHLA 1WUVA 1CX4A 2JJ6A 5I0TA 5LBCA 3IN9A 3OYWA 4A42A 1G9CA 2UY8A 2OZ6A 3RZMA 3POEA 1CQ9A 1F8VA 2D6PA 1CONA 4QPGB 1C1FA 2B42B 3AZXA 4L9BA 2D3SA 4O9EA 4UFMA 4XW3A 4P08A 2J1RA 1BEV3 5G04L 3ZYPA 1LU1A 1W9TA 3CZJA 2IFRA 3VDBA 3R4DB 4X6RB 5DG2A 5B4XA 5FMOL 1X9PA 4KI5M 4LTAA 5LBFA 3SISA 3M1HA 1HXS1 2E51A 1X8MA 1L7QA 4MXWB 4QGLA 1YCIA 3JCIA 3I2KA 4HKLA 1PO13 4IUGA 2LRPA 4YW6A 4UFJA 1RUD3 4AEKA 1SG3A 4YYOA 1WMEA 2BP6A 2RS51 3IB3A 2JDNA 1GZ9A 1QKQA 3AKSA 1IS5A 2WT2A 4ZZ8A 3KGZA 4WM8B 4ZPIA 3VBRC 1PO22 1SBEA 5I0SA 1RMU3 1OOPA 3WNNA 1GFF2 5JSPA 2XJRA 1JN2P 4AFBA 4LO7A 5IT6A 5LW9A 1ALYA 1RINA 1Y7BA 4ARYA 4G3YC 5LB6A 3USUA 2EIDA 3K4DA 4RA0A 3PU8A 1H2LA 4CDXA 4LBJA 2WN2A 2GAUA 5DAPA 4XACA 1XE0A 3H3UA 1XNTA 5FZCA 3WSOA 2X09A 2RS12 4HANA 2XJSA 1JODA 2B4KA 1SDDB 2ARBA 1CWPA 1VBE3 4B3NA 4B4PA 4BB3A 5LASA 1D0HA 3HBZA 1Y9QA 4CA9A 1ND3A 2D93A 2KXLA 3KCXA 1CZVA 1ZM1A 2BYVE 1FV2A 1DF0A 5GLTA 1VRH2 4QX8A 3T2PA 2RJKA 2IXCA 2DV9A 3LQCA 4LA3A 4OQ8A 1GP6A 3NV4A 4JZRA 3MIBA 2WT1A 1XBFA 1OA2A 3KT1A 3U4XA 1XU1A 4N53A 1QQP1 3T2QA 5A7QA 1QF3A
chains in the Genus database with same CATH topology
3WW1A 2QUOA 1AX0A 2IFWA 1B35A 2V5YA 4QPIA 3VBUA 3ZO0B 1F5JA 1PIV2 3RYRA 4AI1A 2JG8C 5DZEA 1WLDA 1DYPA 2MNGA 5CFCC 1HXS3 1M4WA 1AZDA 3ZN4A 4DINB 5T55A 5CFDC 4B29A 3NAPC 4AI3A 4X6QB 4W6YA 5I8TA 1N3QA 3UK9A 1Q8VA 2GDFA 5GLUA 2RS53 5A32A 2BTVC 1W6QB 5KHIA 1ZVFA 1V6JA 1PZ8A 2A7AA 3BPZA 2DTWA 4Q4X3 3MIHA 3R6SA 4CDXB 4RS5A 3PVEA 3ZN6A 4COYA 2JXAA 5EWSA 4AXOA 3HN1A 3TAYA 4JAAA 1OI6A 2HEVF 4GWNA 4CZSA 3ZDSA 1NXD1 5CG9A 1SACA 1WGPA 4QM9A 1MS4A 2PFWA 2XJTA 4QXKA 4WZCA 1HLCA 1D0GA 3WP6A 1ZRDA 1POV0 5CAZA 1WCSA 3D0JA 1UZZA 3WW2A 1O3RA 1O4TA 3S6PA 3RPQA 3WW3A 2VGDA 3URFA 5L7OC 4CEYC 1OFSA 5GLZA 4JGZC 3AM2A 4N53B 3AJZA 3WG3A 3VBUB 4QPIB 2UYAA 4YW1A 5DZFA 3SXWA 3ZXEA 1QQP3 3HT2A 3DV8A 3TBDA 1FMD2 4ES9A 2RS11 4PIXA 1R1A2 4XDQA 1NCQC 2ENRA 4D94A 2Y0OA 3TYJA 1IHMA 1ZBA2 3WQ7A 5K0UC 1DGWX 1WCDJ 2BVVA 2DU0A 4M3CA 5FDBA 4N90A 4XJZA 4LO6B 4OHVA 1G7YA 1E57A 4YVWA 4FTSA 1VB4A 5D8AB 1VLNA 1VRH1 3APBA 3BOPA 4WM7C 2F4PA 1A8DA 1C5IA 1S0CA 3OY8A 1YRZA 3LWCA 4YVSA 2ZMKA 2D43A 2BNMA 3DPRA 3IMNA 4RS5B 3ZN6B 1VBB2 1W6NA 5DXDA 3EJKA 2D3PA 4BMBA 1PIV1 2WLPA 1C5HA 2PQQA 4M00A 1RUG2 5AC92 3ZIXA 2AGSA 4JTOA 1LECA 4L97A 2PA7A 4HVOA 3WXPA 1BVVA 1S0BA 3HIFA 4ES8A 1CR7A 3ATGA 1YI9A 3ILFA 4QQPA 1IS4A 5BPXA 1QMJA 1X33A 4LO8A 1EYBA 3POWA 1LJ7A 4QT6A 1AF9A 4XXPA 4YGDA 3OBTA 3MGUA 2ZX4A 2AREA 3B00A 2VNGA 5BNNA 1ZZ6A 1YLLA 5DUXA 4YW5A 2GH2A 3J8F2 3VBFA 2XPJA 3WP3A 2IXIA 1MZ6A 3IDCB 2RS13 4YM2A 1TMF2 4M3CB 4LE4A 4BPZA 4I0BA 2ZKLA 3WDTA 3LA7A 3ZSLA 4CDUA 2WNEA 1AYN2 1GANA 4DMIA 5C8CC 1QH7A 4C1XA 3OY8B 3ZXFA 5C9AC 1QJY1 1VRH3 1O3TA 3DPRB 1YNAA 5GZFA 2ZGRA 3A4UA 2D6NA 4Z2WA 1W6NB 1VJ2A 4NHMA 1JUIA 3BALA 3RWNA 3AXDA 5K9YA 1DFQA 1N3OA 2MHFA 3E97A 1FMD1 4AI2A 3NKTA 1R1A1 1PIV3 1LOBA 5JAXA 1U5XA 3MF6A 3N36A 3VKLA 4LBKA 4JCKA 4QPGC 4DRRA 5J96B 4KU7A 2JG9A 1MZFA 3C2UA 1QWRA 2XVKA 5HXVA 3NO8A 2RS32 4E9KA 4ASMB 4M01A 1OQDA 4C0BA 2BWCA 2YPJA 5BNNB 3D4KA 2DUQA 3WDYA 1QOOA 2EXIA 2WFF2 4K7JA 4ATFA 1N1VA 1RUI2 1FOD2 2VOKA 3H9AA 4G9SB 3VBFB 3WV6A 3MW2A 1RUG1 4IV3B 5AC91 3GBWA 3VGIA 1X50A 1J1LA 1TE1B 2AYHA 3W9AA 4D7YA 3ZXGA 1DQ4A 1MQTB 2PAEA 3ACLA 3FUOA 3ZXJA 1Q8OA 1A3KA 3MFAA 4CDUB 2ZMLA 3MDPA 5L19A 3MPBA 1GYKA 4RQPC 4Q0VA 4AQ6A 1K5MA 3UKNA 3WDVA 4ONUA 4A7YA 3EXUA 5CBLA 1QJY3 2DYCA 1L3JA 2UYBA 3ZXLA 3E5XA 1V9U2 4K6BA 3JB4C 4XXAA 1KRIA 4Q4Y1 3J8F1 4CDWA 2MEV1 3FMGA 3ZFFA 3A0KA 1BXHA 1FMD3 4LBQD 4KGQA 5KC6A 4FO9A 3LA2A 1JOJA 1LOEA 3ZYJB 1R1A3 1TMF1 4Q26A 4COWA 2ES3A 2WLQA 2VW2A 3EHKA 3AX4A 1UCXA 5C8WA 3SH5A 3QBQA 2XB6C 4FPJA 2XL7A 3SLIA 1AYN1 4A3XA 3O5SA 3B02A 4QGMA 1QXRA 3M3IA 4Q4V2 3WVJA 4PLNA 1FXZA 2R32A 5T50A 1UD1A 4B7KA 1YFWA 2W08A 5CIRA 3WDUA 3T2TA 5DDJ2 5FMOS 4XFGA 2D40A 3FX3A 3EO6A 4O9GA 1ASJ1 1DLLA 1X7NA 2WWSA 4HKWA 4J1WA 4FCAA 4B4QA 5C6CA 5JSRA 5FREA 3WHUA 1VBB3 4IEVA 5IK8A 2XKOA 1MS8A 3A0NA 4GALA 1VBC2 5DUVA 3FBMA 3O7OA 2NN8A 2XH6A 3MIEA 5EYYA 1S0GA 3B9IA 4XF9A 5EXOA 4KQ7A 3M2MA 5JIAA 1RUG3 5AFBA 5AC93 5E1RA 3RI9A 1OOPC 2A6YA 3ST7A 3OD0A 2OVUA 4IL7A 3USSA 5FPZA 2WIIB 3RQ0A 4AI0A 5FBZA 2RS31 2XLGA 4U2AA 1K5MB 5JI9A 2N7GA 4CDXC 4Q4W2 5BNOA 3GZAA 2AZ5A 4Q0SA 2NQYA 5SV5A 2VOWA 2I2SA 5BXXA 3MIDA 3TN91 3IKWA 3SHRA 2WFF1 3LCPA 3U0ZA 1VBD1 1RVF1 5HI0A 3N7LA 4H7LA 3VBSC 1RUI1 1J1TA 3ZMNA 1LODA 3OF1A 1OMIA 4HPKA 1ND2C 4L99A 1H1AA 1H2KA 1MS9A 2ZX0A 3H8UA 2ZGNA 4YG6A 1ND3C 3J8F3 4Q4Y3 3W58A 5F6KA 3WY6A 2IXHA 1PGL1 4DRVA 1GZWA 3FBYA 4YM3A 1SBDA 2VMIA 4KH9A 4WZFA 1LHVA 1TMF3 5F6LB 3NV2A 4N53C 1AYN3 1NZCA 3RJRA 1RUE2 2D3RA 3ZFEA 3RZZA 1B35C 4QPIC 3VBUC 3J4UH 4IEZA 2VULA 3N3HA 3V0BB 1W6OB 4XPVA 5FAXA 3RDIA 3WG2A 1PO12 3KGLA 2FHRA 1ZRRA 1V9U1 3B9CA 1ASJ3 2NP0A 4I0WB 2XJVA 2PYTA 1UU5A 1H9PA 2VQAA 4B8EA 5FOJB 4XE9A 3D6EA 3CJIB 3I2DA 4Z1VA 2DVFA 3PHMA 3SNMA 3SH3A 4YZ2A 2Z2SB 1X8EA 1KITA 3KT7A 3VBHA 4Y22A 4CDQB 2XLAA 3MZHA 4Q4V1 1WMFA 3GF6A 4N43A 3UJOA 4LBLA 4RS5C 3AP7A 3JUUA 3AYEA 2B9UA 5DDJ1 5JR7B 4XQWA 2RS33 2P37A 5BNOB 4ORFA 3AKRA 4K20A 4E4DX 5C4WB 1G86A 4M3CF 2ZTNA 3AKTA 1IOAA 1QH6A 1AJKA 4TYSA 3TN93 3PTYA 1VBC1 4WVZA 2WFF3 3AKPA 4P14A 1VBD3 1JH5A 1RUI3 1FOD3 2WNVA 2WNUA 4DQAA 1GZWB 5LRRA 4NHKA 2WT0A 1CN1A 3O0WA 3E6BA 5T3NA 1GICA 1WW5A 4Y1XA 2A3YA 3ZFEB 4FTBA 3BIWE 2X5IA 4XTPA 4S2GA 4I0AA 3AMMA 1RJ7A 3WR0A 4A7KA 1NCRB 1PVXA 4FQ4A 2R1BA 1OLRA 4I30A 4MV2A 2DVAA 4META 1QJZA 1V9U3 4NHLA 1DQ1A 2PHDA 2RS52 4MYEA 4GH4A 1HV1A 4FXGB 2ZOEB 2E6VA 3M3EA 4YVWC 2P3IA 5K8SA 5E88A 4K1ZA 2BWAA 2PHFA 2Z69A 5FO9B 3HD8B 3VBHB 2DCZA 3VZMA 3N4MA 4N43B 4Y20A 1YUDA 4NO4A 4YVSC 4A2UA 2VUJA 1G9BA 2IXJA 1F31A 1V70A 1RUE1 4Q4V3 4YARA 3ES4A 1U5YA 2K0GA 5DDJ3 4YZ5A 1V00A 5ABJC 3VZNA 2O0OA 1JUHA 4HT1T 4NWVA 1GNZA 1V6MA 2NPIA 4AHYA 1NG0A 3MLLA 5GM0A 1REFA 4AI8A 4JTNA 4COZA 2VNRA 2OIIA 3D0SA 1IS3A 1GQHA 4ZU5A 4OI2A 2WNVB 2WNUB 4J1XA 1VBC3 4FAHA 4P9YA 3NL1A 2DURA 1RUOA 4G4FA 1IKQA 2Y38A 2RM21 4XJ9A 1U5IA 4MSVA 1LKNA 1O3SA 3AP5A 3ZXAC 1JYCA 1DYKA 4INDA 1GBGA 2UU8A 2X5IB 5KXBA 4P9JA 5BNNC 3SCGA 3U11A 1AXZA 4E2QA 1W6PA 1O91A 3AJYA 1S2KA 3IWZA 4Q29A 4HK9A 1CJDA 1WA4A 3M7AA 1JHNA 2E7AA 3FFQA 5J98B 2A6WA 3CO2A 3KQRA 3PNAA 4GH4B 3I4IA 4KU8A 5I8YA 4N9HA 5JLVA 1HX6A 5CVRA 1PNGA 2CNAA 4CDUC 2LTNA 3RG0A 3AP9A 1A6CA 4Y20B 5FTTC 5JOXA 4L11A 4DOUA 2RHPA 3ZX7A 1DQ5A 1WBFA 3CL1A 3GBGA 4Q2FA 3VHOA 4FTEA 4XILA 1C3HA 4C91A 2CYFA 1RUE3 2QZ3A 4XF0A 4XJWA 3MLJA 1EAH2 4CTEA 3RS6A 4OI0A 3VL9A 3X29B 1REEA 4Y1YA 1MEC1 2IXKA 1MS0A 4JC1A 3ZSJA 3L2HA 4LBQA 4B4RA 5JPMB 5GLVA 1BMV1 3T1MA 1MVEA 5BUVA 1ENSA 2JG9C 3V0AA 2HJIA 1G9AA 2C1FA 1RJ8A 2DFCA 2GSYA 3GALA 1YFYA 4KGGA 4XBNA 3FE5A 2VECA 2XLFA 1I3HA 2RMU1 1W6QA 3R05A 5JWPA 5CADA 2X8KA 4LULA 4XFBA 5EYXA 4BWOA 2BGCA 4AQ2A 5IK4A 4IESA 4AG4A 4Y1ZA 1W6PB 2ZX2A 1ZYBA 2VMHA 1S0IA 2YY1A 3UKTA 4XFAA 1DHKB 5FO8B 5J09A 3THTA 4N9IA 1AR82 4Y26A 2XBO2 2Q4SA 5T5OA 5T5PA 3U07A 4XMIA 2XWJB 2GNBA 4RGAA 3TNPB 3W59A 1JW6A 1TNFA 4YM0A 1GSLA 1K5MC 1Y43B 2UURA 1MACA 4X8NA 4PJYA 2A3XA 5IUQA 5ACA2 5FRAA 2DCKA 3UKVA 3H1YA 2Y0IA 3RJ2X 3VN4A 4AVTA 4E2GA 2OYZA 1BKZA 3AP4A 3L2YA 2JENA 2WQZC 5T5LA 4YGEA 1POV1 1FT9A 3VBOB 2DCJA 3B93A 2VUAA 4C1WA 1O3QA 4XF4A 4CDWC 2V09A 1VB2A 3ZFFC 3MW4A 4FPFA 4YM1A 2EAKA 4LE3A 2A6XA 4R52A 2DVGA 4LBQB 1RL3A 2VPVA 1REDA 4N7UA 3V0AB 1S0FA 1NYWA 4BLIA 3CNAA 3CU7A 5JSOA 4M0NA 2D6MA 1NQDA 2P17A 1NLRA 2GN7A 3L9JT 5D8AA 1J58A 4XTMA 2FMYA 3WG4A 1H2NA 4BYYA 2RMU3 1LHOA 2W0XA 1V6IA 1G8WA 1RHI2 3M3OA 4UW3A 3HAGA 2ZABA 3P3PA 3NWKA 5JMCA 4P9XA 1EAH1 3OBRA 5AFEA 1Z0HA 2QDNA 3WHTA 1WLTA 1Z7S2 1VAMA 2EIGA 4MVTA 4GQ7A 5EZWA 2D7FA 2K9ZA 4FPGA 2WL1A 3ALQA 2B39A 5FQ0A 1AL22 4LUMA 4KBBA 3NVCA 2GNTA 1OLQA 4AEDB 2FQPA 1NLSA 5DUUA 4YZ4A 1IPJA 5F9TA 2XHKA 1NQJA 3O0XA 4I3PA 4K1YA 4YSFA 1QJX2 3O12A 1QJY2 1KQRA 2ZCWA 1SDWA 1QXPA 3BB6A 4AVBA 4E4SA 1WW6A 1VP6A 1CAWA 3RNSA 3VKNA 2QE3A 5I91A 1U5ZA 2BFUL 1POV3 2C5DA 1U0AA 1T6GC 3N7JA 1BK1A 4W6XA 3SH4A 1AR81 1S0EA 3E5UA 3E6DA 3U10A 5E16A 2XBO1 1PZ9A 1WLWA 4JGYA 5E89A 4BZ4A 1JYIA 4LO5B 1GZCA 2IC1A 2IZWA 4MXVA 4FPOB 1QDCA 4YNIA 4AFDA 3K51A 2A75A 4AEJA 1SLIA 1RUF1 4JRAA 3ZFEC 5ACA1 1WMDA 2ZGUA 2CY6A 3S7EA 1J3PA 3FC0A 4P5HA 4QQLA 3WQ1A 3H7YA 4R9BA 3AYAA 2P3KA 1Q8PA 3SITA 4D69A 3RYKA 4R4XA 1PK6A 2DVBA 1RUJ2 3EQEA 1EAH3 5LK7B 4K9SA 2VW1A 1AHSA 3KSCA 4MGYE 1O4ZA 1UX6A 2PAMA 2XJPA 1H2MA 3D5OA 4IERA 1PHMA 1AX1A 5FQ0B 1DBNA 5EFUA 3VBHC 4N43C 1CGPA 5FOBB 1TQ5A 1X36A 3LKJA 4DNYA 4NOTA 1OSGA 1A78A 1LHWA 1ULEA 3WDXA 1AX2A 2B7YA 1RHI1 3LSEA 3VZKA 3G7DA 2ET7A 1KFXL 1CAWB 1VR3A 5EJ3A 3ZSEA 1LGBA 1LR5A 3AK0A 4J6GA 1OPOA 2ZHNA 4Q4Y2 4XJAA 4BCUA 2MEV2 4UBHA 1UIKA 4DY5A 1Z7S1 4PBOA 2TEPA 2WNUC 2WNVC 2CTVA 4EN7B 1HKDA 4IV3A 2QZ2A 4MGKE 3ME2A 4JGYB 5FPXA 1S0DA 1AR83 1AL21 5CB7A 2XBO3 1JXNA 1MQTA 2YZ4A 5J48A 4NWWA 1H8TC 2G9FA 4XZPA 1WW7A 2VVDA 4AW7A 1MS5A 4Y5Z0 4LBOA 4MH0E 3M70A 4WVMB 4AGRA 1QJX1 1DZQA 1YJKA 4HN0A 4QQ2A 4PF5A 5ACA3 3VDDB 1ASJ2 2XVGA 4AFMA 2D44A 2R0HA 4L92A 1PK6B 3WUDA 4S2DA 2H0BA 4EJRA 1DQ6A 4R9DA 1S2BA 4QQOA 1MR5A 4GH4C 2DVDA 3INAA 3BCWA 4BA6A 2ZGKA 1APNA 3FFZA 2WINB 1AXYA 1GV9A 2ZHMA 5HCBA 4CRQA 2UWCA 3ZVXA 4P9WA 1UAIA 4JV4A 4SBVA 3AXEA 3WP5A 1UU6A 2R16A 2SBAA 3B69A 3FWEA 5AVAA 2MPFA 2CGNA 3FJSA 1V6KA 4BIOA 2D6LX 4KG8A 2CWSA 3MEPA 3NSTA 1RHI3 3TN92 3TWIA 2ILMA 3M8LA 1OQEA 1VBD2 1RVF2 4MUVA 3AZYA 4F8AA 5BYNA 1RUJ1 4HBNA 3ELNA 1FNYA 1CJPA 5FFOC 3SCHA 2E9QA 2CWMA 1Q3EA 2HWE2 2ZX1A 4HLTA 1PGL2 5HBAA 1Z7S3 4IEXA 4IV1A 2G9GA 4WM8C 3ZYGA 5GZDA 3H1MA 3H7JA 4OUSA 3VKFC 1AL23 4GMP1 4KWLA 3RMXA 4BM8A 2V73A 1WW4A 4W6WA 1DIWA 3FLTA 1OA4A 3GHNA 1MS1A 3E6CC 1QDOA 3PJYA 1QJX3 4WV8A 1FX5A 1VAVA 2H6BA 4KL1A 1OPMA 1V6LA 2WKKA 3AMQA 4GULA 4AYUA 1HRI2 4FSJA 2OZJA 4QMAA 4UBGA 5A33B 1Q5OA 1DU3D 1UKGA 1C28A 3WDWA 4R9AA 4AVVA 3PJQA 4HZFA 4IEUA 4ISRA 1CAVA 4Q0UA 5DG1A 3MIGA 2WA4A 2YGMA 1TNRA 2BQPA 4COUA 4Z8BA 1W0OA 2YUEA 2YYOA 3SCFA 3BOWA 2WJSA 2CGOA 1FPN2 4N7IA 4LUKA 4XJ8A 4XOGA 4CP0A 1XQNA 1LRHA 4I01A 1XYPA 4Y24A 5LK5A 1N1YA 4PIZA 3MICA 2ZKNA 2A70A 2D6OX 2ZGLA 3V0BA 1W6OA 1KDKA 1QNWA 2GH8A 5CFDA 3THPA 3VKOA 2EA7A 2QQPA 4P9GA 4EN9B 3DL3A 2NMOA 4U36A 3ES1A 3I7DA 4Q1PA 2PHUA 3RYPA 4KNCA 1Q8SA 4FPKA 1AYM2 1RUJ3 1J3QA 3CJIA 3OGJA 4IV1B 2DF7A 4Q0PA 1ULGA 1O5LA 3JU9A 4AFCA 3WINE 4FP3A 4AGGA 2CAVA 4AGVA 4JDOA 4YZ1A 4CDQA 4LR4A 1WLCA 1XE8A 4Q8KA 4GMP3 4ZU7A 4L8QA 1QOSA 5KXEA 3DN7A 4YFWA 4K3UA 5C4WA 2QFEA 1LHUA 1N3PA 1H9WA 1PGSA 1FAYA 2WC2A 4HVQA 4MX3A 2QCSB 4QHBA 5L36A 3JQXA 1OFNA 1LENA 1CAVB 3NV3A 5DZGA 2XG3A 4QM8A 2HWE1 4XHXA 5F5QA 5CNAA 2MEV3 2B8MA 4OUMA 3VUOA 2ZAHA 2CL2A 1CAUA 1VIWB 4FPLA 1XNKA 1SLTA 3PVNA 3PLQA 3IBMA 3WX5A 2R061 4EN8B 2JG8B 1GR3A 4XQ4A 5CFCB 2HWB2 2LM3A 2VOVA 2WZPP 1YYNA 5CFDB 1HRI1 2DTYA 1CAXB 3NAPB 1NCRA 1SEFA 4XFHA 4MGZE 3VL8A 3MPPG 1LU2A 3LB9A 3MIFA 5J36A 1J3RA 1KJRA 2KA3A 1WBLA 2BVBA 1YFXA 1KS5A 4WM7A 1HQNA 3R4SA 5D8AC 4OVEA 2RM22 1XNDA 1KD7A 4NR1A 2I07B 3ASIA 1FPN1 3N7KA 4AHZA 5J7MA 2QKDA 1IZ3A 1W2UA 4W65A 4JDNA 4RR3A 1KFUL 2JECA 4HSLA 4PLMA 4AHXA 3ZMOA 2A6ZA 5HCFA 3O0VA 4OHWA 3HR9A 1JBCA 4QU2A 4AQSA 2OUJA 1RC6A 4WVVA 1RVF3 1TME1 1V6OA 4HKOA 1IS6A 1AYM1 2Z5WA 4LEJA 5CG8A 3ILRA 5L7OB 1ZRFA 4CEYB 1QJU1 5JI7A 2HWE3 4JGZB 4XF3A 4AWDA 1QOTA 2O8OA 1CAUB 2ARXA 1UN1A 4WVWA 5CU1A 4OI1A 3M3QA 2R042 1ZRCA 2EVXA 2P34A 2XJQA 2XKPA 2HWD2 1DZRA 1OD5A 1R1ZA 1ZA4A 3CLPA 2I45A 5J3UA 3KZ4C 5EV7A 2R063 4F83A 3C3VA 2Q5TA 2BFUS 1MEC2 5K0UB 1D4VB 1RUC2 4BE3A 2E7TA 1HRI3 1UKRA 3H1WA 3VV1A 1BMV2 4RSUA 5T5JA 1PM7A 1LEDA 3N35A 4AEMA 2JE9A 4LHKA 4UW5A 4P9IA 4WM7B