2HWF3

A comparison of the anti-rhinoviral drug binding pocket in hrv14 and hrv1a
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
238
structure length
238
Chain Sequence
GLPVYITPGSGQFMTTDDMQSPCALPWYHPTKEISIPGEVKNLIEMCQVDTLIPVNNVGNNVGNVSMYTVQLGNQTGMAQKVFSIKVDITSTPLATTLIGEIASYYTHWTGSLRFSFMFCGTANTTLKLLLAYTPPGIDEPTTRKDAMLGTHVVWDVGLQSTISLVVPWVSASHFRLTADNKYSMAGYITCWYQTNLVVPPSTPQTADMLCFVSACKDFCLRMARDTDLHIQSGPIEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A comparison of the anti-rhinoviral drug binding pocket in HRV14 and HRV1A.
pubmed doi rcsb
source organism Human rhinovirus 1a
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 1A COAT PROTEIN (SUBUNIT VP1)
total genus 33
structure length 238
sequence length 238
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1994-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2hwf300
2HWB3 3M8LA 1AL23 3JB4C 2HWC2 4N53C 5AC93 4Q4X1 2HWE2 4GMP0 1ZBA1 4GB32 4CEWA 4RS5B 1VBA2 2WLPA 3ZFEB 5A32B 1AYM3 3VBFB 1AR72 4GB33 1VBC1 4IV3B 1NY71 2MEV2 1AUYA 2BPA2 5BNPA 1AR73 2RS51 3ZFEA 5C4WC 3VBOB 2MEV3 5LK7B 4RHV3 4YVSA 5C8CA 4EJRA 1NA1A 1DDLA 1PVC1 1VRH3 3CJIC 2HWD1 1HRI1 1RUJ1 4JGYC 4CDWC 2PLV2 3VBOC 3CJIA 1VRH2 1R1A3 5K0UA 1AR62 1ASJ2 4NWWA 1PVC3 2R071 3JB8A 1EAH3 5CFDA 1QJY3 1ZBA2 3FBMA 5K0UB 1PGW2 2WZR2 3J8F2 1PIV2 1RVF3 1AR71 2RS53 4Q4V3 1R091 5L7OC 2WZR3 2MEV1 1FPN3 1TMF2 3JD73 5C8CC 1B35C 2RS52 1PO12 2R063 1OOPC 4FSJA 4CDQB 4AEDA 3VDDA 1POV0 5BNOB 1NG0A 1RUG3 5L7OB 1ND2A 1QJY1 4Q4X3 1QJX2 1F2NA 4Q4Y3 1D4M3 2BBVA 1WCDJ 1AYM2 5AC91 1H8TA 4N43C 2RS12 3ZFGC 1ASJ1 4RQPC 1BBT3 4AEDC 1HRV3 1BBT2 1B35B 1QJU3 1VB4A 4CDQC 1RUI1 1PIV1 4PDWC 3JBG2 3ZFGB 1AYN1 5CFDB 1VBB2 5BNNB 1ZBE3 5C9AA 2HWF1 2GSYA 3JBG3 4WM8C 1R083 1PO21 1ASJ3 1FMD2 1RUE1 4NWVA 2WFF1 2RR11 1QJY2 1ZBA3 1RMU1 3VBRC 1SMVA 4CEYA 5DDJ2 4AEDB 4CEWB 1RUE3 2ZTNA 1RVF2 5GKAC 4YVWA 3IDEA 5DDJ3 4WM8A 1R093 1X36A 1A6CA 1HXS1 1NOVA 5JZGC 2RM21 1Z7S1 1RUI2 3VBSB 1NCQA 3VBFC 3VBRB 4WM8B 4QPGA 1EV11 5D8AC 4GH4A 2RMU1 5K0UC 2BFUL 4Q4Y1 5D8AA 1ND3B 5BNPB 1RUC2 2HWD2 2XPJA 1QQP2 1RUF1 5CFCB 1AR61 5BNPC 1OHFA 5A33B 2Y26A 5JZGB 4JGZC 4N53B 1BMV1 1TME2 1M06G 3VBHA 1RUD3 4IV1B 1AL21 1PO23 4RQPB 1VBE2 2RS33 3VBSA 1HRI3 1RUJ3 1BEV2 4CDXA 1ND2C 4FTEA 2RS32 1VBD1 4JGZA 5L7OA 3VBUA 1RUI3 5BNNC 1K5MB 4LLFA 1HX6A 2PLV3 5D8AB 1QQP1 3CJIB 2WS92 5BNNA 4IV1C 1E57A 1MQTC 2WS93 1EAH2 1AR81 4JGZB 3ZFFA 1RUD1 2ZZQA 4RS5A 4GMP3 4WM7A 1RUC3 2HWF2 1VBA1 1POV1 2R061 4Q4W2 1C8M1 1R081 2R043 2WWSA 4IV1A 5C4WA 3VBHB 1BEV1 5ACA3 1PGL2 4YVWC 2HWF3 2BUKA 1RHI2 5BNOA 2IZWA 3NAPA 4BCUA 5BNOC 1K5MC 1TME3 4Y4YA 1D4M2 4CEWC 3TN91 1BBT1 3DPRA 2HWE1 1VBA3 1ND2B 1NCQC 3VBFA 1HRI2 1RUJ2 4QPGC 4Y5Z0 2DF7A 1QJU2 1VRH1 1OPOA 3VBHC 4JGYA 1FMD1 5ABJC 1NCRA 4RHV2 2RR12 5CFCC 2X5IB 1HXS3 5JZGA 1PGW1 1VBC3 2R041 2WZR1 1R082 1FOD1 1RVF1 4YVSB 1RB8G 1HQNA 1AL0G 1TMF3 4RR3C 5FMOS 2R072 2WFF3 3J8F3 5ABJB 4Q4V2 1R1A1 1FPN2 3HAGA 2HWC3 5C9AC 5AC92 1RHI3 1MEC2 4RR3B 2RS11 4IV3A 5FMOL 3VDDC 4RHV1 1TME1 2RS13 5A33A 4IV3C 2HWC1 4Q4X2 1COV2 1HRV2 1FOD2 1V9U1 4GB31 1COV3 1QJX1 4RR3A 2X5IA 4CDUA 4GMP1 1AYM1 2FZ1A 3VBRA 1VBD2 1ND3C 1W39A 4JGYB 2RR13 1BMV2 4WM7B 4PDWA 2WS91 1R1A2 3TN93 1ZBE2 1FPN1 1AYN3 2ZAHA 1MQTB 1PVC2 1VBE1 5C9AB 5A32A 1CD3G 1GFF2 2PLV1 5J98B 1FMD3 2RM23 3ZFGA 1RUD2 5ABJA 4CDQA 1PO22 3ZFFB 2RS31 1C8M3 2RM22 2R073 1NY72 2WFF2 1HRV1 4N53A 1AR91 4CEYC 1NCQB 1NA1B 1EV13 1PO13 2R062 1C8M2 4GH4C 3DPRC 4Q4W1 3J8F1 4CDWA 3VBOA 1R092 3ZFFC 1EV12 1MEC3 1H8TB 1TMF1 1RUG2 4QPIC 2RMU2 1Z7S3 1QJX3 4Q4Y2 1VAKA 4GH4B 4CDXB 1RUH3 4CDUB 1B35A 3ZFEC 2XBO3 1Z7S2 3NAPC 1OOPA 1FOD3 4YVSC 1ZBE1 1RUH2 4RFT0 1RUC1 2XBO2 1QJZA 4QPGB 1NCRC 1QJU1 1VBD3 3ZXAC 5CFDC 2GH8A 1PGL1 5CFCA 1AR83 1VBB3 1AR92 1C8NA 1H8TC 4N43A 1PO11 4Q4W3 4QPIB 1NA1C 2R042 1CJDA 2HWB2 1AL22 2HWD3 2TBVA 3JBG1 1IHMA 1AR93 3TN92 1QQP3 1AYN2 2HWE3 4CDUC 5J96B 1VBB1 4YVWB 3NAPB 1RUG1 1VBE3 1RUF2 1F8VA 4CEYB 1RUE2 1POV3 1RUF3 1BEV3 5ACA1 3JD71 5FOJB 1RMU2 1RUH1 2FZ2A 4Q4V1 5DDJ1 2XBO1 4RQPA 1RMU3 3VBSC 1MEC1 4PDWB 4Z92B 2BFUS 4RS5C 3VDDB 1VB2A 2RMU3 1V9U3 1HXS2 1ND3A 1VBC2 2QQPA 1COV1 5C8CB 1AR63 1K5MA 2X5IC 2HWB1 1X33A 1OOPB 1V9U2 4FTBA 4FTSA 1NCRB 5C4WB 4SBVA 1MQTA 3VBUB 4QPIA 1PIV3 3S6PA 3LOBA 1RHI1 1EAH1 4CDXC 4CDWB 1AR82 5ACA2 3JD72 4N43B 3DPRB 2VQ0A 4WM7C 3VBUC 1D4M1
chains in the Genus database with same CATH superfamily
1AL23 2D3SA 3MIEA 2FD8A 4Y1XA 3LKJA 4QB6A 3H50A 4Q4X1 1PK6B 1RL3A 2K2SA 1DZQA 2Y33A 3AMHA 1ZBA1 4WV8A 4NPRA 1S0IA 5LB6A 3U37A 5FR3A 4EE2A 4JTNA 4OHXA 1WA4A 4URTA 3ZFEB 1V0AA 1FATA 1WUVA 3NQHA 2JG8C 3VBFB 2VUDA 3ZN4A 3POBA 4FXGB 2VZPA 2OZ6A 4PHZA 4ASLA 3AYAA 2VZVA 4AGRA 2RS51 4CYDA 5C4WC 1YCIA 4XFFA 4W6WA 2XG3A 3HBKA 1UWWA 2QBXA 3BCWA 3N7LA 1XYPA 2Z42A 1H8VA 3ZSKA 1LGCA 3W5NA 5IVBA 3WEZA 4CDWC 2DURA 2WNVC 4IERA 3VBOC 1SFPA 4FP3A 3DYMA 5B2GB 2LTNA 4U36A 4NRQA 1ASJ2 5IK5A 3H1YA 3I3BA 5I0DA 3MI8A 4HVQA 5FZGA 1JOBA 1LOFA 1EAH3 2IVJA 1G86A 4CUCA 5FZ7A 5K0UB 4XPVA 5C5UA 2E51A 4LUKA 2JICA 4Q4V3 1R091 5C3RA 4LBMA 4DIQA 2WL1A 4EV0A 3JD73 4IEOA 3WQ1A 5GZFA 3FHQA 1OLME 4FSJA 4CDQB 1ZVFA 2O14A 3I8TA 3VDDA 4TN7A 4FOWA 4AQTA 2J1RA 2F4PA 5A7NA 2VVEA 3V56A 1YFWA 4YG0A 4AGGA 4GIQA 4CU7A 4AVAA 2WNUA 4UBHA 1ND2A 5CKNA 5KR7A 3HQXA 3HD8B 4Q4X3 5LEKA 1MS1A 3VZOA 4AVBA 5IAVA 1HN0A 1KITA 5FBZA 1LESA 1JOPA 5FZKA 2QQUA 3VZKA 4PLOA 2P5BA 4BPZA 5ANNA 2RS12 3K4ZA 3NMBA 2D97A 3OUIA 4GWMA 1W2NA 5FPUA 3ZKYA 5CG8A 1N3OA 4MGKE 1HRV3 3P5BA 5A7WA 5LRSA 2XOMA 3VZNA 4GJYA 5LEJA 1OF3A 4CDQC 4DQAA 2DCYA 4O9GA 4P9IA 2GH2A 2EXHA 1X50A 2VTXA 3ZFGB 3MBWA 4R9AA 3WNMA 2V4VA 1GP5A 2SBAA 3LGRA 3AP6A 4YFWA 3WVJA 5BNNB 1ZBE3 1H0BA 2VQUA 2GSYA 1W03A 2AENA 1UYYA 3FUOA 1T6GC 3ECQA 5D21A 4LPLA 3WG4A 4META 2VOWA 1X9TA 1RUE1 4JHZA 1NKGA 3CIHA 3MLKA 5LBCA 1YQ6A 5BPXA 2RR11 1WKYA 4YGCA 5A1FA 5FKCA 4P08A 4XW3A 3UKTA 2ZXQA 3WSOA 4XQ4A 1REDA 2ZHMA 3AMQA 3NNFA 2DU1A 1CIYA 5C3OA 1RVF2 2WUHA 2ES3A 4NROA 1O7FA 5DDJ3 4NPMA 3SQOA 4WM8A 3AJYA 5F3CA 1K42A 1R093 4XUQA 3RG0A 3MIFA 4LT5A 1J1TA 1W2TA 4XF4A 2ARCA 4AEJA 4UFKA 3ZXDA 5ISLA 5JZGC 4X6QB 4OZXA 4R9CA 2RM21 4CRQA 1SFYA 1EPWA 3BGAA 2P3YA 1O8PA 2BYVE 3VBSB 3VN4A 1QY4A 5I0TA 4AQ2A 2BWAA 5IVYA 1NCQA 4WM8B 1YIFA 5IK7A 4QQLA 1UYZA 2ID4A 4AG4A 2VMDA 4NHKA 2W1WA 5I0UA 1OLMA 2ZGNA 5SV8A 5HCHA 4GH4A 4QMAA 3OJBA 4YPJA 5GZGA 2BFUL 2R30A 2TEPA 4PI2A 2VZSA 5D8AA 3VGIA 3WF0A 1LAJA 1CX1A 3C7GA 2IC1A 4FVVA 3T1LA 4HSJA 3WUDA 2VNVA 1NQDA 1DP0A 1W6OA 1S0DA 4PI0A 4XUOA 3N4MA 1XE8A 3ELNA 5FAXA 2XJUA 1W8OA 4H14A 4RFRB 3TBDA 5L19A 3AM2A 1JI6A 3MUY1 2YU1A 4P9YA 1QQP2 3D4KA 1RUF1 3O1VA 2PHLA 3VD4A 1RGSA 1I5PA 4KQ7A 2A5ZA 2CGNA 4YWAA 5FJKA 4YYOA 4YSFA 5BNPC 2D6NA 3AJZA 1OI6A 3WG1A 2Y26A 4CE8A 1CN1A 2VM9A 2EIDA 1D0GA 1TME2 4IEUA 4ES8A 1M06G 4UW3A 4PLNA 5KC5A 1RUD3 4IV1B 4CA9A 2NMOA 1AL21 3DUIA 3N3HA 1VBE2 2QDNA 2L9LA 2J1VA 4HBNA 3C7OA 3CO2A 3MIGA 1LJ7A 3VBSA 4NIAA 1C57A 2AYHA 1J84A 1WCUA 4M0HA 2YV8A 4W65A 4QU2A 1UO9A 2VZ3A 4E4HA 2RS32 5FY8A 1VBD1 4ONUA 3HN3A 2PTMA 2BERA 2RJKA 2ZGUA 4NN0A 2JD4A 2QVSB 1BK0A 1HB4A 5FZCA 1IS4A 4ES9A 2PLV3 5HPOA 5D8AB 3VD9A 1S0EA 5F5CA 4QB2A 5CNAA 4LTAA 4NE9A 5IVEA 2WO7A 4IV1C 2NN8A 1E57A 5I93A 1O3TA 4AE2A 2VR4A 1EAH2 2PXJA 3QACA 5LBEA 3BPSA 2ZMKA 4GKYA 4YNIA 2IFRA 3ZFFA 3CL1A 5FZ4A 4QKBA 3KT1A 1DYPA 4KG0A 1RUD1 4ZU7A 1NE6A 4NVPA 4LR4A 2CSGA 2Y60A 2ZEXA 4B8EA 3WF4A 2GMEA 2UYAA 4K9SA 1RUC3 4CPBA 2XQRA 4KBBA 3A7QA 3DV8A 2VOTA 5E16A 2HWF2 1EY2A 1HIXA 2G4IA 2R043 2WWSA 5C4WA 2JDHA 1CQ9A 1BKZA 4H7LA 1GWMA 1RJ7A 4XXAA 4XOGA 2PA7A 1LR5A 3NAPA 4CU8A 4BCUA 4A7ZA 1ST8A 1TVGA 2PYTA 1W9YA 3SHRA 2W68A 2VTXJ 5CU1A 5FPAA 3TN91 3KM5A 5DZEA 4BH9A 1DGWA 1MVQA 2WZEA 4BLIA 2YROA 4AZZA 1ND2B 2W46A 1XC6A 3LPFA 3TAYA 5FJHA 3VBFA 1RUJ2 2Y0IA 1DZTA 3ZLIA 3NJYA 4L0PA 5CB7A 3VHPA 2R0HA 3IDBB 5FO8B 2R32A 2R6QA 4Y24A 1H9WA 1VIWB 1OD5A 2BRTA 2JE7A 4BK5A 3KB5A 1MR5A 2Z79A 1NCRA 3PIJA 4RHV2 5ABJC 5I0SA 5GZCA 3U0ZA 1UX6A 2A6WA 5EPAA 4KWJA 5T5OA 5CFCC 5GLZA 1HXS3 5JZGA 2B5HA 1KDMA 1KS5A 1PGW1 1XNBA 2H6CA 3H1WA 3CHXA 4GD4A 1R082 4IEWA 3THCA 5JOWA 1FOD1 5SV5A 5J36A 5EHDA 5A6QA 4YVSB 5JVVA 3OG2A 3WP6A 2WC2A 2XB6C 3IMNA 5FZ6A 1W6MB 5CZKA 4LA2A 4E27A 2BP6A 1TZOA 1VR3A 4MUVA 4AVSA 3W9AA 4AW7A 4XJ8A 1TMF3 4ZXEA 1L7RA 1D7PM 5KXBA 4MG2A 1QOSA 4LORA 1CZTA 2R072 4HVOA 4OHZA 4AVVA 2D43A 4P5YA 1CAVA 1QOTA 3V0BA 4BYYA 4XC9A 4FXKB 4FPEA 5ABJB 2VMCA 1X82A 3B94A 1KFXL 4Y22B 5GZDA 3ZYGA 2DUOA 1DLCA 3UKNA 4A7YA 4JC1A 3HAGA 3LEIA 1PK6A 3OD0A 4Y20B 4CTEA 1MEC2 4RR3B 4TLGA 4PBPA 3P1IA 4FFFA 5FK8A 1YI7A 4ITCA 4NUBA 3TNPB 5CADA 1VAMA 1JUHA 4HKOA 1UX7A 5A33A 5J1XA 2ZHNA 5EJZB 5DXDA 3R05A 3UYJA 1ZZ6A 1Q8OA 1AXKA 4XJWA 1OA3A 4XDQA 1FOD2 1GWKA 1GZ9A 1V9U1 4CCJA 5I91A 2FDIA 2J1SA 1CZSA 2VJXA 2VNRA 2YBPA 1UZ0A 2IVIB 3OPTA 1KD7A 2I07B 4RR3A 1VMJA 4KU8A 4QB1A 1VBD2 3KMHA 4N9IA 3VZLA 4URAA 2Z4FA 2YDEA 3I2HA 3OUHA 1Y9QA 2HEYF 3NRUA 2UWAA 2E6VA 1J1LA 3I2FA 4INDA 1O4ZA 1H6XA 1ZZ7A 2MHFA 3KWVA 2J1TA 4LHLA 4PDWA 1UL9A 4SLIA 2FDJA 3AVSA 4JV4A 2A6XA 2EICA 1JZ2A 2GNBA 3OPWA 1VJ2A 1AYN3 1M4WA 3RMYA 2WYSA 3U10A 1W0NA 2WAAA 1KDKA 1W3VA 3HOBA 4MXWA 2GMMA 3POJA 1FMD3 1ZZ9A 3B3QE 2RM23 5ABJA 2PHWA 3AFKA 4MYEA 3SKJE 4OI0A 2HYXA 4FOQA 1AF9A 1PO22 2Q1MA 4LIUA 1LHOA 1HV1A 2RM22 4DNYA 5HCAA 2NMNA 1HRV1 3E6CC 1AR91 4CEYC 1GBGA 3RWNA 4D6RA 1XU1A 4Y5SA 2V09A 5FPBA 5F6KA 2YU2A 1EV13 4GH4C 4Q4W1 1OD3A 3WY6A 1D2SA 2P3IA 3I3DA 1YNAA 1VMFA 4JZRA 5FO9B 3HMYA 1Y9GA 1H8TB 4AFBA 3H8RA 1W04A 3LD8A 4LKSA 2WLQA 5CVRA 5JPMB 4K20A 2VMHA 2E33A 3O1SA 1Z7S3 4C0HA 2K0GA 4Q4Y2 4NRMA 2UU8A 2YYOA 1RUH3 3DKQA 4MGYE 4BMBA 5C7GA 1B35A 2IUWA 1HB3A 3NAPC 2VD7A 1DYKA 1OOPA 1W8HA 2D6KA 2WA4A 1ZBE1 3L2YA 3RZGA 1Z0HA 2YGLA 3AP9A 2XBO2 1QGLA 2Y0OA 1G9FA 2DFBA 4HONA 4QDQA 4NHXA 4ISQA 4BISA 4BQ2A 4D6SA 1LB2A 4X8NA 2WSVA 2VULA 4CP1A 1H4HA 4BIOA 3SKVA 2J1AA 5H9QA 2ZEWA 4J1XA 1AR83 2WN3A 4JTOA 1C8NA 1H8TC 2DV9A 3AYEA 4FT8A 4N43A 5FZ8A 3U07A 3GALA 1N3QA 2R042 4XFAA 2Y64A 3SITA 4IEYA 4B4RA 1VPHA 3JBG1 4QHBA 1O3QA 1GQPA 1AXZA 2CV6A 3E97A 1VBB1 4RGAA 3NAPB 4XBLA 2MPFA 4BXFA 4A4AA 1TQ5A 4L99A 3H7JA 4HPKB 3A21A 5IVFA 1C1FA 2BGPA 1WZXA 4XF3A 4A44A 1W9TA 3WP5A 2JXAA 3VLBB 4AAXA 3VZMA 4QX8A 5ACA1 4CCNA 5JI7A 4LBKA 2J42A 5FP8A 1SLBA 3O1TA 1RUH1 1UU5A 1UQXA 2ZOEB 5C5TA 2EXJA 4Q4V1 4TXWA 4DUXA 1F31A 3F95A 2D98A 5DDJ1 3VV1A 3ZN6B 1DCSA 4COYA 2GN7A 5EXOA 2OT7A 3WF3A 2ZGKA 1QNYA 4D3WA 5AFEA 4CXYA 5DUUA 3BTAA 2W52A 1UY3A 3VDDB 2QJVA 4UYBA 5KC6A 4O65A 1HXS2 1ND3A 3ES1A 3T3YA 1JU4A 1OVPA 2QQPA 5C8CB 3AXDA 5E8AA 1V6IA 2X5IC 4CUGA 1Q8PA 2JX9A 1V9U2 1WMXA 2ORXA 1CPMA 1A3KA 5KXEA 1NCRB 4JKKA 5IVJA 5HCBA 4K7JA 2VZ1A 4U2AA 1XBFA 4AQ6A 2OZJA 3B93A 3PJQA 1F35A 3OYWB 4JDNA 3UT0A 4EQVA 1PIV3 3K4DA 3BU0A 3S6PA 3WQ7A 1XOYA 3DECA 3PVEA 3LOBA 3M1HA 4DOUA 2VMGA 5L73A 3AVRA 1U5ZA 1FNYA 5F6LB 3UGFA 3NWKA 3DGTA 1RB8G 3GCWA 1D4M1 3K46A 3OBRA 2HWB3 2D5FA 4Y1ZA 4XZPA 2EIGA 1ZRIA 4N53C 4AEMA 5I8SA 4A41A 3BI3A 5BUVA 1PHMA 2UURA 1QIQA 3V0BB 2YHJA 3HPNA 4AVTA 4CEWA 4RS5B 1VBA2 3B69A 4Y22A 1PMJX 1WW7A 4GULA 2WLPA 1RINA 2BGOA 4TZDA 4S2FA 3FJSA 1AYM3 2H0VA 3I2IA 1STMA 5FZOA 4AWDA 1LECA 4QQ2A 3JUUA 1NY71 1GKBA 2B45X 2OXBA 4M00A 4OZOA 5JCTA 1AUYA 3ZSMA 3U1XA 4LITA 1AR73 3WCSA 3BU7A 3VBOB 5LK7B 1SBEA 1J3PA 1FXZA 3LF7A 3H7YA 2VVDA 4OHVA 3W20A 4DUVA 2CDPA 4EJRA 1A34A 3TRSB 4Q1RA 1DDLA 1WLCA 3CKHA 1SLTA 1PVC1 4HK8A 3LSEA 5A7QA 2J7MA 3CJIC 4D7SA 1RUJ1 4XCBA 3CU7A 2ORZA 4Y1YA 3RZZA 1W8TA 3GDBA 1OT5A 2DYCA 1W28A 3WDWA 3GJBA 3EHKA 3J26N 2WR9A 5FCCA 1OURA 3HN1A 4NWWA 3DXUA 1NZCA 3N9MA 5E1RA 1XJAA 5FZ9A 5CFDA 5FZMA 3EBRA 4LBNA 2FDGA 1ENRA 1QJY3 1ZBA2 1H2NA 3L9JT 2NLRA 5FIXA 3J8F2 5F5QA 3T0DA 3MIHA 1JW6A 2BWCA 1PGSA 1QMJA 5T55A 3ZMNA 3ZXLA 4AQSA 2GU9A 2ENRA 1FPN3 4YZ4A 1GSLA 5C8CC 3WNNA 3ITQA 1PO12 1UOGA 2R063 4UFHA 5F3EA 4CCOA 1CONA 3K3NA 3I3EA 5JXIA 2I2SA 4PF1A 5JXGA 1QF3A 1H6YA 1OA2A 4LK7A 3TEWA 5GLTA 1LTEA 1N3PA 1SCRA 5IK8A 3POFA 3AZWA 5F7UA 4KWKA 1DZRA 4PQQA 4XFBA 2QTWB 1AXYA 1MZ5A 3IDCB 2ET1A 3M4FA 4H3WA 1WD4A 3ZPYA 5JSOA 3I2DA 1F2NA 4Q4Y3 3I4IA 4M3CA 3RQ0A 1ULEA 2HEVF 3FWEA 4Z07A 4Q29A 5T5LA 3AB0A 4QX0A 3ZFGC 4IEVA 1ASJ1 5FYUA 4QPWA 4HANA 3JXSA 1W06A 2RHPA 2Q1ZB 4KNCA 3U75A 1V6KA 3PUAA 1NE4A 3WG3A 4NHLA 3WW4A 4BQXA 4DINB 4V2VA 5JXHA 3AZZA 5A3MA 3A0NA 3SH3A 1BBT2 1I1EA 4QAWA 3MHZA 1VB4A 1YI9A 3GF6A 4Y33A 1PIV1 5FREA 2C9AA 4OLLA 3SH5A 3M7AA 2Z5WA 5EIYB 2WA3A 4FFGA 2ATFA 1QJFA 3THPA 4B4QA 1Y7BA 1JYCA 4QQOA 5JMCA 4LO8A 2WBKA 3KHCA 5FZ1A 1G9DA 4JRAA 2JDYA 2Z2SB 4RGGA 2DWRA 3DYOA 4LLOA 3AX4A 1X7NA 2BNMA 4K8FA 3OGSA 4NWVA 4I0WB 5DPNA 3FC0A 4OYUA 4IEQA 2WFF1 2WJSA 5G05L 3AP7A 5A3WA 3BTZA 1W3XA 3ZDSA 3WX5A 2JG8B 1EPZA 4ZXKA 5DDJ2 1T6BX 4RA0A 1V6MA 5GZEA 4JDMA 1ZNPA 4XURA 1KRIA 3THDA 3IDEA 3NVCA 4I3PA 4HSLA 3BN6A 4FPHA 4YGEA 5FRAA 1ACCA 3KV5A 4AFMA 1D4VB 1OC1A 3R4DB 4LE4A 4XHXA 1HXS1 4FPOB 4R8HA 4S2GA 1YEWA 4PIXA 2V73A 3OBAA 1BK1A 3R6SA 3PTYA 4Q0UA 4Y1UA 2ETEA 1YHFA 5F32A 3AMMA 3TEYA 3N36A 3EXUA 4LBJA 1OH3A 1R1ZA 2P6HA 4HETA 4H7MA 4PT6A 3V65A 3MYXA 1GNYA 1YQCA 2XKPA 3USSA 5HXMA 4QPGA 3P3NA 1AJKA 3MLLA 4F83A 2KA3A 4FBFA 3FFZA 4JHTA 5K0UC 1GLHA 3FN9A 5FP7A 3AKTA 4K21A 1ND3B 1JOJA 2NYYA 4PJYA 2DCTA 5BNPB 2IXKA 5FYBA 3KD4A 1AX0A 2XJRA 1XXNA 4JQRA 4LEJA 3RNSA 2HWD2 2XPJA 3E6DA 5IW0A 1RXFA 3BVCA 4IESA 2VZOA 4ZY9A 4EWAA 3HNYM 2GC3A 4AHZA 2GZWA 4KWUA 5A33B 5JZGB 1ZA7A 4JGZC 2OQ6A 4QXKA 3O14A 2Q8OA 3ZKUA 1G7YA 4XCAA 1PMIA 4P9GA 2AREA 3VBHA 4D94A 2BVBA 1H1MA 1W9FA 1SG3A 2PN5A 3VKNA 4Z2AA 1ZRCA 1MZFA 1BCXA 2WIIB 1IKQA 1DG6A 1DYOA 5JSPA 1D2QA 2PFWA 3NL1A 2RS33 5LBFA 2QQIA 1XSRA 5LBBA 2UWBA 4KGQA 1FV2A 3AKSA 4BWOA 2OKXA 1BEV2 4CDXA 1JN2P 1PZ7A 4YW6A 4M3CE 5C70A 4OI2A 2VQAA 3PURA 1SQ4A 3VBUA 3BODA 1TNRA 1RUI3 4CUAA 5BNNC 1K5MB 1UD1A 4DUWA 4LE3A 1AX1A 1S0FA 4IGOA 3KLSA 4K8RB 1T2XA 2Q8CA 3VDCA 3T2TA 1S0GA 4QKDA 3RWKX 1QQP1 3HR9A 1OH4A 5BNNA 1PM7A 3HT2A 3PUHA 4WVZA 4COZA 2W0XA 2EAKA 2P6CA 3H8OA 1PX4A 4EROA 5GLWA 1C28A 1SCSA 1F9KA 4KMQA 3ZR5A 2ZGOA 3GNEA 2YFUA 3GBWA 1DHKB 1L7QA 2CU5A 2JIJA 2YC4A 3K4AA 2AR6A 2E7AA 1VMHA 4LMFA 4QHOA 4LOSA 3FUQA 2GN3A 1O91A 1S0JA 1LOAA 4I09A 2CAVA 4R4ZA 4ZU5A 1KS4A 4AEKA 4E2GA 2VZRA 4AHXA 2NP0A 4IV1A 3GZTB 3VBHB 2NPIA 1AHSA 5ACA3 3M3OA 4UBGA 2E31A 3GBGA 2WABA 4FFIA 1FT9A 2XKOA 1W0PA 3ATGA 4A42A 2VECA 4ASMB 5BNOC 3NW4A 5JPNB 2LRPA 3BOWA 4CEWC 2D3RA 4DB5A 4YZ5A 4FPGA 1H2KA 1ZZBA 1W9SA 3AYDA 2HWE1 3DPRA 4R52A 3HIFA 2VW2A 3ASIA 3I49A 4XYXA 3PVNA 1IGOA 2A70A 2BQPA 4AAPA 1CGPA 2Y6JA 3RZJA 1WCQA 1W90A 4A7KA 2TNFA 1NCQC 2HJIA 2ZS6B 1JYNA 4IL7A 4QXHA 4UF0A 1HQLA 2DF7A 4FP2A 4OMCA 4A2UA 1XNTA 5FZIA 1VRH1 5T52A 3WNXA 2G9FA 2ZJCA 3MV11 2QUOA 3VBHC 1K5JA 1UOJA 4JGYA 4XTPA 1O4YA 3QD6A 4AFCA 5J09A 5LA1A 2F4LA 4A45A 1ONAA 1TE1B 1E5IA 4GWIA 3IT8A 3B9CA 4Q27A 3O1MA 2X09A 5KHJA 4CCKA 3KQ4B 2WDBA 1GP4A 2PELA 1DIWA 2GNMA 1XQNA 4IEZA 2RVAA 2JB8A 4WVMA 5A1LA 3OGJA 1DQ2A 4K1YA 1NLQA 5BYNA 1HQNA 3BB6A 4CXWA 1PMHX 3C3VA 2XMLA 1A78A 4N7UA 1MS0A 1VAVA 2AZ5A 2O8OA 4RR3C 5A7SA 3V64A 4B7EA 4IE7A 5FYCA 1W8NA 3WW3A 1QOOA 1B09A 1S0BA 2QQNA 3PUQA 2VG9A 2XL9A 2RDNA 2D40A 3EQEA 4MO3M 2OQ7A 3MFCA 1PZ8A 2WINB 2HWC3 1OBNA 3KV6A 2JDUA 5FYIA 5AC92 2RS11 3ACHA 4WZFA 2D6LX 4UAPA 3VDDC 3ZXKA 3VHNA 1C3HA 2RS13 4Z82A 3PIGA 2XJVA 5F39A 4V1PA 3K77A 4QXCA 4GA9A 3WD5A 4EYUA 3T4VA 4Q4X2 3LSDA 1O3SA 2VPVA 5FZ3A 5JI9A 1HRV2 2ZGRA 3BTYA 3OYWA 1ZM1A 4UFIA 2WZPP 4NIIA 2ZEZA 1RUOA 3CJXA 1US2A 5KWRA 4NO4A 4XXPA 1QJX1 2XGXA 3WOGA 2VZUA 3NNJA 3QOPA 1HV0A 3QH7A 3GXUA 2ARAA 3ZIXA 2FZ1A 1UPSA 4LO4B 1GNZA 3FE5A 4IEXA 2EVXA 2JE8A 3NV4A 1UZYA 2W1SA 5T54A 2TUNA 3RS6A 2D6OX 3WLUA 3OTFA 1NUKA 2JKBA 3CNAA 1MS4A 1DGLA 2YB7A 3A0KA 2QQWA 3O0VA 3PMEA 3U14A 1YFUA 2JIGA 1MQTB 1PVC2 3OF1A 4MVTA 4RL7A 5FYHA 2WT2A 3UESA 5FPXA 1CD3G 2UYBA 2PLV1 3T30A 3UKVA 4QX7A 1IS3A 4FO9A 3H42B 3IAPA 3DN7A 4IE5A 4MGIE 1RUD2 3ZFGA 4B4PA 3ZSLA 1ZA4A 1SZBA 4LBQD 2JB4A 1HKDA 1DFQA 2R0FA 3BUCA 2VUCA 4QX3A 3UJQA 2WFF2 1GZCA 2A6VA 3POEA 4XUPA 4GAZA 5FBJA 4BU2A 2G9ZA 4OUSA 4B29A 3UL2A 3OGVA 4HKWA 1DLLA 3M3EA 4NR1A 3ZN6A 2VOKA 4B1MA 4H2AA 1MEC3 4IE6A 4OUMA 1RUG2 5H9SA 4QPIC 1J83A 3A22A 5A6YA 2AUYA 4YW5A 3KGZA 3VKFC 4YFZA 1HJFA 1VAKA 1VRBA 1XYNA 1UCXA 2JDZA 2OA2A 1RITA 3ACIA 4HOOA 3FFQA 4UT5A 1A8MA 4CDXB 2XBO3 3AL6A 2E53A 3AKPA 5B4XA 1GQHA 5JMOA 3BTXA 1US3A 2DVGA 4YVSC 4BQWA 1YC61 4JVAA 4M4RA 2YUEA 1UIKA 3NJZA 3RMXA 4E8DA 3OUJA 1JTZX 2BDRA 2PHDA 4QPGB 3RYKA 4YW2A 4AGVA 1JMUB 4XHBA 3ALQA 3T1MA 2QQLA 1WCKA 3IM0A 3JU9A 3OGRA 2A3WA 2GH8A 2WQZC 4XJZA 2ZCWA 4CCMA 3M3CA 1NLRA 1X8EA 2GDFA 2QZ3A 2W87A 3J4UH 1VBB3 2DUPA 1N1SA 3IB3A 3APBA 3A4UA 4QPIB 1SFNA 2XVKA 1XSQA 3M70A 4H55A 1V6OA 1CIWA 2QZ2A 2TBVA 1IHMA 1AYN2 2HWE3 5FZHA 1H4GA 4YVWB 4OFGA 2GP3A 1OXCA 4O7XA 4Y20A 2VO5A 4Q5OA 1VBE3 3DL3A 1BXHA 1QH7A 3OCPA 4DEVA 3WDUA 5BXXA 3M3QA 1APNA 1POV3 2OIIA 2XVGA 5DAWA 4NIHA 1CAXB 1RUF3 2JD9A 4TLFA 2MNGA 2DTWA 3JD71 5FPVA 4QQHA 1RMU2 1MZ6A 2WWUA 5FY9A 5JOXA 2XBO1 1R64A 5IYYA 1SPPB 2VOXA 3HWJA 2A75A 1RMU3 3VBSC 5LRRA 3ZXFA 3IIIA 2VNOA 3Q9OA 1CAWB 1U0AA 4Q8KA 1JYXA 1GICA 4IXLA 5C8WA 1QXRA 4YW1A 4AVCA 5C71A 3FHIB 1F4HA 3N35A 2WNEA 3EJKA 1V9U3 1KGYA 1NXD1 3FLPA 3Q8BA 1COV1 5FY7A 5LWBA 1AR63 1K5MA 3WZ1A 4I01A 1G9BA 4FPKA 2OVUA 4FTBA 2QQMA 3AC0A 3ZYHA 1MS8A 2B39A 4SBVA 4AK3A 2IXHA 5F3IA 2VNGA 2VQTA 2BOJA 3KF5A 4FPFA 4QPIA 3R4UA 4KBZA 4ZPIA 3WP4A 3N9PA 3TEXA 4IGQA 1QXPA 2Y8KA 4CDXC 4ARYA 2ZACA 5FXZA 3JD72 3PU8A 5L36A 3EMRA 4CP0A 2VQ0A 4JCKA 1OSGA 3FLTA 3VBUC 4RD7A 3EYPA 3M8LA 3JB4C 1ZZ8A 3S7EA 2HWC2 2RV9A 1HJGA 5AC93 3GHNA 4GMP0 4KH9A 2QCSB 3TB0A 1XE0A 3AZVA 2IXLA 3WG2A 1OMIA 3B00A 4Y5TA 1UOBA 1Q43A 2VW1A 3ZM8A 1V00A 2CDOA 3T0BA 2O1QA 1UY1A 1K45A 4LOTA 4HK9A 4M3CB 4MGZE 1AR72 2VGDA 1LU2A 4GB33 5DABA 3J7HA 4AI3A 4B3NA 4IV3B 3WQBA 4HN0A 2FDKA 1ODNA 1CAWA 1W6QA 5HI0A 2VXRA 3OPZA 3PTRB 2C0ZA 3SISA 5BNPA 2BPA2 3ZFEA 2RDRA 1VP6A 2D6MA 5DG2A 4QGMA 4ZS2A 2A3XA 2MEV3 4EN9B 2BNNA 4RHV3 3PVOA 5C8CA 4YZ1A 5FOBB 1NA1A 4J6GA 3RZHA 1UY4A 1UYPA 1NX9A 2OUJA 4GXLA 4QQPA 1J3RA 3MF9A 3WT3A 3S7IA 3O1PA 1VRH3 1IQAA 2RDSA 1HRI1 3IKWA 4JGYC 2E32A 2VCAA 1LHNA 1UKGA 3I59A 5CA6A 2C6SA 4KI5M 2KXLA 1VRH2 2QNKA 3URFA 5K0UA 5G04L 4BQ5A 1LOFC 4EZ4A 4MZUA 1PVC3 4FOVA 4AI2A 4JRLA 2GALA 4HKLA 2VUJA 2B4KA 3SCFA 3DYPA 2VUAA 1U12A 2IWGB 3BALA 4XQWA 1IG0A 2ZKLA 1PIV2 1SBDA 2SLIA 3KVBA 4M0NA 1C5IA 4HPKA 2XXZA 1AR71 4Z8BA 3O1RA 2WFPA 5A3PA 1CX4A 2WZR3 5K8SA 3WXPA 1S1AA 1TMF2 3WNLA 3FBYA 1S4CA 1KJLA 2WWJA 2G19A 5FLIA 4PBOA 2P17A 5IATA 4AEDA 5J48A 5F2WA 1POV0 2E26A 4ZS3A 1W0OA 3NNLA 2ZGSA 1H30A 3WR0A 2ILMA 1QJY1 2X53S 4CZSA 5L7OB 1NAEA 3RI8A 4DRVA 1JYVA 4J1WA 2Y38A 3ZMOA 1TEIA 3ES4A 1A8DA 1D4M3 2YPJA 3KVAA 4Q0VA 1WCDJ 1CVNA 1Y43B 3TOJA 2GC0A 1AYM2 3LPGA 4LHSA 4COUA 4QGLA 3TEZA 2HLEA 2Q8DA 1J58A 1JU3A 2D7FA 2GC1A 2V4AA 2C24A 5FZDA 3FX3A 4RQPC 1BBT3 4ATFA 4BHPA 3CMGA 2EF6A 2BW8A 2GC2A 3D3AA 3I59B 4XZUG 3ZXJA 2DBIA 1QJU3 3LDBA 3POWA 4MHRA 5DAPA 2B42B 1FAYA 3JBG2 4OQ8A 2VW0A 3J7NA 2JDKA 2ZMNA 5AVAA 1AYN1 5LY2A 5JAXA 4GWJA 3U11A 3G7DA 5CFDB 4TTGA 5F2SA 5I8YA 4UW6A 4YW3A 1UOFA 3JBG3 3NKGA 5FY1A 4MGTA 2ZKNA 4QKFA 1FYUA 1PO21 2D93A 1ASJ3 1FX5A 3VDAA 4E2QA 2E63A 1GP6A 3D82A 4LULA 5J7MA 5F8PA 1FI2A 1N47A 1VLNA 2KM2A 1QJY2 1ZBA3 1RMU1 2QE3A 4LIVA 2VAUA 2A1XA 1XNCA 1SMVA 1P8JA 4YZ3A 5DAVA 4UFJA 5ERLA 4CEWB 2V5YA 1V6LA 4PIZA 4HXCA 3WDVA 4QXBA 2PHUA 5GKAC 5A70A 1IS5A 5FZBA 1KXGA 1X8MA 1XNKA 2DU0A 2ZGTA 4YVWA 4BDVB 1F5FA 1QXJA 4XBQA 1JYWA 1REEA 1LOCA 4DS0A 1A6CA 1LRHA 2XDVA 1NOVA 1POQA 1YIPA 4LKFA 1Z7S1 4V2WA 4CU6A 2B46X 1Q8VA 1REFA 3DEMA 2VTFA 2EXKA 4FPLA 4XIOA 3BKZA 1DU3D 2A71A 5F5IA 1QDOA 2DFCA 4D0QA 1EV11 3WDYA 4MHUA 5LK5A 5D8AC 3OY8A 3PNAA 2BEOA 1LHWA 1I6XA 1W8UA 2N7GA 2DCJA 3C7FA 2RMU1 4RGKA 4Q4Y1 3MICA 2F17A 3O0XA 1GZTA 1UY2A 1YUDA 4LO5B 3LCPA 3GZUC 4LJHA 5E6HA 4Y26A 3WNOA 4DY5A 1RUNA 2XONA 4NIDA 3ZYPA 2WNVA 3GJAA 1ZRRA 1V6NA 1IZ3A 5D2AA 5AVPA 1BYHA 1Q8SA 1HLCA 1RTVA 3ZO0B 3BIEA 4QM8A 3WF2A 1SLIA 4EN8B 2PAEA 5L9RA 1AR61 1PX3A 2OW4A 4NPLA 5C3QA 2CGPA 3WUCA 3E6BA 4ASKA 1O3RA 2J22A 2I45A 1BMV1 2VZQA 2JKXA 5KHGA 4S2DA 1PK6C 4AHWA 3FLRA 3ZXEA 3FHAA 2C5DA 3ACLA 4FAHA 4P00B 3LA3A 2XVLA 3VKOA 2R1DA 1LOBA 2YBSA 3POGA 4XILA 5FYTA 4AFAA 1HRI3 2W47A 3B5LB 2KR2A 1H1AA 1QH6A 1WMDA 4NMIA 3T09A 1ND2C 3H1MA 4JGZA 5LY1A 4UWDA 1ENQA 2CYFA 4Q0QA 1KEXA 5IJRA 3VKLA 4BQ3A 1GYKA 4LBOA 1S2KA 3DCQA 1HX6A 4K6BA 4Q2FA 3VHOA 2A73B 3KT7A 1V70A 3ZSEA 5B4NA 5KHHA 4IE0A 3GCXA 1OUSA 2ZBJA 2QDRA 1Y4WA 2K46A 1QWRA 1HW5A 2XL7A 3CF6E 3J7LA 3K2OA 4L11A 1MQTC 2PHRA 3AZYA 4W6YA 4YRDA 5F3GA 5F1RA 4QKNA 3AZXA 1AR81 4JGZB 4E4DX 3W59A 2XLGA 3LDRA 2R7EB 4A6SA 4HMZA 2DCZA 4XACA 4NJ4A 5FUIA 1O59A 4DXZA 1YWKA 4DZGA 5LASA 2FMDA 4QPYA 2CTVA 2KD7A 4QDSA 4WM7A 1YYNA 3THTA 2D6PA 2D44A 2VE1A 3BIWE 4XABA 3USUB 1VBA1 1POV1 3U78A 4Q4W2 1LKNA 1C8M1 1GOHA 2AACA 4UW4A 1UMZA 1PGL2 2BUKA 1RHI2 5JR7B 4PIYA 3H8XA 5CBLA 5EP9A 2JG8A 2J1UA 3MLJA 3GHMA 4P9LA 2HYKA 1K5MC 1S55A 1TME3 1WW4A 3MO4A 1OPMA 4TSVA 4Y4YA 3I3MA 3N7MA 3Q8AA 4L9BA 4AL9A 3S57A 3LFIA 2XHNA 3WW1A 2DVAA 1BVP1 4QHZA 1VBA3 1LOGA 1WLTA 4IETA 4P9WA 3ZYJB 2ZX0A 4XAEA 2CHHA 2UY8A 4BK4A 1FV3A 2J1EA 1DGRA 2AH2A 2Y6KA 1OQ1A 4QPGC 2FBEA 4XVHA 2AGSA 4OQ9A 1QJU2 4XEZA 5KXCA 1OPOA 1TG7A 2VCBA 1XNDA 4G9SB 4WVVA 1ZZCA 1FMD1 5FPZA 4BQ1A 2DVDA 4DXSA 3IMMA 2RR12 1LCLA 1OQEA 2PQQA 2X5IB 1UZVA 4LUMA 5IVCA 2QKDA 5FO7B 2R041 3WCRA 2BNOA 2WZR1 4XF1A 5CG9A 2NZ9A 1XNAA 2F6BA 1RVF1 1XPWA 3C8XA 3IZOA 1OFSA 3ACGA 3CDZB 2Q8EA 1EP0A 2WT1A 4QX5A 3I7DA 1ZYBA 1NT0A 1UAIA 5DG1A 3K48A 4EWEA 2HEWF 2WNUB 1AL0G 4HG6B 1JBCA 5T50A 4DO0A 4P14A 4QT6A 4IDZA 4YG3A 3BPZA 3HQRA 2UY9A 1BHGA 4GQ7A 5FMOS 4D8MA 1K12A 5FYSA 3HJRA 1NQJA 2P2KA 4OI4A 4AR2A 3G6JB 3H0OA 4E8CA 2X8KA 3E5QA 4Q4V2 3RGBA 2GMPA 5CKQA 4CP2A 1NZIA 5C9AC 4C1WA 3MFAA 1JS9A 1RIRA 3N9OA 4MLOA 2YGMA 1RC6A 5FMOL 5A3TA 1F4AA 4RHV1 3UETA 4B1LA 4I02A 1CAUA 3OB8A 3CZJA 3LOIA 2HWC1 1XE7A 3IPVA 1COV2 5FYMA 3PJYA 4BXSV 1GANA 1OLRA 4O61A 4I3GA 3OD4A 2OPWA 3KT4A 4GB31 3WNPA 4UI9L 1JZ8A 1U5YA 3JCIA 3RSJA 1COV3 1DF0A 2RJ2A 3RYRA 3S5AA 5FP3A 2WAOA 4ET7A 1MACA 5LA0A 1GZWA 1AYM1 4GMP1 4YM0A 2PHXA 3SXWA 1W39A 2R16A 2YY1A 3WW2A 4XUTA 4P9XA 2FCTA 5IHRA 1DQ1A 1S2EA 3Q8CA 4CCLA 1ENXA 3QBQA 3OEBA 2BOIA 5GJ6A 2XJQA 1GOGA 4IUGA 2WS91 3AXEA 4MXWB 4FPYA 4BA6A 1AZDA 1CR7A 1R1A2 3TN93 1ZBE2 3LIHA 1YQ2A 4LBQB 4OI1A 4FFHA 2BVVA 2JENA 1WGPA 2FCVA 3KGLA 4WZCA 5TSWA 1L7LA 3ACFA 4FCAA 5J37A 3LEGA 2BU9A 1GFF2 1LGNA 2DTYA 2GP5A 3SEPA 4N9HA 5J98B 1KQRA 3KV9A 2XWJB 2HBTA 2AEZA 3MW2A 4GJZA 4JDOA 5FXWA 1O8SA 2IFWA 4AYUA 3H3LA 4YZ2A 1H2LA 3IBMA 2ERFA 3ENRA 4MV2A 2RS31 5IVVA 4FPJA 1GNHA 1H2MA 2R073 1NCQB 1FNZA 1O5UA 4ZHNA 1NA1B 3KSCA 4CCDA 4N7IA 3AKRA 2WO2A 3MGUA 4FOYA 2WRAA 3DPRC 1KFUL 4FPCA 1SPPA 1Y3TA 1J3QA 1R092 4CCEA 3ZFFC 4EN6B 5A3UA 2X29A 1YFXA 3IN9A 4M01A 3K51A 5GM0A 1IPKA 1TMF1 3SLIA 3ZIWA 1X9PA 2ZX1A 4XFGA 4BQYA 3VDBA 3MV01 2RMU2 3D0JA 1QJX3 3NNGA 5A3OA 3WNKA 2P3JA 5DQ0A 2ZMLA 3ZFEC 1OUXA 3RPQA 1DBNA 2WN2A 1FOD3 1RUC1 1BQPA 2VMIA 3N7JA 5FV3A 1QJZA 2DDUA 1ZX5A 2XUMA 3NSTA 1NCRC 3VD7A 3OY8B 5IUQA 4BIFA 1VBD3 4S2HA 4ATEA 1S0CA 2LS6A 2JG9C 4Q0PA 5CFCA 2PHFA 4LBQA 3EB7A 1GV9A 3O1UA 2ZX4A 2AEYA 1Q5OA 3LWCA 5DUVA 4EZHA 4Q4W3 2WNVB 2HWB2 1AL22 1ULOA 1OKQA 4AI0A 5FXXA 1AR93 4MSVA 3HNMA 1QQP3 2Y6HA 3POSA 4L2NA 5J96B 1MVEA 2YBKA 4LA3A 3S0MA 4OUEA 1JHJA 1RUG1 1I5ZA 1JXNA 5CKMA 5EYXA 2VBBA 3NJVA 1RUF2 2VBPA 3USUA 2I74A 1SBFA 2YG0A 4BZ4A 4E4ZA 4CEYB 3LB9A 1OVSA 5FZEA 1RUE2 1XRUA 3AP4A 3RJRA 1AJOA 1Q8QA 1BEV3 2YXSA 3I2GA 4MX3A 3ZVXA 1JZ3A 4D6QA 3M3IA 2HBUA 5C9AB 3C2UA 4C90A 5CYYA 1RJ8A 3GZEA 1Y9MA 3AK0A 3KF3A 5F9TA 2RDQA 3B01A 4D7YA 2P37A 1MEC1 5JLVA 1PNFA 1DQ5A 3LFMA 5HCFA 1W8ZA 2BFUS 5LCWL 3BYWA 4YG6A 3MW4A 1HB2A 3ZSJA 3S30A 5JXJA 2P1BA 4L97A 2VVFA 2BJSA 3LE0A 5FLHA 1X33A 1IQDC 1OOPB 4LHKA 4LNVA 5JR2A 3U4SA 1DQ4A 5C4WB 1H1IA 1QEXA 2O0OA 2ZABA 2CL2A 5E88A 4DXRA 1MQTA 3VBUB 4HVRA 4Y1VA 5FPLA 4EWDA 5HV0A 5HXVA 5D1IA 5DAQA 1O4TA 1UXXX 2YMZA 1AVBA 5L9BA 3INAA 1LNSA 5FMCA 4IE4A 4NIGA 3PLQA 1I9RA 3TWIA 1UU6A 1JZ7A 1EAH1 5IK4A 2OPKA 1AR82 4CDWB 4Z2WA 3E5XA 4N43B 3E5UA 4TYSA 4WM7C 4JX0A 2Q4SA 3WHUA 5JDBA 4CSWA 1GUIA 2ZGPA 3I3QA 2YC0A 4BJ0A 2HWE2 3WHTA 3JZVA 5I8TA 2Q0AA 4DEQA 1QNWA 1WW5A 4B7KA 2XJTA 4GB32 4LQRA 3ZPOA 2GNDA 2JG9A 1H9PA 4TWTA 1CAUB 2W39A 2G1MA 5IFTA 4KL1A 1ALYA 1LEMA 1N1TA 5A32B 1VBC1 2Q30A 2WZ8A 3DF0A 2MEV2 2YZ4A 3AFGA 3ILRA 4XFIA 4CP9A 2A7AA 2CWMA 2EIBA 2XUEA 4O9EA 2W1QA 3VD5A 4LO6B 1UMIA 1IPJA 2PQSA 5GLUA 2ARBA 3I97A 3B9IA 4YVSA 3JQWA 4BLJA 4HFSA 2A6YA 2XJSA 3I54A 4KWLA 4KU7A 1UPIA 2FQPA 3H3UA 3T4HB 1JZ4A 5A7PA 1XB9A 3SNMA 1IOAA 1W99A 2HWD1 3Q8EA 4JKLA 1WLDA 2PLV2 2VH9A 5FMDA 5DUXA 5A7WB 5A6ZA 1W6NB 3CJIA 4LBLA 4L92A 5DUWA 1R1A3 1AR62 4MOAA 3ZXGA 1NXMA 4FQZA 5FQ0B 3SH4A 1UU4A 3UJOA 3DKWA 1WBLA 2ADEA 1YQ5A 2ZGLA 2R071 3JB8A 5A80A 4BQ4A 1BVVA 2DVBA 5FYZA 5F37A 1LEDA 1DQ0A 3OOXA 5L9VA 3FBMA 1PGW2 1YRZA 4CPBD 2E9QA 1RXGA 2WZR2 1XYOA 2IXCA 4LO7A 1RVF3 3CQOA 4AI9A 2RS53 4EN7B 5I0RA 3GZAA 1W6NA 1Z78A 2GNTA 5E89A 5L7OC 1WW6A 2MEV1 1OF4A 5K4LA 1B35C 5JWPA 2RS52 1OOPC 4NAMA 3C7HA 4Q26A 1HB1A 2RJLA 2H0BA 1LODA 5BNOB 1NG0A 4KGGA 1W6QB 1RUG3 3TNQA 3WP3A 5FY0A 4CP9B 1SLAA 3PUSA 3KQRA 1YFYA 4AXOA 4K40A 5FP9A 5FDBA 1QJX2 4IQPA 2BTVC 3CEWA 2JWPA 2BBVA 1OLQA 4P5HA 4YGDA 4E4SA 4RSUA 4NRPA 4QDRA 3B7MA 5AC91 2OYZA 3V0AB 3RVHA 1H8TA 3H8UA 4N43C 3NKTA 3LA2A 3VL8A 4BM8A 2XLFA 5K9YA 3VHRA 5LZ6A 5FXVA 4OMDA 3NV3A 2JDNA 2WNOA 4AEDC 1MZEA 1XU2A 1CWPA 3ZN5A 2JJ6A 3R0RA 3QLQA 5GALA 1B35B 5GLVA 1GR3A 5IFPA 1F5JA 2WO3A 1GMMA 1RUI1 2NM1A 2QQOA 3ILNA 4PDWC 4Q8LA 2LUWA 4GWNA 3IIAA 3TYJA 2C1FA 1VBB2 4ISRA 4K3UA 5FWEA 5C9AA 2HWF1 2QQJA 4AHYA 4WM8C 5ANQA 2DCKA 2B9UA 1R083 4HN1A 1FMD2 2BGCA 3ETPA 3LA7A 5FZFA 1G9CA 3ZYBA 3ETQA 3PHMA 2FMYA 4AF9A 1BLZA 4AOCA 1ZREA 2EA7A 1ULFA 3VBRC 4KG8A 2ADDA 3NO8A 4XF9A 1UNBA 4CEYA 5IWFA 4AEDB 2ZHLA 1RUE3 2ZTNA 4MGQA 1W2OA 5EQUA 4CUBA 1MS9A 3I2JA 4I0AA 4OVEA 4ZZ5A 5CIRA 4RYDA 4R9DA 5FY4A 2IXIA 5FK7A 4MH0E 3VUOA 4DPNA 1X36A 3LQCA 4YGBA 1OKOA 2DVFA 5EZWA 2XR4A 4UOJA 5EJ1B 1PNGA 3R4SA 4YW7A 1BJQA 2Q1FA 3V0AA 1E5HA 1RUI2 1JZ6A 4FAGA 2EXIA 4PCRA 4QU1A 1QHDA 1HQWA 2V5DA 4IW3A 2DBNA 1W6PA 1AX2A 3AYCA 3WDXA 2X10A 2JECA 5F5AA 1N1VA 3VBFC 3VBRB 3QCWA 3ZYFA 3HT1A 3MZHA 5A3NA 4Q0SA 3D5OA 1MS5A 4W8JA 3ZX7A 1QKQA 2CWSA 3LEKA 2CNAA 1UZZA 3KCCA 4J25A 4LK6A 2ZAAA 3LIGA 4PLMA 2CAUA 3AMNA 4OHWA 2WT0A 3J7MA 1GU3A 3UGHA 1Q56A 3WV6A 4BOWA 4LKEA 3KV4A 3KS7A 5A1AA 1GWLA 4Y4RA 4C0BA 1RUC2 1Q3EA 1SDWA 4YW4A 4XF0A 1LU1A 5BY5A 5CFCB 1W2UA 2OUHA 2QQKA 3EO6A 1MPXA 2VL4A 1ULDA 2W92A 1OHFA 1UXZA 3IWZA 2JEMA 2XH6A 5FUPA 2VMFA 4N53B 3O12A 4NHMA 4XIKA 4C8DA 5FZAA 2DUQA 4JQTA 3FL7A 3CZUA 1QJEA 1PO23 2Q5TA 2OX0A 4RQPB 3AL5A 4W6XA 3MW3A 2VY0A 4WVWA 5HV4A 1DQ6A 5H9RA 1CJPA 1SHWB 1W05A 5A3LA 4R4XA 4WBBA 1U5IA 3JQXA 5JOZA 1ZRDA 3OSDA 5EFUA 1UYXA 2P4EA 2HKXA 1RUJ3 1O5LA 2ZGQA 4D69A 2W08A 3LZZA 1TNFA 1W9WA 2JDPA 4N8MA 1WLWA 4LHNA 4FTEA 5FZ0A 4F7ZA 3VB9A 4F8AA 5L7OA 1ODMA 5JSRA 3SEEA 4LKDA 3ORJA 1EUUA 1SLLA 2WQ4A 2XLAA 1BZWA 4LLFA 2JDAA 1HDKA 2C9KA 2VU9A 2B8MA 4MADA 3RZLA 3AMPA 2K9ZA 3O0WA 3CJIB 2UWCA 2WS92 2ZZJA 3LDKA 4HZFA 3LAGA 3L2HA 2WS93 3P3PA 3SC7X 1ULPA 2V72A 2G9GA 2PAMA 4XDOA 2ZA9A 1OA4A 4XBNA 3VKMA 3ZR6A 4JAAA 4Z1VA 3MPBA 4HT1T 2PHTA 4Q1PA 4UXAA 1JZ5A 4QX1A 3I2OA 1NLSA 3HNBM 3PUIA 3OBTA 2ZZQA 3ZOIA 4RS5A 4XJ9A 3ILFA 5FZLA 4D7TA 3GM8A 4GMP3 3ABZA 3D0SA 4YM2A 2W2IA 2C26A 1OQDA 3O7OA 1JYIA 4IGPA 1N1YA 3HQUA 4G4FA 3N9LA 4XFHA 3ZYIB 3PMSA 1LOEA 2R061 1PVXA 1R081 2JDMA 1C5HA 4P02B 1BEV1 2RE9A 1LGBA 1UMHA 1YJKA 2VCMA 4YVWC 2HWF3 1WCSA 5BNOA 3DXTA 2IZWA 4OCTA 4UFMA 4HL0A 2WQ8A 2Y6FA 4NAOA 3MIDA 1CESA 1D4M2 1YO8A 4XAAA 2A6ZA 2GAUA 1UY0A 3ROUA 1UF2C 2W1UA 1BBT1 2Y6LA 5CEHA 2LALA 3IPVB 1GOFA 1G8WA 2B7YA 2CY6A 1CZVA 3IDAA 4XMAA 3IAQA 1J59A 3N9NA 2HH9A 4X6RB 1HRI2 3T2PA 2Z69A 3SCHA 4Y5Z0 3KCYA 4I2OA 2AC1A 1SLCA 1WBFA 4XTMA 5A7OA 2FDFA 3N9QA 5T5JA 3RYPA 4UF0B 2P34A 1DGWX 5BV6A 2RG4A 5EV7A 2QFEA 4P9JA 2OS2A 5FKBA 5LA2A 1VBC3 1DGRN 4COVA 5K7PA 4YM3A 3RI9A 1WMEA 4K1ZA 4QGNA 1O6UA 1ULGA 2WYFA 4YARA 3LEMA 2XQXA 3K75B 4MXVA 2ZGMA 3RJ2X 3O5SA 1W2AX 4A3XA 1D0HA 4COWA 3W5MA 2LROA 3RZMA 5FQ0A 2ARXA 2R1BA 3I2KA 4XJAA 4DXTA 5FYVA 4XUNA 2BBAA 2WFF3 3ON7A 4XJUA 4C91A 3GGLA 2FDHA 1W6OB 4XETA 3J8F3 5BNQA 1ENSA 3U4XA 3KZ4C 4UFLA 1JHNA 2W91A 1R1A1 1W8FA 5C6CA 3FZ3A 2BZDA 3OGGA 3T2OA 1FPN2 3WF1A 1LHVA 1RHI3 4IV3A 3RRDA 1TME1 5KHKA 4ZU4A 3NJXA 3ZDVA 4IV3C 3MF6A 3SCGA 5J3UA 1KJRA 1W8WA 5IT6A 1L3JA 5FMBA 2ET7A 1JUIA 3HVDA 3MDPA 4YLZA 4ZONA 3J9SA 5C3SA 2CGOA 2P3KA 1MS3A 5C3PA 4ORFA 1PM4A 4RN5A 4A3ZA 2X5IA 3M2MA 3PL0A 3N7KA 4CDUA 3VZJA 4C1XA 3VBRA 1IKPA 5EYYA 1F15A 4XMIA 1ND3C 5T5PA 2FHRA 2YFZA 2WNUC 2WKKA 3SMHA 5M0TA 4JGYB 2O8QA 2PMWB 4LXLA 1JH5A 3KHBA 4QD2A 3UGGA 3NNMA 1ULCA 2RR13 4BMEA 1BMV2 3H3ZA 1URXA 4WM7B 2XHKA 5HBAA 2EAAA 1WD3A 2H6BA 3NV1A 4L8QA 1FPN1 3PU3A 3T0AA 1JODA 3UK9A 2ZAHA 4AI8A 4ARXA 1GQGA 1VBE1 2LM3A 2VCCA 2ZX3A 4Y3OA 5FUNA 2BV4A 4WVMB 3X29B 2ZX2A 5A32A 1UN1A 2E7QA 1I3HA 3QH6A 4GKXA 1NYWA 5FYYA 4XFCA 4YM1A 5FFOC 1E5RA 1SACA 4OULA 4CDQA 4HLTA 4CVUA 1YQ8A 4XE9A 4PF5A 1SEFA 3ZFFB 4MGSA 3ME2A 4BE3A 5JOYA 1CAXA 1C8M3 4M3CF 1NY72 1CAVB 2W3JA 4N53A 2D3PA 1YXWA 2VBDA 4FI9A 5IAXA 5JIAA 3S5QA 1PO13 2R062 1C8M2 3F2ZA 3K3OA 1UIJA 3J8F1 1EYBA 2ZHKA 5DAXA 3W21A 3WQ0A 5DN2A 4CDWA 3UNPA 3VBOA 1IS6A 3OBZA 1EV12 2YC2A 3POIA 3CLPA 5AFBA 5DZFA 3RFRA 2C4XA 2VXJA 4NHYA 4QWNA 4CU9A 5FZOB 4GH4B 1SDDB 4W4ZA 3T2QA 4GZ9A 4CDUB 1V6JA 1Z7S2 2JG9B 2YPDA 4QX2A 4DRRA 4PQ9A 5CAZA 1WA6X 1RUH2 4RFT0 1W6PB 3AKQA 1VE0A 1OFNA 5FLJA 1IPSA 3AP5A 3KCXA 3OEAA 2R49A 4DFSA 3MIBA 5KHIA 1PZ9A 1QJU1 2B9VA 5T3NA 4I0BA 4E9KA 3C7EA 2W5FA 3ZXAC 5CFDC 3PVBB 4DY3A 1PGL1 4E2SA 4ZKTB 2NQYA 3HEIA 5LA9A 3D8CA 5C33A 1AR92 5EJ3A 3A23A 4R9BA 5LW9A 1EUTA 2A3YA 1PO11 1E5SA 1NA1C 2VMEA 1G6NA 4GALA 1CJDA 5LATA 4CXXA 2HWD3 3PDQA 3TN92 4BB3A 4XDPA 2FCUA 4W50A 4CDUC 4EN0A 2W94A 1UZWA 2W95A 3H9AA 4QM9A 4A6OA 1YLLA 2ZPXA 4UW5A 1HN1A 4NOTA 1UKRA 1QU0A 1VALA 4X8PA 1ZRFA 1F8VA 4G3YC 5H9PA 3VD3A 5EWSA 2EIEA 3ST7A 5DZGA 1WMFA 3NV2A 4ZZ8A 5FOJB 2Y34A 3Q8FA 5FWJA 5JIUA 3MUZ1 1LHUA 2W9XA 2FZ2A 1C1LA 1C4RA 2XWBB 2EALA 3MPPG 3WINE 5KBFA 4M4PA 4RQPA 1U5XA 2JE9A 2Y6GA 3W58A 4I30A 4XQDA 2E7TA 2WO1A 3P6BA 4PDWB 5DMYA 4Z92B 4RS5C 5A6XA 4N90A 2X05A 4DMIA 1UW8A 1K3IA 3MEPA 1VB2A 2RMU3 4CCCA 4AFDA 2D5HA 2WSUA 2LW8A 3RZKA 1JYTA 1RYYA 4FQ4A 1LENA 1VBC2 3HBZA 3CBNA 5FP4A 3RDIA 4JKMA 1LULA 2HWB1 4IEPA 3GBFA 5APAA 3WDTA 4FTSA 3ZYRA 2PAKA 2VZTA 4F3JA 5FTTC 1GZWB 1G9AA 1YJLA 2IXJA 3BOPA 3FMGA 5CISA 5JUVA 4OHYA 1W6MA 2QQVA 2VOVA 1QDCA 3GYDA 3POYA 3VL9A 1RHI1 2ZEYA 3T08A 3D6EA 3E1F1 1WWYA 5ACA2 3B02A 3UV9A 1S2BA 2XJPA 2VC9A 3DPRB 3O1OA 1IG3A 4AI1A 5KXDA 1CPNA 5FY5A
chains in the Genus database with same CATH topology
1AL23 2D3SA 3MIEA 4Y1XA 3LKJA 3H50A 4Q4X1 1PK6B 1RL3A 2K2SA 1DZQA 3AMHA 1ZBA1 4WV8A 4NPRA 1S0IA 4JTNA 4OHXA 1WA4A 4URTA 3ZFEB 1FATA 1WUVA 3VBFB 2JG8C 3ZN4A 4FXGB 2OZ6A 4ASLA 3AYAA 4AGRA 2RS51 4CYDA 5C4WC 1YCIA 4XFFA 4W6WA 2XG3A 3BCWA 3N7LA 1XYPA 2Z42A 1H8VA 3ZSKA 1LGCA 4CDWC 2DURA 2WNVC 4IERA 3VBOC 4FP3A 5B2GB 2LTNA 4U36A 1ASJ2 5IK5A 3H1YA 3MI8A 4HVQA 1LOFA 1EAH3 1G86A 5K0UB 4XPVA 2E51A 4LUKA 2JICA 4Q4V3 1R091 4LBMA 2WL1A 4EV0A 3JD73 4IEOA 3WQ1A 5GZFA 4FSJA 4CDQB 1ZVFA 3I8TA 3VDDA 4FOWA 4AQTA 2F4PA 2VVEA 3V56A 1YFWA 4YG0A 4AGGA 4GIQA 4AVAA 2WNUA 4UBHA 1ND2A 5LEKA 3HQXA 3HD8B 4Q4X3 1MS1A 3VZOA 4AVBA 1KITA 5FBZA 1LESA 3VZKA 4PLOA 4BPZA 2RS12 2D97A 4GWMA 5CG8A 1N3OA 4MGKE 1HRV3 5LRSA 3VZNA 5LEJA 4CDQC 4DQAA 2DCYA 4O9GA 4P9IA 2GH2A 2EXHA 1X50A 3ZFGB 5I8TA 4R9AA 2SBAA 3LGRA 5BNNB 3AP6A 4YFWA 3WVJA 1ZBE3 1H0BA 2GSYA 2AENA 3FUOA 1T6GC 3ECQA 3WG4A 4META 2VOWA 1RUE1 3MLKA 5BPXA 2RR11 4YGCA 4XW3A 3UKTA 4XQ4A 1REDA 2ZHMA 3AMQA 2DU1A 1RVF2 2ES3A 1O7FA 5DDJ3 4WM8A 3AJYA 1R093 3RG0A 3MIFA 4LT5A 1J1TA 4XF4A 4AEJA 3ZXDA 5JZGC 4X6QB 4OZXA 4R9CA 2RM21 4CRQA 1SFYA 1EPWA 3VBSB 2BYVE 3VN4A 1QY4A 5I0TA 4AQ2A 2BWAA 1NCQA 4WM8B 1YIFA 5IK7A 4QQLA 4AG4A 5I0UA 4NHKA 2ZGNA 5SV8A 4GH4A 4QMAA 3OJBA 5GZGA 2BFUL 2R30A 2TEPA 5D8AA 3VGIA 4FVVA 2IC1A 3T1LA 4HSJA 3WUDA 1NQDA 1W6OA 1S0DA 3N4MA 1XE8A 3ELNA 5FAXA 2XJUA 4H14A 3TBDA 5L19A 3AM2A 4P9YA 1QQP2 3D4KA 1RUF1 2PHLA 1RGSA 4KQ7A 2A5ZA 2CGNA 5BNPC 4YSFA 4YYOA 2D6NA 3AJZA 1OI6A 3WG1A 2Y26A 1CN1A 1D0GA 1TME2 4IEUA 4ES8A 1M06G 4UW3A 4PLNA 5KC5A 1RUD3 4IV1B 2NMOA 1AL21 3DUIA 3N3HA 1VBE2 2QDNA 4HBNA 3CO2A 3MIGA 1LJ7A 3VBSA 1C57A 2AYHA 4M0HA 2YV8A 4W65A 4QU2A 2RS32 1VBD1 4ONUA 2PTMA 2RJKA 2ZGUA 4NN0A 2JD4A 2QVSB 1IS4A 4ES9A 2PLV3 5D8AB 1S0EA 5CNAA 4LTAA 4IV1C 5I93A 2NN8A 1E57A 1O3TA 4AE2A 1EAH2 3QACA 4GKYA 2ZMKA 4YNIA 2IFRA 3ZFFA 3CL1A 3KT1A 1DYPA 4KG0A 1RUD1 4ZU7A 1NE6A 4NVPA 4LR4A 4B8EA 2GMEA 2UYAA 4K9SA 1RUC3 4KBBA 3DV8A 5E16A 2HWF2 1EY2A 1HIXA 2G4IA 2R043 2WWSA 5C4WA 1CQ9A 1BKZA 4H7LA 1RJ7A 4XXAA 4XOGA 2PA7A 1LR5A 3NAPA 4BCUA 4A7ZA 2PYTA 3SHRA 2W68A 3TN91 5CU1A 3KM5A 5DZEA 4BH9A 1DGWA 1MVQA 4BLIA 2YROA 1ND2B 3TAYA 3VBFA 1RUJ2 2Y0IA 1DZTA 5CB7A 3VHPA 2R0HA 3IDBB 5FO8B 2R32A 2R6QA 4Y24A 1H9WA 1VIWB 1OD5A 2JE7A 3KB5A 1MR5A 2Z79A 1NCRA 4RHV2 5ABJC 5I0SA 3U0ZA 5GZCA 1UX6A 2A6WA 4KWJA 5T5OA 5CFCC 5GLZA 1HXS3 5JZGA 2B5HA 1KDMA 1KS5A 1PGW1 1XNBA 2H6CA 3H1WA 5JOWA 1R082 4IEWA 1FOD1 5SV5A 5J36A 4YVSB 5JVVA 3WP6A 2WC2A 2XB6C 3IMNA 1W6MB 4LA2A 4E27A 4MUVA 1VR3A 4AVSA 4AW7A 3W9AA 4XJ8A 1TMF3 5KXBA 1QOSA 4OHZA 2R072 4HVOA 4AVVA 2D43A 1CAVA 1QOTA 3V0BA 4BYYA 4FXKB 4FPEA 5ABJB 3B94A 1X82A 1KFXL 4Y22B 5GZDA 3ZYGA 2DUOA 3UKNA 4A7YA 4JC1A 3HAGA 1PK6A 3OD0A 4Y20B 4CTEA 1MEC2 4RR3B 4PBPA 1YI7A 4ITCA 3TNPB 5CADA 1VAMA 1JUHA 4HKOA 5A33A 2ZHNA 5DXDA 3R05A 1ZZ6A 1Q8OA 1AXKA 4XJWA 1OA3A 4XDQA 1FOD2 1GZ9A 1V9U1 5I91A 2VNRA 4RR3A 1KD7A 2I07B 4KU8A 1VBD2 3KMHA 4N9IA 3VZLA 2YDEA 1Y9QA 2HEYF 2UWAA 2E6VA 1J1LA 4INDA 1O4ZA 1ZZ7A 2MHFA 4LHLA 4PDWA 1UL9A 4SLIA 4JV4A 2A6XA 2GNBA 1VJ2A 1AYN3 1M4WA 3RMYA 3U10A 1KDKA 4MXWA 2GMMA 1FMD3 1ZZ9A 3B3QE 2RM23 5ABJA 2PHWA 3AFKA 4MYEA 4OI0A 4FOQA 1AF9A 1PO22 2Q1MA 1LHOA 1HV1A 2RM22 4DNYA 5HCAA 2NMNA 1HRV1 3E6CC 1AR91 4CEYC 1GBGA 3RWNA 1XU1A 2V09A 5F6KA 1EV13 4GH4C 4Q4W1 3WY6A 1D2SA 2P3IA 1YNAA 5FO9B 3HMYA 1H8TB 4AFBA 5CVRA 2WLQA 5JPMB 4K20A 2VMHA 1Z7S3 4C0HA 2K0GA 4Q4Y2 2UU8A 2YYOA 1RUH3 4MGYE 4BMBA 1B35A 3NAPC 1DYKA 1OOPA 2D6KA 2WA4A 1ZBE1 3L2YA 1Z0HA 2YGLA 3AP9A 2XBO2 1QGLA 2Y0OA 1G9FA 2DFBA 4ISQA 1LB2A 4X8NA 2WSVA 2VULA 4CP1A 1H4HA 4BIOA 5H9QA 4J1XA 1AR83 4JTOA 1C8NA 1H8TC 2DV9A 3AYEA 4FT8A 4N43A 3U07A 3GALA 1N3QA 2R042 4XFAA 3SITA 4IEYA 4B4RA 3JBG1 4QHBA 1O3QA 1AXZA 2CV6A 3E97A 1VBB1 4RGAA 3NAPB 4XBLA 2MPFA 1TQ5A 4L99A 3H7JA 4HPKB 1C1FA 4XF3A 3WP5A 2JXAA 3VLBB 3VZMA 5ACA1 5JI7A 4LBKA 1SLBA 1RUH1 1UU5A 2ZOEB 2EXJA 4Q4V1 1F31A 5DDJ1 2D98A 3VV1A 3ZN6B 4COYA 2GN7A 5EXOA 2ZGKA 1QNYA 4D3WA 5AFEA 5DUUA 3BTAA 2W52A 3VDDB 2QJVA 5KC6A 1HXS2 1ND3A 3ES1A 2QQPA 5C8CB 3AXDA 5E8AA 1V6IA 2X5IC 1Q8PA 2JX9A 1V9U2 1CPMA 1A3KA 5KXEA 1NCRB 5HCBA 4K7JA 4U2AA 4AQ6A 2OZJA 3B93A 3PJQA 3OYWB 4JDNA 1PIV3 3S6PA 3WQ7A 3LOBA 3PVEA 3M1HA 4DOUA 2VMGA 5L73A 1U5ZA 1FNYA 5F6LB 3NWKA 3DGTA 1D4M1 3OBRA 2HWB3 2D5FA 4Y1ZA 4XZPA 2EIGA 4N53C 4AEMA 5I8SA 5BUVA 1PHMA 2UURA 3V0BB 2YHJA 4AVTA 4CEWA 4RS5B 1VBA2 3B69A 4Y22A 1WW7A 4GULA 2WLPA 1RINA 4TZDA 4S2FA 3FJSA 1AYM3 2H0VA 4AWDA 1LECA 4QQ2A 3JUUA 1NY71 1GKBA 2B45X 4M00A 5JCTA 1AUYA 3ZSMA 3WCSA 1AR73 3BU7A 3VBOB 5LK7B 1SBEA 1J3PA 1FXZA 4OHVA 3H7YA 2VVDA 4EJRA 3TRSB 4Q1RA 1DDLA 1WLCA 4HK8A 1SLTA 1PVC1 3LSEA 3CJIC 4D7SA 1RUJ1 3CU7A 4Y1YA 3RZZA 2DYCA 3WDWA 3EHKA 3J26N 5FCCA 3HN1A 4NWWA 1NZCA 5E1RA 5CFDA 3EBRA 4LBNA 1ENRA 1QJY3 1ZBA2 1H2NA 3L9JT 2NLRA 3J8F2 5F5QA 3MIHA 1JW6A 2BWCA 1PGSA 1QMJA 5T55A 3ZMNA 3ZXLA 4AQSA 2GU9A 2ENRA 1FPN3 4YZ4A 1GSLA 5C8CC 1PO12 2R063 1CONA 2I2SA 1QF3A 1OA2A 5IK8A 5GLTA 1LTEA 1N3PA 1SCRA 3AZWA 4KWKA 1DZRA 4XFBA 1AXYA 1MZ5A 3IDCB 2ET1A 3M4FA 4H3WA 1WD4A 3ZPYA 3I2DA 1F2NA 4Q4Y3 3I4IA 4M3CA 3RQ0A 1ULEA 2HEVF 3FWEA 4Z07A 4Q29A 5T5LA 3AB0A 3ZFGC 4IEVA 1ASJ1 4HANA 4KNCA 2RHPA 3WG3A 2Q1ZB 1V6KA 1NE4A 4DINB 4NHLA 3WW4A 3AZZA 5A3MA 3A0NA 3SH3A 1BBT2 1I1EA 1VB4A 1YI9A 3GF6A 1PIV1 5FREA 2C9AA 4OLLA 3SH5A 3M7AA 2Z5WA 2WA3A 4B4QA 2ATFA 3THPA 1Y7BA 1JYCA 4QQOA 5JMCA 4LO8A 1G9DA 4JRAA 2Z2SB 4RGGA 2DWRA 4LLOA 3AX4A 1X7NA 2BNMA 4K8FA 4NWVA 4I0WB 3FC0A 4IEQA 2WFF1 2WJSA 3AP7A 3ZDSA 3WX5A 2JG8B 1EPZA 4ZXKA 5DDJ2 4RA0A 1V6MA 5GZEA 4JDMA 1ZNPA 1KRIA 3IDEA 3NVCA 4I3PA 4HSLA 4FPHA 4YGEA 5FRAA 4AFMA 1D4VB 3R4DB 4LE4A 4XHXA 1HXS1 4FPOB 4R8HA 4S2GA 4PIXA 2V73A 3R6SA 1BK1A 3PTYA 4Q0UA 4Y1UA 2ETEA 1YHFA 3AMMA 3N36A 3EXUA 4LBJA 1R1ZA 4HETA 4H7MA 3V65A 3MYXA 2XKPA 3USSA 4QPGA 3P3NA 1AJKA 3MLLA 4F83A 2KA3A 4FBFA 3FFZA 5K0UC 1GLHA 3AKTA 4K21A 1ND3B 1JOJA 2NYYA 4PJYA 2DCTA 5BNPB 2IXKA 3KD4A 1AX0A 2XJRA 1XXNA 4JQRA 4LEJA 3RNSA 2HWD2 2XPJA 3E6DA 4IESA 4EWAA 2GC3A 4AHZA 2GZWA 5A33B 5JZGB 4JGZC 4QXKA 3O14A 2Q8OA 1G7YA 1PMIA 4P9GA 2AREA 3VBHA 4D94A 2BVBA 1H1MA 3VKNA 2PN5A 1ZRCA 1MZFA 1BCXA 2WIIB 1IKQA 1DG6A 5JSPA 1D2QA 2PFWA 3NL1A 2RS33 2UWBA 4KGQA 1FV2A 3AKSA 4BWOA 1BEV2 4CDXA 1JN2P 1PZ7A 4M3CE 4OI2A 2VQAA 1SQ4A 3VBUA 3BODA 1TNRA 1RUI3 5BNNC 1K5MB 1UD1A 4LE3A 1AX1A 1S0FA 3KLSA 3T2TA 1S0GA 1QQP1 3HR9A 5BNNA 1PM7A 3HT2A 4WVZA 4COZA 2W0XA 2EAKA 4EROA 5GLWA 1C28A 1SCSA 1F9KA 2ZGOA 3GNEA 3GBWA 1DHKB 2AR6A 2E7AA 3FUQA 2GN3A 1O91A 1S0JA 1LOAA 4I09A 2CAVA 4R4ZA 4ZU5A 1KS4A 4AEKA 4E2GA 4AHXA 2NP0A 4IV1A 3GZTB 3VBHB 2NPIA 1AHSA 5ACA3 3M3OA 4UBGA 3GBGA 1FT9A 2XKOA 1W0PA 3ATGA 2VECA 4ASMB 5BNOC 3NW4A 5JPNB 3BOWA 4CEWC 2D3RA 4DB5A 4YZ5A 4FPGA 1H2KA 1ZZBA 3DPRA 3AYDA 2HWE1 4R52A 3HIFA 2VW2A 3ASIA 4XYXA 3PVNA 1IGOA 2A70A 2BQPA 1CGPA 4A7KA 2TNFA 1NCQC 2HJIA 2ZS6B 4IL7A 1HQLA 2DF7A 4FP2A 4A2UA 3WNXA 1VRH1 5T52A 2G9FA 2ZJCA 2QUOA 3VBHC 4JGYA 4XTPA 1O4YA 3QD6A 4AFCA 5J09A 1ONAA 1TE1B 3IT8A 3B9CA 4Q27A 5KHJA 2PELA 1DIWA 2GNMA 1XQNA 4IEZA 4WVMA 3OGJA 1DQ2A 4K1YA 5BYNA 1HQNA 3BB6A 3C3VA 1A78A 4N7UA 1MS0A 1VAVA 2AZ5A 2O8OA 4RR3C 3V64A 4B7EA 3WW3A 1QOOA 1B09A 1S0BA 2VG9A 2XL9A 2D40A 3EQEA 3MFCA 1PZ8A 2WINB 2HWC3 5AC92 2RS11 4WZFA 2D6LX 3VDDC 3ZXKA 3VHNA 1C3HA 2RS13 4Z82A 2XJVA 4V1PA 3WD5A 4GA9A 4Q4X2 3LSDA 1O3SA 2VPVA 5JI9A 1HRV2 2ZGRA 3OYWA 1ZM1A 2WZPP 1RUOA 3CJXA 5KWRA 4NO4A 4XXPA 1QJX1 2XGXA 3WOGA 3QOPA 1HV0A 3QH7A 3ZIXA 2FZ1A 1UPSA 4LO4B 1GNZA 3FE5A 4IEXA 2EVXA 3NV4A 1UZYA 5T54A 2TUNA 3RS6A 2D6OX 3WLUA 3OTFA 2JKBA 3CNAA 1MS4A 1DGLA 3A0KA 3O0VA 3PMEA 1YFUA 4MVTA 1MQTB 1PVC2 3OF1A 4RL7A 2WT2A 5FPXA 1CD3G 2UYBA 2PLV1 3UKVA 1IS3A 4FO9A 4MGIE 3DN7A 3ZFGA 1RUD2 4B4PA 1ZA4A 4LBQD 1HKDA 1DFQA 2R0FA 3UJQA 2WFF2 1GZCA 2A6VA 4OUSA 4B29A 3UL2A 4HKWA 1DLLA 3M3EA 4NR1A 3ZN6A 2VOKA 1MEC3 4OUMA 1RUG2 5H9SA 4QPIC 2AUYA 4YW5A 3KGZA 3VKFC 4YFZA 1VAKA 1XYNA 2JDZA 1UCXA 2OA2A 3WDYA 1RITA 4CDXB 3FFQA 1A8MA 2XBO3 2E53A 3AKPA 1GQHA 2DVGA 4YVSC 4JVAA 2YUEA 1UIKA 3NJZA 3RMXA 1JTZX 2PHDA 3RYKA 4QPGB 4AGVA 4YW2A 4XHBA 3ALQA 3T1MA 1WCKA 3IM0A 3JU9A 2A3WA 2GH8A 2WQZC 4XJZA 2ZCWA 3M3CA 1NLRA 1X8EA 2GDFA 2QZ3A 3J4UH 1VBB3 2DUPA 1N1SA 3APBA 3A4UA 4QPIB 2XVKA 1SFNA 3M70A 4H55A 1V6OA 1CIWA 2QZ2A 2TBVA 1IHMA 1AYN2 2HWE3 1H4GA 4YVWB 4OFGA 4Y20A 1VBE3 3DL3A 1BXHA 1QH7A 3OCPA 3WDUA 5BXXA 3M3QA 1APNA 1POV3 2OIIA 2XVGA 1CAXB 1RUF3 4TLFA 2MNGA 2DTWA 3JD71 4QQHA 1RMU2 1MZ6A 5JOXA 2XBO1 2VOXA 3HWJA 2A75A 1RMU3 3VBSC 5LRRA 3ZXFA 2VNOA 3Q9OA 1CAWB 1U0AA 4Q8KA 1GICA 4IXLA 5C8WA 1QXRA 4YW1A 4AVCA 3FHIB 3N35A 2WNEA 3EJKA 1V9U3 1NXD1 3FLPA 1COV1 1AR63 1K5MA 3WZ1A 4I01A 1G9BA 4FPKA 2OVUA 4FTBA 1MS8A 2B39A 4SBVA 4AK3A 2IXHA 2VNGA 4FPFA 4QPIA 3R4UA 3WP4A 1QXPA 4CDXC 2ZACA 3JD72 5L36A 4CP0A 2VQ0A 4JCKA 1OSGA 3FLTA 3VBUC 4RD7A 3M8LA 3JB4C 1ZZ8A 3S7EA 2HWC2 5AC93 3GHNA 4GMP0 4KH9A 2QCSB 3TB0A 3AZVA 2IXLA 3WG2A 1OMIA 3B00A 1Q43A 2VW1A 1V00A 2O1QA 4M3CB 4HK9A 4MGZE 1AR72 2VGDA 1LU2A 4GB33 4AI3A 4B3NA 4IV3B 4HN0A 1CAWA 1W6QA 5HI0A 2VXRA 3OPZA 3SISA 2C0ZA 5BNPA 2BPA2 3ZFEA 5DG2A 1VP6A 2D6MA 4QGMA 2A3XA 2MEV3 4EN9B 2BNNA 4RHV3 3PVOA 5C8CA 4YZ1A 5FOBB 1NA1A 4J6GA 2OUJA 4QQPA 4GXLA 1J3RA 3MF9A 3WT3A 3S7IA 1VRH3 1IQAA 1HRI1 3IKWA 4JGYC 5CA6A 1LHNA 1UKGA 3I59A 2KXLA 1VRH2 2QNKA 3URFA 5K0UA 1LOFC 4MZUA 1PVC3 4FOVA 4AI2A 4JRLA 2GALA 4HKLA 2VUJA 3SCFA 2VUAA 1U12A 2IWGB 3BALA 4XQWA 2ZKLA 1PIV2 1SBDA 2SLIA 4M0NA 1C5IA 4HPKA 1AR71 4Z8BA 2WFPA 5K8SA 1CX4A 2WZR3 3WXPA 1S1AA 1TMF2 3FBYA 1KJLA 5FLIA 4PBOA 2P17A 4AEDA 5J48A 1POV0 1W0OA 2ZGSA 1H30A 3WR0A 2ILMA 1QJY1 2X53S 4CZSA 5L7OB 3RI8A 4DRVA 4J1WA 2Y38A 3ZMOA 1TEIA 3ES4A 1A8DA 1D4M3 2YPJA 4Q0VA 1WCDJ 1CVNA 1Y43B 3TOJA 2GC0A 1AYM2 4COUA 4QGLA 1J58A 2GC1A 2D7FA 3FX3A 4RQPC 1BBT3 4ATFA 4BHPA 2EF6A 2BW8A 2GC2A 3I59B 3ZXJA 1QJU3 3POWA 2B42B 1FAYA 3JBG2 2VW0A 2ZMNA 5AVAA 1AYN1 5JAXA 5CFDB 3U11A 3G7DA 5I8YA 4UW6A 4YW3A 3JBG3 3NKGA 2ZKNA 1FYUA 1PO21 2D93A 1ASJ3 1FX5A 4E2QA 2E63A 3D82A 4LULA 5J7MA 1FI2A 1N47A 1VLNA 2KM2A 1QJY2 1ZBA3 1RMU1 2QE3A 1XNCA 1SMVA 4YZ3A 4CEWB 2V5YA 1V6LA 4PIZA 3WDVA 2PHUA 5GKAC 1IS5A 1KXGA 1X8MA 1XNKA 2DU0A 2ZGTA 4YVWA 1F5FA 1QXJA 4XBQA 1REEA 1LOCA 4DS0A 1A6CA 1LRHA 1NOVA 1YIPA 1Z7S1 2B46X 1Q8VA 1REFA 2EXKA 4FPLA 4XIOA 1DU3D 2A71A 1QDOA 2DFCA 1EV11 5LK5A 5D8AC 3OY8A 3PNAA 2BEOA 1LHWA 1I6XA 2N7GA 2DCJA 2RMU1 4Q4Y1 3MICA 3O0XA 1YUDA 4LO5B 3LCPA 3GZUC 4Y26A 4DY5A 1RUNA