2HWF3

A comparison of the anti-rhinoviral drug binding pocket in hrv14 and hrv1a
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
238
structure length
238
Chain Sequence
b'GLPVYITPGSGQFMTTDDMQSPCALPWYHPTKEISIPGEVKNLIEMCQVDTLIPVNNVGNNVGNVSMYTVQLGNQTGMAQKVFSIKVDITSTPLATTLIGEIASYYTHWTGSLRFSFMFCGTANTTLKLLLAYTPPGIDEPTTRKDAMLGTHVVWDVGLQSTISLVVPWVSASHFRLTADNKYSMAGYITCWYQTNLVVPPSTPQTADMLCFVSACKDFCLRMARDTDLHIQSGPIEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 1A COAT PROTEIN (SUBUNIT VP1)
publication title A comparison of the anti-rhinoviral drug binding pocket in HRV14 and HRV1A.
pubmed doi rcsb
source organism Human rhinovirus 1a
molecule tags Virus
total genus 33
structure length 238
sequence length 238
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1994-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2hwf300
3ZFFA 1RUC3 4PDWB 2BBVA 4NWVA 1VBA3 2HWF3 4YVSB 3VBOC 2IZWA 5ABJA 1NCRA 1HRV3 3VBFA 1C8NA 4WM8C 1BBT3 5BNOB 2GSYA 3ZFGA 2HWB1 2PLV3 1OOPA 4IV3C 1RVF1 2HWB2 1OHFA 1RUC2 1CJDA 4N53C 3ZFEB 3CJIC 1ND3C 4JGZC 2RS13 5BNPA 1VBA2 2RR11 3VDDA 2RR12 4CDUC 1Z7S3 3VBUB 5C4WB 5CFCB 1PVC1 1AL23 3NAPC 3ZXAC 5BNNB 1ASJ1 4RR3B 1ASJ2 1HRI3 4EJRA 1R083 1NY72 5LK7B 1QQP3 2RS12 1K5MC 3DPRA 4AEDB 2R063 1PGW1 2WFF3 1PO11 1Z7S2 4CDXA 1QJZA 5JZGC 2WZR1 1GFF2 3VBRB 2WZR2 1NCQC 4BCUA 1R093 2FZ1A 1HXS1 1AR63 4QPGC 4RQPC 4CEYB 4IV1B 5K0UB 1EV11 4N43B 1EV12 1QJU3 2R062 2WFF1 2WLPA 2WFF2 1R1A1 5CFDB 1BEV3 1BMV2 1B35B 1RMU3 3VBOA 1ND2C 5FMOS 5L7OC 1R092 4WM8A 2HWD3 5C9AA 1AR61 1AR62 3IDEA 1VRH3 1POV1 4CDQC 4IV3A 2R071 5J98B 2R072 1QJX1 4Q4Y3 3CJIA 4FTSA 1AR93 2RM23 1BEV1 1CD3G 1ND3A 4JGZA 5A33A 1BEV2 4Q4X3 3S6PA 5ACA1 1HX6A 5ACA2 5D8AB 1C8M3 4CDUA 1ZBE3 4QPIC 2HWD2 1TME3 1RUI3 3NAPA 1V9U1 2XBO3 1V9U2 4Q4W1 1PO21 1PO22 1VBE1 2RMU1 1VBC1 1VBE2 1K5MA 2HWC1 2RMU2 4GH4B 2HWC2 1C8M1 5AC91 2RS31 1C8M2 1EAH1 1ZBE2 2RS32 1TME1 4CDWC 1EAH2 1TME2 5JZGA 4Y5Z0 2XBO2 1RVF3 3JD71 1NCQA 1PGL1 3JD72 1PGL2 1AYN1 4QPGA 1AYN2 4RQPA 3VBHB 2RR13 1NA1B 5C9AC 1VB4A 1PVC3 2RS51 2RS52 1ASJ3 4CEWC 2ZTNA 1VAKA 1H8TC 5C8CB 1TMF1 3ZFFB 1RVF2 1ND2A 5L7OA 3HAGA 1A6CA 4CDQA 5ABJB 1NCRB 2WWSA 3VBFB 2XPJA 1PO13 4RFT0 1PVC2 1PIV1 3ZFGB 2WZR3 1OOPB 5FMOL 2X5IC 4WM7C 4QPIA 1HXS3 2ZZQA 1F2NA 5BNPB 1WCDJ 1EV13 1PGW2 3VBSC 4JGYC 3VDDB 1R1A3 1OPOA 1RUG1 1PO12 3TN93 1RUG2 3JB4C 4YVWB 4RS5C 1W39A 1RB8G 1NOVA 1X36A 1MQTB 4PDWC 1HXS2 4CDWA 1FMD1 1COV1 1POV3 1COV2 3DPRB 4YVSC 2R073 1AYM1 3TN91 1QJX3 1AYM2 1AR81 1R1A2 3TN92 4CDXB 5BNOC 1RHI1 1RHI2 1X33A 3J8F1 4FTEA 5ACA3 3J8F2 3ZFEC 2VQ0A 1MEC1 1SMVA 4FTBA 2MEV1 1V9U3 4SBVA 4CEWA 1H8TA 1FOD1 1FPN1 1FOD2 4Q4W3 1QJX2 3VBUC 5C4WC 1FPN2 5CFCC 1PO23 2BFUS 1RUJ3 5BNNC 1VBE3 2RMU3 4Q4V1 1VBC3 4RR3C 2HWC3 2BUKA 3VBOB 1M06G 2DF7A 5AC93 2RS33 4WM8B 5C9AB 1EAH3 4FSJA 5DDJ3 4IV3B 3JD73 4AEDC 2X5IA 1ZBA1 4N53B 1ZBA2 1F8VA 3JBG3 4WM7A 3CJIB 1AYN3 4Q4W2 1ND3B 4JGZB 1RUJ1 5A33B 1RUJ2 1VBD1 3VBRC 1VBD2 1VBC2 2R041 3VBSA 2R042 4JGYA 4CDUB 5AC92 2RS53 3NAPB 4RHV3 1E57A 5A32A 2WS91 4RS5A 2WS92 5DDJ1 4CEYC 1TMF3 4IV1C 5DDJ2 5K0UC 4N43C 1RUD1 1RUD2 1VBB1 3JBG1 1VBB2 4Z92B 4PDWA 3JBG2 5CFDC 4GMP1 1B35C 1K5MB 1POV0 4YVSA 1AR71 2HWE1 1AR72 2BPA2 2HWE2 1D4M1 1D4M2 1RUE1 4RHV1 5BNOA 1PIV3 4RHV2 5JZGB 1VB2A 4GB31 1NCQB 4GB32 1TMF2 5C8CA 3ZFEA 4QPGB 4RQPB 1AL0G 4Y4YA 5D8AC 1RUG3 3VBUA 5C4WA 5CFCA 1QJY3 5BNNA 1PIV2 4RR3A 1ND2B 1RUC1 5L7OB 1DDLA 1AUYA 3LOBA 3JB8A 3FBMA 1FMD3 1COV3 1VBA1 2HWF1 4CDQB 2HWF2 4GH4C 4AEDA 2FZ2A 1HRV1 1NG0A 2TBVA 1AYM3 1HRV2 2BFUL 1AR83 1BBT1 1BBT2 4YVWA 1QJY1 1RHI3 4GMP0 1QJY2 2PLV1 3J8F3 3VBRA 2ZAHA 2PLV2 5GKAC 1NY71 1IHMA 4QPIB 1MQTA 1MEC3 2MEV3 2RS11 1FMD2 5K0UA 4IV1A 4CEYA 3VBHC 4N43A 1FOD3 1NA1C 1FPN3 1Z7S1 1AR82 1AL21 4LLFA 5CFDA 1AL22 4Q4V3 1B35A 1HRI1 5C8CC 1R081 1HRI2 3ZFFC 1R082 1MEC2 4CDWB 2MEV2 1QQP1 1QQP2 2R061 5ABJC 1NCRC 1ZBA3 3VBFC 1HQNA 1BMV1 3ZFGC 1VBD3 4Q4V2 1OOPC 2R043 1R091 5D8AA 2Y26A 2QQPA 2WS93 4CEWB 5BNPC 1H8TB 5J96B 5FOJB 1RUD3 1QJU1 1RUH3 1RUF3 3VDDC 1VBB3 1QJU2 4N53A 4YVWC 4GMP3 4NWWA 1AR73 1RMU1 3M8LA 2HWE3 4GH4A 1RMU2 1D4M3 1MQTC 1RUE3 2HWD1 4GB33 1VRH1 3DPRC 2X5IB 1VRH2 1RUH1 1RUF1 1RUH2 1RUF2 4WM7B 4CDXC 4Q4Y1 1AR91 2RM21 4Q4Y2 2GH8A 1AR92 2RM22 4Q4X1 4Q4X2 3VBHA 3VBSB 4JGYB 1NA1A 1ZBE1 1RUE2 5A32B 4RS5B 1RUI1 2XBO1 1RUI2 2HWB3
chains in the Genus database with same CATH superfamily
1W6PA 1WUVA 2JD4A 5A1AA 2C9AA 3ZFFA 3VD7A 3J4UH 2D5HA 4O9EA 2Q4SA 4J6GA 5GALA 3PL0A 3WUCA 4XUPA 3T4HB 3CHXA 2JX9A 4AI8A 1Y9QA 3C3VA 1JZ5A 2HYKA 3KV5A 5JI9A 3JU9A 1NCRA 1HRV3 1HB3A 2ET7A 4AI2A 5FYSA 4DUXA 2YY1A 2ETEA 1DGLA 1W9FA 5DUWA 3WP5A 3ZDVA 5HV0A 1ZZCA 3AFGA 5FMDA 1QXJA 4MGQA 5GZDA 3PVBB 3IPVB 4AVTA 2WZEA 2ZMNA 4UW5A 1JI6A 2FDHA 5ISLA 2WAOA 3KSCA 2FD8A 3AKSA 1Y4WA 3AP7A 4GZ9A 5FP3A 2OQ7A 5FY9A 2J42A 2QE3A 1QOTA 2V09A 4KBBA 4RGGA 1Y9GA 2JIGA 4BQWA 1NAEA 1VMFA 3UGHA 3AKTA 3FHIB 5DUXA 5FZBA 1R1ZA 1URXA 4AEJA 2AACA 3VBUB 1F8VA 4JDMA 4DEVA 1UPSA 1VMHA 5KHKA 1AJKA 1JODA 5A3TA 1QF3A 4NHXA 4XAEA 5FXXA 5LEKA 4P9LA 5EHDA 1RGSA 3CL1A 3N9PA 4OMCA 1VMJA 5F2SA 3AP6A 1A34A 2A6ZA 1JZ6A 2F4PA 1OLME 1FNYA 1H0BA 4QHOA 4V2WA 3ST7A 5G04L 1QQP3 3AYEA 5HXMA 3A21A 2YPDA 4ATEA 3DPRA 3PUQA 5DMYA 2R063 1PGW1 1W8FA 4HKWA 2AEYA 2WFF3 1GZTA 1D0HA 3FC0A 1PO11 3GCXA 2A73B 4LE4A 3ZN4A 2CAUA 4CDXA 3N7LA 5KWRA 2DCZA 2ARCA 2PQSA 3BYWA 1C3HA 2WZR1 5L36A 2WZR2 3M2MA 1QH7A 4FQ4A 5FPZA 4BCUA 3ZYJB 3I2IA 2YXSA 1R093 3NRUA 2WDBA 3OTFA 3H1YA 4CCKA 2NQYA 3CQOA 4OHWA 4AQ2A 1PZ7A 1XNAA 2HYXA 3GBFA 1VRBA 1VLNA 3J7HA 2R062 3RS6A 2WFF1 2ZXQA 4XFGA 4IE5A 3T3YA 2QTWB 2WFF2 1R1A1 3LSDA 4FFFA 2O14A 4B4QA 1BEV3 3WXPA 4Y5SA 2BYVE 2VUJA 4LA3A 3HPNA 2OPKA 1HN1A 3RI8A 3LEMA 5FMOS 4KGQA 1R092 4IEOA 3PNAA 2HWD3 4UT5A 5C9AA 2K46A 4HK9A 4W8JA 1SBEA 4Q29A 2Q8CA 4OQ8A 4COYA 3SEPA 3O1UA 2ZJCA 4FPHA 4WVVA 4XIOA 4LUMA 4COVA 4IV3A 2C0ZA 4YSFA 4BB3A 5KXCA 3BPZA 1GNZA 1XXNA 3USUA 3OCPA 1VAMA 4YM3A 2Y33A 4TXWA 1ST8A 3HQXA 1F4HA 2DV9A 1G7YA 3ZN6B 1AR93 1BEV1 1ND3A 2K0GA 1JUIA 4JZRA 4ZPIA 1BEV2 1IGOA 4FPCA 5B4XA 1HDKA 3FUOA 5D1IA 1CAWB 3AZXA 1GP6A 3T2PA 1G9DA 4UAPA 5D8AB 1W2UA 3QBQA 4Q27A 1WBLA 1AX0A 4QPIC 4UWDA 3KB5A 4XJAA 2HWD2 2UY8A 3HNYM 4OQ9A 1TME3 1K5JA 1RUI3 1FNZA 2D97A 4WV8A 5GZEA 4CCOA 4FVVA 1LU2A 4FO9A 3PHMA 4HANA 1TG7A 4P02B 1H1IA 3E6BA 5F5CA 3TB0A 3B3QE 3TYJA 1DGRA 4NMIA 3VD9A 2Y8KA 1HV0A 1VBE1 4D8MA 1VBC1 1VBE2 3TNQA 5DABA 1OKOA 3WQ0A 4BQ2A 5LRRA 1UL9A 2WUHA 3QD6A 2CV6A 1C5HA 4AVAA 4XFCA 1SDWA 1TME1 3VL9A 5AVPA 1TME2 3J7NA 1LGBA 4KMQA 4PI2A 3WG1A 4Y5Z0 5JZGA 2BWCA 2FDJA 5C8WA 2VUDA 1PGL1 4KL1A 1D0GA 1CVNA 4ZXEA 1UKGA 4BLJA 1PGL2 2Y34A 5FJHA 2W68A 3O1SA 1KQRA 1FI2A 4QQLA 3GJBA 3M3EA 2XQXA 4RQPA 2CGNA 4CUGA 5HXVA 1QXPA 3VBHB 1CAUA 1IPKA 1I1EA 1XBFA 1SG3A 4I0AA 2WL1A 4META 1H2KA 1VB4A 4QXKA 1PVC3 1S0DA 4W6YA 3KS7A 3ETPA 1VP6A 3TBDA 4ARXA 3OGVA 5BUVA 1L3JA 2RDNA 2E7QA 5C8CB 1LOGA 1MS3A 2W1QA 4L0PA 4AI0A 1YFXA 2YC2A 5F6LB 1YJLA 5L7OA 4BQXA 2Z69A 3EHKA 3N4MA 1RL3A 2WSUA 3HVDA 5T54A 4IESA 1GOHA 2VMHA 4CDQA 4V2VA 5ABJB 4CXYA 4LIUA 2XPJA 5F37A 3AMNA 2AENA 4R9CA 4WVMA 2PXJA 1QWRA 1PVC2 1YQ6A 5T52A 5L73A 2AC1A 5LWBA 3T1MA 4BMBA 2ZEWA 1OOPB 4RA0A 4E8CA 5K8SA 2VMFA 2X5IC 3QH6A 1YC61 3HQRA 1UY1A 1HJFA 2EF6A 3UESA 3V0BB 5JOYA 3WDTA 2JDUA 4YGCA 4CSWA 1W8UA 1IG3A 1CQ9A 4FPKA 1HXS3 2ZZQA 4XUNA 5I0DA 1V6JA 1UWWA 4QDSA 4CA9A 4HKOA 4JRLA 1UY2A 3CKHA 1UZWA 3DUIA 5GLTA 2WO2A 4H55A 3VBSC 4CP1A 2PYTA 3TN93 5JOWA 5KXBA 1PMHX 2VZVA 1RUOA 5EPAA 3MLLA 1YQ5A 1S0JA 1W39A 1RB8G 1NOVA 1YFUA 3RFRA 4ARYA 4YARA 2D5FA 2D98A 1E5SA 1ZX5A 2WRAA 4YM1A 3HT1A 2Q1MA 1VIWB 3ILRA 5GZFA 5I0SA 1MQTB 4PDWC 5L9BA 3P6BA 3OB8A 1HXS2 3POEA 1UO9A 1VJ2A 1X50A 1XPWA 1BZWA 3KVBA 5KBFA 2A75A 2R073 2FHRA 3FBYA 3TEXA 1D4VB 3M3CA 4K1ZA 3TN91 3HWJA 3THDA 5DN2A 3B9IA 3TN92 3I3QA 3MFAA 5BNOC 5FYVA 1X33A 3U0ZA 4GWNA 1FATA 3K3OA 3O14A 4I01A 3PUSA 2EXIA 1L7RA 3QLQA 3VZLA 4BM8A 4FTBA 3GM8A 1O4ZA 1V9U3 4K20A 1H8TA 3QH7A 1WMFA 2Y6HA 2PHRA 2OT7A 4OHXA 4QAWA 1D7PM 5FZ7A 5FYYA 4JRAA 2UYBA 2GU9A 2OA2A 2BOIA 3OY8B 4SLIA 3NV1A 5FXWA 3A0KA 5C4WC 5JUVA 2BFUS 1Q8VA 5FZIA 2OW4A 2W5FA 3VZMA 5BNNC 4XTPA 2RMU3 4RR3C 3VBOB 2BUKA 3BTAA 3R6SA 1M06G 2VNOA 2WNEA 1JUHA 3AKPA 1UYYA 3M7AA 5AC93 1QHDA 2IXHA 1DLCA 2DYCA 4LBNA 4WM8B 5LBFA 1AX1A 4ES9A 3AYCA 2R1BA 4GA9A 5DDJ3 3JD73 4NRPA 1WZXA 2QKDA 2AZ5A 3C7HA 2PN5A 3FE5A 2GN7A 3JBG3 4WM7A 5IAVA 3CJIB 1AYN3 2QJVA 4OZOA 4JGZB 2CY6A 2VZ1A 2XWJB 5GLWA 1W6NA 5J48A 2JG8B 3MLJA 4KG0A 3GBGA 2R041 3SHRA 5FO8B 5JXHA 2R042 4CDUB 3RZJA 1DG6A 2ZGRA 3I3EA 4YZ2A 5AC92 2AR6A 2RS53 2KXLA 3LZZA 4PIZA 2FDIA 5FZKA 4RHV3 4DQAA 3N9MA 5A32A 1DQ4A 1O5UA 5DDJ1 5K0UC 5DDJ2 2Y38A 4N43C 3MIDA 3J26N 2ZCWA 3WF0A 1VBB1 2DUPA 5I8YA 2GMEA 3JBG1 1VBB2 1XE0A 4Z92B 3JBG2 4XFHA 2VW2A 3K75B 3O1RA 5CFDC 2W1WA 1POV0 2GMMA 5FZ0A 4KU8A 1MS4A 2BPA2 1AX2A 5C33A 2RJLA 2A70A 4XJ9A 2AYHA 2J1AA 4RHV1 4DXZA 3BPSA 4RHV2 2WNVB 4QX2A 4Z82A 4GWJA 3VDAA 2RDQA 4TZDA 3IPVA 4QPWA 1VAVA 1WCQA 2ZGTA 3EB7A 1MS8A 2DBNA 4V1PA 2DWRA 3AJZA 4AFDA 3RZKA 2FBEA 1ENSA 1UYPA 2J1UA 3AP9A 4IGQA 4LKSA 4QPGB 4BISA 3Q9OA 2XVKA 3WUDA 1PK6B 3B93A 3CZUA 1HB4A 4LLOA 3SXWA 5FLHA 1G9FA 4UW4A 3DYPA 5FY0A 1UOBA 3AVRA 4Y1UA 5EV7A 1VR3A 3VBUA 1GZWB 2EAAA 4JAAA 1QJY3 3OEAA 4HG6B 2ZMKA 1Y7BA 3RMXA 4LK7A 1ND2B 3O0VA 2YHJA 3IDBB 2ZHMA 2VZ3A 3WCRA 3VV1A 1CIWA 3WNKA 3I4IA 3FBMA 5HCBA 1FMD3 3WNPA 3JXSA 1UIJA 1VBA1 1F9KA 1W0NA 3MUY1 3ATGA 4GH4C 5LW9A 3VKFC 4E4HA 1NG0A 2WNOA 2TBVA 4FPJA 1X9TA 2VCBA 4Y20B 4AW7A 4NHYA 5K9YA 1QJY1 1KS4A 1QJY2 3GZEA 1OA4A 5CKMA 3J8F3 3R05A 1AVBA 2J1VA 2I74A 3GZUC 1XSQA 1W8NA 3H3UA 4XF0A 3ZPOA 5FYMA 4QKBA 3O1OA 4CCCA 4XZUG 5EJZB 2IXLA 1PZ8A 3C8XA 2MEV3 1FMD2 4L97A 5TSWA 4GXLA 2H0BA 3AX4A 3HD8B 4E2SA 1JBCA 2E7TA 4MV2A 1OD5A 1AL21 3AYDA 4IEWA 1AL22 4Y5TA 4Q4V3 2DTYA 4P5YA 5CVRA 4L92A 2IXKA 2W87A 3ZFFC 1DFQA 5F9TA 3Q8AA 3SKVA 2GMPA 1I9RA 4JVAA 2VOTA 4MGYE 5IW0A 1XNDA 4A6OA 5HCFA 3T4VA 5DAQA 5KHHA 5FAXA 2MEV2 2RVAA 2WJSA 2IFWA 1LOFA 4HT1T 4MGIE 1NCRC 1V6MA 2QUOA 1ZBA3 4C91A 4DY5A 1HQNA 5FY8A 3IAPA 1TZOA 3AKQA 3ZN6A 4D0QA 4PBPA 1DQ1A 4Q4V2 4XTMA 2VNGA 5DG2A 3UL2A 2A6WA 1CAWA 2E6VA 4UFJA 2CWMA 3N3HA 3UKVA 1EYBA 5D21A 4QGNA 5D8AA 3WR0A 3M3IA 2Y26A 4ZS3A 2CWSA 4YGDA 2WS93 4CEWB 1W9WA 4S2FA 2VBPA 5IFTA 1DHKB 4XJ8A 5JVVA 1RUD3 5T5PA 3WHUA 3WNMA 1ULGA 1W9TA 3EYPA 5FJKA 3WG2A 4AFAA 4N53A 2ZGNA 3L2YA 2XOMA 4YVWC 4O65A 1X8EA 2IXJA 5F7UA 2B45X 4R8HA 2P3IA 4NWWA 1NE6A 1NLQA 3I3BA 1RMU1 3RGBA 4E8DA 1WBFA 4EN6B 2HWE3 1DQ2A 1RMU2 4HOOA 4BJ0A 4XJUA 1JYWA 2R49A 2JDAA 2ZX1A 3M4FA 3NO8A 5A33A 5C71A 1HKDA 1B09A 1S0FA 3TEWA 3AXDA 1VRH1 3I2JA 3DPRC 4Z8BA 1VRH2 2N7GA 4XCAA 4GALA 3O0XA 1BQPA 2P4EA 5JR7B 4CDXC 4Q4Y1 5A6QA 3VDBA 4JQRA 2ES3A 2RM21 4Q4Y2 2E7AA 2RM22 4MADA 3WNOA 3VBHA 5FYZA 4JGYB 5KXDA 2ZZJA 2GC0A 4GAZA 3NV4A 2OUJA 4RS5B 2XB6C 3PTRB 5EYYA 4QHZA 1E5HA 3U78A 1S0IA 3FX3A 3WP6A 5C5UA 5M0TA 1RUC3 2ZAAA 4UFHA 1JOPA 2XL9A 3N7JA 1UNBA 5JI7A 3RWKX 4XW3A 4YWAA 4AVCA 2VH9A 4NWVA 4KWKA 3WNNA 5FZCA 1H4GA 2HWF3 3LPGA 4YVSB 1CAUB 5C70A 2IZWA 2XJQA 3T2QA 5ABJA 2E53A 1O91A 5H9SA 5FZ6A 4DPNA 2ZX3A 5IT6A 1BBT3 2OPWA 3VDCA 5C3RA 2VZTA 1U12A 1HB2A 1OOPA 4IV3C 5FY5A 3NQHA 3PJQA 4XPVA 3ZPYA 4WVZA 1RUC2 4LHKA 4HXCA 1CJDA 3BGAA 3DECA 3ZFEB 3V0BA 2VTXJ 2VD7A 4CUCA 1N47A 3A23A 3H1WA 1ND3C 4QX3A 4XVHA 3T1LA 4E4SA 1ZA7A 2JDZA 3AZZA 4DFSA 4M01A 2DBIA 2XJUA 3T08A 5JAXA 2B42B 2ZKNA 4J1WA 4DRVA 1U5XA 2KR2A 2YG0A 3O0WA 5BPXA 4CZSA 5CKNA 5CFCB 1CN1A 1GOFA 2FCTA 2ZBJA 4HKLA 2XDVA 5FBZA 4BK5A 3I2HA 4RYDA 4N7IA 3ON7A 1H1MA 1R083 2J1TA 4IERA 5F3GA 3VZKA 3VZJA 3MIEA 5FZOB 1ODMA 4P9GA 1Y3TA 3ZYFA 4CU9A 4BIFA 4P9XA 4NRQA 1ZA4A 4YGBA 4CU7A 5LK7B 1QKQA 3LFMA 3AKRA 3WW4A 3H9AA 1S55A 4YPJA 3ECQA 2QQJA 2F4LA 3OBRA 4LOSA 1F15A 2VOKA 1NUKA 4LBJA 1PGSA 3LEKA 4QGMA 4XZPA 1GLHA 5CIRA 5FYHA 2W46A 2XWBB 5JZGC 2G4IA 4P9IA 4QMAA 3MYXA 1GFF2 1OPMA 3AK0A 1A8MA 3NNLA 1V6KA 4O61A 3AFKA 3ZOIA 3WW2A 4M3CB 2JICA 2GNTA 4GJYA 1AR63 2VULA 2H6CA 4RQPC 4QKDA 5JWPA 4PT6A 4HLTA 4BK4A 3I2FA 1Q8PA 2WAAA 1OQDA 2WIIB 2C24A 2DVDA 1QJU3 3P3NA 4IETA 1HQLA 2VMCA 5F5IA 2WQ8A 4L9BA 5FYTA 3RNSA 1UCXA 5KC6A 3OY8A 3AMHA 3D5OA 1SCRA 5FQ0B 4A7ZA 1W2TA 2R30A 3MICA 1WW4A 1O4TA 3G6JB 4QT6A 3VBOA 4B4RA 5LATA 1XU2A 1SFPA 1UMZA 5L7OC 1A3KA 2CDOA 2Q8DA 2ATFA 4W6XA 3MUZ1 2E33A 3D8CA 4G3YC 4WM8A 3RYKA 1AR61 3QOPA 4XEZA 1AR62 3IN9A 3IDEA 3PVOA 2JJ6A 2VCCA 3RZZA 1HLCA 3LFIA 4IE4A 4CDQC 4HPKB 4LR4A 3GGLA 2P34A 1ULDA 2P3YA 2BW8A 4JKKA 1JYTA 5J98B 1GBGA 3OGRA 1QJX1 2BGPA 4K1YA 4BIOA 5FZAA 3CJIA 3SCFA 3ITQA 4JGZA 1G9AA 1CD3G 4Q4X3 3KT7A 3NV3A 3NJZA 2JG8A 5ACA1 3N9NA 5ACA2 2EIDA 4RN5A 4MVTA 4LMFA 1CIYA 1ZBE3 4CDUA 1ACCA 3E5XA 1YWKA 4GULA 2QQNA 5LY2A 2V5YA 3CO2A 5F3CA 5BYNA 2GC2A 3QCWA 1WCKA 1S0EA 3IKWA 2YBPA 1DQ5A 2YU1A 4HN1A 2V72A 2PHUA 4YLZA 2WZPP 4K7JA 1PO21 2QQMA 2D3RA 2DU0A 1PO22 5FREA 2DCKA 4FAHA 2WFPA 2HWC1 2CHHA 3OBZA 5F6KA 2HWC2 1GNHA 2W2IA 5FXVA 4CPBD 1EAH1 1ZBE2 2YDEA 4QQOA 4B8EA 1EAH2 1YJKA 2WWUA 2WNVA 1OF3A 4JCKA 2WWJA 3POSA 5E6HA 3Q8CA 2VOXA 2WT1A 2QQLA 2UWAA 2JG9B 3WQ7A 4XHXA 1EP0A 1EUUA 1K45A 2Y64A 1I6XA 1CPNA 2PQQA 3GJAA 4QPGA 5IAXA 1UX6A 3R4SA 1PK6A 1OUXA 1DQ0A 4XF4A 2IXIA 1SHWB 4A6SA 4IGPA 1SFNA 2ZGLA 2LUWA 1GZWA 4BXFA 2XJTA 2QQIA 3LKJA 2ZTNA 4RGKA 1VAKA 1H8TC 4HVRA 1TMF1 1DYPA 3WHTA 4NROA 3H7JA 1S4CA 4XHBA 1ZYBA 1ND2A 2VQAA 3FFZA 4FPOB 4B1MA 3O1VA 1PX4A 1MS5A 4GIQA 2A3WA 2DU1A 4CP2A 4XXPA 1LENA 1DP0A 1YEWA 1JH5A 3KLSA 5C3QA 5JXGA 4MG2A 1GQHA 2DFBA 4A2UA 1PO13 1NT0A 4MHRA 5J1XA 4Y20A 4E2GA 5HCHA 1CAVB 5CADA 3ZFGB 2ZPXA 4UBGA 3ZXFA 2WZR3 1LTEA 1XNBA 5CU1A 3VHOA 5C7GA 3K51A 5FMOL 1BYHA 2LM3A 1N3OA 3TOJA 3NW4A 1TNFA 4DMIA 4XF9A 4WM7C 5F39A 3LDBA 4W65A 1YLLA 5BNPB 4NRMA 1K12A 1QDCA 2XXZA 4MSVA 2RG4A 1UOGA 4NOTA 3ZXJA 4YW6A 1WCUA 4I09A 3W9AA 5CBLA 4BXSV 1PGW2 3VDDB 1SACA 2MNGA 1V6IA 5KHGA 3IIIA 1R1A3 1RUG1 5JPNB 1PO12 5AFBA 1FAYA 1RUG2 3NJXA 3OD0A 3FLRA 5L9RA 4QGLA 4D6SA 1DGRN 1LB2A 2G19A 5G05L 3APBA 5BNQA 2WC2A 4AEMA 2HKXA 5CB7A 1UYZA 3GALA 3H3LA 4E2QA 2UY9A 3ZXGA 2QVSB 5T50A 3URFA 1XRUA 1APNA 5T5OA 3I54A 4YW7A 1AXYA 5EIYB 4Q0UA 5JSPA 1AYM1 1ULEA 4HSJA 1AYM2 1JOJA 2YPJA 1R1A2 3ZIXA 4LQRA 1GNYA 2A6YA 3FJSA 2NM1A 2JDPA 4BH9A 4YZ5A 4Z07A 5DZEA 4FTEA 1Y9MA 3C2UA 1X7NA 3HBZA 2D40A 3M70A 4OI1A 4AVBA 2FDGA 2E9QA 4FFIA 1UMHA 1MEC1 5FCCA 4U36A 4CEWA 3LF7A 1JZ4A 2D6PA 3T09A 2WNUB 2V4AA 3KQRA 3VUOA 3H1MA 2Q30A 4B7EA 4G4FA 1FOD1 2WO1A 2CYFA 3DF0A 4LKEA 1FPN1 4LHLA 1FOD2 1HN0A 2JKBA 3VBUC 1LHVA 1FPN2 1WKYA 2WZ8A 3BU0A 5I0TA 1O8PA 1VBE3 1ZNPA 3WP4A 3WW3A 1X8MA 1VBC3 2PAMA 3KD4A 4JKMA 3FN9A 4O7XA 4IW3A 2DF7A 2E63A 2V5DA 1UOFA 1DZRA 1DYKA 1PNFA 1YFYA 2B5HA 2DUOA 5A3WA 5A3LA 4FSJA 2QZ3A 3SH3A 4XILA 4QWNA 5F5QA 3AL5A 3OYWB 2F6BA 3AC0A 1ZRFA 1LHWA 3POBA 3V0AB 4N53B 5LBEA 1LGNA 1V70A 3DXTA 1RUNA 2R16A 4W4ZA 1VBD1 4FOVA 4BOWA 2VBBA 4C0HA 1VBD2 1VBC2 5F1RA 1S0BA 4MXVA 3BOPA 1CGPA 1S2KA 5FPUA 4JGYA 3D3AA 4AGRA 3A0NA 1YQ8A 2WKKA 2BWAA 2W08A 1GP4A 2BGOA 3HQUA 4PIXA 5LRSA 3NAPB 4K6BA 4RS5A 4DINB 5JXIA 4MYEA 4Z2WA 3RYRA 3POJA 4P9WA 2GNDA 4P5HA 1N3QA 2P3KA 4XQ4A 2D3SA 3UGFA 1LHNA 5T5LA 2BP6A 4K8FA 1W6MB 3E97A 4MLOA 2VG9A 1WWYA 4MXWB 5F32A 1CZSA 4EYUA 1Y43B 3U37A 1K5MB 3EJKA 4YVSA 1H2NA 4GJZA 3MPBA 2JENA 1W8OA 4R4XA 1D4M1 3WT3A 3K48A 3W20A 5A7QA 1D4M2 1RUE1 3FHQA 3K4AA 4KWJA 4XMAA 5JSRA 2BZDA 2FMDA 4UFMA 1V6NA 1VB2A 4GB31 1LOFC 1NCQB 4GB32 1GR3A 5FUPA 2ZEXA 4A3XA 1YNAA 1F35A 4AHYA 1OVSA 3M1HA 3ZFEA 4LKDA 4I0WB 2WSVA 4XMIA 4DO0A 1WLWA 1SFYA 3TWIA 2Y0OA 3J9SA 1LRHA 1SLBA 2VPVA 1AL0G 1W99A 1JU3A 2IUWA 4Y4YA 1XYOA 4QQ2A 4XIKA 2YMZA 2QQKA 5D8AC 1JZ7A 2DVBA 1YQCA 2Y0IA 3IDCB 5CFCA 3KF3A 4GD4A 1W0PA 5T3NA 4NVPA 4PLOA 3N7KA 5LA2A 2GC3A 5DAWA 3BI3A 5FZOA 4UBHA 4NIDA 4XBLA 2Z4FA 3PTYA 5EWSA 3ZKYA 1AUYA 1DDLA 3B7MA 2DURA 3JB8A 2HEWF 2NPIA 3HMYA 2XLAA 4Y24A 4XCBA 3WQBA 1RJ7A 5GLZA 4AAXA 3IZOA 2ZGPA 4FBFA 4Y1XA 2BFUL 2W52A 2WO7A 3TRSB 5FZ8A 1ALYA 3S30A 2Q1ZB 1L7QA 5IVYA 3RPQA 5A1LA 1GMMA 3THTA 2PLV1 4YG3A 1VE0A 2ZAHA 4PF1A 2PLV2 3AJYA 4CCJA 3GF6A 1NY71 3CBNA 4QQHA 3CZJA 4M3CA 1XE7A 4I3GA 1MVQA 5IUQA 4FOQA 4RD7A 4LT5A 2RS11 1E5IA 1KDKA 4H7LA 4XYXA 4MGZE 5JOZA 4OHYA 2EAKA 4YFWA 3EXUA 3RMYA 3KCYA 3VBHC 1BCXA 1ULFA 5FUNA 2LTNA 5FZDA 1WGPA 1Z7S1 2D6NA 4FT8A 1G6NA 5FQ0A 2UURA 1ZRDA 5IK4A 4LLFA 4CUAA 1XB9A 1W9SA 1HRI1 2VQUA 5C8CC 3H3ZA 1OT5A 1HRI2 3FZ3A 4QM8A 5A70A 5A3NA 5FMCA 4LNVA 5FRAA 1GQGA 3RQ0A 4EWEA 5A7PA 4E9KA 1YYNA 4CDWB 2O8OA 2VUAA 4Q8KA 4NIGA 1T2XA 1DZQA 4XQWA 1MZ6A 3BIWE 4HPKA 1GKBA 4QPYA 5ABJC 4BZ4A 1AJOA 4UFKA 4W50A 4YZ4A 4ZU7A 4BA6A 1UN1A 4LO4B 3WNLA 3KWVA 2OKXA 1LOCA 1ZZ8A 2B4KA 1BMV1 3FUQA 2XJVA 1OURA 1OOPC 3OUHA 4EV0A 1BK0A 2R043 1GZCA 2QNKA 2RV9A 5A7SA 3PLQA 3SC7X 5GZCA 4IDZA 1O5LA 5F8PA 1OVPA 4GKXA 3S5QA 3LGRA 1BK1A 1RXFA 4NAOA 1YI9A 3B94A 4AGVA 4QM9A 1GSLA 1DBNA 5FOJB 3NNJA 1OC1A 3WD5A 5FO9B 1UY0A 3JUUA 1VBB3 4PBOA 3UKTA 4C0BA 3FL7A 1KS5A 2VTFA 2YV8A 4MGSA 3L2HA 2I2SA 2C1FA 3PUIA 4F7ZA 2A3YA 4RL7A 3KV9A 1LKNA 2NZ9A 2GC1A 4L2NA 3DKWA 4NIIA 2D3PA 3M8LA 3OGGA 4BLIA 4TLGA 1IQDC 2ILMA 4U2AA 5EJ3A 2Y6GA 1MQTC 3RJRA 4AI3A 3C7FA 2RE9A 3CU7A 1UZZA 3POIA 4CXWA 2HLEA 1MS1A 3S0MA 4G9SB 3C7GA 5APAA 3E6CC 2JG9A 2J1RA 3MLKA 2BNOA 5H9RA 3WCSA 1K3IA 4DXSA 3D0SA 1T6BX 1IG0A 3DEMA 3J7MA 4L99A 5FYCA 5LBCA 3VGIA 5J37A 1XC6A 2XLGA 4FPEA 2DDUA 2WYSA 4KWUA 4FXGB 5LA9A 2ZHNA 3M3QA 4H3WA 3FFQA 3KGLA 2BVBA 1FT9A 2Q5TA 1DLLA 4OUSA 2W92A 1DGWX 2IC1A 5F5AA 1ULOA 2XBO1 3U75A 1QEXA 4CXXA 4YRDA 4Q5OA 1OUSA 2HJIA 5FZ9A 4HSLA 1Z0HA 5A3PA 4IEZA 4IE0A 1IS6A 1WMDA 1XQNA 4S2GA 2V73A 3ZIWA 5IVJA 1J83A 2ORXA 1UX7A 2GALA 1MZEA 1VBA3 1KGYA 1WLDA 2YROA 3IT8A 3KCXA 1XYPA 3VBOC 5LY1A 4ZZ8A 4M3CE 1JYCA 5A7NA 1C8NA 3VD4A 4WM8C 4DUVA 2WA3A 2RHPA 3T0DA 2ZGMA 2ADDA 2B39A 2GSYA 1CAVA 1MACA 1OLRA 3ZFGA 3RZGA 5L19A 2VVFA 1PZ9A 4K8RB 3ILFA 1RVF1 1GU3A 5ANQA 4INDA 2ZX0A 2R32A 4XDOA 2DCTA 2WQZC 3CJIC 3ZVXA 4JGZC 3MIHA 3ZKUA 5BNPA 2JB4A 4YZ3A 3RJ2X 3R0RA 4S2HA 1VBA2 3P3PA 2JG8C 3N9OA 4EQVA 3W58A 1JU4A 2JDKA 1AXKA 2QQWA 2QZ2A 2RR11 4YW1A 5CG9A 5AVAA 2RR12 3VDDA 4CDUC 1W6QB 3IIAA 1IS5A 2RDRA 1AL23 4TSVA 1W03A 4XFFA 2BDRA 1ASJ1 3JZVA 3ZO0B 1JOBA 1LR5A 2C9KA 1ASJ2 2GAUA 1ENXA 1V6OA 3MV01 4Y3OA 5EXOA 3WVJA 1BVVA 4BQ4A 4BQ3A 3WDWA 2G9GA 2ID4A 3Q8EA 3MV11 5FK8A 3E5UA 2KA3A 1ZRIA 4Y1ZA 1S2EA 1PM4A 3FLTA 1W2OA 4AEDB 1MR5A 2PAEA 2W94A 3WF2A 2EIGA 4K40A 5F3EA 5T5JA 3RYPA 1W8TA 1WMEA 1A78A 2ZABA 5FP7A 4LEJA 2WN2A 2YBKA 2W3JA 1NZIA 2WNVC 4AOCA 3GHMA 1JW6A 1HB1A 3VBRB 2XUMA 5KHIA 3N36A 3LIGA 2GNBA 2WR9A 1SBDA 3WZ1A 1PMJX 1GUIA 1H2LA 1LHOA 4JKLA 2IWGB 4WZFA 4IEVA 3SCGA 4DXRA 2WBKA 3BIEA 1S0GA 4CP0A 4QPGC 1WD3A 2DCYA 2DVGA 1WLCA 3E6DA 4E27A 1LJ7A 3OUJA 4IV1B 1OXCA 2WNUA 1EV11 1PK6C 3PURA 4CEYB 1HIXA 1EV12 1X82A 2AUYA 2WLPA 4R4ZA 1OQ1A 2NLRA 3LQCA 4FPYA 4OZXA 4Q8LA 2R7EB 1ZRRA 4CCDA 3I2OA 2XMLA 1B35B 3ACIA 4XXAA 1RMU3 3BB6A 1NLSA 1ND2C 1XNKA 3A4UA 2VO5A 2VOWA 2IVIB 3NVCA 3FLPA 2FQPA 5I0RA 3OYWA 1VRH3 1POV1 4GQ7A 1NQJA 3MBWA 3OJBA 4K21A 5FBJA 2VMGA 3V0AA 4IQPA 4LBQB 2V4VA 4XF1A 4AFBA 4QX1A 3ZYBA 4GWIA 4Q4Y3 5FK7A 5A6ZA 4FTSA 4YW2A 2RM23 5IVBA 2MPFA 3W5MA 3SH4A 2VL4A 3D82A 3OBTA 2E32A 1QNWA 2VOVA 1C8M3 4X6QB 2PHXA 2Y60A 4NJ4A 2K2SA 2VQTA 3NAPA 1AZDA 2QDRA 3LE0A 1UY4A 2JDHA 2ADEA 4I3PA 4YFZA 2H6BA 1LOEA 2VMIA 4IGOA 1DCSA 3IMNA 2FMYA 3MHZA 4Q4W1 1W6MA 4XFBA 3ZYPA 5KC5A 3LCPA 3UYJA 2GP5A 4MXWA 4CP9B 1J1LA 4LA2A 4M3CF 3ZYGA 1K5MA 2D6OX 3ASIA 4XE9A 2AH2A 1CESA 4QB1A 4DS0A 1C8M1 4PF5A 2RJKA 2RS31 1C8M2 4A3ZA 3NL1A 2RS32 1A8DA 1W6OB 2EIEA 4I02A 3SISA 3I3DA 3DKQA 4N90A 2XGXA 4BHPA 1J84A 4Y4RA 1NCQA 3OD4A 3BTXA 4URAA 5F2WA 3PVEA 4D69A 5DUUA 3OOXA 1G8WA 1J3PA 3A7QA 3AZWA 4Q26A 3VD5A 1O3QA 1ZRCA 1IPJA 3W59A 4COWA 1YRZA 4TWTA 2OS2A 2WINB 3F2ZA 1XSRA 4NPMA 5C6CA 1I5ZA 1CZVA 1H8VA 1QMJA 1U5YA 2B9UA 1NA1B 3ZX7A 4P14A 4EWAA 5EFUA 5C9AC 4OHZA 5FPXA 2QQOA 2J7MA 4NHKA 1US3A 1T6GC 4CEWC 4CYDA 2W39A 4P00B 2VE1A 4F83A 3PIGA 2UU8A 4ZXKA 3HN3A 3VHRA 2JE7A 2VR4A 2Y6LA 1REEA 2LS6A 3DXUA 3BODA 1NQDA 4HONA 5IK7A 3HAGA 5FY4A 1ZREA 1A6CA 3TEZA 3W5NA 4UXAA 3WOGA 3JQXA 1HQWA 2VCMA 3HIFA 1RYYA 2WWSA 3VBFB 4TYSA 3CDZB 2VVEA 1P8JA 3I59B 3VKOA 3T30A 4AAPA 4OULA 2YU2A 1OMIA 1NX9A 1PIV1 2CL2A 4YM0A 3AZVA 4Q0VA 4BE3A 3U4SA 2FDFA 5CYYA 2K9ZA 4NAMA 5GLUA 3I97A 1C4RA 2XH6A 2WN3A 4IEQA 4A41A 5JDBA 1F2NA 1Z78A 2XHKA 1WCDJ 1U5IA 2XLFA 5BV6A 1QDOA 2GNMA 3DCQA 4JGYC 1XOYA 1BVP1 4KQ7A 2WA4A 3OG2A 1O59A 4EE2A 1H6YA 1S2BA 2O0OA 4ZY9A 4RS5C 1C57A 4CU6A 3NJYA 2VC9A 5CZKA 4CE8A 5C3PA 3DV8A 4L8QA 2QQVA 5GLVA 3CMGA 2BQPA 1CX1A 3ZSKA 2YBSA 4JDNA 3T2OA 3MDPA 2TEPA 1OLQA 1J1TA 3BVCA 5JR2A 4A7KA 4CDWA 4XDQA 1COV1 3K4DA 3K4ZA 1COV2 4YVSC 4XUQA 2VM9A 4OCTA 1HW5A 5I91A 4Y22B 3MF6A 4AGGA 1ULCA 3G7DA 1QJX3 1AR81 1YO8A 4OUEA 4AQ6A 2P6CA 3ES1A 1C28A 2VVDA 2XKOA 5J7MA 5JMOA 1W3VA 1RHI1 2ZOEB 1RHI2 2ZGKA 1LULA 5ACA3 4PI0A 4XACA 3POFA 5E89A 3ZFEC 4E4ZA 3B69A 1SMVA 4Q1RA 3PVNA 1JN2P 1V00A 1W0OA 4OHVA 1LAJA 4DUWA 2WABA 3LIHA 4QD2A 1J59A 5CNAA 5E88A 3U07A 1OH3A 4FCAA 1DIWA 5FKCA 1F4AA 2CAVA 3M3OA 4OI2A 2FCVA 4RSUA 1QJX2 3B00A 3BOWA 5CFCC 1PO23 1OF4A 2X10A 4B7KA 2UWBA 2HWC3 4ISRA 5EYXA 4XOGA 4YNIA 3SKJE 3FMGA 2FCUA 1RXGA 4PHZA 2IVJA 3K2OA 1QJFA 3BN6A 1EAH3 2J22A 4DRRA 2BERA 4A4AA 3GHNA 5KXEA 1Q56A 1SBFA 5CG8A 4PJYA 3ZSMA 5IVVA 3PU8A 4Q0SA 3U4XA 4NPLA 4QXBA 3OUIA 1ZVFA 3PDQA 4P08A 5CKQA 3POWA 5FZ3A 5K7PA 3GZTB 3QACA 4WVWA 2RDSA 3ROUA 1V0AA 4Q0PA 3EMRA 5FOBB 4R9AA 1IKPA 1GP5A 2MHFA 3RZMA 4DOUA 3I2GA 3U10A 1WLTA 3HNBM 3DN7A 1SLLA 2GP3A 3WQ1A 2W1SA 3UV9A 3Q8BA 4AHXA 1TNRA 1TMF3 4IUGA 4XJWA 3IM0A 1LEDA 1IPSA 2VXJA 5FUIA 4XBQA 1PHMA 1C1FA 3TNPB 4QX7A 4LITA 1W2AX 4GMP1 2OYZA 4C1XA 5J36A 2WYFA 4ZS2A 1AR71 1YQ2A 1YHFA 5J3UA 1AR72 4S2DA 2PHLA 4D7TA 2EA7A 2VZPA 1VALA 4PIYA 4MO3M 1GWLA 1R64A 2R0FA 2GH2A 3L9JT 3SEEA 5LBBA 4KH9A 4WZCA 5CA6A 4LTAA 2UWCA 4EWDA 1Q5OA 1O6UA 3UGGA 1TMF2 5A3MA 1G9BA 1J58A 3NJVA 1DF0A 3S6PA 1OQEA 4KWLA 1SPPA 3MIGA 1W8HA 4QDRA 1H30A 4QDQA 1D2QA 4B1LA 1J3QA 2XVLA 4KI5M 3UT0A 3VZNA 3AMMA 2YC4A 2X8KA 1HV1A 1IOAA 3MIBA 3OBAA 1RINA 4LBLA 1JHNA 2VMDA 1BLZA 3LWCA 1UW8A 2NYYA 1ULPA 3WG3A 3WW1A 1UAIA 2VTXA 1RUG3 1REDA 4OFGA 4BWOA 4LBOA 1W6QA 4HK8A 2AREA 3LD8A 5FZ1A 1I5PA 3P1IA 1I3HA 4AQTA 4IEXA 4C90A 2VNRA 3NKGA 1NXMA 2JD9A 3CJXA 3GZAA 4UF0B 4AI1A 3KQ4B 4AXOA 2FDKA 1WW7A 4AZZA 2R0HA 5E8AA 5A1FA 5FDBA 3PIJA 2VAUA 4KNCA 3LOBA 1KRIA 3N35A 4CCNA 4Y1VA 3ZXKA 3AB0A 1C1LA 4LPLA 4JTNA 4AEDA 1HRV1 2O8QA 3VHPA 3O1MA 1AYM3 1N1VA 1HRV2 4YZ1A 2TNFA 2KD7A 3K46A 2D7FA 1LESA 2VCAA 2Z79A 4N9IA 2DCJA 5FPBA 5FZMA 4YVWA 5I0UA 3O5SA 1XNTA 2C26A 4MOAA 5FPVA 4L11A 5DAXA 2GN3A 3MPPG 1JZ3A 2A7AA 1CX4A 3VBRA 4FXKB 4M00A 1Q3EA 1IHMA 2DUQA 2JG9C 4DIQA 4QPIB 1MEC3 2XHNA 3O12A 4GWMA 2CSGA 4AG4A 1SLCA 4LHNA 3V64A 3ZYIB 4I30A 1U5ZA 1UD1A 3N7MA 3EO6A 1UXZA 4CEYA 4IV1A 4E4DX 5HCAA 1QGLA 2IXCA 2PMWB 3WF4A 3IMMA 2D93A 4XAAA 2GDFA 1FOD3 1AF9A 2KM2A 3HN1A 4XDPA 1FPN3 3ZDSA 2ZGOA 2XL7A 5LASA 4QX5A 3VKNA 4AHWA 5FZ4A 2ENRA 1B35A 3OF1A 2TUNA 5JIUA 1Q8QA 1KDMA 4QB2A 3I8TA 3CLPA 2VZOA 3F95A 1IQAA 2ERFA 1MEC2 3SITA 4ASLA 2D6LX 4IEPA 1YCIA 3GCWA 3IBMA 1YFWA 3AYAA 5FR3A 1QQP1 1MZ5A 5CISA 3VN4A 1QQP2 5SV5A 2R061 4CCEA 3AP5A 1AHSA 1SZBA 5JSOA 3E5QA 4LBQA 3BKZA 1S1AA 3KT4A 2B46X 2E31A 3ZFGC 1VBD3 3RWNA 2E26A 1ZZ6A 5SV8A 5FLJA 5FKBA 4OLLA 1R091 2C5DA 3WEZA 4NR1A 1RC6A 1WD4A 4BQYA 3LSEA 4M4RA 2CNAA 3NNFA 3RDIA 2QQPA 1FX5A 1DYOA 1HJGA 1UXXX 1ZZ7A 2BNNA 5E1RA 5BNPC 1SQ4A 2JDMA 5J96B 2B7YA 4LUKA 4IE7A 2YZ4A 4X8NA 1O7FA 1RUF3 3I2KA 3VDDC 3TAYA 3WV6A 5FPAA 4URTA 2VNVA 3ZLIA 1S0CA 3ZSEA 1UU4A 3ACHA 4LO6B 1SLAA 1NYWA 4LOTA 4NIAA 3OPZA 2HEYF 4CP9A 5JXJA 2UYAA 3NSTA 2EICA 4N9HA 2XJPA 4XQDA 5FZEA 1QU0A 4H14A 3MGUA 2P2KA 2SBAA 2X29A 3VD3A 2VW0A 1D4M3 5B2GB 5J09A 1RUE3 2HWD1 5EP9A 1TVGA 1EUTA 2D6MA 3T2TA 1W6OA 4GB33 2PHWA 2O1QA 4BYYA 2X5IB 3BTYA 3KT1A 4FFGA 1RUF1 1GWMA 2WQ4A 4MX3A 2VUCA 1RUF2 1WA4A 5FWEA 4H2AA 5JPMB 1LU1A 5IWFA 1GQPA 1NKGA 1AR91 2QCSB 2BEOA 1MPXA 1AR92 2BOJA 2ZHLA 5FO7B 1CJPA 2F17A 5I8SA 1LODA 5A80A 2VZQA 4D3WA 3GXUA 1KJLA 3VBSB 5B4NA 3VLBB 4FOWA 4OMDA 5A3UA 1POQA 3LOIA 5HPOA 1NA1A 2ZEZA 4Q0QA 1RUE2 2BU9A 4IXLA 5FZGA 1RUI1 1MS0A 3ZYHA 1RUI2 2HWB3 2GZWA 2WNUC 4EN7B 3H42B 4NO4A 2BTVC 3H0OA 2P5BA 3PMEA 5E16A 5K4LA 1VPHA 4DZGA 5IHRA 4PDWB 1DZTA 4R9DA 3AMPA 3VL8A 4AHZA 3KHCA 2BBVA 5FXZA 3LEIA 1TE1B 1SDDB 2XG3A 5A7WB 4AVSA 2VZRA 2YGMA 3ACLA 1UF2C 3VBFA 1QOSA 4ZKTB 3OEBA 4N7UA 1M4WA 2C6SA 3C7EA 3I59A 4XFAA 3SQOA 5BNOB 4JTOA 1EPWA 2HBTA 4QKNA 1OA3A 1CAXB 2HWB1 2W91A 4YW5A 2PLV3 2XJSA 2HWB2 1OHFA 4A44A 4CUBA 2L9LA 4N53C 2VMEA 3AVSA 1H2MA 4JHZA 4XFIA 3WG4A 2YB7A 3ETQA 3C7OA 2RS13 3MIFA 1XNCA 2YGLA 2G9FA 2YC0A 4JX0A 2W1UA 1GWKA 4FP3A 3GYDA 3OSDA 3KHBA 4I2OA 1UKRA 3RSJA 1Z7S3 5C4WB 1PVC1 1UY3A 2ZGUA 2VW1A 3NAPC 4MZUA 2Z42A 1F5JA 3ZXAC 5AFEA 5BNNB 5LA1A 4RR3B 1UYXA 1HRI3 4DXTA 4FFHA 4EJRA 1OBNA 4D94A 4NE9A 1NY72 1V6LA 4GKYA 2ZEYA 3UJOA 1JS9A 4C8DA 1QY4A 3BTZA 4W6WA 4ATFA 1ZM1A 1QXRA 3VZOA 2RS12 1K5MC 1RTVA 3N9QA 4X6RB 2Q8EA 3USSA 4Y22A 5A7OA 4MHUA 2W95A 4XUOA 1Z7S2 5LK5A 1QJZA 3LDRA 1D2SA 3H8UA 3MF9A 1NXD1 1NCQC 4CPBA 5H9PA 5IK5A 3BUCA 1IZ3A 1CZTA 2FZ1A 1GICA 2EALA 3S7IA 1HXS1 2LW8A 3ACGA 4LHSA 2NMOA 1BHGA 3V56A 3MEPA 1IKQA 2ZACA 2AGSA 3AZYA 5K0UB 4N43B 3ZXEA 1CWPA 3OPTA 1UPIA 2W47A 3O1PA 4F3JA 4QXCA 5CFDB 3ALQA 5FV3A 1BMV2 4JV4A 1MZFA 4HN0A 4XJZA 1E5RA 2ZX4A 1W2NA 4FOYA 3PUAA 4XF3A 1JZ2A 4AYUA 4HZFA 4NPRA 5HI0A 1FV3A 3ME2A 5F3IA 1OA2A 4X8PA 3SMHA 4FPFA 5DPNA 4J1XA 3EQEA 3UK9A 3MW4A 4LJHA 4YM2A 5IK8A 2R071 2ORZA 4Y26A 4ZU5A 3NNMA 2R072 2OIIA 1PX3A 1UU6A 4KG8A 2OXBA 1KJRA 2W9XA 2EXJA 2J1SA 2QDNA 5GM0A 3THCA 5CAZA 4AF9A 1W8WA 3U14A 2P3JA 2JDYA 2P17A 4RFRB 3HNMA 4PCRA 1DU3D 2VU9A 3DL3A 3LDKA 1HX6A 1FYUA 2PHDA 3EBRA 3OGSA 3K77A 4CCLA 1QH6A 2ZHKA 4B3NA 2BGCA 3WDUA 1V9U1 2JEMA 2XBO3 4B4PA 5LA0A 1UMIA 4OI4A 1BJQA 1V9U2 3DYMA 5LEJA 3ZR5A 1OH4A 1CR7A 5JLVA 5ANNA 3B9CA 4QU1A 4OI0A 2DVAA 1XE8A 3SNMA 3KGZA 1PNGA 2ZKLA 3LA2A 1YUDA 2OVUA 4HVQA 1H6XA 2RMU1 1Q43A 1BXHA 3MO4A 4RGAA 2RMU2 3NMBA 2HBUA 3D6EA 4GH4B 2ZA9A 1JZ8A 1PVXA 3I49A 4PLNA 2AEZA 2EVXA 1US2A 4I0BA 4QX8A 5A6YA 5AC91 4QKFA 4ZU4A 3INAA 3RZHA 4FP2A 4CDWC 4MGKE 1FXZA 3WY6A 5HV4A 2XBO2 1RVF3 2X53S 3JD71 4D7YA 5FYBA 2CU5A 3JD72 1CONA 1MVEA 2B9VA 3WP3A 1G9CA 1AYN1 4BU2A 1G86A 4TN7A 1AYN2 4MGTA 4KBZA 5IFPA 1QIQA 4KGGA 4R52A 1TEIA 2RR13 3MW2A 4Y1YA 4CRQA 1SLIA 4LKFA 5LB6A 2XKPA 4IEUA 2RS51 5EZWA 1STMA 3ILNA 4A45A 2RS52 1ASJ3 1JYIA 2QQUA 1W6PB 4IEYA 1SEFA 4ISQA 2WT0A 2NP0A 4AL9A 3RRDA 1RVF2 3AL6A 3ZFFB 2R6QA 4ZONA 1SPPB 5FYUA 4AQSA 2XQRA 4UI9L 4Z1VA 2QFEA 4UF0A 1WCSA 2ARXA 1KEXA 4XC9A 4M4PA 2A1XA 4AR2A 1GOGA 2A6XA 1NCRB 4UFLA 1GYKA 5FZHA 3H8XA 4OVEA 4RFT0 3D4KA 2WO3A 4HBNA 1ENQA 4QHBA 2BJSA 1JTZX 2Z5WA 3GDBA 5DQ0A 1O3TA 2VJXA 2X09A 4AI9A 1SLTA 1F5FA 5DZGA 4QPIA 5FP8A 4ZHNA 4K9SA 5H9QA 5L9VA 5JOXA 4UW3A 3KCCA 5A3OA 4YG6A 1EV13 2DVFA 2PELA 4HMZA 1UZVA 4DEQA 2HH9A 2EIBA 1DGWA 4LO7A 3KF5A 5JCTA 1OPOA 4LK6A 5DAVA 3S7EA 3JB4C 1LCLA 4YVWB 4JC1A 4EN8B 3HEIA 4DB5A 4EZHA 3RVHA 4BDVB 1W3XA 4D6RA 4YYOA 1WA6X 4PQ9A 2PA7A 3JCIA 1X36A 1H4HA 3MFCA 3T0BA 3KZ4C 4LORA 2YFZA 3GNEA 1FMD1 1SCSA 1W06A 4NN0A 2JE9A 2A5ZA 4N8MA 4ONUA 1W28A 3DYOA 1POV3 3DPRB 1H9WA 4LO8A 2PTMA 3OPWA 4P9YA 2BV4A 3ACFA 4JDOA 3CIHA 3SH5A 1XU1A 2PHFA 1KFUL 3THPA 4CDXB 4PLMA 5FP9A 4JHTA 4OUMA 4EN0A 3TEYA 3VKMA 2Z2SB 2E51A 2J1EA 3ZMNA 3J8F1 3WF3A 2JKXA 5FFOC 1EY2A 3J8F2 2A3XA 4FAGA 1UOJA 4LBKA 2BVVA 2VQ0A 2X05A 4A7YA 5DAPA 2BRTA 3PU3A 4CVUA 4P9JA 2MEV1 3NV2A 4SBVA 1WW5A 2XUEA 1UZYA 3B5LB 3BU7A 3AM2A 1N1TA 5FY7A 3V65A 1WMXA 3T0AA 1K42A 3X29B 5FWJA 1LOBA 3CF6E 5BXXA 3ZXLA 4Q4W3 3RG0A 3GBWA 3FHAA 5IVEA 2BBAA 1RUJ3 3U1XA 4A42A 4Q4V1 3H8RA 1LEMA 1KXGA 2D6KA 1YIFA 2SLIA 3POGA 4IE6A 3K3NA 4FI9A 4CTEA 2RS33 5C9AB 3HR9A 1F31A 2VZSA 4UYBA 4XABA 3WDXA 1UZ0A 1O8SA 1CPMA 1H9PA 3KV6A 4IV3B 4QXHA 4AEDC 4NHMA 2X5IA 3R4DB 4XETA 1IS4A 5GZGA 1ZBA1 1MS9A 3USUB 1ZBA2 3JQWA 3H7YA 4NUBA 4CU8A 1UQXA 4F8AA 4QX0A 1XJAA 2WT2A 1GANA 4Q4W2 5FIXA 5C5TA 1ND3B 2P6HA 1RUJ1 3ZMOA 5A33B 3IDAA 4M0NA 1IS3A 1RUJ2 3VBRC 3NNGA 3ZR6A 2QBXA 1RIRA 4C1WA 1DQ6A 5BY5A 2I45A 2JB8A 3VBSA 2BNMA 2YFUA 3LA3A 2OX0A 2PAKA 3E1F1 2R1DA 3P5BA 3B01A 3NKTA 3WLUA 3S57A 1E57A 4XURA 2WS91 1YIPA 4CCMA 2WS92 4CEYC 4IV1C 1N1SA 5LCWL 2Q0AA 1GZ9A 4KU7A 1RUD1 3DGTA 1RUD2 4HVOA 2JIJA 5I93A 5FP4A 1O4YA 1H1AA 4PDWA 3I2DA 1EPZA 1LOAA 4H7MA 4MH0E 2XONA 4HFSA 1B35C 2LRPA 1J3RA 5A7WA 4BQ1A 4LXLA 4Q2FA 2HWE1 3LEGA 4YG0A 2CTVA 1RITA 2HWE2 2DFCA 1LGCA 2OZJA 3LAGA 2JDNA 5DUVA 3SLIA 4AEKA 4UW6A 4BMEA 5LZ6A 4QU2A 5BNOA 4AK3A 2ZX2A 2XJRA 1ENRA 1PIV3 4DY3A 5JZGB 4EROA 1CAXA 2P37A 4B29A 3H50A 5D2AA 5C8CA 4FQZA 3O7OA 2PHTA 3POYA 3CEWA 3H8OA 2ZGSA 1RJ8A 1W04A 4XBNA 2Q8OA 1TQ5A 4LBQD 4RQPB 2A6VA 3I7DA 1Q8SA 2I07B 3W21A 3ES4A 4ZZ5A 3RI9A 3AP4A 4QB6A 1PMIA 2CDPA 2H0VA 3ZXDA 3I3MA 3PJYA 4AWDA 2XVGA 1LECA 1W8ZA 5C4WA 3LA7A 3HBKA 2ET1A 4J25A 3WINE 2XR4A 5BNNA 1PIV2 1OFSA 1REFA 2CGOA 4RR3A 3Q8FA 3UJQA 1RUC1 1GV9A 3UKNA 5L7OB 3PMSA 2D44A 4IL7A 5DXDA 3WDYA 1L7LA 4NIHA 1JYXA 4YGEA 1COV3 3J7LA 2VZUA 1JMUB 2HWF1 3OGJA 4ITCA 4K3UA 4CDQB 2CGPA 2HWF2 1ZZ9A 2Y6KA 4LE3A 5EQUA 5JIAA 4AFCA 4ET7A 2FZ2A 4LULA 3BALA 2NN8A 4FPGA 4WBBA 3KMHA 4WVMB 4XUTA 5IVCA 5IYYA 1AR83 3BCWA 3WNXA 1BBT1 1C5IA 1OSGA 2ZMLA 3NWKA 4AE2A 1BBT2 1RHI3 4GMP0 2VGDA 2OQ6A 4AFMA 3WX5A 3KM5A 4NHLA 5GKAC 5JMCA 5C3SA 3VHNA 3UNPA 2Y6JA 5FPLA 4R9BA 4PQQA 1MQTA 2ZS6B 1OFNA 1WW6A 1KFXL 4ES8A 4AVVA 2B8MA 3VKLA 2P1BA 2WLQA 4UFIA 3UETA 4BQ5A 2ARBA 2ZGQA 3WF1A 4UOJA 4ASKA 1YXWA 3IWZA 3S5AA 5K0UA 4N43A 4HETA 5FMBA 5FTTC 1NA1C 5IVFA 2G1MA 1YI7A 4D6QA 4TLFA 5EJ1B 1AR82 2JWPA 5FZLA 5C3OA 5HBAA 5CFDA 1NLRA 1KD7A 1LNSA 3R4UA 1R081 2VXRA 4MUVA 3ZM8A 1R082 5I8TA 1UU5A 4FPLA 3MI8A 4Q1PA 2IFRA 2NMNA 5A6XA 1FV2A 3IAQA 1UIKA 4M0HA 1Q8OA 5CEHA 3O1TA 3VBFC 1JXNA 4LO5B 4Y33A 5DG1A 1O3SA 4EN9B 2LROA 4DNYA 1OI6A 1JYNA 1QJEA 3ZSJA 1ODNA 5ERLA 4BPZA 5DZFA 2HEVF 3VB9A 1OLMA 3HOBA 5FLIA 4O9GA 3U11A 4D7SA 3AMQA 3WSOA 1NE4A 2RJ2A 3LPFA 3HT2A 3MW3A 3D0JA 3LB9A 5KHJA 1JHJA 3KVAA 2OZ6A 1H8TB 1PM7A 3N9LA 2C4XA 1OD3A 3ENRA 1QJU1 1RUH3 2JECA 3ABZA 2A71A 3KV4A 4YW4A 1QJU2 1XYNA 4EZ4A 1JYVA 4COUA 1ZZBA 2EXHA 3A22A 2VY0A 2VECA 3ORJA 1NZCA 1N1YA 4GMP3 5FY1A 1BKZA 2PFWA 2Q1FA 1QOOA 3AXEA 5GJ6A 1AR73 1U0AA 2YYOA 4COZA 5FYIA 4GH4A 1KITA 3IB3A 3WDVA 2Y6FA 1W90A 1ONAA 1LHUA 1N3PA 2D43A 2JE8A 2OUHA 3ELNA 2DTWA 3FWEA 4TTGA 1OKQA 2W0XA 4QQPA 1X9PA 5IATA 2ARAA 2VBDA 1RUH1 3HJRA 4OYUA 3ZN5A 1RUH2 4WM7B 2JXAA 2YUEA 4LBMA 3RZLA 4ORFA 4ASMB 5IJRA 2LALA 5FZFA 4LIVA 2GH8A 1W6NB 1QNYA 2G9ZA 4Q4X1 4Q4X2 3PUHA 2EXKA 4HL0A 4Z2AA 1AXZA 5T55A 3B02A 1W05A 1ZBE1 5KR7A 5A32B 3ZYRA 3MZHA 3SCHA 1O3RA 3CNAA 4YW3A 1W9YA 3ZSLA 4JQTA
chains in the Genus database with same CATH topology
1W6PA 1WUVA 2JD4A 2C9AA 3ZFFA 3J4UH 2D5HA 4O9EA 2Q4SA 4J6GA 5GALA 3WUCA 2JX9A 4AI8A 1Y9QA 3C3VA 2HYKA 5JI9A 3JU9A 1NCRA 1HRV3 2ET7A 4AI2A 2YY1A 2ETEA 1DGLA 3WP5A 5DUWA 1ZZCA 3AFGA 1QXJA 5GZDA 3PVBB 3IPVB 4AVTA 2ZMNA 4UW5A 3KSCA 3AKSA 3AP7A 2QE3A 1QOTA 2V09A 4KBBA 4RGGA 3AKTA 3FHIB 5DUXA 1R1ZA 1URXA 4AEJA 3VBUB 4JDMA 1UPSA 5KHKA 1AJKA 1QF3A 5LEKA 4P9LA 1RGSA 3CL1A 3AP6A 2A6ZA 2F4PA 1FNYA 1H0BA 3ST7A 1QQP3 3AYEA 4ATEA 3DPRA 2R063 1PGW1 4HKWA 2WFF3 1D0HA 3FC0A 1PO11 2A73B 4LE4A 3ZN4A 2CAUA 4CDXA 3N7LA 5KWRA 2DCZA 1C3HA 2WZR1 5L36A 2WZR2 3M2MA 1QH7A 4FQ4A 5FPZA 4BCUA 3ZYJB 2YXSA 1R093 3OTFA 3H1YA 2NQYA 4OHWA 4AQ2A 1PZ7A 3GBFA 1VLNA 2R062 3RS6A 2WFF1 4XFGA 2WFF2 1R1A1 3LSDA 4B4QA 1BEV3 3WXPA 2BYVE 2VUJA 4LA3A 2OPKA 3RI8A 5FMOS 4KGQA 1R092 4IEOA 3PNAA 2HWD3 5C9AA 4HK9A 1SBEA 4Q29A 4COYA 2ZJCA 4FPHA 4WVVA 4XIOA 4LUMA 4COVA 4IV3A 2C0ZA 4YSFA 5KXCA 3BPZA 1GNZA 1XXNA 3USUA 3OCPA 1VAMA 4YM3A 3HQXA 2DV9A 3ZN6B 1G7YA 1AR93 1BEV1 1ND3A 2K0GA 1JUIA 5A33A 3S6PA 1BEV2 1IGOA 4FPCA 1HDKA 3FUOA 5D1IA 1CAWB 3AZXA 1G9DA 5D8AB 1W2UA 3QBQA 4Q27A 1WBLA 1AX0A 4QPIC 3KB5A 4XJAA 2HWD2 2UY8A 1TME3 1RUI3 1FNZA 2D97A 4WV8A 5GZEA 4FVVA 1LU2A 4FO9A 3PHMA 4HANA 1H1IA 3E6BA 3TB0A 3B3QE 3TYJA 1DGRA 1HV0A 1VBE1 1VBC1 1VBE2 3TNQA 3WQ0A 5LRRA 1UL9A 3QD6A 2CV6A 1C5HA 4XFCA 1SDWA 1TME1 3VL9A 5AVPA 1TME2 1LGBA 3WG1A 5JZGA 4Y5Z0 2BWCA 5C8WA 1PGL1 4KL1A 1D0GA 1CVNA 1UKGA 4BLJA 1PGL2 2W68A 1KQRA 1FI2A 4QQLA 3M3EA 4RQPA 2CGNA 5HXVA 1QXPA 3VBHB 1CAUA 1IPKA 1I1EA 4I0AA 2WL1A 4META 1H2KA 1VB4A 4QXKA 1PVC3 1S0DA 4W6YA 3KS7A 3TBDA 1VP6A 5BUVA 1L3JA 2E7QA 5C8CB 1LOGA 1MS3A 4AI0A 1YFXA 5F6LB 1YJLA 5L7OA 2Z69A 3EHKA 3N4MA 1RL3A 2WSUA 5T54A 4IESA 2VMHA 4CDQA 5ABJB 2XPJA 3AMNA 2AENA 4R9CA 4WVMA 1QWRA 1PVC2 5T52A 5L73A 3T1MA 4BMBA 4RA0A 1OOPB 5K8SA 2X5IC 3QH6A 3V0BB 2EF6A 5JOYA 3WDTA 4YGCA 4FPKA 1CQ9A 1HXS3 2ZZQA 1V6JA 4HKOA 4JRLA 3DUIA 5GLTA 4H55A 3VBSC 4CP1A 2PYTA 3TN93 5JOWA 5KXBA 1RUOA 3MLLA 1S0JA 1W39A 1RB8G 1NOVA 1YFUA 4YARA 2D5FA 2D98A 1ZX5A 4YM1A 3HT1A 2Q1MA 1VIWB 3ILRA 5GZFA 5I0SA 1MQTB 4PDWC 1HXS2 1VJ2A 1X50A 1BZWA 5KBFA 2A75A 2R073 2FHRA 3FBYA 1D4VB 3M3CA 4K1ZA 3TN91 3HWJA 3B9IA 3TN92 3MFAA 5BNOC 1X33A 3U0ZA 4GWNA 1FATA 3O14A 4I01A 2EXIA 3VZLA 3QLQA 4BM8A 4FTBA 1O4ZA 1V9U3 4K20A 1H8TA 3QH7A 1WMFA 2PHRA 4OHXA 4JRAA 2UYBA 2GU9A 2OA2A 3OY8B 4SLIA 3NV1A 3A0KA 5C4WC 2BFUS 1Q8VA 2OW4A 3VZMA 5BNNC 4XTPA 2RMU3 4RR3C 3VBOB 2BUKA 3BTAA 3R6SA 1M06G 2VNOA 2WNEA 1JUHA 3AKPA 3M7AA 5AC93 1QHDA 2IXHA 2DYCA 4LBNA 4WM8B 1AX1A 4ES9A 3AYCA 2R1BA 4GA9A 5DDJ3 3JD73 2QKDA 2AZ5A 2PN5A 3FE5A 2GN7A 3JBG3 4WM7A 3CJIB 1AYN3 2QJVA 4JGZB 2CY6A 2XWJB 5GLWA 1W6NA 5J48A 2JG8B 3MLJA 4KG0A 3GBGA 2R041 3SHRA 5FO8B 2R042 4CDUB 1DG6A 2ZGRA 4YZ2A 5AC92 2AR6A 2RS53 2KXLA 3LZZA 4PIZA 4RHV3 4DQAA 5A32A 1DQ4A 1O5UA 5DDJ1 5K0UC 5DDJ2 2Y38A 4N43C 3MIDA 3J26N 2ZCWA 1VBB1 2DUPA 5I8YA 2GMEA 3JBG1 1VBB2 4Z92B 3JBG2 4XFHA 2VW2A 5CFDC 1POV0 2GMMA 4KU8A 1MS4A 2BPA2 1AX2A 5C33A 2RJLA 2A70A 4XJ9A 2AYHA 4RHV1 4DXZA 4RHV2 2WNVB 4Z82A 4TZDA 3IPVA 1VAVA 2ZGTA 1MS8A 4V1PA 2DWRA 3AJZA 4AFDA 2FBEA 1ENSA 3AP9A 4QPGB 3Q9OA 2XVKA 3WUDA 1PK6B 3B93A 4LLOA 3SXWA 5FLHA 1G9FA 4UW4A 4Y1UA 5EV7A 1VR3A 3VBUA 1GZWB 2EAAA 4JAAA 1QJY3 2ZMKA 1Y7BA 3RMXA 1ND2B 3O0VA 2YHJA 3IDBB 2ZHMA 3WCRA 3VV1A 1CIWA 3I4IA 3FBMA 5HCBA 1FMD3 1UIJA 1VBA1 1F9KA 3ATGA 4GH4C 3VKFC 1NG0A 2TBVA 4FPJA 4Y20B 5K9YA 1QJY1 1KS4A 1QJY2 1OA4A 3J8F3 3R05A 1AVBA 2I74A 3GZUC 3H3UA 4XF0A 2IXLA 1PZ8A 2MEV3 1FMD2 4L97A 5TSWA 4GXLA 2H0BA 3AX4A 3HD8B 4E2SA 1JBCA 2E7TA 4MV2A 1OD5A 1AL21 3AYDA 4IEWA 1AL22 4Q4V3 2DTYA 5CVRA 4L92A 2IXKA 3ZFFC 1DFQA 5F9TA 2GMPA 1I9RA 4JVAA 4MGYE 1XNDA 5HCFA 5KHHA 5FAXA 2MEV2 2WJSA 2IFWA 1LOFA 4HT1T 4MGIE 1NCRC 1V6MA 2QUOA 1ZBA3 4C91A 4DY5A 1HQNA 3AKQA 3ZN6A 4PBPA 1DQ1A 4Q4V2 4XTMA 2VNGA 5DG2A 3UL2A 2A6WA 1CAWA 2E6VA 2CWMA 3N3HA 3UKVA 1EYBA 5D8AA 4QGNA 3WR0A 3M3IA 2Y26A 2CWSA 4YGDA 2WS93 4CEWB 4S2FA 1DHKB 4XJ8A 5JVVA 1RUD3 5T5PA 3WHUA 1ULGA 3WG2A 4AFAA 4N53A 2ZGNA 3L2YA 4YVWC 1X8EA 2IXJA 2B45X 4R8HA 2P3IA 4NWWA 1NE6A 4EN6B 1RMU1 1WBFA 2HWE3 1DQ2A 1RMU2 4XJUA 2R49A 2ZX1A 3M4FA 3NO8A 1HKDA 1B09A 1S0FA 3AXDA 1VRH1 4Z8BA 3DPRC 1VRH2 2N7GA 4GALA 3O0XA 1BQPA 5JR7B 4CDXC 4Q4Y1 4JQRA 2ES3A 2RM21 4Q4Y2 2E7AA 2RM22 3VBHA 4JGYB 5KXDA 2ZZJA 2GC0A 3NV4A 2OUJA 4RS5B 2XB6C 5EYYA 1S0IA 3FX3A 3WP6A 1RUC3 2ZAAA 2XL9A 3N7JA 5JI7A 4XW3A 4AVCA 2VH9A 4NWVA 4KWKA 1H4GA 2HWF3 4YVSB 1CAUB 2IZWA 2XJQA 5ABJA 2E53A 1O91A 5H9SA 4DPNA 2ZX3A 5IT6A 1BBT3 1U12A 1OOPA 4IV3C 4XPVA 3PJQA 3ZPYA 4WVZA 1RUC2 4LHKA 3V0BA 1CJDA 3ZFEB 1N47A 3H1WA 1ND3C 3T1LA 4E4SA 2JDZA 3AZZA 4DFSA 4M01A 2XJUA 5JAXA 2B42B 2ZKNA 4J1WA 4DRVA 1U5XA 3O0WA 4CZSA 5BPXA 5CFCB 1CN1A 2ZBJA 4HKLA 5FBZA 4N7IA 1H1MA 1R083 4IERA 3VZKA 3VZJA 3MIEA 4P9GA 1Y3TA 4BIFA 4P9XA 1ZA4A 4YGBA 5LK7B 1QKQA 3AKRA 3WW4A 3H9AA 1S55A 3ECQA 3OBRA 2VOKA 4LBJA 1PGSA 4QGMA 4XZPA 1GLHA 5CIRA 2XWBB 5JZGC 2G4IA 4P9IA 4QMAA 3MYXA 1GFF2 1OPMA 3AK0A 1A8MA 1V6KA 3AFKA 3WW2A 4M3CB 2JICA 2GNTA 1AR63 2VULA 2H6CA 4RQPC 5JWPA 4HLTA 4AW7A 1Q8PA 1OQDA 2WIIB 2DVDA 3P3NA 1QJU3 4IETA 1HQLA 4L9BA 3RNSA 1UCXA 5KC6A 3OY8A 3AMHA 3D5OA 1SCRA 5FQ0B 4A7ZA 2R30A 3MICA 1WW4A 1O4TA 3G6JB 4QT6A 3VBOA 4B4RA 1XU2A 1UMZA 5L7OC 1A3KA 2ATFA 4W6XA 3RYKA 3D8CA 4G3YC 4WM8A 1AR61 3QOPA 4XEZA 1AR62 3IN9A 3IDEA 3PVOA 2JJ6A 3RZZA 1HLCA 4CDQC 4HPKB 4LR4A 2P34A 1ULDA 2BW8A 5J98B 1GBGA 1QJX1 4K1YA 4BIOA 3CJIA 3SCFA 4JGZA 1G9AA 1CD3G 4Q4X3 3KT7A 3NV3A 3NJZA 2JG8A 5ACA1 5ACA2 4CDUA 4MVTA 1ZBE3 3E5XA 1YWKA 4GULA 2V5YA 3CO2A 5BYNA 2GC2A 3QCWA 1WCKA 1S0EA 3IKWA 1DQ5A 4HN1A 2PHUA 4YLZA 2WZPP 4K7JA 1PO21 2D3RA 2DU0A 1PO22 5FREA 2DCKA 4FAHA 2WFPA 2HWC1 5F6KA 2HWC2 1GNHA 1EAH1 1ZBE2 2YDEA 4QQOA 4B8EA 1EAH2 1YJKA 2WNVA 4JCKA 3POSA 2VOXA 2WT1A 2UWAA 2JG9B 3WQ7A 4XHXA 1EP0A 1I6XA 1CPNA 2PQQA 4QPGA 1UX6A 3R4SA 1PK6A 1DQ0A 4XF4A 2IXIA 1SFNA 2ZGLA 2LUWA 1GZWA 2XJTA 3LKJA 2ZTNA 1VAKA 1H8TC 4HVRA 1TMF1 1DYPA 3WHTA 3H7JA 4XHBA 1ZYBA 1ND2A 2VQAA 3FFZA 4FPOB 1MS5A 4GIQA 2A3WA 2DU1A 4CP2A 4XXPA 1LENA 1JH5A 3KLSA 1GQHA 2DFBA 4A2UA 1PO13 4Y20A 4E2GA 1CAVB 5CADA 3ZFGB 2ZPXA 4UBGA 3ZXFA 2WZR3 1LTEA 1XNBA 5CU1A 3VHOA 3K51A 5FMOL 1BYHA 2LM3A 1N3OA 3TOJA 3NW4A 1TNFA 4DMIA 4XF9A 4WM7C 4W65A 1YLLA 5BNPB 3ZXJA 1QDCA 4MSVA 4NOTA 4I09A 3W9AA 5CBLA 1PGW2 3VDDB 1SACA 2MNGA 1V6IA 5KHGA 1R1A3 1RUG1 5JPNB 1PO12 5AFBA 1FAYA 1RUG2 3OD0A 3FLRA 4QGLA 1LB2A 1DGRN 5BNQA 3APBA 2WC2A 4AEMA 2HKXA 5CB7A 3GALA 4E2QA 2UY9A 3ZXGA 2QVSB 5T50A 3URFA 1XRUA 1APNA 5T5OA 3I54A 1AXYA 4Q0UA 5JSPA 1AYM1 1ULEA 4HSJA 1AYM2 1JOJA 2YPJA 1R1A2 3ZIXA 3FJSA 2A6YA 2NM1A 4BH9A 4YZ5A 4Z07A 5DZEA 4FTEA 3C2UA 1X7NA 3HBZA 2D40A 3M70A 4OI1A 4AVBA 2E9QA 1MEC1 5FCCA 4U36A 4CEWA 2D6PA 2WNUB 3VUOA 3KQRA 3H1MA 2Q30A 4B7EA 4G4FA 1FOD1 2CYFA 3DF0A 1FPN1 4LHLA 1FOD2 2JKBA 3VBUC 1LHVA 1FPN2 5I0TA 1VBE3 1ZNPA 3WP4A 3WW3A 1X8MA 1VBC3 2PAMA 3KD4A 2DF7A 2E63A 1YFYA 1DZRA 1DYKA 1PNFA 2B5HA 2DUOA 5A3LA 4FSJA 2QZ3A 3SH3A 4XILA 5F5QA 3OYWB 2F6BA 1ZRFA 1LHWA 3V0AB 4N53B 1LGNA 1V70A 1RUNA 2R16A 1VBD1 4FOVA 4BOWA 4C0HA 1VBD2 1VBC2 5F1RA 1S0BA 4MXVA 3BOPA 1CGPA 1S2KA 4JGYA 4AGRA 3A0NA 5LRSA 2WKKA 2BWAA 2W08A 4PIXA 3NAPB 4K6BA 4RS5A 4DINB 4MYEA 3RYRA 4P9WA 2GNDA 4P5HA 1N3QA 2P3KA 4XQ4A 2D3SA 1LHNA 5T5LA 4K8FA 1W6MB 3E97A 4MLOA 2VG9A 4MXWB 1Y43B 1K5MB 3EJKA 4YVSA 1H2NA 3MPBA 2JENA 4R4XA 1D4M1 3WT3A 3K48A 1D4M2 1RUE1 4KWJA 4XMAA 5JSRA 2FMDA 1V6NA 1VB2A 4GB31 1LOFC 1NCQB 4GB32 1GR3A 4A3XA 1YNAA 4AHYA 3M1HA 3ZFEA 4I0WB 2WSVA 4XMIA 1WLWA 1SFYA 3TWIA 2Y0OA 3J9SA 1LRHA 1SLBA 2VPVA 1AL0G 4Y4YA 1XYOA 4QQ2A 4XIKA 2YMZA 5D8AC 2DVBA 2Y0IA 3IDCB 5CFCA 1W0PA 5T3NA 4NVPA 4PLOA 3N7KA 2GC3A 4UBHA 4XBLA 3PTYA 5EWSA 1DDLA 1AUYA 3B7MA 2DURA 3JB8A 2HEWF 2NPIA 3HMYA 2XLAA 4Y24A 1RJ7A 5GLZA 2ZGPA 4FBFA 4Y1XA 2BFUL 2W52A 3TRSB 3S30A 1ALYA 2Q1ZB 3RPQA 3THTA 2PLV1 4YG3A 2ZAHA 2PLV2 3AJYA 3GF6A 1NY71 4QQHA 4M3CA 1XE7A 4I3GA 1MVQA 5IUQA 4FOQA 4RD7A 4LT5A 2RS11 1KDKA 4H7LA 4XYXA 4MGZE 5JOZA 4OHYA 2EAKA 4YFWA 3EXUA 3RMYA 3KCYA 3VBHC 1BCXA 1ULFA 2LTNA 1WGPA 1Z7S1 2D6NA 4FT8A 1G6NA 5FQ0A 2UURA 1ZRDA 5IK4A 4LLFA 1HRI1 5C8CC 3H3ZA 1HRI2 3FZ3A 4QM8A 4LNVA 5FRAA 1GQGA 3RQ0A 4EWEA 4E9KA 1YYNA 4CDWB 2O8OA 2VUAA 4Q8KA 1DZQA 4XQWA 1MZ6A 3BIWE 4HPKA 1GKBA 4QPYA 5ABJC 4BZ4A 1AJOA 4YZ4A 4ZU7A 4BA6A 1UN1A 4LO4B 1LOCA 1ZZ8A 1BMV1 3FUQA 2XJVA 1OOPC 4EV0A 2R043 1GZCA 2QNKA 3PLQA 5GZCA 1O5LA 4GKXA 3LGRA 1BK1A 1YI9A 3B94A 4AGVA 4QM9A 1GSLA 1DBNA 5FOJB 3WD5A 5FO9B 3JUUA 1VBB3 4PBOA 3UKTA 4C0BA 1KS5A 2YV8A 3L2HA 2I2SA 2C1FA 4F7ZA 2A3YA 4RL7A 1LKNA 2NZ9A 2GC1A 4L2NA 3DKWA 2D3PA 3M8LA 3OGGA 4BLIA 2ILMA 4U2AA 5EJ3A 1MQTC 3RJRA 4AI3A 2RE9A 3CU7A 1UZZA 3S0MA 1MS1A 4G9SB 3E6CC 2JG9A 3MLKA 2BNOA 5H9RA 3WCSA 3D0SA 5J37A 4L99A 3VGIA 2XLGA 4FPEA 4FXGB 2ZHNA 3M3QA 4H3WA 3FFQA 3KGLA 2BVBA 1FT9A 2Q5TA 1DLLA 4OUSA 1DGWX 2IC1A 2XBO1 4YRDA 2HJIA 4HSLA 1Z0HA 4IEZA 1IS6A 1WMDA 1XQNA 4S2GA 2V73A 3ZIWA 2GALA 2YROA 1MZEA 1VBA3 1WLDA 3IT8A 3KCXA 1XYPA 3VBOC 4M3CE 1JYCA 1C8NA 4WM8C 2WA3A 2RHPA 2ZGMA 2GSYA 2B39A 1CAVA 1MACA 1OLRA 3ZFGA 5L19A 2VVFA 1PZ9A 3ILFA 1RVF1 4INDA 2ZX0A 2R32A 2DCTA 2WQZC 3CJIC 3ZVXA 4JGZC 3MIHA 5BNPA 4YZ3A 3RJ2X 3R0RA 4S2HA 1VBA2 3P3PA 2JG8C 3W58A 2QZ2A 1AXKA 2RR11 4YW1A 5CG9A 5AVAA 2RR12 3VDDA 4CDUC 1W6QB 3IIAA 1IS5A 1AL23 4TSVA 4XFFA 1ASJ1 3JZVA 3ZO0B 1LR5A 1ASJ2 2GAUA 1ENXA 1V6OA 3WVJA 5EXOA 1BVVA 3WDWA 2G9GA 3E5UA 2KA3A 4Y1ZA 3FLTA 4AEDB 1MR5A 2PAEA 2EIGA 4K40A 5T5JA 3RYPA 1WMEA 1A78A 2ZABA 4LEJA 2WNVC 3GHMA 1JW6A 3VBRB 5KHIA 2XUMA 3N36A 2GNBA 1SBDA 3WZ1A 1H2LA 1LHOA 4WZFA 2IWGB 4IEVA 3SCGA 1S0GA 4CP0A 4QPGC 1WD3A 2DCYA 2DVGA 1WLCA 3E6DA 4E27A 1LJ7A 4IV1B 4CEYB 2WNUA 1EV11 1PK6C 1HIXA 1EV12 1X82A 2AUYA 2WLPA 4R4ZA 1OQ1A 2NLRA 4FPYA 4OZXA 4Q8LA 1ZRRA 1B35B 4XXAA 1RMU3 3BB6A 1NLSA 1ND2C 1XNKA 3A4UA 2VOWA 3NVCA 3FLPA 2FQPA 5I0RA 3OYWA 1VRH3 1POV1 4GQ7A 1NQJA 3OJBA 4K21A 2VMGA 3V0AA 4IQPA 4LBQB 4XF1A 4AFBA 4Q4Y3 4FTSA 4YW2A 2RM23 2MPFA 3SH4A 3D82A 3OBTA 1QNWA 2VOVA 1C8M3 4X6QB 2PHXA 2K2SA 3NAPA 1AZDA 2QDRA 4I3PA 4YFZA 2H6BA 1LOEA 2VMIA 3IMNA 2FMYA 4Q4W1 1W6MA 4XFBA 3ZYPA 5KC5A 3LCPA 4MXWA 1J1LA 4LA2A 4M3CF 3ZYGA 1K5MA 2D6OX 3ASIA 4XE9A 2AH2A 1CESA 4DS0A 1C8M1 4PF5A 2RJKA 2RS31 1C8M2 3NL1A 2RS32 1A8DA 1W6OB 4I02A 3SISA 4N90A 2XGXA 4BHPA 1NCQA 3OD4A 3PVEA 4D69A 5DUUA 1G8WA 1J3PA 3AZWA 4Q26A 1O3QA 1ZRCA 1IPJA 3W59A 4COWA 1YRZA 4TWTA 2WINB 5C6CA 1I5ZA 1H8VA 1QMJA 1U5YA <