2KD7A

Solution nmr structure of f5/8 type c-terminal domain of a putative chitobiase from bacteroides thetaiotaomicron. northeast structural genomics consortium target btr324b
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
159
structure length
159
Chain Sequence
MGTTISKSGWEVLSFTTQEASGEGAGNGLAKCLIDGDTETFWHAKWQGGSDPLPYDIVIDMKQNIQIAQVELLPRGRGSNNPIKVVEFAASEDNVNWTPIGRFGFTNQDAALEYYVKSIKARYIRLTIPDDGGNSTVAAIRELDVKGTIINLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Putative chitobiase
publication title Solution NMR structure of F5/8 type C-terminal domain of a putative chitobiase from Bacteroides thetaiotaomicron.
rcsb
source organism Bacteroides thetaiotaomicron vpi-5482
total genus 36
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2009-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2kd7A00
1GQPA 3BN6A 3LPFA 1PMHX 1WKYA 1L7RA 3GXUA 4JKKA 4QB2A 4P02B 5LCWL 2W9XA 3HNMA 4XUNA 5IHRA 4OMDA 3CMGA 2B4KA 4A45A 4DUWA 2VJXA 3WNPA 3WNNA 4A41A 2W1WA 3HOBA 4E8DA 2ID4A 1US3A 3LQCA 3T2QA 2E32A 4MGSA 1SDDB 2ZEZA 2W46A 3ETPA 2W1UA 4E8CA 3C8XA 3I3BA 3IIIA 2EICA 4KMQA 2YB7A 3WNKA 4QPWA 4M4PA 3SEPA 4P08A 1KGYA 1GOHA 5HPOA 1RYYA 1XPWA 3HNYM 3I3DA 1UXXX 3WF4A 5G05L 2E33A 2VZSA 3HN3A 1DP0A 1GOFA 4QDSA 3LEGA 3FN9A 4XURA 1PX4A 3ABZA 1OF3A 3A22A 3OB8A 3MO4A 2E26A 5JXHA 3HEIA 1K3IA 2RJ2A 1BHGA 1NX9A 2QQMA 5F7UA 1JU3A 1DYOA 4ZXEA 1T2XA 3OGSA 2Y6JA 1UX7A 1ULPA 1JYXA 2WO3A 4W4ZA 2VMCA 2J1SA 4QX1A 3UESA 2WZEA 2Y6GA 3CDZB 5B4XA 4QX2A 3DYMA 1I5PA 2J22A 5DMYA 2VC9A 1JU4A 1UY2A 3VDAA 3PUIA 2LS6A 1UZ0A 4CU7A 5EJZB 3EYPA 1UXZA 3CZJA 2BBAA 3VD9A 1JHJA 4TXWA 2QQNA 3IB3A 1GMMA 4DEQA 2BZDA 1NUKA 1OF4A 2ZEXA 2E31A 3GDBA 1H6YA 4ZZ8A 4OUEA 3WEZA 3SEEA 2J7MA 4A4AA 1EUTA 3DECA 5IFTA 1US2A 2VZ1A 1PX3A 2VZTA 5JR2A 1GNYA 1K42A 5J1XA 2W47A 4MOAA 2WAOA 5A1AA 5LA2A 3THDA 1KEXA 4ET7A 4LKSA 1UYZA 2YFZA 3MV11 3FHQA 4LPLA 2Y8KA 2J1VA 2W1SA 1JYNA 4ARXA 3I2FA 3C7GA 2VZ3A 4FI9A 2VZVA 2ZXQA 2PQSA 1JZ7A 1UWWA 3CKHA 4ARYA 2YC2A 2QBXA 4OYUA 1CZVA 4BDVB 2CDOA 3VD4A 2EIDA 3D3AA 3UNPA 1JI6A 1W9TA 3WF3A 3HPNA 1UY3A 3FL7A 5C70A 4QX3A 2JE8A 4DXRA 1UY1A 4P5YA 2R7EB 3I2GA 3T0BA 3VD5A 3T0AA 2BGPA 5CYYA 2DDUA 3WQBA 1F4HA 2EIBA 3IAPA 3MBWA 2QQLA 3EB7A 3T2OA 1UYYA 2VR4A 4P00B 4AAXA 5JUVA 2QQIA 1SG3A 3THCA 2ZEYA 2BGOA 2WO1A 4GWIA 4MGQA 4D8MA 2LW8A 4GWJA 2Y6HA 5HXMA 3WSOA 3J7HA 4DUVA 2XQXA 2YFUA 1NKGA 3ACHA 5IYYA 3ACIA 4A44A 3T2PA 2X05A 3A21A 5DQ0A 2WDBA 3GM8A 1JZ2A 2EIEA 4XUQA 2DCJA 2VQUA 2Y6KA 4CU9A 4Z2AA 2W1QA 3WF0A 4ZZ5A 2ORZA 3T08A 4HG6B 3DYPA 3W5NA 2VZRA 3GGLA 3VD7A 3OGVA 2WYSA 1K12A 1MPXA 4DUXA 1K45A 1XNTA 3OBAA 1O8PA 5DPNA 2VO5A 2J1AA 1UY0A 4MO3M 2JDAA 5G04L 5EJ1B 4DEVA 5IJRA 4KI5M 3JXSA 2XOMA 3WF2A 2W95A 3ACGA 1L7QA 2XHNA 2VL4A 2HLEA 3E1F1 5DN2A 3OEAA 3LE0A 4QDRA 3MUY1 4A42A 3LEIA 2RVAA 5IFPA 1XC6A 4QX0A 3K75B 3IDAA 4W50A 2VCBA 4CU6A 3MV01 4RYDA 4CVUA 3I2JA 4JKLA 3BGAA 4BJ0A 1YQ2A 4UOJA 1OH4A 2VMDA 4AG4A 2VCCA 3NRUA 3ZM8A 3ACFA 3C7OA 3K77A 4BXSV 3W5MA 2WQ8A 2XONA 2W94A 1IQDC 2WBKA 3K4AA 3I2KA 4CUAA 4OZOA 2WO2A 2WAAA 2WUHA 4CUBA 1CX1A 1CIYA 4XZUG 1UYXA 3OEBA 2VZQA 2WZ8A 3VD3A 1UMIA 1JZ4A 1TVGA 4CUCA 2V5DA 2X10A 3LPGA 1W8NA 2WN3A 1UMHA 2QQKA 2VQTA 1JYVA 2KD7A 4QB1A 3UETA 2J1EA 3C7HA 4JKMA 4XUTA 1H6XA 4JX0A 4QB6A 2CDPA 5FUIA 2RV9A 3K4DA 3OG2A 2W92A 1J84A 1GU3A 2VMEA 3SKJE 1JZ3A 3NNGA 4PF1A 4DXTA 4CU8A 1SHWB 5JXGA 4PQQA 1W8OA 1XNAA 2VZUA 4LHSA 3DYOA 2QQJA 2WABA 1W9SA 2YG0A 3A23A 1NAEA 1D7PM 3NJXA 4UAPA 3SKVA 1OD3A 4YPJA 1CZSA 3MUZ1 5I0DA 3VDBA 2W91A 3IAQA 3PUHA 1JZ6A 2C26A 3C7FA 1J83A 3NQHA 1JYWA 4A3ZA 3A7QA 2ORXA 5JXIA 3WNMA 1HN1A 2B9VA 2VZPA 3HJRA 5C71A 5LA1A 1ULOA 4LQRA 3T0DA 4D0QA 1UY4A 3WNOA 4TTGA 1GUIA 5LA0A 3HNBM 1CZTA 2C9KA 1TG7A 1JZ8A 4KWUA 1F4AA 4BK4A 1LNSA 1GOGA 1W99A 3I3EA 3K4ZA 3LEKA 4ZY9A 2Y6LA 3I2IA 2W3JA 2WN2A 3AC0A 4GZ9A 3I97A 1O8SA 2W5FA 2Y64A 3CZUA 3OGRA 2YC4A 3F2ZA 5C7GA 2X09A 2VOTA 1JZ5A 1EUUA 1OT5A 4IUGA 4UI9L 2V4VA 1WCQA 3P1IA 1P8JA 3T09A 2JKXA 2L9LA 2HYXA 4XVHA 4QAWA 3VDCA 3FHAA 2VM9A 3NJVA 2OKXA 2DCKA 4XUOA 2Z4FA 2JD9A 2QQOA 5EIYB 1DLCA 4DXSA 4PT6A 4OMCA 1R64A 3CQOA 4RN5A 4XUPA 3K46A 3P6BA 2VZOA 2VMFA 2J1RA 1PMJX 3CIHA 5B4NA 2J1UA 5CZKA 4BK5A 2V72A 3WNLA 4W8JA 4M4RA 5JMOA 2J1TA 2VTFA 3U37A 3ECQA 1W0NA 4A6OA 4QDQA 2BERA 2W87A 5JXJA 1W9WA 4L0PA 2VCAA 2C4XA 1O59A 2ZEWA 3C7EA 4MADA 4JHZA 3WF1A 3I2HA
chains in the Genus database with same CATH superfamily
4D7YA 1W6OA 5ERLA 2HWB2 2W68A 2WJSA 4KG8A 3BN6A 3U14A 4EQVA 1QJX3 1COV3 4UFKA 2RM21 5FKCA 1UPIA 2YPJA 5FRAA 5FZHA 1V9U3 3DXTA 3GXUA 2WO7A 1RUE3 3NL1A 2RS53 2Q30A 1AR71 1VBE3 1R091 5F3GA 5FPAA 4XBNA 5FZLA 3BIEA 3AP9A 3KF3A 3WNXA 4NO4A 3R05A 4C90A 2JG9C 3OPTA 2VJXA 4GB33 3WHTA 1KFUL 4HN1A 4XZPA 3WNPA 5KXDA 1RUI2 1PO12 4NIDA 3GCWA 1KDMA 4E2QA 3HOBA 1VIWB 3TNPB 1V70A 1LHWA 4K1YA 4S2GA 3VBHB 3LQCA 1ZZCA 3POFA 4Q0PA 4BE3A 1XRUA 3IMNA 3U11A 2MEV2 5IVYA 1G9FA 4F83A 4IEZA 3FC0A 1C1FA 1VBD2 5IUQA 4IV3B 3IIIA 1EAH3 2BWCA 1ZM1A 1JYIA 3AZYA 3ZKUA 5FMCA 1EV11 4NVPA 1YRZA 3ZN5A 1POQA 1K5JA 3WDXA 4XCAA 1C4RA 5FREA 3WQ7A 3NKTA 3RMYA 1HN0A 1KGYA 2AENA 1VRH3 3M3IA 3WG1A 2ZCWA 2D43A 4EROA 3ZXDA 3JD72 1XPWA 1RUG2 4FPOB 4FPCA 1N1VA 2JDPA 5G05L 1V6LA 5EZWA 3AMQA 3U78A 1QJY3 1Z7S1 1NXMA 1Z0HA 3FN9A 2IXJA 3H3ZA 4MLOA 4RQPB 4A7KA 1IS6A 3SLIA 5D1IA 1UIJA 2GC3A 4I0AA 4P9JA 3RI9A 1PX4A 5FYIA 4YW6A 3NV1A 3V0AA 1LGBA 2JG8A 1VB2A 1W6PA 1O5UA 1TMF3 2VUDA 1T6BX 2FCTA 1XXNA 3WDVA 1FAYA 3MO4A 1RITA 1XE0A 2E53A 3K3OA 2ADDA 2BDRA 4KGQA 3UT0A 2E26A 2A5ZA 2FMYA 2OUHA 1YFUA 2Z2SB 4FCAA 2WFF3 4Y3OA 5L73A 3SHRA 4GMP0 4Q4W1 1V6KA 2E7AA 2RJ2A 3VBOB 1UNBA 2G9ZA 3WVJA 5J48A 2NPIA 1ND3C 2EALA 5F7UA 3FZ3A 2WS92 5F2WA 3K2OA 3N9MA 2B42B 2Y6JA 1L3JA 2FQPA 3EJKA 5DUUA 1JYXA 1GKBA 4E4ZA 3H3UA 1UN1A 5FPVA 2Y6GA 2ZX2A 1YXWA 4QHOA 5GLZA 5JOYA 1RUC1 2EIGA 5DMYA 1I5PA 4FPFA 1AYN3 1S2EA 2YZ4A 1NE4A 3KV9A 3NVCA 3AMPA 3MF9A 4PDWB 4XE9A 1F35A 1CAWA 2E7QA 4ISQA 3ZYHA 1UXZA 5D8AC 5L7OA 1GZWA 1FPN3 5C3QA 3E6CC 2YGLA 1FOD2 1JHJA 4YGEA 3Q8EA 4BMBA 5A3MA 1LOFA 4Q26A 5FYTA 4QPGC 2AYHA 2VOKA 4ORFA 1QGLA 4FPYA 2WNVB 3POWA 1NUKA 4IV1A 1OF4A 5DDJ1 4BIFA 2WC2A 5K8SA 1H6YA 4GH4B 4YFZA 4X6RB 4WZFA 3WEZA 4RHV1 2J7MA 4XJUA 3SEEA 3WP4A 3ZFGC 1AYM1 1CR7A 1Y9QA 4FPEA 2VZ1A 5IFTA 2VZTA 1MZEA 1H2LA 2WKKA 3KVAA 2D3RA 5IVJA 3PLQA 5IVEA 3KF5A 1GWKA 5E89A 4R52A 5J1XA 1ACCA 3DV8A 4LLFA 4MOAA 2NP0A 1RUNA 1UW8A 4ZXKA 2WAOA 2R1DA 4LULA 4ISRA 3BTYA 2WNUC 1QQP3 5LA2A 3H8OA 1JXNA 5GJ6A 3TRSB 5K9YA 2HWD2 5LW9A 3POGA 2FDHA 5FZFA 2V4AA 4LKSA 1C8NA 3DPRC 4HONA 4HSJA 4HSLA 3DF0A 3R4UA 5F5CA 2ZX4A 4LPLA 4PQ9A 1HJGA 2AEZA 1LECA 2W1SA 3OUIA 1NG0A 5C3PA 2VZ3A 4FI9A 3JB4C 2PQSA 1OURA 2QKDA 3WINE 3VN4A 1JN2P 5KHGA 2B46X 1UWWA 2XG3A 4K8FA 4CPBD 1QKQA 1JZ7A 2WT0A 4AF9A 4NUBA 2AEYA 4BDVB 2CDOA 3NW4A 5DZFA 1Q8OA 4I30A 3ROUA 5BNNB 3TEYA 2P3KA 3D3AA 2VUJA 3M8LA 5DZEA 5FY7A 1F5JA 1PGW2 3KLSA 2Q1ZB 3BVCA 5FZOB 3QACA 1ALYA 1UY3A 4IV3A 3WUCA 1HRI1 5A6QA 4GXLA 1WA4A 5C70A 2R6QA 1HV0A 1SFYA 4AQTA 2AC1A 3WD5A 2I2SA 1AXKA 2AACA 4CEYC 5ISLA 1YUDA 3CHXA 4F7ZA 1AR92 2A6VA 5HV4A 5C8WA 2FDGA 1XE7A 1H2KA 4B4RA 2HWF2 3T0BA 3VD5A 1GQHA 3T0AA 5DUVA 1XNCA 3LGRA 3N7JA 5C5TA 4AVBA 4DINB 1FMD3 4FBFA 1CWPA 4N43C 4AL9A 3HD8B 4RQPA 3VKLA 1R1A2 4NPRA 2WR9A 4P00B 1RMU3 4AAXA 4G3YC 1WWYA 4QXBA 1SG3A 5CU1A 3THCA 5C3SA 2ZEYA 1OD5A 5FZ8A 1D0HA 1H9PA 2DFCA 2GZWA 4P9WA 3IIAA 4GWIA 4YW7A 3VZJA 4AI2A 1U0AA 1GP4A 4UW5A 4EZ4A 4GWJA 4UFJA 5HXMA 2VNOA 5CG8A 1MQTC 3ZN4A 4CDQB 1MS1A 3N3HA 2P17A 3OOXA 3VBOA 2A6YA 3R4SA 2RMU1 4QQPA 2ILMA 1ZRFA 3ENRA 2EXHA 4YG6A 4MXWB 5FLHA 3AJZA 1QMJA 5CFDC 3ACIA 1W3VA 4AFMA 4P9LA 3TEWA 1XQNA 1ODMA 2CWSA 3SCFA 3B00A 4IGPA 1Y9MA 1NCQB 4XFFA 1KXGA 2P3YA 2DCJA 2VQUA 1QDOA 4AVTA 5JSOA 4CU9A 3JQXA 4INDA 5HCAA 3AP4A 5JVVA 4BQ5A 2BQPA 3JBG1 5ACA2 4PDWA 2GALA 4BQWA 1POV0 2I45A 1C8M2 2XUMA 4NWVA 3KHBA 1MVQA 1BBT2 4LOTA 3VD7A 1XYOA 3MIBA 2VMHA 4MZUA 2AZ5A 2D5FA 3AP6A 1K12A 4Y5Z0 1K45A 1YQCA 5DAPA 3OBAA 1O8PA 4BQ3A 1A78A 2YYOA 3E5QA 5G04L 2WNVA 1PNGA 2WZR3 2YGMA 1ZBE1 4DEVA 4EWEA 4KI5M 4XW3A 4GH4A 1STMA 1A8DA 1OQ1A 2EAAA 1UKRA 3LA3A 3WF2A 1DZTA 3ACGA 4C1XA 1PK6B 3D8CA 1QOOA 3RSJA 1WD4A 1FV3A 4EJRA 5FPLA 5CFCA 4OQ8A 3OEAA 4IERA 4QQOA 1GANA 2F4LA 3M70A 1PIV2 4PIXA 4BHPA 1RUH2 2G9GA 3MUY1 1TEIA 5A3OA 5FPXA 3VDDA 4J25A 4QX0A 3Q8FA 5F3CA 2YHJA 1QXRA 4W50A 2E63A 4XFAA 4Y33A 4AHXA 4COZA 4Q4V3 2NLRA 1VBA2 2XL7A 2CNAA 4JC1A 4QWNA 4IESA 2WSUA 2Q1FA 2BP6A 3LIHA 4WBBA 3RPQA 4LMFA 2E51A 1SZBA 4FXGB 4QHBA 3VBFC 1Y43B 4XBLA 1NCRB 4AFAA 4EN9B 4AG4A 4Z82A 3ZXKA 2BOJA 2HWB1 1PVC2 3K77A 4FQZA 3LDRA 2R0FA 4BXSV 4RS5B 1HV1A 4D6QA 5BNNA 4P14A 4AVVA 2FDFA 4RR3C 4WM7C 3ZYGA 4Q1PA 4CUAA 2WO2A 1ENQA 1HB2A 4FOYA 5FZOA 2WWUA 4CUBA 5BNPA 2LM3A 2XBO2 4NE9A 4MVTA 3RMXA 4JRAA 3KV6A 1V6JA 2IVJA 3ZDSA 1XE8A 4AFCA 1NOVA 1QU0A 2VTXA 3C2UA 3M3EA 3MYXA 1W8NA 1KJRA 3B93A 4LE4A 2WN3A 2QQKA 1RUI1 1PO11 2FCVA 5GLWA 4B7EA 4NN0A 1MEC3 2YMZA 3AMMA 1RHI2 3OD4A 1JYVA 3S57A 4HOOA 1DGWA 3UETA 1S0FA 4QXHA 5FY0A 3USUB 2J1EA 3ZOIA 1W03A 4QKNA 4JKMA 1CAVB 2MEV1 4O9GA 5A7PA 3OG2A 1VBD1 2A6ZA 3WG2A 3NNGA 1U5XA 5F9TA 5CA6A 4DXTA 5K0UB 5FZ1A 3WW2A 1LCLA 3TN92 5JXGA 5BNOB 2A3YA 5KXCA 3OBZA 1W8HA 4YG0A 1V6NA 2VZUA 3ZIWA 2C5DA 5FP9A 4LHSA 1AX1A 4Z1VA 3VDDB 2QQJA 2ES3A 5FZMA 3SISA 1WCSA 1RUF2 3A23A 3JD71 1RUG1 2HWE2 3AL5A 2CL2A 1OOPB 3WDWA 3IBMA 3S7EA 2BGCA 5FJHA 4HVOA 4AI0A 4BYYA 5A6YA 2MNGA 2RM23 4EN0A 2ET7A 1NA1B 2I74A 5BV6A 4UFIA 1W06A 3KCYA 4LUMA 1XNKA 2CY6A 2IXKA 5FQ0B 1ZA7A 5IT6A 2G4IA 4ASLA 3ZKYA 1R093 5CIRA 3P5BA 1SBEA 3T2TA 1JZ6A 1F15A 1NCQA 3B5LB 5FYHA 3MFAA 2WL1A 2P37A 3A7QA 4XJ8A 1BXHA 1AXZA 2GN7A 4AWDA 2VD7A 3VKMA 5GZGA 1HN1A 3SMHA 4Q4Y2 4LKDA 1CAXB 5GM0A 4IEYA 5C9AB 5LA1A 5D21A 1ZA4A 5EYXA 3NSTA 4TTGA 2WA3A 4QD2A 4MH0E 2WS91 2QZ3A 2DU1A 5EHDA 5IVBA 2QVSB 1X82A 1DQ5A 2HEVF 4KWUA 2VCMA 3V0BB 1QOTA 3NWKA 4CE8A 4CEWC 1EV13 3ILFA 4CDWC 2W3JA 2WN2A 1IPSA 3MDPA 3I97A 2W5FA 2Y64A 3ZXGA 3D4KA 3KHCA 3ZFEB 1PK6A 3F2ZA 3V64A 4MYEA 2ZA9A 2FDKA 1JTZX 4N9IA 2AUYA 4CCLA 1W2AX 1O3SA 1W04A 4AGVA 3A0KA 1Z7S3 1ZNPA 3T09A 3BPSA 4NHYA 2A73B 1S0JA 1FOD1 4XVHA 1JOJA 4K7JA 3VKNA 5EP9A 5FP8A 1CQ9A 4FTEA 4KGGA 4JQTA 2RDNA 3QD6A 1CPNA 4XUOA 3RNSA 2AGSA 2DURA 1KS4A 4AEDA 1DLCA 1QJZA 2JB8A 1LHUA 2YV8A 5LBEA 3X29B 4NIAA 5FP3A 1S0BA 2PHUA 2X29A 4XF1A 3I4IA 4LHLA 1Q43A 5FZ4A 4Y20A 4Q4W3 3DEMA 2VZOA 4U36A 5FIXA 3U10A 2X8KA 4RS5A 3UJOA 4XCBA 1K5MB 4EN6B 5H9SA 3AYAA 3WNLA 5LEJA 3RJ2X 1ZYBA 2RS13 3QH6A 4CSWA 5JMOA 3GBGA 2J1TA 2VTFA 3RQ0A 2XWBB 5FBJA 2W39A 2HWD1 1NZIA 1W0NA 4A6OA 4GULA 5A32B 2DU0A 1RUC3 4AI1A 5A3UA 2Z69A 4M3CB 4MX3A 4DS0A 2VH9A 1JOBA 3KQ4B 4L0PA 4NHMA 3MLJA 4ATFA 2VCAA 1W2TA 4MADA 4DFSA 1QNWA 3USUA 4FP3A 3M4FA 4CP2A 1V6OA 2OPKA 4IEUA 1CAVA 1GQPA 2D98A 4K40A 2VPVA 3LPFA 1BVP1 2XVGA 3B9IA 4H14A 5I0TA 1PGW1 4FAGA 2LRPA 2DVAA 1S55A 1WKYA 1S0GA 1D0GA 1YCIA 3WV6A 3VLBB 3WZ1A 5K0UA 3D5OA 4JDNA 2ZJCA 4JKKA 4YVSB 1S1AA 4AHZA 4URTA 1W6OB 4N53C 5DDJ3 5LCWL 5BNOA 2WYFA 4XUNA 5IHRA 3H7YA 2JDZA 4RHV3 3M3QA 4PLMA 2HYKA 3R4DB 1AYM3 1MR5A 3H1WA 1U12A 4UYBA 4XJWA 1AR91 5FY4A 4JQRA 3ZVXA 4A45A 5J09A 1OPOA 2ZKLA 2HWF1 1XNDA 4IE7A 3WNNA 1OOPA 1RUOA 4OHYA 1NQDA 5FP4A 1VMHA 3KV5A 1OBNA 1NA1A 3FUQA 2OQ6A 1UOFA 1UU4A 4S2FA 2JDNA 3P3NA 2E32A 4MGSA 4YW2A 1R1A1 5FQ0A 1J58A 4FFHA 2ZEZA 3KT7A 3S5QA 3VKOA 1U5IA 3GJAA 1EP0A 1OKOA 4AQ2A 2W08A 1NLSA 2D6LX 4E2SA 3RZGA 3I3BA 3JQWA 2CWMA 3KMHA 4KMQA 5ANQA 4WM8C 5A80A 3T3YA 4C0HA 4KQ7A 5GKAC 1LGCA 4QQHA 3WNKA 4KG0A 3F95A 4FOVA 4HLTA 4OHZA 1ODNA 5C9AA 1CAXA 3ASIA 3P3PA 3SEPA 3PTYA 2ZX3A 4E9KA 4LBLA 1W90A 2KA3A 1QJU2 2K46A 3VL9A 1RYYA 4Y5SA 3H7JA 1DQ6A 3NAPC 2PQQA 2XWJB 3HN3A 1WBLA 1GOFA 2ZGOA 3G6JB 3R6SA 3O12A 2DUQA 3VHOA 3V0BA 4OLLA 1HRI3 3ZPOA 5GZDA 2XJTA 5C3RA 2PMWB 3ABZA 1RC6A 3Q8CA 5E1RA 1W2NA 3CLPA 5F39A 2JDHA 1ENSA 2WNOA 3ZFEA 2OQ7A 4W65A 4ATEA 2GSYA 1H8TA 5ACA1 4PHZA 1GNHA 3FLPA 1C8M1 5ABJC 5JXHA 3O1TA 3H8RA 1PM7A 2JG8B 4LKFA 5L9BA 1BBT1 3ZFFB 2DVFA 2VAUA 2AR6A 2SLIA 1OA2A 2QQMA 4HK9A 5HCHA 1RJ8A 1JU3A 1DYOA 3HT2A 1MS5A 1T2XA 4D3WA 4EN8B 1ULPA 1JUHA 5FOBB 4ONUA 1W8WA 2GNTA 4IL7A 4YZ3A 3VBSC 3WW1A 3UESA 3Q8AA 4UW4A 1RUJ2 3UL2A 3CDZB 5B4XA 4E4HA 1TQ5A 3VB9A 3J9SA 1XJAA 1DHKB 4XFBA 2VC9A 4DIQA 5FPUA 3NJZA 3VZLA 1UY2A 1ZREA 2RMU3 3VUOA 4XTPA 3MI8A 1DG6A 5JAXA 3RYRA 1K5MA 4CU7A 5EJZB 4XHXA 4AEMA 4RFT0 1YQ6A 1PIV1 3ORJA 3VD9A 1RUH1 2OT7A 2WNEA 3BTXA 1D4M2 2ZGQA 5FZ0A 5FZKA 3WP5A 1X9TA 2YXSA 5A32A 4FTBA 3IB3A 4AAPA 4M3CA 4K3UA 1VBA1 1GMMA 4YVWB 5EQUA 3RZJA 2ZGTA 4DOUA 4CCEA 4ZS3A 4L99A 5C6CA 1OPMA 2BVVA 1Q8QA 1VB4A 2VY0A 2E31A 2FHRA 4NR1A 2OS2A 2BBVA 2OPWA 5FO7B 1RVF2 2X5IB 4QMAA 1ND2C 2OUJA 1ZRIA 3SC7X 3MZHA 4A4AA 4LNVA 1H1IA 1MS8A 1HQNA 1PVC1 4YG3A 2F6BA 2Y26A 4GWMA 2VXJA 4BMEA 1GNYA 1F9KA 1VBC2 2A6WA 1APNA 1K42A 4KBZA 2W47A 3L9JT 1QHDA 5C8CB 4Q2FA 3PDQA 2RE9A 1UL9A 2ARBA 3I3MA 2CU5A 2IC1A 4TSVA 4D7TA 5JSPA 1Z78A 2XBO1 3GNEA 4YVSA 1ZBE3 3CEWA 5DUWA 1KEXA 2TEPA 3HVDA 4UXAA 4XPVA 3ZSEA 1CGPA 1UYZA 3FHQA 3AB0A 1DLLA 4B8EA 3AK0A 1BVVA 1YHFA 3UGHA 2XQRA 2Y8KA 1JYNA 3FX3A 3LEMA 4ZONA 1O3TA 1RHI1 2DCYA 4HN0A 3RZZA 2QZ2A 5IAVA 4ARYA 1X8MA 4B4QA 5H9PA 3N9LA 1LAJA 1CZVA 3VD4A 2DBNA 2E9QA 1I5ZA 1PGSA 5F6LB 2TNFA 1EPWA 2VOWA 1LU2A 2EXKA 3KB5A 4FFIA 5FWJA 1HQWA 1GSLA 5JDBA 1WMFA 2VOVA 3TN91 1YI7A 3NV2A 2BV4A 3GCXA 2JE8A 4LO7A 3VBRB 1XYNA 2D97A 2OZ6A 3OPZA 4A7ZA 4DXRA 4P5YA 5I8YA 5KHKA 1RUF1 5BUVA 2HWE1 2HWB3 4QM8A 5I0UA 1QH6A 2PAEA 1LOCA 3ME2A 5FZ9A 2BGPA 5CEHA 2C1FA 5GLUA 2LUWA 2VW0A 4N9HA 1DYKA 2R49A 1ZVFA 2WSVA 4C0BA 5F1RA 1HIXA 3GZUC 1DU3D 5LWBA 3OPWA 2E7TA 1TMF2 1KFXL 2VE1A 4IE5A 5J7MA 3DXUA 1H8VA 2XKOA 3D6EA 1H2MA 1LHVA 1RXFA 2BRTA 4N7IA 2CYFA 2D7FA 3H8XA 2PELA 1X9PA 3FBMA 4QX7A 1RUD2 5JWPA 4ZPIA 3OY8A 1RUI3 1PO13 4Q4Y1 2P6CA 3HBKA 1MS3A 5FY9A 3RS6A 4ASKA 2DYCA 3CJIB 3MEPA 3ZFFA 1IGOA 1O4ZA 4LBOA 4OUMA 2JDYA 4AFDA 3J7HA 1QDCA 4J6GA 3UV9A 1WLTA 2MEV3 2C24A 3AYDA 2YFUA 3LA7A 3DN7A 2VTXJ 4NHLA 1LJ7A 3ACHA 3J7MA 1VBD3 3VZMA 4PI2A 4A44A 3T2PA 2X05A 4QKFA 4CUGA 3HIFA 5A3NA 4AXOA 5T5LA 2WDBA 4YRDA 3VBUB 3GM8A 1JZ2A 2ZMLA 4QPIB 3POYA 2HWC2 3ZR5A 1JH5A 4Y4YA 4Z2AA 4ZZ5A 2Q1MA 4JGZB 3JD73 4HG6B 1RUG3 3SNMA 1Q8SA 1WCDJ 2VQ0A 3CU7A 4JZRA 3W5NA 3ZYBA 2YU1A 5I0SA 2CGNA 4MSVA 4BM8A 5A1LA 3ITQA 1AL0G 1UPSA 3OGVA 4XDQA 1ONAA 3B7MA 4I09A 2XH6A 3IWZA 4PCRA 1MPXA 1QY4A 4DUXA 3AZXA 1XNTA 2XJSA 5IK5A 1BJQA 5BNQA 1VPHA 3OSDA 4YVWA 4LR4A 5L7OC 3BUCA 3EMRA 5M0TA 4FP2A 1HRV2 2WT1A 2ZTNA 5IJRA 1G9CA 3BTAA 3G7DA 2X5IA 3LDKA 1O4TA 5KHIA 1H4GA 2ZS6B 4AQSA 2FDJA 3BU0A 1LOFC 2RHPA 3N35A 2R32A 2XHNA 1CESA 1G8WA 1VJ2A 2G9FA 2R1BA 2ZABA 3OBTA 2VL4A 1ENXA 2QJVA 4YW3A 1DQ0A 4IV1C 1AHSA 2WS93 3OTFA 3OGJA 1AR82 3E6DA 1J3PA 5DN2A 1A6CA 4DO0A 5C8CA 1V6IA 4LO5B 1GWMA 2GMMA 3PVEA 3SH4A 1JW6A 4R8HA 2RVAA 1NXD1 5IVCA 5CFCB 5LATA 2AREA 3MV01 5CKNA 2Z5WA 2GNDA 1SCSA 4XIOA 4QPGA 3I2DA 3KQRA 4S2DA 2QCSB 2IVIB 1WMEA 4BJ0A 4UOJA 3DCQA 4UWDA 1E5SA 3SCHA 4Y24A 2IFWA 1ZRDA 4TWTA 2DVBA 2DVGA 2RS32 3JCIA 4CDUB 1HB1A 1H4HA 2ETEA 3ACFA 4HANA 1LKNA 1FOD3 5F2SA 2ATFA 4XEZA 3QH7A 1RIRA 2EA7A 4LUKA 3MW3A 2YBKA 3KT1A 3I2KA 4OZOA 3OD0A 4XHBA 1FNYA 2GNMA 1FNZA 2WUHA 4YZ2A 2GC2A 2ZX1A 5JI7A 1OI6A 1QJFA 2OX0A 2XJRA 4XZUG 3VBHC 3AZWA 4TZDA 5SV8A 3PVNA 3OEBA 1MS9A 1ZBA2 1UMIA 3VBRA 3ALQA 4XACA 1W9FA 1AL22 4M00A 1TVGA 1JZ4A 5FMDA 4C1WA 3ZXEA 4LKEA 3OUHA 4IV3C 4V2VA 2PLV2 2NM1A 4OFGA 5BNPB 1AF9A 1F2NA 1UMHA 1JODA 1DQ2A 2VQTA 5JZGB 1BQPA 5DAVA 1DGRA 3O7OA 3PHMA 1XYPA 1YI9A 1J59A 3THTA 3ZMOA 1KITA 3ZN6B 5FLJA 1RMU2 1H6XA 2CDPA 4QQ2A 1XB9A 2HWD3 5FUIA 4AEJA 3K4DA 3POIA 4I0WB 4HK8A 4B29A 4Q0UA 1SQ4A 1G6NA 1YEWA 5J96B 4C91A 2GC1A 4RQPC 4LO6B 1W8OA 1LODA 3N36A 3ZIXA 3NNJA 5GLTA 3T1LA 3CJIA 2E6VA 4GJZA 2A3XA 4HZFA 4BQXA 1YFXA 1QJU1 5F5QA 1PO22 2YG0A 3HT1A 3NJXA 2XL9A 4UAPA 5LA9A 3SKVA 1OFNA 4QXCA 2XPJA 1WMDA 3JU9A 3MUZ1 5K4LA 4QGNA 2PHWA 3VBOC 4Q0SA 3VBUA 5KBFA 4QPIA 2PAKA 2DVDA 1LEMA 1E57A 2GC0A 3GZTB 4FOQA 1ZX5A 4M3CF 3NQHA 3FMGA 4A3ZA 3AFGA 1AR93 3TB0A 4JGZA 4AE2A 1IZ3A 1CAUB 4FFGA 1SDWA 2ORXA 3RYKA 3H3LA 2HWF3 4CA9A 5JXIA 3GBWA 3HJRA 4AQ6A 3WHUA 3MIEA 4BQ1A 1ULOA 2PXJA 2O8OA 4LQRA 4XABA 3T0DA 5A7SA 1X36A 4Y1XA 5IVVA 2VUAA 1UO9A 1IOAA 1R1A3 1QXPA 3HNBM 4NHXA 2CHHA 1CZTA 2RJLA 2VGDA 4FFFA 2C9KA 3E5XA 4PDWC 3SH3A 1TG7A 1QF3A 2DTYA 3ATGA 2IZWA 3VKFC 1DFQA 1GOGA 3I3EA 3LEKA 4ZY9A 5FZAA 5LZ6A 1X8EA 1RUJ1 4Q0QA 3J8F3 4FT8A 5FY8A 3LKJA 3SH5A 1OXCA 4IDZA 5FMOS 3O14A 4NJ4A 1EPZA 1W8TA 3PVOA 1UOJA 5C7GA 1RINA 1AJOA 2VOTA 5C4WB 1OT5A 2QQWA 2WNVC 3CNAA 3OF1A 1REEA 1V6MA 4IUGA 4V1PA 4D94A 4UI9L 2V4VA 1WCQA 3WLUA 3KV4A 2JEMA 4GH4C 3P1IA 5FZGA 1P8JA 1D4M1 4Z2WA 3TNQA 1ZZ8A 3EHKA 4TYSA 3VDCA 3OCPA 2P4EA 2PHDA 5AFBA 3PJYA 4YW1A 3CO2A 5A7QA 5FFOC 4PIZA 4BOWA 4CTEA 5FCCA 3MIHA 2BTVC 4QKDA 4DXSA 1H30A 4AEKA 2BPA2 2D44A 4PT6A 5ACA3 5FYBA 1RVF1 2A1XA 4HXCA 3CQOA 3B01A 4IQPA 4XUPA 1W28A 4B4PA 2BYVE 1BBT3 2K2SA 2B7YA 2DTWA 3P6BA 1SLAA 5FYCA 4AEDB 4CDUA 1MZFA 1CJDA 2J1RA 1PMJX 2LTNA 2QDRA 5FMBA 4CDXB 5B4NA 5DAWA 1VBC1 4JCKA 4LBQB 4Y1UA 4LITA 5DXDA 2Q8OA 4BH9A 5A1FA 2ZPXA 2QE3A 4META 3K48A 2ZHMA 2DFBA 1XOYA 2P1BA 1KD7A 4PLOA 4Y20B 2JJ6A 3WX5A 2OIIA 2UY8A 2A70A 2DUPA 5CAZA 2QFEA 3VHNA 3S7IA 4CXWA 4QDQA 5LY1A 1TME2 1LHOA 1UZVA 3UYJA 5BNNC 3M7AA 3Q8BA 4LA3A 5JXJA 4I02A 4L92A 1B35B 3RFRA 1XSQA 3GBFA 4Z8BA 1W2OA 5JZGA 1LB2A 5DAXA 2OVUA 1WLWA 4AHYA 1IHMA 2BWAA 2CAVA 1S0CA 3KGLA 1PIV3 1GNZA 4OCTA 1RUH3 2RDQA 3ZN6A 4GD4A 2JXAA 1N3QA 3PL0A 4N90A 4FPLA 5IATA 5L19A 4XXPA 1PMHX 4SBVA 1VBA3 4UFHA 1W6MB 4CCKA 3DKWA 4ZU5A 3OGGA 4P02B 4YM3A 3JB8A 2W9XA 3UK9A 4FPHA 2Y6FA 1O3QA 1VMJA 3HNMA 4PJYA 4BIOA 3D82A 2FD8A 1F31A 4DXZA 4EWDA 3CMGA 1UU6A 5FZCA 4CZSA 1F8VA 2B4KA 1PVC3 4AK3A 1OFSA 2HEWF 2FMDA 4A41A 2D6MA 2W1WA 4E8DA 2ID4A 3E97A 4HPKB 5FZ6A 3WP3A 3T2QA 3BYWA 4IGQA 1SDDB 4CDQC 3ETPA 2B5HA 1TE1B 1TMF1 5FYZA 4DY3A 3T4HB 4E8CA 5J36A 4M01A 1XNBA 2Y38A 3C8XA 4J1XA 2UURA 2R072 2Q5TA 3U1XA 3PIJA 4C8DA 2H0BA 1RUD1 3ZPYA 3PMEA 1CAUA 4G4FA 1AR73 4M4PA 1RHI3 5C3OA 1NCQC 4JRLA 4P08A 2IXIA 4ZU4A 3UKTA 2GH2A 1GOHA 2JIJA 3LAGA 1IKPA 5HPOA 5GZEA 4IE6A 4EV0A 1FT9A 3TOJA 3I3DA 2YDEA 4O9EA 5FZIA 4X6QB 1DGRN 2VZSA 1JOPA 1DP0A 5FBZA 4QDSA 3LEGA 3S6PA 2NYYA 4OQ9A 4XURA 4UW6A 1W8UA 3TN93 1O91A 1Y9GA 5FMOL 2MHFA 4JTNA 2HWC1 2P2KA 3A22A 3RYPA 2K9ZA 4WVVA 5LASA 1YYNA 4IGOA 5FOJB 2XJVA 5E88A 1RUF3 2HWE3 5C4WA 2GN3A 3I8TA 4XMIA 2YY1A 3HEIA 3QLQA 1K3IA 3WDTA 4LBKA 1BHGA 1BEV2 4OI2A 5JIUA 1PK6C 4NIIA 5IAXA 1H8TB 5EJ3A 2XXZA 4ZXEA 4HT1T 3AFKA 3OGSA 5IK7A 1UX7A 1LU1A 1UD1A 2WA4A 2WINB 2WO3A 1GP6A 3THPA 2J1SA 4BB3A 3AZVA 4WVZA 4QX1A 1HRV1 4NIGA 2WZEA 2ZHNA 1W05A 3LFIA 4PI0A 2ZGMA 4Q4Y3 5FUNA 3SCGA 2J22A 3WT3A 2QQUA 4KWJA 4YGDA 3INAA 1DGWX 4PIYA 2LS6A 4B1LA 4CDXA 4BQ4A 4GQ7A 4LHKA 1AR81 1DIWA 4LBQA 4XXAA 2RS12 4GKYA 2CAUA 3EYPA 4JGYB 2VVEA 4FQ4A 4COYA 2OZJA 5SV5A 5J37A 1O3RA 4N7UA 1NCRC 2NMOA 4XQWA 3KVBA 4ES8A 2BFUS 1PMIA 2LROA 4NPLA 2ERFA 4TXWA 4RS5C 1WW4A 2O14A 3NNMA 5FAXA 4Q8LA 2BVBA 1B35A 2O1QA 2ZEXA 4DZGA 4XILA 2XVKA 1YFWA 3GDBA 4ZZ8A 4JVAA 4OUEA 1CIWA 2ZHLA 4KWKA 4X8NA 3U0ZA 1VAVA 3WOGA 3DECA 2RS31 1LOEA 5FYSA 1PX3A 4LO8A 4X8PA 1VLNA 4UW3A 5AFEA 3BODA 5IW0A 4JHTA 3I7DA 4RSUA 4DRVA 3TAYA 4PBPA 1O5LA 3NO8A 3TBDA 1W6MA 5A1AA 3RDIA 2R042 1Y7BA 1PVXA 3W21A 5AC92 1S4CA 2ZGSA 1ZBA1 1TNRA 1HKDA 5FDBA 1VBB2 2YFZA 1AL21 3IM0A 3MV11 4WVWA 3U75A 5LEKA 1I3HA 3ZX7A 2PLV1 2J1VA 4WV8A 2VMIA 4ARXA 5K0UC 2VBPA 2ZACA 2ZXQA 3POEA 1H1MA 2PHTA 5BNOC 2JB4A 4B3NA 3CKHA 4H7MA 4Q4X2 4BWOA 2R062 4HPKA 1O4YA 1Q3EA 1RMU1 2QBXA 2YC2A 5DZGA 5H9QA 3VDDC 5CKQA 2WLQA 4DRRA 2EIDA 1R082 4K21A 5LRRA 4E4SA 1JI6A 1GQGA 1YWKA 1OOPC 3WF3A 4KL1A 3HPNA 3SXWA 3FBYA 3LOIA 5A7OA 1DQ1A 1NA1C 4QKBA 3ZXFA 1KRIA 3FL7A 2VW2A 2R30A 1FATA 4QX3A 5BYNA 3FFZA 2ZBJA 4J1WA 2C6SA 1SMVA 1UY1A 4L8QA 2KR2A 1UAIA 1ULEA 2R7EB 1PO21 2FCUA 1OLRA 1VALA 2BJSA 4XDOA 3LWCA 4TLGA 5D2AA 2JENA 5EFUA 2EVXA 3O1PA 4LE3A 2VVDA 2XUEA 4H55A 4UFLA 1TNFA 4UT5A 4OI4A 4NRQA 5ANNA 5LBFA 3UJQA 1F4HA 3ZSKA 5C9AC 2QQLA 3EB7A 2ZGRA 4L11A 3LCPA 1UYYA 1U5YA 3O0WA 2VR4A 4MHUA 2ZGKA 5JUVA 4MGTA 1DQ4A 4Y4RA 4Z07A 4OULA 3ZSMA 4A7YA 5C5UA 2JG9B 2WO1A 4CP1A 3ZYRA 5I91A 1VR3A 4D8MA 3O0VA 2ZAHA 3AVSA 3ZSJA 4R9DA 2Y0IA 3GF6A 1HXS2 2JD4A 3POBA 4GMP1 2ARAA 5FYMA 3MIDA 4RA0A 4DUVA 3ZFEC 3H9AA 5JLVA 2K0GA 4CYDA 2XQXA 4XDPA 5A6ZA 3ZXAC 4BISA 3OYWB 5AVPA 3AKRA 4IE0A 5LBCA 3RI8A 3OY8B 4DPNA 2XHKA 3ZYJB 4NROA 4MHRA 5IYYA 3BB6A 1QXJA 4AW7A 4CCNA 5DUXA 2VBDA 3MGUA 3A21A 2QUOA 1IS5A 4MGKE 1C3HA 4YM0A 3RRDA 3S0MA 2XLGA 2ZGPA 1GLHA 4XUQA 5A6XA 4QXKA 2EXJA 4IEPA 4LEJA 4P9YA 4R9BA 2Y6KA 3AL6A 2YROA 4GALA 4JV4A 4QGMA 1QJU3 3WQ0A 5JMCA 1ENRA 5EPAA 5IWFA 3H1YA 3I3QA 3DYPA 3BOPA 4GA9A 2VZRA 2ZGUA 5FR3A 5HI0A 2XR4A 1A3KA 4HKOA 4JGYA 5T50A 1BK0A 3RVHA 2WYSA 3AXEA 2BFUL 4A3XA 1OQDA 1SFNA 4AOCA 4OVEA 1ASJ2 5KHJA 3J4UH 1BK1A 3VHRA 3N9NA 5DPNA 1JYCA 3BIWE 4XQDA 1K5MC 1UY0A 4JAAA 1SBDA 5T5OA 3ZYFA 1D2QA 1GR3A 3BCWA 4D7SA 3IPVA 3J26N 4ZU7A 3N9OA 2Q0AA 3A4UA 4GAZA 2W95A 2RR12 2XJUA 1MS4A 4YFWA 5I93A 1ND3B 1CD3G 3AKPA 4XF4A 5FJKA 3WW3A 5LB6A 1AR62 4QM9A 5LRSA 3S5AA 3CL1A 5T5JA 5DAQA 1OA4A 3JBG3 2V5YA 4FPGA 5FV3A 1A8MA 4UF0B 1YQ5A 3LE0A 3PU3A 1LHNA 4FVVA 3CJXA 3H50A 4XETA 1GFF2 3BU7A 4R4XA 4A42A 3LEIA 3EO6A 1XC6A 1QJX2 1COV2 2IXCA 2QQVA 3ES4A 3K75B 4IETA 2XJPA 3IDAA 2VCBA 1TME1 1V9U2 5F5AA 4QX8A 4RYDA 5FPBA 5LBBA 4HKWA 1RUE2 1G9DA 2RS52 1HJFA 2XJQA 1VBE2 4FXKB 5CVRA 3CBNA 1LOAA 5D8AB 5C71A 3GHNA 4EWAA 4YVSC 1OHFA 1OH4A 1U5ZA 1BKZA 2JDKA 1D4M3 1SBFA 3ZM8A 3GYDA 3C7OA 3W5MA 2DV9A 1UZZA 4GB32 3BTZA 4QPGB 5A33B 2JECA 2W94A 1PGL2 3B02A 2F17A 3T30A 2CTVA 4CXXA 2WAAA 4LIUA 3R0RA 4XFCA 1MS0A 5E16A 1CX1A 1CIYA 4ITCA 4N8MA 3K3NA 1RVF3 2VZQA 5A7NA 3ZFGB 2ZHKA 3VD3A 3KWVA 1IS4A 1EAH2 4H2AA 3N9QA 2X10A 4OHWA 3O1VA 3BKZA 1SEFA 1NQJA 1NLQA 1B09A 1ULGA 3ZXJA 2BU9A 1VBC3 4B1MA 4IEQA 4TN7A 5CADA 2JDMA 2WNUB 1VRH2 1G9BA 1M06G 1AZDA 1QOSA 4JX0A 3WG3A 4QB6A 1OLMA 3DPRB 1M4WA 2Y34A 1UCXA 1J84A 1ZRRA 2R071 2W92A 1QJY2 2VMEA 2JG9A 5B2GB 2ADEA 4Q27A 3RG0A 2XVLA 2XDVA 1UMZA 2R0HA 5JOXA 1MACA 1SLLA 3VZNA 2A7AA 3HQXA 3U4SA 4CU8A 3M2MA 4PQQA 4LBMA 5TSWA 5FO8B 2QDNA 3L2HA 2MPFA 1SPPB 1CN1A 3BI3A 2I07B 3CF6E 4NPMA 3E6BA 1UIKA 4S2HA 1D4VB 1SLIA 1UZYA 1NAEA 2WFF2 1D7PM 3EXUA 3OYWA 4DQAA 5C33A 3FJSA 2PHLA 3RZKA 1UKGA 4YPJA 1J1LA 2JG8C 5I0DA 3ETQA 3ZFFC 2W91A 3PUHA 1Y4WA 1OA3A 4RFRB 4MV2A 1JYTA 3RJRA 4MGYE 4YSFA 2C26A 4CEYB 4XFIA 1UOGA 2C9AA 1NE6A 4RGKA 1RL3A 1MZ6A 4YARA 1JYWA 4CCJA 1AXYA 1FX5A 3WDUA 2PA7A 2Q8DA 2HKXA 1AUYA 3AMHA 3RWNA 5DG1A 1POV1 4N43B 1R1ZA 1NLRA 2B9VA 2VZPA 2P34A 3AX4A 3ES1A 3PURA 2PHXA 4CCOA 4EE2A 1AYN2 2A3WA 4D0QA 1BEV1 3UKNA 5EXOA 5JIAA 3WNOA 3B94A 1GUIA 1OVPA 1OUXA 3MICA 4YZ4A 1JS9A 1JZ8A 5LK7B 1F4AA 4BK4A 2VNGA 1LNSA 2B45X 1FPN2 3ELNA 2DBIA 3NV4A 1W99A 2D6PA 4OZXA 5FZDA 4K8RB 2Y6LA 3I2IA 1RUD3 3LA2A 3AC0A 4GZ9A 4JTOA 1MQTB 1O8SA 1IG3A 2ARXA 2XKPA 5JOWA 3ZDVA 3WR0A 1N47A 2ZGNA 3ZO0B 1BCXA 1LR5A 1LTEA 3CZUA 3PTRB 1WW5A 5EYYA 4D69A 1ND3A 1XU2A 1SLCA 4LK6A 4COWA 2X09A 2EF6A 1IQAA 4OHXA 4YVWC 1JZ5A 1EUUA 5KR7A 5CFDB 3AP7A 2DWRA 5CISA 2RS11 2RDSA 4UF0A 2X5IC 2EAKA 5LK5A 4YYOA 3ZYPA 2L9LA 4GJYA 1DDLA 4QAWA 5FKBA 5I8SA 3ZMNA 2CSGA 2VM9A 3B3QE 3NJVA 4XYXA 2OKXA 2DCKA 5FPZA 2HWC3 4FPJA 1FV2A 2JDUA 2YUEA 2Z4FA 2QQOA 3PIGA 4B7KA 3W59A 5C8CC 5EIYB 1ULDA 4QX5A 1UQXA 4HFSA 1KDKA 4BQ2A 1QQP2 1A34A 1LGNA 4OMCA 1R64A 2JKBA 3I59B 5APAA 3FWEA 5D8AA 4XFHA 5F37A 1OC1A 2QTWB 4AI9A 4YGCA 2XGXA 1YJKA 1OQEA 2WT2A 2OA2A 4W6XA 2YBSA 3DUIA 4Q5OA 3CIHA 2VULA 4M0NA 3NV3A 4BK5A 5A33A 4CCCA 4XOGA 3FHIB 1KJLA 3FLTA 4MGZE 4WZCA 4W8JA 3BPZA 3TYJA 4M4RA 2R041 2XLAA 4LOSA 5AC91 1HRV3 3J7LA 4QHZA 2VBBA 3O0XA 2HEYF 1VBB1 3ZFGA 2DF7A 2FBEA 4CCMA 2Y60A 2ET1A 2D6NA 2P3JA 1O6UA 1W0PA 2A71A 1AR83 3KT4A 4YZ5A 4UFMA 4Q4X1 2R061 3MFCA 2WNUA 1OLQA 4FO9A 3VBRC 1WCUA 4MXVA 3WF1A 4AVAA 3L2YA 4CPBA 1R081 3AP5A 3DPRA 3FE5A 1QWRA 3LF7A 4NRMA 3VL8A 1FMD2 2PAMA 1L7RA 4QB2A 2A75A 3VBFB 1JBCA 2SBAA 3HBZA 2D40A 4IEOA 2PN5A 3AKSA 5E6HA 4P9XA 2Z42A 1SPPA 4OMDA 3VBHA 1AVBA 2VUCA 2RS33 4BXFA 4DUWA 4RR3B 4WM7B 4MG2A 4F3JA 3DKQA 3RGBA 4IEXA 5DG2A 4I2OA 2ZGLA 4I3GA 3O1MA 4XF0A 2FDIA 1PZ7A 2D93A 5FUPA 1RGSA 1RB8G 1US3A 1YJLA 3AM2A 4NWWA 4XBQA 1W8FA 3CJIC 2W46A 2W1UA 1ZBA3 1LOBA 4QT6A 4RL7A 4CEYA 5FY1A 1WCKA 1YQ8A 1AL23 2VECA 2EICA 2VNVA 2CGPA 3PU8A 4LIVA 1VAMA 2GP3A 2UYAA 2YB7A 2PLV3 1AX2A 1NY72 3AYCA 4XJZA 3MW4A 2H0VA 4NAOA 4QPWA 5FP7A 1EYBA 1PNFA 2DCZA 4N43A 3VBUC 1GZCA 1HXS1 1URXA 2YC0A 4QPIC 3I2OA 1W2UA 3O5SA 5IVFA 2TBVA 1YC61 4DB5A 3QCWA 4PF5A 2BUKA 1T6GC 3HWJA 4NIHA 3MLKA 3Q9OA 5KC6A 3HNYM 3UGFA 1UXXX 4JGZC 4LBNA 3WF4A 1GZTA 1QEXA 4DMIA 2E33A 1VP6A 1UU5A 3LFMA 5LY2A 2GH8A 1E5HA 3J8F2 5F5IA 1HQLA 3AYEA 2VVFA 2D6OX 3IMMA 3LOBA 2GP5A 1MQTA 1OF3A 4D6SA 3OB8A 3BALA 1IKQA 3FLRA 3V65A 3POSA 3OJBA 3WQ1A 3ACLA 5GZCA 3IN9A 1DCSA 2WZR2 3KM5A 1PO23 1S0EA 2O0OA 2VQAA 5FXZA 3VV1A 4XAAA 2WQ4A 5CFDA 4E4DX 5A3TA 3VZOA 4DY5A 4RD7A 1W6QB 4M0HA 3SITA 3AZZA 1NX9A 4M3CE 2H6BA 2GU9A 4NOTA 4K9SA 1ASJ1 3M1HA 3NMBA 4XMAA 5HXVA 3ST7A 3ZR6A 3TEZA 2VOXA 2FZ1A 1WGPA 5GLVA 1JUIA 3NNFA 1WBFA 4U2AA 2A6XA 3D0SA 2VMCA 3PJQA 1FI2A 4W4ZA 1QNYA 1YNAA 2ZAAA 4LJHA 4O65A 4MGIE 3TWIA 4NRPA 3MF6A 4QU2A 5FXXA 5BY5A 4FTSA 1ZZ9A 3I59A 4QX2A 5JR7B 3WW4A 3DYMA 1CJPA 2RR11 5FZEA 1G9AA 2D3SA 1N3PA 4GMP3 4Q4V2 3UGGA 1JU4A 4CP0A 1AR61 1X7NA 3VDAA 1ST8A 5CFCC 5I0RA 3PUIA 5T3NA 1NT0A 1UZ0A 2GMEA 2PFWA 1W6NB 3NJYA 2YU2A 4Q29A 3DGTA 4CEWB 3CZJA 4ES9A 1C8M3 2BBAA 3WDYA 4CDWB 1H9WA 3H1MA 3I54A 4URAA 5CG9A 1HW5A 1COV1 1QJX1 2GMPA 2JX9A 3B69A 3KSCA 5T55A 3EBRA 4CDUC 2QQNA 3ZLIA 3RZMA 1WUVA 1V9U1 4AI3A 1RTVA 5FTTC 3MPBA 2G1MA 1RUE1 2ZOEB 2RS51 1Q8VA 1WMXA 2BZDA 1S0DA 1VBE1 2P6HA 1I9RA 4BA6A 4DEQA 5KWRA 2WZPP 1REDA 4YW4A 1BMV2 2IXLA 4O61A 4YWAA 4Q1RA 1V0AA 2JE9A 1EUTA 4CXYA 1US2A 4YM1A 4HVQA 1WLDA 2BW8A 5FK8A 2JWPA 4GB31 5JR2A 1WLCA 3C3VA 1WD3A 2Y33A 3WP6A 1PGL1 3IKWA 4LO4B 1MEC2 5A7WB 2H6CA 4COVA 1REFA 5BNPC 3TEXA 1HX6A 5JZGC 4V2WA 4YNIA 5FO9B 1QJEA 1EY2A 1H2NA 5FZ3A 3THDA 1OLME 1LEDA 2ZMNA 2D3PA 4Y26A 3VBFA 3W9AA 4AR2A 1KQRA 4MUVA 4OHVA 4ET7A 1UX6A 3OUJA 3MPPG 1H1AA 1EAH1 3LDBA 3M3CA 5CNAA 3I49A 2P5BA 2PYTA 3GHMA 3N7MA 4HL0A 4RR3A 3I2FA 3C7GA 4WM7A 1SFPA 2FZ2A 2F4PA 2DUOA 2VZVA 3RWKX 1LRHA 2W0XA 1VRH1 4CRQA 1L7LA 2BOIA 1UF2C 4OYUA 5HCBA 1W3XA 3PUSA 2WRAA 3UNPA 4Q0VA 2RM22 3RZLA 1W9TA 1QJY1 1TME3 5GZFA 1JHNA 3GZAA 3O1UA 1ZZBA 1HB3A 4GWNA 3IT8A 3PUAA 4PBOA 1AR72 3T1MA 1R092 2P3IA 5I8TA 2XBO3 5H9RA 1PHMA 1J1TA 2VXRA 3QOPA 4KWLA 4XJAA 1GICA 3H42B 1ULFA 2XB6C 3I2GA 4JDMA 4F8AA 1N1TA 2WFF1 4I3PA 4Y22B 5CB7A 2OYZA 1I1EA 1IG0A 2IXHA 4A6SA 4AZZA 2Z79A 2JICA 4I01A 5CYYA 4BU2A 5BXXA 2OXBA 2DDUA 3WQBA 3MBWA 2EIBA 3IAPA 4N53B 5FXVA 3T2OA 3LZZA 3PNAA 5CBLA 4NHKA 2QQIA 5JOZA 3AVRA 3T4VA 4CDQA 4K20A 2ZZJA 1YO8A 2R16A 2BGOA 2V73A 5A3PA 4ZHNA 1EV12 2IUWA 4MGQA 2B9UA 4ZKTB 4BLIA 4HKLA 2GAUA 4MXWA 4XFGA 2LW8A 4YGBA 2Y6HA 3W58A 4CP9B 1LESA 4SLIA 3WSOA 5JPNB 3O1OA 1AYN1 2N7GA 1W6QA 4FPKA 4AGGA 3KS7A 2YPDA 3JUUA 2GNBA 3HQRA 2WIIB 3V56A 1UZWA 4P9IA 2D6KA 2W52A 5HCFA 5F3EA 2EXIA 1NKGA 4ASMB 4NAMA 5C4WC 4COUA 1GZ9A 4WM8B 5L36A 2R073 1FPN1 1Z7S2 1DF0A 3ILRA 4R9AA 2WFPA 5DQ0A 3DL3A 3K51A 2EIEA 3O1RA 1CX4A 2D5HA 1GBGA 1FXZA 1H0BA 3KCCA 5J98B 1C57A 3E5UA 3VGIA 1AX0A 4BPZA 2W1QA 2Y0OA 2ZMKA 2ORZA 3WF0A 1DBNA 3T08A 1Q56A 3NAPB 4P5HA 1PZ8A 2UU8A 4LT5A 3GZEA 5F6KA 4OI1A 1G86A 1W6NA 3AMNA 3GGLA 3GALA 2Q8EA 1ULCA 1VE0A 4CEWA 2HH9A 4QPYA 4Q4W2 4A2UA 4CDWA 5T52A 1ZZ7A 4G9SB 2VW1A 1WW6A 1I6XA 1S2KA 2O8QA 2ZZQA 4AEDC 3U07A 2VNRA 5EV7A 4CDXC 4EZHA 2VO5A 3ZXLA 2J1AA 5FZ7A 4MO3M 2JDAA 4L2NA 1QQP1 2NMNA 5FYYA 2BNMA 5ABJB 4XAEA 5EJ1B 1GP5A 3PVBB 2PHRA 3LSEA 1POV3 1RUC2 3JXSA 2XOMA 4LORA 5HV0A 5JPMB 4FOWA 1NYWA 1VMFA 2LALA 1HLCA 1C5HA 1L7QA 4LBQD 1BEV3 1LOGA 2ENRA 3HR9A 4UBHA 5EWSA 4YLZA 2HLEA 2XMLA 5L9VA 1KS5A 1LULA 3NKGA 3E1F1 1B35C 3KCXA 3IPVB 1BYHA 2W2IA 1GWLA 5A7WA 3VBSB 1E5RA 3HMYA 3IDCB 1DZQA 4QDRA 4BZ4A 5JI9A 5KXBA 3N4MA 5KC5A 1RJ7A 3KGZA 3QBQA 3GJBA 1SACA 2VMGA 4WVMB 4AVCA 5IFPA 1YIPA 5IK8A 4BQYA 1W8ZA 2C0ZA 2Q8CA 1DGLA 1NCRA 3ON7A 1S2BA 1V00A 4KU7A 1IPKA 1C5IA 4CU6A 3RZHA 4W6YA 2KXLA 4DNYA 5F32A 4IXLA 4CVUA 5KXEA 5DDJ2 1X33A 2TUNA 3I2JA 2G19A 5KHHA 4H3WA 4JKLA 3BGAA 1YQ2A 2UWBA 2VMDA 5FK7A 4RHV2 2CV6A 1AYM2 1BLZA 1XSRA 1CONA 2VCCA 3NRUA 5IK4A 2UWCA 1OSGA 5CKMA 3KD4A 1FYUA 1WW7A 2WQ8A 1HB4A 1IQDC 2XONA 3KZ4C 4R9CA 2WBKA 3K4AA 4W6WA 1FMD1 3AXDA 5FY5A 4FAHA 1DZRA 4XF3A 2BNOA 1N1YA 2PHFA 3AKTA 3W20A 3MLLA 1ND2B 1UYXA 3VHPA 2NQYA 2ZX0A 4O7XA 2WLPA 5F3IA 1N1SA 3OBRA 3PUQA 2RDRA 2WZ8A 3S30A 1RXGA 1ZRCA 3HN1A 1J3QA 5T54A 4E27A 1UYPA 1GV9A 1WZXA 4CUCA 2CGOA 2J42A 2V5DA 3LPGA 2RG4A 2KM2A 5T5PA 2NN8A 2VG9A 4OUSA 4Y22A 5BPXA 2QNKA 4Y5TA 4YM2A 2BNNA 1VRBA 2KD7A 4IEWA 4QB1A 5E8AA 3WG4A 2HBUA 3C7HA 4N53A 1BZWA 4XQ4A 3MIFA 2R043 4XUTA 4ZS2A 1GYKA 5AVAA 1CVNA 5AC93 4QGLA 4LXLA 2RV9A 4LHNA 1VBB3 2YBPA 1GU3A 3LB9A 1JZ3A 3SKJE 4PF1A 3MW2A 4LBJA 1HRI2 1QH7A 2OW4A 1N3OA 3IZOA 3N7KA 1NY71 3NNLA 4HMZA 4HVRA 4YW5A 5FLIA 1DYPA 1SHWB 4CP9A 4XJ9A 1XNAA 4LLOA 2AH2A 1Q5OA 3DYOA 2PTMA 4Q4X3 4KBBA 2R063 1IPJA 4H7LA 2WABA 4K6BA 3WXPA 1E5IA 1W9SA 4E2GA 3HAGA 1R083 4UBGA 1UOBA 3AJYA 3LSDA 2WWJA 4P9GA 5L9RA 4WM8A 1HDKA 3PMSA 3WY6A 3POJA 1OD3A 1CZSA 4GKXA 1Y3TA 4L9BA 3VDBA 3J8F1 2RJKA 3IAQA 3M3OA 3VZKA 3WCSA 4FSJA 1MVEA 4LK7A 1SLBA 3C7FA 1H8TC 1TZOA 1J83A 2IFRA 3JZVA 4AHWA 2HJIA 1OKQA 2WZR1 4GIQA 2V09A 4KNCA 3NAPA 4LA2A 3WNMA 4IE4A 2JIGA 4EN7B 1CPMA 3LIGA 3FUOA 2UYBA 4QQLA 4AYUA 1UY4A 2BEOA 1Q8PA 4I0BA 4RGAA 5FWEA 2RMU2 4XF9A 5A3WA 5LA0A 5F8PA 5FXWA 4CCDA 5JCTA 3U4XA 2Q4SA 1J3RA 5JSRA 1OUSA 2JE7A 1XBFA 1F5FA 5J3UA 3K4ZA 4D6RA 4JGYC 1G7YA 4Y1VA 1W0OA 5ABJA 4AVSA 3V0AB 3D0JA 2B8MA 3HQUA 3WUDA 1W6PB 4AGRA 4YZ1A 4LTAA 4L97A 5A70A 1HXS3 4Q4V1 3OGRA 2XLFA 2YC4A 2B39A 1SCRA 1SLTA 1VAKA 2GDFA 3O1SA 2WWSA 4R4ZA 3JBG2 4EYUA 1C28A 1YIFA 3N7LA 3IDEA 4Y1YA 2ARCA 5DABA 1D2SA 3AKQA 3VBSA 3B9CA 4K1ZA 4KH9A 4BLJA 3FFQA 1X50A 2JKXA 3J7NA 4OI0A 2HYXA 3ZSLA 2X53S 1IS3A 3EQEA 3FHAA 4WVMA 5FYUA 4Y1ZA 1QIQA 1S0IA 4IEVA 4JDOA 3H0OA 4XC9A 1OVSA 2JD9A 4TLFA 1ZZ6A 4Q8KA 1OH3A 5A3LA 4NMIA 2ZKNA 2WQZC 1ZBE2 2IWGB 1JMUB 4Z92B 1BMV1 1YFYA 1RUJ3 4RN5A 1WA6X 3K46A 3ILNA 1W9YA 3MIGA 4HBNA 3WCRA 2VMFA 1ASJ3 1CAWB 2J1UA 4PLNA 4XTMA 5CZKA 1MEC1 2V72A 5FYVA 5GALA 5FZBA 2QQPA 5L7OB 4RGGA 4XIKA 3URFA 1GZWB 1XU1A 4AFBA 1W39A 3APBA 1OMIA 3ECQA 3U37A 1C1LA 1NZCA 1LENA 2UWAA 1MZ5A 1ND2A 1PZ9A 3BOWA 4HETA 2BERA 4IW3A 4BCUA 2UY9A 3ZYIB 2HBTA 2RR13 2W87A 3IDBB 3LD8A 4IV1B 4QU1A 3USSA 1AR63 1W9WA 1O7FA 3SQOA 3UKVA 5K7PA 2VU9A 3MHZA 3N9PA 2DCTA 1PM4A 4AI8A 4KU8A 1YLLA 2NZ9A 2C4XA 1O59A 2ZEWA 3A0NA 3C7EA 1AJKA 5HBAA 4JHZA 3H8UA 3I2HA
chains in the Genus database with same CATH topology
1GQPA 3BN6A 3LPFA 1PMHX 1WKYA 1L7RA 3GXUA 4JKKA 4QB2A 4P02B 5LCWL 2W9XA 3HNMA 4XUNA 5IHRA 4OMDA 3CMGA 2B4KA 4A45A 4DUWA 2VJXA 3WNPA 3WNNA 4A41A 2W1WA 3HOBA 4E8DA 2ID4A 1US3A 3LQCA 3T2QA 2E32A 4MGSA 1SDDB 2ZEZA 2W46A 3ETPA 2W1UA 4E8CA 3C8XA 3I3BA 3IIIA 2EICA 4KMQA 2YB7A 3WNKA 4QPWA 4M4PA 3SEPA 4P08A 1KGYA 1GOHA 5HPOA 1RYYA 1XPWA 3HNYM 3I3DA 1UXXX 3WF4A 5G05L 2E33A 2VZSA 3HN3A 1DP0A 1GOFA 4QDSA 3LEGA 3FN9A 4XURA 1PX4A 3ABZA 1OF3A 3A22A 3OB8A 3MO4A 2E26A 5JXHA 3HEIA 1K3IA 2RJ2A 1BHGA 1NX9A 2QQMA 5F7UA 1JU3A 1DYOA 4ZXEA 1T2XA 3OGSA 2Y6JA 1UX7A 1ULPA 1JYXA 2WO3A 4W4ZA 2VMCA 2J1SA 4QX1A 3UESA 2WZEA 2Y6GA 3CDZB 5B4XA 4QX2A 3DYMA 1I5PA 2J22A 5DMYA 2VC9A 1JU4A 1UY2A 3VDAA 3PUIA 2LS6A 1UZ0A 4CU7A 5EJZB 3EYPA 1UXZA 3CZJA 2BBAA 3VD9A 1JHJA 4TXWA 2QQNA 3IB3A 1GMMA 4DEQA 2BZDA 1NUKA 1OF4A 2ZEXA 2E31A 3GDBA 1H6YA 4ZZ8A 4OUEA 3WEZA 3SEEA 2J7MA 4A4AA 1EUTA 3DECA 5IFTA 1US2A 2VZ1A 1PX3A 2VZTA 5JR2A 1GNYA 1K42A 5J1XA 2W47A 4MOAA 2WAOA 5A1AA 5LA2A 3THDA 1KEXA 4ET7A 4LKSA 1UYZA 2YFZA 3MV11 3FHQA 4LPLA 2Y8KA 2J1VA 2W1SA 1JYNA 4ARXA 3I2FA 3C7GA 2VZ3A 4FI9A 2VZVA 2ZXQA 2PQSA 1JZ7A 1UWWA 3CKHA 4ARYA 2YC2A 2QBXA 4OYUA 1CZVA 4BDVB 2CDOA 3VD4A 2EIDA 3D3AA 3UNPA 1JI6A 1W9TA 3WF3A 3HPNA 1UY3A 3FL7A 5C70A 4QX3A 2JE8A 4DXRA 1UY1A 4P5YA 2R7EB 3I2GA 3T0BA 3VD5A 3T0AA 2BGPA 5CYYA 2DDUA 3WQBA 1F4HA 2EIBA 3IAPA 3MBWA 2QQLA 3EB7A 3T2OA 1UYYA 2VR4A 4P00B 4AAXA 5JUVA 2QQIA 1SG3A 3THCA 2ZEYA 2BGOA 2WO1A 4GWIA 4MGQA 4D8MA 2LW8A 4GWJA 2Y6HA 5HXMA 3WSOA 3J7HA 4DUVA 2XQXA 2YFUA 1NKGA 3ACHA 5IYYA 3ACIA 4A44A 3T2PA 2X05A 3A21A 5DQ0A 2WDBA 3GM8A 1JZ2A 2EIEA 4XUQA 2DCJA 2VQUA 2Y6KA 4CU9A 4Z2AA 2W1QA 3WF0A 4ZZ5A 2ORZA 3T08A 4HG6B 3DYPA 3W5NA 2VZRA 3GGLA 3VD7A 3OGVA 2WYSA 1K12A 1MPXA 4DUXA 1K45A 1XNTA 3OBAA 1O8PA 5DPNA 2VO5A 2J1AA 1UY0A 4MO3M 2JDAA 5G04L 5EJ1B 4DEVA 5IJRA 4KI5M 3JXSA 2XOMA 3WF2A 2W95A 3ACGA 1L7QA 2XHNA 2VL4A 2HLEA 3E1F1 5DN2A 3OEAA 3LE0A 4QDRA 3MUY1 4A42A 3LEIA 2RVAA 5IFPA 1XC6A 4QX0A 3K75B 3IDAA 4W50A 2VCBA 4CU6A 3MV01 4RYDA 4CVUA 3I2JA 4JKLA 3BGAA 4BJ0A 1YQ2A 4UOJA 1OH4A 2VMDA 4AG4A 2VCCA 3NRUA 3ZM8A 3ACFA 3C7OA 3K77A 4BXSV 3W5MA 2WQ8A 2XONA 2W94A 1IQDC 2WBKA 3K4AA 3I2KA 4CUAA 4OZOA 2WO2A 2WAAA 2WUHA 4CUBA 1CX1A 1CIYA 4XZUG 1UYXA 3OEBA 2VZQA 2WZ8A 3VD3A 1UMIA 1JZ4A 1TVGA 4CUCA 2V5DA 2X10A 3LPGA 1W8NA 2WN3A 1UMHA 2QQKA 2VQTA 1JYVA 2KD7A 4QB1A 3UETA 2J1EA 3C7HA 4JKMA 4XUTA 1H6XA 4JX0A 4QB6A 2CDPA 5FUIA 2RV9A 3K4DA 3OG2A 2W92A 1J84A 1GU3A 2VMEA 3SKJE 1JZ3A 3NNGA 4PF1A 4DXTA 4CU8A 1SHWB 5JXGA 4PQQA 1W8OA 1XNAA 2VZUA 4LHSA 3DYOA 2QQJA 2WABA 1W9SA 2YG0A 3A23A 1NAEA 1D7PM 3NJXA 4UAPA 3SKVA 1OD3A 4YPJA 1CZSA 3MUZ1 5I0DA 3VDBA 2W91A 3IAQA 3PUHA 1JZ6A 2C26A 3C7FA 1J83A 3NQHA 1JYWA 4A3ZA 3A7QA 2ORXA 5JXIA 3WNMA 1HN1A 2B9VA 2VZPA 3HJRA 5C71A 5LA1A 1ULOA 4LQRA 3T0DA 4D0QA 1UY4A 3WNOA 4TTGA 1GUIA 5LA0A 3HNBM 1CZTA 2C9KA 1TG7A 1JZ8A 4KWUA 1F4AA 4BK4A 1LNSA 1GOGA 1W99A 3I3EA 3K4ZA 3LEKA 4ZY9A 2Y6LA 3I2IA 2W3JA 2WN2A 3AC0A 4GZ9A 3I97A 1O8SA 2W5FA 2Y64A 3CZUA 3OGRA 2YC4A 3F2ZA 5C7GA 2X09A 2VOTA 1JZ5A 1EUUA 1OT5A 4IUGA 4UI9L 2V4VA 1WCQA 3P1IA 1P8JA 3T09A 2JKXA 2L9LA 2HYXA 4XVHA 4QAWA 3VDCA 3FHAA 2VM9A 3NJVA 2OKXA 2DCKA 4XUOA 2Z4FA 2JD9A 2QQOA 5EIYB 1DLCA 4DXSA 4PT6A 4OMCA 1R64A 3CQOA 4RN5A 4XUPA 3K46A 3P6BA 2VZOA 2VMFA 2J1RA 1PMJX 3CIHA 5B4NA 2J1UA 5CZKA 4BK5A 2V72A 3WNLA 4W8JA 4M4RA 5JMOA 2J1TA 2VTFA 3U37A 3ECQA 1W0NA 4A6OA 4QDQA 2BERA 2W87A 5JXJA 1W9WA 4L0PA 2VCAA 2C4XA 1O59A 2ZEWA 3C7EA 4MADA 4JHZA 3WF1A 3I2HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GQP A;  3BN6 A;  3LPF A;  1PMH X;  1WKY A;  1L7R A;  3GXU A;  4JKK A;  4QB2 A;  4P02 B;  5LCW L;  2W9X A;  3HNM A;  4XUN A;  5IHR A;  4OMD A;  3CMG A;  2B4K A;  4A45 A;  4DUW A;  2VJX A;  3WNP A;  3WNN A;  4A41 A;  2W1W A;  3HOB A;  4E8D A;  2ID4 A;  1US3 A;  3LQC A;  3T2Q A;  2E32 A;  4MGS A;  1SDD B;  2ZEZ A;  2W46 A;  3ETP A;  2W1U A;  4E8C A;  3C8X A;  3I3B A;  3III A;  2EIC A;  4KMQ A;  2YB7 A;  3WNK A;  4QPW A;  4M4P A;  3SEP A;  4P08 A;  1KGY A;  1GOH A;  5HPO A;  1RYY A;  1XPW A;  3HNY M;  3I3D A;  1UXX X;  3WF4 A;  5G05 L;  2E33 A;  2VZS A;  3HN3 A;  1DP0 A;  1GOF A;  4QDS A;  3LEG A;  3FN9 A;  4XUR A;  1PX4 A;  3ABZ A;  1OF3 A;  3A22 A;  3OB8 A;  3MO4 A;  2E26 A;  5JXH A;  3HEI A;  1K3I A;  2RJ2 A;  1BHG A;  1NX9 A;  2QQM A;  5F7U A;  1JU3 A;  1DYO A;  4ZXE A;  1T2X A;  3OGS A;  2Y6J A;  1UX7 A;  1ULP A;  1JYX A;  2WO3 A;  4W4Z A;  2VMC A;  2J1S A;  4QX1 A;  3UES A;  2WZE A;  2Y6G A;  3CDZ B;  5B4X A;  4QX2 A;  3DYM A;  1I5P A;  2J22 A;  5DMY A;  2VC9 A;  1JU4 A;  1UY2 A;  3VDA A;  3PUI A;  2LS6 A;  1UZ0 A;  4CU7 A;  5EJZ B;  3EYP A;  1UXZ A;  3CZJ A;  2BBA A;  3VD9 A;  1JHJ A;  4TXW A;  2QQN A;  3IB3 A;  1GMM A;  4DEQ A;  2BZD A;  1NUK A;  1OF4 A;  2ZEX A;  2E31 A;  3GDB A;  1H6Y A;  4ZZ8 A;  4OUE A;  3WEZ A;  3SEE A;  2J7M A;  4A4A A;  1EUT A;  3DEC A;  5IFT A;  1US2 A;  2VZ1 A;  1PX3 A;  2VZT A;  5JR2 A;  1GNY A;  1K42 A;  5J1X A;  2W47 A;  4MOA A;  2WAO A;  5A1A A;  5LA2 A;  3THD A;  1KEX A;  4ET7 A;  4LKS A;  1UYZ A;  2YFZ A;  3MV1 1;  3FHQ A;  4LPL A;  2Y8K A;  2J1V A;  2W1S A;  1JYN A;  4ARX A;  3I2F A;  3C7G A;  2VZ3 A;  4FI9 A;  2VZV A;  2ZXQ A;  2PQS A;  1JZ7 A;  1UWW A;  3CKH A;  4ARY A;  2YC2 A;  2QBX A;  4OYU A;  1CZV A;  4BDV B;  2CDO A;  3VD4 A;  2EID A;  3D3A A;  3UNP A;  1JI6 A;  1W9T A;  3WF3 A;  3HPN A;  1UY3 A;  3FL7 A;  5C70 A;  4QX3 A;  2JE8 A;  4DXR A;  1UY1 A;  4P5Y A;  2R7E B;  3I2G A;  3T0B A;  3VD5 A;  3T0A A;  2BGP A;  5CYY A;  2DDU A;  3WQB A;  1F4H A;  2EIB A;  3IAP A;  3MBW A;  2QQL A;  3EB7 A;  3T2O A;  1UYY A;  2VR4 A;  4P00 B;  4AAX A;  5JUV A;  2QQI A;  1SG3 A;  3THC A;  2ZEY A;  2BGO A;  2WO1 A;  4GWI A;  4MGQ A;  4D8M A;  2LW8 A;  4GWJ A;  2Y6H A;  5HXM A;  3WSO A;  3J7H A;  4DUV A;  2XQX A;  2YFU A;  1NKG A;  3ACH A;  5IYY A;  3ACI A;  4A44 A;  3T2P A;  2X05 A;  3A21 A;  5DQ0 A;  2WDB A;  3GM8 A;  1JZ2 A;  2EIE A;  4XUQ A;  2DCJ A;  2VQU A;  2Y6K A;  4CU9 A;  4Z2A A;  2W1Q A;  3WF0 A;  4ZZ5 A;  2ORZ A;  3T08 A;  4HG6 B;  3DYP A;  3W5N A;  2VZR A;  3GGL A;  3VD7 A;  3OGV A;  2WYS A;  1K12 A;  1MPX A;  4DUX A;  1K45 A;  1XNT A;  3OBA A;  1O8P A;  5DPN A;  2VO5 A;  2J1A A;  1UY0 A;  4MO3 M;  2JDA A;  5G04 L;  5EJ1 B;  4DEV A;  5IJR A;  4KI5 M;  3JXS A;  2XOM A;  3WF2 A;  2W95 A;  3ACG A;  1L7Q A;  2XHN A;  2VL4 A;  2HLE A;  3E1F 1;  5DN2 A;  3OEA A;  3LE0 A;  4QDR A;  3MUY 1;  4A42 A;  3LEI A;  2RVA A;  5IFP A;  1XC6 A;  4QX0 A;  3K75 B;  3IDA A;  4W50 A;  2VCB A;  4CU6 A;  3MV0 1;  4RYD A;  4CVU A;  3I2J A;  4JKL A;  3BGA A;  4BJ0 A;  1YQ2 A;  4UOJ A;  1OH4 A;  2VMD A;  4AG4 A;  2VCC A;  3NRU A;  3ZM8 A;  3ACF A;  3C7O A;  3K77 A;  4BXS V;  3W5M A;  2WQ8 A;  2XON A;  2W94 A;  1IQD C;  2WBK A;  3K4A A;  3I2K A;  4CUA A;  4OZO A;  2WO2 A;  2WAA A;  2WUH A;  4CUB A;  1CX1 A;  1CIY A;  4XZU G;  1UYX A;  3OEB A;  2VZQ A;  2WZ8 A;  3VD3 A;  1UMI A;  1JZ4 A;  1TVG A;  4CUC A;  2V5D A;  2X10 A;  3LPG A;  1W8N A;  2WN3 A;  1UMH A;  2QQK A;  2VQT A;  1JYV A;  2KD7 A;  4QB1 A;  3UET A;  2J1E A;  3C7H A;  4JKM A;  4XUT A;  1H6X A;  4JX0 A;  4QB6 A;  2CDP A;  5FUI A;  2RV9 A;  3K4D A;  3OG2 A;  2W92 A;  1J84 A;  1GU3 A;  2VME A;  3SKJ E;  1JZ3 A;  3NNG A;  4PF1 A;  4DXT A;  4CU8 A;  1SHW B;  5JXG A;  4PQQ A;  1W8O A;  1XNA A;  2VZU A;  4LHS A;  3DYO A;  2QQJ A;  2WAB A;  1W9S A;  2YG0 A;  3A23 A;  1NAE A;  1D7P M;  3NJX A;  4UAP A;  3SKV A;  1OD3 A;  4YPJ A;  1CZS A;  3MUZ 1;  5I0D A;  3VDB A;  2W91 A;  3IAQ A;  3PUH A;  1JZ6 A;  2C26 A;  3C7F A;  1J83 A;  3NQH A;  1JYW A;  4A3Z A;  3A7Q A;  2ORX A;  5JXI A;  3WNM A;  1HN1 A;  2B9V A;  2VZP A;  3HJR A;  5C71 A;  5LA1 A;  1ULO A;  4LQR A;  3T0D A;  4D0Q A;  1UY4 A;  3WNO A;  4TTG A;  1GUI A;  5LA0 A;  3HNB M;  1CZT A;  2C9K A;  1TG7 A;  1JZ8 A;  4KWU A;  1F4A A;  4BK4 A;  1LNS A;  1GOG A;  1W99 A;  3I3E A;  3K4Z A;  3LEK A;  4ZY9 A;  2Y6L A;  3I2I A;  2W3J A;  2WN2 A;  3AC0 A;  4GZ9 A;  3I97 A;  1O8S A;  2W5F A;  2Y64 A;  3CZU A;  3OGR A;  2YC4 A;  3F2Z A;  5C7G A;  2X09 A;  2VOT A;  1JZ5 A;  1EUU A;  1OT5 A;  4IUG A;  4UI9 L;  2V4V A;  1WCQ A;  3P1I A;  1P8J A;  3T09 A;  2JKX A;  2L9L A;  2HYX A;  4XVH A;  4QAW A;  3VDC A;  3FHA A;  2VM9 A;  3NJV A;  2OKX A;  2DCK A;  4XUO A;  2Z4F A;  2JD9 A;  2QQO A;  5EIY B;  1DLC A;  4DXS A;  4PT6 A;  4OMC A;  1R64 A;  3CQO A;  4RN5 A;  4XUP A;  3K46 A;  3P6B A;  2VZO A;  2VMF A;  2J1R A;  1PMJ X;  3CIH A;  5B4N A;  2J1U A;  5CZK A;  4BK5 A;  2V72 A;  3WNL A;  4W8J A;  4M4R A;  5JMO A;  2J1T A;  2VTF A;  3U37 A;  3ECQ A;  1W0N A;  4A6O A;  4QDQ A;  2BER A;  2W87 A;  5JXJ A;  1W9W A;  4L0P A;  2VCA A;  2C4X A;  1O59 A;  2ZEW A;  3C7E A;  4MAD A;  4JHZ A;  3WF1 A;  3I2H A; 
#chains in the Genus database with same CATH topology
 4D7Y A;  1W6O A;  5ERL A;  2HWB 2;  2W68 A;  2WJS A;  4KG8 A;  3BN6 A;  3U14 A;  4EQV A;  1QJX 3;  1COV 3;  4UFK A;  2RM2 1;  5FKC A;  1UPI A;  2YPJ A;  5FRA A;  5FZH A;  1V9U 3;  3DXT A;  3GXU A;  2WO7 A;  1RUE 3;  3NL1 A;  2RS5 3;  2Q30 A;  1AR7 1;  1VBE 3;  1R09 1;  5F3G A;  5FPA A;  4XBN A;  5FZL A;  3BIE A;  3AP9 A;  3KF3 A;  3WNX A;  4NO4 A;  3R05 A;  4C90 A;  2JG9 C;  3OPT A;  2VJX A;  4GB3 3;  3WHT A;  1KFU L;  4HN1 A;  4XZP A;  3WNP A;  5KXD A;  1RUI 2;  1PO1 2;  4NID A;  3GCW A;  1KDM A;  4E2Q A;  3HOB A;  1VIW B;  3TNP B;  1V70 A;  1LHW A;  4K1Y A;  4S2G A;  3VBH B;  3LQC A;  1ZZC A;  3POF A;  4Q0P A;  4BE3 A;  1XRU A;  3IMN A;  3U11 A;  2MEV 2;  5IVY A;  1G9F A;  4F83 A;  4IEZ A;  3FC0 A;  1C1F A;  1VBD 2;  5IUQ A;  4IV3 B;  3III A;  1EAH 3;  2BWC A;  1ZM1 A;  1JYI A;  3AZY A;  3ZKU A;  5FMC A;  1EV1 1;  4NVP A;  1YRZ A;  3ZN5 A;  1POQ A;  1K5J A;  3WDX A;  4XCA A;  1C4R A;  5FRE A;  3WQ7 A;  3NKT A;  3RMY A;  1HN0 A;  1KGY A;  2AEN A;  1VRH 3;  3M3I A;  3WG1 A;  2ZCW A;  2D43 A;  4ERO A;  3ZXD A;  3JD7 2;  1XPW A;  1RUG 2;  4FPO B;  4FPC A;  1N1V A;  2JDP A;  5G05 L;  1V6L A;  5EZW A;  3AMQ A;  3U78 A;  1QJY 3;  1Z7S 1;  1NXM A;  1Z0H A;  3FN9 A;  2IXJ A;  3H3Z A;  4MLO A;  4RQP B;  4A7K A;  1IS6 A;  3SLI A;  5D1I A;  1UIJ A;  2GC3 A;  4I0A A;  4P9J A;  3RI9 A;  1PX4 A;  5FYI A;  4YW6 A;  3NV1 A;  3V0A A;  1LGB A;  2JG8 A;  1VB2 A;  1W6P A;  1O5U A;  1TMF 3;  2VUD A;  1T6B X;  2FCT A;  1XXN A;  3WDV A;  1FAY A;  3MO4 A;  1RIT A;  1XE0 A;  2E53 A;  3K3O A;  2ADD A;  2BDR A;  4KGQ A;  3UT0 A;  2E26 A;  2A5Z A;  2FMY A;  2OUH A;  1YFU A;  2Z2S B;  4FCA A;  2WFF 3;  4Y3O A;  5L73 A;  3SHR A;  4GMP 0;  4Q4W 1;  1V6K A;  2E7A A;  2RJ2 A;  3VBO B;  1UNB A;  2G9Z A;  3WVJ A;  5J48 A;  2NPI A;  1ND3 C;  2EAL A;  5F7U A;  3FZ3 A;  2WS9 2;  5F2W A;  3K2O A;  3N9M A;  2B42 B;  2Y6J A;  1L3J A;  2FQP A;  3EJK A;  5DUU A;  1JYX A;  1GKB A;  4E4Z A;  3H3U A;  1UN1 A;  5FPV A;  2Y6G A;  2ZX2 A;  1YXW A;  4QHO A;  5GLZ A;  5JOY A;  1RUC 1;  2EIG A;  5DMY A;  1I5P A;  4FPF A;  1AYN 3;  1S2E A;  2YZ4 A;  1NE4 A;  3KV9 A;  3NVC A;  3AMP A;  3MF9 A;  4PDW B;  4XE9 A;  1F35 A;  1CAW A;  2E7Q A;  4ISQ A;  3ZYH A;  1UXZ A;  5D8A C;  5L7O A;  1GZW A;  1FPN 3;  5C3Q A;  3E6C C;  2YGL A;  1FOD 2;  1JHJ A;  4YGE A;  3Q8E A;  4BMB A;  5A3M A;  1LOF A;  4Q26 A;  5FYT A;  4QPG C;  2AYH A;  2VOK A;  4ORF A;  1QGL A;  4FPY A;  2WNV B;  3POW A;  1NUK A;  4IV1 A;  1OF4 A;  5DDJ 1;  4BIF A;  2WC2 A;  5K8S A;  1H6Y A;  4GH4 B;  4YFZ A;  4X6R B;  4WZF A;  3WEZ A;  4RHV 1;  2J7M A;  4XJU A;  3SEE A;  3WP4 A;  3ZFG C;  1AYM 1;  1CR7 A;  1Y9Q A;  4FPE A;  2VZ1 A;  5IFT A;  2VZT A;  1MZE A;  1H2L A;  2WKK A;  3KVA A;  2D3R A;  5IVJ A;  3PLQ A;  5IVE A;  3KF5 A;  1GWK A;  5E89 A;  4R52 A;  5J1X A;  1ACC A;  3DV8 A;  4LLF A;  4MOA A;  2NP0 A;  1RUN A;  1UW8 A;  4ZXK A;  2WAO A;  2R1D A;  4LUL A;  4ISR A;  3BTY A;  2WNU C;  1QQP 3;  5LA2 A;  3H8O A;  1JXN A;  5GJ6 A;  3TRS B;  5K9Y A;  2HWD 2;  5LW9 A;  3POG A;  2FDH A;  5FZF A;  2V4A A;  4LKS A;  1C8N A;  3DPR C;  4HON A;  4HSJ A;  4HSL A;  3DF0 A;  3R4U A;  5F5C A;  2ZX4 A;  4LPL A;  4PQ9 A;  1HJG A;  2AEZ A;  1LEC A;  2W1S A;  3OUI A;  1NG0 A;  5C3P A;  2VZ3 A;  4FI9 A;  3JB4 C;  2PQS A;  1OUR A;  2QKD A;  3WIN E;  3VN4 A;  1JN2 P;  5KHG A;  2B46 X;  1UWW A;  2XG3 A;  4K8F A;  4CPB D;  1QKQ A;  1JZ7 A;  2WT0 A;  4AF9 A;  4NUB A;  2AEY A;  4BDV B;  2CDO A;  3NW4 A;  5DZF A;  1Q8O A;  4I30 A;  3ROU A;  5BNN B;  3TEY A;  2P3K A;  3D3A A;  2VUJ A;  3M8L A;  5DZE A;  5FY7 A;  1F5J A;  1PGW 2;  3KLS A;  2Q1Z B;  3BVC A;  5FZO B;  3QAC A;  1ALY A;  1UY3 A;  4IV3 A;  3WUC A;  1HRI 1;  5A6Q A;  4GXL A;  1WA4 A;  5C70 A;  2R6Q A;  1HV0 A;  1SFY A;  4AQT A;  2AC1 A;  3WD5 A;  2I2S A;  1AXK A;  2AAC A;  4CEY C;  5ISL A;  1YUD A;  3CHX A;  4F7Z A;  1AR9 2;  2A6V A;  5HV4 A;  5C8W A;  2FDG A;  1XE7 A;  1H2K A;  4B4R A;  2HWF 2;  3T0B A;  3VD5 A;  1GQH A;  3T0A A;  5DUV A;  1XNC A;  3LGR A;  3N7J A;  5C5T A;  4AVB A;  4DIN B;  1FMD 3;  4FBF A;  1CWP A;  4N43 C;  4AL9 A;  3HD8 B;  4RQP A;  3VKL A;  1R1A 2;  4NPR A;  2WR9 A;  4P00 B;  1RMU 3;  4AAX A;  4G3Y C;  1WWY A;  4QXB A;  1SG3 A;  5CU1 A;  3THC A;  5C3S A;  2ZEY A;  1OD5 A;  5FZ8 A;  1D0H A;  1H9P A;  2DFC A;  2GZW A;  4P9W A;  3IIA A;  4GWI A;  4YW7 A;  3VZJ A;  4AI2 A;  1U0A A;  1GP4 A;  4UW5 A;  4EZ4 A;  4GWJ A;  4UFJ A;  5HXM A;  2VNO A;  5CG8 A;  1MQT C;  3ZN4 A;  4CDQ B;  1MS1 A;  3N3H A;  2P17 A;  3OOX A;  3VBO A;  2A6Y A;  3R4S A;  2RMU 1;  4QQP A;  2ILM A;  1ZRF A;  3ENR A;  2EXH A;  4YG6 A;  4MXW B;  5FLH A;  3AJZ A;  1QMJ A;  5CFD C;  3ACI A;  1W3V A;  4AFM A;  4P9L A;  3TEW A;  1XQN A;  1ODM A;  2CWS A;  3SCF A;  3B00 A;  4IGP A;  1Y9M A;  1NCQ B;  4XFF A;  1KXG A;  2P3Y A;  2DCJ A;  2VQU A;  1QDO A;  4AVT A;  5JSO A;  4CU9 A;  3JQX A;  4IND A;  5HCA A;  3AP4 A;  5JVV A;  4BQ5 A;  2BQP A;  3JBG 1;  5ACA 2;  4PDW A;  2GAL A;  4BQW A;  1POV 0;  2I45 A;  1C8M 2;  2XUM A;  4NWV A;  3KHB A;  1MVQ A;  1BBT 2;  4LOT A;  3VD7 A;  1XYO A;  3MIB A;  2VMH A;  4MZU A;  2AZ5 A;  2D5F A;  3AP6 A;  1K12 A;  4Y5Z 0;  1K45 A;  1YQC A;  5DAP A;  3OBA A;  1O8P A;  4BQ3 A;  1A78 A;  2YYO A;  3E5Q A;  5G04 L;  2WNV A;  1PNG A;  2WZR 3;  2YGM A;  1ZBE 1;  4DEV A;  4EWE A;  4KI5 M;  4XW3 A;  4GH4 A;  1STM A;  1A8D A;  1OQ1 A;  2EAA A;  1UKR A;  3LA3 A;  3WF2 A;  1DZT A;  3ACG A;  4C1X A;  1PK6 B;  3D8C A;  1QOO A;  3RSJ A;  1WD4 A;  1FV3 A;  4EJR A;  5FPL A;  5CFC A;  4OQ8 A;  3OEA A;  4IER A;  4QQO A;  1GAN A;  2F4L A;  3M70 A;  1PIV 2;  4PIX A;  4BHP A;  1RUH 2;  2G9G A;  3MUY 1;  1TEI A;  5A3O A;  5FPX A;  3VDD A;  4J25 A;  4QX0 A;  3Q8F A;  5F3C A;  2YHJ A;  1QXR A;  4W50 A;  2E63 A;  4XFA A;  4Y33 A;  4AHX A;  4COZ A;  4Q4V 3;  2NLR A;  1VBA 2;  2XL7 A;  2CNA A;  4JC1 A;  4QWN A;  4IES A;  2WSU A;  2Q1F A;  2BP6 A;  3LIH A;  4WBB A;  3RPQ A;  4LMF A;  2E51 A;  1SZB A;  4FXG B;  4QHB A;  3VBF C;  1Y43 B;  4XBL A;  1NCR B;  4AFA A;  4EN9 B;  4AG4 A;  4Z82 A;  3ZXK A;  2BOJ A;  2HWB 1;  1PVC 2;  3K77 A;  4FQZ A;  3LDR A;  2R0F A;  4BXS V;  4RS5 B;  1HV1 A;  4D6Q A;  5BNN A;  4P14 A;  4AVV A;  2FDF A;  4RR3 C;  4WM7 C;  3ZYG A;  4Q1P A;  4CUA A;  2WO2 A;  1ENQ A;  1HB2 A;  4FOY A;  5FZO A;  2WWU A;  4CUB A;  5BNP A;  2LM3 A;  2XBO 2;  4NE9 A;  4MVT A;  3RMX A;  4JRA A;  3KV6 A;  1V6J A;  2IVJ A;  3ZDS A;  1XE8 A;  4AFC A;  1NOV A;  1QU0 A;  2VTX A;  3C2U A;  3M3E A;  3MYX A;  1W8N A;  1KJR A;  3B93 A;  4LE4 A;  2WN3 A;  2QQK A;  1RUI 1;  1PO1 1;  2FCV A;  5GLW A;  4B7E A;  4NN0 A;  1MEC 3;  2YMZ A;  3AMM A;  1RHI 2;  3OD4 A;  1JYV A;  3S57 A;  4HOO A;  1DGW A;  3UET A;  1S0F A;  4QXH A;  5FY0 A;  3USU B;  2J1E A;  3ZOI A;  1W03 A;  4QKN A;  4JKM A;  1CAV B;  2MEV 1;  4O9G A;  5A7P A;  3OG2 A;  1VBD 1;  2A6Z A;  3WG2 A;  3NNG A;  1U5X A;  5F9T A;  5CA6 A;  4DXT A;  5K0U B;  5FZ1 A;  3WW2 A;  1LCL A;  3TN9 2;  5JXG A;  5BNO B;  2A3Y A;  5KXC A;  3OBZ A;  1W8H A;  4YG0 A;  1V6N A;  2VZU A;  3ZIW A;  2C5D A;  5FP9 A;  4LHS A;  1AX1 A;  4Z1V A;  3VDD B;  2QQJ A;  2ES3 A;  5FZM A;  3SIS A;  1WCS A;  1RUF 2;  3A23 A;  3JD7 1;  1RUG 1;  2HWE 2;  3AL5 A;  2CL2 A;  1OOP B;  3WDW A;  3IBM A;  3S7E A;  2BGC A;  5FJH A;  4HVO A;  4AI0 A;  4BYY A;  5A6Y A;  2MNG A;  2RM2 3;  4EN0 A;  2ET7 A;  1NA1 B;  2I74 A;  5BV6 A;  4UFI A;  1W06 A;  3KCY A;  4LUM A;  1XNK A;  2CY6 A;  2IXK A;  5FQ0 B;  1ZA7 A;  5IT6 A;  2G4I A;  4ASL A;  3ZKY A;  1R09 3;  5CIR A;  3P5B A;  1SBE A;  3T2T A;  1JZ6 A;  1F15 A;  1NCQ A;  3B5L B;  5FYH A;  3MFA A;  2WL1 A;  2P37 A;  3A7Q A;  4XJ8 A;  1BXH A;  1AXZ A;  2GN7 A;  4AWD A;  2VD7 A;  3VKM A;  5GZG A;  1HN1 A;  3SMH A;  4Q4Y 2;  4LKD A;  1CAX B;  5GM0 A;  4IEY A;  5C9A B;  5LA1 A;  5D21 A;  1ZA4 A;  5EYX A;  3NST A;  4TTG A;  2WA3 A;  4QD2 A;  4MH0 E;  2WS9 1;  2QZ3 A;  2DU1 A;  5EHD A;  5IVB A;  2QVS B;  1X82 A;  1DQ5 A;  2HEV F;  4KWU A;  2VCM A;  3V0B B;  1QOT A;  3NWK A;  4CE8 A;  4CEW C;  1EV1 3;  3ILF A;  4CDW C;  2W3J A;  2WN2 A;  1IPS A;  3MDP A;  3I97 A;  2W5F A;  2Y64 A;  3ZXG A;  3D4K A;  3KHC A;  3ZFE B;  1PK6 A;  3F2Z A;  3V64 A;  4MYE A;  2ZA9 A;  2FDK A;  1JTZ X;  4N9I A;  2AUY A;  4CCL A;  1W2A X;  1O3S A;  1W04 A;  4AGV A;  3A0K A;  1Z7S 3;  1ZNP A;  3T09 A;  3BPS A;  4NHY A;  2A73 B;  1S0J A;  1FOD 1;  4XVH A;  1JOJ A;  4K7J A;  3VKN A;  5EP9 A;  5FP8 A;  1CQ9 A;  4FTE A;  4KGG A;  4JQT A;  2RDN A;  3QD6 A;  1CPN A;  4XUO A;  3RNS A;  2AGS A;  2DUR A;  1KS4 A;  4AED A;  1DLC A;  1QJZ A;  2JB8 A;  1LHU A;  2YV8 A;  5LBE A;  3X29 B;  4NIA A;  5FP3 A;  1S0B A;  2PHU A;  2X29 A;  4XF1 A;  3I4I A;  4LHL A;  1Q43 A;  5FZ4 A;  4Y20 A;  4Q4W 3;  3DEM A;  2VZO A;  4U36 A;  5FIX A;  3U10 A;  2X8K A;  4RS5 A;  3UJO A;  4XCB A;  1K5M B;  4EN6 B;  5H9S A;  3AYA A;  3WNL A;  5LEJ A;  3RJ2 X;  1ZYB A;  2RS1 3;  3QH6 A;  4CSW A;  5JMO A;  3GBG A;  2J1T A;  2VTF A;  3RQ0 A;  2XWB B;  5FBJ A;  2W39 A;  2HWD 1;  1NZI A;  1W0N A;  4A6O A;  4GUL A;  5A32 B;  2DU0 A;  1RUC 3;  4AI1 A;  5A3U A;  2Z69 A;  4M3C B;  4MX3 A;  4DS0 A;  2VH9 A;  1JOB A;  3KQ4 B;  4L0P A;  4NHM A;  3MLJ A;  4ATF A;  2VCA A;  1W2T A;  4MAD A;  4DFS A;  1QNW A;  3USU A;  4FP3 A;  3M4F A;  4CP2 A;  1V6O A;  2OPK A;  4IEU A;  1CAV A;  1GQP A;  2D98 A;  4K40 A;  2VPV A;  3LPF A;  1BVP 1;  2XVG A;  3B9I A;  4H14 A;  5I0T A;  1PGW 1;  4FAG A;  2LRP A;  2DVA A;  1S55 A;  1WKY A;  1S0G A;  1D0G A;  1YCI A;  3WV6 A;  3VLB B;  3WZ1 A;  5K0U A;  3D5O A;  4JDN A;  2ZJC A;  4JKK A;  4YVS B;  1S1A A;  4AHZ A;  4URT A;  1W6O B;  4N53 C;  5DDJ 3;  5LCW L;  5BNO A;  2WYF A;  4XUN A;  5IHR A;  3H7Y A;  2JDZ A;  4RHV 3;  3M3Q A;  4PLM A;  2HYK A;  3R4D B;  1AYM 3;  1MR5 A;  3H1W A;  1U12 A;  4UYB A;  4XJW A;  1AR9 1;  5FY4 A;  4JQR A;  3ZVX A;  4A45 A;  5J09 A;  1OPO A;  2ZKL A;  2HWF 1;  1XND A;  4IE7 A;  3WNN A;  1OOP A;  1RUO A;  4OHY A;  1NQD A;  5FP4 A;  1VMH A;  3KV5 A;  1OBN A;  1NA1 A;  3FUQ A;  2OQ6 A;  1UOF A;  1UU4 A;  4S2F A;  2JDN A;  3P3N A;  2E32 A;  4MGS A;  4YW2 A;  1R1A 1;  5FQ0 A;  1J58 A;  4FFH A;  2ZEZ A;  3KT7 A;  3S5Q A;  3VKO A;  1U5I A;  3GJA A;  1EP0 A;  1OKO A;  4AQ2 A;  2W08 A;  1NLS A;  2D6L X;  4E2S A;  3RZG A;  3I3B A;  3JQW A;  2CWM A;  3KMH A;  4KMQ A;  5ANQ A;  4WM8 C;  5A80 A;  3T3Y A;  4C0H A;  4KQ7 A;  5GKA C;  1LGC A;  4QQH A;  3WNK A;  4KG0 A;  3F95 A;  4FOV A;  4HLT A;  4OHZ A;  1ODN A;  5C9A A;  1CAX A;  3ASI A;  3P3P A;  3SEP A;  3PTY A;  2ZX3 A;  4E9K A;  4LBL A;  1W90 A;  2KA3 A;  1QJU 2;  2K46 A;  3VL9 A;  1RYY A;  4Y5S A;  3H7J A;  1DQ6 A;  3NAP C;  2PQQ A;  2XWJ B;  3HN3 A;  1WBL A;  1GOF A;  2ZGO A;  3G6J B;  3R6S A;  3O12 A;  2DUQ A;  3VHO A;  3V0B A;  4OLL A;  1HRI 3;  3ZPO A;  5GZD A;  2XJT A;  5C3R A;  2PMW B;  3ABZ A;  1RC6 A;  3Q8C A;  5E1R A;  1W2N A;  3CLP A;  5F39 A;  2JDH A;  1ENS A;  2WNO A;  3ZFE A;  2OQ7 A;  4W65 A;  4ATE A;  2GSY A;  1H8T A;  5ACA 1;  4PHZ A;  1GNH A;  3FLP A;  1C8M 1;  5ABJ C;  5JXH A;  3O1T A;  3H8R A;  1PM7 A;  2JG8 B;  4LKF A;  5L9B A;  1BBT 1;  3ZFF B;  2DVF A;  2VAU A;  2AR6 A;  2SLI A;  1OA2 A;  2QQM A;  4HK9 A;  5HCH A;  1RJ8 A;  1JU3 A;  1DYO A;  3HT2 A;  1MS5 A;  1T2X A;  4D3W A;  4EN8 B;  1ULP A;  1JUH A;  5FOB B;  4ONU A;  1W8W A;  2GNT A;  4IL7 A;  4YZ3 A;  3VBS C;  3WW1 A;  3UES A;  3Q8A A;  4UW4 A;  1RUJ 2;  3UL2 A;  3CDZ B;  5B4X A;  4E4H A;  1TQ5 A;  3VB9 A;  3J9S A;  1XJA A;  1DHK B;  4XFB A;  2VC9 A;  4DIQ A;  5FPU A;  3NJZ A;  3VZL A;  1UY2 A;  1ZRE A;  2RMU 3;  3VUO A;  4XTP A;  3MI8 A;  1DG6 A;  5JAX A;  3RYR A;  1K5M A;  4CU7 A;  5EJZ B;  4XHX A;  4AEM A;  4RFT 0;  1YQ6 A;  1PIV 1;  3ORJ A;  3VD9 A;  1RUH 1;  2OT7 A;  2WNE A;  3BTX A;  1D4M 2;  2ZGQ A;  5FZ0 A;  5FZK A;  3WP5 A;  1X9T A;  2YXS A;  5A32 A;  4FTB A;  3IB3 A;  4AAP A;  4M3C A;  4K3U A;  1VBA 1;  1GMM A;  4YVW B;  5EQU A;  3RZJ A;  2ZGT A;  4DOU A;  4CCE A;  4ZS3 A;  4L99 A;  5C6C A;  1OPM A;  2BVV A;  1Q8Q A;  1VB4 A;  2VY0 A;  2E31 A;  2FHR A;  4NR1 A;  2OS2 A;  2BBV A;  2OPW A;  5FO7 B;  1RVF 2;  2X5I B;  4QMA A;  1ND2 C;  2OUJ A;  1ZRI A;  3SC7 X;  3MZH A;  4A4A A;  4LNV A;  1H1I A;  1MS8 A;  1HQN A;  1PVC 1;  4YG3 A;  2F6B A;  2Y26 A;  4GWM A;  2VXJ A;  4BME A;  1GNY A;  1F9K A;  1VBC 2;  2A6W A;  1APN A;  1K42 A;  4KBZ A;  2W47 A;  3L9J T;  1QHD A;  5C8C B;  4Q2F A;  3PDQ A;  2RE9 A;  1UL9 A;  2ARB A;  3I3M A;  2CU5 A;  2IC1 A;  4TSV A;  4D7T A;  5JSP A;  1Z78 A;  2XBO 1;  3GNE A;  4YVS A;  1ZBE 3;  3CEW A;  5DUW A;  1KEX A;  2TEP A;  3HVD A;  4UXA A;  4XPV A;  3ZSE A;  1CGP A;  1UYZ A;  3FHQ A;  3AB0 A;  1DLL A;  4B8E A;  3AK0 A;  1BVV A;  1YHF A;  3UGH A;  2XQR A;  2Y8K A;  1JYN A;  3FX3 A;  3LEM A;  4ZON A;  1O3T A;  1RHI 1;  2DCY A;  4HN0 A;  3RZZ A;  2QZ2 A;  5IAV A;  4ARY A;  1X8M A;  4B4Q A;  5H9P A;  3N9L A;  1LAJ A;  1CZV A;  3VD4 A;  2DBN A;  2E9Q A;  1I5Z A;  1PGS A;  5F6L B;  2TNF A;  1EPW A;  2VOW A;  1LU2 A;  2EXK A;  3KB5 A;  4FFI A;  5FWJ A;  1HQW A;  1GSL A;  5JDB A;  1WMF A;  2VOV A;  3TN9 1;  1YI7 A;  3NV2 A;  2BV4 A;  3GCX A;  2JE8 A;  4LO7 A;  3VBR B;  1XYN A;  2D97 A;  2OZ6 A;  3OPZ A;  4A7Z A;  4DXR A;  4P5Y A;  5I8Y A;  5KHK A;  1RUF 1;  5BUV A;  2HWE 1;  2HWB 3;  4QM8 A;  5I0U A;  1QH6 A;  2PAE A;  1LOC A;  3ME2 A;  5FZ9 A;  2BGP A;  5CEH A;  2C1F A;  5GLU A;  2LUW A;  2VW0 A;  4N9H A;  1DYK A;  2R49 A;  1ZVF A;  2WSV A;  4C0B A;  5F1R A;  1HIX A;  3GZU C;  1DU3 D;  5LWB A;  3OPW A;  2E7T A;  1TMF 2;  1KFX L;  2VE1 A;  4IE5 A;  5J7M A;  3DXU A;  1H8V A;  2XKO A;  3D6E A;  1H2M A;  1LHV A;  1RXF A;  2BRT A;  4N7I A;  2CYF A;  2D7F A;  3H8X A;  2PEL A;  1X9P A;  3FBM A;  4QX7 A;  1RUD 2;  5JWP A;  4ZPI A;  3OY8 A;  1RUI 3;  1PO1 3;  4Q4Y 1;  2P6C A;  3HBK A;  1MS3 A;  5FY9 A;  3RS6 A;  4ASK A;  2DYC A;  3CJI B;  3MEP A;  3ZFF A;  1IGO A;  1O4Z A;  4LBO A;  4OUM A;  2JDY A;  4AFD A;  3J7H A;  1QDC A;  4J6G A;  3UV9 A;  1WLT A;  2MEV 3;  2C24 A;  3AYD A;  2YFU A;  3LA7 A;  3DN7 A;  2VTX J;  4NHL A;  1LJ7 A;  3ACH A;  3J7M A;  1VBD 3;  3VZM A;  4PI2 A;  4A44 A;  3T2P A;  2X05 A;  4QKF A;  4CUG A;  3HIF A;  5A3N A;  4AXO A;  5T5L A;  2WDB A;  4YRD A;  3VBU B;  3GM8 A;  1JZ2 A;  2ZML A;  4QPI B;  3POY A;  2HWC 2;  3ZR5 A;  1JH5 A;  4Y4Y A;  4Z2A A;  4ZZ5 A;  2Q1M A;  4JGZ B;  3JD7 3;  4HG6 B;  1RUG 3;  3SNM A;  1Q8S A;  1WCD J;  2VQ0 A;  3CU7 A;  4JZR A;  3W5N A;  3ZYB A;  2YU1 A;  5I0S A;  2CGN A;  4MSV A;  4BM8 A;  5A1L A;  3ITQ A;  1AL0 G;  1UPS A;  3OGV A;  4XDQ A;  1ONA A;  3B7M A;  4I09 A;  2XH6 A;  3IWZ A;  4PCR A;  1MPX A;  1QY4 A;  4DUX A;  3AZX A;  1XNT A;  2XJS A;  5IK5 A;  1BJQ A;  5BNQ A;  1VPH A;  3OSD A;  4YVW A;  4LR4 A;  5L7O C;  3BUC A;  3EMR A;  5M0T A;  4FP2 A;  1HRV 2;  2WT1 A;  2ZTN A;  5IJR A;  1G9C A;  3BTA A;  3G7D A;  2X5I A;  3LDK A;  1O4T A;  5KHI A;  1H4G A;  2ZS6 B;  4AQS A;  2FDJ A;  3BU0 A;  1LOF C;  2RHP A;  3N35 A;  2R32 A;  2XHN A;  1CES A;  1G8W A;  1VJ2 A;  2G9F A;  2R1B A;  2ZAB A;  3OBT A;  2VL4 A;  1ENX A;  2QJV A;  4YW3 A;  1DQ0 A;  4IV1 C;  1AHS A;  2WS9 3;  3OTF A;  3OGJ A;  1AR8 2;  3E6D A;  1J3P A;  5DN2 A;  1A6C A;  4DO0 A;  5C8C A;  1V6I A;  4LO5 B;  1GWM A;  2GMM A;  3PVE A;  3SH4 A;  1JW6 A;  4R8H A;  2RVA A;  1NXD 1;  5IVC A;  5CFC B;  5LAT A;  2ARE A;  3MV0 1;  5CKN A;  2Z5W A;  2GND A;  1SCS A;  4XIO A;  4QPG A;  3I2D A;  3KQR A;  4S2D A;  2QCS B;  2IVI B;  1WME A;  4BJ0 A;  4UOJ A;  3DCQ A;  4UWD A;  1E5S A;  3SCH A;  4Y24 A;  2IFW A;  1ZRD A;  4TWT A;  2DVB A;  2DVG A;  2RS3 2;  3JCI A;  4CDU B;  1HB1 A;  1H4H A;  2ETE A;  3ACF A;  4HAN A;  1LKN A;  1FOD 3;  5F2S A;  2ATF A;  4XEZ A;  3QH7 A;  1RIR A;  2EA7 A;  4LUK A;  3MW3 A;  2YBK A;  3KT1 A;  3I2K A;  4OZO A;  3OD0 A;  4XHB A;  1FNY A;  2GNM A;  1FNZ A;  2WUH A;  4YZ2 A;  2GC2 A;  2ZX1 A;  5JI7 A;  1OI6 A;  1QJF A;  2OX0 A;  2XJR A;  4XZU G;  3VBH C;  3AZW A;  4TZD A;  5SV8 A;  3PVN A;  3OEB A;  1MS9 A;  1ZBA 2;  1UMI A;  3VBR A;  3ALQ A;  4XAC A;  1W9F A;  1AL2 2;  4M00 A;  1TVG A;  1JZ4 A;  5FMD A;  4C1W A;  3ZXE A;  4LKE A;  3OUH A;  4IV3 C;  4V2V A;  2PLV 2;  2NM1 A;  4OFG A;  5BNP B;  1AF9 A;  1F2N A;  1UMH A;  1JOD A;  1DQ2 A;  2VQT A;  5JZG B;  1BQP A;  5DAV A;  1DGR A;  3O7O A;  3PHM A;  1XYP A;  1YI9 A;  1J59 A;  3THT A;  3ZMO A;  1KIT A;  3ZN6 B;  5FLJ A;  1RMU 2;  1H6X A;  2CDP A;  4QQ2 A;  1XB9 A;  2HWD 3;  5FUI A;  4AEJ A;  3K4D A;  3POI A;  4I0W B;  4HK8 A;  4B29 A;  4Q0U A;  1SQ4 A;  1G6N A;  1YEW A;  5J96 B;  4C91 A;  2GC1 A;  4RQP C;  4LO6 B;  1W8O A;  1LOD A;  3N36 A;  3ZIX A;  3NNJ A;  5GLT A;  3T1L A;  3CJI A;  2E6V A;  4GJZ A;  2A3X A;  4HZF A;  4BQX A;  1YFX A;  1QJU 1;  5F5Q A;  1PO2 2;  2YG0 A;  3HT1 A;  3NJX A;  2XL9 A;  4UAP A;  5LA9 A;  3SKV A;  1OFN A;  4QXC A;  2XPJ A;  1WMD A;  3JU9 A;  3MUZ 1;  5K4L A;  4QGN A;  2PHW A;  3VBO C;  4Q0S A;  3VBU A;  5KBF A;  4QPI A;  2PAK A;  2DVD A;  1LEM A;  1E57 A;  2GC0 A;  3GZT B;  4FOQ A;  1ZX5 A;  4M3C F;  3NQH A;  3FMG A;  4A3Z A;  3AFG A;  1AR9 3;  3TB0 A;  4JGZ A;  4AE2 A;  1IZ3 A;  1CAU B;  4FFG A;  1SDW A;  2ORX A;  3RYK A;  3H3L A;  2HWF 3;  4CA9 A;  5JXI A;  3GBW A;  3HJR A;  4AQ6 A;  3WHU A;  3MIE A;  4BQ1 A;  1ULO A;  2PXJ A;  2O8O A;  4LQR A;  4XAB A;  3T0D A;  5A7S A;  1X36 A;  4Y1X A;  5IVV A;  2VUA A;  1UO9 A;  1IOA A;  1R1A 3;  1QXP A;  3HNB M;  4NHX A;  2CHH A;  1CZT A;  2RJL A;  2VGD A;  4FFF A;  2C9K A;  3E5X A;  4PDW C;  3SH3 A;  1TG7 A;  1QF3 A;  2DTY A;  3ATG A;  2IZW A;  3VKF C;  1DFQ A;  1GOG A;  3I3E A;  3LEK A;  4ZY9 A;  5FZA A;  5LZ6 A;  1X8E A;  1RUJ 1;  4Q0Q A;  3J8F 3;  4FT8 A;  5FY8 A;  3LKJ A;  3SH5 A;  1OXC A;  4IDZ A;  5FMO S;  3O14 A;  4NJ4 A;  1EPZ A;  1W8T A;  3PVO A;  1UOJ A;  5C7G A;  1RIN A;  1AJO A;  2VOT A;  5C4W B;  1OT5 A;  2QQW A;  2WNV C;  3CNA A;  3OF1 A;  1REE A;  1V6M A;  4IUG A;  4V1P A;  4D94 A;  4UI9 L;  2V4V A;  1WCQ A;  3WLU A;  3KV4 A;  2JEM A;  4GH4 C;  3P1I A;  5FZG A;  1P8J A;  1D4M 1;  4Z2W A;  3TNQ A;  1ZZ8 A;  3EHK A;  4TYS A;  3VDC A;  3OCP A;  2P4E A;  2PHD A;  5AFB A;  3PJY A;  4YW1 A;  3CO2 A;  5A7Q A;  5FFO C;  4PIZ A;  4BOW A;  4CTE A;  5FCC A;  3MIH A;  2BTV C;  4QKD A;  4DXS A;  1H30 A;  4AEK A;  2BPA 2;  2D44 A;  4PT6 A;  5ACA 3;  5FYB A;  1RVF 1;  2A1X A;  4HXC A;  3CQO A;  3B01 A;  4IQP A;  4XUP A;  1W28 A;  4B4P A;  2BYV E;  1BBT 3;  2K2S A;  2B7Y A;  2DTW A;  3P6B A;  1SLA A;  5FYC A;  4AED B;  4CDU A;  1MZF A;  1CJD A;  2J1R A;  1PMJ X;  2LTN A;  2QDR A;  5FMB A;  4CDX B;  5B4N A;  5DAW A;  1VBC 1;  4JCK A;  4LBQ B;  4Y1U A;  4LIT A;  5DXD A;  2Q8O A;  4BH9 A;  5A1F A;  2ZPX A;  2QE3 A;  4MET A;  3K48 A;  2ZHM A;  2DFB A;  1XOY A;  2P1B A;  1KD7 A;  4PLO A;  4Y20 B;  2JJ6 A;  3WX5 A;  2OII A;  2UY8 A;  2A70 A;  2DUP A;  5CAZ A;  2QFE A;  3VHN A;  3S7I A;  4CXW A;  4QDQ A;  5LY1 A;  1TME 2;  1LHO A;  1UZV A;  3UYJ A;  5BNN C;  3M7A A;  3Q8B A;  4LA3 A;  5JXJ A;  4I02 A;  4L92 A;  1B35 B;  3RFR A;  1XSQ A;  3GBF A;  4Z8B A;  1W2O A;  5JZG A;  1LB2 A;  5DAX A;  2OVU A;  1WLW A;  4AHY A;  1IHM A;  2BWA A;  2CAV A;  1S0C A;  3KGL A;  1PIV 3;  1GNZ A;  4OCT A;  1RUH 3;  2RDQ A;  3ZN6 A;  4GD4 A;  2JXA A;  1N3Q A;  3PL0 A;  4N90 A;  4FPL A;  5IAT A;  5L19 A;  4XXP A;  1PMH X;  4SBV A;  1VBA 3;  4UFH A;  1W6M B;  4CCK A;  3DKW A;  4ZU5 A;  3OGG A;  4P02 B;  4YM3 A;  3JB8 A;  2W9X A;  3UK9 A;  4FPH A;  2Y6F A;  1O3Q A;  1VMJ A;  3HNM A;  4PJY A;  4BIO A;  3D82 A;  2FD8 A;  1F31 A;  4DXZ A;  4EWD A;  3CMG A;  1UU6 A;  5FZC A;  4CZS A;  1F8V A;  2B4K A;  1PVC 3;  4AK3 A;  1OFS A;  2HEW F;  2FMD A;  4A41 A;  2D6M A;  2W1W A;  4E8D A;  2ID4 A;  3E97 A;  4HPK B;  5FZ6 A;  3WP3 A;  3T2Q A;  3BYW A;  4IGQ A;  1SDD B;  4CDQ C;  3ETP A;  2B5H A;  1TE1 B;  1TMF 1;  5FYZ A;  4DY3 A;  3T4H B;  4E8C A;  5J36 A;  4M01 A;  1XNB A;  2Y38 A;  3C8X A;  4J1X A;  2UUR A;  2R07 2;  2Q5T A;  3U1X A;  3PIJ A;  4C8D A;  2H0B A;  1RUD 1;  3ZPY A;  3PME A;  1CAU A;  4G4F A;  1AR7 3;  4M4P A;  1RHI 3;  5C3O A;  1NCQ C;  4JRL A;  4P08 A;  2IXI A;  4ZU4 A;  3UKT A;  2GH2 A;  1GOH A;  2JIJ A;  3LAG A;  1IKP A;  5HPO A;  5GZE A;  4IE6 A;  4EV0 A;  1FT9 A;  3TOJ A;  3I3D A;  2YDE A;  4O9E A;  5FZI A;  4X6Q B;  1DGR N;  2VZS A;  1JOP A;  1DP0 A;  5FBZ A;  4QDS A;  3LEG A;  3S6P A;  2NYY A;  4OQ9 A;  4XUR A;  4UW6 A;  1W8U A;  3TN9 3;  1O91 A;  1Y9G A;  5FMO L;  2MHF A;  4JTN A;  2HWC 1;  2P2K A;  3A22 A;  3RYP A;  2K9Z A;  4WVV A;  5LAS A;  1YYN A;  4IGO A;  5FOJ B;  2XJV A;  5E88 A;  1RUF 3;  2HWE 3;  5C4W A;  2GN3 A;  3I8T A;  4XMI A;  2YY1 A;  3HEI A;  3QLQ A;  1K3I A;  3WDT A;  4LBK A;  1BHG A;  1BEV 2;  4OI2 A;  5JIU A;  1PK6 C;  4NII A;  5IAX A;  1H8T B;  5EJ3 A;  2XXZ A;  4ZXE A;  4HT1 T;  3AFK A;  3OGS A;  5IK7 A;  1UX7 A;  1LU1 A;  1UD1 A;  2WA4 A;  2WIN B;  2WO3 A;  1GP6 A;  3THP A;  2J1S A;  4BB3 A;  3AZV A;  4WVZ A;  4QX1 A;  1HRV 1;  4NIG A;  2WZE A;  2ZHN A;  1W05 A;  3LFI A;  4PI0 A;  2ZGM A;  4Q4Y 3;  5FUN A;  3SCG A;  2J22 A;  3WT3 A;  2QQU A;  4KWJ A;  4YGD A;  3INA A;  1DGW X;  4PIY A;  2LS6 A;  4B1L A;  4CDX A;  4BQ4 A;  4GQ7 A;  4LHK A;  1AR8 1;  1DIW A;  4LBQ A;  4XXA A;  2RS1 2;  4GKY A;  2CAU A;  3EYP A;  4JGY B;  2VVE A;  4FQ4 A;  4COY A;  2OZJ A;  5SV5 A;  5J37 A;  1O3R A;  4N7U A;  1NCR C;  2NMO A;  4XQW A;  3KVB A;  4ES8 A;  2BFU S;  1PMI A;  2LRO A;  4NPL A;  2ERF A;  4TXW A;  4RS5 C;  1WW4 A;  2O14 A;  3NNM A;  5FAX A;  4Q8L A;  2BVB A;  1B35 A;  2O1Q A;  2ZEX A;  4DZG A;  4XIL A;  2XVK A;  1YFW A;  3GDB A;  4ZZ8 A;  4JVA A;  4OUE A;  1CIW A;  2ZHL A;  4KWK A;  4X8N A;  3U0Z A;  1VAV A;  3WOG A;  3DEC A;  2RS3 1;  1LOE A;  5FYS A;  1PX3 A;  4LO8 A;  4X8P A;  1VLN A;  4UW3 A;  5AFE A;  3BOD A;  5IW0 A;  4JHT A;  3I7D A;  4RSU A;  4DRV A;  3TAY A;  4PBP A;  1O5L A;  3NO8 A;  3TBD A;  1W6M A;  5A1A A;  3RDI A;  2R04 2;  1Y7B A;  1PVX A;  3W21 A;  5AC9 2;  1S4C A;  2ZGS A;  1ZBA 1;  1TNR A;  1HKD A;  5FDB A;  1VBB 2;  2YFZ A;  1AL2 1;  3IM0 A;  3MV1 1;  4WVW A;  3U75 A;  5LEK A;  1I3H A;  3ZX7 A;  2PLV 1;  2J1V A;  4WV8 A;  2VMI A;  4ARX A;  5K0U C;  2VBP A;  2ZAC A;  2ZXQ A;  3POE A;  1H1M A;  2PHT A;  5BNO C;  2JB4 A;  4B3N A;  3CKH A;  4H7M A;  4Q4X 2;  4BWO A;  2R06 2;  4HPK A;  1O4Y A;  1Q3E A;  1RMU 1;  2QBX A;  2YC2 A;  5DZG A;  5H9Q A;  3VDD C;  5CKQ A;  2WLQ A;  4DRR A;  2EID A;  1R08 2;  4K21 A;  5LRR A;  4E4S A;  1JI6 A;  1GQG A;  1YWK A;  1OOP C;  3WF3 A;  4KL1 A;  3HPN A;  3SXW A;  3FBY A;  3LOI A;  5A7O A;  1DQ1 A;  1NA1 C;  4QKB A;  3ZXF A;  1KRI A;  3FL7 A;  2VW2 A;  2R30 A;  1FAT A;  4QX3 A;  5BYN A;  3FFZ A;  2ZBJ A;  4J1W A;  2C6S A;  1SMV A;  1UY1 A;  4L8Q A;  2KR2 A;  1UAI A;  1ULE A;  2R7E B;  1PO2 1;  2FCU A;  1OLR A;  1VAL A;  2BJS A;  4XDO A;  3LWC A;  4TLG A;  5D2A A;  2JEN A;  5EFU A;  2EVX A;  3O1P A;  4LE3 A;  2VVD A;  2XUE A;  4H55 A;  4UFL A;  1TNF A;  4UT5 A;  4OI4 A;  4NRQ A;  5ANN A;  5LBF A;  3UJQ A;  1F4H A;  3ZSK A;  5C9A C;  2QQL A;  3EB7 A;  2ZGR A;  4L11 A;  3LCP A;  1UYY A;  1U5Y A;  3O0W A;  2VR4 A;  4MHU A;  2ZGK A;  5JUV A;  4MGT A;  1DQ4 A;  4Y4R A;  4Z07 A;  4OUL A;  3ZSM A;  4A7Y A;  5C5U A;  2JG9 B;  2WO1 A;  4CP1 A;  3ZYR A;  5I91 A;  1VR3 A;  4D8M A;  3O0V A;  2ZAH A;  3AVS A;  3ZSJ A;  4R9D A;  2Y0I A;  3GF6 A;  1HXS 2;  2JD4 A;  3POB A;  4GMP 1;  2ARA A;  5FYM A;  3MID A;  4RA0 A;  4DUV A;  3ZFE C;  3H9A A;  5JLV A;  2K0G A;  4CYD A;  2XQX A;  4XDP A;  5A6Z A;  3ZXA C;  4BIS A;  3OYW B;  5AVP A;  3AKR A;  4IE0 A;  5LBC A;  3RI8 A;  3OY8 B;  4DPN A;  2XHK A;  3ZYJ B;  4NRO A;  4MHR A;  5IYY A;  3BB6 A;  1QXJ A;  4AW7 A;  4CCN A;  5DUX A;  2VBD A;  3MGU A;  3A21 A;  2QUO A;  1IS5 A;  4MGK E;  1C3H A;  4YM0 A;  3RRD A;  3S0M A;  2XLG A;  2ZGP A;  1GLH A;  4XUQ A;  5A6X A;  4QXK A;  2EXJ A;  4IEP A;  4LEJ A;  4P9Y A;  4R9B A;  2Y6K A;  3AL6 A;  2YRO A;  4GAL A;  4JV4 A;  4QGM A;  1QJU 3;  3WQ0 A;  5JMC A;  1ENR A;  5EPA A;  5IWF A;  3H1Y A;  3I3Q A;  3DYP A;  3BOP A;  4GA9 A;  2VZR A;  2ZGU A;  5FR3 A;  5HI0 A;  2XR4 A;  1A3K A;  4HKO A;  4JGY A;  5T50 A;  1BK0 A;  3RVH A;  2WYS A;  3AXE A;  2BFU L;  4A3X A;  1OQD A;  1SFN A;  4AOC A;  4OVE A;  1ASJ 2;  5KHJ A;  3J4U H;  1BK1 A;  3VHR A;  3N9N A;  5DPN A;  1JYC A;  3BIW E;  4XQD A;  1K5M C;  1UY0 A;  4JAA A;  1SBD A;  5T5O A;  3ZYF A;  1D2Q A;  1GR3 A;  3BCW A;  4D7S A;  3IPV A;  3J26 N;  4ZU7 A;  3N9O A;  2Q0A A;  3A4U A;  4GAZ A;  2W95 A;  2RR1 2;  2XJU A;  1MS4 A;  4YFW A;  5I93 A;  1ND3 B;  1CD3 G;  3AKP A;  4XF4 A;  5FJK A;  3WW3 A;  5LB6 A;  1AR6 2;  4QM9 A;  5LRS A;  3S5A A;  3CL1 A;  5T5J A;  5DAQ A;  1OA4 A;  3JBG 3;  2V5Y A;  4FPG A;  5FV3 A;  1A8M A;  4UF0 B;  1YQ5 A;  3LE0 A;  3PU3 A;  1LHN A;  4FVV A;  3CJX A;  3H50 A;  4XET A;  1GFF 2;  3BU7 A;  4R4X A;  4A42 A;  3LEI A;  3EO6 A;  1XC6 A;  1QJX 2;  1COV 2;  2IXC A;  2QQV A;  3ES4 A;  3K75 B;  4IET A;  2XJP A;  3IDA A;  2VCB A;  1TME 1;  1V9U 2;  5F5A A;  4QX8 A;  4RYD A;  5FPB A;  5LBB A;  4HKW A;  1RUE 2;  1G9D A;  2RS5 2;  1HJF A;  2XJQ A;  1VBE 2;  4FXK B;  5CVR A;  3CBN A;  1LOA A;  5D8A B;  5C71 A;  3GHN A;  4EWA A;  4YVS C;  1OHF A;  1OH4 A;  1U5Z A;  1BKZ A;  2JDK A;  1D4M 3;  1SBF A;  3ZM8 A;  3GYD A;  3C7O A;  3W5M A;  2DV9 A;  1UZZ A;  4GB3 2;  3BTZ A;  4QPG B;  5A33 B;  2JEC A;  2W94 A;  1PGL 2;  3B02 A;  2F17 A;  3T30 A;  2CTV A;  4CXX A;  2WAA A;  4LIU A;  3R0R A;  4XFC A;  1MS0 A;  5E16 A;  1CX1 A;  1CIY A;  4ITC A;  4N8M A;  3K3N A;  1RVF 3;  2VZQ A;  5A7N A;  3ZFG B;  2ZHK A;  3VD3 A;  3KWV A;  1IS4 A;  1EAH 2;  4H2A A;  3N9Q A;  2X10 A;  4OHW A;  3O1V A;  3BKZ A;  1SEF A;  1NQJ A;  1NLQ A;  1B09 A;  1ULG A;  3ZXJ A;  2BU9 A;  1VBC 3;  4B1M A;  4IEQ A;  4TN7 A;  5CAD A;  2JDM A;  2WNU B;  1VRH 2;  1G9B A;  1M06 G;  1AZD A;  1QOS A;  4JX0 A;  3WG3 A;  4QB6 A;  1OLM A;  3DPR B;  1M4W A;  2Y34 A;  1UCX A;  1J84 A;  1ZRR A;  2R07 1;  2W92 A;  1QJY 2;  2VME A;  2JG9 A;  5B2G B;  2ADE A;  4Q27 A;  3RG0 A;  2XVL A;  2XDV A;  1UMZ A;  2R0H A;  5JOX A;  1MAC A;  1SLL A;  3VZN A;  2A7A A;  3HQX A;  3U4S A;  4CU8 A;  3M2M A;  4PQQ A;  4LBM A;  5TSW A;  5FO8 B;  2QDN A;  3L2H A;  2MPF A;  1SPP B;  1CN1 A;  3BI3 A;  2I07 B;  3CF6 E;  4NPM A;  3E6B A;  1UIK A;  4S2H A;  1D4V B;  1SLI A;  1UZY A;  1NAE A;  2WFF 2;  1D7P M;  3EXU A;  3OYW A;  4DQA A;  5C33 A;  3FJS A;  2PHL A;  3RZK A;  1UKG A;  4YPJ A;  1J1L A;  2JG8 C;  5I0D A;  3ETQ A;  3ZFF C;  2W91 A;  3PUH A;  1Y4W A;  1OA3 A;  4RFR B;  4MV2 A;  1JYT A;  3RJR A;  4MGY E;  4YSF A;  2C26 A;  4CEY B;  4XFI A;  1UOG A;  2C9A A;  1NE6 A;  4RGK A;  1RL3 A;  1MZ6 A;  4YAR A;  1JYW A;  4CCJ A;  1AXY A;  1FX5 A;  3WDU A;  2PA7 A;  2Q8D A;  2HKX A;  1AUY A;  3AMH A;  3RWN A;  5DG1 A;  1POV 1;  4N43 B;  1R1Z A;  1NLR A;  2B9V A;  2VZP A;  2P34 A;  3AX4 A;  3ES1 A;  3PUR A;  2PHX A;  4CCO A;  4EE2 A;  1AYN 2;  2A3W A;  4D0Q A;  1BEV 1;  3UKN A;  5EXO A;  5JIA A;  3WNO A;  3B94 A;  1GUI A;  1OVP A;  1OUX A;  3MIC A;  4YZ4 A;  1JS9 A;  1JZ8 A;  5LK7 B;  1F4A A;  4BK4 A;  2VNG A;  1LNS A;  2B45 X;  1FPN 2;  3ELN A;  2DBI A;  3NV4 A;  1W99 A;  2D6P A;  4OZX A;  5FZD A;  4K8R B;  2Y6L A;  3I2I A;  1RUD 3;  3LA2 A;  3AC0 A;  4GZ9 A;  4JTO A;  1MQT B;  1O8S A;  1IG3 A;  2ARX A;  2XKP A;  5JOW A;  3ZDV A;  3WR0 A;  1N47 A;  2ZGN A;  3ZO0 B;  1BCX A;  1LR5 A;  1LTE A;  3CZU A;  3PTR B;  1WW5 A;  5EYY A;  4D69 A;  1ND3 A;  1XU2 A;  1SLC A;  4LK6 A;  4COW A;  2X09 A;  2EF6 A;  1IQA A;  4OHX A;  4YVW C;  1JZ5 A;  1EUU A;  5KR7 A;  5CFD B;  3AP7 A;  2DWR A;  5CIS A;  2RS1 1;  2RDS A;  4UF0 A;  2X5I C;  2EAK A;  5LK5 A;  4YYO A;  3ZYP A;  2L9L A;  4GJY A;  1DDL A;  4QAW A;  5FKB A;  5I8S A;  3ZMN A;  2CSG A;  2VM9 A;  3B3Q E;  3NJV A;  4XYX A;  2OKX A;  2DCK A;  5FPZ A;  2HWC 3;  4FPJ A;  1FV2 A;  2JDU A;  2YUE A;  2Z4F A;  2QQO A;  3PIG A;  4B7K A;  3W59 A;  5C8C C;  5EIY B;  1ULD A;  4QX5 A;  1UQX A;  4HFS A;  1KDK A;  4BQ2 A;  1QQP 2;  1A34 A;  1LGN A;  4OMC A;  1R64 A;  2JKB A;  3I59 B;  5APA A;  3FWE A;  5D8A A;  4XFH A;  5F37 A;  1OC1 A;  2QTW B;  4AI9 A;  4YGC A;  2XGX A;  1YJK A;  1OQE A;  2WT2 A;  2OA2 A;  4W6X A;  2YBS A;  3DUI A;  4Q5O A;  3CIH A;  2VUL A;  4M0N A;  3NV3 A;  4BK5 A;  5A33 A;  4CCC A;  4XOG A;  3FHI B;  1KJL A;  3FLT A;  4MGZ E;  4WZC A;  4W8J A;  3BPZ A;  3TYJ A;  4M4R A;  2R04 1;  2XLA A;  4LOS A;  5AC9 1;  1HRV 3;  3J7L A;  4QHZ A;  2VBB A;  3O0X A;  2HEY F;  1VBB 1;  3ZFG A;  2DF7 A;  2FBE A;  4CCM A;  2Y60 A;  2ET1 A;  2D6N A;  2P3J A;  1O6U A;  1W0P A;  2A71 A;  1AR8 3;  3KT4 A;  4YZ5 A;  4UFM A;  4Q4X 1;  2R06 1;  3MFC A;  2WNU A;  1OLQ A;  4FO9 A;  3VBR C;  1WCU A;  4MXV A;  3WF1 A;  4AVA A;  3L2Y A;  4CPB A;  1R08 1;  3AP5 A;  3DPR A;  3FE5 A;  1QWR A;  3LF7 A;  4NRM A;  3VL8 A;  1FMD 2;  2PAM A;  1L7R A;  4QB2 A;  2A75 A;  3VBF B;  1JBC A;  2SBA A;  3HBZ A;  2D40 A;  4IEO A;  2PN5 A;  3AKS A;  5E6H A;  4P9X A;  2Z42 A;  1SPP A;  4OMD A;  3VBH A;  1AVB A;  2VUC A;  2RS3 3;  4BXF A;  4DUW A;  4RR3 B;  4WM7 B;  4MG2 A;  4F3J A;  3DKQ A;  3RGB A;  4IEX A;  5DG2 A;  4I2O A;  2ZGL A;  4I3G A;  3O1M A;  4XF0 A;  2FDI A;  1PZ7 A;  2D93 A;  5FUP A;  1RGS A;  1RB8 G;  1US3 A;  1YJL A;  3AM2 A;  4NWW A;  4XBQ A;  1W8F A;  3CJI C;  2W46 A;  2W1U A;  1ZBA 3;  1LOB A;  4QT6 A;  4RL7 A;  4CEY A;  5FY1 A;  1WCK A;  1YQ8 A;  1AL2 3;  2VEC A;  2EIC A;  2VNV A;  2CGP A;  3PU8 A;  4LIV A;  1VAM A;  2GP3 A;  2UYA A;  2YB7 A;  2PLV 3;  1AX2 A;  1NY7 2;  3AYC A;  4XJZ A;  3MW4 A;  2H0V A;  4NAO A;  4QPW A;  5FP7 A;  1EYB A;  1PNF A;  2DCZ A;  4N43 A;  3VBU C;  1GZC A;  1HXS 1;  1URX A;  2YC0 A;  4QPI C;  3I2O A;  1W2U A;  3O5S A;  5IVF A;  2TBV A;  1YC6 1;  4DB5 A;  3QCW A;  4PF5 A;  2BUK A;  1T6G C;  3HWJ A;  4NIH A;  3MLK A;  3Q9O A;  5KC6 A;  3HNY M;  3UGF A;  1UXX X;  4JGZ C;  4LBN A;  3WF4 A;  1GZT A;  1QEX A;  4DMI A;  2E33 A;  1VP6 A;  1UU5 A;  3LFM A;  5LY2 A;  2GH8 A;  1E5H A;  3J8F 2;  5F5I A;  1HQL A;  3AYE A;  2VVF A;  2D6O X;  3IMM A;  3LOB A;  2GP5 A;  1MQT A;  1OF3 A;  4D6S A;  3OB8 A;  3BAL A;  1IKQ A;  3FLR A;  3V65 A;  3POS A;  3OJB A;  3WQ1 A;  3ACL A;  5GZC A;  3IN9 A;  1DCS A;  2WZR 2;  3KM5 A;  1PO2 3;  1S0E A;  2O0O A;  2VQA A;  5FXZ A;  3VV1 A;  4XAA A;  2WQ4 A;  5CFD A;  4E4D X;  5A3T A;  3VZO A;  4DY5 A;  4RD7 A;  1W6Q B;  4M0H A;  3SIT A;  3AZZ A;  1NX9 A;  4M3C E;  2H6B A;  2GU9 A;  4NOT A;  4K9S A;  1ASJ 1;  3M1H A;  3NMB A;  4XMA A;  5HXV A;  3ST7 A;  3ZR6 A;  3TEZ A;  2VOX A;  2FZ1 A;  1WGP A;  5GLV A;  1JUI A;  3NNF A;  1WBF A;  4U2A A;  2A6X A;  3D0S A;  2VMC A;  3PJQ A;  1FI2 A;  4W4Z A;  1QNY A;  1YNA A;  2ZAA A;  4LJH A;  4O65 A;  4MGI E;  3TWI A;  4NRP A;  3MF6 A;  4QU2 A;  5FXX A;  5BY5 A;  4FTS A;  1ZZ9 A;  3I59 A;  4QX2 A;  5JR7 B;  3WW4 A;  3DYM A;  1CJP A;  2RR1 1;  5FZE A;  1G9A A;  2D3S A;  1N3P A;  4GMP 3;  4Q4V 2;  3UGG A;  1JU4 A;  4CP0 A;  1AR6 1;  1X7N A;  3VDA A;  1ST8 A;  5CFC C;  5I0R A;  3PUI A;  5T3N A;  1NT0 A;  1UZ0 A;  2GME A;  2PFW A;  1W6N B;  3NJY A;  2YU2 A;  4Q29 A;  3DGT A;  4CEW B;  3CZJ A;  4ES9 A;  1C8M 3;  2BBA A;  3WDY A;  4CDW B;  1H9W A;  3H1M A;  3I54 A;  4URA A;  5CG9 A;  1HW5 A;  1COV 1;  1QJX 1;  2GMP A;  2JX9 A;  3B69 A;  3KSC A;  5T55 A;  3EBR A;  4CDU C;  2QQN A;  3ZLI A;  3RZM A;  1WUV A;  1V9U 1;  4AI3 A;  1RTV A;  5FTT C;  3MPB A;  2G1M A;  1RUE 1;  2ZOE B;  2RS5 1;  1Q8V A;  1WMX A;  2BZD A;  1S0D A;  1VBE 1;  2P6H A;  1I9R A;  4BA6 A;  4DEQ A;  5KWR A;  2WZP P;  1RED A;  4YW4 A;  1BMV 2;  2IXL A;  4O61 A;  4YWA A;  4Q1R A;  1V0A A;  2JE9 A;  1EUT A;  4CXY A;  1US2 A;  4YM1 A;  4HVQ A;  1WLD A;  2BW8 A;  5FK8 A;  2JWP A;  4GB3 1;  5JR2 A;  1WLC A;  3C3V A;  1WD3 A;  2Y33 A;  3WP6 A;  1PGL 1;  3IKW A;  4LO4 B;  1MEC 2;  5A7W B;  2H6C A;  4COV A;  1REF A;  5BNP C;  3TEX A;  1HX6 A;  5JZG C;  4V2W A;  4YNI A;  5FO9 B;  1QJE A;  1EY2 A;  1H2N A;  5FZ3 A;  3THD A;  1OLM E;  1LED A;  2ZMN A;  2D3P A;  4Y26 A;  3VBF A;  3W9A A;  4AR2 A;  1KQR A;  4MUV A;  4OHV A;  4ET7 A;  1UX6 A;  3OUJ A;  3MPP G;  1H1A A;  1EAH 1;  3LDB A;  3M3C A;  5CNA A;  3I49 A;  2P5B A;  2PYT A;  3GHM A;  3N7M A;  4HL0 A;  4RR3 A;  3I2F A;  3C7G A;  4WM7 A;  1SFP A;  2FZ2 A;  2F4P A;  2DUO A;  2VZV A;  3RWK X;  1LRH A;  2W0X A;  1VRH 1;  4CRQ A;  1L7L A;  2BOI A;  1UF2 C;  4OYU A;  5HCB A;  1W3X A;  3PUS A;  2WRA A;  3UNP A;  4Q0V A;  2RM2 2;  3RZL A;  1W9T A;  1QJY 1;  1TME 3;  5GZF A;  1JHN A;  3GZA A;  3O1U A;  1ZZB A;  1HB3 A;  4GWN A;  3IT8 A;  3PUA A;  4PBO A;  1AR7 2;  3T1M A;  1R09 2;  2P3I A;  5I8T A;  2XBO 3;  5H9R A;  1PHM A;  1J1T A;  2VXR A;  3QOP A;  4KWL A;  4XJA A;  1GIC A;  3H42 B;  1ULF A;  2XB6 C;  3I2G A;  4JDM A;  4F8A A;  1N1T A;  2WFF 1;  4I3P A;  4Y22 B;  5CB7 A;  2OYZ A;  1I1E A;  1IG0 A;  2IXH A;  4A6S A;  4AZZ A;  2Z79 A;  2JIC A;  4I01 A;  5CYY A;  4BU2 A;  5BXX A;  2OXB A;  2DDU A;  3WQB A;  3MBW A;  2EIB A;  3IAP A;  4N53 B;  5FXV A;  3T2O A;  3LZZ A;  3PNA A;  5CBL A;  4NHK A;  2QQI A;  5JOZ A;  3AVR A;  3T4V A;  4CDQ A;  4K20 A;  2ZZJ A;  1YO8 A;  2R16 A;  2BGO A;  2V73 A;  5A3P A;  4ZHN A;  1EV1 2;  2IUW A;  4MGQ A;  2B9U A;  4ZKT B;  4BLI A;  4HKL A;  2GAU A;  4MXW A;  4XFG A;  2LW8 A;  4YGB A;  2Y6H A;  3W58 A;  4CP9 B;  1LES A;  4SLI A;  3WSO A;  5JPN B;  3O1O A;  1AYN 1;  2N7G A;  1W6Q A;  4FPK A;  4AGG A;  3KS7 A;  2YPD A;  3JUU A;  2GNB A;  3HQR A;  2WII B;  3V56 A;  1UZW A;  4P9I A;  2D6K A;  2W52 A;  5HCF A;  5F3E A;  2EXI A;  1NKG A;  4ASM B;  4NAM A;  5C4W C;  4COU A;  1GZ9 A;  4WM8 B;  5L36 A;  2R07 3;  1FPN 1;  1Z7S 2;  1DF0 A;  3ILR A;  4R9A A;  2WFP A;  5DQ0 A;  3DL3 A;  3K51 A;  2EIE A;  3O1R A;  1CX4 A;  2D5H A;  1GBG A;  1FXZ A;  1H0B A;  3KCC A;  5J98 B;  1C57 A;  3E5U A;  3VGI A;  1AX0 A;  4BPZ A;  2W1Q A;  2Y0O A;  2ZMK A;  2ORZ A;  3WF0 A;  1DBN A;  3T08 A;  1Q56 A;  3NAP B;  4P5H A;  1PZ8 A;  2UU8 A;  4LT5 A;  3GZE A;  5F6K A;  4OI1 A;  1G86 A;  1W6N A;  3AMN A;  3GGL A;  3GAL A;  2Q8E A;  1ULC A;  1VE0 A;  4CEW A;  2HH9 A;  4QPY A;  4Q4W 2;  4A2U A;  4CDW A;  5T52 A;  1ZZ7 A;  4G9S B;  2VW1 A;  1WW6 A;  1I6X A;  1S2K A;  2O8Q A;  2ZZQ A;  4AED C;  3U07 A;  2VNR A;  5EV7 A;  4CDX C;  4EZH A;  2VO5 A;  3ZXL A;  2J1A A;  5FZ7 A;  4MO3 M;  2JDA A;  4L2N A;  1QQP 1;  2NMN A;  5FYY A;  2BNM A;  5ABJ B;  4XAE A;  5EJ1 B;  1GP5 A;  3PVB B;  2PHR A;  3LSE A;  1POV 3;  1RUC 2;  3JXS A;  2XOM A;  4LOR A;  5HV0 A;  5JPM B;  4FOW A;  1NYW A;  1VMF A;  2LAL A;  1HLC A;  1C5H A;  1L7Q A;  4LBQ D;  1BEV 3;  1LOG A;  2ENR A;  3HR9 A;  4UBH A;  5EWS A;  4YLZ A;  2HLE A;  2XML A;  5L9V A;  1KS5 A;  1LUL A;  3NKG A;  3E1F 1;  1B35 C;  3KCX A;  3IPV B;  1BYH A;  2W2I A;  1GWL A;  5A7W A;  3VBS B;  1E5R A;  3HMY A;  3IDC B;  1DZQ A;  4QDR A;  4BZ4 A;  5JI9 A;  5KXB A;  3N4M A;  5KC5 A;  1RJ7 A;  3KGZ A;  3QBQ A;  3GJB A;  1SAC A;  2VMG A;  4WVM B;  4AVC A;  5IFP A;  1YIP A;  5IK8 A;  4BQY A;  1W8Z A;  2C0Z A;  2Q8C A;  1DGL A;  1NCR A;  3ON7 A;  1S2B A;  1V00 A;  4KU7 A;  1IPK A;  1C5I A;  4CU6 A;  3RZH A;  4W6Y A;  2KXL A;  4DNY A;  5F32 A;  4IXL A;  4CVU A;  5KXE A;  5DDJ 2;  1X33 A;  2TUN A;  3I2J A;  2G19 A;  5KHH A;  4H3W A;  4JKL A;  3BGA A;  1YQ2 A;  2UWB A;  2VMD A;  5FK7 A;  4RHV 2;  2CV6 A;  1AYM 2;  1BLZ A;  1XSR A;  1CON A;  2VCC A;  3NRU A;  5IK4 A;  2UWC A;  1OSG A;  5CKM A;  3KD4 A;  1FYU A;  1WW7 A;  2WQ8 A;  1HB4 A;  1IQD C;  2XON A;  3KZ4 C;  4R9C A;  2WBK A;  3K4A A;  4W6W A;  1FMD 1;  3AXD A;  5FY5 A;  4FAH A;  1DZR A;  4XF3 A;  2BNO A;  1N1Y A;  2PHF A;  3AKT A;  3W20 A;  3MLL A;  1ND2 B;  1UYX A;  3VHP A;  2NQY A;  2ZX0 A;  4O7X A;  2WLP A;  5F3I A;  1N1S A;  3OBR A;  3PUQ A;  2RDR A;  2WZ8 A;  3S30 A;  1RXG A;  1ZRC A;  3HN1 A;  1J3Q A;  5T54 A;  4E27 A;  1UYP A;  1GV9 A;  1WZX A;  4CUC A;  2CGO A;  2J42 A;  2V5D A;  3LPG A;  2RG4 A;  2KM2 A;  5T5P A;  2NN8 A;  2VG9 A;  4OUS A;  4Y22 A;  5BPX A;  2QNK A;  4Y5T A;  4YM2 A;  2BNN A;  1VRB A;  2KD7 A;  4IEW A;  4QB1 A;  5E8A A;  3WG4 A;  2HBU A;  3C7H A;  4N53 A;  1BZW A;  4XQ4 A;  3MIF A;  2R04 3;  4XUT A;  4ZS2 A;  1GYK A;  5AVA A;  1CVN A;  5AC9 3;  4QGL A;  4LXL A;  2RV9 A;  4LHN A;  1VBB 3;  2YBP A;  1GU3 A;  3LB9 A;  1JZ3 A;  3SKJ E;  4PF1 A;  3MW2 A;  4LBJ A;  1HRI 2;  1QH7 A;  2OW4 A;  1N3O A;  3IZO A;  3N7K A;  1NY7 1;  3NNL A;  4HMZ A;  4HVR A;  4YW5 A;  5FLI A;  1DYP A;  1SHW B;  4CP9 A;  4XJ9 A;  1XNA A;  4LLO A;  2AH2 A;  1Q5O A;  3DYO A;  2PTM A;  4Q4X 3;  4KBB A;  2R06 3;  1IPJ A;  4H7L A;  2WAB A;  4K6B A;  3WXP A;  1E5I A;  1W9S A;  4E2G A;  3HAG A;  1R08 3;  4UBG A;  1UOB A;  3AJY A;  3LSD A;  2WWJ A;  4P9G A;  5L9R A;  4WM8 A;  1HDK A;  3PMS A;  3WY6 A;  3POJ A;  1OD3 A;  1CZS A;  4GKX A;  1Y3T A;  4L9B A;  3VDB A;  3J8F 1;  2RJK A;  3IAQ A;  3M3O A;  3VZK A;  3WCS A;  4FSJ A;  1MVE A;  4LK7 A;  1SLB A;  3C7F A;  1H8T C;  1TZO A;  1J83 A;  2IFR A;  3JZV A;  4AHW A;  2HJI A;  1OKQ A;  2WZR 1;  4GIQ A;  2V09 A;  4KNC A;  3NAP A;  4LA2 A;  3WNM A;  4IE4 A;  2JIG A;  4EN7 B;  1CPM A;  3LIG A;  3FUO A;  2UYB A;  4QQL A;  4AYU A;  1UY4 A;  2BEO A;  1Q8P A;  4I0B A;  4RGA A;  5FWE A;  2RMU 2;  4XF9 A;  5A3W A;  5LA0 A;  5F8P A;  5FXW A;  4CCD A;  5JCT A;  3U4X A;  2Q4S A;  1J3R A;  5JSR A;  1OUS A;  2JE7 A;  1XBF A;  1F5F A;  5J3U A;  3K4Z A;  4D6R A;  4JGY C;  1G7Y A;  4Y1V A;  1W0O A;  5ABJ A;  4AVS A;  3V0A B;  3D0J A;  2B8M A;  3HQU A;  3WUD A;  1W6P B;  4AGR A;  4YZ1 A;  4LTA A;  4L97 A;  5A70 A;  1HXS 3;  4Q4V 1;  3OGR A;  2XLF A;  2YC4 A;  2B39 A;  1SCR A;  1SLT A;  1VAK A;  2GDF A;  3O1S A;  2WWS A;  4R4Z A;  3JBG 2;  4EYU A;  1C28 A;  1YIF A;  3N7L A;  3IDE A;  4Y1Y A;  2ARC A;  5DAB A;  1D2S A;  3AKQ A;  3VBS A;  3B9C A;  4K1Z A;  4KH9 A;  4BLJ A;  3FFQ A;  1X50 A;  2JKX A;  3J7N A;  4OI0 A;  2HYX A;  3ZSL A;  2X53 S;  1IS3 A;  3EQE A;  3FHA A;  4WVM A;  5FYU A;  4Y1Z A;  1QIQ A;  1S0I A;  4IEV A;  4JDO A;  3H0O A;  4XC9 A;  1OVS A;  2JD9 A;  4TLF A;  1ZZ6 A;  4Q8K A;  1OH3 A;  5A3L A;  4NMI A;  2ZKN A;  2WQZ C;  1ZBE 2;  2IWG B;  1JMU B;  4Z92 B;  1BMV 1;  1YFY A;  1RUJ 3;  4RN5 A;  1WA6 X;  3K46 A;  3ILN A;  1W9Y A;  3MIG A;  4HBN A;  3WCR A;  2VMF A;  1ASJ 3;  1CAW B;  2J1U A;  4PLN A;  4XTM A;  5CZK A;  1MEC 1;  2V72 A;  5FYV A;  5GAL A;  5FZB A;  2QQP A;  5L7O B;  4RGG A;  4XIK A;  3URF A;  1GZW B;  1XU1 A;  4AFB A;  1W39 A;  3APB A;  1OMI A;  3ECQ A;  3U37 A;  1C1L A;  1NZC A;  1LEN A;  2UWA A;  1MZ5 A;  1ND2 A;  1PZ9 A;  3BOW A;  4HET A;  2BER A;  4IW3 A;  4BCU A;  2UY9 A;  3ZYI B;  2HBT A;  2RR1 3;  2W87 A;  3IDB B;  3LD8 A;  4IV1 B;  4QU1 A;  3USS A;  1AR6 3;  1W9W A;  1O7F A;  3SQO A;  3UKV A;  5K7P A;  2VU9 A;  3MHZ A;  3N9P A;  2DCT A;  1PM4 A;  4AI8 A;  4KU8 A;  1YLL A;  2NZ9 A;  2C4X A;  1O59 A;  2ZEW A;  3A0N A;  3C7E A;  1AJK A;  5HBA A;  4JHZ A;  3H8U A;  3I2H A; 
#chains in the Genus database with same CATH homology
 1GQP A;  3BN6 A;  3LPF A;  1PMH X;  1WKY A;  1L7R A;  3GXU A;  4JKK A;  4QB2 A;  4P02 B;  5LCW L;  2W9X A;  3HNM A;  4XUN A;  5IHR A;  4OMD A;  3CMG A;  2B4K A;  4A45 A;  4DUW A;  2VJX A;  3WNP A;  3WNN A;  4A41 A;  2W1W A;  3HOB A;  4E8D A;  2ID4 A;  1US3 A;  3LQC A;  3T2Q A;  2E32 A;  4MGS A;  1SDD B;  2ZEZ A;  2W46 A;  3ETP A;  2W1U A;  4E8C A;  3C8X A;  3I3B A;  3III A;  2EIC A;  4KMQ A;  2YB7 A;  3WNK A;  4QPW A;  4M4P A;  3SEP A;  4P08 A;  1KGY A;  1GOH A;  5HPO A;  1RYY A;  1XPW A;  3HNY M;  3I3D A;  1UXX X;  3WF4 A;  5G05 L;  2E33 A;  2VZS A;  3HN3 A;  1DP0 A;  1GOF A;  4QDS A;  3LEG A;  3FN9 A;  4XUR A;  1PX4 A;  3ABZ A;  1OF3 A;  3A22 A;  3OB8 A;  3MO4 A;  2E26 A;  5JXH A;  3HEI A;  1K3I A;  2RJ2 A;  1BHG A;  1NX9 A;  2QQM A;  5F7U A;  1JU3 A;  1DYO A;  4ZXE A;  1T2X A;  3OGS A;  2Y6J A;  1UX7 A;  1ULP A;  1JYX A;  2WO3 A;  4W4Z A;  2VMC A;  2J1S A;  4QX1 A;  3UES A;  2WZE A;  2Y6G A;  3CDZ B;  5B4X A;  4QX2 A;  3DYM A;  1I5P A;  2J22 A;  5DMY A;  2VC9 A;  1JU4 A;  1UY2 A;  3VDA A;  3PUI A;  2LS6 A;  1UZ0 A;  4CU7 A;  5EJZ B;  3EYP A;  1UXZ A;  3CZJ A;  2BBA A;  3VD9 A;  1JHJ A;  4TXW A;  2QQN A;  3IB3 A;  1GMM A;  4DEQ A;  2BZD A;  1NUK A;  1OF4 A;  2ZEX A;  2E31 A;  3GDB A;  1H6Y A;  4ZZ8 A;  4OUE A;  3WEZ A;  3SEE A;  2J7M A;  4A4A A;  1EUT A;  3DEC A;  5IFT A;  1US2 A;  2VZ1 A;  1PX3 A;  2VZT A;  5JR2 A;  1GNY A;  1K42 A;  5J1X A;  2W47 A;  4MOA A;  2WAO A;  5A1A A;  5LA2 A;  3THD A;  1KEX A;  4ET7 A;  4LKS A;  1UYZ A;  2YFZ A;  3MV1 1;  3FHQ A;  4LPL A;  2Y8K A;  2J1V A;  2W1S A;  1JYN A;  4ARX A;  3I2F A;  3C7G A;  2VZ3 A;  4FI9 A;  2VZV A;  2ZXQ A;  2PQS A;  1JZ7 A;  1UWW A;  3CKH A;  4ARY A;  2YC2 A;  2QBX A;  4OYU A;  1CZV A;  4BDV B;  2CDO A;  3VD4 A;  2EID A;  3D3A A;  3UNP A;  1JI6 A;  1W9T A;  3WF3 A;  3HPN A;  1UY3 A;  3FL7 A;  5C70 A;  4QX3 A;  2JE8 A;  4DXR A;  1UY1 A;  4P5Y A;  2R7E B;  3I2G A;  3T0B A;  3VD5 A;  3T0A A;  2BGP A;  5CYY A;  2DDU A;  3WQB A;  1F4H A;  2EIB A;  3IAP A;  3MBW A;  2QQL A;  3EB7 A;  3T2O A;  1UYY A;  2VR4 A;  4P00 B;  4AAX A;  5JUV A;  2QQI A;  1SG3 A;  3THC A;  2ZEY A;  2BGO A;  2WO1 A;  4GWI A;  4MGQ A;  4D8M A;  2LW8 A;  4GWJ A;  2Y6H A;  5HXM A;  3WSO A;  3J7H A;  4DUV A;  2XQX A;  2YFU A;  1NKG A;  3ACH A;  5IYY A;  3ACI A;  4A44 A;  3T2P A;  2X05 A;  3A21 A;  5DQ0 A;  2WDB A;  3GM8 A;  1JZ2 A;  2EIE A;  4XUQ A;  2DCJ A;  2VQU A;  2Y6K A;  4CU9 A;  4Z2A A;  2W1Q A;  3WF0 A;  4ZZ5 A;  2ORZ A;  3T08 A;  4HG6 B;  3DYP A;  3W5N A;  2VZR A;  3GGL A;  3VD7 A;  3OGV A;  2WYS A;  1K12 A;  1MPX A;  4DUX A;  1K45 A;  1XNT A;  3OBA A;  1O8P A;  5DPN A;  2VO5 A;  2J1A A;  1UY0 A;  4MO3 M;  2JDA A;  5G04 L;  5EJ1 B;  4DEV A;  5IJR A;  4KI5 M;  3JXS A;  2XOM A;  3WF2 A;  2W95 A;  3ACG A;  1L7Q A;  2XHN A;  2VL4 A;  2HLE A;  3E1F 1;  5DN2 A;  3OEA A;  3LE0 A;  4QDR A;  3MUY 1;  4A42 A;  3LEI A;  2RVA A;  5IFP A;  1XC6 A;  4QX0 A;  3K75 B;  3IDA A;  4W50 A;  2VCB A;  4CU6 A;  3MV0 1;  4RYD A;  4CVU A;  3I2J A;  4JKL A;  3BGA A;  4BJ0 A;  1YQ2 A;  4UOJ A;  1OH4 A;  2VMD A;  4AG4 A;  2VCC A;  3NRU A;  3ZM8 A;  3ACF A;  3C7O A;  3K77 A;  4BXS V;  3W5M A;  2WQ8 A;  2XON A;  2W94 A;  1IQD C;  2WBK A;  3K4A A;  3I2K A;  4CUA A;  4OZO A;  2WO2 A;  2WAA A;  2WUH A;  4CUB A;  1CX1 A;  1CIY A;  4XZU G;  1UYX A;  3OEB A;  2VZQ A;  2WZ8 A;  3VD3 A;  1UMI A;  1JZ4 A;  1TVG A;  4CUC A;  2V5D A;  2X10 A;  3LPG A;  1W8N A;  2WN3 A;  1UMH A;  2QQK A;  2VQT A;  1JYV A;  2KD7 A;  4QB1 A;  3UET A;  2J1E A;  3C7H A;  4JKM A;  4XUT A;  1H6X A;  4JX0 A;  4QB6 A;  2CDP A;  5FUI A;  2RV9 A;  3K4D A;  3OG2 A;  2W92 A;  1J84 A;  1GU3 A;  2VME A;  3SKJ E;  1JZ3 A;  3NNG A;  4PF1 A;  4DXT A;  4CU8 A;  1SHW B;  5JXG A;  4PQQ A;  1W8O A;  1XNA A;  2VZU A;  4LHS A;  3DYO A;  2QQJ A;  2WAB A;  1W9S A;  2YG0 A;  3A23 A;  1NAE A;  1D7P M;  3NJX A;  4UAP A;  3SKV A;  1OD3 A;  4YPJ A;  1CZS A;  3MUZ 1;  5I0D A;  3VDB A;  2W91 A;  3IAQ A;  3PUH A;  1JZ6 A;  2C26 A;  3C7F A;  1J83 A;  3NQH A;  1JYW A;  4A3Z A;  3A7Q A;  2ORX A;  5JXI A;  3WNM A;  1HN1 A;  2B9V A;  2VZP A;  3HJR A;  5C71 A;  5LA1 A;  1ULO A;  4LQR A;  3T0D A;  4D0Q A;  1UY4 A;  3WNO A;  4TTG A;  1GUI A;  5LA0 A;  3HNB M;  1CZT A;  2C9K A;  1TG7 A;  1JZ8 A;  4KWU A;  1F4A A;  4BK4 A;  1LNS A;  1GOG A;  1W99 A;  3I3E A;  3K4Z A;  3LEK A;  4ZY9 A;  2Y6L A;  3I2I A;  2W3J A;  2WN2 A;  3AC0 A;  4GZ9 A;  3I97 A;  1O8S A;  2W5F A;  2Y64 A;  3CZU A;  3OGR A;  2YC4 A;  3F2Z A;  5C7G A;  2X09 A;  2VOT A;  1JZ5 A;  1EUU A;  1OT5 A;  4IUG A;  4UI9 L;  2V4V A;  1WCQ A;  3P1I A;  1P8J A;  3T09 A;  2JKX A;  2L9L A;  2HYX A;  4XVH A;  4QAW A;  3VDC A;  3FHA A;  2VM9 A;  3NJV A;  2OKX A;  2DCK A;  4XUO A;  2Z4F A;  2JD9 A;  2QQO A;  5EIY B;  1DLC A;  4DXS A;  4PT6 A;  4OMC A;  1R64 A;  3CQO A;  4RN5 A;  4XUP A;  3K46 A;  3P6B A;  2VZO A;  2VMF A;  2J1R A;  1PMJ X;  3CIH A;  5B4N A;  2J1U A;  5CZK A;  4BK5 A;  2V72 A;  3WNL A;  4W8J A;  4M4R A;  5JMO A;  2J1T A;  2VTF A;  3U37 A;  3ECQ A;  1W0N A;  4A6O A;  4QDQ A;  2BER A;  2W87 A;  5JXJ A;  1W9W A;  4L0P A;  2VCA A;  2C4X A;  1O59 A;  2ZEW A;  3C7E A;  4MAD A;  4JHZ A;  3WF1 A;  3I2H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...