2KD7A

Solution nmr structure of f5/8 type c-terminal domain of a putative chitobiase from bacteroides thetaiotaomicron. northeast structural genomics consortium target btr324b
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
159
structure length
159
Chain Sequence
MGTTISKSGWEVLSFTTQEASGEGAGNGLAKCLIDGDTETFWHAKWQGGSDPLPYDIVIDMKQNIQIAQVELLPRGRGSNNPIKVVEFAASEDNVNWTPIGRFGFTNQDAALEYYVKSIKARYIRLTIPDDGGNSTVAAIRELDVKGTIINLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of F5/8 type C-terminal domain of a putative chitobiase from Bacteroides thetaiotaomicron.
rcsb
source organism Bacteroides thetaiotaomicron vpi-5482
molecule tags Cell adhesion
molecule keywords Putative chitobiase
total genus 36
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2009-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2kd7A00
1XNAA 1PX4A 2W94A 3WQBA 3IB3A 4W50A 2VZQA 3CKHA 1DP0A 1WKYA 3DYPA 2Y6LA 1BHGA 3LEGA 3CIHA 1GU3A 3NNGA 3K77A 3WNNA 3I2FA 1HN1A 4TXWA 2WYSA 2X09A 3I2GA 4XUOA 1UY3A 2XQXA 2ID4A 4LHSA 4A44A 4FI9A 3WNMA 2BBAA 3BN6A 4JKMA 1K12A 4CUCA 5DPNA 3T09A 5C7GA 3VDAA 2Y64A 2QQKA 3CQOA 1IQDC 2XHNA 2ZEZA 1PMHX 2WQ8A 1UXXX 3WNLA 2WZ8A 1JZ8A 2Y8KA 2YC2A 5CYYA 1GOFA 4D0QA 3W5MA 2VC9A 2VQTA 4ZZ8A 2VMEA 1OH4A 2WO1A 2BGOA 2WN3A 3HPNA 4OMDA 2VR4A 4CU9A 1JYNA 4DUVA 1SHWB 2J1SA 3LEKA 3OGRA 4QX0A 1NUKA 3HNMA 1NKGA 4DEVA 3FHAA 5C70A 4MADA 2DCKA 4ZXEA 5B4XA 3NJVA 2J1UA 3WF4A 2W47A 3PUIA 1JZ5A 1NX9A 2RVAA 2KD7A 3A23A 1CZVA 3WF0A 1MPXA 5IFTA 1UX7A 5JXJA 4TTGA 4MGQA 1UY0A 3NRUA 2QQIA 1D7PM 2VCCA 1R64A 5JR2A 3DECA 3DYOA 4PF1A 1K3IA 3SEEA 3AC0A 2J7MA 3OGVA 3WNOA 1K45A 4XZUG 1H6YA 1KGYA 3K46A 2VQUA 3WF1A 1UY1A 3D3AA 3OB8A 1W8NA 2DDUA 3W5NA 2VCAA 4CVUA 3A21A 4PQQA 3MV11 4BK4A 1EUUA 1JU4A 3CZJA 3UNPA 3IIIA 2E33A 5JXGA 2JD9A 2VZSA 5G05L 5LCWL 1JZ6A 4CUAA 2BGPA 2QQMA 3WNKA 4MOAA 3C7HA 1UZ0A 3ETPA 2W95A 1GOHA 3ZM8A 5HXMA 4ZY9A 2W87A 4E8DA 1ULOA 3HN3A 5FUIA 2QBXA 3GM8A 2J1AA 4OYUA 2EIEA 4QB2A 1W9SA 1UYYA 2VMFA 1F4HA 3U37A 1SDDB 4W8JA 4ET7A 4QDSA 4DEQA 4W4ZA 5G04L 2EIDA 5HPOA 2W46A 2Z4FA 1UMHA 3C7EA 1GMMA 1P8JA 3T2OA 1JZ3A 3ACGA 1L7QA 4P00B 4BXSV 2QQJA 3ABZA 2L9LA 5JMOA 3I2KA 3VDBA 4A41A 4YPJA 1PMJX 2WDBA 2J1VA 1W9WA 3E1F1 4M4PA 5C71A 2C26A 2XONA 3FHQA 4P02B 4OUEA 2Y6JA 4MO3M 2VZTA 1US3A 3I2IA 3K4ZA 1NAEA 5JUVA 2RJ2A 3THCA 2VZUA 2W1UA 1TG7A 3I3DA 3EB7A 2W5FA 3C8XA 2VZPA 2QQLA 1JYXA 1L7RA 3K75B 4GWIA 2W3JA 1W8OA 1W0NA 2XOMA 4UI9L 2VZ3A 3MO4A 1OF3A 4BK5A 3FN9A 4HG6B 2EICA 5IYYA 2PQSA 4LQRA 1CZTA 2W1WA 2Y6GA 3P6BA 3EYPA 3ACFA 4XURA 2ZEWA 2E31A 2X05A 3P1IA 3UETA 3VD4A 4CU6A 3T2QA 1ULPA 2R7EB 4ZZ5A 4Z2AA 2VZRA 2WO2A 2C4XA 1UXZA 4QAWA 1GNYA 3K4DA 4KMQA 1H6XA 3VD7A 5IHRA 4XVHA 2B4KA 3CZUA 1XPWA 4GWJA 3T0BA 1TVGA 3FL7A 1KEXA 4QDRA 2ORZA 4JKLA 1UY2A 4M4RA 2W1SA 5DQ0A 3IAPA 3OG2A 4JHZA 4CU7A 1XNTA 2WZEA 1JHJA 3MV01 4LKSA 1OF4A 2QQNA 3ACHA 2YB7A 3BGAA 5JXHA 3F2ZA 1LNSA 2CDOA 4UAPA 4BDVB 2WAOA 4QB1A 2J1RA 2W1QA 4A3ZA 2DCJA 3OEAA 2ZEXA 2VO5A 4JX0A 2QQOA 4JKKA 4AG4A 2Y6KA 3K4AA 4DXSA 3LPGA 1WCQA 2WAAA 3WEZA 4DXTA 4DUXA 2V72A 3UESA 1JZ4A 2VZOA 2ORXA 4XUQA 3PUHA 1EUTA 2VCBA 3MUZ1 4CUBA 5I0DA 2YG0A 1RYYA 3VDCA 4UOJA 2JE8A 1I5PA 2J22A 2X10A 3C7FA 4AAXA 4PT6A 5EIYB 3HNBM 4L0PA 1UYZA 4ARYA 5LA2A 4KI5M 2Y6HA 3C7OA 1GOGA 1DYOA 5A1AA 3I3BA 4XUNA 2WN2A 2E32A 2LW8A 3SKJE 2C9KA 1UMIA 3THDA 5J1XA 2VOTA 1JU3A 2JKXA 2YFZA 3NJXA 1O8PA 3HJRA 4QX3A 3HNYM 5JXIA 4QDQA 1UWWA 1UY4A 1GQPA 4A45A 4A42A 3GXUA 2YFUA 3CMGA 1CIYA 1XC6A 3A7QA 3IAQA 4P5YA 3OGSA 3LEIA 3GGLA 1O59A 3SKVA 2BERA 1SG3A 2B9VA 4LPLA 4A6OA 5IJRA 3HOBA 4E8CA 3IDAA 3VD3A 5EJ1B 4OZOA 3VD9A 2V5DA 3T08A 2HYXA 4DUWA 2EIBA 5DN2A 4D8MA 3HEIA 2VJXA 3ACIA 1OD3A 1O8SA 2VMDA 3LE0A 3MBWA 3I97A 4DXRA 1F4AA 1K42A 1JYWA 3J7HA 3SEPA 2CDPA 1J83A 4MGSA 1YQ2A 2JDAA 2RV9A 3DYMA 3OBAA 3WSOA 4QPWA 3ECQA 3CDZB 1J84A 2VZVA 3LQCA 4XUTA 5F7UA 5LA0A 3WNPA 3I2JA 1CZSA 2VZ1A 2ZXQA 2WO3A 4KWUA 3T0AA 4GZ9A 1W9TA 3T0DA 4CU8A 2HLEA 2ZEYA 2WABA 1OT5A 1CX1A 5DMYA 4ARXA 4QX1A 3T2PA 2W91A 4BJ0A 2YC4A 3GDBA 1JZ2A 3LPFA 4QX2A 3I3EA 2V4VA 1JZ7A 1GUIA 2W9XA 4P08A 2E26A 4A4AA 4RN5A 3C7GA 1JI6A 2VMCA 2W92A 4IUGA 2OKXA 1JYVA 1UYXA 3WF3A 4QB6A 3JXSA 3OEBA 2LS6A 3NQHA 1T2XA 3I2HA 5B4NA 2WUHA 1DLCA 2VTFA 2WBKA 2J1TA 3A22A 2J1EA 2BZDA 1US2A 3MUY1 5EJZB 1W99A 5IFPA 5CZKA 4OMCA 3WF2A 1PX3A 5LA1A 4RYDA 3VD5A 4XUPA 2VM9A 2VL4A
chains in the Genus database with same CATH superfamily
1XNAA 3WDXA 1S0DA 1PX4A 1PIV1 2AH2A 5JI9A 3OTFA 4KU8A 4Z92B 4W50A 2XJRA 3SH3A 2JXAA 3ZYFA 4AVVA 4GIQA 3M3OA 1FPN2 3R4DB 4YSFA 2UY9A 5BNOB 3GALA 3CL1A 2OA2A 2EIGA 2ARBA 2Y6LA 1JXNA 1H30A 4TLFA 4ZU5A 1DQ5A 2D7FA 2P2KA 4OHXA 3K77A 1FPN3 3FFZA 4XFIA 5L9BA 2XBO1 4TXWA 2WYSA 2NPIA 3PJQA 4IE6A 4BZ4A 4YM0A 2VOXA 4A44A 1RUD3 3RYKA 2DFBA 4FI9A 1RUNA 2WFF2 4JKMA 5DPNA 2RE9A 4Q4W3 2RDNA 1BXHA 4LHKA 3J8F2 2GDFA 2WFF3 3ZFGA 1IQDC 5A7SA 5LWBA 1PMHX 2FQPA 3MEPA 1AR73 1N1SA 2CYFA 1UL9A 2WQ8A 1GNZA 4COUA 1OVSA 1UCXA 2OQ7A 4YVWA 1AR82 2ZGQA 1ZZ6A 2YDEA 4QXKA 2XJVA 2Y8KA 1AYN3 1LR5A 2H0VA 3ZFEA 4M3CB 4COYA 3V64A 4BQ3A 1E57A 3FC0A 5C8CC 1YFUA 2R0FA 1G9BA 4EZHA 1VMJA 3OD4A 1YI9A 2AACA 2VMEA 1OH4A 2WO1A 4AI8A 5CAZA 2BGOA 1QJEA 1V6IA 4GXLA 2XJTA 3J7LA 1WGPA 1H8TA 2VR4A 3NWKA 4OMDA 5GLTA 2OXBA 4RHV2 1SHWB 3VBRB 4CU9A 1JYNA 3KQ4B 2DF7A 2PAEA 3HNMA 4CCDA 4LHNA 2V73A 3PUQA 1GR3A 3FHAA 5ACA2 4Q4X2 1YIPA 1YQCA 3JZVA 4GJYA 4YYOA 5B4XA 4N43C 2FCVA 4ZXEA 1WLWA 4B7EA 1XB9A 2WZR3 3WF4A 2QKDA 4FT8A 5FZBA 4UT5A 2X5IC 2VVFA 1JZ5A 2WS91 1NX9A 5ACA3 2Z79A 4JHTA 5EP9A 2E9QA 2P4EA 2RVAA 4C90A 1QGLA 2KR2A 3S0MA 2HWB1 3VBHC 3WF0A 1MPXA 2BBVA 1J1LA 4IE4A 5FMCA 3USUB 3JD73 1UX7A 1W6OB 1W2AX 1ZBA3 1NOVA 1ZBE1 2QZ3A 2UYBA 3JQWA 4Y4YA 5BV6A 4JQRA 4K8RB 1MR5A 4MGQA 1UY0A 5DAQA 1XNCA 3NRUA 4UW6A 3N7LA 1R64A 2ATFA 2WNVA 2NM1A 5JR2A 4Y1VA 3SEEA 4AVSA 5K0UB 3AC0A 2J7MA 3DL3A 1SLIA 4FPLA 3OGVA 1MVEA 3BOPA 5LRSA 2NN8A 1OQDA 1J3QA 4JQTA 3WP4A 3DPRA 5FYYA 3OY8A 3TYJA 4RL7A 4XCBA 5JZGA 1UY1A 3CJIA 4NO4A 4QPGA 4YW1A 4Y1YA 1V70A 2CTVA 1F2NA 2F6BA 3MYXA 3W5NA 2VCAA 4CVUA 3WHTA 3A21A 1F8VA 2O8OA 3RZZA 4BQ4A 3H8RA 3HQXA 2R16A 3HIFA 1NY71 4A3XA 2WZR2 4OUMA 1MS4A 2IFWA 4CUAA 1R092 4ASMB 5M0TA 3JBG1 2QQMA 3WNKA 1S0CA 1YO8A 3ETPA 3FMGA 1ULCA 3ZM8A 2EXJA 4HVRA 2BEOA 3TEWA 1H9PA 1VBA3 2W52A 2W87A 3NO8A 1XSRA 3AMPA 1VIWB 3LFIA 4WZFA 3LIHA 4GAZA 3VBUB 3NAPB 1WCUA 1VBA2 3ZSEA 1HRV3 3PHMA 5EWSA 2O1QA 3GM8A 1OLRA 4EN8B 5DAVA 1IPJA 1OOPC 4QQ2A 2EIEA 1VMHA 3J8F1 4Y3OA 1OHFA 3WDTA 2H6BA 2VMFA 3RVHA 1ZA4A 2WC2A 1JOBA 3ETQA 5FOBB 4MGIE 4CYDA 2HJIA 3EJKA 3FWEA 2I45A 1PVC1 2EF6A 5F32A 4D6QA 3IPVA 2VTXA 4OQ8A 1LECA 1G8WA 4QDSA 5A1LA 1T6GC 1DFQA 3SCGA 1YRZA 2Z4FA 5FO7B 3J7MA 3NNFA 1P8JA 1PO22 3GJAA 4L2NA 1XBFA 5CKNA 4EN9B 1JBCA 1L7QA 2Q5TA 4UBHA 4I0WB 2JDNA 3ZXAC 5J96B 5LEKA 1IKPA 1VRH3 2NMOA 2WWUA 3ENRA 1J3RA 1X7NA 1IKQA 4OLLA 4YARA 4HOOA 1UMZA 5I0TA 1NLSA 1CAVB 4HT1T 5ACA1 4PDWB 3AXDA 3OPZA 3OJBA 1JHNA 4QGLA 4WBBA 4YPJA 4FBFA 1PMJX 2RS32 3DCQA 4K1YA 1PGW2 2X5IB 5KBFA 1CPMA 2JKBA 2J1VA 4Q4W2 4JTOA 2V09A 1ZRRA 2DV9A 3AKRA 1B35C 2LALA 4M4PA 4Q29A 3WUDA 4IEXA 4FXGB 2XONA 3SISA 4E4HA 4IV1A 1RHI3 2ZMKA 2NLRA 3BPSA 3O1TA 1DQ1A 1W28A 3LF7A 5D8AC 4RFT0 5FYMA 4S2FA 4XDPA 5A7WA 4YG3A 3N9OA 4LBNA 3K4ZA 5FIXA 5JUVA 1S2KA 1KFUL 4YZ1A 1BYHA 2GZWA 1G9DA 3BOWA 4H2AA 1TG7A 4P9XA 3VN4A 4XOGA 2ZA9A 2R041 3EB7A 2W5FA 4A2UA 1ZREA 4Z1VA 1PGL2 1XOYA 1MS9A 3WDWA 1AX1A 1MZ6A 1UPSA 2JG8A 3WP3A 1VB2A 2OZJA 1N1TA 3K75B 5F2SA 3MZHA 4CRQA 1S0FA 1W8OA 5FZKA 3IDCB 1Z7S3 3ZXFA 3O5SA 1S2BA 1C5IA 4XJAA 3MLLA 3E6BA 2ZCWA 4K40A 1AR93 4LTAA 1AYN2 4N9IA 1OH3A 3AP9A 5LZ6A 1GWMA 3R0RA 4DS0A 4EWEA 4D7TA 4CDQB 2P5BA 2XVGA 2Q8CA 2XBO3 1IOAA 4J1WA 4FPYA 1CZTA 1PO12 3P6BA 1AL22 2HEVF 3EYPA 1UOJA 4XURA 1M4WA 5FPAA 1RITA 3RZLA 4OI4A 3CNAA 3WG2A 1BBT1 1G6NA 4D6RA 5ANQA 1W2UA 2E31A 1RINA 4JGZB 3ZYRA 2ZHMA 1UZVA 3MF6A 5EFUA 1G9CA 3OYWB 3VD4A 1UQXA 3O14A 3M1HA 2CAUA 4QM8A 1RVF3 4NHMA 2ZGOA 5FZ7A 2C4XA 4HN0A 3WW4A 4QAWA 4FOYA 1A78A 3K4DA 1S2EA 2QDRA 1RUF3 4B3NA 1X36A 5IHRA 4XAEA 2K46A 4L11A 4CDXC 4PCRA 3WUCA 5F8PA 5IK5A 4YG6A 4JGYA 2R071 4QDRA 2ORZA 4M0HA 1NCQA 3AMHA 4LBQA 2IXLA 4Q0SA 3IAPA 1GZWA 3HN1A 5JI7A 5ANNA 3I3MA 5IAVA 5A3MA 2YGLA 1QF3A 1TEIA 4LA3A 3A4UA 1SCRA 3HAGA 4CSWA 4CU7A 5J09A 1SBDA 4BQ5A 1ZRCA 3WCSA 3RZKA 1UIJA 3EHKA 4MGTA 2YB7A 4HETA 4J25A 3WQ7A 1QJU1 1V6LA 3BGAA 4DQAA 5JXHA 4LK6A 1OC1A 3PMEA 1Y9MA 3WINE 4YGDA 1LNSA 1HN0A 4BDVB 1ENSA 1RTVA 1SLBA 4BQ2A 2DUQA 1RUG3 4A3ZA 1HXS1 2K2SA 3CU7A 2GP3A 3LEMA 4R9CA 3GYDA 1ODMA 1IZ3A 2DTYA 2PN5A 4OHYA 1KRIA 2QE3A 3AYEA 3OBZA 3BTYA 5DABA 4HVQA 1OSGA 4XYXA 2ZX3A 3K4AA 4D3WA 1OD5A 5A3OA 3RJRA 1VE0A 4QPYA 2FDFA 2LRPA 4XF3A 1FMD1 3D0SA 3RZGA 1N1YA 5LBCA 4DXTA 1QJY1 2ARXA 4QD2A 3K3OA 2VBPA 4NPRA 1H1AA 2SLIA 4R52A 2H6CA 4UBGA 2D6NA 4NIIA 3J9SA 1GKBA 4KG0A 4KH9A 2NZ9A 1OBNA 2VZOA 3DUIA 3AZVA 4JV4A 1N3PA 4EN7B 2FDGA 4COWA 1EUTA 2VCBA 2WLQA 4JDNA 4CUBA 1OVPA 4BQYA 2RMU1 4QKDA 3ZFFB 4AQ2A 1GZCA 2YG0A 3MW2A 3NJYA 4WVZA 5GLWA 4UOJA 5J7MA 4ORFA 5C8CB 3VBOB 4ZU7A 1OLMA 2VVEA 2X10A 5FP3A 1LESA 4XMIA 2VU9A 3WW1A 3WG4A 1OMIA 1CAWA 3ZPYA 1BJQA 2P6CA 4UWDA 5FZFA 1CR7A 5FV3A 2OPKA 4KI5M 2G19A 4HKOA 2D3RA 1GOGA 2RS51 4DB5A 4TZDA 4BOWA 2LTNA 2GC0A 5A1AA 2LW8A 3POYA 2PHLA 3LGRA 5BY5A 1AR62 1SLTA 1PVXA 1N3QA 1W8WA 2YY1A 4C8DA 2VOTA 3A0KA 4Q4Y3 1JU3A 4FPGA 3UYJA 2JKXA 1JUIA 4EE2A 5KC5A 2WS92 3ZPOA 1AF9A 1YLLA 1RUOA 1FNZA 3RQ0A 1UO9A 2RS12 1GQPA 3MIHA 3VHRA 5I8YA 2JE7A 1C1FA 4PHZA 4Y5TA 4Y20B 2H0BA 3T1MA 3WR0A 4YWAA 1A8DA 1W6NB 1CIYA 4X6RB 4CDXB 5IAXA 2CGPA 3IAQA 3OGSA 1XYOA 1QOTA 1O59A 2PHTA 1MEC2 5IVVA 1J1TA 1SG3A 2EALA 4LPLA 4OI1A 4B1LA 1W9FA 5F1RA 4A6OA 4I30A 3THPA 1VR3A 2R063 3DN7A 1ZZ7A 2JX9A 3IDAA 1WBLA 2DBIA 3LSEA 2AR6A 2JDYA 1EP0A 1MACA 2HEYF 4QU2A 5C5UA 2PHFA 3NV1A 4Q4W1 5E6HA 3VZJA 1JH5A 2Q4SA 4MZUA 1AL23 2HYXA 2ZMLA 1L7LA 3IN9A 3LOIA 4B4PA 5HBAA 1RUD1 1QJY2 4AFCA 2LM3A 2XUEA 2ZOEB 4GALA 4CZSA 5BNNA 1POQA 5FXZA 2HWE2 2WA3A 5A33B 4I09A 2CWSA 5CU1A 2A6VA 2EAAA 2BOIA 4HONA 3ZX7A 1C3HA 2W2IA 1K42A 1IHMA 4CXWA 1D4M3 4LBLA 2XL9A 5JOZA 3RWKX 4AI1A 4CPBD 4QQHA 2WQ4A 3VBRC 4H7MA 5K0UA 1J83A 1OQ1A 4QQPA 4LBKA 3I7DA 1HB1A 3MI8A 1YXWA 3U14A 1ZRDA 2XBO2 3CHXA 2TNFA 1IG0A 4CCJA 1RUI1 4R9DA 5IT6A 1TME2 2A5ZA 3R05A 4WM8A 4YGEA 1JTZX 3PTYA 4XFAA 5GLVA 3ZIWA 3POBA 4XF0A 3KF5A 3IZOA 3O1MA 2OW4A 4HKLA 4E9KA 4KG8A 4OULA 4CDUC 4Z07A 1GP6A 3CDZB 2JIGA 3O0VA 1UPIA 4Y24A 1J84A 4YW2A 3WG1A 4UW5A 4AI0A 4BIOA 4L97A 3LQCA 3PUSA 1O5UA 1S4CA 3JQXA 1LRHA 3BIEA 4K8FA 3T4VA 5FYVA 1CZSA 4XHBA 2AUYA 4YM2A 2B5HA 2VZ1A 2XH6A 3U07A 2WO3A 5IUQA 1BCXA 4GZ9A 1W9TA 4CU8A 4P9JA 5FZ6A 5FDBA 4ONUA 2HLEA 2ZEYA 2JENA 4GB31 1EYBA 3SLIA 4OCTA 3KV9A 4W6WA 1AL0G 1DGRA 1W8HA 3OOXA 4WVVA 5FK8A 1LTEA 1QJFA 2PTMA 1LHWA 3H42B 5KXCA 1QJZA 3WDYA 3S6PA 3NAPA 3ALQA 3RMXA 2W68A 2DCYA 2HWF2 4HK8A 1JZ2A 3E5UA 1WD3A 3AP4A 1SACA 2W39A 2O0OA 1B35B 4P14A 4QKNA 1PM4A 1RUI3 1Q8SA 1SFYA 4XBLA 4RR3C 4YFWA 5LRRA 1F9KA 3AYCA 2Q30A 2RDSA 2WWSA 4RN5A 4AFAA 4LO5B 5A7OA 3VHOA 1JI6A 1GANA 4FP2A 1RUI2 3PDQA 3Q9OA 4AXOA 5I93A 1JYVA 3WF3A 4QT6A 4QB6A 2DUOA 1QXRA 2DVGA 2GH8A 3AFKA 4LO6B 3T30A 4BQWA 1BZWA 1GBGA 1LOFA 1VBB1 1MS0A 2R30A 2ZTNA 3NQHA 1H2LA 3MF9A 3O12A 4HL0A 1HRI1 2DVBA 4QM9A 3VLBB 4EJRA 5KHKA 5H9PA 5JWPA 2XXZA 3N9NA 2RS52 3GHMA 2IVJA 1OLME 4H3WA 4CEWB 3A22A 3DKQA 5JMCA 1CAVA 5FZOA 4S2HA 1US2A 4L9BA 5K8SA 2FDHA 1W99A 3QBQA 1R1A2 3LSDA 5CZKA 3TAYA 5J36A 1XYNA 3RRDA 3QH6A 1QXJA 1VBC3 5LA1A 1CVNA 1OLQA 4PQ9A 3N9MA 1POV3 4Q4V2 4WVMB 4K7JA 3GBFA 3WQBA 2WLPA 4KWKA 2BNMA 1HJFA 2E6VA 5EZWA 1H8VA 4O9EA 1GSLA 2VZQA 2VUCA 4L99A 5LASA 5FZLA 4BWOA 1LHNA 5A7WB 4UFMA 3DYPA 2SBAA 3POWA 2WT0A 5A32A 1UU6A 4AI3A 1BKZA 1GU3A 2MEV1 3KLSA 3KZ4C 2WJSA 3RZJA 4YRDA 4XFBA 4NIHA 2ZACA 2RDQA 5A3WA 3TOJA 1ASJ3 2P3KA 4AGGA 1UY3A 2XQXA 2ZGRA 3POFA 1AR63 1K5MB 1WW4A 2BFUS 2ID4A 1SQ4A 1ENQA 5J48A 1SPPB 1AYN1 4IE7A 3VZNA 1W06A 3BN6A 4CDUB 1K12A 1RB8G 4C0HA 1HW5A 2WWJA 1UZYA 5ABJA 5J3UA 1CAUA 2DVAA 5C7GA 1R1A3 3FUQA 1RUE2 2QQKA 3NSTA 5F6KA 3MFCA 1W05A 2R0HA 2R072 4LKDA 4BHPA 4DRRA 4DY3A 5D8AB 1N1VA 4FQ4A 4CP1A 2QQWA 2VG9A 1FX5A 1LAJA 2WZ8A 2QTWB 2YC2A 4XFHA 1Q5OA 5A7QA 5FY5A 1GOFA 5KWRA 4V1PA 3BTZA 3W5MA 2VQTA 4IGPA 5A6XA 5JOWA 2A1XA 4GULA 4YVSA 1RMU2 1FPN1 2OZ6A 1S0GA 4A6SA 2P37A 1RXGA 3OBTA 4LUKA 2NMNA 4XXPA 2RR12 3OGRA 4P9LA 3VZLA 3M7AA 3VDDA 4AWDA 3UK9A 5C70A 5FZHA 4MADA 3MIGA 4Y26A 3JB4C 2F4LA 3JBG2 4WM7C 4DXZA 1NT0A 2J1UA 1PGW1 3PUIA 5LB6A 5T5JA 4XJUA 4H55A 2KD7A 2WT2A 2B8MA 4NIGA 2D93A 4ASLA 1YCIA 3USSA 3A23A 5C6CA 1DDLA 2P3JA 1FAYA 1QDCA 4QHZA 5F2WA 4XF1A 5JXJA 5JSRA 4NN0A 1QDOA 4B1MA 4XFGA 3D82A 4IGOA 2D6KA 4HFSA 2HBUA 4ZU4A 4BLJA 2XUMA 1D7PM 5JPMB 3DECA 4RS5C 4YG0A 5FYSA 1PK6C 3WCRA 4QU1A 4NPLA 4XZUG 5DG2A 4MG2A 4IGQA 1KGYA 4NR1A 2Y33A 4XMAA 2JD4A 3SCFA 3CJIB 5CFDC 1C57A 2E7AA 1EPWA 3GBWA 4K1ZA 5F3CA 5FQ0A 3O0XA 2XLFA 1PZ9A 2RR13 3OB8A 4LULA 1W6PA 3TWIA 1KJLA 1PIV2 3AK0A 5DDJ2 4LNVA 2BW8A 5AFEA 5FBZA 3I54A 4R8HA 1F35A 3CZJA 1RUH2 2VY0A 5FY4A 2EA7A 3LA2A 4YW4A 1ULGA 3WQ1A 5DG1A 5LCWL 1UOFA 2Y34A 4FPFA 5AC93 1D4VB 2A70A 1NA1C 1UAIA 2R49A 2BVVA 2WNUB 2W95A 3FJSA 5FZ0A 3U78A 2VUJA 1HLCA 1U5YA 1GOHA 1X8EA 3KB5A 3ZFFA 2OT7A 4FAGA 4E8DA 4QGMA 5FYHA 4E27A 5C4WB 1S0JA 2HH9A 3ES4A 1MS5A 4JCKA 1REFA 2Y0IA 3WW2A 1V6OA 1DGWA 2WFPA 4NRPA 1I1EA 4A7KA 2GNDA 2OVUA 5J98B 3H7YA 5FP8A 1OFNA 4QPIA 2GNMA 5DZGA 4CDWC 3ELNA 1VPHA 1Z7S1 2EAKA 2YV8A 1PO11 3RZHA 4XQWA 3U37A 2QJVA 1SDDB 3OSDA 1DU3D 4ISQA 2JECA 1UW8A 2GC1A 3AVSA 5E8AA 5I0RA 5CADA 1G7YA 1OA4A 1R1A1 4D7YA 3GZEA 4ET7A 3GZTB 1GZ9A 1W90A 3AJZA 3LOBA 3ROUA 1FOD3 4IXLA 3N36A 3SHRA 2IXCA 1FMD2 2W46A 5HCAA 4XIOA 5A70A 1C5HA 1KDKA 1RHI2 1N47A 2EXHA 2R6QA 1FOD2 4OI2A 4Y1ZA 5KXDA 3U4XA 2QUOA 2L9LA 4QKBA 1HDKA 3MGUA 4HXCA 1HRI2 2VVDA 1ND3A 4PDWA 3VDBA 4TLGA 3ZLIA 2DVDA 2YU2A 3PJYA 3WVJA 1DCSA 3I2DA 2DCTA 1WA4A 5JOYA 3MIBA 4FPEA 3BPZA 4FCAA 4QMAA 4UYBA 5FBJA 4DNYA 1LOBA 4QPGC 2XKOA 3VZKA 4Q0UA 1FYUA 4IE5A 5C71A 1GQHA 4YZ2A 3BB6A 2A3YA 5FZAA 1POV1 5IK8A 3FHQA 2D5FA 3M3EA 4P02B 4CCCA 3I2OA 5EPAA 2JG9C 2Y6JA 3MW3A 4Y22A 2VZTA 4FPKA 4NHKA 3I2IA 4LHLA 3N9QA 3RSJA 1UU4A 2VW2A 2RJ2A 1KS5A 1V9U3 1ZBA1 1UN1A 2VZUA 3GNEA 4K20A 1ZRIA 2BNNA 4I2OA 1GNHA 3I3DA 1PZ8A 3ZYPA 4OFGA 3H8OA 2D6OX 4FTEA 3POEA 1LGNA 2ZBJA 3NV2A 5CBLA 1RGSA 3B93A 1QJX3 1YFWA 3C2UA 2YZ4A 1L7RA 2R32A 3ZYHA 2W3JA 1W04A 1TQ5A 2WNUC 1VBE1 3QH7A 1DLLA 1IPSA 1W0NA 3UT0A 1CJDA 3QACA 5CKQA 1YFXA 3MO4A 4LA2A 5HCBA 3RNSA 1OF3A 2R061 2VTXJ 3PVNA 4CCEA 3W20A 4AEDB 5GM0A 4XACA 1DQ2A 5LK5A 1XE7A 2YHJA 2G9FA 4Q4X1 1Y9QA 2VMHA 4AVBA 2GMEA 2Y6GA 4XF9A 3VUOA 3ACFA 3R4SA 5FP9A 3ZSLA 1AR61 4Y5SA 4JGZA 5C4WC 3P1IA 4J1XA 3OYWA 4PF5A 4C0BA 4SBVA 2D3PA 4CU6A 5ERLA 3T2QA 5EXOA 3UKVA 5FRAA 2CL2A 4Z2AA 4XIKA 5KHGA 5A1FA 2WO2A 1UXZA 1LEDA 2HWE1 3U4SA 1H6XA 3W9AA 4KL1A 1NXMA 4IEZA 4UFIA 4XVHA 4YW3A 3Q8BA 1RUH3 1G9AA 2B4KA 1VBE3 3CZUA 1AJOA 1XPWA 4GWJA 3FL7A 4YVSC 1REEA 1WWYA 1UY2A 4M4RA 2ZZJA 4U36A 4AQTA 5C9AA 4IESA 1YQ8A 2BP6A 1Z0HA 1DGLA 1RUJ2 5FLHA 4AFMA 4AVCA 2EXIA 3KV6A 1PGSA 1REDA 3OG2A 1TNRA 2NP0A 2Z69A 1XNTA 1Y9GA 4FFIA 1JHJA 2Q8EA 3MV01 4AK3A 2I74A 2XLAA 5FO9B 1KXGA 3KSCA 4C91A 2ZX2A 3KCXA 1R093 4YZ3A 1W2OA 2VW1A 1NCRA 3CLPA 3KT1A 1VRH1 5FYTA 1ONAA 2PLV3 3GHNA 3F2ZA 4GWNA 2CDOA 3V0BB 3B00A 4CP2A 5JSOA 2HWB3 2WAOA 2J1RA 1PIV3 2WS93 4QB1A 4CP9B 5K9YA 1JS9A 2ZEXA 2VO5A 2ZX0A 1GICA 1JMUB 4KWLA 4LEJA 2Y6KA 4AG4A 2FZ2A 1W0OA 2EXKA 4U2AA 1G86A 4I0BA 2TUNA 2VMGA 5GLZA 3WEZA 2WAAA 5C3SA 4RR3B 5L19A 3O1OA 2AREA 3WY6A 2WRAA 3M3IA 4XBNA 4IW3A 4WVMA 1HIXA 3UESA 2X8KA 2HEWF 2ORXA 3ZYGA 3BU7A 4M3CF 1ZBA2 3MUZ1 5I0DA 5FYCA 4Q8KA 3WDVA 4IETA 4INDA 4RSUA 3TRSB 1WW7A 2TBVA 1RYYA 1WCDJ 2FBEA 4QQOA 1W6QA 5T55A 1V6KA 2C9AA 4NJ4A 4QQLA 3ZFGC 3P5BA 3VBOA 1CX4A 5GLUA 1I5PA 2PAMA 5LATA 5IVBA 4NRMA 3U11A 4ZHNA 4Z82A 5A3NA 3RPQA 3AVRA 3NVCA 3VHPA 2QQUA 4FXKB 3BTXA 1HQLA 1AX2A 5E88A 1IS3A 3ZN6A 4CCOA 4L0PA 1CAWB 4IERA 1GYKA 1IQAA 2GMMA 4Q4X3 4R9BA 4Y1XA 4Q4V1 4HK9A 1OI6A 3KVAA 4AEDC 1W6MA 4WM7B 5F3IA 3WLUA 3CJXA 3M3QA 1Q8OA 3LKJA 4DO0A 2ZGSA 2JDUA 2XJUA 4XUNA 2E32A 3GJBA 3ZKUA 4AHWA 3PIGA 5BNPB 2K0GA 4PIYA 1AR92 1I6XA 2A3WA 3M8LA 4MV2A 4JAAA 2YFZA 3DF0A 1O8PA 3HJRA 5DMYA 3HNYM 1UWWA 4AI9A 4XXAA 1GV9A 2BU9A 4YNIA 3VBUC 4B7KA 4BE3A 2Y6FA 2ARAA 2G9GA 3GXUA 1MQTC 1VBB2 1U5XA 2CY6A 4N90A 4WZCA 4FFGA 5TSWA 3GGLA 1NLRA 4XJ8A 5JZGC 1G9FA 1U0AA 3AZZA 3H3UA 3QLQA 2BERA 5T3NA 3AMMA 4PLNA 3WXPA 1W8TA 1YC61 3FBYA 4R4XA 4AGVA 1XJAA 2VBDA 4XEZA 1AR91 4GQ7A 5IVYA 1AYM2 3VD3A 4LR4A 2JDKA 2B7YA 1XQNA 3VD9A 2HBTA 2B42B 2YBKA 4LOTA 1QQP1 5EYXA 3HWJA 1COV3 1AUYA 5FPXA 2B39A 2XPJA 3SCHA 2EIBA 2JJ6A 1NA1B 4NAMA 2XHKA 3H8XA 2VJXA 4BISA 2I2SA 3PURA 1O8SA 3LE0A 4D6SA 1D2SA 4BA6A 3I97A 1V6NA 4DXRA 5BNOA 2N7GA 1F4AA 3T4HB 1S55A 3VBSB 3FZ3A 3LIGA 1O4ZA 1ND2C 1JYWA 3J7HA 1CQ9A 2NQYA 3M70A 3ZR5A 1XNDA 4C1XA 1AYM1 2A73B 2PXJA 3OBRA 3JBG3 5LY2A 2JDZA 1Q8PA 5L7OB 1BMV2 1OQEA 2GP5A 3ZN5A 1C4RA 5DDJ1 5JCTA 2KA3A 4CDWB 2GN3A 2RJLA 4Q2FA 2FCUA 3URFA 5CFCA 1OPMA 1YHFA 3FHIB 4O65A 3NNLA 3WW3A 1MZFA 1VRH2 4H7LA 1CD3G 4XUTA 2D6PA 5F7UA 3AP5A 2PHRA 3I2JA 3PVEA 4UW3A 5GZDA 2ZXQA 4KWUA 3T0AA 2P34A 1R1ZA 1W2TA 1QH7A 4QHBA 3MW4A 5C3OA 1VAMA 1YYNA 1Z78A 2E7TA 2HWB2 1OT5A 2WABA 3HQRA 3NKGA 1RUD2 3OD0A 4FTSA 1NE4A 2DBNA 2RS33 2D6LX 2VULA 3BCWA 3G7DA 5F6LB 3LDRA 1JODA 4RA0A 1Z7S2 1O7FA 2WYFA 4QX2A 3Q8AA 4COVA 2WZR1 4Z2WA 1B35A 2B9UA 3AKQA 3N7KA 2WR9A 3PIJA 4E2SA 1AR72 3IBMA 4DPNA 2PFWA 2RMU2 3CBNA 1JZ7A 1GUIA 3MPPG 4P08A 1YNAA 2E26A 1AR81 1H1MA 1W0PA 2PLV2 2BVBA 5AVAA 1W9YA 2CSGA 2JG9B 3ZXKA 2AEYA 1GP4A 2O14A 3RFRA 4Q4V3 3OEBA 3VKOA 2VOVA 3USUA 5FMBA 2LS6A 4F83A 3WNXA 5E1RA 3B69A 1T2XA 3V56A 2VBBA 5F39A 2WUHA 1M06G 4XE9A 4Q0VA 1U5ZA 1DLCA 3GCXA 4AQ6A 2WBKA 3I3QA 4FOVA 1V6MA 3KS7A 2J1EA 1ND3B 1RUE1 5FKCA 4XFCA 4MYEA 5F9TA 4LBQD 2BJSA 3ZMOA 2GSYA 1DHKB 2JE9A 2ZGLA 4NROA 5A3PA 1LB2A 1KQRA 4XC9A 1PX3A 1ASJ2 4RYDA 5CFDA 1X9PA 3VD5A 3TEZA 1SZBA 4XUPA 4AE2A 1CONA 5K4LA 1TME1 1X8MA 4Q26A 5IATA 3P3NA 3OGJA 3IB3A 3J4UH 1UF2C 1QWRA 5FZGA 3VBFB 2ADEA 3QOPA 3CKHA 5I0SA 1DP0A 4BMEA 2GMPA 3JB8A 5KHJA 1ZYBA 1WKYA 4LORA 1V9U1 4LUMA 4Y33A 5FYBA 3LEGA 3CIHA 1CN1A 2X29A 2PLV1 1XYPA 2RS13 3NNGA 3PL0A 4BYYA 2UWAA 2CGNA 3ZFEC 3I2FA 1HN1A 5L7OC 4NIAA 4EWAA 1A6CA 2XDVA 1SCSA 2HWD3 3O7OA 2X09A 3I2GA 2QQVA 4OUSA 4XUOA 5FMOS 2XVLA 4KGGA 4GMP3 3BALA 3INAA 2G9ZA 1ZZ9A 4LHSA 5H9SA 5FO8B 2FMYA 3S5AA 1Y7BA 4EROA 5LA9A 5D21A 2Q1MA 3VGIA 4CUCA 4QPGB 4NHYA 1NY72 3N35A 5EQUA 2XJQA 5T54A 1CAUB 4RGKA 3T09A 1QKQA 2O8QA 2RR11 4BQ1A 3VDAA 2Y64A 5FLIA 1AL21 3CQOA 1O4YA 5D8AA 4ZS2A 4FPJA 2D97A 2I07B 1CWPA 3BI3A 2VPVA 5FYIA 2YPJA 1JZ8A 1UYPA 3MHZA 1TE1B 1BK1A 2IXIA 2ARCA 4D0QA 3UGHA 1DGWX 1KD7A 4E4SA 4COZA 4ZZ8A 1PNGA 4RQPB 3UJOA 2GC3A 5E16A 3H1MA 5GZCA 1ZBE2 4L92A 1IS5A 1FOD1 2B45X 1DF0A 1WUVA 3J26N 4LOSA 4PJYA 5JLVA 2FDIA 4M3CE 1YQ6A 4DUVA 4QX0A 2J1SA 5FYZA 3TEYA 4OQ9A 4DEVA 4O9GA 2DCKA 4HVOA 1C8M1 1WMFA 3NJVA 1TMF2 4LE4A 4CCKA 1ZM1A 2PHXA 2Q1FA 3GF6A 3MFAA 4KQ7A 4X8PA 1ZX5A 4XAAA 3NKTA 5FZ4A 5F5AA 3B9CA 3VKMA 2A3XA 3IPVB 1KDMA 5FXWA 1CZVA 5JDBA 4GH4A 3F95A 5IFTA 1QJX1 2J42A 2PAKA 2VGDA 1TZOA 4KU7A 5GJ6A 1HQWA 2PHUA 5EJ3A 2OYZA 3EMRA 1RMU1 5I8TA 2WL1A 4TTGA 3WX5A 3C3VA 4NOTA 4BCUA 1EY2A 1XNBA 3X29B 2FDKA 1BK0A 3UGFA 2RS31 3DXTA 3E97A 1H1IA 3OGGA 4FVVA 4A7YA 4PF1A 5CB7A 1K3IA 2WINB 5FREA 5FP7A 1BBT2 4AHXA 1K45A 5IVEA 1H6YA 2DCZA 4N7IA 4CP9A 4MHUA 1Q56A 3OUHA 5FQ0B 5T52A 1RUE3 2VQUA 5FCCA 3WF1A 2X5IA 2PELA 2RMU3 5C33A 3IDBB 4UW4A 1W8NA 3ACLA 1SLLA 1OOPA 1YIFA 4LMFA 4PQQA 4BK4A 1EUUA 1JU4A 1CAXA 1HXS3 1NXD1 2D40A 3FX3A 3IIIA 4YGBA 3UNPA 4YGCA 5DXDA 1R081 4V2VA 4XF4A 4ZPIA 1S0BA 2BGPA 4MOAA 2R042 2XQRA 1PHMA 4KNCA 1D2QA 1ZZ8A 4WV8A 5DUVA 5GZGA 3ZXLA 3FLTA 4Q0PA 4ZY9A 2A6XA 4CPBA 5A3TA 5I0UA 4I01A 1O3TA 4EYUA 1GFF2 3FUOA 4MHRA 3FBMA 2WNEA 5FUIA 1LJ7A 1WA6X 1FV2A 3GZUC 4Q8LA 2R062 1W03A 3SITA 3HD8B 5DAXA 1LKNA 2LUWA 1ST8A 5T5LA 4QB2A 4DZGA 2P3YA 2HWC2 3OUIA 1QNWA 1W6MB 3H50A 2P1BA 3HVDA 1SBEA 2UWCA 1F4HA 3ZMNA 2ET7A 2ZGPA 1NCQB 3Q8FA 4IV3A 1IS4A 1XNKA 2ZGMA 4AGRA 4F3JA 3KCCA 3N7MA 2AZ5A 2XGXA 4HZFA 4IE0A 1WMDA 1H4GA 5G04L 4IV1C 4CXYA 1WZXA 2EIDA 5HPOA 2UURA 1O3QA 4CP0A 4Z8BA 3C7EA 4LLOA 1AJKA 1GMMA 4LO7A 4AZZA 3O1PA 3POJA 1JZ3A 1QOSA 4IEYA 1W2NA 4D7SA 3POGA 5LK7B 5DAWA 1E5RA 1ND2B 1YUDA 2RM21 3ABZA 5FXVA 2Z42A 5IW0A 3THTA 5FR3A 2P17A 5BNNC 4KWJA 1W8ZA 2IFRA 5FZ3A 3I2KA 4B4RA 5FZIA 4A41A 4BXFA 2ZHLA 3I8TA 2A75A 2FDJA 3DPRB 1I9RA 3WHUA 3MIFA 4HMZA 2Q0AA 4DOUA 3KM5A 4KBBA 4FO9A 5A6ZA 1W8FA 5GKAC 2XJSA 3SXWA 3VKFC 3L2HA 1JN2P 1H9WA 1W9WA 3KMHA 2ZABA 4QXHA 2PHDA 2GALA 4O7XA 3APBA 5FYUA 1RJ7A 5ABJC 3ILNA 5F37A 3S7EA 1VBE2 2BWAA 1YJLA 4OUEA 2QVSB 4PI2A 2BNOA 2RM22 2YMZA 2GH2A 4BIFA 2HWD2 4P9GA 3ME2A 3KGZA 3NL1A 1RC6A 4GMP0 1SFNA 1EV11 2ERFA 4I3GA 3THCA 1FT9A 1OKOA 1MQTB 2DFCA 2W1UA 1QQP3 2BYVE 3AB0A 3PU8A 1OPOA 3LWCA 1MVQA 2R1BA 2YYOA 4XJWA 5DAPA 2OPWA 4AQSA 4I3PA 3C8XA 4XQ4A 1J3PA 4HKWA 1GWKA 2QQLA 5JZGB 3ZYBA 3EXUA 1JYXA 2VUDA 4RGAA 2YGMA 4AEJA 5IVFA 1LEMA 5L7OA 4LO8A 2XMLA 4X8NA 2XOMA 4UI9L 2VZ3A 4ZKTB 4B29A 1MEC1 4N8MA 5IYYA 2JEMA 4A7ZA 3KD4A 3L2YA 2PQSA 1IPKA 2W08A 2CV6A 5JSPA 1X50A 5T5OA 2VUAA 3CO2A 1LOCA 3UETA 2RM23 4GD4A 2VQAA 4XHXA 5A3UA 2R7EB 2C1FA 3IT8A 3K2OA 3MDPA 1K5MC 4NHLA 1AXKA 2VZRA 5AVPA 5F5CA 5FJHA 5FKBA 1HB3A 3S5QA 1BVVA 4BH9A 4AFDA 4KMQA 3UL2A 2Y38A 3VD7A 4AHZA 4MLOA 1V0AA 5AC91 2Y60A 2WZPP 4PBPA 4MH0E 1NYWA 3T0BA 1XU2A 4ES8A 5L73A 1KEXA 4QWNA 2OS2A 5FY1A 2Q8OA 5FTTC 4G3YC 3PMSA 3LZZA 4IV1B 1X82A 3JUUA 5A7PA 1BMV1 2VOWA 3B7MA 4D94A 4JHZA 2WZEA 2JG9A 3K51A 4LKSA 2ETEA 3AYAA 2FD8A 2ZHNA 1OA2A 2XJPA 3DGTA 3TNPB 5BNNB 3J8F3 1BLZA 5LY1A 1QJX2 2JDPA 3W59A 3RZMA 3LD8A 1DBNA 1JW6A 2JB4A 3RMYA 1FXZA 1NE6A 1W6NA 3N3HA 3R4UA 4LKFA 2DCJA 1ODNA 3Q8EA 5F3EA 3IDEA 2P6HA 5FWEA 1H8TC 2QFEA 4FP3A 3A0NA 4JZRA 4DXSA 3RJ2X 2WKKA 3LPGA 4IQPA 4RR3A 4QPIC 4N43A 2R073 5C3QA 4NWWA 3NNJA 4N9HA 2EVXA 4CDQA 3GZAA 1UD1A 2CGOA 4CCMA 3LCPA 4G4FA 4LBMA 5BUVA 4FOQA 3OF1A 4LO4B 1ZVFA 3BTAA 4XUQA 5FPVA 4HPKB 4DFSA 1O3SA 2D6MA 4RS5B 2IZWA 3J7NA 1PK6B 3U1XA 1H2MA 3ITQA 1QXPA 2VH9A 3C7FA 3CJIC 4XABA 4AAXA 4YW5A 4BQXA 5T5PA 1GWLA 4PT6A 1ULDA 2YROA 2ZJCA 4CE8A 1H2KA 3M3CA 1ND3C 1OUXA 1UYZA 3MLJA 4R4ZA 3ST7A 3H1YA 4ARYA 1RUJ3 3OPTA 5LA2A 2ZKNA 2BUKA 2Y6HA 3C7OA 3ZXGA 5DDJ3 3RYPA 1GZWB 3I3BA 4AI2A 5FP4A 2HWC1 3SKJE 2A6WA 2C9KA 3THDA 2ZMNA 4AF9A 4BB3A 4C1WA 3N4MA 3H7JA 1AYM3 3VBFC 3PNAA 1C1LA 4FPOB 3KV5A 4QX3A 4DIQA 5JXIA 4QDQA 3MICA 3N7JA 4A45A 4FOWA 2YFUA 3ZXJA 4ASKA 5FZ8A 4UFLA 4CEYB 1JYIA 1PNFA 1XC6A 5CA6A 2NYYA 4MXVA 4P5YA 3H1WA 3P3PA 4KBZA 5FWJA 2KM2A 3SKVA 1O6UA 2ZGNA 3HT2A 4JGYB 2ZGUA 3AKPA 4V2WA 4EZ4A 3SMHA 4E8CA 1V6JA 3N9PA 2VW0A 4OZOA 5BPXA 5L9VA 1VBC1 1LU2A 3AKTA 4GKYA 1RUF1 1N3OA 1RL3A 4UFHA 4E4ZA 1HX6A 4QXBA 3TN91 2WFF1 3RDIA 3T08A 1PM7A 4GMP1 5CG8A 3VZMA 1NA1A 5BNQA 5HV0A 1FATA 4BMBA 3HEIA 4MXWB 1VBD3 4MSVA 1OD3A 1T6BX 5FPLA 1UX6A 3FE5A 5FPBA 4DRVA 5FLJA 4YFZA 5C8CA 2YU1A 4XQDA 1VB4A 4RHV1 4UF0A 1R091 1XSQA 5A32B 3WQ0A 1HRI3 2JDHA 1BEV1 1VBD2 1ZZBA 3RYRA 1IG3A 4YLZA 3TN93 4MGSA 4XJZA 3VDDC 1AX0A 1YQ2A 1SLAA 2GNTA 3I59A 4FPCA 4FFHA 4LXLA 5AFBA 3DYMA 4URTA 1FMD3 3OBAA 3O1UA 2A7AA 3KT4A 5CFCB 3I4IA 3D4KA 1NCQC 3KHBA 3KF3A 4MGYE 4NRQA 3UJQA 3WSOA 4QPWA 1OOPB 4N7UA 3ZSKA 3VBHA 1SLCA 1CAXB 3D5OA 1SEFA 2E51A 2VZVA 3ORJA 4Y4RA 3TB0A 3ZSJA 4P9WA 5LA0A 3WNPA 1YEWA 1RXFA 2VD7A 1XE0A 1ZA7A 1WLDA 3T0DA 4Y20A 4HN1A 4N53B 4AHYA 1W39A 3B01A 1LOFC 4NAOA 5DUXA 4GA9A 2LROA 2VECA 4QX5A 3LAGA 4QX1A 3KV4A 3T2PA 2W91A 4BJ0A 5DUUA 3AX4A 2JG8C 4X6QB 5DUWA 5FZ9A 1K5MA 5JOXA 3WG3A 2YBSA 3LPFA 1LGCA 1SPPA 5F3GA 3VZOA 1Q8QA 4CDUA 1QU0A 4LJHA 4NUBA 4P9IA 1EPZA 4XJ9A 5ABJB 3ZDSA 2IXHA 2W9XA 5LEJA 2V4AA 3HMYA 3C7GA 2WO7A 1NG0A 2W92A 2VMCA 4YW6A 4XCAA 5A80A 4IUGA 3SH4A 1UYXA 4XZPA 5IVCA 1NZCA 3H0OA 5FUPA 4IEOA 5JR7B 4CEYC 1DGRN 2WSVA 5D2AA 3V0AB 1D4M1 4JDOA 3I2HA 2YUEA 5IK7A 4JGYC 3E6CC 1ACCA 3G6JB 3VKNA 4DINB 2VTFA 4YVSB 2DVFA 1QNYA 2J1TA 4XILA 3VB9A 5ISLA 1B09A 2BZDA 4IDZA 1DQ0A 1RUC2 2XR4A 2C6SA 1HQNA 1H4HA 1RJ8A 5DZEA 1DYPA 1U12A 5I8SA 2JB8A 4CCNA 4LE3A 2RDRA 5FZCA 5E89A 1WMEA 2HWF3 2MPFA 3ATGA 5F5QA 1LODA 2W94A 2XB6C 1QJU2 4EN0A 2FMDA 2VXRA 2GU9A 4CDQC 4IEPA 5JAXA 1BHGA 2CWMA 3OPWA 1UZZA 5L9RA 4AL9A 3WNNA 3AFGA 4JGZC 1CESA 5FJKA 3HR9A 3B9IA 3ON7A 3DPRC 3L9JT 5CIRA 1RUG2 1ULFA 2DYCA 1UNBA 2VQ0A 5FZ1A 3ES1A 3WNMA 1LHVA 2BBAA 3MLKA 3AYDA 2PYTA 5KXBA 3DXUA 2GC2A 1J59A 2V5YA 4IEWA 5JIUA 2YPDA 2XWBB 1RUC3 1CJPA 3BYWA 4GJZA 3D6EA 1LOGA 1LU1A 2K9ZA 1Y43B 1RIRA 2XHNA 2ZEZA 4NE9A 3ZFGB 4E2GA 4META 4IV3C 3RG0A 1UXXX 1C8NA 3NMBA 3NW4A 3WNLA 5IVJA 4N53C 3RS6A 4YVWB 4FTBA 3LA3A 2OUJA 4MGZE 5GALA 4KGQA 5CYYA 1O91A 1QEXA 4OHWA 1F31A 2VC9A 3PTRB 4LLFA 4Q27A 2HWD1 3DKWA 3IWZA 4G9SB 4CEWA 2IUWA 2VNGA 2WN3A 4AEKA 3RGBA 2MNGA 3HPNA 5I91A 1OFSA 1H8TB 3VBRA 3LEKA 1NUKA 1LCLA 2KXLA 3PU3A 1NKGA 4QHOA 4JDMA 3VV1A 4ATEA 5BNPC 1YJKA 5CNAA 3ZVXA 1POV0 5FFOC 1WW6A 4QPIB 2WSUA 2GNBA 5JIAA 4URAA 4WM8C 2ZPXA 2W47A 2OQ6A 3BVCA 3JCIA 1QH6A 3M4FA 4GB33 2CHHA 1VBC2 4XPVA 1ULEA 4BU2A 4XFFA 5HCHA 5FPZA 4HSLA 5FK7A 5B2GB 2P3IA 2FZ1A 3UKTA 4J6GA 5LBFA 1VBA1 1GP5A 2BFUL 3KCYA 4NWVA 1OUSA 3RWNA 3WP5A 3ZYIB 1IGOA 2QQIA 2VCCA 4K3UA 2Z5WA 2JICA 2WNVB 2R043 3DYOA 3ZFFC 1EV12 1NZIA 1AZDA 2OUHA 1AR71 1F15A 2Y0OA 5FZOB 3WNOA 1MZ5A 3R6SA 2DU0A 3EBRA 4B4QA 3K46A 5L36A 4LITA 1OXCA 3OY8B 1LOEA 4XBQA 2WQZC 2D3SA 5GZEA 4K21A 2IXKA 3D3AA 1Q3EA 2PHWA 3LFMA 2DDUA 3IIAA 5DZFA 3MIEA 2UWBA 3MV11 3WOGA 3NNMA 4H14A 2E33A 1O3RA 5JXGA 2JD9A 2VZSA 4XTMA 5G05L 4ZXKA 1JZ6A 3VKLA 4YW7A 1V9U2 3VBSC 3BODA 2E53A 3C7HA 1UZ0A 1TMF1 3S7IA 1DZTA 1RVF2 2PMWB 4HPKA 2ENRA 3MIDA 4RS5A 4RHV3 5HXMA 4QGNA 3V65A 4QX7A 1DZQA 5KXEA 3AP7A 2PQQA 5FMOL 4UFKA 2BGCA 2D44A 2QQPA 2HKXA 1ULOA 2RS11 2ZGKA 3B3QE 1LENA 2QZ2A 2YXSA 1AXYA 3HN3A 4K6BA 2Z2SB 1OA3A 1COV2 2QBXA 2W0XA 2J1AA 4GWMA 4LBJA 3S57A 4OYUA 1SDWA 5D1IA 4EQVA 3SH5A 4QKFA 4AEMA 2RJKA 1W9SA 1UYYA 4PIZA 4ISRA 2QDNA 4AFBA 1TME3 2ILMA 1O4TA 2F17A 4IV3B 2Y26A 1A8MA 2HYKA 4W6XA 4W8JA 5C9AB 3AMNA 4YVWC 2IC1A 1RUC1 3M2MA 1LGBA 3W21A 4DEQA 4W4ZA 1OURA 4LIVA 1HRV1 3ZYJB 2BWCA 1UMHA 1JUHA 2JDMA 3IMNA 3LB9A 4TYSA 4QXCA 2RG4A 3AP6A 3T2OA 5FAXA 3TNQA 3ZR6A 4IEUA 3ACGA 2AENA 4P00B 5IWFA 4BXSV 3OUJA 5SV8A 1ND2A 2QQJA 1HJGA 4AVAA 3AKSA 4F8AA 5JMOA 1D4M2 1S0IA 2WNOA 1LHOA 4I02A 3VDDB 5FY8A 1H2NA 4E2QA 3DV8A 1U5IA 4OVEA 3SQOA 2AGSA 1HXS2 1H0BA 3DEMA 2JIJA 2DWRA 2WDBA 1K5JA 5CFCC 1W6PB 4IEVA 3FLPA 3E1F1 1W3VA 1RUF2 4XDQA 1IS6A 1DQ6A 2ZZQA 4PIXA 3AZYA 2WNUA 5APAA 3IMMA 2C26A 2BV4A 1QIQA 1GLHA 5EYYA 5HXVA 1COV1 5FMDA 5JPNB 5FZMA 1UKRA 3RI9A 4LK7A 3KHCA 4FSJA 3WZ1A 3KVBA 2BQPA 4MO3M 3BIWE 4IEQA 1KITA 5LBEA 1SFPA 4DY5A 2RHPA 1US3A 4OHVA 1NAEA 2WNVC 3AL6A 3PVOA 4P5HA 2DU1A 3NV3A 1FNYA 5FY0A 1MQTA 5AC92 1QOOA 3POSA 4M0NA 3H3LA 4YM1A 5C3PA 5C4WA 4D69A 3EO6A 3V0BA 2VZPA 1WD4A 4TWTA 2UYAA 1ZZCA 1WLCA 3PVBB 3K48A 5J37A 3O1RA 2JG8B 1ZBE3 2DURA 3H9AA 4GWIA 4GB32 5CEHA 3H3ZA 1PZ7A 5FPUA 1C8M3 3O0WA 4EWDA 4LIUA 4WM7A 1UOGA 2XWJB 4BK5A 4M00A 3FN9A 1VRBA 4ZONA 2C5DA 1PO23 4HG6B 2OX0A 3POIA 4XTPA 2EICA 3MPBA 1QJY3 1Y4WA 2BRTA 4LQRA 5H9QA 3UV9A 2W1WA 1TNFA 3VBHB 1DZRA 1XXNA 2C24A 4Q0QA 4RGGA 3ZFEB 1VMFA 2ZEWA 4M3CA 3B94A 2X05A 3LA7A 5BNOC 3I49A 2G4IA 1ULPA 5HCFA 2A71A 3TN92 1MS3A 3CEWA 4ZZ5A 1D0GA 4MGKE 1RUG1 1EV13 1E5SA 2XVKA 3AM2A 1NCRC 5KHIA 1MS8A 1JOPA 1PO21 4N53A 4L8QA 3ZXDA 3E6DA 1GNYA 3AXEA 4RD7A 3K3NA 4WVWA 5KR7A 2FHRA 1F5FA 4DMIA 3QCWA 3NV4A 4EV0A 2ADDA 4S2DA 2A6YA 1KFXL 2Q1ZB 4XETA 1L3JA 2R1DA 5SV5A 1PVC2 1TVGA 4CEWC 1I3HA 1PGL1 1PO13 4JKLA 1YFYA 2VCMA 2W1SA 3GCWA 5DQ0A 4CCLA 1ZRFA 1ENXA 4LBQB 3ZKYA 3BKZA 4OI0A 3GBGA 5BNPA 4CA9A 3JU9A 1UKGA 4E4DX 5BYNA 1W6OA 4RQPC 1PMIA 1OF4A 3HBZA 1ALYA 1WLTA 2QQNA 1XRUA 3ACHA 1MZEA 1VBB3 3FLRA 4NMIA 3S30A 1F5JA 3T2TA 2ES3A 3UGGA 5F5IA 3ILFA 1V00A 3V0AA 1Q8VA 3AL5A 2IWGB 4LBOA 4UAPA 1AVBA 4HBNA 1BEV3 4AOCA 2W1QA 1RVF1 2QNKA 2A6ZA 2YBPA 3LDKA 3OEAA 2IVIB 3E5QA 3JD71 3LDBA 4JX0A 3O1SA 3BUCA 3WP6A 2QQOA 4W6YA 4JKKA 5FXXA 3NJZA 4CUGA 3T3YA 3U75A 2TEPA 4ITCA 2E63A 1TMF3 3AJYA 3ASIA 5CISA 1HRV2 5CG9A 2F4PA 1MEC3 4N43B 1WCQA 5JVVA 4CDWA 1XE8A 4AEDA 3U0ZA 3ZIXA 5HV4A 1A3KA 4DUXA 1D0HA 2ZAAA 4FQZA 3B5LB 5A7NA 4Y22B 2XLGA 2GN7A 2V72A 3SC7X 3WD5A 1JZ4A 3PUHA 1UIKA 2OIIA 2VXJA 4JTNA 1FI2A 4PLOA 1NQDA 2CU5A 4QX8A 3VDCA 2JWPA 1PK6A 2D98A 3PUAA 5HI0A 3IKWA 2JE8A 2AEZA 1WBFA 4PBOA 5C5TA 2J22A 2XKPA 3CF6E 4O61A 3VBSA 1VJ2A 2HWE3 2MHFA 3VBUA 4OZXA 1RHI1 3HBKA 4ATFA 2VNOA 3IM0A 3WV6A 5EIYB 4MVTA 3HNBM 5K0UC 3UKNA 1FV3A 2D5HA 4BM8A 3N9LA 2BDRA 5A6YA 1QHDA 1X33A 2QCSB 1CGPA 1WMXA 4HSJA 1LHUA 1DYOA 1HV1A 3AZXA 3WT3A 3U10A 1VLNA 1YWKA 1R082 2WN2A 4FFFA 4PLMA 2Q8DA 1UMIA 1HB2A 3PLQA 1LOAA 1W8UA 2ZHKA 4PI0A 5J1XA 2MEV2 4S2GA 1VBD1 3ZN4A 1ZNPA 4RFRB 3NJXA 1BBT3 3Q8CA 3KGLA 3HQUA 2ZAHA 2IXJA 1GQGA 1NCRB 5GZFA 1UY4A 4AAPA 4NPMA 5EV7A 4A42A 1UOBA 4K9SA 4MX3A 3ZXEA 4CEYA 1AXZA 3CMGA 4F7ZA 4GH4C 1MS1A 4CDXA 4IL7A 3A7QA 4LT5A 3LEIA 1QY4A 1CPNA 4AVTA 3NAPC 1NQJA 1SBFA 2B9VA 1C8M2 5EHDA 4SLIA 5IJRA 3OCPA 3HOBA 2DTWA 4XDOA 4JRAA 4Q4Y2 1C28A 5EJ1B 2VAUA 2CAVA 5FY7A 4AW7A 4ES9A 1HV0A 1KS4A 5CFDB 2V5DA 2BPA2 3BU0A 2VNVA 4LKEA 4FAHA 5KC6A 3KQRA 4DUWA 1BQPA 4JRLA 3VL9A 3ILRA 5DN2A 4OHZA 4BLIA 1DQ4A 2X53S 2XG3A 4MXWA 4D8MA 1VALA 1RUH1 4I0AA 3ACIA 3KWVA 2VMDA 5A33A 3MBWA 1DG6A 2MEV3 3E5XA 4UF0B 1WCSA 5LBBA 3ZSMA 4Q5OA 2HWC3 1DIWA 1J58A 2ZX4A 5C3RA 1AR83 1URXA 2VOKA 3ZN6B 4Y1UA 3SEPA 3H8UA 4Q4Y1 2CDPA 1E5HA 1EAH2 3I59B 4PDWC 1RUJ1 5FUNA 4UXAA 2JDAA 2RV9A 3TEXA 4YZ5A 1HKDA 2RS53 4XW3A 1EAH3 2BTVC 4WM8B 5C9AC 1NLQA 2FCTA 2ZGTA 3ECQA 1XU1A 2VNRA 5FZEA 5H9RA 1CIWA 3O1VA 4M01A 2CNAA 2E7QA 2PA7A 3T1LA 4CXXA 1W3XA 2YC0A 2ZKLA 4Y5Z0 1YQ5A 1BEV2 1W6QB 4W65A 5T50A 3VBFA 2AC1A 4NVPA 1SMVA 4TN7A 3FFQA 3JD72 2UY8A 4P9YA 1YI7A 4NIDA 1QQP2 3SNMA 1WCKA 1X9TA 3W58A 4CTEA 1RMU3 5C8WA 2AYHA 1JOJA 5CKMA 5A6QA 1PVC3 4Q1PA 1STMA 1CX1A 2WIIB 4ARXA 4MUVA 1E5IA 4YZ4A 3VL8A 2WT1A 3ZO0B 2YC4A 1HB4A 3GDBA 4GKXA 3TBDA 3RI8A 3D8CA 5FOJB 3ZOIA 5FY9A 3WDUA 1WW5A 1VAVA 1VAKA 3I3EA 4HLTA 2V4VA 5FZDA 3KT7A 4Q1RA 2G1MA 1S0EA 1JYCA 1UU5A 3AMQA 3D0JA 1EAH1 4FPHA 3ZDVA 4A4AA 5KHHA 2D43A 4AR2A 4EN6B 2XL7A 1OKQA 2WA4A 1ASJ1 1S1AA 2OKXA 4NHXA 3VHNA 4JVAA 2C0ZA 1I5ZA 5BXXA 3JXSA 4BPZA 1QMJA 2ZX1A 2B46X 4GH4B 1BVP1 1QJU3 3VBOC 3EQEA 5B4NA 5IK4A 2ET1A 5LW9A 4R9AA 4ZS3A 2HWF1 4RQPA 2VE1A 1LULA 4HANA 2GAUA 4UFJA 1APNA 1R083 2DUPA 1A34A 4TSVA 4JC1A 3MUY1 5EJZB 5K7PA 5CVRA 4AYUA 1JYTA 2BOJA 5IFPA 1KJRA 2VMIA 3AZWA 1GZTA 2UU8A 3B02A 3HT1A 1VP6A 1Y3TA 4OMCA 3WF2A 4YM3A 1O5LA 1ENRA 4B8EA 1Q43A 1AHSA 1UZWA 2ZS6B 5A3LA 3QD6A 1DYKA 2VM9A 2VL4A
chains in the Genus database with same CATH topology
1XNAA 1PX4A 2W94A 3WQBA 3IB3A 4W50A 2VZQA 3CKHA 1DP0A 1WKYA 3DYPA 2Y6LA 1BHGA 3LEGA 3CIHA 1GU3A 3NNGA 3K77A 3WNNA 3I2FA 1HN1A 4TXWA 2WYSA 2X09A 3I2GA 4XUOA 1UY3A 2XQXA 2ID4A 4LHSA 4A44A 4FI9A 3WNMA 2BBAA 3BN6A 4JKMA 1K12A 4CUCA 5DPNA 3T09A 5C7GA 3VDAA 2Y64A 2QQKA 3CQOA 1IQDC 2XHNA 2ZEZA 1PMHX 2WQ8A 1UXXX 3WNLA 2WZ8A 1JZ8A 2Y8KA 2YC2A 5CYYA 1GOFA 4D0QA 3W5MA 2VC9A 2VQTA 4ZZ8A 2VMEA 1OH4A 2WO1A 2BGOA 2WN3A 3HPNA 4OMDA 2VR4A 4CU9A 1JYNA 4DUVA 1SHWB 2J1SA 3LEKA 3OGRA 4QX0A 1NUKA 3HNMA 1NKGA 4DEVA 3FHAA 5C70A 4MADA 2DCKA 4ZXEA 5B4XA 3NJVA 2J1UA 3WF4A 2W47A 3PUIA 1JZ5A 1NX9A 2RVAA 2KD7A 3A23A 1CZVA 3WF0A 1MPXA 5IFTA 1UX7A 5JXJA 4TTGA 4MGQA 1UY0A 3NRUA 2QQIA 1D7PM 2VCCA 1R64A 5JR2A 3DECA 3DYOA 4PF1A 1K3IA 3SEEA 3AC0A 2J7MA 3OGVA 3WNOA 1K45A 4XZUG 1H6YA 1KGYA 3K46A 2VQUA 3WF1A 1UY1A 3D3AA 3OB8A 1W8NA 2DDUA 3W5NA 2VCAA 4CVUA 3A21A 4PQQA 3MV11 4BK4A 1EUUA 1JU4A 3CZJA 3UNPA 3IIIA 2E33A 5JXGA 2JD9A 2VZSA 5G05L 5LCWL 1JZ6A 4CUAA 2BGPA 2QQMA 3WNKA 4MOAA 3C7HA 1UZ0A 3ETPA 2W95A 1GOHA 3ZM8A 5HXMA 4ZY9A 2W87A 4E8DA 1ULOA 3HN3A 5FUIA 2QBXA 3GM8A 2J1AA 4OYUA 2EIEA 4QB2A 1W9SA 1UYYA 2VMFA 1F4HA 3U37A 1SDDB 4W8JA 4ET7A 4QDSA 4DEQA 4W4ZA 5G04L 2EIDA 5HPOA 2W46A 2Z4FA 1UMHA 3C7EA 1GMMA 1P8JA 3T2OA 1JZ3A 3ACGA 1L7QA 4P00B 4BXSV 2QQJA 3ABZA 2L9LA 5JMOA 3I2KA 3VDBA 4A41A 4YPJA 1PMJX 2WDBA 2J1VA 1W9WA 3E1F1 4M4PA 5C71A 2C26A 2XONA 3FHQA 4P02B 4OUEA 2Y6JA 4MO3M 2VZTA 1US3A 3I2IA 3K4ZA 1NAEA 5JUVA 2RJ2A 3THCA 2VZUA 2W1UA 1TG7A 3I3DA 3EB7A 2W5FA 3C8XA 2VZPA 2QQLA 1JYXA 1L7RA 3K75B 4GWIA 2W3JA 1W8OA 1W0NA 2XOMA 4UI9L 2VZ3A 3MO4A 1OF3A 4BK5A 3FN9A 4HG6B 2EICA 5IYYA 2PQSA 4LQRA 1CZTA 2W1WA 2Y6GA 3P6BA 3EYPA 3ACFA 4XURA 2ZEWA 2E31A 2X05A 3P1IA 3UETA 3VD4A 4CU6A 3T2QA 1ULPA 2R7EB 4ZZ5A 4Z2AA 2VZRA 2WO2A 2C4XA 1UXZA 4QAWA 1GNYA 3K4DA 4KMQA 1H6XA 3VD7A 5IHRA 4XVHA 2B4KA 3CZUA 1XPWA 4GWJA 3T0BA 1TVGA 3FL7A 1KEXA 4QDRA 2ORZA 4JKLA 1UY2A 4M4RA 2W1SA 5DQ0A 3IAPA 3OG2A 4JHZA 4CU7A 1XNTA 2WZEA 1JHJA 3MV01 4LKSA 1OF4A 2QQNA 3ACHA 2YB7A 3BGAA 5JXHA 3F2ZA 1LNSA 2CDOA 4UAPA 4BDVB 2WAOA 4QB1A 2J1RA 2W1QA 4A3ZA 2DCJA 3OEAA 2ZEXA 2VO5A 4JX0A 2QQOA 4JKKA 4AG4A 2Y6KA 3K4AA 4DXSA 3LPGA 1WCQA 2WAAA 3WEZA 4DXTA 4DUXA 2V72A 3UESA 1JZ4A 2VZOA 2ORXA 4XUQA 3PUHA 1EUTA 2VCBA 3MUZ1 4CUBA 5I0DA 2YG0A 1RYYA 3VDCA 4UOJA 2JE8A 1I5PA 2J22A 2X10A 3C7FA 4AAXA 4PT6A 5EIYB 3HNBM 4L0PA 1UYZA 4ARYA 5LA2A 4KI5M 2Y6HA 3C7OA 1GOGA 1DYOA 5A1AA 3I3BA 4XUNA 2WN2A 2E32A 2LW8A 3SKJE 2C9KA 1UMIA 3THDA 5J1XA 2VOTA 1JU3A 2JKXA 2YFZA 3NJXA 1O8PA 3HJRA 4QX3A 3HNYM 5JXIA 4QDQA 1UWWA 1UY4A 1GQPA 4A45A 4A42A 3GXUA 2YFUA 3CMGA 1CIYA 1XC6A 3A7QA 3IAQA 4P5YA 3OGSA 3LEIA 3GGLA 1O59A 3SKVA 2BERA 1SG3A 2B9VA 4LPLA 4A6OA 5IJRA 3HOBA 4E8CA 3IDAA 3VD3A 5EJ1B 4OZOA 3VD9A 2V5DA 3T08A 2HYXA 4DUWA 2EIBA 5DN2A 4D8MA 3HEIA 2VJXA 3ACIA 1OD3A 1O8SA 2VMDA 3LE0A 3MBWA 3I97A 4DXRA 1F4AA 1K42A 1JYWA 3J7HA 3SEPA 2CDPA 1J83A 4MGSA 1YQ2A 2JDAA 2RV9A 3DYMA 3OBAA 3WSOA 4QPWA 3ECQA 3CDZB 1J84A 2VZVA 3LQCA 4XUTA 5F7UA 5LA0A 3WNPA 3I2JA 1CZSA 2VZ1A 2ZXQA 2WO3A 4KWUA 3T0AA 4GZ9A 1W9TA 3T0DA 4CU8A 2HLEA 2ZEYA 2WABA 1OT5A 1CX1A 5DMYA 4ARXA 4QX1A 3T2PA 2W91A 4BJ0A 2YC4A 3GDBA 1JZ2A 3LPFA 4QX2A 3I3EA 2V4VA 1JZ7A 1GUIA 2W9XA 4P08A 2E26A 4A4AA 4RN5A 3C7GA 1JI6A 2VMCA 2W92A 4IUGA 2OKXA 1JYVA 1UYXA 3WF3A 4QB6A 3JXSA 3OEBA 2LS6A 3NQHA 1T2XA 3I2HA 5B4NA 2WUHA 1DLCA 2VTFA 2WBKA 2J1TA 3A22A 2J1EA 2BZDA 1US2A 3MUY1 5EJZB 1W99A 5IFPA 5CZKA 4OMCA 3WF2A 1PX3A 5LA1A 4RYDA 3VD5A 4XUPA 2VM9A 2VL4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNA A;  1PX4 A;  2W94 A;  3WQB A;  3IB3 A;  4W50 A;  2VZQ A;  3CKH A;  1DP0 A;  1WKY A;  3DYP A;  2Y6L A;  1BHG A;  3LEG A;  3CIH A;  1GU3 A;  3NNG A;  3K77 A;  3WNN A;  3I2F A;  1HN1 A;  4TXW A;  2WYS A;  2X09 A;  3I2G A;  4XUO A;  1UY3 A;  2XQX A;  2ID4 A;  4LHS A;  4A44 A;  4FI9 A;  3WNM A;  2BBA A;  3BN6 A;  4JKM A;  1K12 A;  4CUC A;  5DPN A;  3T09 A;  5C7G A;  3VDA A;  2Y64 A;  2QQK A;  3CQO A;  1IQD C;  2XHN A;  2ZEZ A;  1PMH X;  2WQ8 A;  1UXX X;  3WNL A;  2WZ8 A;  1JZ8 A;  2Y8K A;  2YC2 A;  5CYY A;  1GOF A;  4D0Q A;  3W5M A;  2VC9 A;  2VQT A;  4ZZ8 A;  2VME A;  1OH4 A;  2WO1 A;  2BGO A;  2WN3 A;  3HPN A;  4OMD A;  2VR4 A;  4CU9 A;  1JYN A;  4DUV A;  1SHW B;  2J1S A;  3LEK A;  3OGR A;  4QX0 A;  1NUK A;  3HNM A;  1NKG A;  4DEV A;  3FHA A;  5C70 A;  4MAD A;  2DCK A;  4ZXE A;  5B4X A;  3NJV A;  2J1U A;  3WF4 A;  2W47 A;  3PUI A;  1JZ5 A;  1NX9 A;  2RVA A;  2KD7 A;  3A23 A;  1CZV A;  3WF0 A;  1MPX A;  5IFT A;  1UX7 A;  5JXJ A;  4TTG A;  4MGQ A;  1UY0 A;  3NRU A;  2QQI A;  1D7P M;  2VCC A;  1R64 A;  5JR2 A;  3DEC A;  3DYO A;  4PF1 A;  1K3I A;  3SEE A;  3AC0 A;  2J7M A;  3OGV A;  3WNO A;  1K45 A;  4XZU G;  1H6Y A;  1KGY A;  3K46 A;  2VQU A;  3WF1 A;  1UY1 A;  3D3A A;  3OB8 A;  1W8N A;  2DDU A;  3W5N A;  2VCA A;  4CVU A;  3A21 A;  4PQQ A;  3MV1 1;  4BK4 A;  1EUU A;  1JU4 A;  3CZJ A;  3UNP A;  3III A;  2E33 A;  5JXG A;  2JD9 A;  2VZS A;  5G05 L;  5LCW L;  1JZ6 A;  4CUA A;  2BGP A;  2QQM A;  3WNK A;  4MOA A;  3C7H A;  1UZ0 A;  3ETP A;  2W95 A;  1GOH A;  3ZM8 A;  5HXM A;  4ZY9 A;  2W87 A;  4E8D A;  1ULO A;  3HN3 A;  5FUI A;  2QBX A;  3GM8 A;  2J1A A;  4OYU A;  2EIE A;  4QB2 A;  1W9S A;  1UYY A;  2VMF A;  1F4H A;  3U37 A;  1SDD B;  4W8J A;  4ET7 A;  4QDS A;  4DEQ A;  4W4Z A;  5G04 L;  2EID A;  5HPO A;  2W46 A;  2Z4F A;  1UMH A;  3C7E A;  1GMM A;  1P8J A;  3T2O A;  1JZ3 A;  3ACG A;  1L7Q A;  4P00 B;  4BXS V;  2QQJ A;  3ABZ A;  2L9L A;  5JMO A;  3I2K A;  3VDB A;  4A41 A;  4YPJ A;  1PMJ X;  2WDB A;  2J1V A;  1W9W A;  3E1F 1;  4M4P A;  5C71 A;  2C26 A;  2XON A;  3FHQ A;  4P02 B;  4OUE A;  2Y6J A;  4MO3 M;  2VZT A;  1US3 A;  3I2I A;  3K4Z A;  1NAE A;  5JUV A;  2RJ2 A;  3THC A;  2VZU A;  2W1U A;  1TG7 A;  3I3D A;  3EB7 A;  2W5F A;  3C8X A;  2VZP A;  2QQL A;  1JYX A;  1L7R A;  3K75 B;  4GWI A;  2W3J A;  1W8O A;  1W0N A;  2XOM A;  4UI9 L;  2VZ3 A;  3MO4 A;  1OF3 A;  4BK5 A;  3FN9 A;  4HG6 B;  2EIC A;  5IYY A;  2PQS A;  4LQR A;  1CZT A;  2W1W A;  2Y6G A;  3P6B A;  3EYP A;  3ACF A;  4XUR A;  2ZEW A;  2E31 A;  2X05 A;  3P1I A;  3UET A;  3VD4 A;  4CU6 A;  3T2Q A;  1ULP A;  2R7E B;  4ZZ5 A;  4Z2A A;  2VZR A;  2WO2 A;  2C4X A;  1UXZ A;  4QAW A;  1GNY A;  3K4D A;  4KMQ A;  1H6X A;  3VD7 A;  5IHR A;  4XVH A;  2B4K A;  3CZU A;  1XPW A;  4GWJ A;  3T0B A;  1TVG A;  3FL7 A;  1KEX A;  4QDR A;  2ORZ A;  4JKL A;  1UY2 A;  4M4R A;  2W1S A;  5DQ0 A;  3IAP A;  3OG2 A;  4JHZ A;  4CU7 A;  1XNT A;  2WZE A;  1JHJ A;  3MV0 1;  4LKS A;  1OF4 A;  2QQN A;  3ACH A;  2YB7 A;  3BGA A;  5JXH A;  3F2Z A;  1LNS A;  2CDO A;  4UAP A;  4BDV B;  2WAO A;  4QB1 A;  2J1R A;  2W1Q A;  4A3Z A;  2DCJ A;  3OEA A;  2ZEX A;  2VO5 A;  4JX0 A;  2QQO A;  4JKK A;  4AG4 A;  2Y6K A;  3K4A A;  4DXS A;  3LPG A;  1WCQ A;  2WAA A;  3WEZ A;  4DXT A;  4DUX A;  2V72 A;  3UES A;  1JZ4 A;  2VZO A;  2ORX A;  4XUQ A;  3PUH A;  1EUT A;  2VCB A;  3MUZ 1;  4CUB A;  5I0D A;  2YG0 A;  1RYY A;  3VDC A;  4UOJ A;  2JE8 A;  1I5P A;  2J22 A;  2X10 A;  3C7F A;  4AAX A;  4PT6 A;  5EIY B;  3HNB M;  4L0P A;  1UYZ A;  4ARY A;  5LA2 A;  4KI5 M;  2Y6H A;  3C7O A;  1GOG A;  1DYO A;  5A1A A;  3I3B A;  4XUN A;  2WN2 A;  2E32 A;  2LW8 A;  3SKJ E;  2C9K A;  1UMI A;  3THD A;  5J1X A;  2VOT A;  1JU3 A;  2JKX A;  2YFZ A;  3NJX A;  1O8P A;  3HJR A;  4QX3 A;  3HNY M;  5JXI A;  4QDQ A;  1UWW A;  1UY4 A;  1GQP A;  4A45 A;  4A42 A;  3GXU A;  2YFU A;  3CMG A;  1CIY A;  1XC6 A;  3A7Q A;  3IAQ A;  4P5Y A;  3OGS A;  3LEI A;  3GGL A;  1O59 A;  3SKV A;  2BER A;  1SG3 A;  2B9V A;  4LPL A;  4A6O A;  5IJR A;  3HOB A;  4E8C A;  3IDA A;  3VD3 A;  5EJ1 B;  4OZO A;  3VD9 A;  2V5D A;  3T08 A;  2HYX A;  4DUW A;  2EIB A;  5DN2 A;  4D8M A;  3HEI A;  2VJX A;  3ACI A;  1OD3 A;  1O8S A;  2VMD A;  3LE0 A;  3MBW A;  3I97 A;  4DXR A;  1F4A A;  1K42 A;  1JYW A;  3J7H A;  3SEP A;  2CDP A;  1J83 A;  4MGS A;  1YQ2 A;  2JDA A;  2RV9 A;  3DYM A;  3OBA A;  3WSO A;  4QPW A;  3ECQ A;  3CDZ B;  1J84 A;  2VZV A;  3LQC A;  4XUT A;  5F7U A;  5LA0 A;  3WNP A;  3I2J A;  1CZS A;  2VZ1 A;  2ZXQ A;  2WO3 A;  4KWU A;  3T0A A;  4GZ9 A;  1W9T A;  3T0D A;  4CU8 A;  2HLE A;  2ZEY A;  2WAB A;  1OT5 A;  1CX1 A;  5DMY A;  4ARX A;  4QX1 A;  3T2P A;  2W91 A;  4BJ0 A;  2YC4 A;  3GDB A;  1JZ2 A;  3LPF A;  4QX2 A;  3I3E A;  2V4V A;  1JZ7 A;  1GUI A;  2W9X A;  4P08 A;  2E26 A;  4A4A A;  4RN5 A;  3C7G A;  1JI6 A;  2VMC A;  2W92 A;  4IUG A;  2OKX A;  1JYV A;  1UYX A;  3WF3 A;  4QB6 A;  3JXS A;  3OEB A;  2LS6 A;  3NQH A;  1T2X A;  3I2H A;  5B4N A;  2WUH A;  1DLC A;  2VTF A;  2WBK A;  2J1T A;  3A22 A;  2J1E A;  2BZD A;  1US2 A;  3MUY 1;  5EJZ B;  1W99 A;  5IFP A;  5CZK A;  4OMC A;  3WF2 A;  1PX3 A;  5LA1 A;  4RYD A;  3VD5 A;  4XUP A;  2VM9 A;  2VL4 A; 
#chains in the Genus database with same CATH topology
 1XNA A;  3WDX A;  1S0D A;  1PX4 A;  1PIV 1;  2AH2 A;  5JI9 A;  3OTF A;  4KU8 A;  4Z92 B;  4W50 A;  2XJR A;  3SH3 A;  2JXA A;  3ZYF A;  4AVV A;  4GIQ A;  3M3O A;  1FPN 2;  3R4D B;  4YSF A;  2UY9 A;  5BNO B;  3GAL A;  3CL1 A;  2OA2 A;  2EIG A;  2ARB A;  2Y6L A;  1JXN A;  1H30 A;  4TLF A;  4ZU5 A;  1DQ5 A;  2D7F A;  2P2K A;  4OHX A;  3K77 A;  1FPN 3;  3FFZ A;  4XFI A;  5L9B A;  2XBO 1;  4TXW A;  2WYS A;  2NPI A;  3PJQ A;  4IE6 A;  4BZ4 A;  4YM0 A;  2VOX A;  4A44 A;  1RUD 3;  3RYK A;  2DFB A;  4FI9 A;  1RUN A;  2WFF 2;  4JKM A;  5DPN A;  2RE9 A;  4Q4W 3;  2RDN A;  1BXH A;  4LHK A;  3J8F 2;  2GDF A;  2WFF 3;  3ZFG A;  1IQD C;  5A7S A;  5LWB A;  1PMH X;  2FQP A;  3MEP A;  1AR7 3;  1N1S A;  2CYF A;  1UL9 A;  2WQ8 A;  1GNZ A;  4COU A;  1OVS A;  1UCX A;  2OQ7 A;  4YVW A;  1AR8 2;  2ZGQ A;  1ZZ6 A;  2YDE A;  4QXK A;  2XJV A;  2Y8K A;  1AYN 3;  1LR5 A;  2H0V A;  3ZFE A;  4M3C B;  4COY A;  3V64 A;  4BQ3 A;  1E57 A;  3FC0 A;  5C8C C;  1YFU A;  2R0F A;  1G9B A;  4EZH A;  1VMJ A;  3OD4 A;  1YI9 A;  2AAC A;  2VME A;  1OH4 A;  2WO1 A;  4AI8 A;  5CAZ A;  2BGO A;  1QJE A;  1V6I A;  4GXL A;  2XJT A;  3J7L A;  1WGP A;  1H8T A;  2VR4 A;  3NWK A;  4OMD A;  5GLT A;  2OXB A;  4RHV 2;  1SHW B;  3VBR B;  4CU9 A;  1JYN A;  3KQ4 B;  2DF7 A;  2PAE A;  3HNM A;  4CCD A;  4LHN A;  2V73 A;  3PUQ A;  1GR3 A;  3FHA A;  5ACA 2;  4Q4X 2;  1YIP A;  1YQC A;  3JZV A;  4GJY A;  4YYO A;  5B4X A;  4N43 C;  2FCV A;  4ZXE A;  1WLW A;  4B7E A;  1XB9 A;  2WZR 3;  3WF4 A;  2QKD A;  4FT8 A;  5FZB A;  4UT5 A;  2X5I C;  2VVF A;  1JZ5 A;  2WS9 1;  1NX9 A;  5ACA 3;  2Z79 A;  4JHT A;  5EP9 A;  2E9Q A;  2P4E A;  2RVA A;  4C90 A;  1QGL A;  2KR2 A;  3S0M A;  2HWB 1;  3VBH C;  3WF0 A;  1MPX A;  2BBV A;  1J1L A;  4IE4 A;  5FMC A;  3USU B;  3JD7 3;  1UX7 A;  1W6O B;  1W2A X;  1ZBA 3;  1NOV A;  1ZBE 1;  2QZ3 A;  2UYB A;  3JQW A;  4Y4Y A;  5BV6 A;  4JQR A;  4K8R B;  1MR5 A;  4MGQ A;  1UY0 A;  5DAQ A;  1XNC A;  3NRU A;  4UW6 A;  3N7L A;  1R64 A;  2ATF A;  2WNV A;  2NM1 A;  5JR2 A;  4Y1V A;  3SEE A;  4AVS A;  5K0U B;  3AC0 A;  2J7M A;  3DL3 A;  1SLI A;  4FPL A;  3OGV A;  1MVE A;  3BOP A;  5LRS A;  2NN8 A;  1OQD A;  1J3Q A;  4JQT A;  3WP4 A;  3DPR A;  5FYY A;  3OY8 A;  3TYJ A;  4RL7 A;  4XCB A;  5JZG A;  1UY1 A;  3CJI A;  4NO4 A;  4QPG A;  4YW1 A;  4Y1Y A;  1V70 A;  2CTV A;  1F2N A;  2F6B A;  3MYX A;  3W5N A;  2VCA A;  4CVU A;  3WHT A;  3A21 A;  1F8V A;  2O8O A;  3RZZ A;  4BQ4 A;  3H8R A;  3HQX A;  2R16 A;  3HIF A;  1NY7 1;  4A3X A;  2WZR 2;  4OUM A;  1MS4 A;  2IFW A;  4CUA A;  1R09 2;  4ASM B;  5M0T A;  3JBG 1;  2QQM A;  3WNK A;  1S0C A;  1YO8 A;  3ETP A;  3FMG A;  1ULC A;  3ZM8 A;  2EXJ A;  4HVR A;  2BEO A;  3TEW A;  1H9P A;  1VBA 3;  2W52 A;  2W87 A;  3NO8 A;  1XSR A;  3AMP A;  1VIW B;  3LFI A;  4WZF A;  3LIH A;  4GAZ A;  3VBU B;  3NAP B;  1WCU A;  1VBA 2;  3ZSE A;  1HRV 3;  3PHM A;  5EWS A;  2O1Q A;  3GM8 A;  1OLR A;  4EN8 B;  5DAV A;  1IPJ A;  1OOP C;  4QQ2 A;  2EIE A;  1VMH A;  3J8F 1;  4Y3O A;  1OHF A;  3WDT A;  2H6B A;  2VMF A;  3RVH A;  1ZA4 A;  2WC2 A;  1JOB A;  3ETQ A;  5FOB B;  4MGI E;  4CYD A;  2HJI A;  3EJK A;  3FWE A;  2I45 A;  1PVC 1;  2EF6 A;  5F32 A;  4D6Q A;  3IPV A;  2VTX A;  4OQ8 A;  1LEC A;  1G8W A;  4QDS A;  5A1L A;  1T6G C;  1DFQ A;  3SCG A;  1YRZ A;  2Z4F A;  5FO7 B;  3J7M A;  3NNF A;  1P8J A;  1PO2 2;  3GJA A;  4L2N A;  1XBF A;  5CKN A;  4EN9 B;  1JBC A;  1L7Q A;  2Q5T A;  4UBH A;  4I0W B;  2JDN A;  3ZXA C;  5J96 B;  5LEK A;  1IKP A;  1VRH 3;  2NMO A;  2WWU A;  3ENR A;  1J3R A;  1X7N A;  1IKQ A;  4OLL A;  4YAR A;  4HOO A;  1UMZ A;  5I0T A;  1NLS A;  1CAV B;  4HT1 T;  5ACA 1;  4PDW B;  3AXD A;  3OPZ A;  3OJB A;  1JHN A;  4QGL A;  4WBB A;  4YPJ A;  4FBF A;  1PMJ X;  2RS3 2;  3DCQ A;  4K1Y A;  1PGW 2;  2X5I B;  5KBF A;  1CPM A;  2JKB A;  2J1V A;  4Q4W 2;  4JTO A;  2V09 A;  1ZRR A;  2DV9 A;  3AKR A;  1B35 C;  2LAL A;  4M4P A;  4Q29 A;  3WUD A;  4IEX A;  4FXG B;  2XON A;  3SIS A;  4E4H A;  4IV1 A;  1RHI 3;  2ZMK A;  2NLR A;  3BPS A;  3O1T A;  1DQ1 A;  1W28 A;  3LF7 A;  5D8A C;  4RFT 0;  5FYM A;  4S2F A;  4XDP A;  5A7W A;  4YG3 A;  3N9O A;  4LBN A;  3K4Z A;  5FIX A;  5JUV A;  1S2K A;  1KFU L;  4YZ1 A;  1BYH A;  2GZW A;  1G9D A;  3BOW A;  4H2A A;  1TG7 A;  4P9X A;  3VN4 A;  4XOG A;  2ZA9 A;  2R04 1;  3EB7 A;  2W5F A;  4A2U A;  1ZRE A;  4Z1V A;  1PGL 2;  1XOY A;  1MS9 A;  3WDW A;  1AX1 A;  1MZ6 A;  1UPS A;  2JG8 A;  3WP3 A;  1VB2 A;  2OZJ A;  1N1T A;  3K75 B;  5F2S A;  3MZH A;  4CRQ A;  1S0F A;  1W8O A;  5FZK A;  3IDC B;  1Z7S 3;  3ZXF A;  3O5S A;  1S2B A;  1C5I A;  4XJA A;  3MLL A;  3E6B A;  2ZCW A;  4K40 A;  1AR9 3;  4LTA A;  1AYN 2;  4N9I A;  1OH3 A;  3AP9 A;  5LZ6 A;  1GWM A;  3R0R A;  4DS0 A;  4EWE A;  4D7T A;  4CDQ B;  2P5B A;  2XVG A;  2Q8C A;  2XBO 3;  1IOA A;  4J1W A;  4FPY A;  1CZT A;  1PO1 2;  3P6B A;  1AL2 2;  2HEV F;  3EYP A;  1UOJ A;  4XUR A;  1M4W A;  5FPA A;  1RIT A;  3RZL A;  4OI4 A;  3CNA A;  3WG2 A;  1BBT 1;  1G6N A;  4D6R A;  5ANQ A;  1W2U A;  2E31 A;  1RIN A;  4JGZ B;  3ZYR A;  2ZHM A;  1UZV A;  3MF6 A;  5EFU A;  1G9C A;  3OYW B;  3VD4 A;  1UQX A;  3O14 A;  3M1H A;  2CAU A;  4QM8 A;  1RVF 3;  4NHM A;  2ZGO A;  5FZ7 A;  2C4X A;  4HN0 A;  3WW4 A;  4QAW A;  4FOY A;  1A78 A;  3K4D A;  1S2E A;  2QDR A;  1RUF 3;  4B3N A;  1X36 A;  5IHR A;  4XAE A;  2K46 A;  4L11 A;  4CDX C;  4PCR A;  3WUC A;  5F8P A;  5IK5 A;  4YG6 A;  4JGY A;  2R07 1;  4QDR A;  2ORZ A;  4M0H A;  1NCQ A;  3AMH A;  4LBQ A;  2IXL A;  4Q0S A;  3IAP A;  1GZW A;  3HN1 A;  5JI7 A;  5ANN A;  3I3M A;  5IAV A;  5A3M A;  2YGL A;  1QF3 A;  1TEI A;  4LA3 A;  3A4U A;  1SCR A;  3HAG A;  4CSW A;  4CU7 A;  5J09 A;  1SBD A;  4BQ5 A;  1ZRC A;  3WCS A;  3RZK A;  1UIJ A;  3EHK A;  4MGT A;  2YB7 A;  4HET A;  4J25 A;  3WQ7 A;  1QJU 1;  1V6L A;  3BGA A;  4DQA A;  5JXH A;  4LK6 A;  1OC1 A;  3PME A;  1Y9M A;  3WIN E;  4YGD A;  1LNS A;  1HN0 A;  4BDV B;  1ENS A;  1RTV A;  1SLB A;  4BQ2 A;  2DUQ A;  1RUG 3;  4A3Z A;  1HXS 1;  2K2S A;  3CU7 A;  2GP3 A;  3LEM A;  4R9C A;  3GYD A;  1ODM A;  1IZ3 A;  2DTY A;  2PN5 A;  4OHY A;  1KRI A;  2QE3 A;  3AYE A;  3OBZ A;  3BTY A;  5DAB A;  4HVQ A;  1OSG A;  4XYX A;  2ZX3 A;  3K4A A;  4D3W A;  1OD5 A;  5A3O A;  3RJR A;  1VE0 A;  4QPY A;  2FDF A;  2LRP A;  4XF3 A;  1FMD 1;  3D0S A;  3RZG A;  1N1Y A;  5LBC A;  4DXT A;  1QJY 1;  2ARX A;  4QD2 A;  3K3O A;  2VBP A;  4NPR A;  1H1A A;  2SLI A;  4R52 A;  2H6C A;  4UBG A;  2D6N A;  4NII A;  3J9S A;  1GKB A;  4KG0 A;  4KH9 A;  2NZ9 A;  1OBN A;  2VZO A;  3DUI A;  3AZV A;  4JV4 A;  1N3P A;  4EN7 B;  2FDG A;  4COW A;  1EUT A;  2VCB A;  2WLQ A;  4JDN A;  4CUB A;  1OVP A;  4BQY A;  2RMU 1;  4QKD A;  3ZFF B;  4AQ2 A;  1GZC A;  2YG0 A;  3MW2 A;  3NJY A;  4WVZ A;  5GLW A;  4UOJ A;  5J7M A;  4ORF A;  5C8C B;  3VBO B;  4ZU7 A;  1OLM A;  2VVE A;  2X10 A;  5FP3 A;  1LES A;  4XMI A;  2VU9 A;  3WW1 A;  3WG4 A;  1OMI A;  1CAW A;  3ZPY A;  1BJQ A;  2P6C A;  4UWD A;  5FZF A;  1CR7 A;  5FV3 A;  2OPK A;  4KI5 M;  2G19 A;  4HKO A;  2D3R A;  1GOG A;  2RS5 1;  4DB5 A;  4TZD A;  4BOW A;  2LTN A;  2GC0 A;  5A1A A;  2LW8 A;  3POY A;  2PHL A;  3LGR A;  5BY5 A;  1AR6 2;  1SLT A;  1PVX A;  1N3Q A;  1W8W A;  2YY1 A;  4C8D A;  2VOT A;  3A0K A;  4Q4Y 3;  1JU3 A;  4FPG A;  3UYJ A;  2JKX A;  1JUI A;  4EE2 A;  5KC5 A;  2WS9 2;  3ZPO A;  1AF9 A;  1YLL A;  1RUO A;  1FNZ A;  3RQ0 A;  1UO9 A;  2RS1 2;  1GQP A;  3MIH A;  3VHR A;  5I8Y A;  2JE7 A;  1C1F A;  4PHZ A;  4Y5T A;  4Y20 B;  2H0B A;  3T1M A;  3WR0 A;  4YWA A;  1A8D A;  1W6N B;  1CIY A;  4X6R B;  4CDX B;  5IAX A;  2CGP A;  3IAQ A;  3OGS A;  1XYO A;  1QOT A;  1O59 A;  2PHT A;  1MEC 2;  5IVV A;  1J1T A;  1SG3 A;  2EAL A;  4LPL A;  4OI1 A;  4B1L A;  1W9F A;  5F1R A;  4A6O A;  4I30 A;  3THP A;  1VR3 A;  2R06 3;  3DN7 A;  1ZZ7 A;  2JX9 A;  3IDA A;  1WBL A;  2DBI A;  3LSE A;  2AR6 A;  2JDY A;  1EP0 A;  1MAC A;  2HEY F;  4QU2 A;  5C5U A;  2PHF A;  3NV1 A;  4Q4W 1;  5E6H A;  3VZJ A;  1JH5 A;  2Q4S A;  4MZU A;  1AL2 3;  2HYX A;  2ZML A;  1L7L A;  3IN9 A;  3LOI A;  4B4P A;  5HBA A;  1RUD 1;  1QJY 2;  4AFC A;  2LM3 A;  2XUE A;  2ZOE B;  4GAL A;  4CZS A;  5BNN A;  1POQ A;  5FXZ A;  2HWE 2;  2WA3 A;  5A33 B;  4I09 A;  2CWS A;  5CU1 A;  2A6V A;  2EAA A;  2BOI A;  4HON A;  3ZX7 A;  1C3H A;  2W2I A;  1K42 A;  1IHM A;  4CXW A;  1D4M 3;  4LBL A;  2XL9 A;  5JOZ A;  3RWK X;  4AI1 A;  4CPB D;  4QQH A;  2WQ4 A;  3VBR C;  4H7M A;  5K0U A;  1J83 A;  1OQ1 A;  4QQP A;  4LBK A;  3I7D A;  1HB1 A;  3MI8 A;  1YXW A;  3U14 A;  1ZRD A;  2XBO 2;  3CHX A;  2TNF A;  1IG0 A;  4CCJ A;  1RUI 1;  4R9D A;  5IT6 A;  1TME 2;  2A5Z A;  3R05 A;  4WM8 A;  4YGE A;  1JTZ X;  3PTY A;  4XFA A;  5GLV A;  3ZIW A;  3POB A;  4XF0 A;  3KF5 A;  3IZO A;  3O1M A;  2OW4 A;  4HKL A;  4E9K A;  4KG8 A;  4OUL A;  4CDU C;  4Z07 A;  1GP6 A;  3CDZ B;  2JIG A;  3O0V A;  1UPI A;  4Y24 A;  1J84 A;  4YW2 A;  3WG1 A;  4UW5 A;  4AI0 A;  4BIO A;  4L97 A;  3LQC A;  3PUS A;  1O5U A;  1S4C A;  3JQX A;  1LRH A;  3BIE A;  4K8F A;  3T4V A;  5FYV A;  1CZS A;  4XHB A;  2AUY A;  4YM2 A;  2B5H A;  2VZ1 A;  2XH6 A;  3U07 A;  2WO3 A;  5IUQ A;  1BCX A;  4GZ9 A;  1W9T A;  4CU8 A;  4P9J A;  5FZ6 A;  5FDB A;  4ONU A;  2HLE A;  2ZEY A;  2JEN A;  4GB3 1;  1EYB A;  3SLI A;  4OCT A;  3KV9 A;  4W6W A;  1AL0 G;  1DGR A;  1W8H A;  3OOX A;  4WVV A;  5FK8 A;  1LTE A;  1QJF A;  2PTM A;  1LHW A;  3H42 B;  5KXC A;  1QJZ A;  3WDY A;  3S6P A;  3NAP A;  3ALQ A;  3RMX A;  2W68 A;  2DCY A;  2HWF 2;  4HK8 A;  1JZ2 A;  3E5U A;  1WD3 A;  3AP4 A;  1SAC A;  2W39 A;  2O0O A;  1B35 B;  4P14 A;  4QKN A;  1PM4 A;  1RUI 3;  1Q8S A;  1SFY A;  4XBL A;  4RR3 C;  4YFW A;  5LRR A;  1F9K A;  3AYC A;  2Q30 A;  2RDS A;  2WWS A;  4RN5 A;  4AFA A;  4LO5 B;  5A7O A;  3VHO A;  1JI6 A;  1GAN A;  4FP2 A;  1RUI 2;  3PDQ A;  3Q9O A;  4AXO A;  5I93 A;  1JYV A;  3WF3 A;  4QT6 A;  4QB6 A;  2DUO A;  1QXR A;  2DVG A;  2GH8 A;  3AFK A;  4LO6 B;  3T30 A;  4BQW A;  1BZW A;  1GBG A;  1LOF A;  1VBB 1;  1MS0 A;  2R30 A;  2ZTN A;  3NQH A;  1H2L A;  3MF9 A;  3O12 A;  4HL0 A;  1HRI 1;  2DVB A;  4QM9 A;  3VLB B;  4EJR A;  5KHK A;  5H9P A;  5JWP A;  2XXZ A;  3N9N A;  2RS5 2;  3GHM A;  2IVJ A;  1OLM E;  4H3W A;  4CEW B;  3A22 A;  3DKQ A;  5JMC A;  1CAV A;  5FZO A;  4S2H A;  1US2 A;  4L9B A;  5K8S A;  2FDH A;  1W99 A;  3QBQ A;  1R1A 2;  3LSD A;  5CZK A;  3TAY A;  5J36 A;  1XYN A;  3RRD A;  3QH6 A;  1QXJ A;  1VBC 3;  5LA1 A;  1CVN A;  1OLQ A;  4PQ9 A;  3N9M A;  1POV 3;  4Q4V 2;  4WVM B;  4K7J A;  3GBF A;  3WQB A;  2WLP A;  4KWK A;  2BNM A;  1HJF A;  2E6V A;  5EZW A;  1H8V A;  4O9E A;  1GSL A;  2VZQ A;  2VUC A;  4L99 A;  5LAS A;  5FZL A;  4BWO A;  1LHN A;  5A7W B;  4UFM A;  3DYP A;  2SBA A;  3POW A;  2WT0 A;  5A32 A;  1UU6 A;  4AI3 A;  1BKZ A;  1GU3 A;  2MEV 1;  3KLS A;  3KZ4 C;  2WJS A;  3RZJ A;  4YRD A;  4XFB A;  4NIH A;  2ZAC A;  2RDQ A;  5A3W A;  3TOJ A;  1ASJ 3;  2P3K A;  4AGG A;  1UY3 A;  2XQX A;  2ZGR A;  3POF A;  1AR6 3;  1K5M B;  1WW4 A;  2BFU S;  2ID4 A;  1SQ4 A;  1ENQ A;  5J48 A;  1SPP B;  1AYN 1;  4IE7 A;  3VZN A;  1W06 A;  3BN6 A;  4CDU B;  1K12 A;  1RB8 G;  4C0H A;  1HW5 A;  2WWJ A;  1UZY A;  5ABJ A;  5J3U A;  1CAU A;  2DVA A;  5C7G A;  1R1A 3;  3FUQ A;  1RUE 2;  2QQK A;  3NST A;  5F6K A;  3MFC A;  1W05 A;  2R0H A;  2R07 2;  4LKD A;  4BHP A;  4DRR A;  4DY3 A;  5D8A B;  1N1V A;  4FQ4 A;  4CP1 A;  2QQW A;  2VG9 A;  1FX5 A;  1LAJ A;  2WZ8 A;  2QTW B;  2YC2 A;  4XFH A;  1Q5O A;  5A7Q A;  5FY5 A;  1GOF A;  5KWR A;  4V1P A;  3BTZ A;  3W5M A;  2VQT A;  4IGP A;  5A6X A;  5JOW A;  2A1X A;  4GUL A;  4YVS A;  1RMU 2;  1FPN 1;  2OZ6 A;  1S0G A;  4A6S A;  2P37 A;  1RXG A;  3OBT A;  4LUK A;  2NMN A;  4XXP A;  2RR1 2;  3OGR A;  4P9L A;  3VZL A;  3M7A A;  3VDD A;  4AWD A;  3UK9 A;  5C70 A;  5FZH A;  4MAD A;  3MIG A;  4Y26 A;  3JB4 C;  2F4L A;  3JBG 2;  4WM7 C;  4DXZ A;  1NT0 A;  2J1U A;  1PGW 1;  3PUI A;  5LB6 A;  5T5J A;  4XJU A;  4H55 A;  2KD7 A;  2WT2 A;  2B8M A;  4NIG A;  2D93 A;  4ASL A;  1YCI A;  3USS A;  3A23 A;  5C6C A;  1DDL A;  2P3J A;  1FAY A;  1QDC A;  4QHZ A;  5F2W A;  4XF1 A;  5JXJ A;  5JSR A;  4NN0 A;  1QDO A;  4B1M A;  4XFG A;  3D82 A;  4IGO A;  2D6K A;  4HFS A;  2HBU A;  4ZU4 A;  4BLJ A;  2XUM A;  1D7P M;  5JPM B;  3DEC A;  4RS5 C;  4YG0 A;  5FYS A;  1PK6 C;  3WCR A;  4QU1 A;  4NPL A;  4XZU G;  5DG2 A;  4MG2 A;  4IGQ A;  1KGY A;  4NR1 A;  2Y33 A;  4XMA A;  2JD4 A;  3SCF A;  3CJI B;  5CFD C;  1C57 A;  2E7A A;  1EPW A;  3GBW A;  4K1Z A;  5F3C A;  5FQ0 A;  3O0X A;  2XLF A;  1PZ9 A;  2RR1 3;  3OB8 A;  4LUL A;  1W6P A;  3TWI A;  1KJL A;  1PIV 2;  3AK0 A;  5DDJ 2;  4LNV A;  2BW8 A;  5AFE A;  5FBZ A;  3I54 A;  4R8H A;  1F35 A;  3CZJ A;  1RUH 2;  2VY0 A;  5FY4 A;  2EA7 A;  3LA2 A;  4YW4 A;  1ULG A;  3WQ1 A;  5DG1 A;  5LCW L;  1UOF A;  2Y34 A;  4FPF A;  5AC9 3;  1D4V B;  2A70 A;  1NA1 C;  1UAI A;  2R49 A;  2BVV A;  2WNU B;  2W95 A;  3FJS A;  5FZ0 A;  3U78 A;  2VUJ A;  1HLC A;  1U5Y A;  1GOH A;  1X8E A;  3KB5 A;  3ZFF A;  2OT7 A;  4FAG A;  4E8D A;  4QGM A;  5FYH A;  4E27 A;  5C4W B;  1S0J A;  2HH9 A;  3ES4 A;  1MS5 A;  4JCK A;  1REF A;  2Y0I A;  3WW2 A;  1V6O A;  1DGW A;  2WFP A;  4NRP A;  1I1E A;  4A7K A;  2GND A;  2OVU A;  5J98 B;  3H7Y A;  5FP8 A;  1OFN A;  4QPI A;  2GNM A;  5DZG A;  4CDW C;  3ELN A;  1VPH A;  1Z7S 1;  2EAK A;  2YV8 A;  1PO1 1;  3RZH A;  4XQW A;  3U37 A;  2QJV A;  1SDD B;  3OSD A;  1DU3 D;  4ISQ A;  2JEC A;  1UW8 A;  2GC1 A;  3AVS A;  5E8A A;  5I0R A;  5CAD A;  1G7Y A;  1OA4 A;  1R1A 1;  4D7Y A;  3GZE A;  4ET7 A;  3GZT B;  1GZ9 A;  1W90 A;  3AJZ A;  3LOB A;  3ROU A;  1FOD 3;  4IXL A;  3N36 A;  3SHR A;  2IXC A;  1FMD 2;  2W46 A;  5HCA A;  4XIO A;  5A70 A;  1C5H A;  1KDK A;  1RHI 2;  1N47 A;  2EXH A;  2R6Q A;  1FOD 2;  4OI2 A;  4Y1Z A;  5KXD A;  3U4X A;  2QUO A;  2L9L A;  4QKB A;  1HDK A;  3MGU A;  4HXC A;  1HRI 2;  2VVD A;  1ND3 A;  4PDW A;  3VDB A;  4TLG A;  3ZLI A;  2DVD A;  2YU2 A;  3PJY A;  3WVJ A;  1DCS A;  3I2D A;  2DCT A;  1WA4 A;  5JOY A;  3MIB A;  4FPE A;  3BPZ A;  4FCA A;  4QMA A;  4UYB A;  5FBJ A;  4DNY A;  1LOB A;  4QPG C;  2XKO A;  3VZK A;  4Q0U A;  1FYU A;  4IE5 A;  5C71 A;  1GQH A;  4YZ2 A;  3BB6 A;  2A3Y A;  5FZA A;  1POV 1;  5IK8 A;  3FHQ A;  2D5F A;  3M3E A;  4P02 B;  4CCC A;  3I2O A;  5EPA A;  2JG9 C;  2Y6J A;  3MW3 A;  4Y22 A;  2VZT A;  4FPK A;  4NHK A;  3I2I A;  4LHL A;  3N9Q A;  3RSJ A;  1UU4 A;  2VW2 A;  2RJ2 A;  1KS5 A;  1V9U 3;  1ZBA 1;  1UN1 A;  2VZU A;  3GNE A;  4K20 A;  1ZRI A;  2BNN A;  4I2O A;  1GNH A;  3I3D A;  1PZ8 A;  3ZYP A;  4OFG A;  3H8O A;  2D6O X;  4FTE A;  3POE A;  1LGN A;  2ZBJ A;  3NV2 A;  5CBL A;  1RGS A;  3B93 A;  1QJX 3;  1YFW A;  3C2U A;  2YZ4 A;  1L7R A;  2R32 A;  3ZYH A;  2W3J A;  1W04 A;  1TQ5 A;  2WNU C;  1VBE 1;  3QH7 A;  1DLL A;  1IPS A;  1W0N A;  3UT0 A;  1CJD A;  3QAC A;  5CKQ A;  1YFX A;  3MO4 A;  4LA2 A;  5HCB A;  3RNS A;  1OF3 A;  2R06 1;  2VTX J;  3PVN A;  4CCE A;  3W20 A;  4AED B;  5GM0 A;  4XAC A;  1DQ2 A;  5LK5 A;  1XE7 A;  2YHJ A;  2G9F A;  4Q4X 1;  1Y9Q A;  2VMH A;  4AVB A;  2GME A;  2Y6G A;  4XF9 A;  3VUO A;  3ACF A;  3R4S A;  5FP9 A;  3ZSL A;  1AR6 1;  4Y5S A;  4JGZ A;  5C4W C;  3P1I A;  4J1X A;  3OYW A;  4PF5 A;  4C0B A;  4SBV A;  2D3P A;  4CU6 A;  5ERL A;  3T2Q A;  5EXO A;  3UKV A;  5FRA A;  2CL2 A;  4Z2A A;  4XIK A;  5KHG A;  5A1F A;  2WO2 A;  1UXZ A;  1LED A;  2HWE 1;  3U4S A;  1H6X A;  3W9A A;  4KL1 A;  1NXM A;  4IEZ A;  4UFI A;  4XVH A;  4YW3 A;  3Q8B A;  1RUH 3;  1G9A A;  2B4K A;  1VBE 3;  3CZU A;  1AJO A;  1XPW A;  4GWJ A;  3FL7 A;  4YVS C;  1REE A;  1WWY A;  1UY2 A;  4M4R A;  2ZZJ A;  4U36 A;  4AQT A;  5C9A A;  4IES A;  1YQ8 A;  2BP6 A;  1Z0H A;  1DGL A;  1RUJ 2;  5FLH A;  4AFM A;  4AVC A;  2EXI A;  3KV6 A;  1PGS A;  1RED A;  3OG2 A;  1TNR A;  2NP0 A;  2Z69 A;  1XNT A;  1Y9G A;  4FFI A;  1JHJ A;  2Q8E A;  3MV0 1;  4AK3 A;  2I74 A;  2XLA A;  5FO9 B;  1KXG A;  3KSC A;  4C91 A;  2ZX2 A;  3KCX A;  1R09 3;  4YZ3 A;  1W2O A;  2VW1 A;  1NCR A;  3CLP A;  3KT1 A;  1VRH 1;  5FYT A;  1ONA A;  2PLV 3;  3GHN A;  3F2Z A;  4GWN A;  2CDO A;  3V0B B;  3B00 A;  4CP2 A;  5JSO A;  2HWB 3;  2WAO A;  2J1R A;  1PIV 3;  2WS9 3;  4QB1 A;  4CP9 B;  5K9Y A;  1JS9 A;  2ZEX A;  2VO5 A;  2ZX0 A;  1GIC A;  1JMU B;  4KWL A;  4LEJ A;  2Y6K A;  4AG4 A;  2FZ2 A;  1W0O A;  2EXK A;  4U2A A;  1G86 A;  4I0B A;  2TUN A;  2VMG A;  5GLZ A;  3WEZ A;  2WAA A;  5C3S A;  4RR3 B;  5L19 A;  3O1O A;  2ARE A;  3WY6 A;  2WRA A;  3M3I A;  4XBN A;  4IW3 A;  4WVM A;  1HIX A;  3UES A;  2X8K A;  2HEW F;  2ORX A;  3ZYG A;  3BU7 A;  4M3C F;  1ZBA 2;  3MUZ 1;  5I0D A;  5FYC A;  4Q8K A;  3WDV A;  4IET A;  4IND A;  4RSU A;  3TRS B;  1WW7 A;  2TBV A;  1RYY A;  1WCD J;  2FBE A;  4QQO A;  1W6Q A;  5T55 A;  1V6K A;  2C9A A;  4NJ4 A;  4QQL A;  3ZFG C;  3P5B A;  3VBO A;  1CX4 A;  5GLU A;  1I5P A;  2PAM A;  5LAT A;  5IVB A;  4NRM A;  3U11 A;  4ZHN A;  4Z82 A;  5A3N A;  3RPQ A;  3AVR A;  3NVC A;  3VHP A;  2QQU A;  4FXK B;  3BTX A;  1HQL A;  1AX2 A;  5E88 A;  1IS3 A;  3ZN6 A;  4CCO A;  4L0P A;  1CAW B;  4IER A;  1GYK A;  1IQA A;  2GMM A;  4Q4X 3;  4R9B A;  4Y1X A;  4Q4V 1;  4HK9 A;  1OI6 A;  3KVA A;  4AED C;  1W6M A;  4WM7 B;  5F3I A;  3WLU A;  3CJX A;  3M3Q A;  1Q8O A;  3LKJ A;  4DO0 A;  2ZGS A;  2JDU A;  2XJU A;  4XUN A;  2E32 A;  3GJB A;  3ZKU A;  4AHW A;  3PIG A;  5BNP B;  2K0G A;  4PIY A;  1AR9 2;  1I6X A;  2A3W A;  3M8L A;  4MV2 A;  4JAA A;  2YFZ A;  3DF0 A;  1O8P A;  3HJR A;  5DMY A;  3HNY M;  1UWW A;  4AI9 A;  4XXA A;  1GV9 A;  2BU9 A;  4YNI A;  3VBU C;  4B7K A;  4BE3 A;  2Y6F A;  2ARA A;  2G9G A;  3GXU A;  1MQT C;  1VBB 2;  1U5X A;  2CY6 A;  4N90 A;  4WZC A;  4FFG A;  5TSW A;  3GGL A;  1NLR A;  4XJ8 A;  5JZG C;  1G9F A;  1U0A A;  3AZZ A;  3H3U A;  3QLQ A;  2BER A;  5T3N A;  3AMM A;  4PLN A;  3WXP A;  1W8T A;  1YC6 1;  3FBY A;  4R4X A;  4AGV A;  1XJA A;  2VBD A;  4XEZ A;  1AR9 1;  4GQ7 A;  5IVY A;  1AYM 2;  3VD3 A;  4LR4 A;  2JDK A;  2B7Y A;  1XQN A;  3VD9 A;  2HBT A;  2B42 B;  2YBK A;  4LOT A;  1QQP 1;  5EYX A;  3HWJ A;  1COV 3;  1AUY A;  5FPX A;  2B39 A;  2XPJ A;  3SCH A;  2EIB A;  2JJ6 A;  1NA1 B;  4NAM A;  2XHK A;  3H8X A;  2VJX A;  4BIS A;  2I2S A;  3PUR A;  1O8S A;  3LE0 A;  4D6S A;  1D2S A;  4BA6 A;  3I97 A;  1V6N A;  4DXR A;  5BNO A;  2N7G A;  1F4A A;  3T4H B;  1S55 A;  3VBS B;  3FZ3 A;  3LIG A;  1O4Z A;  1ND2 C;  1JYW A;  3J7H A;  1CQ9 A;  2NQY A;  3M70 A;  3ZR5 A;  1XND A;  4C1X A;  1AYM 1;  2A73 B;  2PXJ A;  3OBR A;  3JBG 3;  5LY2 A;  2JDZ A;  1Q8P A;  5L7O B;  1BMV 2;  1OQE A;  2GP5 A;  3ZN5 A;  1C4R A;  5DDJ 1;  5JCT A;  2KA3 A;  4CDW B;  2GN3 A;  2RJL A;  4Q2F A;  2FCU A;  3URF A;  5CFC A;  1OPM A;  1YHF A;  3FHI B;  4O65 A;  3NNL A;  3WW3 A;  1MZF A;  1VRH 2;  4H7L A;  1CD3 G;  4XUT A;  2D6P A;  5F7U A;  3AP5 A;  2PHR A;  3I2J A;  3PVE A;  4UW3 A;  5GZD A;  2ZXQ A;  4KWU A;  3T0A A;  2P34 A;  1R1Z A;  1W2T A;  1QH7 A;  4QHB A;  3MW4 A;  5C3O A;  1VAM A;  1YYN A;  1Z78 A;  2E7T A;  2HWB 2;  1OT5 A;  2WAB A;  3HQR A;  3NKG A;  1RUD 2;  3OD0 A;  4FTS A;  1NE4 A;  2DBN A;  2RS3 3;  2D6L X;  2VUL A;  3BCW A;  3G7D A;  5F6L B;  3LDR A;  1JOD A;  4RA0 A;  1Z7S 2;  1O7F A;  2WYF A;  4QX2 A;  3Q8A A;  4COV A;  2WZR 1;  4Z2W A;  1B35 A;  2B9U A;  3AKQ A;  3N7K A;  2WR9 A;  3PIJ A;  4E2S A;  1AR7 2;  3IBM A;  4DPN A;  2PFW A;  2RMU 2;  3CBN A;  1JZ7 A;  1GUI A;  3MPP G;  4P08 A;  1YNA A;  2E26 A;  1AR8 1;  1H1M A;  1W0P A;  2PLV 2;  2BVB A;  5AVA A;  1W9Y A;  2CSG A;  2JG9 B;  3ZXK A;  2AEY A;  1GP4 A;  2O14 A;  3RFR A;  4Q4V 3;  3OEB A;  3VKO A;  2VOV A;  3USU A;  5FMB A;  2LS6 A;  4F83 A;  3WNX A;  5E1R A;  3B69 A;  1T2X A;  3V56 A;  2VBB A;  5F39 A;  2WUH A;  1M06 G;  4XE9 A;  4Q0V A;  1U5Z A;  1DLC A;  3GCX A;  4AQ6 A;  2WBK A;  3I3Q A;  4FOV A;  1V6M A;  3KS7 A;  2J1E A;  1ND3 B;  1RUE 1;  5FKC A;  4XFC A;  4MYE A;  5F9T A;  4LBQ D;  2BJS A;  3ZMO A;  2GSY A;  1DHK B;  2JE9 A;  2ZGL A;  4NRO A;  5A3P A;  1LB2 A;  1KQR A;  4XC9 A;  1PX3 A;  1ASJ 2;  4RYD A;  5CFD A;  1X9P A;  3VD5 A;  3TEZ A;  1SZB A;  4XUP A;  4AE2 A;  1CON A;  5K4L A;  1TME 1;  1X8M A;  4Q26 A;  5IAT A;  3P3N A;  3OGJ A;  3IB3 A;  3J4U H;  1UF2 C;  1QWR A;  5FZG A;  3VBF B;  2ADE A;  3QOP A;  3CKH A;  5I0S A;  1DP0 A;  4BME A;  2GMP A;  3JB8 A;  5KHJ A;  1ZYB A;  1WKY A;  4LOR A;  1V9U 1;  4LUM A;  4Y33 A;  5FYB A;  3LEG A;  3CIH A;  1CN1 A;  2X29 A;  2PLV 1;  1XYP A;  2RS1 3;  3NNG A;  3PL0 A;  4BYY A;  2UWA A;  2CGN A;  3ZFE C;  3I2F A;  1HN1 A;  5L7O C;  4NIA A;  4EWA A;  1A6C A;  2XDV A;  1SCS A;  2HWD 3;  3O7O A;  2X09 A;  3I2G A;  2QQV A;  4OUS A;  4XUO A;  5FMO S;  2XVL A;  4KGG A;  4GMP 3;  3BAL A;  3INA A;  2G9Z A;  1ZZ9 A;  4LHS A;  5H9S A;  5FO8 B;  2FMY A;  3S5A A;  1Y7B A;  4ERO A;  5LA9 A;  5D21 A;  2Q1M A;  3VGI A;  4CUC A;  4QPG B;  4NHY A;  1NY7 2;  3N35 A;  5EQU A;  2XJQ A;  5T54 A;  1CAU B;  4RGK A;  3T09 A;  1QKQ A;  2O8Q A;  2RR1 1;  4BQ1 A;  3VDA A;  2Y64 A;  5FLI A;  1AL2 1;  3CQO A;  1O4Y A;  5D8A A;  4ZS2 A;  4FPJ A;  2D97 A;  2I07 B;  1CWP A;  3BI3 A;  2VPV A;  5FYI A;  2YPJ A;  1JZ8 A;  1UYP A;  3MHZ A;  1TE1 B;  1BK1 A;  2IXI A;  2ARC A;  4D0Q A;  3UGH A;  1DGW X;  1KD7 A;  4E4S A;  4COZ A;  4ZZ8 A;  1PNG A;  4RQP B;  3UJO A;  2GC3 A;  5E16 A;  3H1M A;  5GZC A;  1ZBE 2;  4L92 A;  1IS5 A;  1FOD 1;  2B45 X;  1DF0 A;  1WUV A;  3J26 N;  4LOS A;  4PJY A;  5JLV A;  2FDI A;  4M3C E;  1YQ6 A;  4DUV A;  4QX0 A;  2J1S A;  5FYZ A;  3TEY A;  4OQ9 A;  4DEV A;  4O9G A;  2DCK A;  4HVO A;  1C8M 1;  1WMF A;  3NJV A;  1TMF 2;  4LE4 A;  4CCK A;  1ZM1 A;  2PHX A;  2Q1F A;  3GF6 A;  3MFA A;  4KQ7 A;  4X8P A;  1ZX5 A;  4XAA A;  3NKT A;  5FZ4 A;  5F5A A;  3B9C A;  3VKM A;  2A3X A;  3IPV B;  1KDM A;  5FXW A;  1CZV A;  5JDB A;  4GH4 A;  3F95 A;  5IFT A;  1QJX 1;  2J42 A;  2PAK A;  2VGD A;  1TZO A;  4KU7 A;  5GJ6 A;  1HQW A;  2PHU A;  5EJ3 A;  2OYZ A;  3EMR A;  1RMU 1;  5I8T A;  2WL1 A;  4TTG A;  3WX5 A;  3C3V A;  4NOT A;  4BCU A;  1EY2 A;  1XNB A;  3X29 B;  2FDK A;  1BK0 A;  3UGF A;  2RS3 1;  3DXT A;  3E97 A;  1H1I A;  3OGG A;  4FVV A;  4A7Y A;  4PF1 A;  5CB7 A;  1K3I A;  2WIN B;  5FRE A;  5FP7 A;  1BBT 2;  4AHX A;  1K45 A;  5IVE A;  1H6Y A;  2DCZ A;  4N7I A;  4CP9 A;  4MHU A;  1Q56 A;  3OUH A;  5FQ0 B;  5T52 A;  1RUE 3;  2VQU A;  5FCC A;  3WF1 A;  2X5I A;  2PEL A;  2RMU 3;  5C33 A;  3IDB B;  4UW4 A;  1W8N A;  3ACL A;  1SLL A;  1OOP A;  1YIF A;  4LMF A;  4PQQ A;  4BK4 A;  1EUU A;  1JU4 A;  1CAX A;  1HXS 3;  1NXD 1;  2D40 A;  3FX3 A;  3III A;  4YGB A;  3UNP A;  4YGC A;  5DXD A;  1R08 1;  4V2V A;  4XF4 A;  4ZPI A;  1S0B A;  2BGP A;  4MOA A;  2R04 2;  2XQR A;  1PHM A;  4KNC A;  1D2Q A;  1ZZ8 A;  4WV8 A;  5DUV A;  5GZG A;  3ZXL A;  3FLT A;  4Q0P A;  4ZY9 A;  2A6X A;  4CPB A;  5A3T A;  5I0U A;  4I01 A;  1O3T A;  4EYU A;  1GFF 2;  3FUO A;  4MHR A;  3FBM A;  2WNE A;  5FUI A;  1LJ7 A;  1WA6 X;  1FV2 A;  3GZU C;  4Q8L A;  2R06 2;  1W03 A;  3SIT A;  3HD8 B;  5DAX A;  1LKN A;  2LUW A;  1ST8 A;  5T5L A;  4QB2 A;  4DZG A;  2P3Y A;  2HWC 2;  3OUI A;  1QNW A;  1W6M B;  3H50 A;  2P1B A;  3HVD A;  1SBE A;  2UWC A;  1F4H A;  3ZMN A;  2ET7 A;  2ZGP A;  1NCQ B;  3Q8F A;  4IV3 A;  1IS4 A;  1XNK A;  2ZGM A;  4AGR A;  4F3J A;  3KCC A;  3N7M A;  2AZ5 A;  2XGX A;  4HZF A;  4IE0 A;  1WMD A;  1H4G A;  5G04 L;  4IV1 C;  4CXY A;  1WZX A;  2EID A;  5HPO A;  2UUR A;  1O3Q A;  4CP0 A;  4Z8B A;  3C7E A;  4LLO A;  1AJK A;  1GMM A;  4LO7 A;  4AZZ A;  3O1P A;  3POJ A;  1JZ3 A;  1QOS A;  4IEY A;  1W2N A;  4D7S A;  3POG A;  5LK7 B;  5DAW A;  1E5R A;  1ND2 B;  1YUD A;  2RM2 1;  3ABZ A;  5FXV A;  2Z42 A;  5IW0 A;  3THT A;  5FR3 A;  2P17 A;  5BNN C;  4KWJ A;  1W8Z A;  2IFR A;  5FZ3 A;  3I2K A;  4B4R A;  5FZI A;  4A41 A;  4BXF A;  2ZHL A;  3I8T A;  2A75 A;  2FDJ A;  3DPR B;  1I9R A;  3WHU A;  3MIF A;  4HMZ A;  2Q0A A;  4DOU A;  3KM5 A;  4KBB A;  4FO9 A;  5A6Z A;  1W8F A;  5GKA C;  2XJS A;  3SXW A;  3VKF C;  3L2H A;  1JN2 P;  1H9W A;  1W9W A;  3KMH A;  2ZAB A;  4QXH A;  2PHD A;  2GAL A;  4O7X A;  3APB A;  5FYU A;  1RJ7 A;  5ABJ C;  3ILN A;  5F37 A;  3S7E A;  1VBE 2;  2BWA A;  1YJL A;  4OUE A;  2QVS B;  4PI2 A;  2BNO A;  2RM2 2;  2YMZ A;  2GH2 A;  4BIF A;  2HWD 2;  4P9G A;  3ME2 A;  3KGZ A;  3NL1 A;  1RC6 A;  4GMP 0;  1SFN A;  1EV1 1;  2ERF A;  4I3G A;  3THC A;  1FT9 A;  1OKO A;  1MQT B;  2DFC A;  2W1U A;  1QQP 3;  2BYV E;  3AB0 A;  3PU8 A;  1OPO A;  3LWC A;  1MVQ A;  2R1B A;  2YYO A;  4XJW A;  5DAP A;  2OPW A;  4AQS A;  4I3P A;  3C8X A;  4XQ4 A;  1J3P A;  4HKW A;  1GWK A;  2QQL A;  5JZG B;  3ZYB A;  3EXU A;  1JYX A;  2VUD A;  4RGA A;  2YGM A;  4AEJ A;  5IVF A;  1LEM A;  5L7O A;  4LO8 A;  2XML A;  4X8N A;  2XOM A;  4UI9 L;  2VZ3 A;  4ZKT B;  4B29 A;  1MEC 1;  4N8M A;  5IYY A;  2JEM A;  4A7Z A;  3KD4 A;  3L2Y A;  2PQS A;  1IPK A;  2W08 A;  2CV6 A;  5JSP A;  1X50 A;  5T5O A;  2VUA A;  3CO2 A;  1LOC A;  3UET A;  2RM2 3;  4GD4 A;  2VQA A;  4XHX A;  5A3U A;  2R7E B;  2C1F A;  3IT8 A;  3K2O A;  3MDP A;  1K5M C;  4NHL A;  1AXK A;  2VZR A;  5AVP A;  5F5C A;  5FJH A;  5FKB A;  1HB3 A;  3S5Q A;  1BVV A;  4BH9 A;  4AFD A;  4KMQ A;  3UL2 A;  2Y38 A;  3VD7 A;  4AHZ A;  4MLO A;  1V0A A;  5AC9 1;  2Y60 A;  2WZP P;  4PBP A;  4MH0 E;  1NYW A;  3T0B A;  1XU2 A;  4ES8 A;  5L73 A;  1KEX A;  4QWN A;  2OS2 A;  5FY1 A;  2Q8O A;  5FTT C;  4G3Y C;  3PMS A;  3LZZ A;  4IV1 B;  1X82 A;  3JUU A;  5A7P A;  1BMV 1;  2VOW A;  3B7M A;  4D94 A;  4JHZ A;  2WZE A;  2JG9 A;  3K51 A;  4LKS A;  2ETE A;  3AYA A;  2FD8 A;  2ZHN A;  1OA2 A;  2XJP A;  3DGT A;  3TNP B;  5BNN B;  3J8F 3;  1BLZ A;  5LY1 A;  1QJX 2;  2JDP A;  3W59 A;  3RZM A;  3LD8 A;  1DBN A;  1JW6 A;  2JB4 A;  3RMY A;  1FXZ A;  1NE6 A;  1W6N A;  3N3H A;  3R4U A;  4LKF A;  2DCJ A;  1ODN A;  3Q8E A;  5F3E A;  3IDE A;  2P6H A;  5FWE A;  1H8T C;  2QFE A;  4FP3 A;  3A0N A;  4JZR A;  4DXS A;  3RJ2 X;  2WKK A;  3LPG A;  4IQP A;  4RR3 A;  4QPI C;  4N43 A;  2R07 3;  5C3Q A;  4NWW A;  3NNJ A;  4N9H A;  2EVX A;  4CDQ A;  3GZA A;  1UD1 A;  2CGO A;  4CCM A;  3LCP A;  4G4F A;  4LBM A;  5BUV A;  4FOQ A;  3OF1 A;  4LO4 B;  1ZVF A;  3BTA A;  4XUQ A;  5FPV A;  4HPK B;  4DFS A;  1O3S A;  2D6M A;  4RS5 B;  2IZW A;  3J7N A;  1PK6 B;  3U1X A;  1H2M A;  3ITQ A;  1QXP A;  2VH9 A;  3C7F A;  3CJI C;  4XAB A;  4AAX A;  4YW5 A;  4BQX A;  5T5P A;  1GWL A;  4PT6 A;  1ULD A;  2YRO A;  2ZJC A;  4CE8 A;  1H2K A;  3M3C A;  1ND3 C;  1OUX A;  1UYZ A;  3MLJ A;  4R4Z A;  3ST7 A;  3H1Y A;  4ARY A;  1RUJ 3;  3OPT A;  5LA2 A;  2ZKN A;  2BUK A;  2Y6H A;  3C7O A;  3ZXG A;  5DDJ 3;  3RYP A;  1GZW B;  3I3B A;  4AI2 A;  5FP4 A;  2HWC 1;  3SKJ E;  2A6W A;  2C9K A;  3THD A;  2ZMN A;  4AF9 A;  4BB3 A;  4C1W A;  3N4M A;  3H7J A;  1AYM 3;  3VBF C;  3PNA A;  1C1L A;  4FPO B;  3KV5 A;  4QX3 A;  4DIQ A;  5JXI A;  4QDQ A;  3MIC A;  3N7J A;  4A45 A;  4FOW A;  2YFU A;  3ZXJ A;  4ASK A;  5FZ8 A;  4UFL A;  4CEY B;  1JYI A;  1PNF A;  1XC6 A;  5CA6 A;  2NYY A;  4MXV A;  4P5Y A;  3H1W A;  3P3P A;  4KBZ A;  5FWJ A;  2KM2 A;  3SKV A;  1O6U A;  2ZGN A;  3HT2 A;  4JGY B;  2ZGU A;  3AKP A;  4V2W A;  4EZ4 A;  3SMH A;  4E8C A;  1V6J A;  3N9P A;  2VW0 A;  4OZO A;  5BPX A;  5L9V A;  1VBC 1;  1LU2 A;  3AKT A;  4GKY A;  1RUF 1;  1N3O A;  1RL3 A;  4UFH A;  4E4Z A;  1HX6 A;  4QXB A;  3TN9 1;  2WFF 1;  3RDI A;  3T08 A;  1PM7 A;  4GMP 1;  5CG8 A;  3VZM A;  1NA1 A;  5BNQ A;  5HV0 A;  1FAT A;  4BMB A;  3HEI A;  4MXW B;  1VBD 3;  4MSV A;  1OD3 A;  1T6B X;  5FPL A;  1UX6 A;  3FE5 A;  5FPB A;  4DRV A;  5FLJ A;  4YFZ A;  5C8C A;  2YU1 A;  4XQD A;  1VB4 A;  4RHV 1;  4UF0 A;  1R09 1;  1XSQ A;  5A32 B;  3WQ0 A;  1HRI 3;  2JDH A;  1BEV 1;  1VBD 2;  1ZZB A;  3RYR A;  1IG3 A;  4YLZ A;  3TN9 3;  4MGS A;  4XJZ A;  3VDD C;  1AX0 A;  1YQ2 A;  1SLA A;  2GNT A;  3I59 A;  4FPC A;  4FFH A;  4LXL A;  5AFB A;  3DYM A;  4URT A;  1FMD 3;  3OBA A;  3O1U A;  2A7A A;  3KT4 A;  5CFC B;  3I4I A;  3D4K A;  1NCQ C;  3KHB A;  3KF3 A;  4MGY E;  4NRQ A;  3UJQ A;  3WSO A;  4QPW A;  1OOP B;  4N7U A;  3ZSK A;  3VBH A;  1SLC A;  1CAX B;  3D5O A;  1SEF A;  2E51 A;  2VZV A;  3ORJ A;  4Y4R A;  3TB0 A;  3ZSJ A;  4P9W A;  5LA0 A;  3WNP A;  1YEW A;  1RXF A;  2VD7 A;  1XE0 A;  1ZA7 A;  1WLD A;  3T0D A;  4Y20 A;  4HN1 A;  4N53 B;  4AHY A;  1W39 A;  3B01 A;  1LOF C;  4NAO A;  5DUX A;  4GA9 A;  2LRO A;  2VEC A;  4QX5 A;  3LAG A;  4QX1 A;  3KV4 A;  3T2P A;  2W91 A;  4BJ0 A;  5DUU A;  3AX4 A;  2JG8 C;  4X6Q B;  5DUW A;  5FZ9 A;  1K5M A;  5JOX A;  3WG3 A;  2YBS A;  3LPF A;  1LGC A;  1SPP A;  5F3G A;  3VZO A;  1Q8Q A;  4CDU A;  1QU0 A;  4LJH A;  4NUB A;  4P9I A;  1EPZ A;  4XJ9 A;  5ABJ B;  3ZDS A;  2IXH A;  2W9X A;  5LEJ A;  2V4A A;  3HMY A;  3C7G A;  2WO7 A;  1NG0 A;  2W92 A;  2VMC A;  4YW6 A;  4XCA A;  5A80 A;  4IUG A;  3SH4 A;  1UYX A;  4XZP A;  5IVC A;  1NZC A;  3H0O A;  5FUP A;  4IEO A;  5JR7 B;  4CEY C;  1DGR N;  2WSV A;  5D2A A;  3V0A B;  1D4M 1;  4JDO A;  3I2H A;  2YUE A;  5IK7 A;  4JGY C;  3E6C C;  1ACC A;  3G6J B;  3VKN A;  4DIN B;  2VTF A;  4YVS B;  2DVF A;  1QNY A;  2J1T A;  4XIL A;  3VB9 A;  5ISL A;  1B09 A;  2BZD A;  4IDZ A;  1DQ0 A;  1RUC 2;  2XR4 A;  2C6S A;  1HQN A;  1H4H A;  1RJ8 A;  5DZE A;  1DYP A;  1U12 A;  5I8S A;  2JB8 A;  4CCN A;  4LE3 A;  2RDR A;  5FZC A;  5E89 A;  1WME A;  2HWF 3;  2MPF A;  3ATG A;  5F5Q A;  1LOD A;  2W94 A;  2XB6 C;  1QJU 2;  4EN0 A;  2FMD A;  2VXR A;  2GU9 A;  4CDQ C;  4IEP A;  5JAX A;  1BHG A;  2CWM A;  3OPW A;  1UZZ A;  5L9R A;  4AL9 A;  3WNN A;  3AFG A;  4JGZ C;  1CES A;  5FJK A;  3HR9 A;  3B9I A;  3ON7 A;  3DPR C;  3L9J T;  5CIR A;  1RUG 2;  1ULF A;  2DYC A;  1UNB A;  2VQ0 A;  5FZ1 A;  3ES1 A;  3WNM A;  1LHV A;  2BBA A;  3MLK A;  3AYD A;  2PYT A;  5KXB A;  3DXU A;  2GC2 A;  1J59 A;  2V5Y A;  4IEW A;  5JIU A;  2YPD A;  2XWB B;  1RUC 3;  1CJP A;  3BYW A;  4GJZ A;  3D6E A;  1LOG A;  1LU1 A;  2K9Z A;  1Y43 B;  1RIR A;  2XHN A;  2ZEZ A;  4NE9 A;  3ZFG B;  4E2G A;  4MET A;  4IV3 C;  3RG0 A;  1UXX X;  1C8N A;  3NMB A;  3NW4 A;  3WNL A;  5IVJ A;  4N53 C;  3RS6 A;  4YVW B;  4FTB A;  3LA3 A;  2OUJ A;  4MGZ E;  5GAL A;  4KGQ A;  5CYY A;  1O91 A;  1QEX A;  4OHW A;  1F31 A;  2VC9 A;  3PTR B;  4LLF A;  4Q27 A;  2HWD 1;  3DKW A;  3IWZ A;  4G9S B;  4CEW A;  2IUW A;  2VNG A;  2WN3 A;  4AEK A;  3RGB A;  2MNG A;  3HPN A;  5I91 A;  1OFS A;  1H8T B;  3VBR A;  3LEK A;  1NUK A;  1LCL A;  2KXL A;  3PU3 A;  1NKG A;  4QHO A;  4JDM A;  3VV1 A;  4ATE A;  5BNP C;  1YJK A;  5CNA A;  3ZVX A;  1POV 0;  5FFO C;  1WW6 A;  4QPI B;  2WSU A;  2GNB A;  5JIA A;  4URA A;  4WM8 C;  2ZPX A;  2W47 A;  2OQ6 A;  3BVC A;  3JCI A;  1QH6 A;  3M4F A;  4GB3 3;  2CHH A;  1VBC 2;  4XPV A;  1ULE A;  4BU2 A;  4XFF A;  5HCH A;  5FPZ A;  4HSL A;  5FK7 A;  5B2G B;  2P3I A;  2FZ1 A;  3UKT A;  4J6G A;  5LBF A;  1VBA 1;  1GP5 A;  2BFU L;  3KCY A;  4NWV A;  1OUS A;  3RWN A;  3WP5 A;  3ZYI B;  1IGO A;  2QQI A;  2VCC A;  4K3U A;  2Z5W A;  2JIC A;  2WNV B;  2R04 3;  3DYO A;  3ZFF C;  1EV1 2;  1NZI A;  1AZD A;  2OUH A;  1AR7 1;  1F15 A;  2Y0O A;  5FZO B;  3WNO A;  1MZ5 A;  3R6S A;  2DU0 A;  3EBR A;  4B4Q A;  3K46 A;  5L36 A;  4LIT A;  1OXC A;  3OY8 B;  1LOE A;  4XBQ A;  2WQZ C;  2D3S A;  5GZE A;  4K21 A;  2IXK A;  3D3A A;  1Q3E A;  2PHW A;  3LFM A;  2DDU A;  3IIA A;  5DZF A;  3MIE A;  2UWB A;  3MV1 1;  3WOG A;  3NNM A;  4H14 A;  2E33 A;  1O3R A;  5JXG A;  2JD9 A;  2VZS A;  4XTM A;  5G05 L;  4ZXK A;  1JZ6 A;  3VKL A;  4YW7 A;  1V9U 2;  3VBS C;  3BOD A;  2E53 A;  3C7H A;  1UZ0 A;  1TMF 1;  3S7I A;  1DZT A;  1RVF 2;  2PMW B;  4HPK A;  2ENR A;  3MID A;  4RS5 A;  4RHV 3;  5HXM A;  4QGN A;  3V65 A;  4QX7 A;  1DZQ A;  5KXE A;  3AP7 A;  2PQQ A;  5FMO L;  4UFK A;  2BGC A;  2D44 A;  2QQP A;  2HKX A;  1ULO A;  2RS1 1;  2ZGK A;  3B3Q E;  1LEN A;  2QZ2 A;  2YXS A;  1AXY A;  3HN3 A;  4K6B A;  2Z2S B;  1OA3 A;  1COV 2;  2QBX A;  2W0X A;  2J1A A;  4GWM A;  4LBJ A;  3S57 A;  4OYU A;  1SDW A;  5D1I A;  4EQV A;  3SH5 A;  4QKF A;  4AEM A;  2RJK A;  1W9S A;  1UYY A;  4PIZ A;  4ISR A;  2QDN A;  4AFB A;  1TME 3;  2ILM A;  1O4T A;  2F17 A;  4IV3 B;  2Y26 A;  1A8M A;  2HYK A;  4W6X A;  4W8J A;  5C9A B;  3AMN A;  4YVW C;  2IC1 A;  1RUC 1;  3M2M A;  1LGB A;  3W21 A;  4DEQ A;  4W4Z A;  1OUR A;  4LIV A;  1HRV 1;  3ZYJ B;  2BWC A;  1UMH A;  1JUH A;  2JDM A;  3IMN A;  3LB9 A;  4TYS A;  4QXC A;  2RG4 A;  3AP6 A;  3T2O A;  5FAX A;  3TNQ A;  3ZR6 A;  4IEU A;  3ACG A;  2AEN A;  4P00 B;  5IWF A;  4BXS V;  3OUJ A;  5SV8 A;  1ND2 A;  2QQJ A;  1HJG A;  4AVA A;  3AKS A;  4F8A A;  5JMO A;  1D4M 2;  1S0I A;  2WNO A;  1LHO A;  4I02 A;  3VDD B;  5FY8 A;  1H2N A;  4E2Q A;  3DV8 A;  1U5I A;  4OVE A;  3SQO A;  2AGS A;  1HXS 2;  1H0B A;  3DEM A;  2JIJ A;  2DWR A;  2WDB A;  1K5J A;  5CFC C;  1W6P B;  4IEV A;  3FLP A;  3E1F 1;  1W3V A;  1RUF 2;  4XDQ A;  1IS6 A;  1DQ6 A;  2ZZQ A;  4PIX A;  3AZY A;  2WNU A;  5APA A;  3IMM A;  2C26 A;  2BV4 A;  1QIQ A;  1GLH A;  5EYY A;  5HXV A;  1COV 1;  5FMD A;  5JPN B;  5FZM A;  1UKR A;  3RI9 A;  4LK7 A;  3KHC A;  4FSJ A;  3WZ1 A;  3KVB A;  2BQP A;  4MO3 M;  3BIW E;  4IEQ A;  1KIT A;  5LBE A;  1SFP A;  4DY5 A;  2RHP A;  1US3 A;  4OHV A;  1NAE A;  2WNV C;  3AL6 A;  3PVO A;  4P5H A;  2DU1 A;  3NV3 A;  1FNY A;  5FY0 A;  1MQT A;  5AC9 2;  1QOO A;  3POS A;  4M0N A;  3H3L A;  4YM1 A;  5C3P A;  5C4W A;  4D69 A;  3EO6 A;  3V0B A;  2VZP A;  1WD4 A;  4TWT A;  2UYA A;  1ZZC A;  1WLC A;  3PVB B;  3K48 A;  5J37 A;  3O1R A;  2JG8 B;  1ZBE 3;  2DUR A;  3H9A A;  4GWI A;  4GB3 2;  5CEH A;  3H3Z A;  1PZ7 A;  5FPU A;  1C8M 3;  3O0W A;  4EWD A;  4LIU A;  4WM7 A;  1UOG A;  2XWJ B;  4BK5 A;  4M00 A;  3FN9 A;  1VRB A;  4ZON A;  2C5D A;  1PO2 3;  4HG6 B;  2OX0 A;  3POI A;  4XTP A;  2EIC A;  3MPB A;  1QJY 3;  1Y4W A;  2BRT A;  4LQR A;  5H9Q A;  3UV9 A;  2W1W A;  1TNF A;  3VBH B;  1DZR A;  1XXN A;  2C24 A;  4Q0Q A;  4RGG A;  3ZFE B;  1VMF A;  2ZEW A;  4M3C A;  3B94 A;  2X05 A;  3LA7 A;  5BNO C;  3I49 A;  2G4I A;  1ULP A;  5HCF A;  2A71 A;  3TN9 2;  1MS3 A;  3CEW A;  4ZZ5 A;  1D0G A;  4MGK E;  1RUG 1;  1EV1 3;  1E5S A;  2XVK A;  3AM2 A;  1NCR C;  5KHI A;  1MS8 A;  1JOP A;  1PO2 1;  4N53 A;  4L8Q A;  3ZXD A;  3E6D A;  1GNY A;  3AXE A;  4RD7 A;  3K3N A;  4WVW A;  5KR7 A;  2FHR A;  1F5F A;  4DMI A;  3QCW A;  3NV4 A;  4EV0 A;  2ADD A;  4S2D A;  2A6Y A;  1KFX L;  2Q1Z B;  4XET A;  1L3J A;  2R1D A;  5SV5 A;  1PVC 2;  1TVG A;  4CEW C;  1I3H A;  1PGL 1;  1PO1 3;  4JKL A;  1YFY A;  2VCM A;  2W1S A;  3GCW A;  5DQ0 A;  4CCL A;  1ZRF A;  1ENX A;  4LBQ B;  3ZKY A;  3BKZ A;  4OI0 A;  3GBG A;  5BNP A;  4CA9 A;  3JU9 A;  1UKG A;  4E4D X;  5BYN A;  1W6O A;  4RQP C;  1PMI A;  1OF4 A;  3HBZ A;  1ALY A;  1WLT A;  2QQN A;  1XRU A;  3ACH A;  1MZE A;  1VBB 3;  3FLR A;  4NMI A;  3S30 A;  1F5J A;  3T2T A;  2ES3 A;  3UGG A;  5F5I A;  3ILF A;  1V00 A;  3V0A A;  1Q8V A;  3AL5 A;  2IWG B;  4LBO A;  4UAP A;  1AVB A;  4HBN A;  1BEV 3;  4AOC A;  2W1Q A;  1RVF 1;  2QNK A;  2A6Z A;  2YBP A;  3LDK A;  3OEA A;  2IVI B;  3E5Q A;  3JD7 1;  3LDB A;  4JX0 A;  3O1S A;  3BUC A;  3WP6 A;  2QQO A;  4W6Y A;  4JKK A;  5FXX A;  3NJZ A;  4CUG A;  3T3Y A;  3U75 A;  2TEP A;  4ITC A;  2E63 A;  1TMF 3;  3AJY A;  3ASI A;  5CIS A;  1HRV 2;  5CG9 A;  2F4P A;  1MEC 3;  4N43 B;  1WCQ A;  5JVV A;  4CDW A;  1XE8 A;  4AED A;  3U0Z A;  3ZIX A;  5HV4 A;  1A3K A;  4DUX A;  1D0H A;  2ZAA A;  4FQZ A;  3B5L B;  5A7N A;  4Y22 B;  2XLG A;  2GN7 A;  2V72 A;  3SC7 X;  3WD5 A;  1JZ4 A;  3PUH A;  1UIK A;  2OII A;  2VXJ A;  4JTN A;  1FI2 A;  4PLO A;  1NQD A;  2CU5 A;  4QX8 A;  3VDC A;  2JWP A;  1PK6 A;  2D98 A;  3PUA A;  5HI0 A;  3IKW A;  2JE8 A;  2AEZ A;  1WBF A;  4PBO A;  5C5T A;  2J22 A;  2XKP A;  3CF6 E;  4O61 A;  3VBS A;  1VJ2 A;  2HWE 3;  2MHF A;  3VBU A;  4OZX A;  1RHI 1;  3HBK A;  4ATF A;  2VNO A;  3IM0 A;  3WV6 A;  5EIY B;  4MVT A;  3HNB M;  5K0U C;  3UKN A;  1FV3 A;  2D5H A;  4BM8 A;  3N9L A;  2BDR A;  5A6Y A;  1QHD A;  1X33 A;  2QCS B;  1CGP A;  1WMX A;  4HSJ A;  1LHU A;  1DYO A;  1HV1 A;  3AZX A;  3WT3 A;  3U10 A;  1VLN A;  1YWK A;  1R08 2;  2WN2 A;  4FFF A;  4PLM A;  2Q8D A;  1UMI A;  1HB2 A;  3PLQ A;  1LOA A;  1W8U A;  2ZHK A;  4PI0 A;  5J1X A;  2MEV 2;  4S2G A;  1VBD 1;  3ZN4 A;  1ZNP A;  4RFR B;  3NJX A;  1BBT 3;  3Q8C A;  3KGL A;  3HQU A;  2ZAH A;  2IXJ A;  1GQG A;  1NCR B;  5GZF A;  1UY4 A;  4AAP A;  4NPM A;  5EV7 A;  4A42 A;  1UOB A;  4K9S A;  4MX3 A;  3ZXE A;  4CEY A;  1AXZ A;  3CMG A;  4F7Z A;  4GH4 C;  1MS1 A;  4CDX A;  4IL7 A;  3A7Q A;  4LT5 A;  3LEI A;  1QY4 A;  1CPN A;  4AVT A;  3NAP C;  1NQJ A;  1SBF A;  2B9V A;  1C8M 2;  5EHD A;  4SLI A;  5IJR A;  3OCP A;  3HOB A;  2DTW A;  4XDO A;  4JRA A;  4Q4Y 2;  1C28 A;  5EJ1 B;  2VAU A;  2CAV A;  5FY7 A;  4AW7 A;  4ES9 A;  1HV0 A;  1KS4 A;  5CFD B;  2V5D A;  2BPA 2;  3BU0 A;  2VNV A;  4LKE A;  4FAH A;  5KC6 A;  3KQR A;  4DUW A;  1BQP A;  4JRL A;  3VL9 A;  3ILR A;  5DN2 A;  4OHZ A;  4BLI A;  1DQ4 A;  2X53 S;  2XG3 A;  4MXW A;  4D8M A;  1VAL A;  1RUH 1;  4I0A A;  3ACI A;  3KWV A;  2VMD A;  5A33 A;  3MBW A;  1DG6 A;  2MEV 3;  3E5X A;  4UF0 B;  1WCS A;  5LBB A;  3ZSM A;  4Q5O A;  2HWC 3;  1DIW A;  1J58 A;  2ZX4 A;  5C3R A;  1AR8 3;  1URX A;  2VOK A;  3ZN6 B;  4Y1U A;  3SEP A;  3H8U A;  4Q4Y 1;  2CDP A;  1E5H A;  1EAH 2;  3I59 B;  4PDW C;  1RUJ 1;  5FUN A;  4UXA A;  2JDA A;  2RV9 A;  3TEX A;  4YZ5 A;  1HKD A;  2RS5 3;  4XW3 A;  1EAH 3;  2BTV C;  4WM8 B;  5C9A C;  1NLQ A;  2FCT A;  2ZGT A;  3ECQ A;  1XU1 A;  2VNR A;  5FZE A;  5H9R A;  1CIW A;  3O1V A;  4M01 A;  2CNA A;  2E7Q A;  2PA7 A;  3T1L A;  4CXX A;  1W3X A;  2YC0 A;  2ZKL A;  4Y5Z 0;  1YQ5 A;  1BEV 2;  1W6Q B;  4W65 A;  5T50 A;  3VBF A;  2AC1 A;  4NVP A;  1SMV A;  4TN7 A;  3FFQ A;  3JD7 2;  2UY8 A;  4P9Y A;  1YI7 A;  4NID A;  1QQP 2;  3SNM A;  1WCK A;  1X9T A;  3W58 A;  4CTE A;  1RMU 3;  5C8W A;  2AYH A;  1JOJ A;  5CKM A;  5A6Q A;  1PVC 3;  4Q1P A;  1STM A;  1CX1 A;  2WII B;  4ARX A;  4MUV A;  1E5I A;  4YZ4 A;  3VL8 A;  2WT1 A;  3ZO0 B;  2YC4 A;  1HB4 A;  3GDB A;  4GKX A;  3TBD A;  3RI8 A;  3D8C A;  5FOJ B;  3ZOI A;  5FY9 A;  3WDU A;  1WW5 A;  1VAV A;  1VAK A;  3I3E A;  4HLT A;  2V4V A;  5FZD A;  3KT7 A;  4Q1R A;  2G1M A;  1S0E A;  1JYC A;  1UU5 A;  3AMQ A;  3D0J A;  1EAH 1;  4FPH A;  3ZDV A;  4A4A A;  5KHH A;  2D43 A;  4AR2 A;  4EN6 B;  2XL7 A;  1OKQ A;  2WA4 A;  1ASJ 1;  1S1A A;  2OKX A;  4NHX A;  3VHN A;  4JVA A;  2C0Z A;  1I5Z A;  5BXX A;  3JXS A;  4BPZ A;  1QMJ A;  2ZX1 A;  2B46 X;  4GH4 B;  1BVP 1;  1QJU 3;  3VBO C;  3EQE A;  5B4N A;  5IK4 A;  2ET1 A;  5LW9 A;  4R9A A;  4ZS3 A;  2HWF 1;  4RQP A;  2VE1 A;  1LUL A;  4HAN A;  2GAU A;  4UFJ A;  1APN A;  1R08 3;  2DUP A;  1A34 A;  4TSV A;  4JC1 A;  3MUY 1;  5EJZ B;  5K7P A;  5CVR A;  4AYU A;  1JYT A;  2BOJ A;  5IFP A;  1KJR A;  2VMI A;  3AZW A;  1GZT A;  2UU8 A;  3B02 A;  3HT1 A;  1VP6 A;  1Y3T A;  4OMC A;  3WF2 A;  4YM3 A;  1O5L A;  1ENR A;  4B8E A;  1Q43 A;  1AHS A;  1UZW A;  2ZS6 B;  5A3L A;  3QD6 A;  1DYK A;  2VM9 A;  2VL4 A; 
#chains in the Genus database with same CATH homology
 1XNA A;  1PX4 A;  2W94 A;  3WQB A;  3IB3 A;  4W50 A;  2VZQ A;  3CKH A;  1DP0 A;  1WKY A;  3DYP A;  2Y6L A;  1BHG A;  3LEG A;  3CIH A;  1GU3 A;  3NNG A;  3K77 A;  3WNN A;  3I2F A;  1HN1 A;  4TXW A;  2WYS A;  2X09 A;  3I2G A;  4XUO A;  1UY3 A;  2XQX A;  2ID4 A;  4LHS A;  4A44 A;  4FI9 A;  3WNM A;  2BBA A;  3BN6 A;  4JKM A;  1K12 A;  4CUC A;  5DPN A;  3T09 A;  5C7G A;  3VDA A;  2Y64 A;  2QQK A;  3CQO A;  1IQD C;  2XHN A;  2ZEZ A;  1PMH X;  2WQ8 A;  1UXX X;  3WNL A;  2WZ8 A;  1JZ8 A;  2Y8K A;  2YC2 A;  5CYY A;  1GOF A;  4D0Q A;  3W5M A;  2VC9 A;  2VQT A;  4ZZ8 A;  2VME A;  1OH4 A;  2WO1 A;  2BGO A;  2WN3 A;  3HPN A;  4OMD A;  2VR4 A;  4CU9 A;  1JYN A;  4DUV A;  1SHW B;  2J1S A;  3LEK A;  3OGR A;  4QX0 A;  1NUK A;  3HNM A;  1NKG A;  4DEV A;  3FHA A;  5C70 A;  4MAD A;  2DCK A;  4ZXE A;  5B4X A;  3NJV A;  2J1U A;  3WF4 A;  2W47 A;  3PUI A;  1JZ5 A;  1NX9 A;  2RVA A;  2KD7 A;  3A23 A;  1CZV A;  3WF0 A;  1MPX A;  5IFT A;  1UX7 A;  5JXJ A;  4TTG A;  4MGQ A;  1UY0 A;  3NRU A;  2QQI A;  1D7P M;  2VCC A;  1R64 A;  5JR2 A;  3DEC A;  3DYO A;  4PF1 A;  1K3I A;  3SEE A;  3AC0 A;  2J7M A;  3OGV A;  3WNO A;  1K45 A;  4XZU G;  1H6Y A;  1KGY A;  3K46 A;  2VQU A;  3WF1 A;  1UY1 A;  3D3A A;  3OB8 A;  1W8N A;  2DDU A;  3W5N A;  2VCA A;  4CVU A;  3A21 A;  4PQQ A;  3MV1 1;  4BK4 A;  1EUU A;  1JU4 A;  3CZJ A;  3UNP A;  3III A;  2E33 A;  5JXG A;  2JD9 A;  2VZS A;  5G05 L;  5LCW L;  1JZ6 A;  4CUA A;  2BGP A;  2QQM A;  3WNK A;  4MOA A;  3C7H A;  1UZ0 A;  3ETP A;  2W95 A;  1GOH A;  3ZM8 A;  5HXM A;  4ZY9 A;  2W87 A;  4E8D A;  1ULO A;  3HN3 A;  5FUI A;  2QBX A;  3GM8 A;  2J1A A;  4OYU A;  2EIE A;  4QB2 A;  1W9S A;  1UYY A;  2VMF A;  1F4H A;  3U37 A;  1SDD B;  4W8J A;  4ET7 A;  4QDS A;  4DEQ A;  4W4Z A;  5G04 L;  2EID A;  5HPO A;  2W46 A;  2Z4F A;  1UMH A;  3C7E A;  1GMM A;  1P8J A;  3T2O A;  1JZ3 A;  3ACG A;  1L7Q A;  4P00 B;  4BXS V;  2QQJ A;  3ABZ A;  2L9L A;  5JMO A;  3I2K A;  3VDB A;  4A41 A;  4YPJ A;  1PMJ X;  2WDB A;  2J1V A;  1W9W A;  3E1F 1;  4M4P A;  5C71 A;  2C26 A;  2XON A;  3FHQ A;  4P02 B;  4OUE A;  2Y6J A;  4MO3 M;  2VZT A;  1US3 A;  3I2I A;  3K4Z A;  1NAE A;  5JUV A;  2RJ2 A;  3THC A;  2VZU A;  2W1U A;  1TG7 A;  3I3D A;  3EB7 A;  2W5F A;  3C8X A;  2VZP A;  2QQL A;  1JYX A;  1L7R A;  3K75 B;  4GWI A;  2W3J A;  1W8O A;  1W0N A;  2XOM A;  4UI9 L;  2VZ3 A;  3MO4 A;  1OF3 A;  4BK5 A;  3FN9 A;  4HG6 B;  2EIC A;  5IYY A;  2PQS A;  4LQR A;  1CZT A;  2W1W A;  2Y6G A;  3P6B A;  3EYP A;  3ACF A;  4XUR A;  2ZEW A;  2E31 A;  2X05 A;  3P1I A;  3UET A;  3VD4 A;  4CU6 A;  3T2Q A;  1ULP A;  2R7E B;  4ZZ5 A;  4Z2A A;  2VZR A;  2WO2 A;  2C4X A;  1UXZ A;  4QAW A;  1GNY A;  3K4D A;  4KMQ A;  1H6X A;  3VD7 A;  5IHR A;  4XVH A;  2B4K A;  3CZU A;  1XPW A;  4GWJ A;  3T0B A;  1TVG A;  3FL7 A;  1KEX A;  4QDR A;  2ORZ A;  4JKL A;  1UY2 A;  4M4R A;  2W1S A;  5DQ0 A;  3IAP A;  3OG2 A;  4JHZ A;  4CU7 A;  1XNT A;  2WZE A;  1JHJ A;  3MV0 1;  4LKS A;  1OF4 A;  2QQN A;  3ACH A;  2YB7 A;  3BGA A;  5JXH A;  3F2Z A;  1LNS A;  2CDO A;  4UAP A;  4BDV B;  2WAO A;  4QB1 A;  2J1R A;  2W1Q A;  4A3Z A;  2DCJ A;  3OEA A;  2ZEX A;  2VO5 A;  4JX0 A;  2QQO A;  4JKK A;  4AG4 A;  2Y6K A;  3K4A A;  4DXS A;  3LPG A;  1WCQ A;  2WAA A;  3WEZ A;  4DXT A;  4DUX A;  2V72 A;  3UES A;  1JZ4 A;  2VZO A;  2ORX A;  4XUQ A;  3PUH A;  1EUT A;  2VCB A;  3MUZ 1;  4CUB A;  5I0D A;  2YG0 A;  1RYY A;  3VDC A;  4UOJ A;  2JE8 A;  1I5P A;  2J22 A;  2X10 A;  3C7F A;  4AAX A;  4PT6 A;  5EIY B;  3HNB M;  4L0P A;  1UYZ A;  4ARY A;  5LA2 A;  4KI5 M;  2Y6H A;  3C7O A;  1GOG A;  1DYO A;  5A1A A;  3I3B A;  4XUN A;  2WN2 A;  2E32 A;  2LW8 A;  3SKJ E;  2C9K A;  1UMI A;  3THD A;  5J1X A;  2VOT A;  1JU3 A;  2JKX A;  2YFZ A;  3NJX A;  1O8P A;  3HJR A;  4QX3 A;  3HNY M;  5JXI A;  4QDQ A;  1UWW A;  1UY4 A;  1GQP A;  4A45 A;  4A42 A;  3GXU A;  2YFU A;  3CMG A;  1CIY A;  1XC6 A;  3A7Q A;  3IAQ A;  4P5Y A;  3OGS A;  3LEI A;  3GGL A;  1O59 A;  3SKV A;  2BER A;  1SG3 A;  2B9V A;  4LPL A;  4A6O A;  5IJR A;  3HOB A;  4E8C A;  3IDA A;  3VD3 A;  5EJ1 B;  4OZO A;  3VD9 A;  2V5D A;  3T08 A;  2HYX A;  4DUW A;  2EIB A;  5DN2 A;  4D8M A;  3HEI A;  2VJX A;  3ACI A;  1OD3 A;  1O8S A;  2VMD A;  3LE0 A;  3MBW A;  3I97 A;  4DXR A;  1F4A A;  1K42 A;  1JYW A;  3J7H A;  3SEP A;  2CDP A;  1J83 A;  4MGS A;  1YQ2 A;  2JDA A;  2RV9 A;  3DYM A;  3OBA A;  3WSO A;  4QPW A;  3ECQ A;  3CDZ B;  1J84 A;  2VZV A;  3LQC A;  4XUT A;  5F7U A;  5LA0 A;  3WNP A;  3I2J A;  1CZS A;  2VZ1 A;  2ZXQ A;  2WO3 A;  4KWU A;  3T0A A;  4GZ9 A;  1W9T A;  3T0D A;  4CU8 A;  2HLE A;  2ZEY A;  2WAB A;  1OT5 A;  1CX1 A;  5DMY A;  4ARX A;  4QX1 A;  3T2P A;  2W91 A;  4BJ0 A;  2YC4 A;  3GDB A;  1JZ2 A;  3LPF A;  4QX2 A;  3I3E A;  2V4V A;  1JZ7 A;  1GUI A;  2W9X A;  4P08 A;  2E26 A;  4A4A A;  4RN5 A;  3C7G A;  1JI6 A;  2VMC A;  2W92 A;  4IUG A;  2OKX A;  1JYV A;  1UYX A;  3WF3 A;  4QB6 A;  3JXS A;  3OEB A;  2LS6 A;  3NQH A;  1T2X A;  3I2H A;  5B4N A;  2WUH A;  1DLC A;  2VTF A;  2WBK A;  2J1T A;  3A22 A;  2J1E A;  2BZD A;  1US2 A;  3MUY 1;  5EJZ B;  1W99 A;  5IFP A;  5CZK A;  4OMC A;  3WF2 A;  1PX3 A;  5LA1 A;  4RYD A;  3VD5 A;  4XUP A;  2VM9 A;  2VL4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...