2KD7A

Solution nmr structure of f5/8 type c-terminal domain of a putative chitobiase from bacteroides thetaiotaomicron. northeast structural genomics consortium target btr324b
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
159
structure length
159
Chain Sequence
MGTTISKSGWEVLSFTTQEASGEGAGNGLAKCLIDGDTETFWHAKWQGGSDPLPYDIVIDMKQNIQIAQVELLPRGRGSNNPIKVVEFAASEDNVNWTPIGRFGFTNQDAALEYYVKSIKARYIRLTIPDDGGNSTVAAIRELDVKGTIINLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative chitobiase
publication title Solution NMR structure of F5/8 type C-terminal domain of a putative chitobiase from Bacteroides thetaiotaomicron.
rcsb
source organism Bacteroides thetaiotaomicron vpi-5482
molecule tags Cell adhesion
total genus 36
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2009-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2kd7A00
5IYYA 3T2OA 1UYYA 3P1IA 4ZZ8A 3WNNA 4CU6A 3A21A 2VL4A 3LEIA 3I2IA 4QB6A 1F4HA 1GUIA 1GMMA 2J1UA 3K46A 4CU8A 4CU7A 2W87A 2VOTA 1UZ0A 2CDOA 3FL7A 4QDQA 2ORZA 3JXSA 4YPJA 1ULPA 4PT6A 3ABZA 3U37A 2Y6KA 3SEPA 3THDA 2J1SA 1JU4A 3WEZA 4DXTA 4XZUG 5HPOA 4FI9A 4QAWA 1EUUA 3EYPA 3NQHA 4AG4A 4DEVA 3OGVA 2W1WA 3K4AA 3I2FA 2YC4A 3IDAA 1ULOA 4W50A 1UWWA 1US3A 4QX1A 1CZSA 2W5FA 1SHWB 2X09A 2WZEA 1W9SA 4CUCA 3GDBA 3LPFA 1OF3A 3T0DA 3MO4A 3IAQA 4XUNA 3OEAA 4P5YA 3VD9A 1LNSA 3WF1A 4ZZ5A 3C7OA 4A6OA 1UY2A 1PX3A 4A4AA 3UESA 2J1RA 3DYOA 4E8DA 5G04L 5JXIA 2WO3A 4ARXA 1CX1A 4JKKA 3K77A 3OEBA 4TTGA 1P8JA 3WF4A 2VZ1A 2W46A 4BK4A 1UY3A 1H6XA 2QQJA 3MUY1 2VMCA 1W8OA 1O8SA 4DUXA 3WF2A 4QPWA 5I0DA 1UY1A 2W1UA 1JYWA 2Y6LA 1UMHA 1JZ6A 4CUBA 1W8NA 1SG3A 3UETA 3I97A 2EIDA 3HNMA 3CKHA 3J7HA 2YFZA 1K3IA 3T09A 1O59A 1H6YA 5EIYB 2YB7A 3A23A 2VQTA 4UOJA 4UAPA 3C8XA 3T2QA 4BXSV 4W8JA 2W92A 2XQXA 2WN3A 4GZ9A 3I2JA 5JXJA 3LQCA 2WO1A 3C7GA 3CDZB 3I3EA 5JUVA 3I2GA 2J1AA 1OD3A 5CYYA 1JYNA 1TVGA 2RVAA 2WZ8A 3WF0A 2EIEA 2B9VA 4JHZA 4MOAA 3IIIA 2ZEXA 4P02B 4XVHA 4LHSA 2VMFA 2Y6HA 1NUKA 2WN2A 4P00B 5C7GA 4UI9L 5IFPA 3VD7A 2VZVA 3AC0A 5IJRA 3OGSA 1JZ2A 2QQKA 1DYOA 3T08A 1CZTA 1L7QA 1BHGA 3GM8A 4MGQA 1RYYA 5B4XA 2E31A 2VCAA 3CQOA 4JKLA 3OB8A 2W3JA 3CIHA 2VZRA 3T2PA 2VM9A 4LQRA 1WKYA 3NNGA 4A42A 2YFUA 3VD4A 1JZ8A 2L9LA 1D7PM 1K45A 2YG0A 2QQOA 4OMDA 4XUPA 4DUVA 3W5NA 2WBKA 1W9WA 3VDAA 2BZDA 4JX0A 2X10A 1JU3A 2VR4A 3LEKA 3MV11 3A7QA 2ZXQA 3WNPA 4MO3M 4A41A 4QB2A 2W9XA 2VCBA 1WCQA 3ECQA 3SKVA 5C71A 3GGLA 3LE0A 4DUWA 3I2HA 1GU3A 2WAOA 2LS6A 4KMQA 2XONA 4M4RA 3VDBA 2QBXA 2B4KA 1JZ3A 4QX2A 2W1QA 2CDPA 3C7FA 1OH4A 3W5MA 5EJZB 5FUIA 5JR2A 1UXXX 1W9TA 1W0NA 2XHNA 4JKMA 2RJ2A 2J1EA 3A22A 2R7EB 3ACFA 1KGYA 3P6BA 4KI5M 5CZKA 2VZQA 4BJ0A 4XUQA 2ORXA 2W94A 4QX3A 2C4XA 2Y64A 3NJVA 2J7MA 2VZ3A 2V4VA 4OMCA 4ARYA 1TG7A 4CU9A 1R64A 3NJXA 1UXZA 4M4PA 5JMOA 3WNKA 3HPNA 2WAAA 3LEGA 4A3ZA 4QDSA 4OYUA 5C70A 2W1SA 4PQQA 3BGAA 1PX4A 2LW8A 2VJXA 4D8MA 3MV01 2VZTA 1K12A 1IQDC 4GWJA 2DDUA 1YQ2A 1UY0A 5IHRA 5DPNA 5DQ0A 2WUHA 3HJRA 4D0QA 4MADA 4DEQA 3FHAA 2E33A 1XNAA 1UYXA 3MBWA 5G05L 4HG6B 2HYXA 1DLCA 2VMDA 1JYVA 2BBAA 1O8PA 1GOFA 3OGRA 4BK5A 4Z2AA 3HNBM 1JYXA 4GWIA 1UMIA 5F7UA 3UNPA 4XURA 3WSOA 1I5PA 2JE8A 1XC6A 3VD3A 3BN6A 1GOGA 3DYMA 3OG2A 4A45A 1JZ5A 2YC2A 2Y6GA 3FN9A 4XUOA 2BERA 4DXRA 2EIBA 4LKSA 2W47A 3DYPA 4L0PA 3E1F1 3WNMA 1HN1A 2VZPA 3ACHA 3F2ZA 3HN3A 1NKGA 4QDRA 2JDAA 1JZ7A 2J1TA 2PQSA 5HXMA 1CZVA 1GQPA 5DMYA 3CZJA 4IUGA 5LA0A 3K4DA 1OT5A 1EUTA 3T0AA 2VZUA 2J1VA 1GNYA 4OZOA 3SEEA 2QQNA 4PF1A 2EICA 4AAXA 4LPLA 2C9KA 1PMHX 3IAPA 3I3DA 4OUEA 4DXSA 3PUIA 4TXWA 2DCJA 2JD9A 2VZOA 2E32A 3I2KA 3C7HA 2QQIA 3WQBA 5J1XA 3EB7A 2XOMA 1SDDB 2WQ8A 2OKXA 2X05A 3VD5A 3THCA 2Y8KA 3K4ZA 4ZXEA 2VCCA 1J84A 3ACGA 3WNLA 1L7RA 3ZM8A 2DCKA 2WYSA 3WNOA 3ACIA 2ZEYA 4ZY9A 2Y6JA 1T2XA 2V72A 2Z4FA 5JXGA 1US2A 4ET7A 4E8CA 3D3AA 3DECA 3GXUA 1UX7A 2VC9A 5DN2A 1KEXA 5LCWL 2JKXA 3FHQA 2VO5A 1XPWA 2J22A 3CZUA 1NAEA 2QQMA 2V5DA 5JXHA 2ZEWA 3VDCA 1K42A 4P08A 2ID4A 5LA2A 2E26A 3LPGA 4RYDA 2VTFA 5A1AA 3K75B 5LA1A 3PUHA 3C7EA 4XUTA 3HNYM 3NRUA 3OBAA 1GOHA 1OF4A 1JI6A 2RV9A 2VQUA 2VZSA 1JZ4A 2VMEA 3SKJE 1NX9A 1W99A 3CMGA 1PMJX 2QQLA 4RN5A 4W4ZA 4BDVB 4QX0A 2WABA 2WDBA 4KWUA 2KD7A 1J83A 1MPXA 2HLEA 4CUAA 2W95A 3IB3A 2W91A 2BGOA 2C26A 1DP0A 3HEIA 4A44A 2ZEZA 1F4AA 4MGSA 3HOBA 1UY4A 1XNTA 3I3BA 5B4NA 1UYZA 5IFTA 1JHJA 5EJ1B 2BGPA 3MUZ1 4CVUA 4QB1A 3ETPA 3WF3A 3T0BA 2WO2A 1CIYA
chains in the Genus database with same CATH superfamily
5FPXA 4LA3A 5IYYA 4M0HA 2RMU2 2VD7A 3N36A 5FQ0B 1K5MB 2QDNA 1PGW2 3LEIA 2AREA 1UX6A 2ZGUA 3MIDA 4Y5Z0 1AR62 2E7QA 2GMPA 3WW1A 2W87A 3LSEA 4IGQA 1H0BA 1PO12 1UOJA 2ZKLA 3JXSA 1RUE1 4BISA 4I0BA 4GH4C 2WC2A 2JX9A 3ZDVA 1T6GC 3U37A 4META 4HVRA 4IW3A 4DXZA 2YBPA 2GC0A 5KC6A 5C9AC 4CCCA 4F83A 4AFCA 5CAZA 1MQTA 4UW4A 2Y34A 4EZ4A 1RUF2 4DZGA 5FZIA 1QWRA 5FTTC 1VAKA 2F4PA 2H6CA 4ISRA 2XJQA 1LGBA 1RIRA 3H9AA 1QDOA 3OGVA 5J96B 5FZ1A 3JU9A 5T52A 4ATFA 2KM2A 2D3RA 2YC4A 2QQPA 4P9LA 3I7DA 1XRUA 1CZSA 2BYVE 2X09A 4B4PA 3FFQA 4GQ7A 1UZWA 4PHZA 1ND3A 3GDBA 1NYWA 3QBQA 1OC1A 1OMIA 5DUXA 2PHLA 3AKSA 5BXXA 2LTNA 4AEDB 3N7JA 4YWAA 1AR82 4UW5A 4BQ2A 2UURA 1QDCA 2GNTA 3AXDA 1WLDA 3MZHA 4PLNA 5K4LA 2QKDA 3NKGA 4RHV3 4EWAA 4URAA 2JENA 5CKQA 1YFUA 4Q1RA 1DGRA 4ZU5A 1DZRA 1EV13 1FPN2 1B35B 2CAVA 4A6OA 1PHMA 4NIAA 1V6KA 2WFF1 4MXWA 4A4AA 3BALA 3UESA 5CBLA 1AYM1 2Z69A 2BU9A 5K0UB 1GV9A 2J1RA 1I1EA 4JC1A 1UPIA 4FTEA 4IESA 2ZGOA 4QHBA 3K77A 3B9IA 2QCSB 3M1HA 5D8AB 3WF4A 4EN6B 2VZ1A 2VUDA 3KT7A 3G6JB 4GB31 5A7QA 4YYOA 4HFSA 4OI1A 1B09A 3WOGA 3BTXA 2BVBA 1XSRA 4FXGB 5F3EA 4BIOA 1C5IA 2C1FA 4JV4A 2VMCA 4EN0A 1JBCA 2Y0OA 5JZGA 2QDRA 4UBGA 3TNPB 3UT0A 4LKFA 4CZSA 5IVYA 1O8SA 2JDNA 2RDRA 4DUXA 4LO8A 3FMGA 2HWF2 5JSRA 1OI6A 1X7NA 2W52A 4OCTA 5D2AA 1F5JA 2Q1MA 2EXKA 2WFF3 2ZGMA 2P1BA 2A71A 2PHUA 1A78A 1AYM3 3POWA 4LIUA 1NOVA 2Y6LA 4BQYA 1R091 3KB5A 2Q0AA 2ZHMA 4IV1C 1UU4A 2QUOA 3CKHA 5I8YA 1K3IA 1UKRA 2VBPA 3HVDA 1GKBA 4IV3B 1TQ5A 4AI1A 4C90A 4B4RA 5CKNA 2R062 4NHKA 2YY1A 2F6BA 2P3JA 4RR3A 3WW3A 1GP4A 4CDWA 2ZACA 1O91A 3A23A 2VQTA 4CDUA 4R4XA 3E5UA 4YVSA 2JB8A 3C8XA 1HDKA 2RM22 3E5XA 3WW2A 2ZKNA 4FBFA 4NIDA 1PVC2 2XQXA 3UGHA 4IE0A 4AZZA 1DFQA 4NE9A 5CVRA 2DV9A 2QTWB 1IKPA 2VPVA 1HQLA 3Q8AA 2G19A 4WBBA 4PBPA 3FZ3A 3C7GA 2XVGA 4WM8A 2WZR2 3HQUA 3I3EA 4OHVA 4C1WA 1URXA 1QJEA 1OLQA 3N9MA 1OD3A 1YWKA 4M0NA 4CEYC 5EIYB 1XU1A 2RVAA 2WZ8A 4NAOA 4BE3A 4QHZA 4MOAA 2VNGA 4X6QB 3BU7A 1I6XA 4L8QA 2ILMA 3A4UA 4GH4B 5I0RA 1PGL1 3ZOIA 4FFHA 4V1PA 1V70A 1ZA7A 4BPZA 4XVHA 3KGZA 2HH9A 4K8RB 3N4MA 2D3PA 2XJUA 2JDHA 3N7LA 4LORA 3MW2A 1MZ5A 1D4M1 4LBLA 2JJ6A 3H1WA 3UJOA 1R1A1 4YFWA 5A7PA 5C3QA 5J36A 1ULCA 4B7KA 4CDXA 3I3QA 4K9SA 4N7UA 1XSQA 5D1IA 2VMFA 1AR83 3EO6A 3S0MA 3FJSA 3VBRC 2VUAA 4P00B 5FYCA 4XCAA 4IE5A 3DL3A 2PQQA 5IFPA 2F4LA 2GNMA 1RUJ1 2XLAA 2X5IA 2WS91 5LY1A 1HX6A 4HSLA 1FPN3 3AC0A 2XJPA 1Z7S3 4V2WA 5DAVA 4DPNA 1RMU2 1DYOA 3PMSA 4HOOA 5C5TA 5HBAA 1UMZA 2DURA 3OPTA 3LZZA 1ENSA 2R042 3F95A 4XILA 1DYKA 4IE6A 1U12A 3BKZA 3CHXA 2OS2A 1ENQA 4MGQA 2NN8A 5FYMA 2PHTA 4RFT0 2VCAA 3MPPG 5EYYA 2XBO1 3MLJA 3PURA 3WX5A 3WV6A 4D6QA 3OB8A 2W3JA 2O8OA 1UCXA 3NNLA 4TYSA 2VZRA 4HKLA 4XW3A 1DQ1A 1DQ2A 4DRVA 2JDUA 1WKYA 4YVWA 3LA2A 3NNGA 5IVCA 4LEJA 1E57A 2YFUA 3VD4A 4NWVA 1UL9A 1HB2A 4KU7A 2UWBA 5CIRA 5BNOC 5BNNA 1RUJ3 4LOSA 3ROUA 1D7PM 3OGJA 4PLOA 2HWF3 1ZX5A 5LBCA 3AXEA 2JICA 1SCSA 1QY4A 3D5OA 2VTXJ 2D7FA 3O1RA 4QGLA 1R082 1ENRA 2PFWA 1W05A 2TEPA 2ZHLA 5JLVA 4AOCA 3KCCA 1JU3A 1V6MA 2HBUA 2P34A 1NT0A 2WQ4A 4NRPA 5FZMA 4URTA 2Y0IA 1YUDA 4M3CB 2UWAA 4RS5B 2G9FA 5L73A 5TSWA 3T4VA 3VGIA 1ZRFA 5E16A 4NR1A 2BUKA 3QOPA 4XBNA 4DO0A 1SBDA 3O0WA 3ZYHA 2ZX2A 2QJVA 1H9PA 2R063 4JGZA 2GC3A 4A41A 2QFEA 3BOWA 4DY5A 1ENXA 4KBBA 4LLFA 3LDRA 3SKVA 2RM23 4ONUA 5C71A 3GGLA 4WVWA 4DUWA 2WAOA 3JD71 2LS6A 3H1MA 3HAGA 4O7XA 1LCLA 4OHZA 3S30A 3VBHA 3T3YA 4Q4V1 4LHKA 5FMOS 4LOTA 1JZ3A 1XNBA 4QKFA 1PNGA 1SFNA 4QPGA 5A32A 1OH4A 2WA3A 4K20A 2WZR3 5FUIA 5J48A 1QNWA 4KGQA 3DEMA 3M3QA 2J1EA 1AL22 3ACFA 2VH9A 1BMV2 1W2AX 3IDEA 1UOGA 1OA3A 4FT8A 3LOIA 4CP9B 4AFBA 1LOAA 3I2DA 2XPJA 1S2EA 2VULA 2YUEA 3EJKA 4QX3A 2OVUA 5T5LA 3NVCA 3LIGA 2J7MA 3JD73 4LBMA 4JDNA 4QU1A 3LWCA 2HEWF 1X33A 3FLPA 1WMDA 3D6EA 1N47A 1R64A 1DIWA 2A5ZA 3NJXA 4Q4V3 4W6WA 4KG8A 4XFHA 5JMOA 3JB4C 2IXCA 3V0BB 2ET7A 4CEYB 5FJKA 3DV8A 2DUPA 5LB6A 3GHNA 2CL2A 3UKNA 5A6ZA 4UFLA 3HT2A 4LA2A 4OI2A 4WVMB 1RMU3 1JTZX 1RUI2 4AI9A 3AVRA 3ASIA 5FMBA 4BQXA 5F6KA 1X82A 4IGOA 4R4ZA 2CY6A 2VE1A 1TNFA 1DG6A 2JE7A 2UYAA 2VU9A 2ZA9A 3P3NA 2VMGA 5DPNA 2HWE2 5CKMA 1GLHA 1COV1 2DUQA 1FT9A 1U5XA 3O0XA 4MADA 3VN4A 1RINA 4M3CE 2E33A 5L19A 2VQAA 1GICA 3VBRB 4AW7A 3NMBA 3T1LA 1DCSA 2JG9A 4OI4A 1W6OB 1DLCA 4XCBA 4QKBA 4QQPA 1H2MA 4LKDA 4OUSA 1H30A 1YFYA 1W6QA 1EP0A 1JW6A 1RGSA 1BXHA 1SPPA 3OGRA 4K7JA 1VE0A 4D7YA 5F7UA 4XURA 4ZKTB 3PTRB 3VD3A 1XC6A 1VLNA 3WQ1A 1ULDA 1H8TC 1OLME 1QF3A 2XUEA 4XIKA 1JZ5A 2YC2A 3LFMA 5FP9A 4FTBA 1ZBE1 5LATA 4AGVA 5I0UA 1QXPA 3J7MA 4N8MA 2YHJA 3ZFEA 4BQ1A 3AZZA 1COV3 2CNAA 4YZ1A 2XMLA 5FZ9A 3Q8BA 2GN3A 3SNMA 4AVAA 4XFAA 4L0PA 3E1F1 1J3QA 4YSFA 2YBSA 4AI8A 3HN3A 2PHWA 4MZUA 3L2YA 1JZ7A 4MGYE 3AMHA 4K21A 5BNOB 2WR9A 5HXMA 1GQPA 2R1BA 5DMYA 3CZJA 3WW4A 2VVEA 3JUUA 3ZXFA 1H4HA 4FPJA 3K4DA 1OT5A 2BRTA 2ZABA 1OBNA 3T4HB 2VZUA 5K7PA 3JQXA 3SEEA 1WLCA 2XWJB 1D4VB 3ZXJA 3AX4A 5F3IA 4AAXA 4UFMA 1LOFC 3PU8A 1ZBE3 3M8LA 2C9KA 3KV4A 3IAPA 1CAWB 3PUIA 4QX7A 1W2UA 1ZRDA 4D7TA 2C0ZA 2JD9A 1IS3A 4AFAA 2P5BA 2E32A 1F35A 3I59B 2AGSA 2DVBA 1APNA 1WLWA 4IEZA 1KJRA 3EB7A 4M01A 5D21A 4YW2A 5A3LA 2WSUA 5EJ3A 3CJIC 1QJX2 3RZZA 4BB3A 5JI9A 3QH7A 3LA3A 4QPIC 4Y26A 4CDQC 4QXBA 1RUC1 1GP6A 2YGMA 4QM8A 4XDQA 2WWUA 3M2MA 5C6CA 1L7RA 2BWAA 1S0BA 4XQWA 5FP4A 2Q8OA 4E4ZA 5BNPA 5GJ6A 1IS5A 1O5LA 1GWLA 1RHI2 2ZEYA 4ZY9A 2Q8DA 3MDPA 3L9JT 2P17A 5FKCA 4TLFA 1OURA 2Z4FA 1E5HA 5CU1A 4AAPA 4FSJA 2ARBA 1US2A 3AVSA 4E8CA 1FOD1 3GXUA 4OLLA 1EPWA 2ZGRA 3AMQA 2VC9A 3ZXLA 1BYHA 1PZ7A 1HB4A 1E5RA 1XPWA 3CZUA 1SLAA 4CXWA 2XR4A 3VZLA 1DGWX 4IETA 2ZMNA 2WNOA 2HWB3 1RUI3 2XQRA 3WD5A 2IFWA 3ME2A 3RMYA 2D3SA 1LAJA 1QXRA 1CVNA 4FTSA 1GQGA 3PJQA 3RRDA 1LENA 4HKOA 1S4CA 1RUC3 1JUHA 5I91A 1KITA 3B02A 3UK9A 3VZJA 1JYTA 1OUXA 1W6MB 2XJTA 3CL1A 1BJQA 2A6ZA 2ENRA 1TMF2 5A1AA 5IATA 1QQP1 1F15A 3K75B 1YIFA 1HB1A 1ZNPA 2B42B 5DUUA 4Y1ZA 1LJ7A 3URFA 3CO2A 1UYPA 3O0VA 3POGA 3SH4A 3GYDA 5LK5A 3NL1A 1WW7A 2R30A 3K48A 5L9RA 1VRBA 1AZDA 4G3YC 4YLZA 3NV4A 3LF7A 3AZVA 1Q5OA 5F5QA 3OOXA 4QGMA 1CIWA 3KD4A 4IQPA 5A7WB 3UGFA 1W2TA 4MGTA 4JRLA 2PMWB 4IL7A 1NX9A 3QH6A 1PMJX 2W39A 4CCJA 2HWC2 4W4ZA 4FAHA 4QX0A 2WDBA 1XYPA 3OJBA 1NCQC 3DXUA 4A7KA 2E6VA 4C8DA 5AVAA 1MPXA 4QXHA 5LRSA 3IB3A 1ZZ6A 2BGOA 3HIFA 3LB9A 4N53C 5DZGA 2WZPP 3TN91 2JIGA 4BYYA 1LTEA 1WCKA 2XVKA 5KHIA 1D2QA 1F4AA 1VBE1 4QPYA 2P2KA 1H2LA 1KFUL 5LRRA 5JMCA 3HOBA 2YU2A 1H8TB 3KF3A 2B46X 2RS12 2WLQA 5T54A 4C0BA 4AXOA 5FZGA 2GALA 1UZZA 3ETPA 2VOXA 3WF3A 4PI0A 4DOUA 1ND2A 3N9QA 1W90A 1GYKA 1LHNA 2WJSA 3AB0A 4NHYA 5A6XA 4QMAA 1W06A 3VHRA 3ZN6B 4LJHA 3WNNA 2ARCA 2Y33A 3A21A 2X53S 4PQ9A 2NMOA 2WL1A 4FPKA 4N9IA 3I2IA 1QJFA 4QB6A 1SEFA 2PHXA 1QJX3 1AYN2 1HRV2 1ODMA 2NM1A 1GUIA 3POYA 5A7OA 3TN93 5HCHA 3TB0A 4L99A 4CU8A 5FZHA 5LBEA 4CU7A 1RXFA 1VBE3 2CDOA 3FL7A 3J7NA 3JQWA 4QDQA 4PIZA 5FO8B 2D6MA 1ULPA 4MG2A 4PT6A 3WP4A 1LECA 1MQTC 1QJU1 4P9JA 2XKPA 3ABZA 3PTYA 4LLOA 1OOPC 2BFUS 4N43A 3SEPA 1AJOA 2OA2A 3LCPA 5GALA 2D6KA 3ZYIB 3WEZA 4YG6A 1MVEA 4DXTA 5CFDA 5HPOA 2FCVA 1RUH2 3CJIB 5FZ8A 3B5LB 4HN1A 4HPKB 4AI2A 3S5QA 4QPIB 5DAXA 1KDMA 2BBVA 3CNAA 1Q56A 4IEVA 5F5AA 1ZM1A 4FXKB 3WT3A 3NQHA 4XFGA 4AG4A 5A33B 3RYRA 3LGRA 4FPEA 1PK6B 1ND3C 2B5HA 5HCFA 2CGPA 3VBFA 1YQ5A 3I2FA 3J9SA 5AFEA 2HYKA 5C4WA 2FZ1A 4COZA 4Y3OA 1VBB1 1QHDA 1US3A 1TMF3 3IWZA 4ZPIA 1QJU3 5ABJA 3N9OA 3ZXEA 2WZEA 4L92A 1N1YA 1CD3G 5KXBA 2ARAA 5FUPA 3IZOA 3LPFA 4XJZA 2CTVA 4ITCA 4HN0A 3LFIA 5FYYA 1QOTA 5JI7A 1QJY2 5DZEA 1EAH1 3MO4A 4SLIA 3MHZA 5CNAA 1SLBA 4XUNA 3OEAA 3VD9A 1RVF2 4EN9B 2QZ3A 1JUIA 4CCDA 5E8AA 4P9GA 3C7OA 1BCXA 5FDBA 5IK5A 1PX3A 1X9TA 1W6PA 1JHNA 4E8DA 5G04L 5FP7A 2GU9A 2GMEA 3U78A 2VBDA 4XJWA 1OXCA 3BOPA 1NA1C 3OEBA 2X8KA 5FBZA 5A3OA 1CX4A 1I5ZA 2IWGB 4FQZA 1F5FA 2A3YA 2DVFA 3R4DB 1NY72 1J1TA 2R073 2W46A 3NNMA 1VMJA 5DAPA 3POFA 5C33A 3K51A 4BK4A 1UY3A 1JMUB 1U0AA 1ACCA 4NUBA 1IS4A 4FFGA 4Q8LA 2OW4A 2DUOA 1G7YA 1TZOA 1ZBA2 1V9U1 4I0WB 5IVFA 2Z2SB 1W8OA 4XETA 2WKKA 2DFCA 5FMCA 3GHMA 1UKGA 3S7EA 2EVXA 1OPMA 2F17A 2VY0A 4QPWA 3WG2A 2IXLA 3AZWA 3ZFGA 4HL0A 2ZOEB 1IG3A 1NCQB 2FDFA 2LRPA 2PAEA 2BWCA 2W1UA 1JYWA 5J7MA 1H9WA 5JR7B 2BNOA 1UMHA 4YGCA 3GZTB 4N53B 4CDUC 1H1AA 5FPBA 1MACA 1DQ0A 1W8NA 3PUQA 3I97A 1HRI2 4Z07A 1RUG2 1H1IA 3DKQA 5J98B 5A7SA 2PHFA 4Q4Y2 4F8AA 4HSJA 2FBEA 3ES4A 3IM0A 3AK0A 1D0GA 3ILRA 4HMZA 1O59A 5FYVA 1H6YA 2HWD2 3THTA 1CAVA 2HEVF 2FQPA 4XJAA 5FLJA 4FPOB 3T2QA 3OBRA 4R9BA 3USUB 3GCWA 1V6JA 5GLTA 1PO21 5FV3A 3ZFFC 2WN3A 1NE4A 2MEV2 2Y60A 3OTFA 4UBHA 4I30A 4JVAA 3DN7A 3VKFC 5EXOA 1SCRA 3ZIWA 1ZREA 2VXRA 4LBQB 4GALA 4RQPC 3LQCA 2JWPA 3V65A 4Y5SA 3VBUC 3RS6A 3IKWA 3K3NA 3I2GA 3SCHA 2VOKA 4E2SA 3E6BA 3LEMA 5CYYA 5KC5A 1TVGA 4Q0VA 1G9BA 3O5SA 3VBOA 4YW1A 3IIIA 1PIV2 1GZ9A 4NO4A 3ZSJA 4CDXC 4E4SA 4CUAA 2BQPA 4OHYA 1BEV2 1VBD2 4AHXA 1OOPB 3HQRA 2G4IA 4LKEA 1T6BX 4OFGA 4W65A 1WMEA 3OYWA 2E7TA 3ZYPA 3AP6A 4DQAA 2AR6A 5GLZA 4Y1UA 1PO23 3NAPA 1MR5A 1MEC1 4H7MA 4AVVA 1J3PA 4Q29A 3J8F2 4CSWA 1VBA1 5CFCA 4YRDA 3OUJA 4NIHA 1QJY3 5FY0A 2Y6HA 1NUKA 3KHCA 2EAAA 1FMD1 3A0KA 1WCDJ 2GP3A 3B69A 3LDKA 5C7GA 2R0HA 1RVF3 4MH0E 3ZDSA 3ZMNA 3OPWA 3ON7A 3DKWA 1W0OA 2PLV2 1RUD2 5FZBA 3GCXA 1LKNA 3OSDA 1NCRA 4RHV1 4JTOA 4B7EA 1BHGA 4Y22B 1LEDA 4Y20A 3H8OA 1EV11 4Q1PA 4PF5A 4QX8A 1RYYA 3TWIA 2AZ5A 5DUVA 2CGNA 1S0FA 2ZJCA 2K46A 1MEC3 1H1MA 3CF6E 4MXWB 3VBSC 4Y4YA 5K8SA 1YQ8A 1VBA3 1DQ4A 1XYOA 2VVDA 3C2UA 5DAWA 1Q8VA 3T2PA 4FPLA 1FMD3 1A8MA 1R092 5J09A 4JZRA 1N1VA 4BZ4A 5EWSA 4J6GA 1KD7A 4PBOA 2W2IA 3AP5A 4L97A 3H3UA 3ALQA 2QQOA 4OMDA 2JXAA 4BWOA 5KXDA 3AKQA 2YDEA 4JDOA 1NA1B 1F2NA 1GFF2 4JGZC 2BZDA 5EZWA 4B4QA 4XJUA 1C8M2 1EYBA 5FPZA 1GZCA 3MV11 1RUG3 4CUGA 4LO5B 3A7QA 3MIEA 2RMU1 3JB8A 1ZZ9A 1SLLA 4OULA 3IPVB 1DGWA 1AR61 1LOBA 1PGW1 4GWNA 2WLPA 3KT4A 3SCFA 3ZN5A 5IK8A 4QB2A 1A6CA 2ZGKA 3IN9A 3RFRA 3VLBB 2Q5TA 3ECQA 1PM7A 2D6LX 1E5SA 1PO11 1GU3A 5F8PA 5EV7A 4YG3A 4R52A 5B2GB 4NIIA 2YXSA 4WM7C 4DINB 1HXS2 2B4KA 4CDUB 3RMXA 2WQZC 5FP8A 3ZXGA 1SBEA 3DCQA 5FK8A 4YZ4A 1XE0A 4HKWA 4K3UA 2YBKA 2WNVA 3W5MA 1A8DA 2JIJA 4FFFA 1NXMA 3KVAA 2Q1ZB 4M3CF 3RI9A 1UXXX 4O65A 1W0NA 1MS0A 2HKXA 4UFKA 2XHNA 3CEWA 4JKMA 1KDKA 4AVBA 3VB9A 1AVBA 2FDJA 2RJ2A 2RMU3 3A22A 2R7EB 3AJZA 3MFCA 1BZWA 3NO8A 1KGYA 4YW3A 5FZ6A 1RUF1 1H8VA 2DBIA 3IDBB 1AR63 3WUDA 4LUMA 2ADDA 1ULGA 4EJRA 1BEV3 1VBD3 3X29B 4BJ0A 1W3VA 2O1QA 4XUQA 1Y43B 3ZFFB 1OFNA 1CQ9A 1WGPA 5LASA 3NJVA 2GMMA 1PO13 2RR12 4L11A 2G9GA 1Y3TA 1Y9GA 3MFAA 1TG7A 1B35A 4PI2A 4RQPB 2ZPXA 1ZYBA 3J8F3 3QLQA 4M4PA 5FK7A 3VBUB 3O1MA 2AEZA 5K0UA 2KXLA 4A3ZA 2YROA 1AR92 2DYCA 4IERA 1GANA 3ZYGA 5LBFA 1GZWB 2W1SA 4PQQA 4NPMA 5LY2A 4JHTA 2PLV3 2LW8A 4Q0UA 1RUD3 5A1LA 1AR81 5AC92 1PNFA 3ELNA 4NJ4A 5C5UA 2A6YA 3SCGA 1UO9A 2R49A 2VZTA 3TEWA 2VNVA 5DDJ2 1RUF3 4RGGA 2ETEA 4S2HA 1FATA 1UY0A 2GH8A 1FPN1 1AJKA 1Z7S1 5FYTA 1LHVA 1ODNA 3I54A 4EE2A 1XQNA 4QX5A 5IHRA 4FP3A 2BPA2 3KGLA 4CE8A 4CYDA 4D0QA 5FYSA 2V4AA 2MHFA 1W6NB 4O9GA 4LK7A 4Q4W2 2UWCA 5ACA2 4CCKA 2XB6C 3Q8FA 3R0RA 4QGNA 3MBWA 3PIGA 4HG6B 1YYNA 4GMP0 2O14A 5C9AB 3V64A 4LO6B 3OUIA 4DNYA 1JYVA 4P9IA 5HCAA 1VPHA 2YV8A 3LKJA 2WIIB 3GBWA 4BK5A 1IGOA 4GWIA 4FVVA 4OZXA 2ZMKA 2E7AA 3UNPA 3WSOA 1I5PA 2JE8A 4K8FA 3HN1A 4AFMA 5C3SA 3AFKA 4XBQA 3DYMA 2JG8A 4A45A 4YG0A 1QNYA 2I2SA 3VDDC 2VMHA 4RGAA 2HWF1 4TN7A 3JBG2 3VBSB 2WWSA 2EIBA 5F3GA 3WDWA 4LKSA 4CRQA 4P14A 2C5DA 2OUJA 3GBFA 3H8UA 1TE1B 1SMVA 3DYPA 5FO7B 2WFPA 5FLIA 4OI0A 5DG1A 1AHSA 3ACHA 3F2ZA 1OD5A 1AX2A 1JH5A 1LGCA 1YJKA 3HWJA 2JDAA 3VKLA 5KHKA 4Q4X2 5FLHA 5ISLA 2PQSA 3AL6A 3FFZA 4YM3A 1PM4A 3O1SA 2QQUA 4K40A 4ASKA 3DPRC 4WV8A 1POQA 2R061 4ZU4A 5FPUA 1KJLA 1PZ8A 1NQDA 3PHMA 2VUJA 4Z8BA 1EUTA 2WT2A 4GH4A 2RM21 2OYZA 3TYJA 3TBDA 1Q8QA 5L7OC 5C8WA 1PVC1 4OHWA 3ILNA 2ZX0A 5FXVA 1VMFA 2YGLA 3I3DA 3RZLA 1IQAA 4Y1XA 5GZGA 4KQ7A 2VAUA 3I2KA 1GNZA 2QQIA 5KR7A 2D43A 4KG0A 5GM0A 2XOMA 2WZR1 4LUKA 5FBJA 2RDNA 3H42B 2XH6A 2WQ8A 2X05A 1O3TA 3ST7A 2VCCA 1O4ZA 4WM7B 2XLFA 3ZM8A 2VVFA 1JOJA 2DCKA 3FE5A 3MPBA 4BU2A 2RR13 3NJYA 4AEKA 2W68A 5C8CC 3WDTA 3WNOA 1I3HA 1EY2A 3AMNA 3POBA 2XDVA 4FFIA 5FPAA 1V6OA 2IUWA 4OQ8A 5GZEA 3N7MA 4IXLA 4R8HA 5C3RA 5JPMB 2A3WA 4ET7A 3D3AA 3DECA 4YW7A 3ZYFA 1DHKB 1LR5A 1PVC3 3H3ZA 3P3PA 2IXHA 5LCWL 5IT6A 2J22A 4IV1B 3RZHA 4NAMA 4NHMA 4FPFA 2P3YA 4XHBA 2EIGA 1ST8A 3U0ZA 2OQ7A 5FZOB 4FCAA 2GNBA 2YU1A 1O4YA 3WR0A 1HJGA 2E26A 3B00A 4BQWA 1RMU1 1QEXA 5FRAA 3OBTA 2D5FA 3WDVA 4RYDA 1W8FA 2R041 4KL1A 1QKQA 3EHKA 4B1LA 5A70A 1YQ6A 1OKQA 3FHIB 5ACA3 1RXGA 2VQ0A 4CTEA 5FWEA 4XUTA 5I0TA 3AZXA 2VOWA 4AI0A 1G9DA 4YM2A 1ULFA 3D8CA 4LT5A 1QOOA 2OT7A 2PELA 4I01A 1YCIA 1JI6A 4M3CA 4RS5A 5L9BA 1O3SA 4IEYA 5EQUA 2ZCWA 1MS3A 2R16A 1JZ4A 2V73A 3NJZA 5C3PA 2VMEA 2GZWA 2TUNA 2QQVA 2C24A 1W99A 2E53A 1CPMA 4NOTA 3O1TA 4BDVB 2FD8A 4ZHNA 3LIHA 2WABA 1R081 2ET1A 4KWUA 2KD7A 5FY8A 2DVAA 2R043 4MGIE 3ZIXA 3FUQA 3N9LA 3SH3A 1MS4A 1OUSA 3KM5A 3MEPA 4KH9A 3HEIA 4GXLA 5KBFA 3IT8A 4UFJA 1W28A 4L2NA 4Q4X3 1FV3A 2RJLA 2VOVA 4NROA 1ND2C 2OIIA 4LK6A 4XMAA 3WUCA 4NHXA 2YPDA 4YM0A 1UY4A 1L3JA 3ZSMA 4R9CA 1G86A 1TME2 5B4NA 1NZCA 2VBBA 1UYZA 1WBFA 2CHHA 3HBZA 4UYBA 3IMNA 1JHJA 4COVA 2NLRA 5EJ1B 3VDDB 2BGPA 3MUZ1 3PVNA 4QB1A 4WZCA 4BLJA 4AVCA 1CWPA 3B01A 4XQ4A 5EFUA 2Q8EA 2ADEA 4K1ZA 3RG0A 3T0BA 4BHPA 2ZHKA 2R1DA 4SBVA 4CP9A 1CIYA 1DBNA 4YARA 3GALA 1VB2A 1R083 3T2OA 1UYYA 3O1PA 4Q27A 2AYHA 1XE7A 1OKOA 1Y4WA 2J42A 2WSVA 1CESA 2VL4A 1DZQA 4C0HA 5F5IA 2ZZQA 4XF9A 5JAXA 5F2SA 1F4HA 1O5UA 1NE6A 2WO7A 3DPRB 3KZ4C 3UGGA 3V0BA 4XJ8A 3U4XA 2FCTA 2A75A 1AL21 2UU8A 4YPJA 1BMV1 3H3LA 1IPJA 5L7OB 5LA9A 1N3OA 4WVMA 3PIJA 1VRH2 2NP0A 2Y6KA 4CP0A 3Q8CA 3THDA 4AEJA 1CAUB 2J1SA 4NRMA 1RTVA 4R9DA 3D0SA 5T5OA 3VBFC 2ZGQA 5FY4A 2DWRA 4FI9A 4KU8A 3UL2A 1EUUA 2KR2A 4YGEA 2G9ZA 2W08A 3R4UA 3B9CA 4QKDA 1CONA 1PGSA 1WW5A 5H9PA 4ZU7A 2QNKA 3VBRA 5ABJC 4INDA 5FMOL 2OZJA 2I07B 3VZMA 2MNGA 1W6OA 3SISA 5C8CB 2ZAAA 3BCWA 3K4AA 3W20A 1DU3D 1ZZ7A 3AFGA 2HWB1 1RUI1 1AL23 3B93A 1JYIA 2A7AA 3IDAA 3ZYBA 4X8NA 1CGPA 3OCPA 1VBC2 5FPLA 2JDZA 2W5FA 1SHWB 1ZZCA 4LXLA 2P3KA 4CUCA 2HWE1 2VUCA 3WZ1A 2VECA 1OF3A 5IAVA 4DS0A 3RWNA 3AMPA 4CEWA 2VG9A 5FYBA 4NVPA 3IAQA 3FLTA 2V09A 4P5YA 2UY9A 4XDOA 1S55A 1LNSA 1HV0A 3WF1A 4Q5OA 4A6SA 1OPOA 1HB3A 1CJPA 5FZ4A 4FPHA 3ITQA 5BNOA 4XOGA 5FCCA 1XB9A 3DYOA 4LBOA 2Y26A 2RS52 2YC0A 3KQ4B 4LE4A 5JXIA 4ARXA 4JKKA 3OY8B 1S0EA 3LSDA 4XEZA 1P8JA 3C3VA 2HWE3 2XLGA 1ZRCA 1VIWB 5I8TA 2IZWA 1G6NA 4XACA 3D82A 1I9RA 4MHRA 5DABA 3HBKA 1AR72 2VNOA 1H6XA 3APBA 4B1MA 1CAWA 1FNZA 5JWPA 2A70A 1AUYA 1O3QA 3MUY1 4IEQA 5EP9A 1TME3 2MPFA 4UF0A 3J7LA 1C1LA 2WNUA 2ZX1A 1W2NA 3WF2A 1HJFA 2CV6A 5DXDA 5I0DA 2YZ4A 3SITA 4XFIA 3GF6A 4FAGA 2JDPA 2BNNA 2DTWA 5ERLA 1XE8A 4XDPA 4CUBA 1SG3A 2EIDA 3HNMA 5KXCA 1ND2B 2YFZA 3D4KA 3L2HA 4LHLA 4L9BA 4RA0A 2DCTA 4QQLA 4FPCA 1CAXA 3O12A 5A6YA 4YNIA 5CADA 2YB7A 2RJKA 4AFDA 1QJX1 4UAPA 4QQ2A 5GKAC 5LZ6A 4YW4A 1M06G 1VRH3 3ORJA 4W8JA 2VTXA 5HI0A 3KVBA 1WW6A 4PDWA 4JGYA 4GZ9A 1QXJA 3VBOC 5JXJA 1RHI1 3I4IA 1MZEA 1K5JA 1W6MA 1NZIA 1JN2P 5GZDA 4DMIA 5JUVA 5F32A 1VBB2 2J1AA 4QD2A 2BW8A 2NQYA 2XJRA 3WF0A 3NAPC 2EIEA 1ZRRA 4XF0A 4FP2A 2JDYA 1PVXA 5CFCC 4P02B 4AGRA 3MLKA 1W8WA 1UQXA 3PLQA 4CA9A 4D3WA 3ZYJB 5A7WA 4LO7A 4LHSA 1YIPA 4C91A 2VNRA 2GDFA 2TNFA 3AP9A 1HW5A 1TMF1 3M4FA 1RHI3 3KMHA 1NCRC 3K2OA 4GA9A 5E88A 3W58A 4ZS3A 4W6XA 1M4WA 5L9VA 4YW6A 1BLZA 2VW2A 3VD7A 3UKVA 3ZR6A 2ZGNA 4COYA 2IXKA 1VAMA 4QQOA 5IJRA 4F3JA 1JZ2A 3PDQA 4XF3A 4XXAA 5E89A 1W0PA 1X8EA 3T08A 1CZTA 2JDMA 4CDQB 1L7QA 3J4UH 3R6SA 3PVOA 2JE9A 4GMP1 2RS32 3WQ7A 3GM8A 2XKOA 4R9AA 1GR3A 2RS53 1H8TA 4MGKE 2HWC1 3ZPYA 1XNKA 4JKLA 3ZYRA 4AE2A 5LEKA 5FXWA 1IKQA 1SACA 4QKNA 4B8EA 2FDKA 2IC1A 1YLLA 1OSGA 4QWNA 4HANA 4LHNA 2VM9A 2A3XA 1UN1A 3GZAA 5JSPA 3ZN6A 4A42A 2R071 4GULA 3ZXDA 5KHGA 2P37A 4D6RA 5CG9A 3RYKA 1JZ8A 2H6BA 2A1XA 3BIEA 3M3IA 1BBT2 2IVIB 3MW4A 4XUPA 2WBKA 1W9WA 2JDKA 3VDAA 4DUVA 1V0AA 1HQNA 3QACA 2RS11 4GMP3 3MLLA 4CCEA 1LHUA 4COWA 2R32A 3FLRA 4RGKA 3MICA 4HVOA 1IZ3A 1LOFA 1ASJ2 2HWC3 2VR4A 1R1ZA 3ZXAC 4CCLA 1YRZA 3ZSLA 4GWMA 2ZXQA 3E5QA 2CU5A 4MYEA 3SHRA 4UFIA 1C3HA 4HK9A 1WA6X 1YEWA 4XC9A 3KHBA 1W2OA 1LOCA 5JZGC 2W9XA 1HRV1 1AYN1 3CJIA 3ZSKA 1QMJA 1WCQA 4G4FA 4HPKA 2WNVC 4E27A 4QPIA 1SLCA 3LE0A 4V2VA 1ZZBA 1O4TA 1UPSA 3I2HA 4I09A 4KMQA 5JIUA 2XONA 1GZTA 1MS1A 1MZ6A 2EALA 2PAMA 3MGUA 4M4RA 5A33A 1PK6A 3RDIA 3Q9OA 5FKBA 3BU0A 4NIGA 2VW0A 3WNXA 4ASLA 4QX2A 2RS13 2UY8A 3C7FA 4M00A 4CCOA 4IEPA 3KV9A 5EJZB 3RZJA 2ZGTA 1O6UA 3H7YA 3ES1A 2FHRA 5JR2A 2WYFA 3GJAA 3ZSEA 1W9TA 2A73B 2DVDA 1W39A 4YW5A 5KXEA 4RR3C 1RUH1 4NRQA 2CGOA 4CDWC 3U4SA 1B35C 2RE9A 4QT6A 3P6BA 1NLSA 4KI5M 1RUE2 1SFYA 2VZQA 1U5YA 3DGTA 4YVSC 5FJHA 4FQ4A 4YFZA 2PXJA 4FO9A 1AYN3 1HRV3 3V0AB 2ORXA 2W94A 5APAA 3VKNA 2C4XA 3VBOB 4XBLA 1DLLA 2V4VA 5EYXA 5J37A 3E97A 3NV2A 2JB4A 3I49A 5FZ0A 5HXVA 2FDHA 1UXZA 1S0CA 3G7DA 3OBZA 4WM8C 4Q8KA 3LEGA 2TBVA 5GLWA 3LA7A 2BDRA 4QDSA 4D94A 1V6LA 3BIWE 4FPGA 3NAPB 1DDLA 4FOWA 1AXKA 5C70A 3SH5A 4FPYA 5FY5A 5GZCA 3BGAA 1W8TA 3VZKA 4D8MA 4H3WA 1VJ2A 3I8TA 1QJY1 1RUH3 1WD3A 4Z82A 3MV01 3KV6A 4EROA 2XUMA 1IQDC 3PU3A 1POV0 1RVF1 2EXIA 4GWJA 2RS33 3N7KA 3ZN4A 4J1XA 5F9TA 3RZKA 1OH3A 1ONAA 4BMEA 1ZZ8A 5F1RA 5DQ0A 5IVJA 1GBGA 4CPBA 2WUHA 3HJRA 1MQTB 4QU2A 5KWRA 2K0GA 3FHAA 2ERFA 2C6SA 1XNAA 2SLIA 4BQ4A 4E4HA 3WP6A 2DVGA 5I8SA 4QXKA 2BBAA 3BTZA 2D93A 4N53A 2JG8C 1NY71 3OD0A 1GP5A 4D6SA 1JYCA 1GOFA 2X5IC 4HLTA 1CN1A 3P5BA 4Z2AA 4HETA 2B45X 4QXCA 2HEYF 2WFF2 4AL9A 1G9FA 2ZX4A 1AYM2 1Y9QA 1ZBA1 3U11A 1Z78A 3BN6A 4KWKA 4LO4B 3TRSB 1GOGA 1ND3B 4NPLA 3ZMOA 3OG2A 3WG1A 3HD8B 1MZFA 3N35A 4J25A 3FN9A 4ORFA 4E2GA 4EWDA 3KLSA 4FOQA 4XUOA 2DBNA 4DXRA 5C3OA 3USUA 4MGZE 3RPQA 4CXYA 1ASJ3 4Q0SA 1KRIA 4GB32 4CPBD 3DXTA 5BV6A 3ZKYA 1J3RA 2BGCA 4YVWC 4U36A 4XYXA 1HN1A 1F9KA 5IK4A 2FMDA 1HRI1 3BB6A 3BYWA 4LBQA 1RUG1 4QDRA 4C1XA 5FOJB 2J1TA 4UXAA 3TEZA 4Q4Y1 5BNNC 1YQCA 2NPIA 1BQPA 1WW4A 3O7OA 2D98A 1JOPA 4OUMA 2HWD1 4GKXA 5LA0A 3TNQA 1CPNA 3PNAA 5T55A 2J1VA 1GNYA 1ZBA3 3AKTA 4NHLA 3ZXKA 4F7ZA 1FV2A 5FQ0A 1K5MA 4PF1A 1OOPA 4LPLA 1AX0A 5FYUA 2MEV1 5LW9A 3WG4A 1HIXA 1X9PA 1H4GA 1YHFA 1HKDA 4TXWA 5FWJA 3WINE 5JZGB 3FC0A 2AC1A 1SDWA 4O61A 2ATFA 2FMYA 1SDDB 1JOBA 1RUE3 2WNVB 1HRI3 5IVVA 3VD5A 2Y8KA 1QIQA 3IIAA 3NSTA 2AH2A 4LBQD 2YYOA 4Q4Y3 3VKOA 3WHTA 4ZXEA 2B39A 1J84A 1W03A 1WZXA 3ACGA 3VBHC 1HLCA 1PIV1 1UZYA 3RI8A 3THPA 2HWD3 4YZ3A 1Q43A 3MIGA 3SMHA 1BEV1 1A3KA 1VBD1 4QHOA 3GBGA 1T2XA 4QPGC 1C8NA 1RC6A 1LHOA 1Q8PA 1W9YA 2V72A 3VL8A 3RVHA 3MYXA 2HBTA 2BJSA 4Y22A 4A2UA 1UAIA 2LM3A 4BM8A 1UX7A 4BCUA 4RR3B 2D5HA 2MEV3 4CDWB 3J8F1 3FHQA 4AEMA 1YXWA 4I2OA 1LGNA 1Z7S2 4P5HA 1LU1A 4YVSB 1NAEA 1ULEA 2QQMA 3WCSA 3LD8A 4MHUA 1PGL2 1FNYA 1MS9A 4O9EA 3VV1A 2WRAA 4IE7A 1UOBA 5JXHA 2ZEWA 5FP3A 2E9QA 1K42A 2PHDA 2Q8CA 2PLV1 3CLPA 4P08A 1RUD1 2ID4A 3LAGA 5LA2A 1REDA 1FYUA 4MLOA 3WP3A 1D4M2 1PZ9A 1PIV3 3GZEA 1R1A2 4RS5C 4AEDA 4WM8B 4YZ2A 2BEOA 1KS4A 3TOJA 5LA1A 5FXXA 3U75A 4BQ3A 4XTMA 3M70A 4AHYA 3NRUA 1NA1A 4XF4A 2NZ9A 2BVVA 3OBAA 1OF4A 3W9AA 1RUJ2 2WS92 1IG0A 1Y7BA 5FFOC 2RV9A 3S6PA 2ZS6B 2OPWA 2VZSA 5IK7A 4H14A 3LDBA 5GZFA 4DB5A 1JS9A 4XABA 3IPVA 2CWMA 1Q8SA 1RB8G 2FZ2A 3GNEA 5D8AA 4CDXB 1BK0A 5JOWA 4UW3A 2XBO2 1DGRN 3MW3A 2WWJA 4GB33 2NMNA 4AWDA 2PN5A 2JG9C 1STMA 4P9XA 4XQDA 3IBMA 3EQEA 1TNRA 3RJ2X 3SQOA 3ZR5A 2I45A 2JG8B 3H7JA 1X36A 2W95A 1C8M1 1W04A 2W91A 2X5IB 2LALA 3IDCB 2KA3A 5HV4A 2DFBA 5CA6A 2XHKA 4A44A 4KWLA 1KXGA 2Y38A 1MVQA 4MV2A 2OX0A 4MGSA 5FPVA 5T50A 5A3PA 1AX1A 2XXZA 4Z2WA 4KBZA 2ZGPA 3I3BA 4Q0PA 1LOGA 1Q8OA 1W8UA 4Q2FA 5IFTA 3B3QE 4RD7A 1R093 4LITA 4CVUA 5JIAA 3KCXA 2IXJA 4LBNA 3ZFEC 4G9SB 5A7NA 4IV3A 3ZFFA 3KWVA 1O3RA 1HXS1 4YVWB 3TEYA 2XGXA 4P9YA 1IPSA 3P1IA 4ZZ8A 3HQXA 4CU6A 3M3OA 4RQPA 2ZGSA 4LR4A 4PLMA 3PMEA 3U07A 5BNNB 3S57A 1NLRA 2D97A 1C8M3 3VBUA 3WP5A 3U10A 1GMMA 2J1UA 3K46A 4LE3A 4AQ6A 2VOTA 1GZWA 3QCWA 1UZ0A 3JD72 2ORZA 1D2SA 3ETQA 4Q4V2 1HQWA 4XE9A 1YI9A 4AYUA 1WUVA 3V56A 1BVP1 2RR11 5EPAA 4AQ2A 1LOEA 4WZFA 5HV0A 1Y9MA 5FZAA 1JU4A 3LOBA 4CP2A 2GH2A 4JGZB 4K6BA 4XZUG 1HXS3 4QAWA 1QU0A 1NXD1 4Q26A 5AVPA 2XL9A 1LB2A 3EYPA 4IEUA 1W6NA 2ZZJA 1AR91 1LODA 1S0DA 3CJXA 1DYPA 4I0AA 4W6YA 2PAKA 2E63A 4LMFA 4LULA 4RSUA 4ZS2A 5F39A 4CCMA 1XXNA 2JEMA 5A1FA 3VBHB 1WMFA 4Y33A 4DEVA 1BVVA 5BNPC 2W1WA 5C9AA 4UFHA 2VGDA 2Z5WA 4XF1A 3RSJA 5AC91 4ASMB 4A7ZA 1D4M3 4QPGB 4DFSA 4H55A 1ULOA 1C4RA 1R1A3 5DDJ1 3POSA 4W50A 1UWWA 2GC1A 5A32B 4QX1A 4BA6A 5BY5A 3ATGA 5A3UA 4CEWC 1XNCA 1FXZA 1RJ7A 4DY3A 1W9SA 1MS8A 3WG3A 4TLGA 5JVVA 4TZDA 2CWSA 2A6VA 3BPSA 4Q4W1 5ACA1 3T0DA 3VBSA 2GSYA 1W3XA 2WS93 3T1MA 3BVCA 3JCIA 1G8WA 1YI7A 2OPKA 2OZ6A 1AR93 4I3GA 5F2WA 3SLIA 3EMRA 4ZZ5A 1MS5A 2EF6A 3PVEA 1UY2A 4KGGA 1COV2 5AC93 2XBO3 1OQ1A 3BODA 4XMIA 4EN8B 1HN0A 1UIKA 5DDJ3 1UZVA 1NG0A 1OVPA 2BNMA 2WO3A 1CX1A 3NNJA 4UWDA 4AVSA 3JBG1 4TTGA 3AMMA 2QZ2A 2WNUC 5F5CA 1XBFA 3HT1A 4WVZA 4Q4W3 4Y5TA 2QQJA 5DZFA 1DF0A 1OVSA 2DU1A 2B9UA 4JTNA 4NWWA 2XVLA 1WD4A 4Q4X1 4COUA 3NNFA 1XYNA 1SLIA 1U5ZA 2B8MA 2GNDA 4MUVA 1FX5A 1WCSA 2OXBA 2DTYA 4YM1A 1LRHA 1ZBE2 3POEA 2PA7A 1VP6A 2CYFA 3BI3A 1UW8A 3H0OA 1UY1A 4HZFA 4ZXKA 3VHNA 2JG9B 3POIA 4Y1VA 4WM7A 5GLVA 2ARXA 3E6CC 3B94A 1VALA 3OF1A 1JZ6A 3KS7A 3RZMA 1HV1A 2XJSA 2D6PA 3OD4A 1W6QB 1SPPB 3UETA 2PTMA 4B29A 3WY6A 3J7HA 1QH7A 3JBG3 4AVTA 1X50A 2P6CA 4IE4A 1QH6A 1UOFA 2Q4SA 2EAKA 4GD4A 4JGYC 4PDWC 1FI2A 1WCUA 1OLMA 3T09A 2ES3A 5ANQA 2VMIA 4BIFA 1U5IA 3E6DA 1YJLA 4RL7A 4IGPA 4IV1A 4UOJA 3VZNA 4MX3A 3KV5A 1EPZA 4BXSV 1L7LA 3ZFEB 3UJQA 4PIXA 5JOYA 1GWMA 1G9AA 1GNHA 5H9QA 2JD4A 2WA4A 2W92A 1LHWA 5FZOA 5FYHA 3AYCA 3I2JA 4TSVA 2WT0A 2DU0A 3H8RA 1D0HA 2BOJA 2WO1A 3ENRA 5FZDA 4J1WA 2HWB2 1YO8A 2AACA 3CDZB 4EWEA 1N1TA 3RZGA 1QJZA 1LULA 1S0GA 3AM2A 3WHUA 2P3IA 1JYNA 3JZVA 1RUC2 4EQVA 1H2NA 1NLQA 2B9VA 4JHZA 5LK7B 2DF7A 2WINB 4JRAA 5CISA 3PUSA 1VB4A 2ZEXA 4QM9A 4WVVA 3EBRA 4N43C 2B7YA 4CEYA 1W9FA 4H2AA 2QVSB 1FOD2 2A6XA 2BTVC 2RDQA 2K2SA 5CFDC 5A3NA 3ZO0B 1S2BA 2H0BA 2D44A 3MI8A 5JSOA 3O1UA 1POV1 4QQHA 2SBAA 4HXCA 2JKBA 3RWKX 3W21A 2WN2A 1N3PA 2I74A 4P9WA 1YFWA 3ZVXA 4UI9L 1J1LA 2PHRA 3WVJA 5BNPB 3IMMA 2RDSA 4AHZA 2VZVA 3PL0A 3H50A 3OGSA 5FZFA 3TAYA 5C4WC 2QQKA 3HMYA 4E2QA 2UYBA 4CEWB 1RJ8A 5LWBA 4BMBA 1QQP2 1DZTA 2AUYA 1DGLA 1JODA 2VCMA 1V6IA 1WMXA 1IHMA 1N3QA 2E31A 1WLTA 3CQOA 5B4XA 3VDDA 2XL7A 3WLUA 1QGLA 1V6NA 1XOYA 1GSLA 3CIHA 2GP5A 2K9ZA 4BOWA 4S2DA 3KT1A 5FYIA 5LBBA 1SZBA 1IPKA 1POV3 3NW4A 4LQRA 5E1RA 3H8XA 2ZX3A 1OLRA 4Z92B 4ATEA 5JCTA 5FY7A 1KS5A 1SFPA 1W8ZA 2ZAHA 4GJZA 3HR9A 1FAYA 2D6OX 2L9LA 2YG0A 1K45A 5T5PA 4X8PA 4U2AA 1OFSA 3DPRA 3W5NA 1TME1 2N7GA 4A3XA 1C28A 2O0OA 3DUIA 5FREA 4AK3A 1LU2A 1TEIA 3J26N 4NPRA 1GWKA 1REEA 4JX0A 4UF0B 4IDZA 2X10A 4ZONA 3FBMA 5FY1A 5CB7A 2WNUB 1LESA 3NKTA 5L7OA 1G9CA 3MIHA 1A34A 1UNBA 3TN92 3LEKA 4CCNA 2FDGA 3ZX7A 1CAUA 1VBE2 2XJVA 3WNPA 1J58A 3AP7A 3NV1A 1PK6C 4MO3M 4OHXA 5H9RA 4XAEA 1VR3A 3MF9A 5JPNB 5KHJA 5L36A 4LBKA 3TEXA 2VCBA 2GN7A 4XXPA 3AYAA 4JQRA 3ZFGC 4MXVA 1DQ6A 4AI3A 2E51A 5IUQA 1CAXB 3AJYA 3OGGA 5A3MA 3A0NA 3VDBA 5C8CA 1YNAA 2QBXA 3KF5A 3MIBA 2RG4A 3I59A 1XJAA 2EXHA 4XFCA 3O1OA 2Y6FA 1VRH1 2W1QA 3O14A 4JQTA 2CDPA 5GLUA 3B7MA 2D6NA 4AQTA 4YGDA 1Z0HA 3RYPA 4PDWB 4JGYB 3AL5A 3FUOA 5IW0A 2C9AA 3O1VA 4GJYA 2VW1A 4I3PA 1S0IA 3KQRA 5CZKA 5IWFA 5CEHA 1O7FA 1QJU2 2W0XA 3MIFA 3UV9A 1XU2A 4EYUA 3ZLIA 4JAAA 1ALYA 4YGBA 5KHHA 3UKTA 5AFBA 5FAXA 5M0TA 2BOIA 1C1FA 1QOSA 1S0JA 4PCRA 2Y64A 3M3EA 4AGGA 3ZPOA 1FOD3 2VZ3A 3AZYA 4OMCA 1AF9A 4ARYA 4CU9A 4DRRA 3VZOA 2GC2A 4UW6A 1H2KA 1VBC1 3WNKA 4HONA 3HPNA 2WAAA 4IEOA 5FUNA 4XAAA 3RGBA 1F31A 4OYUA 4LBJA 5SV5A 3AKRA 2G1MA 3OY8A 5J3UA 4FOVA 4A7YA 1PX4A 2VJXA 4KNCA 3GZUC 3WQ0A 3VUOA 1K12A 4N43B 4N9HA 2ZGLA 5IVEA 2DDUA 1DQ5A 1QQP3 1YQ2A 1UD1A 4XJ9A 2YPJA 2DCYA 5CFDB 3U14A 2R072 1OA4A 2VXJA 3VL9A 3OPZA 1C57A 4DEQA 5FXZA 2RS51 1UYXA 2IFRA 1EAH2 2YMZA 4N90A 5G05L 1VBC3 2HYXA 4Y24A 3UYJA 3VHOA 1OHFA 3VKMA 1REFA 5FYZA 1C5HA 2HJIA 2VMDA 1X8MA 2V5YA 4BQ5A 4Z1VA 1O8PA 3OUHA 3QD6A 5FZKA 3VBFB 4YZ5A 4E9KA 2QQWA 3W59A 5C4WB 2JECA 4XZPA 1JYXA 3HNBM 3BUCA 1AR71 1KQRA 1UMIA 3INAA 3N3HA 2BV4A 5ABJB 5K9YA 2Z42A 1F8VA 4AQSA 1AXYA 1UIJA 2ZBJA 3KSCA 2Y6GA 4NMIA 3WDUA 5A3TA 3N9PA 1VAVA 4PJYA 3KCYA 2BERA 2IXIA 4FOYA 2FDIA 4EV0A 3POJA 3RNSA 4XFFA 3USSA 3BPZA 5BUVA 3VHPA 2P4EA 2W47A 4HK8A 1RUOA 1RITA 2Q30A 3RJRA 3WNMA 2VZPA 5IAXA 1NKGA 1XNDA 2ZHNA 1AXZA 5FO9B 1V9U2 1K5MC 5FY9A 1IS6A 4Y4RA 3WCRA 1CZVA 2LUWA 1W6PB 4IUGA 4CXXA 3N9NA 1AR73 4AHWA 4BLIA 1N1SA 3T0AA 5CG8A 1BK1A 3D0JA 4OZOA 1ZRIA 2QQNA 4H7LA 4LIVA 5JDBA 2EICA 4S2FA 2PYTA 3EXUA 4UT5A 5DAQA 1PMHX 5BPXA 5JOXA 4OUEA 4EN7B 4DXSA 1ZVFA 5EHDA 2GAUA 2EA7A 2NYYA 3T2TA 3Q8EA 2DCJA 1E5IA 1UF2C 1YC61 2VZOA 4HBNA 3C7HA 3WQBA 5J1XA 3BTYA 4BXFA 1IOAA 2RHPA 3WDXA 3ZFGB 2ZMLA 4JDMA 2OKXA 4LNVA 5A3WA 4GAZA 3THCA 1AL0G 4NN0A 5FIXA 4CP1A 3R4SA 1J59A 3K4ZA 4XIOA 1OA2A 1PO22 3WNLA 5LEJA 2XWBB 2WYSA 3S7IA 3M3CA 3WDYA 5F3CA 5FZ3A 3ACIA 1UU6A 3MF6A 5FR3A 1V00A 4AF9A 2Y6JA 3U1XA 3S5AA 1LEMA 1RUNA 5A6QA 4CDQA 5JXGA 3PVBB 1ZA4A 2CSGA 3M7AA 2AEYA 1YFXA 4IEWA 2A6WA 3BTAA 5DN2A 1KEXA 2JKXA 3T30A 2P6HA 3SC7X 1UU5A 2VO5A 1CAVB 5FZLA 3PJYA 2FCUA 3I2OA 3CBNA 3GJBA 4PIYA 3AYEA 4K1YA 2CAUA 4AEDC 2V5DA 4ES9A 5I93A 1S1AA 5FMDA 5FZ7A 4D7SA 1VBB3 3VDCA 4GIQA 1KFXL 1SLTA 1BKZA 3LPGA 4E4DX 2D40A 1Q3EA 4XPVA 1MEC2 5BYNA 1W8HA 2R0FA 2RS31 2VTFA 1VBA2 4ISQA 3FX3A 5T3NA 5FZCA 5K0UC 3PUAA 5F6LB 5FOBB 4MSVA 1CJDA 2IVJA 1EAH3 2XG3A 1OQEA 2OUHA 1WWYA 3PUHA 4OVEA 3DF0A 3C7EA 4BH9A 1FMD2 2LROA 3HNYM 5F37A 3AKPA 1GOHA 2Q1FA 1CR7A 3H1YA 3K3OA 3R05A 5D8AC 2QE3A 4S2GA 5HCBA 3WXPA 4EZHA 4X6RB 4KWJA 2EXJA 2VQUA 4HT1T 2H0VA 1WA4A 3OYWB 4RHV2 5E6HA 5A80A 5JOZA 2WNEA 3CU7A 3FWEA 3SKJE 4TWTA 1EV12 3ZKUA 3CMGA 4DIQA 3I3MA 2BFUL 4D69A 2QQLA 2X29A 4RN5A 4OQ9A 4ES8A 5CFCB 2BP6A 5ANNA 5I0SA 1BBT1 2OQ6A 4MVTA 1SBFA 2AENA 1JXNA 1J83A 3ILFA 1NQJA 1SQ4A 2R6QA 5DUWA 2HLEA 5BNQA 4Y1YA 1OQDA 1GQHA 1S2KA 5FZEA 2C26A 1DP0A 4RFRB 4HVQA 1ASJ1 2O8QA 1V9U3 4I02A 3NWKA 4JCKA 4Q0QA 4B3NA 1NCRB 2ZEZA 3ACLA 2DCZA 4XHXA 4IV3C 4GKYA 1NCQA 4Y20B 5SV8A 4LTAA 2WT1A 3AYDA 5T5JA 1XNTA 1VMHA 1WBLA 3NV3A 5DG2A 3RQ0A 3FBYA 1RL3A 5H9SA 3AP4A 4N7IA 4XTPA 2ZTNA 2WO2A 3SXWA 4XFBA 4IEXA 5IVBA 4AR2A 3V0AA 2Z79A 1PMIA 1BBT3
chains in the Genus database with same CATH topology
5IYYA 3T2OA 1UYYA 3P1IA 4ZZ8A 3WNNA 4CU6A 3A21A 2VL4A 3LEIA 3I2IA 4QB6A 1F4HA 1GUIA 1GMMA 2J1UA 3K46A 4CU8A 4CU7A 2W87A 2VOTA 1UZ0A 2CDOA 3FL7A 4QDQA 2ORZA 3JXSA 4YPJA 1ULPA 4PT6A 3ABZA 3U37A 2Y6KA 3SEPA 3THDA 2J1SA 1JU4A 3WEZA 4DXTA 4XZUG 5HPOA 4FI9A 4QAWA 1EUUA 3EYPA 3NQHA 4AG4A 4DEVA 3OGVA 2W1WA 3K4AA 3I2FA 2YC4A 3IDAA 1ULOA 4W50A 1UWWA 1US3A 4QX1A 1CZSA 2W5FA 1SHWB 2X09A 2WZEA 1W9SA 4CUCA 3GDBA 3LPFA 1OF3A 3T0DA 3MO4A 3IAQA 4XUNA 3OEAA 4P5YA 3VD9A 1LNSA 3WF1A 4ZZ5A 3C7OA 4A6OA 1UY2A 1PX3A 4A4AA 3UESA 2J1RA 3DYOA 4E8DA 5G04L 5JXIA 2WO3A 4ARXA 1CX1A 4JKKA 3K77A 3OEBA 4TTGA 1P8JA 3WF4A 2VZ1A 2W46A 4BK4A 1UY3A 1H6XA 2QQJA 3MUY1 2VMCA 1W8OA 1O8SA 4DUXA 3WF2A 4QPWA 5I0DA 1UY1A 2W1UA 1JYWA 2Y6LA 1UMHA 1JZ6A 4CUBA 1W8NA 1SG3A 3UETA 3I97A 2EIDA 3HNMA 3CKHA 3J7HA 2YFZA 1K3IA 3T09A 1O59A 1H6YA 5EIYB 2YB7A 3A23A 2VQTA 4UOJA 4UAPA 3C8XA 3T2QA 4BXSV 4W8JA 2W92A 2XQXA 2WN3A 4GZ9A 3I2JA 5JXJA 3LQCA 2WO1A 3C7GA 3CDZB 3I3EA 5JUVA 3I2GA 2J1AA 1OD3A 5CYYA 1JYNA 1TVGA 2RVAA 2WZ8A 3WF0A 2EIEA 2B9VA 4JHZA 4MOAA 3IIIA 2ZEXA 4P02B 4XVHA 4LHSA 2VMFA 2Y6HA 1NUKA 2WN2A 4P00B 5C7GA 4UI9L 5IFPA 3VD7A 2VZVA 3AC0A 5IJRA 3OGSA 1JZ2A 2QQKA 1DYOA 3T08A 1CZTA 1L7QA 1BHGA 3GM8A 4MGQA 1RYYA 5B4XA 2E31A 2VCAA 3CQOA 4JKLA 3OB8A 2W3JA 3CIHA 2VZRA 3T2PA 2VM9A 4LQRA 1WKYA 3NNGA 4A42A 2YFUA 3VD4A 1JZ8A 2L9LA 1D7PM 1K45A 2YG0A 2QQOA 4OMDA 4XUPA 4DUVA 3W5NA 2WBKA 1W9WA 3VDAA 2BZDA 4JX0A 2X10A 1JU3A 2VR4A 3LEKA 3MV11 3A7QA 2ZXQA 3WNPA 4MO3M 4A41A 4QB2A 2W9XA 2VCBA 1WCQA 3ECQA 3SKVA 5C71A 3GGLA 3LE0A 4DUWA 3I2HA 1GU3A 2WAOA 2LS6A 4KMQA 2XONA 4M4RA 3VDBA 2QBXA 2B4KA 1JZ3A 4QX2A 2W1QA 2CDPA 3C7FA 1OH4A 3W5MA 5EJZB 5FUIA 5JR2A 1UXXX 1W9TA 1W0NA 2XHNA 4JKMA 2RJ2A 2J1EA 3A22A 2R7EB 3ACFA 1KGYA 3P6BA 4KI5M 5CZKA 2VZQA 4BJ0A 4XUQA 2ORXA 2W94A 4QX3A 2C4XA 2Y64A 3NJVA 2J7MA 2VZ3A 2V4VA 4OMCA 4ARYA 1TG7A 4CU9A 1R64A 3NJXA 1UXZA 4M4PA 5JMOA 3WNKA 3HPNA 2WAAA 3LEGA 4A3ZA 4QDSA 4OYUA 5C70A 2W1SA 4PQQA 3BGAA 1PX4A 2LW8A 2VJXA 4D8MA 3MV01 2VZTA 1K12A 1IQDC 4GWJA 2DDUA 1YQ2A 1UY0A 5IHRA 5DPNA 5DQ0A 2WUHA 3HJRA 4D0QA 4MADA 4DEQA 3FHAA 2E33A 1XNAA 1UYXA 3MBWA 5G05L 4HG6B 2HYXA 1DLCA 2VMDA 1JYVA 2BBAA 1O8PA 1GOFA 3OGRA 4BK5A 4Z2AA 3HNBM 1JYXA 4GWIA 1UMIA 5F7UA 3UNPA 4XURA 3WSOA 1I5PA 2JE8A 1XC6A 3VD3A 3BN6A 1GOGA 3DYMA 3OG2A 4A45A 1JZ5A 2YC2A 2Y6GA 3FN9A 4XUOA 2BERA 4DXRA 2EIBA 4LKSA 2W47A 3DYPA 4L0PA 3E1F1 3WNMA 1HN1A 2VZPA 3ACHA 3F2ZA 3HN3A 1NKGA 4QDRA 2JDAA 1JZ7A 2J1TA 2PQSA 5HXMA 1CZVA 1GQPA 5DMYA 3CZJA 4IUGA 5LA0A 3K4DA 1OT5A 1EUTA 3T0AA 2VZUA 2J1VA 1GNYA 4OZOA 3SEEA 2QQNA 4PF1A 2EICA 4AAXA 4LPLA 2C9KA 1PMHX 3IAPA 3I3DA 4OUEA 4DXSA 3PUIA 4TXWA 2DCJA 2JD9A 2VZOA 2E32A 3I2KA 3C7HA 2QQIA 3WQBA 5J1XA 3EB7A 2XOMA 1SDDB 2WQ8A 2OKXA 2X05A 3VD5A 3THCA 2Y8KA 3K4ZA 4ZXEA 2VCCA 1J84A 3ACGA 3WNLA 1L7RA 3ZM8A 2DCKA 2WYSA 3WNOA 3ACIA 2ZEYA 4ZY9A 2Y6JA 1T2XA 2V72A 2Z4FA 5JXGA 1US2A 4ET7A 4E8CA 3D3AA 3DECA 3GXUA 1UX7A 2VC9A 5DN2A 1KEXA 5LCWL 2JKXA 3FHQA 2VO5A 1XPWA 2J22A 3CZUA 1NAEA 2QQMA 2V5DA 5JXHA 2ZEWA 3VDCA 1K42A 4P08A 2ID4A 5LA2A 2E26A 3LPGA 4RYDA 2VTFA 5A1AA 3K75B 5LA1A 3PUHA 3C7EA 4XUTA 3HNYM 3NRUA 3OBAA 1GOHA 1OF4A 1JI6A 2RV9A 2VQUA 2VZSA 1JZ4A 2VMEA 3SKJE 1NX9A 1W99A 3CMGA 1PMJX 2QQLA 4RN5A 4W4ZA 4BDVB 4QX0A 2WABA 2WDBA 4KWUA 2KD7A 1J83A 1MPXA 2HLEA 4CUAA 2W95A 3IB3A 2W91A 2BGOA 2C26A 1DP0A 3HEIA 4A44A 2ZEZA 1F4AA 4MGSA 3HOBA 1UY4A 1XNTA 3I3BA 5B4NA 1UYZA 5IFTA 1JHJA 5EJ1B 2BGPA 3MUZ1 4CVUA 4QB1A 3ETPA 3WF3A 3T0BA 2WO2A 1CIYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IYY A;  3T2O A;  1UYY A;  3P1I A;  4ZZ8 A;  3WNN A;  4CU6 A;  3A21 A;  2VL4 A;  3LEI A;  3I2I A;  4QB6 A;  1F4H A;  1GUI A;  1GMM A;  2J1U A;  3K46 A;  4CU8 A;  4CU7 A;  2W87 A;  2VOT A;  1UZ0 A;  2CDO A;  3FL7 A;  4QDQ A;  2ORZ A;  3JXS A;  4YPJ A;  1ULP A;  4PT6 A;  3ABZ A;  3U37 A;  2Y6K A;  3SEP A;  3THD A;  2J1S A;  1JU4 A;  3WEZ A;  4DXT A;  4XZU G;  5HPO A;  4FI9 A;  4QAW A;  1EUU A;  3EYP A;  3NQH A;  4AG4 A;  4DEV A;  3OGV A;  2W1W A;  3K4A A;  3I2F A;  2YC4 A;  3IDA A;  1ULO A;  4W50 A;  1UWW A;  1US3 A;  4QX1 A;  1CZS A;  2W5F A;  1SHW B;  2X09 A;  2WZE A;  1W9S A;  4CUC A;  3GDB A;  3LPF A;  1OF3 A;  3T0D A;  3MO4 A;  3IAQ A;  4XUN A;  3OEA A;  4P5Y A;  3VD9 A;  1LNS A;  3WF1 A;  4ZZ5 A;  3C7O A;  4A6O A;  1UY2 A;  1PX3 A;  4A4A A;  3UES A;  2J1R A;  3DYO A;  4E8D A;  5G04 L;  5JXI A;  2WO3 A;  4ARX A;  1CX1 A;  4JKK A;  3K77 A;  3OEB A;  4TTG A;  1P8J A;  3WF4 A;  2VZ1 A;  2W46 A;  4BK4 A;  1UY3 A;  1H6X A;  2QQJ A;  3MUY 1;  2VMC A;  1W8O A;  1O8S A;  4DUX A;  3WF2 A;  4QPW A;  5I0D A;  1UY1 A;  2W1U A;  1JYW A;  2Y6L A;  1UMH A;  1JZ6 A;  4CUB A;  1W8N A;  1SG3 A;  3UET A;  3I97 A;  2EID A;  3HNM A;  3CKH A;  3J7H A;  2YFZ A;  1K3I A;  3T09 A;  1O59 A;  1H6Y A;  5EIY B;  2YB7 A;  3A23 A;  2VQT A;  4UOJ A;  4UAP A;  3C8X A;  3T2Q A;  4BXS V;  4W8J A;  2W92 A;  2XQX A;  2WN3 A;  4GZ9 A;  3I2J A;  5JXJ A;  3LQC A;  2WO1 A;  3C7G A;  3CDZ B;  3I3E A;  5JUV A;  3I2G A;  2J1A A;  1OD3 A;  5CYY A;  1JYN A;  1TVG A;  2RVA A;  2WZ8 A;  3WF0 A;  2EIE A;  2B9V A;  4JHZ A;  4MOA A;  3III A;  2ZEX A;  4P02 B;  4XVH A;  4LHS A;  2VMF A;  2Y6H A;  1NUK A;  2WN2 A;  4P00 B;  5C7G A;  4UI9 L;  5IFP A;  3VD7 A;  2VZV A;  3AC0 A;  5IJR A;  3OGS A;  1JZ2 A;  2QQK A;  1DYO A;  3T08 A;  1CZT A;  1L7Q A;  1BHG A;  3GM8 A;  4MGQ A;  1RYY A;  5B4X A;  2E31 A;  2VCA A;  3CQO A;  4JKL A;  3OB8 A;  2W3J A;  3CIH A;  2VZR A;  3T2P A;  2VM9 A;  4LQR A;  1WKY A;  3NNG A;  4A42 A;  2YFU A;  3VD4 A;  1JZ8 A;  2L9L A;  1D7P M;  1K45 A;  2YG0 A;  2QQO A;  4OMD A;  4XUP A;  4DUV A;  3W5N A;  2WBK A;  1W9W A;  3VDA A;  2BZD A;  4JX0 A;  2X10 A;  1JU3 A;  2VR4 A;  3LEK A;  3MV1 1;  3A7Q A;  2ZXQ A;  3WNP A;  4MO3 M;  4A41 A;  4QB2 A;  2W9X A;  2VCB A;  1WCQ A;  3ECQ A;  3SKV A;  5C71 A;  3GGL A;  3LE0 A;  4DUW A;  3I2H A;  1GU3 A;  2WAO A;  2LS6 A;  4KMQ A;  2XON A;  4M4R A;  3VDB A;  2QBX A;  2B4K A;  1JZ3 A;  4QX2 A;  2W1Q A;  2CDP A;  3C7F A;  1OH4 A;  3W5M A;  5EJZ B;  5FUI A;  5JR2 A;  1UXX X;  1W9T A;  1W0N A;  2XHN A;  4JKM A;  2RJ2 A;  2J1E A;  3A22 A;  2R7E B;  3ACF A;  1KGY A;  3P6B A;  4KI5 M;  5CZK A;  2VZQ A;  4BJ0 A;  4XUQ A;  2ORX A;  2W94 A;  4QX3 A;  2C4X A;  2Y64 A;  3NJV A;  2J7M A;  2VZ3 A;  2V4V A;  4OMC A;  4ARY A;  1TG7 A;  4CU9 A;  1R64 A;  3NJX A;  1UXZ A;  4M4P A;  5JMO A;  3WNK A;  3HPN A;  2WAA A;  3LEG A;  4A3Z A;  4QDS A;  4OYU A;  5C70 A;  2W1S A;  4PQQ A;  3BGA A;  1PX4 A;  2LW8 A;  2VJX A;  4D8M A;  3MV0 1;  2VZT A;  1K12 A;  1IQD C;  4GWJ A;  2DDU A;  1YQ2 A;  1UY0 A;  5IHR A;  5DPN A;  5DQ0 A;  2WUH A;  3HJR A;  4D0Q A;  4MAD A;  4DEQ A;  3FHA A;  2E33 A;  1XNA A;  1UYX A;  3MBW A;  5G05 L;  4HG6 B;  2HYX A;  1DLC A;  2VMD A;  1JYV A;  2BBA A;  1O8P A;  1GOF A;  3OGR A;  4BK5 A;  4Z2A A;  3HNB M;  1JYX A;  4GWI A;  1UMI A;  5F7U A;  3UNP A;  4XUR A;  3WSO A;  1I5P A;  2JE8 A;  1XC6 A;  3VD3 A;  3BN6 A;  1GOG A;  3DYM A;  3OG2 A;  4A45 A;  1JZ5 A;  2YC2 A;  2Y6G A;  3FN9 A;  4XUO A;  2BER A;  4DXR A;  2EIB A;  4LKS A;  2W47 A;  3DYP A;  4L0P A;  3E1F 1;  3WNM A;  1HN1 A;  2VZP A;  3ACH A;  3F2Z A;  3HN3 A;  1NKG A;  4QDR A;  2JDA A;  1JZ7 A;  2J1T A;  2PQS A;  5HXM A;  1CZV A;  1GQP A;  5DMY A;  3CZJ A;  4IUG A;  5LA0 A;  3K4D A;  1OT5 A;  1EUT A;  3T0A A;  2VZU A;  2J1V A;  1GNY A;  4OZO A;  3SEE A;  2QQN A;  4PF1 A;  2EIC A;  4AAX A;  4LPL A;  2C9K A;  1PMH X;  3IAP A;  3I3D A;  4OUE A;  4DXS A;  3PUI A;  4TXW A;  2DCJ A;  2JD9 A;  2VZO A;  2E32 A;  3I2K A;  3C7H A;  2QQI A;  3WQB A;  5J1X A;  3EB7 A;  2XOM A;  1SDD B;  2WQ8 A;  2OKX A;  2X05 A;  3VD5 A;  3THC A;  2Y8K A;  3K4Z A;  4ZXE A;  2VCC A;  1J84 A;  3ACG A;  3WNL A;  1L7R A;  3ZM8 A;  2DCK A;  2WYS A;  3WNO A;  3ACI A;  2ZEY A;  4ZY9 A;  2Y6J A;  1T2X A;  2V72 A;  2Z4F A;  5JXG A;  1US2 A;  4ET7 A;  4E8C A;  3D3A A;  3DEC A;  3GXU A;  1UX7 A;  2VC9 A;  5DN2 A;  1KEX A;  5LCW L;  2JKX A;  3FHQ A;  2VO5 A;  1XPW A;  2J22 A;  3CZU A;  1NAE A;  2QQM A;  2V5D A;  5JXH A;  2ZEW A;  3VDC A;  1K42 A;  4P08 A;  2ID4 A;  5LA2 A;  2E26 A;  3LPG A;  4RYD A;  2VTF A;  5A1A A;  3K75 B;  5LA1 A;  3PUH A;  3C7E A;  4XUT A;  3HNY M;  3NRU A;  3OBA A;  1GOH A;  1OF4 A;  1JI6 A;  2RV9 A;  2VQU A;  2VZS A;  1JZ4 A;  2VME A;  3SKJ E;  1NX9 A;  1W99 A;  3CMG A;  1PMJ X;  2QQL A;  4RN5 A;  4W4Z A;  4BDV B;  4QX0 A;  2WAB A;  2WDB A;  4KWU A;  2KD7 A;  1J83 A;  1MPX A;  2HLE A;  4CUA A;  2W95 A;  3IB3 A;  2W91 A;  2BGO A;  2C26 A;  1DP0 A;  3HEI A;  4A44 A;  2ZEZ A;  1F4A A;  4MGS A;  3HOB A;  1UY4 A;  1XNT A;  3I3B A;  5B4N A;  1UYZ A;  5IFT A;  1JHJ A;  5EJ1 B;  2BGP A;  3MUZ 1;  4CVU A;  4QB1 A;  3ETP A;  3WF3 A;  3T0B A;  2WO2 A;  1CIY A; 
#chains in the Genus database with same CATH topology
 5FPX A;  4LA3 A;  5IYY A;  4M0H A;  2RMU 2;  2VD7 A;  3N36 A;  5FQ0 B;  1K5M B;  2QDN A;  1PGW 2;  3LEI A;  2ARE A;  1UX6 A;  2ZGU A;  3MID A;  4Y5Z 0;  1AR6 2;  2E7Q A;  2GMP A;  3WW1 A;  2W87 A;  3LSE A;  4IGQ A;  1H0B A;  1PO1 2;  1UOJ A;  2ZKL A;  3JXS A;  1RUE 1;  4BIS A;  4I0B A;  4GH4 C;  2WC2 A;  2JX9 A;  3ZDV A;  1T6G C;  3U37 A;  4MET A;  4HVR A;  4IW3 A;  4DXZ A;  2YBP A;  2GC0 A;  5KC6 A;  5C9A C;  4CCC A;  4F83 A;  4AFC A;  5CAZ A;  1MQT A;  4UW4 A;  2Y34 A;  4EZ4 A;  1RUF 2;  4DZG A;  5FZI A;  1QWR A;  5FTT C;  1VAK A;  2F4P A;  2H6C A;  4ISR A;  2XJQ A;  1LGB A;  1RIR A;  3H9A A;  1QDO A;  3OGV A;  5J96 B;  5FZ1 A;  3JU9 A;  5T52 A;  4ATF A;  2KM2 A;  2D3R A;  2YC4 A;  2QQP A;  4P9L A;  3I7D A;  1XRU A;  1CZS A;  2BYV E;  2X09 A;  4B4P A;  3FFQ A;  4GQ7 A;  1UZW A;  4PHZ A;  1ND3 A;  3GDB A;  1NYW A;  3QBQ A;  1OC1 A;  1OMI A;  5DUX A;  2PHL A;  3AKS A;  5BXX A;  2LTN A;  4AED B;  3N7J A;  4YWA A;  1AR8 2;  4UW5 A;  4BQ2 A;  2UUR A;  1QDC A;  2GNT A;  3AXD A;  1WLD A;  3MZH A;  4PLN A;  5K4L A;  2QKD A;  3NKG A;  4RHV 3;  4EWA A;  4URA A;  2JEN A;  5CKQ A;  1YFU A;  4Q1R A;  1DGR A;  4ZU5 A;  1DZR A;  1EV1 3;  1FPN 2;  1B35 B;  2CAV A;  4A6O A;  1PHM A;  4NIA A;  1V6K A;  2WFF 1;  4MXW A;  4A4A A;  3BAL A;  3UES A;  5CBL A;  1AYM 1;  2Z69 A;  2BU9 A;  5K0U B;  1GV9 A;  2J1R A;  1I1E A;  4JC1 A;  1UPI A;  4FTE A;  4IES A;  2ZGO A;  4QHB A;  3K77 A;  3B9I A;  2QCS B;  3M1H A;  5D8A B;  3WF4 A;  4EN6 B;  2VZ1 A;  2VUD A;  3KT7 A;  3G6J B;  4GB3 1;  5A7Q A;  4YYO A;  4HFS A;  4OI1 A;  1B09 A;  3WOG A;  3BTX A;  2BVB A;  1XSR A;  4FXG B;  5F3E A;  4BIO A;  1C5I A;  2C1F A;  4JV4 A;  2VMC A;  4EN0 A;  1JBC A;  2Y0O A;  5JZG A;  2QDR A;  4UBG A;  3TNP B;  3UT0 A;  4LKF A;  4CZS A;  5IVY A;  1O8S A;  2JDN A;  2RDR A;  4DUX A;  4LO8 A;  3FMG A;  2HWF 2;  5JSR A;  1OI6 A;  1X7N A;  2W52 A;  4OCT A;  5D2A A;  1F5J A;  2Q1M A;  2EXK A;  2WFF 3;  2ZGM A;  2P1B A;  2A71 A;  2PHU A;  1A78 A;  1AYM 3;  3POW A;  4LIU A;  1NOV A;  2Y6L A;  4BQY A;  1R09 1;  3KB5 A;  2Q0A A;  2ZHM A;  4IV1 C;  1UU4 A;  2QUO A;  3CKH A;  5I8Y A;  1K3I A;  1UKR A;  2VBP A;  3HVD A;  1GKB A;  4IV3 B;  1TQ5 A;  4AI1 A;  4C90 A;  4B4R A;  5CKN A;  2R06 2;  4NHK A;  2YY1 A;  2F6B A;  2P3J A;  4RR3 A;  3WW3 A;  1GP4 A;  4CDW A;  2ZAC A;  1O91 A;  3A23 A;  2VQT A;  4CDU A;  4R4X A;  3E5U A;  4YVS A;  2JB8 A;  3C8X A;  1HDK A;  2RM2 2;  3E5X A;  3WW2 A;  2ZKN A;  4FBF A;  4NID A;  1PVC 2;  2XQX A;  3UGH A;  4IE0 A;  4AZZ A;  1DFQ A;  4NE9 A;  5CVR A;  2DV9 A;  2QTW B;  1IKP A;  2VPV A;  1HQL A;  3Q8A A;  2G19 A;  4WBB A;  4PBP A;  3FZ3 A;  3C7G A;  2XVG A;  4WM8 A;  2WZR 2;  3HQU A;  3I3E A;  4OHV A;  4C1W A;  1URX A;  1QJE A;  1OLQ A;  3N9M A;  1OD3 A;  1YWK A;  4M0N A;  4CEY C;  5EIY B;  1XU1 A;  2RVA A;  2WZ8 A;  4NAO A;  4BE3 A;  4QHZ A;  4MOA A;  2VNG A;  4X6Q B;  3BU7 A;  1I6X A;  4L8Q A;  2ILM A;  3A4U A;  4GH4 B;  5I0R A;  1PGL 1;  3ZOI A;  4FFH A;  4V1P A;  1V70 A;  1ZA7 A;  4BPZ A;  4XVH A;  3KGZ A;  2HH9 A;  4K8R B;  3N4M A;  2D3P A;  2XJU A;  2JDH A;  3N7L A;  4LOR A;  3MW2 A;  1MZ5 A;  1D4M 1;  4LBL A;  2JJ6 A;  3H1W A;  3UJO A;  1R1A 1;  4YFW A;  5A7P A;  5C3Q A;  5J36 A;  1ULC A;  4B7K A;  4CDX A;  3I3Q A;  4K9S A;  4N7U A;  1XSQ A;  5D1I A;  2VMF A;  1AR8 3;  3EO6 A;  3S0M A;  3FJS A;  3VBR C;  2VUA A;  4P00 B;  5FYC A;  4XCA A;  4IE5 A;  3DL3 A;  2PQQ A;  5IFP A;  2F4L A;  2GNM A;  1RUJ 1;  2XLA A;  2X5I A;  2WS9 1;  5LY1 A;  1HX6 A;  4HSL A;  1FPN 3;  3AC0 A;  2XJP A;  1Z7S 3;  4V2W A;  5DAV A;  4DPN A;  1RMU 2;  1DYO A;  3PMS A;  4HOO A;  5C5T A;  5HBA A;  1UMZ A;  2DUR A;  3OPT A;  3LZZ A;  1ENS A;  2R04 2;  3F95 A;  4XIL A;  1DYK A;  4IE6 A;  1U12 A;  3BKZ A;  3CHX A;  2OS2 A;  1ENQ A;  4MGQ A;  2NN8 A;  5FYM A;  2PHT A;  4RFT 0;  2VCA A;  3MPP G;  5EYY A;  2XBO 1;  3MLJ A;  3PUR A;  3WX5 A;  3WV6 A;  4D6Q A;  3OB8 A;  2W3J A;  2O8O A;  1UCX A;  3NNL A;  4TYS A;  2VZR A;  4HKL A;  4XW3 A;  1DQ1 A;  1DQ2 A;  4DRV A;  2JDU A;  1WKY A;  4YVW A;  3LA2 A;  3NNG A;  5IVC A;  4LEJ A;  1E57 A;  2YFU A;  3VD4 A;  4NWV A;  1UL9 A;  1HB2 A;  4KU7 A;  2UWB A;  5CIR A;  5BNO C;  5BNN A;  1RUJ 3;  4LOS A;  3ROU A;  1D7P M;  3OGJ A;  4PLO A;  2HWF 3;  1ZX5 A;  5LBC A;  3AXE A;  2JIC A;  1SCS A;  1QY4 A;  3D5O A;  2VTX J;  2D7F A;  3O1R A;  4QGL A;  1R08 2;  1ENR A;  2PFW A;  1W05 A;  2TEP A;  2ZHL A;  5JLV A;  4AOC A;  3KCC A;  1JU3 A;  1V6M A;  2HBU A;  2P34 A;  1NT0 A;  2WQ4 A;  4NRP A;  5FZM A;  4URT A;  2Y0I A;  1YUD A;  4M3C B;  2UWA A;  4RS5 B;  2G9F A;  5L73 A;  5TSW A;  3T4V A;  3VGI A;  1ZRF A;  5E16 A;  4NR1 A;  2BUK A;  3QOP A;  4XBN A;  4DO0 A;  1SBD A;  3O0W A;  3ZYH A;  2ZX2 A;  2QJV A;  1H9P A;  2R06 3;  4JGZ A;  2GC3 A;  4A41 A;  2QFE A;  3BOW A;  4DY5 A;  1ENX A;  4KBB A;  4LLF A;  3LDR A;  3SKV A;  2RM2 3;  4ONU A;  5C71 A;  3GGL A;  4WVW A;  4DUW A;  2WAO A;  3JD7 1;  2LS6 A;  3H1M A;  3HAG A;  4O7X A;  1LCL A;  4OHZ A;  3S30 A;  3VBH A;  3T3Y A;  4Q4V 1;  4LHK A;  5FMO S;  4LOT A;  1JZ3 A;  1XNB A;  4QKF A;  1PNG A;  1SFN A;  4QPG A;  5A32 A;  1OH4 A;  2WA3 A;  4K20 A;  2WZR 3;  5FUI A;  5J48 A;  1QNW A;  4KGQ A;  3DEM A;  3M3Q A;  2J1E A;  1AL2 2;  3ACF A;  2VH9 A;  1BMV 2;  1W2A X;  3IDE A;  1UOG A;  1OA3 A;  4FT8 A;  3LOI A;  4CP9 B;  4AFB A;  1LOA A;  3I2D A;  2XPJ A;  1S2E A;  2VUL A;  2YUE A;  3EJK A;  4QX3 A;  2OVU A;  5T5L A;  3NVC A;  3LIG A;  2J7M A;  3JD7 3;  4LBM A;  4JDN A;  4QU1 A;  3LWC A;  2HEW F;  1X33 A;  3FLP A;  1WMD A;  3D6E A;  1N47 A;  1R64 A;  1DIW A;  2A5Z A;  3NJX A;  4Q4V 3;  4W6W A;  4KG8 A;  4XFH A;  5JMO A;  3JB4 C;  2IXC A;  3V0B B;  2ET7 A;  4CEY B;  5FJK A;  3DV8 A;  2DUP A;  5LB6 A;  3GHN A;  2CL2 A;  3UKN A;  5A6Z A;  4UFL A;  3HT2 A;  4LA2 A;  4OI2 A;  4WVM B;  1RMU 3;  1JTZ X;  1RUI 2;  4AI9 A;  3AVR A;  3ASI A;  5FMB A;  4BQX A;  5F6K A;  1X82 A;  4IGO A;  4R4Z A;  2CY6 A;  2VE1 A;  1TNF A;  1DG6 A;  2JE7 A;  2UYA A;  2VU9 A;  2ZA9 A;  3P3N A;  2VMG A;  5DPN A;  2HWE 2;  5CKM A;  1GLH A;  1COV 1;  2DUQ A;  1FT9 A;  1U5X A;  3O0X A;  4MAD A;  3VN4 A;  1RIN A;  4M3C E;  2E33 A;  5L19 A;  2VQA A;  1GIC A;  3VBR B;  4AW7 A;  3NMB A;  3T1L A;  1DCS A;  2JG9 A;  4OI4 A;  1W6O B;  1DLC A;  4XCB A;  4QKB A;  4QQP A;  1H2M A;  4LKD A;  4OUS A;  1H30 A;  1YFY A;  1W6Q A;  1EP0 A;  1JW6 A;  1RGS A;  1BXH A;  1SPP A;  3OGR A;  4K7J A;  1VE0 A;  4D7Y A;  5F7U A;  4XUR A;  4ZKT B;  3PTR B;  3VD3 A;  1XC6 A;  1VLN A;  3WQ1 A;  1ULD A;  1H8T C;  1OLM E;  1QF3 A;  2XUE A;  4XIK A;  1JZ5 A;  2YC2 A;  3LFM A;  5FP9 A;  4FTB A;  1ZBE 1;  5LAT A;  4AGV A;  5I0U A;  1QXP A;  3J7M A;  4N8M A;  2YHJ A;  3ZFE A;  4BQ1 A;  3AZZ A;  1COV 3;  2CNA A;  4YZ1 A;  2XML A;  5FZ9 A;  3Q8B A;  2GN3 A;  3SNM A;  4AVA A;  4XFA A;  4L0P A;  3E1F 1;  1J3Q A;  4YSF A;  2YBS A;  4AI8 A;  3HN3 A;  2PHW A;  4MZU A;  3L2Y A;  1JZ7 A;  4MGY E;  3AMH A;  4K21 A;  5BNO B;  2WR9 A;  5HXM A;  1GQP A;  2R1B A;  5DMY A;  3CZJ A;  3WW4 A;  2VVE A;  3JUU A;  3ZXF A;  1H4H A;  4FPJ A;  3K4D A;  1OT5 A;  2BRT A;  2ZAB A;  1OBN A;  3T4H B;  2VZU A;  5K7P A;  3JQX A;  3SEE A;  1WLC A;  2XWJ B;  1D4V B;  3ZXJ A;  3AX4 A;  5F3I A;  4AAX A;  4UFM A;  1LOF C;  3PU8 A;  1ZBE 3;  3M8L A;  2C9K A;  3KV4 A;  3IAP A;  1CAW B;  3PUI A;  4QX7 A;  1W2U A;  1ZRD A;  4D7T A;  2C0Z A;  2JD9 A;  1IS3 A;  4AFA A;  2P5B A;  2E32 A;  1F35 A;  3I59 B;  2AGS A;  2DVB A;  1APN A;  1WLW A;  4IEZ A;  1KJR A;  3EB7 A;  4M01 A;  5D21 A;  4YW2 A;  5A3L A;  2WSU A;  5EJ3 A;  3CJI C;  1QJX 2;  3RZZ A;  4BB3 A;  5JI9 A;  3QH7 A;  3LA3 A;  4QPI C;  4Y26 A;  4CDQ C;  4QXB A;  1RUC 1;  1GP6 A;  2YGM A;  4QM8 A;  4XDQ A;  2WWU A;  3M2M A;  5C6C A;  1L7R A;  2BWA A;  1S0B A;  4XQW A;  5FP4 A;  2Q8O A;  4E4Z A;  5BNP A;  5GJ6 A;  1IS5 A;  1O5L A;  1GWL A;  1RHI 2;  2ZEY A;  4ZY9 A;  2Q8D A;  3MDP A;  3L9J T;  2P17 A;  5FKC A;  4TLF A;  1OUR A;  2Z4F A;  1E5H A;  5CU1 A;  4AAP A;  4FSJ A;  2ARB A;  1US2 A;  3AVS A;  4E8C A;  1FOD 1;  3GXU A;  4OLL A;  1EPW A;  2ZGR A;  3AMQ A;  2VC9 A;  3ZXL A;  1BYH A;  1PZ7 A;  1HB4 A;  1E5R A;  1XPW A;  3CZU A;  1SLA A;  4CXW A;  2XR4 A;  3VZL A;  1DGW X;  4IET A;  2ZMN A;  2WNO A;  2HWB 3;  1RUI 3;  2XQR A;  3WD5 A;  2IFW A;  3ME2 A;  3RMY A;  2D3S A;  1LAJ A;  1QXR A;  1CVN A;  4FTS A;  1GQG A;  3PJQ A;  3RRD A;  1LEN A;  4HKO A;  1S4C A;  1RUC 3;  1JUH A;  5I91 A;  1KIT A;  3B02 A;  3UK9 A;  3VZJ A;  1JYT A;  1OUX A;  1W6M B;  2XJT A;  3CL1 A;  1BJQ A;  2A6Z A;  2ENR A;  1TMF 2;  5A1A A;  5IAT A;  1QQP 1;  1F15 A;  3K75 B;  1YIF A;  1HB1 A;  1ZNP A;  2B42 B;  5DUU A;  4Y1Z A;  1LJ7 A;  3URF A;  3CO2 A;  1UYP A;  3O0V A;  3POG A;  3SH4 A;  3GYD A;  5LK5 A;  3NL1 A;  1WW7 A;  2R30 A;  3K48 A;  5L9R A;  1VRB A;  1AZD A;  4G3Y C;  4YLZ A;  3NV4 A;  3LF7 A;  3AZV A;  1Q5O A;  5F5Q A;  3OOX A;  4QGM A;  1CIW A;  3KD4 A;  4IQP A;  5A7W B;  3UGF A;  1W2T A;  4MGT A;  4JRL A;  2PMW B;  4IL7 A;  1NX9 A;  3QH6 A;  1PMJ X;  2W39 A;  4CCJ A;  2HWC 2;  4W4Z A;  4FAH A;  4QX0 A;  2WDB A;  1XYP A;  3OJB A;  1NCQ C;  3DXU A;  4A7K A;  2E6V A;  4C8D A;  5AVA A;  1MPX A;  4QXH A;  5LRS A;  3IB3 A;  1ZZ6 A;  2BGO A;  3HIF A;  3LB9 A;  4N53 C;  5DZG A;  2WZP P;  3TN9 1;  2JIG A;  4BYY A;  1LTE A;  1WCK A;  2XVK A;  5KHI A;  1D2Q A;  1F4A A;  1VBE 1;  4QPY A;  2P2K A;  1H2L A;  1KFU L;  5LRR A;  5JMC A;  3HOB A;  2YU2 A;  1H8T B;  3KF3 A;  2B46 X;  2RS1 2;  2WLQ A;  5T54 A;  4C0B A;  4AXO A;  5FZG A;  2GAL A;  1UZZ A;  3ETP A;  2VOX A;  3WF3 A;  4PI0 A;  4DOU A;  1ND2 A;  3N9Q A;  1W90 A;  1GYK A;  1LHN A;  2WJS A;  3AB0 A;  4NHY A;  5A6X A;  4QMA A;  1W06 A;  3VHR A;  3ZN6 B;  4LJH A;  3WNN A;  2ARC A;  2Y33 A;  3A21 A;  2X53 S;  4PQ9 A;  2NMO A;  2WL1 A;  4FPK A;  4N9I A;  3I2I A;  1QJF A;  4QB6 A;  1SEF A;  2PHX A;  1QJX 3;  1AYN 2;  1HRV 2;  1ODM A;  2NM1 A;  1GUI A;  3POY A;  5A7O A;  3TN9 3;  5HCH A;  3TB0 A;  4L99 A;  4CU8 A;  5FZH A;  5LBE A;  4CU7 A;  1RXF A;  1VBE 3;  2CDO A;  3FL7 A;  3J7N A;  3JQW A;  4QDQ A;  4PIZ A;  5FO8 B;  2D6M A;  1ULP A;  4MG2 A;  4PT6 A;  3WP4 A;  1LEC A;  1MQT C;  1QJU 1;  4P9J A;  2XKP A;  3ABZ A;  3PTY A;  4LLO A;  1OOP C;  2BFU S;  4N43 A;  3SEP A;  1AJO A;  2OA2 A;  3LCP A;  5GAL A;  2D6K A;  3ZYI B;  3WEZ A;  4YG6 A;  1MVE A;  4DXT A;  5CFD A;  5HPO A;  2FCV A;  1RUH 2;  3CJI B;  5FZ8 A;  3B5L B;  4HN1 A;  4HPK B;  4AI2 A;  3S5Q A;  4QPI B;  5DAX A;  1KDM A;  2BBV A;  3CNA A;  1Q56 A;  4IEV A;  5F5A A;  1ZM1 A;  4FXK B;  3WT3 A;  3NQH A;  4XFG A;  4AG4 A;  5A33 B;  3RYR A;  3LGR A;  4FPE A;  1PK6 B;  1ND3 C;  2B5H A;  5HCF A;  2CGP A;  3VBF A;  1YQ5 A;  3I2F A;  3J9S A;  5AFE A;  2HYK A;  5C4W A;  2FZ1 A;  4COZ A;  4Y3O A;  1VBB 1;  1QHD A;  1US3 A;  1TMF 3;  3IWZ A;  4ZPI A;  1QJU 3;  5ABJ A;  3N9O A;  3ZXE A;  2WZE A;  4L92 A;  1N1Y A;  1CD3 G;  5KXB A;  2ARA A;  5FUP A;  3IZO A;  3LPF A;  4XJZ A;  2CTV A;  4ITC A;  4HN0 A;  3LFI A;  5FYY A;  1QOT A;  5JI7 A;  1QJY 2;  5DZE A;  1EAH 1;  3MO4 A;  4SLI A;  3MHZ A;  5CNA A;  1SLB A;  4XUN A;  3OEA A;  3VD9 A;  1RVF 2;  4EN9 B;  2QZ3 A;  1JUI A;  4CCD A;  5E8A A;  4P9G A;  3C7O A;  1BCX A;  5FDB A;  5IK5 A;  1PX3 A;  1X9T A;  1W6P A;  1JHN A;  4E8D A;  5G04 L;  5FP7 A;  2GU9 A;  2GME A;  3U78 A;  2VBD A;  4XJW A;  1OXC A;  3BOP A;  1NA1 C;  3OEB A;  2X8K A;  5FBZ A;  5A3O A;  1CX4 A;  1I5Z A;  2IWG B;  4FQZ A;  1F5F A;  2A3Y A;  2DVF A;  3R4D B;  1NY7 2;  1J1T A;  2R07 3;  2W46 A;  3NNM A;  1VMJ A;  5DAP A;  3POF A;  5C33 A;  3K51 A;  4BK4 A;  1UY3 A;  1JMU B;  1U0A A;  1ACC A;  4NUB A;  1IS4 A;  4FFG A;  4Q8L A;  2OW4 A;  2DUO A;  1G7Y A;  1TZO A;  1ZBA 2;  1V9U 1;  4I0W B;  5IVF A;  2Z2S B;  1W8O A;  4XET A;  2WKK A;  2DFC A;  5FMC A;  3GHM A;  1UKG A;  3S7E A;  2EVX A;  1OPM A;  2F17 A;  2VY0 A;  4QPW A;  3WG2 A;  2IXL A;  3AZW A;  3ZFG A;  4HL0 A;  2ZOE B;  1IG3 A;  1NCQ B;  2FDF A;  2LRP A;  2PAE A;  2BWC A;  2W1U A;  1JYW A;  5J7M A;  1H9W A;  5JR7 B;  2BNO A;  1UMH A;  4YGC A;  3GZT B;  4N53 B;  4CDU C;  1H1A A;  5FPB A;  1MAC A;  1DQ0 A;  1W8N A;  3PUQ A;  3I97 A;  1HRI 2;  4Z07 A;  1RUG 2;  1H1I A;  3DKQ A;  5J98 B;  5A7S A;  2PHF A;  4Q4Y 2;  4F8A A;  4HSJ A;  2FBE A;  3ES4 A;  3IM0 A;  3AK0 A;  1D0G A;  3ILR A;  4HMZ A;  1O59 A;  5FYV A;  1H6Y A;  2HWD 2;  3THT A;  1CAV A;  2HEV F;  2FQP A;  4XJA A;  5FLJ A;  4FPO B;  3T2Q A;  3OBR A;  4R9B A;  3USU B;  3GCW A;  1V6J A;  5GLT A;  1PO2 1;  5FV3 A;  3ZFF C;  2WN3 A;  1NE4 A;  2MEV 2;  2Y60 A;  3OTF A;  4UBH A;  4I30 A;  4JVA A;  3DN7 A;  3VKF C;  5EXO A;  1SCR A;  3ZIW A;  1ZRE A;  2VXR A;  4LBQ B;  4GAL A;  4RQP C;  3LQC A;  2JWP A;  3V65 A;  4Y5S A;  3VBU C;  3RS6 A;  3IKW A;  3K3N A;  3I2G A;  3SCH A;  2VOK A;  4E2S A;  3E6B A;  3LEM A;  5CYY A;  5KC5 A;  1TVG A;  4Q0V A;  1G9B A;  3O5S A;  3VBO A;  4YW1 A;  3III A;  1PIV 2;  1GZ9 A;  4NO4 A;  3ZSJ A;  4CDX C;  4E4S A;  4CUA A;  2BQP A;  4OHY A;  1BEV 2;  1VBD 2;  4AHX A;  1OOP B;  3HQR A;  2G4I A;  4LKE A;  1T6B X;  4OFG A;  4W65 A;  1WME A;  3OYW A;  2E7T A;  3ZYP A;  3AP6 A;  4DQA A;  2AR6 A;  5GLZ A;  4Y1U A;  1PO2 3;  3NAP A;  1MR5 A;  1MEC 1;  4H7M A;  4AVV A;  1J3P A;  4Q29 A;  3J8F 2;  4CSW A;  1VBA 1;  5CFC A;  4YRD A;  3OUJ A;  4NIH A;  1QJY 3;  5FY0 A;  2Y6H A;  1NUK A;  3KHC A;  2EAA A;  1FMD 1;  3A0K A;  1WCD J;  2GP3 A;  3B69 A;  3LDK A;  5C7G A;  2R0H A;  1RVF 3;  4MH0 E;  3ZDS A;  3ZMN A;  3OPW A;  3ON7 A;  3DKW A;  1W0O A;  2PLV 2;  1RUD 2;  5FZB A;  3GCX A;  1LKN A;  3OSD A;  1NCR A;  4RHV 1;  4JTO A;  4B7E A;  1BHG A;  4Y22 B;  1LED A;  4Y20 A;  3H8O A;  1EV1 1;  4Q1P A;  4PF5 A;  4QX8 A;  1RYY A;  3TWI A;  2AZ5 A;  5DUV A;  2CGN A;  1S0F A;  2ZJC A;  2K46 A;  1MEC 3;  1H1M A;  3CF6 E;  4MXW B;  3VBS C;  4Y4Y A;  5K8S A;  1YQ8 A;  1VBA 3;  1DQ4 A;  1XYO A;  2VVD A;  3C2U A;  5DAW A;  1Q8V A;  3T2P A;  4FPL A;  1FMD 3;  1A8M A;  1R09 2;  5J09 A;  4JZR A;  1N1V A;  4BZ4 A;  5EWS A;  4J6G A;  1KD7 A;  4PBO A;  2W2I A;  3AP5 A;  4L97 A;  3H3U A;  3ALQ A;  2QQO A;  4OMD A;  2JXA A;  4BWO A;  5KXD A;  3AKQ A;  2YDE A;  4JDO A;  1NA1 B;  1F2N A;  1GFF 2;  4JGZ C;  2BZD A;  5EZW A;  4B4Q A;  4XJU A;  1C8M 2;  1EYB A;  5FPZ A;  1GZC A;  3MV1 1;  1RUG 3;  4CUG A;  4LO5 B;  3A7Q A;  3MIE A;  2RMU 1;  3JB8 A;  1ZZ9 A;  1SLL A;  4OUL A;  3IPV B;  1DGW A;  1AR6 1;  1LOB A;  1PGW 1;  4GWN A;  2WLP A;  3KT4 A;  3SCF A;  3ZN5 A;  5IK8 A;  4QB2 A;  1A6C A;  2ZGK A;  3IN9 A;  3RFR A;  3VLB B;  2Q5T A;  3ECQ A;  1PM7 A;  2D6L X;  1E5S A;  1PO1 1;  1GU3 A;  5F8P A;  5EV7 A;  4YG3 A;  4R52 A;  5B2G B;  4NII A;  2YXS A;  4WM7 C;  4DIN B;  1HXS 2;  2B4K A;  4CDU B;  3RMX A;  2WQZ C;  5FP8 A;  3ZXG A;  1SBE A;  3DCQ A;  5FK8 A;  4YZ4 A;  1XE0 A;  4HKW A;  4K3U A;  2YBK A;  2WNV A;  3W5M A;  1A8D A;  2JIJ A;  4FFF A;  1NXM A;  3KVA A;  2Q1Z B;  4M3C F;  3RI9 A;  1UXX X;  4O65 A;  1W0N A;  1MS0 A;  2HKX A;  4UFK A;  2XHN A;  3CEW A;  4JKM A;  1KDK A;  4AVB A;  3VB9 A;  1AVB A;  2FDJ A;  2RJ2 A;  2RMU 3;  3A22 A;  2R7E B;  3AJZ A;  3MFC A;  1BZW A;  3NO8 A;  1KGY A;  4YW3 A;  5FZ6 A;  1RUF 1;  1H8V A;  2DBI A;  3IDB B;  1AR6 3;  3WUD A;  4LUM A;  2ADD A;  1ULG A;  4EJR A;  1BEV 3;  1VBD 3;  3X29 B;  4BJ0 A;  1W3V A;  2O1Q A;  4XUQ A;  1Y43 B;  3ZFF B;  1OFN A;  1CQ9 A;  1WGP A;  5LAS A;  3NJV A;  2GMM A;  1PO1 3;  2RR1 2;  4L11 A;  2G9G A;  1Y3T A;  1Y9G A;  3MFA A;  1TG7 A;  1B35 A;  4PI2 A;  4RQP B;  2ZPX A;  1ZYB A;  3J8F 3;  3QLQ A;  4M4P A;  5FK7 A;  3VBU B;  3O1M A;  2AEZ A;  5K0U A;  2KXL A;  4A3Z A;  2YRO A;  1AR9 2;  2DYC A;  4IER A;  1GAN A;  3ZYG A;  5LBF A;  1GZW B;  2W1S A;  4PQQ A;  4NPM A;  5LY2 A;  4JHT A;  2PLV 3;  2LW8 A;  4Q0U A;  1RUD 3;  5A1L A;  1AR8 1;  5AC9 2;  1PNF A;  3ELN A;  4NJ4 A;  5C5U A;  2A6Y A;  3SCG A;  1UO9 A;  2R49 A;  2VZT A;  3TEW A;  2VNV A;  5DDJ 2;  1RUF 3;  4RGG A;  2ETE A;  4S2H A;  1FAT A;  1UY0 A;  2GH8 A;  1FPN 1;  1AJK A;  1Z7S 1;  5FYT A;  1LHV A;  1ODN A;  3I54 A;  4EE2 A;  1XQN A;  4QX5 A;  5IHR A;  4FP3 A;  2BPA 2;  3KGL A;  4CE8 A;  4CYD A;  4D0Q A;  5FYS A;  2V4A A;  2MHF A;  1W6N B;  4O9G A;  4LK7 A;  4Q4W 2;  2UWC A;  5ACA 2;  4CCK A;  2XB6 C;  3Q8F A;  3R0R A;  4QGN A;  3MBW A;  3PIG A;  4HG6 B;  1YYN A;  4GMP 0;  2O14 A;  5C9A B;  3V64 A;  4LO6 B;  3OUI A;  4DNY A;  1JYV A;  4P9I A;  5HCA A;  1VPH A;  2YV8 A;  3LKJ A;  2WII B;  3GBW A;  4BK5 A;  1IGO A;  4GWI A;  4FVV A;  4OZX A;  2ZMK A;  2E7A A;  3UNP A;  3WSO A;  1I5P A;  2JE8 A;  4K8F A;  3HN1 A;  4AFM A;  5C3S A;  3AFK A;  4XBQ A;  3DYM A;  2JG8 A;  4A45 A;  4YG0 A;  1QNY A;  2I2S A;  3VDD C;  2VMH A;  4RGA A;  2HWF 1;  4TN7 A;  3JBG 2;  3VBS B;  2WWS A;  2EIB A;  5F3G A;  3WDW A;  4LKS A;  4CRQ A;  4P14 A;  2C5D A;  2OUJ A;  3GBF A;  3H8U A;  1TE1 B;  1SMV A;  3DYP A;  5FO7 B;  2WFP A;  5FLI A;  4OI0 A;  5DG1 A;  1AHS A;  3ACH A;  3F2Z A;  1OD5 A;  1AX2 A;  1JH5 A;  1LGC A;  1YJK A;  3HWJ A;  2JDA A;  3VKL A;  5KHK A;  4Q4X 2;  5FLH A;  5ISL A;  2PQS A;  3AL6 A;  3FFZ A;  4YM3 A;  1PM4 A;  3O1S A;  2QQU A;  4K40 A;  4ASK A;  3DPR C;  4WV8 A;  1POQ A;  2R06 1;  4ZU4 A;  5FPU A;  1KJL A;  1PZ8 A;  1NQD A;  3PHM A;  2VUJ A;  4Z8B A;  1EUT A;  2WT2 A;  4GH4 A;  2RM2 1;  2OYZ A;  3TYJ A;  3TBD A;  1Q8Q A;  5L7O C;  5C8W A;  1PVC 1;  4OHW A;  3ILN A;  2ZX0 A;  5FXV A;  1VMF A;  2YGL A;  3I3D A;  3RZL A;  1IQA A;  4Y1X A;  5GZG A;  4KQ7 A;  2VAU A;  3I2K A;  1GNZ A;  2QQI A;  5KR7 A;  2D43 A;  4KG0 A;  5GM0 A;  2XOM A;  2WZR 1;  4LUK A;  5FBJ A;  2RDN A;  3H42 B;  2XH6 A;  2WQ8 A;  2X05 A;  1O3T A;  3ST7 A;  2VCC A;  1O4Z A;  4WM7 B;  2XLF A;  3ZM8 A;  2VVF A;  1JOJ A;  2DCK A;  3FE5 A;  3MPB A;  4BU2 A;  2RR1 3;  3NJY A;  4AEK A;  2W68 A;  5C8C C;  3WDT A;  3WNO A;  1I3H A;  1EY2 A;  3AMN A;  3POB A;  2XDV A;  4FFI A;  5FPA A;  1V6O A;  2IUW A;  4OQ8 A;  5GZE A;  3N7M A;  4IXL A;  4R8H A;  5C3R A;  5JPM B;  2A3W A;  4ET7 A;  3D3A A;  3DEC A;  4YW7 A;  3ZYF A;  1DHK B;  1LR5 A;  1PVC 3;  3H3Z A;  3P3P A;  2IXH A;  5LCW L;  5IT6 A;  2J22 A;  4IV1 B;  3RZH A;  4NAM A;  4NHM A;  4FPF A;  2P3Y A;  4XHB A;  2EIG A;  1ST8 A;  3U0Z A;  2OQ7 A;  5FZO B;  4FCA A;  2GNB A;  2YU1 A;  1O4Y A;  3WR0 A;  1HJG A;  2E26 A;  3B00 A;  4BQW A;  1RMU 1;  1QEX A;  5FRA A;  3OBT A;  2D5F A;  3WDV A;  4RYD A;  1W8F A;  2R04 1;  4KL1 A;  1QKQ A;  3EHK A;  4B1L A;  5A70 A;  1YQ6 A;  1OKQ A;  3FHI B;  5ACA 3;  1RXG A;  2VQ0 A;  4CTE A;  5FWE A;  4XUT A;  5I0T A;  3AZX A;  2VOW A;  4AI0 A;  1G9D A;  4YM2 A;  1ULF A;  3D8C A;  4LT5 A;  1QOO A;  2OT7 A;  2PEL A;  4I01 A;  1YCI A;  1JI6 A;  4M3C A;  4RS5 A;  5L9B A;  1O3S A;  4IEY A;  5EQU A;  2ZCW A;  1MS3 A;  2R16 A;  1JZ4 A;  2V73 A;  3NJZ A;  5C3P A;  2VME A;  2GZW A;  2TUN A;  2QQV A;  2C24 A;  1W99 A;  2E53 A;  1CPM A;  4NOT A;  3O1T A;  4BDV B;  2FD8 A;  4ZHN A;  3LIH A;  2WAB A;  1R08 1;  2ET1 A;  4KWU A;  2KD7 A;  5FY8 A;  2DVA A;  2R04 3;  4MGI E;  3ZIX A;  3FUQ A;  3N9L A;  3SH3 A;  1MS4 A;  1OUS A;  3KM5 A;  3MEP A;  4KH9 A;  3HEI A;  4GXL A;  5KBF A;  3IT8 A;  4UFJ A;  1W28 A;  4L2N A;  4Q4X 3;  1FV3 A;  2RJL A;  2VOV A;  4NRO A;  1ND2 C;  2OII A;  4LK6 A;  4XMA A;  3WUC A;  4NHX A;  2YPD A;  4YM0 A;  1UY4 A;  1L3J A;  3ZSM A;  4R9C A;  1G86 A;  1TME 2;  5B4N A;  1NZC A;  2VBB A;  1UYZ A;  1WBF A;  2CHH A;  3HBZ A;  4UYB A;  3IMN A;  1JHJ A;  4COV A;  2NLR A;  5EJ1 B;  3VDD B;  2BGP A;  3MUZ 1;  3PVN A;  4QB1 A;  4WZC A;  4BLJ A;  4AVC A;  1CWP A;  3B01 A;  4XQ4 A;  5EFU A;  2Q8E A;  2ADE A;  4K1Z A;  3RG0 A;  3T0B A;  4BHP A;  2ZHK A;  2R1D A;  4SBV A;  4CP9 A;  1CIY A;  1DBN A;  4YAR A;  3GAL A;  1VB2 A;  1R08 3;  3T2O A;  1UYY A;  3O1P A;  4Q27 A;  2AYH A;  1XE7 A;  1OKO A;  1Y4W A;  2J42 A;  2WSV A;  1CES A;  2VL4 A;  1DZQ A;  4C0H A;  5F5I A;  2ZZQ A;  4XF9 A;  5JAX A;  5F2S A;  1F4H A;  1O5U A;  1NE6 A;  2WO7 A;  3DPR B;  3KZ4 C;  3UGG A;  3V0B A;  4XJ8 A;  3U4X A;  2FCT A;  2A75 A;  1AL2 1;  2UU8 A;  4YPJ A;  1BMV 1;  3H3L A;  1IPJ A;  5L7O B;  5LA9 A;  1N3O A;  4WVM A;  3PIJ A;  1VRH 2;  2NP0 A;  2Y6K A;  4CP0 A;  3Q8C A;  3THD A;  4AEJ A;  1CAU B;  2J1S A;  4NRM A;  1RTV A;  4R9D A;  3D0S A;  5T5O A;  3VBF C;  2ZGQ A;  5FY4 A;  2DWR A;  4FI9 A;  4KU8 A;  3UL2 A;  1EUU A;  2KR2 A;  4YGE A;  2G9Z A;  2W08 A;  3R4U A;  3B9C A;  4QKD A;  1CON A;  1PGS A;  1WW5 A;  5H9P A;  4ZU7 A;  2QNK A;  3VBR A;  5ABJ C;  4IND A;  5FMO L;  2OZJ A;  2I07 B;  3VZM A;  2MNG A;  1W6O A;  3SIS A;  5C8C B;  2ZAA A;  3BCW A;  3K4A A;  3W20 A;  1DU3 D;  1ZZ7 A;  3AFG A;  2HWB 1;  1RUI 1;  1AL2 3;  3B93 A;  1JYI A;  2A7A A;  3IDA A;  3ZYB A;  4X8N A;  1CGP A;  3OCP A;  1VBC 2;  5FPL A;  2JDZ A;  2W5F A;  1SHW B;  1ZZC A;  4LXL A;  2P3K A;  4CUC A;  2HWE 1;  2VUC A;  3WZ1 A;  2VEC A;  1OF3 A;  5IAV A;  4DS0 A;  3RWN A;  3AMP A;  4CEW A;  2VG9 A;  5FYB A;  4NVP A;  3IAQ A;  3FLT A;  2V09 A;  4P5Y A;  2UY9 A;  4XDO A;  1S55 A;  1LNS A;  1HV0 A;  3WF1 A;  4Q5O A;  4A6S A;  1OPO A;  1HB3 A;  1CJP A;  5FZ4 A;  4FPH A;  3ITQ A;  5BNO A;  4XOG A;  5FCC A;  1XB9 A;  3DYO A;  4LBO A;  2Y26 A;  2RS5 2;  2YC0 A;  3KQ4 B;  4LE4 A;  5JXI A;  4ARX A;  4JKK A;  3OY8 B;  1S0E A;  3LSD A;  4XEZ A;  1P8J A;  3C3V A;  2HWE 3;  2XLG A;  1ZRC A;  1VIW B;  5I8T A;  2IZW A;  1G6N A;  4XAC A;  3D82 A;  1I9R A;  4MHR A;  5DAB A;  3HBK A;  1AR7 2;  2VNO A;  1H6X A;  3APB A;  4B1M A;  1CAW A;  1FNZ A;  5JWP A;  2A70 A;  1AUY A;  1O3Q A;  3MUY 1;  4IEQ A;  5EP9 A;  1TME 3;  2MPF A;  4UF0 A;  3J7L A;  1C1L A;  2WNU A;  2ZX1 A;  1W2N A;  3WF2 A;  1HJF A;  2CV6 A;  5DXD A;  5I0D A;  2YZ4 A;  3SIT A;  4XFI A;  3GF6 A;  4FAG A;  2JDP A;  2BNN A;  2DTW A;  5ERL A;  1XE8 A;  4XDP A;  4CUB A;  1SG3 A;  2EID A;  3HNM A;  5KXC A;  1ND2 B;  2YFZ A;  3D4K A;  3L2H A;  4LHL A;  4L9B A;  4RA0 A;  2DCT A;  4QQL A;  4FPC A;  1CAX A;  3O12 A;  5A6Y A;  4YNI A;  5CAD A;  2YB7 A;  2RJK A;  4AFD A;  1QJX 1;  4UAP A;  4QQ2 A;  5GKA C;  5LZ6 A;  4YW4 A;  1M06 G;  1VRH 3;  3ORJ A;  4W8J A;  2VTX A;  5HI0 A;  3KVB A;  1WW6 A;  4PDW A;  4JGY A;  4GZ9 A;  1QXJ A;  3VBO C;  5JXJ A;  1RHI 1;  3I4I A;  1MZE A;  1K5J A;  1W6M A;  1NZI A;  1JN2 P;  5GZD A;  4DMI A;  5JUV A;  5F32 A;  1VBB 2;  2J1A A;  4QD2 A;  2BW8 A;  2NQY A;  2XJR A;  3WF0 A;  3NAP C;  2EIE A;  1ZRR A;  4XF0 A;  4FP2 A;  2JDY A;  1PVX A;  5CFC C;  4P02 B;  4AGR A;  3MLK A;  1W8W A;  1UQX A;  3PLQ A;  4CA9 A;  4D3W A;  3ZYJ B;  5A7W A;  4LO7 A;  4LHS A;  1YIP A;  4C91 A;  2VNR A;  2GDF A;  2TNF A;  3AP9 A;  1HW5 A;  1TMF 1;  3M4F A;  1RHI 3;  3KMH A;  1NCR C;  3K2O A;  4GA9 A;  5E88 A;  3W58 A;  4ZS3 A;  4W6X A;  1M4W A;  5L9V A;  4YW6 A;  1BLZ A;  2VW2 A;  3VD7 A;  3UKV A;  3ZR6 A;  2ZGN A;  4COY A;  2IXK A;  1VAM A;  4QQO A;  5IJR A;  4F3J A;  1JZ2 A;  3PDQ A;  4XF3 A;  4XXA A;  5E89 A;  1W0P A;  1X8E A;  3T08 A;  1CZT A;  2JDM A;  4CDQ B;  1L7Q A;  3J4U H;  3R6S A;  3PVO A;  2JE9 A;  4GMP 1;  2RS3 2;  3WQ7 A;  3GM8 A;  2XKO A;  4R9A A;  1GR3 A;  2RS5 3;  1H8T A;  4MGK E;  2HWC 1;  3ZPY A;  1XNK A;  4JKL A;  3ZYR A;  4AE2 A;  5LEK A;  5FXW A;  1IKQ A;  1SAC A;  4QKN A;  4B8E A;  2FDK A;  2IC1 A;  1YLL A;  1OSG A;  4QWN A;  4HAN A;  4LHN A;  2VM9 A;  2A3X A;  1UN1 A;  3GZA A;  5JSP A;  3ZN6 A;  4A42 A;  2R07 1;  4GUL A;  3ZXD A;  5KHG A;  2P37 A;  4D6R A;  5CG9 A;  3RYK A;  1JZ8 A;  2H6B A;  2A1X A;  3BIE A;  3M3I A;  1BBT 2;  2IVI B;  3MW4 A;  4XUP A;  2WBK A;  1W9W A;  2JDK A;  3VDA A;  4DUV A;  1V0A A;  1HQN A;  3QAC A;  2RS1 1;  4GMP 3;  3MLL A;  4CCE A;  1LHU A;  4COW A;  2R32 A;  3FLR A;  4RGK A;  3MIC A;  4HVO A;  1IZ3 A;  1LOF A;  1ASJ 2;  2HWC 3;  2VR4 A;  1R1Z A;  3ZXA C;  4CCL A;  1YRZ A;  3ZSL A;  4GWM A;  2ZXQ A;  3E5Q A;  2CU5 A;  4MYE A;  3SHR A;  4UFI A;  1C3H A;  4HK9 A;  1WA6 X;  1YEW A;  4XC9 A;  3KHB A;  1W2O A;  1LOC A;  5JZG C;  2W9X A;  1HRV 1;  1AYN 1;  3CJI A;  3ZSK A;  1QMJ A;  1WCQ A;  4G4F A;  4HPK A;  2WNV C;  4E27 A;  4QPI A;  1SLC A;  3LE0 A;  4V2V A;  1ZZB A;  1O4T A;  1UPS A;  3I2H A;  4I09 A;  4KMQ A;  5JIU A;  2XON A;  1GZT A;  1MS1 A;  1MZ6 A;  2EAL A;  2PAM A;  3MGU A;  4M4R A;  5A33 A;  1PK6 A;  3RDI A;  3Q9O A;  5FKB A;  3BU0 A;  4NIG A;  2VW0 A;  3WNX A;  4ASL A;  4QX2 A;  2RS1 3;  2UY8 A;  3C7F A;  4M00 A;  4CCO A;  4IEP A;  3KV9 A;  5EJZ B;  3RZJ A;  2ZGT A;  1O6U A;  3H7Y A;  3ES1 A;  2FHR A;  5JR2 A;  2WYF A;  3GJA A;  3ZSE A;  1W9T A;  2A73 B;  2DVD A;  1W39 A;  4YW5 A;  5KXE A;  4RR3 C;  1RUH 1;  4NRQ A;  2CGO A;  4CDW C;  3U4S A;  1B35 C;  2RE9 A;  4QT6 A;  3P6B A;  1NLS A;  4KI5 M;  1RUE 2;  1SFY A;  2VZQ A;  1U5Y A;  3DGT A;  4YVS C;  5FJH A;  4FQ4 A;  4YFZ A;  2PXJ A;  4FO9 A;  1AYN 3;  1HRV 3;  3V0A B;  2ORX A;  2W94 A;  5APA A;  3VKN A;  2C4X A;  3VBO B;  4XBL A;  1DLL A;  2V4V A;  5EYX A;  5J37 A;  3E97 A;  3NV2 A;  2JB4 A;  3I49 A;  5FZ0 A;  5HXV A;  2FDH A;  1UXZ A;  1S0C A;  3G7D A;  3OBZ A;  4WM8 C;  4Q8K A;  3LEG A;  2TBV A;  5GLW A;  3LA7 A;  2BDR A;  4QDS A;  4D94 A;  1V6L A;  3BIW E;  4FPG A;  3NAP B;  1DDL A;  4FOW A;  1AXK A;  5C70 A;  3SH5 A;  4FPY A;  5FY5 A;  5GZC A;  3BGA A;  1W8T A;  3VZK A;  4D8M A;  4H3W A;  1VJ2 A;  3I8T A;  1QJY 1;  1RUH 3;  1WD3 A;  4Z82 A;  3MV0 1;  3KV6 A;  4ERO A;  2XUM A;  1IQD C;  3PU3 A;  1POV 0;  1RVF 1;  2EXI A;  4GWJ A;  2RS3 3;  3N7K A;  3ZN4 A;  4J1X A;  5F9T A;  3RZK A;  1OH3 A;  1ONA A;  4BME A;  1ZZ8 A;  5F1R A;  5DQ0 A;  5IVJ A;  1GBG A;  4CPB A;  2WUH A;  3HJR A;  1MQT B;  4QU2 A;  5KWR A;  2K0G A;  3FHA A;  2ERF A;  2C6S A;  1XNA A;  2SLI A;  4BQ4 A;  4E4H A;  3WP6 A;  2DVG A;  5I8S A;  4QXK A;  2BBA A;  3BTZ A;  2D93 A;  4N53 A;  2JG8 C;  1NY7 1;  3OD0 A;  1GP5 A;  4D6S A;  1JYC A;  1GOF A;  2X5I C;  4HLT A;  1CN1 A;  3P5B A;  4Z2A A;  4HET A;  2B45 X;  4QXC A;  2HEY F;  2WFF 2;  4AL9 A;  1G9F A;  2ZX4 A;  1AYM 2;  1Y9Q A;  1ZBA 1;  3U11 A;  1Z78 A;  3BN6 A;  4KWK A;  4LO4 B;  3TRS B;  1GOG A;  1ND3 B;  4NPL A;  3ZMO A;  3OG2 A;  3WG1 A;  3HD8 B;  1MZF A;  3N35 A;  4J25 A;  3FN9 A;  4ORF A;  4E2G A;  4EWD A;  3KLS A;  4FOQ A;  4XUO A;  2DBN A;  4DXR A;  5C3O A;  3USU A;  4MGZ E;  3RPQ A;  4CXY A;  1ASJ 3;  4Q0S A;  1KRI A;  4GB3 2;  4CPB D;  3DXT A;  5BV6 A;  3ZKY A;  1J3R A;  2BGC A;  4YVW C;  4U36 A;  4XYX A;  1HN1 A;  1F9K A;  5IK4 A;  2FMD A;  1HRI 1;  3BB6 A;  3BYW A;  4LBQ A;  1RUG 1;  4QDR A;  4C1X A;  5FOJ B;  2J1T A;  4UXA A;  3TEZ A;  4Q4Y 1;  5BNN C;  1YQC A;  2NPI A;  1BQP A;  1WW4 A;  3O7O A;  2D98 A;  1JOP A;  4OUM A;  2HWD 1;  4GKX A;  5LA0 A;  3TNQ A;  1CPN A;  3PNA A;  5T55 A;  2J1V A;  1GNY A;  1ZBA 3;  3AKT A;  4NHL A;  3ZXK A;  4F7Z A;  1FV2 A;  5FQ0 A;  1K5M A;  4PF1 A;  1OOP A;  4LPL A;  1AX0 A;  5FYU A;  2MEV 1;  5LW9 A;  3WG4 A;  1HIX A;  1X9P A;  1H4G A;  1YHF A;  1HKD A;  4TXW A;  5FWJ A;  3WIN E;  5JZG B;  3FC0 A;  2AC1 A;  1SDW A;  4O61 A;  2ATF A;  2FMY A;  1SDD B;  1JOB A;  1RUE 3;  2WNV B;  1HRI 3;  5IVV A;  3VD5 A;  2Y8K A;  1QIQ A;  3IIA A;  3NST A;  2AH2 A;  4LBQ D;  2YYO A;  4Q4Y 3;  3VKO A;  3WHT A;  4ZXE A;  2B39 A;  1J84 A;  1W03 A;  1WZX A;  3ACG A;  3VBH C;  1HLC A;  1PIV 1;  1UZY A;  3RI8 A;  3THP A;  2HWD 3;  4YZ3 A;  1Q43 A;  3MIG A;  3SMH A;  1BEV 1;  1A3K A;  1VBD 1;  4QHO A;  3GBG A;  1T2X A;  4QPG C;  1C8N A;  1RC6 A;  1LHO A;  1Q8P A;  1W9Y A;  2V72 A;  3VL8 A;  3RVH A;  3MYX A;  2HBT A;  2BJS A;  4Y22 A;  4A2U A;  1UAI A;  2LM3 A;  4BM8 A;  1UX7 A;  4BCU A;  4RR3 B;  2D5H A;  2MEV 3;  4CDW B;  3J8F 1;  3FHQ A;  4AEM A;  1YXW A;  4I2O A;  1LGN A;  1Z7S 2;  4P5H A;  1LU1 A;  4YVS B;  1NAE A;  1ULE A;  2QQM A;  3WCS A;  3LD8 A;  4MHU A;  1PGL 2;  1FNY A;  1MS9 A;  4O9E A;  3VV1 A;  2WRA A;  4IE7 A;  1UOB A;  5JXH A;  2ZEW A;  5FP3 A;  2E9Q A;  1K42 A;  2PHD A;  2Q8C A;  2PLV 1;  3CLP A;  4P08 A;  1RUD 1;  2ID4 A;  3LAG A;  5LA2 A;  1RED A;  1FYU A;  4MLO A;  3WP3 A;  1D4M 2;  1PZ9 A;  1PIV 3;  3GZE A;  1R1A 2;  4RS5 C;  4AED A;  4WM8 B;  4YZ2 A;  2BEO A;  1KS4 A;  3TOJ A;  5LA1 A;  5FXX A;  3U75 A;  4BQ3 A;  4XTM A;  3M70 A;  4AHY A;  3NRU A;  1NA1 A;  4XF4 A;  2NZ9 A;  2BVV A;  3OBA A;  1OF4 A;  3W9A A;  1RUJ 2;  2WS9 2;  1IG0 A;  1Y7B A;  5FFO C;  2RV9 A;  3S6P A;  2ZS6 B;  2OPW A;  2VZS A;  5IK7 A;  4H14 A;  3LDB A;  5GZF A;  4DB5 A;  1JS9 A;  4XAB A;  3IPV A;  2CWM A;  1Q8S A;  1RB8 G;  2FZ2 A;  3GNE A;  5D8A A;  4CDX B;  1BK0 A;  5JOW A;  4UW3 A;  2XBO 2;  1DGR N;  3MW3 A;  2WWJ A;  4GB3 3;  2NMN A;  4AWD A;  2PN5 A;  2JG9 C;  1STM A;  4P9X A;  4XQD A;  3IBM A;  3EQE A;  1TNR A;  3RJ2 X;  3SQO A;  3ZR5 A;  2I45 A;  2JG8 B;  3H7J A;  1X36 A;  2W95 A;  1C8M 1;  1W04 A;  2W91 A;  2X5I B;  2LAL A;  3IDC B;  2KA3 A;  5HV4 A;  2DFB A;  5CA6 A;  2XHK A;  4A44 A;  4KWL A;  1KXG A;  2Y38 A;  1MVQ A;  4MV2 A;  2OX0 A;  4MGS A;  5FPV A;  5T50 A;  5A3P A;  1AX1 A;  2XXZ A;  4Z2W A;  4KBZ A;  2ZGP A;  3I3B A;  4Q0P A;  1LOG A;  1Q8O A;  1W8U A;  4Q2F A;  5IFT A;  3B3Q E;  4RD7 A;  1R09 3;  4LIT A;  4CVU A;  5JIA A;  3KCX A;  2IXJ A;  4LBN A;  3ZFE C;  4G9S B;  5A7N A;  4IV3 A;  3ZFF A;  3KWV A;  1O3R A;  1HXS 1;  4YVW B;  3TEY A;  2XGX A;  4P9Y A;  1IPS A;  3P1I A;  4ZZ8 A;  3HQX A;  4CU6 A;  3M3O A;  4RQP A;  2ZGS A;  4LR4 A;  4PLM A;  3PME A;  3U07 A;  5BNN B;  3S57 A;  1NLR A;  2D97 A;  1C8M 3;  3VBU A;  3WP5 A;  3U10 A;  1GMM A;  2J1U A;  3K46 A;  4LE3 A;  4AQ6 A;  2VOT A;  1GZW A;  3QCW A;  1UZ0 A;  3JD7 2;  2ORZ A;  1D2S A;  3ETQ A;  4Q4V 2;  1HQW A;  4XE9 A;  1YI9 A;  4AYU A;  1WUV A;  3V56 A;  1BVP 1;  2RR1 1;  5EPA A;  4AQ2 A;  1LOE A;  4WZF A;  5HV0 A;  1Y9M A;  5FZA A;  1JU4 A;  3LOB A;  4CP2 A;  2GH2 A;  4JGZ B;  4K6B A;  4XZU G;  1HXS 3;  4QAW A;  1QU0 A;  1NXD 1;  4Q26 A;  5AVP A;  2XL9 A;  1LB2 A;  3EYP A;  4IEU A;  1W6N A;  2ZZJ A;  1AR9 1;  1LOD A;  1S0D A;  3CJX A;  1DYP A;  4I0A A;  4W6Y A;  2PAK A;  2E63 A;  4LMF A;  4LUL A;  4RSU A;  4ZS2 A;  5F39 A;  4CCM A;  1XXN A;  2JEM A;  5A1F A;  3VBH B;  1WMF A;  4Y33 A;  4DEV A;  1BVV A;  5BNP C;  2W1W A;  5C9A A;  4UFH A;  2VGD A;  2Z5W A;  4XF1 A;  3RSJ A;  5AC9 1;  4ASM B;  4A7Z A;  1D4M 3;  4QPG B;  4DFS A;  4H55 A;  1ULO A;  1C4R A;  1R1A 3;  5DDJ 1;  3POS A;  4W50 A;  1UWW A;  2GC1 A;  5A32 B;  4QX1 A;  4BA6 A;  5BY5 A;  3ATG A;  5A3U A;  4CEW C;  1XNC A;  1FXZ A;  1RJ7 A;  4DY3 A;  1W9S A;  1MS8 A;  3WG3 A;  4TLG A;  5JVV A;  4TZD A;  2CWS A;  2A6V A;  3BPS A;  4Q4W 1;  5ACA 1;  3T0D A;  3VBS A;  2GSY A;  1W3X A;  2WS9 3;  3T1M A;  3BVC A;  3JCI A;  1G8W A;  1YI7 A;  2OPK A;  2OZ6 A;  1AR9 3;  4I3G A;  5F2W A;  3SLI A;  3EMR A;  4ZZ5 A;  1MS5 A;  2EF6 A;  3PVE A;  1UY2 A;  4KGG A;  1COV 2;  5AC9 3;  2XBO 3;  1OQ1 A;  3BOD A;  4XMI A;  4EN8 B;  1HN0 A;  1UIK A;  5DDJ 3;  1UZV A;  1NG0 A;  1OVP A;  2BNM A;  2WO3 A;  1CX1 A;  3NNJ A;  4UWD A;  4AVS A;  3JBG 1;  4TTG A;  3AMM A;  2QZ2 A;  2WNU C;  5F5C A;  1XBF A;  3HT1 A;  4WVZ A;  4Q4W 3;  4Y5T A;  2QQJ A;  5DZF A;  1DF0 A;  1OVS A;  2DU1 A;  2B9U A;  4JTN A;  4NWW A;  2XVL A;  1WD4 A;  4Q4X 1;  4COU A;  3NNF A;  1XYN A;  1SLI A;  1U5Z A;  2B8M A;  2GND A;  4MUV A;  1FX5 A;  1WCS A;  2OXB A;  2DTY A;  4YM1 A;  1LRH A;  1ZBE 2;  3POE A;  2PA7 A;  1VP6 A;  2CYF A;  3BI3 A;  1UW8 A;  3H0O A;  1UY1 A;  4HZF A;  4ZXK A;  3VHN A;  2JG9 B;  3POI A;  4Y1V A;  4WM7 A;  5GLV A;  2ARX A;  3E6C C;  3B94 A;  1VAL A;  3OF1 A;  1JZ6 A;  3KS7 A;  3RZM A;  1HV1 A;  2XJS A;  2D6P A;  3OD4 A;  1W6Q B;  1SPP B;  3UET A;  2PTM A;  4B29 A;  3WY6 A;  3J7H A;  1QH7 A;  3JBG 3;  4AVT A;  1X50 A;  2P6C A;  4IE4 A;  1QH6 A;  1UOF A;  2Q4S A;  2EAK A;  4GD4 A;  4JGY C;  4PDW C;  1FI2 A;  1WCU A;  1OLM A;  3T09 A;  2ES3 A;  5ANQ A;  2VMI A;  4BIF A;  1U5I A;  3E6D A;  1YJL A;  4RL7 A;  4IGP A;  4IV1 A;  4UOJ A;  3VZN A;  4MX3 A;  3KV5 A;  1EPZ A;  4BXS V;  1L7L A;  3ZFE B;  3UJQ A;  4PIX A;  5JOY A;  1GWM A;  1G9A A;  1GNH A;  5H9Q A;  2JD4 A;  2WA4 A;  2W92 A;  1LHW A;  5FZO A;  5FYH A;  3AYC A;  3I2J A;  4TSV A;  2WT0 A;  2DU0 A;  3H8R A;  1D0H A;  2BOJ A;  2WO1 A;  3ENR A;  5FZD A;  4J1W A;  2HWB 2;  1YO8 A;  2AAC A;  3CDZ B;  4EWE A;  1N1T A;  3RZG A;  1QJZ A;  1LUL A;  1S0G A;  3AM2 A;  3WHU A;  2P3I A;  1JYN A;  3JZV A;  1RUC 2;  4EQV A;  1H2N A;  1NLQ A;  2B9V A;  4JHZ A;  5LK7 B;  2DF7 A;  2WIN B;  4JRA A;  5CIS A;  3PUS A;  1VB4 A;  2ZEX A;  4QM9 A;  4WVV A;  3EBR A;  4N43 C;  2B7Y A;  4CEY A;  1W9F A;  4H2A A;  2QVS B;  1FOD 2;  2A6X A;  2BTV C;  2RDQ A;  2K2S A;  5CFD C;  5A3N A;  3ZO0 B;  1S2B A;  2H0B A;  2D44 A;  3MI8 A;  5JSO A;  3O1U A;  1POV 1;  4QQH A;  2SBA A;  4HXC A;  2JKB A;  3RWK X;  3W21 A;  2WN2 A;  1N3P A;  2I74 A;  4P9W A;  1YFW A;  3ZVX A;  4UI9 L;  1J1L A;  2PHR A;  3WVJ A;  5BNP B;  3IMM A;  2RDS A;  4AHZ A;  2VZV A;  3PL0 A;  3H50 A;  3OGS A;  5FZF A;  3TAY A;  5C4W C;  2QQK A;  3HMY A;  4E2Q A;  2UYB A;  4CEW B;  1RJ8 A;  5LWB A;  4BMB A;  1QQP 2;  1DZT A;  2AUY A;  1DGL A;  1JOD A;  2VCM A;  1V6I A;  1WMX A;  1IHM A;  1N3Q A;  2E31 A;  1WLT A;  3CQO A;  5B4X A;  3VDD A;  2XL7 A;  3WLU A;  1QGL A;  1V6N A;  1XOY A;  1GSL A;  3CIH A;  2GP5 A;  2K9Z A;  4BOW A;  4S2D A;  3KT1 A;  5FYI A;  5LBB A;  1SZB A;  1IPK A;  1POV 3;  3NW4 A;  4LQR A;  5E1R A;  3H8X A;  2ZX3 A;  1OLR A;  4Z92 B;  4ATE A;  5JCT A;  5FY7 A;  1KS5 A;  1SFP A;  1W8Z A;  2ZAH A;  4GJZ A;  3HR9 A;  1FAY A;  2D6O X;  2L9L A;  2YG0 A;  1K45 A;  5T5P A;  4X8P A;  4U2A A;  1OFS A;  3DPR A;  3W5N A;  1TME 1;  2N7G A;  4A3X A;  1C28 A;  2O0O A;  3DUI A;  5FRE A;  4AK3 A;  1LU2 A;  1TEI A;  3J26 N;  4NPR A;  1GWK A;  1REE A;  4JX0 A;  4UF0 B;  4IDZ A;  2X10 A;  4ZON A;  3FBM A;  5FY1 A;  5CB7 A;  2WNU B;  1LES A;  3NKT A;  5L7O A;  1G9C A;  3MIH A;  1A34 A;  1UNB A;  3TN9 2;  3LEK A;  4CCN A;  2FDG A;  3ZX7 A;  1CAU A;  1VBE 2;  2XJV A;  3WNP A;  1J58 A;  3AP7 A;  3NV1 A;  1PK6 C;  4MO3 M;  4OHX A;  5H9R A;  4XAE A;  1VR3 A;  3MF9 A;  5JPN B;  5KHJ A;  5L36 A;  4LBK A;  3TEX A;  2VCB A;  2GN7 A;  4XXP A;  3AYA A;  4JQR A;  3ZFG C;  4MXV A;  1DQ6 A;  4AI3 A;  2E51 A;  5IUQ A;  1CAX B;  3AJY A;  3OGG A;  5A3M A;  3A0N A;  3VDB A;  5C8C A;  1YNA A;  2QBX A;  3KF5 A;  3MIB A;  2RG4 A;  3I59 A;  1XJA A;  2EXH A;  4XFC A;  3O1O A;  2Y6F A;  1VRH 1;  2W1Q A;  3O14 A;  4JQT A;  2CDP A;  5GLU A;  3B7M A;  2D6N A;  4AQT A;  4YGD A;  1Z0H A;  3RYP A;  4PDW B;  4JGY B;  3AL5 A;  3FUO A;  5IW0 A;  2C9A A;  3O1V A;  4GJY A;  2VW1 A;  4I3P A;  1S0I A;  3KQR A;  5CZK A;  5IWF A;  5CEH A;  1O7F A;  1QJU 2;  2W0X A;  3MIF A;  3UV9 A;  1XU2 A;  4EYU A;  3ZLI A;  4JAA A;  1ALY A;  4YGB A;  5KHH A;  3UKT A;  5AFB A;  5FAX A;  5M0T A;  2BOI A;  1C1F A;  1QOS A;  1S0J A;  4PCR A;  2Y64 A;  3M3E A;  4AGG A;  3ZPO A;  1FOD 3;  2VZ3 A;  3AZY A;  4OMC A;  1AF9 A;  4ARY A;  4CU9 A;  4DRR A;  3VZO A;  2GC2 A;  4UW6 A;  1H2K A;  1VBC 1;  3WNK A;  4HON A;  3HPN A;  2WAA A;  4IEO A;  5FUN A;  4XAA A;  3RGB A;  1F31 A;  4OYU A;  4LBJ A;  5SV5 A;  3AKR A;  2G1M A;  3OY8 A;  5J3U A;  4FOV A;  4A7Y A;  1PX4 A;  2VJX A;  4KNC A;  3GZU C;  3WQ0 A;  3VUO A;  1K12 A;  4N43 B;  4N9H A;  2ZGL A;  5IVE A;  2DDU A;  1DQ5 A;  1QQP 3;  1YQ2 A;  1UD1 A;  4XJ9 A;  2YPJ A;  2DCY A;  5CFD B;  3U14 A;  2R07 2;  1OA4 A;  2VXJ A;  3VL9 A;  3OPZ A;  1C57 A;  4DEQ A;  5FXZ A;  2RS5 1;  1UYX A;  2IFR A;  1EAH 2;  2YMZ A;  4N90 A;  5G05 L;  1VBC 3;  2HYX A;  4Y24 A;  3UYJ A;  3VHO A;  1OHF A;  3VKM A;  1REF A;  5FYZ A;  1C5H A;  2HJI A;  2VMD A;  1X8M A;  2V5Y A;  4BQ5 A;  4Z1V A;  1O8P A;  3OUH A;  3QD6 A;  5FZK A;  3VBF B;  4YZ5 A;  4E9K A;  2QQW A;  3W59 A;  5C4W B;  2JEC A;  4XZP A;  1JYX A;  3HNB M;  3BUC A;  1AR7 1;  1KQR A;  1UMI A;  3INA A;  3N3H A;  2BV4 A;  5ABJ B;  5K9Y A;  2Z42 A;  1F8V A;  4AQS A;  1AXY A;  1UIJ A;  2ZBJ A;  3KSC A;  2Y6G A;  4NMI A;  3WDU A;  5A3T A;  3N9P A;  1VAV A;  4PJY A;  3KCY A;  2BER A;  2IXI A;  4FOY A;  2FDI A;  4EV0 A;  3POJ A;  3RNS A;  4XFF A;  3USS A;  3BPZ A;  5BUV A;  3VHP A;  2P4E A;  2W47 A;  4HK8 A;  1RUO A;  1RIT A;  2Q30 A;  3RJR A;  3WNM A;  2VZP A;  5IAX A;  1NKG A;  1XND A;  2ZHN A;  1AXZ A;  5FO9 B;  1V9U 2;  1K5M C;  5FY9 A;  1IS6 A;  4Y4R A;  3WCR A;  1CZV A;  2LUW A;  1W6P B;  4IUG A;  4CXX A;  3N9N A;  1AR7 3;  4AHW A;  4BLI A;  1N1S A;  3T0A A;  5CG8 A;  1BK1 A;  3D0J A;  4OZO A;  1ZRI A;  2QQN A;  4H7L A;  4LIV A;  5JDB A;  2EIC A;  4S2F A;  2PYT A;  3EXU A;  4UT5 A;  5DAQ A;  1PMH X;  5BPX A;  5JOX A;  4OUE A;  4EN7 B;  4DXS A;  1ZVF A;  5EHD A;  2GAU A;  2EA7 A;  2NYY A;  3T2T A;  3Q8E A;  2DCJ A;  1E5I A;  1UF2 C;  1YC6 1;  2VZO A;  4HBN A;  3C7H A;  3WQB A;  5J1X A;  3BTY A;  4BXF A;  1IOA A;  2RHP A;  3WDX A;  3ZFG B;  2ZML A;  4JDM A;  2OKX A;  4LNV A;  5A3W A;  4GAZ A;  3THC A;  1AL0 G;  4NN0 A;  5FIX A;  4CP1 A;  3R4S A;  1J59 A;  3K4Z A;  4XIO A;  1OA2 A;  1PO2 2;  3WNL A;  5LEJ A;  2XWB B;  2WYS A;  3S7I A;  3M3C A;  3WDY A;  5F3C A;  5FZ3 A;  3ACI A;  1UU6 A;  3MF6 A;  5FR3 A;  1V00 A;  4AF9 A;  2Y6J A;  3U1X A;  3S5A A;  1LEM A;  1RUN A;  5A6Q A;  4CDQ A;  5JXG A;  3PVB B;  1ZA4 A;  2CSG A;  3M7A A;  2AEY A;  1YFX A;  4IEW A;  2A6W A;  3BTA A;  5DN2 A;  1KEX A;  2JKX A;  3T30 A;  2P6H A;  3SC7 X;  1UU5 A;  2VO5 A;  1CAV B;  5FZL A;  3PJY A;  2FCU A;  3I2O A;  3CBN A;  3GJB A;  4PIY A;  3AYE A;  4K1Y A;  2CAU A;  4AED C;  2V5D A;  4ES9 A;  5I93 A;  1S1A A;  5FMD A;  5FZ7 A;  4D7S A;  1VBB 3;  3VDC A;  4GIQ A;  1KFX L;  1SLT A;  1BKZ A;  3LPG A;  4E4D X;  2D40 A;  1Q3E A;  4XPV A;  1MEC 2;  5BYN A;  1W8H A;  2R0F A;  2RS3 1;  2VTF A;  1VBA 2;  4ISQ A;  3FX3 A;  5T3N A;  5FZC A;  5K0U C;  3PUA A;  5F6L B;  5FOB B;  4MSV A;  1CJD A;  2IVJ A;  1EAH 3;  2XG3 A;  1OQE A;  2OUH A;  1WWY A;  3PUH A;  4OVE A;  3DF0 A;  3C7E A;  4BH9 A;  1FMD 2;  2LRO A;  3HNY M;  5F37 A;  3AKP A;  1GOH A;  2Q1F A;  1CR7 A;  3H1Y A;  3K3O A;  3R05 A;  5D8A C;  2QE3 A;  4S2G A;  5HCB A;  3WXP A;  4EZH A;  4X6R B;  4KWJ A;  2EXJ A;  2VQU A;  4HT1 T;  2H0V A;  1WA4 A;  3OYW B;  4RHV 2;  5E6H A;  5A80 A;  5JOZ A;  2WNE A;  3CU7 A;  3FWE A;  3SKJ E;  4TWT A;  1EV1 2;  3ZKU A;  3CMG A;  4DIQ A;  3I3M A;  2BFU L;  4D69 A;  2QQL A;  2X29 A;  4RN5 A;  4OQ9 A;  4ES8 A;  5CFC B;  2BP6 A;  5ANN A;  5I0S A;  1BBT 1;  2OQ6 A;  4MVT A;  1SBF A;  2AEN A;  1JXN A;  1J83 A;  3ILF A;  1NQJ A;  1SQ4 A;  2R6Q A;  5DUW A;  2HLE A;  5BNQ A;  4Y1Y A;  1OQD A;  1GQH A;  1S2K A;  5FZE A;  2C26 A;  1DP0 A;  4RFR B;  4HVQ A;  1ASJ 1;  2O8Q A;  1V9U 3;  4I02 A;  3NWK A;  4JCK A;  4Q0Q A;  4B3N A;  1NCR B;  2ZEZ A;  3ACL A;  2DCZ A;  4XHX A;  4IV3 C;  4GKY A;  1NCQ A;  4Y20 B;  5SV8 A;  4LTA A;  2WT1 A;  3AYD A;  5T5J A;  1XNT A;  1VMH A;  1WBL A;  3NV3 A;  5DG2 A;  3RQ0 A;  3FBY A;  1RL3 A;  5H9S A;  3AP4 A;  4N7I A;  4XTP A;  2ZTN A;  2WO2 A;  3SXW A;  4XFB A;  4IEX A;  5IVB A;  4AR2 A;  3V0A A;  2Z79 A;  1PMI A;  1BBT 3; 
#chains in the Genus database with same CATH homology
 5IYY A;  3T2O A;  1UYY A;  3P1I A;  4ZZ8 A;  3WNN A;  4CU6 A;  3A21 A;  2VL4 A;  3LEI A;  3I2I A;  4QB6 A;  1F4H A;  1GUI A;  1GMM A;  2J1U A;  3K46 A;  4CU8 A;  4CU7 A;  2W87 A;  2VOT A;  1UZ0 A;  2CDO A;  3FL7 A;  4QDQ A;  2ORZ A;  3JXS A;  4YPJ A;  1ULP A;  4PT6 A;  3ABZ A;  3U37 A;  2Y6K A;  3SEP A;  3THD A;  2J1S A;  1JU4 A;  3WEZ A;  4DXT A;  4XZU G;  5HPO A;  4FI9 A;  4QAW A;  1EUU A;  3EYP A;  3NQH A;  4AG4 A;  4DEV A;  3OGV A;  2W1W A;  3K4A A;  3I2F A;  2YC4 A;  3IDA A;  1ULO A;  4W50 A;  1UWW A;  1US3 A;  4QX1 A;  1CZS A;  2W5F A;  1SHW B;  2X09 A;  2WZE A;  1W9S A;  4CUC A;  3GDB A;  3LPF A;  1OF3 A;  3T0D A;  3MO4 A;  3IAQ A;  4XUN A;  3OEA A;  4P5Y A;  3VD9 A;  1LNS A;  3WF1 A;  4ZZ5 A;  3C7O A;  4A6O A;  1UY2 A;  1PX3 A;  4A4A A;  3UES A;  2J1R A;  3DYO A;  4E8D A;  5G04 L;  5JXI A;  2WO3 A;  4ARX A;  1CX1 A;  4JKK A;  3K77 A;  3OEB A;  4TTG A;  1P8J A;  3WF4 A;  2VZ1 A;  2W46 A;  4BK4 A;  1UY3 A;  1H6X A;  2QQJ A;  3MUY 1;  2VMC A;  1W8O A;  1O8S A;  4DUX A;  3WF2 A;  4QPW A;  5I0D A;  1UY1 A;  2W1U A;  1JYW A;  2Y6L A;  1UMH A;  1JZ6 A;  4CUB A;  1W8N A;  1SG3 A;  3UET A;  3I97 A;  2EID A;  3HNM A;  3CKH A;  3J7H A;  2YFZ A;  1K3I A;  3T09 A;  1O59 A;  1H6Y A;  5EIY B;  2YB7 A;  3A23 A;  2VQT A;  4UOJ A;  4UAP A;  3C8X A;  3T2Q A;  4BXS V;  4W8J A;  2W92 A;  2XQX A;  2WN3 A;  4GZ9 A;  3I2J A;  5JXJ A;  3LQC A;  2WO1 A;  3C7G A;  3CDZ B;  3I3E A;  5JUV A;  3I2G A;  2J1A A;  1OD3 A;  5CYY A;  1JYN A;  1TVG A;  2RVA A;  2WZ8 A;  3WF0 A;  2EIE A;  2B9V A;  4JHZ A;  4MOA A;  3III A;  2ZEX A;  4P02 B;  4XVH A;  4LHS A;  2VMF A;  2Y6H A;  1NUK A;  2WN2 A;  4P00 B;  5C7G A;  4UI9 L;  5IFP A;  3VD7 A;  2VZV A;  3AC0 A;  5IJR A;  3OGS A;  1JZ2 A;  2QQK A;  1DYO A;  3T08 A;  1CZT A;  1L7Q A;  1BHG A;  3GM8 A;  4MGQ A;  1RYY A;  5B4X A;  2E31 A;  2VCA A;  3CQO A;  4JKL A;  3OB8 A;  2W3J A;  3CIH A;  2VZR A;  3T2P A;  2VM9 A;  4LQR A;  1WKY A;  3NNG A;  4A42 A;  2YFU A;  3VD4 A;  1JZ8 A;  2L9L A;  1D7P M;  1K45 A;  2YG0 A;  2QQO A;  4OMD A;  4XUP A;  4DUV A;  3W5N A;  2WBK A;  1W9W A;  3VDA A;  2BZD A;  4JX0 A;  2X10 A;  1JU3 A;  2VR4 A;  3LEK A;  3MV1 1;  3A7Q A;  2ZXQ A;  3WNP A;  4MO3 M;  4A41 A;  4QB2 A;  2W9X A;  2VCB A;  1WCQ A;  3ECQ A;  3SKV A;  5C71 A;  3GGL A;  3LE0 A;  4DUW A;  3I2H A;  1GU3 A;  2WAO A;  2LS6 A;  4KMQ A;  2XON A;  4M4R A;  3VDB A;  2QBX A;  2B4K A;  1JZ3 A;  4QX2 A;  2W1Q A;  2CDP A;  3C7F A;  1OH4 A;  3W5M A;  5EJZ B;  5FUI A;  5JR2 A;  1UXX X;  1W9T A;  1W0N A;  2XHN A;  4JKM A;  2RJ2 A;  2J1E A;  3A22 A;  2R7E B;  3ACF A;  1KGY A;  3P6B A;  4KI5 M;  5CZK A;  2VZQ A;  4BJ0 A;  4XUQ A;  2ORX A;  2W94 A;  4QX3 A;  2C4X A;  2Y64 A;  3NJV A;  2J7M A;  2VZ3 A;  2V4V A;  4OMC A;  4ARY A;  1TG7 A;  4CU9 A;  1R64 A;  3NJX A;  1UXZ A;  4M4P A;  5JMO A;  3WNK A;  3HPN A;  2WAA A;  3LEG A;  4A3Z A;  4QDS A;  4OYU A;  5C70 A;  2W1S A;  4PQQ A;  3BGA A;  1PX4 A;  2LW8 A;  2VJX A;  4D8M A;  3MV0 1;  2VZT A;  1K12 A;  1IQD C;  4GWJ A;  2DDU A;  1YQ2 A;  1UY0 A;  5IHR A;  5DPN A;  5DQ0 A;  2WUH A;  3HJR A;  4D0Q A;  4MAD A;  4DEQ A;  3FHA A;  2E33 A;  1XNA A;  1UYX A;  3MBW A;  5G05 L;  4HG6 B;  2HYX A;  1DLC A;  2VMD A;  1JYV A;  2BBA A;  1O8P A;  1GOF A;  3OGR A;  4BK5 A;  4Z2A A;  3HNB M;  1JYX A;  4GWI A;  1UMI A;  5F7U A;  3UNP A;  4XUR A;  3WSO A;  1I5P A;  2JE8 A;  1XC6 A;  3VD3 A;  3BN6 A;  1GOG A;  3DYM A;  3OG2 A;  4A45 A;  1JZ5 A;  2YC2 A;  2Y6G A;  3FN9 A;  4XUO A;  2BER A;  4DXR A;  2EIB A;  4LKS A;  2W47 A;  3DYP A;  4L0P A;  3E1F 1;  3WNM A;  1HN1 A;  2VZP A;  3ACH A;  3F2Z A;  3HN3 A;  1NKG A;  4QDR A;  2JDA A;  1JZ7 A;  2J1T A;  2PQS A;  5HXM A;  1CZV A;  1GQP A;  5DMY A;  3CZJ A;  4IUG A;  5LA0 A;  3K4D A;  1OT5 A;  1EUT A;  3T0A A;  2VZU A;  2J1V A;  1GNY A;  4OZO A;  3SEE A;  2QQN A;  4PF1 A;  2EIC A;  4AAX A;  4LPL A;  2C9K A;  1PMH X;  3IAP A;  3I3D A;  4OUE A;  4DXS A;  3PUI A;  4TXW A;  2DCJ A;  2JD9 A;  2VZO A;  2E32 A;  3I2K A;  3C7H A;  2QQI A;  3WQB A;  5J1X A;  3EB7 A;  2XOM A;  1SDD B;  2WQ8 A;  2OKX A;  2X05 A;  3VD5 A;  3THC A;  2Y8K A;  3K4Z A;  4ZXE A;  2VCC A;  1J84 A;  3ACG A;  3WNL A;  1L7R A;  3ZM8 A;  2DCK A;  2WYS A;  3WNO A;  3ACI A;  2ZEY A;  4ZY9 A;  2Y6J A;  1T2X A;  2V72 A;  2Z4F A;  5JXG A;  1US2 A;  4ET7 A;  4E8C A;  3D3A A;  3DEC A;  3GXU A;  1UX7 A;  2VC9 A;  5DN2 A;  1KEX A;  5LCW L;  2JKX A;  3FHQ A;  2VO5 A;  1XPW A;  2J22 A;  3CZU A;  1NAE A;  2QQM A;  2V5D A;  5JXH A;  2ZEW A;  3VDC A;  1K42 A;  4P08 A;  2ID4 A;  5LA2 A;  2E26 A;  3LPG A;  4RYD A;  2VTF A;  5A1A A;  3K75 B;  5LA1 A;  3PUH A;  3C7E A;  4XUT A;  3HNY M;  3NRU A;  3OBA A;  1GOH A;  1OF4 A;  1JI6 A;  2RV9 A;  2VQU A;  2VZS A;  1JZ4 A;  2VME A;  3SKJ E;  1NX9 A;  1W99 A;  3CMG A;  1PMJ X;  2QQL A;  4RN5 A;  4W4Z A;  4BDV B;  4QX0 A;  2WAB A;  2WDB A;  4KWU A;  2KD7 A;  1J83 A;  1MPX A;  2HLE A;  4CUA A;  2W95 A;  3IB3 A;  2W91 A;  2BGO A;  2C26 A;  1DP0 A;  3HEI A;  4A44 A;  2ZEZ A;  1F4A A;  4MGS A;  3HOB A;  1UY4 A;  1XNT A;  3I3B A;  5B4N A;  1UYZ A;  5IFT A;  1JHJ A;  5EJ1 B;  2BGP A;  3MUZ 1;  4CVU A;  4QB1 A;  3ETP A;  3WF3 A;  3T0B A;  2WO2 A;  1CIY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...