4S2FA

Joint x-ray/neutron structure of trichoderma reesei xylanase ii at ph 4.4
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
190
structure length
190
Chain Sequence
ETIQPGTGYNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNSGNFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQQGLTLGTMDYQIVAVEGYFSSGSASITVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Direct determination of protonation states and visualization of hydrogen bonding in a glycoside hydrolase with neutron crystallography.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Endo-1,4-beta-xylanase 2
total genus 55
structure length 190
sequence length 190
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2015-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4s2fA00
1KS4A 1HIXA 3AMHA 3WT3A 1XYPA 2BWAA 2Z79A 3WP6A 3WX5A 1YNAA 1UU6A 1IGOA 2BW8A 2VG9A 4XPVA 1UU5A 4HK8A 3VHNA 2DCKA 1UKRA 1REDA 4S2HA 3HD8B 2BWCA 1PVXA 3AKRA 1H4HA 1QH7A 2C1FA 1OLQA 3RI8A 1XXNA 4HKWA 2DFCA 5HXVA 3VZLA 3WP3A 1BK1A 1NLRA 2VGDA 3AMQA 2F6BA 4NPRA 3B5LB 2DFBA 2B45X 3MF6A 3VZMA 3ZSEA 3VZKA 3B7MA 2DCYA 3O7OA 3MF9A 4IXLA 4XQ4A 3VZJA 1F5JA 3M4FA 1H1AA 1HV1A 1OA2A 1W2UA 2VULA 1REEA 1XYOA 1ENXA 5K7PA 2NQYA 2QZ3A 2B46X 3AKTA 1XNBA 3LGRA 1BCXA 1H4GA 2JEMA 4H7MA 4S2FA 2D97A 1AXKA 3VLBB 1KS5A 4XQDA 1XYNA 1XNDA 2NLRA 2BVVA 2D98A 3VHPA 1C5IA 2JICA 1OA3A 2B42B 1OLRA 4HK9A 3AMNA 3WXPA 3WQ0A 1M4WA 1C5HA 1TE1B 1QH6A 3VL8A 3AMMA 3WR0A 3WQ1A 3WQ7A 3VHOA 3AKQA 3VZNA 3WP4A 4S2GA 5K9YA 2DCJA 4S2DA 1H8VA 3WP5A 3WY6A 4XQWA 2DCZA 3MFAA 1REFA 1UU4A 1BVVA 3AMPA 1HV0A 1T6GC 3MFCA 1H0BA 2QZ2A 3LB9A 3AKPA 3VZOA 4HKOA 3VGIA 3AKSA 1XNCA 4HKLA 5EJ3A 3RI9A 1OA4A 3VL9A 2JENA 3EXUA 2VUJA 1XNKA
chains in the Genus database with same CATH superfamily
2VNVA 4I30A 1HIXA 4Q4W1 2B9UA 2C9AA 1LULA 4NHKA 2G9FA 1LEDA 2E32A 5IATA 2CGNA 1ALYA 1EV13 1QJY2 3B02A 1VBE3 1CPMA 5CNAA 1R083 1SACA 5FZ1A 3SCFA 3VHNA 1GZ9A 5JZGA 4UAPA 3IIAA 3FZ3A 1I5ZA 1AR63 3ZXGA 1RTVA 2OW4A 1XE7A 4FAGA 1RUJ1 1UW8A 3W21A 2XL7A 4A6OA 1PM7A 1JTZX 4HKWA 4QXKA 1RHI3 1TZOA 3DPRA 4QDRA 4AVBA 4IDZA 3I49A 1MQTA 1UNBA 1SZBA 3AMQA 2NYYA 4COVA 4PI2A 3UGFA 1UIKA 1VBD3 2WJSA 1ZRRA 1LU2A 4ZY9A 4BQYA 4YM3A 2R30A 5FJHA 4GH4A 4BOWA 1L7QA 1SFPA 1Z7S1 2A5ZA 2CYFA 4FXKB 4DUWA 4KU8A 4ZHNA 5T5JA 4E2GA 3I7DA 4KH9A 1OKOA 4KU7A 1AYM3 2R073 1H1AA 1MEC2 2GN7A 2PHUA 4RFT0 1RYYA 2XKOA 4OHYA 1RUC3 2R32A 3PVEA 5TSWA 2IUWA 2R042 2R063 1OLMA 5JPMB 4LKEA 3O0VA 1BLZA 3RRDA 3O1PA 1U5YA 3KM5A 4IL7A 5A7NA 3RPQA 1XNBA 1QJY1 3M1HA 1DZQA 1RL3A 5DDJ1 5GLVA 1F31A 1MVQA 1ZA7A 2BOIA 4XOGA 3N9MA 1NCRC 1R1A2 2FQPA 4H2AA 4BMEA 1KS5A 3GALA 3FBYA 2EALA 5JIAA 5HI0A 5LK7B 3GF6A 1RUJ2 2Y8KA 2DVDA 3NO8A 1ZBE3 1DQ5A 5FQ0A 2Q4SA 2Q8CA 4OQ9A 3BIEA 5AC93 1VRH1 1O59A 4Y1YA 2CNAA 1DBNA 4RFRB 5JSOA 5FBJA 2E6VA 3LDRA 1O7FA 2W3JA 2Y6KA 3V64A 5HCFA 2ZEZA 4MSVA 3EB7A 5DZGA 3WDTA 2W92A 2JJ6A 5I8YA 3CU7A 3DUIA 4K3UA 2JD4A 3AMMA 1GWLA 3I2DA 2UY9A 3IDEA 4RL7A 4A6SA 4CYDA 3L2HA 4DZGA 4CU7A 2R061 3GHNA 3U14A 5K9YA 2WQ4A 1W3XA 1S2EA 2VZTA 4YWAA 3I59B 4ES8A 1W6OA 2BYVE 3IAPA 3OD0A 5FXWA 1G86A 1YI7A 5ANQA 1OSGA 5A3OA 5J3UA 1JZ6A 2BGCA 4NHLA 1GNHA 1GKBA 1REFA 4HXCA 4BPZA 4GULA 3MIHA 1Z7S3 3KT4A 4WM8B 3JCIA 5F8PA 3J4UH 2JDKA 1XNCA 3OPWA 5L19A 4Z2WA 1K5JA 2PTMA 4FVVA 2Z42A 3HT2A 3SCGA 4NPLA 4GIQA 1JHJA 3FFQA 3H1MA 4MXVA 2E63A 4CCJA 1I6XA 4N53A 4LBQD 1KS4A 4IEOA 2XVLA 5IK4A 3VBOA 3BODA 1OOPC 3M3IA 5KR7A 2DDUA 3KV5A 1LOAA 3PURA 4M3CA 4JGZB 2YGLA 4D6QA 2VZRA 1R093 1UPSA 3K4AA 2XKPA 3KVBA 4P08A 2Q8DA 1W06A 3HNYM 1IG0A 3JD73 1GP4A 1N1VA 4HSLA 3BI3A 1O3RA 4INDA 2V4AA 2R062 5FO9B 4CDWC 4Q4X1 2BWCA 5J98B 4IEYA 4Q4W2 3WDYA 5JSRA 4RGKA 3UNPA 2C1FA 3P1IA 2WINB 2ZX2A 4FXGB 4G4FA 2BBAA 3VZLA 4AFCA 2X05A 3WP3A 1ZZ6A 5T54A 1W9FA 3PTRB 2WT1A 4YW5A 2Z5WA 4IERA 3DN7A 4LLFA 1BBT2 4AHZA 1HQLA 1YFXA 2ILMA 3C7GA 5J7MA 1RUG1 5JI7A 2RR11 4AOCA 2AR6A 2JDAA 4W6WA 1N3QA 3HIFA 5F5IA 3RNSA 3HQUA 2XJPA 4Y26A 2Q8EA 2AUYA 3Q9OA 2A3WA 3BUCA 4XJZA 5LWBA 1NXD1 4YGBA 2GNTA 3ITQA 2XBO2 4L99A 1HB1A 4FTEA 4LQRA 1VBB2 4HL0A 3N4MA 4KMQA 4XABA 3BALA 3HBZA 3SEPA 3MW4A 1H8TC 4X8PA 5E88A 3OG2A 4H7MA 1OFNA 4JQTA 4YZ1A 1HQNA 3WINE 4XQDA 2W0XA 3PNAA 2TNFA 1UN1A 1W05A 1RJ8A 2YC4A 3LEKA 2EIBA 3JD71 1KFXL 2ZX4A 4Q1PA 3MZHA 5A3WA 3S30A 4CCNA 4DQAA 2VBDA 1XE8A 3LFMA 5FMOS 3WNKA 4JVAA 2W87A 2XDVA 5I0UA 4BQ2A 1Z0HA 4AQ6A 5CA6A 3AMNA 2WAOA 3O1VA 2J1SA 2WYFA 4UFMA 4Z1VA 1DGWX 1DG6A 1QH6A 2VU9A 2XJSA 4HPKB 5F3GA 4DXRA 1C28A 1Q8PA 4OUMA 3ON7A 2VOKA 3AP9A 2L9LA 2SLIA 1X82A 2YBKA 1U5ZA 4ARXA 5ISLA 5GALA 4AGVA 2QE3A 5F1RA 4EQVA 4HANA 1QWRA 4ISRA 4YG6A 1DYOA 3T09A 1VPHA 4A7YA 2VXJA 3CHXA 4QKBA 1PGL2 1LHOA 2QQJA 4KI5M 4XUNA 1ND2A 1OFSA 1JBCA 2E7QA 1MR5A 2YPJA 5L73A 4SLIA 4JGYC 4CP2A 3PUIA 3UV9A 2VOVA 5CU1A 3OUHA 1PO22 3H3UA 4YVSA 1DZRA 3PVOA 3ILNA 1UAIA 1A34A 1PK6C 1DQ0A 2A6ZA 1OLME 1UO9A 3OGRA 3NKTA 4Y20A 2PFWA 5J96B 2BOJA 1JOPA 2YXSA 4AEKA 1NY71 2GDFA 3EXUA 3SH3A 4LBQB 4FFFA 4WM8A 2AZ5A 4R8HA 4WVVA 2VOTA 1W90A 4YGEA 3ZOIA 5JSPA 5HCHA 2PN5A 4IEQA 4P00B 3WG1A 3WUCA 4DEQA 2ZBJA 5T3NA 2OPKA 1YHFA 4HN1A 3VD7A 2CWSA 4BK4A 5A1AA 2QQPA 4UW5A 2G9GA 4IE5A 3HOBA 4N43A 5BUVA 3S0MA 5EZWA 2ADEA 1NCRA 2VPVA 2YPDA 4N53B 4QKNA 3ZXEA 2VY0A 5LW9A 3A21A 1QIQA 2CWMA 1DCSA 1LR5A 3WV6A 5AC91 1UQXA 1QXJA 3O14A 1AUYA 4K1ZA 4CA9A 1LGNA 2QQIA 2R1DA 4BXFA 1UMZA 1LKNA 1PGL1 4RR3B 1IOAA 1R082 1OD5A 5DDJ3 5IHRA 1OVPA 1UOFA 3DL3A 3H7YA 3TEZA 4YG0A 3RGBA 3M3QA 4YW3A 4UBHA 4COUA 2F6BA 3TRSB 1F9KA 1G9CA 1PO21 4XHBA 4DS0A 1XPWA 5JXGA 1W3VA 2DCYA 2TUNA 3IDAA 4M4PA 4AL9A 4YZ5A 5LEKA 5H9QA 1PZ9A 4Y1VA 5A3MA 1P8JA 4CCEA 3MICA 5A6ZA 5GZCA 2VR4A 4HN0A 5FMCA 2IXHA 4H7LA 3ZSLA 1W2UA 2Y33A 2OVUA 4IEPA 4AR2A 3SISA 5AFEA 2LUWA 4FOQA 5EYYA 4CUCA 1I1EA 1TNFA 2WQZC 3KGLA 4P9YA 1TMF2 3RWKX 5FWJA 2YFUA 2ZOEB 4LHLA 2X09A 2ETEA 2GC2A 1JOBA 4LBQA 1AL0G 4AVVA 1OF3A 5HCAA 4DOUA 2J1TA 2VCMA 3KVAA 2ZTNA 1JU3A 3R4UA 4CDQA 4B7EA 1HRI3 1BCXA 1VBD1 2ARAA 3VKNA 4TLFA 3OUJA 4DY3A 4MX3A 3PUQA 5ABJA 2I45A 5AC92 2ENRA 1JODA 2OT7A 2UU8A 4FFHA 2XWJB 2Z69A 1QJEA 1R081 2BERA 2Q1MA 4M3CE 4IEUA 3LOBA 4CXXA 5F37A 5LBFA 3ZR6A 2WIIB 4RYDA 2KA3A 1OA3A 1BZWA 4LK6A 2VMFA 1DHKB 3C7FA 2W91A 4HK9A 3AYDA 1OF4A 1PO12 1RUI3 4Y3OA 5FMDA 3WXPA 5LCWL 4CXYA 1Q8SA 1W8OA 3A4UA 2BV4A 5IUQA 1CX1A 1H2MA 1OUXA 4WV8A 3K75B 4AVAA 2JG8A 1CAVA 1QJZA 4XUOA 3WR0A 1DIWA 2RDRA 1AXYA 3QACA 4CP9A 2VH9A 3VZNA 4HG6B 4WM7B 1OH3A 2DVAA 1FPN3 4FFIA 4GALA 5APAA 4BJ0A 4YM2A 5EXOA 3UKTA 1VBD2 2WWSA 4WM7C 4FI9A 4KWLA 5EV7A 3JQXA 3E1F1 5I8SA 3TWIA 1JI6A 2JDMA 1G7YA 1RHI2 3WW3A 3MFCA 1VALA 3M70A 3VGIA 4HKLA 5C9AB 4TSVA 4QQHA 2FDGA 3B93A 5DAXA 1V9U2 2CSGA 3S57A 1ULGA 2JG8B 2FMYA 4L0PA 2YROA 2V4VA 2XB6C 1SFNA 5K0UC 1ZNPA 3B69A 1AL23 3I3EA 2GMPA 3MLLA 3NRUA 2FZ1A 4QX2A 4XILA 2Q0AA 1GICA 1RUF2 4MGSA 3WW4A 1X33A 2V72A 4YSFA 3LE0A 4K8FA 1ZREA 1NY72 2J22A 3IPVA 4LBMA 1W8WA 2WA3A 3B3QE 2PLV3 5IVVA 4XF1A 1BEV2 4EN6B 3BCWA 2WNUA 1APNA 4FFGA 4EJRA 3LKJA 4QT6A 4Q0PA 5GM0A 3RI8A 2VUCA 4QGLA 3A0NA 2DV9A 4A7KA 1KITA 5A70A 2XUEA 3MIGA 4QPGA 3SNMA 3M8LA 1ZBA3 5J48A 3ZSMA 1UZZA 3M3EA 2PQSA 3E6BA 1MZFA 5E1RA 4XDOA 1PVC3 4O65A 1LHUA 5FZ4A 3PIJA 2WZ8A 3VZKA 1S2BA 2DWRA 2JKBA 3IT8A 3OBZA 4BLJA 4IXLA 1CZVA 4X8NA 1WUVA 1F5JA 2RS32 3ZXDA 4D7TA 1GZWB 5AFBA 2F4PA 1F8VA 5AVPA 1ZA4A 2ZGLA 4LO8A 3PU8A 1F4HA 5EPAA 1H9WA 4LKFA 4L92A 4MH0E 2IVIB 4KGGA 5IK8A 5FRAA 3TYJA 3IDCB 2NN8A 2FCUA 1LOFC 2RS13 2VVEA 3I2IA 4GJYA 1J3PA 1NA1B 1WW7A 2VD7A 2P3JA 2CU5A 1XU2A 2Z2SB 1JOJA 3AK0A 4CDWB 1CPNA 3P3NA 1RINA 1F15A 2RMU2 2VOWA 5IK5A 1H6XA 1N1SA 3WHTA 2VZQA 5C3OA 2HWF1 5DMYA 3FHIB 3T1LA 5IFTA 3N35A 1UXXX 2VQTA 3ACLA 5JR7B 4AHWA 1RUE2 4NE9A 1US2A 2WS93 1W2AX 3AXDA 4XVHA 5FLHA 3KV6A 2FCVA 4N53C 1RC6A 5JZGB 3AYAA 4UBGA 4XJUA 1RMU1 1DQ4A 5EQUA 1UY1A 2ET7A 5IVEA 4P5HA 1XQNA 4JTNA 4LUKA 3BPZA 4PQQA 1GBGA 2RG4A 3Q8CA 4RR3A 4EE2A 5F32A 1ZRIA 2RS33 4XDPA 4K9SA 1AZDA 4XAAA 1BYHA 1JMUB 2D93A 1PO11 4CDUA 1JYVA 2NP0A 1ZZ8A 4OHWA 5EJZB 1D7PM 1N3OA 2BZDA 2D5HA 4KWKA 5I0SA 3LEGA 4TXWA 5F3EA 5L9BA 3H0OA 3USSA 3WG2A 3WDWA 2BUKA 2XJVA 3UJQA 5EJ1B 3NNFA 1YUDA 3KQ4B 1LAJA 1RUG3 3ILRA 5JWPA 4NVPA 3AMPA 5FP8A 3WZ1A 4DMIA 1RB8G 1DQ6A 4MOAA 2AGSA 3NNLA 5CAZA 1W0NA 1TQ5A 4K7JA 5LY2A 4NO4A 5A1LA 2PLV2 1F35A 3S7EA 5ACA2 5IWFA 4CXWA 2P3YA 2RVAA 4JDMA 1CX4A 4QPIB 2CGOA 3BOPA 4RGAA 5LA2A 1RHI1 4Q4X3 1AX2A 1RUF3 4LO6B 2ZEWA 4AI0A 3ZXFA 5KXBA 3D6EA 3TAYA 1LHWA 1IS3A 1AR61 1GUIA 1YEWA 1LGCA 1MZ6A 3V0BB 1OOPB 1LCLA 1NCQB 2LRPA 3J7LA 1NA1C 1L3JA 3BU0A 4QM9A 2YDEA 4Q29A 1UF2C 1QNWA 3MUZ1 5C4WB 1X50A 3VKLA 1NCQC 1XE0A 2V5YA 1GR3A 1AR72 2DTWA 2WFF1 1BK1A 3SC7X 4E4SA 2QVSB 2Y6HA 1AYN3 4PLNA 3HAGA 2VVFA 2OQ7A 2VTXA 2KD7A 1CIYA 1NE6A 3OTFA 4YFZA 5CFDC 5KXDA 4A3XA 1O5UA 3O12A 4F7ZA 5HV4A 1HXS3 5JOYA 5IAXA 1OT5A 1RXFA 3S6PA 3E5UA 4QPYA 3ILFA 1YI9A 2B4KA 5CKMA 4OLLA 1ASJ3 4QHBA 3VKMA 4MZUA 4FP2A 1S0EA 1YQ2A 3U0ZA 1NOVA 4FPHA 1FNYA 2BFUL 2RS51 4XCBA 3L2YA 1YJLA 1R64A 5KBFA 2I74A 4GB31 4XCAA 1Q56A 4OMCA 5K7PA 1V0AA 1PO23 4CRQA 5FQ0B 4AHYA 5FYCA 1C4RA 4QM8A 5C6CA 3AKTA 3B00A 3ZN6A 1WMDA 4AXOA 1RJ7A 4LBNA 4NIAA 3I59A 2HWB2 1UYPA 2W47A 3MO4A 4Y5SA 4YGDA 4XAEA 5F2SA 2EAKA 4EROA 5HV0A 2W08A 2ZZQA 2Y6FA 5C9AC 5T52A 2QQWA 3QLQA 2VO5A 2Q1FA 1VRH3 2CGPA 4AAXA 5BNQA 4Q0QA 3VBSC 5C8CB 1O6UA 2YV8A 3VBFB 4BQ5A 4XF9A 4B1MA 4L8QA 2RHPA 1HRI2 5C7GA 3GNEA 1MS1A 1J58A 3ZR5A 1EY2A 3E6DA 4KBZA 4XACA 3C3VA 4YPJA 3VBSB 5C8CC 1QOTA 2D3SA 4TN7A 4AVTA 3D82A 2H0BA 4LHNA 1JZ8A 3U07A 2WZR2 1Y9QA 5FZIA 1Q8QA 1TMF3 2GALA 4FT8A 4QX7A 4BQXA 3OY8B 4M00A 3EJKA 2YZ4A 2GC3A 2X8KA 4Q4Y3 3ZPYA 4DFSA 5BNPC 3NW4A 1VB2A 2GMMA 4A3ZA 4PDWB 4KG8A 1AVBA 5LA1A 4PBOA 1SLCA 2ZKNA 3JUUA 3NJVA 3W59A 1RMU2 3ZVXA 4IGOA 1O4ZA 4NWVA 3OGJA 2E9QA 3MBWA 1KEXA 5C8WA 5DAQA 2DCZA 1KJRA 2A71A 4DXTA 2ZX3A 1CAVB 2UYAA 3D8CA 3POWA 5DAWA 4YARA 5GKAC 1SHWB 4CZSA 3D5OA 3T0DA 4LT5A 4UF0A 3JXSA 2ZGTA 1NQDA 3ENRA 5K8SA 3WQBA 4AFMA 1DZTA 1ENQA 3GM8A 4K21A 5BNOA 1A3KA 4JGYA 5DG1A 3NAPA 5IFPA 2GNDA 2MHFA 3C7HA 2WO7A 3CQOA 1XNKA 4XXAA 4Q4V2 5JXJA 2ZMLA 1RUJ3 2WT0A 4FPJA 3HNMA 3AL5A 3Q8EA 3AMHA 5FUIA 3POGA 4D94A 1FATA 1CZTA 1Y9MA 4LITA 1W6NA 5C3SA 3WP6A 1RIRA 5FP4A 1WKYA 1UU6A 2UYBA 5DUWA 2ARBA 4LIUA 5FP3A 5JXHA 2KR2A 1OC1A 1LHNA 1L7RA 1CIWA 2JDUA 2IXKA 4LEJA 1UYZA 4Q4W3 1DGRN 4CPBD 3A22A 1QXPA 2FZ2A 3P3PA 2F4LA 4IV3B 1ENRA 1OOPA 1MPXA 1SMVA 1A78A 1FOD1 5FZLA 1S0BA 2ADDA 4TTGA 1KD7A 3MIEA 2QUOA 1VP6A 1MACA 2WKKA 3POFA 1FYUA 4CSWA 2VZPA 4KWJA 3P5BA 4CDXB 1JZ2A 4ZZ8A 2HLEA 2C24A 5JAXA 3TN91 1PX4A 3O7OA 1AYN2 2Y0IA 4QAWA 1YC61 4XIOA 1IHMA 1VB4A 1WW5A 4N9IA 4AG4A 4GKXA 1MVEA 2OIIA 1HV1A 3NVCA 4FPEA 3R4DB 4UWDA 5A80A 3T08A 1ODMA 3WF1A 3LF7A 1IPSA 2GZWA 1OQ1A 3LDKA 5L9RA 4G3YC 4NOTA 4C1WA 4A4AA 5HCBA 5CBLA 1SPPB 5CB7A 3IM0A 2O14A 4Y20B 4S2FA 4BQWA 4XJWA 4EZ4A 3K4DA 1WMFA 2HBTA 4QPGB 1DQ2A 4WM8C 2WRAA 3CKHA 4CUGA 4Y22A 5KC6A 5A7PA 2XUMA 3KSCA 3R4SA 4C0HA 4CDQB 3O1TA 4XFCA 4IGQA 1WCKA 3VBUB 4WBBA 1UPIA 4QHOA 2PAEA 5CIRA 5JOZA 3CMGA 1V6MA 2EVXA 5BNPB 1W9SA 2GSYA 1TEIA 5GZFA 3BKZA 2P5BA 1DU3D 3N36A 4QPWA 1WW6A 4UXAA 3WW2A 4RSUA 4JGZC 3USUB 1JHNA 4UFIA 4AI9A 4JC1A 3NKGA 2YG0A 3ZX7A 1ND3C 1QQP2 2HYKA 1YIFA 2D6MA 2P17A 3BYWA 4Y4YA 1JZ4A 3RZKA 4QU2A 2ERFA 4S2GA 2QTWB 1KDKA 3PUAA 4MXWA 3LIHA 3MEPA 4QGNA 2HWB3 4BWOA 1GOGA 2A3XA 1SBDA 3KWVA 5FYYA 3RZLA 2P4EA 5F2WA 4B3NA 3KV9A 4MGQA 2FDIA 1NXMA 3WNOA 5BNOB 1BHGA 2ZXQA 2VMGA 2YUEA 1W6PA 4LE4A 1AJKA 3MI8A 1UYYA 3HN3A 4XBLA 4IE6A 1X9TA 1HX6A 2A6WA 2XLFA 3T30A 3WEZA 5D2AA 3TBDA 5FLJA 1D2QA 2JDNA 4HKOA 1OKQA 4R9CA 1JYTA 3BB6A 2HWC1 5C3QA 2D6KA 2R072 3VUOA 2A6VA 1ASJ2 5EJ3A 2ZA9A 1YLLA 3AZWA 1POV3 4CDWA 2A75A 4E2QA 2FBEA 3CJXA 3Q8FA 1VR3A 3HPNA 5FOBB 1GNYA 3RJRA 1UL9A 1HB4A 1VMJA 4IV3A 4I0WB 4LMFA 4Q0SA 3ATGA 1WLCA 1Q8OA 1RUH3 1VMHA 1UX6A 3KF5A 1COV1 4JAAA 4XEZA 3CNAA 2PHWA 3PMSA 4DUVA 4Q4V3 3NNJA 3OBTA 3PJYA 4UFHA 4CU8A 5LY1A 1ND3A 4WVMB 3RS6A 2ZS6B 3HD8B 4BU2A 1WMXA 2G4IA 2V09A 2ZKLA 2E33A 3O1SA 2XXZA 2DFCA 5FDBA 3BTZA 3EHKA 2UWBA 1QJY3 2XVGA 1OD3A 4QDQA 4AWDA 2J1UA 2VZUA 5F3IA 1K5MB 3VZMA 3PU3A 2W1WA 3AL6A 3HQRA 1RUC1 2WSUA 4O9EA 4Y24A 5CVRA 3RYPA 2JE8A 1D2SA 3S7IA 3U1XA 4CU9A 3KQRA 2GP5A 1PHMA 4ORFA 2CDPA 2UWCA 4J25A 4OHXA 2R071 4DO0A 1ZBA2 2CV6A 2QDNA 3EQEA 4LO7A 3VZJA 5DUUA 3ZM8A 4Q4Y2 3SCHA 3POBA 1EAH3 4DRRA 1OBNA 1W8ZA 2PHLA 5F7UA 4CCOA 3IAQA 1NX9A 4ISQA 1XYOA 4QX1A 1ENXA 1U5XA 5C33A 2WZR3 5FZHA 4RHV1 2NQYA 1STMA 5I0RA 3HJRA 2ZPXA 2GN3A 2XPJA 2R49A 4ZZ5A 4ASLA 3GGLA 1O4TA 1LOFA 2XLGA 4BDVB 4BQ4A 3H8UA 3KB5A 2BRTA 4Y5TA 2AC1A 4AE2A 2O8QA 5C71A 4C0BA 3W5MA 5GZDA 1DF0A 1G9BA 3E5QA 1ULFA 3U78A 5LA9A 4E4HA 3DKQA 4OULA 4O61A 1VBE1 3DV8A 4AVSA 4CP9B 3VDDA 4XMIA 4R52A 1AR81 3MW3A 3M3OA 1G9DA 3L9JT 1UCXA 1TVGA 2UURA 4YLZA 4R4ZA 2JDYA 4BQ1A 3NQHA 4GQ7A 4CU6A 3JBG1 5FO7B 3U75A 2DBNA 4Y5Z0 3WG3A 3O0XA 4RQPB 5FZ7A 3M2MA 3DKWA 2JG9B 1YQ6A 3ZDVA 3WQ1A 4LE3A 1FPN2 1K3IA 3WQ7A 1RUNA 4BMBA 2RMU3 2CY6A 1HQWA 4NMIA 3I4IA 2H0VA 1YFWA 3ZYRA 2E31A 2Y38A 1HXS2 5ABJB 2JE9A 3VBOC 4V2VA 2IC1A 2ZAAA 2WWJA 2O0OA 1QQP1 4KNCA 2XL9A 3ZFGB 4HMZA 4LO5B 4AQSA 4DXZA 5D8AA 4PCRA 4MUVA 4YVWC 4PDWC 1HJGA 2NZ9A 4K6BA 2QCSB 1RUOA 2PAKA 3EBRA 3GBWA 3ZYBA 1WGPA 5E6HA 3DPRC 3PHMA 3LEIA 2O1QA 3BTYA 4LPLA 4GZ9A 3OCPA 3FMGA 5LATA 1S0JA 1AR82 3GZEA 4LOTA 4OI2A 1CGPA 3WCSA 2W9XA 1EV12 1AJOA 3MLKA 4LJHA 1K12A 4A7ZA 3AP5A 1H8TB 1W6QB 4ONUA 2EIGA 5FXVA 2GC1A 3R6SA 1IQDC 2DTYA 2E26A 3C2UA 5FYSA 1E5IA 5A3PA 3GXUA 5KHKA 1CJPA 4DRVA 3HWJA 4CDQC 4JRAA 1REDA 2A3YA 5FPAA 2SBAA 2XJQA 3ZFGA 5FY1A 4GMP1 1F4AA 1PVXA 3OYWB 5C3PA 5EWSA 3PIGA 2VUDA 1HW5A 4CEYA 1CESA 2R7EB 3IWZA 1KXGA 4NUBA 2QQVA 5J37A 3RYRA 2B9VA 3PJQA 3ETQA 1HB2A 3WNNA 1FAYA 3B5LB 4NPRA 4PT6A 4XFHA 5JUVA 4B4PA 3POJA 3RWNA 5E89A 2PQQA 1ZZBA 1FV2A 2EIEA 3MPPG 3ZSEA 1BJQA 1QNYA 2R041 4PIYA 4Y33A 4W4ZA 2MEV3 3ETPA 2W1UA 3ZDSA 4EN8B 1JZ7A 3VDDC 4WZCA 2OS2A 5BPXA 2HJIA 2QQLA 4BCUA 1LOCA 3T0AA 3W5NA 4AVCA 4XIKA 1F2NA 1R1A1 2X5IA 5IYYA 1QJU1 5HPOA 2D7FA 5L7OA 4XETA 4A2UA 2YYOA 3KF3A 1V6OA 2JDPA 2B8MA 3I97A 2R043 3U4SA 2D43A 1MS3A 3MYXA 3SLIA 5FZ0A 1YXWA 4UFKA 3ZFFC 3LGRA 1O4YA 4QX0A 3IZOA 3TNQA 1X36A 2BJSA 2BVBA 2GMEA 4BM8A 2XG3A 1SG3A 3LZZA 4JHZA 4J1XA 3AB0A 3EYPA 2VZOA 1OPMA 2VMDA 1CD3G 4QU1A 3VHPA 1V6JA 1ULEA 3T3YA 1NUKA 2HWD1 2VMCA 1DDLA 4MGTA 2JXAA 2HEVF 1VBC2 4PIXA 5FTTC 2HH9A 4P9IA 4CDXC 3GZUC 1QU0A 4UYBA 1POV0 1JXNA 4MGZE 4O9GA 1VIWB 2D6NA 3VV1A 1WD3A 1QF3A 1TE1B 2YGMA 1W28A 1T2XA 1GNZA 3M7AA 3C7EA 2ZHMA 2FDFA 2XMLA 1XSQA 1Q5OA 3K3OA 2NMNA 3SKJE 1J1LA 4AFAA 1UMHA 2ARCA 4FO9A 5IVFA 2DCJA 1AR93 2BNMA 4GKYA 3KMHA 1IPKA 3U37A 5B4NA 5FPVA 2PHTA 3WP5A 1GZWA 2YBPA 3D3AA 3RVHA 3WF0A 1B09A 2IXJA 2OX0A 2RDQA 1XU1A 2W52A 4MADA 3ZYJB 1U5IA 1CWPA 1IS6A 3K4ZA 3PVNA 3T2QA 1W6OB 3APBA 1FMD2 1T6GC 4XBQA 3LB9A 1QY4A 3URFA 3I3QA 3AKSA 4OUEA 3O5SA 1I5PA 1OA4A 2JENA 4FTBA 1XNTA 3MGUA 1VBC1 4FQ4A 3V56A 1JZ3A 3G7DA 5IVYA 2WNEA 1LJ7A 4YM1A 2P37A 2E51A 2PHFA 3HN1A 1SLLA 1H1IA 2DBIA 3WT3A 3ZXJA 1XYPA 2N7GA 1C8M2 1EUUA 1CVNA 1DQ1A 5BYNA 4N8MA 3MIBA 1J3RA 1RUD3 4XPVA 4Y1UA 3W20A 4ASMB 5DDJ2 1W2TA 4GA9A 1UOGA 4QXHA 1VBB3 4S2HA 3CLPA 4PF1A 1T6BX 4LHKA 1RVF1 2J1VA 2JB4A 3C8XA 4BYYA 4FSJA 1BMV2 4FPCA 5FZ9A 3DGTA 4Q0UA 5DZFA 4ZU7A 3THPA 1EPZA 5F5AA 1HB3A 2VTXJ 1GQPA 3A0KA 3C7OA 3FHAA 1ZM1A 2B45X 4XHXA 5KWRA 4CEYC 1N1TA 1FMD1 1HRV2 2K2SA 4OUSA 4C90A 3WNLA 1H9PA 3AXEA 4JRLA 1YWKA 3WVJA 3J8F1 5C4WA 2OUHA 3LAGA 2WYSA 1Q8VA 1VBA3 2Z4FA 4LULA 2BBVA 2GNMA 1EAH1 3AYEA 1OURA 2J1EA 1XOYA 3MLJA 5FYZA 5DZEA 4YVSC 1XBFA 2FDHA 3RFRA 2RM22 4Q26A 5FXZA 3M3CA 3UGHA 2JB8A 3H3ZA 5LBBA 2DVGA 1QEXA 2QQOA 2QZ3A 5FY7A 5K0UA 3AC0A 3JD72 4MYEA 4QQLA 5CFDA 3ZFEB 5J1XA 5FK8A 3LCPA 4ZU5A 2VQAA 2XVKA 4LK7A 4W6YA 4MHRA 3I2HA 1PNFA 5FFOC 5E8AA 4Y1ZA 3T2OA 3KV4A 3UETA 2BGPA 2XHNA 1QHDA 1UOBA 1AXKA 1E5HA 1QJU2 2WN2A 1R1ZA 4XC9A 2JIJA 3N9OA 3VLBB 1UY3A 4N43B 2WZEA 1CONA 2ES3A 3ORJA 1DYKA 1NLSA 1I3HA 4N7IA 2K9ZA 4W6XA 4XFGA 4U36A 5K0UB 4CTEA 1X8EA 1ZRFA 3D0JA 1NA1A 2P2KA 1NG0A 4EN9B 5FYMA 1MS5A 4QB2A 4IGPA 3OBAA 4QPGC 4EV0A 5C5UA 1GWMA 3KS7A 1O8PA 1K5MC 3VDCA 1JS9A 4E4ZA 4J1WA 1VLNA 3NAPB 3FC0A 3POSA 2Y6LA 5FZOB 1XC6A 2VXRA 3E97A 1WWYA 1IKPA 2AEZA 2J1AA 1B35A 4UOJA 3VKOA 1POQA 1YRZA 2HWD2 3FBMA 1BEV3 1MEC1 4DIQA 3JZVA 3ZXLA 5C4WC 3VHOA 4FPFA 3MW2A 1V70A 3HNBM 3N9PA 4ET7A 2P6HA 2D40A 4LOSA 1W6NB 4PHZA 5LRRA 3LIGA 2RM21 4BLIA 2XH6A 3VKFC 4FOWA 3T4VA 1J84A 4S2DA 1SLTA 1W6MA 5D1IA 1S0CA 4BQ3A 2PELA 4M0HA 2ZGUA 4JDNA 3J8F3 3KT1A 4AEDA 4MG2A 1V9U3 4UW6A 4UFLA 2B5HA 2WSVA 4XBNA 4AW7A 1O5LA 3LFIA 1ZRDA 4D7SA 1W9YA 1ZZCA 1JYWA 3TEXA 1CAXA 3VL9A 2YBSA 5IVJA 1VRH2 1PZ7A 4RS5A 4V2WA 4XXPA 3LPFA 2HWE1 1VAVA 3I3BA 2XJRA 5FOJB 2XBO1 2IVJA 1VBB1 1FNZA 2Y6JA 2XJTA 5FO8B 4GMP3 1S0FA 2PYTA 2BW8A 1CQ9A 2CAVA 2HKXA 1UU5A 1YO8A 3CBNA 5FR3A 2WA4A 2JG8C 3A23A 5CKQA 2XONA 1W8FA 4DXSA 4W50A 3ABZA 4TWTA 1MZEA 3ZIWA 2BDRA 1NQJA 3MV01 2GAUA 4RD7A 3VBOB 3H8RA 4L11A 1ST8A 5KHJA 1IS5A 2P3KA 4E9KA 1GQGA 4KG0A 3WLUA 5I8TA 3VD4A 5BXXA 2FCTA 4R9DA 1W99A 5ERLA 1WA4A 1RVF2 2ZHLA 4TLGA 3ST7A 3AZZA 1AX1A 3UKNA 3DF0A 1UY2A 2WR9A 1IKQA 4YW7A 1QJX1 1WCQA 1GZTA 1AR73 2D6PA 1MS4A 4FPGA 4UF0B 1E5SA 5FIXA 4AYUA 4AZZA 5EIYB 1D4M2 1KJLA 4LBOA 4BISA 4Y22B 2WFPA 2ZEXA 1REEA 1LB2A 1QJX3 4HSJA 5F5CA 2C26A 1QKQA 5FMOL 1GWKA 1Z7S2 5F39A 1LODA 5JOWA 3OJBA 3AP4A 1VAKA 3J8F2 3FLTA 4ASKA 1H4GA 2JEMA 2QQUA 2VW1A 1EAH2 2ZHNA 4LA3A 3CJIB 1PMIA 4NRMA 5FPBA 4BZ4A 4Y4RA 4EWEA 4BK5A 1O3QA 4HETA 4M3CB 4Q4X2 3JB8A 1DLLA 2GU9A 2WLQA 2BQPA 5ACA3 1TNRA 2YC0A 2BVVA 3ZFFB 3THTA 5GLZA 2OUJA 2MNGA 5AVAA 1DP0A 5FZCA 1ULDA 2B42B 2AYHA 3ACFA 3AFGA 2PHXA 2W1QA 3HQXA 2OKXA 1BBT1 1TG7A 2ZCWA 2ZGKA 4Q2FA 4QMAA 1NZIA 2HWE3 3VD3A 1RUG2 1M4WA 2JECA 1EP0A 1K45A 3LD8A 2XBO3 4HT1T 3IIIA 3J7HA 4XTPA 4Q5OA 3VL8A 1W6MB 1WLDA 2QQMA 3LOIA 1D4M1 5FKCA 3HT1A 3V0AB 2VBPA 4W8JA 3WCRA 2ZGSA 5K4LA 5G04L 2IXCA 3GYDA 1SLAA 1QJU3 3RMXA 2OXBA 3KCCA 4RQPC 5FY9A 2XQRA 2WO3A 4XQWA 2PMWB 2VAUA 1V9U1 5D8AC 1H2LA 2EAAA 5FCCA 5M0TA 4AI2A 3D0SA 1VMFA 1UZYA 5FZKA 5H9RA 4G9SB 5FWEA 3KLSA 1XJAA 1PK6A 1W03A 1WD4A 3WD5A 3ZFGC 1GP6A 4K40A 4P9GA 4URAA 1X8MA 3QBQA 4MXWB 3SEEA 2V5DA 3WNMA 4LLOA 1MEC3 2ZMKA 3QH7A 3ZMOA 1OH4A 1VBA2 2WLPA 1PIV3 2ZJCA 2RJLA 2EIDA 2VTFA 1GYKA 3FLRA 3VBHA 3ACIA 3ZIXA 1BEV1 3QCWA 5BNNA 4BIFA 5LBCA 1VAMA 2XGXA 4QX5A 1DFQA 2XQXA 1SFYA 3I2GA 4CCLA 2LALA 4LO4B 3ZYHA 2I07B 3ZFEC 4AAPA 3J9SA 3FUOA 2DURA 3EO6A 3OPTA 3UYJA 2X10A 2VZVA 5T50A 2JIGA 2WNVA 4L97A 2ZZJA 2W5FA 3GZTB 1WA6X 5FZGA 5LA0A 3DCQA 4FAHA 4QWNA 4ZU4A 5JMCA 4LA2A 2VC9A 1QH7A 3CDZB 1OLQA 4R9AA 2JWPA 1OXCA 4QPIA 3ZXKA 3VN4A 1W8HA 3VBUC 4BB3A 3S5AA 1UWWA 3OF1A 3P6BA 4N7UA 4RA0A 4HZFA 4R4XA 4LORA 4COZA 4SBVA 5H9PA 4QHZA 3GBGA 2YY1A 4IE0A 4D3WA 2A6YA 1N1YA 1ND3B 4WVMA 3B7MA 1YCIA 2RE9A 4JKLA 1Y43B 4MHUA 5GZEA 3ZFEA 3O1RA 1JYIA 1VBA1 2Q5TA 3N7JA 1WCSA 5CFCC 5CG8A 2NPIA 3ES4A 1GU3A 2EXHA 3CIHA 2VULA 2AREA 1NCRB 1X7NA 3BTAA 3ZKYA 3V65A 1FMD3 1UY4A 3WW1A 3NV4A 4D6RA 2J7MA 3NJZA 2RR12 3VDDB 2RMU1 2GP3A 1J3QA 1LU1A 4MLOA 2C6SA 5GLWA 3FJSA 1QJX2 3NSTA 4QX8A 5T5LA 2HWF2 1L7LA 1LECA 3I3MA 5DUVA 4AI8A 4K20A 5C3RA 4MO3M 4IETA 4HOOA 1URXA 5FUPA 3WNXA 1AX0A 1Z78A 1C3HA 5JI9A 4CCKA 3E5XA 4RQPA 2W94A 1K5MA 3WF2A 2NLRA 4OFGA 1RVF3 4XJ8A 3ACGA 1BBT3 2ZX0A 4I2OA 5BY5A 5JR2A 3RG0A 3H50A 4LXLA 1RITA 3UGGA 5CYYA 4A45A 1O8SA 1PX3A 1LTEA 5FMBA 1CAWB 3I3DA 3GJAA 3ACHA 3IBMA 1UY0A 1HKDA 1RUF1 1RUE3 4OI0A 2VZ3A 1Q43A 3KZ4C 2BTVC 4R9BA 3ZN4A 4ZKTB 3LSDA 4NIHA 4OCTA 1GOFA 4JGYB 1SBFA 4U2AA 1GOHA 2ZGOA 3WHUA 1SLBA 4NHXA 2GC0A 2HEYF 5FYHA 5L7OC 4KQ7A 1WLTA 1YYNA 2A1XA 2P34A 1DYPA 3KHBA 2WNUB 2YFZA 1QMJA 5IAVA 1O3TA 3FLPA 4XF4A 3MFAA 4DNYA 3J7MA 1UKGA 4YFWA 1AF9A 2RDNA 1O91A 1HV0A 3O1OA 5FZAA 1PNGA 1WMEA 2Y34A 3AKPA 3LWCA 1VRBA 1AR62 1X9PA 4B1LA 1D0GA 2RS31 4P5YA 2FHRA 1A6CA 4FQZA 3W9AA 1KQRA 2UWAA 2VECA 4XUPA 4QXBA 1PMHX 4XMAA 1NCQA 1UMIA 2DUPA 3OY8A 1D4VB 2C4XA 3SXWA 4CEWC 1RMU3 3ZYFA 3GZAA 2JD9A 2BWAA 1HJFA 2Z79A 5T5OA 1Y7BA 2Y6GA 4CPBA 3AM2A 3WX5A 1YNAA 2VG9A 5CZKA 3AX4A 2WFF2 5FY4A 2BP6A 4FPLA 2BFUS 4QQPA 3CZUA 4URTA 1MS0A 5CISA 5J36A 1JYXA 4IEZA 5IK7A 2HWD3 4XFBA 2R16A 4Z2AA 2VMEA 2CHHA 4K8RB 1DGLA 2QFEA 1FX5A 4XZUG 3AJYA 1M06G 1A8MA 2ZAHA 4Q27A 4Q8LA 4UW3A 4AF9A 3N9NA 3SKVA 4IV1C 2X5IC 4I02A 2F17A 4NRQA 4NR1A 2D44A 4YW1A 4FP3A 3ZYPA 2VCBA 2IXLA 2RS52 3ROUA 3DYPA 4YZ4A 4PBPA 4GWMA 2JG9C 3MUY1 4AGGA 4QB6A 4IEWA 1SCRA 2V73A 4FOVA 4PIZA 5JOXA 4H14A 4JTOA 1O3SA 3WDVA 4CEYB 4DUXA 1CN1A 1R1A3 3ZYGA 3R05A 4FPOB 5CFDB 1OA2A 4QD2A 2WUHA 3GBFA 1DGRA 4XW3A 2LM3A 2GH2A 2HWB1 4LKDA 3T4HB 2ZGNA 4NPMA 2WN3A 3ZN5A 4CCDA 1G6NA 1CAXB 1OQDA 2ZABA 2MEV1 2VBBA 3MV11 3AZXA 2R0HA 3K2OA 2TEPA 1PMJX 5FY8A 1S4CA 2WWUA 5FY5A 2LROA 2XJUA 5H9SA 5B4XA 4V1PA 4JCKA 4UW4A 4YVWB 2IFRA 2IFWA 4D69A 2NMOA 3OD4A 1TMF1 2C0ZA 3W58A 5LBEA 5A7OA 1XYNA 4PLMA 4CDXA 1CR7A 2CDOA 2W1SA 2EXKA 4I0AA 4CE8A 1GSLA 2VJXA 3WOGA 2D98A 2IWGB 2VE1A 1UYXA 2VZSA 1PIV2 1WW4A 2XWBB 3FX3A 3K46A 4WVZA 4L9BA 3LA7A 3OPZA 4BE3A 2EF6A 2PLV1 5ACA1 1KDMA 2VCAA 3RZJA 4I3GA 3HEIA 1C57A 1CAUA 2GNBA 4FOYA 1BXHA 5DQ0A 2ZGQA 1H30A 3KD4A 3LPGA 5DAPA 4TZDA 3DYMA 5L7OB 2BU9A 2DF7A 1Y3TA 2ORXA 1ULOA 2ZMNA 3AZVA 4MGYE 3ZMNA 4E2SA 4IEVA 3ZFFA 3VD9A 4XZPA 3AFKA 5FK7A 5KXCA 5KC5A 3WP4A 5FZOA 1SPPA 5FJKA 3VHRA 4DEVA 4F3JA 1RXGA 4PQ9A 5FYUA 1ZRCA 4ZXKA 5KXEA 2MEV2 5JXIA 2WAAA 5CG9A 1JYCA 4NRPA 3NL1A 4GH4B 1PVC2 4IV1B 5D21A 1AR71 2RS53 4ZPIA 3KHCA 1UXZA 2JE7A 4COWA 3RZGA 3IMNA 5ANNA 5KHHA 1W9WA 1W2NA 4QQOA 4OQ8A 2ZGPA 2YB7A 4KWUA 2QZ2A 4D7YA 3NMBA 3VZOA 2ZGMA 3N7LA 5I0DA 2RV9A 3SITA 3PLQA 4CDUB 1W8NA 3N9LA 4MGIE 2Y0OA 5T55A 4PJYA 3RI9A 2DUQA 4XFFA 3OGGA 4JX0A 1SLIA 5FYTA 1RUE1 2R1BA 3JBG3 5JMOA 2XLAA 3BOWA 3VBUA 5LASA 5A3TA 3THDA 3O1MA 2BNOA 1RUI1 1ND2C 2ZACA 1AR92 4RS5C 4E27A 3H8XA 1YFUA 1H2NA 1W8TA 3FN9A 5FZMA 4FPYA 4NIDA 1IG3A 1CAUB 1BQPA 2X29A 3POEA 2DVFA 4C91A 1IS4A 3LA3A 3OBRA 4DY5A 3TN92 5EFUA 5DXDA 1XXNA 4IV3C 2ZX1A 3RYKA 3NV2A 4B7KA 5LK5A 3OEBA 3VDAA 5BNNC 1LENA 1BK0A 1NLRA 4FCAA 1BKZA 1QOSA 4PI0A 1S2KA 1HRI1 3ES1A 4XFIA 4KGQA 3MF6A 1V6IA 2WO1A 5C5TA 1S55A 5A1FA 5BNNB 5EHDA 4C8DA 2BNNA 2WQ8A 3H1WA 2A73B 3G6JB 4WM7A 2J1RA 4XTMA 5JIUA 2E7TA 2H6CA 3RMYA 4E8DA 4OVEA 4OYUA 3I2FA 4YZ3A 2VUAA 3CJIA 1UX7A 2Y26A 4M3CF 4M0NA 3J7NA 4K1YA 1QDCA 4OHVA 3DECA 1PO13 1RUI2 5I93A 1AR91 3MPBA 4GH4C 5F6KA 1QGLA 4YRDA 5A6YA 4QQ2A 1J59A 4IW3A 3RJ2X 2Q30A 3GHMA 4WVWA 3KCYA 2D97A 2WT2A 3DPRB 3UT0A 4P9JA 1CAWA 2AACA 1LOEA 1W39A 2D6OX 2W46A 3NWKA 3VB9A 3VBRB 4EN7B 1XNAA 1UZ0A 4XF3A 4DINB 3A7QA 2P3IA 3VDBA 3RZHA 4CDUC 3B94A 3NNMA 3AP6A 1Q3EA 4GAZA 2NM1A 2JDZA 1S0DA 1NYWA 2EA7A 2JICA 2W95A 4PDWA 5JZGC 5L36A 4NHYA 1OI6A 3MHZA 4Q4V1 2HWF3 4DB5A 2I2SA 4QKFA 1OMIA 3IPVB 3B01A 1OUSA 4IE4A 5FYVA 5F9TA 1RUH1 5IVBA 1C1FA 3UL2A 2WC2A 3I2JA 2KXLA 3OSDA 2P1BA 3H9AA 4RS5B 3F95A 3WDUA 4CUAA 5FKBA 1ZYBA 1PIV1 3O0WA 4I01A 4B4RA 3AZYA 1E5RA 2HWC3 1V6KA 1JU4A 1Y9GA 3QD6A 3OEAA 3T2TA 1POV1 2AH2A 4N9HA 3ZN6B 1I9RA 1IPJA 1NAEA 4GB32 4GB33 3VBFA 3QH6A 1LESA 1S0IA 4N90A 1W2OA 1YQ5A 4LNVA 5FPUA 2WL1A 3T1MA 1FOD2 4NROA 2G9ZA 3WY6A 4P9WA 1UU4A 1XSRA 3QOPA 1EYBA 4JHTA 3ZPOA 2ID4A 2VNGA 4XJAA 5LZ6A 2XHKA 1A8DA 4ATFA 3OGSA 4JGZA 1H0BA 4XF0A 4YW4A 1EPWA 1PM4A 1GZCA 3DYOA 1AYN1 4ITCA 1D4M3 3I2KA 4CCMA 1PVC1 5A33A 2B39A 1GLHA 1YJKA 5FZ3A 4YVSB 2PA7A 2DU0A 4A42A 3INAA 3NJYA 4HVOA 4BHPA 3ELNA 3O1UA 5HBAA 4MVTA 1UOJA 1E57A 1HN0A 4NIIA 1PGW1 1XB9A 1RUD1 4P9LA 3T2PA 4HK8A 4N43C 4XJ9A 4YGCA 4ZXEA 1OQEA 2OA2A 4NAOA 1WBFA 3WF4A 2DCTA 1VE0A 4X6RB 4ARYA 3AVSA 4BH9A 1RGSA 4FTSA 3T0BA 1YFYA 3VBFC 5LRSA 5HXVA 1MS9A 2G19A 1SDWA 3B9CA 4BA6A 3BVCA 4Y1XA 5FYIA 3CO2A 5FPZA 2VGDA 4EZHA 4IUGA 2QQNA 2VQUA 2DFBA 4YZ2A 4GWJA 5BNOC 2RJ2A 4L2NA 1G9FA 3DXUA 4YNIA 5CEHA 1MS8A 4XQ4A 1QJFA 2VW2A 4RGGA 5FZ8A 1OVSA 4PLOA 3WDXA 4AFDA 5I91A 3M4FA 1HN1A 1IQAA 4XE9A 4COYA 1J83A 3SQOA 1LEMA 2Y64A 3IKWA 5DPNA 2VNRA 3POYA 4JQRA 1QQP3 3OB8A 3UJOA 5JVVA 4IE7A 4HPKA 2X53S 5DABA 2R6QA 2A6XA 2RR13 4XYXA 2VMHA 1BVP1 3ALQA 4F8AA 3OYWA 3PL0A 2UY8A 5FXXA 4D8MA 3V0AA 2FDKA 1RUD2 2ZGRA 5A32A 1EUTA 5BNPA 2E53A 2QDRA 1S1AA 2VOXA 1LOGA 4XDQA 3UKVA 4B8EA 2GH8A 1WLWA 2XR4A 2ARXA 4BXSV 1N47A 1B35C 2AEYA 5FY0A 4FBFA 1FI2A 2WS91 2VZ1A 4JZRA 3CJIC 1U0AA 2ATFA 2CL2A 2HWC2 4HBNA 2Y60A 3RDIA 3N9QA 1B35B 2VVDA 1NT0A 4C1XA 1JH5A 3U11A 3FL7A 1OLRA 3LA2A 4AFBA 1DLCA 3WQ0A 4OHZA 1ND2B 1NKGA 4RN5A 5SV5A 1C5HA 2JX9A 3H3LA 5JCTA 3E6CC 1COV2 2YU1A 4XUQA 5A7SA 3GJBA 1MQTB 1OHFA 1W9TA 4CP1A 4META 5GZGA 1RUH2 2J42A 4YVWA 5GLTA 3WSOA 3JB4C 2WZR1 2W2IA 4I3PA 3SH5A 5FV3A 1FXZA 1W8UA 1V00A 2WDBA 4ATEA 1CJDA 4D6SA 5F3CA 1SBEA 3DXTA 4YW6A 5EYXA 5A33B 1H1MA 4DPNA 4B4QA 1WZXA 4MGKE 1G9AA 5F5QA 2RM23 4XFAA 1RUC2 3RQ0A 2WNUC 3ME2A 4AK3A 3THCA 3AVRA 2PHRA 2K46A 2WS92 3GCWA 4ES9A 2FDJA 2YU2A 2FD8A 2DU1A 4GXLA 2QKDA 1JW6A 2LS6A 2JDHA 1ZBA1 4OZOA 3ZYIB 2AENA 5IVCA 1JN2P 1ZZ7A 1N3PA 1LOBA 4LUMA 1W0PA 2DUOA 5JDBA 3IB3A 5DG2A 3X29B 5C9AA 5FAXA 3BIWE 3NV1A 1ACCA 4M4RA 1WCDJ 1IZ3A 1QOOA 3TOJA 3LQCA 2VMIA 1IGOA 1ZZ9A 4TYSA 1WBLA 4CCCA 3ZXAC 3ZLIA 4UFJA 3WNPA 3S5QA 3K51A 5C8CA 1COV3 3H42B 1KRIA 3ZO0B 1ZBE1 2OZ6A 4YG3A 2JKXA 3JQWA 3CEWA 3KT7A 1VBE2 2YC2A 1PGW2 4OMDA 2WABA 3NAPC 2D6LX 3BU7A 4P14A 3FFZA 4QKDA 2QQKA 2OZJA 2R0FA 3NJXA 4HVQA 1K42A 3I54A 3CL1A 4AEDC 4LR4A 2E7AA 2YMZA 2HYXA 2QBXA 2X5IB 3H7JA 3JBG2 3N7KA 3LDBA 3Q8BA 3U10A 4AGRA 5CADA 3AYCA 4NWWA 3BGAA 3PMEA 1ASJ1 4IQPA 2WZPP 1F5FA 3TNPB 1GQHA 3KCXA 4CP0A 5FP9A 1PGSA 1FPN1 1NLQA 1LGBA 1V6NA 4P02B 1AYM1 1HDKA 1MQTC 2MPFA 3BN6A 3JU9A 2W39A 4E8CA 2RJKA 4AI1A 2WNOA 2FMDA 2RDSA 1HXS1 5D8AB 4AHXA 4F83A 1KGYA 4AI3A 2B46X 4NHMA 4X6QB 3IMMA 1W0OA 2C5DA 4LBLA 2K0GA 4M01A 1SQ4A 3CF6E 4GWNA 3PTYA 3J26N 3IN9A 5E16A 1AL22 2VM9A 4HVRA 5L9VA 4CEWA 4LTAA 1XNDA 3SMHA 5FZBA 1ULPA 4QX3A 2P6CA 2WNVC 5JLVA 1AR83 4CUBA 4Q1RA 5SV8A 1ONAA 1C5IA 1MZ5A 3PUSA 4I09A 2W68A 2OPWA 4LKSA 5GLUA 2ZEYA 4AEJA 4Q8KA 4J6GA 1GP5A 1EV11 4EN0A 3N3HA 3GCXA 5F6LB 4LBKA 3VBRA 1VBC3 1AXZA 2H6BA 2LTNA 1GMMA 4ZS2A 3TB0A 5C70A 3WG4A 1JZ5A 4A41A 5A6QA 4QGMA 4EWAA 4IV1A 4D0QA 1KFUL 5FZFA 3AKQA 2Q8OA 4RHV3 1R092 4ZS3A 1D0HA 4JKMA 4NAMA 2D5FA 1PK6B 2BEOA 2A7AA 1H8VA 5LB6A 1FV3A 3K3NA 2DYCA 4B29A 1H2KA 4BIOA 3RSJA 1H8TA 1LHVA 1UD1A 1W6QA 1CZSA 1U12A 3FWEA 4Z92B 3R0RA 3VBRC 1TME1 1C8NA 1FT9A 1W04A 4H3WA 5DUXA 3TN93 3EMRA 1J1TA 5CFCB 4ZONA 4P9XA 2OQ6A 2WO2A 1UZWA 4GD4A 5FREA 5I0TA 3OOXA 2VCCA 5A3UA 5KHGA 5FZEA 2JG9A 4JDOA 3V0BA 4FPKA 2DVBA 1UZVA 4O7XA 4AQTA 1FOD3 5FUNA 1C8M3 5FBZA 5KHIA 3H8OA 3ZSJA 5GJ6A 2OYZA 4JV4A 4RR3C 4PF5A 4A44A 5BV6A 3HR9A 3MIFA 3VBHB 5DN2A 3VD5A 3U4XA 4XURA 4UI9L 2DCKA 3I8TA 1UKRA 2EXJA 5J09A 3LEMA 3B9IA 1YQCA 3ZSKA 1R091 5FLIA 3AKRA 4AEDB 1HRV1 1H4HA 3K48A 3HMYA 4GJZA 5B2GB 3UK9A 2Q1ZB 1SDDB 2KM2A 1QXRA 2WNVB 1H6YA 3AJZA 2EXIA 3LSEA 5A3LA 2WBKA 4QXCA 4IESA 1GV9A 2VL4A 2RS11 1ZX5A 4CVUA 1GANA 4OZXA 5CFCA 3POIA 2PXJA 4Z82A 5A6XA 2O8OA 4HLTA 2VQ0A 5JPNB 4H55A 3WF3A 5IT6A 1ZBE2 4MV2A 1TME2 3MF9A 3UESA 1JUIA 2HBUA 4HONA 1LNSA 1VJ2A 3SH4A 1PZ8A 4YW2A 2TBVA 4EWDA 1Y4WA 2EICA 3FUQA 3HVDA 2PAMA 3FHQA 4JKKA 4QDSA 5DAVA 1DGWA 4EYUA 4Z07A 1ZVFA 2IZWA 2LW8A 5EP9A 4OI1A 1US3A 2ZHKA 1ULCA 4I0BA 4QPIC 5FZDA 3MDPA 4AQ2A 3BTXA 3WUDA 1W6PB 1HLCA 1YQ8A 3BPSA 3K77A 2QJVA 1NE4A 2D3PA 5A7WA 4NJ4A 4Q4Y1 1V6LA 5T5PA 1AYM2 3KGZA 5CKNA 3TEYA 1SEFA 5IW0A 3MIDA 3H1YA 5G05L 4RHV2 2BGOA 1UIJA 5FP7A 2VW0A 1HRV3 4YM0A 3PUHA 5HXMA 4UT5A 3Q8AA 1XRUA 2RS12 4NN0A 2B7YA 3FE5A 4GWIA 5A7WB 1JYNA 4CEWB 1AL21 3PDQA 3OUIA 2HEWF 3GDBA 1C8M1 3TEWA 1QDOA 3NNGA 5FYBA 4OI4A 3RZZA 1JUHA 5FPXA 1G8WA 3I2OA 2VNOA 4IEXA 4NIGA 3ECQA 5ABJC 2QNKA 5FZ6A 2BPA2 3HBKA 3IDBB 2C9KA 2D3RA 3F2ZA 4HFSA 4LIVA 2XOMA 1WCUA 3NV3A 3SHRA 3VBSA 4KL1A 5LEJA 3DEMA 1BMV1 5FPLA 1TME3 2G1MA 4AEMA 4E4DX 3D4KA 2CAUA 2ET1A 1ODNA 3AP7A 4QB1A 2CTVA 1LRHA 1AHSA 1OPOA 3N7MA 4LBJA 1YIPA 2A70A 3RZMA 4GMP0 2YHJA 4LHSA 3ZKUA 3PVBB 1BVVA 1S0GA 1NZCA 2HWE2 4Q0VA 3ASIA 3OGVA 4WZFA 5A3NA 5A32B 1ENSA 1C1LA 2IXIA 1SCSA 5A7QA 4Z8BA 4KBBA 3CZJA 4W65A 1GFF2 4YYOA 5IJRA 3VBHC 2PHDA 3USUA 2VUJA 2ORZA 2WFF3 4XUTA
chains in the Genus database with same CATH topology
4I30A 1HIXA 4Q4W1 2B9UA 2C9AA 1LULA 4NHKA 2G9FA 1LEDA 2CGNA 1ALYA 1EV13 1QJY2 3B02A 1VBE3 1CPMA 5CNAA 1R083 1SACA 3SCFA 3VHNA 1GZ9A 5JZGA 3IIAA 3FZ3A 1I5ZA 1AR63 3ZXGA 1RTVA 2OW4A 1XE7A 4FAGA 1RUJ1 1UW8A 2XL7A 1PM7A 1JTZX 4HKWA 4QXKA 1RHI3 3DPRA 4AVBA 1MQTA 3AMQA 2NYYA 4COVA 1UIKA 1VBD3 2WJSA 1ZRRA 1LU2A 4YM3A 2R30A 4GH4A 4BOWA 1Z7S1 4FXKB 2A5ZA 2CYFA 4KU8A 5T5JA 4E2GA 3I7DA 4KH9A 4KU7A 1AYM3 2R073 1H1AA 1MEC2 2GN7A 2PHUA 4RFT0 2XKOA 4OHYA 1RUC3 2R32A 3PVEA 5TSWA 2R042 2R063 5JPMB 3O0VA 3RRDA 1U5YA 3KM5A 4IL7A 3RPQA 1XNBA 1QJY1 3M1HA 1DZQA 1RL3A 5DDJ1 5GLVA 1F31A 1MVQA 4XOGA 1NCRC 1R1A2 2FQPA 4BMEA 1KS5A 3GALA 3FBYA 2EALA 5JIAA 5HI0A 5LK7B 3GF6A 1RUJ2 2DVDA 3NO8A 1ZBE3 1DQ5A 5FQ0A 2Q4SA 5AC93 1VRH1 4Y1YA 2CNAA 1DBNA 5JSOA 2E6VA 1O7FA 3V64A 5HCFA 4MSVA 5DZGA 3WDTA 2JJ6A 5I8YA 3CU7A 3DUIA 4K3UA 2JD4A 3AMMA 3I2DA 3IDEA 2UY9A 4RL7A 4CYDA 4DZGA 3L2HA 2R061 3GHNA 5K9YA 2WQ4A 3I59B 4ES8A 1W6OA 2BYVE 3OD0A 1G86A 1YI7A 1OSGA 5J3UA 2BGCA 4NHLA 1GNHA 1GKBA 1REFA 4BPZA 4GULA 3MIHA 1Z7S3 3KT4A 4WM8B 3JCIA 3J4UH 1XNCA 5L19A 4Z2WA 2PTMA 4FVVA 3SCGA 2Z42A 3HT2A 4GIQA 3FFQA 3H1MA 4MXVA 2E63A 1I6XA 4N53A 4LBQD 1KS4A 4IEOA 2XVLA 5IK4A 3VBOA 3BODA 1OOPC 3M3IA 1LOAA 4M3CA 4JGZB 2YGLA 1R093 1UPSA 2XKPA 3JD73 1N1VA 4HSLA 1O3RA 4INDA 2R062 5FO9B 4CDWC 4Q4X1 2BWCA 5J98B 4IEYA 4Q4W2 3WDYA 5JSRA 2C1FA 2WINB 2ZX2A 4FXGB 4G4FA 3VZLA 4AFCA 3WP3A 1ZZ6A 5T54A 2WT1A 4YW5A 2Z5WA 4IERA 3DN7A 4LLFA 1BBT2 4AHZA 1HQLA 1YFXA 2ILMA 5J7MA 1RUG1 5JI7A 2RR11 2AR6A 4W6WA 1N3QA 3HIFA 3RNSA 2XJPA 4Y26A 2AUYA 3Q9OA 2A3WA 4XJZA 1NXD1 4YGBA 2GNTA 2XBO2 4L99A 4FTEA 1VBB2 4HL0A 3N4MA 3BALA 3HBZA 3MW4A 1H8TC 4X8PA 5E88A 4H7MA 1OFNA 4YZ1A 1HQNA 3WINE 4XQDA 2W0XA 3PNAA 2TNFA 1UN1A 1RJ8A 3JD71 1KFXL 2ZX4A 4Q1PA 3MZHA 3S30A 4DQAA 1XE8A 5FMOS 4JVAA 5I0UA 1Z0HA 4AQ6A 5CA6A 3AMNA 4Z1VA 1DGWX 1DG6A 1QH6A 2VU9A 2XJSA 4HPKB 1C28A 1Q8PA 4OUMA 2VOKA 3AP9A 2SLIA 1X82A 1U5ZA 5GALA 4AGVA 2QE3A 5F1RA 4HANA 1QWRA 4ISRA 4YG6A 4A7YA 1PGL2 1LHOA 1ND2A 1OFSA 1JBCA 2E7QA 1MR5A 2YPJA 5L73A 4SLIA 4JGYC 4CP2A 3UV9A 2VOVA 5CU1A 1PO22 3H3UA 4YVSA 1DZRA 3PVOA 3ILNA 1UAIA 1PK6C 1DQ0A 2A6ZA 3NKTA 4Y20A 2PFWA 5J96B 2YXSA 4AEKA 1NY71 2GDFA 3EXUA 3SH3A 4LBQB 4WM8A 2AZ5A 4R8HA 4WVVA 4YGEA 5JSPA 2PN5A 4IEQA 3WG1A 3WUCA 2ZBJA 5T3NA 2OPKA 1YHFA 4HN1A 2CWSA 2QQPA 4UW5A 2G9GA 4N43A 5BUVA 3S0MA 5EZWA 3ZXEA 1NCRA 2VPVA 4N53B 2VY0A 2CWMA 3WV6A 1LR5A 5AC91 1QXJA 3O14A 1AUYA 4K1ZA 1LGNA 2R1DA 1UMZA 1LKNA 1PGL1 4RR3B 1IOAA 1R082 1OD5A 5DDJ3 3H7YA 3DL3A 4YG0A 3M3QA 4YW3A 4UBHA 4COUA 2F6BA 3TRSB 1F9KA 1G9CA 1PO21 4XHBA 4DS0A 2DCYA 2TUNA 4YZ5A 5LEKA 5H9QA 1PZ9A 4Y1VA 5A3MA 3MICA 5GZCA 4HN0A 2IXHA 4H7LA 3ZSLA 1W2UA 5AFEA 2OVUA 4IEPA 3SISA 1I1EA 2LUWA 4FOQA 5EYYA 1TNFA 2WQZC 3KGLA 4P9YA 1TMF2 2ZOEB 4LHLA 2ETEA 2GC2A 4LBQA 1AL0G 4AVVA 5HCAA 4DOUA 3R4UA 2ZTNA 4CDQA 4B7EA 1HRI3 1BCXA 1VBD1 3VKNA 4TLFA 4DY3A 4MX3A 5ABJA 2I45A 5AC92 2ENRA 2UU8A 2XWJB 2Z69A 1R081 2Q1MA 4M3CE 4IEUA 3LOBA 2WIIB 2KA3A 1OA3A 1BZWA 1DHKB 4HK9A 3AYDA 1PO12 1RUI3 3WXPA 1Q8SA 3A4UA 5IUQA 1H2MA 4WV8A 4AVAA 2JG8A 1CAVA 1QJZA 3WR0A 1DIWA 1AXYA 3QACA 2VH9A 3VZNA 4WM7B 2DVAA 1FPN3 4GALA 4YM2A 5EXOA 3UKTA 1VBD2 2WWSA 4WM7C 4KWLA 5EV7A 3JQXA 5I8SA 3TWIA 1G7YA 1RHI2 3WW3A 3MFCA 1VALA 3M70A 3VGIA 4HKLA 5C9AB 4TSVA 4QQHA 3B93A 1V9U2 1ULGA 2JG8B 2FMYA 2YROA 2XB6C 1SFNA 5K0UC 1ZNPA 3B69A 1AL23 3MLLA 2GMPA 2FZ1A 4XILA 2Q0AA 1GICA 1RUF2 3WW4A 1X33A 4YSFA 4K8FA 1ZREA 1NY72 3IPVA 4LBMA 3B3QE 2WA3A 2PLV3 4XF1A 1BEV2 4EN6B 3BCWA 2WNUA 1APNA 4EJRA 3LKJA 4QT6A 4Q0PA 5GM0A 3RI8A 4QGLA 3A0NA 2DV9A 4A7KA 1KITA 3MIGA 4QPGA 3SNMA 3M8LA 1ZBA3 5J48A 3ZSMA 1UZZA 3M3EA 3E6BA 1MZFA 5E1RA 1PVC3 1LHUA 3VZKA 1S2BA 2DWRA 2JKBA 3IT8A 4BLJA 4IXLA 4X8NA 1WUVA 1F5JA 2RS32 3ZXDA 4D7TA 1GZWB 5AFBA 2F4PA 1F8VA 5AVPA 1ZA4A 2ZGLA 4LO8A 1H9WA 4L92A 4MH0E 4KGGA 5IK8A 5FRAA 3TYJA 3IDCB 2NN8A 1LOFC 2RS13 2VVEA 1J3PA 1NA1B 1WW7A 2P3JA 1XU2A 2Z2SB 1JOJA 3AK0A 4CDWB 1CPNA 3P3NA 1RINA 2RMU2 2VOWA 5IK5A 1N1SA 3WHTA 2HWF1 3FHIB 3T1LA 3N35A 3ACLA 5JR7B 4AHWA 1RUE2 2WS93 3AXDA 5FLHA 4N53C 1RC6A 5JZGB 3AYAA 4UBGA 4XJUA 1RMU1 1DQ4A 2ET7A 4P5HA 1XQNA 4JTNA 4LUKA 3BPZA 1GBGA 4RR3A 2RS33 4K9SA 1AZDA 1BYHA 2D93A 1PO11 4CDUA 2NP0A 1ZZ8A 4OHWA 1N3OA 4KWKA 2D5HA 5I0SA 3WG2A 3H0OA 3USSA 3WDWA 2XJVA 2BUKA 3UJQA 1YUDA 1RUG3 3ILRA 5JWPA 4NVPA 3AMPA 3WZ1A 4DMIA 1RB8G 1DQ6A 2AGSA 5CAZA 1TQ5A 4K7JA 4NO4A 2PLV2 3S7EA 5ACA2 4JDMA 1CX4A 4QPIB 2CGOA 3BOPA 4RGAA 1RHI1 4Q4X3 1AX2A 1RUF3 4LO6B 4AI0A 3ZXFA 5KXBA 3D6EA 3TAYA 1LHWA 1IS3A 1AR61 1LGCA 1MZ6A 3V0BB 1OOPB 1LCLA 1NCQB 1NA1C 1L3JA 4QM9A 2YDEA 4Q29A 1UF2C 1QNWA 5C4WB 1X50A 3VKLA 1NCQC 2V5YA 1GR3A 1AR72 2DTWA 2WFF1 1BK1A 4E4SA 2QVSB 1AYN3 4PLNA 3HAGA 2VVFA 1NE6A 3OTFA 4YFZA 5CFDC 5KXDA 4A3XA 1O5UA 3O12A 4F7ZA 5JOYA 1HXS3 3S6PA 3E5UA 4QPYA 3ILFA 1YI9A 4OLLA 1ASJ3 4QHBA 3VKMA 4MZUA 4FP2A 1S0EA 3U0ZA 1NOVA 4FPHA 1FNYA 2BFUL 2RS51 3L2YA 1YJLA 5KBFA 2I74A 4GB31 1Q56A 5K7PA 1PO23 4CRQA 5FQ0B 4AHYA 1C4RA 4QM8A 5C6CA 3AKTA 3B00A 3ZN6A 1WMDA 4AXOA 1RJ7A 4LBNA 3I59A 2HWB2 4YGDA 2EAKA 4EROA 2W08A 2ZZQA 5C9AC 5T52A 3QLQA 2CGPA 1VRH3 5BNQA 4Q0QA 3VBSC 5C8CB 2YV8A 3VBFB 4XF9A 4L8QA 2RHPA 1HRI2 3GNEA 1MS1A 1J58A 1EY2A 3E6DA 3C3VA 3VBSB 5C8CC 1QOTA 2D3SA 4AVTA 1J59A 3D82A 2H0BA 4LHNA 3U07A 2WZR2 1Y9QA 1Q8QA 1TMF3 2GALA 4FT8A 3OY8B 4M00A 3EJKA 2YZ4A 2GC3A 2X8KA 4Q4Y3 3ZPYA 4DFSA 5BNPC 3NW4A 1VB2A 2GMMA 4PDWB 4KG8A 1AVBA 4PBOA 1SLCA 2ZKNA 3JUUA 3W59A 1RMU2 3ZVXA 1O4ZA 4NWVA 3OGJA 2E9QA 5C8WA 2DCZA 1KJRA 2A71A 2ZX3A 1CAVB 2UYAA 3D8CA 3POWA 4YARA 5GKAC 4CZSA 3D5OA 4LT5A 2ZGTA 1NQDA 3ENRA 5K8SA 4AFMA 1DZTA 1ENQA 4K21A 5BNOA 1A3KA 4JGYA 5DG1A 3NAPA 2GNDA 2MHFA 1XNKA 4XXAA 4Q4V2 2ZMLA 1RUJ3 2WT0A 4FPJA 3AMHA 4D94A 1FATA 1W6NA 3WP6A 1RIRA 1UU6A 2UYBA 5DUWA 2ARBA 1LHNA 1CIWA 4LEJA 2IXKA 4Q4W3 1DGRN 2FZ2A 1QXPA 3P3PA 1ENRA 1OOPA 1SMVA 1A78A 1FOD1 1S0BA 1KD7A 3MIEA 2QUOA 1VP6A 1MACA 2WKKA 1FYUA 4CDXB 4KWJA 5JAXA 3TN91 3O7OA 1AYN2 2Y0IA 4XIOA 1IHMA 1VB4A 1WW5A 4N9IA 4AG4A 4GKXA 1MVEA 2OIIA 1HV1A 3NVCA 4FPEA 3R4DB 2GZWA 1OQ1A 4G3YC 4NOTA 4C1WA 5HCBA 5CBLA 5CB7A 3IM0A 4Y20B 4S2FA 4XJWA 1WMFA 4QPGB 1DQ2A 4WM8C 4Y22A 5KC6A 4C0HA 2XUMA 3KSCA 3R4SA 4CDQB 4XFCA 1WCKA 3VBUB 4WBBA 1UPIA 2PAEA 5CIRA 5JOZA 1V6MA 2EVXA 5BNPB 2GSYA 1TEIA 5GZFA 1DU3D 3N36A 1WW6A 4UXAA 3WW2A 4RSUA 4JGZC 3USUB 1JHNA 4JC1A 3NKGA 3ZX7A 1ND3C 1QQP2 2HYKA 1YIFA 2D6MA 2P17A 4Y4YA 4QU2A 2ERFA 4S2GA 1KDKA 4MXWA 3MEPA 4QGNA 2HWB3 4BWOA 2A3XA 1SBDA 4B3NA 1NXMA 5BNOB 2VMGA 2YUEA 1W6PA 4LE4A 1AJKA 3MI8A 4XBLA 1HX6A 2A6WA 2XLFA 3TBDA 5FLJA 1D2QA 4HKOA 1OKQA 4R9CA 3BB6A 2HWC1 3VUOA 2D6KA 2R072 2A6VA 1ASJ2 5EJ3A 2ZA9A 1YLLA 3AZWA 1POV3 4CDWA 2A75A 4E2QA 2FBEA 3CJXA 1VR3A 5FOBB 3RJRA 1UL9A 4IV3A 4I0WB 4Q0SA 3ATGA 1WLCA 1Q8OA 1RUH3 1UX6A 1COV1 4JAAA 4XEZA 3CNAA 2PHWA 3PMSA 4Q4V3 3OBTA 3PJYA 1ND3A 4WVMB 3RS6A 2ZS6B 3HD8B 2G4IA 2V09A 2ZKLA 2DFCA 5FDBA 3EHKA 2UWBA 1QJY3 2XVGA 4AWDA 1K5MB 3VZMA 4O9EA 5CVRA 1RUC1 2WSUA 4Y24A 3S7IA 3W58A 3RYPA 1D2SA 3KQRA 1PHMA 4ORFA 2UWCA 4OHXA 2R071 2QDNA 1ZBA2 2CV6A 3EQEA 4LO7A 3VZJA 5DUUA 4Q4Y2 3SCHA 1EAH3 4DRRA 2PHLA 4ISQA 1XYOA 5C33A 1ENXA 1U5XA 2WZR3 4RHV1 2NQYA 5I0RA 2ZPXA 2GN3A 2XPJA 2R49A 4ASLA 1O4TA 1LOFA 2XLGA 3H8UA 3KB5A 4AE2A 2O8QA 4C0BA 5GZDA 1DF0A 1G9BA 3E5QA 1ULFA 4OULA 4AVSA 1VBE1 3DV8A 3VDDA 4XMIA 4R52A 1AR81 3MW3A 3M3OA 1G9DA 3L9JT 1UCXA 2UURA 4YLZA 4R4ZA 4BQ1A 4GQ7A 3JBG1 5FO7B 4Y5Z0 3WG3A 3O0XA 4RQPB 3M2MA 3DKWA 2JG9B 3WQ1A 4LE3A 1FPN2 3WQ7A 1RUNA 4BMBA 2RMU3 2CY6A 1HQWA 3I4IA 2H0VA 1YFWA 3ZYRA 2Y38A 5ABJB 1HXS2 2JE9A 3VBOC 2IC1A 2ZAAA 2O0OA 1QQP1 4KNCA 2XL9A 3ZFGB 4HMZA 4LO5B 4AQSA 4DXZA 5D8AA 4PCRA 4MUVA 4YVWC 4PDWC 2NZ9A 4K6BA 2QCSB 1RUOA 2PAKA 3EBRA 3GBWA 1WGPA 3DPRC 3PHMA 2O1QA 3OCPA 3FMGA 1S0JA 1AR82 4OI2A 1CGPA 3WCSA 1EV12 1AJOA 3MLKA 4A7ZA 3AP5A 1H8TB 1W6QB 4ONUA 2EIGA 2GC1A 3R6SA 2DTYA 3C2UA 5KHKA 1CJPA 4DRVA 3HWJA 4CDQC 4JRAA 1REDA 2A3YA 2SBAA 2XJQA 3ZFGA 4GMP1 1PVXA 3OYWB 5EWSA 1HW5A 4CEYA 1CESA 3IWZA 1KXGA 5J37A 3RYRA 3PJQA 3ETQA 1FAYA 3B5LB 4NPRA 4XFHA 4B4PA 3RWNA 5E89A 2PQQA 1ZZBA 1FV2A 3MPPG 3ZSEA 1BJQA 1QNYA 2R041 4PIYA 4EN8B 2MEV3 3ZDSA 3VDDC 4WZCA 5BPXA 2HJIA 4BCUA 1LOCA 4AVCA 4XIKA 1F2NA 1R1A1 2X5IA 1QJU1 2D7FA 5L7OA 4XETA 4A2UA 2YYOA 1V6OA 2B8MA 2R043 2D43A 1MS3A 3MYXA 3SLIA 3ZFFC 1YXWA 3LGRA 1O4YA 3TNQA 1X36A 2BVBA 2GMEA 4BM8A 2XG3A 3LZZA 4J1XA 3AB0A 1OPMA 1CD3G 3VHPA 1V6JA 1ULEA 2HWD1 1DDLA 2JXAA 2HEVF 1VBC2 4PIXA 5FTTC 4P9IA 4CDXC 3GZUC 1QU0A 1POV0 1JXNA 4MGZE 4O9GA 1VIWB 2D6NA 3VV1A 1WD3A 1QF3A 1TE1B 2YGMA 1GNZA 3M7AA 2ZHMA 1Q5OA 2NMNA 1J1LA 4AFAA 4FO9A 2DCJA 1AR93 2BNMA 4GKYA 3KMHA 1IPKA 2PHTA 3WP5A 1GZWA 1B09A 2IXJA 1XU1A 2W52A 3ZYJB 1U5IA 1IS6A 3PVNA 1W6OB 3APBA 1FMD2 1T6GC 4XBQA 3LB9A 1QY4A 3URFA 3AKSA 3O5SA 1OA4A 2JENA 4FTBA 3MGUA 1VBC1 4FQ4A 3V56A 3G7DA 2WNEA 1LJ7A 4YM1A 2P37A 2E51A 2PHFA 3HN1A 1SLLA 1H1IA 3WT3A 3ZXJA 1XYPA 2N7GA 1C8M2 1CVNA 1DQ1A 5BYNA 3MIBA 1J3RA 1RUD3 4XPVA 4Y1UA 4ASMB 5DDJ2 4GA9A 1VBB3 4S2HA 3CLPA 4LHKA 1RVF1 4BYYA 4FSJA 1BMV2 4FPCA 3DGTA 4Q0UA 5DZFA 4ZU7A 3THPA 1EPZA 3A0KA 1ZM1A 2B45X 4XHXA 5KWRA 4CEYC 1N1TA 1FMD1 1HRV2 2K2SA 4OUSA 4C90A 1H9PA 3AXEA 4JRLA 1YWKA 3WVJA 3J8F1 5C4WA 2OUHA 3LAGA 1Q8VA 1VBA3 4LULA 2BBVA 2GNMA 1EAH1 3AYEA 3MLJA 5DZEA 4YVSC 2RM22 4Q26A 3M3CA 3H3ZA 2DVGA 5K0UA 2QZ3A 3JD72 4MYEA 4QQLA 5CFDA 3ZFEB 3LCPA 4ZU5A 2VQAA 2XVKA 4W6YA 5FFOC 1PNFA 5E8AA 4Y1ZA 1QHDA 1AXKA 3VLBB 1QJU2 1R1ZA 4N43B 1CONA 2ES3A 1DYKA 1NLSA 1I3HA 4N7IA 2K9ZA 4W6XA 4XFGA 4U36A 5K0UB 4CTEA 1X8EA 1ZRFA 3D0JA 1NA1A 2P2KA 1NG0A 4EN9B 1MS5A 4QPGC 4EV0A 3KS7A 1K5MC 4E4ZA 4J1WA 1VLNA 3NAPB 3FC0A 3POSA 2VXRA 3E97A 1IKPA 1B35A 3VKOA 2HWD2 1YRZA 3FBMA 1BEV3 1MEC1 5C4WC 3JZVA 3ZXLA 3VHOA 4FPFA 3MW2A 1V70A 2D40A 5LRRA 1W6NB 2RM21 4BLIA 2XH6A 3VKFC 4FOWA 4S2DA 1SLTA 1W6MA 5D1IA 1S0CA 2PELA 4M0HA 2ZGUA 4JDNA 3J8F3 3KT1A 4AEDA 1V9U3 4UW6A 2B5HA 2WSVA 4XBNA 4AW7A 1O5LA 1ZRDA 4D7SA 1ZZCA 1CAXA 3VL9A 1VRH2 1PZ7A 4RS5A 4XXPA 2HWE1 1VAVA 2XJRA 5FOJB 2XBO1 1VBB1 1FNZA 2XJTA 5FO8B 4GMP3 1S0FA 2PYTA 2BW8A 1CQ9A 2CAVA 2HKXA 1UU5A 1YO8A 2WA4A 2JG8C 4TWTA 1MZEA 3ZIWA 1NQJA 2GAUA 4RD7A 3VBOB 4L11A 5KHJA 1IS5A 2P3KA 4E9KA 1GQGA 4KG0A 3WLUA 5I8TA 5BXXA 4R9DA 1WA4A 1RVF2 2ZHLA 3ST7A 3AZZA 1AX1A 3UKNA 3DF0A 1IKQA 1QJX1 2D6PA 1AR73 4FPGA 1MS4A 4AYUA 1D4M2 1KJLA 4LBOA 4Y22B 2WFPA 1REEA 1LB2A 1QJX3 4HSJA 1QKQA 5FMOL 1Z7S2 1LODA 5JOWA 3OJBA 3AP4A 1VAKA 3J8F2 3FLTA 1H4GA 2JEMA 4LA3A 2VW1A 1EAH2 2ZHNA 4BZ4A 3CJIB 1PMIA 1O3QA 4EWEA 4HETA 4M3CB 4Q4X2 3JB8A 1DLLA 2GU9A 2WLQA 2BQPA 5ACA3 1TNRA 2YC0A 2BVVA 3ZFFB 3THTA 5GLZA 2OUJA 2MNGA 5AVAA 1ULDA 2B42B 2AYHA 3AFGA 2PHXA 3HQXA 1BBT1 2ZCWA 2ZGKA 4Q2FA 4QMAA 2HWE3 1RUG2 1M4WA 2JECA 1EP0A 2XBO3 4HT1T 4XTPA 3VL8A 1W6MB 1WLDA 3LOIA 1D4M1 3HT1A 3V0AB 3WCRA 2ZGSA 2IXCA 3GYDA 1SLAA 1QJU3 3RMXA 3KCCA 4RQPC 4XQWA 5FCCA 1V9U1 5D8AC 1H2LA 2EAAA 4AI2A 3D0SA 1UZYA 5H9RA 4G9SB 3KLSA 1PK6A 1WD4A 3WD5A 3ZFGC 4K40A 4P9GA 1X8MA 3QBQA 4MXWB 4LLOA 1MEC3 2ZMKA 3QH7A 3ZMOA 2WLPA 1VBA2 1PIV3 2ZJCA 2RJLA 1GYKA 3FLRA 3VBHA 3ZIXA 1BEV1 3QCWA 5BNNA 4BIFA 1VAMA 2XGXA 4QX5A 1DFQA 1SFYA 2LALA 4LO4B 2I07B 3ZFEC 3J9SA 3FUOA 2DURA 3EO6A 5T50A 2WNVA 4L97A 2ZZJA 3GZTB 4FAHA 5JMCA 4ZU4A 4LA2A 1QH7A 4R9AA 1OLQA 4QPIA 3ZXKA 3VN4A 3VBUC 3OF1A 4RA0A 4N7UA 4HZFA 4R4XA 4COZA 4SBVA 5H9PA 3GBGA 2YY1A 4D3WA 2A6YA 1N1YA 1ND3B 4WVMA 3B7MA 1YCIA 2RE9A 5GZEA 1Y43B 3ZFEA 1JYIA 1VBA1 2Q5TA 3N7JA 1WCSA 5CFCC 5CG8A 2NPIA 3ES4A 2EXHA 2VULA 2AREA 1NCRB 1X7NA 3BTAA 3V65A 1FMD3 3WW1A 3NV4A 3NJZA 2RR12 3VDDB 2RMU1 1J3QA 1LU1A 4MLOA 5GLWA 3FJSA 1QJX2 3NSTA 5T5LA 2HWF2 1LECA 5DUVA 4AI8A 4K20A 4IETA 1URXA 3WNXA 1AX0A 1Z78A 1C3HA 5JI9A 3E5XA 4RQPA 1K5MA 2NLRA 4OFGA 1RVF3 4XJ8A 1BBT3 2ZX0A 4I2OA 5BY5A 3RG0A 3H50A 1RITA 1LTEA 1CAWB 3IBMA 1HKDA 1RUF1 1RUE3 4OI0A 1Q43A 3KZ4C 2BTVC 4R9BA 3ZN4A 4ZKTB 3LSDA 4JGYB 1SBFA 4U2AA 2ZGOA 3WHUA 1SLBA 2GC0A 2HEYF 5L7OC 4KQ7A 1WLTA 1YYNA 2P34A 1DYPA 1O3TA 2WNUB 1QMJA 3FLPA 4XF4A 3MFAA 4DNYA 1UKGA 4YFWA 1AF9A 1O91A 1HV0A 1PNGA 1WMEA 3AKPA 3LWCA 1AR62 1D0GA 2RS31 2FHRA 1A6CA 4FQZA 3W9AA 1KQRA 2UWAA 2VECA 4XMAA 1NCQA 2DUPA 3OY8A 1D4VB 3SXWA 4CEWC 1RMU3 3GZAA 2BWAA 5T5OA 2Z79A 1Y7BA 3AM2A 3WX5A 1YNAA 2VG9A 3AX4A 2WFF2 4FPLA 2BFUS 4QQPA 4URTA 5J36A 1MS0A 5IK7A 4IEZA 2HWD3 4XFBA 2R16A 1DGLA 2QFEA 1FX5A 3AJYA 1M06G 1A8MA 2ZAHA 4Q27A 4Q8LA 4UW3A 4AF9A 4IV1C 2X5IC 4I02A 4NR1A 4YW1A 2D44A 4FP3A 3ZYPA 2IXLA 2RS52 3ROUA 4YZ4A 4PBPA 4GWMA 2JG9C 4AGGA 4IEWA 1SCRA 2V73A 4FOVA 4PIZA 5JOXA 4H14A 4JTOA 1O3SA 3WDVA 4CEYB 1CN1A 1R1A3 3ZYGA 3R05A 4FPOB 5CFDB 1OA2A 4QD2A 3GBFA 1DGRA 4XW3A 2LM3A 2GH2A 2HWB1 2ZGNA 3ZN5A 2ZABA 1G6NA 1CAXB 1OQDA 2MEV1 3AZXA 2R0HA 2TEPA 2XJUA 5H9SA 4V1PA 4JCKA 4UW4A 4YVWB 2IFRA 2IFWA 4D69A 2NMOA 3OD4A 1TMF1 2C0ZA 1XYNA 4PLMA 4CDXA 1CR7A 4I0AA 2EXKA 1GSLA 3WOGA 2D98A 2IWGB 4IV3B 2XWBB 1PIV2 1WW4A 3FX3A 4WVZA 4L9BA 3LA7A 3OPZA 4BE3A 2EF6A 2PLV1 5ACA1 1KDMA 4I3GA 1C57A 1CAUA 2GNBA 4FOY