4S2FA

Joint x-ray/neutron structure of trichoderma reesei xylanase ii at ph 4.4
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
190
structure length
190
Chain Sequence
ETIQPGTGYNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNSGNFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQQGLTLGTMDYQIVAVEGYFSSGSASITVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Endo-1,4-beta-xylanase 2
publication title Direct determination of protonation states and visualization of hydrogen bonding in a glycoside hydrolase with neutron crystallography.
pubmed doi rcsb
total genus 55
structure length 190
sequence length 190
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2015-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4s2fA00
3VHPA 1YNAA 3AKPA 5EJ3A 2C1FA 5K7PA 3AMMA 4HK9A 2DCJA 2VUJA 2BWCA 3AKSA 3RI8A 3WQ1A 1C5HA 1OA2A 1REEA 1XNKA 4XQWA 3AMNA 3WP4A 4S2FA 5HXVA 1IGOA 4HK8A 3WQ0A 1TE1B 3LGRA 3WP3A 3RI9A 3ZSEA 3WP6A 1NLRA 3WX5A 4S2HA 2DFCA 1T6GC 2D97A 1XYOA 3WY6A 4HKWA 2F6BA 4XPVA 1XNDA 2BW8A 1UU4A 1HV1A 3VHOA 3VL9A 1HIXA 1XNBA 1C5IA 2QZ3A 1KS5A 3AMHA 1OA3A 1XNCA 4XQDA 2JICA 2D98A 2NQYA 1OLQA 2B46X 1F5JA 3O7OA 3AMPA 1QH7A 2QZ2A 3B5LB 4NPRA 3EXUA 2B45X 3VL8A 1ENXA 4H7MA 3VZLA 2JEMA 1H4HA 1H8VA 1HV0A 2B42B 1UU6A 3VHNA 3VZNA 3VZMA 3VGIA 2Z79A 1REFA 3AKQA 4HKLA 3VZOA 1PVXA 1BK1A 1M4WA 2VULA 3AKRA 3VLBB 3WT3A 2DCYA 3VZKA 1H0BA 2VG9A 3MF9A 1XYNA 1AXKA 4XQ4A 1REDA 1UU5A 3MFAA 1QH6A 1BVVA 5K9YA 2VGDA 3VZJA 1UKRA 3WP5A 3B7MA 1BCXA 3LB9A 2NLRA 3AMQA 3MFCA 3M4FA 3WQ7A 1XXNA 4IXLA 3AKTA 1W2UA 1OA4A 2DCZA 1H1AA 3HD8B 1XYPA 4S2GA 1OLRA 1KS4A 3MF6A 2BWAA 2BVVA 2DCKA 4HKOA 2JENA 3WR0A 3WXPA 1H4GA 2DFBA 4S2DA
chains in the Genus database with same CATH superfamily
4CDUB 2AC1A 1BKZA 4LBQA 4BDVB 4OI1A 1LGBA 2ZX1A 5JZGC 2XONA 1DHKB 4CYDA 5BPXA 4HK9A 1CX1A 1F8VA 3RI8A 5EJZB 1ND3B 3UKTA 3PL0A 4NUBA 1OA2A 4Q5OA 3TAYA 2NYYA 3ZKYA 2J1UA 1KFUL 4UFLA 5JXGA 5FV3A 5FZIA 1LEMA 1GZ9A 3PTYA 3ZR6A 2VM9A 2WDBA 1PZ8A 5KC6A 5JSRA 2NN8A 2VMDA 1JOJA 1RINA 2JE9A 2ZEYA 3A7QA 1VRH2 3JXSA 2WZ8A 3BN6A 2JJ6A 3UV9A 1CAUA 1DYPA 1OKOA 1VBD3 2EIGA 4MH0E 1UZ0A 3HPNA 4ISRA 2YPJA 1W6PB 1W9TA 3MYXA 4FVVA 4XURA 1XPWA 1GU3A 4KBBA 5HCFA 1Y3TA 1EPWA 1CESA 1V6KA 4L92A 3WF2A 4ZU4A 3KVAA 4PQQA 4GH4C 5A1AA 1YFUA 2WS91 2WQ8A 4P9LA 1WKYA 1OD3A 3OBZA 4YNIA 5H9RA 5FZDA 1A8DA 3VBHA 1PVC1 1E57A 2PAKA 5LA9A 2O8QA 4NHLA 3ZYFA 1XNCA 3VDDB 5A1LA 1JH5A 4HLTA 5FLHA 3V0AA 1PX4A 2JDPA 3N9LA 1OMIA 2EALA 2UY8A 2A6YA 2EF6A 4YWAA 1QH7A 1TMF1 1UZWA 4CDQC 1NG0A 4PBOA 4ZONA 3LDBA 4A3XA 4B29A 1XRUA 4OHVA 2GAUA 4Q29A 2X5IB 2D3PA 5C4WB 2GNTA 3KV4A 1LKNA 2BVBA 1KEXA 1PK6B 4Z82A 1IG3A 4V2WA 2DVDA 3U78A 1WWYA 2ZMNA 1NQDA 2IUWA 2YBPA 1PMHX 5JIAA 5FMDA 3IBMA 2AH2A 2XKOA 2W1SA 1O4ZA 5JCTA 2DCYA 3J7MA 4QGMA 3HQRA 4V1PA 4ASMB 1POQA 3MF9A 3VN4A 3KSCA 1OBNA 4LIUA 5JOXA 4UFIA 2QQOA 2ZBJA 3ASIA 3HT2A 2YBSA 3LIHA 4I2OA 5FZCA 4PDWB 4WM8C 5DZGA 3ZIWA 3N7MA 1O59A 2HBUA 3BCWA 4LQRA 5I0RA 1FT9A 1FV2A 3EB7A 3DXUA 4MHRA 3VBSC 2VQ0A 5LZ6A 2DVAA 2IFRA 2VMHA 3PLQA 3GHNA 3SNMA 2XJSA 3KWVA 4W6WA 1R1A1 3W59A 3FHAA 4N90A 1DZRA 5EJ1B 4LBJA 2WQ4A 1AYM2 1GNYA 1J1LA 4FTSA 1RUF3 4FOWA 2WYSA 3SLIA 4CCCA 4ZU5A 5FPUA 1CR7A 1KFXL 3NKGA 4QHZA 4XUPA 1JTZX 2WO2A 2BVVA 1MACA 3CJIB 3ZPOA 5FZ9A 4AFBA 1MEC2 5T52A 2XR4A 4B7EA 4QDSA 1RUE3 3RYRA 1HLCA 3U4SA 3EO6A 2UWBA 1OQEA 5FYCA 3E97A 4RYDA 3ZFEB 1K3IA 2VUJA 2XBO3 1F4AA 3ZYPA 4RD7A 5D8AB 2RR12 4LULA 1MQTC 2JD4A 2WR9A 3WP4A 2K9ZA 2LW8A 4Z2AA 4Y20A 4NR1A 1LHOA 4AI9A 4DEQA 4AEMA 5IVCA 1IGOA 2JG9C 4JX0A 4TXWA 3VV1A 5IUQA 5C8CA 5HXMA 2FZ2A 3J7NA 2D43A 3HMYA 3P1IA 1GV9A 1XE0A 2QJVA 4NAOA 5ANNA 3CHXA 5JMOA 4QPYA 3FJSA 4AI8A 4PLOA 2DUPA 1AXZA 2IXIA 1HJFA 2Y6LA 2VZTA 4PCRA 5FZMA 3SH4A 2X8KA 2HWB1 1SMVA 4M0NA 4META 3ROUA 3KF5A 4BQ2A 5ACA3 4PJYA 1UD1A 2ZPXA 1VB4A 2EIDA 5JLVA 5DDJ3 1N1YA 1RTVA 3RS6A 3RVHA 2HLEA 3OBTA 2WNEA 3FL7A 1JS9A 1QJY2 2ZMKA 4RHV3 2C26A 3QH7A 3H42B 4JRAA 4P9JA 4QKBA 2W9XA 4XBQA 3MUY1 3DYMA 3LIGA 2RMU1 4OZOA 2ZX2A 5B4XA 5CBLA 1YQ2A 4EV0A 1AHSA 4FAHA 4LIVA 2A1XA 1AXYA 2V5YA 4NPRA 5CG8A 3WVJA 2GC0A 2ZABA 1GNHA 3KT1A 5JSOA 3HQUA 4ZHNA 4BQ1A 1TQ5A 4WVMA 1H8VA 1W2AX 1UYXA 2D7FA 1WD3A 4YW7A 5LCWL 2P5BA 4DRVA 1UQXA 4YVWC 1PO11 2GC2A 5BUVA 4EZ4A 2FBEA 2J1RA 1W06A 4HZFA 4AVTA 2JKXA 2PLV3 2R042 4XZUG 4Q4W2 4RFT0 4UF0A 1W8FA 3AKRA 1W6PA 2A71A 1O6UA 1W6QB 2OS2A 1GQPA 4YW2A 3E6BA 2HWE3 4NE9A 3I2FA 1BEV3 4OLLA 4X8PA 1CZSA 1G8WA 4DY3A 1ZRIA 1GZWB 1Q8QA 1N3OA 3DECA 3K4AA 1SQ4A 2XOMA 4W6XA 4MGQA 1PX3A 3WCRA 4JRLA 3T1LA 1UKRA 2E7AA 2VNVA 3WP5A 1UAIA 1JZ4A 5A7WA 4N9IA 1JN2P 2FMYA 4JGZB 3VDDA 1ZBA2 1UIJA 2XHNA 4YM2A 1WCDJ 2Y0OA 5C8WA 1W6OB 2C24A 4F83A 5FK8A 2GALA 5L19A 2Q0AA 4AGGA 2Y0IA 3CIHA 1YEWA 2VVEA 5H9SA 5C4WA 4BMEA 4FPKA 2PXJA 1VAMA 5KXBA 2VOXA 3OD0A 3NMBA 1YFYA 2ZX0A 1PK6A 4UT5A 2QVSB 3B02A 4R9AA 2QQWA 3T3YA 4I02A 2WFF1 4IE0A 4XUOA 3ZLIA 4M4PA 4MVTA 3WINE 4AGRA 4CP0A 2OW4A 4CXYA 2E32A 3DUIA 4S2DA 3VHPA 1KGYA 3L2YA 4NHXA 1Z7S1 2VOWA 3V56A 2LM3A 3PDQA 1RUNA 1W39A 3JB8A 4K40A 4CE8A 1J3PA 2WWJA 3POBA 1KXGA 3JBG2 3D8CA 1XNKA 1HXS3 3BPSA 1S0CA 3I3DA 1DFQA 2A6ZA 2VMCA 3K4DA 4GULA 5LBFA 4CU8A 2GN3A 3LOIA 5T55A 2VCBA 4JGYC 4AR2A 4YVSC 1QNYA 4YSFA 4AAPA 4NAMA 2JG8C 4JVAA 1TG7A 3Q8FA 1QEXA 2DCTA 1OPMA 4FTBA 3AYAA 3U0ZA 1JYIA 4ZU7A 4QQ2A 1NX9A 2WT0A 4E4ZA 1AJOA 5DZFA 4XPVA 4YGDA 3I2JA 2IXHA 3VD5A 4MO3M 3DYOA 1ULFA 3AZVA 4GZ9A 3KGLA 4Q0PA 1J3RA 5IT6A 1NY72 3GXUA 2JXAA 2BJSA 3CJIA 5EXOA 1LODA 2FZ1A 3IIAA 4L97A 3X29B 5A6XA 3T2QA 5JXIA 2VZPA 3U37A 2HWC3 4AEKA 4KL1A 5BNPB 5T3NA 5FPAA 2ZGTA 1QJX3 1O4TA 1VBB3 2XG3A 1YQ8A 3ZOIA 5LA0A 5C3OA 1BQPA 1GSLA 2BQPA 3KVBA 3OGJA 3R4DB 4PLMA 3RFRA 3ZFEA 3GZUC 4I3PA 4N7UA 3LEGA 3O0WA 1IG0A 4NJ4A 5D8AA 1NXD1 3LWCA 2R073 4UWDA 1NCQB 3ACGA 4PIYA 1NCRC 4BISA 1PIV1 1SLCA 4OCTA 5LBEA 4CEWA 4XUNA 4Y1XA 1ONAA 3DKQA 3POFA 2RM22 2WRAA 4IEVA 3ETQA 1OQ1A 1X8EA 2F17A 4K7JA 2GSYA 4KI5M 2JDNA 2TBVA 3UGHA 4JZRA 2WNVA 2RDNA 1RUH2 3I2IA 3J4UH 1OQDA 3USSA 1K5MC 3NNFA 1WA4A 5LB6A 1ZBE1 1UF2C 2JDHA 3VBFA 1BK1A 1BZWA 4CCNA 4Q4V2 2DUOA 2Z2SB 2VG9A 2CV6A 4X6RB 4BK5A 4DQAA 1VRH3 4Q8KA 5AVPA 4ASLA 2JE7A 4XJWA 1RVF2 3MFAA 3AX4A 5FY1A 2AR6A 1BVVA 3HNMA 3M3QA 2VGDA 3OUJA 5GLZA 3ZIXA 3RDIA 4P9GA 2R063 2PELA 4R9BA 4YRDA 4AQ2A 5KC5A 3DCQA 3M4FA 4FPFA 2H6BA 3CL1A 2ZGRA 3IT8A 1TZOA 2XJQA 2ZGSA 2JWPA 4J1WA 1IS5A 5JR2A 5CFCB 4HN1A 1AL0G 2C0ZA 2P6HA 2WZR1 3TRSB 1CZVA 4IE6A 4ORFA 1V0AA 3IWZA 1WD4A 2E26A 4XDQA 2ZMLA 3WDWA 1AR71 1UIKA 2QFEA 2ZGPA 3K3OA 4JKMA 5FZHA 3C2UA 1OOPA 5KHGA 1QJU2 5FO8B 4DXSA 5FP7A 2A70A 4PT6A 2E33A 1JHNA 2VZQA 4HKOA 2JENA 5AVAA 5H9QA 1AL22 4AZZA 1WMFA 2A3YA 4UYBA 4BQYA 5KR7A 1ZZBA 3MLKA 4NRQA 4QU1A 4KU8A 5FY8A 1CWPA 1LHUA 4OUEA 4HSJA 1I6XA 4NPMA 5BV6A 1U5XA 2QE3A 4CTEA 1EY2A 1RUJ3 3LQCA 4IGQA 3GJBA 1GZWA 2VZ1A 2WWUA 1H8TA 1REEA 4BWOA 4AG4A 1ASJ1 3AP5A 1UOJA 1J84A 1RUI2 4DEVA 5LA1A 2W3JA 3WQ0A 5F5QA 1S2BA 5FUPA 1WCSA 5J98B 5L36A 1W0PA 4QX8A 5A7QA 3PU3A 3O12A 4YM0A 4AFMA 1OHFA 1W6OA 1D2QA 4S2HA 4MOAA 4JC1A 2D97A 2XMLA 3BOWA 3WY6A 4E8CA 4KGGA 3JUUA 2VH9A 3J8F2 5IVFA 1PO22 1UU4A 3E5XA 1AYM3 1J59A 5IAXA 3LOBA 5K0UA 1IS3A 3WEZA 5FY9A 4NN0A 3LDKA 4QKNA 4NVPA 5J7MA 2D6NA 3MBWA 4LEJA 5JOZA 4YG6A 2B8MA 3PUQA 1AR91 3N9MA 1PNGA 3OF1A 3T09A 3OPZA 1TME1 2C9KA 1GWKA 4JDOA 4AFAA 4MV2A 4GJYA 1MEC3 4YZ3A 1OLQA 2B46X 3PUIA 1Q8SA 3KT4A 5FZLA 1PGSA 3AYCA 2VCCA 3SEEA 3VKNA 3INAA 2HWF1 3ZM8A 3POGA 4GALA 3ZMOA 2E9QA 3DYPA 3D6EA 3N35A 5FZOB 4BQ5A 1LU1A 3ACFA 1D0HA 3T2PA 2GC1A 3JZVA 3FLTA 2RR13 3RYPA 1AR63 4QKDA 3M3OA 3WUCA 4GJZA 3NAPC 3B69A 1FOD2 3FUOA 5BNQA 4BMBA 1ACCA 4CDUC 1K45A 3U4XA 1O3TA 3ZXDA 3AL5A 2ES3A 2HYKA 3I49A 2WA4A 4GIQA 3WZ1A 2YC0A 3C7EA 2RHPA 1SCSA 1UX7A 1FMD2 1ND3C 1F15A 5L73A 4L8QA 2A5ZA 3E6CC 4WZFA 2HEWF 1AYN1 1L7QA 1S0GA 2GDFA 5IK5A 4BJ0A 5BNPA 3F2ZA 2AZ5A 5M0TA 2P6CA 5LBBA 1R093 2ATFA 3VBOC 1UO9A 2VBDA 2AEZA 2DVBA 4IXLA 3SC7X 3KF3A 1YI9A 1OUXA 1V9U2 2VMGA 1H1MA 1QJY3 1ZZ6A 3O0VA 1OA4A 3UKNA 5FZ1A 2FCUA 3RZZA 3FE5A 3FLPA 4W50A 3JU9A 5C3PA 3ZXGA 3L9JT 3D5OA 3LEKA 1OLRA 4DNYA 4LUMA 3IDCB 1QQP1 1LHNA 3I2OA 4LE4A 1G6NA 4DXZA 1BXHA 3GBFA 4MGIE 5IK4A 5IK8A 4HXCA 2B5HA 2J1SA 2X05A 2RS51 3ETPA 3VD9A 4XF1A 4Q0QA 2OYZA 1NA1B 1C57A 4XEZA 3UESA 4XDPA 5FPVA 2IZWA 1XBFA 2HYXA 3N9NA 4YW4A 3HIFA 3MDPA 3ZR5A 1VBE2 1CX4A 2R043 4MXWB 1MS0A 5JMCA 1YQ5A 4Q4W3 2CDPA 1SHWB 2JDMA 1V6LA 1XE7A 1MPXA 2B7YA 4WVVA 1MZEA 3N3HA 4JKLA 1WMXA 2X5IC 4XQWA 1CAUB 1VALA 2PHDA 3O1TA 1NE4A 1WLCA 4LUKA 4UFMA 2VU9A 3LKJA 2ZGMA 2RG4A 2E51A 3IM0A 1SCRA 1PK6C 1FXZA 1SLTA 2DTYA 4K1YA 4LBNA 2WLPA 4A44A 3O14A 4MGTA 3VUOA 3VBUA 4CP2A 3TB0A 4WZCA 3VDCA 5GZFA 4AAXA 4YW3A 3A4UA 1PO21 5K4LA 3I97A 1E5RA 3VBHB 2NM1A 2DYCA 1L7LA 3CBNA 4FT8A 1ZBA3 1YQCA 4HKWA 3I7DA 4XE9A 1F4HA 2D6KA 3KHBA 5F3GA 4B3NA 3BKZA 2HWD2 3AXDA 4LK7A 4R52A 3C7OA 5FZGA 3SKVA 3V0AB 4YFWA 4PDWC 4JDMA 1Q8VA 2VD7A 4AVVA 1C5IA 4QD2A 4LKEA 4Q4X1 1FNYA 1KS5A 4AW7A 1SFNA 2MEV2 1GYKA 4KWJA 3WW2A 3C7GA 4DXRA 4H7LA 5EIYB 3CKHA 5A3LA 3J26N 5IW0A 3S7IA 1NLSA 4XHXA 1BLZA 2ZKNA 3LFIA 5IJRA 4RS5A 4TN7A 2QZ2A 2WNUC 3LEIA 4QWNA 3M3IA 2CWMA 4UW6A 5FXXA 4PIXA 2AREA 2B45X 2RJ2A 5CKNA 4CEYC 4IESA 1MS8A 1FOD1 1HV0A 3JBG3 4ES9A 3S0MA 4COYA 3MIBA 1UWWA 4DY5A 1WZXA 2JDUA 3IPVA 3RZHA 3IMMA 5FZ7A 1FPN1 5KXDA 2Z79A 5CB7A 4JHZA 3HQXA 3SH3A 4GMP3 5I8SA 3N4MA 1D4M3 2ADEA 3OUIA 3PUSA 3PVNA 2WWSA 4O7XA 3ZYBA 1BYHA 5EYXA 4DZGA 4LHNA 1FI2A 1OKQA 2CDOA 1ULCA 2JIGA 2K2SA 1CVNA 5D8AC 1PVC2 1C3HA 1WCQA 2VL4A 3AVRA 4XJ9A 5FMOS 1DP0A 3DXTA 3ZO0B 1H1IA 1JU4A 5J37A 5JAXA 1V9U1 2IXCA 2Y34A 3HAGA 3HNYM 4MGZE 3KQ4B 1HJGA 1GICA 2MNGA 1PMJX 2WKKA 2X09A 3B00A 1LHWA 3HNBM 4Q4Y1 1TMF2 4GQ7A 1VR3A 5LASA 2PTMA 4KWKA 4D69A 3T4HB 2D3SA 4QX5A 2VBBA 4W6YA 2VNRA 1QGLA 1S2KA 1UMZA 4S2GA 3OCPA 5FZOA 3IDAA 4LO5B 1VP6A 5ABJA 1Y9GA 5HV4A 3W21A 4HONA 4K8RB 2YPDA 2ARBA 4HVRA 1UMHA 4YZ4A 5FUIA 4EN9B 3ZVXA 3WR0A 4EYUA 4ZPIA 4B1MA 3EJKA 3J7HA 4KG0A 2W1UA 3WXPA 3FLRA 3GBWA 4XHBA 2RM23 1N1TA 3BTXA 4Y20B 1RYYA 4AEDA 2C1FA 3VHRA 4XIOA 3ATGA 1RUH3 4ZXEA 5C8CB 5FUNA 2H6CA 4OUMA 2I07B 1HB1A 2VNGA 3H3ZA 5FDBA 3WCSA 3H0OA 4Q4V3 2VOTA 2YDEA 5FWEA 2K0GA 4S2FA 1V00A 2R7EB 1EYBA 2LS6A 2RDRA 3MIGA 3OYWA 1C1LA 4HK8A 4XACA 5AC91 1RVF3 3WP3A 1IPJA 2J7MA 2Q1MA 3RI9A 4B4QA 3KV9A 1OH3A 4CDWA 1O3QA 4XF4A 5I0TA 2HWD1 5CISA 1T6GC 2NMOA 4J25A 1UZZA 2WN3A 3M1HA 3LA2A 1NYWA 3B94A 1OT5A 1ZVFA 2XVLA 4H14A 4E4HA 4KNCA 3OPTA 1RC6A 1SFYA 2JECA 1JW6A 3I4IA 4LBMA 4LNVA 4UXAA 3TN93 3WDXA 5JWPA 2MEV1 2X10A 4CDXB 3FX3A 4EN6B 4BB3A 5J3UA 1NA1A 2B9UA 1I1EA 1XU1A 4LPLA 4N43C 1QJU3 3MHZA 4QM9A 4MYEA 4XCAA 4JGZC 4PF5A 3R6SA 3U07A 2W5FA 2JICA 4M3CF 4WVMB 1VBC1 3AM2A 3CDZB 4EE2A 2HBTA 1AL23 1XOYA 1S0JA 3ACLA 4Z2WA 1Q8PA 4MXWA 4HBNA 1H2KA 2HH9A 4A6SA 1SPPA 2Z4FA 2VO5A 4UAPA 1O3SA 1ZRFA 4BH9A 1ST8A 4UF0B 5DUWA 1CONA 4IV3A 2P3JA 4HANA 5F3EA 5A32A 5J09A 4HG6B 5JSPA 2WAOA 1JMUB 1KJLA 3GDBA 3PTRB 5DPNA 4A3ZA 1C4RA 5F5CA 1G9FA 1WBLA 1RUI3 4Q8LA 5I93A 4E9KA 2P34A 2VECA 3AJZA 3I3BA 3WG1A 2ZS6B 4BA6A 2HWB2 4KWLA 3OOXA 1RUC1 5A7WB 4XF0A 4K21A 4YW1A 1YI7A 5I0DA 2D93A 5CKQA 4AFCA 4R9CA 2QTWB 1X33A 1REDA 3WNOA 3ZYJB 1ULPA 4GAZA 1UU5A 1AVBA 2WO7A 1CD3G 4BQXA 4ZY9A 3H8XA 5K8SA 4JAAA 2OPKA 2RMU2 2C6SA 3DPRC 3P3NA 5FMOL 2XJTA 3S7EA 1OPOA 3S6PA 4DUVA 5JPMB 2NLRA 5BNOA 2ORXA 4BPZA 4UOJA 4O9GA 1ZNPA 3W9AA 3WDVA 1DQ5A 2YV8A 4GB33 1O8SA 5IVVA 2SBAA 4RR3B 3BUCA 4DINB 3ZN4A 1GZTA 1H6XA 1PO12 1WW6A 2DUQA 4FOYA 3HT1A 5I0UA 1JYWA 1J58A 3BTAA 4R9DA 3T2OA 4ASKA 2YC4A 4QAWA 4CVUA 4DUWA 4CCKA 2WABA 2DF7A 3NW4A 1LU2A 1R081 4B7KA 2QUOA 5LY2A 1V6NA 5F39A 1RL3A 3ZXLA 3O1MA 2DFBA 2J1VA 3MICA 4EWEA 5C70A 1JUIA 4LBLA 5JXHA 1CIWA 1K5JA 3GBGA 4QPGC 5LRRA 4OHZA 4OVEA 1POV1 5K7PA 2VVDA 2WL1A 4Y5TA 1NXMA 4GMP0 5EFUA 3D82A 4IGPA 4YGCA 5T5LA 2BRTA 4AI0A 1OH4A 1ULGA 5CZKA 4JTNA 4D7SA 3D0SA 1HRI1 1NCQC 4XJAA 1UCXA 1MZFA 4UBHA 3KV5A 2Y6GA 4XCBA 5E88A 5KXEA 2ZKLA 3AXEA 3NJZA 3RMYA 1RUOA 5CEHA 4JHTA 1X9PA 1NAEA 4XVHA 5LY1A 5C3QA 3B93A 3E5UA 1VE0A 4L2NA 3WF4A 2RS33 5EZWA 1NLRA 1US2A 1MS1A 2O1QA 4XUTA 4XFAA 3GZEA 1GQHA 4QPIA 4RQPB 2XHKA 2XGXA 4OMCA 3TYJA 1DGWA 5F2SA 3THCA 1ZZ9A 4LBKA 4LHLA 4CCOA 4FTEA 4DO0A 1JYCA 2BU9A 1K12A 2WFF2 4W4ZA 5L7OA 1CAXB 1QJFA 3VDBA 2A73B 2GNMA 1MVEA 4LK6A 1B35C 2DBNA 1CN1A 4CUBA 1LR5A 5FYZA 1JYVA 2JB4A 5A6ZA 3RYKA 1NOVA 1Z7S2 3M70A 2VQAA 1S1AA 1DF0A 1EUTA 3QH6A 3K77A 3FZ3A 1ZREA 1H30A 5CKMA 4A7KA 1F31A 2DURA 1UXXX 2E53A 2VZSA 4AGVA 1QNWA 4CEWB 1S4CA 3I59B 5F6KA 2ZHMA 4QQHA 5CFCC 1DQ2A 2C9AA 5CFDB 4ARXA 1RB8G 2QDRA 5DAVA 2WNVB 3H8OA 3CU7A 2AGSA 5CNAA 3ZXKA 2GC3A 1WW7A 4YZ5A 2VQTA 2GH2A 3VBFB 1GFF2 2XXZA 1H4HA 2R0FA 2R16A 3SMHA 2Y6HA 1OF3A 4DS0A 1WLDA 1IQDC 3VZNA 5JIUA 3ZPYA 4NO4A 2VUAA 3PMSA 1PM7A 3VZOA 4QQLA 1PVXA 4AHYA 1LOEA 3ACIA 3MIFA 3BGAA 2OUHA 1PZ9A 2WJSA 4C1XA 2YU2A 4BLJA 2EXHA 4CPBD 1V70A 4OZXA 5CA6A 5T5JA 3PU8A 4CDXA 2UU8A 2YMZA 1SFPA 2FQPA 3BALA 5F3IA 4Z8BA 4DPNA 2F4PA 4WV8A 1RUD1 3JB4C 1SLLA 3I2GA 2D6OX 2OZ6A 1QWRA 3ILFA 3IZOA 1OOPB 3THDA 1ENSA 4CUCA 3ZKUA 3B9IA 3H1WA 1DYOA 1MVQA 3IIIA 3JCIA 4QM8A 4C91A 1VAVA 2ZOEB 4EN8B 1V6OA 1PIV2 2ILMA 2EAKA 1XSQA 4TTGA 4MZUA 1LAJA 3VD4A 3PVBB 3GZAA 3PNAA 3MIHA 5JI7A 5T50A 3VBRA 5HBAA 4IERA 4BLIA 1MZ5A 2CGNA 3EBRA 1SDDB 3BOPA 3UT0A 1V6JA 3ZFFC 1ZBE2 5FBZA 3NQHA 3ZFGA 4L99A 1H8TB 3WG4A 3VD3A 2SLIA 4B8EA 3ZYIB 5JUVA 1QXPA 2RVAA 4EWAA 1QF3A 3NNLA 3K46A 4WVWA 1GLHA 2WSUA 4Z07A 5A70A 2ZX3A 4QMAA 4IV1A 3AKSA 1OVSA 1MR5A 2GN7A 3WQ1A 4FI9A 4LR4A 1C5HA 1MS9A 4ATEA 4E4SA 1F2NA 3AMNA 1HB4A 4Q26A 2WS93 3A0KA 4XIKA 5BXXA 1VRBA 4Y1YA 3OY8A 2ZEXA 5IVJA 1PVC3 4NOTA 4WM7C 2WZR2 4XFFA 4C0HA 3LGRA 2PHXA 1W0NA 5JZGB 3N7LA 3DN7A 4FAGA 5K0UB 1RITA 2BGCA 3GZTB 5F8PA 3WX5A 4RR3A 1AR72 1FATA 1UNBA 3FHQA 4K9SA 1XNAA 4M3CB 5FCCA 5TSWA 2RDSA 3ST7A 4PF1A 1YFWA 3MPPG 2EXKA 4FPJA 2P3IA 4XYXA 3VHOA 2BFUS 5DQ0A 1S0EA 4Q2FA 4KQ7A 1LTEA 1W8TA 2VW1A 4F8AA 3MEPA 3NV2A 4NIHA 4FFIA 1TVGA 1X8MA 1LECA 2IWGB 4CA9A 2YROA 3AJYA 4CCJA 4XXPA 2D6PA 2BEOA 3NWKA 3AMPA 1ASJ2 4GH4B 4CCLA 2WA3A 2ZXQA 2D40A 2VUCA 2YFUA 2ETEA 1N47A 4DUXA 4L11A 1YO8A 2W95A 1YRZA 2AEYA 3QOPA 4XDOA 3IMNA 2B42B 4LXLA 5C7GA 2Y33A 4L0PA 4EQVA 5LWBA 1WBFA 2EAAA 3RZKA 4CCEA 1WW5A 1LOFA 3T4VA 1NA1C 1RHI1 3C7FA 3VGIA 2MHFA 3CO2A 1ND2A 2XB6C 4RQPA 1R1A3 1PGL1 3DF0A 3BU0A 4FPEA 5JPNB 5GZCA 4J6GA 5F5IA 1W0OA 3WT3A 3AB0A 1ZM1A 3NV1A 4FP2A 4Y1UA 1QOTA 4YM3A 1VMFA 1CAXA 4QX3A 4URTA 4HVOA 1AR92 4CUAA 4I01A 4NPLA 2P4EA 1TME2 3BVCA 3WF0A 2ZGLA 4AQSA 3K3NA 4QHOA 2W94A 5F7UA 1HN0A 2KM2A 2IXJA 5FYYA 3ZSEA 4LJHA 4BIFA 4D6SA 5FZBA 5D21A 4YZ2A 2QQVA 5FZKA 3LSDA 1JZ7A 3SXWA 5C9AA 3I59A 3LZZA 3T1MA 2PAMA 2HWF2 1I5PA 5CFDA 1W2UA 3FWEA 1DGWX 3VBHC 1H1AA 4R4ZA 1NE6A 1COV1 1HRV1 5EHDA 4A41A 5KHIA 1LOBA 1DGRN 2JIJA 2ZCWA 4AFDA 3LA7A 2CGPA 5FO9B 1JHJA 1YC61 5KXCA 2UYBA 5A1FA 4B4PA 2R32A 1O5UA 2VAUA 1D2SA 3SCGA 2CU5A 5BNNA 3ALQA 2E31A 5FZ8A 3U14A 3K4ZA 4FXKB 1J83A 5EJ3A 3KCXA 2DBIA 1LENA 4CP9B 2VW2A 1A78A 5FYVA 3R4SA 3KZ4C 4XJUA 1AYN2 1BBT2 3AZYA 3GHMA 4CRQA 1G9CA 5DUXA 2FDKA 2YGMA 3VBUB 3O1PA 1EAH2 2ORZA 2HWB3 5I8YA 2JDYA 4WBBA 4DMIA 3IN9A 3I2KA 1RXFA 4FPHA 1VBA1 2XVGA 4EN7B 2ZZQA 4KG8A 3QCWA 1QDCA 3WF3A 4ZXKA 3WDUA 3O1OA 5FFOC 4E4DX 2JB8A 4MGSA 3GCWA 2XJUA 1RXGA 1RMU1 1N3PA 3RZLA 3OSDA 2RMU3 1XE8A 3WG3A 4Q0SA 4ZKTB 1AR82 1J3QA 1CPNA 1QQP2 3LAGA 5FPZA 3AC0A 3KT7A 4YG0A 1MS5A 2OUJA 2V72A 3IDEA 1JYXA 4QB1A 4QQOA 2RS52 5LK5A 1LESA 4EZHA 2BNNA 2OQ7A 4U2AA 2LRPA 4O61A 5FYMA 4CP9A 3AK0A 4XETA 4PQ9A 1OXCA 2Y8KA 1R64A 4N53A 2BFUL 4RS5B 1PO13 4X8NA 3A22A 2QZ3A 2NP0A 4TSVA 1VIWB 1IQAA 1KJRA 2GU9A 4XAEA 3T0AA 1DIWA 5FKBA 4JKKA 4M3CE 4UBGA 1URXA 4FFGA 1LOAA 3NL1A 3AP4A 3IPVB 1LULA 2VTXJ 3UJQA 4XOGA 5FR3A 5EV7A 3ZYHA 1DLCA 5GLTA 3EXUA 3BYWA 3H7YA 2RJLA 3RPQA 5ERLA 2FCTA 2F4LA 5FZ4A 3PJYA 2XKPA 5JZGA 2Y38A 5T5OA 4NWVA 4OQ9A 4X6QB 3S5QA 2BZDA 3VZMA 1EV11 1D4M1 3HEIA 2AENA 4CU6A 1C8M1 3HN1A 3P5BA 5AFBA 3MPBA 1W6NB 3ELNA 3FN9A 1G9DA 4M3CA 3O1SA 4IE5A 4TWTA 4NRPA 5C8CC 4FOQA 1KQRA 4MHUA 4NIDA 2BP6A 3JD71 4YVWB 5JXJA 1T6BX 2OQ6A 4Q4X2 4ONUA 2VNOA 3NVCA 4GD4A 4XQ4A 2E63A 1UOBA 4NIAA 3THPA 3ZX7A 5EQUA 3AZZA 3SHRA 2QBXA 3OEAA 4FP3A 3VZJA 4L9BA 2WFF3 5FY7A 3QBQA 2A6WA 4AQ6A 1BCXA 2J42A 1UXZA 1GOHA 5ABJB 3ILRA 4EWDA 1QXRA 2VJXA 1Z7S3 3OUHA 4GWIA 3AKTA 4HFSA 5J1XA 4YGEA 1W03A 1ULDA 4GH4A 3MO4A 4ATFA 3IDBB 1DQ1A 4XJZA 3WUDA 4XTMA 2VZ3A 3AZXA 4AEDB 1FPN2 4EJRA 5F37A 4IEWA 1HB3A 3FC0A 3M3EA 3MLLA 4UW3A 1H2MA 1YJKA 3N9OA 3WSOA 5C5UA 2Z69A 2YYOA 4AL9A 1POV0 1XSRA 1G9BA 1DGRA 1BBT1 3NO8A 4CDQA 1I5ZA 3SISA 3THTA 2XJPA 2BNOA 4CU9A 3KS7A 5CG9A 1EAH1 4OULA 5EPAA 3OYWB 2HEVF 3N9QA 3E1F1 5A7NA 3USUA 2ZJCA 2BNMA 4P02B 1PGW2 4OYUA 5FZ6A 1PNFA 2YU1A 3R4UA 4SLIA 5DAXA 1G9AA 1RUG1 2R6QA 2TEPA 3ZXAC 4CDWB 5JDBA 5FZ3A 3UK9A 4Q4Y2 2Q8OA 2RS11 5G05L 4E2GA 1N3QA 4BIOA 1O5LA 2WLQA 3PMEA 2I2SA 2G9FA 3OPWA 3TNPB 3B3QE 1AR81 1TE1B 4LLOA 1BJQA 3ZSLA 4AHXA 3S5AA 5C3SA 1OUSA 1VLNA 2MPFA 4YPJA 2PA7A 3DV8A 4P5HA 4CPBA 4FPLA 1FV3A 4XILA 3C8XA 4WM8A 4UI9L 4Y5Z0 2DFCA 2JDZA 3D3AA 1NKGA 2Y6KA 4MADA 1D7PM 3AFGA 3H1YA 2XL7A 1U12A 3DKWA 1W3XA 3M8LA 3PHMA 2VR4A 3NV4A 1UX6A 4JGYB 5H9PA 4QU2A 5A33A 3VDDC 1PIV3 3VBSA 5A7SA 1HV1A 4D3WA 2XUEA 5A7OA 1OURA 4YYOA 2WZPP 4CCMA 3U11A 5ISLA 4CCDA 1SPPB 3CNAA 3O1VA 1XQNA 5SV5A 5C4WC 2ZX4A 2R1DA 4BU2A 3ILNA 4K1ZA 1ENRA 1ZBE3 1VMJA 2XL9A 3R05A 4IV3B 4LOTA 2D98A 4K6BA 1DU3D 2KA3A 2ARAA 5A32B 5LEKA 3ITQA 4IGOA 1YCIA 4RR3C 5FKCA 1F5FA 4BQ4A 4FPOB 5IHRA 3HBZA 1VBD1 3NJYA 5FOJB 4HN0A 3OTFA 2H0VA 2ZTNA 3ON7A 3OGVA 3N9PA 4IEYA 1W05A 2XLGA 1IKPA 5AC92 3GGLA 3H8UA 3EMRA 3SH5A 4COWA 4DIQA 2DVGA 2W1WA 3WNMA 1OLMA 1ZA4A 2X53S 5KHKA 4JV4A 4I3GA 2LROA 1O91A 2RV9A 4A6OA 5IK7A 3WW1A 2ZGUA 1APNA 4JQTA 4NHMA 4RSUA 1RGSA 2X29A 5J36A 1MQTA 2PHRA 4AVSA 1REFA 1I3HA 2WZR3 5L9RA 5DG2A 2OT7A 4M00A 2ET1A 2OA2A 3NNGA 4IEUA 1H2NA 3RMXA 3TBDA 1MS4A 4RHV2 4C1WA 2IVJA 2JG9A 2VC9A 5BNOB 1AZDA 5IYYA 1XYNA 1AR73 1WCUA 3MW3A 1ZRDA 4ZZ8A 4B4RA 1X9TA 1OFNA 2ZZJA 2VTXA 1TEIA 4XFGA 3OBAA 4I30A 1K5MB 1VBC2 1W8WA 4Z92B 1X36A 4Y5SA 1VAKA 2Q5TA 3OBRA 2P2KA 5JI9A 2FDGA 1SBDA 4GA9A 1QJEA 4IW3A 1W99A 4R8HA 2A7AA 5CVRA 2XWBB 4COUA 3WQ7A 1XXNA 2O8OA 4XFHA 3CJIC 1H6YA 2UY9A 2JX9A 2ZHKA 4BM8A 5I8TA 3H1MA 2G1MA 2ZGKA 4LO8A 4AWDA 2P3KA 1STMA 5EP9A 3TNQA 3MF6A 1L3JA 1LOGA 1ASJ3 4MXVA 2RJKA 4LKDA 3ZFEC 4RN5A 3ZXEA 2VPVA 5BY5A 4E2QA 1BEV2 1RUC2 2EICA 3SEPA 1DG6A 1PGW1 1W6NA 2I45A 1BHGA 3V0BA 3AZWA 1SG3A 4FQZA 5FJHA 3ZN6A 4PHZA 2O14A 4QB6A 4QX2A 4CEWC 1VMHA 1Q8OA 3FHIB 3N7JA 3AMMA 4YVWA 5FYUA 2FCVA 4G3YC 2WNVC 4LLFA 1RUF1 5LBCA 1CIYA 5FXZA 2PQQA 4MGYE 1HX6A 3PJQA 3AP7A 4JDNA 4QPIB 4QX1A 1WGPA 1CAVA 4XMIA 3VBFC 1OF4A 4FPYA 4XTPA 5A6QA 1O3RA 1G86A 2RS31 1IS6A 3OD4A 1UOGA 4NHYA 4AVAA 1HQWA 4YARA 2PHTA 5L7OB 3LA3A 3TEXA 2WYFA 1ZA7A 2ZA9A 3J9SA 1TME3 2CHHA 4Y24A 4Y1ZA 2WN2A 3K75B 1RUE1 4IEXA 4YGBA 1WUVA 3NJVA 4HT1T 5FTTC 4HMZA 3WNXA 3TEZA 1DGLA 1SEFA 5T54A 2FDJA 1UKGA 2HWF3 3RGBA 2XBO1 1R082 1W8OA 3RZMA 1US3A 2A3XA 1QDOA 4LOSA 4ISQA 2ARCA 1XNBA 2VXRA 3WF1A 1LRHA 2QKDA 2WSVA 4HSLA 4FPCA 2EA7A 1DLLA 2ADDA 4A2UA 2XLAA 2YZ4A 5CAZA 1OOPC 3BPZA 3NKTA 5E8AA 1X82A 2FDFA 1HRI2 4IEZA 1DQ4A 3AYDA 3RNSA 5I0SA 2L9LA 3KV6A 1S0DA 2BPA2 4OI0A 5T5PA 4IETA 5FJKA 1CAWB 2G9GA 3GCXA 5E89A 1IOAA 3UYJA 1XJAA 2V4AA 5IATA 1ZZ8A 1Q3EA 4FO9A 4RGAA 1C28A 1PHMA 1QMJA 1AYN3 3BODA 4CXXA 1JZ3A 1ENXA 4H7MA 5ACA1 2XUMA 4QXHA 4FXGB 3VKLA 4YLZA 2EIEA 5FO7B 3CZJA 2YGLA 5DDJ1 4CUGA 5CYYA 4LTAA 1H8TC 1LHVA 4RHV1 4XBLA 2XH6A 3H8RA 2CSGA 3ZXFA 2DU0A 2ZEWA 4QXBA 2QQIA 2OZJA 4XC9A 4JGYA 5DXDA 4YVSA 2VZUA 4C8DA 1BMV1 2JG8A 1VBB2 3MW4A 5F3CA 2VE1A 1AXKA 1QQP3 4E2SA 4Q1RA 1DQ6A 2QQJA 3NAPB 1ODMA 1JODA 2KR2A 4TLGA 4KMQA 2RS53 4UW5A 5LEJA 3QLQA 1JI6A 5HCAA 2R072 3ZMNA 3MV11 1YWKA 4GWNA 1GOGA 2NPIA 4IEOA 1QY4A 3KD4A 1CJDA 2GMPA 3ECQA 5FXWA 3VBRB 2QQPA 4FSJA 5K0UC 1YUDA 5GJ6A 5A80A 3O1UA 3T0BA 2PLV1 5GLUA 1UZYA 2VCMA 2O0OA 1NZCA 1U0AA 2W52A 4HPKB 4Y1VA 2Z42A 3ZFGB 3POYA 1Q43A 1GZCA 2HWE1 5FY5A 1BEV1 5DUVA 2VXJA 3VBOB 2BWAA 4ARYA 4YZ1A 1GANA 1WMDA 2CL2A 4IV1B 3AP6A 1P8JA 1XB9A 2GNBA 2OXBA 2P37A 4BXSV 1D4VB 1UY2A 1VB2A 5ANQA 4ET7A 3U75A 1QHDA 5KWRA 5IWFA 4I09A 2CGOA 1WCKA 1NCRA 1S0IA 2BTVC 1PM4A 3J8F3 4UW4A 5E6HA 1PO23 4PLNA 2A6XA 5F32A 3A0NA 3MV01 3OY8B 2R062 3B01A 3GM8A 4AYUA 3GYDA 4XABA 1YIFA 1UY0A 1CQ9A 1RUD2 2IXLA 2ZEZA 3H9AA 1YFXA 4QX7A 5FYHA 5A3NA 1UY1A 3HVDA 3SKJE 4BK4A 1K5MA 4EROA 2WZEA 1M06G 2OVUA 2PQSA 2I74A 2OPWA 3RWNA 4Q4X3 5HXVA 2GP3A 4COZA 4DRRA 2GP5A 3K2OA 1YHFA 4D8MA 3ZN5A 4HVQA 1W28A 2UURA 3FFZA 2D6LX 4XW3A 3IKWA 3L2HA 1GWLA 1W8UA 5HI0A 3PVOA 4IE7A 3MW2A 5BNPC 4IQPA 1F9KA 4H2AA 2ET7A 2VY0A 2OKXA 4DXTA 4ZZ5A 1GP4A 4P14A 5IFPA 1VJ2A 1XNDA 3M3CA 3LCPA 4NHKA 3VL9A 1D0GA 1HXS1 4V2VA 1FOD3 2CY6A 1RUJ2 1TNRA 2W91A 4Y4YA 3POWA 4XF3A 5DAQA 3AMHA 4LO6B 1FPN3 3KGZA 4PBPA 2D6MA 2XDVA 1HN1A 1W9FA 3N7KA 1FMD3 1DCSA 4RGKA 2Q1ZB 4URAA 2NQYA 3URFA 1H9WA 5D1IA 1RIRA 1HQLA 1JYTA 3WNPA 2WAAA 3KHCA 3B5LB 4Y26A 2ARXA 2EXIA 1ND2B 3VL8A 3ZYRA 1W2OA 3WOGA 2G4IA 4ZS3A 4LE3A 4AQTA 1LEDA 5FYTA 1WW4A 1V9U3 1FAYA 2WQZC 1X50A 2A6VA 5JR7B 4NIGA 3KLSA 2HWC1 4W65A 1WMEA 3KCYA 4Q4Y3 2WNUB 3P3PA 1J1TA 1BK0A 1QJX1 1VBB1 2DU1A 2B39A 5A6YA 1PZ7A 2VZVA 4OHYA 1MS3A 1SDWA 4OHXA 4CEYB 3POIA 3BTZA 1EUUA 2LTNA 3M7AA 1FNZA 1C8NA 5HV0A 4AF9A 3VBUC 4AVCA 5C9AB 5HCBA 1BVP1 2R071 1S2EA 4PI2A 4IE4A 3WHUA 5F9TA 3C3VA 1UOFA 3AP9A 2DTWA 1Z78A 2H0BA 2ZAHA 1ZRRA 1DZTA 4D7TA 5A3UA 5JOYA 2BDRA 5K9YA 3LD8A 3Q8CA 1R1ZA 1HB2A 2XJVA 4QQPA 3RWKX 2ZAAA 2WT1A 4WVZA 5E16A 5B4NA 1VBE3 1IS4A 2KXLA 3HWJA 5FPXA 2DVFA 2XWJB 3WG2A 4GXLA 4QT6A 1HDKA 1AR62 2QQMA 2XJRA 1CAWA 2PHUA 3GJAA 5BNNB 1VRH1 2YBKA 3QD6A 4RGGA 4DOUA 1IPSA 4CU7A 1RHI2 1W6MB 4Q0UA 2DCKA 1PGL2 3WNLA 1UYPA 5DUUA 4RS5C 5AC93 3V64A 2R061 4Y3OA 4JCKA 1GQGA 5DMYA 1EP0A 2Y60A 2ENRA 3ZSMA 4RA0A 2VCAA 4MX3A 1YNAA 2HWD3 2Q1FA 2Z5WA 3UGGA 4KH9A 3WW4A 1YQ6A 2OIIA 3RZJA 4K8FA 4LHKA 1UY4A 1R092 2GZWA 1ENQA 5C6CA 2BWCA 1V6IA 2BGPA 2YY1A 3Q8EA 1UMIA 4IDZA 4MUVA 2PHWA 2CAVA 3QACA 3NAPA 4RFRB 2WNOA 2MEV3 1GUIA 5FZ0A 5GKAC 3S57A 2XQRA 5FLJA 2LUWA 4CDUA 1YXWA 3UJOA 3W5MA 2YC2A 3AVSA 2WIIB 3SCHA 4CZSA 3K48A 2VW0A 5FIXA 2XQXA 2PFWA 5IVEA 1VBC3 1ND3A 1COV2 3MGUA 1HRV2 1Z0HA 4XJ8A 2RE9A 1H2LA 4N53B 3ZXJA 4AI3A 4HPKA 4DB5A 5A3WA 5IVBA 4YW6A 3WDTA 2CAUA 5D2AA 5GZEA 1UW8A 1YYNA 4LA2A 4C0BA 5FOBB 2V4VA 1A8MA 4QGNA 1RUJ1 5A3TA 5L9VA 3A23A 5IVYA 3VBOA 1JZ8A 4LHSA 3GF6A 3A21A 4OI2A 4TLFA 3ZSJA 4BYYA 1A6CA 4G9SB 2DV9A 5C33A 5IAVA 2ZGNA 2VBPA 3LPGA 3ME2A 5DAWA 3SITA 5A3PA 1OA3A 1QJZA 4FBFA 3PVEA 1DQ0A 5ABJC 3POSA 2VUDA 4N8MA 1RUC3 2G19A 4AI1A 4DFSA 1VBA2 4D94A 5LW9A 3HBKA 5GZDA 2IC1A 5F1RA 2V73A 1TNFA 2VTFA 2ZGOA 4LO7A 1LCLA 1DDLA 4N43B 5FAXA 3RQ0A 5BYNA 1AYM1 4AEDC 3VZLA 1RMU2 1TMF3 2JEMA 3IAPA 3HJRA 4D6QA 3I3QA 3DGTA 4OFGA 3NV3A 4Y4RA 5LK7B 1UU6A 2DDUA 4CSWA 2P3YA 2N7GA 3VHNA 5APAA 5A3OA 1N1VA 3RRDA 2X5IA 3UETA 1M4WA 1MEC1 3WDYA 1UL9A 3OB8A 3MZHA 2XLFA 1H0BA 5DZEA 3VDAA 4AHZA 4AVBA 1W9YA 2HJIA 4PI0A 4UFJA 5E1RA 3UKVA 4CDWC 4ES8A 4AK3A 3EHKA 1HQNA 1QH6A 2QQKA 2JDAA 3J7LA 4FQ4A 4XFIA 1R083 1W04A 1QIQA 2RR11 3BIEA 1AR61 3LB9A 3AYEA 2XPJA 3PURA 3AMQA 2J1EA 1KD7A 1EPZA 3MFCA 4INDA 2UWCA 4A45A 5JOWA 3LF7A 2CTVA 1POV3 1GP6A 2GMEA 2PAEA 4PDWA 1UY3A 4FCAA 4JTOA 1H9PA 4PIZA 2BUKA 2WO3A 3MIDA 5J48A 4QB2A 4CDQB 3GALA 1XYPA 1RJ8A 3Q8AA 1W3VA 1HRI3 3DPRB 4U36A 4D7YA 4XFCA 1Q56A 1KS4A 2W08A 1CZTA 1EV12 2Q30A 1D4M2 5FK7A 1NQJA 3VB9A 3USUB 3VKMA 3F95A 1C8M2 3KMHA 3CJXA 2VQUA 1NUKA 3M2MA 4JQRA 1JOPA 5FY0A 1GKBA 1QU0A 2ID4A 2WNUA 3RZGA 4QDQA 3CF6E 1H4GA 1R091 2WUHA 3D0JA 2D5HA 3WNNA 3JD72 1K42A 3AKPA 3WQBA 4LKFA 4IV3C 5GALA 4CEYA 2W92A 1QJY1 1O7FA 4OQ8A 4OI4A 3LDRA 4C90A 2QQUA 4UFHA 4UFKA 5EYYA 1LNSA 1SZBA 4WM8B 2EVXA 3LEMA 1ULOA 1U5YA 5KHHA 4QPGB 1QOSA 5A33B 4N9HA 2WC2A 3VBSB 2D44A 3SCFA 1XNTA 4J1XA 4LT5A 3POEA 5FXVA 3NRUA 4P5YA 2W1QA 1IZ3A 1XU2A 3FBMA 2F6BA 2D5FA 3SQOA 5BNOC 2R041 1KITA 2BW8A 2BYVE 3K51A 4LA3A 4Q4W1 1W6MA 1W2NA 5FZFA 5FWJA 3BTYA 2BV4A 1HIXA 2BOJA 3LPFA 2YG0A 5FPLA 3WHTA 4P9YA 1U5ZA 1ODNA 2A75A 1C1FA 3TOJA 4NMIA 4A7ZA 1W8HA 3GNEA 1RUG2 4Q0VA 3C7HA 2PHLA 3O7OA 2W0XA 1XC6A 1B35B 4XFBA 2V09A 5I91A 1RJ7A 3UGFA 2RS12 2G9ZA 1ZBA1 3KCCA 4Y22B 3HN3A 4XF9A 4NROA 1MQTB 5G04L 1DBNA 2J1TA 4LBQD 5B2GB 3ZSKA 1LJ7A 1OD5A 1ULEA 2JG9B 1RUD3 3W58A 2GMMA 3TN92 2E6VA 3DEMA 2D3RA 3I8TA 3UNPA 3WLUA 1Q5OA 3VKFC 5GZGA 1S0BA 2EXJA 4IUGA 4LITA 4HKLA 5FQ0B 3RJRA 3ORJA 3OGSA 3VZKA 1S55A 2VVFA 2BBAA 3B9CA 2AYHA 4TYSA 5DABA 2WT2A 1A3KA 1SLBA 2Q8CA 4HETA 1B09A 5FP8A 4QPIC 1GBGA 2IXKA 1QOOA 3UL2A 1DZQA 1GNZA 1Y9QA 2GNDA 2CNAA 2ZHNA 3JBG1 3KQRA 3Q9OA 3CEWA 1W6QA 2WO1A 4AE2A 5L7OC 5FYSA 1VBD2 4IL7A 2ZHLA 2WFPA 2YHJA 4B1LA 1NZIA 3PIJA 2QQLA 3FMGA 3T08A 4GMP1 2Y6FA 2HEYF 4A7YA 1AX0A 3T2TA 4GKYA 4K20A 4N43A 4TZDA 4JGZA 3V0BB 5GM0A 3ZN6B 4FFHA 4Y33A 1LGNA 5F2WA 2FMDA 2VZOA 4QXCA 2NMNA 2ERFA 1HKDA 1KRIA 1ZZCA 1OFSA 2Q4SA 4XBNA 3OJBA 4FOVA 1NY71 1SACA 1MZ6A 1CAVB 2PYTA 3O0XA 2HKXA 2W2IA 3G7DA 4FFFA 3JQWA 1CPMA 2DCJA 5HCHA 1U5IA 5A7PA 3ZFFB 3H3LA 1ZZ7A 3R0RA 2FDHA 4I0AA 3CQOA 4GB32 4O65A 4EN0A 4H3WA 4ZS2A 2Y64A 1E5SA 4BE3A 2JD9A 2BERA 4LBOA 5FMCA 1W8ZA 2Q8DA 3TWIA 4R4XA 2FD8A 5LRSA 2FDIA 3AFKA 4AEJA 4CDXC 4XAAA 2RM21 2YB7A 5C3RA 2PN5A 4AI2A 3DL3A 1XYOA 3MIEA 4NRMA 4F3JA 1OSGA 1RUH1 2VMFA 3DPRA 2W46A 5C71A 3U1XA 1GWMA 4WM7B 4OUSA 4YM1A 1YJLA 4Q4V1 1KDMA 2ZGQA 4MLOA 5FZAA 2C5DA 4F7ZA 5FY4A 1AX1A 2PHFA 1IKQA 4D0QA 4GWJA 4GWMA 1DYKA 1GP5A 1RHI3 2Q8EA 1A34A 2CYFA 1RVF1 5DG1A 4XXAA 3VBRC 1JZ5A 1SBEA 1RUF2 3LFMA 4XQDA 4KWUA 5FYIA 4LORA 1HW5A 2VZRA 1W9WA 4M4RA 4A42A 2RS32 4QDRA 1GMMA 2AACA 3BIWE 5FMBA 3ZFGC 3Q8BA 1UPSA 1NT0A 4N7IA 3RJ2X 4NIIA 5DN2A 3TEWA 2R49A 3V65A 3PIGA 4XMAA 3TN91 1UZVA 3D4KA 2FHRA 2W39A 3FUQA 4QGLA 2JE8A 1RUE2 4QPGA 4YVSB 3MI8A 4COVA 5DAPA 4FPGA 2JG8B 4IV1C 3I3EA 3I2HA 4D6RA 2JKBA 5GLWA 1AJKA 1OLME 2E7TA 1QJU1 3HR9A 4IEQA 1NCQA 2XBO2 3S30A 4RL7A 3WD5A 3I3MA 4YW5A 4P08A 5A3MA 2VULA 3VLBB 4LBQB 1AL21 3I54A 3JQXA 1JZ6A 3HOBA 5CIRA 1COV3 1UYZA 1HRV3 2LALA 4OHWA 3T0DA 4MGKE 1SLAA 1CGPA 3I2DA 3O5SA 3IB3A 2R1BA 3PUHA 1SLIA 1ZX5A 4P9XA 1VPHA 4BQ3A 5HPOA 4M01A 2B9VA 2WINB 3RSJA 3WW3A 2KD7A 2JDKA 1T2XA 3TEYA 1FYUA 2W68A 1E5HA 3ZDSA 2TUNA 1QKQA 5LA2A 1RUI1 2YXSA 1O8PA 1B35A 5GLVA 1JYNA 4M0HA 1OI6A 2DCZA 2R0HA 3NSTA 3FBYA 3OGGA 1NLQA 4O9EA 4Y22A 5ACA2 2A3WA 3P6BA 1GR3A 1WLWA 2C4XA 1NCRB 4KBZA 5DDJ2 5EWSA 1ZYBA 1VBA3 2Y26A 5FBJA 2Y6JA 2W87A 2YUEA 3OG2A 5CFCA 4Z1VA 3J8F1 5FLIA 4LKSA 3BB6A 3NNMA 2J1AA 5L9BA 1WA6X 1RMU3 4QHBA 1L7RA 2ZACA 1BMV2 4LMFA 1CJPA 1LOCA 2NZ9A 3LSEA 5F5AA 5FQ0A 4GB31 3MLJA 2J22A 1E5IA 4MG2A 5FYBA 3OGRA 1LOFC 4YFZA 4LO4B 4E8DA 1JXNA 1ND2C 4RQPC 1YLLA 5IFTA 1UPIA 4Q1PA 3APBA 1Y43B 4QKFA 3T30A 1W2TA 3H3UA 1UN1A 2PLV2 3ENRA 1JU3A 1JOBA 2BOIA 3ES4A 3MUZ1 4E27A 3POJA 4H55A 3G6JB 1AX2A 2OX0A 3WP6A 2QDNA 2HWE2 4AOCA 4HOOA 3LE0A 4QX0A 2VOVA 4QPWA 3CZUA 5CADA 4CP1A 5C5TA 2VMEA 1Y9MA 4QXKA 1JZ2A 3ACHA 3H50A 5C9AC 4P00B 5J96B 3RG0A 5F6LB 5CFDC 3W20A 2R30A 5LATA 1UYYA 3EQEA 5KBFA 5FP9A 3BU7A 2IFWA 2QCSB 3WV6A 1FMD1 3N36A 1EV13 4CXWA 3EYPA 2PMWB 1Y7BA 3O1RA 4BXFA 1C8M3 2WS92 3ZDVA 4BQWA 3E6DA 2E7QA 1AR93 1F5JA 3U10A 3NNJA 3VD7A 5FRAA 3ZFFA 2UWAA 1W9SA 3JD73 4BCUA 1ALYA 4NWWA 1GOFA 1QXJA 2QQNA 4KU7A 3KM5A 5BNNC 1PMIA 5FPBA 4SBVA 2B4KA 3ZYGA 1WLTA 2BGOA 3ES1A 1AF9A 2WBKA 2K46A 4BOWA 3ABZA 4YG3A 1O4YA 1OVPA 3IAQA 4MSVA 2EIBA 5SV8A 1N1SA 4I0WB 1JBCA 1G7YA 1JUHA 4IEPA 1LGCA 4GKXA 5FP3A 2BBVA 4XUQA 3AKQA 5FZEA 2RDQA 1F35A 1HXS2 1Y4WA 1V6MA 2W47A 3AL6A 2GH8A 3OEBA 4WM7A 1KDKA 2VMIA 1OC1A 3KB5A 3W5NA 5JVVA 5FREA 3VKOA 3BI3A 1W90A 5KHJA 4BHPA 3CMGA 4OMDA 4K3UA 4W8JA 4BZ4A 1VBE1 3CLPA 4XZPA 2P17A 1W8NA 2IVIB 3PUAA 2YFZA 4P9IA 3B7MA 4P9WA 1SBFA 1FX5A 1BBT3 2TNFA 2AUYA 2QNKA 4HL0A 1I9RA 1EAH3 2V5DA 1YIPA 2P1BA 4N53C 1ZRCA 1IPKA 4I0BA 4AHWA 2VOKA 1IHMA 1X7NA 5CU1A 1RUG3 3HD8B 1LB2A 1R1A2 4A4AA 2HWC2 4G4FA 5AFEA 2RS13 4KGQA 1QJX2 3NJXA 2DWRA 4Q27A 1AR83 3E5QA 3WNKA 4AXOA 4ITCA 3H7JA 2CWSA 2XVKA 1AUYA 5FP4A 2UYAA 3FFQA 1S0FA
chains in the Genus database with same CATH topology
4CDUB 1BKZA 4LBQA 4OI1A 1LGBA 2ZX1A 5JZGC 1DHKB 4CYDA 5BPXA 4HK9A 1F8VA 3RI8A 1ND3B 3UKTA 1OA2A 3TAYA 2NYYA 1KFUL 1LEMA 1GZ9A 3PTYA 1PZ8A 5KC6A 5JSRA 2NN8A 1JOJA 1RINA 2JE9A 1VRH2 2JJ6A 3UV9A 1CAUA 1DYPA 4MH0E 1VBD3 2EIGA 4ISRA 2YPJA 1W6PB 3MYXA 4FVVA 4KBBA 5HCFA 1Y3TA 1EPWA 1CESA 1V6KA 4L92A 4ZU4A 4GH4C 1YFUA 2WS91 4P9LA 4YNIA 5H9RA 3VBHA 1A8DA 1PVC1 1E57A 2PAKA 2O8QA 4NHLA 1XNCA 3VDDB 1JH5A 4HLTA 5FLHA 3V0AA 1OMIA 2EALA 2UY8A 2A6YA 2EF6A 1QH7A 1TMF1 4CDQC 1NG0A 4PBOA 4A3XA 4B29A 1XRUA 4OHVA 2GAUA 4Q29A 2X5IB 2D3PA 5C4WB 2GNTA 1LKNA 2BVBA 1PK6B 4Z82A 2DVDA 2ZMNA 1NQDA 5JIAA 3IBMA 2AH2A 2XKOA 1O4ZA 5JCTA 2DCYA 4QGMA 4ASMB 4V1PA 3MF9A 3VN4A 3KSCA 5JOXA 2ZBJA 3ASIA 3HT2A 4I2OA 4PDWB 4WM8C 5DZGA 3ZIWA 3N7MA 3BCWA 5I0RA 1FT9A 1FV2A 3VBSC 2VQ0A 2DVAA 2IFRA 2VMHA 3PLQA 3GHNA 3SNMA 2XJSA 4W6WA 1R1A1 3W59A 4N90A 1DZRA 4LBJA 2WQ4A 1AYM2 1J1LA 4FTSA 1RUF3 4FOWA 3SLIA 4ZU5A 1CR7A 1KFXL 3NKGA 1JTZX 2BVVA 1MACA 3CJIB 4AFBA 1MEC2 5T52A 4B7EA 1RUE3 3RYRA 1HLCA 3EO6A 2UWBA 1OQEA 3E97A 3ZFEB 2VUJA 2XBO3 3ZYPA 4RD7A 5D8AB 2RR12 4LULA 1MQTC 2JD4A 3WP4A 2K9ZA 4Y20A 4NR1A 1LHOA 4AEMA 1IGOA 2JG9C 3VV1A 5IUQA 5C8CA 2FZ2A 2D43A 3HMYA 1GV9A 2QJVA 4QPYA 3FJSA 4AI8A 4PLOA 2DUPA 1AXZA 2IXIA 4PCRA 3SH4A 2X8KA 2HWB1 1SMVA 4M0NA 4META 3ROUA 5ACA3 4PJYA 1UD1A 2ZPXA 1VB4A 5JLVA 5DDJ3 1N1YA 1RTVA 3RS6A 3OBTA 2WNEA 1QJY2 2ZMKA 4RHV3 4P9JA 3QH7A 4JRAA 4XBQA 5CBLA 2RMU1 2ZX2A 4EV0A 1AHSA 4FAHA 1AXYA 2V5YA 4NPRA 5CG8A 3WVJA 2GC0A 2ZABA 1GNHA 3KT1A 5JSOA 4BQ1A 1TQ5A 4WVMA 1H8VA 2D7FA 1WD3A 4DRVA 4YVWC 5BUVA 1PO11 2GC2A 2FBEA 4HZFA 4AVTA 2R042 2PLV3 4Q4W2 4RFT0 3AKRA 1W6PA 2A71A 1W6QB 4YW2A 3E6BA 2HWE3 4X8PA 1BEV3 4OLLA 4DY3A 1G8WA 1GZWB 1Q8QA 1N3OA 1SQ4A 4W6XA 3WCRA 4JRLA 3T1LA 1UKRA 2E7AA 3WP5A 1UAIA 4N9IA 1JN2P 2FMYA 4JGZB 3VDDA 1ZBA2 1UIJA 4YM2A 1WCDJ 2Y0OA 5C8WA 1W6OB 4F83A 2GALA 5L19A 2Q0AA 4AGGA 2Y0IA 2VVEA 5H9SA 5C4WA 4BMEA 4FPKA 5KXBA 1VAMA 2VOXA 3OD0A 1YFYA 2ZX0A 1PK6A 2QVSB 3B02A 4R9AA 4I02A 2WFF1 4MVTA 3WINE 4AGRA 4CP0A 2OW4A 3DUIA 4S2DA 3VHPA 3L2YA 1Z7S1 2VOWA 3V56A 2LM3A 1RUNA 1W39A 3JB8A 4K40A 1J3PA 1KXGA 3JBG2 3D8CA 1XNKA 1HXS3 1S0CA 1DFQA 2A6ZA 4GULA 2GN3A 3LOIA 5T55A 4YSFA 4JGYC 4YVSC 1QNYA 2JG8C 4JVAA 2DCTA 1OPMA 4FTBA 3AYAA 3U0ZA 1JYIA 4ZU7A 4QQ2A 2WT0A 4E4ZA 1AJOA 5DZFA 4XPVA 4YGDA 2IXHA 1ULFA 3AZVA 3KGLA 4Q0PA 1J3RA 5IT6A 1NY72 2JXAA 3CJIA 5EXOA 1LODA 2FZ1A 3IIAA 4L97A 3X29B 2HWC3 4AEKA 4KL1A 5BNPB 5T3NA 2ZGTA 1QJX3 1O4TA 1VBB3 2XG3A 1BQPA 1GSLA 2BQPA 3R4DB 3OGJA 4PLMA 3ZFEA 3GZUC 4I3PA 4N7UA 3O0WA 5D8AA 1NXD1 3LWCA 2R073 1NCQB 4PIYA 1NCRC 1PIV1 1SLCA 4CEWA 4Y1XA 1ONAA 4IEVA 2RM22 3ETQA 1OQ1A 1X8EA 4K7JA 2GSYA 2TBVA 2WNVA 1RUH2 3J4UH 1OQDA 3USSA 1K5MC 1WA4A 1ZBE1 1UF2C 3VBFA 1BK1A 1BZWA 4Q4V2 2DUOA 2Z2SB 2VG9A 2CV6A 4X6RB 4DQAA 1VRH3 4Q8KA 5AVPA 4ASLA 2JE7A 4XJWA 1RVF2 3MFAA 3AX4A 2AR6A 1BVVA 3M3QA 2VGDA 5GLZA 3ZIXA 3RDIA 4P9GA 2R063 2PELA 4R9BA 4YRDA 4AQ2A 5KC5A 3M4FA 4FPFA 2H6BA 3CL1A 2ZGRA 3IT8A 2XJQA 2ZGSA 4J1WA 1IS5A 5CFCB 4HN1A 1AL0G 2C0ZA 2WZR1 3TRSB 4ORFA 3IWZA 1WD4A 4XDQA 3WDWA 2ZMLA 1AR71 1UIKA 2QFEA 2ZGPA 5KHGA 3C2UA 1OOPA 1QJU2 5FO8B 2A70A 1JHNA 4HKOA 2JENA 5AVAA 5H9QA 1AL22 1WMFA 2A3YA 1ZZBA 3MLKA 4KU8A 1LHUA 4HSJA 1I6XA 5BV6A 1U5XA 2QE3A 4CTEA 1EY2A 1RUJ3 1GZWA 1H8TA 1REEA 4BWOA 4AG4A 1ASJ1 3AP5A 1RUI2 3WQ0A 5F5QA 1S2BA 1WCSA 5J98B 1W0PA 3O12A 4YM0A 4AFMA 1OHFA 1W6OA 1D2QA 4S2HA 4JC1A 2D97A 3BOWA 3WY6A 4KGGA 3JUUA 2VH9A 3J8F2 1PO22 1UU4A 3E5XA 1AYM3 1J59A 3LOBA 5K0UA 1IS3A 4NN0A 4NVPA 5J7MA 2D6NA 5JOZA 4LEJA 4YG6A 2B8MA 1AR91 1PNGA 3OF1A 3OPZA 1TME1 4JDOA 4AFAA 4MV2A 4YZ3A 1MEC3 1OLQA 2B46X 1Q8SA 3KT4A 1PGSA 3AYCA 3VKNA 3INAA 2HWF1 4GALA 3ZMOA 2E9QA 3N35A 3D6EA 1LU1A 1D0HA 2GC1A 3JZVA 3FLTA 2RR13 3RYPA 1AR63 3M3OA 3WUCA 3NAPC 3B69A 1FOD2 3FUOA 5BNQA 4BMBA 4CDUC 3U4XA 1O3TA 3ZXDA 2ES3A 2HYKA 2WA4A 4GIQA 3WZ1A 2YC0A 2RHPA 1SCSA 1FMD2 1ND3C 5L73A 3E6CC 4L8QA 2A5ZA 4WZFA 2HEWF 1AYN1 1S0GA 2GDFA 5IK5A 5BNPA 2AZ5A 1R093 2ATFA 3VBOC 4IXLA 2DVBA 1YI9A 1V9U2 2VMGA 1H1MA 1QJY3 1ZZ6A 3O0VA 1OA4A 3UKNA 3RZZA 3FE5A 3FLPA 3JU9A 3ZXGA 3L9JT 3D5OA 1OLRA 4DNYA 4LUMA 3IDCB 1QQP1 1LHNA 4LE4A 1G6NA 4DXZA 1BXHA 3GBFA 4MGIE 5IK4A 5IK8A 2B5HA 2RS51 4XF1A 4Q0QA 2OYZA 1NA1B 1C57A 4XEZA 2IZWA 4YW4A 3HIFA 3MDPA 1VBE2 1CX4A 2R043 4MXWB 1MS0A 5JMCA 4Q4W3 1V6LA 1XE7A 2B7YA 4WVVA 4XQWA 1MZEA 3N3HA 2X5IC 1CAUB 1VALA 2PHDA 1NE4A 1WLCA 4LUKA 2VU9A 3LKJA 2ZGMA 2E51A 3IM0A 1SCRA 1PK6C 1FXZA 1SLTA 2DTYA 4K1YA 4LBNA 2WLPA 3O14A 3VUOA 3VBUA 4CP2A 3TB0A 4WZCA 5GZFA 4YW3A 3A4UA 1PO21 3VBHB 2NM1A 2DYCA 4HKWA 4FT8A 1ZBA3 4XE9A 3I7DA 2D6KA 4B3NA 2HWD2 3AXDA 4R52A 3V0AB 4YFWA 4PDWC 4JDMA 1Q8VA 4AVVA 1C5IA 4QD2A 4Q4X1 1FNYA 1KS5A 4AW7A 1SFNA 2MEV2 1GYKA 4KWJA 3WW2A 4H7LA 5A3LA 3J26N 3S7IA 1NLSA 4XHXA 2ZKNA 4RS5A 2QZ2A 2WNUC 3M3IA 2CWMA 4UW6A 4PIXA 2AREA 2B45X 4CEYC 4IESA 1MS8A 1FOD1 1HV0A 3JBG3 4ES9A 3S0MA 4COYA 3MIBA 4DY5A 3IPVA 1FPN1 5KXDA 2Z79A 5CB7A 3HQXA 3SH3A 4GMP3 5I8SA 3N4MA 1D4M3 3PVNA 4DZGA 2WWSA 1BYHA 5EYXA 4LHNA 1FI2A 1OKQA 1ULCA 2K2SA 1CVNA 5D8AC 1PVC2 1C3HA 4XJ9A 5FMOS 3ZO0B 1H1IA 5J37A 5JAXA 1V9U1 2IXCA 4MGZE 3HAGA 1GICA 2MNGA 2WKKA 3B00A 1LHWA 4Q4Y1 1TMF2 4GQ7A 1VR3A 4D69A 2PTMA 4KWKA 2D3SA 4QX5A 4W6YA 2VNRA 1QGLA 1S2KA 1UMZA 4S2GA 3OCPA 4LO5B 1VP6A 5ABJA 2ARBA 4HVRA 4YZ4A 4EN9B 3ZVXA 3WR0A 3EJKA 4KG0A 3WXPA 3FLRA 3GBWA 4XHBA 2RM23 1N1TA 4Y20B 4AEDA 2C1FA 3VHRA 4XIOA 3ATGA 1RUH3 5C8CB 2H6CA 4OUMA 2I07B 2VNGA 3H3ZA 5FDBA 3WCSA 3H0OA 4Q4V3 2YDEA 2K0GA 4S2FA 1V00A 1EYBA 3MIGA 3OYWA 1C1LA 4HK8A 5AC91 1RVF3 3WP3A 1IPJA 2Q1MA 3RI9A 4B4QA 4CDWA 1O3QA 4XF4A 5I0TA 2HWD1 1T6GC 2NMOA 1UZZA 3M1HA 3LA2A 1NYWA 3B94A 1ZVFA 2XVLA 4H14A 4KNCA 1RC6A 1SFYA 2JECA 1JW6A 3I4IA 4LBMA 4LNVA 4UXAA 3TN93 3WDXA 5JWPA 2MEV1 4CDXB 3FX3A 4EN6B 5J3UA 1NA1A 2B9UA 1I1EA 1XU1A 4N43C 4QM9A 1QJU3 4MYEA 4JGZC 4PF5A 3R6SA 3U07A 4WVMB 2JICA 4M3CF 1VBC1 3AM2A 1AL23 1S0JA 3ACLA 4Z2WA 1Q8PA 4MXWA 4HBNA 1H2KA 1O3SA 1ZRFA 4BH9A 5DUWA 1CONA 4IV3A 2P3JA 4HANA 5A32A 5J09A 5JSPA 1KJLA 1C4RA 1G9FA 1WBLA 1RUI3 4Q8LA 5I93A 4E9KA 2P34A 2VECA 3AJZA 3WG1A 2ZS6B 4BA6A 2HWB2 4KWLA 1RUC1 4XF0A 4K21A 4YW1A 1YI7A 2D93A 4AFCA 4R9CA 1X33A 1REDA 3ZYJB 1UU5A 1AVBA 1CD3G 5K8SA 4JAAA 2OPKA 2RMU2 3DPRC 5FMOL 3P3NA 2XJTA 3S7EA 1OPOA 3S6PA 5JPMB 2NLRA 5BNOA 4BPZA 4O9GA 1ZNPA 3W9AA 3WDVA 1DQ5A 2YV8A 4GB33 2SBAA 4RR3B 4DINB 3ZN4A 1PO12 1WW6A 2DUQA 4FOYA 3HT1A 5I0UA 1J58A 3BTAA 4R9DA 3NW4A 2DF7A 4B7KA 1LU2A 1R081 2QUOA 1V6NA 1RL3A 3ZXLA 2DFBA 4EWEA 3MICA 1JUIA 4LBLA 1CIWA 3GBGA 4QPGC 5LRRA 4OHZA 4OVEA 1POV1 5K7PA 2VVDA 2WL1A 1NXMA 4GMP0 5EFUA 3D82A 4YGCA 5T5LA 4AI0A 1ULGA 4JTNA 4D7SA 3D0SA 1HRI1 1NCQC 4XJAA 1UCXA 1MZFA 4UBHA 5E88A 5KXEA 2ZKLA 3AXEA 3NJZA 3RMYA 1RUOA 3B93A 3E5UA 4L2NA 2RS33 5EZWA 1NLRA 2O1QA 1MS1A 4XFAA 1GQHA 4QPIA 4RQPB 2XHKA 2XGXA 3TYJA 1DGWA 1ZZ9A 4LBKA 4LHLA 4FTEA 1JYCA 5L7OA 2WFF2 1CAXB 2A73B 2GNMA 1MVEA 1B35C 1CN1A 1LR5A 3RYKA 1NOVA 1Z7S2 3M70A 2VQAA 1S1AA 1DF0A 3QH6A 3FZ3A 1ZREA 1H30A 4A7KA 1F31A 2DURA 4AGVA 2E53A 1QNWA 4CEWB 3I59B 5F6KA 2ZHMA 4QQHA 5CFCC 1DQ2A 2C9AA 5CFDB 1RB8G 2QDRA 2WNVB 3CU7A 2AGSA 5CNAA 3ZXKA 2GC3A 1WW7A 4YZ5A 2GH2A 3VBFB 1GFF2 1H4HA 2R0FA 2R16A 3SMHA 4DS0A 1WLDA 3VZNA 5JIUA 3ZPYA 4NO4A 2VUAA 3PMSA 1PM7A 3VZOA 4QQLA 1PVXA 4AHYA 1LOEA 3MIFA 2OUHA 1PZ9A 2WJSA 4C1XA 4BLJA 2EXHA 1V70A 4OZXA 5CA6A 5T5JA 4CDXA 2UU8A 2YMZA 2FQPA 3BALA 4Z8BA 4DPNA 2F4PA 4WV8A 1RUD1 3JB4C 1SLLA 2D6OX 2OZ6A 1QWRA 3ILFA 1OOPB 1ENSA 3B9IA 3H1WA 1MVQA 3JCIA 4QM8A 4C91A 1VAVA 2ZOEB 4EN8B 1V6OA 1PIV2 2ILMA 2EAKA 4MZUA 3PVBB 3GZAA 3PNAA 3MIHA 5JI7A 5T50A 3VBRA 5HBAA 4IERA 4BLIA 1MZ5A 2CGNA 3EBRA 3BOPA 1V6JA 3ZFFC 1ZBE2 5FBZA 3ZFGA 4L99A 1H8TB 3WG4A 2SLIA 4B8EA 3ZYIB 1QXPA 4EWAA 1QF3A 4WVWA 4Z07A 1GLHA 2WSUA 2ZX3A 4QMAA 4IV1A 3AKSA 1MR5A 2GN7A 3WQ1A 4LR4A 1C5HA 1MS9A 4ATEA 4E4SA 1F2NA 3AMNA 4Q26A 2WS93 3A0KA 4XIKA 5BXXA 4Y1YA 3OY8A 1PVC3 4NOTA 4WM7C 2WZR2 4XFFA 4C0HA 3LGRA 2PHXA 5JZGB 3N7LA 3DN7A 4FAGA 5K0UB 1RITA 2BGCA 3GZTB 3WX5A 4RR3A 1AR72 1FATA 4K9SA 4M3CB 5FCCA 5TSWA 3ST7A 1YFWA 3MPPG 2EXKA 4FPJA 2P3IA 4XYXA 3VHOA 2BFUS 1S0EA 4Q2FA 4KQ7A 1LTEA 2VW1A 4F8AA 3MEPA 3NV2A 1X8MA 1LECA 2IWGB 2YROA 3AJYA 4XXPA 2D6PA 2BEOA 3NWKA 3AMPA 1ASJ2 4GH4B 2WA3A 2D40A 2ETEA 1N47A 4L11A 1YO8A 1YRZA 3QOPA 3IMNA 2B42B 1WBFA 2EAAA 1WW5A 1LOFA 1NA1C 1RHI1 3VGIA 2MHFA 3CO2A 1ND2A 2XB6C 4RQPA 1R1A3 1PGL1 3DF0A 4FPEA 5JPNB 5GZCA 4J6GA 1W0OA 3WT3A 3AB0A 1ZM1A 3NV1A 4FP2A 4Y1UA 1QOTA 4YM3A 1CAXA 4URTA 4HVOA 1AR92 4I01A 1TME2 2ZGLA 4AQSA 2KM2A 2IXJA 4BIFA 4YZ2A 3LSDA 3SXWA 5C9AA 3I59A 3LZZA 3T1MA 2PAMA 2HWF2 5CFDA 1W2UA 3FWEA 1DGWX 3VBHC 1H1AA 4R4ZA 1NE6A 1COV1 1HRV1 5KHIA 1LOBA 1DGRN 2ZCWA 4AFDA 3LA7A 2CGPA 5FO9B 5KXCA 2UYBA 4B4PA 2R32A 1O5UA 3SCGA 1D2SA 5BNNA 3ALQA 4FXKB 5EJ3A 3KCXA 1LENA 2VW2A 1A78A 3R4SA 3KZ4C 4XJUA 1AYN2 1BBT2 3AZYA 3GHMA 4CRQA 1G9CA 5DUXA 2YGMA 3VBUB 1EAH2 2HWB3 5I8YA 4WBBA 4DMIA 3IN9A 4FPHA 1VBA1 2XVGA 4EN7B 2ZZQA 4KG8A 3QCWA 1QDCA 4ZXKA 3WDUA 5FFOC 4E4DX 2XJUA 1RMU1 1N3PA 2RMU3 1XE8A 3WG3A 4Q0SA 4ZKTB 1AR82 1J3QA 1CPNA 1QQP2 3LAGA 5FPZA 3KT7A 4YG0A 1MS5A 2OUJA 3IDEA 4QQOA 2RS52 5LK5A 1LESA 2BNNA 4U2AA 3AK0A 4XETA 4PQ9A 4N53A 2BFUL 4RS5B 1PO13 4X8NA 2QZ3A 2NP0A 4TSVA 1VIWB 1IQAA 1KJRA 2GU9A 1DIWA 4M3CE 4UBGA 1URXA 1LOAA 3NL1A 3AP4A 3IPVB 1LULA 3UJQA 4XOGA 5EV7A 5GLTA 3EXUA 3H7YA 2RJLA 3RPQA 3PJYA 2XKPA 5JZGA 2Y38A 5T5OA 4NWVA 4X6QB 3VZMA 1EV11 1D4M1 2AENA 1C8M1 3HN1A 5AFBA 3MPBA 1W6NB 3ELNA 1G9DA 4M3CA 4TWTA 5C8CC 4FOQA 1KQRA 3JD71 4YVWB 4Q4X2 4ONUA 2VNOA 3NVCA 4XQ4A 2E63A 3ZX7A 3THPA 3SHRA 3AZZA 4FP3A 3VZJA 4L9BA 2WFF3 3QBQA 2A6WA 4AQ6A 1BCXA 5ABJB 3ILRA 4EWDA 1QXRA 1Z7S3 3AKTA 4HFSA 4YGEA 1ULDA 4GH4A 4ATFA 3IDBB 1DQ1A 4XJZA 3WUDA 4XTMA 3AZXA 4AEDB 1FPN2 4EJRA 4IEWA 3M3EA 3FC0A 3MLLA 4UW3A 1H2MA 1YJKA 2Z69A 2YYOA 1POV0 1G9BA 1DGRA 1BBT1 3NO8A 4CDQA 1I5ZA 3SISA 3THTA 2XJPA 2BNOA 5CG9A 3KS7A 1EAH1 4OULA 3OYWB 2HEVF 3USUA 2ZJCA 2BNMA 1PGW2 1PNFA 1G9AA 3R4UA 4SLIA 1RUG1 2R6QA 2TEPA 3ZXAC 4CDWB 5JDBA 3UK9A 4Q4Y2 2Q8OA 2RS11 4E2GA 1N3QA 4BIOA 1O5LA 2WLQA 3PMEA 2I2SA 2G9FA 3TNPB 3B3QE 1AR81 1TE1B 4LLOA 1BJQA 3ZSLA 4AHXA 1VLNA 2MPFA 2PA7A 3DV8A 4P5HA 4FPLA 1FV3A 4XILA 4WM8A 4Y5Z0 2DFCA 2JDZA 3AFGA 3H1YA 2XL7A 1U12A 3DKWA 4JGYB 3M8LA 3PHMA 3NV4A 5A33A 1UX6A 5H9PA 3VDDC 4QU2A 3VBSA 1PIV3 1HV1A 4D3WA 4YYOA 2WZPP 3U11A 3CNAA 1XQNA 5SV5A 5C4WC 2ZX4A 2R1DA 3ILNA 4K1ZA 1ENRA 1ZBE3 2XL9A 3R05A 4IV3B 5A32B 2D98A 4K6BA 1DU3D 2KA3A 5LEKA 4RR3C 1YCIA 1F5FA 4FPOB 3HBZA 1VBD1 5FOJB 4HN0A 3OTFA 2H0VA 2ZTNA 4IEYA 2XLGA 1IKPA 5AC92 3H8UA 3SH5A 4COWA 2DVGA 1ZA4A 2X53S 5KHKA 4JV4A 4I3GA 1O91A 5IK7A 3WW1A 2ZGUA 1APNA 4NHMA 4RSUA 1RGSA 2X29A 5J36A 1MQTA 2PHRA 4AVSA 1REFA 1I3HA 2WZR3 5DG2A 4M00A 2ET1A 2OA2A 3RMXA 4IEUA 1H2NA 3TBDA 4C1WA 1MS4A 4RHV2 2JG9A 5BNOB 1AZDA 1XYNA 1AR73 1ZRDA 3MW3A 4B4RA 1OFNA 2ZZJA 1TEIA 4XFGA 4I30A 1K5MB 1VBC2 4Z92B 1X36A 1VAKA 2Q5TA 3OBRA 2P2KA 5JI9A 1SBDA 4GA9A 4R8HA 5CVRA 2A7AA 2XWBB 4COUA 3WQ7A 1XXNA 2O8OA 4XFHA 3CJIC 2UY9A 2JX9A 2ZHKA 4BM8A 5I8TA 3H1MA 2ZGKA 4LO8A 4AWDA 2P3KA 3TNQA 3MF6A 1L3JA 1LOGA 1ASJ3 4MXVA 2RJKA 3ZFEC 3ZXEA 2VPVA 5BY5A 4E2QA 1BEV2 1RUC2 1DG6A 1PGW1 1W6NA 2I45A 3V0BA 3AZWA 4FQZA 4CEWC 3ZN6A 3FHIB 1Q8OA 3N7JA 3AMMA 4YVWA 4G3YC 2WNVC 4LLFA 1RUF1 2PQQA 4MGYE 1HX6A 3PJQA 3AP7A 4JDNA 4QPIB 4XMIA 1WGPA 1CAVA 3VBFC 1O3RA 4FPYA 4XTPA 1G86A 2RS31 1IS6A 3OD4A 4AVAA 1HQWA 4YARA 2PHTA 5L7OB 3LA3A 4D7TA 2ZA9A 3J9SA 1TME3 4Y24A 3ZSEA 4Y1ZA 4YGBA 1RUE1 4IEXA 1WUVA 4HT1T 5FTTC 4HMZA 3WNXA 1DGLA 1SEFA 5T54A 1UKGA 2HWF3 2XBO1 1R082 2A3XA 1QDOA 4ISQA 1XNBA 2VXRA 1LRHA 2QKDA 2WSVA 4HSLA 4FPCA 2EA7A 1DLLA 4A2UA 5CAZA 2XLAA 2YZ4A 1OOPC 3BPZA 3NKTA 5E8AA 1X82A 1HRI2 4IEZA 1DQ4A 3AYDA 3RNSA 5I0SA 1S0DA 2BPA2 4OI0A 5T5PA 4IETA 1CAWB 2G9GA 5L36A 5E89A 1IOAA 1ZZ8A 1Q3EA 4FO9A 4RGAA 1C28A 1PHMA 1QMJA 1AYN3 3BODA 1ENXA 4H7MA 5ACA1 2XUMA 4FXGB 3VKLA 4YLZA 5FO7B 5DDJ1 2YGLA 4LTAA 1H8TC 1LHVA 4RHV1 4XBLA 2XH6A 3ZXFA 2DU0A 2OZJA 4JGYA 5DXDA 4YVSA 1BMV1 2JG8A 1VBB2 3MW4A 1AXKA 1QQP3 4E2SA 4Q1RA 1DQ6A 3NAPB 5LEJA 2RS53 4UW5A 3QLQA 5HCAA 2R072 3ZMNA 4GWNA 1YWKA 2NPIA 4IEOA 1QY4A 3KD4A 1CJDA 2GMPA 3ECQA 3VBRB 2QQPA 4FSJA 5K0UC 1YUDA 5GJ6A 2PLV1 5GLUA 1UZYA 2O0OA 1NZCA 1U0AA 2W52A 4HPKB 4Y1VA 2Z42A 3ZFGB 3POYA 1Q43A 1GZCA 2HWE1 1BEV1 5DUVA 3VBOB 2BWAA 4YZ1A 1GANA 1WMDA 2CL2A 4IV1B 3AP6A 2GNBA 2P37A 1D4VB 1VB2A 5KWRA 1QHDA 4I09A 2CGOA 1WCKA 1NCRA 1S0IA 2BTVC 4UW4A 3J8F3 1PO23 4PLNA 2A6XA 3A0NA 3OY8B 2R062 3B01A 4AYUA 3GYDA 1YIFA 2IXLA 1CQ9A 1RUD2 3H9AA 1YFXA 4EROA 1K5MA 1M06G 2OVUA 3RWNA 2I74A 4Q4X3 5HXVA 4COZA 4DRRA 1YHFA 3ZN5A 4HVQA 2UURA 3FFZA 2D6LX 4XW3A 3IKWA 3L2HA 5HI0A 3PVOA 3MW2A 5BNPC 4IQPA 1F9KA 2ET7A 2VY0A 4P14A 1VJ2A 1XNDA 3M3CA 3LCPA 4NHKA 3VL9A 1D0GA 1HXS1 1FOD3 2CY6A 1RUJ2 1TNRA 4Y4YA 3POWA 4XF3A 3AMHA 4LO6B 1FPN3 3KGZA 4PBPA 2D6MA 3N7KA 1FMD3 2Q1ZB 2NQYA 3URFA 1H9WA 5D1IA 1RIRA 1HQLA 3B5LB 4Y26A 2ARXA 2EXIA 1ND2B 3VL8A