5C8CA

Crystal structure of recombinant coxsackievirus a16 capsid
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
297
structure length
259
Chain Sequence
GDPIADMLQVLPTAANTEASSDKNLIETRCVLNHHSTQETAIGNFFSRAGLVSIITMPTTGTQNTDGYVNWDIDLMGYAQLRRKCELFTYMRFDAEFTFVVAKPNGELVPQLLQYMYVPPGAPKPTSRDSFAWQTATNPSVFVKMTDPPAQVSVPFMSPASAYQWFYDGYPTFGEHLQANDLDYGQCPNNMMGTFSIRTVGTEKSPHSITLRVYMRIKHVRAWIPRPLRNQPYLFKTNPNYKGNDIKCTSTSRDKITTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP1
publication title Structures of Coxsackievirus A16 Capsids with Native Antigenicity: Implications for Particle Expansion, Receptor Binding, and Immunogenicity.
pubmed doi rcsb
source organism Coxsackievirus a16 (strain tainan/5079/98)
molecule tags Virus
total genus 45
structure length 259
sequence length 297
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5c8cA00
2IZWA 1NCQA 1TMF2 5A32B 1ZBE1 1VB4A 1RUF3 2R041 1VBD2 3VDDA 1EV12 3ZFGC 4CEWB 3VBHA 1ND3C 2GSYA 1RUE1 1CJDA 4Q4X3 1PIV2 1RUG3 4SBVA 1AYM2 1BMV2 1HRI2 5L7OB 1B35A 3DPRB 1BEV1 1H8TC 1RUD2 1TMF3 1V9U1 2WZR2 1QJY2 1VBD3 1EV13 4RS5B 1W39A 4N43C 1PO12 1PIV3 5JZGB 1AYM3 1OOPA 5C4WB 1HRI3 1PVC1 1A6CA 1RUD3 2WZR3 5D8AA 4Q4Y2 1RUF1 1QJY3 1PGL1 4CDXA 4IV3C 3TN92 1RUG1 5FMOL 4JGYC 1PO13 1QJU3 1CD3G 1BBT1 1K5MA 5C9AC 2XPJA 1PO21 1PGW2 5BNPB 1TMF1 3VBFC 1ND2B 4Q4Y3 1VRH1 1AR92 3TN93 5CFDB 2XBO2 5BNOC 1HRI1 1H8TB 4WM8B 1ASJ1 1POV0 2PLV1 1R092 4CDWC 3VBOB 1AR93 1QJU1 3VBUC 2XBO3 4RHV2 5ABJC 5ACA1 4GH4A 1R081 4FSJA 4GMP3 3VBRC 4LLFA 4RR3A 5C8CC 4JGZA 5BNNB 4JGYB 1R093 1RUH2 1OPOA 4PDWA 3TN91 1QJX2 5C9AB 4Z92B 4RHV3 4NWVA 3VBFB 1IHMA 5DDJ2 5J96B 3ZFGA 2RMU2 1ND3A 1ZBA1 4FTBA 1AR91 4Q4V2 1RUH3 5BNOB 1QJX3 1VBE1 1TME1 2FZ2A 2RS51 4YVWA 1AYN1 2Y26A 3CJIB 4CDWB 2RMU3 4N43A 4BCUA 4CEWC 4Q4V3 5ABJB 1VBB2 1VBC2 2DF7A 2HWF2 2R061 2R072 5L7OC 3DPRC 5C8CB 2RR11 4IV3A 4AEDB 4JGYA 1RUJ2 4RS5C 1FOD1 1NOVA 3JB8A 5JZGC 2WS91 3NAPC 3VBFA 1VBB3 5C4WC 1VBC3 2HWF3 2R073 1OHFA 1FMD2 4RFT0 1E57A 4WM7C 1RUI1 1RUJ3 5BNOA 1FPN2 3VBSC 1MQTB 1C8M2 4N53B 5BNPC 4CDWA 1FMD3 1EAH2 1ND2C 3ZXAC 3VBUA 1RMU1 1FPN3 5CFDC 5ABJA 4CDUC 2HWF1 2GH8A 3VBRA 2R071 1C8M3 3JBG1 5C8CA 4WM8C 1EAH3 1C8NA 1RUJ1 3VBOC 2MEV2 1HXS1 2TBVA 2BFUS 3NAPB 2HWB1 1COV2 2WLPA 3J8F2 4WM7B 4CEYB 1RVF2 4Q4X1 5BNNC 2QQPA 3VBSB 3FBMA 2MEV3 1COV3 5A32A 4YVSC 1NY72 2HWD2 3J8F3 1VBA2 4CEWA 1F2NA 1VBD1 1EV11 1RVF3 1QJZA 1PIV1 1GFF2 1AR82 1AYM1 4CDUB 1BMV1 1AR62 5L7OA 2BUKA 3DPRA 1WCDJ 1RUD1 2WZR1 2HWD3 1QJY1 1VBA3 3CJIC 4RS5A 4CDQB 1PO11 5JZGA 1AR83 3NAPA 5C4WA 1AR63 1HX6A 1COV1 1SMVA 4WM7A 1D4M2 4Q4Y1 4AEDC 3VBSA 2HWE2 2HWC2 2VQ0A 2WFF2 1PGW1 5CFCC 4RQPB 4YVSB 2RS32 3S6PA 5BNPA 1ND2A 4FTEA 1AL0G 1D4M3 2X5IB 4GB32 1R1A2 4QPGB 2RM22 1MEC2 2WWSA 5CFDA 2XBO1 2HWE3 4CDUA 1AR61 2HWC3 2WFF3 1H8TA 4WM8A 4GMP1 2RS33 5DDJ3 1MQTC 1M06G 4N53C 4GB33 1RUC2 1R1A3 1R091 3VBOA 2RM23 2BBVA 1RHI2 1MEC3 5GKAC 4RHV1 3ZFFB 4IV1B 3LOBA 1AL22 1D4M1 5BNNA 1RUC3 1QQP2 1RUH1 1QJX1 1RHI3 5C9AA 1NCQB 2HWC1 1AR72 2WFF1 1ZBE2 5CFCB 2R042 4YVSA 2ZAHA 5DDJ1 3VBHB 1RUE2 1AL23 2RMU1 4QPIC 4CEYC 4Q4V1 1QQP3 1BEV2 1V9U2 1AR73 3ZFEC 1ZBE3 5K0UC 2R043 3CJIA 1RUE3 1RUC1 1OOPB 1PVC2 1BEV3 1V9U3 5D8AB 1VBB1 1VBC1 1PGL2 4RR3C 5FMOS 3JD72 4NWWA 4AEDA 1VAKA 1BBT2 3JB4C 4Q4W2 1PO22 1PVC3 4CDQC 1AR71 4FTSA 5CFCA 1Z7S2 5FOJB 1NA1C 1VRH2 3JD73 1FMD1 4QPIB 1BBT3 4Q4W3 1PO23 1FPN1 3ZFEB 1ASJ2 5K0UB 1Z7S3 4YVWC 1MQTA 2PLV2 1C8M1 4N53A 1VRH3 4RQPC 2ZZQA 1QJU2 3M8LA 1EAH1 1POV3 2X5IC 2RS12 4QPGC 5ACA2 1R082 4GH4B 1ASJ3 4RR3B 4JGZB 2PLV3 1DDLA 3JD71 4PDWB 1HRV2 4Q4W1 2RS13 3IDEA 5ACA3 1NCRC 2MEV1 1R083 5J98B 1Z7S1 1NA1B 2BFUL 3ZFGB 1ND3B 1ZBA2 3ZFFC 4IV1C 3J8F1 1VB2A 4QPIA 4CEYA 1POV1 1VBE2 1HRV3 1TME2 1RVF1 1NG0A 2RS52 3ZFEA 4YVWB 1AYN2 1NCQC 5K0UA 1RB8G 1ZBA3 4N43B 3VDDC 1NY71 2HWD1 3VBHC 1VBA1 1VBE3 2RS11 1F8VA 1TME3 2R062 1AR81 2RS53 1B35C 1AYN3 2RR12 5AC92 4IV3B 4Y4YA 1X33A 1HRV1 1FOD2 4CDQA 2WS92 1NCRB 1OOPC 4GMP0 2R063 4Y5Z0 1HQNA 1NA1A 2RR13 5D8AC 1RUI2 5AC93 4CDXC 5A33B 1FOD3 2WS93 1K5MC 2HWE1 4RQPA 2RS31 3VDDB 1RUI3 3VBUB 1X36A 2X5IA 1RMU2 4GB31 1R1A1 4QPGA 2RM21 4EJRA 1MEC1 1B35B 3VBRB 3JBG2 5AC91 1RMU3 1HXS2 1AUYA 2HWB2 1NCRA 2FZ1A 1RHI1 3HAGA 3JBG3 4GH4C 2BPA2 1RUF2 3ZFFA 4IV1A 2ZTNA 5LK7B 4CDXB 4JGZC 4Q4X2 1AL21 1RUG2 4PDWC 5A33A 1HXS3 1K5MB 1QQP1 2HWB3
chains in the Genus database with same CATH superfamily
1GMMA 5FP8A 1NCQA 3HNYM 1DLCA 2BJSA 3FUQA 4BXSV 3OPZA 5APAA 1VB4A 1RUF3 2R041 2B4KA 4LR4A 3OF1A 1W8ZA 3T0AA 2GSYA 5FBJA 4MGTA 5A80A 2D5FA 3WOGA 1BMV2 4EROA 1W6NA 5IW0A 2VY0A 4PLOA 1GWKA 4RD7A 3VHOA 5IK8A 1H8TC 2WZR2 3LFIA 3IB3A 3NW4A 2XLGA 1J3PA 1K45A 5FZEA 1MS4A 3BTZA 2QZ2A 2ET7A 4UYBA 1WCUA 2XLFA 3M3CA 3PUIA 1UZYA 1PO12 4N43C 3V0BB 1IS5A 1W0NA 3RS6A 1AYM3 3THDA 5HI0A 1HRI3 2WIIB 4FPJA 1PX3A 1NAEA 3NNGA 3ZXLA 1YRZA 3GCWA 1UCXA 2ORXA 3DYMA 1RUD3 5FWEA 4MUVA 4XJAA 4LBNA 4ZONA 4LORA 1RUOA 1TZOA 2ZEYA 4IV3C 5LA2A 1B09A 3H1WA 4JKLA 1ST8A 3SITA 4LE3A 3GNEA 1LU2A 2XPJA 3B9CA 1PO21 2D98A 2I07B 4LE4A 1IPSA 4CCCA 1RXGA 4EV0A 3DV8A 5IT6A 5FZLA 1DGWA 3POYA 4Q4Y3 1LHVA 2QQWA 4CPBA 3VZOA 1SACA 2ZX1A 2KA3A 4JQTA 3RRDA 1XYOA 3I2DA 4UXAA 5L9RA 2ZGNA 2JB4A 2Y6JA 4M4RA 3RPQA 2FDKA 1UO9A 1N1YA 5DUVA 5LA9A 2ZGRA 1DZTA 1LOFC 1MPXA 1V6LA 4HONA 4JTOA 4Y5SA 1JYNA 4UFLA 3B9IA 3TYJA 2XBO3 5A3WA 4AVSA 3LD8A 5IFPA 3H1YA 5FLJA 3N9LA 4JKKA 3CL1A 2FDIA 4IE5A 2WQ8A 5EJ3A 4AEKA 1SQ4A 2WYFA 5IK4A 1W6PA 4K21A 1HIXA 5C8CC 4HVOA 5DXDA 5JOYA 3KV4A 1YQ6A 4BLIA 4CCLA 1R093 3A23A 2VQAA 4YZ5A 3I3MA 2R32A 3WHUA 3OEBA 1SDWA 5FYTA 4AVCA 1HJGA 1APNA 1PM7A 1ZRRA 2FCVA 2VMFA 4NWVA 4RHV3 3VBFB 4YSFA 1IHMA 2FMYA 2W1UA 3LA3A 5DDJ2 2X05A 4BJ0A 5J96B 3USUA 1DQ1A 3TEXA 2XJPA 5DAXA 1ZBA1 5D1IA 1OH4A 1BHGA 4OZOA 5DMYA 1AR91 4SLIA 3C7GA 3H7JA 5LA0A 1RUH3 5BNOB 2ET1A 1CAUB 4RA0A 1VBE1 2JDHA 4QKFA 3IN9A 2HH9A 2JG8C 2XH6A 3IT8A 2Q30A 3WNPA 4AL9A 5HCHA 5BPXA 3RZKA 2EIDA 4AGVA 1LESA 3OD4A 2D3RA 2IXIA 1QNWA 2RMU3 4OUEA 3VKLA 4CDWB 4N43A 3VL8A 4CP1A 3F95A 1OLMA 5F32A 3GDBA 5DUWA 4Q4V3 1ODMA 1WZXA 5EWSA 5LWBA 5ABJB 5C70A 1LNSA 3AMMA 4DXZA 2R061 3N7JA 4A7KA 3O1UA 4IV3A 3E5UA 1QKQA 1ZZ6A 1U0AA 2JKXA 1RUJ2 4YRDA 3U07A 3BTAA 3PU8A 4W6XA 1C5HA 1EP0A 1FYUA 2EF6A 1E5HA 4H7MA 1WCKA 2WAOA 4XFAA 1LHWA 4YG3A 4GXLA 3WP4A 1F4AA 4AEMA 2BRTA 2VCCA 3NAPC 5F5QA 3E97A 1VBC3 2HWF3 2JDPA 4NIAA 4E4DX 3BKZA 5F8PA 1QOOA 2R073 5FLHA 4OVEA 4RFT0 3SEPA 4FXGB 2A70A 4WM7C 4K7JA 1JZ2A 1S1AA 3OUJA 3H3LA 1QXJA 1FPN2 3Q8FA 3KGZA 1FATA 4FCAA 1UZZA 2YGLA 1U5IA 2GP5A 4YW1A 1UX6A 3U75A 3NNLA 1ZRFA 4QKDA 1OA3A 1LOFA 1HV1A 3HN1A 3W21A 4XBQA 2Z4FA 1C5IA 5LRSA 4HVQA 3WF1A 4L0PA 4NIGA 2ENRA 5CADA 1H1MA 1GWMA 4XBNA 4LQRA 4WZCA 2ZGOA 4OHWA 5C8CA 4H3WA 3M3QA 1HN1A 4PI0A 1NLRA 1EAH3 4GD4A 1ONAA 4FPHA 3AMPA 2EIBA 2VOKA 5DZGA 1H8VA 4COUA 2HWB1 2WO7A 2B9UA 3B5LB 1OF4A 2W3JA 3RI9A 2YU1A 2G9GA 4HPKA 5A7WB 1Z78A 4ARYA 2OPKA 2AR6A 1CZVA 3I3DA 1UY1A 3GCXA 1PZ8A 3POFA 4Q4X1 1GNHA 3ZSJA 2QQPA 3U37A 3PTRB 5EHDA 2BVVA 3E1F1 2JG8A 4K6BA 1JH5A 1J84A 5FYZA 1URXA 4QPYA 5FY7A 2XOMA 3HPNA 2DTWA 4X6RB 5EYXA 5FPBA 3SH4A 1DYKA 2XLAA 3WDXA 3I2OA 1BK1A 1F2NA 4LKSA 3ACIA 4IL7A 4CU6A 1NXD1 4PBOA 1RVF3 1WCQA 3AB0A 3GJAA 3M1HA 1AR82 5FK8A 4ZXEA 3QH6A 4CDUB 1SG3A 4DINB 1BMV1 3LQCA 5IJRA 5GZFA 5JIUA 5LBEA 1PK6B 5EFUA 4Y4RA 2WZR1 3FLTA 3OGVA 1K12A 4Y3OA 4YW7A 3M4FA 4CXXA 2HWD3 1JZ8A 4CXYA 4HFSA 1UN1A 1VPHA 3V0BA 1PO11 2VM9A 2R16A 1XOYA 4QQPA 3NAPA 2ZGUA 2WFPA 2RDQA 3NJXA 2UYBA 4H2AA 3ZXKA 1HX6A 1Y9GA 1COV1 3B00A 1U5XA 5LY1A 4KG0A 5IK7A 3BTYA 2JDMA 3NMBA 4HLTA 4WM7A 1UU5A 3I2HA 4NAMA 4RYDA 3CLPA 3OOXA 3PVBB 4CU9A 3OB8A 1ULGA 5KWRA 1WUVA 2PHXA 4EWAA 1PMJX 3WW1A 3EJKA 4YVSB 1F4HA 4XF1A 2YU2A 3U11A 4B1LA 3ACGA 4WVZA 3T2QA 4XUTA 2X5IB 4GB32 4DEVA 1R1A2 3MIDA 4QPGB 1OLME 4S2HA 1YYNA 4QB6A 2WWSA 3N4MA 2WABA 1MS1A 2QJVA 2VOWA 3BOPA 1K3IA 1RTVA 4TWTA 3FX3A 4UF0A 1KFXL 1J3RA 2RS33 4XE9A 2XDVA 2ETEA 5LZ6A 1GQPA 3WUCA 4AAXA 2ZMKA 2VTFA 2C9AA 2A3YA 1X9TA 4AQ2A 3T0DA 4AHWA 3OD0A 3IDCB 2AENA 1UY0A 5IVBA 4IV1B 2XR4A 3PUAA 4N8MA 5I93A 1CZSA 2JDKA 4FQZA 1QHDA 1SPPB 1ZA4A 2QQOA 5GLWA 4DXSA 3MIHA 4GALA 4DEQA 5FO8B 2OUJA 4P00B 4XMAA 5EP9A 4BE3A 2XXZA 2VOVA 2WT1A 1IG3A 1QQP2 4IW3A 1PMHX 1G9BA 4XC9A 1XNAA 2ZJCA 1AR72 4ES9A 2WFF1 3ATGA 3O0VA 1HKDA 1GP6A 1Q5OA 2ZAHA 3ZN6B 5DDJ1 5KBFA 5CKNA 3LDKA 1O4ZA 3DGTA 4WVMA 3VKOA 1WW6A 3D0JA 4P9IA 2VAUA 4OMCA 4DUVA 5J7MA 1GNYA 2HBTA 2ZEXA 3ES4A 5FDBA 3CNAA 4CCOA 4WV8A 1CAUA 1Q8VA 1O8PA 4XMIA 5DG1A 3ZDSA 3U1XA 2R043 2VD7A 3RZGA 2GP3A 3WINE 4DXRA 1IKQA 4LXLA 3T4HB 1RIRA 2IXHA 2X53S 2YZ4A 4HKLA 1DZRA 4UFIA 2OYZA 1C3HA 4JKMA 4CZSA 3H8UA 2XHKA 4KWKA 3TEYA 5FUPA 1PK6C 3JD72 5BNQA 4KU7A 4LMFA 4NWWA 4DUXA 4PJYA 3I2JA 3LEMA 4XETA 2XJVA 1XC6A 3JB4C 4XTMA 1V6OA 4IEXA 4HMZA 5KHKA 2IFRA 5E6HA 1NYWA 4AI9A 2XWBB 1BVVA 4FTSA 1TNFA 3A22A 3WF2A 5FOJB 1LKNA 2ARXA 3LKJA 4BQ2A 3CEWA 5DAWA 4NPLA 1LHNA 4UBHA 5JOWA 2D6NA 1CESA 4X8PA 4XACA 4C1WA 1PZ7A 3VKNA 2D6LX 1PO23 2B39A 1FPN1 3BOWA 5C8WA 1GANA 5H9SA 4QQLA 2QQJA 4S2GA 3LCPA 1Z7S3 2HEYF 3GF6A 4OUMA 2PLV2 1BQPA 5FZHA 5FZ3A 4J1XA 4ZU5A 2Q4SA 1Q8QA 1QJU2 4QHBA 4OHYA 3NJVA 4UW4A 5K9YA 5DABA 2X5IC 1L7QA 2Y38A 4QPGC 3OTFA 1LB2A 4YZ4A 2CSGA 3WZ1A 2YC4A 3ELNA 2DCZA 3SNMA 4LEJA 4ZZ5A 4XOGA 3FLPA 3O12A 3MUZ1 1OC1A 1JUHA 3RYKA 3EXUA 3P3PA 4YW4A 2VECA 4XFIA 1GP5A 3LWCA 2F6BA 3EO6A 5C33A 2K2SA 2RS13 1QJEA 5FYHA 5FY9A 3WP3A 3AP4A 2YPJA 2WJSA 3T08A 1W6MA 4LBOA 2GNBA 2Q1MA 1NA1B 2CDPA 3RG0A 2VZQA 1ND3B 4ZU7A 4IV1C 5I8SA 1UPSA 5A7WA 1UZWA 4LNVA 1QMJA 5LBBA 3LFMA 1HRV3 4CYDA 1QF3A 1SLIA 1TME2 4Y1YA 3EMRA 3NL1A 3FUOA 4B8EA 4ZS3A 4CCKA 2BNOA 1E5IA 4GWMA 4YVWB 2OKXA 1AYN2 1BZWA 1PHMA 3B93A 4N9HA 2Q0AA 3U10A 3VB9A 2W68A 4IEQA 4AGGA 1U5YA 1ZBA3 1G8WA 1WMDA 3U4SA 3MFCA 4XDOA 3S57A 1CQ9A 4AFBA 1VBE3 3BU7A 4C8DA 3V0AA 2LROA 1W8HA 2ZGTA 3RDIA 1AR81 2LTNA 4ASKA 1XQNA 2DBNA 3N9QA 3CZUA 1PK6A 3DYOA 4TSVA 5AC92 1OFSA 2WKKA 1X33A 2G1MA 4LO4B 3USSA 1FT9A 1YO8A 1Q8PA 1AX1A 2CWMA 3WNOA 3UJQA 4B29A 1IOAA 1UYXA 5DAPA 2XUEA 2PHTA 4HXCA 2R063 3J7MA 4IE0A 4Y5Z0 3T30A 2QQVA 1HQNA 3CIHA 3WG2A 1W8FA 4FP2A 3RSJA 2EA7A 4P9XA 2O8OA 5ANQA 1RUI2 5GM0A 1QH7A 3ECQA 2H0BA 5FRAA 1AXZA 2AYHA 2P6HA 1KJLA 1F35A 2P3YA 2VW0A 3ES1A 3NQHA 3FL7A 4G9SB 4P08A 3ZYGA 4AW7A 3JCIA 1W9SA 1IS3A 4CDXC 4Z2WA 5A33B 1RITA 1YXWA 3K77A 1QH6A 2JDZA 2H6BA 3NJZA 4CU7A 2YBKA 2OW4A 3KS7A 2BZDA 3HWJA 1ZZ7A 1FX5A 1SCRA 2A6YA 4MOAA 2V72A 4MLOA 4EN6B 3W5NA 3I2KA 2X5IA 3AFKA 3AP5A 4GB31 4XF3A 4XUOA 1R1A1 5JR2A 4QPGA 2PN5A 3HN3A 2XJTA 2GN3A 4LO7A 5T5PA 4IEPA 5JSPA 3ENRA 3U14A 4NMIA 3JBG2 4FPEA 1FNZA 2BGCA 2XVGA 3M70A 4LKDA 5LK5A 3WG3A 4O9GA 1NX9A 2Y34A 1DYOA 1AUYA 1OFNA 2EXJA 2VZPA 4K1YA 3AP7A 5KXBA 4XHBA 1WLWA 2FDFA 5FXVA 5F6LB 1QIQA 2X8KA 4AFAA 3IDBB 2BPA2 4IV1A 1PVXA 2ZTNA 2HYXA 2VL4A 4YZ2A 2IFWA 3UJOA 4XFHA 3ILRA 3J4UH 1S4CA 2ZABA 4NVPA 3AZYA 4LUMA 5CG8A 1WLCA 1QQP1 1LCLA 2HWB3 3PLQA 5FP9A 5F2SA 4GWIA 3ZYPA 2JG9C 4A3ZA 3JU9A 4JZRA 3WF3A 3ZN6A 1YQCA 1ND3C 1CJDA 4Q4X3 1RUG3 4NHYA 4SBVA 3UESA 3OEAA 5KHHA 3OGGA 3NV4A 3O1OA 4AHYA 3ZPYA 3IM0A 5A3PA 3C3VA 1I3HA 4UT5A 1ENSA 1T2XA 3AP9A 1QJY2 4UWDA 4UAPA 3DL3A 5GLTA 2FQPA 2VW2A 4WZFA 2PHRA 2YB7A 5C4WB 1OLQA 1V6JA 1WBFA 2ORZA 3AMNA 3LE0A 4FPGA 4G3YC 4A3XA 3ZYHA 1Y43B 2WZR3 3EBRA 4IEOA 1PM4A 1S2KA 2W08A 3N35A 2YMZA 5DUUA 2AREA 3FC0A 1LULA 5FZGA 3W59A 4QD2A 3WVJA 4CDXA 3MGUA 4JGYC 2QKDA 3WDYA 1EUTA 2CAVA 1PO13 4KGGA 1W8UA 2ZX2A 1VMHA 1V6KA 1WD4A 3AXEA 3MIGA 4V1PA 5C9AC 1PGW2 2WNVB 4META 1QGLA 5BNPB 1TMF1 3WNNA 4KGQA 2GN7A 2UYAA 1NZIA 1OXCA 3ASIA 3D8CA 3K75B 5FK7A 3SMHA 5JXGA 1AR92 3WQBA 4W6YA 2Y6GA 1ZZ9A 3A7QA 3T4VA 2FD8A 4NAOA 3AZZA 4R52A 1GNZA 4XZPA 1W2NA 2HKXA 2V73A 1QXRA 4XEZA 1H8TB 2ZAAA 3VKFC 4FPCA 3ZXGA 2GH2A 2BNMA 2CWSA 2PLV1 3LIHA 1O3QA 1J83A 2AZ5A 1SFPA 5FZ1A 3PDQA 3VBOB 3SQOA 1QJU1 4QX5A 4BU2A 4OI4A 1HQLA 3AP6A 4A7ZA 5FY4A 1WA4A 4JCKA 1GZCA 1GZ9A 3K2OA 4K1ZA 2ATFA 2DU1A 2BP6A 5F9TA 2LALA 2WAAA 1RGSA 2XHNA 5FREA 5BNNB 1GOGA 1TEIA 1YCIA 1DHKB 3TN91 4IE7A 1QJX2 5JOZA 1UYZA 1X8EA 4PCRA 4Y26A 4AGRA 2JG9A 3ZLIA 3GZEA 2PHLA 4JDOA 1ND3A 4CVUA 4AI0A 3MHZA 1X50A 3K3NA 1XU1A 2VVDA 3SH5A 4FTBA 4Y1UA 1LOEA 1H1IA 3HJRA 4LBJA 2FDJA 1H4HA 1TME1 5IVCA 1BCXA 1WD3A 1KJRA 1AZDA 3IBMA 2W1QA 4YVWA 4GKYA 1AYN1 4QX0A 2OPWA 3CJIB 4CE8A 3WLUA 4IEYA 4NIHA 1I6XA 2I45A 4LUKA 3AYAA 3OPWA 3MIEA 4AOCA 3SCFA 1V70A 2G19A 2LW8A 3NJYA 3MLLA 2DF7A 3R4SA 1ULDA 3SHRA 5IATA 2P37A 5C8CB 5IK5A 1O7FA 4LBQD 4XFGA 3R05A 3WDWA 5IFTA 2VZUA 3PMSA 4GWJA 1SLAA 4LOSA 4JGYA 4M3CF 4URTA 1SDDB 3KHBA 5LRRA 3VUOA 4MX3A 1MZ5A 1NOVA 2A6VA 4CA9A 4IXLA 4E8CA 3DCQA 5C4WC 1Q56A 1I1EA 3NV1A 2BYVE 2QQMA 4RGKA 5FPZA 4CRQA 2ZX3A 5HCAA 1OHFA 4I09A 1FMD2 2WNOA 4R9DA 3SXWA 3MPPG 4A45A 1RUI1 2W47A 5I0TA 5I0UA 3BI3A 1RUJ3 3TRSB 2FBEA 3VGIA 2DU0A 4OZXA 4PHZA 2Z5WA 5LATA 5AFBA 3VBSC 5FO9B 1S0BA 4NPMA 1PX4A 2IVIB 4QB1A 5C3SA 4QQ2A 4KG8A 1C8M2 2WNVC 5BNPC 2E31A 1JYTA 3VDAA 2DURA 3ZXAC 1W05A 2FCTA 2VPVA 5AVPA 1MACA 3HEIA 4LT5A 5DG2A 1FPN3 3WW4A 2RV9A 2O1QA 3G6JB 5KXDA 1HN0A 2B8MA 4P9WA 3H8XA 4YYOA 1XYPA 2JDAA 4K8RB 3RNSA 3ETQA 4QM9A 1OI6A 3JBG1 4MV2A 1UYPA 4AQTA 1H0BA 1W04A 3KVBA 2GAUA 4LHNA 4NUBA 2ILMA 4DY5A 1C8NA 1OKQA 4LIUA 3ZXFA 4ET7A 4YM0A 3WHTA 3VBOC 2C26A 4LBQA 2ID4A 2MEV2 5FIXA 1C1FA 3NAPB 3A21A 1COV2 2WRAA 4E2QA 3WNKA 2WLPA 1A8MA 1US2A 3LSDA 4AF9A 4WM7B 4MH0E 2WO3A 3T1MA 4CEYB 1W0OA 4EN0A 3N7KA 3FHIB 3VD3A 5E16A 2BERA 4LPLA 5BNNC 5JI7A 4QHZA 1AXKA 1D4VB 1N1VA 3K4AA 2G4IA 5T54A 4LKEA 3FJSA 3LDRA 4XHXA 1WW4A 1LEDA 4IETA 2VOXA 5KR7A 1UXZA 1FNYA 3MYXA 3THCA 1E5SA 2KM2A 3VHRA 1L7LA 2VJXA 1GFF2 3QOPA 4CUGA 4TXWA 5EJZB 2E26A 4HK9A 1F15A 2NN8A 4XJ8A 5A6QA 1S55A 1OT5A 2XONA 4UF0B 3FFZA 1JYWA 1OQ1A 3HNBM 2J7MA 2OZJA 3AFGA 5DQ0A 2C5DA 1QJY1 2WQZC 3DKWA 3CJIC 1CX1A 1JBCA 4Q0UA 1TQ5A 1GP4A 3L2HA 4NRMA 4XBLA 3UGGA 1AR83 2OQ6A 5C4WA 2DFCA 4AVAA 3NRUA 4GJYA 3N9OA 2D7FA 3ALQA 5H9RA 4MZUA 1JYIA 2DCTA 1LU1A 1OVSA 5CU1A 2J1UA 3BIWE 1XRUA 4BISA 1UMHA 1GOHA 4AFCA 4MGKE 4NHKA 5D2AA 3UK9A 2Y64A 3EB7A 2W9XA 3VBSA 1JU3A 2BBAA 2HWE2 4DMIA 3U78A 4A2UA 3H0OA 3M2MA 2WFF2 1J59A 3UGHA 2WO2A 3BCWA 1PGW1 2WNVA 4Y22A 4LK6A 3S6PA 4Z2AA 1CAVB 2W39A 5BNPA 5HBAA 1NUKA 4XZUG 1ULCA 3SEEA 4WVMB 4FTEA 3R4DB 2YY1A 4L8QA 1UKGA 3B94A 5I0DA 2J1AA 3WUDA 4D6RA 2VO5A 2XJRA 1RJ7A 4YFWA 1MEC2 4IDZA 1DP0A 4BIFA 4YARA 1EPWA 1AR61 5JIAA 3OGJA 1XSRA 2WT0A 2E63A 1H8TA 2WNEA 1DU3D 1L7RA 3B7MA 4GMP1 4TYSA 5A1LA 3FHQA 3C7EA 3VD7A 3HQXA 3NNJA 5IVVA 3WEZA 1N1TA 4GB33 1R1A3 4QXKA 3VBOA 3H42B 2BBVA 1RHI2 1ULOA 3CMGA 5GKAC 5F37A 1G7YA 1YFWA 3T0BA 1UW8A 2BEOA 1JHNA 3LOBA 4EWDA 5FZ0A 1A3KA 2WA3A 3VLBB 2PAKA 1D4M1 1MZEA 2WNUB 4XAAA 2HEWF 4OI2A 5BNNA 4EQVA 2P17A 3N7LA 3AYDA 1REEA 2JIJA 1AJKA 1C57A 4FFIA 1S0EA 4EN9B 1QJX1 1ACCA 1PGSA 4BQ5A 1VAVA 3MBWA 4NHLA 5J1XA 1VALA 2HWC1 5L36A 4LO5B 3FZ3A 4O61A 1DCSA 3I54A 2VBPA 1RUE2 1KDMA 3HNMA 5A6YA 2GNTA 1JOPA 2ZCWA 1KDKA 4QPIC 1EYBA 4CEYC 3T09A 5DPNA 1QQP3 4OMDA 3G7DA 2PMWB 1DQ0A 3BPZA 3VDBA 4HBNA 3TNPB 1AR73 1NT0A 1XJAA 3ZFEC 4S2DA 3DKQA 3IMMA 2V09A 5K0UC 5J48A 1JZ3A 2HBUA 4J25A 1AF9A 2Y6HA 3CJIA 3GZAA 4ARXA 3IDAA 1RUC1 4CCEA 4IE6A 5JSRA 1HQWA 2WWUA 1GBGA 1PVC2 1YLLA 1OPMA 2KXLA 3C7OA 2BWAA 1PNGA 2VGDA 5FFOC 5ERLA 5C6CA 1N3OA 1ZRIA 3LAGA 3LSEA 2JB8A 2Y6FA 4MHRA 4CXWA 1PGL2 4RR3C 1U12A 1O5LA 1ENQA 4PT6A 5FMOS 1XPWA 4PBPA 5IAVA 1BBT2 1W99A 2Y8KA 4M0HA 4MGSA 5IWFA 4M3CA 5A3NA 4XXAA 2PQSA 3ACLA 3FLRA 5FZ4A 3WG1A 3C7FA 1W6MB 1NQDA 1UQXA 3SC7X 4BZ4A 4OQ8A 3VZKA 3WF4A 1CAXB 1VRH2 3JD73 3RWKX 1FMD1 4KQ7A 3ROUA 2YFZA 4QGMA 1W28A 3WG4A 4YM1A 1GU3A 3LEGA 3MF6A 3I2IA 1ASJ2 1C28A 1QOSA 2P3IA 2EXKA 5GJ6A 2ZHMA 4KL1A 1C8M1 2NQYA 3H50A 2D6OX 1KS5A 2ZZQA 5LCWL 4FPKA 5F3EA 4TLFA 1ZX5A 5FYYA 1POV3 4HG6B 1SHWB 1UU4A 3DXTA 5IVEA 5ACA2 1ZZBA 1OSGA 3V0AB 3H1MA 2Y0IA 5T5JA 3KCYA 1LECA 4COVA 4P9LA 2ARBA 3KB5A 4JVAA 2CV6A 2PLV3 1DDLA 2MHFA 3J26N 4HSLA 3I8TA 4XW3A 1VP6A 2NPIA 3VD4A 3B01A 4Q4W1 5GZEA 5FYVA 2PFWA 2VZ3A 3IDEA 1G9FA 1XB9A 2MEV1 1UIKA 1IPKA 3ZFGB 5FZMA 4RFRB 1JTZX 3T2OA 1WLDA 3MV01 2TNFA 4M0NA 3O1SA 3TEZA 4C1XA 5F1RA 4QPIA 4HSJA 3GBFA 3O7OA 4CEYA 3EQEA 2WNUC 1HV0A 2JE7A 1OD5A 4XIKA 2E32A 1EY2A 3OYWA 4YG6A 3I3QA 3ZFEA 1UY4A 2E7QA 4X8NA 5K0UA 2KD7A 2HJIA 3D5OA 2Z2SB 5JCTA 2VC9A 4NOTA 5EQUA 4URAA 3I3EA 2J1EA 4IGPA 3C2UA 4RGGA 1F8VA 1TME3 2VMDA 5A6ZA 4ISQA 1B35C 4K8FA 4YGCA 2UWCA 1AYN3 1JUIA 4D6QA 2RR12 1W2UA 5L19A 1UZ0A 4B4RA 4DRVA 1O3SA 1IS4A 1UF2C 1LEMA 4OUSA 2B42B 5A3OA 4E27A 3WQ0A 4QX7A 2WS92 1SEFA 4MXVA 3MLJA 3VL9A 3WQ7A 1DGLA 4FPLA 3THPA 3FFQA 2EVXA 3LEKA 4U2AA 1M4WA 3FBYA 5AC93 2UU8A 1SBFA 5FY0A 1LRHA 2Y60A 2A6ZA 2TUNA 5B2GB 1D2QA 3E5XA 3R4UA 4QMAA 3HQUA 1IS6A 1K5MC 2HWE1 3LPGA 4PIYA 4BQYA 4Y20B 1QU0A 4CCMA 2WL1A 4QQHA 2WYSA 4XJZA 4Q8LA 1CAVA 1VMJA 4YW3A 3ST7A 1RUI3 1UZVA 3VBUB 1GICA 4GULA 1RMU2 5AFEA 3ZYIB 1WW7A 4JAAA 1Q43A 4UOJA 3KV6A 1J58A 2JDUA 3CZJA 2JD9A 3I4IA 3KWVA 4LHSA 1HW5A 1MEC1 3NO8A 4EJRA 5JSOA 4NE9A 3VBRB 1LOGA 2WZPP 2W94A 3OBTA 4A42A 2JICA 1REFA 2GDFA 3AJZA 2YG0A 3TAYA 3WD5A 4DY3A 2KR2A 2CTVA 3POBA 1TNRA 5BY5A 2VZRA 3W58A 1JOBA 5LB6A 1HXS2 4IEWA 3UNPA 1AHSA 1RHI1 3TB0A 4EZHA 2N7GA 3H8OA 1G9DA 3KLSA 4Y5TA 1OH3A 1GOFA 3BN6A 3JBG3 1IG0A 4DZGA 5A7SA 2ZMLA 3RZLA 5FY1A 4CDXB 1HDKA 1W3VA 2WNUA 4ISRA 4Y1XA 5LASA 3ZIWA 4E2SA 3RZHA 5IVJA 1YNAA 4OHVA 4BYYA 2XKOA 4BQWA 5HV0A 1WWYA 1DIWA 2CGNA 1TMF2 1CX4A 3N9PA 1JZ6A 2JD4A 3VDCA 5A3UA 1V6MA 4MYEA 1VBD2 1EV12 2JE8A 3ZFGC 1RUE1 1PIV2 1D2SA 1UX7A 4LBMA 1W8NA 1H2NA 2GNMA 1S2BA 1UMZA 3C7HA 3O1TA 2WC2A 2GC0A 2OXBA 3DYPA 2QBXA 1B35A 3K46A 3KD4A 3DPRB 4BMEA 5BUVA 3KGLA 4XQDA 4MADA 3H3ZA 2WBKA 3O1MA 4EN7B 4A41A 2XJSA 3GJBA 1KRIA 5HCBA 2WDBA 1SZBA 1XNKA 2Z79A 2ZA9A 4RS5B 5CB7A 4C0HA 1MS3A 4BH9A 2WN2A 3ILNA 2IC1A 4Q0VA 4COYA 1PVC1 3ZKYA 2VQUA 5FYUA 4INDA 1A6CA 1D7PM 1LGBA 1V6IA 3KMHA 3AKQA 1RUF1 1O8SA 4B4PA 1QJY3 1PGL1 1W2TA 4AXOA 4A44A 1OQDA 3IIIA 4LA3A 5CVRA 4FP3A 1IKPA 4LK7A 3DN7A 5LY2A 3TN92 4ZZ8A 1N3PA 2X10A 4HETA 4JC1A 1CD3G 1BBT1 4CSWA 1MS9A 2ZMNA 1K5MA 4CP0A 4IUGA 1H4GA 2JG9B 3I2FA 3N7MA 2E6VA 1MZ6A 1BYHA 4BA6A 1ND2B 3AMQA 3PTYA 3BIEA 4IERA 1CAXA 5FYSA 1VRH1 5IVFA 2H0VA 2RJLA 1ULFA 4L97A 1MZFA 4CP9A 1GUIA 2DCKA 2J1RA 5CFDB 4PF5A 4BB3A 1SBEA 1HRI1 2D5HA 2VVEA 5CKMA 3O1PA 2P6CA 5JAXA 2VXRA 5FP7A 2V4AA 5L73A 1ULEA 3QCWA 1ASJ1 1POV0 4JHTA 2Y0OA 4OLLA 2XJQA 5T50A 3RMYA 5F3CA 2WWJA 4AE2A 4XVHA 3WDVA 4DXTA 1AR93 3IAQA 3VBUC 2ZBJA 3LPFA 3MO4A 4FOQA 1KQRA 2D3SA 3V65A 2VZTA 5ACA1 1UOBA 3NVCA 5CNAA 2AC1A 3QH7A 4ZY9A 4GMP3 5DZEA 3VBRC 3AZWA 3WCRA 4FAGA 5FMDA 5FUIA 5J37A 2ZX0A 1Y9MA 1G9CA 1IQAA 4JGYB 4FFHA 1OPOA 1QDOA 4XIOA 4QX2A 5C9AB 1WA6X 3K51A 1YI7A 1JODA 1YC61 4L11A 2ZGLA 4R9CA 5FPAA 5A3MA 4BIOA 3PIGA 1CVNA 1JYVA 1A78A 2F4PA 5GZCA 3ZFGA 2ZGPA 4QM8A 1YJKA 2UY9A 1G9AA 2OZ6A 4F8AA 3MFAA 1HJFA 2QQIA 1QJX3 2XJUA 1DFQA 3L2YA 4ONUA 5C3QA 2GC1A 3MLKA 3PUQA 1UMIA 2FZ2A 3WXPA 3AZVA 4N9IA 4I2OA 2MPFA 4UFKA 4FPOB 3RQ0A 1H2LA 4BCUA 3KT4A 5JXJA 2CDOA 3KV5A 4ASMB 1RINA 3QACA 3GYDA 5FPLA 2R0HA 1LGNA 4QX8A 2PTMA 1RL3A 3E6BA 4XFFA 2QFEA 1XE7A 1UY2A 1VBB2 2ZGSA 4UFJA 4CTEA 2W1WA 2VZ1A 4HOOA 1OF3A 3E5QA 3DPRC 4TN7A 1WBLA 1H6YA 2RR11 2VU9A 1W2OA 1W9YA 5BYNA 4FFFA 4AEDB 4MG2A 3RYPA 4XFBA 4YW2A 2E53A 2OIIA 4RS5C 4LITA 2Q5TA 3UYJA 2Q8DA 4LBQB 1H9PA 3JB8A 5FYMA 2ZXQA 2WS91 4L2NA 1WKYA 2JWPA 3PIJA 2XUMA 4M00A 2VNRA 2JENA 3LB9A 1ODNA 5KC6A 2C24A 1E57A 3BGAA 1S0CA 5JLVA 1OA2A 4XJWA 5KHGA 1X8MA 1ZA7A 3S7EA 4YNIA 1W0PA 2YROA 3LA2A 1GLHA 1CWPA 3WNMA 3ZSMA 3BU0A 4BHPA 1W9FA 1CONA 2V4VA 3LZZA 3ZKUA 4Q8KA 1GKBA 3BALA 3CF6E 4Y20A 4LJHA 2W5FA 1GR3A 2B7YA 4Z1VA 1FMD3 1ND2C 1QEXA 5ISLA 2DUQA 3I59A 2DBIA 3VBUA 1RMU1 1TE1B 3ABZA 2AEYA 5CFDC 1U5ZA 2W1SA 2JDNA 2ZHKA 3OCPA 2E33A 2HWF1 5G05L 4LO8A 2GH8A 2YC0A 1UIJA 2R071 3VBRA 3APBA 1C8M3 2QTWB 4MVTA 1GWLA 3HBKA 3AX4A 1NLQA 4BQXA 1CZTA 1PNFA 4QB2A 5FO7B 5A6XA 3MW2A 2NYYA 4K20A 3WSOA 4FFGA 4XDQA 4B7KA 1SLBA 3WX5A 3WW2A 2PQQA 1HXS1 2TBVA 2BFUS 3D6EA 1W9WA 2O14A 4V2WA 3JXSA 1OKOA 3VZNA 3I97A 3SCGA 2VNVA 3RFRA 4Y1ZA 4QQOA 4QHOA 2I2SA 3J8F2 1NE4A 2CNAA 3OBRA 3NV3A 5E88A 1O91A 1H2KA 2VOTA 4I0BA 1Y7BA 4COWA 1WGPA 3AVSA 3OUHA 3AL5A 4Q2FA 2CYFA 3VBSB 2HLEA 2VE1A 3AM2A 2FDGA 3P5BA 1CIWA 2XB6C 1H30A 3FBMA 2MEV3 4XFCA 1O3RA 2A7AA 4COZA 2E7AA 4QKBA 4Y22B 1COV3 2YGMA 3ACFA 1C4RA 1NE6A 4XXPA 1VBA2 2WUHA 4IE4A 1VBD1 3IPVB 1EV11 3RVHA 1DBNA 1CGPA 2DV9A 3GHNA 1LR5A 1QJZA 2YBPA 4HN0A 1PIV1 4ZU4A 4LBLA 4QDQA 1AR62 5KXEA 3LOIA 2FCUA 2QQKA 3NKTA 4D0QA 2BUKA 3WDTA 3DPRA 1DQ2A 1RJ8A 3O0WA 3O1VA 1WCDJ 2ZHLA 3OBAA 2Q1FA 1MS5A 4EN8B 1X7NA 5CAZA 4RS5A 4EZ4A 5I91A 4CDQB 1ALYA 1SFNA 1E5RA 2ZOEB 4KWJA 5F6KA 3GHMA 1UWWA 4KWUA 4GZ9A 5F39A 3ZYJB 2PAMA 2ZS6B 1OQEA 2J42A 1AX2A 1SMVA 1WCSA 2ES3A 1D4M2 5JMCA 4QXCA 4F7ZA 3DXUA 3H9AA 4XCBA 3W9AA 4QWNA 1BJQA 4AEDC 3L9JT 2DVDA 3RI8A 2O8QA 2ZGKA 4NIIA 3VHPA 5FLIA 2HWC2 4E4SA 2EAAA 2BNNA 4LHLA 3ZM8A 3S5AA 3KF3A 4YW6A 2J1SA 5CFCC 2XL7A 4RQPB 1DLLA 3FN9A 1ND2A 2IVJA 5TSWA 3MV11 1UOJA 4ASLA 3AKSA 4V2VA 3ZDVA 4LULA 2RM22 1N47A 1YFXA 3LGRA 5CFDA 1LENA 3HR9A 4R9AA 3M3EA 2HWE3 4HL0A 4HZFA 5FZ7A 1I5ZA 3WP5A 4P5YA 2WFF3 1LJ7A 4AQSA 3SLIA 1Q3EA 5FXWA 4QGLA 4QXHA 1DQ5A 5DDJ3 5FPVA 4JTNA 5J09A 4QX3A 5FUNA 3Q8EA 1RUC2 5ANNA 2HYKA 4L92A 4J1WA 1O59A 1MEC3 3ZXJA 2GC3A 3LA7A 4YFZA 5FZAA 3ZX7A 4NO4A 2A71A 3MUY1 3RZZA 3A4UA 2WO1A 2PXJA 2B45X 1AL22 3MPBA 3ZN4A 2ZEZA 4TLGA 4D8MA 1DGRN 2YXSA 4QU2A 1QY4A 1HB3A 2XG3A 2YFUA 1RXFA 2XVLA 1RHI3 3GGLA 4M3CB 5C9AA 1G86A 2WT2A 1ZZ8A 3JQWA 1XSQA 1ZBE2 4YZ3A 3RGBA 5C3PA 5FY5A 1FAYA 3Q8CA 2NLRA 1A8DA 1O4YA 2BTVC 1I9RA 1AX0A 2SLIA 2DUPA 4IQPA 4PQ9A 3VBHB 2VNGA 1YFYA 1JU4A 2A1XA 1HB2A 1OVPA 4X6QB 2C4XA 3ACHA 1W8TA 1A34A 3GXUA 1IPJA 4CUAA 3K48A 1ZRCA 1BEV2 1ZZCA 1SLCA 1V9U2 4I0WB 4JQRA 4AI1A 3ILFA 5FZBA 5C7GA 4Y24A 4OI0A 2C1FA 2BVBA 3BODA 4XUQA 2W46A 4XPVA 3WF0A 4WVVA 2D44A 2DVAA 2CHHA 2EXIA 4QXBA 3AMHA 1RUE3 2YUEA 3P6BA 4Z07A 2JXAA 2O0OA 3CBNA 1K42A 1FXZA 1VJ2A 3PJQA 3OPTA 1OOPB 1S2EA 3KT1A 1UPIA 2VH9A 3PURA 4MGQA 4P14A 4UBGA 3N3HA 4B1MA 4BM8A 2F17A 3KHCA 1GYKA 2V5DA 5FJHA 5D8AB 1VBB1 3WQ1A 5KHIA 2OX0A 2J22A 3V64A 4KH9A 4Q26A 4UW3A 2Q8EA 5K8SA 2PHWA 4UW5A 4AEDA 1VAKA 4Q4W2 3B3QE 4IEVA 2QE3A 1WMFA 4GKXA 3ZXEA 1PVC3 4CDQC 4E2GA 1SFYA 3C8XA 3NSTA 2QQUA 5CFCA 1NQJA 4XILA 1EPZA 4K3UA 2EAKA 3S0MA 4FAHA 4D94A 4YM2A 3D4KA 4QPIB 1XE8A 1T6BX 1OD3A 4Z82A 3D82A 3KF5A 1BBT3 2QDNA 2Q1ZB 2W91A 3OYWB 3ZFEB 3R0RA 1RC6A 5K0UB 2YV8A 1GZWB 3TWIA 5FAXA 1KXGA 1VRH3 4RQPC 2G9FA 1N3QA 4N90A 5F5CA 3T1LA 3ZR6A 2IUWA 2P3JA 3T3YA 3J7HA 2VULA 5BXXA 5JVVA 1O3TA 4LBKA 5FJKA 1BK0A 3HOBA 5A3LA 2R49A 1R082 3AKRA 4GH4B 1FV3A 3N9NA 4AHZA 1X82A 4WVWA 4ZPIA 3LIGA 1ASJ3 4RR3B 1POQA 4ATEA 2XKPA 4JGZB 4NPRA 1ZREA 1Q8OA 1YIPA 2W52A 4AAPA 4PDWB 2E7TA 4NROA 1PZ9A 2PA7A 3TOJA 5ACA3 1NCRC 3AYEA 1NZCA 4FOWA 4M4PA 5FTTC 1Z7S1 2YBSA 4QX1A 2RHPA 2EIGA 4OHXA 2BWCA 1DG6A 5LBFA 3J8F1 2OUHA 4KI5M 2GALA 5FOBB 3ZN5A 1O4TA 1S0FA 3DEMA 3PUHA 3ZO0B 1Y9QA 4N7IA 4O9EA 1KEXA 5EV7A 2RS52 2NMNA 4FVVA 2C0ZA 4OQ9A 4NJ4A 4KNCA 4R9BA 5T55A 5JOXA 1RB8G 3PVOA 4XYXA 4HVRA 2Y6LA 3A0KA 1SBDA 4YM3A 4YWAA 4N7UA 4UW6A 1YI9A 3W20A 3VDDC 5FWJA 2WSVA 5EXOA 1VBA1 3VBHC 3IPVA 4ITCA 2RS11 2DCYA 1J1LA 4FO9A 1JYXA 5EPAA 3RZMA 4RL7A 1Q8SA 3PL0A 2VMCA 1FV2A 1V00A 4ES8A 5KHJA 2PHDA 4Y4YA 5JR7B 4RN5A 4ZKTB 1Y3TA 1JN2P 2ZKNA 3UETA 1HRV1 1FOD2 1XNCA 2YC2A 4CDQA 1MS8A 1OOPC 4UFHA 4D69A 4LHKA 3WW3A 4DO0A 5A7OA 5F3GA 1BLZA 4DOUA 1MR5A 1T6GC 4AVTA 2E51A 1DZQA 2EALA 2RR13 5D8AC 3N9MA 4PLMA 4JRLA 1CPNA 4RSUA 2D40A 4I3GA 4CP2A 2D93A 1OMIA 2WS93 4YPJA 4XF0A 1RYYA 5IYYA 2JX9A 1DGRA 5IHRA 1TG7A 3OY8A 4BQ1A 4RQPA 2IXLA 3INAA 4ORFA 5FY8A 1X36A 3ZYRA 4XJ9A 4DFSA 3JUUA 3WCSA 2RM21 2A75A 2C6SA 2QQLA 4AFMA 4AWDA 4EWEA 2P5BA 1B35B 1UNBA 4YGBA 5C5UA 5LEJA 1STMA 5FP3A 4G4FA 2QZ3A 2R0FA 5FYCA 3E6CC 2VCBA 1I5PA 5FZ8A 3S30A 1ZYBA 3IIAA 2UY8A 3GM8A 4A6SA 3KQ4B 2JDYA 1RMU3 3Q8BA 4FPYA 2VMEA 2WINB 1NCRA 2QDRA 4YW5A 3HAGA 2OA2A 2UWAA 4YGEA 5FZKA 4NHXA 3H7YA 2CGOA 4GH4C 1JW6A 1RUF2 5DZFA 1CR7A 1ZM1A 2H6CA 5A7PA 3HVDA 5LK7B 1S0IA 2DTYA 3ZOIA 3D0SA 4JGZC 3U0ZA 1AL21 5DUXA 2JIGA 4TTGA 4FT8A 1R64A 3CDZB 1CJPA 2K0GA 3POEA 4H14A 4L99A 4PDWC 4AG4A 1HXS3 3RJRA 4DUWA 1K5MB 3MI8A 2JEMA 2RJKA 2ADEA 2ADDA 2QNKA 2IZWA 2PELA 2RG4A 4MO3M 4Q0SA 4EE2A 5A32B 2WR9A 1FI2A 4GJZA 3I49A 1ZBE1 3MIFA 1IZ3A 1JS9A 2VCAA 3GZUC 3VDDA 4CEWB 2ZZJA 3VBHA 2QQNA 2JJ6A 4CP9B 1CIYA 1LOAA 4O7XA 3CO2A 1AYM2 1HRI2 4I01A 4C0BA 3ZR5A 1K5JA 4U36A 4BK4A 5L7OB 3H8RA 2IXJA 5C3RA 1BEV1 1RUD2 1TMF3 1V9U1 1W6OB 2VUCA 5K7PA 4D6SA 1XNTA 1VBD3 2AACA 1EV13 3JZVA 1VLNA 3PNAA 1W39A 2B5HA 4XUNA 5FMBA 5FZDA 5FYIA 4E9KA 3KSCA 1PIV3 1WMXA 1J1TA 2A6XA 2K46A 5JZGB 1OOPA 2D97A 4IEZA 2WN3A 1XBFA 2F4LA 5D8AA 4Q4Y2 5DAVA 1QNYA 1YQ5A 3O14A 5I0SA 3TEWA 3FE5A 2XMLA 1RUG1 3M3OA 5CKQA 5FMOL 3DUIA 1QJU3 3KQRA 1YJLA 3AJYA 4PQQA 4D7TA 3I3BA 2W0XA 3FHAA 3RWNA 1MS0A 2LM3A 2DYCA 1JZ7A 3VBFC 2LRPA 3FWEA 3JQXA 4OFGA 4CCNA 1NXMA 1LAJA 4F3JA 2WA4A 4LTAA 3PMEA 2AEZA 1W8WA 4I30A 1F9KA 4MXWB 4R4ZA 3GALA 5F2WA 5FBZA 5FZIA 4FQ4A 1IQDC 2XBO2 1SLTA 1W90A 2B46X 4I3PA 3TN93 5BNOC 1DF0A 4AVVA 5LA1A 3RZJA 5T5OA 4DRRA 1TVGA 4WM8B 4NRQA 5E89A 5L9BA 3AZXA 2VMHA 3O1RA 1GZWA 3CU7A 2EICA 1H1AA 1R092 5F3IA 3UGFA 4CDWC 2DVBA 1CAWB 3VD5A 2AUYA 2ZGQA 3OJBA 1DQ6A 4XF9A 2VUDA 4YZ1A 4RHV2 3BVCA 4IESA 2D6KA 4Y33A 5AVAA 5ABJC 5EIYB 4NR1A 4P9YA 3EHKA 1R081 4GH4A 3BUCA 4FSJA 1XNBA 4QGNA 4LLFA 1MVEA 4RR3A 4JGZA 4JDNA 3X29B 4KBBA 4H7LA 3BTXA 1RUH2 4PDWA 1S0GA 3KZ4C 4HT1T 4P02B 5D21A 3TNQA 3T2PA 1W06A 4Z92B 3THTA 5SV8A 3SISA 4B7EA 3IMNA 4W8JA 5FPUA 4ZHNA 4CU8A 1PMIA 1WMEA 2RMU2 5IUQA 3PJYA 5A7NA 3ZPOA 3KV9A 1Y4WA 4Q4V2 2DCJA 2X29A 3HT1A 3MDPA 2Y33A 5B4XA 3FMGA 2VG9A 2Y6KA 1F5FA 5H9PA 4C91A 3POWA 4LOTA 2RS51 3KCXA 5EJ1B 3WNXA 4XCAA 5HPOA 4OYUA 2Y26A 4MGIE 1GQGA 5F5AA 4XQ4A 4CEWC 3I59B 4LIVA 4S2FA 1JYCA 2VZSA 1NKGA 5H9QA 1SLLA 1BKZA 4AI2A 4Q27A 1VBC2 2HWF2 5HV4A 3UKNA 4AYUA 4E4ZA 2R072 4CCDA 5L7OC 3QLQA 2E9QA 1O5UA 1LTEA 1UL9A 1XE0A 4Z8BA 1HLCA 1OBNA 1XYNA 2NM1A 4K9SA 1IGOA 5GLVA 2VVFA 2YYOA 3WT3A 2R1DA 2VR4A 2CY6A 1FOD1 3GZTB 3Q8AA 2LUWA 5JZGC 2ZHNA 4M3CE 3VBFA 3NNMA 1VBB3 4D7YA 1UOGA 2VBBA 4I0AA 2P2KA 5CG9A 2V5YA 5IAXA 1YQ2A 4IEUA 2VQTA 1W2AX 2A6WA 2YPDA 1H6XA 5A7QA 4AI3A 4DPNA 3AK0A 2CU5A 5BNOA 4C90A 2D43A 1LOCA 3J7LA 2J1TA 2VBDA 3PVNA 3MIBA 3PU3A 4LKFA 3WR0A 1MQTB 5CA6A 1LHOA 4N53B 4OHZA 2C9KA 3BPSA 4HKOA 3AXDA 4CDWA 1EAH2 5J3UA 1V6NA 3ETPA 5C3OA 4AEJA 1RUNA 4JV4A 2BV4A 5ABJA 5FZFA 5T5LA 2CL2A 4FOYA 4CDUC 1SCSA 2HEVF 2XGXA 1P8JA 2BOJA 5FP4A 3ORJA 2A3WA 3K3OA 3KM5A 3NV2A 4WM8C 4DS0A 4Y1VA 4FOVA 5JPMB 4BDVB 1RUJ1 2K9ZA 5GLUA 5T52A 3SH3A 3DF0A 2WLQA 5HXMA 3KCCA 1JZ5A 4QAWA 4LO6B 2GNDA 4W4ZA 3VD9A 1UY3A 1QXPA 2GU9A 4D3WA 1R1ZA 1AJOA 5FXXA 4FBFA 2DVFA 4HN1A 4QPWA 5CISA 3UL2A 1YEWA 1YUDA 3CQOA 1RVF2 3ZSLA 3AKTA 4GQ7A 3ZIXA 1VIWB 4MGZE 4PIXA 4A4AA 5FZOB 2JKBA 1LHUA 2QCSB 5HXVA 2RJ2A 4BLJA 3AVRA 1N1SA 1XXNA 5A32A 3LF7A 3M7AA 4YVSC 1NY72 2HWD2 2P34A 2BGPA 3J8F3 5FQ0B 5FV3A 3ZSKA 4CEWA 2DWRA 5EZWA 2GMMA 3MW3A 4YG0A 3T2TA 5F5IA 5I8TA 2RVAA 5FXZA 2A3XA 4HANA 1UU6A 1AYM1 1W6QB 2VZVA 1VRBA 3N36A 4P5HA 4TZDA 2NP0A 3U4XA 5FKCA 2UURA 1KITA 4B4QA 5L7OA 1OUSA 2DVGA 1ENXA 1W6OA 3NWKA 1RUD1 5E8AA 2J1VA 4AVBA 4W6WA 4YGDA 4XUPA 1VBA3 1ENRA 4KMQA 1F31A 2JECA 3MZHA 2XVKA 5FPXA 1NLSA 3AKPA 5JZGA 1LODA 4LA2A 3O5SA 1KS4A 1AR63 5FYBA 1MVQA 3WDUA 4BK5A 4E8DA 5CEHA 5A1AA 1W3XA 2XL9A 1AVBA 2AGSA 2LS6A 4Q4Y1 1UKRA 4KU8A 4BOWA 5KXCA 2L9LA 2Z42A 4AZZA 4H55A 2ZPXA 4ZXKA 4BXFA 1ZRDA 5J36A 3PVEA 4W50A 3AC0A 2VQ0A 3MW4A 3S5QA 4JHZA 2GMEA 4IGQA 2RS32 1JOJA 3KVAA 2YDEA 3I2GA 4I02A 1W9TA 2OS2A 1AL0G 1D4M3 2GC2A 2RDSA 1KD7A 2R1BA 3OGRA 4MXWA 4UI9L 1W03A 3IWZA 1S0DA 2XBO1 2VMGA 2QUOA 2X09A 4CDUA 5LW9A 2HWC3 2I74A 4DIQA 2OVUA 4WM8A 4JX0A 1MQTC 2W2IA 2G9ZA 4MSVA 4N53C 5HCFA 1M06G 1R091 2XWJB 2ZEWA 5LBCA 2RM23 1CAWA 1JI6A 4GIQA 5A3TA 2R6QA 4NRPA 3ZYFA 3BB6A 4LLOA 4QKNA 1KFUL 1YQ8A 4RHV1 2ERFA 3AL6A 4K40A 1GQHA 4MGYE 3ZFFB 5JPNB 1O6UA 2JE9A 5FMCA 3Q9OA 4XJUA 2VXJA 3ITQA 1WW5A 2RDNA 2VTXA 2Q8OA 2W92A 5C71A 1RUC3 2Z69A 4BQ4A 1VAMA 2R30A 1RUH1 2VTXJ 1YIFA 1W8OA 3AYCA 4BWOA 3OSDA 1NCQB 1VMFA 1JXNA 5CFCB 2D3PA 3POSA 2R042 4YVSA 3OBZA 1H2MA 1GZTA 2WZEA 1G6NA 1AL23 3HMYA 2RMU1 2BW8A 3B02A 5JWPA 1W6NB 4Q4V1 5FKBA 3VZJA 1DQ4A 1D0HA 5DAQA 1J3QA 4GWNA 2ARAA 4UFMA 1HB4A 3IAPA 5DN2A 1ZBE3 2NZ9A 3J7NA 1OLRA 1YHFA 4Q0PA 4BMBA 4FI9A 4XURA 4ZS2A 3I7DA 5I8YA 2WSUA 2OQ7A 3NKGA 4MHUA 1DYPA 3VZLA 3VZMA 3IZOA 4AI8A 3URFA 3ME2A 4QT6A 1GSLA 3F2ZA 3MEPA 3J9SA 1BEV3 3GBGA 3POGA 1V9U3 4J6GA 1VBC1 2W87A 5GZGA 1SPPA 3HQRA 4IGOA 2XQRA 5FZCA 5JXIA 1PO22 4A7YA 4W65A 3D3AA 3LDBA 3TBDA 1OUXA 1AR71 2PYTA 4Q5OA 1Z7S2 4A6OA 3WP6A 5JUVA 1REDA 3CJXA 1NA1C 3QBQA 3GBWA 3S7IA 2WQ4A 4Q1PA 2VNOA 3IKWA 2ZGMA 1UD1A 1UXXX 2RDRA 2VMIA 3B69A 2D6MA 4Q4W3 4RGAA 3NNFA 5L9VA 5T3NA 3UT0A 4BPZA 4AFDA 3VV1A 5FCCA 1D0GA 2IXCA 2BU9A 2ARCA 4HKWA 1KGYA 2OT7A 4YVWC 3VKMA 1UYYA 1MQTA 4N53A 1LGCA 3WNLA 4O65A 4FPFA 3M8LA 4DQAA 1EAH1 2XQXA 3QD6A 1ULPA 3UKVA 1XU2A 2RS12 2A5ZA 4KWLA 2TEPA 5JDBA 4PIZA 5KC5A 2AH2A 2P1BA 2NMOA 4CCJA 5SV5A 3SKJE 1W6PB 4ATFA 1OA4A 1V0AA 4FXKB 4KBZA 4YLZA 2MNGA 5GALA 3JD71 1HB1A 3VHNA 3CHXA 1HRV2 2RE9A 3RMXA 1L3JA 2IXKA 3H3UA 3ZMNA 4CUCA 5A1FA 2FDHA 5CIRA 5FZ6A 4R4XA 4PI2A 2BGOA 5BV6A 5EYYA 1R083 5J98B 2EXHA 2UWBA 3OGSA 2BFUL 1XNDA 3USUB 2WZ8A 1ZBA2 1VR3A 3WY6A 3ZFFC 3DECA 3POJA 1ZNPA 1VB2A 3MICA 2VUJA 4OI1A 2SBAA 5B4NA 4HK8A 1POV1 1VBE2 4QDSA 2GZWA 5IVYA 1RVF1 1NG0A 3R6SA 1UOFA 5C5TA 4GAZA 1NCQC 5FZOA 4WBBA 3OY8B 5G04L 1JZ4A 2VCMA 2CAUA 4N43B 1CPMA 3CKHA 3P3NA 5FQ0A 1NY71 2HWD1 2ZKLA 5JXHA 5M0TA 4D7SA 4R8HA 2EIEA 4AQ6A 3BYWA 3HBZA 1OURA 3V56A 2VUAA 3ZVXA 4OCTA 2R062 1W6QA 5JI9A 2RS53 4Q29A 2QVSB 2B9VA 5FR3A 4PF1A 2Q8CA 1CN1A 5JMOA 1H9WA 4IV3B 1EUUA 3ZXDA 5F7UA 3E6DA 4QDRA 4JRAA 2A73B 2VZOA 1JMUB 2IWGB 3OUIA 5CYYA 3VN4A 1LOBA 3ZYBA 2P3KA 1NCRB 4GMP0 3P1IA 3EYPA 2VW1A 1QDCA 5FZ9A 1NA1A 3W5MA 4Q1RA 5GLZA 1YFUA 4L9BA 3ZSEA 3K4DA 5CZKA 2D6PA 1AXYA 1QJFA 1UAIA 2DDUA 4NHMA 1F5JA 3HD8B 4BQ3A 1FOD3 1ZVFA 4Q0QA 4XTPA 3A0NA 3M3IA 2ZACA 2DUOA 2P4EA 3HIFA 3K4ZA 2ZX4A 3SCHA 4AR2A 1WLTA 2RS31 3UV9A 1X9PA 3VDDB 5CBLA 4EYUA 3RYRA 3WV6A 1JHJA 2PAEA 2PHUA 3KT7A 1QOTA 4QU1A 3SKVA 2GMPA 5I0RA 1QWRA 3RJ2X 4DNYA 2BQPA 1BXHA 4XAEA 1S0JA 1GV9A 4E4HA 4P9GA 5AC91 3OG2A 3O0XA 4P9JA 3POIA 2BOIA 4DB5A 4F83A 5GZDA 3ON7A 4CUBA 4GA9A 5K4LA 2BDRA 4XF4A 4NIDA 1BVP1 2HWB2 1US3A 2FZ1A 3PHMA 4JDMA 3MF9A 2W95A 5A70A 3PUSA 5LEKA 4PLNA 4AK3A 4B3NA 4HPKB 2FHRA 2PHFA 4M01A 4XQWA 5E1RA 3ZFFA 1DGWX 1Z0HA 3LEIA 3UKTA 4OULA 1C1LA 1RUG2 2YHJA 4NN0A 4Q4X2 4AHXA 4XDPA 2DFBA 2R7EB 4XABA 1VE0A 5A33A 3ZMOA 2CGPA 1YWKA 2JG8B 4CPBD 3HT2A 2FMDA
chains in the Genus database with same CATH topology
1NCQA 3FUQA 3OPZA 1VB4A 1RUF3 2R041 4LR4A 3OF1A 2GSYA 2D5FA 3WOGA 1BMV2 4EROA 1W6NA 2VY0A 4PLOA 4RD7A 3VHOA 5IK8A 1H8TC 2WZR2 3NW4A 2XLGA 1J3PA 1MS4A 2QZ2A 2ET7A 2XLFA 3M3CA 4N43C 1UZYA 1PO12 3V0BB 1IS5A 3RS6A 1AYM3 5HI0A 1HRI3 2WIIB 4FPJA 3ZXLA 1YRZA 1UCXA 1RUD3 1RUOA 4MUVA 4XJAA 4LBNA 4IV3C 1B09A 3H1WA 3SITA 4LE3A 3GNEA 1LU2A 2XPJA 3B9CA 1PO21 2D98A 2I07B 4LE4A 4EV0A 3DV8A 5IT6A 1DGWA 3POYA 4Q4Y3 1LHVA 3VZOA 1SACA 2ZX1A 2KA3A 3RRDA 1XYOA 3I2DA 4UXAA 2ZGNA 3RPQA 1N1YA 5DUVA 2ZGRA 1DZTA 1LOFC 1V6LA 4JTOA 3B9IA 3TYJA 2XBO3 4AVSA 3H1YA 5FLJA 3CL1A 5EJ3A 4AEKA 1SQ4A 5IK4A 1W6PA 4K21A 1HIXA 5C8CC 4HVOA 5DXDA 5JOYA 4BLIA 1R093 2VQAA 4YZ5A 2R32A 3WHUA 1SDWA 4AVCA 1APNA 1PM7A 1ZRRA 4NWVA 4RHV3 3VBFB 4YSFA 1IHMA 2FMYA 3LA3A 5DDJ2 5J96B 3USUA 1DQ1A 2XJPA 1ZBA1 5D1IA 1AR91 4SLIA 3H7JA 1RUH3 5BNOB 2ET1A 1CAUB 4RA0A 1VBE1 3IN9A 2JG8C 3IT8A 2XH6A 2Q30A 5BPXA 4AGVA 1LESA 3OD4A 2D3RA 2IXIA 1QNWA 2RMU3 3VKLA 4CDWB 4CP1A 4N43A 3VL8A 5DUWA 4Q4V3 5EWSA 5ABJB 3AMMA 4DXZA 2R061 3N7JA 4A7KA 4IV3A 3E5UA 1QKQA 1ZZ6A 1U0AA 1RUJ2 4YRDA 3U07A 3BTAA 4W6XA 1C5HA 1EP0A 1FYUA 2EF6A 4H7MA 4XFAA 1WCKA 3VHPA 4YG3A 1LHWA 3WP4A 4GXLA 4AEMA 3NAPC 5F5QA 3E97A 1VBC3 2HWF3 4E4DX 1QOOA 2R073 5FLHA 4OVEA 4RFT0 4FXGB 2A70A 4WM7C 4K7JA 1S1AA 1QXJA 1FPN2 3KGZA 1FATA 4FCAA 1UZZA 2YGLA 1U5IA 4YW1A 1UX6A 1ZRFA 1OA3A 1LOFA 1HV1A 3HN1A 4XBQA 1C5IA 5LRSA 4HVQA 2ENRA 5CADA 1H1MA 4XBNA 4WZCA 2ZGOA 4OHWA 5C8CA 4H3WA 3M3QA 1NLRA 1EAH3 1ONAA 4FPHA 3AMPA 2VOKA 5DZGA 1H8VA 4COUA 2HWB1 2B9UA 3B5LB 3RI9A 2G9GA 4HPKA 1Z78A 2OPKA 2AR6A 1PZ8A 4Q4X1 2QQPA 1GNHA 3ZSJA 2BVVA 4K6BA 2JG8A 1JH5A 1URXA 4QPYA 2DTWA 4X6RB 5EYXA 3SH4A 1DYKA 2XLAA 3WDXA 1BK1A 1F2NA 4IL7A 1NXD1 4PBOA 1RVF3 3AB0A 3M1HA 1AR82 3QH6A 4CDUB 4DINB 1BMV1 5GZFA 5JIUA 1PK6B 5EFUA 2WZR1 3FLTA 3M4FA 2HWD3 4HFSA 1UN1A 3V0BA 1PO11 2R16A 4QQPA 3NAPA 2ZGUA 2WFPA 3ZXKA 2UYBA 1HX6A 3B00A 1COV1 1U5XA 4KG0A 5IK7A 4HLTA 4WM7A 1UU5A 3CLPA 3PVBB 1ULGA 5KWRA 1WUVA 2PHXA 4EWAA 3WW1A 3EJKA 4YVSB 4XF1A 3U11A 4WVZA 2X5IB 4GB32 1R1A2 3MIDA 4QPGB 4S2HA 1YYNA 2WWSA 3N4MA 1MS1A 2QJVA 2VOWA 3BOPA 1RTVA 4TWTA 3FX3A 1KFXL 1J3RA 2RS33 4XE9A 2ETEA 3WUCA 2ZMKA 2C9AA 2A3YA 4AQ2A 4AHWA 3OD0A 3IDCB 2AENA 4IV1B 5I93A 4FQZA 1QHDA 1ZA4A 5GLWA 3MIHA 4GALA 5FO8B 2OUJA 4XMAA 4BE3A 2WT1A 2VOVA 1QQP2 1G9BA 2ZJCA 1AR72 4ES9A 2WFF1 3ATGA 3O0VA 1HKDA 5KBFA 1Q5OA 2ZAHA 3ZN6B 5DDJ1 1O4ZA 3DGTA 4WVMA 3VKOA 1WW6A 3D0JA 4P9IA 5J7MA 3ES4A 5FDBA 3CNAA 4WV8A 1CAUA 1Q8VA 4XMIA 5DG1A 3ZDSA 2R043 3WINE 1IKQA 1RIRA 2IXHA 2X53S 2YZ4A 4HKLA 1DZRA 2OYZA 1C3HA 4CZSA 3H8UA 2XHKA 4KWKA 1PK6C 3JD72 5BNQA 4KU7A 4NWWA 4PJYA 4XETA 2XJVA 3JB4C 4XTMA 1V6OA 4IEXA 4HMZA 5KHKA 2IFRA 1NYWA 2XWBB 1BVVA 4FTSA 1TNFA 5FOJB 1LKNA 2ARXA 3LKJA 3CEWA 4UBHA 1LHNA 5JOWA 2D6NA 1CESA 4X8PA 4C1WA 1PZ7A 3VKNA 2D6LX 1PO23 2B39A 1FPN1 3BOWA 5C8WA 1GANA 5H9SA 4QQLA 4S2GA 3LCPA 1Z7S3 2HEYF 3GF6A 4OUMA 2PLV2 1BQPA 4J1XA 4ZU5A 2Q4SA 1Q8QA 1QJU2 4QHBA 4OHYA 4UW4A 5K9YA 2X5IC 2Y38A 4QPGC 3OTFA 1LB2A 4YZ4A 3WZ1A 3ELNA 2DCZA 3SNMA 4LEJA 4XOGA 3FLPA 3O12A 1JUHA 3RYKA 3EXUA 3P3PA 4YW4A 2VECA 4XFIA 3LWCA 2F6BA 3EO6A 5C33A 2K2SA 2RS13 3WP3A 3AP4A 2YPJA 2WJSA 1W6MA 4LBOA 2GNBA 2Q1MA 1NA1B 3RG0A 1ND3B 4ZU7A 4IV1C 5I8SA 1UPSA 4LNVA 1QMJA 1HRV3 4CYDA 1QF3A 1SLIA 1TME2 4Y1YA 4B8EA 3NL1A 3FUOA 2BNOA 4GWMA 4YVWB 1AYN2 1BZWA 1PHMA 3B93A 4N9HA 2Q0AA 3U10A 2W68A 4IEQA 4AGGA 1U5YA 1ZBA3 1G8WA 1WMDA 3MFCA 1CQ9A 4AFBA 1VBE3 3BU7A 3V0AA 2ZGTA 3RDIA 1AR81 2LTNA 1XQNA 1PK6A 4TSVA 5AC92 1OFSA 2WKKA 1X33A 4LO4B 3USSA 1FT9A 1YO8A 1Q8PA 1AX1A 2CWMA 3UJQA 4B29A 1IOAA 2PHTA 2R063 4Y5Z0 1HQNA 3WG2A 4FP2A 3RSJA 2EA7A 4P9XA 2O8OA 5GM0A 1RUI2 3S7IA 1QH7A 3ECQA 2H0BA 5FRAA 1AXZA 2AYHA 2VW0A 1KJLA 3ZYGA 3ES1A 4G9SB 4CDXC 4AW7A 3JCIA 1IS3A 4Z2WA 5A33B 1RITA 1YXWA 1QH6A 2JDZA 2H6BA 3NJZA 2OW4A 3KS7A 3HWJA 1ZZ7A 1FX5A 1SCRA 2A6YA 4MLOA 4EN6B 2X5IA 3AFKA 3AP5A 4GB31 4XF3A 1R1A1 4QPGA 2PN5A 2XJTA 2GN3A 4LO7A 5T5PA 4IEPA 5JSPA 3ENRA 3JBG2 4FPEA 1FNZA 2BGCA 2XVGA 3M70A 5LK5A 3WG3A 4O9GA 1AUYA 1OFNA 2EXJA 4K1YA 3AP7A 5KXBA 4XHBA 1WLWA 5F6LB 2X8KA 4AFAA 3IDBB 2BPA2 4IV1A 1PVXA 2ZTNA 4YZ2A 2IFWA 3UJOA 4XFHA 3ILRA 3J4UH 2ZABA 4NVPA 3AZYA 4LUMA 5CG8A 1WLCA 1QQP1 1LCLA 2HWB3 3PLQA 3ZYPA 2JG9C 3JU9A 3ZN6A 1ND3C 1CJDA 4Q4X3 1RUG3 4SBVA 5KHHA 3OGGA 3NV4A 4AHYA 3ZPYA 3IM0A 3C3VA 1I3HA 1ENSA 3AP9A 1QJY2 5GLTA 3DL3A 2FQPA 2VW2A 4WZFA 2PHRA 5C4WB 1OLQA 1V6JA 1WBFA 3AMNA 4FPGA 4G3YC 4A3XA 1Y43B 2WZR3 3EBRA 4IEOA 1S2KA 2W08A 3N35A 2YMZA 5DUUA 2AREA 3FC0A 1LULA 3W59A 3WVJA 4QD2A 4CDXA 3MGUA 4JGYC 2QKDA 3WDYA 2CAVA 1PO13 4KGGA 2ZX2A 1WD4A 1V6KA 3AXEA 3MIGA 4V1PA 5C9AC 1PGW2 2WNVB 4META 1QGLA 5BNPB 1TMF1 4KGQA 2GN7A 2UYAA 3ASIA 3D8CA 3SMHA 1AR92 4W6YA 1ZZ9A 3AZZA 4R52A 1GNZA 4XZPA 2HKXA 2V73A 1QXRA 4XEZA 1H8TB 2ZAAA 3VKFC 4FPCA 3ZXGA 2GH2A 2BNMA 2CWSA 2PLV1 1O3QA 2AZ5A 3VBOB 1QJU1 4QX5A 4OI4A 1HQLA 3AP6A 4A7ZA 1WA4A 4JCKA 1GZCA 1GZ9A 4K1ZA 2ATFA 2DU1A 5F9TA 2LALA 1RGSA 5BNNB 5FREA 1TEIA 1YCIA 1DHKB 3TN91 1QJX2 5JOZA 1X8EA 4PCRA 4Y26A 4AGRA 2JG9A 2PHLA 4JDOA 1ND3A 4AI0A 1X50A 4FTBA 1XU1A 2VVDA 3SH5A 4Y1UA 1LOEA 1H1IA 4LBJA 1H4HA 1TME1 1BCXA 1WD3A 1KJRA 1AZDA 3IBMA 4YVWA 4GKYA 1AYN1 3CJIB 3WLUA 4IEYA 1I6XA 2I45A 4LUKA 3AYAA 3MIEA 3SCFA 1V70A 3MLLA 2DF7A 3R4SA 1ULDA 3SHRA 2P37A 5C8CB 5IK5A 1O7FA 4LBQD 4XFGA 3R05A 3WDWA 3PMSA 4M3CF 1SLAA 4URTA 4JGYA 5LRRA 3VUOA 4MX3A 1MZ5A 1NOVA 2A6VA 4IXLA 5C4WC 1I1EA 1Q56A 3NV1A 2BYVE 5HCAA 5FPZA 4CRQA 2ZX3A 1OHFA 4I09A 1FMD2 4R9DA 3SXWA 3MPPG 1RUI1 5I0TA 5I0UA 1RUJ3 3TRSB 2FBEA 3VGIA 2DU0A 4OZXA 5AFBA 2Z5WA 5FO9B 3VBSC 1S0BA 4QQ2A 4KG8A 1C8M2 2WNVC 5BNPC 2DURA 3ZXAC 2VPVA 5AVPA 1MACA 4LT5A 5DG2A 1FPN3 3WW4A 2O1QA 3G6JB 5KXDA 2B8MA 4P9WA 4YYOA 1XYPA 3RNSA 3ETQA 4QM9A 1OI6A 3JBG1 4MV2A 4AQTA 1H0BA 2GAUA 4LHNA 4DY5A 2ILMA 1C8NA 1OKQA 3ZXFA 4YM0A 3WHTA 3VBOC 4LBQA 2MEV2 1C1FA 3NAPB 1COV2 4E2QA 2WLPA 1A8MA 3LSDA 4AF9A 4WM7B 4MH0E 3T1MA 4CEYB 1W0OA 4EN0A 3N7KA 3FHIB 5E16A 5BNNC 5JI7A 1AXKA 1D4VB 1N1VA 2G4IA 5T54A 3FJSA 4XHXA 1WW4A 1LEDA 4IETA 2VOXA 1FNYA 3MYXA 2KM2A 3VHRA 3QOPA 1GFF2 4HK9A 2NN8A 4XJ8A 1S55A 3FFZA 1OQ1A 2OZJA 3AFGA 2C5DA 1QJY1 2WQZC 3DKWA 3CJIC 1JBCA 4Q0UA 1TQ5A 3L2HA 4XBLA 1AR83 5C4WA 2DFCA 4AVAA 2D7FA 3ALQA 5H9RA 4MZUA 1JYIA 2DCTA 1LU1A 5CU1A 3BIWE 1XRUA 4AFCA 4MGKE 4NHKA 3UK9A 3VBSA 2HWE2 4DMIA 4A2UA 3H0OA 3M2MA 2WFF2 1J59A 3BCWA 1PGW1 2WNVA 4Y22A 3S6PA 5BNPA 1CAVB 2W39A 5HBAA 1ULCA 4FTEA 4WVMB 3R4DB 2YY1A 4L8QA 1UKGA 3B94A 3WUDA 2XJRA 1RJ7A 4YFWA 1MEC2 4BIFA 4YARA 1EPWA 1AR61 5JIAA 3OGJA 2WT0A 2E63A 1H8TA 2WNEA 1DU3D 3B7MA 4TYSA 4GMP1 3HQXA 1N1TA 4GB33 1R1A3 4QXKA 3VBOA 2BBVA 1RHI2 5GKAC 1G7YA 1YFWA 1UW8A 2BEOA 1JHNA 3LOBA 4EWDA 1A3KA 2WA3A 3VLBB 2PAKA 1D4M1 1MZEA 2WNUB 2HEWF 4OI2A 5BNNA 2P17A 3N7LA 3AYDA 1REEA 1AJKA 1C57A 4EN9B 1S0EA 1QJX1 1PGSA 1VAVA 4NHLA 1VALA 2HWC1 5L36A 4LO5B 3FZ3A 3I54A 1RUE2 1KDMA 2GNTA 2ZCWA 1KDKA 4QPIC 1EYBA 4CEYC 1QQP3 3G7DA 1DQ0A 3BPZA 4HBNA 3TNPB 1AR73 3ZFEC 4S2DA 2V09A 5K0UC 5J48A 1AF9A 3CJIA 3GZAA 1RUC1 5JSRA 1HQWA 1GBGA 1PVC2 1YLLA 1OPMA 2KXLA 2BWAA 1PNGA 2VGDA 5FFOC 5C6CA 1N3OA 3LAGA 3LSEA 1PGL2 4RR3C 1U12A 1O5LA 1ENQA 5FMOS 4PBPA 1BBT2 4M0HA 4M3CA 4XXAA 3ACLA 3WG1A 3FLRA 1W6MB 1NQDA 4BZ4A 3VZKA 1CAXB 1VRH2 3JD73 1FMD1 4KQ7A 3ROUA 4QGMA 3WG4A 4YM1A 3MF6A 1ASJ2 1C28A 1QOSA 2P3IA 2EXKA 5GJ6A 2ZHMA 4KL1A 1C8M1 2NQYA 3H50A 2D6OX 1KS5A 2ZZQA 4FPKA 4TLFA 1ZX5A 1POV3 1UU4A 5ACA2 1ZZBA 1OSGA 3V0AB 3H1MA 2Y0IA 5T5JA 3KCYA 1LECA 4COVA 4P9LA 2ARBA 3KB5A 4JVAA 2CV6A 2PLV3 1DDLA 2MHFA 3J26N 4HSLA 3I8TA 4XW3A 1VP6A 2NPIA 3B01A 4Q4W1 5GZEA 2PFWA 3IDEA 1G9FA 2MEV1 1UIKA 1IPKA 3ZFGB 1JTZX 1WLDA 4M0NA 2TNFA 4C1XA 5F1RA 4QPIA 4HSJA 3GBFA 3O7OA 4CEYA 3EQEA 2WNUC 1HV0A 2JE7A 1OD5A 4XIKA 4YG6A 1EY2A 3OYWA 3ZFEA 2E7QA 4X8NA 5K0UA 2HJIA 3D5OA 2Z2SB 5JCTA 4NOTA 3C2UA 4RGGA 1F8VA 1TME3 4ISQA 1B35C 4K8FA 4YGCA 2UWCA 1AYN3 1JUIA 2RR12 1W2UA 5L19A 4DRVA 4B4RA 1O3SA 1IS4A 1UF2C 1LEMA 4OUSA 2B42B 4E27A 3WQ0A 2WS92 1SEFA 4MXVA 3MLJA 3VL9A 3WQ7A 1DGLA 4FPLA 3THPA 3FFQA 2EVXA 4U2AA 1M4WA 3FBYA 5AC93 2UU8A 1SBFA 1LRHA 2A6ZA 2TUNA 5B2GB 1D2QA 3E5XA 3R4UA 4QMAA 1IS6A 1K5MC 2HWE1 4PIYA 4Y20B 1QU0A 2WL1A 4QQHA 4XJZA 4Q8LA 1CAVA 4YW3A 3ST7A 1RUI3 3VBUB 1GICA 4GULA 1RMU2 5AFEA 3ZYIB 1WW7A 4JAAA 1Q43A 1J58A 3I4IA 4EJRA 1HW5A 1MEC1 3NO8A 5JSOA 3VBRB 1LOGA 2WZPP 3OBTA 2JICA 1REFA 2GDFA 3AJZA 3TAYA 3WD5A 4DY3A 2CTVA 1TNRA 5BY5A 3W58A 1HXS2 4IEWA 1AHSA 1RHI1 3TB0A 2N7GA 1G9DA 3KLSA 3JBG3 4DZGA 2ZMLA 4CDXB 1HDKA 2WNUA 4ISRA 4Y1XA 3ZIWA 4E2SA 1YNAA 4OHVA 4BYYA 2XKOA 1DIWA 2CGNA 1TMF2 1CX4A 2JD4A 1V6MA 4MYEA 1VBD2 1EV12 3ZFGC 1RUE1 1PIV2 1D2SA 4LBMA 1H2NA 2GNMA 1S2BA 1UMZA 2WC2A 2GC0A 5BUVA 4BMEA 1B35A 3KD4A 3DPRB 3KGLA 4XQDA 3H3ZA 4EN7B 2XJSA 1KRIA 5HCBA 1XNKA 2Z79A 2ZA9A 4RS5B 5CB7A 4C0HA 1MS3A 4BH9A 3ILNA 2IC1A 4Q0VA 4COYA 1PVC1 4INDA 1A6CA 1LGBA 1V6IA 3KMHA 3AKQA 1RUF1 4B4PA 1QJY3 1PGL1 4AXOA 1OQDA 4LA3A 3TN92 5CVRA 4FP3A 1IKPA 3DN7A 1N3PA 4HETA 4JC1A 1CD3G 1BBT1 1MS9A 2ZMNA 1K5MA 4CP0A 1H4GA 2JG9B 3N7MA 2E6VA 1MZ6A 1BYHA 4BA6A 1ND2B 3AMQA 3PTYA 4IERA 1CAXA 1VRH1 2H0VA 2RJLA 1ULFA 4L97A 1MZFA 2DCKA 5CFDB 4PF5A 1SBEA 1HRI1 2D5HA 2VVEA 5JAXA 2VXRA 5L73A 1ULEA 3QCWA 1ASJ1 1POV0 5T50A 2Y0OA 4OLLA 2XJQA 3RMYA 4AE2A 3WDVA 1AR93 3VBUC 2ZBJA 4FOQA 1KQRA 2D3SA 3V65A 5ACA1 3NVCA 5CNAA 3QH7A 4GMP3 5DZEA 3VBRC 3AZWA 3WCRA 4FAGA 5J37A 2ZX0A 1G9CA 1IQAA 4JGYB 1OPOA 1QDOA 4XIOA 5C9AB 3K51A 1YI7A 5A3MA 4L11A 4R9CA 2ZGLA 4BIOA 1CVNA 1A78A 2F4PA 5GZCA 3ZFGA 2ZGPA 4QM8A 1YJKA 2UY9A 1G9AA 2OZ6A 4F8AA 3MFAA 1QJX3 2XJUA 1DFQA 3L2YA 4ONUA 2GC1A 3MLKA 2FZ2A 3WXPA 3AZVA 4N9IA 4I2OA 2MPFA 4FPOB 3RQ0A 1H2LA 4BCUA 3KT4A 4ASMB 1RINA 3QACA 3GYDA 2R0HA 1LGNA 2PTMA 1RL3A 3E6BA 4XFFA 2QFEA 1XE7A 1VBB2 2ZGSA 4CTEA 3E5QA 3DPRC 1WBLA 2RR11 2VU9A 5BYNA 4AEDB 3RYPA 4XFBA 4YW2A 2E53A 2OIIA 4RS5C 2Q5TA 4LBQB 1H9PA 3JB8A 2WS91 4L2NA 2XUMA 4M00A 2VNRA 2JENA 3LB9A 5KC6A 1E57A 5JLVA 1S0CA 1OA2A 4XJWA 5KHGA 1X8MA 3S7EA 4YNIA 1W0PA 2YROA 3LA2A 1GLHA 3ZSMA 4BHPA 3LZZA 1CONA 4Q8KA 1GKBA 3BALA 3CF6E 4Y20A 1GR3A 2B7YA 4Z1VA 1FMD3 1ND2C 2DUQA 3I59A 3VBUA 1RMU1 1TE1B 5CFDC 1U5ZA 2ZHKA 3OCPA 2HWF1 4LO8A 2GH8A 2YC0A 1UIJA 2R071 3VBRA 3APBA 1C8M3 4MVTA 3AX4A 1PNFA 5FO7B 3MW2A 2NYYA 4K20A 4B7KA 4XDQA 1SLBA 3WX5A 3WW2A 2PQQA 1HXS1 2TBVA 2BFUS 3D6EA 3VZNA 3SCGA 4Y1ZA 4QQOA 5E88A 2I2SA 3J8F2 1NE4A 2CNAA 3OBRA 3NV3A 1O91A