5C8CA

Crystal structure of recombinant coxsackievirus a16 capsid
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
297
structure length
259
Chain Sequence
GDPIADMLQVLPTAANTEASSDKNLIETRCVLNHHSTQETAIGNFFSRAGLVSIITMPTTGTQNTDGYVNWDIDLMGYAQLRRKCELFTYMRFDAEFTFVVAKPNGELVPQLLQYMYVPPGAPKPTSRDSFAWQTATNPSVFVKMTDPPAQVSVPFMSPASAYQWFYDGYPTFGEHLQANDLDYGQCPNNMMGTFSIRTVGTEKSPHSITLRVYMRIKHVRAWIPRPLRNQPYLFKTNPNYKGNDIKCTSTSRDKITTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords VP1
publication title Structures of Coxsackievirus A16 Capsids with Native Antigenicity: Implications for Particle Expansion, Receptor Binding, and Immunogenicity.
pubmed doi rcsb
source organism Coxsackievirus a16 (strain tainan/5079/98)
total genus 45
structure length 259
sequence length 297
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5c8cA00
1VBB3 4RR3B 3ZFGB 5CFDA 4SBVA 3VBOC 4RHV2 4FTSA 1EV11 2RS11 1VBB1 1E57A 3VBHC 5ABJB 1ZBE2 1PGW2 2R063 2HWB2 5DDJ2 1R092 5C4WB 4Q4Y2 1BEV1 1HRI3 4JGZC 2R043 1VB2A 2HWC2 4Q4V3 1HRI1 1W39A 1AR83 2RM22 4JGYC 1RUI2 1AR93 1AL21 3VDDB 2R062 3ZXAC 4Q4V1 2FZ2A 1ASJ3 1AR91 4CDXA 1PGL1 1F8VA 1PVC3 1HRV2 1RUF1 3JB8A 2HWD3 1AR61 1QJX1 5C8CB 1QQP3 3VBHA 1RMU3 1VBD2 5AC93 2RS32 1COV2 2WWSA 1MEC1 1NCQA 1VRH3 1R1A3 1PO22 4GMP3 1HXS1 5CFCC 1VRH1 1RUG1 1ZBA2 4PDWA 4JGZA 2HWD2 2XBO1 2DF7A 4Y5Z0 5BNNA 3CJIA 4CEWA 4JGYA 5AC92 4CEYC 4FSJA 1HX6A 1R1A2 2R073 2VQ0A 4IV1C 5C9AC 5A32B 1NG0A 2WFF3 2R071 1H8TB 4YVSA 2PLV3 1QJU1 4Z92B 1PIV1 5ABJA 1ND2C 1V9U3 1BMV1 3J8F3 4Q4W1 1BBT1 4AEDC 5BNOC 1POV1 1RUJ2 2RS53 2RMU3 4Y4YA 2PLV2 1AYN1 1VBA2 2HWF2 1RUH1 1RUD3 1V9U2 5ACA3 1VBC1 3J8F2 4CEYA 1C8M3 1R082 3JD73 5D8AC 1NCRA 4WM7C 3ZFEB 4CDWB 1PO13 1NA1C 4RS5B 3NAPC 1FMD3 1PO11 1RUD2 2GSYA 1RUC3 1EAH3 1IHMA 1CJDA 5C8CA 1AUYA 1QJZA 1RHI1 1C8M2 3TN91 1D4M1 4N43B 3JD72 4RQPB 1AR72 4Q4X3 2RR13 4GB33 5FOJB 2HWE3 1RVF3 4Q4X1 1GFF2 1RUC2 4QPIA 5K0UB 1QJY3 1OOPA 1SMVA 3VBRA 1B35A 1TMF2 2RR12 1ND3B 3VBOB 4GB32 2BBVA 1NA1A 1Z7S3 2HWE2 4QPGB 4CDXC 4GMP0 4N53A 1X36A 1EV13 1Z7S1 2RS13 4IV3C 2MEV2 3VBFA 3DPRB 1QJY2 1AYM1 2FZ1A 2WZR2 1FPN2 3S6PA 1MQTA 5JZGC 4YVWA 2WS91 1BEV3 1NCQC 3LOBA 1EV12 1CD3G 1VBB2 2X5IA 4PDWC 1AL23 5BNNC 3CJIC 4CEWC 1BEV2 3ZFEA 4Q4Y1 4GH4A 1RB8G 5A33A 1FOD3 1HQNA 1NY72 1RUF3 2HWC1 1AR63 1HRI2 2R042 4IV3A 3ZFGC 4YVSC 1QJX3 1FOD1 1DDLA 2RM21 4WM8B 4Q4V2 1AR82 4RFT0 5ABJC 5CFCB 3ZFFB 1AR92 1MEC3 4RQPA 5LK7B 1HXS3 1VB4A 5JZGA 1ASJ2 1RUG3 5C4WC 1RUF2 1HRV1 4NWWA 1RUE1 3FBMA 1PVC2 1QJX2 2XBO3 1VBD1 2RS31 4IV1B 1MEC2 1COV1 1QQP2 1K5MB 5C9AB 1RMU2 3VBSA 1PO21 4CDUB 4FTEA 1ND3A 2ZZQA 1VRH2 1RUG2 5L7OA 1NCRC 1ZBA1 1QJU3 1ND2B 4RR3A 1PIV3 3ZFGA 3DPRA 4AEDB 5BNOB 2BUKA 5C8CC 4Q4W3 1BBT3 2GH8A 1POV3 2R072 3JBG1 5C4WA 1AYN3 2WFF2 3IDEA 1RUH3 4WM7B 1VBC3 1BMV2 4Q4W2 3NAPB 4QPIC 5BNPB 1OOPC 3M8LA 3VDDA 3VBRC 1B35C 1RUJ1 5CFDB 1AYN2 4CDQB 1VBA1 2HWF1 2RMU2 2RS52 1H8TC 4N53C 4WM8A 1RHI3 3VBFC 3TN93 5J98B 1D4M3 3ZFFA 5ACA2 5GKAC 1R081 1MQTC 4YVWC 1PO12 1TME3 2BFUL 1FMD2 1VBE3 1TME1 1EAH2 1VBE1 2X5IC 3VBUB 1AR71 4CDUA 4Q4X2 3ZFEC 4CDWC 4GH4C 5A32A 1RVF2 1H8TA 3VBHB 1AYM3 1NCQB 1TMF1 2WS93 4RQPC 4PDWB 4JGZB 2BPA2 1Z7S2 2MEV1 4CEWB 4JGYB 1AYM2 2RS12 4RHV1 1ZBE3 2WZR1 1FPN1 1X33A 2HWB3 1F2NA 5BNPA 1ZBE1 1PGW1 4Q4Y3 2Y26A 3VBSC 2HWB1 5DDJ1 1C8NA 4YVSB 1ND3C 1R091 4CDWA 4CDQA 1POV0 2HWC3 4RS5A 5L7OC 4QPGC 2RM23 1RUI3 4RR3C 3DPRC 1AL22 1RUI1 2BFUS 2R061 4N43A 1NY71 1HRV3 1PGL2 1RUE3 4FTBA 4NWVA 1FOD2 2R041 4CEYB 1AR62 1VBD3 3VBUA 2RS33 1AR81 1COV3 5K0UA 1NCRB 1PO23 4BCUA 1HXS2 1ASJ1 3VDDC 1ZBA3 1RUE2 1A6CA 3VBOA 1PVC1 1OHFA 4QPGA 2QQPA 2XBO2 2HWD1 1QQP1 1AL0G 1RMU1 2ZAHA 4WM8C 5AC91 3ZFFC 1R1A1 4GMP1 1WCDJ 3JBG3 4QPIB 5FMOL 1QJU2 1OOPB 3VBRB 1PIV2 1NOVA 1B35B 5D8AB 5J96B 3HAGA 1NA1B 1K5MC 1BBT2 1RUJ3 3JBG2 4LLFA 4N53B 4CDUC 1VBA3 2HWF3 2WFF1 3VBFB 2PLV1 1RUH2 1MQTB 1VBC2 4YVWB 1R083 1V9U1 2TBVA 3J8F1 5CFCA 2ZTNA 2X5IB 2RS51 2RMU1 1VAKA 3JB4C 1RUD1 1RHI2 2XPJA 1AR73 5ACA1 3TN92 4GH4B 1D4M2 1C8M1 4IV1A 5C9AA 1K5MA 5BNPC 3JD71 5A33B 4CDXB 1FMD1 1OPOA 4IV3B 5CFDC 1TME2 4CDQC 1VBE2 2IZWA 4RS5C 1RUC1 1EAH1 1ND2A 4AEDA 5JZGB 1TMF3 5BNOA 4EJRA 5FMOS 2RR11 4N43C 4GB31 2HWE1 1RVF1 2MEV3 2WLPA 4RHV3 2WZR3 1FPN3 5BNNB 3CJIB 3VBSB 1M06G 1QJY1 5D8AA 4WM7A 3VBUC 3NAPA 5K0UC 5L7OB 2WS92 5DDJ3 1R093
chains in the Genus database with same CATH superfamily
1VBB3 4CXWA 3ZFGB 5CFDA 4SBVA 2E6VA 4MHRA 1U5XA 3VB9A 3GGLA 4ISQA 2RJLA 2VMCA 2W39A 1VBB1 4HFSA 1Y9MA 2VCMA 3POFA 1QH6A 3FBYA 2C5DA 1W2TA 3AYEA 4BH9A 2K9ZA 2QQVA 1UU5A 2R063 1UMZA 3FFQA 3WOGA 1NAEA 3DECA 1LOFC 3GCWA 4YSFA 3KQ4B 1MS9A 4AHZA 3LDRA 4GJYA 1SHWB 2HEWF 3IDAA 4L97A 1AR83 2ORXA 2RM22 1RUI2 2YC4A 4EN6B 5L9VA 2OQ7A 3ACIA 1PZ8A 2A3XA 4Q26A 4LO8A 5DUUA 2CGOA 2VY0A 1CR7A 1STMA 5I0TA 2ZHLA 4PBPA 3WNXA 2FZ2A 4KL1A 3P6BA 1PGL1 3WNMA 4CPBD 2OIIA 1ULCA 1UZ0A 1JZ2A 4X8NA 3WF2A 1LRHA 2J1RA 3NW4A 2R7EB 2DU0A 1JYVA 1UOJA 3NJVA 3I2JA 3TAYA 5LZ6A 4LO6B 3WW4A 1Q5OA 1RMU3 1V6JA 4FP2A 3R6SA 4CCKA 3EMRA 1COV2 4UBHA 2Z79A 3UKTA 4A2UA 1CVNA 1NCQA 2P3JA 1SLCA 1HXS1 4CU8A 1YQ5A 3X29B 5FY9A 4O7XA 4PDWA 3NMBA 4PF5A 3SEEA 2GU9A 1ZZBA 1QOTA 2VMEA 5FYHA 4D6SA 2DVDA 4Y5Z0 1ONAA 2PHTA 3AB0A 1UY1A 3USUB 1XB9A 1XYNA 4JGYA 4CEWA 1KS5A 4CEYC 5A7NA 1JOPA 3CU7A 1QDCA 1U12A 3CNAA 3KS7A 3LEIA 4BQXA 3BN6A 3GXUA 4LO7A 4R9CA 1K42A 2VQ0A 3HEIA 4XDOA 5A32B 1Y7BA 1PNGA 2YGLA 4X8PA 2VE1A 1XE0A 2EVXA 3J7HA 2VC9A 5C5UA 1Q8QA 3T4VA 3LWCA 3WNNA 1FATA 1V9U3 2OT7A 4OHWA 1BMV1 3H3ZA 2XB6C 3FN9A 5FLIA 4AEDC 5I0DA 1U5YA 3A0KA 3MGUA 4PQ9A 3F2ZA 1JOBA 3RFRA 3SH5A 3AMPA 4JZRA 1RUJ2 3ALQA 4WV8A 3ZX7A 4AWDA 1LECA 5FR3A 1AYN1 3AP6A 2QVSB 2Y6LA 4JHZA 1TQ5A 3ZYIB 2P3KA 1NLSA 5FWJA 3LSDA 3ZKUA 4NN0A 1CONA 1MZEA 3T0DA 1F35A 4QPWA 2G1MA 4JX0A 3V0AB 5CKNA 4KQ7A 4JTOA 4LBQD 3ZFEB 1W06A 4CDWB 1PO13 5KXBA 2WNVB 1NA1C 3SHRA 3E1F1 3CQOA 3OUJA 1CAXA 1UCXA 5CAZA 2VZVA 3AJYA 1PO11 1R64A 4HETA 1KGYA 1RUD2 4IL7A 4J25A 1RUC3 1FV3A 1EAH3 2XJQA 3AKQA 4Y22A 4XAAA 4CRQA 1ZRCA 4FPCA 1Z78A 1L7RA 4OHVA 5DG2A 5I93A 4XQWA 3E6CC 2D43A 1QNWA 1D4M1 3RYPA 4RQPB 3UYJA 4PCRA 1W8HA 3HD8B 4Q4X3 2NN8A 4CXYA 1JZ5A 4HT1T 3WUDA 1N1YA 1GP4A 4E4SA 1OD3A 4E8CA 1RVF3 3N3HA 4Q4X1 5B4XA 1DP0A 3VLBB 1UOFA 2UY9A 4QPIA 3BPZA 1FT9A 2VTFA 3N7JA 3BODA 2HJIA 4AVVA 4XJAA 1TMF2 1TG7A 2RR12 4JQRA 1ND3B 4OMDA 3MIHA 2EIEA 2Y8KA 1SLBA 4CU6A 1Z7S3 5IT6A 1XNBA 5B2GB 1BCXA 1DYOA 1SFYA 2DFCA 2JG8A 2AEYA 4GMP0 3UJOA 4E8DA 1YWKA 2VZTA 1EV13 3OF1A 1Z7S1 2CV6A 4L99A 3VBFA 2B46X 5FZ0A 3VHPA 5T54A 5M0TA 4M4RA 1OURA 4IUGA 5LBBA 1AYM1 2XVKA 1PX4A 3S5AA 3ES1A 1GOHA 4AFCA 3N4MA 3THTA 4AQ6A 4L92A 1IS3A 5JZGC 2WS91 5GLVA 1W6QA 2HLEA 2Z5WA 3M3OA 4IE4A 4LORA 1W8TA 3N7MA 5DAXA 4BDVB 3GHNA 2VNRA 3OSDA 4XMAA 4IEVA 5CKQA 4DPNA 2YFUA 1LR5A 2XUEA 3WVJA 2WZ8A 3LGRA 4P00B 5F3EA 5AFEA 1IG0A 4YG6A 3AJZA 3WP3A 3WNKA 3QBQA 1W9TA 2YBKA 3IT8A 4IESA 5IVYA 2BGCA 3CJIC 3ROUA 4MO3M 1BEV2 4DRRA 3RJ2X 1LEMA 3KLSA 4AAXA 3I3DA 3U07A 4ZZ8A 4LO5B 4BE3A 2H0BA 2CTVA 2PAMA 3RNSA 4FOYA 2YUEA 4Y1UA 3RG0A 2K2SA 5FMBA 2RM21 3UGHA 2XWJB 3K75B 2FCUA 3M4FA 1W9FA 4Q4V2 4W65A 5IUQA 1LKNA 4WVZA 4FPEA 4A7ZA 3WF0A 5CFCB 2B5HA 2ZAAA 2ZPXA 4LMFA 1TEIA 3MUY1 4HLTA 4UW6A 2GMMA 4E27A 4AFAA 1ASJ2 1XJAA 1Y9GA 2HYXA 3BU0A 1RUG3 1HQLA 1RUF2 3R0RA 5FO7B 1JYIA 1RTVA 3FBMA 1QJX2 2XBO3 2D93A 3S30A 3U4SA 3OGVA 1I1EA 2JG9B 5J37A 4MV2A 2Y60A 4XIOA 4JKLA 1COV1 1JODA 4BQYA 3VBSA 3LEKA 3MLJA 5FZ7A 5A7QA 3ZMOA 4AHYA 2JKBA 3I7DA 1HJFA 1V6KA 1VRH2 2FDFA 2VUCA 3J26N 4WVMA 5HPOA 3EYPA 2A3WA 1G6NA 2ES3A 2DTYA 3OGGA 3OBRA 4FOWA 1QJU3 2E32A 1ND2B 4KMQA 4Y3OA 4QQ2A 1J84A 2Q1ZB 3A22A 5KHKA 2BUKA 3D4KA 3RS6A 4Q4W3 2Z42A 5F6LB 3H3LA 1BBT3 5F39A 2GH8A 1TE1B 3LFIA 1WA4A 3O0XA 2BDRA 4YWAA 2R072 4LKSA 4CUCA 1JZ3A 3JBG1 4LOTA 2KA3A 3ZLIA 2WFF2 4LUMA 4DY5A 1X8MA 1ENRA 1NXD1 1YQ2A 3I54A 5C3OA 2Q0AA 1GMMA 3ZYRA 4MGQA 4FFIA 2AUYA 4H2AA 4OUSA 3KHBA 3NAPB 4CA9A 1J3PA 1OOPC 2F4LA 3M8LA 4K9SA 5T5OA 4MHUA 3VDDA 4UOJA 3P3PA 4JDMA 4XDQA 2GMPA 2Y6GA 3WDWA 3H8RA 1RUJ1 3WCRA 1XBFA 5J3UA 5L36A 5A1AA 3GJAA 2RMU2 1PM4A 1H8TC 2LUWA 1WCKA 5HCBA 5FYBA 1VAVA 1KRIA 3MLLA 3SC7X 1SPPB 5F6KA 1CN1A 1OF4A 3AP7A 3A4UA 1OQEA 3ZM8A 2JECA 1HW5A 4AI8A 4YVWC 4E4ZA 1DQ6A 3QLQA 1TME3 5L73A 1UXZA 1OVSA 4YNIA 1OLMA 3GYDA 1UYXA 2Q1MA 1TME1 4XF1A 2A3YA 2K46A 2X5IC 2ZMNA 2AREA 3THDA 3CKHA 1UL9A 2VZOA 3F95A 3AZYA 2A1XA 5CZKA 3LAGA 4DNYA 4YARA 3HMYA 3ACLA 2XLGA 4Q29A 3SKVA 4ASKA 3I8TA 2H0VA 2ZKNA 2X53S 3GBGA 4KU8A 2OZ6A 2GH2A 3S7EA 1KQRA 4AVAA 2DDUA 3MO4A 3RZMA 2VW0A 1WD4A 2NYYA 1DGRA 4UBGA 2WIIB 3OEAA 1O3RA 4UT5A 4XE9A 4Q27A 4HG6B 4EYUA 4LNVA 4ATFA 4BB3A 1TMF1 3ZSKA 4KI5M 2Y34A 2ZEYA 4NHLA 4QB1A 4D94A 3NJYA 3T30A 4G3YC 2BPA2 2WKKA 4UFIA 1HB1A 2BU9A 4IEPA 1GICA 2XJPA 1N47A 4R9DA 2RS12 4BLJA 4KWKA 3FX3A 3BCWA 4CXXA 3CDZB 5G05L 2HWB3 1F2NA 3ZYFA 4EZHA 5A6ZA 5BNPA 2WWUA 2W2IA 4BK5A 1ZRRA 4OUMA 4Q4Y3 2VOVA 2JDZA 2HWB1 3PUQA 2FBEA 1QXPA 4YVSB 1KFXL 2FDIA 1GQPA 4CDQA 1POV0 2XH6A 5AVAA 3RZGA 3H7JA 1W3VA 2D6LX 3OY8B 4LE3A 3NSTA 3AYDA 3Q8EA 1WW4A 2BWAA 5FUIA 1FX5A 3DPRC 1GZ9A 1W6PA 5F8PA 3VDCA 2PYTA 4CYDA 2J42A 3LEMA 1H4HA 4N43A 3POYA 1HRV3 4UYBA 2YV8A 1RUE3 1GNHA 5FV3A 3U78A 1FOD2 4WBBA 1AVBA 1J59A 3APBA 2UWCA 1KS4A 4CEYB 1AR62 1U5IA 4QM8A 4XUQA 2P6CA 3C7GA 4XUPA 1NCRB 4OVEA 4R9BA 5K0UA 4ISRA 4M3CE 4PIYA 4B3NA 1GBGA 1VIWB 1ASJ1 1F4HA 2PTMA 4O9EA 4OZOA 5C3PA 2Q8DA 1UU4A 2PAEA 1S1AA 1A6CA 4ORFA 4FFFA 4Y1ZA 1JUHA 2A6XA 4QAWA 1SDWA 3SXWA 2QQPA 3MICA 1ZA4A 2CAVA 2HYKA 3VD5A 1H2KA 4MZUA 5FZ4A 4I01A 1CAVB 2IFRA 4XVHA 2NMOA 5I0SA 3E6DA 2ET1A 1MZ6A 4H3WA 5EP9A 4IETA 2WL1A 1R1A1 2YZ4A 5F5IA 1HKDA 3PVEA 3B93A 2JJ6A 2RVAA 3NWKA 4INDA 2C4XA 4LOSA 4JQTA 5K7PA 1UO9A 2VBDA 3MBWA 2E31A 1OF3A 3HN3A 2D3RA 3M70A 3VBRB 1I9RA 2EXIA 4U2AA 5FZGA 2J1SA 1NOVA 3I2IA 1B35B 5JPNB 1BHGA 4XF4A 4HK8A 2WUHA 5DAQA 1NA1B 3MIDA 5FYVA 1ZX5A 2XKOA 4BA6A 2UWBA 3JUUA 2D3SA 2R30A 1VBA3 2HWF3 2WFF1 4KG8A 5IFTA 3PVBB 2PLV1 3KSCA 2ZHKA 3KGLA 3KV5A 5GLWA 3BKZA 4QQOA 1MQTB 3O1TA 3FLRA 3MYXA 5GZEA 1JYXA 4NIHA 1W9YA 3FE5A 3J8F1 2WT1A 2JD9A 1N3PA 4IEXA 3VD4A 5FZOA 5DQ0A 1J1LA 2UY8A 5EQUA 1YIFA 2GC3A 2RMU1 3VZOA 1VAKA 3LB9A 2ADDA 4QHZA 4K3UA 1WCSA 3ZXDA 5JMOA 1DQ0A 3FMGA 3RGBA 1WMDA 2VMHA 1AR73 5APAA 3TN92 1C8M1 3MW4A 4IV1A 5C9AA 4C91A 1K5MA 2VZPA 3HVDA 3JD71 4A3XA 2BP6A 4EV0A 1AXZA 4MUVA 3NNMA 1CQ9A 5LWBA 4UFJA 1GP5A 5CFDC 2WJSA 1DGRN 2DVAA 4OLLA 2X8KA 2WNVC 1O8SA 2AGSA 1GWLA 4HBNA 5E8AA 1QEXA 1IS5A 2DURA 1QU0A 5JZGB 5BNOA 2VQUA 1LTEA 1PK6B 5DN2A 5JXGA 4EJRA 1ZZ9A 5FOBB 4LE4A 1HN1A 4DOUA 1UN1A 3HR9A 4AL9A 4GB31 4BWOA 4R8HA 2O8OA 1XE7A 1S2BA 2OW4A 4NRPA 1HV0A 4ONUA 3KZ4C 1O5LA 3ITQA 4CTEA 2CGPA 3WNOA 1CPMA 2E7TA 1FPN3 2WZR3 3CJIB 4SLIA 2VVDA 1BZWA 1QJY1 5D8AA 3B69A 4ZS2A 3ZR5A 1ENQA 3T1MA 4NOTA 5L7OB 4AE2A 1CESA 1KJRA 4LK6A 5IWFA 1PM7A 3QH6A 2XDVA 4RR3B 2YGMA 1SLAA 2E63A 4PBOA 4RHV2 4YRDA 2RS11 4AXOA 3TEZA 3IBMA 3QD6A 5FYSA 3OYWB 5A1LA 5JOXA 1NE6A 2RDRA 3C7OA 2ARBA 1ZBE2 1PGW2 3I4IA 3EXUA 4JHTA 5JCTA 1ST8A 5DDJ2 1R092 1JW6A 4RL7A 1YHFA 3BVCA 3BOWA 5ACA2 4BXFA 4YM1A 3ASIA 1DIWA 1OQ1A 2CWSA 2R043 2XHNA 4XTPA 2IWGB 3GZEA 2HWC2 3D0JA 4XXPA 2W1UA 3MIFA 3OGSA 4V2WA 1ULGA 4GWIA 4JGYC 4HMZA 4PT6A 4QXBA 1ZZ7A 5C33A 2R062 3HJRA 3ZXAC 3MV11 1BVP1 5HBAA 4Q1PA 3MW2A 4LQRA 4CDXA 4CUGA 4YW7A 5AVPA 2QQWA 1F8VA 2PQSA 2VMIA 3MEPA 4XHBA 3S7IA 1HB2A 1QMJA 4XEZA 4CPBA 4K40A 4HN0A 2IFWA 2HWD3 1AR61 5KBFA 2WO1A 5CKMA 3ZPOA 2BZDA 2JE7A 5CIRA 5FYTA 3VBHA 5IVJA 1VBD2 3VD3A 2YMZA 4Q1RA 2RS32 5LBEA 3KT4A 5AC93 2ZEZA 5FP7A 3RI8A 1MEC1 1W6NB 2J1AA 4K20A 3ETPA 4DO0A 1W6MB 3W58A 5CFCC 2I2SA 2D5HA 4CUAA 4FPJA 1XNAA 1IPJA 2WO3A 4LHKA 4JGZA 5DG1A 4AI2A 5EPAA 1H2MA 5HI0A 2QZ3A 2UYBA 4D0QA 5IK5A 3WP6A 4QKNA 1QHDA 3Q8BA 1F4AA 4QXHA 4Z07A 3SCHA 3QCWA 1I5PA 2JG9C 4E9KA 1GUIA 3TNPB 4EQVA 4R4ZA 1JTZX 2D98A 3ON7A 5A3OA 4LBJA 4UFKA 1MPXA 1YNAA 5FQ0B 2C6SA 4PQQA 2IXKA 2VXRA 4YG0A 1A3KA 1H8TB 2YBSA 4COZA 2DBIA 3IKWA 4IEWA 4NR1A 4QB2A 4ATEA 2ZX1A 4QDSA 5GKAC 4LR4A 3HNYM 3LDBA 4H7MA 4XFFA 1ND2C 4QX2A 1C57A 2IUWA 3DKQA 1ODMA 4Q2FA 2FHRA 4FOVA 2WQZC 2NQYA 3B02A 1PZ7A 3POEA 2DVFA 4XPVA 2VULA 3BTAA 4Y4YA 3LE0A 4OFGA 2BERA 1URXA 1CJPA 2ZGNA 1TNRA 5FLHA 4CP9B 5GZFA 3TBDA 2WNUC 5JWPA 4BM8A 5FZ8A 5IJRA 4RD7A 1V9U2 3GALA 3I3EA 3O0WA 5ACA3 3N9LA 1UF2C 2ZX3A 5IVEA 1DF0A 1GWKA 1J58A 1Q8PA 3KV4A 2W92A 2VNGA 4RS5B 3NAPC 2OUHA 1RGSA 5JOZA 1ACCA 4YW6A 1WMFA 3NNJA 3PUHA 4M0NA 2WT2A 3GM8A 5FPZA 3WDXA 2Y0OA 1RITA 2WRAA 1Q43A 1SLIA 1CPNA 2CYFA 2PA7A 1QJZA 2ZGLA 1YJLA 3CMGA 2DU1A 5DZFA 5D2AA 2KD7A 2D97A 4Y5SA 2W95A 4W4ZA 3TN91 3VL9A 4PJYA 2R6QA 1ZYBA 1N1SA 2BNOA 3BTXA 1UKGA 3AMMA 5FZCA 1IGOA 5DXDA 4FPOB 5CEHA 3H50A 2HWE3 5FOJB 2ZXQA 3ZYBA 4E4HA 3BI3A 1DCSA 3POBA 1GFF2 5LATA 1RUC2 3RZHA 3KVAA 4LIUA 2JDHA 4RA0A 4IEUA 2VECA 2NZ9A 1H4GA 3E5QA 3USUA 4AVSA 2ID4A 1QDOA 1WLTA 4QU2A 4HXCA 3QACA 1WBLA 1VMHA 1ULDA 2BNMA 4MH0E 1HB3A 3VBOB 2XR4A 3SEPA 5IVVA 2EXHA 4IXLA 2ARAA 5IW0A 4A3ZA 3ZXLA 4N53A 3G6JB 3ZIXA 2XJTA 3AZVA 2MEV2 2B9UA 3OCPA 3DPRB 5C3SA 1DGLA 4NO4A 2FZ1A 3H7YA 2HEYF 5LA9A 5FXVA 3PU3A 4AI0A 4TWTA 1EY2A 5FZ1A 1PVXA 2PHUA 4E2SA 1YXWA 4FO9A 5FREA 5JAXA 1ZZ8A 3LOBA 1CWPA 3W59A 1DBNA 1EV12 2YROA 3WNPA 1UPIA 2ZGTA 3FJSA 3I3MA 1TNFA 2AR6A 1SFNA 1J3RA 1CZTA 4FQ4A 3TNQA 5KR7A 5BNNC 4FPYA 1JMUB 4CU7A 3H1WA 2F17A 3ZFEA 4GH4A 5FMCA 1WGPA 2A5ZA 3ZYPA 1RB8G 2FCVA 1NY72 2RE9A 3AYCA 4JRAA 2HWC1 5L9RA 2JE8A 1HRI2 5ANNA 5FAXA 2ORZA 1JBCA 4IV3A 1O4TA 3HPNA 4NRQA 4YVSC 5FPBA 4QQLA 1EUTA 4A41A 5FP3A 3KCCA 2J22A 2CU5A 5ABJC 2GALA 2DFBA 3AC0A 1AR92 5IYYA 1W6OB 4RQPA 2Q5TA 3ILNA 1HXS3 4GA9A 4XFGA 1OLME 4WVWA 1S4CA 2JD4A 2X10A 1S0JA 1X8EA 2BWCA 4FQZA 1JHJA 3ZKYA 4BIFA 5B4NA 5KC6A 2P1BA 1K5JA 4LHSA 5JSRA 1PVC2 4BISA 2PQQA 1WMEA 2VG9A 1A78A 1C1LA 4E2QA 1VBD1 2RS31 4LBQB 1QQP2 3CLPA 1JH5A 3MFAA 5CISA 2Y6JA 3SCGA 1ND3A 2CSGA 2FMYA 4M3CB 4QQHA 4MG2A 3VZKA 1RUG2 3PNAA 1NCRC 1VP6A 1XNKA 2XLAA 1XSRA 4ZU7A 3IWZA 1OFNA 3GZUC 1N1TA 4TZDA 1UZYA 4L8QA 3I3BA 2DV9A 4OCTA 1S0FA 3DGTA 2VZ1A 5C8CC 1B09A 2P17A 2BJSA 1V6NA 5E16A 3I2FA 2JE9A 1CAUA 5E88A 4JTNA 5JLVA 2SLIA 5EYYA 2ZS6B 5C4WA 2G19A 1AYN3 4W6XA 4QB6A 2E7QA 2ARXA 2E7AA 2FQPA 1ZRFA 2Q8EA 4YW2A 4WM7B 2XGXA 2AYHA 4GWJA 4QM9A 4Q4W2 4TN7A 3N35A 5FZ3A 1ULEA 4COYA 2A6VA 3VBRC 5BV6A 1BLZA 2WINB 4XMIA 1B35C 1W3XA 5CFDB 1DYPA 2VZQA 3SH4A 1O3QA 2J1UA 2RS52 5FY0A 1NLRA 4AEJA 3SCFA 2WWJA 3AKSA 5LEKA 1T6BX 1D4M3 5J98B 4DB5A 3ZN5A 2JICA 5D21A 2WO2A 4HANA 3PUSA 1MQTC 1V6IA 2OZJA 5FZ9A 1UWWA 4B4RA 3OBAA 2VBBA 1U0AA 5IHRA 4IEYA 5HV4A 3FUQA 3WHTA 2EIBA 1FMD2 4H7LA 4NHXA 1GU3A 1ZREA 1K12A 3T2OA 2MPFA 5DUWA 3BOPA 1W0OA 3ZDVA 2P6HA 4NAMA 1C3HA 1JXNA 4Y4RA 3T2PA 5FPAA 4LLOA 4FBFA 1ZZ6A 2C9KA 4QGLA 4AW7A 1YFYA 2ZGSA 4K8FA 1IQDC 3WT3A 3C2UA 5F3CA 2VD7A 1DQ4A 4MGSA 2ETEA 2Q30A 1V6MA 1XQNA 2KR2A 3RVHA 5JXJA 3K2OA 3U1XA 4CCNA 1AYM3 3JU9A 4CCOA 3B5LB 4UW5A 3T0BA 4COVA 1OPMA 1NCQB 3OUIA 3K46A 3KV6A 2FCTA 4NMIA 2BRTA 2OQ6A 2WS93 2ZHMA 4BMBA 1H6YA 1KITA 1UX7A 4XIKA 4PDWB 1YYNA 4LBMA 3BB6A 4PIZA 4WZFA 1ZZCA 2XXZA 3B9IA 5FP4A 1PK6C 1LOCA 2BV4A 2QUOA 3PJYA 2MEV1 4CEWB 4P5YA 4PI2A 4JGYB 4QX0A 2XONA 3M3EA 3ZXEA 3SQOA 2AZ5A 1KFUL 3H1YA 3IAPA 2W1WA 3Q8FA 2BOIA 4XQ4A 4XBQA 1OUXA 1RYYA 3FHAA 3AM2A 3Q9OA 3GCXA 3MF6A 4DQAA 5JI9A 3O1RA 4QHBA 1PMHX 3N9QA 4GULA 5JXIA 3H8OA 2JENA 5L7OC 5HCHA 2ZGKA 2XQRA 4BQ3A 1SBFA 2RM23 1RUI3 1EPWA 3CL1A 4RR3C 2VOXA 1X50A 4B7KA 1AL22 1KD7A 1RUI1 1F5FA 3WW1A 4YM2A 2BFUS 1Q8OA 2H6BA 1HLCA 3RMXA 1NY71 4UFMA 2EIGA 4YG3A 3TEWA 5F2SA 1M4WA 4UFHA 5FXXA 5FIXA 1WD3A 1W05A 3GBWA 1COV3 1RIRA 2ARCA 4XOGA 1XXNA 2W87A 3ZMNA 4ZY9A 3K4DA 1CIYA 5KHGA 5JI7A 4BCUA 2PFWA 3VKMA 1CAXB 4CP1A 1RUE2 1OBNA 4Y22B 1GOGA 1GSLA 3A23A 3E97A 1AX0A 4ARXA 2ZMLA 1PVC1 2Q8OA 3V64A 4AEKA 5T55A 4EN9B 5A6XA 5CA6A 4QPGA 1O3TA 5L9BA 3IDBB 1UPSA 3RZLA 3SLIA 3H9AA 3AXEA 3AL6A 1QQP1 2JIJA 3DYMA 5FBJA 4P9GA 4WM8C 5ISLA 3T2QA 3Q8CA 5K9YA 2WO7A 3ZFFC 1LOFA 4XF9A 4XJZA 5E1RA 4GMP1 2ZACA 1WCDJ 3JBG3 3WP4A 4XJUA 2Q8CA 3T09A 3HNBM 3I59A 1SEFA 4QPIB 2WNUB 2WN2A 5E6HA 2QDRA 3VL8A 3T3YA 2XVLA 5DUVA 4Q0VA 1E5SA 1PIV2 1RJ7A 2JIGA 5J96B 3HWJA 1WA6X 3HAGA 4QPYA 1K5MC 5I91A 5JSPA 1J3QA 1RUJ3 2EAKA 2WYSA 5A6YA 2JG8B 4CDUC 4X6QB 4MOAA 1AX2A 2B9VA 3VBFB 3PTRB 5FYIA 4AR2A 1RUH2 1G9FA 5C8WA 1LHWA 4TLFA 4META 4PIXA 3INAA 2P34A 1VBC2 3FWEA 1NZCA 1W6QB 2B45X 3AVSA 3MPPG 4J1XA 2VQTA 2C26A 2Y64A 2YY1A 2ZTNA 1V0AA 2OX0A 1WWYA 1H8VA 3AXDA 1UYPA 4FOQA 2RS51 2W46A 3OD0A 1CX4A 1YC61 4YFWA 4CU9A 1VPHA 3IM0A 3V0BA 2QQKA 3ME2A 4XTMA 2V09A 5LRSA 1RUD1 1G9AA 5IVFA 1S0IA 4AI1A 1I6XA 3WQBA 3ORJA 1RHI2 5JUVA 3HOBA 3PIGA 1DFQA 3RSJA 2NM1A 2WAOA 4V2VA 2VW2A 5FO8B 2QQNA 4B8EA 2IXHA 3HT2A 4RGKA 1IZ3A 2GC0A 5T5JA 1FMD1 2QBXA 3N9NA 1E5HA 4AYUA 4DY3A 1CIWA 3M1HA 3I3QA 1VBE2 2D6OX 4RS5C 4ARYA 3WQ0A 3ZDSA 1ZNPA 2YB7A 1CAVA 3DF0A 1OT5A 3KWVA 4AEDA 2VVFA 1TMF3 1H6XA 3T1LA 1N3OA 2Y38A 2XQXA 4QDQA 1QNYA 5FMOS 1Q8SA 2F6BA 2RR11 1ULOA 1JZ6A 3UJQA 4DIQA 2WLPA 4RFRB 3VHOA 4KBZA 2B39A 1UY4A 1S0DA 1O4YA 5BNNB 4HOOA 3VBSB 4AGGA 5JSOA 5KXDA 4FAHA 1Q56A 1J1TA 4NHMA 3VBUC 4WVMB 4LULA 5FRAA 1JZ4A 3VUOA 4R4XA 3DL3A 2R16A 2XJVA 3ZYHA 4C8DA 2A71A 1RJ8A 4OHYA 2AENA 2LRPA 2ZJCA 4MXVA 1F9KA 3VBOC 2CL2A 3FZ3A 4M4PA 4FTSA 3D6EA 3EJKA 4QXKA 4ZPIA 1E57A 3VBHC 5ABJB 4XHXA 3W5NA 3I2KA 4XJ9A 1DLLA 5T50A 4YGCA 2D3PA 3L2HA 2A73B 5HV0A 1V6OA 4J1WA 3ZN6B 1XNTA 1BEV1 4NUBA 3IPVA 3MIEA 4LITA 4QDRA 4FPHA 3KMHA 2E51A 3AP4A 4JGZC 5I8SA 1RL3A 3ZO0B 3T0AA 3K77A 3RMYA 4Q4V3 1W39A 4KG0A 1AL21 3VDDB 5LB6A 4HN1A 3VHRA 3U4XA 1O7FA 4Q4V1 4P9LA 2IC1A 3RRDA 5A7PA 5FBZA 5EWSA 1ASJ3 1W8FA 4HPKA 4AQTA 2OA2A 4E2GA 3WDVA 4LIVA 2YG0A 1NE4A 4MXWB 4NROA 3JZVA 3PVOA 4RGAA 4S2GA 4L2NA 1RUF1 2JDUA 5FPLA 2ZABA 4AFDA 1ZRIA 1QJX1 3RYKA 3SITA 3VHNA 5C8CB 3RWNA 3ATGA 2JDNA 4P08A 5FY5A 2R0HA 2PXJA 5A7OA 3U0ZA 2WWSA 3RZJA 5A80A 3T4HB 1VRH3 1R1A3 1PO22 3GJBA 1UAIA 1GV9A 2PHFA 4AVBA 2BGOA 4XFHA 4AVCA 1VRH1 1W9WA 1ZBA2 3SNMA 5FP8A 3Q8AA 2HWD2 3A7QA 5I0RA 1HQWA 3C7HA 1C1FA 1IKPA 5HXVA 2DF7A 1OLQA 3USSA 3ZSEA 3CJIA 2WR9A 3AMHA 3M3CA 5AC92 4FSJA 4BQ4A 3PJQA 3N9PA 1HX6A 3NNFA 2P3IA 4FVVA 4XUTA 5A3LA 2R073 2WA3A 2P2KA 1WLCA 3MIGA 1GANA 4RSUA 2Y6KA 1NG0A 2WFF3 3PU8A 4P9WA 2R071 3V56A 3QOPA 1YFXA 1W2AX 2OXBA 2PLV3 3U11A 3BTYA 4H55A 3NNLA 5A7WA 3WDUA 4Z92B 1W0PA 1PIV1 4W6YA 2VOTA 5KXEA 4BOWA 2I74A 1FNYA 4A45A 3J8F3 4XQDA 4AHXA 3ACGA 1D2SA 5T3NA 1PHMA 1POV1 2E9QA 1UY3A 4CSWA 5C7GA 4I30A 2RMU3 3FHQA 3TEYA 2EIDA 2VUAA 1WZXA 4XJ8A 3SKJE 4P9XA 4BYYA 2BNNA 5LY2A 1RUH1 1W8NA 4QKFA 5E89A 4JRLA 3WQ7A 4D7SA 2GMEA 1VBC1 4C1XA 3POWA 1C8M3 1DHKB 2FDJA 3A21A 1R082 3JD73 4WM7C 1LOAA 3LIGA 3NO8A 3WW3A 4YZ2A 5BYNA 1G9CA 2GNDA 3OUHA 4BPZA 4YGDA 4Q0SA 2P3YA 2G9ZA 2QDNA 3O7OA 1IHMA 4PF1A 4S2DA 1W6PB 4JAAA 3AZXA 1AUYA 4FXGB 4ET7A 3AKRA 1RHI1 3MV01 1W2OA 2WN3A 1MS3A 2WA4A 4N43B 2D6PA 5FP9A 4ZXKA 1XYOA 5H9RA 2DUQA 1IQAA 4XDPA 4DS0A 2FD8A 3HT1A 1PMJX 4GB33 2JDMA 3PMEA 2VR4A 2RJ2A 1FXZA 3VKFC 2OPKA 4FCAA 5BPXA 4DXRA 4O9GA 2NPIA 2ZKLA 1MS0A 1W8WA 5K0UB 2IVJA 3UKVA 3MZHA 1QJY3 1OOPA 1SMVA 5FZKA 5EIYB 2EICA 3DV8A 4LUKA 5C5TA 3AK0A 4YW3A 4Q0UA 4DEVA 4A7YA 5JVVA 2VCCA 2JXAA 2VL4A 4MSVA 4ZZ5A 2HWE2 4UW3A 2BBVA 1Q3EA 3THCA 1XC6A 4I3GA 5KC5A 1X36A 4N9IA 3RZZA 3OGJA 2RS13 4IV3C 1UNBA 1SBEA 1UQXA 3I2GA 3VN4A 4YYOA 3ZN4A 4CP2A 3VZLA 3O14A 4GAZA 4UAPA 1Y9QA 1W8OA 2JWPA 3S6PA 3LQCA 1ULFA 4EZ4A 1UIKA 2XL7A 5CG9A 3OGRA 2PHRA 1AJKA 4YVWA 4FFHA 1U5ZA 1LGNA 4IE7A 1NCQC 4HKLA 1KDKA 5H9SA 4JKKA 5FJHA 4OQ8A 5FYCA 1PZ9A 3WW2A 3VKNA 4BU2A 1CD3G 1MR5A 1MS8A 1H30A 1VBB2 3LD8A 2X5IA 1UU6A 2VNOA 4TLGA 1TZOA 4PDWC 2A7AA 4AHWA 1I3HA 1ALYA 1YEWA 1US2A 4CEWC 5FPUA 3OB8A 4NHKA 3WDTA 5CYYA 3S0MA 2TUNA 2OYZA 4A4AA 2R32A 5JIUA 2A75A 4ZU4A 3W9AA 5FYMA 3P3NA 4IERA 5CNAA 5K8SA 4UXAA 1FOD3 1HQNA 4HVOA 5A33A 2XJRA 3LA2A 1GYKA 4UF0A 1DYKA 5A3NA 1NT0A 3WG1A 1AR63 2GNTA 4Y33A 3K4ZA 5K4LA 1ULPA 1FOD1 2O0OA 2W47A 3B01A 5FLJA 4AAPA 3IIAA 3I2OA 1DDLA 4WM8B 4Q5OA 3ZYJB 2V4AA 3OJBA 4LEJA 4AGRA 1AR82 4NPLA 4RFT0 4EWDA 3NJZA 1MEC3 4QX1A 3G7DA 3ZFFB 5FZOB 1H9PA 5FZDA 3ES4A 4Y20B 5LASA 4OYUA 4B4PA 2SBAA 5LBFA 5C4WC 4IE5A 3HIFA 3C8XA 3ETQA 2RHPA 3AKTA 1L7LA 2XJUA 3PVNA 5CU1A 4YZ4A 3ZSLA 1GNZA 5FY4A 3GZTB 3CZUA 3ACFA 2X05A 4C90A 4YZ1A 4IV1B 5BNQA 5C9AB 1K5MB 4UWDA 4LXLA 1RMU2 3KM5A 3M7AA 4GWNA 1PO21 3WF3A 2D5FA 4CDUB 2ZZQA 1QGLA 5F9TA 3UNPA 2FDHA 2VZRA 2VZ3A 4UW4A 1OI6A 3FC0A 3KV9A 4I02A 4XCAA 1ZBA1 4XUOA 2JEMA 1N1VA 2Q4SA 3H3UA 4IGQA 1GZWA 2UYAA 3R4UA 2WYFA 4UI9L 3ZFGA 3DPRA 1X9PA 3HBKA 2AH2A 5BNOB 1BVVA 5CADA 3WZ1A 1LHNA 1W2UA 3QH7A 4DXSA 5JXHA 4IW3A 5IATA 2E26A 4XZPA 1LENA 4N90A 2Z2SB 1GLHA 5A70A 4XBNA 1DQ1A 1YI9A 5A3MA 1W9SA 1WW5A 4F83A 1BYHA 2P4EA 5ERLA 3MHZA 3DKWA 2MNGA 3IDEA 4NAOA 2C0ZA 4ASMB 2A6ZA 2AACA 3AVRA 5F37A 1XU1A 3IMMA 3R05A 3KQRA 2D7FA 1BMV2 3PUAA 4D6QA 3MIBA 2QQLA 4B29A 4QPIC 1LAJA 4Z1VA 5CBLA 1T2XA 1AXKA 3NV1A 3U75A 1F15A 3BUCA 4NIIA 2DBNA 3N36A 4I09A 4Q0QA 4LKFA 1US3A 3NV3A 4M01A 1AYN2 3NKTA 1IS4A 1OXCA 1SLTA 1W03A 2LROA 4S2FA 2W5FA 2XUMA 4TYSA 3VV1A 4BHPA 4AFMA 2JG8C 3WG3A 3FLPA 1SBDA 2E33A 2DUPA 1VR3A 1A8MA 3VBFC 3HQRA 3TN93 3ZXGA 3AX4A 2ZGOA 3K51A 1R081 3ZVXA 5FUNA 5TSWA 4AI3A 1UOGA 2XKPA 2YBPA 1PO12 2WLQA 5IVCA 3WEZA 4NPMA 4CUBA 1QOSA 4RYDA 2WT0A 1LNSA 1NQJA 2O14A 2R1BA 3LSEA 1EAH2 2WZEA 4D3WA 4EWAA 3POJA 4CE8A 3VBUB 3TB0A 4LJHA 4DXZA 4QX7A 4YW4A 3UK9A 1UY0A 2DCYA 3PHMA 4Q4X2 4OUEA 5F3IA 4EROA 5EJZB 5LCWL 1WW6A 1CAWB 1RVF2 4KBBA 5A32A 2WNOA 3R4SA 4Y24A 1OSGA 2CWMA 3U10A 3VBHB 4QD2A 4BXSV 1DU3D 5JMCA 3WXPA 1JUIA 1Y4WA 1O59A 1QWRA 3I2DA 1JYWA 2YU1A 3ENRA 5FUPA 1GP6A 3DCQA 4JGZB 3AFKA 2QQOA 2GDFA 1JHNA 4KU7A 1Z7S2 3O5SA 1SG3A 2WBKA 1YIPA 2YPJA 1AYM2 1H0BA 5EXOA 4RHV1 1WKYA 1ZBE3 4CP0A 3AP5A 5IK7A 5FZEA 4IGPA 2TNFA 1ZBE1 1PGW1 2JB8A 4OZXA 3H1MA 3LPFA 3BIWE 5FWEA 5SV8A 3V0AA 1VLNA 3VBSC 3E5XA 5DDJ1 2EA7A 2Y6HA 3B7MA 1R091 4CDWA 2AEZA 1LB2A 4IE0A 2WNVA 2HWC3 1YFUA 3P5BA 2N7GA 4QPGC 4BQWA 4DUVA 4XFIA 3KF5A 3OPWA 5GM0A 2XG3A 5F1RA 2F4PA 1RINA 5A7SA 1V70A 3CHXA 4MYEA 4K8RB 2QQIA 4OULA 3AKPA 4XCBA 2R061 4LHNA 4MGYE 4BLIA 4QKDA 2RJKA 4QT6A 1Y3TA 2VH9A 4BMEA 4CCJA 1MVQA 4NWVA 1H1AA 3TEXA 1MS5A 1HDKA 1BK1A 3M3IA 1F5JA 3R4DB 3WF4A 1VBD3 1LOBA 2RS33 1AR81 2D6MA 3J7MA 1NKGA 3UV9A 3BPSA 2WZPP 4KWLA 4I2OA 4URTA 1WMXA 1XYPA 2VMGA 3VDDC 1W8ZA 1OA2A 2C24A 5EHDA 5I0UA 3VD9A 2PHWA 2DVGA 5FY1A 1SQ4A 2YFZA 5CB7A 3L2YA 1R1ZA 4DZGA 1OHFA 2VM9A 4AVTA 2VJXA 2XBO2 4P9YA 1LGCA 4K1YA 4G9SB 3FHIB 2PHXA 4AI9A 5FXWA 1RMU1 2MHFA 5FCCA 2DVBA 2VCBA 1DQ5A 5DZGA 3LEGA 2ATFA 3BIEA 2W0XA 3U14A 4A6OA 3LOIA 3WR0A 2ZA9A 1KEXA 2ZHNA 1SLLA 1QJU2 2GNBA 3AYAA 3W21A 1WCUA 4HVQA 3KF3A 2Q1FA 3DEMA 4LO4B 1IG3A 3WSOA 4XFAA 1UW8A 4LTAA 1BBT2 5FMDA 1H2NA 2QQMA 2XOMA 5LRRA 1D2QA 3JBG2 1G7YA 3RYRA 4LLFA 2CY6A 4N53B 4Z2WA 3OPZA 2X29A 3PUIA 1KJLA 2VXJA 3LCPA 2D44A 4PLOA 5JOWA 4OMCA 1Q8VA 3NNGA 3POIA 4QU1A 2G9GA 2QNKA 4ES9A 1V9U1 4NHYA 2PMWB 3I49A 1LOGA 5CFCA 3ZYGA 3WP5A 2P37A 5BY5A 1WCQA 5FKBA 4IEZA 2ZZJA 3LIHA 3J9SA 1GQGA 2D40A 4D8MA 3W5MA 3JB4C 1YQ8A 4XAEA 4XC9A 4QXCA 1ODNA 2O1QA 5FYUA 5GJ6A 5GLUA 2JG9A 1UXXX 4XFBA 2XPJA 2CDOA 5D1IA 2GAUA 4TTGA 4GH4B 4YFZA 1W04A 5LA0A 4P14A 2E53A 3OPTA 2R1DA 4L9BA 4P9IA 5BNPC 1JN2P 5A3PA 4QMAA 4ES8A 1W2NA 1UYYA 1YI7A 2ILMA 3DXUA 4AGVA 5FZLA 1OPOA 3MFCA 4IV3B 4D7YA 1TME2 5L19A 1XRUA 2W52A 2HH9A 4RGGA 4P5HA 4YGEA 3ZIWA 4CDQC 1G86A 2VQAA 1RUC1 1EAH1 2PELA 5FZIA 1NUKA 1ND2A 3C7FA 4B4QA 2YHJA 5GZCA 1LCLA 1WW7A 5T52A 2D6KA 3N9MA 3B00A 3ZXKA 3O1MA 5JIAA 5LBCA 2VAUA 1XPWA 2DCKA 3DYOA 2UWAA 4YGBA 4N43C 4QQPA 3ZOIA 4B1MA 3DUIA 1RVF1 2BBAA 2MEV3 2WNUA 1SZBA 1EP0A 2VW1A 2HEVF 2BVVA 2BYVE 4HONA 1D4VB 5GLZA 2YYOA 1M06G 1S0CA 3RJRA 1OH3A 5FPXA 4LA3A 1XE8A 1YQCA 2Y33A 3LA7A 3NAPA 5K0UC 4GQ7A 1QIQA 1IPKA 1UY2A 2VCAA 4I3PA 1GKBA 3KT7A 5HCFA 4FP3A 4YZ3A 2OS2A 1PMIA 1MACA 3I2HA 3D0SA 3WV6A 3PTYA 3UGFA 2RDQA 1EV11 3H8UA 4R52A 4LHLA 1JI6A 1W0NA 1G9BA 1WBFA 1JYNA 4GIQA 1CAUB 2BVBA 1H9WA 1SFPA 2HWB2 4NVPA 4OHZA 1SPPA 2BOJA 2Z69A 5BXXA 1NXMA 1FI2A 2VOKA 2VZUA 4Q4Y2 3JQXA 5FZMA 3ST7A 5C4WB 1JU3A 5F3GA 4ASLA 1WUVA 1OD5A 1OC1A 1HRI3 1SACA 2O8QA 2QFEA 4EN7B 1VB2A 5LEJA 3ZSJA 5ANQA 4L0PA 2EAAA 1XNDA 2VU9A 1HRI1 2B42B 2TEPA 3B9CA 2I07B 2PHDA 4FFGA 1AR93 5FFOC 1Z0HA 2WAAA 3RI9A 1BJQA 4NPRA 4E4DX 4NE9A 5A3TA 5FO9B 2ZCWA 4K6BA 1AR91 3RDIA 3B3QE 4YM0A 2YC0A 4BZ4A 5LK5A 3CEWA 1PVC3 2L9LA 1QY4A 2WFPA 2WSVA 1HRV2 3WQ1A 4YZ5A 5EJ3A 3OD4A 3JB8A 4HKWA 4BK4A 5FJKA 2AC1A 2KM2A 2GN7A 3DXTA 3MDPA 4L11A 4I0AA 1D0HA 1QQP3 4MADA 2V73A 5CVRA 1YRZA 3POGA 3OG2A 2XJSA 3IZOA 4PLNA 4K21A 2V5DA 4A6SA 1W99A 4K7JA 3PIJA 4WVVA 1JYCA 1XOYA 2LALA 4GMP3 2JDAA 4ZS3A 1UIJA 2LM3A 4BQ5A 4DFSA 1IS6A 4XJWA 4P02B 4H14A 4GKXA 4LBLA 4X6RB 1RUG1 3H8XA 1UZWA 1K3IA 3O12A 1CZSA 5C3RA 4MLOA 4NIGA 3H42B 2JX9A 2XBO1 2Z4FA 1EPZA 2J1VA 3O1VA 5BNNA 1LU2A 2HBUA 2FDGA 1GZCA 2W94A 1X9TA 3BU7A 4B7EA 1PGSA 3EO6A 4M00A 1RUOA 1R1A2 3RWKX 2ZEWA 4GXLA 3IAQA 2VBPA 4IV1C 5C9AC 1DZRA 2G4IA 3NKGA 4JDNA 4A7KA 2PN5A 5AFBA 2W9XA 1X82A 4OHXA 2BW8A 4XUNA 4YVSA 2LW8A 3LA3A 1QJU1 3CIHA 2CGNA 3VKLA 3AZZA 2BQPA 3HQUA 3PLQA 5FZBA 3OY8A 4AK3A 5ABJA 4P9JA 1C5HA 3FUOA 2FDKA 1E5RA 4EN0A 4Q4W1 1OLRA 3I97A 1BBT1 3E6BA 5FYZA 4ZHNA 3EQEA 3MW3A 4XETA 2XWBB 4Y1YA 5DZEA 3ZN6A 5BNOC 5I8TA 1OFSA 3GNEA 2C1FA 4COUA 2RS53 4U36A 4LBOA 3URFA 2ZX4A 3ACHA 2PLV2 1OA3A 2DCTA 4MVTA 1VBA2 1O91A 3WX5A 2HWF2 1RUD3 5GZGA 2CNAA 4QKBA 5FZHA 2LS6A 3WDYA 3HN1A 4V1PA 3ABZA 4KNCA 5J36A 5C3QA 3J8F2 4CEYA 2J1EA 2ZGPA 3ILRA 1AZDA 2VNVA 2VPVA 2WSUA 4B1LA 5D8AC 4C0BA 1NCRA 2LTNA 4JKMA 1VALA 4O61A 4N7UA 4M0HA 4ZKTB 1TVGA 1FMD3 2QTWB 4MXWA 3IMNA 3SH3A 2GSYA 3ELNA 3PL0A 1LHOA 2NP0A 1CJDA 1W90A 5DMYA 2ZOEB 5C8CA 1APNA 1PNFA 1MVEA 1XU2A 5A3WA 1QH7A 1C8M2 3AZWA 2YDEA 1HIXA 1AX1A 3UL2A 4Z8BA 4XW3A 5I8YA 2XMLA 3JD72 5JPMB 1AR72 4LBNA 5J7MA 4D6RA 2RR13 5CG8A 3D3AA 3THPA 3IN9A 2P5BA 3POSA 1JZ7A 3WCSA 4A44A 3LDKA 1QJEA 3M3QA 2ZBJA 4AF9A 1IKQA 4GJZA 1V6LA 4OI2A 1LESA 5FPVA 2PAKA 4FT8A 3VBRA 4CZSA 4D7TA 5JOYA 1O6UA 4XURA 4Y1XA 3WINE 1SCSA 1B35A 1YLLA 4JDOA 4JVAA 4PHZA 3O1PA 4GB32 1J83A 3CO2A 2HBTA 3H0OA 1NA1A 5LY1A 1JYTA 2ZMKA 4QPGB 4CDXC 5JDBA 2DTWA 3OBZA 3M2MA 3NQHA 5DABA 1ZM1A 5C6CA 2VO5A 1VMFA 4IQPA 1QJY2 4URAA 4K1ZA 3AMQA 2WZR2 1FPN2 3C3VA 3MLKA 3MUZ1 1MQTA 2B8MA 3AFGA 2V72A 4W8JA 1GOFA 1OMIA 2RV9A 1BEV3 1VRBA 3ZXFA 2IXLA 2B4KA 1MS1A 3I59B 4S2HA 2JDYA 1YO8A 1OKQA 2QQUA 3ZXJA 4LBKA 3U37A 3S57A 2YXSA 2ERFA 4ITCA 3UESA 3BGAA 4YPJA 4AEMA 2XL9A 1AL23 4NIDA 2GC1A 3T08A 2VTXA 3ILFA 5T5LA 1GZTA 4GALA 3J7LA 4Q4Y1 2ET7A 2YPDA 1UKRA 5GLTA 5A3UA 2WNEA 1S2KA 1UX6A 4Z2AA 3OEBA 3GDBA 1RUF3 3IIIA 3HBZA 2R042 4KWJA 3VZMA 4QX8A 1QJX3 3ZFGC 4DUWA 2D6NA 2EF6A 2QE3A 5LA1A 1S55A 4I0WB 1E5IA 5LK7B 2EXKA 4Y26A 1G9DA 4XF0A 2IXJA 3JCIA 1VB4A 5JZGA 5FKCA 1SDDB 1PK6A 2Y0IA 3O1UA 1POQA 3ZSMA 3LPGA 5EZWA 4LT5A 1XNCA 2I45A 2WDBA 3V0BB 2Y6FA 1HRV1 4NIAA 4NWWA 3UKNA 1RUE1 3D82A 4IE6A 1VAMA 2DYCA 2JDKA 2JKXA 1QF3A 1OQDA 3K4AA 1MEC2 1ZVFA 3NV4A 5FY8A 1CX1A 5DAVA 1UZZA 1REEA 4FTEA 3OBTA 4OQ9A 3DYPA 1FAYA 1QXRA 4YLZA 4ZXEA 4CCEA 5L7OA 2ZGRA 3IDCB 1RC6A 5J09A 5LW9A 4RR3A 1PIV3 4DMIA 3JXSA 4FXKB 5BUVA 5IVBA 4AEDB 1UZVA 3GF6A 4N7IA 3AP9A 1BQPA 4TXWA 1DZTA 2IXIA 2WC2A 1L3JA 3FLTA 3OYWA 1LU1A 5G04L 4DINB 1NQDA 1PX3A 3PMSA 1L7QA 1POV3 1MZFA 2RDNA 1C5IA 2DUOA 4XYXA 1AF9A 2X09A 1DG6A 3GBFA 4HKOA 4N8MA 3J4UH 2VVEA 4AQ2A 3LF7A 3KD4A 1RUH3 2CAUA 4AZZA 3EHKA 3J7NA 1H2LA 2XVGA 1UD1A 3RZKA 1CGPA 3VKOA 4CVUA 4MGKE 1VBC3 1O8PA 3RQ0A 1UYZA 5F32A 2ADEA 2GP5A 5BNPB 5DUXA 1DGWX 1NZIA 4QHOA 1N3QA 5FYYA 5J1XA 1YUDA 4FI9A 3CF6E 1OUSA 2OVUA 1S0BA 3AL5A 1VBA1 4CDQB 5FDBA 4Q0PA 2HWF1 1ENXA 2V5YA 4N53C 2IXCA 2JDPA 4BIOA 4WM8A 1RHI3 2ENRA 3KHCA 4KGGA 4FPKA 4IGOA 3WUCA 3N7KA 3WY6A 3HQXA 3ZFFA 4CCCA 1UMHA 1VE0A 2B7YA 2IVIB 2W08A 2ZX0A 4JCKA 4XXAA 3IPVB 4QX5A 4G4FA 4Y20A 3P1IA 4W6WA 1YCIA 1EUUA 2J1TA 3WG2A 5F5AA 1W6NA 4BQ2A 5J48A 4MGTA 4O65A 1W6MA 4CCDA 1P8JA 2BFUL 2PHLA 4Y5TA 1VBE3 3C7EA 5GALA 3RPQA 1BK0A 1LGBA 3TWIA 3WG4A 1HN0A 4A42A 1VBE1 5IAXA 3DN7A 5F2WA 5FY7A 2C9AA 4YW5A 5EYXA 3W20A 4HPKB 1AR71 5A1FA 2W1QA 4CDUA 4KWUA 5KWRA 1GNYA 3T2TA 2OPWA 2VOWA 3UT0A 3ZFEC 5SV5A 4CDWC 2ZX2A 4GH4C 2RDSA 1S0GA 5FZFA 3VD7A 3NJXA 4EE2A 5FQ0A 1LJ7A 2GN3A 1H8TA 1ZA7A 2EALA 2GP3A 1UMIA 2QCSB 4MGZE 3BYWA 5F5CA 4TSVA 3KB5A 1WLDA 1G8WA 1REFA 3K3OA 5HXMA 1QXJA 2A70A 4M3CF 2W91A 1D0GA 4XF3A 4LKDA 4Q8LA 4RQPC 3UETA 3V65A 4J6GA 4N9HA 1MS4A 4D69A 2A6YA 1GR3A 4FPFA 4Z82A 1UOBA 4XBLA 3UGGA 1OA4A 1AXYA 3HNMA 5HCAA 3PDQA 2ZGQA 4NRMA 5FTTC 1DQ2A 4CP9A 2WZR1 1FPN1 1LHUA 1X33A 4HSLA 4OI4A 4BQ1A 2BTVC 4OI0A 1H1IA 3MI8A 4HSJA 1EYBA 1F31A 2Y26A 3O0VA 4LK7A 1REDA 5DAWA 4AG4A 1C8NA 4QWNA 1WLWA 2WQ4A 1ND3C 2VUDA 1W8UA 3B94A 3SMHA 2R0FA 4RS5A 4XILA 1SCRA 5A7WB 5KHJA 2UU8A 3JQWA 2DCJA 1XSQA 1JU4A 1LOEA 2R49A 4GWMA 3E5UA 2YU2A 3SISA 2VMFA 4MX3A 3LKJA 3ZPYA 2VGDA 2J7MA 1HJGA 2NLRA 3KGZA 2OUJA 1A8DA 5EV7A 5JR2A 3FFZA 1ZRDA 1IOAA 1I5ZA 1K45A 1PGL2 3AMNA 4FTBA 4NJ4A 1KDMA 2W68A 4PLMA 2R041 3GZAA 2A6WA 1O4ZA 5GZDA 2OKXA 3N9OA 4KGQA 4ZU5A 3VBUA 4QGNA 4IEOA 1RUNA 5DAPA 4YW1A 2XHKA 3MPBA 1PO23 4XZUG 3N7LA 4FAGA 3L9JT 2FMDA 1HXS2 1S0EA 3WNLA 1ZBA3 2ZGMA 1C28A 4AOCA 5EJ1B 3VGIA 3VBOA 1YQ6A 5KHIA 1NX9A 3MF9A 1CAWA 1RXGA 3VZNA 5C70A 4QX3A 3NVCA 2HWD1 2EXJA 4ZONA 5T5PA 2G9FA 4AQSA 4XFCA 1AL0G 2ZAHA 2QKDA 1LULA 5AC91 4LKEA 1VMJA 1LEDA 2QZ2A 3NL1A 3CBNA 4OI1A 3WD5A 5IK4A 3D8CA 4EWEA 4GZ9A 1GQHA 1OKOA 4Q8KA 2VTXJ 5KHHA 3K48A 2GZWA 5FMOL 3O1OA 1OOPB 3A0NA 2W1SA 1OH4A 4IDZA 1FYUA 5IAVA 3TYJA 3VDAA 4BJ0A 5LA2A 1DGWA 3BALA 5D8AB 1YJKA 4PI0A 4RN5A 4MGIE 5FZ6A 5H9PA 4AFBA 4DRVA 5F7UA 3LZZA 4FPLA 2V4VA 2JB4A 2WQ8A 4R9AA 3WLUA 1QOOA 3WF1A 4CCMA 1S2EA 1JOJA 4JV4A 3KT1A 1QKQA 4FPGA 2BEOA 2VUJA 1AJOA 2UURA 1BXHA 2XLFA 4YVWB 1R083 3K3NA 2CDPA 4DEQA 2W3JA 2TBVA 1C4RA 4F8AA 4EN8B 4KH9A 3NRUA 2DCZA 1NLQA 1JZ8A 1DLCA 1W6OA 4W50A 1MZ5A 1QJFA 3KCYA 1BKZA 3FL7A 2NMNA 3CZJA 1Y43B 2X5IB 5F5QA 3VDBA 4HVRA 4JC1A 1RXFA 4XACA 4COWA 1IPSA 3PURA 1O5UA 4CCLA 3VZJA 1FNZA 1DZQA 5IK8A 4LPLA 2KXLA 5FZAA 5JR7B 3O1SA 5ACA1 1AHSA 4IEQA 4QGMA 1LODA 1D4M2 2DWRA 5IFPA 1ENSA 1VJ2A 4LBQA 5EFUA 2H6CA 4XABA 3EBRA 5FK8A 4HZFA 1CZVA 3TOJA 5A33B 4CDXB 5A6QA 4UF0B 5FK7A 3S5QA 1KXGA 4Y1VA 5H9QA 1HB4A 4M3CA 1JS9A 3TRSB 2QJVA 4DUXA 1W28A 3ECQA 3BTZA 2BGPA 2WABA 4F7ZA 2IZWA 3OOXA 4C1WA 4YM3A 1A34A 2GNMA 4LA2A 3IB3A 3LFMA 3CJXA 4C0HA 2VMDA 5C71A 2K0GA 3KCXA 1OVPA 3ZR6A 2CHHA 2HKXA 3EB7A 3GHMA 3D5OA 1V00A 4GKYA 5FXZA 3WHUA 1GWMA 2HWE1 4F3JA 4UFLA 5KXCA 1H1MA 1D7PM 2YC2A 4RHV3 1NYWA 2QQJA 1X7NA 4HL0A 1LHVA 4I0BA 2VZSA 3NV2A 4HK9A 4WM7A 4WZCA 3KVBA 2RG4A 3OTFA 1YFWA 2GC2A 4GD4A 2WS92 5DDJ3 5DPNA 1O3SA 2ZEXA 2ZGUA 1R093 4DXTA 1GZWB 1HV1A 1FV2A 1T6GC
chains in the Genus database with same CATH topology
1VBB3 3ZFGB 5CFDA 4SBVA 2E6VA 1U5XA 4ISQA 2RJLA 4HFSA 2W39A 1VBB1 1QH6A 3FBYA 2C5DA 3AYEA 4BH9A 2K9ZA 1UU5A 2R063 1UMZA 3FFQA 3WOGA 1LOFC 4YSFA 1MS9A 4AHZA 4L97A 2HEWF 1AR83 2RM22 4EN6B 1RUI2 1PZ8A 2A3XA 4Q26A 4LO8A 5DUUA 2CGOA 2VY0A 1CR7A 5I0TA 2FZ2A 2ZHLA 4PBPA 3WNXA 4KL1A 1PGL1 2OIIA 1ULCA 4X8NA 1LRHA 3NW4A 2DU0A 3TAYA 4LO6B 3WW4A 1Q5OA 1RMU3 1V6JA 4FP2A 3R6SA 1COV2 4UBHA 2Z79A 3UKTA 4A2UA 1CVNA 1NCQA 2P3JA 1SLCA 1HXS1 3X29B 4PDWA 4PF5A 2GU9A 1ZZBA 1QOTA 2DVDA 4Y5Z0 1ONAA 2PHTA 3AB0A 3USUB 4CEWA 1XYNA 4JGYA 4CEYC 1KS5A 3CU7A 1QDCA 1U12A 3CNAA 3KS7A 4R9CA 4LO7A 2VQ0A 5A32B 1Y7BA 1PNGA 2YGLA 4X8PA 2EVXA 1Q8QA 3LWCA 1FATA 1V9U3 4OHWA 1BMV1 3H3ZA 2XB6C 5FLIA 4AEDC 1U5YA 3A0KA 3MGUA 4PQ9A 3SH5A 3AMPA 1RUJ2 3ALQA 4WV8A 3ZX7A 4AWDA 1LECA 1AYN1 3AP6A 2QVSB 1TQ5A 3ZYIB 2P3KA 1NLSA 3LSDA 4NN0A 1CONA 1MZEA 3V0AB 4KQ7A 4JTOA 4LBQD 3ZFEB 4CDWB 1PO13 5KXBA 2WNVB 1NA1C 3SHRA 5CAZA 1CAXA 1UCXA 3AJYA 1PO11 4HETA 4XQ4A 4IL7A 1RUD2 4Y22A 1RUC3 1FV3A 1EAH3 2XJQA 3AKQA 1ZRCA 4CRQA 4FPCA 1Z78A 5DG2A 4OHVA 5I93A 3E6CC 4XQWA 2D43A 1QNWA 1D4M1 3RYPA 4RQPB 4PCRA 4Q4X3 3HD8B 2NN8A 4HT1T 3WUDA 1N1YA 4E4SA 1RVF3 3N3HA 4Q4X1 3VLBB 2UY9A 4QPIA 3BPZA 1FT9A 3N7JA 3BODA 2HJIA 4AVVA 4XJAA 1TMF2 2RR12 4JQRA 1ND3B 3MIHA 1SLBA 1Z7S3 5IT6A 1XNBA 5B2GB 1BCXA 1SFYA 2DFCA 2JG8A 4GMP0 3UJOA 1YWKA 1EV13 3OF1A 1Z7S1 2CV6A 4L99A 3VBFA 2B46X 3VHPA 5T54A 1AYM1 2XVKA 3ES1A 4AFCA 3N4MA 3THTA 4AQ6A 4L92A 1IS3A 5JZGC 2WS91 5GLVA 1W6QA 2Z5WA 3M3OA 3N7MA 3GHNA 2VNRA 4XMAA 4IEVA 4DPNA 1LR5A 3WVJA 3LGRA 5AFEA 4YG6A 3AJZA 3WP3A 3QBQA 3IT8A 4IESA 2BGCA 3CJIC 3ROUA 1BEV2 4DRRA 3RJ2X 1LEMA 3KLSA 3U07A 4LO5B 4BE3A 2H0BA 2CTVA 2PAMA 3RNSA 4FOYA 2YUEA 4Y1UA 3RG0A 2K2SA 2RM21 2XWJB 3M4FA 4Q4V2 4A7ZA 4W65A 5IUQA 1LKNA 4WVZA 4FPEA 5CFCB 2B5HA 2ZAAA 2ZPXA 1TEIA 4HLTA 4UW6A 2GMMA 4E27A 4AFAA 1ASJ2 1RUG3 1HQLA 1RUF2 3R0RA 5FO7B 1JYIA 1RTVA 3FBMA 1QJX2 2XBO3 2D93A 3S30A 5J37A 1I1EA 2JG9B 4MV2A 4XIOA 1COV1 3VBSA 3MLJA 3ZMOA 4AHYA 2JKBA 3I7DA 1V6KA 1VRH2 3J26N 4WVMA 2A3WA 1G6NA 2ES3A 2DTYA 3OGGA 3OBRA 4FOWA 1QJU3 1ND2B 4QQ2A 2Q1ZB 5KHKA 2BUKA 3D4KA 3RS6A 4Q4W3 2Z42A 5F6LB 1BBT3 1TE1B 2GH8A 3O0XA 1WA4A 2R072 3JBG1 2KA3A 2WFF2 4LUMA 4DY5A 1X8MA 1ENRA 1NXD1 3I54A 2Q0AA 3ZYRA 2AUYA 4OUSA 3NAPB 1J3PA 1OOPC 3M8LA 4K9SA 5T5OA 3VDDA 3P3PA 4JDMA 4XDQA 2GMPA 3WDWA 1RUJ1 3WCRA 5J3UA 5L36A 2RMU2 1H8TC 2LUWA 1WCKA 5HCBA 1VAVA 1KRIA 3MLLA 5F6KA 1CN1A 3AP7A 3A4UA 1OQEA 2JECA 1HW5A 4AI8A 4YVWC 4E4ZA 1DQ6A 3QLQA 1TME3 5L73A 4YNIA 3GYDA 2Q1MA 1TME1 4XF1A 2A3YA 2X5IC 2ZMNA 2AREA 1UL9A 3AZYA 4YARA 3LAGA 4DNYA 3HMYA 3ACLA 2XLGA 4Q29A 3I8TA 2H0VA 2ZKNA 2X53S 3GBGA 4KU8A 2OZ6A 2GH2A 3S7EA 1KQRA 4AVAA 2VW0A 1WD4A 2NYYA 1DGRA 4UBGA 2WIIB 1O3RA 4XE9A 4Q27A 4LNVA 4ATFA 1TMF1 3ZSKA 4NHLA 4D94A 4G3YC 2BPA2 2WKKA 4IEPA 1GICA 2XJPA 1N47A 4R9DA 2RS12 4BLJA 4KWKA 3FX3A 3BCWA 2HWB3 1F2NA 5BNPA 1ZRRA 4OUMA 4Q4Y3 2VOVA 2JDZA 2HWB1 2FBEA 1QXPA 4YVSB 1KFXL 4CDQA 1POV0 2XH6A 5AVAA 3H7JA 2D6LX 3OY8B 4LE3A 3NSTA 3AYDA 1WW4A 2BWAA 1FX5A 3DPRC 1GZ9A 1W6PA 2PYTA 4CYDA 1H4HA 4N43A 3POYA 1HRV3 2YV8A 1RUE3 1GNHA 1FOD2 4WBBA 1AVBA 1J59A 3APBA 2UWCA 1KS4A 4CEYB 1AR62 1U5IA 4QM8A 5K0UA 1NCRB 4OVEA 4R9BA 4ISRA 4M3CE 4PIYA 4B3NA 1GBGA 1VIWB 1ASJ1 2PTMA 4O9EA 1UU4A 2PAEA 1S1AA 1A6CA 4ORFA 4Y1ZA 1JUHA 2A6XA 1SDWA 3SXWA 2QQPA 3MICA 1ZA4A 2CAVA 2HYKA 1H2KA 4MZUA 4I01A 1CAVB 2IFRA 2NMOA 5I0SA 3E6DA 2ET1A 1MZ6A 4H3WA 4IETA 2WL1A 1R1A1 2YZ4A 1HKDA 3PVEA 3B93A 2JJ6A 3NWKA 4INDA 5K7PA 3M70A 2D3RA 3VBRB 1I9RA 2EXIA 4U2AA 5JPNB 1NOVA 1B35B 4XF4A 4HK8A 1NA1B 3MIDA 1ZX5A 2XKOA 4BA6A 2UWBA 3JUUA 2D3SA 2R30A 1VBA3 2HWF3 2WFF1 4KG8A 3PVBB 2PLV1 3KSCA 2ZHKA 3KGLA 5GLWA 4QQOA 1MQTB 3FLRA 3MYXA 5GZEA 3FE5A 3J8F1 2WT1A 1N3PA 4IEXA 1J1LA 2UY8A 1YIFA 2GC3A 2RMU1 3VZOA 1VAKA 3LB9A 4K3UA 1WCSA 3ZXDA 1DQ0A 3FMGA 1WMDA 2VMHA 1AR73 3TN92 1C8M1 3MW4A 4IV1A 5C9AA 4C91A 1K5MA 4A3XA 4EV0A 3JD71 1AXZA 4MUVA 1CQ9A 5CFDC 2WJSA 1DGRN 2DVAA 4OLLA 2X8KA 2WNVC 2AGSA 4HBNA 5E8AA 1IS5A 2DURA 1QU0A 5JZGB 5BNOA 1LTEA 1PK6B 4EJRA 1ZZ9A 5FOBB 4LE4A 4DOUA 1UN1A 3HR9A 4GB31 4BWOA 4R8HA 2O8OA 1XE7A 1S2BA 2OW4A 4ONUA 1HV0A 2CGPA 3KZ4C 1O5LA 4CTEA 1CPMA 2E7TA 1FPN3 2WZR3 3CJIB 4SLIA 2VVDA 1BZWA 1QJY1 5D8AA 3B69A 1ENQA 3T1MA 4NOTA 5L7OB 4AE2A 1CESA 1KJRA 1PM7A 3QH6A 4RR3B 2YGMA 1SLAA 2E63A 4PBOA 4RHV2 4YRDA 2RS11 4AXOA 3IBMA 3QD6A 3OYWB 5JOXA 1NE6A 2ARBA 1ZBE2 1PGW2 3I4IA 3EXUA 5JCTA 5DDJ2 1R092 1JW6A 4RL7A 1YHFA 3BOWA 4YM1A 3ASIA 1DIWA 1OQ1A 2CWSA 2R043 4XTPA 2IWGB 2HWC2 3D0JA 4XXPA 3MIFA 1ULGA 4JGYC 4HMZA 5C33A 1ZZ7A 2R062 3ZXAC 1BVP1 5HBAA 4Q1PA 3MW2A 4CDXA 5AVPA 1F8VA 2VMIA 3MEPA 4XHBA 3S7IA 1QMJA 4XEZA 4K40A 4HN0A 2IFWA 2HWD3 1AR61 5KBFA 2JE7A 3VBHA 5CIRA 1VBD2 2YMZA 4Q1RA 2RS32 5AC93 3KT4A 3RI8A 1MEC1 1W6NB 4K20A 1W6MB 3W58A 5CFCC 2I2SA 2D5HA 4FPJA 1IPJA 4LHKA 4JGZA 5DG1A 4AI2A 1H2MA 5HI0A 2QZ3A 2UYBA 5IK5A 3WP6A 1QHDA 4Z07A 3SCHA 3QCWA 2JG9C 4E9KA 3TNPB 4R4ZA 1JTZX 2D98A 4LBJA 1YNAA 5FQ0B 4YG0A 2IXKA 2VXRA 4COZA 1A3KA 1H8TB 3IKWA 4IEWA 4NR1A 4ATEA 2ZX1A 4LR4A 4H7MA 4XFFA 1ND2C 1C57A 4Q2FA 2FHRA 4FOVA 2WQZC 2NQYA 3B02A 1PZ7A 2DVFA 4XPVA 2VULA 3BTAA 4Y4YA 4OFGA 1URXA 1CJPA 2ZGNA 1TNRA 5FLHA 5GZFA 3TBDA 2WNUC 5JWPA 4BM8A 4RD7A 1V9U2 3GALA 3O0WA 5ACA3 1UF2C 2ZX3A 1DF0A 1J58A 1Q8PA 4RS5B 2VNGA 3NAPC 2OUHA 1RGSA 5JOZA 1WMFA 4M0NA 2WT2A 5FPZA 3WDXA 2Y0OA 1RITA 1Q43A 1SLIA 1CPNA 2CYFA 2PA7A 1QJZA 2ZGLA 1YJLA 5DZFA 2DU1A 2D97A 3TN91 3VL9A 4PJYA 2R6QA 1ZYBA 1N1SA 2BNOA 1UKGA 3AMMA 1IGOA 5DXDA 4FPOB 5FOJB 3H50A 2HWE3 1GFF2 1RUC2 4RA0A 4IEUA 2VECA 2NZ9A 1H4GA 3E5QA 3USUA 4AVSA 1QDOA 1WLTA 4QU2A 3QACA 1WBLA 1ULDA 2BNMA 4MH0E 3VBOB 2EXHA 4IXLA 3ZXLA 4N53A 3G6JB 3ZIXA 2XJTA 3AZVA 2MEV2 2B9UA 3OCPA 3DPRB 1DGLA 4NO4A 2FZ1A 3H7YA 2HEYF 4AI0A 4TWTA 1EY2A 1PVXA 2PHUA 4E2SA 1YXWA 4FO9A 5FREA 5JAXA 1ZZ8A 3LOBA 3W59A 1DBNA 1EV12 2YROA 1UPIA 2ZGTA 3FJSA 1TNFA 2AR6A 1SFNA 1J3RA 4FQ4A 3TNQA 5BNNC 4FPYA 3H1WA 3ZFEA 4GH4A 1WGPA 2A5ZA 3ZYPA 1RB8G 1NY72 2RE9A 3AYCA 4JRAA 2HWC1 1HRI2 5FAXA 1JBCA 4IV3A 1O4TA 4YVSC 4QQLA 3KCCA 5ABJC 2GALA 2DFBA 1AR92 1W6OB 4RQPA 2Q5TA 3ILNA 1HXS3 4GA9A 4XFGA 4WVWA 2JD4A 4BIFA 1S0JA 1X8EA 2BWCA 4FQZA 5KC6A 5JSRA 1PVC2 2PQQA 1WMEA 2VG9A 1A78A 1C1LA 4E2QA 1VBD1 2RS31 4LBQB 1QQP2 3CLPA 1JH5A 3MFAA 3SCGA 1ND3A 2FMYA 4M3CB 4QQHA 3VZKA 1RUG2 3PNAA 1NCRC 1VP6A 1XNKA 2XLAA 4ZU7A 3IWZA 1OFNA 3GZUC 1N1TA 4TZDA 1UZYA 4L8QA 2DV9A 1S0FA 3DGTA 5C8CC 1B09A 2P17A 1V6NA 5E16A 2JE9A 1CAUA 5E88A 4JTNA 5JLVA 2SLIA 5EYYA 2ZS6B 5C4WA 4W6XA 1AYN3 2E7QA 2ARXA 2E7AA 2FQPA 1ZRFA 4YW2A 4WM7B 2XGXA 2AYHA 4QM9A 4Q4W2 3N35A 1ULEA 4COYA 2A6VA 3VBRC 5BV6A 2WINB 4XMIA 1B35C 5CFDB 1DYPA 3SH4A 1O3QA 2RS52 1NLRA 4AEJA 3SCFA 5LEKA 3AKSA 5J98B 1D4M3 4DB5A 3ZN5A 2JICA 4HANA 1MQTC 1V6IA 2OZJA 4B4RA 1U0AA 4IEYA 3FUQA 3WHTA 1FMD2 4H7LA 1ZREA 2MPFA 5DUWA 3BOPA 1W0OA 1C3HA 1JXNA 4LLOA 4FBFA 1ZZ6A 4QGLA 4AW7A 1YFYA 2ZGSA 4K8FA 3WT3A 3C2UA 1DQ4A 2ETEA 2Q30A 1V6MA 1XQNA 1AYM3 3JU9A 3B5LB 4UW5A 4COVA 1OPMA 1NCQB 2WS93 2ZHMA 4BMBA 1KITA 4XIKA 4PDWB 1YYNA 4LBMA 3BB6A 4PIZA 4WZFA 1ZZCA 3B9IA 1PK6C 1LOCA 2QUOA 3PJYA 2MEV1 4CEWB 4JGYB 3M3EA 3ZXEA 2AZ5A 1KFUL 3H1YA 4XBQA 3AM2A 3Q9OA 3MF6A 4DQAA 5JI9A 4QHBA 4GULA 2JENA 5L7OC 2ZGKA 1SBFA 2RM23 1RUI3 1EPWA 3CL1A 4RR3C 2VOXA 1X50A 4B7KA 1AL22 1KD7A 1RUI1 1F5FA 3WW1A 4YM2A 2BFUS 1Q8OA 2H6BA 1HLCA 3RMXA 1NY71 4YG3A 2EIGA 1M4WA 1WD3A 3GBWA 1COV3 1RIRA 4XOGA 1XXNA 3ZMNA 5KHGA 5JI7A 4BCUA 2PFWA 3VKMA 1CAXB 4CP1A 1RUE2 4Y22B 1GSLA 3E97A 4EN9B 1AX0A 2ZMLA 1PVC1 2Q8OA 3V64A 4AEKA 5T55A 5CA6A 1O3TA 4QPGA 3IDBB 1UPSA 3SLIA 3H9AA 3AXEA 1QQP1 4P9GA 4WM8C 5K9YA 3ZFFC 1LOFA 4XF9A 4XJZA 5E1RA 4GMP1 2ZACA 1WCDJ 3JBG3 3WP4A 4XJUA 3I59A 1SEFA 4QPIB 2WNUB 3VL8A 2QDRA 2XVLA 5DUVA 4Q0VA 1PIV2 1RJ7A 5J96B 3HWJA 3HAGA 4QPYA 1K5MC 5I91A 5JSPA 1J3QA 1RUJ3 2EAKA 2JG8B 4CDUC 4X6QB 1AX2A 3VBFB 1RUH2 1G9FA 5C8WA 1LHWA 4TLFA 4META 4PIXA 3INAA 2P34A 1VBC2 3FWEA 1NZCA 1W6QB 2B45X 3MPPG 4J1XA 2YY1A 2ZTNA 3AXDA 4FOQA 1H8VA 2RS51 3OD0A 1CX4A 4YFWA 3IM0A 3V0BA 3ME2A 4XTMA 2V09A 5LRSA 1RUD1 1G9AA 1S0IA 4AI1A 1I6XA 1RHI2 1DFQA 3RSJA 2NM1A 2VW2A 5FO8B 4B8EA 2IXHA 3HT2A 1IZ3A 2GC0A 5T5JA 1FMD1 4AYUA 4DY3A 1CIWA 3M1HA 1VBE2 2D6OX 4RS5C 3WQ0A 3ZDSA 1ZNPA 1CAVA 3DF0A 4AEDA 2VVFA 1TMF3 3T1LA 1N3OA 2Y38A 1QNYA 5FMOS 1Q8SA 2F6BA 2RR11 3UJQA 2WLPA 3VHOA 2B39A 1S0DA 1O4YA 5BNNB 3VBSB 4AGGA 5JSOA 5KXDA 4FAHA 1Q56A 1J1TA 4NHMA 3VBUC 4WVMB 4LULA 5FRAA 3VUOA 4R4XA 3DL3A 2R16A 2XJVA 2A71A 1RJ8A 4OHYA 2AENA 2ZJCA 4MXVA 1F9KA 3VBOC 2CL2A 3FZ3A 4FTSA 3D6EA 3EJKA 4QXKA 1E57A 3VBHC 5ABJB 4XHXA 4XJ9A 1DLLA 5T50A 4YGCA 2D3PA 3L2HA 2A73B 1V6OA 4J1WA 3ZN6B 1BEV1 3IPVA 3MIEA 4FPHA 3KMHA 2E51A 3AP4A 4JGZC 5I8SA 1RL3A 3ZO0B 3RMYA 4Q4V3 1W39A 4KG0A 1AL21 3VDDB 4HN1A 3VHRA 3U4XA 1O7FA 4Q4V1 4P9LA 2IC1A 3RRDA 5FBZA 5EWSA 1ASJ3 4AQTA 4HPKA 2OA2A 4E2GA 3WDVA 1NE4A 4MXWB 4RGAA 3JZVA 3PVOA 4S2GA 4L2NA 1RUF1 2ZABA 4AFDA 1QJX1 3RYKA 3SITA 3VHNA 5C8CB 3RWNA 3ATGA 2R0HA 3U0ZA 2WWSA 1VRH3 1R1A3 1PO22 1UAIA 1GV9A 2PHFA 4AVBA 4AVCA 4XFHA 1VRH1 1ZBA2 3SNMA 2HWD2 5I0RA 1HQWA 5HXVA 1C1FA 1IKPA 3USSA 2DF7A 1OLQA 3ZSEA 3CJIA 3AMHA 3M3CA 5AC92 4FSJA 3PJQA 1HX6A 2P3IA 4FVVA 5A3LA 2R073 2WA3A 2P2KA 1WLCA 3MIGA 1GANA 4RSUA 1NG0A 2WFF3 4P9WA 2R071 3V56A 3QOPA 1YFXA 3U11A 2PLV3 4H55A 3WDUA 4Z92B 1W0PA 1PIV1 4W6YA 5KXEA 4BOWA 2I74A 1FNYA 3J8F3 4XQDA 4AHXA 1D2SA 5T3NA 1PHMA 1POV1 2E9QA 4I30A 2RMU3 2VUAA 4XJ8A 4P9XA 4BYYA 2BNNA 1RUH1 5E89A 4D7SA 3WQ7A 4JRLA 2GMEA 1VBC1 4C1XA 3POWA 1C8M3 1DHKB 1R082 3JD73 4WM7C 1LOAA 3WW3A 3NO8A 4YZ2A 5BYNA 1G9CA 2GNDA 4BPZA 4YGDA 4Q0SA 2QDNA 3O7OA 1IHMA 4S2DA 1W6PB 4JAAA 3AZXA 1AUYA 4FXGB 1FV2A 3AKRA 1RHI1 1MS3A 2WA4A 4N43B 2D6PA 4ZXKA 4DS0A 1XYOA 5H9RA 2DUQA 1IQAA 3HT1A 4GB33 3PMEA 1FXZA 3VKFC 2OPKA 4FCAA 5BPXA 4O9GA 2NPIA 2ZKLA 1MS0A 5K0UB 3UKVA 3MZHA 1QJY3 1OOPA 1SMVA 3DV8A 4LUKA 3AK0A 4YW3A 4Q0UA 4A7YA 5JVVA 2JXAA 4MSVA 2BBVA 2HWE2 4UW3A 1Q3EA 4I3GA 5KC5A 1X36A 4N9IA 3RZZA 3OGJA 2RS13 4IV3C 1SBEA 3VN4A 4YYOA 3ZN4A 4CP2A 3VZLA 3O14A 3S6PA 1Y9QA 5CG9A 1ULFA 1UIKA 2XL7A 2PHRA 1AJKA 4YVWA 1U5ZA 1LGNA 1NCQC 4HKLA 1KDKA 5H9SA 1PZ9A 3WW2A 3VKNA 1CD3G 1MR5A 1MS8A 1H30A 1VBB2 2X5IA 1UU6A 2VNOA 4AHWA 4PDWC 2A7AA 1I3HA 1ALYA 4CEWC 3S0MA 4NHKA 3WDTA 2TUNA 2OYZA 2R32A 5JIUA 2A75A 4ZU4A 3W9AA 3P3NA 4IERA 5CNAA 5K8SA 4UXAA 1FOD3 1HQNA 4HVOA 5A33A 2XJRA 3LA2A 1GYKA 1DYKA 3WG1A 1AR63 2GNTA