5C8CA

Crystal structure of recombinant coxsackievirus a16 capsid
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
297
structure length
259
Chain Sequence
GDPIADMLQVLPTAANTEASSDKNLIETRCVLNHHSTQETAIGNFFSRAGLVSIITMPTTGTQNTDGYVNWDIDLMGYAQLRRKCELFTYMRFDAEFTFVVAKPNGELVPQLLQYMYVPPGAPKPTSRDSFAWQTATNPSVFVKMTDPPAQVSVPFMSPASAYQWFYDGYPTFGEHLQANDLDYGQCPNNMMGTFSIRTVGTEKSPHSITLRVYMRIKHVRAWIPRPLRNQPYLFKTNPNYKGNDIKCTSTSRDKITTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP1
publication title Structures of Coxsackievirus A16 Capsids with Native Antigenicity: Implications for Particle Expansion, Receptor Binding, and Immunogenicity.
pubmed doi rcsb
source organism Coxsackievirus a16 (strain tainan/5079/98)
molecule tags Virus
total genus 45
structure length 259
sequence length 297
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5c8cA00
1NA1A 3VBOA 1QJU1 4CDWB 5BNNA 5C4WC 1RUG1 1C8M3 1V9U1 1D4M3 1VBE2 2QQPA 2WS93 1R1A2 1PO23 3CJIA 3JBG2 3JD71 2WWSA 5FMOL 1MQTB 1EAH2 4CDQB 2R041 2WFF3 1B35B 2X5IC 1C8M1 3JB4C 1EV12 5BNPB 1D4M1 2WS91 3DPRB 3VBHA 1PO21 1CJDA 1RUH1 1AUYA 1R083 2WFF1 5JZGB 2R063 1NA1C 1RMU3 3VBOC 5BNNC 1HRI2 1VAKA 1HQNA 1NCQB 1NOVA 2R073 1PIV2 1R081 1AYN2 3M8LA 1COV3 3CJIC 1RUJ1 2R061 3VBSA 1RMU1 2R071 1BEV2 1ZBA3 3VBHC 1COV1 1RUE2 1VRH1 1VBD2 2RS33 2HWC2 1VB4A 3VBUB 1VBA2 3ZFFA 1W39A 1AR63 5CFDA 1X33A 2RR12 1ZBA1 1VBB2 1AL22 4BCUA 4CDUA 5C9AA 1H8TB 5L7OA 1RUG2 4Q4W3 1OOPA 3VBSC 1V9U2 4SBVA 4GH4B 1RUD3 2RMU3 1TMF3 1C8NA 1GFF2 1AR91 2R042 4Y5Z0 5CFCB 1QJX3 4FTEA 2MEV3 4CEYA 1PVC2 2RMU1 3ZFFC 1RUH2 4JGYB 1RVF3 5CFDC 4JGZB 4RQPB 1QJX1 4RR3A 3ZFEA 4YVSA 4CDUC 5C9AC 4N53A 5L7OC 1TME3 1OOPC 1RVF1 1RUJ2 3VBFA 2RM23 2HWF3 2PLV3 4Z92B 4AEDB 4CEWB 4CEYC 4QPGA 1VRH2 1AR73 4RHV1 1ND2A 2RM21 2HWF1 2PLV1 3ZFEC 4RR3C 3TN93 1X36A 5DDJ3 4YVSC 1FPN3 4Q4X3 4N53C 1QJZA 1AR71 2HWB2 1PGW2 4IV1A 5J96B 5DDJ1 4CDXA 3JB8A 1FPN1 4Q4X1 3VBFC 4N43B 1NY71 2GSYA 3ZXAC 5BNOA 1AR92 1NCRB 4QPGC 5A33A 1BMV2 1FMD3 1ND2C 4RS5A 1VBC3 1AYM2 4WM7A 3J8F1 4GB33 5K0UA 5C4WB 5ACA3 4FTSA 4LLFA 1FMD1 4IV1C 2HWD3 2XBO2 1VBC1 3VBRA 4CDXC 1BBT3 4GB31 1Z7S3 5D8AA 5ACA1 1AR82 2VQ0A 2X5IB 1A6CA 1F2NA 1ZBE2 2HWE2 5BNOC 1FOD3 1HRV3 3NAPA 1Z7S1 3VDDA 4RS5C 1RUI3 5A32A 1HXS2 4WM7C 4RHV2 1R093 1NA1B 1QQP2 3VBOB 5K0UC 5BNNB 2RS13 1FOD1 1PGL1 4Q4V2 1HRV1 1RUI1 2RS53 4Y4YA 1HX6A 3CJIB 3VBRC 5AC92 4FSJA 1R091 5D8AC 2RS11 4QPIA 1PO12 1RUC2 1RHI3 1ASJ3 1POV3 2RS51 5ABJA 3VBHB 1MEC2 2RS31 3ZFGA 1NY72 3NAPC 2WZR3 3VDDC 1QJU2 4WM8A 1RHI1 1ASJ1 2XPJA 1AR61 1POV1 4IV3A 2IZWA 1ND3A 3JD72 3J8F2 2WZR1 1RUF3 3HAGA 4Q4W1 4Q4Y3 1SMVA 1C8M2 3VBSB 1AL0G 1D4M2 2ZAHA 2WS92 4QPIC 1QJY3 1RUD1 1PO22 1TMF1 4PDWA 2WFF2 5ABJC 1RUF1 4Q4Y1 5C8CA 3ZFGC 1VBE3 2MEV1 1R1A3 4RFT0 1QJY1 3ZFFB 4WM8C 2TBVA 3JBG3 5CFDB 1EAH3 4IV3C 1ND3C 1R082 4EJRA 1EV13 2BBVA 2R062 4CDUB 5C9AB 1RMU2 1R1A1 5L7OB 1TME1 1PGL2 1OOPB 2R072 3FBMA 1COV2 1NG0A 1K5MA 4PDWC 1CD3G 1HRI3 4YVWA 1PIV3 4CDWA 1AYN3 4CEYB 1ZBA2 4NWVA 2RS32 5J98B 1HRI1 1POV0 3ZFEB 4RR3B 3TN91 1BEV3 1AR62 4YVSB 1MQTA 1PIV1 4CDQA 1AYN1 4N53B 1B35A 1RUE3 1VBD3 2HWC3 5BNPA 1IHMA 1VBA3 3DPRA 5LK7B 2ZZQA 1K5MC 4Q4W2 1BEV1 3VBFB 2RR13 5JZGA 1RUE1 1RUD2 2RMU2 2HWC1 1TMF2 1AL23 4YVWC 2DF7A 4CDWC 1VBA1 1RUG3 4QPGB 1QJX2 1NCQA 1M06G 1ND2B 2RR11 1V9U3 2MEV2 2FZ2A 2GH8A 1RVF2 1MQTC 4CDQC 2R043 1B35C 2ZTNA 5BNPC 4IV1B 2HWD1 3LOBA 3DPRC 1PVC3 2BFUS 1TME2 1BBT1 1RUH3 4CDXB 3VBUA 5JZGC 2RM22 2HWF2 5BNOB 1PVC1 2PLV2 2BPA2 1NCQC 3JD73 5A33B 4GMP3 1VB2A 1H8TA 4RS5B 1RUJ3 1AR72 4WM7B 5K0UB 4GH4A 3TN92 5DDJ2 4GMP1 1FPN2 4Q4X2 5CFCA 1VRH3 3VBRB 5FOJB 5D8AB 3VBUC 3IDEA 4JGYA 4JGZA 4RQPA 1OHFA 2HWB3 3NAPB 1H8TC 3VDDB 5A32B 4FTBA 1FMD2 4GH4C 1VBC2 2HWB1 1PGW1 5FMOS 1RB8G 4GB32 1AR93 5ACA2 5CFCC 2FZ1A 4AEDA 2HWD2 4CEWA 4QPIB 1AYM3 1BBT2 4JGYC 2BUKA 4JGZC 1Z7S2 4RQPC 5ABJB 1BMV1 3ZFGB 1VBE1 2XBO3 1FOD2 1AYM1 3JBG1 4WM8B 1HRV2 1EAH1 4IV3B 1AR83 1ND3B 1RUI2 1DDLA 1EV11 1ZBE3 2HWE3 2XBO1 1R092 4GMP0 4N43A 2RS12 3S6PA 4AEDC 2BFUL 5C8CC 2WLPA 1AR81 4CEWC 2RS52 1HXS3 1NCRA 1ZBE1 4RHV3 2HWE1 4PDWB 1QQP3 1F8VA 4Q4V3 1RHI2 1ASJ2 1WCDJ 5C8CB 4NWWA 5C4WA 1HXS1 5AC93 1QQP1 2WZR2 4Q4V1 1PO13 1RUC3 5GKAC 4N43C 2X5IA 1VBD1 5AC91 1MEC3 1VBB3 1OPOA 1QJU3 1PO11 1NCRC 1RUC1 1RUF2 1E57A 4Q4Y2 1K5MB 2Y26A 1QJY2 1MEC1 1VBB1 1AL21 4YVWB 3J8F3
chains in the Genus database with same CATH superfamily
2GC0A 4JVAA 3BYWA 1QJU1 5JIAA 2XJQA 3WX5A 4CDWB 5C4WC 2VU9A 3LGRA 3DECA 3EB7A 1F35A 1C8M3 1JUHA 2WT1A 4BMBA 4XACA 4XUQA 4BB3A 1V9U1 1D4M3 1GQHA 3I2JA 1I5PA 5FYCA 1PO23 2VQUA 3ZR6A 2A6XA 1CIWA 4BIFA 4AYUA 1GNHA 3I49A 1OLME 5JIUA 2WFF3 5FMCA 4CA9A 2A75A 3OBRA 5F5AA 2YC4A 5L9VA 1W8FA 3CJXA 2Q8EA 2BOJA 4G3YC 3ES1A 1RUH1 2BGPA 3BPZA 3THCA 5IVEA 4UFMA 3ROUA 3EQEA 3BOPA 2VBDA 2WABA 1SLCA 5F2SA 2W1QA 3MZHA 3ES4A 3T3YA 4IESA 3BCWA 4QB2A 4TSVA 3OEAA 1NA1C 5BNNC 1HRI2 1G9FA 1VAKA 2FDFA 4YPJA 1HQNA 1NOVA 2HLEA 2R073 1Y9GA 1PIV2 1WBFA 2HH9A 4FBFA 3M8LA 3RS6A 4XABA 3UV9A 4ASLA 4R9DA 1G9DA 1YQ6A 1BZWA 1TG7A 2W0XA 3ZLIA 4NHXA 2V4AA 5I8SA 5FYBA 3VHNA 1FT9A 1XSQA 3AYDA 2ARBA 4EN0A 3ZYPA 3MLLA 1BEV2 2WN3A 3C2UA 4MGQA 2VVEA 3GZEA 1STMA 1UIJA 3T2TA 4AFCA 3VBHC 1COV1 4PLOA 4QHZA 2B9UA 4XAEA 3MW2A 2HWC2 4CUAA 2XH6A 1MS3A 3D4KA 3KB5A 3TRSB 4BYYA 1VBA2 3H9AA 1W39A 4OCTA 2WC2A 4BLIA 2E26A 2BYVE 5CFDA 1N1SA 1X33A 2K9ZA 1UKRA 2DCYA 4WVMA 2YMZA 1H30A 4NUBA 1O91A 2NYYA 1VBB2 4XJUA 1W8UA 4MV2A 3OGSA 4KMQA 4E8DA 1H8TB 4Y22A 2ZMLA 4LEJA 2LTNA 1O4TA 1OOPA 4J6GA 4PIZA 1H1IA 3N7KA 4TN7A 3VGIA 4I2OA 3I97A 2VTXJ 4QX7A 5C71A 1C8NA 5GALA 1IPSA 5EWSA 3MHZA 5FQ0B 4XVHA 2R042 1ODNA 1QJX3 4FTEA 1UYPA 3QOPA 1KRIA 3O1PA 2MEV3 1ZA4A 3H3UA 4MO3M 4QT6A 2BWCA 3N36A 5DMYA 4OLLA 2ZHNA 2DBIA 1OLQA 4MXWB 1OQEA 2OUJA 1UPIA 4K7JA 2EXIA 4N53A 1W2AX 2ZGQA 5LA1A 1TME3 1SQ4A 3MLJA 2QQMA 4QX3A 1OC1A 1W03A 1W0PA 1BXHA 4W50A 1J58A 1TEIA 4JQTA 4LUMA 2RM23 1V6MA 4QB1A 4YLZA 4UBGA 3V65A 1HB4A 5GLVA 3RZGA 4CRQA 2YG0A 3WP4A 3U10A 4TLFA 3WXPA 1WLWA 3W20A 4CEWB 2A3XA 3MEPA 1OUSA 5JPMB 2WZPP 1XQNA 1G86A 2PTMA 1XOYA 2D3SA 2D7FA 2QQWA 2RDNA 5FZBA 2E9QA 3E5QA 3CZUA 3W58A 1FPN3 3SXWA 1W6QA 1T2XA 3ZDVA 4E9KA 2EALA 2G9FA 2GNTA 4KBZA 2R16A 4ARXA 5I0DA 3AVRA 3KT1A 2A73B 3VBFC 3O14A 3S30A 3LWCA 2VL4A 1W06A 1ULCA 2BRTA 2F6BA 2JG9B 1QMJA 4ZONA 4KNCA 4MLOA 5FP3A 1WCKA 2WN2A 5FK7A 1NCRB 4E2SA 2EAAA 5A33A 3VD3A 3WP5A 3AP9A 1FMD3 1ND2C 1U12A 2W46A 1GQGA 3GNEA 2XL7A 5DUXA 1AYM2 2UURA 3GBGA 3MV01 4WM7A 4EWDA 5JOXA 2VOXA 5A6ZA 3K51A 3N4MA 2WZEA 1E5IA 5ACA3 4FTSA 2Y6GA 1O4YA 2JDUA 4P00B 3UESA 4W6WA 1T6GC 2HYKA 1GZWB 3B93A 2XBO2 3LSEA 3N3HA 4IGPA 4IV1C 1UWWA 5FCCA 5A3WA 4CP9B 4MADA 5JPNB 5J36A 4CDXC 2PHRA 3LA2A 5LB6A 3TB0A 1Z7S3 4MGKE 2WNOA 1AR82 5CKQA 4LHKA 4S2HA 2ERFA 5LRSA 4LR4A 4A7KA 3NJZA 1JI6A 2DYCA 3ZXLA 2WAAA 2XG3A 4Y24A 5BNOC 2A71A 1FOD3 4D6SA 1JZ2A 3PMSA 1LHWA 4N9IA 4COUA 1OKQA 1W8OA 2VZ1A 3NAPA 1YEWA 4V2VA 2ZOEB 4RS5C 4OYUA 1Y9QA 2DTYA 1YWKA 1PNGA 3KHBA 1S55A 1J3RA 4IEUA 4P5YA 1CWPA 1ZA7A 2XMLA 3APBA 1KS5A 3VBOB 2RS13 3HT1A 1PGL1 1OH4A 2DU0A 3OOXA 3LA7A 4HANA 4Z2AA 1WLCA 5JMCA 1RUI1 1V0AA 4OZXA 2EXJA 4Y4YA 5FO9B 3CJIB 3DYPA 5I0RA 5GZDA 3RYPA 3HOBA 4FPGA 5D8AC 1IG3A 2VZSA 5FZCA 1J1TA 4BE3A 1BLZA 4FQ4A 1ZZ8A 2E63A 4OHWA 3IMMA 1NE6A 2JG8B 1MS8A 5B4NA 3ZFGA 1LOCA 5I93A 1DYPA 2WZR3 1UX7A 2A5ZA 1OVPA 3MF6A 4AAPA 4K40A 1OA3A 1RHI1 4HOOA 2Z79A 3THDA 3O1TA 2IZWA 5SV5A 2JWPA 2PHFA 1ND3A 2VG9A 2RHPA 1NAEA 1XBFA 2Y6KA 3J8F2 4ZU7A 4XXPA 1W8WA 1U5IA 5EIYB 3GCWA 2CGPA 3OGRA 1EYBA 4LITA 1LOFA 3J4UH 3LZZA 4A45A 2WS92 4QPIC 5JXGA 5KXCA 4XF1A 5LWBA 5A7PA 4YGDA 3E1F1 3DYOA 2WINB 4PDWA 1F4HA 3N9QA 2ZGNA 5F7UA 3I2OA 1W2UA 4R8HA 5ABJC 3O1SA 4P02B 1UXXX 3E6BA 2XR4A 2CU5A 2Q0AA 1VBE3 1KITA 1OI6A 2CWSA 2MEV1 3PJYA 4M3CF 1W6NA 4WVWA 4UOJA 1VPHA 4MVTA 5DZEA 1ZVFA 2P3YA 2ZGKA 2TBVA 3J9SA 5FRAA 4D6RA 4D7SA 5F1RA 1EAH3 4IV3C 5FYUA 5HV4A 1ZZ9A 1R082 2Y6FA 1C5IA 2ZMKA 3BPSA 4EN8B 2JX9A 2P37A 3N35A 3MI8A 2QQUA 3MIEA 2R062 3FHAA 2Y6LA 4BQ4A 2W2IA 5L7OB 1TME1 5FP8A 2FBEA 1A34A 4PLMA 5ISLA 3ACFA 4H7LA 3FBMA 2ZHKA 4LOSA 2WRAA 3U11A 3UJQA 3K46A 2V5DA 3DCQA 4D8MA 4MYEA 5A6XA 1Y7BA 1SBDA 2PHTA 5FZDA 1S0IA 5I0TA 1LECA 2PAEA 3OJBA 3GALA 4PJYA 1OA2A 4FFIA 5FZ7A 1JYVA 1OLMA 2V5YA 4GKYA 2Q30A 3BGAA 4DUXA 1DGRA 1OXCA 4YVWA 2GH2A 1ALYA 1XC6A 3B7MA 3VHOA 3WW3A 4GJZA 4L9BA 3LPFA 3ZYRA 4CEYB 2CGOA 3LD8A 3KD4A 2VJXA 4RFRB 2Y34A 1W2OA 2RS32 5T54A 2BWAA 3IM0A 3R4DB 1HRI1 1QJEA 2Y33A 2W95A 4QQPA 1X7NA 3OBZA 5GZGA 4MGTA 3QH6A 1AR62 1PIV1 4CDQA 3PTYA 2J1RA 4LUKA 2RJLA 4NROA 1RUE3 1OLRA 3ZKUA 4AQSA 1VBD3 4FCAA 1W8NA 4IEVA 2ZX1A 4LIUA 4P9XA 5M0TA 3RDIA 3TOJA 2FHRA 1W04A 1HQLA 2XQXA 2RDRA 3DPRA 4JKMA 3ZSMA 3VD5A 4DIQA 4XJWA 1PK6B 5LK7B 4NHMA 2XHKA 1CX1A 4CXWA 1BEV1 3K48A 2P3IA 2HKXA 2WNVA 2EAKA 3VL9A 4OFGA 3NNMA 2RMU2 2VM9A 2HWC1 1TMF2 3C7GA 3JXSA 4GALA 3N7MA 4E4HA 2D5HA 5CISA 4QM9A 5J48A 1VBA1 2WO2A 5FUNA 2BVBA 1KXGA 2VVFA 4QPGB 4XXAA 4B7KA 4B4PA 1MPXA 3DEMA 1SFNA 3OY8A 3WNNA 2EICA 3VKNA 4YM3A 2DCZA 5IVJA 1O8SA 3A22A 1RVF2 1IPKA 4XETA 2WYSA 5L19A 5FDBA 1B35C 2D6KA 3IKWA 2ZTNA 2A6YA 3HPNA 1PNFA 3ZOIA 2DFCA 4QU1A 1YQCA 3TEXA 2Z5WA 3LOBA 3OCPA 2WT2A 4FFGA 4BQ1A 3DXTA 3R0RA 1NQJA 2ATFA 3WHUA 3AP6A 5FFOC 2UY9A 3O0VA 1MS0A 4EYUA 3G6JB 3RMYA 2OVUA 3H42B 5T55A 4DO0A 2BPA2 2VXRA 5FP9A 1DQ2A 2E53A 4GULA 4HSJA 4XYXA 3BUCA 3VZKA 3ZSEA 3NWKA 3NRUA 5D2AA 4KU7A 5DN2A 5EYXA 3QLQA 4X8NA 1AR72 2ADEA 4LJHA 1AX2A 2QBXA 5EXOA 3PURA 5K0UB 2XVGA 1IS4A 5HPOA 2VZVA 5DDJ2 1J84A 5DAWA 4M4PA 1XE0A 1VRH3 5FYVA 5C3QA 5F3IA 3WEZA 4AVCA 3I2FA 1JYNA 1RUNA 4MGSA 3VBUC 2PMWB 4YZ1A 4AHYA 2NM1A 1CONA 3U4XA 4JDOA 1HV0A 4YSFA 4H14A 4LKSA 3T1MA 1C57A 5AVAA 3UKNA 2B5HA 3DKWA 5F37A 3VDDB 1JUIA 5A32B 3O1OA 2W5FA 2VNVA 5JXIA 2VUAA 3MO4A 3WOGA 1VMHA 4XDPA 2F4LA 3ZXEA 1VBC2 3PJQA 4IEYA 1RB8G 3M3OA 4YG6A 2BQPA 4GB32 1R1ZA 2ARCA 4OULA 1SZBA 2AEYA 2ZZJA 3KWVA 5CFCC 4CUBA 3M1HA 3SC7X 5A3NA 5C8WA 5T5JA 3WNPA 1SLBA 4MGYE 4PQQA 3IZOA 1BBT2 4JGYC 4JV4A 4XZPA 4AGVA 5BXXA 2ZX3A 5IVCA 3ATGA 4AI8A 3WQ7A 4XAAA 2JE8A 5SV8A 3T0AA 2E33A 2V09A 4FOVA 4MXVA 1VBE1 3KF5A 4AGGA 4QDQA 1OSGA 1AYM1 2HEYF 3Q8BA 4WM8B 1NT0A 3IDBB 3Q8CA 5FK8A 1EAH1 3FE5A 2A7AA 3URFA 5FLIA 4X8PA 2Y6HA 1DDLA 1JU4A 2XDVA 2ADDA 5IK5A 4OVEA 2HWE3 1JYIA 2KM2A 2GMMA 2XBO1 1R092 1UZ0A 5DAQA 2A6WA 5J3UA 5JI9A 3PVBB 4AHXA 2K0GA 3S6PA 3GZAA 4AEDC 1JXNA 1XRUA 3JQWA 3LIGA 3WQ0A 4R9BA 1AR81 2JDPA 1HXS3 4AFDA 3MIDA 1F8VA 4XCAA 4XCBA 2C9KA 3I3EA 4Q4V3 3THPA 4W6YA 1ASJ2 3MYXA 2ZACA 4O65A 5C8CB 4KGGA 4QHOA 4JCKA 4NWWA 2MNGA 5C4WA 5AVPA 4AVBA 1W0OA 3MIBA 4C1WA 4FVVA 1IQAA 2ARAA 3FBYA 2BJSA 5FP4A 4JHZA 1PO13 1RUC3 5A1LA 3FWEA 1JYCA 3RJRA 3HWJA 2P2KA 4W4ZA 3FJSA 5FR3A 4IE5A 1KQRA 2AR6A 2H0VA 4FI9A 4N43C 1VBD1 1X50A 4JHTA 1MEC3 1O3SA 2ZGOA 1CZSA 3IIIA 3POIA 3SCHA 4RYDA 2NP0A 4IEXA 4AI9A 1QJU3 2PFWA 3RGBA 3WNOA 1YNAA 5GM0A 4DOUA 1RUF2 3EJKA 4Q4Y2 3RWKX 2YC2A 2P3JA 3AKSA 4LQRA 3WQBA 5GLTA 1QJY2 3D8CA 3LOIA 5F39A 1UOFA 5CBLA 1NA1A 1N3PA 5BNNA 4H7MA 4XBLA 1W99A 2GU9A 2VULA 4META 2QZ2A 1DQ0A 4AF9A 1HDKA 3Q8FA 4EROA 1GLHA 1KDMA 1R1A2 2CNAA 4QX5A 2JDYA 5FJKA 4BM8A 5KR7A 3POBA 1IQDC 3EO6A 3JBG2 3M3IA 3N9LA 2PELA 1MQTB 4LA3A 3LEKA 4Z8BA 5IVFA 2X5IC 1PZ7A 4JTNA 1P8JA 4Y33A 5BNPB 3WW4A 1ENRA 2WS91 4EQVA 2XGXA 3VBHA 3RYRA 4GZ9A 3ZN5A 3W59A 4GAZA 1CAWB 5F9TA 4MX3A 2ZX2A 5JZGB 2EIEA 3ZYFA 4IGOA 1FNZA 1J1LA 2AENA 4OUMA 2E31A 1CR7A 4QU2A 4MHUA 2P34A 2RJ2A 4LBKA 2B46X 1NCQB 5F3GA 1TE1B 1ZREA 5KHHA 3ZXJA 1ONAA 1R081 2XJVA 4MSVA 4XJ9A 3OGJA 4CXYA 1COV3 1K45A 2K46A 3IPVA 5KC6A 2R061 2D98A 4AW7A 3B9IA 1G7YA 2OPWA 5KXDA 2DCKA 3HBKA 4NPRA 3AKPA 5JAXA 4QGLA 3FHIB 3NL1A 5LY2A 3KF3A 5FZIA 4JRAA 3U1XA 1VRH1 3WR0A 4BH9A 1YRZA 2ARXA 2WO1A 3MDPA 3W5MA 2C6SA 2XB6C 3DV8A 4KWKA 3PUIA 3GXUA 4RD7A 5D1IA 4URAA 3I2DA 5A7QA 1QDCA 1UNBA 3VB9A 2F4PA 3F2ZA 1ULFA 1FATA 2FQPA 4I30A 1PVXA 1E5HA 3K4DA 4NPLA 3WF4A 1BKZA 5JVVA 3RI8A 4HL0A 4OUSA 1DYOA 4Y5SA 1YJLA 1MS9A 1OFNA 2QQKA 2O8QA 1O4ZA 1RUG2 1SDDB 3BKZA 4LPLA 2BEOA 1W28A 3VBSC 5FZOB 5CAZA 1CAUA 3HN1A 2G9ZA 4GH4B 3RZMA 4DRVA 5IK7A 4CCJA 4JKLA 3U14A 5FPVA 1RYYA 1UW8A 3TBDA 4AXOA 3AMHA 2EIBA 3I3MA 1WD4A 3MIFA 3V0BB 2VCMA 4OHXA 3MIHA 5EFUA 3HNBM 5ANNA 5EP9A 4YW3A 3T08A 2RMU1 3ZFFC 3O5SA 4IERA 3NV4A 1S1AA 1W90A 1FXZA 4RGAA 4XBQA 1UOJA 4I3GA 4JGZB 3BN6A 5JSPA 4RQPB 3K4ZA 4AEKA 1L7QA 4HVRA 1YIPA 3KGLA 1XJAA 4LMFA 1YQ5A 4YM0A 4CDUC 1OMIA 4IEQA 5T50A 5C9AC 4XQ4A 3S7EA 4AFAA 4E2QA 3OPZA 1N47A 1RVF1 5D21A 3ST7A 1TNRA 3PUHA 2Y38A 1XNBA 1GWLA 2CL2A 3UYJA 1RUJ2 3ETPA 1VR3A 3FL7A 3VBFA 1XNDA 2X8KA 3I4IA 5K8SA 2RJKA 1W6OA 5BV6A 4PI0A 3V0AB 4AI2A 3MF9A 1I5ZA 1UOBA 4YW7A 3C8XA 1WCQA 4FPFA 4LT5A 1W05A 3B9CA 3CMGA 4ZXKA 3USUA 4E4DX 1F15A 1ND2A 1C4RA 5IW0A 2P6HA 1OD3A 2WO3A 3FUOA 3LB9A 5A1FA 3BIEA 3ZFEC 4RR3C 2DFBA 1X36A 1QKQA 3PTRB 2J1UA 2ET1A 4KWLA 3TN93 5JR2A 4YVSC 1JYTA 1JZ3A 2WNUB 1FNYA 2RV9A 3WNLA 1PM4A 1LKNA 2YGLA 3MFCA 1AR71 2HWB2 1UMHA 1NXMA 3WVJA 1LTEA 2QDNA 4IV1A 4B8EA 1IG0A 5J96B 2ENRA 5C33A 3GF6A 5F5IA 4L92A 5DDJ1 4CDXA 3JB8A 4Y20A 5KXEA 5L73A 1QDOA 2NZ9A 4NMIA 4W6XA 2FDGA 3AMPA 2FCVA 1NY71 1SLAA 2XONA 2EIGA 2WA4A 4BOWA 1Z0HA 3ILNA 1AR92 4FFHA 5BNOA 3RZHA 2YBPA 2JXAA 3GJAA 4A6SA 5FMBA 3RPQA 3ZXKA 1DGWX 4RS5A 3ZMNA 2J1VA 3KZ4C 5GZCA 1D2QA 3PIJA 3G7DA 5FPXA 1J3PA 4MHRA 1DHKB 1H2MA 1YYNA 3LEIA 4LLFA 5FY1A 3H8UA 2UWBA 2CV6A 1VBC1 4PHZA 1UD1A 3SEPA 5GJ6A 4GB31 4HK9A 4S2DA 4EN7B 5D8AA 1UY3A 2VQ0A 2JD4A 2W68A 1F2NA 3TEZA 3AX4A 3AL5A 3U4SA 4ZS2A 2JENA 2YGMA 3GDBA 5FO7B 1F31A 1H2KA 1LGBA 4UBHA 2C4XA 3VHPA 1ZX5A 5A6YA 3RI9A 5DG2A 1W9SA 1RUI3 5A7NA 4XC9A 1FAYA 1SLTA 4YGCA 4MH0E 2Y6JA 2JD9A 3WSOA 3T0DA 1SPPA 4RHV2 4HZFA 3JCIA 4GQ7A 1QQP2 1DCSA 4IQPA 5E88A 4EN6B 1UU6A 4FPKA 1TQ5A 1XYPA 3DXUA 4N90A 5FTTC 2P4EA 1YC61 3LE0A 1YIFA 3OPTA 3VBRC 3RQ0A 4CU6A 3KGZA 5AC92 2F17A 1R091 2BNNA 2UYBA 1HW5A 3CHXA 4A41A 4QPIA 5FXVA 1RHI3 1OKOA 3BI3A 1OVSA 3HEIA 4URTA 5FP7A 5IAXA 5ABJA 1QHDA 2FMDA 2BW8A 4QGNA 1CAVA 4CCKA 4BU2A 4COZA 3HT2A 3TNQA 4MUVA 1ASJ1 2CDPA 4WZCA 1POV1 2R0HA 2WQ4A 4IV3A 4XUTA 3IAPA 2D3RA 4AWDA 4CCOA 4CZSA 4DNYA 1S0BA 4DY5A 4CCNA 2OXBA 4NR1A 5FY9A 4PIXA 4CE8A 4W65A 1WGPA 2JDMA 3VUOA 5L9BA 3WNMA 1YJKA 5JWPA 1W9YA 1AL0G 3KQ4B 4QX1A 2VZ3A 2XKPA 2W94A 2VOTA 3A23A 1UL9A 1S0DA 2QE3A 1FX5A 2VY0A 3ZKYA 1REEA 3ORJA 2WJSA 4L2NA 1HB1A 4M0HA 3ITQA 1IS6A 1RUF1 4E8CA 4Q4Y1 1BHGA 1UZVA 3PUQA 5FZ4A 3A0NA 3QD6A 3UT0A 1QJY1 3LDKA 4ZZ5A 2QDRA 5A3UA 2C9AA 2ZEYA 3L2YA 5CFDB 2W1SA 3BALA 4WVMB 2X05A 3WUDA 4EJRA 1QXPA 3J7HA 2BBVA 4AVTA 4JC1A 3M4FA 3WDUA 4UAPA 2IXJA 1RMU2 5A3MA 1R1A1 4NN0A 4Y22B 5K4LA 4K8FA 1QOTA 1OOPB 2JIJA 3NKGA 1ZZ7A 1WW5A 4P9LA 4Y1XA 3ON7A 5FKCA 4AOCA 5K7PA 2GN3A 5KXBA 2CAVA 3BTXA 1JW6A 2VOKA 1NG0A 3WDYA 1D0GA 1SCSA 4HPKA 2I07B 1D2SA 2WQ8A 4YW1A 4XFAA 1KFXL 1HRI3 1OQ1A 4FPYA 2ORZA 3ACHA 1KDKA 3POJA 5GLUA 2VTFA 3CBNA 2OKXA 5A70A 1PIV3 2D5FA 4YG3A 1ZBA2 2PQSA 3IWZA 5LA2A 4D94A 4NWVA 5J98B 4OQ9A 1NE4A 3WLUA 5DABA 2RE9A 2ZEXA 4ISQA 1APNA 1CIYA 4BWOA 4EV0A 4K1YA 3TN91 5JLVA 3POWA 1BEV3 4AZZA 3ZSLA 1KJRA 4N53B 4R52A 1B35A 1WMXA 2HWC3 2OX0A 2P5BA 4PLNA 3UKTA 1AJOA 1HV1A 4P08A 1VBA3 3PU3A 5F5CA 3NNGA 2ZCWA 2ZZQA 4JDNA 1K5MC 4Q4W2 1UZZA 1PGSA 1YLLA 3MW4A 4CP1A 4LLOA 1GNZA 5BYNA 1GWKA 1T6BX 1PZ9A 1RUD2 4I0WB 1CVNA 1EP0A 1PHMA 2Y60A 4AQ6A 2YU1A 1PMIA 4CDWC 1Y43B 2P3KA 3O7OA 1F4AA 4I0BA 5FZ0A 2PHUA 1M06G 1VAVA 2G1MA 4PBOA 3A0KA 1VALA 3KV5A 2IXCA 2VUCA 3KVBA 4XPVA 5FREA 4LO8A 5GLZA 1BK0A 4LKFA 4NRQA 5EYYA 1XNTA 1ZRRA 5C5TA 3HBZA 3TYJA 2R043 3WQ1A 4A4AA 1W6QB 1SBFA 2FDHA 3IDCB 4HKLA 5DUWA 4A7YA 1Q8OA 3I2HA 3FFZA 2XJTA 2Q8CA 1MZ5A 4N8MA 4KBBA 4BISA 1CQ9A 3AFGA 2I2SA 3VBUA 3NV1A 2ZBJA 4IEOA 4A3XA 1BVP1 5IK4A 3S57A 2VNRA 2HWF2 2ORXA 1W3XA 2PLV2 1UYZA 4L8QA 2X09A 3JD73 5A33B 2VECA 4V2WA 1VB2A 1DGRN 4UFHA 1UQXA 2ZGMA 2ZKNA 4JDMA 2Z69A 3ABZA 3AKRA 4WM7B 1I1EA 5DG1A 2DDUA 4KQ7A 4YM2A 2UWCA 3S0MA 4UWDA 4GMP1 3MFAA 5CG9A 3CIHA 4Q4X2 4A2UA 4IE4A 5CFCA 4BQYA 3W21A 5IFTA 5FOJB 2KA3A 3HMYA 1V6KA 2PAMA 4M3CA 4TTGA 4QXKA 3KV6A 5I0UA 5FKBA 2WWJA 4LHNA 3WZ1A 4JGYA 1IOAA 3FHQA 2PAKA 4AAXA 2G4IA 3O1VA 2EXHA 1O8PA 4U36A 3NAPB 1LB2A 2ZHLA 1NZCA 1HJGA 1H8TC 2AYHA 4WVZA 3VLBB 5HCAA 3NKTA 3ZPOA 1W6MA 4K8RB 4B4QA 2J1SA 2YXSA 5FPLA 4B4RA 1GANA 5GZEA 2HWB1 3D82A 4DQAA 1XYNA 2IVIB 3R05A 3VHRA 3I59A 4Q29A 1LOGA 3O1MA 4AEDA 5AFBA 2HWD2 3H3LA 1H6YA 1K12A 2ZX4A 5FPAA 1AYM3 1VRBA 2N7GA 2W1UA 4YARA 4DUWA 3ZVXA 2JB8A 4O9GA 2BUKA 1NYWA 2G9GA 3I3QA 1BYHA 5FYMA 3OYWA 2OPKA 3VZJA 4CTEA 3ZFGB 2XBO3 5G04L 3ENRA 5DUVA 1KFUL 5FUIA 2BP6A 2B39A 4ARYA 3AYAA 1HRV2 4OI4A 3P3PA 2OYZA 2QQJA 1E5SA 4XUPA 1AR83 1ND3B 1UCXA 1HJFA 4UW5A 1LODA 3VZOA 4AFBA 4OMDA 2IXLA 1ULOA 3ZN4A 4N43A 4LNVA 1GMMA 4L0PA 3DUIA 4AR2A 2TEPA 4B3NA 3KT7A 1DZQA 4G4FA 2TNFA 2RS52 4CEWC 4YZ4A 1CJPA 4KI5M 4UW4A 5H9QA 4CUGA 3B01A 4PDWB 4UF0A 4YW5A 2YY1A 1SHWB 3IBMA 5DXDA 3J7MA 3NV3A 5C3RA 1LU2A 3NV2A 2VTXA 3H8XA 1VMFA 1W6NB 3T2PA 5JUVA 2IVJA 1Q56A 4YNIA 1H8VA 1D0HA 1H4HA 2J1AA 4UFKA 3RVHA 3H8RA 1QQP1 2VGDA 4FFFA 4HLTA 4LBQD 1MZFA 3VKLA 1YFXA 4K21A 5JXHA 1S0GA 3RJ2X 3CEWA 5FPBA 2X5IA 1BJQA 4J25A 4IDZA 3IMNA 2LM3A 3WCSA 5AC91 5C5UA 1K42A 2JG9C 4ORFA 1OPOA 2CSGA 4KU8A 2PHDA 2YDEA 3HQRA 2O14A 1NCRC 1XSRA 4O7XA 1E57A 1UKGA 2NPIA 3LDBA 4LO6B 2Y26A 4N7UA 4NRMA 1YCIA 4YG0A 4Q0PA 4IE0A 4RSUA 1VBB1 5FJHA 4YVWB 3J8F3 3X29B 2RDSA 1AHSA 4GIQA 1WW4A 3WDWA 2XJSA 2XQRA 3HD8B 3VDBA 1CESA 3C7HA 2I45A 3AZVA 1SEFA 2WS93 2PA7A 4A44A 3W9AA 5J1XA 3NVCA 4FXGB 1H9PA 2Q4SA 2GP3A 4CDQB 2R041 4D69A 2A6VA 1ULPA 2VMEA 3JB4C 1EV12 1WLTA 2B9VA 2D93A 1O3QA 5EHDA 4CU9A 1H2LA 3U0ZA 3DPRB 1U5YA 1OQDA 4F8AA 1CJDA 2AEZA 2YPDA 4TZDA 2CYFA 4RN5A 1AUYA 3WG1A 2WNVB 3RWNA 1R083 3WT3A 5IAVA 4LBQA 1I3HA 3GZTB 5FLJA 5HBAA 2R063 3VBOC 3K77A 4CU8A 5FZEA 2DUPA 2QQLA 2YFZA 5E6HA 4L97A 2VZQA 3M3QA 4Q0SA 2DUOA 3OY8B 3ME2A 4K9SA 1AYN2 3HJRA 4QKBA 4XQDA 3SCFA 1D4VB 1S0JA 2Q1ZB 3S5AA 3CJIC 3D3AA 4QKNA 3PVNA 3UETA 5JOYA 3VBSA 2PXJA 2YUEA 3THTA 4BK5A 1RMU1 2GALA 1XU1A 1GP4A 2H6CA 2VZOA 2YV8A 2YYOA 4QB6A 5EQUA 5IYYA 3ASIA 4ZKTB 4OI0A 2KXLA 4NHYA 5FWJA 1WCSA 1OT5A 2VMCA 4FPLA 1DYKA 3ZN6A 3VD7A 2G19A 2VW1A 3LAGA 2LUWA 2JG8C 2RS33 3H3ZA 2DU1A 4AEJA 4GD4A 4JKKA 4MGZE 1RJ8A 3MPBA 1ZZCA 4FO9A 4XF9A 3ZFFA 5F3CA 4WZFA 5JCTA 3NO8A 3QACA 5FO8B 1AR63 3UGGA 5I8TA 1CAXA 4PQ9A 2RR12 2IFWA 4XF4A 4OI2A 1ZBA1 1IS5A 1AL22 4LA2A 4BCUA 4CDUA 3WNXA 5C9AA 2DBNA 1QF3A 2WR9A 3CKHA 4I01A 3W5NA 2BVVA 3RG0A 4DXTA 3AKQA 3PIGA 1V9U2 4SBVA 4QM8A 4XMAA 3FC0A 3ZYGA 2RMU3 1TMF3 2ZGTA 3E97A 2PN5A 1GFF2 2E7AA 4LHLA 3JUUA 4CPBD 3E5XA 2J42A 4Y5Z0 1CN1A 3USSA 4XF0A 3NW4A 5T5OA 3WW2A 1H4GA 4QQLA 4K6BA 1PVC2 2VCCA 3D5OA 4NJ4A 5FZGA 5A7WA 1RUH2 5IVBA 1RVF3 1DLLA 4YYOA 1HB3A 1YFUA 2FCTA 4UXAA 3ZFEA 4RR3A 2AUYA 1HKDA 1EPWA 2EF6A 5FBZA 3LDRA 4Y1YA 4YVSA 4Q0QA 1NKGA 3NJYA 1V00A 2WAOA 3MICA 5EPAA 3JU9A 5L7OC 4Q1PA 4DUVA 4BIOA 3E6DA 2A70A 3VDCA 2VOVA 4ASKA 1OA4A 1YQ8A 3RZKA 5CKNA 4XFCA 5E8AA 3KS7A 3RSJA 5JSRA 5FAXA 2OIIA 2ZHMA 3AL6A 4Z92B 4YZ2A 4H3WA 4NAOA 4AQ2A 4NRPA 3WF2A 3SNMA 4CEYC 3FUQA 4YGBA 2Q8OA 1OD5A 1AR73 1QH6A 2QUOA 3EMRA 4LO4B 2XJUA 3AJZA 3QH7A 2JDAA 2HWF1 4YFWA 1LNSA 3ZYJB 1JZ6A 2PLV1 4LORA 4M00A 1SACA 4C1XA 3ZSJA 4DRRA 4ET7A 5DDJ3 5EV7A 5HCFA 4BQ2A 2VD7A 4GKXA 4YRDA 5C3SA 2QQOA 1ENSA 4LE4A 2FCUA 4CPBA 1QJZA 3SH5A 3VD4A 3WF0A 5CNAA 1C5HA 3GGLA 1ENXA 4DXZA 4BK4A 1U5XA 1W2TA 1DBNA 1PK6C 1W8TA 3AMNA 4Q4X1 5F32A 2RG4A 1UY4A 3T4VA 4FP3A 3KV9A 5DZFA 2GSYA 2DVAA 4R9CA 3U78A 1DGLA 1S0EA 4HETA 4HT1T 1SLIA 5FYIA 4QPGC 2DVBA 4I0AA 3CU7A 1AX1A 2HYXA 2ZMNA 4Z07A 3WP3A 5CKMA 1N3OA 2JECA 2VUJA 2QZ3A 1PMJX 1VBC3 2ZGLA 2JIGA 2NMOA 5LBFA 3RMXA 3J8F1 5EZWA 4GB33 3N9OA 1LESA 5C4WB 3AC0A 3B02A 1W6PA 1F9KA 3T1LA 3UL2A 1ZRDA 1WCUA 3HVDA 4P9IA 4OQ8A 1UYYA 4HONA 3LIHA 1LOAA 3BVCA 5EJ1B 3WNKA 3VBRA 1UZWA 1BBT3 1QOSA 4XTPA 3R6SA 3TEWA 3OUJA 4AI3A 2W1WA 5IVVA 1ENQA 5C6CA 1ZBE2 1RIRA 3P6BA 4QQHA 5FIXA 2XJPA 2ZAAA 1QEXA 1AXZA 4BA6A 1OH3A 4D7YA 2GMPA 2C26A 4LTAA 4COWA 3WF3A 1GOGA 3INAA 4DXSA 3KCXA 1R093 2VMDA 2DCJA 1NA1B 3QCWA 3WDXA 5L9RA 1UPSA 5A1AA 5BNNB 5K0UC 1POQA 5JI7A 1CPMA 5IJRA 1HRV1 1Q8VA 1QJFA 2VMHA 2EVXA 4V1PA 2JDKA 3H1MA 4MOAA 5LASA 2VW0A 1V6OA 4C8DA 2WIIB 2BBAA 4FSJA 4KGQA 2B7YA 1BVVA 5BNQA 5B4XA 1ASJ3 3WD5A 1GSLA 1POV3 2E7TA 1B09A 1UF2C 2RS51 1TVGA 3EXUA 1W0NA 2D97A 3VBHB 4PF5A 1RINA 1RXGA 2RS31 3AMQA 1O3RA 2BERA 2AREA 3VDDC 4TYSA 4AEMA 3O1UA 4HG6B 5I0SA 2XPJA 2R1DA 1AR61 3GZUC 1FV3A 4C0HA 4DS0A 5KHIA 4XIKA 3VKMA 2DURA 2E6VA 2R7EB 3JD72 5FZAA 4GA9A 3OSDA 1MS1A 4XILA 2AZ5A 4L11A 1RUF3 2V4VA 3HAGA 3IPVB 1C8M2 3NNFA 4Q4Y3 1C1FA 4WBBA 1XPWA 2I74A 3LPGA 4BHPA 1SCRA 1D4M2 1VAMA 3TWIA 1QJY3 1URXA 1LULA 2W52A 4GWIA 1PO22 1TMF1 3A21A 1DQ5A 4CP2A 1Y3TA 3HNYM 3SQOA 3IAQA 1OF3A 1LEMA 2WFF2 4FPJA 3ACGA 4O9EA 3D0SA 1JBCA 3KT4A 3MBWA 3TNPB 2P6CA 3FZ3A 4U2AA 1LJ7A 1R1A3 2OW4A 4WM8C 3JBG3 4P9YA 1GQPA 4JQRA 2B8MA 1CZVA 2ZGUA 3ZX7A 2DUQA 2D6MA 3OB8A 4UYBA 5E89A 2GC2A 3MLKA 4Y1ZA 4XEZA 4P14A 5FLHA 5IK8A 1H1AA 1DQ4A 2CHHA 3NJVA 1PGL2 1WMFA 1V70A 2R072 4GWJA 2HEVF 1CAUB 3AZXA 5FYZA 3O12A 2D3PA 1K5MA 1DG6A 1XYOA 4XHBA 1CD3G 4W8JA 3PVOA 2GP5A 3HQXA 4PCRA 2WBKA 3SISA 2Y64A 1QY4A 1XNCA 2ZPXA 2W39A 4CDWA 1UMIA 2EA7A 4DY3A 4CCEA 3GHMA 4XHXA 1AXKA 4KH9A 4NHLA 4QGMA 4C90A 2FDIA 1REDA 3JQXA 1DZTA 2QCSB 5FY0A 2VMFA 4DEQA 1AYN1 5LA9A 4HBNA 1BK1A 4RGKA 3SLIA 3ZPYA 1DLCA 4KG8A 2D6NA 3AMMA 5A3LA 2XL9A 4HN1A 3N9MA 1IHMA 2UWAA 3OUHA 3PU8A 1OF4A 1UY2A 1OURA 3P5BA 3VL8A 3B69A 1NX9A 1RL3A 2HBTA 2VCAA 3VBFB 2CAUA 1O5UA 1I6XA 2JDNA 4OZOA 1W6OB 1RGSA 5FOBB 1JOJA 4Z1VA 2DF7A 4IETA 1N1TA 3J7LA 3O0WA 1N3QA 2CTVA 4UFJA 1RUG3 5DAXA 2VNOA 1QJX2 5KBFA 4DEVA 1WBLA 2CWMA 3USUB 2QQVA 1ND2B 2RR11 4Q8LA 2D40A 2MEV2 2MHFA 4IEPA 2FZ2A 5FY4A 4XMIA 1ULEA 4KL1A 1MQTC 3AJYA 1MZ6A 3SKJE 3NSTA 3VZMA 1V6LA 1ZYBA 2J1TA 3OD4A 5DQ0A 4FOQA 5BNPC 2BU9A 2SBAA 2YBKA 2VZUA 4QKFA 4IV1B 4F7ZA 3AZYA 1MS5A 4UT5A 2SLIA 1JH5A 2BFUS 1TME2 1BBT1 1VJ2A 1YHFA 3OTFA 4Y20B 3K3OA 3SCGA 4CDXB 4P5HA 3OGGA 1PX3A 3ZIWA 4D6QA 1VLNA 5JZGC 1YFWA 5HI0A 5HCBA 3E6CC 1LHNA 2IUWA 4I3PA 2GNMA 2RM22 4LULA 2YBSA 1PVC1 5BNOB 4BXFA 4CVUA 1UN1A 4A7ZA 3LF7A 4QHBA 2VUDA 1NCQC 2WSUA 4YFZA 1SLLA 4GMP3 1RTVA 5IHRA 3BTYA 4XUOA 4DFSA 5T5LA 5L36A 1O3TA 1H8TA 1LRHA 4RS5B 2HEWF 2IC1A 4HKWA 1RUJ3 2B42B 3B5LB 3N9PA 1TNFA 4AGRA 4Y1VA 5T5PA 1JN2P 1SFYA 4C91A 3SH3A 4MG2A 1FPN2 5FBJA 5FQ0A 3POFA 4DB5A 3DN7A 1Z78A 3MW3A 5LEKA 1LCLA 3AZWA 3KCCA 5ANQA 2NMNA 4LBNA 3I7DA 3NMBA 1YI7A 3I54A 5J09A 1VP6A 1EUUA 1XE8A 1LHUA 5D8AB 5FZKA 3EBRA 2IXIA 2QKDA 3GYDA 4QKDA 5IFPA 3PUSA 4BLJA 5A6QA 2FD8A 5F6LB 1UO9A 4MXWA 5LEJA 1GKBA 3T0BA 1OHFA 1WMDA 4H2AA 2QQNA 2HWB3 2XUEA 2X29A 3VZNA 1US2A 5IWFA 5BUVA 1LGCA 1N1YA 1WUVA 2BTVC 4LIVA 3QBQA 1SPPB 5E1RA 4BDVB 1S0FA 1PZ8A 2PHWA 4FOYA 1FMD2 3MPPG 1L7LA 4IUGA 1QIQA 4GH4C 5DAVA 3K2OA 3E5UA 4ITCA 1JZ4A 1G9CA 3VN4A 4Q26A 5FMOS 2OQ7A 2BGCA 2ET7A 5JR7B 3KQRA 4YWAA 5A7OA 4Q5OA 4PF1A 1AR93 4ZPIA 3OD0A 5ACA2 2VMGA 3FMGA 1Q5OA 1JOBA 2D6PA 4MZUA 4CSWA 2NLRA 2O8OA 4CEWA 4QPIB 1KGYA 2Q8DA 1YQ2A 2XOMA 4ZY9A 1C1LA 3SHRA 3GJBA 3HN3A 4JGZC 1Z7S2 3O0XA 5DPNA 4AL9A 4RQPC 5ABJB 5CIRA 1CAVB 2CDOA 2E7QA 2XJRA 2AC1A 1FOD2 4E4ZA 1AJKA 3JBG1 1JOPA 3GBFA 5CA6A 1Q8QA 4IV3B 4JAAA 2H6BA 3BTAA 5FXXA 3PUAA 1UZYA 1JHJA 1NXD1 1UU5A 3HQUA 4N9HA 3SITA 2Q1FA 2DVFA 1WA4A 4BQ3A 2RS12 4XFBA 4FAHA 1WKYA 2BFUL 2JG9A 2VBBA 4AVSA 2YU2A 4S2GA 2LRPA 5HXMA 3LKJA 2VZPA 1NCRA 1ULGA 1ZBE1 4RHV3 4FAGA 3BB6A 1OFSA 1QQP3 2VMIA 4ZXEA 4LBLA 5HV0A 3OPWA 5FPZA 2D43A 1S2EA 4QX8A 1WCDJ 4B7EA 3WG3A 5F3EA 2WNUC 4GXLA 4NIAA 3I8TA 3L9JT 4CCMA 5AC93 2WZ8A 3P3NA 4CYDA 1GZWA 1L7RA 3OG2A 4CP9A 2WZR2 2ZEZA 3PMEA 2R32A 2Q5TA 5FZLA 1GYKA 4YGEA 4K20A 3SKVA 2EIDA 2GNDA 2QQIA 3B00A 3ZIXA 1IKQA 2VH9A 3AYCA 1VBB3 4Q8KA 5LZ6A 1NZIA 1H0BA 4NIHA 1S2KA 2W92A 3KV4A 4BPZA 2QFEA 1RC6A 1ZRFA 3ZM8A 4HPKB 3KM5A 3WDTA 2BNOA 2QNKA 4HVOA 3R4SA 5FWEA 2IWGB 4KWUA 2Z42A 4PBPA 4XDQA 3ACLA 3VD9A 2CY6A 2D44A 1EPZA 2VAUA 4LBJA 2VO5A 2VQTA 1JTZX 2ZXQA 3VBOA 4AQTA 3AYEA 1RUG1 4UI9L 4NHKA 4SLIA 3MGUA 2DWRA 4XJZA 4Y26A 3U07A 1VBE2 2QQPA 3TEYA 1DP0A 3T30A 4CXXA 3AKTA 3CJIA 4QQOA 3JD71 2AGSA 2YB7A 1WD3A 2WWSA 3B94A 3UJOA 3ALQA 4CU7A 5FMOL 1EAH2 2DV9A 4N7IA 1HB2A 4LE3A 5F6KA 3VKFC 1B35B 2WWUA 5KC5A 2QVSB 5B2GB 1C8M1 5JXJA 2ZJCA 4XJ8A 2Z4FA 4COVA 4DMIA 1D4M1 1W8HA 4ZZ8A 1RXFA 1PO21 2XVKA 2WUHA 1UX6A 2JG8A 2E51A 3A4UA 1VIWB 2WFF1 4H55A 1UU4A 2J1EA 4IGQA 3I2GA 4BQWA 5I91A 4I02A 3R4UA 3KLSA 1FYUA 1RMU3 4QXCA 5APAA 3H1WA 3K3NA 5FPUA 3LQCA 3N7LA 1YUDA 3ZXDA 2J7MA 5F2WA 1XB9A 4QDRA 3T2QA 1A8DA 3AB0A 5FYHA 4AG4A 1UXZA 1RUJ1 2Y0IA 1NLQA 3CDZB 1K5JA 4NIIA 4E27A 2A6ZA 3MUY1 2GC1A 1DQ6A 2VOWA 5H9SA 2XWBB 2R071 5BY5A 2DVDA 2QTWB 1LR5A 1A3KA 1ZBA3 4HN0A 1DGWA 1RUE2 3FLRA 3WY6A 3M70A 1AVBA 1VBD2 4M4RA 4DINB 1VB4A 1PM7A 2W08A 3VBUB 3NQHA 5GLWA 1KEXA 1N1VA 1OBNA 3RRDA 3V56A 2OA2A 3AP7A 4FPOB 1Q3EA 1XNAA 3OBAA 1J3QA 4J1WA 4EE2A 3ELNA 2XLAA 1UY1A 2RDQA 5EJZB 3OBTA 1J83A 4UFIA 4NVPA 1Y9MA 3EHKA 4QAWA 2ZS6B 5FZ6A 1QWRA 4E2GA 5J37A 5L7OA 4Q4W3 4AI0A 1ZNPA 1DFQA 3NNJA 1R64A 2R30A 3OEBA 1RUD3 1REFA 4P9WA 3LA3A 1NLSA 5LBBA 3PDQA 1AR91 2JKXA 4ISRA 5CFCB 5LCWL 2MPFA 1CPNA 3POGA 3IIAA 3ZR5A 3N7JA 1LOBA 1GOFA 2FMYA 4M3CB 4CEYA 1GOHA 1D7PM 1YXWA 3KMHA 1JHNA 1XE7A 4JGYB 4LOTA 5CFDC 5TSWA 1UOGA 3ZYHA 5F8PA 1QJX1 4ZS3A 2VBPA 1HN0A 1O6UA 1AXYA 3WDVA 2BGOA 4HSLA 3F95A 3RYKA 1GP6A 1NQDA 1OOPC 4EWEA 1W6MB 3ZYIB 2ZGPA 3AXEA 3ILRA 4Y1UA 2BOIA 5T52A 4CCLA 5IT6A 1A8MA 3S7IA 4DPNA 1JZ7A 1PK6A 1HIXA 3I3DA 3WCRA 3UGFA 2VPVA 2HWF3 3I2IA 1W8ZA 2PLV3 3ZO0B 1X82A 3POYA 4M0NA 3I59B 3KSCA 4AEDB 5CYYA 2DCTA 4B1LA 4D3WA 4ES8A 3WP6A 1X8MA 3DF0A 4Q0UA 1DF0A 2X53S 3BU7A 4QPGA 1VRH2 2J22A 2NQYA 5ERLA 1EY2A 1S0CA 2WO7A 4GJYA 4RHV1 4WVVA 5DZGA 2RM21 1MS4A 3NNLA 3ZYBA 5CADA 5BPXA 4BJ0A 5JSOA 4RA0A 4XFFA 1TZOA 3H1YA 2W91A 3DGTA 3OYWB 2JE9A 3M3CA 2R49A 4Q4X3 4AHZA 2IXKA 2PHXA 4EZ4A 4N53C 1FV2A 1VE0A 4XTMA 2BNMA 2YPJA 3EYPA 2KD7A 3U75A 1PGW2 1X8EA 2JE7A 2UU8A 3PNAA 1K3IA 4QMAA 5FXWA 1ZRCA 1S2BA 1VMJA 1US3A 4D0QA 5LA0A 2LW8A 4JZRA 1WA6X 1FPN1 3MV11 3MIGA 1G6NA 1I9RA 1QNYA 4N43B 4IXLA 4XJAA 2ETEA 2GN7A 4Q27A 4LXLA 3LCPA 4LBOA 2FDJA 4LBMA 2IFRA 2HJIA 3K75B 3ZXAC 3LSDA 4FP2A 1DQ1A 3AK0A 3Q8AA 1W9FA 3HR9A 4QXHA 5H9PA 4CCDA 5JOZA 4OHYA 3SMHA 1BMV2 2C24A 4TWTA 4UF0B 2GC3A 2PHLA 3CNAA 4D7TA 1MVEA 1QOOA 1O59A 2OUHA 1XXNA 4IEWA 1QU0A 2WKKA 5K0UA 4F3JA 1RUOA 4ATFA 2YZ4A 4FOWA 4QD2A 1FMD1 1RJ7A 2HWD3 3UNPA 1AZDA 1LU1A 2XLGA 2DTWA 4YW2A 5FZMA 2K2SA 5A3TA 4L99A 2LALA 5ACA1 2VR4A 4BXSV 2X5IB 1A6CA 5LRRA 5GZFA 4ATEA 2HWE2 2VW2A 4UFLA 3TAYA 1GR3A 1IZ3A 1MACA 3AXDA 4Z2WA 1HRV3 2VCBA 4HVQA 5CEHA 4PT6A 1CZTA 1Z7S1 3VDDA 2ID4A 4LK6A 3NJXA 4R4XA 4FQZA 1HXS2 5DAPA 1WW6A 2TUNA 5A32A 2WA3A 2XHNA 4WM7C 3OUIA 4F83A 4XW3A 4B29A 2VNGA 4E4SA 2PQQA 3AM2A 1GZTA 1QXRA 2OS2A 3ACIA 1FOD1 2E32A 4Q4V2 3GBWA 1JU3A 1KJLA 1EUTA 1GBGA 3P1IA 3O1RA 2VVDA 2RS53 3H7JA 1V6JA 1X9PA 3WG2A 3HIFA 1HX6A 3GCXA 2ZX0A 2W47A 5C3PA 1YFYA 4RGGA 1W9WA 2RS11 1PO12 1RUC2 1WW7A 1U0AA 3HNMA 3ILFA 4AE2A 5LW9A 2JKBA 2VQAA 3CL1A 2XUMA 3C7EA 4MGIE 2V72A 4HK8A 2LROA 3VDAA 1C28A 1O5LA 1ODMA 3PL0A 5FZ9A 5CB7A 5K9YA 2GNBA 1MEC2 2XLFA 4XFIA 4FXKB 1NY72 4ZU4A 3NAPC 4YW4A 1H9WA 2W9XA 1WLDA 2X10A 3AP5A 1PMHX 1QJU2 4BZ4A 4Y3OA 3S5QA 4WM8A 4LBQB 2A1XA 3RZJA 5I8YA 1YI9A 1SDWA 4XUNA 5EJ3A 2EXKA 2ZGSA 5FZHA 4C0BA 5FZ8A 1IKPA 2BDRA 2W87A 1ACCA 2WZR1 2ZABA 2C0ZA 2VXJA 1Q43A 1HLCA 1XNKA 5DUUA 3CQOA 4Q4W1 1GWMA 1SMVA 4DXRA 3VBSB 1OUXA 5FY7A 2LS6A 5T3NA 2ZAHA 5JDBA 1RUD1 4O61A 5F5QA 4XDOA 3ZN6B 4IL7A 4I09A 2PYTA 5KHGA 1JZ8A 2O0OA 1KD7A 5C8CA 3ZFGC 4Q2FA 2OZ6A 5C3OA 3I3BA 4RFT0 3RFRA 1GP5A 4ZU5A 3ZFFB 1HN1A 3AVSA 4LO7A 2ILMA 2OT7A 3FN9A 4QPWA 1CAXB 4ONUA 1ND3C 3GM8A 2YC0A 1JS9A 4NE9A 3M2MA 1EV13 3WF1A 1QNWA 4S2FA 5CG8A 4AVAA 2AACA 2D6OX 4TLGA 4UW3A 4CDUB 5C9AB 3C3VA 3JZVA 4AI1A 2ZKLA 2ZGRA 3PLQA 1JMUB 1PX4A 4QDSA 1LOFC 4QPYA 5G05L 2UY8A 4AK3A 1G9AA 4X6QB 2A3WA 1COV2 1LEDA 3LFIA 3SH4A 1C3HA 2FDKA 4PDWC 4IE7A 4XOGA 5LATA 1ZRIA 4NO4A 4QXBA 5FZ1A 4QX2A 4FPEA 2GZWA 2R0FA 2XKOA 4YZ3A 4AFMA 1AYN3 1QXJA 3N9NA 3Q8EA 2V73A 4XE9A 5A7WB 4KG0A 4CCCA 5C7GA 1G9BA 3DL3A 4NAMA 3VV1A 1UY0A 1POV0 4LK7A 3WHTA 1W9TA 2WNEA 3M7AA 3MUZ1 3WG4A 4RR3B 3ZFEB 5AFEA 3CLPA 3FLPA 4YVSB 5HCHA 1MQTA 2JB4A 5IUQA 4BQXA 4B1MA 1JYWA 2WDBA 4A6OA 4RL7A 2QJVA 4Y4RA 5BNPA 1ULDA 4Z82A 5FYTA 2WSVA 1AX0A 1Q8PA 4OUEA 3KVAA 1IGOA 1V6NA 3ZSKA 3LFMA 4OMCA 4EN9B 2RR13 1CAWA 5JZGA 1RUE1 2JDHA 5C70A 1AL23 2JDZA 4YVWC 1LHOA 2R1BA 3H8OA 4X6RB 3VKOA 4A3ZA 1DU3D 1NCQA 3C7OA 1GZCA 4FPHA 1V9U3 2Y8KA 3RZLA 5KWRA 1QGLA 3T2OA 2WFPA 3ETQA 1SG3A 4Q1RA 2GH8A 3L2HA 4DZGA 4CDQC 1LHVA 2OZJA 1V6IA 2XVLA 2BZDA 2ZA9A 2ZEWA 3IT8A 4QWNA 5CZKA 4YW6A 3VZLA 4XZUG 4IEZA 1O7FA 4LKDA 4AVVA 1MZEA 2HWD1 1WZXA 2YHJA 4QX0A 2WQZC 4WV8A 3ZXFA 3DPRC 1PVC3 2OQ6A 5A3OA 1RUH3 4FT8A 3T4HB 5IATA 4Y5TA 2WNVC 5CU1A 1L3JA 3AZZA 3H50A 3KCYA 1WMEA 1F5FA 1CX4A 1JZ5A 4PI2A 3K4AA 1Y4WA 2VZRA 3WV6A 1E5RA 2IXHA 4OI1A 3H7YA 4COYA 3LEGA 1LOEA 2P1BA 2P17A 5E16A 1HQWA 3ECQA 5IVYA 4A42A 1OPMA 2YFUA 5A7SA 2AH2A 4EWAA 5FZOA 4GH4A 1H1MA 3BIWE 5CVRA 1W6PB 3TN92 1SBEA 2GDFA 1RITA 1ZZBA 3BODA 4BQ5A 1S4CA 1BCXA 3C7FA 5KHKA 1CGPA 1KS4A 4LO5B 3ZXGA 3IDAA 4ES9A 3V0BA 3VBRB 4NIDA 1G8WA 1ZZ6A 5LY1A 2HBUA 3H0OA 5FUPA 3OF1A 2XWJB 4HXCA 4OHVA 2GAUA 3IDEA 5KHJA 1JYXA 2O1QA 1M4WA 4P9GA 1H6XA 1NUKA 2WT0A 4GWMA 4JGZA 4KWJA 4R4ZA 5FY8A 4QQ2A 4PIYA 4K1ZA 4RQPA 4LHSA 3ZMOA 2C1FA 4TXWA 4INDA 5FV3A 1LAJA 2XXZA 3AP4A 2ES3A 4M01A 3PHMA 2NN8A 2CGNA 2DVGA 1IS3A 4CUCA 2VE1A 5FYSA 4YZ5A 4JTOA 3BU0A 4FTBA 3A7QA 1JODA 3WUCA 4XFGA 3UKVA 4G9SB 2A3YA 2JICA 2UYAA 2WL1A 4XFHA 4YM1A 3CO2A 1YO8A 1PGW1 3DKQA 3T09A 3V64A 4ASMB 3U37A 3Q9OA 4JX0A 4ZHNA 2FZ1A 4XF3A 1UAIA 3V0AA 1Q8SA 5J7MA 2YROA 4K3UA 1H2NA 3FLTA 4XQWA 3WINE 1DZRA 3OGVA 4NPMA 1IPJA 4GWNA 4HFSA 4XIOA 5LK5A 2Q1MA 1F5JA 3RZZA 2Y0OA 5A80A 1BMV1 4Q0VA 4P9JA 1LENA 1BQPA 1ZM1A 1UIKA 2WNUA 3CZJA 3SEEA 4IE6A 4FPCA 4HKOA 4XURA 5FMDA 1MVQA 1W3VA 3AFKA 5FYYA 3GHNA 2GMEA 2VC9A 4OHZA 3ZDSA 1RUI2 1UMZA 3B3QE 1EV11 1GU3A 1ZBE3 2Z2SB 4R9AA 4IW3A 1SFPA 4GMP0 3I2KA 3POEA 2WLQA 3IB3A 1GNYA 5LBCA 2JEMA 5C8CC 2WLPA 3UK9A 4M3CE 3LEMA 4XBNA 5LBEA 3IN9A 4JRLA 1GZ9A 1NLRA 2HWE1 4CP0A 3FFQA 1GICA 3RNSA 1WWYA 5HXVA 4BMEA 5FZ3A 1RHI2 4J1XA 3J26N 4EZHA 3DYMA 2KR2A 4AHWA 2R6QA 1HXS1 3D6EA 5A3PA 1XU2A 2D6LX 1W2NA 1ST8A 1J59A 2BV4A 2JJ6A 4HMZA 3UGHA 4Q4V1 5GKAC 1AF9A 2VZTA 4NOTA 2WYFA 5FY5A 5H9RA 2L9LA 1FI2A 1LGNA 3CF6E 3J7NA 5JMOA 3M3EA 5FZFA 5JOWA 3KHCA 2H0BA 3PVEA 1DIWA 3FX3A 3POSA 1PO11 1RUC1 3BTZA 1UYXA 1K5MB 3D0JA 4LKEA 1MR5A 1A78A 1U5ZA 1GUIA 4NIGA 2B4KA 2B45X 2RVAA 3WW1A 1GV9A 4UW6A 1MEC1 1QH7A 3BOWA 2W3JA 2C5DA 1AL21 5FXZA 1X9TA
chains in the Genus database with same CATH topology
2GC0A 4JVAA 4CDWB 1QJU1 5JIAA 2XJQA 3WX5A 5C4WC 2VU9A 3LGRA 2WT1A 1C8M3 1JUHA 4BMBA 1V9U1 1D4M3 1GQHA 1PO23 2A6XA 1CIWA 4BIFA 4AYUA 1GNHA 5JIUA 2WFF3 2A75A 3OBRA 3CJXA 4G3YC 3ES1A 1RUH1 3BPZA 3ROUA 3EQEA 3BOPA 1SLCA 3MZHA 3ES4A 4IESA 3BCWA 4TSVA 1NA1C 5BNNC 1HRI2 1G9FA 1VAKA 1HQNA 1NOVA 2R073 1PIV2 1WBFA 4FBFA 3M8LA 3RS6A 3UV9A 4ASLA 4R9DA 1G9DA 1BZWA 2W0XA 5I8SA 3VHNA 1FT9A 3AYDA 2ARBA 4EN0A 3ZYPA 3MLLA 1BEV2 3C2UA 2VVEA 3T2TA 4AFCA 1UIJA 3VBHC 1COV1 4PLOA 2B9UA 3MW2A 2HWC2 2XH6A 1MS3A 3D4KA 3KB5A 3TRSB 4BYYA 1VBA2 3H9AA 1W39A 2WC2A 4BLIA 2BYVE 5CFDA 1N1SA 1X33A 2K9ZA 1UKRA 2DCYA 4WVMA 2YMZA 1H30A 1O91A 2NYYA 1VBB2 4XJUA 4MV2A 1H8TB 4Y22A 2ZMLA 4LEJA 2LTNA 1O4TA 1OOPA 4J6GA 4PIZA 1H1IA 3N7KA 3VGIA 4I2OA 1C8NA 5GALA 5EWSA 5FQ0B 2R042 1QJX3 4FTEA 3QOPA 1KRIA 2MEV3 1ZA4A 3H3UA 4QT6A 2BWCA 3N36A 4OLLA 2ZHNA 1OLQA 4MXWB 1OQEA 2OUJA 1UPIA 4K7JA 2EXIA 4N53A 2ZGQA 1TME3 1SQ4A 3MLJA 1W0PA 1BXHA 1J58A 1TEIA 4LUMA 2RM23 1V6MA 4YLZA 4UBGA 3V65A 5GLVA 4CRQA 3WP4A 3U10A 4TLFA 3WXPA 1WLWA 4CEWB 2A3XA 3MEPA 2WZPP 1XQNA 1G86A 2PTMA 2D3SA 2D7FA 2E9QA 3E5QA 3W58A 1FPN3 3SXWA 1W6QA 4E9KA 2EALA 2G9FA 2GNTA 2R16A 3KT1A 2A73B 3VBFC 3O14A 3S30A 3LWCA 1ULCA 2F6BA 2JG9B 1QMJA 4KNCA 4MLOA 1WCKA 4E2SA 1NCRB 2EAAA 5A33A 3WP5A 3AP9A 1FMD3 1ND2C 1U12A 3GNEA 1GQGA 2XL7A 5DUXA 1AYM2 2UURA 3GBGA 4WM7A 4EWDA 5JOXA 2VOXA 3K51A 3N4MA 5ACA3 4FTSA 1O4YA 4W6WA 1T6GC 2HYKA 1GZWB 3B93A 2XBO2 3LSEA 3N3HA 4IV1C 3U0ZA 5FCCA 5JPNB 5J36A 4CDXC 2PHRA 3LA2A 3TB0A 1Z7S3 4MGKE 1AR82 4LHKA 4S2HA 2ERFA 5LRSA 4LR4A 4A7KA 3NJZA 2DYCA 3ZXLA 2XG3A 4Y24A 5BNOC 2A71A 1FOD3 3PMSA 1LHWA 4N9IA 4COUA 1OKQA 3NAPA 2ZOEB 4RS5C 1Y9QA 2DTYA 1YWKA 1PNGA 1S55A 1J3RA 4IEUA 3APBA 1KS5A 3VBOB 2RS13 3HT1A 1PGL1 2DU0A 3LA7A 4HANA 1WLCA 5JMCA 1RUI1 4OZXA 2EXJA 4Y4YA 5FO9B 3CJIB 5I0RA 5GZDA 3RYPA 4FPGA 5D8AC 1J1TA 4FQ4A 1ZZ8A 2E63A 4OHWA 1NE6A 2JG8B 1MS8A 3ZFGA 1LOCA 5I93A 1DYPA 2WZR3 2A5ZA 3MF6A 4K40A 1OA3A 1RHI1 2Z79A 2IZWA 5SV5A 2PHFA 1ND3A 2VG9A 2RHPA 3J8F2 4ZU7A 4XXPA 1U5IA 2CGPA 1EYBA 1LOFA 3J4UH 3LZZA 2WS92 4QPIC 5KXCA 4XF1A 4YGDA 4PDWA 2WINB 2ZGNA 1W2UA 4R8HA 5ABJC 3E6BA 2Q0AA 1VBE3 1KITA 1OI6A 2CWSA 2MEV1 3PJYA 4M3CF 1W6NA 4WVWA 4MVTA 5DZEA 1ZVFA 2ZGKA 2TBVA 3J9SA 5FRAA 4D7SA 5F1RA 1EAH3 4IV3C 1ZZ9A 1R082 2ZMKA 1C5IA 4EN8B 2JX9A 2P37A 3N35A 3MI8A 3MIEA 2R062 5L7OB 1TME1 2FBEA 4PLMA 4H7LA 3FBMA 2ZHKA 3U11A 3UJQA 4MYEA 1Y7BA 1SBDA 2PHTA 1S0IA 5I0TA 1LECA 2PAEA 3OJBA 3GALA 4PJYA 1OA2A 2V5YA 4GKYA 2Q30A 1DGRA 4YVWA 2GH2A 1ALYA 3B7MA 3VHOA 3WW3A 4L9BA 3ZYRA 4CEYB 2CGOA 3KD4A 2RS32 5T54A 2BWAA 3IM0A 3R4DB 1HRI1 4QQPA 1X7NA 5GZGA 3QH6A 1AR62 1PIV1 4CDQA 3PTYA 4AQSA 4LUKA 2RJLA 5JPMB 1RUE3 1OLRA 1VBD3 4FCAA 4P9XA 4IEVA 2ZX1A 3RDIA 3TOJA 2FHRA 3ZSMA 1HQLA 3DPRA 4XJWA 1PK6B 5LK7B 4NHMA 2XHKA 1BEV1 3K48A 2P3IA 2WNVA 2HKXA 2EAKA 3VL9A 4OFGA 2RMU2 2HWC1 1TMF2 4GALA 3N7MA 2D5HA 5J48A 4QM9A 1VBA1 2VVFA 2BVBA 1KXGA 4QPGB 4XXAA 4B7KA 4B4PA 1SFNA 3OY8A 4YM3A 3VKNA 2DCZA 1RVF2 1IPKA 4XETA 5L19A 5FDBA 1B35C 2D6KA 3IKWA 2ZTNA 2A6YA 1PNFA 2DFCA 2Z5WA 3LOBA 3OCPA 2WT2A 4BQ1A 3R0RA 1NQJA 2ATFA 3WHUA 3AP6A 5FFOC 2UY9A 3O0VA 1MS0A 3G6JB 3RMYA 2OVUA 5T55A 2BPA2 2VXRA 1DQ2A 2E53A 4GULA 4HSJA 4XYXA 3VZKA 3ZSEA 3NWKA 4KU7A 5EYXA 3QLQA 4X8NA 1AR72 1AX2A 5EXOA 5K0UB 2XVGA 1IS4A 5DDJ2 1VRH3 1RUNA 4AVCA 3VBUC 4YZ1A 4AHYA 2NM1A 1CONA 3U4XA 4JDOA 1HV0A 4YSFA 4H14A 3T1MA 1C57A 5AVAA 3UKNA 2B5HA 3DKWA 3VDDB 1JUIA 5A32B 2VUAA 3WOGA 3ZXEA 1VBC2 3PJQA 4IEYA 1RB8G 3M3OA 4YG6A 2BQPA 4GB32 1R1ZA 4OULA 2ZZJA 5CFCC 3M1HA 5C8WA 5T5JA 1SLBA 4MGYE 4JV4A 1BBT2 4JGYC 4XZPA 4AGVA 5BXXA 2ZX3A 3ATGA 4AI8A 3WQ7A 5SV8A 2V09A 4FOVA 4MXVA 1VBE1 4AGGA 1OSGA 1AYM1 2HEYF 4WM8B 3IDBB 1EAH1 3FE5A 2A7AA 3URFA 5FLIA 4X8PA 1DDLA 5IK5A 4OVEA 2HWE3 1JYIA 2KM2A 2GMMA 2XBO1 1R092 5JI9A 2A6WA 5J3UA 3PVBB 4AHXA 2K0GA 3S6PA 3GZAA 4AEDC 1JXNA 1XRUA 3JQWA 3WQ0A 4R9BA 1AR81 1HXS3 4AFDA 3MIDA 1F8VA 4Q4V3 3THPA 4W6YA 1ASJ2 3MYXA 2ZACA 5C8CB 4KGGA 4JCKA 4NWWA 2MNGA 5C4WA 5AVPA 4AVBA 1W0OA 3MIBA 4C1WA 4FVVA 1IQAA 3FBYA 1PO13 1RUC3 3FWEA 1JYCA 3RJRA 3HWJA 2P2KA 3FJSA 1KQRA 2AR6A 2H0VA 4N43C 1VBD1 1X50A 1MEC3 1O3SA 2ZGOA 3SCHA 2NP0A 4IEXA 1QJU3 2PFWA 1YNAA 5GM0A 4DOUA 1RUF2 3EJKA 4Q4Y2 2P3JA 3AKSA 5GLTA 1QJY2 3D8CA 3LOIA 5CBLA 1NA1A 1N3PA 5BNNA 4H7MA 4XBLA 2GU9A 2VULA 4META 2QZ2A 1DQ0A 4AF9A 1HDKA 4EROA 1GLHA 1KDMA 1R1A2 2CNAA 4QX5A 4BM8A 3EO6A 3JBG2 3M3IA 2PELA 1MQTB 4LA3A 4Z8BA 2X5IC 1PZ7A 4JTNA 5BNPB 3WW4A 1ENRA 2WS91 2XGXA 3VBHA 3RYRA 3ZN5A 3W59A 1CAWB 5F9TA 4MX3A 2ZX2A 5JZGB 1FNZA 1J1LA 2AENA 4OUMA 1CR7A 4QU2A 2P34A 4LBKA 2B46X 1NCQB 1TE1B 1ZREA 5KHHA 3ZXJA 1ONAA 1R081 2XJVA 4MSVA 4XJ9A 3OGJA 1COV3 3IPVA 5KC6A 2R061 2D98A 4AW7A 3B9IA 1G7YA 5KXDA 2DCKA 4NPRA 3AKPA 5JAXA 4QGLA 3FHIB 3NL1A 4BH9A 4JRAA 1VRH1 3WR0A 1YRZA 2ARXA 3MDPA 2XB6C 3DV8A 4KWKA 4RD7A 5D1IA 3I2DA 1QDCA 2F4PA 1ULFA 1FATA 2FQPA 4I30A 1PVXA 1BKZA 5JVVA 3RI8A 4HL0A 4OUSA 1YJLA 1MS9A 1OFNA 2O8QA 1O4ZA 1RUG2 2BEOA 3VBSC 5CAZA 1CAUA 3HN1A 4GH4B 4DRVA 5IK7A 1UW8A 3TBDA 4AXOA 3AMHA 1WD4A 3MIFA 3V0BB 4OHXA 3MIHA 5EFUA 4YW3A 2RMU1 3ZFFC 3O5SA 4IERA 3NV4A 1S1AA 4XBQA 1FXZA 4RGAA 4I3GA 4JGZB 5JSPA 4RQPB 4AEKA 4HVRA 1YIPA 3KGLA 4YM0A 4CDUC 5C9AC 1OMIA 4IEQA 5T50A 4XQ4A 3S7EA 4AFAA 4E2QA 3OPZA 1N47A 1RVF1 3ST7A 1TNRA 2Y38A 1XNBA 2CL2A 1RUJ2 1VR3A 3VBFA 1XNDA 2X8KA 3I4IA 5K8SA 2RJKA 1W6OA 5BV6A 3V0AB 4AI2A 3MF9A 1I5ZA 4LT5A 4FPFA 3B9CA 4ZXKA 3USUA 4E4DX 1ND2A 1C4RA 3FUOA 3LB9A 3ZFEC 4RR3C 2DFBA 1X36A 1QKQA 3TN93 4KWLA 2ET1A 4YVSC 2WNUB 1FNYA 1LKNA 2YGLA 3MFCA 1AR71 2HWB2 1NXMA 3WVJA 1LTEA 2QDNA 4IV1A 4B8EA 5J96B 2ENRA 5C33A 3GF6A 4L92A 5DDJ1 4CDXA 3JB8A 4Y20A 5KXEA 5L73A 1QDOA 2NZ9A 4W6XA 3AMPA 1NY71 1SLAA 2EIGA 2WA4A 4BOWA 1Z0HA 3ILNA 1AR92 5BNOA 2JXAA 3RPQA 3ZXKA 1DGWX 4RS5A 3ZMNA 3KZ4C 5GZCA 1D2QA 3G7DA 5FPXA 1J3PA 1DHKB 1H2MA 1YYNA 4LLFA 3H8UA 2UWBA 2CV6A 1VBC1 1UD1A 5GJ6A 4GB31 4HK9A 4S2DA 4EN7B 5D8AA 2VQ0A 2JD4A 2W68A 1F2NA 3AX4A 2JENA 2YGMA 5FO7B 1F31A 1H2KA 1LGBA 4UBHA 3VHPA 1ZX5A 3RI9A 5DG2A 1RUI3 1FAYA 1SLTA 4YGCA 4MH0E 4RHV2 4HZFA 3JCIA 4GQ7A 1QQP2 4IQPA 5E88A 4EN6B 1UU6A 4FPKA 1TQ5A 1XYPA 4N90A 5FTTC 1YIFA 3VBRC 3RQ0A 5AC92 3KGZA 1R091 2BNNA 2UYBA 1HW5A 4QPIA 1RHI3 4URTA 5ABJA 1QHDA 2FMDA 2BW8A 4QGNA 1CAVA 4COZA 3HT2A 3TNQA 4MUVA 1ASJ1 4WZCA 1POV1 2R0HA 2WQ4A 4IV3A 2D3RA 4AWDA 4CZSA 4DNYA 1S0BA 4DY5A 4NR1A 4PIXA 4W65A 1WGPA 3VUOA 1YJKA 5JWPA 1AL0G 2XKPA 1UL9A 1S0DA 2QE3A 1FX5A 2VY0A 1REEA 4L2NA 2WJSA 4M0HA 1IS6A 1RUF1 4Q4Y1 3A0NA 3QD6A 1QJY1 2QDRA 2C9AA 3L2YA 5CFDB 3BALA 4WVMB 3WUDA 4EJRA 1QXPA 2BBVA 4AVTA 4JC1A 3M4FA 3WDUA 2IXJA 1RMU2 5A3MA 1R1A1 4NN0A 4Y22B 4K8FA 1QOTA 1OOPB 3NKGA 5K7PA 1ZZ7A 1WW5A 4P9LA 4Y1XA 5KXBA 2GN3A 2CAVA 1JW6A 2VOKA 1NG0A 3WDYA 1D0GA 1SCSA 4HPKA 2I07B 1D2SA 4YW1A 4XFAA 1KFXL 1HRI3 1OQ1A 4FPYA 1KDKA 5GLUA 1PIV3 2D5FA 4YG3A 1ZBA2 4D94A 3IWZA 4NWVA 5J98B 1NE4A 3WLUA 2RE9A 4ISQA 1APNA 4BWOA 4EV0A 4K1YA 3TN91 5JLVA 3POWA 1BEV3 3ZSLA 1KJRA 4N53B 4R52A 1B35A 2HWC3 4PLNA 3UKTA 1AJOA 1HV1A 1VBA3 2ZCWA 2ZZQA 4JDNA 1K5MC 4Q4W2 1UZZA 1PGSA 1YLLA 3MW4A 4CP1A 4LLOA 1GNZA 5BYNA 1PZ9A 1RUD2 4I0WB 1CVNA 1EP0A 1PHMA 4AQ6A 4CDWC 1PMIA 1Y43B 2P3KA 3O7OA 4I0BA 2PHUA 1M06G 1VAVA 4PBOA 3A0KA 1VALA 5GLZA 2IXCA 5FREA 4BE3A 4XPVA 4LO8A 5EYYA 1ZRRA 3HBZA 3TYJA 2R043 3WQ1A 1W6QB 1SBFA 3IDCB 4HKLA 5DUWA 4A7YA 1Q8OA 3FFZA 2XJTA 1MZ5A 4KBBA 1CQ9A 3AFGA 2I2SA 3VBUA 3NV1A 2ZBJA 4IEOA 4A3XA 1BVP1 5IK4A 2VNRA 2HWF2 2PLV2 4L8QA 5A33B 2VECA 1VB2A 1DGRN 2ZGMA 2ZKNA 4JDMA 2Z69A 3AKRA 4WM7B 1I1EA 5DG1A 4YM2A 4KQ7A 2UWCA 3S0MA 4GMP1 3MFAA 5CG9A 4Q4X2 4A2UA 5CFCA 5FOJB 2KA3A 3HMYA 1V6KA 2PAMA 4M3CA 4QXKA 5I0UA 4LHNA 3WZ1A 4JGYA 1IOAA 2PAKA 2G4IA 2EXHA 4U36A 3NAPB 1LB2A 2ZHLA 1NZCA 3VLBB 1H8TC 2AYHA 4WVZA 5HCAA 3NKTA 1W6MA 4B4QA 2YXSA 4B4RA 1GANA 5GZEA 2HWB1 3D82A 4DQAA 1XYNA 3R05A 3VHRA 3I59A 4Q29A 1LOGA 4AEDA 5AFBA 2HWD2 2ZX4A 1AYM3 2N7GA 4YARA 3ZVXA 4O9GA 2BUKA 1NYWA 2G9GA 1BYHA 3OYWA 2OPKA 3VZJA 4CTEA 3ZFGB 2XBO3 3ENRA 5DUVA 1KFUL 2B39A 3AYAA 1HRV2 4OI4A 3P3PA 2OYZA 1AR83 1ND3B 1UCXA 4UW5A 1LODA 3VZOA 4AFBA 2IXLA 3ZN4A 4N43A 4LNVA 3DUIA 2TEPA 4B3NA 3KT7A 1DZQA 4G4FA 2TNFA 2RS52 4CEWC 4YZ4A 1CJPA 5H9QA 4UW4A 3B01A 4PDWB 4YW5A 2YY1A 3IBMA 5DXDA 3NV3A 1LU2A 3NV2A 1W6NB 1Q56A 4YNIA 1H8VA 1D0HA 1H4HA 1QQP1 2VGDA 4HLTA 4LBQD 1MZFA 3VKLA 1YFXA 4K21A 1S0GA 3RJ2X 3CEWA 2X5IA 1BJQA 3IMNA 2LM3A 3WCSA 5AC91 2JG9C 4ORFA 1OPOA 4KU8A 2PHDA 2YDEA 1NCRC 1E57A 1UKGA 2NPIA 4LO6B 2Y26A 4N7UA 1YCIA 4YG0A 4Q0PA 4RSUA 1VBB1 4YVWB 3J8F3 3X29B 1AHSA 4GIQA 1WW4A 3WDWA 2XJSA 3HD8B 1CESA 2I45A 3AZVA 1SEFA 2WS93 2PA7A 3W9AA 3NVCA 4FXGB 1H9PA 2Q4SA 4CDQB 2R041 4D69A 2A6VA 3JB4C 1O3QA 1EV12 1WLTA 2D93A 1H2LA 3DPRB 1U5YA 1OQDA 4F8AA 1CJDA 4TZDA 2CYFA 1AUYA 3WG1A 2WNVB 3RWNA 1R083 3WT3A 4LBQA 1I3HA 3GZTB 5FLJA 5HBAA 2R063 3VBOC 2DUPA 4L97A 3M3QA 4Q0SA 2DUOA 3OY8B 3ME2A 4K9SA 1AYN2 3SCFA 4XQDA 1D4VB 1S0JA 2Q1ZB 3CJIC 5JOYA 3PVNA 3VBSA 2YUEA 3THTA 1RMU1 2GALA 1XU1A 2H6CA 2YV8A 2YYOA 3ASIA 4ZKTB 4OI0A 2KXLA 1WCSA 4FPLA 3ZN6A 1DYKA 2VW1A 3LAGA 2LUWA 2JG8C 2RS33 3H3ZA 2DU1A 4AEJA 4MGZE 1RJ8A 3MPBA 1ZZCA 4FO9A 4XF9A 3ZFFA 5JCTA 4WZFA 3NO8A 3QACA 5FO8B 1AR63 5I8TA 1CAXA 4PQ9A 2RR12 2IFWA 4XF4A 4OI2A 1ZBA1 1IS5A 1AL22 4LA2A 4BCUA 4CDUA 3WNXA 5C9AA 1QF3A 4I01A 2BVVA 3RG0A 3AKQA 1V9U2 4SBVA 4QM8A 4XMAA 3FC0A 3ZYGA 2RMU3 1TMF3 2ZGTA 3E97A 2PN5A 1GFF2 2E7AA 4LHLA 3JUUA 3E5XA 4Y5Z0 1CN1A 3USSA 4XF0A 3NW4A 5T5OA 3WW2A 1H4GA 4QQLA 4K6BA 1PVC2 3D5OA 1RUH2 1RVF3 1DLLA 4YYOA 1YFUA 4UXAA 3ZFEA 4RR3A 2AUYA 1HKDA 1EPWA 2EF6A 5FBZA 4Y1YA 4YVSA 4Q0QA 1V00A 3MICA 3JU9A 5L7OC 4Q1PA 4BIOA 3E6DA 2A70A 3BOWA 1OA4A 4XFCA 5E8AA 3KS7A 3RSJA 5JSRA 5FAXA 2OIIA 2ZHMA 4Z92B 4YZ2A 4H3WA 4AQ2A 3SNMA 4CEYC 3FUQA 4YGBA 2Q8OA 1OD5A 1AR73 1QH6A 2QUOA 4LO4B 2XJUA 3AJZA 3QH7A 2HWF1 4YFWA 3ZYJB 2PLV1 4M00A 1SACA 4C1XA 3ZSJA 4DRRA 5DDJ3 5EV7A 5HCFA 4GKXA 4YRDA 1ENSA 4LE4A 1QJZA 3SH5A 5CNAA 1C5HA 1ENXA 4DXZA 1U5XA 1DBNA 1PK6C 3AMNA 4Q4X1 4FP3A 5DZFA 2GSYA 2DVAA 4R9CA 1DGLA 1S0EA 4HETA 4HT1T 1SLIA 4QPGC 2DVBA 4I0AA 3CU7A 1AX1A 4Z07A 2ZMNA 3WP3A 1N3OA 2JECA 2VUJA 2QZ3A 1VBC3 2ZGLA 2NMOA 3RMXA 3J8F1 5EZWA 4GB33 1LESA 5C4WB 3B02A 1W6PA 1F9KA 3T1LA 3UL2A 1ZRDA 4P9IA 1LOAA 3VBRA 1BBT3 1QOSA 4XTPA 3R6SA 4AI3A 1ENQA 5C6CA 1ZBE2 1RIRA 4QQHA 2XJPA 2ZAAA 1AXZA 4BA6A 4D7YA 2GMPA 4LTAA 4COWA 3INAA 3KCXA 1R093 3QCWA 2DCJA 1NA1B 3WDXA