5C8CA

Crystal structure of recombinant coxsackievirus a16 capsid
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
297
structure length
259
Chain Sequence
b'GDPIADMLQVLPTAANTEASSDKNLIETRCVLNHHSTQETAIGNFFSRAGLVSIITMPTTGTQNTDGYVNWDIDLMGYAQLRRKCELFTYMRFDAEFTFVVAKPNGELVPQLLQYMYVPPGAPKPTSRDSFAWQTATNPSVFVKMTDPPAQVSVPFMSPASAYQWFYDGYPTFGEHLQANDLDYGQCPNNMMGTFSIRTVGTEKSPHSITLRVYMRIKHVRAWIPRPLRNQPYLFKTNPNYKGNDIKCTSTSRDKITTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP1
publication title Structures of Coxsackievirus A16 Capsids with Native Antigenicity: Implications for Particle Expansion, Receptor Binding, and Immunogenicity.
pubmed doi rcsb
source organism Coxsackievirus a16 (strain tainan/5079/98)
molecule tags Virus
total genus 45
structure length 259
sequence length 297
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5c8cA00
1NA1A 1VBE3 1COV3 4RHV3 1VAKA 4CEWC 3CJIC 1AR81 3VBUB 1FMD2 2RS52 1RUC1 3J8F1 2ZZQA 1RMU3 5C8CC 2PLV1 3VBRC 1QJU2 3VDDC 3DPRA 1BEV3 1NCRB 1SMVA 5J98B 5CFDA 5BNOA 1QJY3 1FOD2 1VBC3 2ZAHA 4Q4W3 4RQPB 3NAPA 1ASJ3 3IDEA 4PDWA 1AYM2 2HWB3 1AR73 1AYN3 1RUI1 1IHMA 1NA1C 1QQP1 1RUF3 2R071 1AR82 3VBFB 1RUC2 3DPRC 1R1A3 3VBHA 1ND3A 5BNOC 5CFDC 2PLV2 1AL22 3ZFFA 1PO21 2WFF3 1TME1 4PDWC 4CDUA 3JB8A 1HRI2 4JGZB 3TN92 3FBMA 3ZFGC 1FPN1 4Q4Y3 2BFUS 1ND2A 2R063 2FZ1A 2WWSA 2GH8A 4WM8A 4GMP3 1BBT3 1NOVA 1H8TB 1RUH3 5K0UB 2R072 1C8M3 4BCUA 1PGL2 1MEC1 2HWE3 1D4M1 3VBSB 1POV0 3VBHC 2RS13 2Y26A 3JD73 3ZFFC 4AEDA 1VB2A 3JB4C 2HWC1 4CDUC 4SBVA 4QPIA 4CDXC 1RUJ1 5ABJC 1PO22 2RM21 1TME2 1ND2C 1EV13 4Q4V2 1AR63 2IZWA 1FPN2 4WM8C 2R041 1AL0G 1AUYA 3JBG1 1HQNA 4FTSA 1R093 1Z7S1 2MEV3 4N53A 2RR12 4Q4X3 5DDJ3 5BNNB 4NWWA 1HRV3 2BUKA 1C8NA 1D4M2 4AEDC 1W39A 4QPIC 1X33A 1RUD3 4CDWA 3VBOA 2HWC2 1RUG3 1NCQA 1PIV2 4CDQB 5BNPB 5A33A 4N53C 1QJU1 4QPGA 3JBG2 3VBFA 1VB4A 1QJX3 3ZXAC 1TMF3 2WS93 2RS33 4N43C 5L7OB 2RMU1 5J96B 2TBVA 1RVF3 1B35B 1RB8G 1M06G 4CDWC 3VBOC 1NCQC 1RHI3 1NG0A 3HAGA 1HXS3 2VQ0A 5FMOS 4GH4B 1H8TA 4GB33 5K0UA 5JZGB 1PO12 4NWVA 1A6CA 4QPGC 3VBFC 1X36A 4FSJA 5D8AA 1AL21 3ZFEB 1HRI1 1K5MA 3TN91 1VBB3 1RMU1 5C9AB 2RMU2 1RUC3 4EJRA 3J8F3 1OHFA 4RS5B 1R082 4Q4W1 1ASJ1 5CFCB 5K0UC 4RR3B 2HWB1 1AR71 1AYN1 1PGL1 1WCDJ 4IV1B 1RUI3 5D8AC 1E57A 1AR93 1VBE2 1QQP3 4WM7A 4CEYB 1PVC3 1K5MC 3NAPC 1VBA3 4Q4V1 2XBO3 1POV1 1RMU2 4CDQA 5BNPA 2WFF1 4YVWB 1VBC2 4CEWB 4Q4W2 2RR11 2DF7A 1ASJ2 1PO23 1NY71 2HWB2 1AR72 1AYN2 5FOJB 4IV3A 5C8CB 3VBRB 1FPN3 2BFUL 3VDDB 5L7OA 4WM7C 1ND3C 1RUF2 1RUH1 1C8M1 2HWE1 1PIV1 2RS11 4CDQC 3JD71 1MEC3 5A32B 1D4M3 1R1A2 5C4WB 5JZGA 4GMP0 1ZBA1 5AC91 3VBUA 2QQPA 2WFF2 1EV11 1RUJ3 4IV3C 2RM23 1NY72 1NCRA 4Q4Y2 5L7OC 2FZ2A 2R062 1RUE1 3ZFEA 4RQPA 1R091 2WZR1 5C9AA 2R043 3JBG3 4Q4X1 1RUH2 1QJZA 1Z7S3 3LOBA 1C8M2 4RFT0 1EAH3 2HWF3 3ZFGB 1VBD3 1V9U3 4JGYB 2HWE2 2RS12 1PO11 3JD72 3VBUC 1PGW2 4IV1A 1VRH3 1ZBA2 5AC92 2HWD1 1NCRC 1EV12 3ZFEC 3VBHB 1AR62 4RQPC 1HX6A 3ZFFB 1RUE2 1FMD3 2RS53 1R092 4CDUB 4JGZA 2WZR2 4CDXB 1QJX1 1R081 1ZBE1 1QJU3 5ABJB 4Q4X2 5DDJ2 2RS31 1ND2B 1FOD3 4YVWA 2GSYA 4WM8B 4FTEA 1AYM3 4IV1C 1RHI1 1OOPB 5ACA1 3VBRA 3VDDA 1VBE1 3VBSA 4YVSB 1MQTB 1RUG2 1COV1 4RHV1 2HWD2 5FMOL 4AEDB 4JGZC 4QPIB 1AR83 2X5IB 1GFF2 5A32A 1BEV1 5C4WA 1QJX2 1QJY1 1ZBE2 2PLV3 1AL23 1VBC1 4YVWC 1TMF2 1VBB1 2RS32 1H8TC 2WS92 2BPA2 1RVF2 1CJDA 1HRI3 3TN93 4N53B 5BNNA 1BMV2 3VBSC 1RHI2 1RUF1 5ACA2 1HXS2 4N43B 1CD3G 1COV2 4GB32 4RHV2 2R073 4Z92B 2XPJA 4FTBA 3ZFGA 1AR91 4JGYA 4Y4YA 4CDWB 1R1A1 3VBOB 1NCQB 5C4WC 1PVC1 1BEV2 1VBA1 1QJY2 5A33B 2XBO1 3CJIB 1VBB2 5BNNC 1TME3 4Q4Y1 4QPGB 2R061 4Q4V3 3J8F2 1POV3 4GMP1 1BBT1 1B35A 4CDXA 2RR13 5ABJA 4JGYC 1RUI2 2BBVA 5BNPC 2ZTNA 1AR92 4GH4A 1NA1B 4LLFA 1QQP2 1PGW1 1PVC2 3M8LA 1OOPA 1VBA2 2HWC3 4YVSA 1MQTA 1F2NA 1AR61 2XBO2 1PIV3 5D8AB 3DPRB 5BNOB 5CFDB 1B35C 1ZBA3 2MEV1 5AC93 1BBT2 1K5MB 2X5IA 3NAPB 5DDJ1 5LK7B 4PDWB 1HRV1 4RS5A 4GH4C 5CFCA 1RUE3 5JZGC 4RR3A 2WZR3 1OOPC 1EAH1 2HWF1 1RUD1 1VBD1 1V9U1 1RUG1 1MQTC 4YVSC 2WLPA 1MEC2 4N43A 4CEYA 4WM7B 1ND3B 1PO13 1VRH1 5C9AC 2X5IC 3S6PA 2MEV2 4RS5C 1RUJ2 2RM22 1OPOA 2WS91 1TMF1 2HWD3 4Y5Z0 5CFCC 1HRV2 1FMD1 2RS51 4RR3C 1RVF1 4CEWA 3CJIA 2R042 1DDLA 2RMU3 1BMV1 1Z7S2 5C8CA 1HXS1 1R083 1ZBE3 1FOD1 1EAH2 4IV3B 2HWF2 1RUD2 1VBD2 1V9U2 5GKAC 4GB31 4CEYC 1AYM1 1F8VA 1VRH2 5ACA3
chains in the Genus database with same CATH superfamily
1BKZA 1JHJA 1NA1A 1VBE3 3BIWE 3I3EA 4Q0UA 3LDRA 1W99A 1COV3 1S0CA 1MS8A 4RHV3 2W68A 1D2QA 4HKLA 4G4FA 2W94A 4IDZA 2BEOA 1AR81 3AMPA 2HEVF 3VBUB 1FMD2 1PK6A 2X10A 2XDVA 4OFGA 4HVQA 3J8F1 1RMU3 4XACA 3VBRC 1N3PA 2YV8A 3VDDC 1NXMA 4IXLA 1BEV3 4M3CB 1MR5A 2D6KA 3ACHA 2OUJA 2Q8CA 2XJTA 2W1WA 5FUPA 1VBC3 5KXDA 1JZ5A 1HJGA 3ZN6A 4DMIA 2Z42A 4NO4A 2IXLA 1SLAA 2HWB3 1AR73 1MACA 2D3PA 3B5LB 4ZZ5A 5IAXA 1UX7A 1CAXA 1DF0A 1W8OA 3D0SA 3UL2A 5IK8A 2E26A 1YI7A 2A6ZA 5KHKA 1OH3A 4JAAA 4QQPA 1RUF3 3BPZA 4FOYA 3GALA 4LKSA 3M2MA 4LBQA 2G9FA 2R071 2ZS6B 3POEA 2WQZC 1AJKA 5J36A 1Q8OA 2IWGB 3JUUA 5BV6A 4BYYA 3A7QA 3HT1A 3MUZ1 2VMEA 3IZOA 3BU0A 1R1A3 2KXLA 5GZFA 4COVA 5EYXA 2P4EA 4QGMA 2HBTA 3CO2A 1BVP1 2Y8KA 1W8FA 2PLV2 1UMHA 3OUJA 4GD4A 4I0AA 3ZFFA 3URFA 1PO21 1S2BA 4A7ZA 1NZIA 4EROA 4EE2A 1F5FA 4CDUA 3FLRA 1EPWA 3FUQA 4D94A 4LE4A 1W8WA 3TYJA 3TN92 1WCQA 3ZFGC 3E6DA 2XUEA 1IOAA 4NUBA 5JSOA 3BIEA 4OMDA 4HVOA 1EUTA 2CNAA 1ZA7A 2JIJA 3MW2A 1NOVA 2P6CA 4YM1A 5FY0A 1RUH3 4O7XA 1UMIA 4XDPA 2BU9A 4LTAA 3O1TA 4GALA 4NIGA 1C8M3 1I5ZA 4BCUA 5IFTA 1XE0A 4I30A 2QQLA 1D4M1 3VBSB 1POV0 4AGGA 2VXJA 2Y26A 4KMQA 5F5CA 2A75A 1U0AA 2YXSA 3PIGA 5J09A 1CPNA 5EP9A 2WINB 1VB2A 2B45X 1GZWB 3JB4C 3A0KA 3BTYA 3VHRA 1RITA 4K1YA 4CDXC 3AP7A 1BJQA 1LGNA 2VO5A 4M0HA 4N8MA 1TME2 3OY8B 1ZA4A 4JTNA 5FZ4A 1ND2C 1BQPA 2W3JA 2NMOA 1LECA 1CAWB 2W52A 1AR63 4KWUA 4Q4V2 4BWOA 4PLNA 2P3IA 1F5JA 1LCLA 2ZMNA 1AF9A 4WM8C 1UCXA 2Q30A 1AUYA 2ZMLA 3JBG1 4LBKA 3J7HA 1Z7S1 4EN8B 2MEV3 3M70A 3MBWA 2RR12 1D0GA 5GZGA 4Q4X3 5DDJ3 1JOBA 3ZR6A 4M3CA 1JZ3A 1AX2A 4Y4RA 3T2PA 5GLWA 4ATFA 4JZRA 2BUKA 3NVCA 3KWVA 4GWJA 4JDNA 4B7EA 4CA9A 4EN7B 4AEDC 4ZY9A 1JTZX 3MGUA 1OH4A 1W39A 4QD2A 5IVFA 3HWJA 3RRDA 5I8YA 3KD4A 1MS5A 1RUD3 1X33A 4XJZA 2ADEA 3GCWA 5IVBA 1NQJA 5GLTA 1CZSA 2ES3A 2VUDA 4TLFA 3SEEA 3CKHA 1GNZA 1VJ2A 1W6OB 3IIIA 3V0AB 4QWNA 2LUWA 1ZRFA 2Q4SA 2WZPP 4DINB 1YI9A 1HDKA 3FLPA 3WNNA 4K8FA 4N53C 4BLIA 1EY2A 4HT1T 1WA4A 4QPGA 3W5MA 2VBDA 3IB3A 1OA4A 2DTYA 4NIDA 3CNAA 4AGVA 2DUQA 4FFIA 4LMFA 1YQ6A 2XJQA 3IT8A 3H8XA 4HN1A 4N43C 5J96B 5LK5A 4CU8A 3AMHA 3ZMNA 1W2TA 2SLIA 4FBFA 2Z4FA 3MF9A 5F39A 1KRIA 1TZOA 3VBOC 3WY6A 1NCQC 4AVVA 1DGRA 1W8ZA 1E5IA 1OI6A 1JZ8A 1HXS3 2QKDA 4D6RA 3NV3A 3OPWA 4NRQA 2VQ0A 4QGLA 2AZ5A 2P1BA 4AF9A 3VKNA 4XJAA 5FXZA 4UAPA 1JU3A 4Y5TA 5IW0A 2VOKA 4NWVA 5JSRA 2ZMKA 1LOEA 3H7JA 4PLOA 5EV7A 4Q1RA 4BK5A 2VBPA 3D4KA 4QDQA 1MZFA 3PUQA 4FXGB 5EJ3A 3K4AA 3J26N 5CYYA 5A7PA 3RI8A 1HKDA 5FZHA 3H9AA 3I2HA 3LPGA 2VVEA 5FR3A 5F3GA 2OPKA 3AYDA 3OY8A 4KBBA 5EXOA 3OG2A 2VMFA 5APAA 1CAWA 4QT6A 3TEWA 4H2AA 3VHNA 4META 4RS5B 3AMMA 4BK4A 3VL9A 2PHXA 1LNSA 4Q4W1 3ROUA 4LUMA 2E53A 2Y6HA 1F31A 2WFPA 2JDYA 4RR3B 5C3QA 1WCDJ 5FCCA 2RJ2A 1Y9MA 1GYKA 1UIJA 1YJLA 4QX1A 2FDGA 4MGSA 4IV1B 4PF5A 1RXFA 1WLCA 4EWEA 5C3SA 4CCNA 1QQP3 4WM7A 2H0VA 1PVC3 2XVKA 2A3XA 3BN6A 3C7OA 3UGFA 1K5MC 2Z5WA 4LR4A 2WYFA 3OJBA 1GWLA 4Y24A 5KC6A 3E5XA 3S7IA 4UFKA 2XBO3 2V73A 4XJ8A 1W6MB 3TWIA 2ZX4A 3WNLA 3VN4A 4LIUA 5DZEA 3JZVA 4A42A 5A6XA 3FL7A 3J7MA 3ORJA 2UWAA 3AFGA 1JZ4A 1BHGA 4XUQA 3K4DA 1SG3A 1DHKB 2WO7A 4ZKTB 1IS4A 1AYN2 5FRAA 4IEVA 4LO6B 4XFHA 4N90A 1MZ6A 3LD8A 1ZX5A 4XFBA 5ERLA 3PJQA 4O65A 4R9AA 4ES9A 3U78A 1ONAA 2I2SA 4QU1A 2R30A 4XPVA 3QACA 4CVUA 5HI0A 2VZOA 2QBXA 1AZDA 2B46X 1OF3A 4YM0A 2CWMA 1PIV1 2R7EB 1DGWX 2RS11 1Q43A 2X29A 4QQHA 5A32B 1AXKA 4AK3A 1AXZA 3Q8AA 3M1HA 3R4DB 1XNCA 1DLLA 4GMP0 1IPSA 5FWJA 4AI0A 1KJLA 1W9WA 5H9RA 1UZYA 2WFF2 3H7YA 1KJRA 1EV11 4CCLA 3UNPA 1RUJ3 1GP6A 4ZU4A 1JI6A 3H8OA 4UW3A 2GALA 4Q4Y2 3MPPG 1O3QA 3H8UA 3MFCA 3KCYA 5L36A 1YO8A 2B39A 2R043 1UX6A 4QHOA 4RGKA 1CAUB 3WD5A 4GJZA 4IEWA 1VIWB 3ZN4A 3RS6A 2R1DA 3WDWA 2HWF3 3DUIA 2PTMA 4AQTA 1E5RA 4P00B 2Y6JA 5FMDA 4XUNA 1JYNA 1MZEA 4ZXKA 3FN9A 3JD72 3KMHA 3C7EA 4BQXA 3BKZA 4UYBA 4FFHA 3VBUC 3FFQA 5KXEA 5IK5A 2GZWA 4O9EA 4IV1A 1OVPA 3WQ0A 3EMRA 3ZYRA 5JPNB 1RGSA 4L9BA 2HWD1 2D5FA 1SBDA 5T3NA 3WCRA 3KGZA 3UETA 3ZFEC 3VBHB 4IQPA 3VB9A 2BV4A 3I8TA 4Y22B 4B1MA 1YFUA 3KVAA 3UKTA 4C91A 3S7EA 5DQ0A 4J1XA 2WUHA 3KLSA 1POQA 1W6MA 2R32A 1QJX1 4JC1A 2LTNA 2PHDA 4YW4A 1UY0A 5J37A 3WF1A 1WGPA 3K2OA 2WBKA 1FOD3 2GAUA 1H4GA 1ZRCA 4E27A 2Y60A 5FPAA 3FX3A 2VZRA 4N7IA 4Q27A 1UZZA 4FTEA 3BPSA 2YDEA 2CYFA 3PNAA 3UKVA 3TEYA 1K42A 1OOPB 3J7NA 4YZ5A 1UMZA 1VBE1 2QQIA 4YVSB 1RUG2 1COV1 1XXNA 4X8NA 4RHV1 2D93A 2EXJA 4QHZA 2GU9A 5BPXA 4P9WA 3AP9A 2DVAA 4LA2A 4LORA 4X6RB 5FKCA 1WW5A 1OLMA 1A8MA 2XLFA 1SHWB 4F83A 2WN2A 3P1IA 4K40A 1AR83 4U2AA 5HCFA 2X5IB 4CUAA 3I59A 5FLIA 3VUOA 3LGRA 3ST7A 1BEV1 5A32A 4XIOA 3EB7A 2ZPXA 1ZBE2 4YVWC 1AL23 1VBC1 2VW0A 2XONA 4IGPA 1TMF2 4COZA 4W65A 2XWJB 4K3UA 2VUAA 4BQ4A 2DUOA 2ET7A 5JWPA 4CUBA 1RTVA 2B9UA 1HB4A 3VBSC 1UZ0A 4AL9A 1RUF1 3BU7A 1C1FA 3FHIB 4OHVA 4PBOA 2YBKA 4ZU5A 5CEHA 2C26A 4GULA 3BUCA 1IS3A 5F1RA 1CAUA 4HANA 4KU8A 3AXDA 2B5HA 2G9GA 2R073 4HBNA 2AGSA 3O0XA 4QB2A 5FQ0A 1ENQA 3JXSA 4HPKA 1AR91 1W8TA 2XOMA 1R1A1 2IC1A 4AHYA 3LDBA 2BTVC 4XOGA 1YUDA 5F6KA 5JOZA 5C70A 3TB0A 2VCCA 2JDKA 3VKFC 4QKDA 4R9DA 1QJY2 4Z1VA 5A33B 2D40A 2D6NA 2ZHLA 1UNBA 2KM2A 4KWKA 1VBB2 4NAMA 4M3CF 2ZX1A 5LZ6A 1DBNA 2R0HA 1JH5A 3LFIA 4R8HA 3D8CA 5GZDA 3SCFA 1LU1A 5C3RA 1YFXA 1Y9GA 4AE2A 4YGDA 4LKEA 5HCBA 2EIBA 2VBBA 5T5OA 1W9YA 2K0GA 5FY7A 4KWJA 1LESA 1OKOA 1EPZA 4AGRA 3MIGA 4QQLA 3MDPA 2VZVA 3M3OA 3D3AA 4QKFA 1F9KA 3ZPOA 4MXVA 5FAXA 4MHUA 4CCCA 4LA3A 5EIYB 2FDFA 3H3LA 4J6GA 4DB5A 2E9QA 3PU3A 3ZSLA 3HR9A 2AC1A 2G4IA 2CL2A 1OA2A 4W50A 1OOPA 1HJFA 4D3WA 1VBA2 4GZ9A 1IS6A 1O8PA 4YVSA 4XBLA 5J3UA 4PQ9A 1W0OA 1AR61 3QH6A 4IE5A 4FAHA 2VNGA 3MO4A 1WD4A 2WC2A 4WZCA 5C6CA 2RDNA 4IL7A 5A7WA 5BNOB 2TUNA 1UOGA 1YXWA 1G9BA 3B93A 1NYWA 1T6GC 1DZTA 2MEV1 2X5IA 4MSVA 4P9YA 5DDJ1 4UBGA 5LATA 4E4HA 4NIHA 1ZZCA 4EZHA 3QLQA 3DXUA 1V6OA 4AFBA 1XYPA 2UU8A 4FOWA 4Q5OA 1DU3D 3H1MA 3ON7A 2RVAA 3RPQA 2J22A 1YFWA 4R4ZA 3SC7X 3SCHA 2J42A 4LE3A 3PMSA 4XF4A 3AKPA 2CGNA 5JXGA 1RUD1 4JCKA 2I45A 3NV4A 1MQTC 3P6BA 4OHXA 4AZZA 4IETA 1JODA 1SLIA 3WNXA 3EJKA 2C1FA 1I5PA 1MEC2 1OVSA 2ZX3A 3FUOA 3IN9A 5LBCA 4HK8A 1OFNA 2QQUA 4LEJA 3T0DA 4LO5B 2A6YA 5K8SA 3LQCA 4AVBA 2XLGA 2ZHNA 2Y64A 1V6IA 2QZ3A 4RS5C 5FO8B 4LPLA 4UFIA 4ET7A 1MS4A 5FYTA 3AJZA 1HRV2 1FMD1 2ZKNA 4RR3C 1FXZA 2W95A 1W2OA 2QQJA 2VZUA 4QX5A 4YGEA 1Y9QA 3VZLA 5DUXA 5FKBA 1K12A 4FCAA 1DDLA 1BMV1 2EXHA 4MO3M 3N4MA 2Y33A 4BH9A 4G3YC 1HXS1 1ZBE3 4IV3B 1X8MA 5A7NA 4TWTA 5C8WA 1V9U2 2V4VA 3N7LA 3CF6E 4PHZA 3POFA 2XG3A 5GLUA 4JQTA 3MIBA 3SCGA 5KHHA 4OZXA 1V6KA 2YYOA 2R49A 4RA0A 2PHLA 2YBSA 4XQ4A 1GWKA 1VRH2 1IZ3A 3WG4A 3I2FA 4LHNA 3WNKA 4Q0VA 4BZ4A 3CDZB 4C1WA 4HZFA 5BNOC 4R9CA 4LO7A 3MPBA 3KHCA 2A6WA 2P17A 1G86A 3M3IA 1DQ0A 1VAKA 5FYVA 5ANNA 1BK0A 1UF2C 3ZMOA 3CJIC 4NJ4A 1OLME 4P14A 3HJRA 2RS52 1A3KA 3LA3A 1XNKA 2ZZQA 2ZBJA 1H2NA 3PU8A 5LBEA 4BLJA 2PLV1 4DY5A 1QJU2 1XE8A 1FNYA 1GWMA 2WT2A 3ZYGA 2X8KA 1NCRB 5A7QA 5BNOA 1WW4A 1QJY3 5FYZA 1KD7A 4Q4W3 2CWSA 4XJ9A 2CY6A 2VMIA 2PHUA 1AYM2 4AVSA 4MADA 1ULFA 2VZ1A 4QXCA 4AOCA 1J58A 2J7MA 2ADDA 1IHMA 1N1TA 1UYZA 3OPTA 5CA6A 5FZFA 3LZZA 2WWUA 1Q56A 1QQP1 2VZQA 1JOPA 1H8VA 2E6VA 3PMEA 1OSGA 2WYSA 3BOWA 3NV1A 5JR7B 4TXWA 3VD5A 2VZPA 3K3NA 5G05L 1C3HA 1XYNA 3W9AA 4C0BA 3E6BA 3KHBA 4I02A 3RI9A 4QQOA 4RGAA 1OLQA 1RUC2 3AP5A 1SQ4A 1GZ9A 4DEVA 2F17A 5CFDC 2LW8A 4NRPA 1E5HA 4PI2A 4NE9A 1X8EA 2VCMA 2YZ4A 4XW3A 1CZTA 3P3PA 5CNAA 1QY4A 1TME1 2WZ8A 4PDWC 4YW1A 5FYIA 2ARXA 1HRI2 1X9PA 3WR0A 1S0JA 4NR1A 2BFUS 1ND2A 1TG7A 2R063 3DGTA 2VQAA 3H3UA 2GC2A 1CESA 3CL1A 2D44A 4J1WA 4WM8A 2KD7A 5K9YA 3OF1A 1C1LA 1LULA 4EN9B 4CP9B 2BP6A 4XMAA 2Y6KA 3ACFA 4Y1YA 1PGL2 3OGJA 1W04A 2QQOA 1YHFA 3IM0A 1X50A 3NJYA 5EHDA 3TEXA 3GBWA 4PI0A 1MS1A 3VBHC 2RS13 4EZ4A 1W9SA 1YCIA 4OVEA 3WUDA 3THPA 1XU1A 4KL1A 4AEDA 5T54A 4SBVA 5LASA 2LROA 3NSTA 1RUJ1 1JHNA 2BWAA 1LHNA 3M3QA 2EXKA 3MW3A 4FPJA 5A80A 5FPUA 1UYPA 3WG1A 1HV0A 2A7AA 3ZDSA 5JDBA 1WMFA 1W8HA 1WD3A 1EV13 4JRLA 2MNGA 4FPKA 1CX4A 3ME2A 5I0DA 4LBOA 4WVVA 2R041 3AVSA 2BOIA 2JDPA 1N1YA 2EICA 2Y6FA 2FD8A 4N53A 4DUVA 1QMJA 5AFBA 1GNHA 5BNNB 4KQ7A 4MLOA 4NWWA 1HRV3 4XUPA 2ZGMA 1OUXA 1ZZ6A 3K75B 3N9QA 2VJXA 5JMCA 5KC5A 4MHRA 2JJ6A 1OQEA 5FZAA 4CZSA 2I07B 3BODA 2JE9A 3LSDA 5T52A 3U07A 5JXHA 2JG8B 3AL6A 4AG4A 5JOWA 5EYYA 1PNGA 2C9AA 3VBOA 2HWC2 1NCQA 1QH6A 2JDMA 4CP1A 5FK7A 4CU7A 2DBIA 4OUMA 5BNPB 2WSUA 3PVBB 1WWYA 3N7JA 3OPZA 4D7TA 5IUQA 3T2TA 1PVXA 5FUIA 5CB7A 3ZIWA 3B9CA 4YW7A 1KQRA 5I93A 3V0BB 1ZM1A 2AENA 3RJRA 3VD7A 1H1AA 1VB4A 4CU6A 4EV0A 2FDIA 4OUSA 3H50A 2CGOA 1QJX3 1YC61 4ZXEA 5GJ6A 5F7UA 4I2OA 1SPPA 4PCRA 3ETPA 5FOBB 2VUJA 4JV4A 1RVF3 1GQPA 4DPNA 2VZSA 3USUA 5E8AA 2R6QA 3GBGA 5HCHA 1H9WA 1IS5A 2EF6A 5FUNA 2IFRA 4C1XA 4NPRA 3VKLA 3ZSMA 4XDOA 3FZ3A 3RZLA 5FMOS 2IFWA 2LRPA 1FATA 1O91A 1PO12 2WRAA 2YROA 2CAUA 4OUEA 4BOWA 1DYPA 1RJ8A 3HVDA 4BQ3A 2P5BA 2JECA 4UW4A 2VMHA 5FWEA 3VBFC 4OLLA 4CCKA 1X36A 4CPBA 1NUKA 3RZKA 2BNNA 2R16A 2VOWA 3FE5A 5JSPA 1F35A 1AL21 1OD5A 1YJKA 3ZFEB 3KCCA 5T55A 3RSJA 1K5MA 4PIXA 5DABA 4URAA 2WNVB 2VW2A 4X8PA 2RMU2 2UY8A 1WLDA 1RUC3 2GP3A 4HL0A 4EJRA 2EIEA 3VLBB 1STMA 3S57A 3FWEA 3ASIA 1R082 2PAEA 2WNUB 3NMBA 3WSOA 3D82A 4DFSA 4UXAA 5A70A 4OI2A 1WLTA 4B7KA 1AYN1 3B94A 1YQ5A 1OUSA 4BE3A 5JLVA 3C7FA 4V1PA 3KGLA 4QU2A 3I2JA 1UYYA 1RUI3 1LOCA 2Y6GA 1YQ8A 3AYAA 1GKBA 3OBTA 1E57A 1AR93 4UI9L 2FCUA 4H55A 1PNFA 3WP6A 4L97A 3E1F1 4GQ7A 2W2IA 4P9IA 1Y43B 4QDSA 2Q8DA 5BNPA 5FY9A 5CISA 2PHFA 2VY0A 2VTFA 3N9PA 4JVAA 2WFF1 4XFIA 5GZEA 4OQ9A 2RDQA 4YVWB 5FYYA 1I1EA 3V0BA 4O61A 2PQSA 1O4YA 1ASJ2 3K51A 4NPMA 4AQ6A 2HEWF 3KS7A 5FPXA 2WJSA 3RYPA 3N7MA 1R1ZA 1UKGA 1O5LA 3ZXKA 5D1IA 4CP0A 2BFUL 4AEKA 1RUNA 5DUUA 2ZEWA 4W6XA 1GZTA 4OI4A 1V6MA 3U0ZA 1XNBA 1E5SA 4AI3A 4DS0A 1DP0A 2OVUA 4NAOA 2ZZJA 2ZGQA 2B4KA 1ALYA 4YFWA 5FYHA 5GLZA 3U1XA 2PXJA 4HLTA 4CDQC 1H6XA 3JD71 2V5DA 1BVVA 2FMYA 2QJVA 1GBGA 3B00A 4LOSA 2A6XA 2DWRA 3G6JB 3BTXA 1PMIA 3BCWA 3VBUA 2GP5A 3BTAA 4XF0A 3ZKUA 3WZ1A 1VP6A 1UY2A 2C24A 4URTA 4ARYA 3N3HA 4IV3C 2RM23 2VH9A 2HJIA 4LO4B 5L7OC 2FZ2A 4CSWA 3WP3A 3ZFEA 1KDKA 2OPWA 1UY3A 3UV9A 3POYA 2JKBA 2IXIA 2DVBA 3JU9A 2WNVA 3KF5A 1ZREA 1YFYA 3Q8FA 2ID4A 5A3OA 4XVHA 5T50A 1GMMA 3N35A 5D21A 3LOBA 4NPLA 2JENA 4XQWA 5F5QA 2WNUA 5J7MA 2J1SA 1PZ7A 4HMZA 2FHRA 4NOTA 3ZYBA 5A7OA 5HXMA 2DUPA 1XC6A 2HWE2 2O8OA 2Y6LA 1ZRIA 4N7UA 5FZ7A 2CHHA 5L73A 5FZOB 5IVJA 5DAPA 3Q8EA 2V5YA 2DVDA 1PGW2 2F4PA 2XQXA 3MLJA 5HV0A 1PMHX 3KV9A 1HB2A 3FJSA 4YM3A 3RJ2X 5IVVA 1S0IA 1NCRC 3N9OA 4E8CA 1NE6A 3I3DA 1SBEA 1LAJA 4XTPA 3HQXA 5BY5A 1HX6A 4FFFA 4A2UA 4XFGA 4YZ2A 1RUE2 1FMD3 1HLCA 2BZDA 4NROA 4RGGA 1R092 4YW3A 3ZYFA 3WG3A 2WZR2 5JI9A 1ZBE1 3AMQA 1A78A 3J4UH 2ZGLA 4YVWA 3ZSKA 3I49A 4FPEA 2OZJA 5KXCA 1W8NA 1ULDA 4MX3A 4CCOA 2JXAA 1QH7A 1UU5A 3PTRB 3NNJA 4YLZA 3WHTA 4B29A 2EA7A 5DUVA 5JVVA 3I3MA 4INDA 4XEZA 3VBSA 1MQTB 4GJYA 2ZA9A 3ATGA 2TEPA 4XETA 3WDUA 1G9CA 1PM4A 1D2SA 1R64A 5FMOL 4BIFA 1O3SA 1GZWA 4FOVA 4P02B 4FQZA 4Q29A 4QPIB 4CCDA 3A21A 3NWKA 4XURA 1H0BA 3J7LA 3MICA 1QJY1 2PLV3 3ZYPA 4Y20B 5F5IA 2WS92 1VBB1 2RS32 2UWCA 2ZX0A 2BPA2 3BOPA 3OBAA 5C7GA 1APNA 2JDHA 3SXWA 5CG8A 3TN93 4BQYA 3GZTB 2HBUA 1DG6A 1V6JA 3PLQA 4FQ4A 4ZS2A 1RHI2 1C28A 3B69A 1X9TA 3SKVA 2D6OX 5ACA2 4P5HA 1C4RA 2GDFA 1MS0A 4QQ2A 5CVRA 1JYCA 4GB32 4E4SA 2FDJA 1TNRA 5A3PA 4PIYA 5I0UA 1UQXA 3ETQA 1Q8SA 4Z92B 2A3YA 4WV8A 1SDDB 4ASMB 4YFZA 4CDWB 1QWRA 1HW5A 1QGLA 2BNMA 2OT7A 3JCIA 3OGSA 3AFKA 5FZOA 1DQ2A 1VALA 2QE3A 1QF3A 3OEAA 3O5SA 4CXWA 1W6OA 2E31A 2VL4A 3V0AA 1GANA 1VBA1 5A6QA 5FMCA 4I3PA 3AC0A 5IVYA 4LHSA 2VVFA 4DO0A 3CJIB 3IDAA 3WW4A 4JQRA 2VPVA 1TME3 2J1RA 2VGDA 5BNNC 5FDBA 1W28A 2R061 1XJAA 2JWPA 4Q4V3 3J8F2 4DEQA 2DFCA 3U14A 3S0MA 2HYXA 2O14A 1JOJA 2AACA 4KBZA 5FZ6A 3DF0A 5A1AA 4MG2A 2WL1A 2ZGUA 1SLTA 1XNTA 2WA3A 3AYCA 2IVJA 4FPHA 2JG8C 2RR13 4OI0A 4BM8A 2IVIB 3GNEA 2ZGKA 5FY1A 1UOFA 3ECQA 4XC9A 3F2ZA 4I3GA 2D3RA 2Q0AA 1Q5OA 3QOPA 2AEYA 5BNPC 3WF2A 1LENA 2VMGA 1QXRA 3KM5A 4LT5A 1MPXA 1W8UA 4UFLA 4Q26A 2VD7A 3ZSJA 3POSA 1VMJA 2ZGRA 3M8LA 3RFRA 3CEWA 5M0TA 3C8XA 4BQ2A 1XSRA 4KGGA 3L2YA 1MQTA 3WF4A 1TE1B 1SLLA 3FHAA 1VPHA 3WW3A 2JX9A 2QFEA 5D8AB 3QBQA 1NLQA 2UYBA 4XDQA 4XMIA 3T0AA 2BYVE 5IVEA 5LA0A 5CFDB 2HYKA 4D0QA 1ZZ7A 4OZOA 4XIKA 4I01A 3RWKX 3H1YA 5A1FA 4MGYE 4IW3A 2D43A 1F4HA 4PDWB 3WT3A 2XKPA 1HRV1 4RS5A 2EXIA 2QUOA 5FMBA 4Y20A 2YPJA 4Z2WA 1J3PA 1UAIA 4CUGA 5I8TA 2F4LA 5JR2A 4HXCA 4YG3A 5FZIA 1RUE3 1PZ8A 3BGAA 4RR3A 5FYMA 5E88A 2XR4A 1QKQA 2WZR3 3LIGA 1NT0A 4KG8A 3Q8BA 3THDA 2ZX2A 4UF0B 1V9U1 1EYBA 4XTMA 2WLPA 2X09A 3AP4A 2PELA 3O7OA 2WWJA 3H42B 1Y3TA 2GNBA 2VOVA 2Y34A 1CAVB 2GH2A 3CQOA 3CJXA 4KU7A 1WMDA 1VRH1 2WNVC 1XYOA 2XH6A 2P34A 3AKRA 3INAA 4GKXA 4H3WA 3WDYA 1NE4A 4NVPA 3ZX7A 4R52A 1N1SA 1PM7A 5F3IA 2WNUC 4GWMA 3LEGA 5F8PA 3LKJA 4D7YA 4K7JA 1PGSA 4D7SA 2W87A 2XJRA 2RS51 4FI9A 1RVF1 3S5AA 3CJIA 5F2WA 1OT5A 1PX3A 1ZVFA 3UESA 4BQ5A 4A6OA 1Z7S2 2Y0OA 3H3ZA 1J3RA 2P3YA 3LDKA 2PYTA 3VDAA 1ZRRA 2AREA 1EAH2 3GCXA 2FCTA 1IPKA 3KV6A 4YG6A 3T2OA 1VBD2 4BIOA 1KDMA 2RE9A 1KITA 2XVLA 5GKAC 5KWRA 4XCAA 1LHWA 3IBMA 1AYM1 3GXUA 4KG0A 1F8VA 1I9RA 1URXA 4BXSV 2LS6A 1W6PB 5BUVA 3WW1A 2VM9A 1XNDA 3DN7A 1KFXL 5TSWA 1EUUA 2CTVA 4N9IA 3RYKA 2VE1A 5ACA3 1G9DA 3UKNA 4KGQA 1UU4A 2OYZA 1SCSA 5CG9A 1AVBA 1DFQA 1S0DA 1FYUA 1LR5A 1JW6A 5C3PA 2NP0A 4RD7A 2FDKA 2PHRA 3A23A 3MIHA 2C5DA 1RUC1 3I2OA 2JD4A 4NIIA 4JX0A 2D3SA 2G19A 2WO3A 5C71A 1H1MA 4HOOA 2AYHA 4LBQD 1H2LA 4QB1A 2W5FA 2VR4A 1SMVA 5J98B 5H9SA 5CFDA 2ZACA 1DQ5A 5EPAA 4RQPB 1OQ1A 2ZAHA 2IUWA 5FY5A 4COWA 3RZJA 2UYAA 3IDEA 5CAZA 3JQWA 4PDWA 4DXRA 1JYIA 4XFCA 1AYN3 1RUI1 3VZOA 1W06A 3GBFA 1OA3A 5LA2A 3WF0A 4E2QA 3KV4A 3ZXJA 3SITA 4Z07A 3N36A 1RC6A 3IPVB 1FV3A 4DQAA 4QKNA 5FK8A 4ISRA 1UL9A 4HVRA 4XF9A 2DCKA 3PVOA 3HQUA 3M4FA 4B3NA 2D98A 3IAQA 5DXDA 1L3JA 2EVXA 2VG9A 4HKOA 3U37A 1CIYA 3VBFB 3DPRC 3VBHA 4Y22A 3UGGA 3RQ0A 1JUIA 4K21A 5CZKA 1KS5A 3R4UA 3ZOIA 2WFF3 1N3QA 3ZKYA 5IFPA 5FZ3A 3APBA 1GR3A 1NXD1 2A73B 4JGZB 4UT5A 3U75A 1XRUA 3C7GA 4Q4Y3 3WG2A 3ILFA 2R0FA 2VCBA 2FZ1A 4L8QA 1UZVA 2ZGOA 1RXGA 1SCRA 2QQKA 4QDRA 5FP8A 4EQVA 5FP3A 4DXTA 5KHGA 5CKNA 2QCSB 5G04L 4AEJA 3KQ4B 3MFAA 3T1MA 4XILA 5T5PA 1MS9A 3GZEA 3WW2A 1FV2A 4Y1UA 4K8RB 4A6SA 3JD73 2OKXA 1FT9A 1XQNA 3NL1A 4XABA 3V64A 3SH5A 2VC9A 3V65A 3K3OA 4IGQA 4TYSA 2JDAA 3LCPA 2HWC1 3ZIXA 4MH0E 4LLOA 1UN1A 1W3XA 2XLAA 3BB6A 1QXJA 2RM21 4HETA 2YBPA 3T30A 4DUXA 1SZBA 1RYYA 4HKWA 2IZWA 3OSDA 3KT7A 1FPN2 2BGCA 3U4XA 1AL0G 4Q8LA 5ISLA 1HQNA 2OQ6A 3AZZA 5AFEA 3FMGA 3OBRA 3THTA 4GA9A 2PFWA 3GJBA 4BU2A 5AVAA 4ZS3A 2W92A 3K46A 4XQDA 5GLVA 4XBQA 1CVNA 2XJUA 3LFMA 3SKJE 1S2EA 2VQTA 3MYXA 4I0BA 3PIJA 4QPIC 3KZ4C 3MV11 3N7KA 5FXWA 4IEYA 2VNVA 1DQ4A 1RUG3 2RDSA 5B4NA 1AX1A 3EHKA 3BYWA 1WCKA 1PIV2 5FZCA 4CDQB 2JIGA 5IATA 2OS2A 5C5UA 5JXIA 4AVAA 5A33A 5JCTA 3T1LA 3CIHA 2WAAA 2YFUA 4XUOA 1WBLA 5LCWL 4FPOB 2ORXA 3C3VA 3VBFA 3O1PA 4AXOA 3NO8A 5I0SA 3TNQA 2BQPA 1XSQA 1DYOA 3ZXAC 1LEMA 1TMF3 1W6NB 5L7OB 2BVBA 2RMU1 4XZPA 2CGPA 4LXLA 1JS9A 1B35B 2FMDA 2JEMA 3T09A 4COUA 4RSUA 2E51A 4AW7A 2NM1A 3GGLA 1XOYA 4CDWC 4Q0SA 3HAGA 5FPVA 1ST8A 1FI2A 2CAVA 5FP4A 4XHBA 5F37A 1OKQA 5FBZA 1IKPA 3SNMA 4GH4B 5F6LB 1YLLA 4YSFA 3RNSA 5F2SA 1A6CA 5FY8A 3WNMA 4FPYA 4NMIA 4F7ZA 4EYUA 3WEZA 4FSJA 4QAWA 2GNDA 1O8SA 3E97A 3BTZA 4ZZ8A 1GOHA 1O3RA 2WDBA 1D0HA 2C6SA 4FVVA 5SV8A 1F4AA 1UO9A 3DXTA 3J9SA 3K4ZA 1HQWA 3TNPB 2E7TA 1VBB3 3TN91 1YIPA 2E33A 2DU0A 2OW4A 1KS4A 2JDNA 2RJLA 5FYCA 3HN3A 3POIA 5DAXA 3WOGA 3PDQA 4MZUA 1DZQA 1NQDA 2GNTA 1JZ7A 1X82A 1ASJ1 5CFCB 4QPWA 5K0UC 4MVTA 5IYYA 1QXPA 4W4ZA 4J25A 5A3UA 1RIRA 3VDCA 1OXCA 3I4IA 1K5JA 2JB4A 5FPBA 1DGRN 2NPIA 5D8AC 1C5HA 1VBE2 2Z2SB 4FFGA 1IGOA 4CEYB 4E2SA 1ULOA 1GP5A 4IE0A 3ZLIA 5L19A 4Y26A 4BB3A 4OQ8A 1VBA3 1US3A 4TLGA 1LOBA 1I3HA 5A6YA 1BZWA 1O59A 4HONA 4MXWB 1ODNA 3NJZA 4Q4V1 5E1RA 4F8AA 1W2UA 1RMU2 1OQDA 3WV6A 4CDQA 4WBBA 3GYDA 1O3TA 2W91A 3T2QA 2J1VA 2OZ6A 2W08A 1RJ7A 1H4HA 4LHLA 3U11A 4AI9A 2YMZA 4QGNA 1BXHA 5IJRA 3RZZA 1VBC2 4CEWB 2RR11 2VMDA 2DF7A 1ACCA 1FAYA 4EN0A 2HWB2 1AR72 3K77A 5DPNA 4CRQA 3ACGA 4IV3A 4WVZA 5C8CB 1QDOA 1CONA 4AHXA 4K6BA 1FPN3 3NJVA 5L7OA 1GOFA 1QNYA 2EAKA 1BCXA 2W47A 1UY1A 1RUF2 4YG0A 5EJZB 5FIXA 1XPWA 4A7KA 3MV01 5DG1A 1TVGA 4LNVA 2VAUA 3I2KA 4PJYA 1NX9A 3LEIA 3Q8CA 2HWE1 3AP6A 4LITA 3WDTA 3POGA 4DRVA 2ARAA 2J1AA 1MEC3 1W0PA 3ZYIB 1PMJX 1R1A2 3SMHA 3GDBA 4XBNA 3HOBA 1O4ZA 1VE0A 5GM0A 3KCXA 4IESA 2VTXA 3W58A 3WP5A 1PK6B 3ENRA 2GMMA 5FFOC 4L0PA 1IPJA 1NY72 1NCRA 2W9XA 4TZDA 2OXBA 1RUE1 1W9FA 2BWCA 1Q8PA 1R091 3AMNA 3IMNA 4AR2A 2VZTA 2WZR1 1GQHA 4IGOA 4V2WA 3ZN6B 3I54A 4QX3A 1RUH2 2W1UA 5FBJA 1JYVA 3O1SA 1C8M2 2YC4A 4RFT0 1UXZA 1CAXB 2YHJA 1V9U3 2VU9A 3EBRA 3HNMA 2NMNA 5DG2A 5JI7A 2D5HA 1PHMA 5HCAA 3PURA 3I3BA 1U5XA 3TEZA 5F9TA 4EWDA 4JTOA 1SDWA 5FZLA 5C3OA 2XMLA 2ZGPA 2XWBB 4A3ZA 2O0OA 1VRH3 4OHYA 4H7LA 1ZBA2 4UFMA 5AC92 3NNMA 2PA7A 1UYXA 5FZBA 3O1RA 1FNZA 2UURA 3HD8B 3ES1A 1AR62 4XJUA 3HT2A 2E32A 1GV9A 1WBFA 3KB5A 4RQPC 3HEIA 4EN6B 4UBHA 5CKQA 1SBFA 3ZFFB 2RS53 2VVDA 2W39A 4FT8A 4P9GA 4RYDA 4AYUA 4IEXA 4MGQA 4BMEA 3ZXEA 4CDUB 2DVGA 2QQMA 4LK7A 5ABJB 1QJU3 2XB6C 3E6CC 4Q4X2 5DDJ2 4IE7A 2XXZA 2RS31 4LHKA 3LAGA 4Z2AA 3LEMA 5B2GB 4HN0A 2GSYA 2Q1ZB 4P08A 4QB6A 4AAXA 5HV4A 4CP9A 3GZAA 1AYM3 4MGIE 2ZGSA 4MV2A 5IK4A 1WA6X 2VOTA 2ZHKA 1RHI1 2BBAA 3I2GA 4Z82A 5ACA1 4XF3A 5JIAA 1ULCA 3B9IA 5DAWA 5IT6A 4JKMA 1HIXA 2IXJA 4QX0A 5FYBA 1VAMA 2GN7A 2YGMA 3POWA 5L9BA 1WMEA 2YC2A 5CU1A 4MYEA 1XU2A 2SBAA 2A71A 4BDVB 5L9RA 4FPCA 4N9HA 4S2HA 1UOJA 3CZUA 5FJHA 4JGZC 1X7NA 4G9SB 2Z79A 2WR9A 2VCAA 1VR3A 2YB7A 3IDBB 4M4RA 5A3WA 4CE8A 1IQAA 2V72A 2E63A 2JKXA 2OX0A 1SFYA 1J59A 2UWBA 4UFHA 1N3OA 2FCVA 2UY9A 3SQOA 2BOJA 1S0EA 1CJDA 1HRI3 2XQRA 4K1ZA 1CWPA 3T08A 5BNNA 2DV9A 4WZFA 1W6QB 3R0RA 1BMV2 4LULA 4UW6A 3RVHA 1CX1A 1LRHA 3HNBM 4CTEA 1HXS2 1CN1A 3CU7A 3GF6A 3ZYHA 1JYWA 4QX8A 1CD3G 2VNOA 4XFAA 3U10A 5LWBA 1DGWA 3AKQA 3PVNA 1JMUB 4YGBA 1AX0A 3NW4A 2JG8A 3X29B 2XPJA 4FTBA 2QNKA 5FZ1A 4Y4YA 2GC3A 3AZXA 5C4WC 4DZGA 1HN1A 5SV5A 4C0HA 4JDMA 3UJQA 3LWCA 3FLTA 5BXXA 3K48A 3TOJA 1WZXA 4AI8A 3FFZA 3PUSA 2P3KA 2J1UA 4L11A 1VRBA 2YFZA 4P5YA 3PTYA 4Q4Y1 4OI1A 2C4XA 4QPGB 3T0BA 3HQRA 4YZ1A 3CMGA 5FZKA 3AYEA 1POV3 5A3LA 1WCUA 3B02A 1UWWA 2V4AA 1XBFA 1VAVA 4S2DA 2G1MA 1DGLA 3DECA 2ZCWA 3LA2A 4B8EA 1VMFA 1WUVA 4P9JA 5ABJA 3N9LA 3PJYA 1J1LA 3NKGA 1V6LA 4AFMA 4JGYC 1BLZA 4A3XA 4OULA 3DYMA 2Q5TA 4XCBA 2WO2A 3ITQA 5FO7B 4AHWA 4Z8BA 1QQP2 2YGLA 2FDHA 2DU1A 2QTWB 1PVC2 3ZXFA 4Y3OA 4NHYA 4AFCA 4C90A 3VKOA 3PUIA 1YQCA 2HWC3 5LA1A 1OLRA 3PUAA 5D2AA 2RG4A 2XBO2 2VXRA 4NHXA 5IHRA 2PHTA 3DPRB 2D6LX 5E89A 1B35C 3A22A 3D0JA 4DRRA 4MGZE 1ZBA3 1SLCA 2A3WA 1BBT2 3NAPB 4AI1A 5AC93 1PZ9A 3HPNA 3EQEA 1LHVA 4PQQA 4Q1PA 4W8JA 1L7LA 2AR6A 4Y1XA 2HEYF 3ZPYA 5FZ9A 5BNQA 5KHIA 4E2GA 5LW9A 3O0WA 2K2SA 4K9SA 5IAVA 1MVQA 4GH4C 2FBEA 4EWAA 2BW8A 1LOFC 2WAOA 3AM2A 4XFFA 4ZPIA 2I74A 3DKWA 4KI5M 1CIWA 1W90A 1P8JA 4JHZA 1AXYA 1EAH1 3NNGA 1W6QA 4FXKB 4AI2A 2QDRA 1VBD1 4CU9A 5CADA 1RUG1 2VZ3A 2WA4A 4FP2A 3I2IA 2X53S 3N9MA 4BXFA 2QQWA 3JQXA 3HMYA 4PT6A 3GHMA 3HNYM 1QOSA 4ZONA 4E4ZA 1G8WA 1GUIA 1GQGA 1ND3B 4JKKA 3KT1A 4WM7B 5DAVA 1PO13 4AQSA 4COYA 3LF7A 3RYRA 4BQ1A 1JBCA 3NJXA 2V09A 3LE0A 4JHTA 5FZMA 3TBDA 3OGGA 3ELNA 4XF1A 1D4VB 3S6PA 1RUJ2 1J1TA 2JD9A 2KA3A 1OPOA 1TMF1 5LEKA 4O9GA 5CFCC 4ZHNA 4ZU7A 3RMXA 4AHZA 2IXCA 1KEXA 1J83A 2H6CA 1BK1A 3LIHA 4QM9A 1W3VA 5BYNA 2R042 2RMU3 1QU0A 2OIIA 4Q0QA 2EALA 3WCSA 5FV3A 1VMHA 2W1SA 2YC0A 2HKXA 2ZAAA 3H1WA 3C7HA 1R083 1TEIA 4Y5SA 2HWF2 2XVGA 5FY4A 2B8MA 3P5BA 4UW5A 2WQ4A 3GZUC 3NV2A 4L92A 4CEYC 3EXUA 3OYWB 2VNRA 5JUVA 2ZABA 1NKGA 3WF3A 2PAKA 2VUCA 2GC1A 4YWAA 4JRAA 2L9LA 2P2KA 1UZWA 2YPDA 2ZKLA 4KNCA 1H2MA 5EQUA 4CEWC 4RL7A 5K4LA 4XZUG 1AHSA 2XJSA 1DZRA 3ALQA 2RHPA 2ZXQA 5DUWA 4M0NA 4JDOA 5C8CC 5DMYA 2O8QA 5E6HA 3DPRA 3GM8A 1G9AA 3D5OA 3ZXGA 1YNAA 1FOD2 2B42B 2OA2A 4AFDA 3ACLA 5AVPA 4ASKA 3NAPA 4CCMA 1ASJ3 2JE7A 2RDRA 4AQ2A 1OFSA 1QJFA 2ZGTA 1UD1A 4MGKE 4F3JA 4CXXA 2DCJA 1CJPA 3B01A 1LODA 1S1AA 2CSGA 3O0VA 1NA1C 4BPZA 3UJOA 1HB1A 2EIDA 2ILMA 4BJ0A 4BQWA 5LA9A 5A3MA 3HBZA 4IEQA 3ZR5A 1PK6C 2ARCA 2WO1A 4YARA 1Y7BA 4CXYA 1AR82 5J1XA 3CBNA 2W0XA 1H2KA 1UKRA 1LKNA 1EP0A 1ND3A 2OUHA 3IMMA 3NNFA 1ENSA 1AL22 1S4CA 4LKDA 4WVMB 2BVVA 3DL3A 2NQYA 3UGHA 3WXPA 2JDZA 3LEKA 2W1QA 1LHUA 4BHPA 3H8RA 3JB8A 1O7FA 5KHJA 3FBMA 3T4VA 3KQRA 1QOTA 1FPN1 4LBMA 4LJHA 1HB3A 5EFUA 4ARXA 3VDBA 2WWSA 4ASLA 2D97A 2GH8A 3CHXA 1UPIA 1UOBA 1JUHA 4YPJA 4GMP3 1BBT3 1T6BX 2NN8A 1Q3EA 3IWZA 2TNFA 1H8TB 1YRZA 2PMWB 5A1LA 5K0UB 3R05A 2CV6A 2R072 3AX4A 2ARBA 1IG0A 1RINA 2B7YA 4KWLA 5DZFA 4CP2A 3MLKA 5FPLA 4XYXA 1MEC1 1TQ5A 2HWE3 3O1MA 3DEMA 3WP4A 1JZ2A 4E9KA 1U5IA 3I3QA 3OYWA 4HSJA 4RN5A 4OCTA 3ZFFC 4B4QA 2IXKA 1S0FA 2WABA 1LHOA 3OEBA 1JZ6A 2A70A 3AB0A 3M3EA 4CDUC 3AXEA 3KVBA 4IEUA 4QPIA 4TSVA 3TAYA 1DYKA 3QH7A 5ABJC 2JG9B 1PO22 3GJAA 2NZ9A 4NHMA 3I59B 2YU1A 1L7QA 3V56A 5FZGA 3H0OA 5I0TA 4FPFA 5CIRA 4DY3A 3SH4A 3AZVA 4FTSA 4XAEA 1R093 5T5JA 1WW7A 2BNOA 2Z69A 1C57A 3ZYJB 4QX2A 4A45A 2LM3A 3RMYA 2NLRA 4YZ4A 5CKMA 1W2AX 1JN2P 3ES4A 1C8NA 1D4M2 1ZRDA 1W0NA 3P3NA 4D69A 1YQ2A 2HH9A 5EJ1B 3L2HA 2MPFA 1GICA 5LY1A 5FQ0B 5FYUA 4M3CE 2VULA 2XKOA 1VLNA 5DZGA 4CDWA 4HPKB 2Q1FA 2GMPA 5A6ZA 3Q9OA 1W2NA 2BGOA 1OC1A 1F15A 1H1IA 2PHWA 3I2DA 1DQ6A 1H6YA 2Y0IA 4IE6A 2BERA 1JU4A 4S2FA 4DXSA 4A7YA 1J3QA 3WHUA 2ZHMA 4D6QA 3QCWA 4QXBA 5FP9A 1QJU1 3W5NA 3AVRA 3JBG2 2WQ8A 3LSEA 4TN7A 5KXBA 1US2A 4RFRB 1NLRA 3RZGA 3D6EA 2WS93 4WVMA 2RS33 1XNAA 2KR2A 3GHNA 3O12A 3OD0A 2TBVA 1MVEA 1KXGA 1RUOA 3AZYA 4CPBD 2C0ZA 3ZN5A 1GNYA 4B4RA 1YEWA 3OTFA 1RB8G 3VHOA 1M06G 1GOGA 2VOXA 3S30A 1RHI3 5LRRA 1NG0A 4AEMA 1Z0HA 4XXPA 1G9FA 3RWNA 5LY2A 2PAMA 3THCA 1H8TA 4GB33 5K0UA 5JZGB 4PF1A 1PX4A 3HN1A 2ENRA 3WQ1A 4B4PA 3PVEA 3VL8A 2IXHA 5KBFA 4GXLA 4M01A 4QPGC 1V0AA 4DOUA 1A34A 5D8AA 1MZ5A 4NHKA 2FQPA 5LBFA 2Y38A 2XJPA 2Q8EA 1DCSA 1UIKA 1XB9A 1KFUL 5A7WB 3CLPA 3AKSA 1HRI1 4CYDA 1RMU1 1SEFA 2JG9A 5FLHA 5FPZA 5C9AB 2H0BA 4JKLA 2YY1A 1OHFA 3J8F3 1J84A 1M4WA 2BDRA 2CDPA 2E7QA 4QXKA 3BVCA 3VHPA 3SEPA 2E7AA 2HWB1 1AR71 4OHZA 4FPLA 1PGL1 4UF0A 3IDCB 2ZEXA 5H9QA 3OUIA 3MZHA 2DYCA 2BJSA 1G6NA 1UPSA 3CZJA 2JE8A 4LBJA 5ANQA 2ZEZA 1CAVA 3VZNA 1S0GA 4LK6A 4UOJA 4ORFA 5EZWA 4GIQA 1XE7A 2YUEA 1REDA 4LQRA 4YW2A 2DDUA 5CBLA 3NAPC 2D7FA 4Q0PA 2JDUA 5FXVA 2GMEA 3OCPA 1POV1 3BALA 4E8DA 4H7MA 1QEXA 2A1XA 3SHRA 2WT0A 4M4PA 4DIQA 5A3NA 2YU2A 2P6HA 1N47A 3IKWA 3WQBA 1MS3A 1A8DA 4Q4W2 2G9ZA 2WNOA 5JXJA 4TTGA 1LGBA 1PO23 1NY71 5B4XA 2OQ7A 3OBZA 1IKQA 4YYOA 5FOJB 3MIFA 2DCZA 4FP3A 1CPMA 3VBRB 4L2NA 2ZEYA 3VDDB 4B1LA 1JYXA 4K20A 4WM7C 4XJWA 1ND3C 3FHQA 1DIWA 1NLSA 1RUH1 5DN2A 3W59A 3ILNA 3OUHA 1W6PA 1C8M1 2W46A 5L9VA 5FZDA 1SACA 3PHMA 1WMXA 3L9JT 4LKFA 3O14A 4V2VA 4E4DX 4PBPA 1LB2A 4YGCA 4A41A 2P37A 3VKMA 5LRSA 5I0RA 3WLUA 1D4M3 2DCTA 3DV8A 3AJYA 1ZZBA 3MHZA 5C4WB 5JZGA 2WIIB 3MEPA 5JMOA 1ZBA1 1O6UA 2K9ZA 5AC91 5GZCA 1W9TA 4QPYA 2QQPA 3SLIA 3RZMA 2JICA 2XL7A 3A4UA 1UU6A 1ENRA 3ZXLA 2ETEA 4UWDA 1QJEA 3S5QA 3ZSEA 2R062 2O1QA 1Y4WA 5E16A 3POJA 2ATFA 4RQPA 3ZM8A 4M00A 1I6XA 4QMAA 1GSLA 5C9AA 3DYPA 1G7YA 5FXXA 3JBG3 4Q4X1 1QJZA 5GALA 3VGIA 1Z7S3 2ORZA 5H9PA 5FP7A 1V00A 5LBBA 3SISA 1EAH3 3ZFGB 1VBD3 4S2GA 2A6VA 5DAQA 5FZEA 4JGYB 4QM8A 5A3TA 1HV1A 5F3CA 2JB8A 2RS12 3IPVA 1PO11 4I09A 1JYTA 2QDNA 4A4AA 2VTXJ 2ZJCA 3UYJA 2D6PA 4QHBA 4YM2A 4PLMA 3MF6A 1B09A 2CU5A 3VZMA 2PQQA 3VD3A 4FAGA 1LEDA 5FREA 3WDVA 1EV12 4ONUA 2WN3A 5FYSA 1HQLA 3WX5A 5JPMB 1K45A 2VQUA 3POBA 4YW5A 4ES8A 3DYOA 3MI8A 5JAXA 1T2XA 3LA7A 2MHFA 2C9KA 5T5LA 4JGZA 1QNWA 4CDXB 3EYPA 1R081 5HXVA 3TRSB 2QZ2A 5F32A 1ULEA 5IWFA 3USSA 4GKYA 1CQ9A 5FZ8A 1ND2B 1SFNA 4W6WA 5FJKA 5A7SA 3W20A 3RGBA 4OYUA 3VZJA 2Q1MA 1GLHA 3MUY1 3PL0A 4L99A 4CCJA 4WM8B 3KSCA 3DCQA 1S0BA 4W6YA 4IV1C 1K3IA 4LBLA 3I97A 1W05A 4BISA 3VBRA 4YNIA 3VDDA 1GU3A 1N1VA 1QIQA 2VECA 1S2KA 1HN0A 3ZDVA 2F6BA 3ZXDA 1GZCA 2AUYA 4R4XA 2HWD2 2EAAA 4YZ3A 4AEDB 4KH9A 3NNLA 2J1TA 3VV1A 1YIFA 1GFF2 4SLIA 5JOXA 1U5YA 3OD4A 4DUWA 2PN5A 5C4WA 2HLEA 3BI3A 1QJX2 1WKYA 3IAPA 4NHLA 2DCYA 3W21A 1H8TC 1V6NA 3N9NA 1LU2A 3A0NA 3R4SA 2XUMA 3RG0A 1RVF2 2DTWA 2VW1A 5I8SA 3SH3A 4LBNA 1L7RA 2WT1A 4N53B 3ILRA 4ISQA 3RDIA 2AEZA 5HBAA 1V70A 3O1OA 5FZ0A 1REFA 4DNYA 5I91A 4N43B 4XXAA 1QDCA 1LOGA 1COV2 3I7DA 4RHV2 3E5UA 4IEPA 4Q8KA 2XHNA 3UT0A 4HFSA 4BMBA 4HK9A 1Q8VA 1ULPA 2JG9C 5JIUA 2WZEA 3ZFGA 4JGYA 2R1BA 3VBOB 4IE4A 1NCQB 2WLQA 3FBYA 2XJVA 4AFAA 3WINE 1PVC1 3QD6A 1C5IA 1OBNA 1BEV2 1LJ7A 1U5ZA 3E5QA 1KGYA 1YYNA 2ZOEB 4LO8A 4OMCA 3KT4A 1BYHA 1WCSA 1ZZ8A 1S55A 2XBO1 1D7PM 1H30A 2X05A 3WNOA 5F3EA 2EIGA 3VD9A 4YRDA 4X6QB 2QQNA 5IVCA 4XE9A 3T3YA 4H14A 3NRUA 4IERA 2LALA 4LOTA 5FTTC 1W6NA 3RZHA 4HSLA 2K46A 1Z78A 1BBT1 2AH2A 2ET1A 1SPPB 4GMP1 3LPFA 4GWNA 3U4SA 5LEJA 1NAEA 2GC0A 1B35A 1OD3A 2D6MA 2VMCA 4CDXA 1QOOA 4HG6B 4PIZA 3MLLA 2RJKA 1OURA 4QXHA 3USUB 2DURA 4UFJA 1RUI2 2BBVA 3R6SA 4FO9A 1WW6A 2BRTA 3AZWA 3OGRA 2ZTNA 1AR92 1W03A 1NA1B 4GH4A 4LLFA 4BA6A 1LOFA 1PGW1 2GN3A 3WDXA 4NN0A 2ERFA 1CR7A 4DXZA 3VD4A 2B9VA 1UXXX 4XAAA 5JOYA 2WNEA 2GNMA 4Q2FA 3ZO0B 3MIDA 4D6SA 1RL3A 1F2NA 2QQVA 3T4HB 3ACIA 4OHWA 3KV5A 1FX5A 1PIV3 3F95A 2P3JA 3M3CA 5HPOA 1REEA 1ZYBA 2N7GA 1NZCA 3M7AA 4XHXA 5KR7A 1LOAA 2WSVA 3LB9A 2J1EA 2DFBA 4QKBA 4Y1VA 4P9LA 1IG3A 1ULGA 3PUHA 1CZVA 2RV9A 4GAZA 4U36A 5EWSA 1K5MB 5FO9B 2WKKA 5LK7B 2ZGNA 4YW6A 4NRMA 3LOIA 4R9BA 4IEOA 5C5TA 2XGXA 3WVJA 5LB6A 1Q8QA 1ZNPA 3WNPA 3O1VA 2H6BA 5CFCA 5K7PA 2DVFA 5JZGC 2DBNA 3AL5A 4IUGA 3C2UA 4LBQB 3AKTA 2NYYA 1OOPC 1JXNA 3OB8A 2HWF1 3MIEA 4WVWA 4C8DA 4YVSC 1O5UA 1OPMA 1SLBA 2BGPA 2YG0A 4MOAA 4ATEA 1OF4A 3HIFA 3OGVA 4ITCA 4XUTA 4N43A 4CEYA 3KF3A 3B7MA 4LIVA 4AWDA 1QHDA 4CCEA 1YWKA 1ODMA 4NIAA 3B3QE 3IIAA 5C9AC 2X5IC 4QX7A 3NQHA 4MXWA 3VZKA 5IK7A 1TNFA 2QVSB 5F5AA 2MEV2 4CUCA 1OMIA 3UK9A 1H9PA 1DLCA 3O1UA 2RM22 1SFPA 1LTEA 1LGCA 2HWD3 2WS91 4Y5Z0 3NKTA 4AVCA 4AVTA 3WQ7A 1UW8A 4CEWA 1AJOA 3ABZA 1CGPA 2A5ZA 2Q8OA 1O4TA 1WLWA 4I0WB 4IEZA 1UY4A 3FC0A 3EO6A 5C8CA 3OOXA 3HBKA 1FOD1 4FOQA 1GP4A 4P9XA 1RUD2 3MW4A 3WUCA 4AAPA 4D8MA 4GB31 2XHKA 1ZZ9A 4A44A 2CDOA 3ZVXA 4MUVA 4FPGA 1IQDC 1U12A 2XL9A 4MGTA 4Y33A 1ENXA 5FLJA 3DKQA 4Y1ZA 3AK0A 4LUKA 5C33A 3G7DA 4GWIA 5J48A 1DQ1A
chains in the Genus database with same CATH topology
1BKZA 1NA1A 1VBE3 3BIWE 4Q0UA 1COV3 1S0CA 1MS8A 4RHV3 2W68A 1D2QA 4HKLA 4G4FA 2BEOA 1AR81 3AMPA 2HEVF 3VBUB 1FMD2 1PK6A 4OFGA 4HVQA 3J8F1 1RMU3 3VBRC 1N3PA 2YV8A 3VDDC 1NXMA 4IXLA 1BEV3 4M3CB 1MR5A 2D6KA 2OUJA 2XJTA 1VBC3 5KXDA 3ZN6A 4DMIA 2Z42A 4NO4A 2IXLA 1SLAA 2HWB3 1AR73 1MACA 2D3PA 3B5LB 1CAXA 1DF0A 3D0SA 3UL2A 5IK8A 1YI7A 2A6ZA 5KHKA 4JAAA 4QQPA 1RUF3 3BPZA 4FOYA 3GALA 3M2MA 4LBQA 2G9FA 2R071 2ZS6B 2WQZC 1AJKA 5J36A 1Q8OA 2IWGB 3JUUA 5BV6A 4BYYA 3HT1A 1R1A3 2KXLA 5GZFA 4COVA 5EYXA 4QGMA 5BNOC 3CO2A 1BVP1 2PLV2 4I0AA 3ZFFA 3URFA 1PO21 1S2BA 4A7ZA 4EROA 1F5FA 4CDUA 3FLRA 1EPWA 3FUQA 4D94A 4LE4A 3TYJA 3TN92 3ZFGC 3E6DA 1IOAA 5JSOA 4HVOA 2CNAA 3MW2A 1NOVA 4YM1A 1RUH3 4LTAA 4GALA 1C8M3 1I5ZA 4BCUA 4I30A 1D4M1 3VBSB 1POV0 4AGGA 2Y26A 2A75A 1U0AA 2YXSA 5J09A 1CPNA 2WINB 1VB2A 2B45X 1GZWB 3JB4C 3A0KA 3VHRA 1RITA 4K1YA 4CDXC 3AP7A 1BJQA 1LGNA 4M0HA 5T54A 1TME2 3OY8B 1ZA4A 4JTNA 1ND2C 1BQPA 2W52A 2NMOA 1LECA 1CAWB 4Q4V2 1AR63 4BWOA 4PLNA 2P3IA 1F5JA 1LCLA 2ZMNA 1AF9A 4WM8C 1UCXA 2Q30A 1AUYA 2ZMLA 3JBG1 4LBKA 1Z7S1 4EN8B 2MEV3 3M70A 2RR12 1D0GA 5GZGA 4Q4X3 5DDJ3 4M3CA 1AX2A 5GLWA 4ATFA 2BUKA 3NVCA 4JDNA 4B7EA 4EN7B 4AEDC 1JTZX 3MGUA 1W39A 4QD2A 3HWJA 3RRDA 5I8YA 3KD4A 1MS5A 1RUD3 1X33A 4XJZA 1NQJA 5GLTA 2ES3A 4TLFA 1GNZA 1VJ2A 1W6OB 3V0AB 1ZRFA 2LUWA 2Q4SA 2WZPP 4DINB 1YI9A 1HDKA 3FLPA 4K8FA 4N53C 4BLIA 1EY2A 4HT1T 1WA4A 4QPGA 1OA4A 2DTYA 3CNAA 4AGVA 2DUQA 2XJQA 3IT8A 4HN1A 4N43C 5J96B 5LK5A 3AMHA 3ZMNA 2SLIA 4FBFA 3MF9A 1KRIA 3VBOC 3WY6A 1NCQC 4AVVA 1DGRA 1OI6A 1HXS3 2QKDA 3NV3A 2VQ0A 4QGLA 2AZ5A 4AF9A 3VKNA 4XJAA 2VOKA 4NWVA 5JSRA 2ZMKA 1LOEA 3H7JA 4PLOA 5EV7A 4Q1RA 3D4KA 1MZFA 3RI8A 4FXGB 5EJ3A 3J26N 1HKDA 3H9AA 2VVEA 2OPKA 3AYDA 3OY8A 4KBBA 5EXOA 1CAWA 4QT6A 3VHNA 4META 4RS5B 3AMMA 3VL9A 2PHXA 4Q4W1 3ROUA 4LUMA 2E53A 1F31A 2WFPA 4RR3B 1WCDJ 5FCCA 1YJLA 1GYKA 1UIJA 4IV1B 4PF5A 1WLCA 4EWEA 1QQP3 4WM7A 2H0VA 1PVC3 2XVKA 2A3XA 1K5MC 2Z5WA 4LR4A 3OJBA 4Y24A 5KC6A 3E5XA 3S7IA 2XBO3 2V73A 4XJ8A 1W6MB 3TWIA 2ZX4A 3VN4A 5DZEA 3JZVA 2UWAA 3AFGA 1DHKB 4ZKTB 1IS4A 1AYN2 5FRAA 4IEVA 4LO6B 4XFHA 4N90A 1MZ6A 4XFBA 1ZX5A 3PJQA 4R9AA 4ES9A 1ONAA 2I2SA 2R30A 4XPVA 3QACA 5HI0A 1AZDA 2B46X 4YM0A 2CWMA 1PIV1 2RS11 1DGWX 1Q43A 2X29A 4QQHA 5A32B 1AXKA 4AK3A 1AXZA 3M1HA 3R4DB 1XNCA 1DLLA 4GMP0 4AI0A 1KJLA 5H9RA 1UZYA 2WFF2 3H7YA 1KJRA 1EV11 1RUJ3 4ZU4A 4UW3A 2GALA 4Q4Y2 3MPPG 1O3QA 3H8UA 3MFCA 3KCYA 5L36A 1YO8A 2B39A 2R043 1UX6A 1CAUB 3WD5A 4IEWA 1VIWB 3ZN4A 3RS6A 2R1DA 3WDWA 2HWF3 3DUIA 2PTMA 4AQTA 1MZEA 4ZXKA 3JD72 3KMHA 3VBUC 3FFQA 5KXEA 5IK5A 2GZWA 4O9EA 4IV1A 3WQ0A 3ZYRA 5JPNB 1RGSA 4L9BA 2HWD1 2D5FA 1SBDA 5T3NA 3WCRA 3KGZA 3ZFEC 3VBHB 4IQPA 4Y22B 3I8TA 1YFUA 3UKTA 4C91A 3S7EA 4J1XA 3KLSA 1W6MA 2R32A 1QJX1 4JC1A 2LTNA 2PHDA 4YW4A 5J37A 1WGPA 1FOD3 2GAUA 1H4GA 1ZRCA 4E27A 3FX3A 4N7IA 4Q27A 1UZZA 4FTEA 2YDEA 2CYFA 3PNAA 3UKVA 1OOPB 4YZ5A 1UMZA 1VBE1 4YVSB 1RUG2 1COV1 1XXNA 4X8NA 4RHV1 2D93A 2EXJA 5BPXA 2GU9A 4P9WA 3AP9A 2DVAA 4LA2A 4X6RB 1WW5A 1A8MA 2XLFA 4F83A 4K40A 4U2AA 1AR83 5HCFA 2X5IB 3I59A 5FLIA 3VUOA 3LGRA 3ST7A 1BEV1 5A32A 4XIOA 2ZPXA 1ZBE2 4YVWC 1AL23 1VBC1 2VW0A 1TMF2 4COZA 4W65A 2XWJB 4K3UA 2VUAA 2DUOA 2ET7A 5JWPA 1RTVA 2B9UA 3VBSC 1RUF1 3BU7A 1C1FA 3FHIB 4OHVA 4PBOA 4ZU5A 4GULA 1IS3A 5F1RA 1CAUA 4HANA 4KU8A 3AXDA 2B5HA 2G9GA 2R073 4HBNA 2AGSA 3O0XA 5FQ0A 1ENQA 4HPKA 1AR91 1R1A1 2IC1A 4AHYA 2BTVC 4XOGA 1YUDA 5F6KA 5JOZA 3TB0A 3VKFC 4R9DA 1QJY2 4Z1VA 5A33B 2D40A 2D6NA 2ZHLA 2KM2A 4KWKA 1VBB2 4M3CF 2ZX1A 1DBNA 2R0HA 1JH5A 4R8HA 5GZDA 3D8CA 3SCFA 1LU1A 1YFXA 4AE2A 4YGDA 5HCBA 5T5OA 2K0GA 4KWJA 1LESA 1EPZA 4AGRA 3MIGA 4QQLA 3MDPA 3M3OA 1F9KA 4MXVA 5FAXA 4LA3A 4J6GA 4DB5A 2E9QA 3ZSLA 3HR9A 2G4IA 2CL2A 1OA2A 1OOPA 4D3WA 1VBA2 1IS6A 4YVSA 4XBLA 5J3UA 4PQ9A 1W0OA 1AR61 3QH6A 4FAHA 2VNGA 1WD4A 2WC2A 4WZCA 5C6CA 4IL7A 5BNOB 2TUNA 1YXWA 1G9BA 3B93A 1NYWA 1T6GC 1DZTA 2MEV1 2X5IA 4MSVA 4P9YA 5DDJ1 4UBGA 1ZZCA 3QLQA 1V6OA 4AFBA 1XYPA 2UU8A 4FOWA 3RPQA 1DU3D 3H1MA 4R4ZA 1YFWA 3SCHA 4LE3A 3PMSA 4XF4A 3AKPA 2CGNA 1RUD1 4JCKA 2I45A 3NV4A 1MQTC 4OHXA 4IETA 1SLIA 3WNXA 3EJKA 2C1FA 1MEC2 3IN9A 2ZX3A 3FUOA 4HK8A 1OFNA 4LEJA 4LO5B 2A6YA 5K8SA 4AVBA 2XLGA 2ZHNA 1V6IA 2QZ3A 4RS5C 5FO8B 1MS4A 3AJZA 1HRV2 1FMD1 2ZKNA 4RR3C 1FXZA 4YGEA 4QX5A 1Y9QA 3VZLA 5DUXA 4FCAA 1DDLA 1BMV1 2EXHA 3N4MA 4BH9A 4G3YC 1HXS1 1ZBE3 4IV3B 1X8MA 4TWTA 5C8WA 1V9U2 3N7LA 3CF6E 2XG3A 5GLUA 3MIBA 3SCGA 5KHHA 4OZXA 1V6KA 2YYOA 2R49A 4RA0A 2PHLA 4XQ4A 1VRH2 1IZ3A 3WG4A 4LHNA 4Q0VA 4BZ4A 4C1WA 4HZFA 4R9CA 4LO7A 3MPBA 2A6WA 2P17A 1G86A 3M3IA 1DQ0A 1VAKA 1UF2C 3ZMOA 3CJIC 4P14A 2RS52 1A3KA 3LA3A 1XNKA 2ZZQA 2ZBJA 1H2NA 4BLJA 4DY5A 2PLV1 1QJU2 1XE8A 1FNYA 2WT2A 3ZYGA 2X8KA 1NCRB 5BNOA 1WW4A 1QJY3 1KD7A 4Q4W3 2CWSA 4XJ9A 2CY6A 2VMIA 2PHUA 1AYM2 4AVSA 1ULFA 1J58A 1IHMA 1N1TA 5CA6A 3LZZA 1Q56A 1QQP1 1H8VA 2E6VA 3PMEA 1OSGA 3BOWA 3NV1A 5JR7B 1C3HA 1XYNA 3W9AA 4C0BA 3E6BA 4I02A 3RI9A 4QQOA 4RGAA 1OLQA 1RUC2 3AP5A 1SQ4A 1GZ9A 5CFDC 1X8EA 2YZ4A 4XW3A 3P3PA 5CNAA 1QY4A 1TME1 4PDWC 4YW1A 2ARXA 1HRI2 3WR0A 1S0JA 4NR1A 2BFUS 1ND2A 2R063 3DGTA 2VQAA 3H3UA 2GC2A 1CESA 3CL1A 2D44A 4J1WA 4WM8A 5K9YA 3OF1A 1C1LA 1LULA 4EN9B 4XMAA 4Y1YA 1PGL2 3OGJA 1YHFA 3IM0A 1X50A 3GBWA 1MS1A 3VBHC 2RS13 1YCIA 4OVEA 3WUDA 3THPA 1XU1A 4KL1A 4AEDA 4SBVA 3NSTA 1RUJ1 1JHNA 2BWAA 1LHNA 3M3QA 2EXKA 3MW3A 4FPJA 5JDBA 3WG1A 1HV0A 2A7AA 3ZDSA 1WMFA 1WD3A 1EV13 4JRLA 2MNGA 4FPKA 1CX4A 3ME2A 4LBOA 4WVVA 2R041 1N1YA 4N53A 1QMJA 5AFBA 1GNHA 5BNNB 4KQ7A 4MLOA 4NWWA 1HRV3 2ZGMA 1ZZ6A 5JMCA 5KC5A 2JJ6A 1OQEA 4CZSA 2I07B 3BODA 2JE9A 3LSDA 5T52A 3U07A 2JG8B 4AG4A 5JOWA 5EYYA 1PNGA 2C9AA 3VBOA 2HWC2 1NCQA 1QH6A 4CP1A 4OUMA 5BNPB 2WSUA 3PVBB 3OPZA 3N7JA 4D7TA 5IUQA 3T2TA 1PVXA 5CB7A 3ZIWA 3B9CA 1KQRA 5I93A 3V0BB 1ZM1A 2AENA 3RJRA 1H1AA 1VB4A 4EV0A 4OUSA 3H50A 2CGOA 1QJX3 5GJ6A 4I2OA 4PCRA 5FOBB 2VUJA 4JV4A 1RVF3 4DPNA 3USUA 5E8AA 2R6QA 3GBGA 1H9WA 1IS5A 2EF6A 2IFRA 4C1XA 4NPRA 3VKLA 3ZSMA 3FZ3A 5FMOS 2IFWA 1FATA 1O91A 1PO12 2YROA 2CAUA 4BOWA 1DYPA 1RJ8A 2JECA 4UW4A 2VMHA 3VBFC 4OLLA 1X36A 2BNNA 2R16A 2VOWA 3FE5A 5JSPA 1AL21 1OD5A 1YJKA 3ZFEB 3KCCA 5T55A 3RSJA 1K5MA 4PIXA 2WNVB 2VW2A 4X8PA 2RMU2 2UY8A 1WLDA 1RUC3 4HL0A 4EJRA 3VLBB 3FWEA 3ASIA 1R082 2PAEA 2WNUB 4DFSA 3D82A 4UXAA 4OI2A 1WLTA 4B7KA 1AYN1 3B94A 4BE3A 5JLVA 4V1PA 3KGLA 4QU2A 1RUI3 1LOCA 3AYAA 1GKBA 3OBTA 1E57A 1AR93 4H55A 1PNFA 3WP6A 4L97A 4GQ7A 4P9IA 1Y43B 5BNPA 2PHFA 2VY0A 4XFIA 4JVAA 5GZEA 2WFF1 4YVWB 1I1EA 3V0BA 1O4YA 1ASJ2 3K51A 5FPXA 4AQ6A 2HEWF 3KS7A 2WJSA 3RYPA 3N7MA 1R1ZA 1UKGA 1O5LA 3ZXKA 5D1IA 4CP0A 2BFUL 4AEKA 1RUNA 5DUUA 4W6XA 4OI4A 1V6MA 3U0ZA 1XNBA 4AI3A 4DS0A 2OVUA 2ZZJA 2ZGQA 4YFWA 1ALYA 5GLZA 4CDQC 4HLTA 3JD71 1BVVA 2FMYA 2QJVA 1GBGA 3B00A 2A6XA 2DWRA 3G6JB 1PMIA 3BCWA 3VBUA 3BTAA 4XF0A 3WZ1A 1VP6A 4URTA 3N3HA 4IV3C 2RM23 2VH9A 2HJIA 4LO4B 5L7OC 2FZ2A 3WP3A 3ZFEA 1KDKA 3UV9A 3POYA 2JKBA 2IXIA 2DVBA 3JU9A 2WNVA 1ZREA 1YFYA 5T50A 3N35A 3LOBA 2JENA 4XQWA 5F5QA 2WNUA 5J7MA 1PZ7A 4HMZA 2FHRA 4NOTA 2DUPA 2HWE2 2O8OA 4N7UA 5L73A 2V5YA 2DVDA 1PGW2 2F4PA 3MLJA 3FJSA 4YM3A 3RJ2X 1S0IA 1NCRC 1NE6A 1SBEA 4XTPA 3HQXA 5BY5A 1HX6A 4A2UA 4XFGA 4YZ2A 1RUE2 1FMD3 1HLCA 4RGGA 1R092 4YW3A 3WG3A 2WZR2 5JI9A 1ZBE1 3AMQA 1A78A 3J4UH 2ZGLA 4YVWA 3ZSKA 4FPEA 2OZJA 5KXCA 1ULDA 4MX3A 2JXAA 1QH7A 1UU5A 4YLZA 3WHTA 4B29A 2EA7A 5DUVA 5JVVA 4INDA 4XEZA 3VBSA 1MQTB 2ZA9A 3ATGA 2TEPA 4XETA 3WDUA 1G9CA 1D2SA 5FMOL 4BIFA 1O3SA 1GZWA 4FOVA 4FQZA 4Q29A 4QPIB 3NWKA 1H0BA 3MICA 1QJY1 2PLV3 3ZYPA 4Y20B 2WS92 1VBB1 2RS32 2UWCA 2ZX0A 2BPA2 3BOPA 1APNA 3SXWA 5CG8A 3TN93 3GZTB 1DG6A 1V6JA 3PLQA 4FQ4A 1RHI2 1C28A 3B69A 2D6OX 5ACA2 4P5HA 1C4RA 2GDFA 1MS0A 4QQ2A 5CVRA 1JYCA 4GB32 1TNRA 4PIYA 5I0UA 3ETQA 1Q8SA 4Z92B 2A3YA 4WV8A 4ASMB 4YFZA 4CDWB 1QWRA 1HW5A 1QGLA 2BNMA 3JCIA 3AFKA 1DQ2A 1VALA 2QE3A 1QF3A 3O5SA 1W6OA 3V0AA 1GANA 1VBA1 4I3PA 2VVFA 3CJIB 3WW4A 4JQRA 2VPVA 1TME3 5BNNC 2VGDA 5FDBA 2R061 4Q4V3 3J8F2 2DFCA 3S0MA 1JOJA 3DF0A 2WL1A 2ZGUA 1SLTA 2WA3A 3AYCA 4FPHA 2JG8C 2RR13 4OI0A 4BM8A 3GNEA 2ZGKA 3ECQA 4I3GA 2D3RA 2Q0AA 1Q5OA 3QOPA 5BNPC 1LENA 2VMGA 1QXRA 3KM5A 4LT5A 4Q26A 3ZSJA 3POSA 2ZGRA 3M8LA 3CEWA 4KGGA 3L2YA 1MQTA 1TE1B 1SLLA 3WW3A 2JX9A 2QFEA 5D8AB 3QBQA 2UYBA 4XDQA 4XMIA 2BYVE 5CFDB 2HYKA 1ZZ7A 4XIKA 4I01A 3H1YA 4MGYE 4PDWB 2D43A 3WT3A 2XKPA 1HRV1 4RS5A 2EXIA 2QUOA 4Y20A 2YPJA 4Z2WA 1J3PA 1UAIA 5I8TA 4YG3A 1RUE3 1PZ8A 4RR3A 5E88A 1QKQA 2WZR3 4KG8A 2ZX2A 1V9U1 1EYBA 4XTMA 2WLPA 3AP4A 2PELA 3O7OA 1Y3TA 2GNBA 2VOVA 1CAVB 2GH2A 3CJXA 4KU7A 1WMDA 1VRH1 2WNVC 1XYOA 2XH6A 2P34A 3AKRA 3INAA 4GKXA 4H3WA 3WDYA 1NE4A 4NVPA 3ZX7A 4R52A 1N1SA 1PM7A 2WNUC 4GWMA 3LKJA 4D7YA 4K7JA 1PGSA 4D7SA 2XJRA 2RS51 1RVF1 3CJIA 1ZVFA 1Z7S2 2Y0OA 3H3ZA 1J3RA 2PYTA 1ZRRA 2AREA 1EAH2 1IPKA 4YG6A 4BIOA 1VBD2 1KDMA 2RE9A 1KITA 2XVLA 5GKAC 5KWRA 1LHWA 3IBMA 1AYM1 4KG0A 1F8VA 1I9RA 1URXA 1W6PB 5BUVA 3WW1A 1XNDA 3DN7A 1KFXL 5TSWA 2CTVA 4N9IA 3RYKA 1G9DA 5ACA3 3UKNA 4KGQA 1UU4A 2OYZA 1SCSA 5CG9A 1AVBA 1DFQA 1S0DA 1FYUA 1LR5A 1JW6A 2NP0A 4RD7A 2PHRA 3MIHA 2C5DA 1RUC1 2JD4A 2D3SA 1H1MA 4LBQD 2AYHA 1H2LA 1SMVA 5J98B 5H9SA 5CFDA 2ZACA 1DQ5A 4RQPB 1OQ1A 2ZAHA 4COWA 2UYAA 3IDEA 5CAZA 3JQWA 4PDWA 1JYIA 4XFCA 1AYN3 1RUI1 3VZOA 3GBFA 1OA3A 4E2QA 3ZXJA 3SITA 4Z07A 3N36A 1RC6A 3IPVB 1FV3A 4DQAA 4ISRA 1UL9A 4HVRA 4XF9A 2DCKA 3PVOA 3M4FA 4B3NA 2D98A 5DXDA 1L3JA 2EVXA 2VG9A 4HKOA 3VBFB 3DPRC 3VBHA 4Y22A 3RQ0A 1JUIA 4K21A 1KS5A 3R4UA 2WFF3 1N3QA 3APBA 1GR3A 1NXD1 2A73B 4JGZB 1XRUA 3WG2A 4Q4Y3 3ILFA 2R0FA 4L8QA 2FZ1A 2ZGOA 1SCRA 5KHGA 2QCSB 4AEJA 3MFAA 3T1MA 4XILA 5T5PA 1MS9A 3WW2A 1FV2A 4Y1UA 3JD73 1FT9A 1XQNA 3NL1A 3V64A 3V65A 3SH5A 3ZIXA 4TYSA 3LCPA 2HWC1 4MH0E 4LLOA 1UN1A 2XLAA 3BB6A 1QXJA 2RM21 4HETA 4HKWA 2IZWA 3KT7A 1FPN2 2BGCA 3U4XA 1AL0G 4Q8LA 1HQNA 3AZZA 5AFEA 3FMGA 3OBRA 3THTA 4GA9A 2PFWA 5AVAA 4XQDA 5GLVA 4XBQA 1CVNA 2XJUA 3MYXA 4I0BA 4QPIC 3KZ4C 3N7KA 4IEYA 1DQ4A 1RUG3 1AX1A 3EHKA 1WCKA 1PIV2 4CDQB 4AVAA 5A33A 5JCTA 3T1LA 1WBLA 4FPOB 3C3VA 3VBFA 4AXOA 3NO8A 5I0SA 3TNQA 2BQPA 3ZXAC 1LEMA 1TMF3 1W6NB 5L7OB 2BVBA 2RMU1 4XZPA 2CGPA 1B35B 2FMDA 2JEMA 4COUA 4RSUA 2E51A 4AW7A 2NM1A 4CDWC 4Q0SA 3HAGA 1FI2A 2CAVA 4XHBA 1OKQA 5FBZA 1IKPA 3SNMA 4GH4B 5F6LB 1YLLA 4YSFA 3RNSA 1A6CA 4FPYA 4F7ZA 4FSJA 2GNDA 3E97A 1O3RA 1D0HA 5SV8A 4FVVA 3J9SA 1HQWA 3TNPB 2E7TA 1VBB3 3TN91 1YIPA