4IERA

Cys-persulfenate bound cysteine dioxygenase at ph 5.5 in the presence of cys
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
186
structure length
186
Chain Sequence
ELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cysteine Dioxygenase Structures from pH4 to 9: Consistent Cys-Persulfenate Formation at Intermediate pH and a Cys-Bound Enzyme at Higher pH.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
molecule keywords Cysteine dioxygenase type 1
total genus 55
structure length 186
sequence length 186
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2012-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ierA00
1H1IA 5HI0A 3CJXA 2QVSB 1EPZA 1QXJA 4WBBA 1SFNA 2BGCA 4IETA 1QY4A 2C0ZA 5E16A 1DGWA 5LRRA 2GAUA 4AXOA 5KHKA 3IWZA 4XF4A 1VR3A 5LEJA 1O5LA 3RNSA 1NZCA 4HSLA 4Q0PA 3RYRA 1O5UA 3N4MA 4K8FA 4KWLA 1UIJA 5JR7B 2D5FA 2PHDA 2CGPA 1O7FA 4IEVA 4FBFA 2UY8A 1L3JA 1RTVA 3QOPA 4OLLA 2MHFA 4UXAA 3LOIA 4I0BA 3UKNA 1YLLA 5BXXA 2HKXA 1VJ2A 4MGIE 5FLJA 2WC2A 4HVRA 3IIAA 4YSFA 3H1YA 3EHKA 1SQ4A 2ATFA 4F8AA 1GQGA 3WW4A 1DGRA 1QWRA 4I3PA 4MZUA 4XFBA 1O3SA 2BEOA 3ROUA 3IDCB 3BB6A 5C8WA 3SCFA 3I54A 3CF6E 5LRSA 1RL3A 2F4PA 3FX3A 3NL1A 3LA2A 3MZHA 3CO2A 1UPIA 1DZRA 4HBNA 1J58A 1X7NA 2EA7A 1X8MA 2VPVA 1J1LA 3GBFA 2IXLA 5I8YA 3B02A 5EZWA 3CLPA 4PIXA 2HJIA 4LEJA 2B8MA 4TLFA 3M70A 2N7GA 1PM7A 1CAVA 2MPFA 1QXRA 4LLOA 2BNNA 5I93A 2ZCWA 2FQPA 1XE8A 4HN0A 4IEOA 3SHRA 1WA4A 4HZFA 4YNIA 5D1IA 4IEPA 1H1MA 1NYWA 1I6XA 4D7TA 2KXLA 2ET1A 3CEWA 1RUNA 3H7YA 4EWDA 4EWAA 2Q1ZB 3BALA 3NW4A 3JZVA 5T3NA 1YUDA 2D40A 3BCWA 2VECA 2VQAA 1Y9QA 3ELNA 3U11A 1XRUA 4E2QA 1O3RA 5BV6A 4E2SA 4FAHA 2QCSB 2PTMA 4QXKA 4N9IA 2B5HA 5CVRA 4IERA 3UKTA 4HVQA 1J3QA 3D0SA 2XHKA 4ZU4A 3TNPB 4MX3A 2Q4SA 5J3UA 1Y3TA 4IEZA 2PAKA 3M3IA 4QGMA 5F1RA 2ZKLA 3FE5A 3DV8A 4XEZA 3RYPA 4EV0A 3H7JA 3PNAA 5E1RA 2OPKA 3WW3A 5KHHA 1SEFA 1NXMA 4JVAA 4XFGA 4J1XA 4Q0UA 1ZNPA 2P17A 3KSCA 1ZRCA 4L2NA 1UD1A 3RZZA 4EWEA 3LZZA 3OF1A 2O1QA 3WW1A 1YWKA 4HVOA 4AQ6A 4RD7A 5JSOA 3FWEA 3MPBA 2WFPA 2V09A 4XF9A 3KMHA 4HN1A 1CAXA 2OA2A 4OFGA 5JCTA 4LUMA 4KU8A 1JUHA 1RC6A 3C3VA 3R6SA 4PJYA 3FHIB 4L11A 3H3ZA 4MGYE 1Q3EA 4ORFA 1G6NA 2IXJA 5FDBA 3D82A 3KGLA 4QGLA 3EJKA 5FQ0A 2QJVA 5I0TA 4MH0E 3PLQA 5JSPA 3FZ3A 3ZDSA 1OFNA 2CAVA 2EAAA 4WVZA 3D0JA 2IXKA 3E6CC 2UYBA 4QM9A 1ZZBA 1LKNA 3OTFA 2D93A 1UIKA 2GZWA 3HT1A 2ETEA 4JV4A 4ZU5A 3H8UA 5CADA 5AVPA 1XE7A 4BH9A 3RDIA 5BUVA 1EYBA 1EP0A 3HQXA 4MGKE 1VP6A 1J3PA 3RPQA 4KWKA 1CAWB 5CU1A 4I0AA 5FCCA 5FQ0B 4EROA 1IPKA 1HW5A 2O8QA 3G7DA 3L2HA 3NSTA 2D5HA 4R52A 1LR5A 2PAEA 4YRDA 4XFCA 3EO6A 5JAXA 4IEUA 4I2OA 3E97A 2ET7A 5C6CA 2XLAA 1FT9A 4MGZE 2OZJA 3BU7A 2OZ6A 4XETA 2BNOA 3SXWA 1UW8A 2XLFA 4R8HA 2E9QA 5KHJA 4Q0VA 1EY2A 3NJZA 2IXCA 4KU7A 4X6QB 3MDPA 3LA7A 2UYAA 1LB2A 1CAUB 1LRHA 5KHGA 4N9HA 1ZZ9A 4WZCA 3MYXA 4B29A 3SCHA 5JSRA 2FMYA 5FPZA 4XFHA 5BPXA 4ONUA 4HMZA 4PIYA 3UKVA 1ZZCA 1TQ5A 3KCCA 4BIFA 4ZU7A 3O14A 3LA3A 1O3QA 3DN7A 5J48A 1OI6A 4PIZA 3DKWA 4XF0A 5FLIA 5LEKA 1YFUA 4QX5A 5FPXA 1X82A 5EFUA 2QDRA 4XF1A 3SMHA 1GQHA 3HT2A 4AVCA 3WW2A 3EBRA 3BPZA 4CYDA 2K9ZA 4AVAA 3E6DA 4E2GA 2XGXA 3RYKA 3OGJA 3IDBB 2GC0A 3IBMA 1O4TA 2PYTA 3H3UA 4BYYA 4F7ZA 3ETQA 4HSJA 5J7MA 2BNMA 1Q5OA 2OYZA 4XFIA 1ZREA 2GC2A 1WGPA 2IC1A 3VHRA 1CAXB 4MUVA 4JTNA 4KL1A 1Q43A 1DZTA 5KHIA 4LUKA 3SCGA 1ZX5A 4JTOA 2IXHA 4J1WA 3CL1A 1YFWA 3U10A 1CGPA 3I7DA 2PFWA 2GC3A 4X6RB 1RUOA 4XFAA 3E6BA 1OD5A 4BHPA 1NE4A 1YFXA 2PA7A 2BYVE 2Z2SB 4YARA 4AVBA 4Q0SA 2PAMA 4UBHA 3EQEA 4FT8A 3H1WA 4UBGA 2UY9A 1X8EA 2PQQA 2XL9A 1J59A 1UCXA 3S7EA 1ZRRA 4META 1WLTA 4LA3A 4H7LA 1ZZ7A 3S7IA 3NKTA 1OMIA 4HLTA 1V70A 2DCTA 3DL3A 4XFFA 3ES1A 2GH2A 2XKPA 1CX4A 1NE6A 4Q29A 3H9AA 3E5UA 5I0SA 2I45A 4O9GA 4P9GA 2XL7A 3LWCA 3GYDA 3KGZA 4QMAA 5FLHA 1ZRDA 1FI2A 2K0GA 4LA2A 1CAWA 4O9EA 3ST7A 3LAGA 4AQ2A 4Z07A 4XF3A 4IEYA 2MNGA 2GC1A 3H1MA 2QNKA 3HIFA 4I02A 5KBFA 4IEQA 1YFYA 3I59B 4D7SA 3USSA 4I09A 4NVPA 5I91A 4KWJA 5I0RA 2XKOA 3E5QA 5I0UA 3FFQA 2CAUA 5K8SA 3H50A 3ES4A 4IESA 5BY5A 2Z69A 4A2UA 3S0MA 2H6CA 2CV6A 4IEXA 2EVXA 3QACA 2IXIA 2B9UA 3E5XA 4IEWA 3ACLA 3FJSA 1CAUA 1RGSA 4YYOA 1YHFA 4MV2A 4QGNA 4Z82A 1CAVB 1FXZA 1ZZ6A 4I01A 3PVBB 1PMIA 1ZVFA 3NVCA 3I59A 3TNQA 2H0VA 1J3RA 1I5ZA 2Q30A 2Y0OA 2XLGA 2PHLA 3OD0A 2H6BA 4DINB 4Q0QA 1ZRFA 1O3TA 4LULA 1IPJA 4LTAA 4QM8A 2GU9A 3U0ZA 1U12A 4FAGA 1ZZ8A 2Q0AA 3OCPA 5I8TA 4GULA 5I8SA
chains in the Genus database with same CATH superfamily
4XZPA 5HI0A 1QJX1 1SFPA 1WLDA 2DWRA 3HNYM 1KJLA 1D4M1 3ZFGC 5HCHA 2A75A 3N36A 1RUG3 1DGWA 3TAYA 3UGGA 2JB4A 1ENRA 1AYM2 2GAUA 2VOWA 1XXNA 2ZEXA 1FNYA 3A0KA 4XF4A 3F95A 3RNSA 1H9WA 1NZCA 3GXUA 4Q0PA 2VULA 4XQ4A 3RYRA 4MOAA 1RUD3 4RYDA 3HBKA 1YEWA 3WHUA 4QPGB 1RUJ2 4M0NA 1X9TA 1PNFA 1XB9A 2MEV1 4K1YA 1O6UA 4FFIA 5JR7B 2JDMA 4A3XA 3HNBM 2PHDA 4N53A 3J9SA 3KV4A 4QU1A 2PHFA 4KNCA 2VAUA 2B42B 1YYNA 2LUWA 4CEWA 1ENXA 4I0BA 2ZGQA 5LEJA 3F2ZA 1DGRN 4MGIE 5DAWA 1W2NA 3RFRA 1W9TA 2VXJA 2V73A 2Z5WA 4HVRA 2BDRA 5A3PA 3ECQA 3H1YA 1K45A 5CFDA 1LGNA 2DYCA 3OPWA 1R091 3S5AA 2IFRA 4PBPA 4YW5A 4GXLA 5A7PA 1S0FA 2XWJB 3WW4A 1A8MA 3LSEA 5A3UA 1GNYA 5KR7A 1QWRA 3UESA 4I3PA 4M3CE 3OGGA 5FMOL 1RUJ3 3ROUA 4Y3OA 5C8WA 2LM3A 2EIEA 1DYPA 1AXZA 2RS32 1MZ5A 2C9AA 4PF5A 4TXWA 3FX3A 2ZGUA 3LA2A 5IT6A 3OOXA 1DZRA 2JKXA 1GZTA 2FMDA 4AFCA 2VU9A 5CAZA 3AFGA 2EA7A 1X8MA 1DQ1A 3P5BA 2HEYF 2G19A 1IKPA 3GBFA 5EJ3A 2IXLA 2W87A 4CCDA 4DZGA 1F35A 3BODA 4YVSA 5FP8A 3CLPA 4LEJA 5C4WA 4LR4A 2X10A 3LDBA 4YVSB 1PM7A 1CAVA 2HWF1 1QXRA 5ABJA 1CQ9A 2BNNA 3WDUA 3ZXJA 1ND2B 5I93A 1DQ5A 1XE8A 4HN0A 2WABA 3AP5A 4M3CA 3TBDA 3FUOA 4IEOA 3OJBA 4A6OA 2GMPA 2WFF2 4QQOA 2VOXA 3WUCA 4CEYA 3BTAA 1FV3A 1UY0A 4HZFA 4YNIA 3RQ0A 5FKBA 1OPOA 1PO12 2KXLA 4D7TA 2ET1A 4WM7A 1CR7A 1T6GC 2YGLA 1BBT3 1IPSA 3QBQA 3VDAA 4AHZA 2W91A 3OUJA 5GZFA 4EWDA 3RG0A 2DV9A 5LBFA 1CX1A 3ZYRA 2VO5A 3RJRA 3TWIA 3LEIA 5JVVA 1XYNA 1CVNA 2D40A 4DY3A 1R1A2 3GDBA 5L7OA 4BQWA 2VZSA 1O3RA 3ELNA 4E2QA 2K2SA 1DF0A 3GJBA 1G9CA 5DAXA 2WNVC 4O65A 2HWE2 3N9NA 4A7YA 3K77A 4HFSA 4PDWB 2Z79A 2EXJA 2NPIA 3ZR5A 1DLLA 3D5OA 4EN0A 3UKTA 2P4EA 4HVQA 3BKZA 5BNNB 4PDWA 3D0SA 2XHKA 5FZ9A 3ZM8A 3POIA 3KV6A 1CZVA 3TNPB 3UJQA 3VBUA 4MX3A 5HXVA 1PGL2 4YW2A 5APAA 4IEZA 3AL5A 5AVAA 1COV3 1PX3A 3HOBA 4DXSA 2HWF3 1AR83 4XTMA 5FYHA 1NG0A 4XPVA 4B1MA 3O0VA 1GYKA 4UFKA 3RWKX 5A3TA 4AR2A 3POEA 4NPMA 2E7QA 2OUJA 4LO6B 1NOVA 4RHV3 3UGFA 1MS3A 5FZOA 5BNOA 5KC6A 3VD4A 1AR71 5C3SA 2GP5A 5LY1A 2VTFA 4FFHA 5KHHA 5F5IA 1NXMA 1LU2A 2VBBA 3U4XA 5FYUA 1LEMA 4J1XA 3TN91 1G86A 1N3QA 2RG4A 1W2OA 4P9JA 1W3VA 2KD7A 2RM21 4Q0UA 1RJ8A 4YGBA 4BU2A 2P17A 1Y43B 3KSCA 2VC9A 5LA1A 1UD1A 1H8VA 3FHQA 1W0NA 3LFIA 4KI5M 3UJOA 5JWPA 1W6MA 3OF1A 4AQ6A 3ZYBA 1G9AA 1HQWA 2W52A 1VBB2 4B1LA 4CDXB 3GCWA 5JUVA 2GP3A 4CXXA 3FWEA 1I5PA 2WYSA 4OMDA 4R9BA 4LHKA 5IVJA 1XNDA 2W68A 4KH9A 2A7AA 2GMEA 1H4GA 1E5RA 2YROA 2VUDA 5IK8A 4IL7A 1QH7A 2J1EA 3N9OA 1LAJA 5JCTA 2EXHA 1CD3G 3LEKA 4KBBA 3IT8A 4X8NA 1JUHA 1OUSA 3Q8EA 3MFCA 2XONA 5FAXA 3IM0A 4L92A 5FMDA 3H3ZA 2PLV2 3BOPA 2OQ7A 4XIKA 5FY7A 1C1FA 3KGLA 3H8OA 4BMEA 1XOYA 2EIDA 3GHMA 2A1XA 3MUZ1 2VBPA 4NIIA 5I0TA 3GBWA 3FZ3A 2F4LA 4A7ZA 3ZDSA 1RUC1 1ULOA 1PMJX 1JYIA 1POV0 5FP9A 4B4QA 1W8WA 2MEV3 1V6OA 2EAAA 2LS6A 4KGGA 1FPN1 4WVZA 2IXKA 5JOZA 2HWB3 1ULCA 2K46A 1LKNA 4H3WA 3DGTA 2D93A 1UIKA 4FPOB 4N90A 1RUE2 2WSVA 1SCSA 4ZONA 3J7MA 4XW3A 4JV4A 2X29A 5C9AA 4ASLA 1GP5A 3Q8AA 3ZVXA 4K9SA 3B69A 3JD73 4XIOA 3NAPC 2YV8A 4Q4V3 1DQ0A 1QJX3 2FCUA 3ZSLA 1HDKA 2OVUA 4YGDA 3RRDA 3G6JB 3HWJA 4BK4A 1W8OA 2GMMA 2QDNA 1U5XA 1OVSA 5ACA2 2GALA 1ZYBA 1NA1C 4Z1VA 3AP7A 1WZXA 3MUY1 2Q8CA 4EROA 4NHYA 4O7XA 5FBZA 1GKBA 1KITA 2QQVA 1W6QB 2G9FA 4PCRA 5FOBB 3NSTA 1K12A 1NY72 2WL1A 2ZKNA 2PXJA 4FPCA 3AMPA 3SNMA 2PAEA 5ANQA 4FTBA 2Y33A 3I2JA 1JHJA 4AI0A 4B7KA 4YM1A 1DIWA 5C6CA 2A70A 1LHVA 1NLSA 2XLAA 2YHJA 4MHRA 1FNZA 1HRI3 3D6EA 3WHTA 2RS13 1GBGA 1RHI3 3TN93 1GMMA 5T54A 4AVVA 3ZIWA 3AKQA 1UW8A 4YZ1A 5T5LA 1W8UA 4RSUA 2E9QA 5LA2A 1KJRA 3ZXKA 3ZXFA 4AHXA 3N35A 4LT5A 1APNA 1PO22 2IXCA 5L73A 2G9ZA 3MF6A 1AL22 4X6QB 1MPXA 2JENA 2WNOA 4DFSA 1RUE1 5DZFA 2VZ1A 4QQ2A 2GDFA 4CUCA 3UNPA 2W2IA 4N9HA 1RUF1 3V0BB 1WMFA 1W0OA 4IUGA 4WZCA 4ES8A 3FLPA 4B29A 4Y24A 4ZS2A 1FV2A 3K4DA 4HMZA 3JXSA 4PIYA 4PHZA 1ZZCA 4Y1YA 5DUVA 3VBUC 3R4SA 4Y5SA 3LCPA 2C9KA 5J1XA 3KCCA 4COZA 4HK9A 4ZU7A 3O14A 1NCQA 4C1WA 4M4PA 2ZZJA 3BU0A 4IGQA 2WNUC 3MIDA 4Y1VA 1LCLA 5FY9A 2RHPA 4PIZA 4YW4A 1CWPA 1JXNA 5FLIA 3B94A 1QJU1 2VUCA 3THPA 2OXBA 5FYZA 2ZAHA 5FZFA 5EFUA 3A7QA 2HH9A 2QDRA 4GB33 3WNLA 3PJYA 1GQHA 2DFCA 5IAXA 3RZGA 3WW2A 1DDLA 3JUUA 2Y64A 5F5QA 4KMQA 3GJAA 1AX1A 5JMCA 4CYDA 4DEQA 5C9AC 1N3OA 1RHI2 2EALA 4AVAA 4A41A 1EV11 3E6DA 2XGXA 3PUQA 5D2AA 5L9VA 3RYKA 2C24A 1MS1A 3GHNA 1W6MB 1DYOA 4FQ4A 1NCRC 4FPGA 1VBB1 1ZA4A 2PYTA 3H3UA 1E57A 2VMEA 4QPIB 4F83A 5FMBA 4Q5OA 4EN8B 2UWAA 4OI1A 3WINE 1RJ7A 4F7ZA 2RDNA 4AI1A 2FDFA 1RXFA 2BNMA 3WF2A 2XMLA 4BJ0A 4YG6A 4QPIA 4QX8A 4XABA 4AEDA 1PGW1 2ERFA 3VBHA 1KD7A 1RMU1 4D6RA 5B4NA 5C71A 4R9DA 5J09A 2WZR1 3WCSA 3IPVB 2VMHA 5KHIA 3SCGA 1TVGA 3Q9OA 4J6GA 4LLFA 4XYXA 1ZX5A 1HB2A 2IXHA 1Z7S1 4JQTA 3BYWA 1RUI3 3JU9A 3OG2A 4AF9A 4QX3A 2O14A 3M2MA 1CGPA 1U5IA 2VXRA 2DDUA 4FOWA 3TEZA 2PFWA 1XNTA 3N9PA 2ZOEB 1ZBE2 3M1HA 1QOTA 4X6RB 5FZ7A 1NT0A 3E6BA 1OD5A 1HN1A 5F5AA 5A32B 3CDZB 4K8RB 2HWB2 1NE4A 2DUPA 2ZEYA 4BDVB 5KXEA 1YFXA 5J96B 2PA7A 2BYVE 2WQ4A 4XCAA 1UKGA 2VQTA 2WN2A 3AMHA 4CU6A 3TN92 1TNRA 1LECA 1UY2A 4C8DA 5LK5A 4UFMA 5FBJA 4CP2A 3ZXLA 3NRUA 4ARYA 1SDDB 3R4UA 2BW8A 2PLV1 5E6HA 2R0FA 2XL9A 2WNVA 1J59A 1ASJ3 1JU4A 1US3A 2QBXA 5LBBA 3ZFEC 3S7EA 2ZHKA 4AFBA 1OBNA 2RR12 1LHOA 1IKQA 4PI2A 4FVVA 1UY3A 4M3CB 5F3GA 2JD4A 4D7YA 1PZ9A 5KC5A 2EXIA 3ZN5A 2B7YA 1QU0A 1OOPB 3I8TA 1W6QA 1W6OA 4LOTA 4BIOA 4EQVA 2BOJA 3QH6A 4GJZA 2GH2A 4XFFA 3ZN6B 2XKPA 1CX4A 1I1EA 4CXYA 1OOPA 2R062 4IE6A 3SISA 4Q29A 4XURA 1RUD1 2W47A 1WD4A 3HN3A 4XVHA 2RM22 4N43C 5FTTC 3O0WA 3MHZA 4DXTA 2WT1A 1PVC3 1RUG1 2W08A 3LWCA 4JX0A 5DZEA 1JOPA 3I49A 3OUIA 4YW6A 1XPWA 5CNAA 1KFUL 1S4CA 5FZCA 3O1VA 3N9QA 1QJU3 3PIJA 3C7GA 4RQPC 4AQ2A 4UW3A 4N43A 3O7OA 2ZZQA 3AZZA 2OS2A 2A6YA 1IQAA 1YI7A 4CDWC 2VMFA 2YC2A 5KBFA 1ZM1A 2ENRA 1RUH1 4CZSA 4OUMA 5CISA 4YG0A 1Z0HA 3AKRA 4QKBA 4AQTA 5GZCA 5I91A 3VZKA 3ZSJA 2XKOA 3WQ0A 5I0UA 4RR3B 4CDQC 1N1SA 3OYWA 3AM2A 4AWDA 2JXAA 1H30A 1WCUA 4IESA 3A0NA 3NJXA 1QJY1 3RVHA 5BY5A 3OY8B 1UAIA 1N1YA 2H6CA 5FUNA 3VZNA 2QZ2A 3ZN4A 4IXLA 3OBRA 5FR3A 4BQ3A 2EVXA 2IXIA 3GCXA 1R1A1 3PMSA 2VZQA 2BTVC 4OHZA 2A6ZA 1CPNA 2XQXA 1R1A3 4YYOA 1VBD1 4AI3A 2WJSA 3T4HB 1FXZA 1POV3 4XE9A 1XBFA 1QJY3 1ZVFA 4YM2A 1C8M3 1LHUA 2VH9A 2WA4A 3MF9A 4NHLA 5FYBA 1DU3D 2AEYA 5AFEA 4QPIC 1OQEA 1GZWB 3I59A 1U0AA 1VBC1 2GNMA 3PDQA 5A70A 5CKQA 3ZXDA 5LWBA 3WDXA 2BV4A 1US2A 3N9LA 3LDKA 1GZ9A 3LEMA 2WLPA 4HT1T 1R092 1ZRFA 4NR1A 1FMD1 1NAEA 4LULA 3RI8A 5IFTA 1O3TA 1F9KA 2GU9A 1TMF3 3AP9A 2ARXA 1ZZ8A 2Q0AA 3MIEA 1HV1A 1NXD1 1YJKA 2CY6A 4S2DA 4LXLA 5I8TA 2VZPA 2EXKA 4FFGA 1COV2 3CJXA 4YFZA 2VW2A 1UZ0A 1EPZA 1JYXA 1SFNA 3JD71 1PVC2 2C0ZA 5E16A 3FMGA 1DQ2A 1CZTA 5AC93 1C8M2 3IWZA 5GLTA 1BVVA 2ZPXA 2YUEA 4COYA 3WP3A 4DY5A 3O1UA 1YRZA 1O5UA 3N4MA 1C5IA 2R063 3KHBA 4UFJA 4K8FA 2DCKA 1N1VA 3PURA 2WUHA 4LBJA 4KWLA 1UYZA 4YWAA 2J7MA 1YIFA 4GAZA 4KGQA 5FZHA 2X5IC 2CGPA 4N7UA 1O7FA 4IEVA 2RMU1 3PHMA 3MIGA 4QDQA 2WYFA 4LPLA 4XXAA 4TZDA 1RTVA 3QOPA 1E5IA 3USUB 2BWCA 4BQ4A 3GM8A 3VGIA 2OIIA 1MR5A 1QJX2 4JGYB 4SBVA 4AK3A 5L7OC 5C9AB 1H2LA 1VLNA 2VCCA 1ASJ2 4AAPA 3WG3A 3WDVA 5HBAA 1YCIA 1SCRA 3WQ1A 1NCQC 4RA0A 4CRQA 5A7QA 4F8AA 3K3OA 3O1MA 2DVAA 4XQDA 1KS4A 3ITQA 1Z78A 2EF6A 3ALQA 1HXS2 2ZX1A 1MVQA 3I2IA 1HJGA 4LHNA 2EIGA 1I9RA 3BB6A 4H55A 4DUWA 3SKVA 1GLHA 5M0TA 2E26A 2V4AA 3JCIA 3SQOA 3NJYA 1HRI2 2GN3A 5D8AC 3V56A 1D2QA 2RM23 4J25A 1X7NA 4CTEA 2D6NA 2JDKA 1JZ3A 3CIHA 2QQPA 3MPPG 4P9XA 4QKNA 2AUYA 3HQUA 3U07A 1AX0A 2ORZA 2VNVA 3U14A 4IV1B 4FOQA 4NHKA 2HJIA 4PIXA 2AGSA 5F3EA 4X8PA 4EZ4A 1XQNA 2WZR3 3QLQA 3KB5A 5D8AA 5F8PA 1A8DA 1O91A 1YQ5A 4L0PA 2PQSA 4LBQB 3ACGA 4CPBA 1UYYA 2CDOA 3OGSA 5K0UC 3N9MA 5EWSA 1AF9A 1AR82 1GNHA 3WQBA 1RMU2 4UWDA 2E7AA 3VKNA 4OQ8A 5FXVA 4Q1PA 4XJUA 4AE2A 1YI9A 1LOEA 3NV1A 4GH4A 4Y22B 5DAPA 2BUKA 4JC1A 5D1IA 1TZOA 4AVSA 4IEPA 2WKKA 1NYWA 4CXWA 5FK8A 1BHGA 4XTPA 2BBVA 3CEWA 5FREA 2QZ3A 4OMCA 4FTEA 1O59A 1QOSA 1R1ZA 5T5JA 2ZGSA 2ZGNA 4P9YA 4ZHNA 3ZYFA 1ZBA2 1VRBA 1HB4A 3M3CA 3DYPA 2VECA 1O8PA 3AB0A 4E8DA 1XRUA 1GQPA 5FZIA 5C3PA 1SLBA 1MQTA 3NV2A 5IVYA 3NAPB 1NQJA 1J84A 4XMAA 4NWWA 1GV9A 3BVCA 3J8F1 1OSGA 3QD6A 1ACCA 1GNZA 1W39A 3VKMA 1R081 4IERA 3Q8BA 4PLNA 1RUI2 5IK4A 3H0OA 3WSOA 4CDXA 3DXUA 2TUNA 5DN2A 1PO13 5IATA 2Y6KA 4LBKA 1AHSA 2QQMA 3ZXGA 4HONA 5J3UA 1EUUA 4IDZA 4OHVA 1Y3TA 3O1PA 1LGBA 3VBHB 3PUIA 2ZX0A 5F2WA 2JECA 4D69A 5FZLA 5LASA 4WZFA 4JHZA 4UFIA 2PAKA 1C8NA 4QQHA 3M3IA 4JHTA 3T08A 5F1RA 2RE9A 3WP5A 3B9IA 2ZKLA 5A3MA 1MZEA 4OZXA 3ZKUA 4ASKA 5LZ6A 3S57A 1W2UA 5E1RA 3MFAA 1PO23 3VBFC 4DIQA 4IE0A 1CJPA 4XUTA 4XDPA 1D4VB 1PK6A 2JB8A 1H8TB 4V1PA 3S30A 2HWD3 4AFMA 2W92A 2ZMNA 1A3KA 4NROA 5EP9A 5FZ4A 4Z92B 4BOWA 2RS11 5AC92 1OQDA 2DTWA 2TEPA 3RZZA 4HKWA 2Q8DA 3ZFFC 2R1DA 3LZZA 3VBSC 2O1QA 1YWKA 4S2FA 2HYXA 2J1SA 3CZJA 4RD7A 3O5SA 5BNNC 4DRRA 4EJRA 1RUJ1 2WFPA 3SH3A 2UURA 2V09A 4Q8LA 1UOGA 2CYFA 5FYSA 1PIV3 2I07B 1S0GA 2WZR2 3GNEA 4RGKA 5SV8A 1UMZA 2VW0A 2VVEA 4WVVA 4HN1A 2VQUA 3MEPA 4YPJA 2RVAA 1YXWA 2WNVB 4BLIA 3T2TA 5BNPC 5T5OA 3AZXA 1RC6A 1BEV1 1W3XA 3ASIA 3C3VA 5FYTA 3R6SA 3U78A 2QKDA 3WNMA 4MGYE 4ZZ5A 1DGWX 2R16A 4Q4V2 4H7MA 4ORFA 4Q4V1 4BK5A 1ULPA 1H2MA 3WZ1A 2IXJA 4OUSA 1HQLA 3GALA 5A7SA 1UZWA 3D82A 4BPZA 3AK0A 3AJYA 3PVNA 1GWKA 3OEBA 1HQNA 4LKEA 3NKGA 4UI9L 2BVVA 2XG3A 4DPNA 4BQXA 3ZMOA 2VM9A 2WS92 5JSPA 1S2EA 3WDWA 1OLMA 2VVDA 1W90A 3B01A 1SZBA 4CP0A 1JUIA 1ND2C 3LF7A 3E6CC 3LGRA 1FPN3 3JBG2 5A1FA 3V0AA 2HEWF 4BXFA 3WP4A 4DQAA 3O12A 5EYXA 4YW3A 5A6XA 1YQ2A 3C7HA 3AC0A 3CBNA 2D97A 4FXKB 1H6YA 1OUXA 4BMBA 4YZ3A 2BFUL 5AVPA 1XE7A 4GWMA 3URFA 3BTYA 4Y1XA 1MS8A 2YBSA 1SFYA 3AZVA 1FOD1 1EYBA 1RUG2 1I3HA 1UO9A 2D6LX 5E89A 4NPLA 2IVJA 1VAKA 4MGKE 2R041 1XNAA 1J3PA 4HL0A 2WAAA 4LE3A 4RFT0 5D8AB 2WNUA 1MS5A 2WWUA 4I0WB 3K2OA 5T52A 3DPRA 4TLGA 2YU2A 2RMU2 1GWLA 2BRTA 3CJIA 4JDOA 5DMYA 1IPKA 5DUXA 4W50A 2VZUA 4AI2A 2VZTA 4COUA 1PHMA 1JZ5A 2D5HA 1WMEA 4R52A 2XH6A 5FMCA 4XFCA 3I2KA 3WLUA 3WG2A 1GP4A 1NCQB 4IEUA 1S0EA 5EPAA 5JI9A 4MXWA 1Z7S2 4AL9A 1UMIA 2KM2A 2B4KA 1A34A 4MGZE 2RS53 2BZDA 2OZ6A 3ZFEA 1ULFA 4Q27A 2J1UA 3NNJA 5GKAC 2PHWA 3SXWA 2NN8A 2XLFA 3VBRC 4CCOA 4OQ9A 2VL4A 1TE1B 4BQ2A 1EY2A 2Y6HA 4AGVA 1JI6A 3NAPA 1E5SA 2HWE1 3ZYGA 4OI0A 3MDPA 4MVTA 3UYJA 1LB2A 3UT0A 3DXTA 2BQPA 4EN6B 5KHGA 3MYXA 1Y7BA 2CWMA 4QPGC 5ANNA 1QIQA 3HD8B 4Q4X2 5BPXA 2WT2A 3WF4A 4ONUA 1G9BA 3UKVA 2R1BA 1JU3A 4K40A 2P2KA 1BK1A 1TQ5A 1PO11 2P5BA 2VMGA 4KQ7A 4NIAA 4Q4Y2 2FBEA 2HLEA 3LA3A 4PBOA 4CDWA 3QCWA 1NKGA 1WW4A 2WBKA 1OI6A 2D6OX 3ZFGB 4XF0A 4MSVA 4BA6A 4H14A 1YFUA 4ZZ8A 2BJSA 3TEXA 4XF1A 4G3YC 2R073 4NRPA 5A3WA 3IDEA 1W06A 1JHNA 3VDDC 5BNQA 4L99A 3LB9A 2WR9A 1A6CA 2K9ZA 4E2GA 4JGYC 1XC6A 3RI9A 1BBT1 4CDUB 3IDBB 4XUQA 2G1MA 3AYDA 2WWJA 1YJLA 2WDBA 1O4TA 4JRAA 1B35C 4FPEA 1WWYA 1H2KA 4BYYA 4CEYC 4YW7A 3ETQA 2BGPA 4MGQA 2OYZA 1UX6A 3AYEA 4MHUA 1AL21 2QQWA 3VHRA 1LTEA 2AEZA 3WF0A 5FO7B 3MIFA 3PTRB 5FUPA 4P14A 5GLWA 4GALA 2HBUA 3M3OA 4U36A 4D6SA 3VUOA 4Y26A 3B5LB 4L8QA 3RWNA 5C3RA 5KWRA 1K5MC 3FLRA 3I2DA 1PNGA 3R4DB 5C4WB 2WNEA 5FPLA 3O1OA 1CONA 3MIBA 3SEEA 3UGHA 2DU1A 4NJ4A 3BI3A 3ENRA 5IVEA 1LGCA 3WNNA 3ATGA 4J1WA 1K42A 1S55A 5ABJB 3VKOA 1RB8G 2AZ5A 3NV3A 5K7PA 1W6OB 4E4SA 2GC3A 3RZLA 1OKOA 4XFAA 1GFF2 2XBO2 1Y9GA 3M8LA 4N8MA 2XDVA 5AFBA 2XBO3 5IK5A 2W46A 1REEA 2D7FA 3ME2A 2Z4FA 2A71A 4WM7B 5J98B 4YARA 4CU7A 2XB6C 4XHXA 4XJZA 3NNLA 1V00A 4HK8A 1MS4A 1RUI1 2PAMA 4IV1A 4FP3A 3OBAA 1MEC1 3EQEA 2P3KA 2D98A 4FT8A 1OA4A 3H1WA 3VHNA 5LA0A 4R4ZA 3THCA 3LIHA 1KEXA 1BKZA 3WX5A 1BVP1 3WR0A 2NYYA 1WKYA 4LA3A 4N43B 5LY2A 2IUWA 1D0GA 1S0CA 1RMU3 2Z42A 2G4IA 4BE3A 4NIGA 2R7EB 3S7IA 1AL23 1IS5A 5FYCA 4GH4B 1FMD2 1C1LA 1OMIA 4HXCA 2F17A 2NM1A 5K4LA 5TSWA 3V0BA 1NX9A 2D3RA 1ULGA 3DL3A 2FCVA 1OOPC 3ZSKA 3DKQA 4RR3A 4LQRA 1NE6A 1OFSA 1VRH1 1XSQA 4GH4C 2CGNA 3E5UA 4K6BA 2QQIA 5I0SA 5FO9B 3VZJA 2ID4A 2FDJA 1CIYA 3U4SA 3ZFEB 1JZ2A 2AYHA 2XL7A 1MQTC 3K4ZA 3POWA 5FZOB 2UWCA 5BNOB 5F7UA 3TYJA 1LHNA 3VDDA 3IKWA 1UL9A 5FLHA 2X09A 2YY1A 1HB1A 1BMV1 1UYXA 3SH4A 1PMHX 4YM3A 3P3NA 4NN0A 4XF3A 1V9U3 4S2GA 2GC1A 1JS9A 4WM7C 4XBLA 5EXOA 4EZHA 1PGW2 2DCYA 1QGLA 3H1MA 3HIFA 4FI9A 5FY5A 4D7SA 1GZWA 2JDYA 1EPWA 3I59B 4FPYA 3LE0A 3DF0A 3H8XA 2BVBA 5FPUA 5I0RA 3GZEA 1F4AA 3E5QA 1DQ6A 4JGZC 3FFQA 2CAUA 2NMOA 3T3YA 5IVCA 1HLCA 5K8SA 5ABJC 2J1RA 3ES4A 4M4RA 4L97A 3S0MA 1UOFA 2W1QA 4XOGA 4XAEA 4AZZA 1DP0A 5CFCC 2JD9A 3POSA 1M4WA 3QACA 4QKFA 4AQSA 1SPPA 4ASMB 3IPVA 1YNAA 4GZ9A 1LNSA 4W6YA 4COVA 1CAUA 4QQPA 4W6XA 1TME2 5DDJ2 5BNPA 1YHFA 3ZDVA 4I01A 2WS93 3T4VA 3W21A 2D43A 1DHKB 2YC4A 3I3BA 4CEWC 2WIIB 4URTA 2JDNA 2YBKA 4IGOA 2ZX2A 1JMUB 5L9BA 4A44A 4BB3A 1U5ZA 1X36A 2JKBA 5FMOS 2LROA 3TNQA 1J3RA 4PQQA 3VD7A 3M7AA 3B9CA 2PHLA 3OD0A 3ORJA 3B3QE 1UOBA 2X8KA 2H6BA 4DINB 4ZS3A 3H8RA 1S0BA 1CJDA 5FZEA 5C8CC 4Q0QA 4NRMA 3CQOA 4LTAA 2ZBJA 3U0ZA 1U12A 1V9U1 3T30A 1AR72 1VAMA 5H9SA 4TTGA 2DVBA 5JOYA 2JG8C 1PZ8A 2ZMLA 1W8HA 1LOBA 4MO3M 2Y6GA 1QXJA 3OSDA 4IETA 1QY4A 4LORA 3HVDA 1F2NA 5DG1A 1L7LA 3KV9A 5LRRA 2VY0A 3H3LA 1FAYA 3AVRA 4IGPA 4LO8A 4ARXA 1VR3A 5KHKA 2OW4A 1O5LA 2YFZA 4YM0A 1JYVA 1L7QA 1V6NA 3N7KA 3V0AB 2NP0A 1KFXL 3CMGA 4OULA 1GUIA 2QQKA 5KXBA 1AJKA 3KS7A 5KXCA 1UIJA 3ZN6A 2D5FA 1AR62 3KV5A 1SDWA 1GOHA 1NCRB 1ENSA 3PL0A 4IW3A 2ZX4A 5FUIA 5A7OA 5HV0A 3J7HA 4CDUC 2NQYA 5A33A 2RJ2A 3RZHA 2VOVA 3Q8FA 4UXAA 1BEV2 3LOIA 4PLMA 3UKNA 3GZAA 1YLLA 5BXXA 4QAWA 2HKXA 3PVEA 2D6KA 1CPMA 2WC2A 1OH3A 3AX4A 3E1F1 3SLIA 4Y4RA 5A33B 1BEV3 3RZJA 5C5UA 2Y0IA 4YSFA 2QQLA 5JIAA 3EHKA 5CG8A 1HKDA 1SQ4A 4OZOA 4IV3C 4CUAA 5SV5A 5FY4A 2P6CA 4LBQA 1R64A 2ATFA 1UKRA 1GQGA 3I3MA 2WNUB 5DDJ3 1AR63 5FO8B 3GZUC 4MADA 4MZUA 1G9FA 3H42B 1OF4A 2XBO1 1O3SA 5FY0A 4CSWA 1NY71 1DZQA 1W8TA 3BOWA 4QQLA 4JKMA 4XJ9A 5C5TA 1RXGA 3NQHA 1QJFA 3SCFA 3I54A 3CF6E 3ZIXA 1NA1B 4RS5B 1OA3A 1BBT2 5IYYA 3N7JA 2F4PA 5IW0A 5JXJA 3NL1A 2D6MA 5DABA 4HBNA 2WO2A 4CP1A 4XDQA 2HWD1 2VPVA 4I3GA 4AGGA 2PHXA 2YU1A 2ARAA 4DMIA 3VBRA 2UU8A 3B02A 1UU5A 3DCQA 4PQ9A 4B4RA 3AVSA 5FJHA 3AMQA 3WOGA 2B8MA 4TLFA 1QQP2 1TNFA 5GLZA 3VBRB 1B09A 1UQXA 1V9U2 1OT5A 2N7GA 4LKFA 3N7LA 1RVF1 2ZHLA 3U37A 2X05A 4LLOA 1EUTA 3W59A 5EJ1B 2FQPA 1N3PA 3ZXEA 5F32A 4WVMB 3D8CA 5CB7A 2EICA 3SHRA 3WG1A 4FOYA 4MGTA 3LSDA 1UPSA 1ZA7A 4FPJA 5HCAA 3CU7A 4AHWA 1I6XA 4R9AA 5A1LA 3SH5A 4QD2A 1W04A 4GKXA 1RUNA 3H7YA 3J8F3 3UETA 3VHOA 2JG9A 3BALA 3NW4A 3JZVA 1N1TA 2QTWB 4K7JA 4FSJA 1ZBA1 5T3NA 2XUEA 3S5QA 5H9QA 2TBVA 3VV1A 1F5JA 5T50A 3ZFGA 1OH4A 4PLOA 2EIBA 4DB5A 1BCXA 1Y9QA 4Y1ZA 1REDA 2JE9A 2Y8KA 1C5HA 5HCBA 4QU2A 5BNPB 5JXIA 1ZBA3 2P3YA 5DG2A 2B45X 2ZJCA 3MLLA 5I0DA 1GP6A 2JG9C 4QXKA 4N9IA 3ZX7A 2YYOA 4CU9A 2B5HA 2VNOA 5CVRA 2VNGA 1QMJA 2QQUA 4NO4A 2Q8OA 1KDKA 4Q4X3 4Y1UA 2FDGA 4TN7A 2XVGA 2DUOA 2Q4SA 5FYVA 1SLCA 2A3WA 1GU3A 4GD4A 3NO8A 4HPKA 1ULDA 1X50A 3AZYA 4XAAA 2LRPA 3B00A 4W6WA 4M00A 4QGMA 3AKSA 2CU5A 5FZBA 2WZPP 1V6JA 3RGBA 2RV9A 1MS0A 3LKJA 3FE5A 3B93A 3OEAA 4QXBA 1H8TC 4XJAA 4LKDA 3CZUA 3K48A 4CP9A 3PNAA 2W5FA 2BPA2 3WT3A 5FP3A 4Y5TA 1BLZA 3ACIA 3WW3A 1SMVA 3O1TA 4QPYA 4JVAA 4CP9B 1CN1A 1AL0G 2PELA 2RS52 4NMIA 3RS6A 2Y26A 1F4HA 2DVFA 3WF3A 1GWMA 2RS51 4XXPA 1ZNPA 3I2HA 1QOOA 1YQCA 3JQXA 3MO4A 4FFFA 4NWVA 4L2NA 4DO0A 3VBHC 2JJ6A 3SITA 4AEJA 3WW1A 2X53S 2HYKA 4UT5A 1G8WA 4AOCA 3VHPA 2P6HA 3MPBA 3VD3A 3K4AA 1FPN2 5T55A 3A21A 1QEXA 5FKCA 1RINA 4LO4B 2EAKA 4XF9A 4PDWC 4QT6A 3CJIC 4CDXC 1EAH2 3KMHA 2BERA 4V2WA 5G04L 4HOOA 2P34A 2VTXA 2W39A 3ZO0B 1CAXA 1J1TA 3GZTB 4OI4A 1R093 3LFMA 4M01A 3ZFFB 2VMCA 5GLUA 5CEHA 4RGGA 1AXKA 3FHIB 2JDPA 1SLLA 1RITA 2RDRA 4P9LA 4JQRA 1UU6A 2DCZA 1JYNA 3NNMA 3P3PA 5DXDA 1DQ4A 4QGLA 2VOTA 1XYPA 2E32A 3EJKA 4NOTA 5H9PA 1VMHA 4LO5B 4LOSA 2QJVA 1QDOA 4MH0E 5IWFA 1WW5A 3IN9A 1OFNA 4JKLA 1F31A 1WCKA 1O8SA 4XACA 5D21A 1F8VA 2Y38A 3D0JA 3KVBA 1QNWA 1AZDA 2PN5A 3AXEA 3I4IA 3THTA 4AAXA 1IG0A 4AFDA 3MW2A 1JTZX 2FD8A 4QM9A 1J83A 5K0UB 1ZZBA 2J1VA 1ST8A 5FXWA 4QDRA 3OTFA 4E9KA 1QKQA 2GZWA 1RUC3 2JIJA 3IIIA 4MXWB 5JMOA 3P1IA 1IZ3A 1GZCA 3U1XA 1XE0A 3BN6A 4Q4Y3 2RS12 5AC91 1JOBA 3POYA 4P9IA 4RQPA 3H8UA 2QQJA 5CADA 4TSVA 3OGRA 5LATA 2JWPA 1EP0A 3EMRA 2R042 2C1FA 2JDZA 2ZX3A 2E6VA 3HQXA 2YFUA 1LOAA 4BCUA 1FOD2 1YO8A 4L9BA 4OHWA 1BMV2 1D2SA 1QQP1 4OHXA 4OVEA 1VBA3 2YPDA 2VZOA 4I0AA 4RS5C 4FPLA 1XYOA 4DOUA 1LJ7A 2CTVA 5FQ0B 5LA9A 4V2VA 4LO7A 2V5YA 1OVPA 4LJHA 5ACA3 3G7DA 4LK6A 3I2OA 3WDYA 1UY4A 4LIVA 4YFWA 5IVFA 4GA9A 1LU1A 1VBC3 2CGOA 3EO6A 4JCKA 1AR91 1WBLA 5EHDA 3SC7X 3UV9A 2VMIA 2Q1MA 1WD3A 2GN7A 3JD72 4IE4A 4ISRA 4UW5A 3W5NA 2VNRA 3T09A 4GKYA 2JEMA 3LDRA 5HPOA 4E8CA 2OZJA 3BU7A 3KCYA 2HWD2 5FZ0A 1VB2A 4AVTA 2FZ1A 4XETA 1OQ1A 3KVAA 3WXPA 4R8HA 4NE9A 5DPNA 2SLIA 4Q0VA 3NJZA 4Z2AA 4Y20A 1PO21 3AJZA 4KU7A 5BYNA 2UYAA 3MICA 4P5HA 1W9SA 2HBTA 5IJRA 1CAUB 5CFDB 1LRHA 5JLVA 3S6PA 1OLRA 4AW7A 5JIUA 3UL2A 4LBMA 3TOJA 1DFQA 1DBNA 1RUH2 3ILFA 1W9FA 3HBZA 4QKDA 4YZ4A 5FPZA 4ISQA 2WFF1 2HWC2 1VMJA 3K3NA 1Y9MA 1LOFC 4K3UA 3WUDA 2Y6LA 1HRV2 2J42A 2XWBB 4HPKB 4Q4X1 1M06G 4P02B 1RUH3 5T5PA 2NZ9A 5LBEA 3TEYA 4QB2A 1MZFA 2Y6FA 5J36A 1R083 3BTZA 3K46A 1O3QA 2FDIA 4K20A 4IV3A 5BUVA 2ZS6B 5JZGB 4UAPA 4BLJA 5H9RA 4JGYA 4CE8A 5IFPA 2J1TA 1GR3A 2ZGMA 3BIEA 4IV3B 3RMXA 5JZGA 2RJKA 3AKTA 1OA2A 2JG8B 3SMHA 5JPNB 2DBNA 2J1AA 1VPHA 2R49A 3HT2A 1UZVA 1ZRIA 1PGSA 1QJZA 2VZVA 3BPZA 4C0BA 2ZACA 1NQDA 1ULEA 1UMHA 3ZKYA 4JZRA 4WVWA 3BPSA 4FPKA 2A6WA 3IBMA 5GJ6A 3POGA 3ZYHA 2B46X 1SBEA 2JIGA 5IHRA 4JAAA 3WEZA 3W9AA 1JYTA 1NCRA 2XVLA 3I3QA 1LEDA 1UWWA 5DAVA 4MXVA 1W2TA 3CHXA 2XXZA 3T2PA 2RJLA 4NAOA 5JDBA 1ND3A 1Q5OA 4QHBA 4XFIA 3T0BA 1ZREA 2VZRA 3HAGA 4RHV2 1CAXB 4MUVA 1TMF2 3ZFFA 2PHTA 4QB6A 4PT6A 2R6QA 5FZ6A 2VBDA 4FXGB 4KL1A 1P8JA 1W0PA 1Q43A 1SG3A 1DZTA 3ACHA 1YC61 3Q8CA 1JZ8A 1D4M2 5FY1A 1ASJ1 3D3AA 4LUKA 5FOJB 3LOBA 5FXXA 5CFCB 4GJYA 4BWOA 4XHBA 5FZDA 3KF5A 4M3CF 4JGZB 2V72A 2W1WA 1C4RA 1JH5A 5ERLA 1RUOA 2ADDA 4Y22A 4YGEA 2D3SA 5C8CB 2R32A 1HXS3 1HXS1 3JBG1 1BJQA 3OD4A 4JGZA 2IWGB 3CKHA 5FRAA 1YIPA 3MIHA 1UY1A 5DDJ1 1SLTA 4AVBA 2E53A 4CUBA 2C4XA 1WLCA 3MI8A 3FN9A 4HKLA 3PUSA 4Q0SA 4RQPB 4AYUA 4U2AA 4UBHA 4DNYA 3EB7A 1ONAA 2W1UA 4COWA 2JE8A 4UBGA 2JDUA 1UXXX 2UY9A 1X8EA 4GIQA 4CU8A 5CBLA 2WZEA 5JXHA 3WDTA 1JYWA 5FPVA 1AX2A 4AFAA 1C3HA 1W8FA 2TNFA 1MQTB 5IUQA 4AI9A 3W20A 1WLTA 3IMMA 1T2XA 3T1MA 1QJEA 1ZZ7A 2VR4A 3I97A 5CYYA 4ZXKA 3WNKA 4LBNA 1BYHA 1U5YA 3NKTA 2XOMA 3PVOA 4TYSA 4WM8B 3A4UA 1PIV2 1S2KA 2AR6A 4XC9A 3VZMA 3MBWA 4QDSA 2YXSA 1MZ6A 2GNTA 1V70A 2DCTA 1VBA2 1QJU2 2XVKA 3ES1A 4B3NA 1TEIA 3T2OA 2Q5TA 2ZGPA 3FLTA 1FYUA 2VCBA 3HMYA 5KXDA 3H9AA 2XJUA 5FP4A 1BXHA 1EV13 2OUHA 4P9GA 5A7NA 4FP2A 2DF7A 4YVWC 2VGDA 2BOIA 3KQ4B 4BQ1A 1SPPB 1D4M3 4PF1A 2L9LA 1ZRDA 4P5YA 1FI2A 2WA3A 1CAWA 2CL2A 4GB32 1SLAA 4O9EA 3ST7A 3UK9A 3VB9A 5F6KA 1VBE3 1WLWA 3RJ2X 2D44A 5CKNA 4IQPA 1BZWA 3K51A 2MNGA 2WT0A 3J7NA 3J7LA 1TMF1 4YVWB 5CKMA 4DUXA 5DZGA 1W03A 2QNKA 4I02A 5FXZA 5FZGA 4IEQA 3M3QA 4GMP3 1PZ7A 1MEC2 2V4VA 4I09A 4KG8A 4MYEA 4HKOA 3WP6A 5JOXA 3WCRA 4HETA 3JQWA 1WW6A 5JI7A 4C91A 1HRV3 1SBDA 2PMWB 1AUYA 4GWNA 5FZAA 2HWC1 4Q2FA 4MG2A 1ODNA 1QH6A 3C7OA 3H50A 2RDSA 4Q4W1 1C8M1 4ET7A 2Z69A 4XBNA 1RUE3 2JE7A 4A2UA 4WM8C 4AGRA 2WS91 1IG3A 2GNDA 1POV1 2WO1A 3AKPA 3T2QA 4EN9B 1QF3A 4IEXA 1EAH3 1OC1A 4B7EA 5C4WC 5IVVA 2B9UA 1D0HA 3AFKA 1Q8OA 3E5XA 4QX0A 4NIHA 3ACLA 3FJSA 1RGSA 1GOFA 1VRH2 2XHNA 4YLZA 4QGNA 4Z82A 1CAVB 1ZBE3 1ZZ6A 3WD5A 2XR4A 3PVBB 3AL6A 5L9RA 3C7EA 3AP6A 5GALA 3NVCA 2E7TA 5E8AA 1LENA 1VB4A 3JB4C 4AEDC 4CEYB 3R05A 1HIXA 2HWC3 3DECA 2X5IA 2H0VA 3ZMNA 3AMMA 4XQWA 1I5ZA 1STMA 1HRV1 2Q30A 2Y0OA 2XLGA 3PU3A 5GLVA 3KT7A 1VBC2 3ZR6A 5ACA1 2SBAA 2E31A 2ZEWA 4RGAA 3RDIA 1ND3B 4Z8BA 4GMP1 4DRVA 1MACA 3A22A 5A1AA 1IPJA 5CA6A 4A45A 3R0RA 2QE3A 1IGOA 1VBA1 3POBA 3M4FA 3AXDA 2JDHA 2C26A 3OCPA 1QQP3 1S0JA 4IE5A 4LHLA 1H1IA 5C7GA 2RR13 3LPGA 1K5MA 1UXZA 2E63A 2QVSB 3P6BA 4CA9A 1V0AA 4WBBA 1FOD3 2BGCA 4WV8A 3VL9A 2IZWA 3VBOA 3FUQA 2ZGTA 5JZGC 3FL7A 5HCFA 4CCJA 4XZUG 2AACA 4MGSA 5A3OA 4D6QA 1W6PA 4AXOA 4DXRA 2ZGKA 3C2UA 1AYN2 1W28A 2I2SA 4HSLA 3VBUB 1AJOA 4QX7A 5JXGA 2VCMA 1VRH3 2XJQA 1RUC2 5C8CA 1XJAA 1VE0A 2P3JA 3IZOA 2ARCA 2LALA 3VKLA 4NHMA 2MEV2 5FIXA 3AYCA 1OXCA 1B35B 1JBCA 1KDMA 2W1SA 4BQYA 4QX1A 4LBQD 5K0UA 2CNAA 2RDQA 3ZPYA 4FBFA 1R082 1Q8QA 2DFBA 1NLQA 1L3JA 1V6IA 2Q1FA 2UY8A 2YC0A 2YDEA 4P00B 3RMYA 3J8F2 2LW8A 4OLLA 2MHFA 1AXYA 2BFUS 2YMZA 3ZYPA 4BISA 1VALA 1UU4A 1MVEA 2FDKA 2D6PA 5C3QA 2BGOA 1VJ2A 4JDNA 5FLJA 3VKFC 1RIRA 2PLV3 3VDDB 1OF3A 4KG0A 3IIAA 4AHYA 1MEC3 1UOJA 5HV4A 1QJY2 4OHYA 1VMFA 1SBFA 2OKXA 4WM8A 5JPMB 3ILNA 4Q8KA 1PIV1 1UN1A 3MV01 3B7MA 2OT7A 3BGAA 1DGRA 1LOFA 4WVMA 4XFBA 4NIDA 1UZZA 2VVFA 2BEOA 4XCBA 3IDCB 3MV11 3ZPOA 3OGVA 3N7MA 2WO7A 5LRSA 1C57A 5EV7A 1RL3A 1OPMA 3ZLIA 3MZHA 4UF0B 1EV12 3CO2A 5GM0A 1UPIA 2G9GA 1H1AA 4ZY9A 1J58A 4A6SA 1WCSA 1FX5A 1G7YA 1W8NA 4XUNA 5CFDC 1J1LA 1PK6C 1IHMA 3RZKA 1HB3A 2HEVF 3DYMA 5EZWA 5I8YA 5FYIA 5B2GB 4OYUA 1YQ6A 3T0DA 1H8TA 2ZGOA 3APBA 3M70A 1A78A 1IS4A 4H2AA 5F9TA 4YVWA 2MPFA 3V65A 1XNKA 4N53C 3AP4A 2CWSA 1LHWA 1DCSA 1UX7A 1UZYA 2Y60A 2ZCWA 4CCEA 5A3NA 4CCCA 1W9WA 1IQDC 1WA4A 5EQUA 3VLBB 2DUQA 4B4PA 2KA3A 4K1ZA 1KQRA 1X33A 1H1MA 3C8XA 2ORXA 3PUAA 2VUJA 5J37A 1HJFA 1KGYA 2D3PA 4Y5Z0 4EWAA 2Q1ZB 3ACFA 4S2HA 3NMBA 1SLIA 3I3DA 4DEVA 1WMDA 3W5MA 1XNBA 3POFA 1YUDA 2OPWA 5IVBA 2VW1A 4ZPIA 3BCWA 2QFEA 2VQAA 5FZ8A 3KCXA 2R071 3U11A 4BM8A 4CCMA 3HQRA 4AI8A 4ES9A 2JG8A 5BV6A 4E2SA 4FAHA 2XJTA 2YZ4A 2P3IA 2VMDA 4R4XA 3VN4A 2ZAAA 2QCSB 1SACA 3TB0A 2A3YA 2PTMA 3HPNA 5F3IA 2FZ2A 2I74A 5A80A 3MW3A 1LODA 4P9WA 4E4HA 4LBLA 4AEMA 1QXPA 1J3QA 5CZKA 2VTXJ 2XJPA 4ZU4A 2WFF3 3VBSB 4I30A 2R30A 3HN1A 3M3EA 3KF3A 2W95A 1C28A 1OD3A 2DU0A 1KXGA 1RVF3 1KS5A 3IMNA 3KT4A 5EJZB 1T6BX 1RUF3 5GZEA 3VDCA 3CNAA 2QQNA 5HXMA 3ON7A 2ZHNA 3VBOC 3DV8A 4XEZA 3RYPA 2W0XA 4EV0A 1WCQA 3H7JA 4LHSA 4LNVA 3O0XA 4UOJA 3VBFB 5DAQA 2OPKA 4RFRB 1BK0A 4XILA 5EYYA 1SEFA 1VIWB 4EN7B 4Q26A 4UW4A 2GH8A 3AYAA 3VBOB 4E27A 4XFGA 2RS31 3QH7A 4Z2WA 3LEGA 2OX0A 3FFZA 5CFCA 1K5JA 4XJ8A 4MLOA 1QDCA 1S1AA 1ZRCA 1CZSA 4EWEA 4GWJA 1PX4A 3VL8A 2BBAA 4HVOA 3L2YA 4YZ5A 3O1RA 3WVJA 3CJIB 5BNNA 5JSOA 2ZGLA 4G4FA 2AENA 2CHHA 1Q8SA 2F6BA 2GNBA 4XUOA 1L7RA 4OUEA 4NAMA 1LESA 4URAA 5LCWL 3OYWB 5C33A 2OA2A 4OFGA 2WSUA 4LUMA 5FV3A 3WY6A 2XJSA 4QHZA 4KU8A 4FTSA 4CCKA 4YW1A 4PJYA 1DYKA 4L11A 1Y4WA 1Q3EA 2R043 3OPTA 1G6NA 4O61A 4LBOA 3HJRA 2ZA9A 4EE2A 1AR92 2NLRA 5FDBA 2AC1A 2ZGRA 5A6ZA 3RSJA 3I2GA 4HANA 1IS6A 4Q4Y1 4LMFA 5FQ0A 4RN5A 3PLQA 4GWIA 4A3ZA 2ADEA 1NZIA 2CAVA 1LOGA 4LK7A 3INAA 3VZOA 1Q56A 1V6KA 2HWB1 2UYBA 4LE4A 2VOKA 3L9JT 4N53B 2R061 2ES3A 4QWNA 4W8JA 4DUVA 1GANA 4N7IA 3JB8A 5FPAA 3RZMA 3HT1A 2ETEA 3FBMA 4UYBA 3FHAA 4FPHA 4UF0A 1O4YA 1SHWB 4ZU5A 2DVGA 5A3LA 1VAVA 4CCNA 2JX9A 5FZKA 2DVDA 4EYUA 1WMXA 2JG9B 4BH9A 4QXCA 1PK6B 3AZWA 4NUBA 1VP6A 4PI0A 1UNBA 2VJXA 3N3HA 3RPQA 2O8OA 4KWKA 5F37A 2V5DA 2NMNA 3KHCA 1H9PA 1CAWB 3PIGA 5CU1A 2VZ3A 5FY8A 5FCCA 3C7FA 4JDMA 1VBE2 1FMD3 2DTYA 5IAVA 1LULA 3DUIA 2J22A 2ZMKA 1HW5A 2IFWA 4G9SB 1JZ4A 2O8QA 2DBIA 3L2HA 3EXUA 3LQCA 4D3WA 5DQ0A 3LD8A 1LR5A 1LOCA 1AVBA 4QHOA 4YRDA 3U75A 2ZABA 4DS0A 5ISLA 4KBZA 1BQPA 5JAXA 1H0BA 4I2OA 3E97A 3J26N 2ET7A 2W94A 1AYN1 3KT1A 2WRAA 4UFLA 2DURA 2JDAA 1FT9A 1MS9A 2WZ8A 2WWSA 4AEKA 2UWBA 1H6XA 1S0IA 4A4AA 2RS33 1VBD3 3MW4A 4YVSC 2BNOA 2XQRA 3MLKA 4Q1RA 4BQ5A 1DG6A 5EIYB 3AMNA 1CESA 4GMP0 5KHJA 3IDAA 4IV1C 1AR73 5A7WA 1WCDJ 2BP6A 4RHV1 1ALYA 3LA7A 3BTXA 4E4DX 4OI2A 1W6NB 2X5IB 2GSYA 2VQ0A 3OBZA 3SEPA 1AR81 1ZZ9A 2YGMA 2A3XA 1WUVA 1COV1 4BXSV 1F5FA 2WN3A 1GSLA 2FHRA 3KM5A 2FMYA 5G05L 3SCHA 5JSRA 4XFHA 3HR9A 1OURA 2VCAA 3WF1A 1PM4A 1ND2A 2QQOA 2VUAA 4QPWA 3OBTA 1JN2P 4BIFA 3GBGA 4UFHA 3DN7A 5J48A 1H2NA 4DXZA 5JR2A 4Y33A 3DKWA 4NPRA 5LEKA 1VBE1 4A42A 4QX5A 4SLIA 5FPXA 1OKQA 1X82A 1S0DA 1W2AX 3OB8A 4GQ7A 2ZHMA 5DUWA 1F15A 4YZ2A 2FDHA 4AVCA 3A23A 5FP7A 3EBRA 1PVC1 3DPRB 2VG9A 2CSGA 5L7OB 4W65A 5FZMA 5C3OA 5F3CA 1ND3C 3OGJA 2O0OA 2GC0A 1AYM3 3NNGA 1HN0A 1XU1A 3J4UH 1KRIA 4QXHA 2XUMA 5J7MA 4HSJA 3ETPA 4D8MA 2E51A 1JODA 3NV4A 3OY8A 5IK7A 2CDPA 2GC2A 5FK7A 5FJKA 1WGPA 2WO3A 1N47A 2IC1A 4XUPA 2Y34A 4JTNA 1RUF2 3PUHA 4CPBD 1RVF2 3PJQA 2B9VA 2P1BA 1NUKA 3WV6A 1G9DA 1WW7A 5GZGA 1S2BA 4JTOA 1W99A 4Y4YA 5B4XA 3LIGA 2C6SA 4TWTA 3GGLA 4FPFA 5FZ1A 3CL1A 2ZEZA 5LW9A 3KZ4C 1YFWA 4ITCA 4M0HA 4Q4W2 3VDBA 3U10A 4OCTA 4JKKA 3I7DA 5FFOC 3WNOA 2B39A 1HX6A 3IB3A 4K21A 2QUOA 1XSRA 3FBYA 4D0QA 4ZXEA 2XJVA 4INDA 3JBG3 2BU9A 5F6LB 4QPGA 4BHPA 1ODMA 5K9YA 1K3IA 2ARBA 2YPJA 4LITA 4LKSA 4RL7A 4XMIA 3DYOA 3VD5A 4CDWB 2Z2SB 1AR61 1WA6X 1RUD2 4UW6A 2HWF2 5GZDA 3ZSEA 4CCLA 4C1XA 4P08A 5F39A 4AEDB 4FOVA 5CIRA 3OUHA 4XDOA 4LIUA 3ZOIA 2A6XA 2LTNA 2VD7A 3PTYA 1Z7S3 2YBPA 3ZXAC 1W9YA 4CEWB 4D94A 3MLJA 2KR2A 5L19A 3DEMA 5L36A 2XPJA 1E5HA 1QNYA 1IS3A 1GICA 4B8EA 2PQQA 1WBFA 1JW6A 2AREA 5BNOC 1UCXA 2W9XA 4XJWA 3TEWA 1ZRRA 3MGUA 4META 3TRSB 3ABZA 1JZ6A 4H7LA 1NLRA 4CDUA 4Y20B 5FZ3A 1QHDA 2H0BA 2PHUA 2RMU3 1FATA 4CDQA 1OLME 4F3JA 5F2SA 5FWJA 1PVXA 4E4ZA 4HLTA 3BIWE 5JOWA 3VD9A 2IVIB 1OHFA 3I3EA 4A7KA 1Q8VA 3KD4A 3IAQA 4RR3C 4CDQB 4BZ4A 1VBB3 3WQ7A 4FO9A 5A32A 1REFA 3W58A 1JZ7A 5LK7B 1VBD2 1H4HA 1V6MA 3KLSA 1O4ZA 4HG6B 4ZKTB 1AYM1 3USUA 3WG4A 4CUGA 2I45A 4O9GA 5LB6A 4CVUA 3X29B 3VZLA 2VE1A 3PU8A 4YGCA 4KWUA 1W8ZA 5FYMA 3GYDA 2W3JA 3KGZA 4QMAA 3SKJE 2PHRA 3ZYJB 2K0GA 4GB31 4LA2A 5FPBA 4ATEA 5A7WB 2ILMA 4NHXA 1UYPA 2RR11 3HEIA 3LAGA 2A5ZA 2R072 1GOGA 3NJVA 4R9CA 4Z07A 4AG4A 2WAOA 1W6NA 1HV0A 4IEYA 3D4KA 3K75B 3ZSMA 4ATFA 3POJA 3FC0A 1DGLA 2C5DA 1YFYA 3USSA 2XJRA 2YB7A 4NVPA 5F5CA 1UF2C 3WNXA 1IOAA 4KWJA 1OLQA 2P37A 4XBQA 3IAPA 2A73B 1PGL1 5E88A 4IE7A 1D7PM 2E33A 1CIWA 2WQZC 3GF6A 3T0AA 1TG7A 1V6LA 2R0HA 3NWKA 1X9PA 5DUUA 3VBSA 5FYYA 5C70A 3THDA 2JICA 2WLQA 2WINB 2FCTA 3I2FA 2HWE3 1JOJA 1JYCA 2CV6A 1ZBE1 2Y6JA 3O1SA 1TME3 1K5MB 3HNMA 2OQ6A 2AH2A 4FQZA 2YG0A 4IEWA 5A6YA 1W05A 3V64A 3ILRA 4W4ZA 3VBFA 1EAH1 4MV2A 1TME1 1RHI1 4FCAA 3ZYIB 1HRI1 1W6PB 2ZXQA 1Q8PA 2DCJA 1PMIA 3WNPA 3EYPA 3KWVA 1AYN3 4Q4W3 4YG3A 5A6QA 3PMEA 1POQA 3T1LA 3OPZA 1AR93 4QX2A 2Q8EA 1XNCA 4QB1A 4NRQA 3BUCA 3KQRA 2BWAA 2A6VA 5LBCA 2WQ8A 5FWEA 3NNFA 5CG9A 1B35A 1YQ8A 1NA1A 4C90A 1URXA 1XU2A 2ZTNA 3DPRC 4QM8A 4RS5A 4FAGA 1DLCA 1RYYA 3LPFA 4JRLA 4C0HA 1ENQA 4GULA 5I8SA
chains in the Genus database with same CATH topology
4XZPA 5HI0A 1QJX1 1WLDA 2DWRA 1KJLA 1D4M1 3ZFGC 2A75A 3N36A 1RUG3 1DGWA 3TAYA 1ENRA 1AYM2 2GAUA 2VOWA 1XXNA 3A0KA 1FNYA 4XF4A 3RNSA 1H9WA 1NZCA 4XQ4A 4Q0PA 2VULA 3RYRA 1RUD3 3WHUA 4QPGB 1RUJ2 4M0NA 1PNFA 2MEV1 4K1YA 5JR7B 4A3XA 2PHDA 4N53A 3J9SA 2PHFA 4KNCA 2B42B 1YYNA 2LUWA 4CEWA 1ENXA 4I0BA 2ZGQA 1DGRN 4MGIE 2Z5WA 2V73A 4HVRA 3ECQA 3H1YA 5CFDA 1LGNA 2DYCA 1R091 2IFRA 4PBPA 4YW5A 4GXLA 1S0FA 2XWJB 3WW4A 1A8MA 3LSEA 1QWRA 4I3PA 4M3CE 3OGGA 5FMOL 1RUJ3 3ROUA 5C8WA 2LM3A 1DYPA 1AXZA 2RS32 1MZ5A 2C9AA 4PF5A 3FX3A 2ZGUA 3LA2A 5IT6A 1DZRA 4AFCA 2FMDA 2VU9A 5CAZA 3AFGA 2EA7A 1X8MA 1DQ1A 5EJ3A 2HEYF 3GBFA 1IKPA 2IXLA 4DZGA 3BODA 4YVSA 3CLPA 4LEJA 5C4WA 4LR4A 4YVSB 1PM7A 1CAVA 2HWF1 1QXRA 5ABJA 1CQ9A 2BNNA 3WDUA 3ZXJA 1ND2B 5I93A 1DQ5A 1XE8A 4HN0A 3TBDA 3AP5A 4M3CA 3FUOA 4IEOA 3OJBA 4CEYA 2GMPA 2WFF2 4QQOA 2VOXA 3WUCA 3BTAA 1FV3A 3RQ0A 4HZFA 4YNIA 1OPOA 1PO12 2KXLA 4D7TA 2ET1A 4WM7A 1CR7A 1T6GC 2YGLA 1BBT3 3QBQA 4AHZA 4EWDA 5GZFA 3RG0A 2DV9A 3ZYRA 3RJRA 3TWIA 5JVVA 1XYNA 1CVNA 2D40A 4DY3A 1R1A2 5L7OA 1O3RA 3ELNA 4E2QA 2K2SA 1DF0A 1G9CA 2WNVC 2HWE2 4A7YA 4HFSA 4PDWB 2Z79A 2EXJA 2NPIA 1DLLA 3D5OA 4EN0A 3UKTA 4HVQA 5BNNB 4PDWA 3D0SA 2XHKA 3TNPB 3VBUA 3UJQA 4MX3A 5HXVA 1PGL2 4YW2A 4IEZA 5AVAA 1COV3 2HWF3 1AR83 4XTMA 1NG0A 4XPVA 3O0VA 1GYKA 2E7QA 2OUJA 4LO6B 1NOVA 4RHV3 1MS3A 5BNOA 5KC6A 1AR71 5KHHA 1NXMA 1LU2A 3U4XA 1LEMA 4J1XA 3TN91 1G86A 1N3QA 4Q0UA 4P9JA 4YGBA 2RM21 1RJ8A 2P17A 1Y43B 3KSCA 1UD1A 1H8VA 5JWPA 3UJOA 1W6MA 3OF1A 4AQ6A 1G9AA 1HQWA 2W52A 1VBB2 4CDXB 3FWEA 4R9BA 4LHKA 1XNDA 2W68A 4KH9A 2A7AA 2GMEA 1H4GA 2YROA 5IK8A 4IL7A 1QH7A 5JCTA 2EXHA 1CD3G 4KBBA 3IT8A 4X8NA 1JUHA 3MFCA 5FAXA 3IM0A 4L92A 3H3ZA 2PLV2 3BOPA 4XIKA 1C1FA 3KGLA 4BMEA 3GHMA 5I0TA 3GBWA 3FZ3A 4A7ZA 3ZDSA 1RUC1 1JYIA 1POV0 4B4QA 1V6OA 2EAAA 2MEV3 4KGGA 4WVZA 1FPN1 2IXKA 5JOZA 2HWB3 1ULCA 1LKNA 4H3WA 3DGTA 2D93A 1UIKA 4FPOB 4N90A 1RUE2 2WSVA 1SCSA 4XW3A 4JV4A 2X29A 5C9AA 4ASLA 3ZVXA 4K9SA 3B69A 3JD73 4XIOA 3NAPC 2YV8A 4Q4V3 1DQ0A 1QJX3 3ZSLA 1HDKA 2OVUA 4YGDA 3RRDA 3G6JB 3HWJA 2GMMA 2QDNA 1U5XA 5ACA2 2GALA 1ZYBA 1NA1C 4Z1VA 3AP7A 4EROA 5FBZA 1KITA 1GKBA 1W6QB 2G9FA 4PCRA 5FOBB 3NSTA 1NY72 2WL1A 2ZKNA 4FPCA 3AMPA 3SNMA 2PAEA 4FTBA 4AI0A 4B7KA 4YM1A 1DIWA 5C6CA 2A70A 1LHVA 1NLSA 2XLAA 2YHJA 1FNZA 1HRI3 3D6EA 3WHTA 2RS13 1GBGA 1RHI3 3TN93 5T54A 4AVVA 3ZIWA 3AKQA 1UW8A 4YZ1A 5T5LA 4AHXA 4RSUA 2E9QA 3ZXKA 1KJRA 4LT5A 3ZXFA 3N35A 1APNA 1PO22 2IXCA 5L73A 3MF6A 1AL22 4X6QB 2JENA 4DFSA 1RUE1 5DZFA 4QQ2A 2GDFA 3V0BB 4N9HA 1RUF1 1WMFA 1W0OA 4WZCA 4ES8A 3FLPA 4B29A 4Y24A 1FV2A 4HMZA 4PIYA 4Y1YA 5DUVA 1ZZCA 3VBUC 3R4SA 3LCPA 3KCCA 4COZA 4HK9A 4ZU7A 3O14A 1NCQA 4C1WA 2ZZJA 2WNUC 3MIDA 4Y1VA 1LCLA 2RHPA 4PIZA 4YW4A 1JXNA 5FLIA 3B94A 1QJU1 3THPA 1ENQA 2ZAHA 5EFUA 2QDRA 4GB33 3PJYA 1GQHA 2DFCA 3WW2A 1DDLA 3JUUA 5F5QA 1AX1A 5JMCA 4CYDA 5C9AC 1N3OA 1RHI2 2EALA 4AVAA 1EV11 3E6DA 2XGXA 3RYKA 1MS1A 3GHNA 1W6MB 4FQ4A 1NCRC 4FPGA 1VBB1 1ZA4A 2PYTA 3H3UA 1E57A 4QPIB 4F83A 4EN8B 4F7ZA 2UWAA 4OI1A 3WINE 1RJ7A 4AI1A 2BNMA 4YG6A 4QPIA 4AEDA 1PGW1 2ERFA 3VBHA 1KD7A 1RMU1 4R9DA 5J09A 2WZR1 3WCSA 3IPVB 2VMHA 5KHIA 3SCGA 3Q9OA 4J6GA 4LLFA 4XYXA 1ZX5A 2IXHA 1Z7S1 1RUI3 3JU9A 4AF9A 3M2MA 1CGPA 1U5IA 2VXRA 4FOWA 2PFWA 2ZOEB 1ZBE2 3M1HA 1QOTA 4X6RB 3E6BA 1OD5A 5A32B 2HWB2 1NE4A 2DUPA 5KXEA 1YFXA 5J96B 2PA7A 2BYVE 2WQ4A 1UKGA 3AMHA 3TN92 1TNRA 1LECA 5LK5A 4CP2A 3ZXLA 3R4UA 2BW8A 2PLV1 2R0FA 2XL9A 2WNVA 1J59A 1ASJ3 3ZFEC 3S7EA 2ZHKA 4AFBA 2RR12 1LHOA 1IKQA 4FVVA 4M3CB 2JD4A 4D7YA 1PZ9A 5KC5A 2EXIA 3ZN5A 2B7YA 1QU0A 1OOPB 3I8TA 1W6QA 1W6OA 4BIOA 4XFFA 3QH6A 2GH2A 3ZN6B 2XKPA 1CX4A 1I1EA 1OOPA 2R062 3SISA 4Q29A 1RUD1 1WD4A 2RM22 4N43C 5FTTC 3O0WA 2WT1A 1PVC3 1RUG1 2W08A 3LWCA 5DZEA 5CNAA 1KFUL 1QJU3 4RQPC 4AQ2A 4UW3A 4N43A 3O7OA 2ZZQA 3AZZA 2A6YA 1IQAA 1YI7A 4CDWC 5KBFA 1ZM1A 2ENRA 1RUH1 4CZSA 4OUMA 4YG0A 1Z0HA 3AKRA 4AQTA 5GZCA 5I91A 3VZKA 3ZSJA 2XKOA 3WQ0A 5I0UA 4RR3B 4CDQC 1N1SA 3OYWA 3AM2A 4AWDA 2JXAA 1H30A 4IESA 3A0NA 5BY5A 1QJY1 3OY8B 1UAIA 1N1YA 2H6CA 3VZNA 3ZN4A 2QZ2A 4IXLA 3OBRA 2EVXA 2IXIA 3PMSA 1R1A1 2BTVC 4OHZA 2A6ZA 1CPNA 1R1A3 4YYOA 1VBD1 4AI3A 2WJSA 1FXZA 1POV3 4XE9A 1QJY3 1ZVFA 4YM2A 1C8M3 1LHUA 2VH9A 2WA4A 3MF9A 4NHLA 1DU3D 5AFEA 4QPIC 1OQEA 1GZWB 3I59A 1U0AA 1VBC1 2GNMA 3ZXDA 3WDXA 1GZ9A 2WLPA 4HT1T 1R092 1ZRFA 4NR1A 1FMD1 4LULA 1O3TA 3RI8A 1F9KA 2GU9A 1TMF3 3AP9A 2ARXA 1ZZ8A 2Q0AA 3MIEA 1HV1A 1NXD1 1YJKA 2CY6A 4S2DA 5I8TA 2EXKA 1COV2 3CJXA 4YFZA 2VW2A 1EPZA 1SFNA 3JD71 1PVC2 2C0ZA 5E16A 3FMGA 1DQ2A 5AC93 1C8M2 3IWZA 5GLTA 1BVVA 2ZPXA 2YUEA 4COYA 3WP3A 4DY5A 1YRZA 1O5UA 3N4MA 1C5IA 2R063 4K8FA 2DCKA 1N1VA 4LBJA 4KWLA 1YIFA 4KGQA 2X5IC 2CGPA 4N7UA 1O7FA 4IEVA 2RMU1 3PHMA 3MIGA 4XXAA 4TZDA 1RTVA 3QOPA 3USUB 2BWCA 3VGIA 2OIIA 1MR5A 1QJX2 4JGYB 4SBVA 4AK3A 5L7OC 5C9AB 1H2LA 1VLNA 1ASJ2 3WG3A 3WDVA 5HBAA 1YCIA 1SCRA 3WQ1A 1NCQC 4RA0A 4CRQA 4F8AA 2DVAA 4XQDA 1KS4A 1Z78A 2EF6A 3ALQA 1HXS2 2ZX1A 1MVQA 4LHNA 2EIGA 1I9RA 3BB6A 4H55A 1GLHA 3JCIA 1HRI2 2GN3A 5D8AC 3V56A 1D2QA 2RM23 1X7NA 4CTEA 2D6NA 2QQPA 3MPPG 4P9XA 2AUYA 3U07A 1AX0A 4IV1B 4FOQA 4NHKA 2HJIA 4PIXA 2AGSA 4X8PA 1XQNA 2WZR3 3QLQA 3KB5A 5D8AA 1A8DA 1O91A 4LBQB 5K0UC 5EWSA 1AF9A 1AR82 1GNHA 1RMU2 2E7AA 3VKNA 4Q1PA 4XJUA 4AE2A 1YI9A 1LOEA 3NV1A 4GH4A 4Y22B 2BUKA 4JC1A 5D1IA 4AVSA 4IEPA 2WKKA 1NYWA 4XTPA 2BBVA 3CEWA 5FREA 2QZ3A 4FTEA 1QOSA 1R1ZA 5T5JA 2ZGSA 2ZGNA 4P9YA 1ZBA2 3M3CA 2VECA 3AB0A 1XRUA 1SLBA 1MQTA 3NV2A 3NAPB 1NQJA 4XMAA 4NWWA 1GV9A 3J8F1 1OSGA 3QD6A 1GNZA 1W39A 3VKMA 1R081 4IERA 4PLNA 5IK4A 1RUI2 3H0OA 4CDXA 2TUNA 1PO13 4LBKA 1AHSA 3ZXGA 5J3UA 4OHVA 1Y3TA 1LGBA 3VBHB 2ZX0A 2JECA 4D69A 4WZFA 2PAKA 1C8NA 4QQHA 3M3IA 5F1RA 2RE9A 3WP5A 3B9IA 2ZKLA 5A3MA 1MZEA 4OZXA 1W2UA 5E1RA 3MFAA 1PO23 3VBFC 1CJPA 1D4VB 1PK6A 1H8TB 4V1PA 3S30A 2HWD3 4AFMA 2ZMNA 1A3KA 4Z92B 4BOWA 2RS11 5AC92 1OQDA 2DTWA 2TEPA 3RZZA 4HKWA 3ZFFC 2R1DA 3LZZA 3VBSC 2O1QA 1YWKA 4S2FA 4RD7A 3O5SA 5BNNC 4DRRA 4EJRA 1RUJ1 2WFPA 3SH3A 2UURA 2V09A 4Q8LA 2CYFA 1PIV3 2I07B 1S0GA 3GNEA 5SV8A 1UMZA 2VW0A 2VVEA 4WVVA 4HN1A 3MEPA 2WNVB 1YXWA 4BLIA 3T2TA 5BNPC 5T5OA 3AZXA 1RC6A 1BEV1 3C3VA 3ASIA 3R6SA 2QKDA 4MGYE 1DGWX 2R16A 4Q4V2 4H7MA 4ORFA 4Q4V1 3WZ1A 1H2MA 2IXJA 4OUSA 1HQLA 3GALA 3D82A 4BPZA 3AK0A 3AJYA 3PVNA 1HQNA 3NKGA 2BVVA 2XG3A 4DPNA 3ZMOA 2WS92 5JSPA 3WDWA 2VVDA 3B01A 4CP0A 1JUIA 1ND2C 3E6CC 3LGRA 1FPN3 3JBG2 3V0AA 2HEWF 4DQAA 3O12A 5EYXA 4YW3A 4FXKB 2D97A 4BMBA 4YZ3A 2BFUL 5AVPA 1XE7A 4GWMA 3URFA 4Y1XA 1MS8A 3AZVA 1SFYA 3RDIA 1FOD1 1EYBA 1RUG2 1I3HA 2D6LX 5E89A 1VAKA 4MGKE 2R041 1J3PA 4HL0A 4LE3A 4RFT0 5D8AB 2WNUA 1MS5A 4I0WB 5T52A 3DPRA 2RMU2 3CJIA 4JDOA 1IPKA 5DUXA 4AI2A 4COUA 1PHMA 2D5HA 1WMEA 4R52A 2XH6A 4XFCA 3WLUA 3WG2A 1NCQB 4IEUA 1S0EA 5JI9A 4MXWA 1Z7S2 2KM2A 4MGZE 2RS53 2OZ6A 3ZFEA 1ULFA 4Q27A 3VBRC 5GKAC 2PHWA 3SXWA 2NN8A 2XLFA 1TE1B 1EY2A 4AGVA 3ZYGA 3NAPA 2HWE1 4OI0A 3MDPA 4MVTA 1LB2A 2BQPA 4EN6B 5KHGA 3MYXA 1Y7BA 2CWMA 4QPGC 3HD8B 4Q4X2 5BPXA 2WT2A 1G9BA 4ONUA 3UKVA 2R1BA 4K40A 2P2KA 1BK1A 1TQ5A 1PO11 2VMGA 4KQ7A 4Q4Y2 2FBEA 4PBOA 3LA3A 4CDWA 3QCWA 1WW4A 1OI6A 2D6OX 3ZFGB 4XF0A 4MSVA 4BA6A 4H14A 1YFUA 4XF1A 4G3YC 2R073 3IDEA 1JHNA 3VDDC 5BNQA 4L99A 3LB9A 1A6CA 2K9ZA 4E2GA 4JGYC 3RI9A 1BBT1 4CDUB 3IDBB 3AYDA 1YJLA 1O4TA 4JRAA 1B35C 4FPEA 1H2KA 4BYYA 4CEYC 3ETQA 2OYZA 1UX6A 3AYEA 1AL21 3VHRA 1LTEA 5FO7B 3MIFA 4P14A 5GLWA 4GALA 4U36A 3M3OA 3VUOA 4Y26A 3B5LB 4L8QA 3RWNA 5KWRA 1K5MC 3FLRA 3I2DA 1PNGA 3R4DB 5C4WB 2WNEA 1CONA 3MIBA 2DU1A 3ENRA 1LGCA 3ATGA 4J1WA 1S55A 5ABJB 3VKOA 1RB8G 2AZ5A 3NV3A 5K7PA 1W6OB 4E4SA 2GC3A 4XFAA 1GFF2 2XBO2 3M8LA 5AFBA 2XBO3 5IK5A 1REEA 2D7FA 3ME2A 4WM7B 2A71A 5J98B 4YARA 2XB6C 4XHXA 4XJZA 1V00A 4HK8A 1MS4A 1RUI1 2PAMA 4IV1A 4FP3A 1MEC1 3EQEA 2P3KA 2D98A 4FT8A 1OA4A 3H1WA 3VHNA 4R4ZA 1BKZA 3WX5A 1BVP1 3WR0A 2NYYA 4LA3A 4N43B 1D0GA 1S0CA 1RMU3 2Z42A 2G4IA 4BE3A 3S7IA 1AL23 1IS5A 4GH4B 1FMD2 1C1LA 1OMIA 3V0BA 2NM1A 5TSWA 2D3RA 1ULGA 3DL3A 1OOPC 3ZSKA 4RR3A 1NE6A 1OFSA 1VRH1 4GH4C 2CGNA 3E5UA 4K6BA 5I0SA 5FO9B 3VZJA 3ZFEB 2AYHA 2XL7A 1MQTC 3POWA 5BNOB 2UWCA 3TYJA 1LHNA 3VDDA 3IKWA 1UL9A 5FLHA 2YY1A 1BMV1 3SH4A 4YM3A 3P3NA 4NN0A 4XF3A 1V9U3 4S2GA 2GC1A 4WM7C 4XBLA 5EXOA 1PGW2 2DCYA 1QGLA 3H1MA 3HIFA 4D7SA 1GZWA 3I59B 1EPWA 4FPYA 3DF0A 2BVBA 5I0RA 3E5QA 1DQ6A 4JGZC 3FFQA 2CAUA 2NMOA 1HLCA 5K8SA 5ABJC 3ES4A 4L97A 3S0MA 4XOGA 5CFCC 3POSA 1M4WA 3QACA 4AQSA 4ASMB 3IPVA 1YNAA 4COVA 4W6YA 1CAUA 4QQPA 4W6XA 1TME2 5DDJ2 5BNPA 1YHFA 4I01A 2WS93 2D43A 1DHKB 4CEWC 2WIIB 4URTA 2ZX2A 1U5ZA 1X36A 2JKBA 5FMOS 3TNQA 1J3RA 3M7AA 3B9CA 2PHLA 3OD0A 3B3QE 2X8KA 2H6BA 4DINB 1S0BA 1CJDA 5C8CC 4Q0QA 4LTAA 2ZBJA 3U0ZA 1U12A 1V9U1 1AR72 1VAMA 5H9SA 2DVBA 5JOYA 2JG8C 1PZ8A 2ZMLA 1LOBA 1QXJA 4IETA 1QY4A 1F2NA 5DG1A 5LRRA 2VY0A 1FAYA 4LO8A 5KHKA 5LEJA 1VR3A 2OW4A 1O5LA 4YM0A 1V6NA 3N7KA 3V0AB 2NP0A 1KFXL 4OULA 5KXBA 1AJKA 3KS7A 5KXCA 1UIJA 3ZN6A 2D5FA 1AR62 1SDWA 1NCRB 1ENSA 2ZX4A 4CDUC 2NQYA 5A33A 2VOVA 4UXAA 1BEV2 3LOIA 4PLMA 3UKNA 3GZAA 1YLLA 5BXXA 2HKXA 3PVEA 2D6KA 1CPMA 2WC2A 3AX4A 5A33B 3SLIA 1BEV3 2Y0IA 4YSFA 5JIAA 3EHKA 5CG8A 1HKDA 1SQ4A 4IV3C 5SV5A 4LBQA 2ATFA 1UKRA 1GQGA 2WNUB 5DDJ3 1AR63 5FO8B 3GZUC 4MZUA 1G9FA 2XBO1 1O3SA 1NY71 1DZQA 4QQLA 3BOWA 4XJ9A 3SCFA 3I54A 3CF6E 3ZIXA 1NA1B 4RS5B 1OA3A 1BBT2 3N7JA 2F4PA 3NL1A 2D6MA 4HBNA 4CP1A 4XDQA 2HWD1 2VPVA 4I3GA 4AGGA 2PHXA 4DMIA 3VBRA 2UU8A 3B02A 1UU5A 4PQ9A 4B4RA 3AMQA 3WOGA 2B8MA 4TLFA 1QQP2 1TNFA 5GLZA 3VBRB 1B09A 1V9U2 2N7GA 3N7LA 1RVF1 2ZHLA 4LLOA 2FQPA 1N3PA 3ZXEA 4WVMB 3D8CA 5CB7A 3SHRA 3WG1A 4FOYA 3LSDA 1UPSA 4FPJA 5HCAA 3CU7A 4AHWA 1I6XA 4R9AA 3SH5A 4QD2A 4GKXA 1RUNA 3H7YA 3J8F3 3VHOA 2JG9A 3BALA 3NW4A 3JZVA 1N1TA 4FSJA 4K7JA 1ZBA1 5T3NA 5H9QA 2TBVA 3VV1A 1F5JA 5T50A 3ZFGA 4PLOA 4DB5A 1BCXA 1Y9QA 4Y1ZA 1REDA 2JE9A 5HCBA 1C5HA 5BNPB 4QU2A 1ZBA3 5DG2A 2B45X 2ZJCA 3MLLA 2JG9C 4QXKA 4N9IA 3ZX7A 2YYOA 2B5HA 2VNOA 5CVRA 2VNGA 1QMJA 4NO4A 2Q8OA 1KDKA 4Q4X3 4Y1UA 2XVGA 2DUOA 2Q4SA 1SLCA 2A3WA 3NO8A 4HPKA 1ULDA 1X50A 3AZYA 3B00A 4W6WA 4M00A 4QGMA 3AKSA 2WZPP 1V6JA 1MS0A 3LKJA 3FE5A