4IERA

Cys-persulfenate bound cysteine dioxygenase at ph 5.5 in the presence of cys
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
186
structure length
186
Chain Sequence
ELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cysteine dioxygenase type 1
publication title Cysteine Dioxygenase Structures from pH4 to 9: Consistent Cys-Persulfenate Formation at Intermediate pH and a Cys-Bound Enzyme at Higher pH.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 55
structure length 186
sequence length 186
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2012-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ierA00
5LRRA 5LEJA 4KWKA 5FLIA 4N9HA 3NL1A 2N7GA 1YHFA 3I7DA 3LZZA 3RYRA 2BNMA 4XEZA 1XRUA 1G6NA 3WW3A 2ATFA 4K8FA 3U11A 4CYDA 4XFAA 3DN7A 4XFHA 4F7ZA 4IEPA 4J1XA 2E9QA 3KCCA 3DV8A 1J3RA 4XETA 3M70A 3BPZA 1ZVFA 4HVOA 5FDBA 3DKWA 3IDCB 3O14A 3UKNA 4FT8A 2CAUA 3SCFA 4EROA 2WC2A 3FJSA 3MDPA 2Z2SB 5JR7B 1NE6A 5FPZA 1L3JA 2F4PA 5E16A 4R52A 3S7IA 3C3VA 2OZ6A 1O5LA 1EP0A 2D93A 3PVBB 4BIFA 3FFQA 4YARA 1LRHA 4IESA 1IPKA 3UKTA 2H6BA 4FBFA 1O7FA 2IC1A 3R6SA 1I5ZA 1ZZ9A 3SCHA 1UW8A 1RTVA 1ZZ6A 2ET1A 1OI6A 1XE8A 1ZNPA 4XFBA 3H1YA 4MX3A 3FHIB 4TLFA 4UBHA 4YSFA 4XFGA 1X7NA 1OMIA 1O3RA 1RGSA 5BV6A 4FAHA 3D0JA 4MV2A 4BH9A 1YUDA 4ONUA 4YNIA 4AXOA 2MHFA 1YFYA 3LA3A 1O3SA 3TNQA 1RC6A 1QWRA 3HQXA 2OYZA 3UKVA 4L2NA 3RZZA 4HSJA 4LTAA 4Q0PA 3ROUA 5JSPA 3H1MA 4IEZA 1LKNA 1VJ2A 3OF1A 1SFNA 3WW2A 3LA2A 4XFCA 3G7DA 2PTMA 3EQEA 4IEUA 4YYOA 3S0MA 2GAUA 2Y0OA 3LOIA 2ET7A 3ACLA 2ZKLA 4Q0SA 1DZRA 2GU9A 3LAGA 2IXKA 2CV6A 2UYBA 1HW5A 1O4TA 4KWLA 5EFUA 4D7SA 4LUKA 4WZCA 5I8YA 5JSRA 1ZZCA 4LUMA 2Q4SA 1FXZA 1SQ4A 2FMYA 1DZTA 4AVBA 1EYBA 1PMIA 5BPXA 3H7JA 1VR3A 4DINB 3BCWA 3M3IA 2Q0AA 3ELNA 5F1RA 3H3ZA 5FLJA 1O5UA 3NSTA 3IBMA 1CAWB 1UD1A 3WW4A 2EVXA 5CADA 2V09A 4LULA 2XLGA 2GC1A 2XLAA 3GYDA 1H1IA 4AVAA 3KGLA 2HKXA 2O1QA 3HT2A 3RYKA 5C6CA 4IEXA 2MPFA 2OZJA 3ES1A 1ZX5A 4B29A 3H9AA 4E2QA 3D82A 3FZ3A 4MUVA 1GQGA 4RD7A 1EY2A 3EJKA 1UIKA 1DGRA 1X8MA 2P17A 3H1WA 4IERA 5FCCA 5JSOA 1CAWA 1J59A 2PQQA 4X6QB 3E5UA 4I01A 2DCTA 1OD5A 2KXLA 2EAAA 1FI2A 3SHRA 3RPQA 5BXXA 1QXRA 3H7YA 3OCPA 3E5XA 4OFGA 3TNPB 3D0SA 4QM8A 4WBBA 2VPVA 4IEYA 5KHGA 3B02A 3CF6E 4PJYA 1EPZA 1UCXA 5CU1A 1X8EA 4AVCA 3QACA 2XKPA 5KHHA 1CGPA 1O3TA 3IWZA 4XF3A 3BU7A 4Z82A 2UY8A 4I0BA 3NKTA 3S7EA 3CL1A 2Q30A 1CAUB 1YLLA 5AVPA 4PIZA 3BB6A 3OD0A 1YFWA 4XFIA 1ZZ8A 5EZWA 1JUHA 3EBRA 4O9GA 2EA7A 2WFPA 3BALA 2Q1ZB 2VECA 3OGJA 4I2OA 3MYXA 2D5HA 3OTFA 3RNSA 4EWDA 5FQ0B 1NXMA 2O8QA 3FE5A 1XE7A 2PAKA 1IPJA 4EWAA 2ZCWA 4A2UA 5I93A 3LWCA 4Z07A 1ZRFA 4OLLA 2XL9A 5HI0A 2B8MA 1CAUA 3USSA 5FPXA 4IETA 2BNOA 2D40A 2QJVA 5I8TA 4JTNA 3H50A 1J58A 2GC2A 2BGCA 3ETQA 3NVCA 2IXCA 5LEKA 1RUOA 1ZRCA 4I0AA 2XKOA 4MGKE 1CX4A 4EV0A 4QGLA 1WLTA 1UIJA 2QNKA 3H3UA 3JZVA 3CJXA 2QVSB 3HT1A 5FQ0A 2D5FA 4WVZA 1H1MA 3E97A 4BHPA 4QX5A 3IDBB 3L2HA 4BYYA 4XF1A 3RYPA 1RL3A 5BUVA 4MZUA 4NVPA 4H7LA 3NJZA 4XF4A 4UXAA 1ZZBA 1O3QA 2MNGA 4JV4A 2GH2A 4JVAA 5I0SA 2IXJA 3U0ZA 1Q43A 1LB2A 1I6XA 1J3PA 3QOPA 4KU8A 3VHRA 1J3QA 1WA4A 4HLTA 2VQAA 4ZU4A 2XHKA 2PHLA 2PFWA 3CO2A 4ORFA 3SXWA 3I54A 3RDIA 4X6RB 1Y9QA 3SMHA 2OA2A 4HMZA 5C8WA 3KSCA 5KBFA 1DGWA 2PAMA 4META 1Q3EA 3KGZA 1V70A 3IIAA 4XFFA 3FWEA 4I02A 1UPIA 1YFUA 2XGXA 3PLQA 4P9GA 4KWJA 4PIYA 4IEQA 4EWEA 4D7TA 5KHKA 4LEJA 1CAVB 2PAEA 5CVRA 4XF9A 4HN0A 2BYVE 4L11A 4IEOA 4PIXA 4F8AA 3GBFA 3E6CC 4QGMA 4R8HA 2UY9A 4I09A 2I45A 5E1RA 4LA2A 4MH0E 1ZZ7A 1GQHA 4E2GA 5LRSA 4UBGA 2PYTA 4JTOA 4GULA 1ZRRA 4O9EA 2BNNA 3CLPA 5K8SA 1CAXB 3H8UA 1CAVA 3E6DA 3U10A 3KMHA 1LR5A 5FLHA 5D1IA 5JCTA 4HVQA 1YFXA 1J1LA 4HVRA 2PA7A 2OPKA 1NZCA 4HBNA 3MZHA 5I91A 2PHDA 1NE4A 1VP6A 3EHKA 3EO6A 3PNAA 4QXKA 3ZDSA 2Z69A 4KU7A 4HN1A 5I8SA 1CAXA 3ST7A 4FAGA 4LA3A 4AQ2A 1SEFA 4QGNA 5J3UA 4AQ6A 1TQ5A 1YWKA 1PM7A 4QM9A 4ZU7A 2XLFA 4XF0A 4Q29A 2K9ZA 5T3NA 2IXLA 5J7MA 2C0ZA 2B5HA 5J48A 3CEWA 4MGZE 4HSLA 1NYWA 1Q5OA 2UYAA 3DL3A 3FX3A 5BY5A 2CAVA 2H0VA 2QCSB 4MGYE 2B9UA 2XL7A 2K0GA 2FQPA 3MPBA 3N4MA 3NW4A 3WW1A 2H6CA 3I59B 2IXIA 3LA7A 3E6BA 1ZRDA 2ETEA 2HJIA 3E5QA 3HIFA 4Q0UA 2GC0A 4I3PA 4ZU5A 4E2SA 1FT9A 1OFNA 5I0UA 4YRDA 4Q0VA 3ES4A 5KHJA 5KHIA 4MGIE 2GZWA 1Y3TA 3SCGA 1WGPA 2BEOA 2CGPA 3I59A 2IXHA 4LLOA 5I0RA 2GC3A 4N9IA 4J1WA 1QY4A 1U12A 2QDRA 5I0TA 4IEVA 4IEWA 1RUNA 4QMAA 5JAXA 4HZFA 1X82A 1QXJA 1ZREA 4KL1A 4Q0QA
chains in the Genus database with same CATH superfamily
3BPSA 3ZFFA 4U36A 4DEVA 4LBKA 1XYPA 2JDZA 2Q8OA 4MGQA 4GD4A 2N7GA 1YHFA 2W1WA 4LK6A 2BBAA 5ANQA 2CWSA 3I7DA 3AXDA 1G6NA 1XOYA 2ATFA 1A8DA 4P00B 3MIDA 1LEMA 4OI2A 1BEV2 4XFAA 2XH6A 3WP6A 1YI7A 4IE7A 2PHWA 4J1XA 3R4SA 1MQTA 3HJRA 1NXD1 1PO11 1RMU3 4AI8A 1XSRA 4QQPA 3DKWA 3IDCB 2WZPP 4OYUA 3O14A 2VMIA 4OHZA 2PHFA 4N8MA 1V6NA 3I3EA 2CAUA 2RS11 4EROA 5JWPA 4B7KA 4QPGA 5LB6A 4ZXEA 3Q8BA 4Y5TA 4ZS2A 3MDPA 3VZJA 5JDBA 2WS93 2ZEWA 1I5PA 1F5FA 4MOAA 1NE6A 3N7JA 3U07A 4CPBA 2LS6A 1QGLA 1AYN3 3FHQA 4AHWA 3AP6A 1OQEA 1DQ5A 4W8JA 1NG0A 1FX5A 2D93A 3MEPA 1XNBA 3MLJA 2OT7A 4SLIA 2QQNA 3FFQA 4UI9L 2OQ7A 1LRHA 1KFXL 2CTVA 1IPKA 2JB4A 3ME2A 4JHTA 1C8M1 1VAMA 4QPYA 4OMDA 4H7MA 1H2KA 5E88A 1JBCA 3SCHA 2VR4A 2QQUA 1U5ZA 3JBG2 3LEMA 4YZ3A 2ET1A 1MS5A 1ZNPA 3OD4A 2VCAA 2HEVF 3H1YA 1RINA 4MX3A 4QXCA 4TLFA 1E5SA 1SLCA 2XVLA 1X7NA 3ACHA 3TB0A 1N1TA 1PVC3 4NAOA 4AFBA 4LKSA 3EXUA 4BH9A 3G6JB 3U75A 4XDPA 3NO8A 4AXOA 5IHRA 4JGYC 2QQLA 2XJPA 5L36A 1WW5A 4FOWA 4Q2FA 1FOD1 4BLJA 3VZKA 4BMBA 2ZHNA 1Q56A 1CWPA 5CFCA 1UAIA 4CU9A 3HQXA 3OUJA 4FPFA 2OYZA 4CDXB 3B3QE 1Z78A 4NIGA 2DFCA 3WSOA 4ET7A 3RZZA 1XXNA 4HSJA 1DGWX 3FC0A 4LTAA 3JD73 1VIWB 3OB8A 5JSPA 1H6XA 2NMOA 4XQ4A 2PHRA 1QJU1 2VTXA 1XSQA 2JE7A 4E9KA 1LKNA 1ZBA3 1SFNA 4P08A 3WW2A 2UURA 4D6SA 1G7YA 2FDHA 2LTNA 2PLV3 3C7FA 4Y22A 4CPBD 1LOCA 2WR9A 4Q1PA 2YMZA 2VZOA 1ND3C 3VDDC 1GOHA 3FUOA 3IKWA 3ACLA 1BBT2 2WQZC 4PLMA 3VBFA 5L7OC 4C8DA 3RJ2X 1N3QA 1VBE1 3NMBA 4KQ7A 5FZFA 2P2KA 2IXKA 2CV6A 1W6OA 1HW5A 3AFGA 3U14A 4CEYC 4P9JA 2HBTA 1W8OA 1H6YA 5EFUA 3WHUA 2W47A 5F6LB 3UETA 2CWMA 3KQ4B 4LO5B 1C5HA 1BK1A 3KCXA 4LUMA 5IVYA 2XHNA 1FXZA 2W5FA 2FMYA 2YBKA 1S0CA 4AVBA 3IAPA 4LLFA 1QKQA 4JGYB 5BPXA 5LBBA 2RS31 3H7JA 3LSEA 2W0XA 3VKMA 4XOGA 3HR9A 4GMP3 1LODA 1VRH1 2DVDA 3E1F1 4L9BA 5C8CA 3OGVA 4ATEA 1GQPA 4TTGA 1JYNA 2YG0A 3MUY1 3PUIA 3AZVA 1W9TA 1S1AA 3SKVA 5C9AC 1PO12 3N9QA 3ASIA 5FR3A 2P3KA 1YIFA 4XBNA 4LO8A 5F8PA 2I2SA 1ZBE1 2LM3A 5CADA 3WDYA 1RHI1 2V09A 4YLZA 1NA1C 3KV9A 4YW7A 5GZCA 5IAXA 4Q4V1 2Q1FA 1HRV1 2DCKA 3PJYA 4D94A 5B4XA 2X53S 3GYDA 3VDDB 2ARAA 2P3JA 4XJ8A 3KGLA 5L7OB 4LK7A 4XAEA 1MVEA 3F2ZA 5FP9A 2EIDA 5A7SA 3WVJA 4XJZA 1LHVA 4K1ZA 4Y1YA 1QOOA 4CEYB 1NX9A 1QH6A 2PELA 4WVMB 4YVWC 1MVQA 3C2UA 2VE1A 1EY2A 3KT4A 1FMD2 3OYWB 2WUHA 3UK9A 4P5HA 4QHZA 3VBRA 4KH9A 3D4KA 4XUOA 5JPNB 3MPPG 2Y60A 2ZXQA 4XE9A 4DNYA 3QH6A 4OUMA 3DEMA 2VU9A 2YPDA 2DCTA 1HJGA 1AXZA 4JKMA 3U4XA 2QFEA 1PGL1 2Y6KA 1AR61 3N9LA 3VKLA 2W94A 2YY1A 5EJ1B 1QXRA 3W21A 2R072 1JZ5A 1O4YA 4HXCA 2QQJA 4OFGA 3WG4A 5JZGA 1SDDB 1V9U1 3ZR5A 4XUPA 3TNPB 5A3WA 5C9AB 2AACA 4WBBA 4BWOA 3WNOA 3UT0A 1SG3A 4YM2A 1SLBA 5A1AA 3WNKA 1F31A 3ZYHA 4CP9B 4BQ5A 1NA1B 1K42A 1JYIA 3H8XA 1RITA 4LHNA 1W04A 5KHHA 3HQUA 2QQIA 4GMP0 4Z2AA 1D0HA 1QDOA 1ASJ3 4XF3A 2NQYA 4XQWA 4GKYA 4Z82A 1UZ0A 3F95A 1M06G 4FFIA 4K21A 3WY6A 2PQSA 3S7EA 5A3OA 1W05A 1PVXA 1CAUB 2ENRA 1OBNA 2WT2A 5AVAA 4OZOA 1RUJ3 1F4HA 1W06A 4PDWA 4YVWB 5HXVA 1DLCA 4KG8A 3WLUA 4K3UA 4COZA 1U5YA 1JUHA 2KR2A 2C24A 4O9GA 2E33A 4XJ9A 5F5QA 5DUWA 4X8NA 1G9DA 1T2XA 4WM7A 3U37A 4DXSA 3OPTA 1TZOA 2D5HA 2D44A 2XUEA 4CVUA 1BJQA 4TWTA 5FP3A 2RR13 3OTFA 4GJYA 3RNSA 4AEKA 2P5BA 2R1BA 1RMU1 5FTTC 4ZS3A 4FFHA 4COVA 2O8QA 4EWDA 4D6QA 3FE5A 4K1YA 3NV3A 1UMHA 2YZ4A 3GNEA 4DXTA 4A2UA 1N1VA 4AFAA 1KXGA 2LALA 4CXXA 5BNNC 3TWIA 4OLLA 3LPFA 1XNCA 5LA2A 3SEEA 2EIEA 5FPXA 4CCCA 1QIQA 1N1YA 5LBEA 1W2AX 2D40A 5F2WA 2JDUA 1VRH2 5FRAA 4BQ2A 4JTNA 4QX2A 4EN7B 1KRIA 4JDMA 2G4IA 1EV12 5LA0A 2BGCA 2WLQA 3OEAA 4F83A 1FNYA 4LQRA 1OOPC 5GM0A 4MGKE 4RS5C 3MGUA 1FV3A 4UF0A 3ZPYA 3I3QA 3VN4A 2DUPA 2QNKA 3NJXA 4XUTA 1NOVA 3JZVA 4JDOA 3CJXA 1JOJA 1HRV2 1UL9A 2GN3A 3OSDA 3VBHB 5IATA 1JYWA 3T0AA 1OQDA 4QX5A 4MSVA 5C33A 3UYJA 4RSUA 3MHZA 3MI8A 4J6GA 4CDQC 2YXSA 5BUVA 2KM2A 1H8VA 2ERFA 4IGOA 4IXLA 2VZQA 1M4WA 4IDZA 1QJX1 2TNFA 2HH9A 4NHXA 4XMIA 2VZPA 2V4AA 4RFT0 1MZ6A 3VKOA 2GH2A 1UY2A 2OIIA 1BHGA 4XIKA 4QX1A 5E6HA 2TUNA 4FPCA 5BNNB 1OA4A 5FY1A 1CVNA 2HWB1 3MFAA 1COV3 4KU8A 2GMPA 1OUXA 1KS4A 1J3QA 3JD71 3OY8A 1JN2P 1XU2A 2EXHA 2VQAA 3S6PA 4HT1T 4JKKA 5EWSA 3LOBA 2ZHLA 5FK8A 1N1SA 3I54A 4NHYA 4C0HA 5A1LA 1V9U2 3ZXEA 1TME2 3RDIA 1ULGA 4FO9A 4IW3A 1OOPB 1WLDA 1GZCA 4Y4RA 2PLV1 2OA2A 2YDEA 3KD4A 4RS5B 3SMHA 3T08A 4EN6B 4OULA 2VXRA 5DAXA 2WRAA 4ARYA 4QX3A 5BNPC 1BXHA 2G9GA 1X36A 3O1PA 4MGTA 3FBYA 3WNPA 5IT6A 1AX2A 3ZLIA 1AR92 2QTWB 3NQHA 2WN2A 5FY4A 4RFRB 2J1EA 3X29B 4DIQA 4MG2A 2XGXA 3PLQA 4P9GA 1U5XA 3KV4A 5ACA2 1GMMA 2BFUS 1BYHA 4EWEA 1JW6A 5DXDA 4LEJA 1MS1A 4XTPA 5K4LA 4LIVA 1NCRC 1AL21 1IKPA 1C28A 2BVBA 2WFF2 2E7TA 3SITA 4KG0A 5EPAA 4F8AA 4YZ1A 1NQJA 3T09A 4COWA 4Q4W2 5K0UA 3E6CC 5GLTA 5L19A 1W9YA 2ARXA 4NRQA 1UZVA 2UY9A 5FKBA 1R082 3B7MA 3OPZA 2WO3A 5FKCA 1REFA 4CCLA 2DCJA 1E5IA 4D3WA 2RHPA 2EAKA 3IN9A 3NAPB 1W3XA 3WG2A 4D69A 1ZRRA 1JH5A 1BKZA 3CLPA 4GB31 4DS0A 3ZFEC 3VDAA 1CAXB 3HAGA 3WNMA 4DRRA 5FY8A 2VQ0A 3H3LA 5BNPB 1CAVA 3RJRA 5CFDA 3ZSEA 1W8NA 2HWE2 4EZ4A 2ZGKA 2WYSA 4XHXA 1HDKA 3GXUA 2BPA2 5FLHA 3ZFGC 2C26A 2FBEA 2JD4A 5KC5A 5JCTA 2BVVA 2XPJA 4HVQA 4QPIC 2CDPA 3AXEA 3KHBA 2PN5A 1LHWA 2PA7A 4UFIA 3N7KA 4XCBA 5C3PA 3VDBA 1ULOA 1UXXX 5LW9A 1NCRB 1FATA 4NR1A 3THTA 3AJYA 3EO6A 5DAVA 4QPWA 2B7YA 2Q8CA 2HYKA 4KU7A 4QDQA 5I8SA 5FAXA 3ZMOA 1UNBA 2VMCA 3ZYIB 4Y4YA 2Q8EA 1SHWB 2VC9A 4JRLA 5IVBA 4QGNA 5J3UA 1QJX2 2ZABA 4C1WA 3BTZA 3CZJA 1PM7A 3POJA 1LOFA 2XLFA 5CISA 3RVHA 5C3QA 4M4RA 3AP5A 4O65A 4N90A 3ZX7A 3KT7A 4JAAA 2O8OA 4FXKB 2O14A 3T3YA 1C57A 2RM23 1QJY2 3MIEA 5J7MA 2B5HA 4LBNA 3UL2A 2HWB2 1ASJ1 1OC1A 4LOTA 1DU3D 1TE1B 2GP3A 3FX3A 2A1XA 1JZ6A 5FP7A 4EJRA 4GZ9A 1O4ZA 3JB4C 4DUVA 2QCSB 3ZFGB 1ZM1A 5IUQA 2B9UA 1H2NA 5GLVA 1EAH3 1MQTC 1RUJ1 1US3A 1W8ZA 4QPIB 5EP9A 5APAA 4YZ2A 4Q4Y3 1Z7S3 1UU6A 4NPMA 1AR83 1D0GA 2H6CA 3J7MA 5FY0A 4B1LA 4BM8A 1HRI1 1KFUL 3LA7A 1ENRA 4B7EA 1RUC3 5IK7A 1UKGA 1OLMA 4Z8BA 1RUE2 4OHXA 1F4AA 4GH4A 4RL7A 3A23A 1G86A 1XC6A 2RR11 2GC0A 3AMQA 4A4AA 4Q5OA 2WINB 1QQP3 3DXUA 3INAA 3FMGA 4LKEA 1FT9A 3SC7X 3ZMNA 1JZ2A 3POGA 2HWD1 5I0UA 3ZFFB 2J7MA 3N9PA 1AL22 1ZRIA 4YRDA 3Q8EA 3HBKA 3NNFA 3K4ZA 4FTEA 5D2AA 1FAYA 3ZXDA 4Q1RA 2WZR1 5EYXA 4QHBA 3NKGA 1UZWA 2GZWA 2VOWA 2X5IA 3AYEA 3R4DB 1AJOA 2JKXA 4XMAA 1W8FA 3SCGA 2J1AA 4ASKA 2BEOA 5LZ6A 3I59A 1RUOA 1AR73 1VBD2 1PIV1 2KD7A 2IXHA 1HV1A 1NKGA 2OUJA 3VBUA 1W8TA 4RHV3 2WNVA 4OHVA 5C5UA 2WAAA 1DBNA 1U12A 1MQTB 2Q1MA 4W6XA 5EXOA 4AGGA 1GP4A 1WUVA 4GB32 4M0HA 3LDKA 3HVDA 1QXJA 1W9WA 1QH7A 2CL2A 4BQ1A 3BU0A 2AYHA 2YU2A 2WQ8A 2PHXA 2D3RA 3W5MA 1SLAA 5FBZA 2R041 5LEJA 2MEV3 2OVUA 4N9HA 3NL1A 5FLIA 4XAAA 4XPVA 3AKPA 3VUOA 1XRUA 2A70A 3MIGA 4RGAA 3I3BA 3RFRA 3K51A 4N7UA 5AC92 2XDVA 4CYDA 3DN7A 1IS4A 1UN1A 2R0HA 1BZWA 4AWDA 1VMJA 4XZPA 3ZYJB 1KGYA 1TVGA 2BERA 3CHXA 3DV8A 4AHYA 3WDTA 5FYVA 4B8EA 3M70A 1A6CA 1QF3A 5C71A 1Z0HA 5IK5A 2DF7A 2QE3A 3RZJA 1ZVFA 4BCUA 3ACFA 4DEQA 1RUD2 1YI9A 4BA6A 4YG3A 4WV8A 3AZZA 4FT8A 2FMDA 3BTAA 3ZR6A 2VM9A 3SCFA 2C5DA 1XNAA 2JX9A 4HKLA 5IW0A 3VBSA 3DF0A 4CUAA 2WC2A 3DXTA 2NMNA 4FPGA 1OT5A 5FV3A 3ZXKA 1FPN2 1PMJX 5EJZB 1WBFA 2XJTA 3AP7A 4QT6A 3WF2A 3AJZA 1YQ5A 2AZ5A 1L3JA 1RUH2 3WQBA 3LEIA 5KC6A 1T6BX 5E16A 2R1DA 3POIA 3NJYA 1DZQA 1ENQA 4IESA 5C8CC 3HNMA 3UKTA 1JZ4A 2H6BA 4FBFA 1GP5A 2W1QA 1O7FA 1IG3A 1RTVA 2JG9A 3WNXA 2VQTA 2OX0A 2ORZA 5DDJ3 4AZZA 4E4ZA 2DVBA 1HRI2 4QU2A 1H0BA 2VOKA 3O1SA 4XFGA 4Y22B 3A4UA 3BIEA 3H8OA 2A3YA 3O7OA 4NN0A 3VZMA 2GH8A 2H0BA 1RGSA 4FCAA 4JRAA 4TLGA 5D21A 3D0JA 4PCRA 3V64A 3VBFB 2A6WA 4YNIA 3BKZA 3K3OA 3B93A 1ZA7A 2GMEA 2MHFA 1W6OB 1JOPA 3I3MA 2FDKA 2HWD2 3DYMA 3VD3A 2NPIA 4H2AA 1RVF1 1QWRA 3ETPA 2VOXA 4L2NA 5CB7A 4CDWA 4IGQA 2W68A 4Q0PA 2ADDA 4RQPA 2WZR2 1XNDA 3ZN5A 1RB8G 5JIAA 1NLQA 2A6XA 1W8UA 2OPWA 4QWNA 3SH3A 4EYUA 3RZLA 5CKNA 1DIWA 1DQ2A 4IEZA 4UAPA 1PIV2 4INDA 4RR3A 4XFCA 1OHFA 2PTMA 2XMLA 5A3PA 5C8CB 3AVSA 4YYOA 4AYUA 5JZGC 2GAUA 3N9OA 2A6ZA 2D6LX 2IFRA 5FMBA 1U5IA 5A7OA 3DUIA 4PT6A 1DZRA 1VALA 2R7EB 4AGRA 5IK8A 1XE0A 4K40A 4Q26A 5BNOC 2JE9A 2XJUA 5GLWA 5LA9A 3OGRA 3RI9A 2JB8A 3IZOA 3POSA 5FYMA 2W87A 1UU4A 3WCSA 2R042 2WZ8A 3PURA 1Y7BA 1CN1A 2VZVA 4JGZA 1DZTA 5A1FA 3M4FA 1LNSA 4I0WB 1EYBA 3WT3A 4FSJA 3KS7A 1MEC1 2QQPA 1AYM3 3DECA 4YW5A 1E5RA 2G9ZA 1J1TA 1OLME 1UOGA 1TMF1 3I2JA 4PDWC 1G9AA 3VZOA 2Q0AA 1VBC2 1VMFA 4K6BA 4LHKA 5F1RA 3H3ZA 5FLJA 4ZXKA 3CQOA 1GZWA 3AYCA 4XJWA 3VBRB 3W9AA 4AQTA 4Z92B 4CCEA 2FDIA 3MIBA 4LHSA 3GALA 2BOIA 4QDRA 1UD1A 4FPJA 3TEXA 2ZJCA 2BGOA 2R49A 3K2OA 5JMOA 1OA2A 1OKQA 4LULA 4CP1A 4Q4Y1 4YGDA 4PBPA 2XLGA 3GCWA 4OQ9A 2YGLA 3TOJA 2WL1A 2Z5WA 3OEBA 5JZGB 3LPGA 1H1IA 4CU6A 1UZZA 2RMU3 3LIGA 5G05L 1XB9A 1IQAA 3RYKA 5C6CA 2WT1A 4PHZA 1I3HA 2MPFA 2OZJA 2YC2A 3AYAA 4B29A 5CA6A 3M8LA 4YW2A 2GNDA 1VBB2 3I4IA 5BNOB 1LOAA 1DFQA 1NCQA 2A3XA 1QQP1 3I8TA 4GWJA 3J8F2 4LKDA 3D82A 4B4PA 1ULPA 1GQGA 3N9MA 4ZONA 4TZDA 1UIKA 2RS53 3H1WA 4QQHA 1CAWA 1S0EA 4EE2A 2VUJA 2PQQA 3E5UA 2VW0A 4I01A 2BUKA 4IL7A 1OD5A 1PGW1 2EAAA 5TSWA 3SHRA 3SH5A 1CONA 4PDWB 1SLIA 5BXXA 5JI9A 3H7YA 3NNJA 3E5XA 3OCPA 4GWIA 5F37A 2VNRA 1OVPA 4CDXC 4QM8A 5FMCA 5KHGA 4A42A 5FUNA 3CF6E 1UZYA 1F2NA 1IHMA 2VY0A 1O59A 2XBO3 1H4GA 2ZMLA 3KZ4C 4UT5A 3QACA 5CU1A 1VAKA 2XKPA 3BN6A 3IDEA 3IIIA 5FOBB 2UWAA 1RVF2 1IOAA 4NJ4A 1CGPA 2AC1A 2IVIB 3I2IA 3M3QA 1HLCA 2D6NA 1SLLA 4CSWA 1SZBA 4P9WA 1S2BA 4CCKA 2HWF2 1U0AA 2VCMA 4NE9A 4YM0A 5HBAA 3FHAA 4NRMA 2ZGMA 1UQXA 4LBQA 2MEV1 4PIZA 1OFSA 2W92A 3RI8A 3OD0A 4KI5M 1YFWA 4D6RA 3O1RA 4XQDA 5GZGA 5EZWA 3TN91 4LOSA 4Q4X1 1Q8PA 3VZNA 1DF0A 2DCZA 3V0BA 3FFZA 4FPKA 3M3CA 2JD9A 2EXJA 2XONA 1N3OA 2XQRA 3IB3A 3MYXA 4I2OA 2E32A 4UF0B 5KWRA 1V6MA 3J7NA 3O0XA 3O1OA 1SACA 3LB9A 5T54A 4Y1UA 4QB2A 4BLIA 2D3SA 2W3JA 2PAKA 2WABA 1IPJA 2Y8KA 4FOVA 1NY71 2K46A 4HK8A 3NNGA 3M7AA 4Z07A 4GWMA 1W8HA 1YNAA 4YW1A 2Y26A 4AFDA 5LBFA 4HONA 1MEC2 4E4SA 4IETA 4CRQA 2BNOA 5FJKA 5I8TA 1TMF2 3S5QA 2GC2A 2BWCA 3NVCA 4CDUA 4JQTA 3AMMA 1BCXA 2BOJA 5A6ZA 1ULFA 2ZKNA 3ZYPA 1ULDA 1RUI3 2YUEA 3MIFA 3N36A 3PUSA 4QX0A 1SBFA 1US2A 1MS8A 1W6PA 3N7MA 4YW4A 4EV0A 1O91A 4QGLA 5CG9A 1IQDC 2OKXA 4QU1A 1UIJA 4YGEA 1S55A 3OY8B 5BNQA 1ODNA 3H3UA 2W08A 4R4XA 5FQ0A 3B01A 5FZ9A 1S2EA 4LBQD 3VV1A 3E97A 2JENA 1GOGA 1WMXA 5FYHA 4S2HA 3L2HA 4NOTA 4BHPA 5JOXA 1R093 3AZWA 4TSVA 5C3OA 4A7ZA 2I07B 1JYXA 2Y6LA 1KJLA 4H7LA 3NJZA 3CIHA 4HOOA 4UXAA 1L7QA 5FIXA 1HB4A 1O3QA 4M3CA 2R30A 4JV4A 3C8XA 5A33A 4A7YA 3Q8CA 1IS5A 1GP6A 3WQ7A 3JQWA 5JMCA 3KHCA 1LB2A 4QKDA 1PX4A 4XYXA 1RUG3 1V6IA 2QZ2A 2ZGUA 1J3PA 4LO4B 4EN0A 4H14A 1CD3G 1YQ6A 4MADA 1W0PA 4GALA 5CKQA 1WA4A 1HQWA 5EHDA 4ZU4A 4WM8A 3WP5A 3ZXAC 3WX5A 1BK0A 3CO2A 4MXWA 4ORFA 3SXWA 4EN9B 3CJIA 3OOXA 2RS12 1HXS3 5K0UB 2Z42A 1PZ9A 4DUWA 1B35C 4M01A 5F2SA 2X8KA 4YVSA 4QHOA 3IMMA 4A3XA 3AX4A 4BXSV 2PAMA 4META 2EALA 1IG0A 1R1A1 3AB0A 3OGGA 2WNOA 2F6BA 4XFFA 2WT0A 3FWEA 2HWC1 4ASMB 3VB9A 1ONAA 4FQZA 1UPSA 2EXKA 5FZIA 3VGIA 4KWJA 1WD4A 1C8M2 1G8WA 4HANA 5F3GA 1K45A 4D7TA 4YG6A 1CAVB 5CVRA 4XF9A 4HN0A 1VBA1 1D4M1 3OBRA 4L11A 4ZZ8A 1KITA 2X05A 3M2MA 4CU7A 4AFCA 4XCAA 3TN92 1AYM1 4PIXA 2JG8A 2VNGA 4Q4X2 3GBFA 2DURA 4JQRA 4NAMA 3ABZA 3T2OA 5FZ0A 4Y26A 5FZ8A 3GBGA 1POV3 4R8HA 1MS3A 2WLPA 2FCVA 4I09A 1RXGA 4BOWA 4OHYA 1XYNA 2P6CA 2ARBA 2QUOA 4CCMA 1DQ1A 4Y24A 1ZZ7A 1FOD2 5FZAA 5JIUA 2G19A 4GH4C 4UBGA 1F15A 4QKNA 1AXKA 1UOBA 1BVVA 2EF6A 3OG2A 1X9TA 1NY72 5IVJA 5L9RA 4O9EA 1LTEA 3DPRA 1B35B 2ZMKA 4GIQA 4U2AA 1UX6A 4OI4A 4OMCA 5T5OA 2RMU1 3PTYA 1QJU2 2DVAA 1W6QA 1OLQA 1RJ7A 3VKNA 3U10A 4CCJA 5CKMA 2ZHMA 3RZMA 1J83A 1LR5A 1LHOA 3MW3A 4N43C 2B39A 1H8TC 4UFHA 4YZ5A 1LU2A 4LO7A 4Y33A 5GZDA 3VBHC 3K3NA 1DP0A 3ENRA 5J36A 1JMUB 2X5IC 3KCYA 1NLRA 4HBNA 3MZHA 1TNRA 2O0OA 2RS51 3DKQA 5I91A 1VBE2 5M0TA 3GJAA 1GWKA 1T6GC 3HN1A 4FXGB 3POBA 2JE8A 1BVP1 3EHKA 1QEXA 4PF5A 1ULCA 4QXKA 3WG1A 5FMDA 3OJBA 2VOVA 2WNVC 1PNFA 1F8VA 4V2VA 1RUF3 3WHTA 2FDFA 2LRPA 4FAGA 1YQ8A 5JXGA 4QB1A 2WQ4A 4AQ6A 3T1MA 2VMGA 2RS32 5DG2A 1GYKA 4GH4B 3RRDA 4ZU7A 5CNAA 1XYOA 2WS91 4LBOA 4LBMA 4XF0A 2Y38A 5FY5A 3BTXA 1PHMA 1VB2A 5D8AA 2XBO1 2XB6C 5CEHA 1LHUA 1AYN1 2ID4A 3VD9A 4A6OA 3MFCA 4RGKA 2IXLA 3UJQA 4XJUA 1AL0G 4UW6A 2C0ZA 3CEWA 5DN2A 2J1SA 1POV0 1NYWA 1BMV1 1PGL2 1ZBE2 4AG4A 1RHI2 5LK5A 3ZXFA 1FNZA 1MZ5A 2RJ2A 4Q4V2 2R32A 4N43B 1H8TB 2K0GA 2FQPA 2XJRA 3WDUA 2A71A 3NV4A 5CZKA 1SBEA 4DZGA 3HQRA 2X5IB 3H0OA 2WKKA 3NW4A 4KGQA 4NPRA 3WW1A 4UW3A 3I59B 1HB3A 4TYSA 3RSJA 1N47A 1GWLA 1PVC1 2IVJA 2WNUA 3AMPA 1R1A2 4FP3A 4L99A 3ZXLA 4XDQA 1V0AA 4R9AA 3E6BA 2HWC2 4N53C 4PI0A 2ETEA 2HJIA 2WNVB 2YC4A 3VBSC 1ZRDA 2J1UA 4K9SA 4Y5SA 4QD2A 3CBNA 4ZU5A 3J7HA 5FXWA 4E2SA 3AKQA 3FLRA 3JU9A 3M3EA 1W28A 2R0FA 1RJ8A 1LOBA 1VBA2 3RS6A 1D4M2 3S5AA 2YC0A 3FBMA 4G9SB 5EV7A 5FZOA 1PK6A 1AR62 4O7XA 4Q0VA 3WCRA 4H55A 4CUCA 1WWYA 2JWPA 4M4PA 1ZBA1 3O0VA 4LITA 3RMYA 5B4NA 4UW4A 2J1RA 2BBVA 1PO23 3NAPC 2WSUA 3USUA 3ILNA 2Y0IA 2YBSA 5J98B 1ACCA 1YQ2A 2CGPA 2OQ6A 1W8WA 3MW2A 2GC3A 4EZHA 4N9IA 2R063 4M3CE 5FUPA 3LIHA 2D6KA 2ZGSA 4B3NA 3GBWA 2GDFA 3K46A 4HL0A 3OBTA 3B9CA 5JOZA 2B46X 3MUZ1 2JECA 4AF9A 3KV6A 3P3NA 4IEVA 2ZAAA 3O1MA 3PIGA 2VMEA 2VULA 4HZFA 1X82A 4MYEA 1KD7A 4UFLA 1FYUA 4WVWA 5IWFA 3MLLA 4BJ0A 4KL1A 1NAEA 3APBA 1R091 1WCQA 4XACA 4COUA 3WP4A 3IM0A 4N53B 1HN1A 5FYTA 4M3CF 3VBSB 4CDWC 2VVFA 1DLLA 5LA1A 3RZKA 3PTRB 4KWKA 1UMZA 2WNEA 3GM8A 4RQPC 1QOTA 3JXSA 1OF3A 5FY7A 3LZZA 4GMP1 2YPJA 3RYRA 4DRVA 1JYTA 2K2SA 3SKJE 3TEZA 5FBJA 1GFF2 1UX7A 5KXBA 3WF0A 3RMXA 2F4LA 4RR3C 4AOCA 4DFSA 4GXLA 1H9PA 3Q8FA 5T5JA 4F7ZA 2VBBA 1RMU2 5LASA 3W58A 4YPJA 3AKSA 1YQCA 1BEV3 1WLWA 3WF3A 1V6OA 3WDXA 1QJFA 4P02B 4XETA 3N3HA 4ZKTB 3LEGA 2JG9B 3EYPA 2GP5A 1VB4A 1NT0A 4HVOA 5FDBA 2ZGNA 1HXS1 4NWVA 5FPLA 2X10A 4URTA 4QKFA 3UKNA 1ND3A 2DBIA 3WINE 2WS92 5CYYA 5L7OA 4NUBA 4E4DX 5IYYA 3QH7A 1ENSA 1AYN2 4BISA 2DU0A 4AK3A 3LSDA 2AH2A 3I2FA 5FPZA 4CEYA 2IZWA 4NHKA 2F4PA 1PZ8A 4R52A 1BMV2 4E4HA 2OZ6A 1O5LA 3T4HB 4LBJA 1OURA 2BQPA 1UO9A 3PVBB 4PLOA 4BIFA 2IUWA 5HXMA 4YARA 2ZX3A 4NIDA 1GOFA 4CDWB 4KNCA 3WNLA 4OVEA 1QMJA 4RQPB 2IC1A 5A70A 3CZUA 3N7LA 4XBQA 1ZZ9A 3R6SA 1ZZ6A 1OI6A 1XE8A 5E89A 4QX8A 4RR3B 3JBG3 1PVC2 1AX1A 3WDVA 4DY3A 3QBQA 1SPPA 2W52A 3ZKYA 4YSFA 5T52A 3ZFFC 4LT5A 1OMIA 2ADEA 4CP0A 1X33A 3W59A 5BV6A 3POEA 4FAHA 2RV9A 1WCDJ 3IMNA 1RYYA 1GUIA 1YUDA 1V6LA 2J1VA 3K4DA 4CP9A 1YFYA 4FPYA 4E8DA 1DYKA 1A78A 1RC6A 3VHPA 5A32A 4JHZA 2HBUA 3JD72 4C91A 3LQCA 1MS4A 3UGGA 2ORXA 5F6KA 1LJ7A 2DUQA 1Y9MA 3HEIA 3LGRA 2GMMA 4Y20A 1ZBA2 3VKFC 3H1MA 4JGZB 1GZ9A 5GLZA 3UV9A 2BW8A 4AL9A 4NHMA 1OPOA 4AE2A 2PLV2 3OF1A 1F35A 3LA2A 1O8SA 3T2TA 3T0BA 5FY9A 4FP2A 2YGMA 5E8AA 3EQEA 3S0MA 1AF9A 1C1LA 1GZWB 1S0FA 2ET7A 3ZO0B 2ZKLA 2XJSA 4QPGC 1HIXA 4GKXA 4I3GA 4Q0SA 1A3KA 4KBZA 4NIIA 1BBT3 4EN8B 2UYBA 4PF1A 2X29A 1O4TA 2L9LA 4D7SA 1DDLA 4LUKA 4WZCA 3ZVXA 5JSRA 5L9VA 1RUF1 4QKBA 3P3PA 3D5OA 5FXZA 4X8PA 2C9KA 4OCTA 1SFPA 2Q4SA 4BMEA 3FLTA 1UYPA 2VBDA 4P14A 1G9CA 1PMIA 2QQVA 1UOJA 2A6VA 1LU1A 2VG9A 1VR3A 1NCQB 3HNYM 3ECQA 3M3OA 1AVBA 4DINB 3JB8A 4E8CA 4S2GA 5JOYA 4B4RA 3VBOA 3EMRA 1PX3A 4CUBA 2XWBB 4LMFA 1LOGA 1O5UA 2QQMA 2AEYA 1CAWB 2BWAA 3IBMA 5LY1A 4BQXA 3GZAA 3T2PA 1I1EA 2EVXA 3CMGA 3Q9OA 4BPZA 1PO13 3O0WA 5A7NA 2AGSA 1OH3A 2VZUA 2Y6FA 1PGSA 1H4HA 4KMQA 3HMYA 1V6JA 4UW5A 4OI1A 4XUQA 3ZPOA 5CFCC 5IVEA 3V0AA 5DZFA 4AVAA 1UOFA 2HKXA 2ZGLA 4QPGB 3S57A 1B09A 4IEXA 3PUQA 4R4ZA 3P6BA 1C3HA 1CESA 1ZX5A 3LE0A 1K5MA 4UFKA 5HV0A 2E31A 1BLZA 2XG3A 2Y64A 3KWVA 4E2QA 5LCWL 3PL0A 5LATA 1P8JA 4LR4A 3WDWA 1UU5A 3FZ3A 3I49A 2QDNA 4RD7A 2VNOA 4UWDA 3ZSMA 1S2KA 1X8MA 2P17A 1COV1 3P5BA 4IERA 5FCCA 5JSOA 4G3YC 3JQXA 2D97A 3RQ0A 1OH4A 1FMD3 2I74A 2JDMA 4X6QB 1AUYA 3VBFC 4NIAA 1GV9A 3OBZA 2Y34A 1KDKA 2KXLA 4LBQB 4FTBA 1FI2A 3BIWE 5DMYA 3RPQA 2DU1A 5ANNA 5FWEA 1W2NA 2D6MA 5F5IA 5A6YA 3THPA 5F5CA 1QXPA 1GNYA 3V0BB 3D0SA 3SEPA 2R073 3LDRA 5FWJA 4LE3A 4HPKA 2ES3A 3O5SA 2CY6A 4QAWA 3KVBA 4OQ8A 4IEYA 3MBWA 3B02A 4SBVA 2PXJA 2ZACA 3VLBB 4LORA 1AX0A 1Y43B 3WF4A 4A6SA 5K7PA 1UCXA 1W2UA 1X8EA 2A6YA 2ZEZA 1ASJ2 1SCSA 2P4EA 3AMHA 4URAA 1F5JA 4IE4A 2E63A 5CFCB 1O3TA 5IVFA 1JYVA 2DVGA 4CDQA 3KQRA 4IUGA 3VZLA 3D3AA 5GZFA 4I0BA 1RUJ2 5FZ6A 1LEDA 3CL1A 4NROA 1YLLA 5AVPA 4HETA 3WQ1A 2PHTA 2LW8A 4XFIA 2NN8A 4WM8C 4LBLA 3VHOA 4AR2A 3EBRA 1OQ1A 2EA7A 3CJIC 1OVSA 2WFPA 2G9FA 1OLRA 2YHJA 2ZGQA 3BALA 3HOBA 3NNMA 5DAWA 3ZYBA 2VECA 1MS9A 3OGJA 2RR12 5F3IA 1W6PB 3K48A 4QDSA 4YVSC 1MZEA 3B94A 1UF2C 2RDSA 2D6OX 1BEV1 2ZGRA 1V6KA 3NWKA 3U78A 4CA9A 4GAZA 2VO5A 2VBPA 5FQ0B 5HPOA 5K9YA 4A41A 4YM3A 2XVGA 4XW3A 1IS6A 4FPLA 2DVFA 3AKTA 3C7EA 3HWJA 5I93A 2NLRA 3LWCA 4QB6A 3VBRC 1APNA 5IFPA 2KA3A 5FZ3A 4DB5A 4BU2A 1ZRFA 3GHNA 3HBZA 2XL9A 5FFOC 5FYZA 5HI0A 4CEWA 3VL8A 5F32A 3USSA 4CCOA 4IQPA 1A34A 3ZN6A 1URXA 2QJVA 4M3CB 4QQ2A 5A33B 4CXYA 2JXAA 3H50A 4R9BA 2ZMNA 1J58A 2Y33A 3ETQA 2RDQA 1VRH3 1DGLA 4AHZA 2IXCA 5LEKA 1ZRCA 2V5YA 3EB7A 1IPSA 1EV13 1JHNA 4I0AA 4E27A 5JR2A 3R4UA 3KM5A 1O8PA 1O6UA 4B4QA 5AFEA 3ZSJA 4UFJA 4WM8B 5A7PA 2DFBA 3BI3A 2D5FA 4LIUA 4MXWB 3FUQA 1H1MA 1XNKA 2VUDA 3CJIB 1W9SA 3JBG1 4JC1A 1HRV3 1CPMA 3DPRC 1EPWA 2JIJA 4YVSB 2VZ3A 2ZX2A 3BYWA 4IE0A 1STMA 5FXXA 5JXHA 3I2OA 3T30A 3L9JT 3PU8A 4AGVA 2EXIA 5C4WA 4XF4A 2VQUA 2P34A 2VXJA 2XOMA 3AZXA 3ITQA 4YG0A 1TG7A 1Q8QA 5IAVA 2MNGA 1PM4A 5DQ0A 2IXJA 2BTVC 4HKOA 4ASLA 1WMDA 2RM21 2Y6GA 3ATGA 4ES8A 3U0ZA 3WUCA 2OXBA 4MLOA 3ZFEA 1COV2 1Q43A 5EQUA 3GZEA 4XURA 4AQSA 5FYCA 3QOPA 4AHXA 2FHRA 4WM7C 1TEIA 1VAVA 3VHRA 2P6HA 1IS3A 4XABA 4HLTA 4UFMA 2FZ1A 4D0QA 1EAH1 2PHLA 2P1BA 1YRZA 2PFWA 1Z7S1 2Y6JA 3LEKA 3WOGA 1AR81 1RUC1 1Y9QA 2WO2A 2VAUA 4L8QA 4HMZA 5HV4A 1V9U3 5C8WA 5F3CA 1TME3 3WZ1A 5KBFA 5FYSA 5GLUA 5J37A 3KGZA 1KEXA 5LY2A 1V70A 4P9IA 5FO9B 3IIAA 5F39A 1BBT1 2WO7A 5GKAC 5J1XA 4DO0A 2TEPA 1YFUA 5D8AC 5DPNA 3VD7A 2VW1A 5BYNA 1AR93 3DPRB 3MIHA 2LROA 4ITCA 3NNLA 1C5IA 1ND2A 3KB5A 4PIYA 5KHKA 3LFIA 4KBBA 4XUNA 4AVSA 2Z79A 3GCXA 4A44A 5ACA3 5KXCA 1AHSA 3AP4A 2WDBA 1W6QB 2BYVE 1WW6A 3LCPA 4IEOA 2A3WA 5KR7A 2VVEA 2VH9A 1AR71 1JI6A 2ZX1A 4PLNA 4AEMA 2C4XA 2WFF3 4XILA 1ENXA 3JCIA 4QXBA 4WM7B 3QD6A 4Q4W3 1UWWA 1EUTA 5C70A 1JHJA 3BTYA 5KXDA 5ISLA 4RHV1 3KF5A 4MH0E 2WNUC 3NJVA 3KT1A 1R083 2ZEYA 4E2GA 2JIGA 2PYTA 2NYYA 4JTOA 4GULA 2BNNA 4YW6A 4EQVA 4GWNA 4TXWA 2FZ2A 3R0RA 4S2DA 1CZVA 4W50A 4FFGA 4ATFA 1LGCA 1LECA 3BOPA 2C6SA 1WW4A 5DG1A 2ZX0A 4AEDA 2V72A 4L92A 2AEZA 3AYDA 3KMHA 5A3UA 5LWBA 5FZMA 1KS5A 1PK6C 2HWE3 4PI2A 2YROA 5D8AB 1WBLA 3ZSKA 1W6NA 1GKBA 4O61A 1YJKA 2WWJA 1YFXA 1J1LA 4HVRA 5FP4A 1S0JA 2OPKA 1NZCA 3DYOA 4A7KA 5IVCA 1LENA 5H9RA 2PHDA 3GDBA 3PMSA 3LDBA 1VLNA 1NE4A 1FMD1 1VP6A 3BUCA 4W6YA 4KGGA 4HN1A 4Y1XA 3ZXJA 3VHNA 1W9FA 1WLCA 2B45X 2JDHA 4RYDA 5T5PA 1H9WA 1OD3A 4ZZ5A 1ST8A 2BRTA 1NUKA 4AQ2A 1WKYA 2ZEXA 1SEFA 5A7WA 3RWKX 3ZKUA 2R071 5C3SA 2WNUB 5FPVA 3CDZB 4UYBA 4WVVA 3DCQA 3IAQA 1D4VB 3GZUC 1QJX3 5G04L 2RM22 1YIPA 1QJZA 3WXPA 2W95A 1S0BA 3OUIA 1JZ3A 4P9XA 2ZBJA 1DQ6A 1GLHA 2DUOA 4HKWA 5FYIA 2K9ZA 5T3NA 1XNTA 3ALQA 5K0UC 3ZXGA 5J48A 3K77A 3AMNA 3B69A 1A8MA 3BGAA 3J9SA 4HSLA 4MGZE 4BDVB 1AXYA 1Q5OA 1QJY3 3DL3A 4K8RB 4OUSA 5FZCA 2CAVA 3TAYA 2WBKA 1EAH2 2HWB3 1POQA 2H0VA 5FZOB 1PK6B 4Q4Y2 1Z7S2 4A3ZA 1IKQA 3N35A 2XL7A 3V65A 1AR82 5DDJ1 2R16A 5HCBA 1CZTA 1HB2A 4C90A 3MO4A 4HK9A 5FMOL 2DV9A 3ZYGA 3USUB 4BE3A 1RUC2 3N4MA 1JS9A 1YXWA 2EIBA 2IXIA 2VZRA 1JUIA 2WIIB 3WEZA 1S0IA 4P9LA 1DYPA 3L2YA 5CFDC 2NP0A 1YO8A 2A7AA 2RVAA 1S0GA 1QQP2 2W39A 1GBGA 1RUE3 3PU3A 4HG6B 5JVVA 1WMEA 1JU4A 2B4KA 2W1UA 5ABJA 4DOUA 4YFWA 1YCIA 4XJAA 3PHMA 1YEWA 3J26N 3N9NA 4IE5A 1WMFA 5FZ1A 1PGW2 2Y6HA 3CKHA 4RN5A 3AVRA 2XJQA 5FJHA 5CBLA 1ODMA 5JLVA 5A6QA 3MLKA 2BFUL 5KHJA 4AI2A 4FI9A 5KHIA 1AL23 1AR72 3O12A 2DBNA 2J1TA 2VMHA 2W2IA 1MZFA 2WZEA 3KV5A 4S2FA 1Y3TA 1WGPA 3KVAA 2XJVA 4NHLA 5DUUA 5I0RA 3SH4A 1L7LA 3OBAA 4RHV2 1EV11 1WA6X 4J1WA 1LAJA 4COYA 1VBD3 2IWGB 1JU3A 3PVEA 1LOFC 4YFZA 1GNHA 3RG0A 1W6MA 1JOBA 3IPVA 1HX6A 1Q8OA 4MO3M 4BQ3A 4CXWA 4IEWA 3UGFA 5J09A 1S0DA 1LHNA 1RUNA 5JUVA 4AVVA 3ZN4A 2B42B 4QQOA 1ZREA 1Y4WA 4GB33 4L97A 4CE8A 4Q0QA 5CFDB 1AZDA 1ND3B 2MEV2 3K4AA 1CX1A 5LRRA 4TN7A 2SLIA 1DG6A 1BQPA 2JDAA 4XTMA 3PIJA 4JZRA 3VL9A 1FV2A 4NO4A 4IV1A 1SFYA 4XVHA 2BNMA 4XEZA 3WW3A 4BXFA 4AI9A 4ARXA 4K8FA 1GR3A 4XXAA 2VNVA 3U11A 4OHWA 1TNFA 4IV3A 4XFHA 3JUUA 5GALA 4IEPA 3LD8A 2BU9A 1W0NA 4Y1VA 2E9QA 5CIRA 5AC93 3ACGA 2R6QA 3B5LB 3KCCA 3GJBA 4W65A 1J3RA 1DHKB 3FL7A 4XHBA 5JXIA 2VCCA 1OSGA 3BPZA 2F17A 3P1IA 1UYYA 4AAPA 3H8RA 1GZTA 5DABA 4LJHA 5FPUA 2BV4A 2CGOA 3ACIA 3NV1A 3PMEA 1SPPB 4MGSA 4FFFA 2XQXA 1TME1 1XQNA 3OGSA 1RUD3 5H9PA 5FXVA 3W20A 3FJSA 3ORJA 3VDCA 3AFKA 2Z2SB 1LULA 3I97A 5FK7A 5JR7B 1RIRA 1H2LA 3KLSA 5BNOA 5F3EA 3ZYFA 5A32B 1FPN3 3S7IA 2C9AA 2Z4FA 3C3VA 1C1FA 1AR91 3SQOA 3U4SA 2W1SA 1EP0A 3UNPA 1RUH3 3MW4A 5JPMB 5H9QA 3VBOC 3VBUC 5ACA1 5IVVA 1WCSA 5HCFA 4HFSA 1PNGA 4Y20B 3C7OA 2DCYA 5DDJ2 5FZDA 3QCWA 1I5ZA 2VGDA 4H3WA 1UW8A 1R1ZA 2Q5TA 5EJ3A 2EICA 3WG3A 3J4UH 3WR0A 2JDPA 4XFBA 2E53A 3FHIB 1W0OA 2WFF1 1PMHX 5CG8A 4UBHA 4BQYA 2UWCA 5JI7A 1HRI3 1AJKA 4Q4W1 2D7FA 1O3RA 4C1XA 4MV2A 1R081 2VMFA 4ONUA 4R9DA 3LA3A 1K5MC 2LUWA 3K75B 4Q27A 1O3SA 3TNQA 4UOJA 4DQAA 1XJAA 4PQ9A 3UKVA 3BODA 1XBFA 2HWD3 4JKLA 1QOSA 4BK5A 3NV2A 2CU5A 5SV8A 3ROUA 3UJOA 3IT8A 4Y5Z0 5LK7B 3ZM8A 2HWE1 2WZR3 2D98A 4D7YA 1VJ2A 4DXZA 3CU7A 3HN3A 5EIYB 3G7DA 3VBOB 1DCSA 1LGNA 1ULEA 3VBUB 4IEUA 1PIV3 2VZ1A 3HPNA 2Y0OA 2QQOA 3LOIA 4N7IA 1W90A 3A0NA 4OI0A 3ON7A 5DAPA 2GU9A 3LAGA 2ZOEB 3AP9A 3CNAA 4ISRA 5JXJA 2ZHKA 4KWLA 1NLSA 1VPHA 1VRBA 2GN7A 1ZZCA 5I8YA 4Z2WA 2YFUA 2ZS6B 4CDXA 3V0AB 4LKFA 4D8MA 1SQ4A 2CSGA 4YGBA 4Q8KA 2E6VA 2VZSA 1AYM2 2WWUA 2YU1A 5C5TA 3ZSLA 2CGNA 1K5MB 1W39A 2R043 2WO1A 1MACA 4WZFA 4AEJA 1R64A 2JG9C 4J25A 5A3MA 2ZA9A 4YGCA 3BCWA 3M3IA 3WD5A 3ELNA 4W6WA 1RUI1 2UU8A 4XXPA 3ZOIA 3LF7A 3NSTA 1VMHA 2YYOA 3DYPA 1QJY1 5FZHA 2A73B 1VBC3 2FD8A 3THCA 3WNNA 5FMOS 3WW4A 1W99A 3RZGA 5FZ4A 4FQ4A 1G9BA 2RMU2 4K20A 5FYYA 2GC1A 4BZ4A 4FOQA 2CDOA 2XLAA 3POYA 3UGHA 4GQ7A 2BDRA 2O1QA 4M00A 3HT2A 3O1TA 1CIYA 2ARCA 2D43A 4HPKB 1X9PA 5EYYA 3ES1A 4JGYA 3Q8AA 1F9KA 1QU0A 1JZ8A 1W2OA 4BK4A 1RUE1 4CEWC 3H9AA 5IK4A 3BVCA 2RS52 2GNBA 2X09A 4MUVA 3ILFA 1VBB3 3EJKA 1RUG1 2V5DA 2QBXA 1DGRA 2HYXA 3J8F3 2OS2A 4CDQB 5AFBA 4DXRA 1J59A 1D2QA 5A7QA 4ZHNA 4KWUA 4NRPA 5ERLA 2UWBA 2XUMA 4AI3A 1UY1A 5HCAA 3WUDA 4F3JA 4CU8A 3AC0A 1OUSA 4FOYA 2FCTA 2IFWA 3VDDA 1LCLA 4FPOB 5I0DA 2WJSA 2WN3A 2VPVA 2XBO2 5FZBA 1VBD1 1UYZA 1W03A 4JGZC 4PJYA 2HEWF 2VUAA 4P5YA 3U1XA 4CCDA 4AI1A 1EPZA 1GU3A 5C4WC 2WAOA 4AVCA 2RJKA 3PVOA 4XIOA 4QQLA 4BQWA 4C0BA 2W46A 4NPLA 4WVMA 5FZ7A 4XZUG 1WCUA 2CYFA 4FVVA 3OYWA 3S30A 4V1PA 1MS0A 3IWZA 1RVF3 2J42A 3BU7A 1MR5A 2UY8A 1IGOA 4ZY9A 3NKTA 3I2GA 5JOWA 2Q30A 4CEWB 3MF6A 5C7GA 4Y3OA 2ZPXA 1CZSA 2HWF3 1K3IA 3GHMA 4R9CA 1GWMA 3ZN6B 3BB6A 3H42B 3RZHA 1YC61 1K5JA 4LNVA 1LGBA 5FPAA 2SBAA 1ZZ8A 1POV1 4W4ZA 3I2DA 3PDQA 4OUEA 1WD3A 2ZZQA 3AKRA 2P3YA 2Q1ZB 5C9AA 2D6PA 2BJSA 5F5AA 5AC91 1MPXA 2JDKA 1NA1A 2BGPA 4PQQA 4YW3A 2AREA 3A0KA 3C7GA 3A22A 4YM1A 3UESA 1EUUA 1NXMA 1NCQC 2RDNA 1XE7A 2CHHA 4Q8LA 1B35A 1D7PM 4EWAA 2ZCWA 4Y1ZA 1SLTA 4NIHA 1X50A 1ND2C 2C1FA 2VCBA 1RUD1 3O1UA 1HKDA 1DYOA 2B8MA 5C4WB 2WWSA 1CAUA 5GZEA 1GANA 2XWJB 3WF1A 3I2HA 5FZEA 3LFMA 4BIOA 5LBCA 4P9YA 4YVWA 5FO8B 2RJLA 4FTSA 1HN0A 2WYFA 4DMIA 1MEC3 2QQWA 3PVNA 1RUI2 5DAQA 2XR4A 1KJRA 1FPN1 3DGTA 3ZFEB 1TMF3 3MICA 2XXZA 3ZIXA 1RUH1 2GNMA 1UKRA 2XKOA 3J7LA 1CX4A 5DUVA 5FPBA 3C7HA 3T0DA 3POWA 3FLPA 1WLTA 1DQ0A 1JZ7A 2EIGA 5FUIA 2HLEA 3W5NA 1Q8SA 3HT1A 2QVSB 4FPHA 2CNAA 3RGBA 2AUYA 2JDNA 1R092 4WVZA 2VTFA 3V56A 2OUHA 3R05A 1PZ7A 3IDBB 1CPNA 3LKJA 4BYYA 1KDMA 4AW7A 1ZYBA 4XF1A 1RL3A 3RYPA 4MZUA 4NVPA 2RG4A 3TEYA 4Z1VA 1ZZBA 1H1AA 1OXCA 1QHDA 3ZDVA 3ZYRA 4AEDC 5I0SA 4JVAA 1LESA 3THDA 1SMVA 5HCHA 5DZEA 1RUG2 2VMDA 3D8CA 2FCUA 5IJRA 1UMIA 3T2QA 1I9RA 3HNBM 2E26A 1ND2B 1I6XA 4AI0A 4ES9A 5FREA 4JX0A 2HEYF 3T1LA 1E57A 3B9IA 1K12A 1YJLA 2XHKA 2QQKA 4BQ4A 2ZTNA 2JDYA 3ILRA 1HXS2 1OKOA 2WSVA 1DGRN 1H8TA 1KQRA 1XU1A 3GF6A 4N43A 3VBHA 1D2SA 1GICA 2DTWA 1JYCA 3AM2A 4X6RB 3A7QA 1E5HA 2ILMA 2V73A 3KSCA 2RS13 3URFA 1DGWA 1Q3EA 1UY3A 1L7RA 4L0PA 2ZAHA 2AR6A 4V2WA 4I02A 5KXEA 1UPIA 2PHUA 1QNYA 5FOJB 3OUHA 4PBOA 5FZKA 4CDUC 4IE6A 5BNNA 2NM1A 1WCKA 4IEQA 1G9FA 2YBPA 4XDOA 1XPWA 2PAEA 1REDA 1C8M3 4JCKA 4LPLA 1H2MA 4NWWA 4AEDB 3D6EA 1UYXA 1YYNA 2V4VA 3I2KA 2VTXJ 4CUGA 5FP8A 1PO21 4YWAA 3RWNA 3WV6A 5T50A 3IDAA 3VD4A 1CQ9A 1W6NB 4ZPIA 3TBDA 3T4VA 2DTYA 5F9TA 1OOPA 3TN93 4RS5A 2AENA 2R061 4QGMA 4Q4X3 1V00A 2JJ6A 2I45A 3AL5A 1JODA 3A21A 2GNTA 5E1RA 2VUCA 1VBC1 4LA2A 1UY0A 1GQHA 2P37A 2QZ3A 4GJZA 5LRSA 5L73A 2GSYA 4G4FA 1FOD3 1N3PA 1NQDA 5K8SA 5IFTA 1Q8VA 1VE0A 3H8UA 5ABJC 1CIWA 4MHRA 2WA3A 4IGPA 1CJPA 5A7WB 4CTEA 1HQNA 2E7QA 3E6DA 5C3RA 5FO7B 2W9XA 5T55A 4N53A 1HB1A 1OF4A 1QJU3 3I3DA 1GNZA 5A3TA 4LXLA 5D1IA 4CDUB 2VVDA 5DZGA 2D3PA 4MXVA 4LHLA 4MVTA 1VBB1 3WQ0A 5A80A 2RE9A 3OPWA 3J8F1 4GA9A 2VJXA 3PUAA 2B9VA 5CAZA 3QLQA 5FYBA 4LO6B 2VW2A 3PNAA 1VBE3 3ZDSA 2Z69A 5T5LA 5B2GB 1RUF2 4DUXA 1IZ3A 3NAPA 3ZIWA 1C4RA 1RXFA 3GGLA 1Y9GA 1CAXA 3ST7A 4LA3A 5BNPA 1SDWA 1TQ5A 2J22A 1YWKA 4QM9A 2ZZJA 3SLIA 5A3LA 1S4CA 1HQLA 3MV01 5FYUA 2JKBA 2RS33 4Q29A 1UY4A 3AL6A 4MHUA 2DYCA 2JG8C 4BB3A 4M0NA 2YFZA 3TYJA 4IV1C 5ABJB 4I30A 2DDUA 4JDNA 1QNWA 3POFA 1QJEA 1JXNA 2UYAA 4NMIA 4XC9A 2Q8DA 5BY5A 1ALYA 1REEA 1NCRA 2FDJA 3TEWA 4IV3C 1WW7A 2QKDA 4K7JA 3VD5A 3KF3A 4MGYE 1ZBE3 5GJ6A 2HWF1 3M1HA 1GSLA 1LOEA 1RHI3 1H30A 2VL4A 3MF9A 3MPBA 1W3VA 2W91A 2VZTA 2ZGTA 1C8NA 4Q4V3 2PMWB 1UXZA 4CP2A 2E7AA 3B00A 3WP3A 2NZ9A 5DUXA 4AFMA 4CZSA 2A75A 2OW4A 2YV8A 5A6XA 2ZGPA 2YB7A 3PJQA 1DQ4A 1OA3A 4Q0UA 3E5QA 3HIFA 1R1A3 5FZLA 2BP6A 1W6MB 2E51A 2P3IA 3IPVB 4RA0A 4I3PA 2G1MA 2FDGA 3GZTB 4OZXA 3O1VA 2HWC3 1QDCA 4DY5A 2ZX4A 4FPEA 3HD8B 2RDRA 1W2TA 4LE4A 1OFNA 5FZGA 4DPNA 4XBLA 1HJFA 5L9BA 1CR7A 3TRSB 3MV11 1PO22 3AK0A 3ZFGA 1VBA3 2BZDA 2JEMA 1D4M3 3ES4A 3SNMA 5J96B 2JG8B 4B1MA 4QPIA 1AR63 4CCNA 4MGIE 4IV1B 4YZ4A 2WA4A 1CJDA 1NZIA 2GALA 2R062 5F7UA 1WZXA 2ZGOA 3BOWA 5A3NA 4LLOA 3AZYA 2A5ZA 1OPMA 1JTZX 2JICA 4IV3B 3FN9A 3PUHA 3NRUA 2VD7A 3SISA 4AVTA 1J84A 1QY4A 2VOTA 1HV0A 2QDRA 1SBDA 5I0TA 5SV5A 4RGGA 4QXHA 1ZA4A 4QMAA 4A45A 2DWRA 4AAXA 1SCRA 5JAXA 4QX7A 2TBVA 2XVKA 5H9SA 4ISQA
chains in the Genus database with same CATH topology
3ZFFA 4U36A 4LBKA 1XYPA 2JDZA 2Q8OA 2N7GA 1YHFA 2CWSA 3I7DA 3AXDA 1G6NA 2ATFA 1A8DA 3MIDA 1LEMA 4OI2A 1BEV2 4XFAA 2XH6A 3WP6A 1YI7A 2PHWA 4J1XA 3R4SA 1MQTA 1NXD1 1PO11 1RMU3 4AI8A 4QQPA 3DKWA 3IDCB 2WZPP 3O14A 2VMIA 4OHZA 2PHFA 1V6NA 2CAUA 2RS11 4EROA 5JWPA 4B7KA 4QPGA 3MDPA 3VZJA 5JDBA 2WS93 1F5FA 1NE6A 3N7JA 3U07A 1QGLA 1AYN3 4AHWA 3AP6A 1OQEA 1DQ5A 1NG0A 1FX5A 2D93A 3MEPA 1XNBA 3MLJA 4SLIA 3FFQA 1LRHA 1KFXL 2CTVA 1IPKA 3ME2A 1C8M1 1VAMA 4QPYA 4H7MA 1H2KA 5E88A 1JBCA 3SCHA 1U5ZA 3JBG2 4YZ3A 2ET1A 1MS5A 1ZNPA 3OD4A 3H1YA 2HEVF 4MX3A 1RINA 4TLFA 1SLCA 2XVLA 1X7NA 3TB0A 1N1TA 1PVC3 4AFBA 4BH9A 3EXUA 3G6JB 4AXOA 3NO8A 5L36A 4JGYC 2XJPA 1WW5A 4FOWA 4Q2FA 1FOD1 4BLJA 3VZKA 4BMBA 2ZHNA 1Q56A 5CFCA 1UAIA 3HQXA 4FPFA 2OYZA 4CDXB 3B3QE 1Z78A 2DFCA 3RZZA 1XXNA 4HSJA 1DGWX 3FC0A 4LTAA 3JD73 1VIWB 5JSPA 2NMOA 4XQ4A 2PHRA 1QJU1 2JE7A 4E9KA 1LKNA 1ZBA3 1SFNA 3WW2A 2UURA 1G7YA 2LTNA 2PLV3 4Y22A 1LOCA 4Q1PA 2YMZA 1ND3C 3VDDC 3FUOA 3IKWA 3ACLA 1BBT2 2WQZC 4PLMA 3VBFA 5L7OC 3RJ2X 1N3QA 1VBE1 4KQ7A 2P2KA 2IXKA 2CV6A 1W6OA 1HW5A 3AFGA 4CEYC 4P9JA 5EFUA 3WHUA 5F6LB 2CWMA 4LO5B 1C5HA 1BK1A 3KCXA 4LUMA 1FXZA 2FMYA 1S0CA 4AVBA 4LLFA 1QKQA 4JGYB 5BPXA 2RS31 3H7JA 3LSEA 2W0XA 3VKMA 4XOGA 3HR9A 4GMP3 1LODA 1VRH1 2DVDA 4L9BA 5C8CA 4ATEA 3AZVA 1S1AA 5C9AC 1PO12 3ASIA 2P3KA 1YIFA 4XBNA 4LO8A 2I2SA 1ZBE1 2LM3A 5CADA 3WDYA 1RHI1 2V09A 4YLZA 1NA1C 5GZCA 4Q4V1 3PJYA 1HRV1 2DCKA 4D94A 2X53S 3GYDA 3VDDB 2P3JA 4XJ8A 3KGLA 5L7OB 1MVEA 3WVJA 4XJZA 1LHVA 4K1ZA 4Y1YA 1QOOA 4CEYB 1QH6A 2PELA 4WVMB 4YVWC 1MVQA 3C2UA 3KT4A 1EY2A 3OYWB 1FMD2 3UK9A 4P5HA 3VBRA 4KH9A 3D4KA 5JPNB 3MPPG 4XE9A 4DNYA 3QH6A 4OUMA 2VU9A 2DCTA 3U4XA 1AXZA 2QFEA 1AR61 3VKLA 2YY1A 1QXRA 2R072 1O4YA 4OFGA 3WG4A 5JZGA 1V9U1 3TNPB 5C9AB 4WBBA 4BWOA 4YM2A 1SLBA 1F31A 1NA1B 1JYIA 1RITA 4LHNA 5KHHA 4GMP0 1D0HA 1QDOA 1ASJ3 4XF3A 2NQYA 4XQWA 4GKYA 4Z82A 1M06G 4K21A 3WY6A 3S7EA 1PVXA 1CAUB 2ENRA 5AVAA 2WT2A 1RUJ3 4PDWA 4YVWB 5HXVA 4KG8A 3WLUA 4K3UA 4COZA 1U5YA 1JUHA 4O9GA 4XJ9A 5F5QA 5DUWA 4X8NA 1G9DA 4WM7A 2D5HA 2D44A 1BJQA 4TWTA 2RR13 3OTFA 3RNSA 4AEKA 2R1BA 1RMU1 5FTTC 4COVA 4EWDA 2O8QA 3FE5A 4K1YA 3NV3A 2YZ4A 3GNEA 4A2UA 1N1VA 4AFAA 1KXGA 2LALA 5BNNC 3TWIA 4OLLA 1XNCA 5FPXA 1N1YA 2D40A 5FRAA 1VRH2 4JTNA 4EN7B 1KRIA 4JDMA 2G4IA 1EV12 2BGCA 2WLQA 1FNYA 1OOPC 5GM0A 4MGKE 4RS5C 3MGUA 1FV3A 3ZPYA 3VN4A 2DUPA 2QNKA 1NOVA 3JZVA 4JDOA 3CJXA 1JOJA 1HRV2 1UL9A 2GN3A 3VBHB 1OQDA 4QX5A 4MSVA 5C33A 4RSUA 3MI8A 4J6GA 4CDQC 2YXSA 5BUVA 2KM2A 1H8VA 2ERFA 4IXLA 1M4WA 1QJX1 2TNFA 4XMIA 3VKOA 4RFT0 1MZ6A 2GH2A 2OIIA 4XIKA 2TUNA 4FPCA 5BNNB 1OA4A 1CVNA 2HWB1 3MFAA 1COV3 4KU8A 2GMPA 1KS4A 1J3QA 3JD71 3OY8A 1JN2P 1XU2A 2EXHA 2VQAA 3S6PA 4HT1T 5EWSA 3LOBA 2ZHLA 1N1SA 3I54A 4C0HA 1V9U2 3ZXEA 1TME2 3RDIA 1ULGA 4FO9A 1OOPB 1WLDA 1GZCA 3SMHA 2PLV1 2OA2A 2YDEA 3KD4A 4RS5B 4EN6B 4OULA 2VXRA 5BNPC 1BXHA 2G9GA 1X36A 3FBYA 5IT6A 1AX2A 1AR92 3X29B 2XGXA 3PLQA 4P9GA 1U5XA 5ACA2 2BFUS 1BYHA 4EWEA 1JW6A 5DXDA 4LEJA 1MS1A 4XTPA 1NCRC 1AL21 1IKPA 1C28A 2BVBA 2WFF2 2E7TA 3SITA 4KG0A 4F8AA 4YZ1A 1NQJA 4COWA 4Q4W2 5K0UA 3E6CC 5GLTA 5L19A 2ARXA 2UY9A 1R082 3B7MA 3OPZA 1REFA 2DCJA 4D3WA 2RHPA 2EAKA 3IN9A 3NAPB 3WG2A 4D69A 1ZRRA 1JH5A 1BKZA 3CLPA 4GB31 4DS0A 3ZFEC 1CAXB 3HAGA 4DRRA 2VQ0A 5BNPB 1CAVA 3RJRA 5CFDA 3ZSEA 2HWE2 2ZGKA 4XHXA 1HDKA 2BPA2 5FLHA 3ZFGC 2FBEA 2JD4A 5KC5A 5JCTA 2BVVA 2XPJA 4HVQA 4QPIC 3AXEA 2PN5A 1LHWA 2PA7A 3N7KA 1NCRB 1FATA 4NR1A 3THTA 3AJYA 3EO6A 2B7YA 2HYKA 4KU7A 5I8SA 5FAXA 3ZMOA 3ZYIB 4Y4YA 4JRLA 4QGNA 5J3UA 1QJX2 2ZABA 4C1WA 1PM7A 1LOFA 2XLFA 3AP5A 4N90A 3ZX7A 3KT7A 4JAAA 2O8OA 4FXKB 1C57A 2RM23 1QJY2 3MIEA 5J7MA 2B5HA 4LBNA 3UL2A 2HWB2 1ASJ1 1DU3D 1TE1B 3FX3A 4EJRA 1O4ZA 3JB4C 2QCSB 3ZFGB 1ZM1A 5IUQA 2B9UA 1H2NA 5GLVA 1EAH3 1MQTC 1RUJ1 4QPIB 4YZ2A 4Q4Y3 1Z7S3 1UU6A 1AR83 1D0GA 2H6CA 4BM8A 1HRI1 1KFUL 3LA7A 1ENRA 4B7EA 1RUC3 5IK7A 1UKGA 4Z8BA 1RUE2 4OHXA 4GH4A 4RL7A 1G86A 2RR11 2GC0A 3AMQA 2WINB 1QQP3 3INAA 3FMGA 1FT9A 3ZMNA 2HWD1 5I0UA 3ZFFB 1AL22 4YRDA 4FTEA 1FAYA 3ZXDA 4Q1RA 2WZR1 5EYXA 4QHBA 3NKGA 2GZWA 3AYEA 2VOWA 2X5IA 3R4DB 4XMAA 1AJOA 3SCGA 2BEOA 3I59A 1AR73 1VBD2 1PIV1 2IXHA 1HV1A 2OUJA 3VBUA 4RHV3 2WNVA 4OHVA 1DBNA 1U12A 1MQTB 2Q1MA 4W6XA 5EXOA 4AGGA 1WUVA 4GB32 4M0HA 1QXJA 4BQ1A 1QH7A 2CL2A 2AYHA 2PHXA 2D3RA 1SLAA 5FBZA 2R041 5LEJA 2MEV3 2OVUA 4N9HA 3NL1A 5FLIA 4XPVA 3AKPA 3VUOA 1XRUA 2A70A 3MIGA 4RGAA 3K51A 4N7UA 5AC92 4CYDA 3DN7A 1IS4A 1UN1A 2R0HA 1BZWA 4AWDA 4XZPA 3ZYJB 3DV8A 4AHYA 3WDTA 4B8EA 3M70A 1A6CA 1QF3A 5IK5A 1Z0HA 2DF7A 2QE3A 1ZVFA 4BCUA 1RUD2 1YI9A 4BA6A 4YG3A 4WV8A 3AZZA 4FT8A 2FMDA 3BTAA 3SCFA 2C5DA 4HKLA 2JX9A 3VBSA 3DF0A 2WC2A 2NMNA 4FPGA 3ZXKA 1FPN2 1WBFA 2XJTA 3AP7A 4QT6A 3AJZA 2AZ5A 1L3JA 1RUH2 5KC6A 5E16A 2R1DA 1DZQA 1ENQA 4IESA 5C8CC 3UKTA 2H6BA 4FBFA 1O7FA 1RTVA 2JG9A 3WNXA 5DDJ3 4E4ZA 2DVBA 1HRI2 4QU2A 1H0BA 2VOKA 4XFGA 4Y22B 3A4UA 2A3YA 3O7OA 4NN0A 3VZMA 2GH8A 2H0BA 1RGSA 4FCAA 4JRAA 3V64A 3VBFB 3D0JA 4PCRA 2A6WA 4YNIA 3B93A 2GMEA 2MHFA 1W6OB 2HWD2 2NPIA 1RVF1 1QWRA 2VOXA 4L2NA 5CB7A 4CDWA 2W68A 4Q0PA 4RQPA 2WZR2 1XNDA 3ZN5A 1RB8G 5JIAA 3SH3A 2A6XA 1DIWA 1DQ2A 4IEZA 1PIV2 4INDA 4RR3A 4XFCA 1OHFA 2PTMA 5C8CB 5JZGC 4YYOA 4AYUA 2GAUA 2A6ZA 2D6LX 2IFRA 1U5IA 3DUIA 1DZRA 1VALA 5IK8A 4AGRA 4K40A 4Q26A 5BNOC 2JE9A 2XJUA 5GLWA 3RI9A 3POSA 1UU4A 3WCSA 2R042 1Y7BA 1CN1A 4JGZA 1DZTA 3M4FA 4I0WB 1EYBA 3WT3A 4FSJA 3KS7A 1MEC1 2QQPA 1AYM3 4YW5A 1J1TA 1TMF1 4PDWC 1G9AA 3VZOA 2Q0AA 1VBC2 4K6BA 4LHKA 5F1RA 3H3ZA 5FLJA 4ZXKA 3W9AA 1GZWA 3AYCA 4XJWA 3VBRB 4AQTA 4Z92B 3MIBA 3GALA 1UD1A 4FPJA 2ZJCA 2R49A 1OA2A 1OKQA 4LULA 4CP1A 4Q4Y1 4YGDA 4PBPA 2XLGA 2YGLA 3TOJA 2WL1A 2Z5WA 5JZGB 1H1IA 1UZZA 2RMU3 1IQAA 3RYKA 5C6CA 2WT1A 1I3HA 2MPFA 2OZJA 3AYAA 4B29A 5CA6A 3M8LA 4YW2A 2GNDA 1VBB2 3I4IA 5BNOB 1LOAA 1DFQA 1NCQA 2A3XA 1QQP1 3I8TA 3J8F2 3D82A 4B4PA 1GQGA 4TZDA 1UIKA 2RS53 3H1WA 4QQHA 1CAWA 1S0EA 2VUJA 2PQQA 3E5UA 2VW0A 4I01A 2BUKA 4IL7A 1OD5A 1PGW1 2EAAA 5TSWA 3SHRA 3SH5A 1CONA 4PDWB 1SLIA 5BXXA 5JI9A 3H7YA 3OCPA 3E5XA 2VNRA 4CDXC 4QM8A 5KHGA 3CF6E 1UZYA 1F2NA 1IHMA 2VY0A 2XBO3 1H4GA 2ZMLA 3KZ4C 5CU1A 3QACA 1VAKA 2XKPA 3IDEA 5FOBB 2UWAA 1RVF2 1IOAA 1CGPA 3M3QA 1HLCA 2D6NA 1SLLA 4P9WA 1S2BA 2HWF2 1U0AA 4YM0A 5HBAA 2ZGMA 4LBQA 2MEV1 4PIZA 1OFSA 3RI8A 3OD0A 1YFWA 4XQDA 5GZGA 5EZWA 3TN91 4Q4X1 1Q8PA 3VZNA 1DF0A 2DCZA 3V0BA 3FFZA 4FPKA 3M3CA 2EXJA 4I2OA 1N3OA 3MYXA 5KWRA 1V6MA 3O0XA 1SACA 3LB9A 5T54A 4Y1UA 4BLIA 2D3SA 2PAKA 1IPJA 4FOVA 1NY71 4HK8A 3M7AA 4Z07A 4GWMA 1YNAA 4YW1A 2Y26A 4AFDA 4E4SA 1MEC2 4IETA 4CRQA 2BNOA 5I8TA 1TMF2 2GC2A 2BWCA 3NVCA 4CDUA 3AMMA 1BCXA 1RUOA 1ULFA 2ZKNA 3ZYPA 1ULDA 1RUI3 2YUEA 3MIFA 3N36A 1SBFA 1W6PA 1MS8A 3N7MA 4YW4A 4EV0A 1O91A 4QGLA 5CG9A 4YGEA 1UIJA 5BNQA 1S55A 3OY8B 3H3UA 2W08A 4R4XA 5FQ0A 3B01A 4LBQD 3VV1A 3E97A 2JENA 4BHPA 4S2HA 3L2HA 4NOTA 5JOXA 1R093 3AZWA 4TSVA 4A7ZA 2I07B 1KJLA 4H7LA 3NJZA 4UXAA 1O3QA 4M3CA 2R30A 4JV4A 5A33A 4A7YA 1IS5A 3WQ7A 3JQWA 5JMCA 1LB2A 4XYXA 1RUG3 1V6IA 2QZ2A 2ZGUA 1J3PA 4LO4B 4EN0A 4H14A 1CD3G 1PGL1 1W0PA 4GALA 1WA4A 1HQWA 4ZU4A 3WP5A 4WM8A 3ZXAC 3WX5A 3CO2A 4MXWA 4ORFA 3SXWA 4EN9B 3CJIA 2RS12 1HXS3 5K0UB 2Z42A 1PZ9A 1B35C 4M01A 2X8KA 4YVSA 4A3XA 3AX4A 2PAMA 4META 2EALA 1R1A1 3AB0A 3OGGA 2F6BA 4XFFA 2WT0A 3FWEA 2HWC1 4ASMB 1ONAA 4FQZA 1UPSA 2EXKA 3VGIA 4KWJA 1WD4A 1C8M2 1G8WA 4HANA 4D7TA 4YG6A 1CAVB 5CVRA 4XF9A 4HN0A 1VBA1 1D4M1 3OBRA 4L11A 1KITA 3M2MA 4AFCA 3TN92 1AYM1 4PIXA 2JG8A 2VNGA 4Q4X2 3GBFA 2DURA 4JQRA 4Y26A 3GBGA 1POV3 4R8HA 1MS3A 2WLPA 4I09A 4BOWA 4OHYA 1XYNA 2ARBA 2QUOA 1DQ1A 4Y24A 1ZZ7A 1FOD2 5JIUA 4UBGA 4GH4C 1AXKA 1BVVA 2EF6A 1NY72 4O9EA 1LTEA 3DPRA 1B35B 2ZMKA 4GIQA 4U2AA 1UX6A 4OI4A 5T5OA 2RMU1 3PTYA 1QJU2 2DVAA 1W6QA 1OLQA 1RJ7A 3VKNA 3U10A 2ZHMA 1LR5A 1LHOA 3MW3A 4N43C 2B39A 1H8TC 4YZ5A 1LU2A 4LO7A 5GZDA 3VBHC 5J36A 3ENRA 2X5IC 3KCYA 1NLRA 4HBNA 3MZHA 1TNRA 2O0OA 2RS51 5I91A 1VBE2 4FXGB 1T6GC 3HN1A 1BVP1 3EHKA 4PF5A 1ULCA 4QXKA 3WG1A 3OJBA 2VOVA 2WNVC 1PNFA 1F8VA 1RUF3 3WHTA 4FAGA 2WQ4A 4AQ6A 3T1MA 2VMGA 2RS32 5DG2A 1GYKA 4GH4B 3RRDA 4ZU7A 5CNAA 1XYOA 2WS91 4LBOA 4LBMA 4XF0A 2Y38A 1PHMA 1VB2A 5D8AA 2XBO1 2XB6C 1LHUA 1AYN1 3MFCA 2IXLA 3UJQA 4XJUA 1AL0G 4UW6A 2C0ZA 3CEWA 1POV0 1NYWA 1BMV1 1PGL2 1ZBE2 4AG4A 1RHI2 5LK5A 3ZXFA 1FNZA 1MZ5A 4Q4V2 2R32A 4N43B 2K0GA 1H8TB 2FQPA 2XJRA 3WDUA 2A71A 3NV4A 1SBEA 4DZGA 2X5IB 3H0OA 2WKKA 3NW4A 4KGQA 4NPRA 3WW1A 4UW3A 3I59B 4TYSA 3RSJA 1N47A 1PVC1 3AMPA 2WNUA 3ZXLA 4FP3A 1R1A2 4L99A 4XDQA 4R9AA 3E6BA 2HWC2 4N53C 3VBSC 2ETEA 2HJIA 2WNVB 1ZRDA 4K9SA 4QD2A 4ZU5A 4E2SA 3AKQA 3FLRA 3JU9A 3M3EA 2R0FA 1RJ8A 1LOBA 1VBA2 3RS6A 1D4M2 2YC0A 3FBMA 4G9SB 5EV7A 1PK6A 1AR62 4Q0VA 3WCRA 4H55A 1ZBA1 3O0VA 3RMYA 2BBVA 4UW4A 1PO23 3NAPC 2WSUA 3USUA 3ILNA 2Y0IA 5J98B 2CGPA 3MW2A 2GC3A 4N9IA 2R063 4M3CE 2D6KA 2ZGSA 4B3NA 3GBWA 2GDFA 4HL0A 3OBTA 3B9CA 5JOZA 2B46X 2JECA 4AF9A 3P3NA 4IEVA 2ZAAA 2VULA 4HZFA 1X82A 4MYEA 1KD7A 4WVWA 1FYUA 3MLLA 4KL1A 3APBA 1R091 4COUA 3WP4A 3IM0A 4N53B 3VBSB 4CDWC 4M3CF 2VVFA 1DLLA 4KWKA 1UMZA 2WNEA 4RQPC 1QOTA 3LZZA 4GMP1 2YPJA 3RYRA 4DRVA 2K2SA 1GFF2 5KXBA 3RMXA 4RR3C 4DFSA 4GXLA 1H9PA 5T5JA 4F7ZA 1RMU2 3W58A 3AKSA 1BEV3 1WLWA 1V6OA 3WDXA 4XETA 3N3HA 4ZKTB 2JG9B 1VB4A 4HVOA 5FDBA 2ZGNA 1HXS1 4NWVA 4URTA 3UKNA 1ND3A 3WINE 2WS92 5L7OA 4E4DX 3QH7A 1ENSA 1AYN2 2DU0A 4AK3A 3LSDA 2AH2A 5FPZA 4CEYA 2IZWA 4NHKA 2F4PA 1PZ8A 4R52A 1BMV2 2OZ6A 1O5LA 4LBJA 2BQPA 4BIFA 3PVBB 4PLOA 4YARA 2ZX3A 4CDWB 4KNCA 4OVEA 1QMJA 4RQPB 2IC1A 3N7LA 4XBQA 1ZZ9A 3R6SA 1ZZ6A 1OI6A 1XE8A 5E89A 4RR3B 3JBG3 1PVC2 1AX1A 3WDVA 4DY3A 3QBQA 2W52A 4YSFA 5T52A 3ZFFC 4LT5A 1OMIA 4CP0A 1X33A 3W59A 5BV6A 4FAHA 1WCDJ 3IMNA 1YUDA 1V6LA 1YFYA 4FPYA 1DYKA 1A78A 1RC6A 3VHPA 5A32A 3JD72 4C91A 1MS4A 5F6KA 1LJ7A 2DUQA 3LGRA 2GMMA 4Y20A 1ZBA2 3VKFC 3H1MA 4JGZB 1GZ9A 5GLZA 3UV9A 2BW8A 4NHMA 1OPOA 4AE2A 2PLV2 3OF1A 3LA2A 3T2TA 4FP2A 2YGMA 5E8AA 3EQEA 3S0MA 1AF9A 1C1LA 1GZWB 1S0FA 2ET7A 3ZO0B 2ZKLA 2XJSA 4QPGC 1HIXA 4GKXA 4I3GA 4Q0SA 1A3KA 1BBT3 4EN8B 2UYBA 2X29A 1O4TA 4D7SA 1DDLA 4LUKA 4WZCA 3ZVXA 5JSRA 1RUF1 3P3PA