2TEPA

Peanut lectin complexed with t-antigenic disaccharide
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
232
structure length
232
Chain Sequence
b'AETVSFNFNSFSEGNPAINFQGDVTVLSNGNIQLTNLNKVNSVGRVLYAMPVRIWSSATGNVASFLTSFSFEMKDIKDYDPADGIIFFIAPEDTQIPAGSIGGGTLGVSDTKGAGHFVGVEFDTYSNSEYNDPPTDHVGIDVNSVDSVKTVPWNSVSGAVVKVTVIYDSSTKTLSVAVTNDNGDITTIAQVVDLKAKLPERVKFGFSASGSLGGRQIHLIRSWSFTSTLITT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (PEANUT LECTIN)
publication title The Specificity of Peanut Agglutinin for Thomsen-Friedenreich Antigen is Mediated by Water-Bridges
pubmed rcsb
molecule tags Lectin
total genus 55
structure length 232
sequence length 232
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2tepA00
1LHOA 3TAYA 2UWBA 3AYDA 4FVVA 1WD4A 5DUXA 5CB7A 5IUQA 3TB0A 4FP3A 5EWSA 1QNYA 2CL2A 1DFQA 1OQ1A 2G4IA 2ZGRA 1N47A 2JJ6A 5JOXA 1WUVA 1GZWB 2YV8A 5DUVA 5H9SA 4AVSA 2ES3A 1LECA 5E88A 2A3YA 2E7QA 2WT0A 1V6IA 4YW3A 3ENRA 3VKOA 1RITA 4BLIA 4Y22B 4XDQA 5F9TA 2GMEA 2A6YA 3RQ0A 1AX2A 3KQRA 5GZCA 1ENRA 2EAKA 5HCAA 1NXD1 3AYAA 1SACA 4TYSA 3AZYA 2VXRA 1SBFA 4JRAA 1W6PB 4DFSA 3WZ1A 4M00A 5IK7A 2DTWA 2EXKA 3L2YA 5FRAA 3WDYA 2DVDA 3IPVA 1LGBA 1S0FA 3IN9A 5GLVA 5GZDA 5GALA 1N1TA 1G8WA 3AP6A 3GNEA 2EIGA 3RMXA 3VKLA 2ZAAA 4K21A 4FPFA 3ASIA 2DUQA 1AJKA 1ULCA 5FREA 4BM8A 3IPVB 1LU2A 5GLUA 4YZ3A 3WG3A 5BYNA 2VH9A 3N36A 4Q8LA 2JD4A 1WBFA 4BLJA 2YMZA 1SLTA 4K1ZA 1V6JA 1S0BA 1PZ9A 2OUHA 4F83A 2D6NA 4YM2A 5T50A 4TZDA 2KM2A 2A71A 3AJZA 5GLZA 3WDWA 4H55A 1YXWA 5LK5A 3M3OA 1H9WA 4U2AA 1A78A 1MVEA 4LBKA 4Y1YA 1JBCA 1IS4A 4YM3A 3RG0A 1GZCA 2D6OX 2EXHA 2GDFA 3N7KA 3SNMA 3ZSKA 4SLIA 1BQPA 3OJBA 3AP9A 5T5LA 1JOJA 1V6OA 4FP2A 1CPNA 4YW5A 3UJOA 4C1WA 1GSLA 1URXA 4M01A 3M1HA 2ZGLA 1U0AA 3N35A 1LHVA 4HANA 5GLWA 4XMIA 3PJQA 1GLHA 1AX0A 4PBPA 1DQ0A 2AUYA 3DGTA 5JOZA 2ZGKA 1QDOA 1QF3A 1Z78A 4GWNA 5DUWA 2VY0A 1LEDA 2LALA 5EYXA 5DG2A 3T1LA 1MS8A 4XIOA 1QOTA 1N1SA 2HYKA 5JLVA 2ERFA 1BKZA 4Y1VA 4XYXA 3NV2A 4U36A 4YG0A 2A3WA 4NO4A 5DXDA 3AJYA 1WW5A 4YFZA 1Y7BA 2TEPA 1QKQA 3OGGA 5DUUA 4CRQA 1MS1A 2D6MA 3WUCA 4XJAA 4XTMA 4ZXKA 3BIWE 4XJZA 5HCFA 3ZXFA 1AF9A 2CWSA 2Q5TA 3UL2A 4YGBA 2WJSA 5HCBA 3ILRA 1DGLA 3BODA 1DIWA 2R1DA 3ILNA 1AXYA 2OUJA 4L8QA 4FPEA 4JCKA 1ULDA 3UK9A 4FPYA 2NP0A 1QDCA 2D43A 3W58A 2E53A 5JVVA 3WHTA 3HN1A 4YW2A 5CA6A 2ENRA 3FFZA 3FLRA 3V0BA 1MS5A 3B00A 5IT6A 2B7YA 1F31A 2JKBA 3WOGA 3B01A 1BJQA 1DQ4A 3RSJA 1ZA4A 2R49A 4FPOB 3LSEA 4AGVA 1G7YA 4XMAA 5JDBA 3JU9A 2VUAA 3WUDA 3ZVXA 1AXZA 3N7LA 2CNAA 4Y1UA 3WCRA 1AXKA 4LBQB 5F5QA 4YGEA 2P3KA 3ZYPA 4FQ4A 1KQRA 2DUPA 2R0FA 4FQZA 3SH5A 3WDTA 4GALA 4YM1A 5JOYA 2FHRA 3NV3A 4YGDA 1WLDA 3ZSMA 2NMNA 3N3HA 5DZFA 4XJ8A 2SBAA 5GZFA 2YXSA 4JC1A 4WVWA 2ARXA 1IS5A 3AZZA 3QLQA 1AVBA 4Y20B 4Y1XA 4BMEA 2ZZJA 4XHBA 3O0WA 4GXLA 4YW4A 1C57A 2GN3A 1W6NB 3ZYRA 4XXAA 3USUA 5KXCA 1C1LA 4LBNA 2PELA 3ZSJA 3FBYA 3V0AA 1PZ8A 4MYEA 1FNYA 1V00A 2H0BA 1DHKB 2JECA 4LBMA 2AR6A 2I2SA 1N3OA 2E51A 3WDUA 1DQ2A 1S0GA 2D6LX 2DVBA 2ZBJA 3V0AB 1KJRA 1JXNA 2PHTA 4YLZA 1LULA 2C9AA 2D44A 5DG1A 1VIWB 5AVAA 1RIRA 1WLWA 2WQZC 4HL0A 3HMYA 4M3CA 4I30A 3M2MA 1ENSA 1Q8SA 5KXDA 1LCLA 1YRZA 4D69A 5KXBA 1G9CA 1LU1A 3IKWA 2DTYA 3M3EA 1W6OA 5CNAA 3AP4A 1ULGA 4M3CB 1GNZA 3POSA 4IQPA 4ATEA 2DYCA 1KDMA 2ZGNA 4BOWA 4UW6A 2DV9A 3OYWA 2A6XA 2EXIA 3WG1A 2D3SA 1G9FA 1HLCA 2YZ4A 1UKGA 1MS0A 1UMZA 2GALA 1S1AA 2E6VA 3FLPA 1CJPA 4Q2FA 1PZ7A 3WDXA 2AH2A 2DVGA 3OYWB 4DS0A 4XBNA 3RS6A 5H9QA 1BZWA 5E89A 2W39A 5T52A 2PHXA 4DRVA 3HR9A 1LOFC 1JYIA 5T5JA 2ZHLA 4CTEA 3LSDA 3QCWA 4XILA 3ATGA 5T5PA 2R0HA 1AZDA 1N3QA 3AX4A 2CY6A 1YO8A 1BXHA 2D6PA 3U4XA 5L73A 2JDZA 1IS3A 3IMNA 1GICA 3FLTA 1MACA 1CONA 1W0PA 2AREA 1WLCA 1FV2A 1IKPA 1BYHA 4UW4A 3O5SA 2GNTA 2PHWA 1G9DA 3A4UA 1Q8PA 5H9PA 1R1ZA 1AJOA 1YI7A 1WW7A 3W59A 4XE9A 2FMDA 4AYUA 5CBLA 4AVTA 2ARBA 2NMOA 1DBNA 2P2KA 3NV1A 2D6KA 3ZXKA 3GALA 4Q27A 2DURA 1C4RA 2ZACA 4FOWA 5GLTA 2GMMA 1LHUA 1UL9A 3NWKA 1APNA 3BOPA 4PBOA 4K20A 4XJ9A 3MW4A 1IKQA 2WKKA 1D0HA 4LBLA 1N1VA 1JW6A 2ZHNA 3T2TA 1SCRA 1Z0HA 1LOCA 5CAZA 2A6WA 3CNAA 1ONAA 2CTVA 2JE7A 2YROA 1FAYA 3PVOA 3WLUA 3OBTA 1ULFA 1GKBA 1LODA 1KITA 2GNBA 2WSUA 2UURA 1OKQA 4K1YA 3VV1A 3PVEA 1MZ5A 1J1TA 4AGGA 1GYKA 4XTPA 5SV8A 1UZYA 4GKYA 2UWAA 1SBEA 5EYYA 5T5OA 2C5DA 3ZXLA 5KXEA 3RMYA 4XJUA 5JOWA 1W6MA 3I4IA 2ZHKA 1KDKA 3VKFC 1ENQA 2RHPA 1DQ5A 4Q26A 1A8DA 2WSVA 2Z42A 2A75A 1UZZA 3AFKA 4GKXA 1W6MB 4XHXA 5IK8A 1YIFA 1Q8OA 1QOOA 4KBBA 1O4ZA 3I8TA 2ZA9A 2D7FA 2YY1A 3M3QA 3WHUA 5E8AA 4P9XA 2D3RA 3MW2A 5IK5A 3N7MA 3V0BB 1G9BA 1SLBA 3H0OA 2SLIA 1O4YA 3KM5A 4YW1A 4XJWA 3MW3A 4YZ4A 1MS9A 4XBLA 1C1FA 3V64A 3B3QE 2UWCA 1KJLA 1V6NA 3LCPA 3V65A 1HKDA 2A3XA 3ZPYA 4XOGA 1W6QA 1QU0A 3VUOA 1OFSA 1MR5A 2OW4A 5IK4A 1JHNA 1LOGA 1GNHA 2W08A 3WNXA 3VKNA 3OY8A 3Q9OA 1GZ9A 4BPZA 1XQNA 2AGSA 4C1XA 1W6QB 1NLSA 4R9DA 4XZPA 1CN1A 3AP5A 2ZABA 1MVQA 1Q8VA 1S0CA 2VU9A 4YZ5A 1I1EA 1WW4A 1DYPA 4UW5A 3DUIA 4DPNA 3SH4A 1AX1A 5EXOA 3USUB 4NOTA 2AYHA 1LJ7A 3OPZA 2ZMNA 4LBOA 1A3KA 3ILFA 1CQ9A 1QNWA 3ZXJA 4Q1RA 2ZGSA 3OBRA 1GBGA 2GMPA 1GZWA 4FOQA 4M3CF 3A0KA 4FPKA 1LOFA 1MZ6A 1YYNA 4FPHA 4YZ2A 3N7JA 1W0OA 4XXPA 2BQPA 3WCSA 4Y22A 1EPWA 5GZGA 3WDVA 3BTAA 2VW0A 4YFWA 1LEMA 4FOYA 4BMBA 3VKMA 4GA9A 4R9BA 1W6PA 2PHUA 1LHNA 3R4UA 4PCRA 1W6OB 4LBQD 1DQ1A 3WG4A 1SLAA 1S0JA 1S0EA 2A6ZA 4ISQA 1H30A 3AXDA 4ISRA 1JN2P 4YG6A 1HQLA 3ZSLA 5H9RA 4PQ9A 2P3IA 1CIWA 3SH3A 3PMEA 3APBA 4WV8A 2ZHMA 1IOAA 2EF6A 4OZXA 3RRDA 1WD3A 3R05A 3T1MA 3ZXEA 2A6VA 2CWMA 4P9YA 5GM0A 3WVJA 2DU1A 2PHFA 1SCSA 1ZM1A 4CZSA 2VW2A 2R1BA 1QGLA 3INAA 3POYA 1FNZA 4Y26A 1SLCA 2DUOA 3D5OA 4XBQA 4ASMB 2WT2A 4ITCA 2VW1A 1Q8QA 3JUUA 2XB6C 2DVFA 4RL7A 4Y1ZA 1S0DA 2D3PA 1MS4A 2WLQA 3D6EA 3B9CA 2ZGUA 2DU0A 5DZEA 2E7TA 2P34A 2GNDA 3AK0A 2W52A 3MEPA 3AZVA 1S0IA 2ZGPA 1DQ6A 1IS6A 1LOBA 5T54A 1RINA 1G86A 1GANA 3C2UA 2ZKNA 5GJ6A 1HQWA 1VLNA 1WW6A 1DYKA 3O0VA 4YGCA 1LHWA 1VALA 2ZGQA 3SITA 1LESA 1V6LA 4FPLA 4FPGA 4W65A 1QOSA 2P3JA 2NM1A 2ZMKA 4YG3A 2NYYA 3WV6A 5GZEA 1VAMA 4Q8KA 1KRIA 4AWDA 2NZ9A 2DVAA 3POWA 2ZGTA 2EALA 3O0XA 4YZ1A 4M3CE 3PVNA 4R9CA 4WVVA 2ZGOA 2NN8A 2A7AA 4XIKA 2V73A 4BQ1A 1SLIA 3FUQA 4P9WA 1D2SA 1DZQA 1N1YA 1UAIA 1WCSA 1LOAA 1LOEA 2A5ZA 2OVUA 4UW3A 3SISA 4AGRA 1LENA 3D4KA 1CVNA 1I3HA 1FV3A 3MPPG 1ULEA 2JE9A 5JMCA 3NV4A 2WT1A 1B09A 3AZWA 3B69A 3IM0A 1V6MA 2PHRA 1TEIA 3SLIA 4FPJA 1CR7A 2CYFA 4PF5A 1CESA 3AZXA 1FYUA 1MS3A 1FX5A 2LTNA 2ZGMA 1H9PA 2EXJA 2P37A 1CPMA 2W68A 1Q56A 2GNMA 3UJQA 2WNEA 2UU8A 1JYCA 2A70A 1F9KA 3AP7A 4DRRA 1QMJA 1GV9A 1G9AA 2V5YA 1UN1A 5T55A 1UPSA 4Y24A 1DLLA 1F5FA 4DQAA 4LBJA 4ZKTB 1HDKA 1X50A 3AYEA 4FPCA 4LBQA 2GN7A 1FATA 1SLLA 4R9AA 4GWMA 4Z8BA 5DZGA 1VAVA 3FUOA 4ATFA 1WBLA 3M3CA 1LTEA 4Q1PA 4RA0A 4FOVA 3OY8B 4AVVA 1JUIA 2R16A 1V6KA 3A0NA 1UX6A 1SBDA 2ZMLA 4Y20A 2XG3A 3O12A 1SFYA 4YM0A 3WG2A 4WZFA 3R4SA 3AXEA 1W6NA 1LGCA 2AENA 2DWRA 1LGNA 3AYCA 1N3PA 4P14A
chains in the Genus database with same CATH superfamily
2OQ7A 5FV3A 2VQAA 2UWBA 3OF1A 2BVBA 4FVVA 2BGOA 3TB0A 5AFEA 2VCAA 2CL2A 5FZIA 1DFQA 1AR71 4TLGA 4E9KA 3OGJA 1JZ8A 2VMFA 3RI8A 1HW5A 2CGNA 1QJY1 4RS5B 2RS32 1WUVA 1WKYA 4HLTA 3WW3A 3OPWA 1YQCA 2CDOA 4JKMA 5JZGA 1B35C 3BTYA 2A3YA 3UYJA 4Z1VA 5FMOL 3VKOA 3ENRA 2FZ2A 4NVPA 4QKBA 1W9SA 4COYA 5F9TA 1PM7A 4S2GA 4N8MA 5LW9A 3QBQA 4P02B 4DB5A 2X53S 1LRHA 5HCAA 2EAKA 1NXD1 2DCKA 4LEJA 2VXRA 3I54A 1Q43A 1U5IA 1FMD2 1W6PB 3GGLA 4W6WA 4NPMA 1O3RA 4M0HA 4JQRA 1PO11 1FOD3 5FRAA 3ZXGA 1LGBA 3E1F1 3BN6A 2C24A 3CO2A 1N1TA 3WW1A 4IV1A 3GNEA 3RMXA 3VZKA 3MLLA 3UKTA 5F8PA 5A6XA 3EJKA 1AJKA 3VBOA 4BM8A 5L7OC 3IPVB 3U11A 1H8TB 1LU2A 5FK7A 4YZ3A 4Q4W1 5BYNA 3O1PA 5CFDA 1AR82 2VH9A 3GBFA 3ORJA 1QHDA 1W2TA 1WBFA 1IGOA 3MYXA 4BQWA 5BUVA 4CDWA 2VZ3A 1VMJA 4QPIC 5K4LA 1J3QA 1S0BA 5LBCA 1PZ9A 1K5MB 4F83A 1AR73 2D6NA 4YM2A 4TZDA 2E26A 2KM2A 2A71A 4OMDA 2MNGA 1QJY3 3WDWA 3FHIB 4Y3OA 4A7YA 1MVEA 4RYDA 4Y1YA 1JBCA 1OMIA 5K0UA 3QD6A 3RG0A 5HXMA 2D6OX 4Q4X1 3WP5A 1HX6A 2RMU2 5BNPB 2WO3A 1BQPA 2ZCWA 4SLIA 5A32B 5T5LA 5D21A 4EYUA 5LK7B 4E4HA 1O59A 3PUAA 2YPDA 4QX5A 4RR3A 3UJOA 4C1WA 1RC6A 4M01A 3EO6A 4OLLA 1U0AA 2QJVA 5AFBA 3N35A 5L9VA 1RUG2 3AVRA 4ZS3A 3D0JA 5GLWA 2W3JA 3GXUA 1PO13 4XMIA 4FAGA 3E6CC 5CVRA 5JSPA 2ZGKA 5F2SA 2D40A 1O6UA 4F8AA 2LALA 5EYXA 5DG2A 2JXAA 3H1WA 5LA9A 2YUEA 1TE1B 2W92A 5EP9A 4OMCA 4Q4W3 4CVUA 1GU3A 1DGRN 2A3WA 5DXDA 1HN0A 2E33A 3AJYA 5FPXA 1Y7BA 4B3NA 5J37A 5BY5A 1QKQA 3OEBA 3OGGA 1QH6A 4TSVA 1ZRFA 2QQJA 3T4HB 3R6SA 1ND3B 3DYPA 3KV9A 4XTMA 4NIDA 2GU9A 2VCBA 2Q5TA 4JHZA 2VG9A 4EN6B 3N9PA 4IEWA 2WJSA 4YGBA 4Q5OA 1DGLA 1XNBA 4NIAA 3LQCA 3T0DA 3RYKA 3OGSA 1EP0A 4CEWC 1GOHA 4L8QA 4JCKA 4Q4X3 1D0GA 4FPYA 1QDCA 4MGQA 2D43A 4NPLA 5JCTA 4OHWA 5A7SA 3RZGA 2P3YA 3ACLA 4XEZA 1BLZA 1U12A 5F3IA 2W9XA 5CA6A 1UZVA 3KCXA 1XXNA 4JDMA 5JMOA 4Q0UA 5FWJA 1ZZ9A 1UZ0A 1DU3D 2JDAA 3V0BA 3JD71 4ZY9A 4UF0A 5A6QA 3U37A 3RSJA 2VCMA 4LK7A 3LDBA 4AGVA 4CCMA 1CGPA 1FPN2 1UZWA 3VL9A 5FPUA 5CG9A 1B35A 2E32A 3ZVXA 3N7LA 2CNAA 3WCRA 3JXSA 4YGEA 2FDGA 4LXLA 1F2NA 1KQRA 1Z7S2 1ZRIA 2DUPA 2R0FA 4RHV2 3RI9A 1BK1A 3SH5A 1BBT1 1WLDA 5FUPA 4W8JA 5DZFA 2SBAA 2BJSA 1J3PA 5FZBA 4WVWA 4CU8A 4Z8BA 2W46A 1Y4WA 4RFT0 4XQDA 5CKNA 4BMEA 1AYM2 3IWZA 2B39A 3S30A 4WVMB 5C8CB 1W03A 2FDKA 4UFJA 4XXAA 1XNTA 4H2AA 2WNUC 4LBNA 4W50A 4MGSA 3TOJA 2PELA 5L7OA 1V00A 4E8DA 3I2IA 4LBMA 3LIGA 1X8EA 5FPZA 1O3QA 3O1VA 1MQTC 1S0GA 2D6LX 3CZJA 2ZBJA 3IT8A 4QPIA 4BH9A 1JZ4A 1LULA 2R041 3JD73 4MO3M 2VMHA 3DN7A 2OA2A 3J8F2 4HVRA 4N43C 5DDJ1 5I93A 1GOFA 4OVEA 4CP9A 1W2NA 4D69A 3X29B 4QGLA 1NA1B 1LU1A 3IKWA 3M3EA 4IE0A 3UGFA 1ULGA 1GNZA 1W99A 4IQPA 4QU2A 4ATEA 2DYCA 2JDUA 1KDMA 4JX0A 4Z82A 4PI2A 3NL1A 4CEYB 2WLPA 4UW6A 5EIYB 2A6XA 1RUH1 3WG1A 5ABJC 2D3SA 5TSWA 1RGSA 2RJ2A 2W1UA 1GFF2 1OF4A 4QX0A 2E6VA 3MHZA 3WDXA 2HEWF 1E5HA 1PZ7A 2AH2A 4HKOA 4R4ZA 2HWE2 3SXWA 1QXPA 1UMHA 3CQOA 1POV1 4AVCA 5H9QA 3WW2A 2Y6HA 5FUIA 4QM9A 5T52A 3ZXAC 3CKHA 1WA6X 4OUEA 4FTEA 4JAAA 5T5JA 4D6RA 2BOJA 2ZHLA 4JKKA 3LSDA 3LEMA 2WQ4A 3QCWA 3VBSB 5BNOB 1RUD1 2ILMA 1H6YA 2VTXJ 4HN0A 4BIFA 1JH5A 3AX4A 2V4AA 4QX7A 3U75A 1YO8A 1BXHA 4A3XA 2R043 1CAUB 3B93A 3UV9A 1YEWA 5DDJ3 1UU6A 1MACA 1VBC3 2DCZA 3IDBB 2WZPP 2E63A 3ZMNA 3T2QA 4Y4YA 5IVCA 4OHZA 1FV2A 4QDRA 1H1MA 4M4RA 4XQ4A 1YLLA 2PHWA 4CEWA 2GP3A 2TUNA 1EPZA 3D82A 5A1AA 2JG8B 3W59A 1ZBA2 1W04A 4KWUA 3VN4A 1PO22 3T0BA 5A7OA 1CWPA 1RUH3 4AVTA 2ARBA 1U5ZA 3IZOA 1VBA2 1AUYA 1F4HA 4CCKA 2DURA 4P00B 1LHUA 4WM8C 1MPXA 4XDPA 1UL9A 2ET7A 1HN1A 3BOPA 2ATFA 4PBOA 4K20A 2UYBA 4MXVA 3MW4A 4LBLA 1N1VA 3T2TA 1POV3 2Y0OA 1Z0HA 1EUTA 4G3YC 5FQ0A 2A6WA 3KCCA 3AKSA 3ACIA 2CTVA 3E6DA 3HAGA 5A3WA 5F5CA 1RHI1 3OBTA 3VHOA 1LODA 1KITA 1ZZ6A 2P6HA 1OKQA 4D7TA 3I2HA 4FSJA 4KWJA 4J6GA 3MLKA 3POEA 1MZ5A 3PVEA 5LRSA 1RUD3 1UQXA 4ZU5A 1OVSA 2C9KA 5EYYA 1SBEA 4AL9A 3ZXLA 4AHZA 5DMYA 2RM23 3I4IA 1AR92 2ZHKA 2Y60A 1KDKA 2WO7A 3VKFC 2NPIA 2G9GA 1SHWB 2C26A 1JZ2A 2GC0A 5ANQA 4AFMA 1UZZA 4GKXA 2V5DA 2WNUA 5A33A 4X8NA 4KBBA 2PLV2 2RDNA 2BRTA 2ZA9A 3WQ0A 3DV8A 2Z79A 5FMCA 3M3QA 1OHFA 3WHUA 3L9JT 4DUWA 1F8VA 4MXWA 3N7MA 5CYYA 1SLBA 3H8UA 5FK8A 1QWRA 3H0OA 4LLOA 3KM5A 4YW1A 1ZYBA 1MQTA 5LCWL 1MS9A 4B8EA 5FMBA 3V64A 1KJLA 2ORZA 4N43A 1SPPB 4DEQA 1XOYA 3VUOA 1OFSA 2RJKA 3CIHA 1RHI3 1VB2A 4WZCA 3AVSA 3Q9OA 3MIFA 4AF9A 4E2SA 1HXS1 4CUAA 1VMHA 4R9DA 4XZPA 1HV0A 3PUSA 4LITA 3AP5A 4IEQA 5DAWA 2XUEA 1MVQA 1Q8VA 5DAVA 5ABJA 1I9RA 2RDSA 3DUIA 3E5QA 3LF7A 4B1MA 4LIVA 4OUSA 3USUB 1YNAA 2CGOA 2AYHA 1XB9A 2ORXA 1LJ7A 4NE9A 3U14A 1GQGA 2ZJCA 3OPZA 4OI2A 4LA2A 2ZMNA 2XMLA 4KU7A 5EQUA 1A3KA 3VBFC 3I7DA 3GYDA 4IEOA 1BVVA 3KGZA 5FYTA 4A2UA 3ZXJA 3PTYA 4Q1RA 3WP4A 2ZGSA 4ZPIA 4A4AA 2GMPA 1GZWA 1S2BA 1YQ2A 3J4UH 1HJGA 2DBIA 3I2FA 5IJRA 3VDDC 3RWKX 2VOKA 1WGPA 5I0UA 1S2EA 1RUJ2 4DXTA 1W0OA 4XXPA 4K3UA 2Q4SA 4AXOA 3CU7A 3QACA 3ZN4A 1YFXA 5L9RA 2L9LA 3ECQA 1H8VA 1PNFA 4OULA 4R8HA 3AMQA 4FOYA 4YFWA 4DUVA 1QJY2 2AZ5A 1XBFA 4PI0A 4RN5A 5FZKA 5HPOA 2JEMA 4R9BA 2FD8A 4PCRA 3RGBA 3LEGA 1D4M1 1W6OB 1DZTA 2JDKA 1SLAA 4PJYA 4HONA 4XF9A 5FOBB 4JDOA 3WQBA 1O5LA 2JDPA 3AXDA 5EHDA 1HXS3 4CP2A 1HQLA 5FCCA 5FZ4A 2QFEA 3PMEA 3WINE 4WV8A 3S5AA 3LOBA 5M0TA 1IOAA 5FBJA 1PVC2 3MICA 2AC1A 2OPKA 1W0NA 1KS5A 3T1MA 1PO12 4AK3A 1TVGA 4WM8A 2CWMA 4HFSA 2HWF1 4XFCA 4AVBA 1PIV3 2R062 2DU1A 5A3NA 2PHFA 3RVHA 4D6QA 4FTBA 2GP5A 4LORA 2W94A 3U78A 1QGLA 4HK8A 3POYA 4BYYA 1SLCA 3R0RA 4X6QB 5IATA 4ASMB 2WT2A 4QPYA 4Q4W2 2VW1A 2VOTA 4EWAA 1JYTA 4XFHA 5F3GA 4CXXA 4S2DA 1OSGA 2VNVA 3JUUA 1SMVA 2ZX3A 3ZO0B 4QQOA 3OEAA 1OT5A 1OLRA 2DU0A 4P9JA 2F4LA 1QXJA 4F3JA 3AMHA 5HBAA 1OOPC 2IFWA 4JGZC 1O5UA 1DQ6A 5FYYA 1NKGA 2B9UA 1GANA 2VR4A 2V72A 1W8OA 5D2AA 1U5XA 1RUE3 1VLNA 3K75B 1BMV2 1JUHA 4YGCA 4Q4X2 4XFGA 5BXXA 4I3GA 2XDVA 4NROA 4FPLA 2P3JA 3SCGA 3KD4A 4EE2A 3WV6A 2NYYA 5GZEA 3WP6A 4NHYA 4QMAA 4Q8KA 3IIIA 4AEKA 2NZ9A 2DVAA 3POWA 3OGVA 3HBKA 1E5IA 4YZ1A 4GB31 4R9CA 2HWF3 3PVNA 2RJLA 1ND2C 4L92A 2WZR1 4YW6A 2X09A 2WINB 3MV11 4XIKA 3POGA 5EZWA 2H6CA 2XHKA 5EJ1B 1D2SA 2BBVA 2LROA 3B9IA 1FT9A 2G19A 4IW3A 1NE6A 1ODNA 4NIIA 4Q4Y2 1I3HA 3J9SA 4HN1A 1ULEA 5JMCA 2PHLA 4XAEA 3IMMA 4A3ZA 3VD4A 1V6MA 2OIIA 3BPSA 3SLIA 4FPJA 4O7XA 1CESA 3C7GA 1BEV1 5FY1A 3HQUA 2BP6A 4OCTA 1GWLA 2VQTA 1H9PA 2P37A 2XGXA 3THTA 3ZOIA 1YJKA 4MZUA 3JB4C 2WNEA 3ZYGA 2UU8A 2BW8A 3B7MA 1F9KA 3VBFA 1SFNA 4XZUG 1NCRC 5FO7B 4MOAA 2J1UA 1R093 4N53B 1F4AA 1VMFA 4NAMA 2B5HA 4AEDC 1UY1A 4LKDA 3VDDA 2ZEYA 4EV0A 3EXUA 1X50A 4FPCA 2XUMA 4PIXA 4LT5A 1SLLA 2VMGA 2WS92 3DL3A 3A23A 4GB33 4JRLA 3JD72 1OI6A 1ZZCA 4Q0PA 1VAVA 3NJXA 4JKLA 2WZR3 4C90A 3IIAA 2WWUA 4GJYA 3KT1A 1LTEA 4P9LA 4X8PA 4FOVA 4AVVA 4IGQA 4Q4V1 2ZMLA 3W20A 4CCNA 2Y6FA 4QB2A 3ZFFB 1SFYA 5JSOA 1W8WA 2BGCA 3JBG2 3VBRB 3WG2A 2BV4A 4OHVA 4PHZA 2V09A 3ES4A 4Y4RA 4CXYA 2PYTA 1NZCA 3RZKA 2AENA 4D8MA 2B46X 1YFYA 3H7JA 4P14A 3TEZA 5F1RA 1BEV3 3NMBA 3I3EA 4FXKB 1DCSA 5DUXA 5IUQA 4QXCA 1OQ1A 2G4IA 5FZHA 4F7ZA 1PMJX 2IVIB 2YC2A 1UYXA 2WYSA 1GP4A 1QJFA 3SEEA 1A8MA 1ZX5A 5I0TA 2WAAA 1J3RA 5E88A 2E7QA 4RGKA 3O1RA 1PGW1 5JR2A 4Z07A 3GJBA 1UOJA 1OH3A 1YFUA 2D93A 3KQRA 4QX2A 2ARAA 4IEZA 3WEZA 2WZEA 2FCUA 1ENRA 5JZGB 1QY4A 3AYAA 3AZYA 2JIJA 3QH6A 3SKVA 1OOPA 4DFSA 1WZXA 4CP0A 4JGZA 3L2YA 5DDJ2 1CD3G 5GLVA 3LIHA 1VBC2 2K2SA 5GALA 1RMU1 1LR5A 2VBBA 4Q4V3 5I91A 2PAMA 2ZAAA 4J25A 4YWAA 4HVQA 1PGSA 4FPFA 3NAPB 4KH9A 4QPGC 2ZEZA 1S4CA 4O9EA 3WG3A 3ROUA 2WL1A 4DNYA 3NKTA 3N36A 4IV1B 3UKNA 1RB8G 5FZFA 3U1XA 4IEYA 3AL5A 1NY71 3VBOB 1V6JA 4L99A 4ZXEA 1OF3A 5T50A 4K6BA 1ND2A 3I2OA 4XVHA 4CDWB 1M4WA 2VE1A 5FMDA 3K4DA 1A78A 2HWD2 4B4PA 2XPJA 1MEC1 1GQPA 3K4ZA 4Q0SA 4IV3C 1HRI1 2EXHA 3GBGA 3H7YA 1JZ3A 4BA6A 4BISA 1UY4A 2B42B 4MVTA 1JOJA 1XYNA 2AEYA 1CPNA 2H0VA 2KXLA 1RVF2 3P5BA 2KD7A 5LZ6A 3MF9A 2RM22 2QKDA 3UETA 1GLHA 1AX0A 5JXJA 3MIHA 4AEJA 1QJX1 1RMU3 2VY0A 3WF1A 1LEDA 2D5HA 3UKVA 5BNNC 2ZX2A 1RL3A 4QPWA 2HBUA 1NCRA 1XNDA 4A42A 1E57A 4OFGA 1N1SA 2ERFA 3OBAA 1BKZA 1JI6A 3PL0A 4Y1VA 3NV2A 3H8XA 2LUWA 3ME2A 2XJPA 4AEDA 1WW5A 3NJZA 2TEPA 5A80A 4BIOA 2GC2A 3T08A 1ULOA 2BGPA 5C3RA 3ZDVA 4CRQA 2WDBA 2D6MA 1RXFA 5FYBA 4XJAA 4ES9A 4XF3A 4IGOA 2VUCA 2XHNA 3BIWE 5F39A 4ZXKA 1AF9A 4CDUB 2CDPA 2QE3A 2W1WA 2Z69A 2WWJA 3UL2A 5LA0A 2CHHA 2A1XA 2K9ZA 5HCBA 5LASA 5IAVA 3GZUC 1DIWA 2WQ8A 2LRPA 1RHI2 1V9U1 2R1DA 4NWVA 5T3NA 3MF6A 1JU4A 2OUJA 4BU2A 4FPEA 4E4DX 1HRI3 3ZFGB 2BERA 1CZSA 4KGGA 3HJRA 5IVVA 3ZMOA 2Y6JA 2YU1A 5JSRA 2E53A 2XWJB 3T2OA 4BQ2A 2DFCA 1W90A 3HN1A 3VD7A 2JKXA 2R6QA 4YW2A 1JMUB 3PIJA 5C71A 4K8FA 2Y26A 3S0MA 5DAQA 3I2JA 1MS5A 1XNKA 3VBHC 3T0AA 1F31A 3TEXA 1QJX3 3WW4A 5JXIA 4RSUA 1YCIA 4PLOA 2R49A 1COV1 4IEPA 4OHYA 1RXGA 4BJ0A 5FP4A 2K46A 3WUDA 5LBBA 4LBQB 4UF0B 1CAXA 4WM7B 3GZTB 3NVCA 4QDSA 4GALA 1H4GA 3WQ7A 2FHRA 3NV3A 1JYVA 4NIHA 3O7OA 1B35B 4N9IA 4QXBA 5B2GB 1H2MA 2ARXA 4CU6A 1AVBA 1JU3A 1E5SA 4QB6A 2Q8OA 4GXLA 3LPGA 3MGUA 2VMDA 3VBUB 1UXXX 3D0SA 4DXSA 1V9U3 5LATA 4WBBA 1JOPA 5A6ZA 5B4NA 1HXS2 1US3A 4QPGA 2AACA 4C0BA 1PZ8A 4MYEA 4D94A 3LA7A 3V0AA 5FZ9A 1XYOA 1DHKB 1DG6A 4FBFA 1NLQA 2IC1A 3FJSA 2I2SA 1N3OA 1ASJ1 2RR11 2DVBA 2H6BA 3WDUA 1JXNA 4OI1A 5DG1A 1PIV2 2PMWB 2VZPA 4IEXA 5FXWA 1NQDA 2WQZC 1XSRA 3HMYA 3NNJA 4I30A 1COV3 2CAVA 3M2MA 1ENSA 4QPIB 1BK0A 1Q8SA 2P17A 5KXDA 5KXBA 2G1MA 2KR2A 4NRQA 3FBMA 2DTYA 1W8TA 4IV3A 4NHXA 3AMPA 3TN92 2X5IC 1X8MA 1WCUA 4AQTA 2ZGNA 4BOWA 5C8WA 4UFMA 1F15A 1MZEA 2QQLA 4UI9L 4AI3A 5FY4A 3Q8BA 1HLCA 3WR0A 4AOCA 3S6PA 3C7EA 2VZOA 3BTXA 3KMHA 4HSLA 5A3TA 3MFAA 1S1AA 4UFHA 5KC6A 3FLPA 2P6CA 1CJPA 4Q2FA 1DLCA 4LHSA 3PMSA 2DVGA 2Q8EA 3S7EA 5C3SA 1RUE2 4D3WA 1W28A 3RS6A 4UFKA 2X05A 5BNNA 4BE3A 3ACHA 5E89A 1D7PM 4KU8A 2RS12 4HK9A 4RS5C 2BNOA 2PAEA 4PT6A 4ASLA 4BCUA 1PGL1 1JYIA 3OUJA 4RGGA 4NJ4A 3HEIA 2HEVF 3RJRA 5T5PA 3ATGA 4AQSA 4COVA 1N3QA 2RR13 5JAXA 2CY6A 1CJDA 1Q5OA 2HWF2 1AYN2 2JDZA 1IS3A 4EN0A 3IMNA 5IVEA 3JQXA 3FLTA 3CMGA 1TNRA 1CONA 2JIGA 2QNKA 1RUI1 2RVAA 1WLCA 4L2NA 5FYUA 3LDRA 4LMFA 2ETEA 2XLGA 1IKPA 1BYHA 5JR7B 3GF6A 4TTGA 3O5SA 5FY5A 3LWCA 2JDHA 1M06G 5IFPA 5H9PA 1HB2A 3T4VA 1AJOA 4B29A 1YI7A 1UY3A 3GZAA 1YHFA 4K8RB 2FMDA 1OPOA 4KQ7A 5G04L 3ZXDA 2NMOA 3ZXKA 4CEWB 2PQQA 3RZJA 2P4EA 2ZACA 3HN3A 4GH4B 4B7EA 1ZRDA 3M7AA 3DXTA 4HVOA 3AKRA 3VBHA 1NZIA 3IDEA 5LEKA 2QQOA 1IKQA 1C8NA 1D0HA 2BZDA 2WKKA 1K5MC 1J83A 1SCRA 1W05A 1ONAA 1R092 4CE8A 3PVOA 1VBB1 1ZBE1 2GNBA 3DXUA 1W8UA 5FQ0B 4AGGA 4XTPA 5C9AB 5BNPC 2OZJA 2UWAA 4HOOA 4PIZA 4GB32 1L3JA 3LPFA 4XJUA 2WZR2 4A6SA 5KWRA 4QB1A 4B1LA 2X29A 1RUI3 3ALQA 5HV0A 1DQ5A 4Q26A 2FMYA 3AFKA 2BU9A 4XHXA 5LY2A 1X36A 1YIFA 5IK8A 4FTSA 2WNVB 1O4ZA 3ZKYA 1WMFA 5LA1A 2ZPXA 5IK5A 2FCVA 5JUVA 2WO2A 2WNUB 1BEV2 1O4YA 2MPFA 2XL7A 3MFCA 3PTRB 5A33B 4YZ4A 1C1FA 4S2FA 5A7WB 1V6NA 1RYYA 2BFUL 4MXWB 1UY2A 2NLRA 4QQ2A 5J09A 1ODMA 5FXVA 1MQTB 3E5XA 3AM2A 5FO8B 5FZEA 1ZBE3 1JHNA 1VBB3 5EV7A 3WNXA 1GZTA 4HMZA 3VKNA 4AFAA 5FDBA 1SG3A 4N43B 4W6YA 4O61A 1XQNA 2X5IA 1KEXA 4QT6A 1CZTA 1VP6A 3ZDSA 4OQ8A 2ZABA 3TEWA 4CCLA 1S0CA 3ZFEC 1DYPA 4MGZE 3MV01 1EV11 2JDYA 1O7FA 4FT8A 4DPNA 5A7NA 2D98A 1AL21 1AX1A 5EXOA 5FYVA 4K40A 4RGAA 5A3OA 3EBRA 3BI3A 1WCKA 4LBOA 3DYMA 5ABJB 5J7MA 2A73B 2OS2A 3ILFA 1H1IA 4YVSB 2TBVA 1POQA 2IFRA 3MIEA 4RS5A 5IVBA 2E7AA 4NN0A 1UOBA 1GBGA 3OBRA 4CDQB 2X8KA 4M3CF 3HT1A 1DGWX 3MIGA 2B45X 3LEKA 1YYNA 4QQHA 4XCBA 3AMMA 1HRV1 4YZ2A 2WN2A 3O1SA 3H8RA 2RV9A 4N90A 1Y43B 3WDVA 1BBT3 2BYVE 2VW0A 5J48A 5FY8A 1EAH1 2DCTA 2XBO2 2BNNA 3MO4A 5I8YA 1W6PA 2PHUA 3K3OA 3OSDA 4I0BA 2F17A 1HB4A 1DQ1A 4H7MA 5FLIA 1S0EA 4AFBA 4ET7A 4EWEA 1PGW2 2C1FA 2WNOA 2YC0A 1JN2P 4ISRA 3ZYHA 1TMF1 1GUIA 2VOWA 5H9RA 3M4FA 2P3IA 2XH6A 3SH3A 3WT3A 5BNQA 2FBEA 4LE3A 1GMMA 5E16A 3KVBA 2EF6A 1YI9A 2R072 1EV13 3TEYA 3PU3A 5C6CA 1XC6A 3CLPA 2A6VA 4BHPA 2VXJA 2HWB1 1AL23 5GM0A 3PVBB 3UGHA 4B7KA 4BXSV 1FXZA 4CZSA 1K5MA 1CZVA 4AQ2A 3I49A 3A22A 5FP3A 3KT4A 1FNZA 1QXRA 4Y26A 4WM8B 4CA9A 1C8M1 1SDWA 1J58A 2YDEA 4HPKA 1JOBA 1Q8QA 1PX3A 3EYPA 4RL7A 4TN7A 3ZYIB 1HRV3 1MS4A 2N7GA 2ZX0A 4A41A 5DZEA 5BNPA 5FR3A 4LE4A 2ZAHA 4CEYC 4V2WA 3AZVA 1S0IA 1EAH3 1UIKA 2WA4A 4ZS2A 1C28A 2W5FA 4JTNA 1WLTA 2UYAA 2EIEA 2GAUA 4UBHA 5DAPA 1O8PA 3C2UA 1VBE1 4C91A 1WW6A 1QH7A 1DYKA 4GWIA 3VLBB 1PMIA 1LHWA 2P1BA 1HRI2 4UYBA 5FLHA 1LESA 4W65A 1TMF3 1QOSA 2ZMKA 4XF1A 5F7UA 1VAMA 5APAA 1Y3TA 4I0AA 1KRIA 1UXZA 3ITQA 4QGMA 1HIXA 1NCQC 3THPA 4M3CE 4WVVA 3VBSC 4YARA 2VQUA 3OB8A 4NR1A 4QAWA 1QJX2 4QKDA 1REEA 2NN8A 2A7AA 4JQTA 2DDUA 1SLIA 4P9WA 1DZQA 1N1YA 1WCSA 2A5ZA 4L97A 1LOEA 3I3QA 3O14A 3SISA 1OKOA 1LENA 3OUHA 3MZHA 2C0ZA 4Q29A 1PMHX 2JG9B 5A3UA 1FV3A 1W9WA 1TME2 2W87A 3JB8A 2QQIA 2XR4A 3NV4A 2IXHA 2WT1A 1O4TA 3CF6E 5BV6A 2ZX1A 1KD7A 4NRPA 4PF5A 5F37A 3ZFEA 5A7PA 1IQDC 3C3VA 5LEJA 2XJVA 2W95A 3PLQA 1OC1A 4COZA 4EQVA 5FMOS 5I0DA 2W68A 4O9GA 1CPMA 1Q56A 1RUC1 4GQ7A 5D1IA 1NAEA 1VBE3 2BNMA 4IL7A 1CX4A 3AP7A 4DRRA 5HV4A 2G9FA 3MDPA 5CISA 3KF5A 5CFCB 4QQLA 1UN1A 3RZZA 1UPSA 4Y24A 3DPRC 2BVVA 3ZIXA 2YYOA 2J42A 1QQP1 3AYEA 3NRUA 2VCCA 1HB3A 3LFIA 3KV6A 3O1MA 5J1XA 4GWMA 4IETA 1ZREA 2YFUA 2GC3A 1WBLA 5F3EA 1BCXA 5BPXA 3OY8B 4N7IA 1KXGA 1KFUL 5A1LA 1JUIA 2R16A 5C5UA 3N9MA 1FOD2 5FY7A 2XG3A 1O3SA 1YWKA 4DMIA 4YM0A 3HVDA 4WVMA 4WZFA 3R4SA 5C5TA 3AXEA 2GZWA 4ASKA 4UOJA 4IERA 1LGNA 3AYCA 4XUNA 5FOJB 4XFFA 4YNIA 3TAYA 1X7NA 5CB7A 4FP3A 1RUC3 2JJ6A 2JDNA 1OUXA 4CDXB 2YV8A 4MLOA 4QKFA 1AR72 2VTFA 5H9SA 4AVSA 2ES3A 4TWTA 4N9HA 1A6CA 2WT0A 5JWPA 4YW3A 5KR7A 1IPJA 4Y22B 1AX2A 5GZCA 1FMD1 1KFXL 1QQP3 2VZTA 4BK5A 3WXPA 4TYSA 1SBFA 4JRAA 1OFNA 3WZ1A 4M00A 5IK7A 2DTWA 5C3QA 1WMEA 5F3CA 1UU4A 4ZU4A 3WDYA 2DVDA 3LD8A 3LZZA 3IN9A 5GZDA 2ZEXA 2X10A 3I2GA 5FZCA 1G8WA 2TNFA 4LO6B 3VKLA 4K21A 1OOPB 3ZYFA 4JGZB 3ASIA 5FREA 1ULCA 4ZZ8A 2HYXA 5FZOA 4QXHA 1VRH1 3RYRA 5F5AA 2WBKA 4MHUA 3K48A 4SBVA 4W6XA 3BU7A 2EVXA 5F32A 2JD4A 3OD0A 4K1ZA 2XQRA 1NCQA 2IWGB 1FI2A 2W1SA 4HXCA 3VBSA 4H7LA 2AEZA 3AJZA 5GLZA 1EUUA 4MUVA 4H55A 4KNCA 4EZHA 5D8AB 4BQ5A 2PN5A 5DPNA 3WF2A 4U2AA 2VBPA 4ARYA 1CAUA 3NJYA 1W06A 4HBNA 2C4XA 2MEV1 4LBKA 4UAPA 4YM3A 4RQPC 1VR3A 5JPNB 3ZSKA 3N7KA 1D4M3 2GDFA 5FZ0A 4YVWB 1QEXA 3VZNA 3ZLIA 4CCDA 2EIDA 3FX3A 1FMD3 2RS51 3SCHA 4YW5A 4FP2A 3J7LA 4PLNA 1URXA 3IAPA 2QZ3A 3H1YA 3MUY1 4RD7A 2XJUA 5GKAC 1YFWA 1LHVA 4HANA 4XCAA 1D2QA 4Y5Z0 1UD1A 4PBPA 3A7QA 2AUYA 3DGTA 5J96B 5JOZA 4GWNA 1Z78A 1QF3A 2P5BA 5DUWA 2QQMA 5FFOC 2JDMA 4C8DA 3S57A 1VBD1 4IE7A 3T2PA 4FXGB 3MUZ1 5EFUA 5LB6A 3T1LA 5LY1A 5CKMA 4XIOA 1QOTA 2YU2A 2HYKA 2BWCA 5FPAA 5JLVA 1VRH3 1GP5A 3DPRA 1UO9A 4YG0A 4QXKA 5FZAA 4ARXA 4YFZA 4JGYC 1U5YA 2FDHA 2OPWA 3EMRA 1X33A 1IPSA 1VE0A 4IESA 2VM9A 4M0NA 1NX9A 4LUKA 5FAXA 3DCQA 1DGWA 3W5NA 5C4WB 4J1WA 3VZJA 3AKPA 3BODA 2MEV3 1ZBE2 2HJIA 3ILNA 1AXYA 4DEVA 2Y6GA 3I2KA 4LO8A 3UK9A 1ALYA 2CV6A 1ZZBA 2RS53 3H3ZA 5I0SA 2BWAA 4XFIA 5JVVA 4XUTA 1HJFA 3ZKUA 2WRAA 2ENRA 4AI0A 2OX0A 1O3TA 3FLRA 3PUIA 4PDWB 1HB1A 4QDQA 3AMNA 2XXZA 3BYWA 2R32A 4LIUA 2YGMA 3B00A 3WOGA 5IVYA 4QWNA 1FPN1 1CAVA 1L7RA 2JE8A 1AR61 3B01A 1BJQA 2G9ZA 1VBD3 2XKOA 3ELNA 4IE6A 5FTTC 4FPOB 3C7HA 1OLQA 2QCSB 2WWSA 2VMIA 1G7YA 3I97A 4XAAA 2VUAA 1SPPA 3OBZA 4RHV1 1AXZA 2O14A 1PHMA 3NQHA 1AXKA 4Y1UA 3ZYPA 4CUGA 2P3KA 1JTZX 2QQNA 3ACGA 4YM1A 2VOXA 3BPZA 3ZSMA 4XC9A 4XJ8A 5GZFA 1T2XA 2YXSA 4C0HA 1BBT2 4KG0A 3DEMA 4XACA 1W3XA 3AZZA 3QLQA 4L0PA 1E5RA 4Y20B 4Y1XA 4Y5TA 4HG6B 1PK6B 4XHBA 5FZGA 4XUOA 4YW4A 2XJRA 1C57A 5FP9A 5JI7A 2GN3A 1W6NB 3ZYRA 3USUA 3ZSJA 3FBYA 4AI9A 2YPJA 3HD8B 4I3PA 2RDRA 4KI5M 2H0BA 3H42B 3MBWA 2XVKA 3KQ4B 5A3MA 2JECA 4AFDA 1NXMA 4N53C 4CU7A 3AB0A 2E51A 2W1QA 3J8F1 4QPGB 4A7ZA 3V0AB 4XPVA 1AL22 2C9AA 2D44A 5A3LA 5HI0A 3WY6A 2VL4A 3E5UA 1FPN3 4XUQA 1AR63 4HL0A 4INDA 4M3CA 4UXAA 2R042 2ARCA 2QQUA 2W0XA 2W2IA 2VZQA 1YRZA 3TWIA 1G9CA 2NQYA 1H6XA 1GOGA 4RQPA 1OQEA 5LBFA 1W6OA 3WNKA 5FO9B 3N4MA 5F6LB 2IXJA 3POSA 1HRV2 3ZFFC 2VZUA 5FIXA 3RPQA 3VBRC 2DV9A 3OYWA 4QHBA 2EXIA 4OI0A 1G9FA 1R081 1XE8A 4UWDA 1UKGA 5FLJA 5KC5A 1EAH2 1NT0A 4AI8A 3LDKA 1RUH2 2CU5A 4E4SA 1W3VA 2Q1ZB 4IEVA 4LPLA 4DS0A 3J7MA 5J3UA 2VAUA 2IXIA 2VNGA 5KHHA 1O8SA 5CFDB 2IXKA 1BZWA 1ZA7A 4LHNA 1ZRCA 1TMF2 2PHXA 2YC4A 4DRVA 2E9QA 1JZ7A 1LOFC 3BTZA 4PQQA 4CTEA 2JENA 4JGYA 5BNNB 2R0HA 3J8F3 3IAQA 4Y33A 3UGGA 2D6PA 2B4KA 4MGTA 4LO4B 2CGPA 1RUD2 1S55A 3I59A 4FCAA 3BB6A 1XRUA 3GM8A 5K0UB 1W0PA 1VPHA 2AREA 3LKJA 3ZX7A 4P9IA 5CIRA 3CJIC 3ON7A 2WIIB 2GNTA 4LOSA 4QKNA 5FYMA 2VZRA 4RR3B 1ST8A 3A4UA 1PO21 2XKPA 3AKTA 1VBA1 1WW7A 4XURA 4AVAA 3WQ1A 3CBNA 3SEPA 2GSYA 1VRBA 3NAPC 4YRDA 5FJHA 3GHMA 4ZZ5A 4AYUA 4CXWA 5CBLA 1Y9GA 2HWC1 3NV1A 4HSJA 1R083 2D6KA 5GLTA 4CCEA 4A6OA 4L9BA 4E2QA 2GMMA 1NG0A 3BALA 2JB4A 3J26N 3NWKA 3KHBA 1UMIA 2Y38A 1UF2C 4XJ9A 5A6YA 1UOGA 1K45A 3VDBA 2VJXA 1JW6A 2ZHNA 2WA3A 4AQ6A 1GR3A 1P8JA 3MIDA 1FAYA 3WLUA 4NUBA 5FYHA 3VBHB 3K3NA 2WSUA 2IUWA 2JB8A 4N7UA 5LBEA 2Z5WA 1TQ5A 4GULA 1MEC3 3VV1A 3HNYM 3RJ2X 2EIBA 4NIGA 5SV8A 1UZYA 3POBA 1UNBA 5KXEA 2XL9A 3NNFA 2HH9A 4BWOA 1W6MA 5FYZA 4B4RA 2VOVA 1DP0A 1ENQA 2J1RA 4GD4A 4AHXA 2QDNA 3VB9A 1RUNA 1UPIA 1W2AX 1A8DA 1QJZA 1AL0G 2WSVA 2Z42A 2DCJA 1IZ3A 1H2KA 3PHMA 5E6HA 3WNLA 4AE2A 1R64A 1Q8OA 4OZOA 5FZ1A 5FXXA 2O0OA 2OQ6A 3I8TA 4LK6A 3KHCA 1VBA3 2YY1A 4COWA 3SMHA 2F4PA 3MW2A 4N53A 2HWC3 3V0BB 5JIUA 2SLIA 2LS6A 3HQXA 4XBLA 3B94A 1RUC2 4BXFA 5DQ0A 3LCPA 4GIQA 4LULA 4IEUA 2VQ0A 3PU8A 1RJ7A 1W6QA 3AKQA 3AL6A 1QU0A 1Y9MA 4MHRA 1OPMA 4MSVA 4CDUC 3ZSEA 4HKWA 3VDAA 5IK4A 2HEYF 2W08A 1LOGA 1NOVA 2GH2A 1CAWA 3AFGA 3D8CA 1EY2A 4XFBA 4KGQA 5FPVA 3GCWA 5DN2A 3THCA 4A45A 1YC61 4BPZA 4P08A 1NLSA 3GHNA 5DAXA 1IG3A 3ZFFA 4BQXA 1CN1A 1ZVFA 3ZFGC 3VBRA 3OPTA 2VU9A 4CCCA 4E4ZA 4YZ5A 1WW4A 2WN3A 4UW5A 4O65A 5ERLA 1REDA 4CYDA 5B4XA 3SH4A 1WCDJ 3BCWA 2JWPA 3IB3A 3I3DA 1RJ8A 5L9BA 2VNRA 5L7OB 3HT2A 4FFFA 3MLJA 5CZKA 2QZ2A 1CQ9A 1L7QA 2BUKA 3DF0A 5FYIA 2Q8DA 2ADEA 4LNVA 5ACA1 1QJU1 1RUJ1 1JS9A 1OQDA 1W8NA 2IXLA 3A0KA 3HOBA 1LOFA 3WNNA 2OXBA 4AAXA 1MZ6A 4OUMA 2MHFA 3N7JA 3JCIA 3CJXA 2BQPA 3D3AA 1HQNA 2VPVA 3OOXA 4WM7C 4NRMA 1EPWA 4FFGA 5GZGA 3H8OA 3FMGA 1OD3A 3H1MA 4CP9B 1UYYA 4W4ZA 2E31A 4AW7A 3P3NA 1X82A 4BMBA 2YGLA 4GA9A 5FXZA 3WNOA 3R4UA 2Y64A 3K77A 2FDFA 4H14A 3CJIA 1S0JA 2A6ZA 3I2DA 4OQ9A 4ISQA 2VBDA 1H30A 1D4M2 3VBUC 1TZOA 1CIWA 1PVC1 3APBA 1R1A1 3NAPA 3BGAA 2ZHMA 1UWWA 5HXVA 4OZXA 2WYFA 2R061 3R05A 4IUGA 4FAHA 3HWJA 3FHQA 3ZXEA 2Y34A 3RFRA 2K0GA 3FL7A 3ACFA 4KMQA 3WVJA 4NAOA 1ASJ3 5FP7A 1SCSA 2ID4A 3H50A 2VW2A 5C3PA 2OT7A 2ZS6B 5K8SA 3C7FA 3INAA 1YIPA 5A3PA 1VJ2A 5IWFA 3CDZB 3D5OA 3ZYBA 1W9TA 5ACA3 1QJU3 1RUJ3 1VRH2 1XPWA 3C8XA 4LOTA 4Q0VA 3SQOA 4Z2WA 4AR2A 5FZ3A 2QQVA 2DVFA 2VECA 3D6EA 3KGLA 2QDRA 1WMXA 3B9CA 3P1IA 5IFTA 4EROA 3HBZA 5IW0A 2P34A 4HPKB 3MEPA 4LR4A 2I07B 4PIYA 3F2ZA 1LOBA 5T54A 1BMV1 1RINA 1H8TC 4D7SA 3ZM8A 4IGPA 1G86A 1DDLA 1OXCA 4QU1A 5FY0A 2MEV2 1CIYA 1PNGA 4GMP1 5F6KA 2Y6LA 2VO5A 4XW3A 1OUSA 4FPGA 3E97A 3FN9A 2RS52 1PVC3 2Q1MA 3W5MA 4YG3A 3RNSA 1R1A3 3S5QA 2XWBB 1W8FA 3TYJA 2R063 4MH0E 2ZGTA 3O0XA 3OTFA 5FBZA 3U07A 3URFA 3WF4A 1C3HA 2ZTNA 2ZGOA 1UYPA 4LHLA 4S2HA 3LA3A 1VBD2 2QQPA 2V73A 4BQ1A 4Q4Y1 5KXCA 4TLFA 2XJTA 2OVUA 1LOAA 4UW3A 4CDUA 3NNLA 1J1LA 1YJLA 4OYUA 5J36A 3QH7A 1OVPA 2F6BA 3ZN6A 3BOWA 3GDBA 2RG4A 5K7PA 2VVDA 2O1QA 5LRRA 4ZONA 1B09A 3B69A 3IM0A 4XF4A 4M4PA 3ZFGA 1C5HA 1TEIA 1CR7A 3PDQA 4DZGA 2ZKLA 3SCFA 3TNQA 3BUCA 1FX5A 1YQ8A 2GNMA 4CCJA 4GH4C 1GP6A 1JYCA 2A70A 4LQRA 3ZFEB 1UX7A 1QMJA 1GV9A 1NE4A 3LA2A 4GMP3 2XLAA 2V5YA 4DOUA 2Z4FA 5T55A 3KVAA 3PURA 1ND3C 1F5FA 5JXHA 4DQAA 4LBJA 4GWJA 2WS91 1UCXA 5C3OA 4LBQA 3LEIA 2OZ6A 5L36A 1OLMA 4R9AA 4WM7A 2B9VA 4XQWA 4CPBA 4BK4A 1RTVA 3FUOA 5C9AC 2ADDA 1AR62 3M3CA 3T09A 4BQ4A 4JVAA 3CZUA 1K12A 1TG7A 2B8MA 4ONUA 4Q4Y3 4NHMA 3A0NA 3JBG1 1UX6A 1SBDA 3GBWA 1Y9QA 4I09A 3C7OA 3VDCA 4Y5SA 2YFZA 4GAZA 4LUMA 3VBUA 4K7JA 4Q4V2 2OKXA 2QTWB 2Y8KA 1ZZ8A 2WAOA 4HETA 4DIQA 2WNVC 1N3PA 3VD9A 1LHOA 1YUDA 1HV1A 3EHKA 3AYDA 2PQSA 1WD4A 3KS7A 5EWSA 4CUCA 1QNYA 2ZGRA 1PVXA 1K3IA 1N47A 1SQ4A 5CKQA 3SKJE 5JOXA 1H0BA 5DUVA 1GZWB 1X9TA 2PTMA 2XLFA 1ULPA 2XONA 3UT0A 4KG8A 4V2VA 5JIAA 1LECA 3FFQA 3LB9A 3ZR5A 2QBXA 1UW8A 1V6IA 5E1RA 1RITA 4BLIA 4GMP0 1X9PA 2GMEA 2A6YA 2WS93 1RUF1 4XDQA 3RQ0A 5C8CC 1SACA 2IXCA 4MX3A 1W9YA 1VBC1 4KWKA 2YBPA 4NHKA 3WD5A 4MV2A 3G7DA 1JZ6A 2WC2A 2EXKA 1Q3EA 4QHOA 4QX8A 3IPVA 2QUOA 3JQWA 1S0FA 1H8TA 5FP8A 5I8SA 2ZXQA 2J1EA 3JBG3 4X6RB 5AC91 3AP6A 2ZEWA 2EIGA 1J84A 1SZBA 4GJZA 1RMU2 2DUQA 2WFF1 4KL1A 2VGDA 4LKSA 1PX4A 4P5HA 5HCHA 4D7YA 5GLUA 2W47A 4KWLA 4YVSC 1V0AA 4Q8LA 3H3UA 3TRSB 4BLJA 1R082 2YMZA 1XU1A 4TXWA 1SLTA 4CDQC 1K42A 3IDAA 5FZOB 2OUHA 1NA1C 4JDNA 1I5ZA 1NY72 2HWD1 2VNOA 5A32A 1YXWA 2J1VA 5LK5A 3M3OA 3OGRA 1H9WA 1NCQB 1EYBA 4IDZA 1IQAA 3R4DB 1IS4A 4IE4A 3K2OA 1GZCA 1RVF1 2YG0A 3SNMA 4DXZA 3OJBA 3AP9A 1RUF3 1MEC2 1V6OA 2EICA 2RM21 1GSLA 5KHGA 3M1HA 4AG4A 2ZGLA 5C33A 2BPA2 4BQYA 3PJQA 1UY0A 3POIA 1DQ0A 4UT5A 5IHRA 1W2OA 4LHKA 1QDOA 4DXRA 1AHSA 4URAA 4GH4A 1XNAA 4BQ3A 5AC93 5KBFA 3VD3A 3NNMA 2HWB3 3ETQA 5BNOC 1MS8A 2WFF3 5FZ6A 1GNYA 3VD5A 1UIJA 3LGRA 4XYXA 3VGIA 3CEWA 1ND3A 4P9GA 4U36A 3HNMA 2LW8A 4NO4A 3RDIA 1C8M3 3IBMA 2HWC2 2V4VA 4EZ4A 2VZ1A 5DUUA 3WNMA 3FWEA 1MS1A 3GJAA 3I3MA 3WUCA 3DPRB 3J7NA 3O1OA 4XJZA 1WMDA 5HCFA 2HWD3 3ZXFA 5C9AA 2CWSA 4I2OA 2JG8C 1SDDB 2Q8CA 2I74A 3ILRA 2PXJA 5FWEA 1C5IA 4G4FA 1JYXA 1RVF3 1W2UA 1ULDA 3PIGA 4MGKE 1H1AA 1V9U2 1ZZ7A 4J1XA 1BHGA 3W58A 1LB2A 3NJVA 2R7EB 4RFRB 3JZVA 3WHTA 5JXGA 4BB3A 2WNVA 4I02A 4A44A 1IPKA 3I3BA 3FFZA 5F2WA 3VBFB 4JTOA 5IT6A 5FUNA 2B7YA 2JKBA 3KSCA 1WWYA 4AHWA 3K46A 3RZLA 1DQ4A 3S7IA 4LO7A 1A34A 1ZA4A 3LSEA 5A7WA 4DY5A 2FDIA 1UKRA 4XMAA 3VDDB 1OD5A 3JU9A 5JDBA 1COV2 5F5QA 1CAVB 5FYSA 4FQ4A 3T3YA 2UY9A 1GWMA 3WDTA 4FQZA 5JOYA 4YGDA 3FC0A 1GQHA 2JG9C 2NMNA 3N3HA 1NYWA 2Y6KA 4XDOA 5C8CA 4H3WA 3DKQA 3DYOA 4JC1A 4XF0A 2BBAA 3B02A 1IS5A 2DBNA 2ZZJA 3LFMA 3O0WA 3N9LA 1POV0 5A1FA 5IVJA 5L19A 1TNFA 4JHTA 2RS31 3TNPB 1XNCA 5KHKA 3H3LA 1H2NA 1C1LA 5EJZB 1H2LA 2FZ1A 3BIEA 2D5FA 2PAKA 3T30A 4AHYA 1FNYA 4MG2A 2XQXA 5FPLA 3M3IA 2GC1A 4YVSA 3VHRA 5CFCC 5ISLA 1PIV1 2AR6A 3WSOA 4CDQA 3OG2A 1XE0A 4R4XA 1DQ2A 1ACCA 3M8LA 3ZR6A 2HLEA 4QD2A 1KJRA 5JPMB 2PHTA 4YLZA 5AVAA 1NA1A 1VIWB 1STMA 4FI9A 3ZN5A 1ASJ2 1RIRA 1WLWA 2RR12 4EWDA 4Q0QA 2Q1FA 5FPBA 4CEYA 3BU0A 3TN91 1LCLA 3NSTA 5ACA2 1QJU2 4YW7A 5CNAA 5F5IA 3AP4A 4M3CB 3N9QA 1W9FA 5DABA 1I6XA 2UY8A 1AR81 3PNAA 1OA4A 3K51A 3VHNA 2YZ4A 4RQPB 3VZLA 3V56A 4QX1A 1MS0A 1UMZA 1RUE1 3MPBA 3K4AA 2GALA 2VZSA 3ES1A 2RDQA 3OYWB 3Q8EA 1OA2A 2RS11 4XBNA 2RS33 2FQPA 1REFA 3KCYA 5BNOA 4MGIE 5CEHA 1LAJA 2W39A 4JV4A 3NNGA 4CDXC 4CU9A 3HR9A 3P3PA 1R1A2 2PHDA 2RMU1 2XVGA 3L2HA 4FFIA 5FKBA 5FYCA 4AZZA 4D6SA 1AYN1 4XILA 3VZOA 1ND2B 1PGL2 1AZDA 3WP3A 2BDRA 3U4XA 5L73A 4IE5A 4XETA 1RUG1 4CSWA 1GICA 4JGYB 4NMIA 1DZRA 2JG8A 3FHAA 4MGYE 5LWBA 3TN93 3HIFA 4UW4A 1OURA 4NHLA 3I59B 1RUI2 1G9DA 2XOMA 1Q8PA 4L11A 1R1ZA 3BKZA 2BFUS 1AR83 4D0QA 4AI2A 4XE9A 4YSFA 2HBTA 2WR9A 1XJAA 4LTAA 3WF3A 5A7QA 1DBNA 2P2KA 3GALA 4Q27A 3SHRA 1C4RA 4FOWA 4YPJA 3OUIA 2BTVC 1APNA 5FKCA 1XU2A 1NCRB 4WVZA 5LA2A 1R091 1XSQA 2RS13 2VMCA 1LOCA 5CAZA 3CNAA 4AEDB 2JE7A 2YROA 1W8ZA 1VB4A 5D8AC 1ULFA 1GKBA 5K9YA 2UURA 2WO1A 2RMU3 4K1YA 2WZ8A 5IAXA 1AYN3 1VBB2 3RWNA 1J1TA 3ZYJB 1GYKA 3KV5A 2JG9A 4GKYA 4YVWC 5T5OA 4EN8B 2C5DA 2VD7A 4LKFA 1PM4A 5CU1A 3RMYA 2IVJA 1RUG3 3E6BA 2O8QA 2WABA 3W21A 5JOWA 3NO8A 2YB7A 3POFA 4GZ9A 1LNSA 3F95A 3CHXA 5KHIA 3NW4A 2RHPA 3VZMA 2PFWA 2QQWA 3U10A 1GWKA 2VZVA 2A75A 4Z2AA 1UU5A 1W6MB 1H4HA 3EQEA 1QOOA 2O8OA 3PUHA 2D7FA 3O1UA 5A70A 3FE5A 5E8AA 4DY3A 1W8HA 1Z7S1 4NPRA 2D3RA 4P9XA 5CFCA 3AC0A 1IG0A 4CP1A 1MZFA 4BZ4A 1G9BA 4BDVB 3RYPA 4JZRA 2VC9A 4XJWA 3CL1A 3MW3A 5CADA 1T6BX 3B3QE 2UWCA 4G9SB 4CUBA 3V65A 3DECA 1HKDA 2A3XA 2BOIA 3J7HA 3A21A 3M70A 3ST7A 3ZPYA 3TBDA 3ZPOA 4XOGA 1AYM1 4LA3A 2D97A 2WFPA 1CAXB 1OBNA 3EB7A 1MR5A 2OW4A 3ETPA 5FZLA 1GNHA 3GZEA 3BVCA 3OY8A 3U4SA 5C4WC 1GZ9A 5AVPA 3VHPA 2AGSA 4C1XA 1W6QB 1OA3A 5FZDA 2C6SA 2FCTA 2QVSB 3POJA 3Q8FA 3Q8CA 1JHJA 2W91A 1I1EA 1CAWB 4QX3A 4XFAA 5CG8A 3KT7A 3FZ3A 1S2KA 3RZHA 1ENXA 3PUQA 3GCXA 4NOTA 3ZIWA 1EV12 4YYOA 2PA7A 2J1SA 2LM3A 4PDWC 2J22A 3N9OA 3G6JB 1DF0A 5G05L 3SC7X 1QNWA 2Q0AA 1G6NA 1I5PA 2VUJA 4CDXA 2Y0IA 4FOQA 3MIBA 2Y33A 3UNPA 1IHMA 4FPKA 1Z7S3 1NQJA 2CAUA 1JZ5A 3KWVA 4FPHA 2ZOEB 4RHV3 4AAPA 4XUPA 2XBO1 3WCSA 4Y22A 5FZ7A 4NWWA 1XYPA 3BTAA 4ORFA 4AEMA 1LEMA 2YBSA 1LKNA 1F5JA 5C70A 3VKMA 1QJEA 1AYM3 4IV3B 1LHNA 2XJSA 2EA7A 3WF0A 1WA4A 2HWE1 4LBQD 3WG4A 3KV4A 3QOPA 3LE0A 2RE9A 3RZMA 3KB5A 4CPBD 1PK6C 4QM8A 4YG6A 1OH4A 3ZSLA 1ZRRA 1KGYA 1RUF2 4META 2ZZQA 4PQ9A 4EN9B 2R071 4CCOA 2J1AA 4FFHA 4URTA 3CJIB 4OHXA 3W9AA 3RRDA 1WD3A 1O91A 1JODA 1V70A 5FJKA 3LOIA 5FZ8A 2BEOA 3KZ4C 1OLME 4I01A 4AFCA 4P9YA 4DINB 1NUKA 1SFPA 2IZWA 5EPAA 1ZM1A 2DCYA 5AC92 2HWB2 2R1BA 3VL8A 1UYZA 2WFF2 5JZGC 2VVFA 2DUOA 4XBQA 4ITCA 4UBGA 5D8AA 3NKGA 4AI1A 2R30A 2XB6C 3HQRA 1C8M2 1W39A 4Y1ZA 1S0DA 1YQ5A 2D3PA 2WLQA 3B5LB 1ZBA1 3HNBM 2XBO3 2ZGUA 3PJYA 2E7TA 4YVWA 1KS4A 2GNDA 3AK0A 2W52A 2ZGPA 1IS6A 3KF3A 4HKLA 3WX5A 3THDA 4P5YA 3UESA 4IV1C 1DYOA 2ZKNA 2HWE3 4LKEA 5GJ6A 1HQWA 2HKXA 3H9AA 3O0VA 1J59A 1VALA 2ZGQA 4E2GA 3OD4A 3VBOC 3SITA 5IVFA 1SEFA 1V6LA 1VBE2 2Z2SB 4HZFA 2VUDA 1JYWA 5CFDC 2R073 2NM1A 2YBKA 4E8CA 5I8TA 4I0WB 2KA3A 2FDJA 2J1TA 4COUA 1YQ6A 1L7LA 1US2A 4AWDA 4CDWC 5FZMA 2EALA 2YHJA 5J98B 1DGRA 2VVEA 4XABA 1AR91 1BVP1 5EJ3A 1XE7A 3FUQA 4MADA 3Q8AA 4B4QA 4EJRA 1UAIA 4HT1T 4AGRA 1JYNA 2NP0A 1TME1 3WNPA 2JICA 2VMEA 1CVNA 3D4KA 4EN7B 5K0UC 2Q30A 5C4WA 3OCPA 1RUOA 1UOFA 2DF7A 4E27A 2ET1A 2VULA 2XVLA 2JE9A 2JX9A 2PLV1 3MPPG 4PLMA 4UFIA 4IXLA 1ZBA3 3AZWA 4RR3C 4A7KA 1PO23 2PHRA 2VTXA 3KLSA 2EAAA 2CYFA 4ES8A 1VAKA 3AZXA 1FYUA 1QIQA 1MS3A 3ABZA 2LTNA 2ZGMA 4LJHA 4LLFA 2J7MA 3ZN6B 5JI9A 5KHJA 2EXJA 3U0ZA 4Z92B 2JD9A 5IYYA 3UJQA 3MI8A 4R52A 4PDWA 2QQKA 2GH8A 1ZNPA 2I45A 5ANNA 4QGNA 1G9AA 3HPNA 4LO5B 2WUHA 3USSA 5I0RA 1K5JA 1D4VB 4K9SA 1DLLA 4DO0A 4ZKTB 1HDKA 3IDCB 3P6BA 4QQPA 2GN7A 1F35A 5C7GA 1FATA 4ZHNA 4V1PA 4QHZA 5DZGA 1QQP2 4OI4A 3O1TA 4ATFA 1WCQA 4KBZA 1FOD1 1AR93 4DUXA 5SV5A 2CSGA 4Q1PA 4RA0A 5FY9A 4PF1A 3DKWA 1V6KA 4UFLA 2X5IB 1TME3 2OYZA 4Y20A 3N9NA 3O12A 1T6GC 1PK6A 4FO9A 1CX1A 2PLV3 2ZX4A 1NLRA 1W6NA 2XJQA 3LAGA 4ZU7A 1LGCA 2DFBA 2DWRA
chains in the Genus database with same CATH topology
2VQAA 2UWBA 3OF1A 2BVBA 4FVVA 3TB0A 5AFEA 2CL2A 1DFQA 1AR71 4E9KA 3OGJA 3RI8A 1HW5A 2CGNA 1QJY1 4RS5B 2RS32 1WUVA 4HLTA 3WW3A 5JZGA 1B35C 2A3YA 2FZ2A 4Z1VA 5FMOL 3VKOA 3ENRA 4NVPA 4COYA 5F9TA 1PM7A 4S2GA 3QBQA 4DB5A 2X53S 1LRHA 5HCAA 2EAKA 1NXD1 2DCKA 4LEJA 2VXRA 3I54A 1Q43A 1U5IA 1FMD2 1W6PB 4W6WA 1O3RA 4M0HA 4JQRA 1PO11 1FOD3 5FRAA 3ZXGA 1LGBA 3CO2A 1N1TA 3WW1A 4IV1A 3GNEA 3RMXA 3VZKA 3MLLA 3UKTA 3EJKA 1AJKA 3VBOA 4BM8A 5L7OC 3IPVB 3U11A 1H8TB 1LU2A 5BYNA 4YZ3A 4Q4W1 5CFDA 1AR82 2VH9A 3GBFA 1QHDA 1WBFA 1IGOA 3MYXA 5BUVA 4CDWA 4QPIC 1J3QA 1S0BA 1PZ9A 1K5MB 4F83A 1AR73 2D6NA 4YM2A 4TZDA 2KM2A 2A71A 2MNGA 1QJY3 3WDWA 3FHIB 4A7YA 1MVEA 4Y1YA 1JBCA 1OMIA 5K0UA 3QD6A 3RG0A 2D6OX 4Q4X1 3WP5A 1HX6A 2RMU2 5BNPB 4SLIA 1BQPA 2ZCWA 5A32B 5T5LA 5LK7B 4QX5A 4RR3A 3UJOA 4C1WA 1RC6A 4M01A 3EO6A 4OLLA 1U0AA 2QJVA 5AFBA 3N35A 1RUG2 3D0JA 5GLWA 4FAGA 3E6CC 1PO13 4XMIA 5CVRA 5JSPA 2ZGKA 2D40A 4F8AA 2LALA 5EYXA 5DG2A 2JXAA 3H1WA 2YUEA 1TE1B 4Q4W3 2A3WA 1DGRN 5DXDA 3AJYA 5FPXA 1Y7BA 4B3NA 5J37A 5BY5A 1QKQA 3OGGA 1ZRFA 1QH6A 4TSVA 3R6SA 1ND3B 4XTMA 2GU9A 2Q5TA 2VG9A 4EN6B 4IEWA 2WJSA 4YGBA 1DGLA 1XNBA 3RYKA 1EP0A 4CEWC 4L8QA 4JCKA 4Q4X3 1D0GA 4FPYA 1QDCA 5JCTA 2D43A 4OHWA 3ACLA 4XEZA 1U12A 5CA6A 3KCXA 1XXNA 4JDMA 4Q0UA 1ZZ9A 1DU3D 3V0BA 3JD71 3RSJA 4AGVA 1CGPA 1FPN2 3VL9A 5CG9A 1B35A 3ZVXA 3N7LA 2CNAA 3WCRA 4YGEA 1F2NA 1KQRA 1Z7S2 2DUPA 2R0FA 3SH5A 4RHV2 3RI9A 1BK1A 1BBT1 1WLDA 5DZFA 2SBAA 1J3PA 4WVWA 4XQDA 4RFT0 4BMEA 1AYM2 3IWZA 2B39A 3S30A 4WVMB 5C8CB 4XXAA 2WNUC 4LBNA 3TOJA 2PELA 5L7OA 1V00A 4LBMA 1X8EA 5FPZA 1O3QA 1MQTC 1S0GA 2D6LX 3IT8A 2ZBJA 4QPIA 4BH9A 1LULA 2R041 3JD73 2VMHA 3DN7A 2OA2A 3J8F2 4HVRA 4N43C 5DDJ1 5I93A 4OVEA 4D69A 3X29B 4QGLA 1NA1B 1LU1A 3IKWA 3M3EA 1ULGA 1GNZA 4QU2A 4IQPA 4ATEA 2DYCA 1KDMA 4Z82A 4CEYB 3NL1A 2WLPA 4UW6A 2A6XA 1RUH1 3WG1A 5ABJC 2D3SA 5TSWA 1RGSA 1GFF2 2E6VA 3WDXA 2HEWF 1PZ7A 2AH2A 4HKOA 4R4ZA 2HWE2 3SXWA 1QXPA 1POV1 4AVCA 5H9QA 3WW2A 4QM9A 5T52A 3ZXAC 4FTEA 4JAAA 5T5JA 2ZHLA 3LSDA 3QCWA 2WQ4A 3VBSB 5BNOB 1RUD1 2ILMA 4HN0A 4BIFA 1JH5A 3AX4A 1YO8A 1BXHA 4A3XA 2R043 1CAUB 3B93A 3UV9A 5DDJ3 1UU6A 1MACA 1VBC3 2DCZA 3IDBB 2WZPP 2E63A 3ZMNA 4Y4YA 4OHZA 1FV2A 4XQ4A 1H1MA 1YLLA 2PHWA 4CEWA 2TUNA 3D82A 1EPZA 2JG8B 3W59A 1ZBA2 3VN4A 1PO22 1RUH3 4AVTA 2ARBA 1U5ZA 1VBA2 1AUYA 2DURA 1LHUA 4WM8C 1UL9A 2ET7A 3BOPA 2ATFA 4PBOA 4K20A 2UYBA 4MXVA 3MW4A 4LBLA 1N1VA 3T2TA 1POV3 2Y0OA 1Z0HA 4G3YC 5FQ0A 2A6WA 3KCCA 3AKSA 2CTVA 3E6DA 3HAGA 1RHI1 3OBTA 3VHOA 1LODA 1KITA 1ZZ6A 1OKQA 4D7TA 4FSJA 4KWJA 4J6GA 3MLKA 3PVEA 1MZ5A 5LRSA 1RUD3 4ZU5A 5EYYA 1SBEA 3ZXLA 4AHZA 2RM23 3I4IA 1AR92 2ZHKA 1KDKA 3VKFC 2NPIA 2G9GA 2GC0A 4AFMA 1UZZA 4GKXA 2WNUA 5A33A 4X8NA 4KBBA 2PLV2 3WQ0A 2ZA9A 3DV8A 2Z79A 3M3QA 1OHFA 3WHUA 3L9JT 1F8VA 4MXWA 3N7MA 1SLBA 3H8UA 1QWRA 3H0OA 4LLOA 3KM5A 4YW1A 1ZYBA 1MQTA 1MS9A 4B8EA 3V64A 1KJLA 4N43A 3VUOA 1OFSA 2RJKA 1RHI3 1VB2A 4WZCA 3Q9OA 4AF9A 3MIFA 4E2SA 1HXS1 4R9DA 4XZPA 1HV0A 3AP5A 4IEQA 1MVQA 1Q8VA 5ABJA 1I9RA 3E5QA 3DUIA 4OUSA 3USUB 1YNAA 2CGOA 2AYHA 1LJ7A 1GQGA 2ZJCA 3OPZA 4OI2A 4LA2A 2ZMNA 5JSRA 4KU7A 3VBFC 1A3KA 3I7DA 3GYDA 4IEOA 1BVVA 3KGZA 4A2UA 3ZXJA 3PTYA 4Q1RA 3WP4A 2ZGSA 1S2BA 1GZWA 2GMPA 3J4UH 3VDDC 2VOKA 1WGPA 5I0UA 1RUJ2 1W0OA 4XXPA 4K3UA 2Q4SA 4AXOA 3CU7A 3QACA 3ZN4A 1YFXA 3ECQA 1H8VA 1PNFA 4OULA 4R8HA 3AMQA 4FOYA 4YFWA 1QJY2 2AZ5A 2JEMA 4R9BA 4PCRA 1D4M1 1W6OB 1DZTA 4PJYA 1SLAA 4XF9A 5FOBB 4JDOA 1O5LA 3AXDA 1HXS3 4CP2A 1HQLA 5FCCA 3WINE 2QFEA 3PMEA 4WV8A 3LOBA 1IOAA 1PVC2 3MICA 2OPKA 1KS5A 3T1MA 1PO12 4AK3A 4WM8A 2CWMA 4HFSA 2HWF1 4XFCA 4AVBA 1PIV3 2R062 2DU1A 2PHFA 4FTBA 1QGLA 4HK8A 3POYA 4BYYA 1SLCA 3R0RA 4X6QB 4ASMB 2WT2A 4QPYA 4Q4W2 2VW1A 4EWAA 4XFHA 4S2DA 1OSGA 3JUUA 1SMVA 2ZX3A 3ZO0B 4QQOA 1OLRA 2DU0A 4P9JA 1QXJA 4F3JA 3AMHA 5HBAA 1OOPC 2IFWA 4JGZC 1O5UA 1DQ6A 2B9UA 1GANA 1U5XA 1RUE3 1VLNA 1BMV2 1JUHA 4YGCA 4Q4X2 4XFGA 5BXXA 4I3GA 4FPLA 2P3JA 3SCGA 3KD4A 3WV6A 2NYYA 5GZEA 3WP6A 4QMAA 4Q8KA 4AEKA 2NZ9A 2DVAA 3POWA 4YZ1A 4GB31 4R9CA 2HWF3 3PVNA 2RJLA 1ND2C 4L92A 2WZR1 2WINB 4XIKA 5EZWA 2XHKA 2H6CA 1D2SA 2BBVA 3B9IA 1FT9A 1NE6A 4Q4Y2 1I3HA 3J9SA 4HN1A 1ULEA 5JMCA 2PHLA 1V6MA 2OIIA 3SLIA 4FPJA 1CESA 1BEV1 3THTA 2XGXA 1H9PA 2P37A 1YJKA 4MZUA 3JB4C 2WNEA 3ZYGA 2UU8A 2BW8A 3B7MA 1F9KA 3VBFA 1SFNA 1NCRC 5FO7B 1R093 4N53B 2B5HA 4AEDC 3VDDA 4EV0A 3EXUA 1X50A 4FPCA 2XUMA 4PIXA 4LT5A 1SLLA 2VMGA 2WS92 3DL3A 4GB33 4JRLA 4Z8BA 3JD72 1OI6A 1ZZCA 4Q0PA 1VAVA 2WZR3 4C90A 3IIAA 4X8PA 3KT1A 1LTEA 4P9LA 4FOVA 4AVVA 4Q4V1 2ZMLA 3ZFFB 1SFYA 5JSOA 2BGCA 3JBG2 3VBRB 3WG2A 4OHVA 2V09A 3ES4A 2PYTA 1NZCA 2AENA 2B46X 1YFYA 3H7JA 4P14A 5F1RA 1BEV3 5DUXA 4FXKB 5IUQA 1OQ1A 2G4IA 4F7ZA 1A8MA 1ZX5A 5I0TA 1J3RA 5E88A 2E7QA 1PGW1 4Z07A 1YFUA 2D93A 3KQRA 4IEZA 1ENRA 5JZGB 1QY4A 3AYAA 3AZYA 3QH6A 1OOPA 4DFSA 4CP0A 4JGZA 3L2YA 5DDJ2 1CD3G 5GLVA 1VBC2 2K2SA 5GALA 1RMU1 1LR5A 4Q4V3 5I91A 2PAMA 2ZAAA 4HVQA 1PGSA 4FPFA 3NAPB 4KH9A 4QPGC 4O9EA 3WG3A 3ROUA 2WL1A 4DNYA 3NKTA 3N36A 4IV1B 3UKNA 1RB8G 4IEYA 1NY71 3VBOB 1V6JA 4L99A 5T50A 4K6BA 1ND2A 4CDWB 1M4WA 1A78A 2HWD2 4B4PA 2XPJA 1MEC1 4Q0SA 4IV3C 1HRI1 2EXHA 3GBGA 3H7YA 4BA6A 2B42B 4MVTA 1JOJA 1XYNA 2H0VA 1CPNA 2KXLA 1RVF2 3MF9A 2RM22 2QKDA 1GLHA 1AX0A 3MIHA 4AEJA 1QJX1 1RMU3 2VY0A 1LEDA 2D5HA 3UKVA 5BNNC 2ZX2A 1RL3A 1NCRA 1XNDA 1E57A 4OFGA 1N1SA 2ERFA 1BKZA 4Y1VA 3NV2A 2LUWA 3ME2A 2XJPA 4AEDA 1WW5A 3NJZA 2TEPA 4BIOA 2GC2A 4CRQA 2D6MA 4XJAA 4ES9A 4XF3A 4ZXKA 3BIWE 4CDUB 1AF9A 2QE3A 2Z69A 3UL2A 2K9ZA 5HCBA 3GZUC 1DIWA 2R1DA 1RHI2 1V9U1 4NWVA 4E4DX 5T3NA 3MF6A 2OUJA 4FPEA 1HRI3 3ZFGB 4KGGA 3ZMOA 2E53A 2XWJB 2DFCA 3HN1A 2R6QA 4YW2A 4K8FA 2Y26A 3S0MA 1MS5A 1XNKA 3VBHC 1F31A 1QJX3 3WW4A 4RSUA 1YCIA 4PLOA 2R49A 1COV1 4IEPA 4OHYA 3WUDA 4LBQB 1CAXA 4WM7B 3GZTB 3NVCA 3WQ7A 4GALA 1H4GA 2FHRA 3NV3A 3O7OA 1B35B 4N9IA 5B2GB 1H2MA 2ARXA 1AVBA 2Q8OA 4GXLA 3MGUA 3VBUB 3D0SA 1V9U3 4WBBA 1HXS2 4C0BA 4QPGA 3V0AA 1PZ8A 4MYEA 4D94A 3LA7A 1XYOA 1DHKB 1DG6A 4FBFA 2IC1A 3FJSA 2I2SA 1N3OA 1ASJ1 2RR11 2DVBA 2H6BA 3WDUA 1JXNA 4OI1A 5DG1A 1PIV2 4IEXA 1NQDA 2WQZC 3HMYA 4I30A 1COV3 2CAVA 3M2MA 1ENSA 4QPIB 1Q8SA 5KXDA 2P17A 5KXBA 3FBMA 2DTYA 4IV3A 3AMPA 3TN92 2X5IC 1X8MA 4AQTA 2ZGNA 4BOWA 5C8WA 1MZEA 4AI3A 1HLCA 3WR0A 3S6PA 3KMHA 4HSLA 3MFAA 1S1AA 5KC6A 3FLPA 4Q2FA 1CJPA 3PMSA 2DVGA 3S7EA 1RUE2 4D3WA 3RS6A 5BNNA 4BE3A 5E89A 4KU8A 4RS5C 2RS12 4HK9A 2BNOA 2PAEA 4ASLA 4BCUA 1PGL1 1JYIA 4RGGA 3RJRA 2HEVF 5T5PA 3ATGA 4AQSA 4COVA 1N3QA 2RR13 5JAXA 2CY6A 1CJDA 1Q5OA 2HWF2 1AYN2 2JDZA 1IS3A 4EN0A 3IMNA 3JQXA 3FLTA 1TNRA 1CONA 2QNKA 1RUI1 4L2NA 1WLCA 2ETEA 2XLGA 1IKPA 1BYHA 5JR7B 3GF6A 3O5SA 3LWCA 1M06G 5H9PA 1AJOA 4B29A 1YI7A 3GZAA 1YHFA 2FMDA 1OPOA 4KQ7A 3ZXDA 2NMOA 3ZXKA 4CEWB 2PQQA 4GH4B 2ZACA 1ZRDA 4B7EA 3M7AA 4HVOA 3AKRA 3VBHA 3IDEA 5LEKA 1IKQA 1C8NA 1D0HA 2WKKA 1K5MC 1SCRA 1ONAA 1R092 3PVOA 1VBB1 1ZBE1 2GNBA 5FQ0B 4AGGA 4XTPA 5C9AB 5BNPC 2OZJA 2UWAA 4PIZA 4GB32 1L3JA 4XJUA 2WZR2 5KWRA 2X29A 1RUI3 3ALQA 1DQ5A 4Q26A 2FMYA 3AFKA 4XHXA 5IK8A 1X36A 1YIFA 4FTSA 2WNVB 1O4ZA 1WMFA 2ZPXA 5IK5A 2WNUB 1BEV2 1O4YA 2MPFA 2XL7A 3MFCA 5A33B 4YZ4A 1C1FA 4S2FA 1V6NA 2BFUL 4MXWB 2NLRA 4QQ2A 5J09A 1MQTB 3E5XA 3AM2A 5FO8B 1JHNA 1VBB3 1ZBE3 5EV7A 3WNXA 4HMZA 3VKNA 4AFAA 5FDBA 4N43B 4W6YA 1XQNA 2X5IA 4QT6A 1VP6A 3ZDSA 2ZABA 1S0CA 3ZFEC 1DYPA 4MGZE 1EV11 1O7FA 4FT8A 4DPNA 2D98A 1AL21 1AX1A 5EXOA 4K40A 4RGAA 3EBRA 1WCKA 4LBOA 5ABJB 5J7MA 2A73B 3ILFA 1H1IA 4YVSB 2TBVA 2IFRA 3MIEA 4RS5A 2E7AA 4NN0A 3OBRA 1GBGA 4CDQB 2X8KA 4M3CF 3HT1A 1DGWX 3MIGA 2B45X 1YYNA 4QQHA 3AMMA 1HRV1 4YZ2A 4N90A 1Y43B 3WDVA 1BBT3 2BYVE 2VW0A 5J48A 1EAH1 2DCTA 2XBO2 2BNNA 5I8YA 1W6PA 2PHUA 4I0BA 1DQ1A 4H7MA 5FLIA 1S0EA 4AFBA 4EWEA 1PGW2 2C1FA 2YC0A 1JN2P 4ISRA