2TEPA

Peanut lectin complexed with t-antigenic disaccharide
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
232
structure length
232
Chain Sequence
AETVSFNFNSFSEGNPAINFQGDVTVLSNGNIQLTNLNKVNSVGRVLYAMPVRIWSSATGNVASFLTSFSFEMKDIKDYDPADGIIFFIAPEDTQIPAGSIGGGTLGVSDTKGAGHFVGVEFDTYSNSEYNDPPTDHVGIDVNSVDSVKTVPWNSVSGAVVKVTVIYDSSTKTLSVAVTNDNGDITTIAQVVDLKAKLPERVKFGFSASGSLGGRQIHLIRSWSFTSTLITT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lectin
molecule keywords PROTEIN (PEANUT LECTIN)
publication title The Specificity of Peanut Agglutinin for Thomsen-Friedenreich Antigen is Mediated by Water-Bridges
pubmed rcsb
total genus 55
structure length 232
sequence length 232
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2tepA00
5H9RA 1S0JA 2R49A 2Z42A 4M3CB 3PVEA 1WBFA 3UJQA 5JOZA 1W6OB 1V6NA 3M3EA 4M3CE 4YGDA 4C1WA 3BODA 3AJYA 1JXNA 1W6MB 5JVVA 2D6OX 2PELA 4AYUA 5CNAA 4YZ3A 4C1XA 1V00A 2SBAA 4W65A 5DUXA 2EIGA 4HANA 1OFSA 2PHUA 3HR9A 2JE9A 4XILA 5GJ6A 1CR7A 3SITA 2AUYA 4Q26A 1IKPA 1G9FA 1IS3A 1RITA 4F83A 1ZM1A 1MACA 2OUJA 3ZXEA 3AP4A 1LGCA 5GLWA 3OYWA 1S0BA 1CJPA 3MPPG 2CL2A 4XHBA 4BMBA 3WHUA 3M3OA 1S0CA 2EXKA 1HDKA 3V0BB 4ASMB 1KITA 5KXCA 1SFYA 3ASIA 3ZSKA 1BQPA 1AXYA 1W6PB 3N7KA 1S0IA 1DQ4A 1PZ9A 2TEPA 2R0HA 1A3KA 3AXDA 1H9WA 3FBYA 5LK5A 1UL9A 2W08A 4BMEA 1AXZA 5JOYA 1Q8OA 1U0AA 1Q8QA 2GN7A 1WLDA 2WKKA 4Y1YA 4YW4A 1V6LA 3IKWA 3ZXFA 3KQRA 2DVFA 4U2AA 3RQ0A 4YM0A 1BZWA 1DYKA 2C5DA 1WBLA 2A6XA 4UW4A 1CVNA 5DZGA 3RMXA 2WQZC 4AVSA 5H9SA 1JN2P 1I3HA 3SH4A 3AFKA 1LGBA 3FLTA 2C9AA 2ZGKA 2ES3A 2AYHA 3D5OA 4FPGA 4K20A 3SH5A 1UKGA 4YG0A 1JOJA 4LBMA 2DV9A 1AZDA 3JU9A 3ZXJA 4RA0A 3TB0A 4Y1ZA 5F9TA 2ZZJA 2DVAA 1WW5A 1DIWA 3SISA 3N7JA 4UW6A 3V0AA 1V6OA 5GLUA 3QLQA 1N3OA 2NN8A 1AJKA 1GZWB 3OPZA 1SLTA 1LU1A 1UZYA 1S1AA 3ZYPA 3O12A 1JBCA 4AGGA 2ZA9A 4FVVA 1N1YA 5DZFA 4YM3A 1QDOA 2ZGNA 3ILNA 4RL7A 3M1HA 4ZXKA 4LBQA 1WW6A 4L8QA 1FATA 1S0FA 2PHFA 3BIWE 3O5SA 1RIRA 2WSUA 2DTWA 3D6EA 1ULCA 4XXAA 2FHRA 4CTEA 4YW1A 2AR6A 3OBTA 1Y7BA 2R1DA 2NMNA 1DGLA 4CRQA 4AGVA 1G7YA 2R16A 2P3IA 3GALA 4DQAA 2GNBA 3AZYA 2V5YA 1ONAA 1MS9A 2UURA 1GNHA 2E7QA 1N3QA 1GV9A 3O0WA 1GSLA 1SCRA 2YV8A 1NLSA 1YXWA 1OKQA 3R4UA 5SV8A 1ULGA 1W6QB 5DG1A 1W6OA 2E7TA 4FOQA 2E53A 4PQ9A 2P3KA 5AVAA 2A75A 3AZWA 2NM1A 4AGRA 3MEPA 2NYYA 1LOCA 2YY1A 4P9WA 2CWMA 3VV1A 2D6LX 4Q2FA 4U36A 4XBLA 3B69A 4XTPA 4Y26A 1VAVA 1SBDA 1JUIA 1Q8SA 2DUOA 2A71A 2PHTA 1WW4A 1LOEA 2PHXA 3RG0A 2D44A 1C1FA 2ZAAA 2GMMA 4DPNA 1B09A 5T5OA 3VKOA 4R9CA 2AREA 4FPOB 3LSDA 4TYSA 5T5PA 1SBEA 1G86A 3W58A 2ZHMA 3V0BA 5T5JA 3A4UA 1LOBA 2GNTA 2VH9A 2VW0A 2WSVA 3AYDA 1W6PA 1WD3A 4AWDA 4PF5A 1BKZA 4K1YA 3RSJA 2LALA 2JKBA 4ZKTB 3WCSA 2DVDA 3FUOA 5T54A 1DQ2A 1Q8PA 4XMIA 2D6PA 1LULA 1I1EA 3UK9A 5DZEA 2ZABA 2R1BA 2CYFA 5FREA 5DUVA 1AX1A 1JYCA 2D7FA 3APBA 2ZGPA 1LTEA 3WV6A 2XG3A 2UWCA 2ZGLA 5EWSA 4CZSA 1QOTA 3N35A 1J1TA 1DQ1A 2P2KA 1DZQA 2R0FA 5CAZA 5GZCA 3N36A 3AYCA 2ZHNA 1JW6A 1N3PA 5EYXA 4Z8BA 4XYXA 1LCLA 1MS0A 2CY6A 1IKQA 3OY8B 4P9YA 1Q8VA 5BYNA 1YIFA 3AZZA 1SLLA 1LESA 4H55A 4HL0A 1ENSA 1IS6A 1AF9A 5HCAA 3N7LA 2ZBJA 3PMEA 1GZWA 3B3QE 3WG4A 1GBGA 3TAYA 2ERFA 5GZGA 1OQ1A 5H9PA 2V73A 4FOWA 3U4XA 2EAKA 1QDCA 3MW4A 5GZFA 3WUCA 4AVVA 4UW3A 1LOAA 3ZSLA 3Q9OA 3OGGA 1H9PA 4FOVA 2D3RA 2ZGTA 2ZGRA 3RMYA 2ZHLA 3PVNA 4BOWA 3WDYA 1NXD1 2ZMKA 1GKBA 3IM0A 2WJSA 1SLAA 1LHOA 1QKQA 3IN9A 3ZXLA 3NV2A 5KXDA 1FNZA 1WCSA 1DYPA 4XJ9A 1LHWA 2P34A 1LEMA 3SNMA 3GNEA 1EPWA 4GKXA 1D2SA 1V6KA 4XHXA 5JDBA 1WD4A 1SLCA 1HQLA 2ZACA 3AZVA 1FV2A 3WOGA 3IPVB 5IT6A 2VU9A 1ULEA 4FPCA 3A0NA 2AGSA 3NWKA 4XMAA 5EYYA 3T2TA 1G9BA 4YW5A 4JRAA 3VUOA 2CWSA 1UPSA 3USUB 1LHVA 4YZ4A 1HQWA 4Y22B 1LGNA 4DRRA 1LOFA 4ATFA 4YZ2A 2YMZA 2YROA 2I2SA 4FP3A 2A6VA 4XE9A 5GLVA 1G8WA 1LHNA 4ITCA 3WDUA 3C2UA 3PVOA 4FPKA 4Q1RA 1O4YA 4DFSA 3V64A 3AP6A 3MW3A 3ZSMA 4SLIA 4BLJA 2RHPA 3MW2A 1AVBA 2DUPA 1UMZA 2JECA 2VW1A 4GA9A 4R9AA 4Y20B 4FPHA 2E6VA 2ZHKA 5E8AA 1S0EA 4OZXA 2JDZA 2P3JA 2BQPA 4I30A 1GZCA 5GALA 1BJQA 3ATGA 3ZSJA 3VKLA 1Z78A 2G4IA 2PHWA 1WLCA 1CQ9A 1CPMA 4YFZA 3H0OA 1F31A 2D6MA 2EXHA 3POYA 4M3CA 5DG2A 4XJAA 4KBBA 4Y1UA 3OJBA 1FAYA 2A6YA 4LBJA 3NV3A 2DWRA 4XTMA 1QF3A 3D4KA 3HMYA 2AH2A 2A6WA 2ZGQA 4LBQD 1V6MA 4LBNA 3FLRA 3IMNA 1W6MA 1VALA 2LTNA 4YM1A 5DUUA 5JLVA 2UU8A 3N3HA 5H9QA 4Y1VA 1DQ6A 4GWNA 5FRAA 4Y24A 1VIWB 1MS3A 2UWAA 1PZ8A 2P37A 3M2MA 5L73A 2ZGMA 5E88A 3NV4A 3CNAA 1LECA 2ZGSA 4WZFA 2DTYA 1AX0A 4GKYA 3LCPA 3R05A 4FPEA 3L2YA 1LENA 3AZXA 2A70A 3INAA 1IS4A 1KQRA 4Q27A 2SLIA 4LBQB 1ENQA 3AP9A 4R9BA 4XDQA 5IK7A 1W0PA 2UWBA 2NP0A 5GLZA 2NMOA 1A78A 2VXRA 4FP2A 4WVVA 1ENRA 4YGBA 4YGEA 5CBLA 3ZYRA 4ISQA 1FNYA 3WDWA 4M3CF 1Q56A 5T52A 4NOTA 1LU2A 3VKMA 4YG3A 2A3XA 4UW5A 1MS8A 3WNXA 1O4ZA 2DVGA 2VY0A 4Q8LA 3KM5A 2WNEA 1CPNA 3FLPA 3O0VA 4K21A 2D6KA 1VAMA 5F5QA 5HCFA 2GNDA 3WCRA 4FPJA 3T1LA 1F9KA 3AYAA 1FYUA 2D3PA 3VKNA 1ULDA 1QNYA 5JOWA 4GWMA 5JMCA 2CTVA 1MZ6A 5IK5A 1SCSA 3WVJA 4YZ1A 1BYHA 3IPVA 2JJ6A 4GALA 1W0OA 2D3SA 1SLIA 3POWA 4XBQA 2EALA 5IUQA 4MYEA 1MS1A 1ZA4A 1TEIA 1BXHA 2DU0A 4TZDA 3LSEA 1N1SA 1CESA 1A8DA 1LODA 1MS4A 2WT2A 3DUIA 5HCBA 1W6NB 1IOAA 2A7AA 2OUHA 1N1TA 3USUA 4YZ5A 1FV3A 1MVQA 4Y1XA 4YGCA 4Y22A 1QOSA 5GZEA 1DLLA 5IK8A 3ILRA 2DYCA 4ISRA 4Q1PA 1UX6A 1GICA 1URXA 1X50A 4FPYA 2GMPA 3POSA 4XJ8A 5T55A 2GNMA 3VKFC 2B7YA 1JHNA 1VLNA 2GALA 2OVUA 1N1VA 4AVTA 3AX4A 5CA6A 2AENA 4Q8KA 2ENRA 3UJOA 4FQ4A 1RINA 1V6IA 4PCRA 4XIOA 5T50A 1KJLA 1R1ZA 1SBFA 3AXEA 5GZDA 3PJQA 4FPFA 4Y20A 4BPZA 1S0GA 1LOFC 4P14A 1HLCA 3BOPA 1MVEA 4M00A 3WLUA 1LHUA 2VUAA 2GN3A 4GXLA 3QCWA 2YXSA 2D43A 4LBKA 5DXDA 3I8TA 3OBRA 1PZ7A 3BTAA 1KJRA 3AP7A 4ATEA 4M01A 2VW2A 3WG3A 3AJZA 3WG2A 1GNZA 1DQ5A 4XBNA 2ZMLA 1KRIA 1D0HA 4FPLA 3W59A 1AJOA 1JYIA 3HN1A 1W6QA 3FFZA 5T5LA 3ZVXA 3V65A 1S0DA 4DS0A 1CIWA 4JC1A 1GANA 2FMDA 3B9CA 2CNAA 4K1ZA 3NV1A 4WV8A 3RRDA 1XQNA 1KDMA 5EXOA 1QMJA 2NZ9A 4YM2A 1ULFA 2A5ZA 2KM2A 2OW4A 2ZKNA 3OYWB 4D69A 2EF6A 3UL2A 1DFQA 2ARXA 4PBOA 5GM0A 2EXIA 3ILFA 3SH3A 2D6NA 3JUUA 1GZ9A 1SACA 3R4SA 4LBLA 2A3YA 4YLZA 4BM8A 2E51A 2ZGUA 3WHTA 2DUQA 1YI7A 5KXEA 2W52A 2HYKA 1C57A 3WZ1A 4YG6A 3WDXA 2A3WA 1LOGA 3I4IA 1MS5A 3B01A 1FX5A 1QGLA 5DUWA 2JE7A 1HKDA 5E89A 3M3CA 4IQPA 1QU0A 3T1MA 1MZ5A 4DRVA 3WDTA 2W68A 1AX2A 1AXKA 3SLIA 2XB6C 4BLIA 1IS5A 1CONA 4FQZA 3N7MA 4YW3A 4FOYA 1WW7A 4XIKA 4R9DA 1C4RA 2GDFA 5JOXA 1YO8A 1G9DA 3V0AB 1UZZA 2WT1A 3DGTA 2DU1A 1V6JA 2PHRA 1YRZA 2A6ZA 1DQ0A 1MR5A 3AK0A 4JCKA 4WVWA 3WUDA 1QNWA 1DHKB 4XXPA 1G9AA 3B00A 1LJ7A 2ZGOA 3OY8A 3ENRA 4P9XA 1APNA 1H30A 2ARBA 2DVBA 3AYEA 5GLTA 4PBPA 2JD4A 5CB7A 3AP5A 4LBOA 1W6NA 3WG1A 3FUQA 2W39A 1C1LA 1UN1A 4XJZA 3WDVA 1G9CA 1UAIA 5KXBA 2GMEA 5IK4A 2EXJA 2WLQA 1Z0HA 4XJWA 3ZPYA 1F5FA 3A0KA 2WT0A 4XOGA 1KDKA 2DURA 1WUVA 3O0XA 4YW2A 4XZPA 1N47A 3RS6A 3ZXKA 4XJUA 1SLBA 1GYKA 1LEDA 1CN1A 1QOOA 3M3QA 1GLHA 2YZ4A 4NO4A 4BQ1A 4YFWA 1DBNA 2H0BA 2ZMNA 1YYNA 2Q5TA 1WLWA
chains in the Genus database with same CATH superfamily
2PFWA 4TLGA 5H9RA 4ZZ5A 4FI9A 1SG3A 4M3CB 2JDNA 3PVEA 2VE1A 3LFIA 1UPIA 2D93A 2V72A 3NL1A 1W6OB 2YBPA 1QJEA 1QJY3 1CAVA 1F5JA 4K8RB 3NO8A 4C1WA 3BODA 5FZBA 3AJYA 4K7JA 5ERLA 3TEZA 1W6MB 5FYIA 5JVVA 2D6OX 2PELA 3I2FA 3WXPA 1OMIA 2EIGA 1CX4A 1OFSA 2PHUA 4HANA 1OKOA 3OB8A 1CR7A 1RJ8A 2AUYA 1NOVA 1BLZA 1XRUA 3E5XA 4PDWA 4Q26A 1NQJA 1O6UA 1PGL1 3SKVA 1RITA 1ZM1A 2QQKA 3I2IA 3AP4A 1YI9A 3M7AA 4XHBA 1CJPA 2VD7A 2CL2A 3MPPG 1XXNA 2K0GA 3U11A 2YB7A 2IVIB 5JSOA 2JWPA 3THCA 3ZYFA 3ASIA 1BQPA 1S0IA 2J1AA 4UFMA 5CKMA 3VZNA 1ZYBA 3I59A 1H9WA 2OZ6A 3LEGA 4JV4A 4QHZA 3EJKA 4IGOA 4RHV3 1WLDA 4Y1YA 3KS7A 4KQ7A 5HXVA 4Z1VA 4AFBA 3NAPB 4IEXA 2DVFA 4BQ5A 3ZFGC 1RXGA 2HLEA 4XQDA 4W4ZA 5FPAA 2VTXA 4DEVA 1CVNA 1HB3A 2W3JA 2CAVA 2VMEA 1RUI1 3VHPA 3FLTA 2C9AA 2ZGKA 1ZBA2 2AYHA 4KWUA 4PHZA 4QGMA 3SH5A 1UKGA 5EZWA 3T30A 4MH0E 1JOJA 4N90A 1Q43A 3GF6A 3ZYHA 1AZDA 4RA0A 2DCYA 2WA4A 4CCDA 1NX9A 2DVAA 2FCUA 1WW5A 2O0OA 5IVYA 4OUMA 3WNMA 2VBPA 1UY1A 3MIFA 5FZOA 4OI1A 1UOBA 1N3OA 2RDSA 4NPRA 1GWMA 1S1AA 2TBVA 1Z7S3 2WABA 5CFCA 1JBCA 3SHRA 4AGGA 2ZA9A 4PQQA 3OUHA 5FJKA 1OBNA 3URFA 1RUJ2 2EAAA 1QDOA 4Y4RA 1RUOA 3M1HA 4A3XA 1W90A 4ZXKA 4QQOA 4AE2A 5KR7A 2MPFA 2RS51 3MFAA 5K9YA 4OVEA 4XFCA 1I9RA 3ZXLA 3IT8A 4BCUA 4RFT0 3F95A 3BIEA 1QJU3 4CTEA 2AR6A 3WNOA 1OH4A 5JXGA 1T6BX 2R1DA 1PVC3 4FTEA 4FO9A 1DGLA 3ZLIA 5FZMA 2D5HA 2NQYA 4QPWA 5L19A 3WF3A 1ENXA 4QKDA 4DQAA 2GNBA 1ZBE3 4COVA 2V5YA 2BVBA 2YC2A 2UURA 2CGOA 4HN1A 2ZS6B 3ZFFB 4IE4A 1YQCA 1GV9A 1TZOA 1WA6X 1GSLA 4MXWA 1NA1C 4COZA 4D6SA 5K7PA 2QQWA 1DG6A 4JGZA 5FZIA 2P17A 5BNPB 1VBC3 1AYN1 2XUEA 4PF1A 2VOTA 4OFGA 1I5ZA 1OURA 1VE0A 4KWJA 3VDDA 2E7TA 5IVVA 3DF0A 3AZWA 4UT5A 4XACA 4AGRA 3BOWA 3MEPA 3T0DA 3Q8AA 2YPJA 4AEKA 2CWMA 3AL6A 1CIYA 3OSDA 4Q2FA 2RR11 4XTPA 1YHFA 1Y4WA 2UY8A 4NIAA 5FPUA 1LRHA 2PHTA 4CP9A 2Z2SB 1LOEA 3LA2A 1AR72 2WFF3 4X8PA 3WNNA 4DPNA 3H3UA 1RB8G 1W9FA 3EMRA 4R9CA 2XBO2 3RZHA 2C1FA 3NKGA 5T5PA 5KHJA 3KV5A 4CDQC 1J83A 2WRAA 3H8UA 3SEPA 1NCQA 4R4XA 3U75A 1LOBA 4AWDA 1WCKA 1WD3A 4XURA 1BKZA 1NE6A 5GKAC 2I07B 2LALA 3PUHA 4H7LA 4WM7A 4CEWC 4ZKTB 3WCSA 3FUOA 4DIQA 2ZJCA 4IV1A 4XMIA 5JXIA 1I1EA 1OF3A 3UK9A 1TMF1 2WIIB 3A21A 3CU7A 5DZEA 4ZONA 4OI0A 3LIHA 4CPBA 5F39A 1DYOA 3MGUA 2ZGPA 2XG3A 2DFBA 2UWCA 2ZGLA 3MV11 4I2OA 3IIIA 4QMAA 4MGSA 2KA3A 4TTGA 4P5YA 2ZHNA 1J1LA 5EYXA 2BWAA 3SXWA 5A7QA 4XYXA 3VD3A 4Z8BA 2CSGA 4CCCA 3RJ2X 1GNYA 2CY6A 1Q8VA 2RDRA 1YIFA 3D0SA 1X8MA 4H55A 4NHMA 4HL0A 5BYNA 1AHSA 1ENSA 2RE9A 1CAUB 3NJVA 2ZBJA 3PMEA 3WP4A 1GZWA 1RUJ3 3WG4A 2UY9A 3R0RA 2VG9A 4BQYA 3UESA 4CDUA 4AVBA 2Q8OA 4KG8A 4AVVA 1A6CA 4QX3A 1HW5A 2WYSA 1UF2C 4P00B 1H9PA 2IXHA 3VD4A 3WDYA 3Q8EA 1GKBA 1SLAA 1QKQA 2RS11 3BB6A 4N43B 4JGYA 2Q1ZB 4XF0A 3V56A 5HCHA 4IDZA 1JU4A 4CDXB 1ACCA 1EV13 4RR3A 4EN6B 2ADDA 1CZTA 5FZCA 4XHXA 3I2DA 1QJZA 5EJ3A 4DXRA 5KHGA 2ZACA 5JI9A 1V70A 4QD2A 3VBSB 3VBFB 5IVJA 3WNPA 3NWKA 3B93A 2OYZA 5FFOC 2VZSA 3T2TA 1G9BA 1CAWA 4OUEA 4JRAA 2CWSA 4DZGA 1OUXA 4QGLA 3USUB 1H6YA 4YZ4A 3SKJE 1X7NA 1AR82 5C8CC 4DRRA 4QWNA 2N7GA 1ZRRA 2D97A 4GH4B 4IEYA 5LY1A 5IAVA 4N53C 1RUH1 4XE9A 2OA2A 5GLVA 1EUUA 4TLFA 3FBMA 3IBMA 1WZXA 3WQBA 5C9AA 3PVOA 4FPKA 4Q1RA 4RS5C 3V64A 3AP6A 3WNKA 5JZGA 3DYOA 4SLIA 4NN0A 1VBD2 2XBO3 5DPNA 2FD8A 4XDPA 4B29A 1UMZA 4FPHA 5FLHA 5D2AA 5E8AA 1S0EA 5F5AA 2JDZA 2VVFA 1PHMA 3CJIB 3O1UA 5FZLA 1KGYA 4D7TA 2G4IA 2PHWA 4AEJA 1CQ9A 1BMV2 1CPMA 4LUKA 5FY5A 3P5BA 3AC0A 1JYTA 2ZX2A 4JKKA 5DG2A 5K0UA 2R042 5C33A 3OTFA 4XJAA 4OHXA 3TWIA 4Y1UA 3VBOA 1SDDB 3NRUA 1Q3EA 1R1A1 2R062 2AH2A 2VJXA 1V6MA 1OPOA 4LBNA 1PO22 4DY3A 3FLRA 4ZPIA 2BYVE 2W92A 4YRDA 3HBKA 2LTNA 3I49A 2W47A 4QU1A 1COV2 3ZFEB 3PMSA 3FX3A 2HWD1 1E5RA 3LPFA 4QDQA 1OLRA 2V4AA 2RMU3 3GZEA 4S2GA 4JHZA 4RN5A 2Y0IA 1OHFA 1VIWB 3NAPC 2P37A 3WR0A 1WLTA 2J7MA 5E88A 3BCWA 5FYBA 3ITQA 1W2OA 1DP0A 4QPGB 3POGA 4Q27A 3SQOA 3RWNA 3CBNA 5LRRA 3ACHA 2LS6A 3Q8FA 1W0PA 4XFAA 1XOYA 4Y3OA 2XJUA 5IK7A 4GB33 1W03A 1A78A 2VXRA 4WVVA 5J36A 3KF5A 4QB1A 3LE0A 3VL8A 5JCTA 4YGEA 4IGQA 4WM8A 1QH7A 3ZYRA 1W39A 1FNYA 1H8TB 1UXXX 4EWDA 5F3CA 1Q56A 1UYPA 3RZMA 1OLME 5F37A 2A3XA 3IAPA 4Y33A 2VY0A 4MGZE 5A3PA 1CX1A 2HBTA 2WNEA 3TNPB 4C90A 5FY7A 1VAMA 5FYVA 2HBUA 1BEV1 4UBHA 1I5PA 5A7WA 2R7EB 3VKNA 1POQA 4AK3A 4R4ZA 3VHOA 1A34A 1NLQA 2XJSA 2VZTA 4URTA 3OGSA 1HQNA 4GALA 2AZ5A 4HFSA 3MDPA 4MYEA 2Y60A 4Q4X1 1JS9A 1FOD2 1QJX2 1K5MC 4XEZA 4TZDA 2JG8A 1I6XA 1CESA 1MS4A 1OD3A 3D8CA 3WP6A 1KFUL 5A3NA 2QQNA 4AHYA 1ASJ3 1KS5A 4B4PA 2JB8A 4Q4V1 5FWJA 1DLLA 5JXJA 3ILRA 2DYCA 4ISRA 3OOXA 1W8UA 2OIIA 1UX6A 1AR61 1URXA 1X50A 2VQTA 4FPYA 3POSA 3NNFA 3WF1A 5I0SA 4I3PA 3ZFFC 4ZU4A 5FLIA 1K42A 1JHNA 4CCOA 3KF3A 5FPXA 4HSJA 5HI0A 2AENA 3UJOA 4CSWA 1V6IA 4L99A 4EWEA 3AXEA 2XPJA 5HV0A 3NNLA 5LA9A 4M00A 3WLUA 1LHUA 1WMEA 4LBKA 4LO6B 3A22A 5DAWA 3UT0A 1UMIA 3CMGA 3KVBA 3AP7A 4MGKE 1W8OA 3WG3A 3ZN5A 4O61A 1DQ5A 3ZN6A 4AL9A 1UU5A 1ZZ8A 1ALYA 1J3RA 4NE9A 3H9AA 1PGW1 1JYIA 3FFZA 1PO23 2WWSA 4UYBA 3VD7A 4B1LA 2BGPA 1S0DA 4DS0A 2BGCA 2MEV2 3HEIA 1S4CA 3FFQA 1GANA 4JC1A 4MGQA 4XFFA 1COV3 4K1ZA 4WV8A 4H3WA 3LPGA 2KXLA 1FXZA 1RUD2 1QMJA 1VB2A 3ETPA 4RQPB 3NQHA 4NPMA 2ZEYA 5FMCA 3BGAA 3MHZA 2EF6A 4GJZA 3ZFGA 2JDYA 3DYMA 1PO11 2VMCA 3SH3A 3OPWA 3AB0A 4LBLA 4BM8A 1WGPA 1FPN2 2E51A 3DKWA 3WHTA 2FQPA 2DUQA 2YGLA 1EY2A 1QJY1 4H7MA 1RVF2 4LLFA 4YSFA 1VJ2A 2WINB 4HVOA 4PLMA 2HYKA 4FFGA 5IVCA 1NY71 4YG6A 4CP1A 1NZIA 4P9GA 4B8EA 1AYM3 2OT7A 4CCLA 1UCXA 5FZ1A 1QGLA 4P9IA 5FXWA 2O14A 5FP3A 2OXBA 2OZJA 1OLMA 1IGOA 2VM9A 3VBHC 3ZN4A 1QU0A 5A3OA 2MNGA 5FYZA 4A42A 1AX2A 3PVBB 3ZOIA 2VZVA 2XB6C 2RS33 4KBZA 5FZ6A 1HB2A 1K12A 4BLIA 5ABJB 2R6QA 1WW7A 2JDAA 1X9PA 3U37A 1K3IA 4AZZA 1KD7A 2GDFA 2VBBA 1G9DA 5I8SA 1UZZA 2WT1A 3DGTA 5DDJ2 3W20A 1SMVA 5C4WB 1MR5A 4NHYA 4RGAA 4JAAA 3WUDA 4MGIE 1DHKB 3C7GA 1G9AA 5ANQA 1W2NA 5FMBA 4IE6A 5FZ0A 1FOD3 1IG0A 4RHV1 4EYUA 3PUAA 1RMU1 4WZCA 5G04L 3T3YA 3ENRA 1ODNA 1OQEA 3JXSA 1O3RA 4N9HA 2ZKLA 3OG2A 3RGBA 1HN0A 1V9U3 2JICA 3WG1A 2VCBA 4SBVA 3T08A 2PMWB 2Z69A 1RUF2 1ZRFA 3M8LA 4JZRA 1G9CA 1UAIA 5J37A 1F2NA 3VBSC 5KXBA 1TME3 1NA1A 3QOPA 3EYPA 3VBFC 1F5FA 2WNVB 4XOGA 1WUVA 1WMFA 5DAQA 3H7YA 3KSCA 2GU9A 1UXZA 3M3QA 3UGFA 1GLHA 3PU8A 1YFXA 3SCGA 4EROA 4YFWA 4NIHA 3LDBA 2H0BA 2ZMNA 5DQ0A 4JKMA 4GH4C 2Q5TA 1PNFA 3MLKA 4D0QA 3GZTB 5CEHA 1TVGA 4LMFA 1WBFA 1RHI2 5JOZA 2RDNA 4OI4A 3KZ4C 1V6NA 2W87A 4M3CE 1NQDA 5CYYA 5FOBB 4XAEA 1QJU1 1TNFA 1OLQA 1PVC1 4CDQA 4UI9L 1JXNA 1W2AX 4B3NA 4XCAA 3MZHA 3WF4A 4KU7A 4AYUA 4C8DA 4YZ3A 1V00A 1RUD3 2B9VA 4Q0SA 5DUXA 5BV6A 1ZBE1 5AC93 3N9NA 1YIPA 4XILA 1ZZ9A 2JE9A 5GJ6A 5C5UA 3SITA 5F1RA 3U4XA 3IAQA 4D6RA 4Z07A 1IQAA 5FZ9A 1MACA 5FZDA 3T0AA 5ISLA 4Q0QA 3EXUA 3OYWA 2YYOA 4BMBA 4D94A 2KR2A 3MIGA 2XOMA 3LIGA 2VCCA 2EXKA 1HDKA 1VBC1 4DUWA 4ASMB 1KITA 1SFYA 3ZSKA 2EVXA 1W6PB 1C3HA 1DQ4A 1O3SA 1PMJX 3K2OA 2R0HA 1A3KA 4HMZA 4F7ZA 1OVPA 3MIHA 5JOYA 4DXZA 3VBUB 1Q8QA 3CJXA 4YW4A 3IKWA 3B94A 2IXLA 1JZ2A 4U2AA 3FHQA 5FZ3A 3RQ0A 2BBVA 4QKBA 3I2KA 1WBLA 2A6XA 2R072 4HPKB 5FZ8A 2WFF1 1JN2P 4E4DX 3SH4A 4AVAA 1LGBA 4K20A 1NAEA 4G3YC 4D8MA 2J1UA 4QPGC 3JU9A 5CADA 1YJLA 2YU1A 2ZZJA 4GZ9A 4HLTA 1X9TA 5C3QA 3VDBA 4IESA 5FV3A 3N7JA 3GZAA 4QB6A 3TRSB 2G9ZA 1V6OA 5LA1A 4IEOA 4KI5M 2JKXA 4BIOA 1S2EA 3WP5A 3I3QA 5FO9B 1H8TC 2WS92 2DCTA 3K3NA 4H14A 2ET7A 2WZR2 5EP9A 3O12A 3SCHA 3J7MA 3CLPA 1U5ZA 5LEKA 2E26A 4PIZA 3OEBA 2I45A 2OQ7A 4C0HA 3KHCA 1QHDA 3KT7A 2JDPA 4D7YA 1WW6A 3WX5A 2XJQA 1AR92 1X8EA 1ZZBA 5FYUA 2LM3A 2VMIA 3RI8A 3O5SA 1RIRA 2GC3A 1TG7A 2WAOA 1XNBA 2WNUA 4AAPA 1VBA2 5J1XA 1CD3G 1OD5A 1M06G 1Y7BA 2ZZQA 3JD72 4QX5A 2NMNA 2WZ8A 4QKNA 4AGVA 3N4MA 2R16A 2W5FA 2P3IA 5T3NA 3HQUA 4XZUG 3GALA 2PHDA 4UBGA 5C8CA 2XL9A 3AZYA 5J96B 1RUJ1 3GHNA 1O4TA 3QH6A 1SPPA 1ZZCA 4W6WA 1EAH2 2E7QA 1J58A 1N3QA 4KWLA 5F3EA 4RS5A 5ACA2 3O0WA 2YV8A 4MLOA 4OQ9A 3AMPA 2HWF3 1OKQA 3FHAA 3ZDVA 2FMYA 1XJAA 1NCRB 1UIJA 2IUWA 3ZXDA 1ULGA 1W6QB 4MHRA 5J98B 1W6OA 2W0XA 4FOQA 3ZR5A 4QQLA 4LE4A 2A75A 3BPSA 3DEMA 2NYYA 1LOCA 1EV11 5LB6A 2AEYA 2P4EA 5FZHA 3HQRA 2VMDA 2D6LX 4U36A 2P5BA 1D7PM 2FCVA 3B69A 3KB5A 5D1IA 2XHKA 4FXKB 3VGIA 4IV3A 3WQ1A 1JUIA 1Q8SA 3TEYA 1D4M2 2A71A 1KFXL 4ET7A 1OSGA 2PHXA 3AKTA 4A7KA 4BA6A 4GJYA 4XF3A 1B09A 5L7OA 3I2OA 1ZRCA 1UQXA 3WSOA 1G86A 1QQP2 1PK6C 1H2MA 1PIV2 1QY4A 2ZHMA 4XW3A 3PUSA 2VH9A 3GZUC 4PF5A 3RSJA 4E4HA 4JX0A 2R32A 2JKBA 4AI8A 1YQ8A 4XFHA 1BK0A 2TUNA 4AAXA 2D6PA 4O65A 2R073 1YQ5A 1LULA 5EJ1B 1XPWA 4E9KA 3I97A 5A3TA 2ZABA 1RUG1 3NAPA 4LK6A 1AX1A 1VRH2 5FREA 4F8AA 3DN7A 2PHLA 3QACA 4IEVA 5JIAA 4FSJA 4Z2WA 1LTEA 2JXAA 4IE0A 4CUCA 2VECA 2WYFA 1FMD1 4Q4Y1 5EWSA 2HWE3 1J1TA 1C8M2 2P2KA 3NNJA 2RG4A 3RPQA 5CAZA 3IDCB 1N3PA 4OI2A 2VO5A 2HWC2 4K40A 2CV6A 3U14A 1IZ3A 1OOPB 3RYPA 3OY8B 1O8PA 1W99A 5LBEA 2WZR3 1AF9A 4LXLA 1GP4A 1ZX5A 5CU1A 5HCAA 5FO8B 2WUHA 3E97A 2ET1A 3I3EA 3AKQA 4IEUA 2ERFA 4COWA 1B35B 1OQ1A 4HKOA 4Y4YA 3G6JB 5A33B 1W2UA 4FOWA 2LW8A 1AR93 2EAKA 1QDCA 2PLV2 2Y6FA 4WBBA 3JQXA 5GZFA 3WUCA 5A6ZA 4UW3A 1LOAA 1F15A 2C24A 4A41A 1PM4A 1VBA3 3WNLA 2BP6A 1R081 4XUOA 2ZHLA 4JKLA 1UWWA 5C4WC 1NXD1 3VLBB 2RMU1 1PM7A 2VUJA 3KT4A 3NJZA 1VBB2 3CL1A 1XNCA 2VQAA 4YWAA 1NT0A 1WCSA 5KXDA 3O1MA 1K5MA 2MHFA 1A8MA 1HRI2 2W1QA 1H2KA 3SNMA 2P34A 1RC6A 1RUC2 2VR4A 2X53S 3NJXA 1D2SA 1V6KA 2VNOA 2WLPA 5HXMA 1POV1 1WD4A 3P3PA 1HQLA 1NXMA 2IFRA 3MIBA 1LNSA 3ACIA 5ACA3 3BU0A 3OEAA 3IPVB 4IL7A 4QM8A 3TN93 5KWRA 2VU9A 1ULEA 4FPCA 1W9WA 2IXJA 4GB31 4ARYA 4F3JA 4PJYA 4TSVA 2JIGA 4A6OA 1UPSA 2WNVC 5DAXA 2RM23 3EHKA 3VZKA 3I3DA 3K48A 2QZ2A 4G9SB 2YMZA 4Q4W1 1BK1A 4FP3A 2A6VA 3JB4C 4L0PA 4HOOA 3UV9A 3ZYJB 4DUVA 1GWLA 1C8NA 1D4M3 3E1F1 4ITCA 1HXS1 3K4ZA 2WN3A 4PDWB 3C2UA 4XFIA 3WDUA 3ZSEA 4DFSA 3FWEA 3ZSMA 3MW3A 1OC1A 2D40A 2FZ1A 4BLJA 5EHDA 4Z92B 2VQ0A 3JBG2 1XU1A 4FAGA 3MW2A 1VMJA 3FE5A 3PIGA 4R9AA 4Y20B 3C3VA 4YW7A 2G9GA 4OZXA 2QQUA 3PHMA 2P3JA 2BQPA 3I59B 1GZCA 3KCYA 3GJBA 5F8PA 5EQUA 1BJQA 1KEXA 4LIUA 5C3SA 5J48A 3IZOA 1Z78A 1SFNA 3VD9A 4LO8A 4CVUA 2YPDA 1UZVA 1NZCA 4KU8A 1ASJ1 1WLCA 1XE7A 4CE8A 3JQWA 2BNOA 2D6MA 2I74A 3M70A 4BJ0A 4ZU5A 2K9ZA 4CU6A 1DGWA 4ES8A 1W8TA 1GP6A 4MOAA 5FK7A 4KBBA 3VBRB 4AHXA 5LASA 3UGGA 4C0BA 2QJVA 4YVWB 5BNOB 4LBJA 2VNGA 1OH3A 2DWRA 1H0BA 3NV3A 4XTMA 1QF3A 1MEC1 5KHIA 2WN2A 4LBQD 4AHWA 2Q1MA 4OYUA 3IMNA 3RZLA 3VL9A 4IEWA 2HWC3 4GMP0 3FHIB 1HV1A 5FZOB 1ZZ6A 2HWB2 3CDZB 2UU8A 3N3HA 3VBUC 1F8VA 1FI2A 5L9RA 3VBHA 4G4FA 4AI2A 1MS3A 4AR2A 5CFCB 1LECA 1US2A 3ZYIB 2DTYA 3U4SA 4CP2A 4KG0A 1CAUA 4A4AA 3ECQA 3BKZA 3L2YA 2XQXA 3J26N 1PO21 3INAA 4MV2A 3BTYA 1IS4A 4AXOA 4NIGA 1H2LA 1ENQA 1LR5A 4R9BA 4LEJA 4META 5GLZA 2NMOA 1COV1 4FFIA 4UOJA 2OQ6A 3VB9A 3D3AA 3C7EA 4J25A 1UYZA 1ZBA3 5T52A 4D3WA 4K3UA 2J1TA 5JR2A 3VKMA 4J6GA 2ZTNA 3H1MA 4LO5B 1MS8A 1E5SA 4UW5A 2DVGA 4YG3A 3KM5A 5F6LB 1W8FA 4RSUA 3CKHA 1V0AA 3RZZA 1MPXA 2GNDA 2GH2A 4B1MA 3SMHA 1XYOA 4GWIA 1AL0G 2VMGA 3NW4A 4LA3A 1T6GC 3RZKA 5LEJA 5B4XA 5KC5A 4A44A 1SCSA 5K4LA 4YZ1A 5JXHA 2BZDA 2J1EA 4JGZB 1AYM1 2Y6LA 3RZGA 4I0BA 2D3SA 3POWA 4XBQA 3RDIA 3VBFA 4A45A 4FTSA 4P08A 1NG0A 5JSRA 4AQSA 3TOJA 2PQSA 3LSEA 1N1SA 1LODA 3K4AA 2WT2A 2JDKA 2PAKA 1W6NB 1IOAA 3RYRA 3USUA 1FV3A 1MVQA 4LJHA 1W8NA 2RS31 4AEDB 3UKTA 5GZEA 2WNOA 2VUCA 1YQ2A 4UFLA 4S2HA 1W8WA 4LKEA 4NPLA 4I0WB 4AF9A 4QPIA 1AL21 5T55A 2HYXA 3VKFC 5A70A 2B7YA 5FMOS 5KHKA 4DO0A 3CZUA 1VLNA 3J7LA 4Z2AA 5CA6A 4XF1A 1FOD1 4XIOA 2XJRA 1NCRC 1RUI2 1R1ZA 1SBFA 3BTZA 2X05A 3ST7A 1LOFC 3T2QA 3BYWA 1MVEA 4L11A 3H8OA 2XJVA 1HX6A 3MPBA 4GXLA 2D43A 4LO7A 1V9U1 4WM7B 2J1VA 3CO2A 5FOJB 3OD0A 3TEXA 3WT3A 2QZ3A 3PURA 2VW2A 2Y8KA 1IQDC 1GNZA 5I93A 1W3XA 1TME1 2ZMLA 4XBNA 1KRIA 1NYWA 1UOGA 4CDWB 2J1SA 1EP0A 2XGXA 4FPLA 3W59A 1GP5A 1L7RA 3HN1A 5F7UA 2QBXA 2VNVA 2XVGA 4KNCA 3ZIXA 3X29B 3ZVXA 4OHVA 2K2SA 1CIWA 3GXUA 2FMDA 5LBCA 3VN4A 2CNAA 1JODA 2ZPXA 1XQNA 2BU9A 2ZX3A 3ZKUA 4AQ6A 4WVMA 5FYHA 1R092 1AR73 2RS52 2XLFA 3FN9A 3GBFA 2VZQA 1JZ4A 1ULFA 2A5ZA 2KM2A 4JHTA 3CIHA 3POBA 2B8MA 5FPVA 4LIVA 3ZYBA 4PBOA 4BB3A 2EXIA 3ILFA 2D6NA 3FZ3A 1GZ9A 1SACA 4I01A 2JENA 4YLZA 2VZ1A 2VPVA 3IDEA 3S57A 5EPAA 5TSWA 2WZPP 4CDUB 1SQ4A 5JIUA 3SC7X 3RWKX 2YFUA 3Q8BA 3WDXA 2A3WA 1RUD1 1L3JA 3I4IA 2XKPA 5EFUA 5AC91 3ZXGA 5DUWA 2JE7A 2BOJA 2FDFA 4LHLA 1OOPC 1MZ5A 4DRVA 5D8AB 1AYN2 1H8TA 1VMHA 1CZSA 3EQEA 3KT1A 2W68A 4RR3B 3WDTA 4LK7A 1IS5A 4FQZA 3J8F2 4K6BA 5BUVA 2VZ3A 4XIKA 1SZBA 4EJRA 4ES9A 3DCQA 3I2HA 5KBFA 4R9DA 1C4RA 4LORA 4OZOA 5JOXA 5LZ6A 4B7EA 3V0AB 4ZU7A 2RR12 4XUNA 1ST8A 1YRZA 2QQLA 2XXZA 5A3UA 2G19A 4BQ3A 4XXPA 2JD9A 3RNSA 3B00A 1L7LA 1CAWB 2GC1A 4EQVA 5ABJC 4DEQA 1FT9A 1YJKA 2Y6JA 3CQOA 4IXLA 4BDVB 1H30A 2ARBA 5C70A 2XWBB 3G7DA 3ALQA 4PBPA 4EZ4A 2RDQA 2Z4FA 1UMHA 3IDAA 5CB7A 1LAJA 1ZRDA 1GR3A 4KGQA 4ZY9A 1JU3A 2WBKA 4QX0A 4XPVA 5FZ7A 1HN1A 1F4AA 3FUQA 3O1PA 1C1LA 2CDPA 3VBRA 3WDVA 1X82A 1W8HA 3A7QA 2EXJA 4IETA 4XJWA 5CFDB 3ZMNA 3A0KA 2JG9B 5FP9A 1KDKA 1TMF2 2DURA 1GUIA 1MZFA 3RS6A 3EO6A 1QOOA 5A32B 5BXXA 1DBNA 2FDGA 2W91A 1HRV1 4OHWA 1YYNA 3PNAA 1BVP1 3MBWA 3C7FA 4QDRA 3I2GA 2ORXA 5KHHA 2R49A 4PDWC 2Z42A 1WCDJ 1C5IA 5D21A 4J1XA 5IATA 4Y5TA 1P8JA 5FUNA 2VUDA 5CG8A 3BPZA 3HVDA 3OBAA 4CYDA 4FTBA 1AR83 3VBOB 1TNRA 3M3EA 4YGDA 2V5DA 1J59A 3HT1A 5LA0A 2W2IA 1YNAA 1PK6A 2L9LA 2P6HA 3GCWA 2WAAA 4AEMA 2WR9A 5FK8A 4C1XA 2SBAA 1UY4A 1R093 4W65A 4DOUA 1POV0 2DDUA 5FYSA 2YBSA 4DNYA 1VBD3 5CG9A 2WZEA 4DUXA 2V09A 1IKPA 1G9FA 5C6CA 1IS3A 1UW8A 3HNBM 5E16A 2HEVF 4HT1T 5FZFA 5CISA 2RJLA 1LGCA 4JDNA 5GLWA 1S0BA 2RS12 4CEYB 4BQXA 2HWF1 5BNPC 3WHUA 1OA2A 3HJRA 3M3OA 1RTVA 4URAA 4LA2A 4CUGA 3V0BB 2RJKA 3O1OA 5BNOC 4YVWC 1AXYA 1PMIA 4N7UA 4IEQA 1JYWA 1KS4A 3MYXA 1PZ9A 2TEPA 1STMA 3N9LA 3FBYA 1UL9A 2W08A 1AXZA 1WMDA 1VPHA 1ND2B 1Q8OA 2GN7A 3LZZA 1V6LA 2R043 2X5IB 2B39A 4GQ7A 2GH8A 5IVBA 1AYN3 3KQRA 4YM0A 3LD8A 1J3QA 2QQMA 3AMQA 5DZGA 2Q1FA 2R063 2WQZC 3B9IA 4AVSA 1O59A 1I3HA 3J8F3 1E5IA 1W9YA 2FBEA 4O9EA 4KMQA 3D5OA 2ES3A 4J1WA 4FPGA 4MVTA 4XQWA 3BALA 5EV7A 1H2NA 3LEIA 5FTTC 3LKJA 5BY5A 5A7WB 1PVXA 5ABJA 3AL5A 1BBT1 1RUH2 3I2JA 1O5UA 4Y1ZA 3SISA 2BJSA 2ARAA 4Y5Z0 1O7FA 1PX4A 4XAAA 5C4WA 3LDKA 3QLQA 5JSPA 1DDLA 2NN8A 1AJKA 2X09A 2R071 5JAXA 2XL7A 2D98A 3LGRA 3OPZA 1LU1A 1UZYA 4Q0UA 5IFTA 1QXRA 1VBE2 1GWKA 1JOPA 3N9PA 5DZFA 4UAPA 5IVFA 4NMIA 5LA2A 1UY3A 2GC0A 3AFGA 3OD4A 4L8QA 2HWE1 4LBQA 4XVHA 2PHFA 3ZIWA 4MZUA 2EIEA 1IHMA 1HIXA 3UETA 2E9QA 4QX8A 3HN3A 2DTWA 3T2PA 3GBGA 4AFDA 1RJ7A 4QXBA 2FHRA 4XXAA 3HNMA 4BYYA 3HT2A 4XF9A 1VP6A 2YFZA 2P1BA 2WNVA 4CXYA 1ZZ7A 3DKQA 5ANNA 4QXKA 4BISA 3KGZA 1R1A2 2R30A 4DMIA 3GCXA 4AEDC 1GNHA 5DABA 3PU3A 5C3RA 2HWD2 3VHRA 3I3MA 4RS5B 3HAGA 1QJX3 2ORZA 1YXWA 4OQ8A 1VBA1 3R4UA 4GULA 4GAZA 5SV8A 2NPIA 4FXGB 2W94A 4N43C 4PQ9A 2Q8DA 1LKNA 2Q8EA 1MQTB 3POIA 2BBAA 2NM1A 4CDXC 5A3WA 2YY1A 5A6YA 1S2KA 2DBIA 2X10A 2ZCWA 2QDRA 3GM8A 3VV1A 4JQRA 4NRQA 1VAVA 2GAUA 1WW4A 3TN91 1YFUA 4ZXEA 4BE3A 4NWVA 3RG0A 2D44A 2C9KA 2GMMA 4P9LA 3VKOA 1ZVFA 2AREA 3LSDA 4CDWC 3O1RA 3BN6A 2XONA 3W58A 1E5HA 1Z7S1 2RM21 1H4GA 5T5JA 1JZ8A 2GNTA 2VW0A 2WSVA 3AYDA 1BEV2 1W6PA 3PTRB 2XWJB 4IE5A 1YCIA 4CP0A 1VMFA 3O7OA 5A7NA 3PL0A 5LW9A 1GOFA 2CHHA 4RGKA 1DQ2A 3I7DA 4IGPA 4EN8B 4ZHNA 5A3MA 3VBUA 3S7EA 5BPXA 1OA3A 1VAKA 2R1BA 2CYFA 1W2TA 2D7FA 4H2AA 4JRLA 2B46X 4Q4X2 2MEV3 3POEA 2K46A 2C6SA 3H7JA 1RUNA 1WCQA 1TE1B 2HEWF 1QOTA 5IAXA 3CJIC 2FDJA 3MO4A 2XLGA 4EWAA 5FY4A 1PX3A 2ZX0A 5GZCA 3N36A 4EN7B 2J1RA 4BXFA 4CEWA 1W05A 2B4KA 2GSYA 5FQ0B 1AR62 1LCLA 4P9YA 3H8XA 1IKQA 3AVRA 3AZZA 3KVAA 1MZEA 1LESA 1SLLA 2YU2A 4S2FA 1YC61 4UF0A 1FPN3 5FXVA 3WW2A 4EN9B 2H0VA 2CU5A 1VBE3 3LEKA 4XETA 5LY2A 1RVF3 1RXFA 3B3QE 5D8AC 1GBGA 3TAYA 4AHZA 4LNVA 2Y6GA 4L9BA 5CVRA 5GZGA 4N8MA 1REFA 1W9SA 1UU4A 3N9MA 2V73A 2BW8A 3MW4A 4O9GA 3ZPOA 4YVSB 1ODMA 4AI0A 5FXXA 3RZJA 4LQRA 3ZSLA 1NA1B 3OGGA 4FOVA 4IEPA 3ZFEC 2D3RA 3K51A 2ZGRA 4YNIA 3RMYA 3T2OA 3KV6A 4M4PA 3BI3A 3GBWA 3IM0A 4HKWA 1DZRA 1LHOA 1CAXB 2CGNA 3IN9A 4HSLA 3NV2A 5F6KA 4JQTA 5L9BA 1YLLA 1UKRA 2HEYF 1JYXA 1R1A3 1XYPA 3RYKA 1PGW2 4L97A 4XJ9A 1LEMA 5BNNB 3GNEA 1EPWA 3OPTA 5L9VA 2CGPA 3ACFA 5DDJ3 2EICA 1XSRA 4R8HA 3RFRA 3AZVA 4OHZA 4E2GA 3DPRB 3WOGA 3S7IA 3ES4A 1JI6A 2E31A 2QQIA 2P3YA 3A0NA 2AGSA 1NLRA 2DCJA 5G05L 1IG3A 4INDA 3GDBA 4YW5A 5CFDC 1PO12 3VUOA 5IW0A 4P02B 2JG9C 3RJRA 1NCRA 1ZBA1 1LHVA 1YWKA 3OGJA 1HQWA 4Y22B 5FWEA 1LOFA 1RUF3 4YZ2A 1QJY2 3KMHA 2YROA 1Y43B 4RD7A 4CU9A 2VZRA 1G8WA 3ZX7A 1NY72 5A3LA 1LHNA 4RGGA 5K8SA 1O4YA 4B4RA 2JIJA 2PA7A 4IE7A 2PXJA 1NE4A 3B02A 1DCSA 3TEWA 4E8CA 2QVSB 2DUPA 5FPLA 4DB5A 4GA9A 3WQ7A 3S6PA 2E6VA 4QGNA 4QX7A 4CCMA 4FBFA 3L9JT 1EUTA 4A7ZA 2Y6KA 3ATGA 3ZSJA 4N53A 2XR4A 4V1PA 3N9QA 3FC0A 1RHI3 5LK7B 5A32A 2WWUA 2WC2A 3TYJA 4YFZA 2F17A 2UYAA 3LQCA 3MLJA 1F31A 4NJ4A 3ACGA 2GZWA 2ARCA 3POYA 4M3CA 3K75B 4Q4X3 4RHV2 3C8XA 1OI6A 1RMU2 4NHKA 4IUGA 4NRMA 5DAVA 1XSQA 3J7HA 2A6YA 4QKFA 4CEYC 4N9IA 2VQUA 3HMYA 2ZGQA 3VDAA 5A7SA 1H8VA 1W6MA 4IW3A 3E5QA 4AFAA 4PI0A 1EYBA 4YM1A 1UOJA 1EPZA 4TXWA 5DUUA 1AR63 5JLVA 5FR3A 4ARXA 2VZPA 4XUQA 1GQGA 3H50A 1ND2C 2JDMA 4JTNA 5H9QA 1ND3B 3UNPA 2X5IC 3DL3A 4FCAA 4GWNA 4OUSA 4Y24A 2UWAA 1PZ8A 3HPNA 3M2MA 3PDQA 5L73A 1DGRN 2WDBA 2ZEWA 3NV4A 3CNAA 5E1RA 4WZFA 5C8WA 1AX0A 4GKYA 2DFCA 3LCPA 3M4FA 3R05A 4FPEA 1JTZX 2A70A 3H1YA 2OPWA 1KQRA 2SLIA 4B7KA 3AP9A 4XDQA 4FT8A 4NIDA 5EJZB 2NP0A 5A33A 5JR7B 3NMBA 4Q0VA 5A6XA 2X8KA 1ENRA 2WA3A 4YGBA 2WNUB 2BFUL 4RQPC 5CBLA 1AR71 1Y3TA 2IFWA 4ISQA 3WDWA 4AVCA 4M3CF 1M4WA 1H1AA 4NOTA 5F2WA 2XBO1 1LU2A 2JDUA 3WNXA 4Q8LA 3MICA 1QJU2 3FLPA 1PVC2 3O0VA 2D6KA 5KC6A 3OF1A 1OUSA 2ETEA 4X6RB 5HCFA 5JPNB 4O7XA 2YC0A 2O8OA 4HONA 1FYUA 5JOWA 4GD4A 1ZBE2 4A7YA 4GWMA 3RVHA 5JMCA 3KGLA 4AFCA 4JDMA 1BYHA 3IPVA 3WW3A 2WS93 3ZYGA 1PO13 3NNMA 4OULA 4DY5A 3FJSA 1MS1A 3U10A 1ZA4A 4LE3A 1TEIA 1BXHA 1A8DA 3DUIA 1VBC2 4XUPA 2YUEA 4AI9A 2ATFA 1QOSA 5IK8A 2VULA 4IV3B 1JHJA 1T2XA 3AKSA 1GICA 1XYNA 1VRBA 2P6CA 2GMPA 5FAXA 3JD73 2VC9A 1UNBA 4BK4A 4XF4A 1OQDA 5L7OB 3OGVA 4FFFA 4M4RA 1N1VA 3IIAA 5A80A 4Q8KA 4FQ4A 1RINA 1UYYA 2WFF2 4PCRA 5T50A 1KJLA 4XFGA 4FPFA 1SHWB 4Y20A 1S0GA 3OBZA 1HLCA 1MQTC 4K9SA 4MADA 3J4UH 2Q8CA 1EAH3 2VUAA 3QCWA 5JWPA 1O3QA 2IC1A 4W6XA 5DXDA 3OBRA 2WL1A 3LA3A 3BTAA 1DGWX 3I3BA 5F5CA 3ZFFA 3ZKYA 1RMU3 2BOIA 4I02A 4BZ4A 4D7SA 1CAVB 5LATA 1PGSA 1D0HA 2BVVA 5BNPA 2WQ8A 1AJOA 3OCPA 3POJA 3S5QA 4DINB 2FDHA 1E57A 3ORJA 5BNOA 1YQ6A 4YVWA 1QJFA 3V65A 2D5FA 3P6BA 4EE2A 4FAHA 1JYNA 1IPKA 4COUA 5FYYA 3RRDA 1KDMA 1PNGA 4OMCA 4Q5OA 5EXOA 1PMHX 4LR4A 3MUY1 4BQWA 3EB7A 4BHPA 2BDRA 3AVSA 2NLRA 1REDA 4LOSA 3UL2A 2IWGB 2ARXA 1QQP3 4HVRA 4LUMA 1PIV3 3T4HB 3HD8B 2W1WA 3M3IA 4MO3M 1UY2A 5FBZA 3P3NA 1AR81 2ZGUA 1DF0A 1YI7A 5IJRA 4QAWA 3W5MA 1QEXA 4GMP3 2W52A 3N9OA 1C57A 2X29A 3MF9A 4KWKA 3LOIA 1S2BA 3DV8A 4RFRB 1ZNPA 1LOGA 1R091 1U5YA 2E33A 2QE3A 3KWVA 1O91A 4QQHA 3B01A 3B7MA 1VRH3 1VBD1 3D82A 1OT5A 4MXVA 5F32A 1HKDA 2LRPA 4RYDA 1K5MB 4CA9A 1RUE2 4Z82A 2GP3A 3PUQA 4W50A 1UYXA 3RI9A 1CONA 2C4XA 1C8M3 1GU3A 3N7MA 4YW3A 4GWJA 2QQJA 3L2HA 4CXXA 1NKGA 1YUDA 1EV12 1W0NA 3OUJA 5L36A 3BTXA 1XU2A 2FDIA 3E6BA 1CJDA 3C7OA 1BMV1 2DU1A 2PHRA 3QH7A 4YVSC 5A6QA 1DQ0A 4Q0PA 2FZ2A 3ZM8A 2YG0A 1QNWA 5FY1A 4AW7A 4BXSV 5I8TA 2WFPA 1LJ7A 1IPJA 1WKYA 2R041 3THTA 2HH9A 2O1QA 4P9XA 3GGLA 1CWPA 1HJFA 1APNA 2R061 2XDVA 2JD4A 4QPYA 3J8F1 2PLV3 3WP3A 3MUZ1 3QD6A 1UX7A 4QXHA 5BNNC 4LBOA 1W6NA 2UYBA 2Q4SA 2W39A 2QFEA 4AEDA 3LEMA 1Q5OA 4I3GA 3U07A 2VOKA 2GMEA 1VBB3 3DPRC 3GJAA 1QH6A 4AFMA 5J3UA 3H3LA 3T09A 1HRI3 3AM2A 1SEFA 3C7HA 3ZPYA 2DBNA 1RUC3 3O0XA 1RUG2 3MI8A 4HZFA 4N43A 1ZA7A 1YFWA 3ZXKA 1SLBA 1LEDA 2ZXQA 4QT6A 1C5HA 1O8SA 4CDXA 2H6BA 2YZ4A 2J22A 4CCKA 2Y26A 1FMD2 4Q4Y2 4BQ1A 5JUVA 5HBAA 4KH9A 1WLWA 3KCXA 4MXWB 2VZUA 4EV0A 3LA7A 3VBSA 1BHGA 1S0JA 4YARA 3TNQA 2B45X 1PGL2 2YC4A 3UJQA 3ACLA 1KXGA 3VDDB 3KV9A 5J7MA 3MLLA 1J3PA 1YFYA 4CDWA 2HKXA 3LAGA 1JUHA 1L7QA 4YW6A 1JZ5A 2FCTA 4Y5SA 5CNAA 3VZMA 4QXCA 4GH4A 1GQPA 1VR3A 2B5HA 5C3OA 1JMUB 2Y38A 2ZEXA 3HR9A 3JCIA 5FPBA 4HBNA 4CP9B 1US3A 2VTXJ 1HJGA 3JBG3 2PAEA 4QM9A 1R082 3VBHB 3ZR6A 2OUJA 4F83A 3ZXEA 3O1TA 2RMU2 1QJX1 2XQRA 4PLNA 3MV01 1U5IA 1S0CA 2VXJA 1NCQB 1C28A 4I09A 3VD5A 3U0ZA 2VAUA 5KXCA 3ES1A 1RGSA 5FZAA 2XJPA 3N7KA 4ZZ8A 3VZLA 2BEOA 3CJIA 1XNAA 1BVVA 3AXDA 4LULA 5LK5A 1XNDA 4BMEA 5DMYA 2BV4A 1F35A 2QQOA 4IV1B 1SDWA 1U0AA 2WKKA 3ZXFA 4D6QA 5J09A 5HPOA 4PIYA 1OXCA 4GB32 5EIYB 1RUE3 2VCMA 2VOVA 2C26A 3H42B 1BZWA 1DYKA 2C5DA 1OPMA 5FCCA 4UW4A 3BUCA 1XBFA 3H3ZA 1ND3C 3RMXA 5FZEA 5H9SA 5FXZA 3SEEA 3AFKA 5SV5A 4CU8A 3K77A 4LKSA 5D8AA 3USSA 2G1MA 2BNMA 2A73B 2RV9A 4YG0A 4NUBA 1G6NA 4LBMA 2DV9A 4PLOA 1JYVA 4Q4W2 3ZXJA 3TB0A 1X33A 2HWB3 5F9TA 2IXIA 1DIWA 2DF7A 1HXS2 2B42B 2OPKA 3DXUA 3E6CC 2RJ2A 3A23A 4UW6A 4XCBA 3ZFEA 5E6HA 2E32A 5GLUA 3V0AA 3CF6E 2WNUC 4YYOA 1GZWB 2XUMA 3KHBA 1WWYA 4MUVA 4XUTA 1SLTA 4OMDA 1WA4A 2Y34A 4LHKA 3ZYPA 4PI2A 4CCNA 2MEV1 3CEWA 4FVVA 1N1YA 4HXCA 4QPGA 4YM3A 4RL7A 2ZGNA 3ILNA 5FMDA 2PQQA 2AC1A 5FIXA 1FATA 1S0FA 3BIWE 4QPIB 1ASJ2 1JH5A 3POFA 4LOTA 4MX3A 4BQ2A 5IYYA 2WSUA 3D6EA 4JGYB 1RUG3 1DGRA 1ULCA 2W1SA 5I0DA 2RVAA 4BIFA 4YW1A 1UO9A 3OBTA 1J84A 5CFDA 4NAOA 2JG9A 3K4DA 4CRQA 4MG2A 3HQXA 1FPN1 1G7YA 1FMD3 4Q4Y3 3VHNA 1VBE1 1RVF1 1MEC2 2QNKA 1B35C 2QDNA 5I0TA 2DCZA 3DXTA 1ONAA 1MS9A 5FYTA 5A1FA 4IV3C 5FY8A 1SCRA 5C3PA 1NLSA 1UIKA 4E4SA 4PT6A 3ZO0B 2E7AA 5L7OC 3S30A 5DG1A 2E53A 3AKPA 2P3KA 5AVAA 2ZEZA 2ID4A 4PIXA 3K46A 4P9WA 3J9SA 3ROUA 5C71A 4OCTA 5C9AB 4WVMB 3WW4A 3WEZA 3NSTA 4XBLA 5DDJ1 1XE0A 4L92A 4Y26A 5JZGB 1D4VB 2LUWA 1R083 3LFMA 1SBDA 3MIDA 2OS2A 2DUOA 3EBRA 2O8QA 2ADEA 3B5LB 2V4VA 4A3ZA 1C1FA 2ZAAA 2EA7A 1RUI3 3LB9A 5FMOL 2JE8A 5F5IA 5T5OA 2XKOA 4FPOB 4ZS2A 5F3IA 4TYSA 2LROA 1SBEA 4CEYA 2ILMA 1POV3 2JX9A 3DYPA 4BQ4A 4LO4B 4ZS3A 3V0BA 3A4UA 3ZXAC 2WWJA 1JZ3A 2IXKA 1JZ7A 1RUF1 2EIDA 4V2WA 4W8JA 4K1YA 4FFHA 2Q30A 1H6XA 2DVDA 3MIEA 5T54A 2QQPA 5I0RA 1Q8PA 3E6DA 1W9TA 5FJHA 1ND2A 3PUIA 4NRPA 4XABA 4B4QA 5IHRA 5K0UB 4HETA 1AYM2 1AUYA 1ULPA 2X5IA 5DUVA 1OFNA 1JYCA 2B9UA 1QWRA 3APBA 3HOBA 3U78A 3WV6A 1XE8A 4Q4W3 1BCXA 4CZSA 3N35A 2RS32 2RS53 1HXS3 2Y0OA 4CXWA 1DQ1A 1DZQA 2R0FA 1QXPA 1RYYA 3AYCA 5JI7A 3O1SA 1JW6A 3UKVA 1U5XA 1W06A 2JEMA 1RHI1 3PJYA 4RQPA 1MS0A 1AL22 4MGTA 3WF0A 3W5NA 1IPSA 1IS6A 5LBBA 3SCFA 4COYA 5F2SA 1H4HA 2F6BA 4E2QA 3N7LA 3VBRC 1X36A 5B2GB 2WO7A 2VNRA 3ME2A 5CKNA 1W8ZA 3J7NA 5H9PA 1O3TA 1Y9MA 4MHUA 2QUOA 1V9U2 5JPMB 1W28A 4WM8B 2BWCA 3Q9OA 4NIIA 4BOWA 2ZGTA 4P9JA 3PVNA 4UFKA 2ZMKA 2IZWA 2WJSA 5CZKA 2ZX4A 1TME2 1FNZA 5FYCA 3I54A 2XMLA 4XDOA 1MEC3 3CZJA 1DYPA 1LHWA 5CFCC 1DLCA 4GKXA 3BU7A 5JDBA 1SLCA 2IXCA 2RR13 2BNNA 4NHLA 5DN2A 1FV2A 5APAA 5IT6A 3K3OA 5FP4A 3P1IA 4YPJA 4JTOA 1H1IA 4XMAA 5EYYA 2BGOA 5LWBA 2JG8B 1W3VA 5FY9A 2GP5A 1PK6B 1GOGA 2XVLA 2VZOA 1LGNA 4ATFA 5AFEA 1MQTA 2W9XA 2PN5A 2XH6A 3IDBB 2I2SA 3IMMA 3WD5A 2BERA 5FYMA 1Y9GA 5C7GA 1HB1A 1TMF3 4XFBA 5AC92 2PYTA 3AMMA 2RHPA 4JGZC 4AI3A 1AVBA 2WS91 3HNYM 5FY0A 3O1VA 2VW1A 2JECA 1SFPA 3VDDC 2WZR1 2JDHA 1UY0A 2ZHKA 4IEZA 1XB9A 2VVDA 4I30A 5GALA 2OKXA 3VKLA 2WQ4A 1OF4A 4X8NA 3IWZA 1AR91 2G9FA 4XQ4A 2W1UA 4GIQA 3VZOA 2HJIA 4I0AA 3JZVA 3H0OA 4OLLA 3ZN6B 2EXHA 2AACA 2FDKA 3E5UA 4MGYE 5I8YA 1HV0A 3JD71 5FO7B 1OVSA 4AQTA 2F4LA 3OJBA 1FAYA 4UWDA 1K45A 2VOWA 3PTYA 4AG4A 3D4KA 4QX1A 1UU6A 1NCQC 2A6WA 2WO1A 4ORFA 3R6SA 4HN0A 4Q29A 3KLSA 4LPLA 1VALA 2CAUA 1RL3A 4HK8A 1EAH1 1U12A 4BU2A 4WM7C 1AL23 2VMHA 4WVZA 5FZKA 4ASKA 2VL4A 5ACA1 5CKQA 3ZFGB 4IV1C 2C0ZA 2RS13 3HWJA 3H8RA 4Y1VA 5DAPA 3ON7A 2QCSB 1DQ6A 5FRAA 5FQ0A 1YEWA 4LT5A 4BH9A 5JMOA 2YDEA 2XHNA 2ZGMA 1GMMA 2ZGSA 1DZTA 4CUAA 1TQ5A 5A7PA 5BNQA 1LENA 5A7OA 3AZXA 5IVEA 4IERA 1JZ6A 1REEA 3PLQA 1H1MA 4LBQB 4QB2A 1HRV2 3W9AA 2UWBA 1XNTA 2VGDA 4FP2A 3T4VA 4EN0A 1D4M1 4QHBA 4UFHA 4YVSA 5FP7A 3O14A 1VB4A 5FP8A 4CU7A 4ASLA 2WO3A 2XLAA 4W6YA 5M0TA 3WY6A 4HPKA 1JOBA 1CAXA 1O4ZA 1QQP1 1CPNA 1PIV1 2DCKA 4K21A 4NAMA 1RUH3 4C91A 5BNNA 5F5QA 1D0GA 3WCRA 2IVJA 4CDUC 4FPJA 1ZREA 3T1LA 1F9KA 1UD1A 1W04A 2D3PA 3AYAA 1ULDA 1QNYA 3D0JA 4GMP1 4Q4V2 3OGRA 5FPZA 3GHMA 3NVCA 2CTVA 5I0UA 1MZ6A 5IK5A 1NUKA 3WVJA 1UZWA 3DPRA 3JB8A 4QPIC 2JJ6A 2YBKA 3NKTA 3MFCA 4JDOA 5FUIA 1W0OA 3QBQA 1SLIA 2ZX1A 5IUQA 2EALA 2CDOA 1VRH1 2E63A 4JGYC 4NVPA 3WQ0A 3LDRA 2VTFA 3HBZA 2DU0A 1QXJA 2HWF2 4AI1A 3F2ZA 3IB3A 5HCBA 4RR3C 5LCWL 2A7AA 1XC6A 2KD7A 1N1TA 2OUHA 3WF2A 4QQ2A 4YGCA 4Y1XA 3THDA 4Y22A 4YZ5A 1F4HA 1C8M1 2AEZA 3AKRA 3CHXA 4Q1PA 3KD4A 2HWC1 4AQ2A 5C5TA 4XJ8A 3W21A 4S2DA 2GNMA 4CPBD 5FKBA 5CIRA 1CGPA 2GALA 2OVUA 4AVTA 2F4PA 3AX4A 4MSVA 2GC2A 5LBFA 2ENRA 4NHXA 4ONUA 3UYJA 3DECA 4UFIA 5GZDA 3FMGA 3R4DB 4BPZA 2YGMA 3PJQA 4HKLA 4V2VA 5FZGA 2XVKA 4P14A 3BOPA 2BPA2 5LRSA 4QQPA 3WW1A 4QHOA 2GN3A 2PLV1 2OX0A 2HWD3 2YXSA 3ZMOA 1GOHA 1BBT2 4DXTA 3GYDA 5C9AC 2A1XA 2W95A 3I8TA 1PZ7A 5JZGC 2Y64A 3Q8CA 1KJRA 5IFPA 3THPA 2BFUS 3ELNA 2BRTA 3AJZA 4M01A 5FBJA 3WG2A 4ATEA 3ETQA 5I91A 1VBB1 5FZ4A 2VOXA 1O5LA 3WINE 1HRI1 4CDQB 2YHJA 4JVAA 1RUC1 1W6QA 5T5LA 4XC9A 4QDSA 3B9CA 1GQHA 4UFJA 3NV1A 3OUIA 3PIJA 4M0HA 4CEWB 1GZTA 2Q0AA 2HWE2 5AVPA 2VMFA 3KCCA 2NZ9A 1UOFA 4YM2A 4HVQA 2OW4A 3KV4A 4X6QB 2ZKNA 4UF0B 3OYWB 2Z79A 3TBDA 4D69A 1OA4A 4KGGA 1DFQA 2ZOEB 5K0UC 4N7IA 5GM0A 1ND3A 4NROA 3JUUA 5A1LA 3UKNA 4A6SA 3R4SA 3VBOC 2A3YA 2Z5WA 1R64A 2QKDA 1BEV3 5F3GA 5FKCA 1QIQA 1ZRIA 3KQ4B 5KXEA 1HRV3 3ABZA 1WCUA 3S5AA 3WZ1A 3AMHA 3LF7A 1CZVA 4HK9A 1GFF2 1MS5A 2XJTA 2H6CA 2W46A 1FX5A 4CCEA 5AFBA 2Y33A 3JBG1 2J42A 2Y6HA 1DU3D 4E2SA 5E89A 3M3CA 4IQPA 3T1MA 3HIFA 1UZ0A 5FLJA 2QTWB 2QQVA 5A1AA 1AXKA 3SLIA 5B4NA 4LHSA 4Q4V3 4AOCA 4FOYA 1D2QA 4BK5A 4CCJA 3T0BA 2TNFA 1K5JA 5FUPA 3VZJA 1ULOA 1YO8A 1HB4A 4E8DA 3MF6A 1WMXA 4OHYA 4E4ZA 1V6JA 3AMNA 3AK0A 2A6ZA 2BUKA 4JCKA 4TN7A 4WVWA 3VDCA 4WM8C 3FL7A 1Y9QA 3TN92 1OOPA 2ZGOA 3OY8A 3ZDSA 3LWCA 3S0MA 4LITA 1RUE1 4R52A 4KL1A 4LHNA 3U1XA 4QX2A 5IWFA 2DVBA 3AYEA 1LB2A 5GLTA 3UGHA 2EIBA 4DXSA 3LOBA 3AP5A 3BVCA 1Z7S2 5FDBA 1B35A 2RM22 4HG6B 2VVEA 3NNGA 1UN1A 4XJZA 4E27A 4TWTA 3NJYA 2HWB1 2JB4A 2PAMA 5IK4A 4LLOA 2WLQA 4LKFA 1Z0HA 4QU2A 4BWOA 3H1WA 4M0NA 4UXAA 4EZHA 2WT0A 4A2UA 2BTVC 2WO2A 4YW2A 4CUBA 4NWWA 4XZPA 1N47A 2JG8C 5C8CB 4P5HA 4XJUA 1GYKA 4K8FA 4NR1A 1CN1A 1S55A 1XNKA 2PTMA 4LTAA 4N53B 4NO4A 5HV4A 1BBT3 4LKDA 4L2NA 1SPPB 2VCAA 2ZAHA 2VBDA
chains in the Genus database with same CATH topology
2PFWA 5H9RA 4M3CB 3PVEA 1UPIA 2D93A 3NL1A 1W6OB 1QJY3 1CAVA 1F5JA 4C1WA 3NO8A 3BODA 3AJYA 4K7JA 1W6MB 5JVVA 2D6OX 2PELA 3WXPA 1OMIA 2EIGA 1CX4A 1OFSA 2PHUA 4HANA 1CR7A 1RJ8A 2AUYA 1NOVA 3E5XA 1XRUA 4PDWA 4Q26A 1NQJA 1PGL1 1RITA 1ZM1A 3AP4A 1YI9A 3M7AA 4XHBA 1CJPA 3MPPG 2CL2A 3U11A 1XXNA 2K0GA 5JSOA 3ASIA 1BQPA 1S0IA 3VZNA 1ZYBA 3I59A 1H9WA 2OZ6A 4JV4A 3EJKA 4RHV3 1WLDA 4Y1YA 3KS7A 4KQ7A 5HXVA 4Z1VA 4AFBA 3NAPB 4IEXA 2DVFA 3ZFGC 4XQDA 1CVNA 2CAVA 1RUI1 3VHPA 3FLTA 2C9AA 2ZGKA 1ZBA2 2AYHA 4QGMA 3SH5A 3VBRA 4DY3A 1UKGA 5EZWA 4MH0E 1JOJA 4N90A 1Q43A 3GF6A 1AZDA 4RA0A 2DCYA 2WA4A 2DVAA 1WW5A 2O0OA 4OUMA 3MIFA 4OI1A 1N3OA 4NPRA 1S1AA 2TBVA 1Z7S3 5CFCA 1JBCA 3SHRA 4AGGA 2ZA9A 3URFA 1RUJ2 2EAAA 1QDOA 1RUOA 3M1HA 4A3XA 4ZXKA 4AE2A 4QQOA 2MPFA 2RS51 3MFAA 5K9YA 4OVEA 4XFCA 1I9RA 3ZXLA 3IT8A 4BCUA 4RFT0 1QJU3 4CTEA 2AR6A 4FTEA 2R1DA 1PVC3 4FO9A 1DGLA 2D5HA 2NQYA 5L19A 1ENXA 4DQAA 2GNBA 1ZBE3 4COVA 2V5YA 2BVBA 2UURA 2CGOA 4HN1A 2ZS6B 3ZFFB 5LK7B 1GV9A 4MXWA 1GSLA 4COZA 1NA1C 5K7PA 1DG6A 4JGZA 5BNPB 2P17A 1VBC3 1AYN1 4OFGA 1I5ZA 3VDDA 4KWJA 2E7TA 3DF0A 3AZWA 4AGRA 3BOWA 3MEPA 2YPJA 4AEKA 2CWMA 4Q2FA 2RR11 4XTPA 1YHFA 2UY8A 1LRHA 2PHTA 2Z2SB 1LOEA 3LA2A 1AR72 2WFF3 4X8PA 4DPNA 1RB8G 3H3UA 4R9CA 2XBO2 2C1FA 3NKGA 5T5PA 5KHJA 4CDQC 3H8UA 1NCQA 4R4XA 1LOBA 4AWDA 1WCKA 1WD3A 1BKZA 1NE6A 5GKAC 2I07B 2LALA 4H7LA 4WM7A 4CEWC 4ZKTB 3WCSA 3FUOA 2ZJCA 4IV1A 4XMIA 1I1EA 3UK9A 1TMF1 2WIIB 5DZEA 3CU7A 4OI0A 3MGUA 2ZGPA 2XG3A 2DFBA 2UWCA 2ZGLA 4I2OA 4QMAA 2KA3A 2ZHNA 1J1LA 5EYXA 2BWAA 3SXWA 4Z8BA 4XYXA 3RJ2X 2CY6A 1Q8VA 5BYNA 1YIFA 3D0SA 1X8MA 4H55A 4NHMA 4HL0A 1AHSA 1ENSA 2RE9A 1CAUB 2ZBJA 3PMEA 3WP4A 1GZWA 1RUJ3 3WG4A 2UY9A 3R0RA 2VG9A 4CDUA 4AVBA 2Q8OA 4KG8A 4AVVA 1A6CA 1HW5A 1UF2C 1H9PA 2IXHA 3WDYA 1GKBA 1SLAA 1QKQA 2RS11 3BB6A 4N43B 4JGYA 2Q1ZB 4XF0A 3V56A 4CDXB 1EV13 4RR3A 4EN6B 4XHXA 3I2DA 1QJZA 5EJ3A 5KHGA 2ZACA 5JI9A 1V70A 4QD2A 3VBSB 3VBFB 3NWKA 3B93A 2OYZA 5FFOC 3T2TA 1G9BA 1CAWA 4JRAA 2CWSA 4DZGA 4QGLA 3USUB 4YZ4A 1X7NA 1AR82 5C8CC 4DRRA 2N7GA 1ZRRA 2D97A 4GH4B 4IEYA 4N53C 1RUH1 4XE9A 2OA2A 5GLVA 4TLFA 3FBMA 3IBMA 5C9AA 3PVOA 4FPKA 4Q1RA 4RS5C 3V64A 3AP6A 5JZGA 4SLIA 4NN0A 1VBD2 2XBO3 4B29A 1UMZA 4FPHA 5FLHA 5E8AA 1S0EA 2JDZA 2VVFA 1PHMA 3CJIB 4D7TA 2PHWA 2G4IA 4AEJA 1CQ9A 1BMV2 1CPMA 4LUKA 2ZX2A 5DG2A 5K0UA 2R042 5C33A 3OTFA 4XJAA 4OHXA 3TWIA 4Y1UA 3VBOA 1Q3EA 1R1A1 2R062 2AH2A 1V6MA 1OPOA 4LBNA 1PO22 3FLRA 2BYVE 4YRDA 2LTNA 1COV2 3ZFEB 3PMSA 3FX3A 2HWD1 1OLRA 2RMU3 4S2GA 2Y0IA 1OHFA 1VIWB 3NAPC 2P37A 3WR0A 1WLTA 5E88A 3BCWA 4QPGB 4Q27A 3RWNA 5LRRA 5IK7A 1ZREA 1W0PA 4XFAA 2XJUA 4GB33 1A78A 2VXRA 4WVVA 5J36A 3VL8A 5JCTA 4YGEA 4WM8A 1QH7A 3ZYRA 1W39A 1FNYA 1H8TB 4EWDA 1Q56A 2A3XA 2VY0A 4MGZE 3TNPB 2WNEA 4C90A 1VAMA 1BEV1 4UBHA 3VKNA 4AK3A 4R4ZA 3VHOA 2XJSA 4URTA 1HQNA 4GALA 2AZ5A 4HFSA 3MDPA 4MYEA 4Q4X1 1QJX2 1FOD2 4XEZA 1K5MC 4TZDA 2JG8A 1I6XA 1CESA 1MS4A 3D8CA 3WP6A 1KFUL 4AHYA 1ASJ3 1KS5A 4B4PA 4Q4V1 1DLLA 3ILRA 2DYCA 4ISRA 2OIIA 1UX6A 1AR61 1URXA 1X50A 4FPYA 3POSA 5I0SA 4I3PA 3ZFFC 4ZU4A 5FLIA 1JHNA 5FPXA 5HI0A 4HSJA 2AENA 3UJOA 1V6IA 4L99A 4EWEA 3AXEA 2XPJA 4M00A 3WLUA 1LHUA 1WMEA 4LBKA 4LO6B 3AP7A 4MGKE 3WG3A 3ZN5A 1DQ5A 3ZN6A 1UU5A 1ZZ8A 1ALYA 1J3RA 3H9AA 1PGW1 1JYIA 3FFZA 1PO23 2WWSA 1S0DA 4DS0A 2BGCA 2MEV2 3FFQA 4JC1A 1GANA 4XFFA 1COV3 4K1ZA 4WV8A 4H3WA 2KXLA 1FXZA 1RUD2 1QMJA 1VB2A 4RQPB 3ZFGA 2EF6A 1PO11 3SH3A 3AB0A 4LBLA 4BM8A 1WGPA 1FPN2 2E51A 3DKWA 3WHTA 2FQPA 2DUQA 2YGLA 1EY2A 1QJY1 4H7MA 1RVF2 4LLFA 4YSFA 1VJ2A 2WINB 4HVOA 4PLMA 2HYKA 1NY71 4YG6A 4CP1A 4P9GA 4B8EA 1AYM3 1UCXA 1QGLA 4P9IA 2OZJA 1IGOA 3VBHC 3ZN4A 1QU0A 2MNGA 1AX2A 3PVBB 2XB6C 2RS33 4BLIA 5ABJB 2R6QA 1WW7A 1KD7A 2GDFA 1G9DA 5I8SA 1UZZA 2WT1A 3DGTA 5DDJ2 5C4WB 1SMVA 1MR5A 4RGAA 3WUDA 4JAAA 1G9AA 4MGIE 1DHKB 1FOD3 4RHV1 1RMU1 4WZCA 3ENRA 1OQEA 1O3RA 4N9HA 2ZKLA 1V9U3 2JICA 3WG1A 4SBVA 2Z69A 1RUF2 1ZRFA 3M8LA 1G9CA 1UAIA 5J37A 1F2NA 3VBSC 5KXBA 1TME3 1NA1A 3QOPA 3VBFC 1F5FA 2WNVB 4XOGA 1WUVA 1WMFA 3H7YA 3KSCA 2GU9A 3M3QA 1GLHA 1YFXA 3SCGA 4EROA 4YFWA 2H0BA 2ZMNA 4GH4C 2Q5TA 1PNFA 3MLKA 3GZTB 1WBFA 1RHI2 5JOZA 4OI4A 3KZ4C 1V6NA 4M3CE 1NQDA 5FOBB 1QJU1 1TNFA 1OLQA 1PVC1 4CDQA 1JXNA 4B3NA 3MZHA 4KU7A 4AYUA 4YZ3A 1V00A 1RUD3 4Q0SA 5DUXA 5BV6A 1ZBE1 5AC93 1YIPA 4XILA 1ZZ9A 2JE9A 5GJ6A 3SITA 5F1RA 3U4XA 4Z07A 1IQAA 1MACA 4Q0QA 3EXUA 3OYWA 2YYOA 4BMBA 4D94A 3MIGA 2EXKA 1HDKA 1VBC1 4ASMB 1KITA 1SFYA 3ZSKA 2EVXA 1W6PB 1C3HA 1DQ4A 1O3SA 2R0HA 1A3KA 4HMZA 4F7ZA 3MIHA 5JOYA 4DXZA 3VBUB 1Q8QA 3CJXA 4YW4A 3IKWA 3B94A 2IXLA 4U2AA 3RQ0A 2BBVA 1WBLA 2A6XA 2R072 4HPKB 2WFF1 1JN2P 4E4DX 3SH4A 4AVAA 1LGBA 4K20A 4G3YC 4QPGC 3JU9A 1YJLA 2ZZJA 4HLTA 4IESA 3N7JA 3GZAA 3TRSB 1V6OA 4IEOA 3WP5A 5FO9B 1H8TC 2WS92 2DCTA 4H14A 2ET7A 2WZR2 3O12A 3SCHA 3CLPA 1U5ZA 5LEKA 4PIZA 2I45A 4C0HA 1QHDA 3KT7A 4D7YA 1WW6A 3WX5A 2XJQA 1AR92 1X8EA 1ZZBA 2LM3A 2VMIA 3RI8A 3O5SA 1RIRA 2GC3A 1XNBA 2WNUA 1VBA2 1M06G 1CD3G 1OD5A 1Y7BA 2ZZQA 3JD72 4QX5A 2NMNA 3N4MA 4AGVA 2R16A 2P3IA 5T3NA 3GALA 2PHDA 4UBGA 5C8CA 2XL9A 3AZYA 5J96B 1RUJ1 3GHNA 1O4TA 3QH6A 1ZZCA 4W6WA 1EAH2 2E7QA 1J58A 1N3QA 4KWLA 4RS5A 5ACA2 3O0WA 2YV8A 4MLOA 3AMPA 2HWF3 1OKQA 2FMYA 1NCRB 1UIJA 3ZXDA 1ULGA 1W6QB 5J98B 1W6OA 2W0XA 4FOQA 4QQLA 4LE4A 2A75A 2NYYA 1LOCA 1EV11 2D6LX 4U36A 3KB5A 3B69A 5D1IA 4BIOA 3VGIA 2XHKA 4FXKB 4IV3A 3WQ1A 1JUIA 1Q8SA 1D4M2 2A71A 1KFXL 1OSGA 2PHXA 3AKTA 4A7KA 4BA6A 4XF3A 1B09A 5L7OA 1ZRCA 1G86A 1QQP2 1PK6C 1H2MA 1PIV2 1QY4A 2ZHMA 4XW3A 2VH9A 3GZUC 4PF5A 3RSJA 4AI8A 2R32A 2JKBA 4XFHA 2TUNA 2D6PA 2R073 1LULA 4E9KA 2ZABA 1RUG1 3NAPA 5FREA 1AX1A 1VRH2 4F8AA 3DN7A 2PHLA 3QACA 4IEVA 5JIAA 4FSJA 4Z2WA 1LTEA 2JXAA 2VECA 1FMD1 4Q4Y1 5EWSA 2HWE3 1J1TA 1C8M2 2P2KA 3RPQA 5CAZA 3IDCB 1N3PA 4OI2A 2HWC2 4K40A 2CV6A 1IZ3A 1OOPB 3RYPA 3OY8B 2WZR3 1AF9A 1ZX5A 5CU1A 5HCAA 5FO8B 3E97A 2ET1A 3AKQA 4IEUA 2ERFA 4COWA 1B35B 1OQ1A 4HKOA 4Y4YA 3G6JB 5A33B 1W2UA 4FOWA 5ABJC 1AR93 2EAKA 1QDCA 2PLV2 4WBBA 5GZFA 3JQXA 3WUCA 4UW3A 1LOAA 1VBA3 1R081 2ZHLA 5C4WC 1NXD1 3VLBB 2RMU1 2VUJA 1PM7A 3KT4A 3NJZA 1VBB2 3CL1A 2VQAA 1XNCA 5KXDA 1WCSA 1K5MA 2MHFA 1A8MA 1HRI2 1H2KA 3SNMA 2P34A 1RC6A 1RUC2 2X53S 1D2SA 1V6KA 2VNOA 2WLPA 1POV1 1WD4A 3P3PA 1HQLA 1NXMA 2IFRA 3MIBA 5ACA3 3IPVB 4IL7A 4QM8A 3TN93 5KWRA 2VU9A 1ULEA 4FPCA 4GB31 2IXJA 4F3JA 4PJYA 4TSVA 1UPSA 2WNVC 2RM23 3EHKA 3VZKA 3K48A 2QZ2A 4G9SB 2YMZA 4Q4W1 1BK1A 4FP3A 2A6VA 3JB4C 3UV9A 3ZYJB 1C8NA 1D4M3 4ITCA 1HXS1 4PDWB 4XFIA 3C2UA 3WDUA 3ZSEA 4DFSA 3FWEA 3ZSMA 3MW3A 2D40A 2FZ1A 4BLJA 4Z92B 2VQ0A 3JBG2 1XU1A 4FAGA 3MW2A 3FE5A 4Y20B 4R9AA 3C3VA 2G9GA 4OZXA 3PHMA 2P3JA 2BQPA 3I59B 1GZCA 3KCYA 1BJQA 5J48A 1Z78A 1SFNA 4LO8A 1NZCA 4KU8A 1ASJ1 1WLCA 1XE7A 3JQWA 2BNOA 2D6MA 2I74A 3M70A 4ZU5A 2K9ZA 1DGWA 4ES8A 3VBRB 4KBBA 4AHXA 4C0BA 5BNOB 2QJVA 4YVWB 4LBJA 2VNGA 3NV3A 2DWRA 1H0BA 4XTMA 1QF3A 1MEC1 5KHIA 4LBQD 4AHWA 2Q1MA 3IMNA 3VL9A 4IEWA 2HWC3 4GMP0 3FHIB 1HV1A 1ZZ6A 2HWB2 2UU8A 3N3HA 3VBUC 1F8VA 1FI2A 3VBHA 4G4FA 4AI2A 1MS3A 5CFCB 1LECA 3ZYIB 4CP2A 2DTYA 4KG0A 1CAUA 3ECQA 3L2YA 3J26N 1PO21 3INAA 4MV2A 1IS4A 4AXOA 1H2LA 1ENQA 1LR5A 4R9BA 4LEJA 4META 5GLZA 2NMOA 1COV1 5T52A 1ZBA3 4D3WA 4K3UA 3VKMA 4J6GA 2ZTNA 3H1MA 4LO5B 1MS8A 4UW5A 4YG3A 2DVGA 3KM5A 5F6LB 4RSUA 3RZZA 2GNDA 2GH2A 3SMHA 1XYOA 1AL0G 2VMGA 3NW4A 4LA3A 1T6GC 5LEJA 5KC5A 1SCSA 4YZ1A 4JGZB 1AYM1 4I0BA 2D3SA 3POWA 4XBQA 3RDIA 3VBFA 4FTSA 5JSRA 1NG0A 4AQSA 3TOJA 3LSEA 1N1SA 1LODA 2WT2A 2PAKA 1W6NB 1IOAA 3RYRA 3USUA 1FV3A 1MVQA 2RS31 4AEDB 3UKTA 5GZEA 4S2HA 4I0WB 4AF9A 4QPIA 1AL21 5T55A 3VKFC 2B7YA 5FMOS 5KHKA 1VLNA 5CA6A 4XF1A 1FOD1 4XIOA 2XJRA 1NCRC 1RUI2 1R1ZA 1SBFA 3ST7A 1LOFC 1MVEA 4L11A 2XJVA 1HX6A 3MPBA 4GXLA 2D43A 4LO7A 1V9U1 4WM7B 5FOJB