2TEPA

Peanut lectin complexed with t-antigenic disaccharide
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
232
structure length
232
Chain Sequence
AETVSFNFNSFSEGNPAINFQGDVTVLSNGNIQLTNLNKVNSVGRVLYAMPVRIWSSATGNVASFLTSFSFEMKDIKDYDPADGIIFFIAPEDTQIPAGSIGGGTLGVSDTKGAGHFVGVEFDTYSNSEYNDPPTDHVGIDVNSVDSVKTVPWNSVSGAVVKVTVIYDSSTKTLSVAVTNDNGDITTIAQVVDLKAKLPERVKFGFSASGSLGGRQIHLIRSWSFTSTLITT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Specificity of Peanut Agglutinin for Thomsen-Friedenreich Antigen is Mediated by Water-Bridges
pubmed rcsb
molecule tags Lectin
molecule keywords PROTEIN (PEANUT LECTIN)
total genus 55
structure length 232
sequence length 232
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2tepA00
3FBYA 4Q8KA 2ZGPA 2NN8A 1LENA 5GLUA 3USUA 4AWDA 1I1EA 5F5QA 1C1LA 1QDOA 1G7YA 1J1TA 1LHVA 1DGLA 2NMOA 4Y1XA 2V73A 4XOGA 5GM0A 3WUDA 2P3IA 4XBQA 1QOTA 2A6VA 3UJOA 3M3CA 4ATFA 3FLPA 2R1BA 3PMEA 3M3QA 4K1ZA 1KITA 1W6PB 1W0PA 4CZSA 3DGTA 2JE9A 5E89A 1ZM1A 3POSA 4XJ9A 1Q56A 1GBGA 1MS0A 3AP9A 3ILNA 3MPPG 3AZVA 1VAVA 2GALA 1OKQA 2P37A 1D2SA 4LBKA 4XBNA 3GNEA 5HCBA 3TB0A 2OUJA 2KM2A 3WNXA 2WT2A 4D69A 5T55A 3B9CA 3N7LA 1G86A 1GICA 4BLIA 4YGBA 3V64A 3IPVA 5T54A 2WLQA 4YG6A 1VALA 4RL7A 4L8QA 2E51A 4KBBA 2ZACA 1IKPA 3SISA 3WDTA 1R1ZA 1VLNA 4CRQA 1FV2A 2HYKA 3ILFA 4Q27A 5SV8A 2ZMKA 1S0BA 5GZFA 2CYFA 4FPJA 3B3QE 4FOQA 3OY8A 1GZWA 2AENA 3AP7A 1N1TA 1VIWB 3D6EA 1DQ2A 1LGCA 3O5SA 3POWA 5H9QA 1BQPA 3WHUA 1LGBA 3HN1A 2EALA 2VUAA 2W52A 1V6LA 3ZPYA 1W6MA 1Q8SA 3D4KA 1WBLA 2EXKA 3LCPA 2A3YA 2DYCA 2VH9A 1LOCA 3AYDA 4PCRA 1GZWB 2A7AA 2P3KA 3RMYA 1V6NA 2UWCA 1LOBA 3OY8B 3Q9OA 2XG3A 4Y1YA 1HLCA 2UWBA 2ERFA 1AX2A 3BOPA 2ZBJA 4ATEA 4XJ8A 1BJQA 1BZWA 2R0FA 1RITA 3WUCA 3SLIA 3WZ1A 3O0WA 5JMCA 4Y22B 1DYPA 5BYNA 3WVJA 1JYIA 5HCAA 2A5ZA 4M01A 1IS4A 3ZSLA 1NXD1 2DVFA 4Q8LA 3AX4A 3WDXA 2ES3A 3M2MA 2W08A 1V6OA 1B09A 2DVDA 2P3JA 4PQ9A 4XHXA 1S0DA 4NOTA 2CY6A 4YW5A 1CVNA 2UWAA 3U4XA 1RIRA 4AGVA 5JDBA 5CA6A 3N35A 3SNMA 2LALA 1AVBA 1G9DA 4Y22A 2H0BA 2B7YA 1FX5A 4YZ4A 3QCWA 5T5PA 1O4ZA 1KDMA 1O4YA 4WV8A 2A70A 3SH4A 1IS5A 3LSEA 4BMEA 4UW3A 5GZGA 2C9AA 1QOOA 2R0HA 2NP0A 3OBTA 4NO4A 1UAIA 1G8WA 1W6MB 5KXCA 1SBFA 4XHBA 3W59A 1OQ1A 1S0CA 1W6PA 3W58A 3SH5A 4K20A 2VW2A 5GLTA 2FHRA 1UZZA 2R1DA 1PZ8A 3OPZA 1QOSA 3AYCA 3BODA 3OBRA 4TYSA 1APNA 1MS4A 3L2YA 4JCKA 4FPLA 4LBNA 4FPOB 3RQ0A 1QF3A 1YRZA 4GXLA 3JU9A 4PBOA 1X50A 5DZEA 1LHWA 2ZGOA 3KQRA 2EIGA 3SITA 3WV6A 1LESA 2DWRA 5T50A 4Q1PA 1AJKA 3FUQA 1KJRA 5DG1A 1CPNA 2DVBA 3WCRA 1CR7A 3ZXLA 3V0BB 3LSDA 1S0GA 1LOGA 1SBEA 1ENRA 1GV9A 3NV1A 4HANA 1MZ6A 1GKBA 5GLVA 1GSLA 2DTWA 2D6OX 3R4UA 1F31A 4YGEA 2D44A 2GMMA 1GNZA 3CNAA 5KXDA 1LOAA 1AJOA 2C5DA 3AXEA 5JOZA 1MACA 2RHPA 2VW0A 4PF5A 1QGLA 2NM1A 1DLLA 2CNAA 1DIWA 1AX0A 2ZGMA 4Y20B 3WDYA 1MS9A 3PVNA 3AP5A 2ENRA 4FPEA 2PHUA 1QU0A 3WG3A 3D5OA 5JVVA 2ZHNA 1LOFA 2DVAA 1V6KA 1QKQA 2GNMA 1N1SA 3IMNA 1S0IA 4U36A 2WKKA 1SLLA 1FNYA 2OW4A 2Q5TA 2VXRA 4FPKA 3NWKA 3T1LA 5F9TA 4AVSA 4ZXKA 2A71A 1MZ5A 1KDKA 1W6OB 2A75A 4JRAA 3AYAA 4LBQD 3ZSKA 4YM2A 1BYHA 5CB7A 4YM0A 2NMNA 4Y20A 3WCSA 1FAYA 1W6QB 3NV2A 4GWMA 4RA0A 3ZYPA 5EXOA 1JN2P 1CESA 1V6IA 1SCRA 2YXSA 4YFWA 2JKBA 5E8AA 4XMIA 4YW4A 4XMAA 1UN1A 3AP6A 3AZYA 3B01A 4YZ3A 3AJZA 3BTAA 2A3WA 4AGRA 2AYHA 5KXBA 3IN9A 3N7KA 3RS6A 1QMJA 1F5FA 1S0FA 4GWNA 1CN1A 1MS1A 3VKLA 3VKMA 3RMXA 4GKXA 4Y1VA 1WBFA 3VUOA 1UMZA 4Y26A 3ATGA 2ZAAA 3M3OA 4LBJA 2GMPA 3IPVB 1GZCA 4FQ4A 4IQPA 2GNTA 4R9DA 1N3QA 4UW4A 4YW1A 1SLIA 3UK9A 3ZXKA 5KXEA 1IS6A 1F9KA 1Z78A 1LHNA 1DBNA 2CTVA 4Y1ZA 1ONAA 1W6NA 2ZGKA 2WQZC 3RSJA 4ISQA 3T1MA 1WW4A 4GA9A 1JHNA 5GLWA 1DQ0A 1JUIA 1GNHA 2ZGSA 1V00A 2P34A 4W65A 3UL2A 3WDVA 4XJUA 1MS8A 3DUIA 1WW5A 5GZDA 2Z42A 4ITCA 1FYUA 3AZWA 3IKWA 4FOWA 4UW6A 1HDKA 1G9CA 4Q2FA 1ULFA 1CQ9A 2I2SA 3WDUA 5IK8A 1LJ7A 1Q8VA 1AXYA 2ZHLA 4YLZA 2ZGTA 4AVVA 1JYCA 5DUVA 1JW6A 2SLIA 1WUVA 2DUOA 2A6WA 2ZA9A 1DHKB 1WCSA 1WW6A 2V5YA 2UURA 3INAA 1G9BA 5CAZA 4XILA 3N3HA 1UKGA 1AF9A 1AXZA 4LBQA 2PHXA 2NYYA 3HR9A 4FPCA 5DG2A 1LULA 1LHUA 5EYXA 1ENQA 1S0EA 5JOXA 2EF6A 2ZGUA 1A78A 3AJYA 3MEPA 4M00A 4YW3A 3ENRA 2W68A 4XBLA 3RRDA 2DVGA 2ZGLA 2VW1A 4P9XA 4Q26A 3WG4A 4BQ1A 3VKOA 4R9BA 1N1YA 3ZXEA 1MR5A 1H9PA 2EXHA 1WD3A 3BIWE 3MW4A 5CNAA 5FREA 2YROA 2WT1A 1UZYA 1JOJA 5DUXA 1JBCA 2PHWA 2CL2A 3AK0A 1LEDA 1FNZA 1GYKA 5E88A 3HMYA 5JLVA 4BMBA 3H0OA 3MW3A 3OYWB 4Y24A 1LOFC 1TEIA 1UPSA 4I30A 3B69A 4YGDA 3NV3A 2ZGQA 1N3OA 1YO8A 2JDZA 5IT6A 1W6QA 4BPZA 1AZDA 2E7TA 4P14A 5GLZA 2D7FA 2WSVA 5DUUA 2JJ6A 4GKYA 1LCLA 1ULDA 2D3RA 2DU0A 1N47A 4OZXA 5FRAA 4DQAA 2AGSA 1UL9A 2EXIA 2ZMNA 1HQLA 1S1AA 1KRIA 1H9WA 2D43A 2AUYA 4FPHA 4DFSA 4DRVA 3M1HA 4Z8BA 1V6MA 1HKDA 4TZDA 3POYA 1QNYA 2P2KA 1SLCA 1N1VA 4YM3A 1C57A 2A3XA 3FLRA 1HQWA 3FFZA 4FQZA 4XIKA 4PBPA 1KQRA 1V6JA 3N7JA 2D3SA 3IM0A 3V0BA 1CONA 1QDCA 4M3CA 1YXWA 2A6ZA 2D6KA 2D6MA 1G9FA 3ILRA 1IKQA 4BOWA 2A6XA 3NV4A 4LBOA 4R9CA 1LU2A 5DXDA 3PVEA 4YG0A 1CJPA 1LODA 3O12A 3WLUA 2PHFA 3O0XA 3N7MA 4H55A 3PVOA 4WVVA 3ZXJA 1DYKA 2ZGNA 2YZ4A 4K21A 5IUQA 2GNDA 1AX1A 4LBMA 2ZMLA 2AREA 1QNWA 1Z0HA 4M3CB 5IK4A 4XIOA 2CWMA 3TAYA 1A3KA 4FP2A 1WLDA 4YGCA 5T5LA 3SH3A 4FP3A 2ZABA 4LBQB 3A0NA 1FV3A 5DUWA 5T5JA 1Q8OA 3V0AB 1URXA 1VAMA 4K1YA 1Q8QA 1RINA 4R9AA 5IK5A 4XZPA 5EYYA 3B00A 3UJQA 2E53A 2JECA 4Q1RA 3WDWA 2DUPA 5CBLA 1SLBA 3N36A 2JE7A 1U0AA 5H9PA 1Q8PA 1JXNA 1LGNA 2NZ9A 1SLTA 1G9AA 1LECA 3R4SA 4DRRA 1W0OA 2WNEA 4FVVA 3ZSMA 4MYEA 1BXHA 3I8TA 4P9YA 1C4RA 2ZKNA 1WLCA 3AZZA 5T52A 2ZGRA 3V0AA 1AXKA 3OYWA 3M3EA 4M3CF 1W6OA 2VY0A 4XDQA 4BM8A 3MW2A 1DQ6A 2A6YA 2E6VA 1DZQA 2DU1A 3VKNA 4HL0A 2YY1A 2G4IA 3USUB 1SBDA 3GALA 1ENSA 1FATA 3AYEA 2GMEA 2EAKA 5EWSA 3WHTA 2OVUA 1D0HA 4WZFA 4P9WA 4BLJA 5GZCA 4GALA 1GLHA 3RG0A 3VKFC 4UW5A 4Y1UA 2BQPA 1WLWA 4FPGA 4YG3A 1ULCA 2R16A 1CPMA 3V65A 5IK7A 3AZXA 5H9SA 5JOYA 4FOYA 2ZHKA 1WD4A 3AFKA 4CTEA 4YFZA 2AH2A 1OFSA 2GDFA 1A8DA 2OUHA 3FLTA 2ZHMA 2UU8A 3AXDA 3T2TA 1LTEA 1YIFA 1LU1A 2DV9A 2GN3A 2CWSA 1NLSA 2D6LX 2EXJA 1ULEA 4XJWA 3ZYRA 3KM5A 1GZ9A 2DUQA 5DZFA 1MS5A 2WT0A 1ULGA 4FOVA 2ZZJA 2AR6A 1N3PA 2ARBA 2SBAA 3ZSJA 2E7QA 1DFQA 4FPFA 2D6NA 5GALA 4F83A 3WOGA 3WG1A 1YYNA 4ZKTB 2JD4A 1ZA4A 5H9RA 1SACA 5HCFA 2D3PA 1XQNA 1MVQA 3OJBA 1Y7BA 1PZ7A 3APBA 4XXPA 2YMZA 1DQ1A 1DQ4A 4XYXA 2TEPA 2ARXA 3JUUA 3ASIA 4ISRA 1S0JA 5JOWA 3A0KA 4WVWA 4ASMB 3R05A 4DPNA 4FPYA 1MVEA 1UX6A 4XE9A 4AYUA 2XB6C 1DQ5A 5GZEA 4JC1A 3WG2A 4SLIA 2W39A 1H30A 1LEMA 1SCSA 3PJQA 4AVTA 1W6NB 4LBLA 2R49A 4XTMA 2WSUA 1WW7A 3FUOA 2GN7A 4XTPA 5T5OA 3VV1A 4XJAA 1LHOA 1SLAA 4YZ5A 1SFYA 4YM1A 5AVAA 1IS3A 2PELA 4XJZA 4XXAA 3ZVXA 3OGGA 3ZXFA 2WJSA 4YZ2A 1PZ9A 1GANA 1C1FA 2FMDA 3A4UA 5DZGA 4C1XA 5GJ6A 1MS3A 1I3HA 2YV8A 1LOEA 4M3CE 5L73A 1BKZA 3QLQA 3C2UA 4AGGA 4DS0A 1CIWA 2LTNA 2GNBA 2PHTA 4C1WA 1EPWA 1IOAA 3AP4A 1YI7A 4U2AA 3O0VA 5LK5A 2D6PA 2DTYA 2VU9A 2PHRA 3I4IA 4YZ1A 4YW2A 2DURA 1KJLA
chains in the Genus database with same CATH superfamily
1UY0A 5IATA 3I59B 3LF7A 5DDJ3 2HH9A 1IZ3A 5LK7B 2IFRA 2XBO3 2YGLA 5FY5A 5A3WA 1J1TA 3VBRA 2XHNA 5FP4A 4Y1XA 5I0TA 5FV3A 4XOGA 5GM0A 5J96B 2VOVA 1AYN1 4J25A 3WUDA 5BV6A 2A6VA 4HVQA 3M3CA 1PVC2 5C9AA 2H0VA 4PDWA 3PMEA 4QPGC 5FKBA 1TME3 2Y64A 1ODNA 1QXRA 1U5YA 1W0PA 3NJXA 4BQWA 5JXJA 3I2DA 4QQHA 1ASJ1 5I8TA 4IV1C 1W06A 1PMHX 1EY2A 3NNLA 4XJ9A 3I59A 2QQNA 4LBKA 1EAH1 3RJRA 4PIZA 4MVTA 4XC9A 1PGSA 2RDSA 4QX8A 3UGFA 5FZKA 3U1XA 4D69A 5T55A 2BPA2 2H6BA 3B9CA 2NQYA 2O14A 3N7LA 4BLIA 1H2NA 4B1MA 5JXGA 1V9U3 3AM2A 5T54A 2VNOA 1BBT3 1VALA 2E51A 3VZLA 3NJYA 4CRQA 3PURA 2OIIA 1O3TA 4Q4W1 1S0BA 2LRPA 1HJGA 5FP3A 4NPMA 1OT5A 2NP0A 3OY8A 1AR62 3AP7A 1N1TA 5LBEA 4IE7A 3OOXA 4QPIC 3ZFFC 1DQ2A 2BOIA 3KB5A 1JZ7A 2BWAA 1BQPA 4MXWB 5ISLA 4RR3C 5F5CA 4A42A 5E6HA 4QPYA 3AFGA 4Q4X3 4QHZA 2J42A 3IDBB 2YBKA 5A3LA 4E2SA 1QH7A 4XEZA 2GC2A 3HPNA 4C8DA 2A3YA 1RXGA 5LZ6A 4IXLA 2HWB2 4ES8A 2HEYF 1GZWB 5FQ0A 2A7AA 2BFUS 2P3KA 3H3LA 4NHKA 1DYOA 4G9SB 3OY8B 4MGQA 2UWBA 1AX2A 4IGQA 3FE5A 3E6BA 5L7OB 3AMQA 1BJQA 3VBOA 1BZWA 3GXUA 1RITA 1O8SA 3SLIA 2WAOA 5CKMA 5JMCA 2A1XA 3D0SA 4Y22B 1DYPA 1OUSA 5BYNA 1F2NA 3KS7A 4RHV2 1JYIA 1GWMA 1ND2A 5HCAA 5LWBA 2WZR3 4GJYA 2A5ZA 2VVFA 4M01A 3RFRA 3TN91 5A70A 1NXD1 4Q8LA 3SHRA 2ES3A 3M2MA 3UGGA 2W08A 1PM4A 4IDZA 4D6QA 4PQ9A 5KR7A 1H6XA 1CAVA 4P5YA 5LEJA 1AYM3 5CA6A 2Y6JA 3ES1A 4DUVA 4LHLA 5CISA 4COYA 2LALA 2X5IA 1JZ5A 5C3QA 3QD6A 1FX5A 2R072 1O4YA 3GF6A 1UIKA 2K0GA 1QJX3 5FO7B 1NUKA 1RUOA 2XJPA 4IEXA 2Y60A 3EMRA 1QOOA 5ACA2 5JPNB 4CDWB 4X8PA 2WWUA 4NO4A 1XNAA 3W59A 1ZBA1 3GHNA 1K5MB 4K20A 4D7SA 5EIYB 2FHRA 4CUGA 1OSGA 1PO13 1UZZA 2VULA 3OPZA 4QX7A 5FZOA 3WQBA 3AYCA 3BODA 1QJU1 1UOBA 3OBRA 4TYSA 4CCLA 1Z7S3 1GP5A 1ZZ8A 2KA3A 1RUF2 2QBXA 4FPOB 2VVDA 3RQ0A 4AFDA 2XJQA 2ZOEB 3DKWA 4GXLA 3PL0A 1RUI1 3KGLA 3LKJA 3T2PA 1LHWA 1OH3A 2ZGOA 2EIGA 3CIHA 4ONUA 3SITA 2EIBA 1VE0A 2QQLA 2Q0AA 4Q1PA 1AJKA 1CPNA 2Q4SA 3WT3A 4OUMA 4P08A 1WA6X 3BU7A 3ZXLA 3MIHA 3KLSA 4Z1VA 1AR93 4CDUC 5LRRA 5A3PA 1PVC1 5FZGA 3DPRC 3OGRA 4M4RA 2WN2A 1RGSA 4K8RB 4P02B 1D4M3 1MQTC 4LHNA 2HWE3 2P17A 3CNAA 4IUGA 2C24A 4B4QA 1AJOA 1MACA 3VHOA 2RM21 5FYZA 1GFF2 2HWC2 1DLLA 1PHMA 4GZ9A 1DIWA 4XFAA 4Y20B 3VBUB 2DFCA 2YHJA 3AP5A 1C28A 2QCSB 3MHZA 4FPEA 1QU0A 4L97A 4NWWA 4QU1A 1QJU2 5JVVA 4Q29A 1LOFA 4LQRA 5A3OA 4JGZC 1V6KA 1QKQA 1L7LA 2GNMA 2ZEYA 4Q4V1 3RWKX 3VDAA 1H8TA 1VBC2 4KL1A 1NOVA 1EYBA 5F3IA 1FMD2 4ZXKA 1NCQB 1KDKA 4LBQD 4PDWB 4EE2A 3H9AA 4BQ4A 2NMNA 1UCXA 2RM23 4AQTA 4Q4V2 1JN2P 3O14A 3N9NA 4YFWA 2YXSA 4OMCA 4X6RB 5A3MA 2I45A 2HWD2 1FXZA 3AP6A 2PFWA 3AZYA 1WCQA 4H2AA 3AJZA 2A3WA 2XUMA 3ZYIB 1FOD2 3N7KA 2C6SA 2YBPA 1PO22 2RM22 1HRV2 1MS1A 5A1AA 2O8QA 2BVBA 4Y26A 3ATGA 3JBG2 2ZAAA 3M3OA 4B7EA 2RS31 4FQ4A 2QQMA 1ND3B 3OBAA 4CEWA 4FTSA 2FZ2A 1U5ZA 3K46A 4W6YA 4AFCA 1PIV3 1ONAA 3MIBA 4QPGB 4QQ2A 4CCMA 4EYUA 3CBNA 1OA4A 3SEPA 3RSJA 3U11A 3LA3A 2DBNA 4ISQA 3T1MA 2BZDA 4AHZA 3PNAA 5GLWA 4BXSV 3MFAA 4AFBA 4AVAA 1GNHA 3PU8A 4JKMA 1BEV1 5FZHA 1UY1A 2BWCA 3ABZA 4N43C 2VZUA 1RUI2 1E5RA 4GH4B 4CDUA 1FYUA 2EIDA 5C3RA 1G9CA 1NCRB 5L19A 3U07A 2I2SA 2PAMA 4V2VA 3ZIWA 1Q8VA 5IFTA 3KV9A 4N90A 4IL7A 1UYZA 2DCYA 3AKPA 1D4M2 1JYVA 2ZEXA 4IE6A 4UFMA 4ZU4A 4DEVA 2A6WA 3IBMA 3KCCA 2ZA9A 3VBOB 5LCWL 3G6JB 1WCSA 4XQ4A 4AAXA 1A6CA 1NG0A 3VBOC 4XILA 3N3HA 5CAZA 2PHXA 2NYYA 4FPCA 2A73B 4KGGA 2QQUA 1WWYA 2LROA 4YW6A 2EF6A 3AJYA 2IWGB 5F3EA 2XKPA 4ASLA 2ZCWA 2DVGA 1HB4A 1BLZA 4R4ZA 2VW1A 4P9XA 5CIRA 4QXHA 1J3QA 3FJSA 4R9BA 1N1YA 3ZXEA 1MR5A 2WDBA 1H9PA 4GD4A 1W39A 4GH4C 5IW0A 4A3ZA 4WVMA 1RUJ1 4D6RA 3WY6A 1OOPB 1SFPA 3HNBM 2JB4A 1OLMA 1UZYA 5DUXA 4MV2A 4TLFA 5FY1A 4BH9A 2Z69A 3LDKA 5BNNA 2VR4A 1LEDA 3HQUA 5A1LA 3ORJA 4JTOA 2EICA 5CZKA 3OYWB 4Y24A 1WCKA 5IAVA 1LAJA 1A8MA 3ALQA 3KZ4C 3OUJA 4QQOA 3T4HB 3PTYA 3ZN6B 3RYPA 4CP0A 4URAA 3B94A 2OQ6A 1VMHA 2C9KA 2F4PA 2D7FA 5IJRA 3WW4A 3K48A 2WSVA 5A33A 4CU8A 2D3RA 1VRH3 4OZXA 4DQAA 2AGSA 3PUQA 3VBSC 3WSOA 1GNYA 2W1QA 4Y5Z0 5C7GA 1PGL2 2VCCA 4RN5A 3VBUC 4FPHA 4DFSA 3C7EA 4Z8BA 2QTWB 2BTVC 5CFDC 1N1VA 4YM3A 2YGMA 3BUCA 3FLRA 1S4CA 4JGYA 4FQZA 4XIKA 1KQRA 2ZX2A 4CDWC 2D3SA 2Y33A 1CONA 1ZNPA 3TEYA 4NWVA 3MF6A 2Q8DA 1GOFA 2XONA 2BV4A 1RJ8A 2YBSA 4ORFA 2D6MA 2JDAA 1XU2A 1XBFA 2NPIA 3LDRA 2A6XA 2VUJA 5BNQA 5EHDA 1W05A 4P9JA 4A45A 5C3PA 5FPXA 2XJVA 2G9FA 4LKDA 2HWC1 4IE0A 1REDA 3WLUA 2J7MA 2JDUA 3N7MA 4H55A 5FXWA 2HWE1 3WNKA 2QZ2A 1DYKA 3ZXJA 3VB9A 4CA9A 5C3OA 4QX5A 1GOGA 5JR7B 4R4XA 2BVVA 5DDJ2 5IUQA 4QB6A 5F3GA 3ROUA 1MEC1 4GMP0 2ZMLA 3DPRB 1SHWB 2RS11 3MIDA 1Z0HA 4CEYB 1C8NA 1F4AA 4MXWA 5IVCA 3BALA 2CWMA 3TAYA 1K5MC 1WLDA 5JZGB 1RVF1 4H7LA 5JSOA 2ZABA 4RS5C 3BKZA 3FBMA 4QB1A 1AL21 5DUWA 2UY9A 3WINE 1J3PA 3O1SA 1SDDB 1Q8OA 5HXVA 4CDXB 3VZMA 1URXA 1VAMA 2FCVA 2RS32 4PI2A 1RINA 5IK5A 5CG9A 4JGZB 5EYYA 1ND2B 4Q1RA 5HCHA 1JTZX 4GQ7A 4IETA 1ZRRA 4UF0B 1IPJA 5F32A 1AYM2 3FHIB 2XJRA 2XJSA 4ZZ5A 3N36A 5FY4A 5H9PA 1Q8PA 3NJZA 1LGNA 4XUOA 1YIPA 1G9AA 1QQP3 4LR4A 3PUAA 1W0OA 2WNEA 1ZBA3 3USSA 1VBB1 4LUKA 3I97A 1UXZA 4B29A 2RS51 3N9PA 1MQTB 4OHWA 4QPIB 4LXLA 3ZFFB 1WLCA 5J36A 3CJXA 5FY8A 4RR3A 4CXWA 3FL7A 1XXNA 3M3EA 2VZPA 1IQAA 4HONA 4DMIA 2VY0A 2D97A 2RVAA 3AVRA 1AR71 2TUNA 3MW2A 4LO5B 4BM8A 5J3UA 3VKNA 1DZQA 1OUXA 4LKSA 1SPPA 4HL0A 4NAMA 4C91A 1VMFA 5BNPA 1KS4A 1OPOA 1SBDA 1UY4A 1C3HA 2W2IA 3USUB 4FSJA 2PLV2 3IDAA 4XFIA 4AAPA 4AFAA 2EAKA 5EWSA 5FZ0A 4NHLA 3WHTA 5FWJA 1X8MA 4EWDA 1HXS2 4BLJA 4EWAA 2UYBA 5J1XA 2RS33 1QJEA 3GJAA 3LA7A 3MDPA 5FZ4A 5FJHA 3TN93 3MBWA 1NXMA 4YG3A 5KC5A 1ULCA 2R16A 1AR73 3CJIA 1X9PA 3M70A 4A7ZA 2FMYA 2JG9B 1D0GA 3OD0A 5IK7A 2JICA 4RQPA 1W04A 4XUTA 1TZOA 4YFZA 4HVRA 2AH2A 3K51A 4CYDA 1UZ0A 3I3EA 3A22A 4H3WA 3RJ2X 1AR72 3EBRA 3IZOA 4I02A 2JDNA 1QJY1 1LU1A 3Q8FA 1DGWA 5DQ0A 5FP9A 4MLOA 2P5BA 1GZ9A 2VO5A 2ZTNA 2W46A 4LOTA 4DUXA 4LBLA 2WT0A 1ULGA 1W8WA 3T30A 4J6GA 4FAHA 2MPFA 4R52A 3PIGA 1TMF1 4XCBA 2W1UA 3ZXGA 4DIQA 4BK5A 4F83A 1REEA 2HWB3 4LKEA 1OF3A 3CLPA 1H1AA 3WQ1A 4FBFA 4ZKTB 2JD4A 1H2LA 1ZA4A 1O8PA 1TME2 1U5IA 1XQNA 3T08A 1Y7BA 1PZ7A 1SMVA 2WA3A 2VZSA 1DQ1A 1UY2A 2YMZA 2ZX1A 2VMCA 3MI8A 4NRMA 2JG8A 3ASIA 5HPOA 3NAPC 4H14A 3NKGA 4ISRA 5ACA1 1K45A 2FCUA 5L9BA 4XF3A 4ASMB 4K9SA 2K46A 3O1RA 2UYAA 3S5QA 1MVEA 4TWTA 4OVEA 4XE9A 1V9U1 2G19A 3IAPA 3A7QA 1ST8A 2X8KA 1YC61 5L7OC 4ZHNA 2QQJA 4HVOA 3RGBA 4MH0E 2WYFA 2FD8A 3U75A 2J1RA 4XTMA 5I8SA 4KWJA 4GWIA 5T5OA 3PHMA 4J1XA 4XJAA 3WR0A 1SLAA 5LB6A 5AVAA 1GZTA 3BGAA 3NSTA 3NNGA 1RJ7A 3OGGA 4EN0A 3VD7A 1POV1 5DZGA 2XJTA 4BYYA 1W90A 3WNLA 4EZHA 1I3HA 2VCBA 2R043 2MEV2 2QQKA 3QLQA 2GNBA 2WO7A 3JZVA 4AI0A 1EPWA 1YHFA 2W92A 4NHYA 4OZOA 2FDGA 2WO1A 2QNKA 1UKRA 4RS5B 3OEBA 1HXS3 1ND3A 5LK5A 2D6PA 2BBAA 2N7GA 3Q8BA 3POBA 2Y6LA 3I54A 4QKBA 4I0BA 4WBBA 3ZFEC 2ATFA 4YW2A 2EVXA 2RE9A 1OF4A 4IEZA 1KJLA 4QPGA 4UWDA 1ZZ6A 5GLUA 2NN8A 1LENA 3KQ4B 4UI9L 4Q8KA 2J1VA 2J1SA 5F7UA 1I1EA 3VN4A 5I91A 4I2OA 1HB3A 1XYNA 3M8LA 1G7YA 2C1FA 2ARCA 1DGLA 5F1RA 1S2BA 2V4VA 4XAAA 4AI9A 1AL22 2ID4A 4JQTA 2XUEA 1ULOA 2I74A 2P3IA 4ATFA 3UJOA 4V2WA 4XF1A 3UESA 4CDUB 3BTXA 3M3QA 2QQOA 2WNUC 3NVCA 4K1ZA 3RZLA 3PUHA 1KITA 1W6PB 2D5HA 2K9ZA 4N9HA 4JQRA 4B8EA 4CZSA 1D7PM 4WM8C 2ZEWA 2VOTA 2VNVA 4W4ZA 3WNOA 1AYM1 1TNFA 4NRPA 5FJKA 1RUD3 1MS0A 3AP9A 3ILNA 3MPPG 3AZVA 4XBNA 3WW2A 5HCBA 3T2QA 4F3JA 3DYOA 1RTVA 2IXCA 2MEV3 2KM2A 1S55A 4KGQA 3UV9A 4JGZA 4QX3A 2QQVA 2WLQA 4YG6A 5CFDB 3VDDA 4IE5A 1QJX2 1DGRA 1RUE1 3WDTA 4CEWC 2XLFA 5KHJA 1R1ZA 1OHFA 2J1UA 5LBCA 2PQQA 5SV8A 3B3QE 2WINB 1JH5A 1GZWA 2AENA 4FOQA 3LGRA 3D6EA 4QGMA 3POEA 4LULA 4DY3A 1UYYA 4E2GA 3GCWA 5FZDA 5FLIA 1H6YA 1LGBA 1ZBE1 1PMJX 5FZ7A 4AI8A 4EN6B 1DU3D 5EP9A 3UKVA 1W6MA 3D4KA 2BJSA 4TLGA 4KG8A 3D0JA 2EXKA 4UFLA 1SPPB 5BNPB 4BE3A 3LIGA 1J1LA 4HPKB 4XQDA 1JHJA 2UWCA 2FDKA 1LOBA 4UXAA 1CAVB 1HLCA 4INDA 4D6SA 3BOPA 2ZBJA 5A7OA 4G4FA 2R0FA 4BB3A 4HN0A 1RUH2 5ABJB 2X5IB 3THCA 2JEMA 1GUIA 4XF9A 4L92A 1LB2A 2E63A 4YVWC 1UNBA 3ECQA 3ZSLA 4OHZA 1RVF2 3WDXA 2DVFA 1K42A 3WW1A 1DGWX 1PGL1 2KD7A 1RUC2 1NE6A 1UYXA 2P3JA 3SXWA 5A33B 4XHXA 1S0DA 4NOTA 2R7EB 1XNBA 2Y8KA 4IERA 2VGDA 3U4XA 3OGSA 5JDBA 1NA1A 2HWC3 2F17A 3N35A 4OI4A 3F95A 3HJRA 1L7QA 3ZXDA 3IAQA 3NQHA 3RZKA 3MYXA 4MO3M 1G9DA 4Y4RA 4KH9A 5A3TA 1W3XA 3QCWA 5T5PA 4NPLA 4KWUA 4QXKA 3ZDVA 3P5BA 1KDMA 1L7RA 4WV8A 1AYN2 2A70A 2MHFA 5FPZA 4PI0A 4I01A 3HNYM 4BMEA 1VJ2A 4GB32 1ZRFA 4O7XA 2J1EA 2VZOA 3QBQA 3S6PA 3OBTA 2Z4FA 4QM8A 4COZA 1OQ1A 1S0CA 1JS9A 3T0AA 3W58A 3KT7A 3BVCA 2VW2A 2QDRA 3CU7A 3AC0A 5GLTA 4CU6A 2WNVA 4PIXA 4S2GA 4B7KA 1APNA 4A6SA 1MS4A 5FYIA 4JCKA 2W47A 4LBNA 2XVKA 2MNGA 4QX1A 4QGLA 5CVRA 4J1WA 1HQNA 4LE4A 3ZYJB 3O1OA 3POJA 1EUTA 4H7MA 1LESA 2RDQA 2DWRA 3FUQA 1NY71 2CDOA 3E1F1 1UWWA 4JTNA 3KT4A 1BVVA 1VRBA 1Y9MA 3MFCA 2XL7A 3LSDA 4AI3A 5A6QA 3CKHA 1M4WA 2DCZA 1D4M1 4S2HA 2XGXA 1MZ6A 2VVEA 2WA4A 5K0UB 2D6OX 3R4UA 3DXTA 1AYN3 1GQHA 4JX0A 1SZBA 4P9LA 2RJKA 2X10A 5D8AC 1B35C 1W0NA 5KXDA 1LOAA 2VMFA 4LTAA 2RHPA 2VCMA 4WM7A 1QGLA 2NM1A 2G9ZA 4AF9A 5J7MA 2DBIA 1YEWA 4GAZA 1OA3A 5LA0A 2PLV1 3WG3A 1FPN3 1W9FA 3CO2A 2DVAA 3J8F1 1S0IA 1MQTA 3O1UA 2WKKA 1Y43B 1O7FA 2QFEA 2XKOA 3B5LB 3K3NA 1RMU1 4NAOA 1WMEA 1XE7A 3O1PA 3QH7A 2Q5TA 3LOBA 5F9TA 4KQ7A 4O61A 1LNSA 2A71A 3CJIC 2A75A 2BU9A 3AYAA 1UD1A 2HYXA 3ZSKA 4YM2A 1XNKA 3CF6E 5CB7A 4E27A 4L11A 5FZFA 1FAYA 1W6QB 3NV2A 4OULA 3POIA 4RA0A 5EXOA 3ZYPA 3HNMA 4CU9A 1CESA 4W6WA 1RXFA 2W9XA 4FTEA 4CEYC 4YW4A 3MUZ1 4XMIA 3R6SA 2R30A 3BTAA 1H8TC 1LKNA 1PO12 2AYHA 3MICA 3IN9A 3I2OA 1QMJA 4HETA 1F5FA 4CDQA 1S0FA 2JX9A 3MLJA 2B45X 5CKNA 2P6CA 1XJAA 3VKMA 1Y4WA 2AACA 1UMZA 4LBJA 5KWRA 4ET7A 4IQPA 4UW4A 2GNTA 2FBEA 3LEIA 3KWVA 1RMU2 1F9KA 1UZVA 3QACA 1LHNA 1NCRA 3I7DA 1W6NA 5JIAA 1EP0A 1QQP2 1OBNA 1UW8A 3MIFA 3ZSEA 2BDRA 2Z2SB 1US3A 2VC9A 5FMDA 2CV6A 3FC0A 1JUIA 4NIIA 1DP0A 2VD7A 5A7WB 1V00A 3WDVA 1RUC1 1PGW1 2R6QA 2JXAA 3KV6A 1MS8A 3DUIA 3WP5A 1WW5A 4ITCA 4FOWA 3IKWA 2IXKA 4UW6A 3TEWA 2YU1A 3O1MA 2ET7A 4Q2FA 1HV1A 4RGKA 3ZLIA 1AXYA 1XNCA 1K5JA 4AVVA 2ADDA 5FYVA 2C4XA 5KC6A 4Q0UA 3S7EA 5B4NA 5DUVA 2SLIA 3DKQA 2BEOA 2DUOA 4IESA 3T2OA 1DHKB 2VMEA 1WW6A 3INAA 1X36A 3EHKA 3ME2A 3SKJE 5IVEA 2BW8A 4PLNA 1AF9A 1EAH3 3GBGA 3PIJA 3HR9A 4Q4V3 5EYXA 1S0EA 1OD5A 4YNIA 2ZGUA 4YSFA 1A78A 5A6XA 3S0MA 1T6GC 2ZKLA 3ENRA 2P3YA 2W68A 2ZAHA 1ND3C 4ZS3A 5FYCA 2VZRA 5FLJA 4N53B 3E97A 3WG4A 2TNFA 2VMGA 3VKOA 1HRV3 2J1AA 3PUSA 1NA1B 4OI0A 3BIWE 3MW4A 5DABA 4WVZA 3LEKA 5DAXA 2Q30A 1WKYA 4Q4W2 4E4ZA 1F15A 2X29A 5FYTA 4ASKA 1POQA 5FXVA 3JB4C 5IVVA 5M0TA 1TQ5A 1W8NA 4GB31 2CL2A 4UYBA 2HWF3 3IT8A 1RB8G 2XMLA 1GYKA 1S2EA 3GBFA 3MIGA 5LA1A 3MW3A 1LOFC 1TEIA 1UPSA 1EPZA 3AL5A 3B69A 4YGDA 2ZGQA 5IVJA 2JDZA 4BPZA 3HBKA 1AZDA 1VBA2 3D82A 2E7TA 5GLZA 2WNVB 4NHXA 4JV4A 2HWB1 4GKYA 1LCLA 5C4WA 4AE2A 4E4HA 4FXGB 3MLLA 1UL9A 3I2JA 2AEZA 4CCNA 1KRIA 2WYSA 2BFUL 2RDNA 3AKQA 3M1HA 1V6MA 1HKDA 4CCDA 4QXCA 3POYA 1QNYA 2YC2A 1C57A 2A3XA 4C0HA 1CX1A 1AUYA 1OPMA 1RUE3 4CUBA 5CFCC 3VZOA 2DF7A 5LBFA 5FQ0B 4IGPA 4QQLA 2OZJA 4D0QA 4RYDA 5LRSA 3CHXA 1RUG2 1I6XA 4P00B 1FT9A 2ORZA 5JIUA 1G9FA 3DPRA 1PO23 1KXGA 3MGUA 5K0UA 2Y6FA 1LU2A 3JCIA 3VBRC 4JZRA 3M7AA 1VBE3 2PHFA 4LHSA 4AQSA 2WQ4A 4WVVA 5LY1A 5F37A 4YYOA 5LA9A 1PVXA 4K21A 3PU3A 4DOUA 5FYHA 3T09A 3W9AA 5FOJB 4NE9A 4AI2A 5JI9A 5BXXA 2VCAA 5HI0A 1RUJ3 3BN6A 3VZKA 4HPKA 5J09A 2VECA 4IEQA 4D8MA 2VNGA 1JOPA 3KHCA 3RYKA 2R042 4NUBA 3V0AB 1WLTA 4K1YA 3J7MA 2VMHA 2X05A 1GMMA 2BNMA 1YFYA 2BUKA 3B00A 5HXMA 4WM8B 2VMIA 5TSWA 1J83A 4QDSA 4S2FA 3FFQA 1RUH1 1PO21 2JE7A 5FZOB 3R4SA 3VBFC 4AEMA 2IVIB 1QJY3 2JE8A 3OUIA 4MYEA 3I8TA 2WZR1 1C4RA 2WFF1 2ZKNA 1NX9A 1O3RA 3AZZA 4M4PA 5C5UA 3V0AA 4A41A 1C8M1 3OYWA 1UO9A 1Y3TA 5FZ6A 4DXRA 1H4HA 3O1TA 1W6OA 2WR9A 4XDQA 1R64A 3TWIA 4PHZA 5BNNC 2E6VA 1IHMA 3BOWA 3I3MA 3R0RA 5KHIA 2RS13 1W8HA 4LNVA 1FATA 2GC1A 1E5HA 5C5TA 2VQUA 3UKNA 1W2UA 3VDCA 2OVUA 4P9WA 2VMDA 1ZBE3 1Q3EA 1O4TA 1H4GA 2YUEA 2ZS6B 3J4UH 2WFF2 4HBNA 1ASJ2 5H9SA 2R073 3FZ3A 4DB5A 3AFKA 2ZJCA 3MUY1 4BCUA 4LLFA 3RVHA 4CTEA 2OKXA 4LO7A 3H1WA 2CGOA 2OUHA 4LITA 1UMHA 4IV3A 4BQ2A 4GMP3 3FX3A 1H8TB 2WFF3 1RVF3 1UMIA 1VBD2 3I2FA 4G3YC 3T2TA 4DO0A 1LTEA 1YIFA 2DV9A 5SV5A 1V9U2 2VZVA 4CE8A 1NLSA 2D6LX 2PTMA 1JZ6A 1WCDJ 3FWEA 1W8UA 4N53A 4QX0A 5DZFA 5ANNA 4BDVB 2AC1A 4JVAA 2ZZJA 2P6HA 3S57A 4HMZA 1N3PA 2ARBA 3ZSJA 1RUF3 4OUEA 5F5IA 5FMBA 4XZUG 1L3JA 1DFQA 3S30A 5FY0A 2WS93 3WOGA 3KF5A 1W8TA 4GWJA 4OQ9A 4FFIA 5H9RA 1C5IA 1GP6A 1SACA 4HFSA 2Q8OA 2Y34A 1O3QA 2OQ7A 2VQTA 3JUUA 5IVBA 1GWLA 4YW7A 2ORXA 4RFRB 1S0JA 2XHKA 2V09A 4PQQA 4WVWA 1CWPA 4FPYA 3I2IA 5IAXA 4MZUA 1VAKA 1DLCA 2XB6C 1E5IA 2D98A 4JC1A 4NROA 4QAWA 1K3IA 5J98B 4KNCA 2FDJA 2R071 3WG2A 3PJQA 5F2WA 4HKWA 5ERLA 4ZU5A 5JZGC 1AR83 2HBUA 2DFBA 2EA7A 2R49A 2WSUA 2WWSA 1LR5A 1BEV3 3FUOA 2GN7A 4XTPA 5AC91 4MGTA 1JZ8A 1SFYA 3E5XA 3HOBA 2DDUA 2VBPA 1JZ4A 2PELA 4XXAA 4EN8B 4A3XA 3VBSB 3HQXA 4OHXA 4LLOA 1C1FA 4C1XA 3VZNA 3PMSA 5GJ6A 2GP5A 5L73A 3C2UA 4DS0A 5JXHA 2OPWA 4FTBA 1ZYBA 4Q0SA 2WLPA 3NKTA 2IC1A 1B35A 3AP4A 3P3NA 1DZTA 1YI7A 3O0VA 3PLQA 2DTYA 4RQPC 1OH4A 4RGGA 1YI9A 1WZXA 1STMA 2ZX4A 4UT5A 2HLEA 3EYPA 1ZREA 3USUA 1YQ5A 3JQWA 3URFA 1U12A 3IDEA 3I3BA 1RUC3 4Z2AA 1W8ZA 5LW9A 2YYOA 1LHVA 3EJKA 4YRDA 3ZN5A 2W87A 4ARYA 1QQP1 2V73A 5FYBA 4UFJA 1WCUA 4HG6B 1QOTA 4XBQA 2WC2A 1RUH3 3MF9A 3FLPA 3O7OA 2R1BA 2B4KA 2XDVA 1YCIA 3P1IA 3J7HA 5JAXA 2K2SA 3I3DA 3MV01 4IEVA 4XW3A 3BTZA 1RUNA 1X82A 1CAUB 1UYPA 3DGTA 2JE9A 2WBKA 4ARXA 1QJY2 3ZX7A 1GBGA 3BPSA 5E88A 1TNRA 2ETEA 2I07B 1VAVA 5F3CA 1D2SA 4QQPA 3GNEA 4BU2A 3ZKYA 2JG8C 4M0HA 4CCCA 5T3NA 4LK6A 5FZAA 3CZJA 2E9QA 1G86A 1GICA 2VZ3A 4AEKA 4AR2A 3V64A 3WQ7A 3ACIA 4CCJA 3ZN6A 4RL7A 4L8QA 5C8CA 5EQUA 4YVWB 4OI2A 3J7LA 4KBBA 2ZACA 1IKPA 3SISA 5JPMB 2BRTA 2HYKA 3ILFA 4A2UA 3H7YA 1AR92 2ZMKA 5D8AA 2DCKA 5FZIA 2CYFA 1GWKA 5GZFA 4AHYA 3ZYHA 3AKTA 3IMMA 4FO9A 2XLAA 3W5MA 1RUJ2 2Y0IA 1H1IA 4LIVA 5JMOA 1LGCA 2WS91 1R082 2KXLA 4LMFA 1OXCA 4E8DA 1VBB3 5H9QA 3I2HA 1PNGA 1Q43A 3WHUA 3TBDA 4BA6A 1PX3A 3HN1A 2EALA 4HK9A 2W52A 1V6LA 3WF3A 2QE3A 1H8VA 3F2ZA 3ZPYA 4TN7A 2B9UA 4JHZA 3BIEA 1WBLA 4YVWA 3JBG1 2Y26A 2DYCA 3AYDA 2E32A 1PK6C 1EV13 1F5JA 4PCRA 3ZFEA 3IWZA 3RMYA 1V6NA 2V5DA 3M3IA 4DZGA 1W2TA 3OPWA 3Q9OA 2XG3A 4PJYA 5AC93 2ERFA 4QKNA 2HWF1 5FWEA 1KGYA 1AR81 3FHAA 4XJ8A 1MEC3 3OPTA 4NIHA 3WUCA 3ZYFA 3O0WA 3K2OA 4IEUA 3RI8A 3RPQA 4NIDA 3VBHB 1IS4A 3MO4A 3VZJA 2W3JA 4NN0A 4CDQC 3AX4A 3LPFA 2YC4A 1HRI3 4OUSA 3SEEA 1B09A 2DVDA 1ZRDA 2JG9C 2CY6A 5LATA 3I3QA 2UWAA 3CL1A 2XQRA 4AGVA 4MHRA 3WP3A 1JUHA 3SNMA 4OLLA 5FYSA 1ZVFA 4O65A 2H0BA 2VUCA 2B7YA 3SC7X 4GB33 3KD4A 1KFXL 3KV4A 4AK3A 2CGPA 1O4ZA 1HN1A 2IUWA 3J7NA 3TNPB 1G6NA 3ZN4A 5A6ZA 1O3SA 3SH4A 1DCSA 2GZWA 2GC3A 3VBHC 1IS5A 3LSEA 4N8MA 2C9AA 4MGZE 2HWE2 1NA1C 1UAIA 1G8WA 1HRV1 5DN2A 5I0UA 2WQ8A 4QD2A 5FZ8A 4DNYA 1W6PA 3SH5A 5AC92 2R1DA 5FTTC 1QOSA 4RGAA 3W20A 1RUD2 1KD7A 4KMQA 1LRHA 2W5FA 4P9GA 3ZIXA 3HAGA 3L2YA 1DDLA 1W2OA 1YJKA 2O1QA 2IXHA 3N9LA 5F6LB 4QPIA 1NQDA 3ZFFA 4C0BA 1QF3A 3SCFA 1PM7A 4HSJA 4PBOA 3KQRA 3OG2A 2W91A 1X7NA 1XNTA 2BP6A 3HVDA 5FO9B 4L2NA 2DVBA 3WCRA 3ZMNA 3T0DA 1CAXA 4K6BA 1UX7A 2VQ0A 3RDIA 2HWD3 1S0GA 1LOGA 2QZ3A 1GV9A 3OUHA 3THDA 4HANA 5JWPA 2X53S 1KS5A 1GKBA 2B42B 5GLVA 2BBVA 2DTWA 2OA2A 4YGEA 3GJBA 1C8M3 2D44A 3UETA 1O5UA 1PX4A 1M06G 3OBZA 5CG8A 2WO2A 1XSRA 3BI3A 4RFT0 5JOZA 1UF2C 4E9KA 1VBD3 1PK6B 4M0NA 2CNAA 1AX0A 3WDYA 5A6YA 4TTGA 1MS9A 2RJ2A 3PVNA 2ENRA 2Y0OA 2ZX0A 1RUD1 2ARAA 1HRI2 4HK8A 3JD73 3IIAA 1K5MA 3NNJA 3RNSA 3WF4A 2RMU3 4BHPA 1SLLA 3DL3A 1BBT2 4OCTA 4Y4YA 4LA3A 2Q1FA 3T1LA 3KV5A 4FPKA 3NWKA 5ABJA 1MZ5A 3JB8A 3OGJA 1W6OB 4KI5M 2BNOA 3VDBA 5BUVA 1BYHA 1XOYA 3CDZB 4PT6A 5EV7A 4LEJA 4YM0A 2AEYA 2OYZA 3WCSA 1OC1A 2XBO2 1V6IA 5BNOA 2JKBA 1ZX5A 3LPGA 3M4FA 1BVP1 5E8AA 3TOJA 1UN1A 3WNPA 4CP1A 3B01A 4YZ3A 5K8SA 1IPKA 4AGRA 5KXBA 3RS6A 2VPVA 4LO4B 1WA4A 3VKLA 4YVSA 3RMXA 1NLQA 1P8JA 4V1PA 1WBFA 4FFFA 4Y1VA 4AHWA 2J1TA 3VUOA 4MXVA 2V4AA 1GZCA 3ZXKA 4OQ8A 3K4AA 4NIGA 2PYTA 5KXEA 1Z78A 4Q4X2 3WF1A 3TNQA 5FR3A 1DBNA 4WVMB 5FIXA 4FFHA 4Y1ZA 1TME1 1W8OA 5DAPA 3THPA 5E1RA 4ZU7A 5F6KA 1WW4A 2BYVE 4N7IA 1XB9A 1ASJ3 3VBUA 1JHNA 3KT1A 5A32B 1DQ0A 2E31A 4JRLA 1ZZCA 1GQGA 2BGOA 3ZFGB 1AR63 3P6BA 4FFGA 3UL2A 4MUVA 3TRSB 1QXPA 1E57A 5GZDA 2Z42A 3C7OA 5JI7A 4BIOA 1WMFA 1YQ8A 1HDKA 3SCGA 5FY7A 2WZR2 1ULFA 4RHV1 5D1IA 4UFIA 4COVA 1YNAA 5IK8A 2ZHLA 3LQCA 1DGRN 1EV11 1RHI1 4LE3A 5F8PA 4QU2A 2C0ZA 4URTA 2Y38A 1J84A 1WUVA 4A7KA 2WNOA 3NJVA 4CXYA 2PLV3 1OQDA 4BQ5A 5A7QA 1G9BA 4YWAA 1UOGA 1KEXA 1VBA1 2W0XA 4HZFA 1W9TA 2F4LA 4LBQA 1LHUA 2JWPA 5JOXA 3SCHA 1RHI2 3MEPA 4M00A 4LK7A 4Y5SA 3WNMA 4S2DA 4YW3A 2PHLA 4RHV3 4XBLA 3RRDA 1VP6A 1JYTA 2CSGA 1FI2A 2NLRA 4Q26A 1FMD3 5C9AB 1CX4A 1UU6A 4META 4BQ1A 5J48A 2VZTA 2WUHA 4AQ2A 2HKXA 4EWEA 4MSVA 1WD3A 2DCTA 1AR61 1NZIA 4MX3A 1B35B 1ZBA2 2EAAA 3FN9A 2WZPP 5C4WB 1YQ6A 1X8EA 5FYMA 2PHWA 3EO6A 3TEXA 2R062 1FNZA 3GZUC 3HMYA 2P4EA 4N9IA 3AMPA 5JLVA 3ZO0B 4I30A 5F2SA 5FZCA 1N3OA 1YO8A 3D8CA 3GM8A 1W6QA 3VL9A 3WF2A 2JIGA 4K3UA 3ZYGA 4P14A 2XWJB 5EPAA 5JZGA 2JJ6A 1ULDA 5IFPA 3EB7A 5FRAA 3VD9A 2EXIA 1HQLA 1S1AA 4CU7A 4Q0VA 2VUDA 1QY4A 2AUYA 4DRVA 5KHGA 5IWFA 3TN92 4XPVA 4AEDC 2P2KA 1COV3 2BNNA 4OHVA 4BK4A 1ZZ7A 1HQWA 5LA2A 4CP2A 3IM0A 2JDPA 3VBFB 5HBAA 1EAH2 1QDCA 1IG3A 4ZXEA 3J8F3 1MEC2 5FMOL 3OF1A 2D6KA 3GZTB 3ILRA 4W8JA 1IKQA 2WIIB 4GJZA 4LA2A 5LBBA 4R9CA 2YG0A 3MPBA 5DXDA 3TEZA 3GZAA 3PVEA 4K8FA 3LFIA 1CJPA 4JKLA 1LODA 4QDRA 4CDXC 5CYYA 1NLRA 2CGNA 2BERA 4JKKA 1JZ3A 1CZTA 4SBVA 3ES4A 2JB8A 1TVGA 5D8AB 1JYWA 2PXJA 4EJRA 3POGA 2GNDA 3SMHA 2RS52 4RSUA 4WM8A 1S2KA 4MGSA 3PTRB 4CCEA 3L9JT 5IK4A 4XIOA 1CIYA 3EXUA 5LY2A 5T5LA 3SH3A 4FP3A 5ACA3 1OFNA 1AHSA 3L2HA 3A0NA 1QJFA 4XUPA 1PIV2 1FV3A 3LA2A 4KWKA 2YDEA 4QHOA 5F39A 2WFPA 2XJUA 3LEMA 4K40A 5D21A 1Q8QA 1V0AA 3ZFEB 4XZPA 3UJQA 2JECA 2RDRA 2RS12 2LM3A 2DUPA 4XACA 3ZOIA 5CBLA 1SLBA 1QIQA 4XQWA 3H42B 5FBZA 5A7NA 5I93A 2NZ9A 1SLTA 1D4VB 4YVSB 4ES9A 4Q4W3 4DRRA 2B39A 5JR2A 5LEKA 3KVAA 4QT6A 4JAAA 2XVGA 3VBHA 3AVSA 4MG2A 1BXHA 3ACGA 1CD3G 1YFUA 4MGYE 4HSLA 1MPXA 5T52A 2OZ6A 4XAEA 1AXKA 3OGVA 1H1MA 1QWRA 1R093 4YPJA 5I8YA 2OPKA 2FDFA 1JU4A 5FP7A 2O8OA 2J22A 4I09A 4M3CF 3DXUA 2A6YA 2VZQA 1VBB2 2RR12 2W95A 5A32A 5EJZB 3H8RA 3G7DA 1W9SA 2YY1A 2G4IA 4MGIE 2W94A 1VPHA 3GALA 5EFUA 3R4DB 3AYEA 2GMEA 5C9AC 1ACCA 4I0WB 1CJDA 3QH6A 1XSQA 4AW7A 1D0HA 1GQPA 3B93A 4WZFA 1SDWA 3N9QA 5BNNB 5J37A 4D94A 3LZZA 1RUI3 3DYPA 3I49A 3VLBB 2PA7A 3VKFC 1GLHA 4XFBA 3ITQA 4Y1UA 2PN5A 2BQPA 1VB4A 1WLWA 4FPGA 4WM7B 4AI1A 4FAGA 4P5HA 3ZPOA 4Y3OA 5EJ3A 1CPMA 3V65A 5KHHA 2RV9A 3AZXA 1CZSA 1OVPA 3LE0A 4N7UA 4ZONA 2ZHKA 5JUVA 5B2GB 1EUUA 1U5XA 4CXXA 3RZMA 3CZUA 1ZRIA 1OFSA 2GDFA 2GH8A 4EZ4A 4HXCA 1ODMA 3FLTA 4UF0A 1JZ2A 2Z5WA 2XBO1 4L99A 1UU5A 1CAXB 2UU8A 3AXDA 2RS53 3OD4A 4A4AA 2GN3A 2CWSA 4JDMA 3GCXA 2EXJA 1ULEA 4XJWA 1KFUL 1H2KA 3KM5A 4FI9A 1POV0 1MS5A 5C8WA 1JODA 2R041 2WRAA 1ZZ9A 1WMXA 2AR6A 4PDWC 3W5NA 1W99A 3WD5A 2SBAA 4BIFA 5FZ1A 2CDPA 2LS6A 2E7QA 4HT1T 2ZX3A 3WG1A 1YYNA 3HN3A 5FAXA 2RG4A 1F4HA 5IVFA 2D3PA 2VOKA 3C7GA 3H1YA 4XYXA 3GDBA 3APBA 3SKVA 1HJFA 1DQ4A 3V56A 3N4MA 3TYJA 4ZPIA 4KU8A 1YJLA 1ZA7A 2PMWB 3R05A 4OYUA 1CAWA 2HJIA 4Q5OA 2Q8EA 5FK8A 2CU5A 5FBJA 4SLIA 2W39A 1SCSA 1Z7S2 2D93A 2QQPA 3B02A 4AVTA 1W2NA 4BZ4A 1YWKA 5AFBA 1WW7A 4ZZ8A 5IYYA 3A23A 3VV1A 1LHOA 4YVSC 5FZ3A 4B4PA 4YM1A 3ON7A 5A7WA 1IS3A 4XJZA 1NY72 4BQYA 3ZVXA 3ZXFA 2WJSA 1NAEA 1GANA 1RUG1 4ZS2A 2FMDA 2CAVA 2OXBA 4MOAA 3OB8A 2YV8A 1MZFA 4L9BA 5CFCA 3VDDB 1CIWA 1GP4A 2BGCA 2PHTA 2Q1ZB 5BNOB 4C1WA 3N9MA 2W1SA 3VBFA 1IOAA 1QHDA 1XNDA 2HBTA 2L9LA 5CKQA 2Q8CA 4Q4Y3 4LOSA 1JI6A 4YZ1A 2BOJA 1FPN1 3HT2A 1PGW2 3K77A 3KCXA 3P3PA 4W6XA 4XURA 4CCKA 3GYDA 2RR11 1BEV2 4AEDB 3FBYA 2ZGPA 4LPLA 4AWDA 1R1A2 1VR3A 5F5QA 3ACFA 1C1LA 2IXJA 4QPWA 1QDOA 2VTXJ 1UOFA 4TSVA 5F5AA 2RJLA 3Q8CA 2NMOA 3ACLA 4E4DX 2G1MA 2JG8B 5DAVA 1XRUA 4IW3A 1TG7A 2VBBA 4DXZA 3ELNA 3SQOA 1OA2A 1WGPA 5GKAC 3H3UA 3HT1A 3UT0A 2WN3A 3KCYA 5CEHA 2D5FA 1R083 2E7AA 2VZ1A 2WS92 4JDOA 5E89A 2VG9A 1HB1A 1OOPA 1ZM1A 3POSA 3VD3A 5BNOC 1Q56A 4NRQA 2GALA 1OKQA 1FOD1 2P37A 3ZDSA 4IV3B 2H6CA 3HEIA 3TB0A 5FP8A 5C4WC 4UFKA 2OUJA 1J58A 3RI9A 2JIJA 2WT2A 4P9IA 3WNXA 1VBC1 3BCWA 1ZBE2 4YGBA 1YFWA 1SG3A 5HV0A 1ZRCA 3IPVA 3K3OA 1J59A 3DECA 2KR2A 4FXKB 3VHRA 3LWCA 5JSPA 1SEFA 1O91A 1UOJA 4AXOA 1VLNA 1Y9QA 1FV2A 5ABJC 4Q27A 1ALYA 4IEWA 4CCOA 4FPJA 5FPLA 1RL3A 1VIWB 2QQWA 1W2AX 1OI6A 2P1BA 3O5SA 3POWA 1PMIA 4R8HA 4RD7A 5K9YA 3CMGA 2ZEZA 2GC0A 3KF3A 2YB7A 3LD8A 3NNFA 1I5PA 4QKDA 5CADA 2VUAA 4LIUA 4BXFA 3H8OA 1US2A 2GP3A 2VM9A 1Q8SA 2VE1A 4Z82A 4QB2A 2QQIA 2XH6A 1ND2C 1NT0A 3LCPA 5DMYA 2VH9A 1LOCA 4AEJA 4D7TA 4EROA 4ZY9A 4EN9B 4Y1YA 1HIXA 2OT7A 2XQXA 4L0PA 3ZM8A 5FMOS 4E4SA 1XPWA 2OX0A 4ATEA 1X33A 3JXSA 4B4RA 5L36A 5D2AA 2QUOA 1QJZA 3WZ1A 1PVC3 2AZ5A 4Z2WA 3MZHA 4COUA 3WVJA 3IDCB 2X5IC 2B5HA 1UU4A 3ETQA 5I0DA 5A1FA 4DUWA 5FYYA 2O0OA 3JD72 1FMD1 1V6OA 2VOWA 2UY8A 5KHKA 1XYPA 3S7IA 2XOMA 5A7PA 1W28A 4YW5A 1Q5OA 4AVBA 1CVNA 1RIRA 3MLKA 2FCTA 2PAEA 1BK0A 4NVPA 1A34A 1AVBA 2IXIA 4Y22A 1W3VA 1QXJA 2B46X 3WNNA 4YZ4A 2ET1A 1Z7S1 1NYWA 4NMIA 3U78A 4UBGA 2VTXA 4QGNA 4XFCA 2R061 1UY3A 1ULPA 2YPDA 2VJXA 4MADA 4O9EA 4UAPA 1OLRA 4UW3A 5GZGA 3NL1A 2R0HA 3VD5A 2B9VA 4F8AA 3WX5A 3O1VA 4JHTA 5KXCA 1W6MB 2GSYA 2JKXA 1SBFA 4XHBA 1XE8A 2JDHA 3LDBA 2PAKA 3NW4A 2D40A 3OTFA 4EN7B 1JOBA 3VGIA 1PZ8A 1F35A 1AL0G 1QJX1 3B7MA 1BMV2 2E26A 3ACHA 5FPAA 4FPLA 1UPIA 1RMU3 1CAWB 3U14A 1YRZA 1NCQC 3J26N 3ETPA 3JU9A 4DY5A 2MEV1 5AFEA 1V70A 1X50A 5DZEA 4RR3B 4AG4A 3H8XA 4QM9A 3NRUA 3U10A 3WV6A 1JYXA 2LW8A 5C8CB 5T50A 5FMCA 1PIV1 4KG0A 1KJRA 2Y6HA 5DG1A 1PK6A 1VBD1 3KGZA 5L9RA 2EIEA 1CR7A 2E33A 4QHBA 5FLHA 3V0BB 1BMV1 1JMUB 1SBEA 2YPJA 2Y6KA 1ENRA 5FZEA 3WXPA 5K0UC 3NV1A 2JD9A 4UFHA 4N43A 1GSLA 2XVLA 5C70A 1F31A 1W03A 5CFCB 1ENXA 2FQPA 2GMMA 1GNZA 4XDOA 3Q8AA 1OLQA 2C5DA 3A21A 3AXEA 3BB6A 3KVBA 2VW0A 4PF5A 2JDKA 1K12A 5BNPC 4Q0QA 4NPRA 2WL1A 4N53C 1X9TA 2ZGMA 3PJYA 3BYWA 5FUIA 4XDPA 2JG9A 4AEDA 4RQPB 1UXXX 2PHUA 4QMAA 3D5OA 3K4DA 5LASA 2ZHNA 5FZLA 4U36A 1I9RA 1N1SA 1H0BA 1XU1A 3IMNA 4JGYC 4BQXA 5C8CC 2Q1MA 2XLGA 3VD4A 2TBVA 1FNYA 2OW4A 2VXRA 3ZR5A 4IEOA 4AVSA 5JCTA 3VHPA 4JRAA 1MZEA 1VMJA 3GGLA 5EJ1B 1AL23 3D3AA 2X09A 3BPZA 4Y20A 1RHI3 4GWMA 4OI1A 3H8UA 1VBE2 3LOIA 4IV1A 3VL8A 1HX6A 1SCRA 2ZPXA 3HD8B 2QVSB 4XMAA 4OHYA 3THTA 5FPBA 2B8MA 4HN1A 5EZWA 3KMHA 1HV0A 2RR13 2QJVA 4CPBA 4GWNA 1CN1A 2WZEA 2IZWA 1YFXA 2PHDA 1OKOA 3RZJA 4GKXA 2WNVC 3ZFGA 5L9VA 2WO3A 2JDMA 2GMPA 1BK1A 2XXZA 3IPVB 3NAPB 4IGOA 4R9DA 1N3QA 1VBC3 4YW1A 1SLIA 5FXZA 3UK9A 3WQ0A 5K4LA 4A7YA 3H3ZA 1IS6A 4D3WA 4CSWA 2CTVA 5FXXA 2ZGKA 2WNUB 4B1LA 5C3SA 4AZZA 2WQZC 1FPN2 5G04L 1IGOA 4KWLA 1BHGA 4GA9A 1GOHA 4K7JA 3UGHA 2C26A 2GH2A 3DYMA 5FDBA 5A7SA 2VXJA 2ZGSA 3VBSA 2CAUA 2P34A 2YFUA 4W65A 3RYRA 3VHNA 1GU3A 4WZCA 4XJUA 3RZGA 3PVBB 1C8M2 3AZWA 4I3GA 3DN7A 1CQ9A 1OMIA 3LIHA 1XYOA 3WDUA 1LJ7A 4LUMA 5K7PA 4YLZA 1O59A 2ZGTA 2Y6GA 5I0RA 4RS5A 3U37A 3POFA 1JYCA 2PQSA 1JW6A 3C8XA 1VRH1 5FZBA 3DF0A 2GAUA 4HKOA 2V5YA 2UURA 3AB0A 3HBZA 4IV3C 4KU7A 3BTYA 2G9GA 4QKFA 1UKGA 3CQOA 1AXZA 2CHHA 2RMU1 5DG2A 4LHKA 1LULA 3GHMA 3JD71 3X29B 1ENQA 4XFHA 4CDXA 3QOPA 1YQ2A 2FDHA 5BPXA 4XUNA 2ZGLA 3HWJA 1OURA 4XCAA 1HRI1 4FCAA 4FT8A 3EQEA 3ZKUA 5BY5A 4CPBD 4D7YA 2EXHA 4PIYA 3AKRA 4EV0A 2HEWF 3C7HA 1RYYA 5AVPA 3ZYBA 4C90A 1BBT1 5CNAA 3N9OA 4Q4Y2 2YROA 5FREA 2WT1A 4BQ3A 3AMHA 1JOJA 4DINB 1JBCA 5FOBB 4OFGA 2XL9A 1O6UA 1GR3A 3K4ZA 3WW3A 4XABA 3AK0A 1TMF2 5DAQA 4A6OA 4BMBA 3H0OA 3ZFGC 4KBZA 5C71A 1TE1B 1NKGA 3I2KA 3NV3A 5CFDA 2HWF2 5IT6A 3WEZA 4LO6B 3UYJA 4I3PA 1T6BX 5L7OA 1QJU3 5FY9A 4LORA 5FZMA 4Y5TA 5DUUA 3ZR6A 1E5SA 2DU0A 4LKFA 1OD3A 1N47A 2FZ1A 2XPJA 2ZMNA 3AMNA 5A3NA 1H9WA 2D43A 1RC6A 1QEXA 3W21A 2ZZQA 1SFNA 2IFWA 3DEMA 1YUDA 4TZDA 1DG6A 1SLCA 2R063 1J3RA 4NHMA 3FFZA 5JXIA 3CJIB 4PBPA 4UOJA 1V6JA 3DCQA 3N7JA 3FMGA 1HXS1 3V0BA 3C7FA 1Y9GA 4QDQA 4M3CA 1YXWA 2A6ZA 3WP4A 2OS2A 2YU2A 1RUE2 4IE4A 2XWBB 4BOWA 4QX2A 3NV4A 4LBOA 4CUCA 5FUNA 3Q8EA 1RUG3 4YG0A 1POV3 1EV12 5DAWA 4Z07A 4AL9A 3O12A 4GIQA 3VBRB 4CDWA 3MV11 3O0XA 4JGYB 2V72A 1JU3A 3OCPA 4QWNA 3J9SA 3PVOA 4AQ6A 4CUAA 2RMU2 2ZGNA 2ADEA 2YZ4A 1COV2 1ZZBA 1I5ZA 5DPNA 3WF0A 4CVUA 1R1A3 5G05L 3ST7A 4A44A 1AX1A 4LBMA 2AREA 1QNWA 2WABA 2VTFA 4M3CB 4B3NA 1C5HA 5FZ9A 3NNMA 4DXTA 1A3KA 4FP2A 4PLMA 1W8FA 4XF4A 4YGCA 3UNPA 5FYUA 2QKDA 1OOPC 3JQXA 3RWNA 5APAA 4LBQB 1YLLA 1D2QA 3HIFA 4XF0A 5T5JA 2VBDA 4Q4X1 1W9WA 5FKCA 2WAAA 4MGKE 4XVHA 4IV1B 3LEGA 3C3VA 4R9AA 3JBG3 5CU1A 3WDWA 3LB9A 2E53A 2F6BA 3B9IA 4GULA 1TMF3 1BCXA 3HQRA 3AL6A 4CEYA 1T2XA 2XR4A 3NMBA 4TXWA 2R32A 2JENA 3U4SA 4EQVA 3H1MA 1U0AA 1JXNA 1DF0A 2VQAA 2YFZA 3FHQA 1LECA 3AMMA 1VB2A 3LFMA 3RZHA 3DV8A 4FVVA 1JYNA 1R092 3ZSMA 1CGPA 4Y33A 3S5AA 3NAPA 3E5QA 4P9YA 4GMP1 3KHBA 5DDJ1 4CP9B 3RZZA 2ZGRA 5FO8B 1COV1 1HB2A 3BU0A 3PDQA 1NCRC 4W50A 4AHXA 4LJHA 1R1A1 2HEVF 1DQ6A 4XFFA 1AR91 1R091 1FOD3 2DU1A 1UQXA 2QDNA 3J8F2 4HLTA 4Z92B 4OMDA 1CZVA 3LAGA 4E2QA 1ENSA 2BGPA 3IB3A 2JDYA 3E6DA 3VDDC 1NCQA 4PF1A 4AOCA 4DEQA 2ZXQA 1IG0A 5GZCA 4CP9A 4DXSA 3PUIA 4GALA 4F7ZA 1PNFA 3RG0A 4NJ4A 4UW5A 1IPSA 2VAUA 1W9YA 4HKLA 3T4VA 5FUPA 1F8VA 4COWA 2YC0A 3OEAA 5JOYA 4MHUA 4FOYA 1OVSA 4NR1A 1WD4A 5IVYA 1PO11 4X6QB 1AR82 1A8DA 1NE4A 5B4XA 5E16A 4BISA 2ZHMA 1H2MA 1NQJA 1XE0A 4LO8A 1XC6A 4CEWB 3T3YA 3ZMOA 5A80A 4WM7C 5HV4A 4QXBA 3OSDA 3ZYRA 2DUQA 4N43B 4PLOA 3CEWA 5I0SA 2ILMA 4GH4A 3H7JA 4FOVA 1QH6A 4JDNA 4Q4Y1 1REFA 2IVJA 1WMDA 3MIEA 4XFGA 5JSRA 2VNRA 2D6NA 4FPFA 3GBWA 5GALA 4I0AA 4O9GA 1R081 3AKSA 1SQ4A 5HCFA 5FPUA 2Z79A 1HN0A 1MVQA 3OJBA 4CDQB 3KSCA 2TEPA 2ARXA 2LUWA 5JOWA 3A0KA 3E5UA 4BWOA 4E8CA 4DPNA 4AVCA 1NZCA 1UX6A 2WZ8A 5FPVA 1YQCA 4AYUA 1DQ5A 1UZWA 3IIIA 5GZEA 1CAUA 1H30A 1LEMA 1OLME 2DCJA 1VRH2 4X8NA 5ANQA 2W1WA 1OQEA 1IQDC 1W6NB 5IHRA 2FDIA 4XXPA 1HW5A 2GU9A 3NO8A 2IXLA 4HOOA 4IEYA 2HWD1 5FCCA 4NIAA 3UKTA 4YARA 4YZ5A 1VBE1 3ZXAC 4XUQA 4YZ2A 1PZ9A 4Q0PA 5KBFA 3A4UA 3I2GA 2WWJA 1VBA3 1MS3A 4IEPA 1LOEA 4M3CE 1BKZA 3T0BA 4AGGA 4AFMA 2LTNA 4XETA 3H50A 5A3UA 4UBHA 5FFOC 1UIJA 5C33A 1O5LA 3E6CC 1RUF1 4LT5A 5C6CA 2VOXA 2VL4A 3WP6A 1DZRA 3GZEA 4U2AA 3U0ZA 2VU9A 2PHRA 3I4IA 2DURA 5FK7A 2WNUA 3K75B 4BJ0A
chains in the Genus database with same CATH topology
3I59B 5DDJ3 1IZ3A 5LK7B 2IFRA 2XBO3 2YGLA 1J1TA 3VBRA 4Y1XA 5I0TA 5J96B 4XOGA 5GM0A 2VOVA 1AYN1 3WUDA 5BV6A 2A6VA 4HVQA 3M3CA 1PVC2 5C9AA 2H0VA 4PDWA 3PMEA 4QPGC 1TME3 1QXRA 1U5YA 1W0PA 3I2DA 4QQHA 1ASJ1 5I8TA 4IV1C 1EY2A 4XJ9A 3I59A 4LBKA 1EAH1 3RJRA 4PIZA 4MVTA 1PGSA 4D69A 5T55A 2BPA2 2H6BA 3B9CA 2NQYA 3N7LA 4BLIA 1H2NA 1V9U3 3AM2A 5T54A 2VNOA 1BBT3 1VALA 2E51A 3VZLA 4CRQA 2OIIA 1O3TA 4Q4W1 1S0BA 2NP0A 3OY8A 1AR62 3AP7A 1N1TA 4QPIC 3ZFFC 1DQ2A 3KB5A 2BWAA 1BQPA 4MXWB 4RR3C 4QPYA 3AFGA 4Q4X3 3IDBB 5A3LA 4E2SA 1QH7A 4XEZA 2GC2A 2A3YA 4IXLA 2HWB2 4ES8A 2HEYF 1GZWB 5FQ0A 2A7AA 2BFUS 2P3KA 4NHKA 4G9SB 3OY8B 2UWBA 1AX2A 3FE5A 3E6BA 5L7OB 3AMQA 1BJQA 3VBOA 1BZWA 1RITA 3SLIA 5JMCA 3D0SA 4Y22B 1DYPA 5BYNA 1F2NA 3KS7A 4RHV2 1JYIA 1ND2A 5HCAA 2WZR3 2A5ZA 2VVFA 4M01A 3TN91 1NXD1 4Q8LA 3SHRA 2ES3A 3M2MA 2W08A 4PQ9A 1CAVA 5LEJA 1AYM3 5CA6A 3ES1A 4LHLA 4COYA 2LALA 2X5IA 3QD6A 1FX5A 2R072 1O4YA 3GF6A 1UIKA 1QJX3 2K0GA 5FO7B 1RUOA 2XJPA 4IEXA 1QOOA 5ACA2 5JPNB 4CDWB 4X8PA 4NO4A 3W59A 1ZBA1 3GHNA 1K5MB 4K20A 4D7SA 2FHRA 1OSGA 1PO13 1UZZA 2VULA 3OPZA 3AYCA 3BODA 1QJU1 3OBRA 4TYSA 1Z7S3 1ZZ8A 2KA3A 1RUF2 4FPOB 2VVDA 3RQ0A 4AFDA 2XJQA 2ZOEB 3DKWA 4GXLA 1RUI1 3KGLA 3LKJA 1LHWA 2ZGOA 2EIGA 4ONUA 3SITA 2Q0AA 4Q1PA 1AJKA 1CPNA 2Q4SA 3WT3A 4OUMA 3BU7A 3ZXLA 3MIHA 3KLSA 4Z1VA 1AR93 4CDUC 5LRRA 1PVC1 3DPRC 1RGSA 1D4M3 1MQTC 4LHNA 2HWE3 2P17A 3CNAA 4B4QA 1AJOA 1MACA 3VHOA 2RM21 1GFF2 2HWC2 1DLLA 1PHMA 4XFAA 1DIWA 4Y20B 3VBUB 2DFCA 2YHJA 3AP5A 1C28A 2QCSB 4FPEA 4L97A 1QU0A 4NWWA 1QJU2 5JVVA 4Q29A 1LOFA 4JGZC 1V6KA 1QKQA 2GNMA 4Q4V1 1H8TA 1VBC2 4KL1A 1NOVA 1EYBA 1FMD2 4ZXKA 1NCQB 1KDKA 4LBQD 4PDWB 3H9AA 2NMNA 1UCXA 2RM23 4AQTA 4Q4V2 1JN2P 3O14A 4YFWA 2YXSA 4X6RB 5A3MA 2I45A 2HWD2 1FXZA 3AP6A 2PFWA 3AZYA 3AJZA 2A3WA 2XUMA 3ZYIB 1FOD2 3N7KA 1PO22 2RM22 1MS1A 1HRV2 2O8QA 2BVBA 4Y26A 3ATGA 3JBG2 2ZAAA 3M3OA 4B7EA 2RS31 4FQ4A 1ND3B 4CEWA 4FTSA 2FZ2A 1U5ZA 4W6YA 4AFCA 1PIV3 1ONAA 3MIBA 4QPGB 4QQ2A 1OA4A 3RSJA 3U11A 3LA3A 4ISQA 3T1MA 4AHZA 3PNAA 5GLWA 3MFAA 4AFBA 4AVAA 1GNHA 1BEV1 2BWCA 4N43C 1RUI2 4GH4B 4CDUA 1FYUA 1G9CA 1NCRB 5L19A 3U07A 2I2SA 2PAMA 3ZIWA 1Q8VA 4N90A 4IL7A 2DCYA 3AKPA 1D4M2 4ZU4A 2A6WA 3IBMA 3KCCA 2ZA9A 3VBOB 3G6JB 1WCSA 4XQ4A 1A6CA 1NG0A 3VBOC 4XILA 3N3HA 5CAZA 2PHXA 2NYYA 4FPCA 2A73B 4KGGA 2EF6A 3AJYA 2IWGB 2XKPA 4ASLA 2ZCWA 2DVGA 4R4ZA 2VW1A 4P9XA 5CIRA 1J3QA 3FJSA 4R9BA 1N1YA 3ZXEA 1MR5A 1H9PA 4GH4C 1W39A 4WVMA 1RUJ1 3WY6A 1OOPB 1UZYA 5DUXA 4MV2A 4TLFA 4BH9A 2Z69A 5BNNA 1LEDA 4JTOA 3OYWB 4Y24A 1WCKA 1A8MA 3ALQA 3KZ4C 4QQOA 3PTYA 3ZN6B 3RYPA 4CP0A 3B94A 2F4PA 2D7FA 3WW4A 3K48A 2WSVA 5A33A 2D3RA 1VRH3 4OZXA 4DQAA 2AGSA 3VBSC 4Y5Z0 1PGL2 3VBUC 4FPHA 4DFSA 4Z8BA 2BTVC 5CFDC 1N1VA 4YM3A 2YGMA 3FLRA 4JGYA 4FQZA 4XIKA 1KQRA 2ZX2A 4CDWC 2D3SA 1CONA 1ZNPA 4NWVA 3MF6A 1RJ8A 4ORFA 2D6MA 1XU2A 2NPIA 2A6XA 2VUJA 5BNQA 4P9JA 5FPXA 2XJVA 2G9FA 2HWC1 1REDA 3WLUA 3N7MA 4H55A 3ZXJA 2HWE1 2QZ2A 1DYKA 4QX5A 5JR7B 4R4XA 2BVVA 5DDJ2 5IUQA 3ROUA 1MEC1 4GMP0 2ZMLA 3DPRB 2RS11 3MIDA 1Z0HA 4CEYB 1C8NA 4MXWA 3BALA 2CWMA 3TAYA 1K5MC 1WLDA 5JZGB 1RVF1 4H7LA 5JSOA 2ZABA 4RS5C 3FBMA 1AL21 5DUWA 2UY9A 3WINE 1J3PA 1Q8OA 5HXVA 4CDXB 3VZMA 1URXA 1VAMA 2RS32 1RINA 5IK5A 5CG9A 4JGZB 5EYYA 1ND2B 4Q1RA 1JTZX 4GQ7A 4IETA 1ZRRA 1IPJA 1AYM2 3FHIB 2XJRA 2XJSA 3N36A 5H9PA 1Q8PA 3NJZA 1LGNA 1YIPA 1G9AA 1QQP3 4LR4A 1W0OA 2WNEA 1ZBA3 3USSA 1VBB1 4LUKA 4B29A 2RS51 1MQTB 4OHWA 4QPIB 3ZFFB 1WLCA 5J36A 3CJXA 4RR3A 1XXNA 3M3EA 1IQAA 4DMIA 2VY0A 2D97A 1AR71 2TUNA 3MW2A 4LO5B 4BM8A 5J3UA 3VKNA 1DZQA 4C91A 5BNPA 4HL0A 1KS4A 1OPOA 1SBDA 3USUB 1C3HA 4FSJA 2PLV2 4XFIA 4AFAA 2EAKA 5EWSA 4NHLA 3WHTA 1X8MA 4EWDA 1HXS2 4BLJA 4EWAA 2UYBA 2RS33 3LA7A 3TN93 3MDPA 5KC5A 4YG3A 1NXMA 1ULCA 2R16A 1AR73 3CJIA 4A7ZA 3M70A 5IK7A 2FMYA 2JG9B 1D0GA 3OD0A 2JICA 4RQPA 4YFZA 4HVRA 2AH2A 3K51A 4CYDA 4H3WA 3RJ2X 1AR72 3EBRA 4I02A 1QJY1 1LU1A 1DGWA 4MLOA 1GZ9A 2ZTNA 2WT0A 1ULGA 4FAHA 4J6GA 2MPFA 4R52A 1TMF1 3ZXGA 4F83A 1REEA 2HWB3 3CLPA 1H1AA 3WQ1A 4FBFA 4ZKTB 1H2LA 2JD4A 1ZA4A 1TME2 1U5IA 1XQNA 1Y7BA 1PZ7A 1SMVA 2WA3A 2YMZA 1DQ1A 2ZX1A 3MI8A 4XXPA 4ZU5A 5BNNB 2JG8A 3ASIA 3NAPC 4H14A 3NKGA 4ISRA 5ACA1 1ZRFA 4XF3A 4ASMB 4K9SA 2UYAA 1MVEA 4TWTA 4OVEA 4XE9A 1V9U1 2X8KA 5L7OC 4HVOA 4MH0E 4XTMA 5I8SA 4KWJA 5T5OA 3PHMA 4J1XA 4XJAA 3WR0A 1SLAA 5AVAA 3NSTA 1RJ7A 3OGGA 4EN0A 1POV1 5DZGA 2XJTA 4BYYA 1I3HA 2R043 2MEV2 3QLQA 2GNBA 3JZVA 4AI0A 1EPWA 1YHFA 2QNKA 1UKRA 4RS5B 1HXS3 1ND3A 5LK5A 2D6PA 2N7GA 3ZFEC 3I54A 4I0BA 4WBBA 2ATFA 4YW2A 2EVXA 2RE9A 4IEZA 1KJLA 4QPGA 1ZZ6A 5GLUA 2NN8A 1LENA 4Q8KA 1I1EA 3VN4A 5I91A 4I2OA 1XYNA 3M8LA 1G7YA 2C1FA 1DGLA 5F1RA 1S2BA 1AL22 2P3IA 2I74A 4ATFA 3UJOA 4XF1A 4CDUB 3M3QA 2WNUC 3NVCA 4K1ZA 1KITA 1W6PB 2D5HA 2K9ZA 4N9HA 4JQRA 4B8EA 4CZSA 4WM8C 1AYM1 1TNFA 1RUD3 1MS0A 3AP9A 3ILNA 3MPPG 3AZVA 4XBNA 3WW2A 5HCBA 4F3JA 1RTVA 2IXCA 2MEV3 2KM2A 1S55A 4KGQA 3UV9A 4JGZA 2WLQA 4YG6A 5CFDB 3VDDA 1QJX2 1DGRA 1RUE1 3WDTA 4CEWC 2XLFA 5KHJA 1R1ZA 1OHFA 2PQQA 5SV8A 3B3QE 2WINB 1JH5A 1GZWA 2AENA 4FOQA 3LGRA 3D6EA 4QGMA 4LULA 4DY3A 4E2GA 5FLIA 1LGBA 1ZBE1 4AI8A 4EN6B 1DU3D 3UKVA 1W6MA 3D4KA 4KG8A 3D0JA 2EXKA 5BNPB 4BE3A 1J1LA 4HPKB 4XQDA 2UWCA 1LOBA 4UXAA 1CAVB 1HLCA 4INDA 3BOPA 2ZBJA 4G4FA 2R0FA 4HN0A 1RUH2 5ABJB 2X5IB 2JEMA 4XF9A 4L92A 1LB2A 2E63A 4YVWC 3ECQA 3ZSLA 4OHZA 1RVF2 3WDXA 2DVFA 3WW1A 1DGWX 1PGL1 1RUC2 1NE6A 2P3JA 3SXWA 5A33B 4XHXA 1S0DA 4NOTA 1XNBA 4IERA 2VGDA 3U4XA 5JDBA 1NA1A 2HWC3 3N35A 4OI4A 3ZXDA 3MYXA 1G9DA 4KH9A 3QCWA 5T5PA 4QXKA 1KDMA 4WV8A 5FPZA 1AYN2 2A70A 2MHFA 4I01A 4BMEA 1VJ2A 4GB32 3QBQA 3S6PA 3OBTA 4QM8A 4COZA 1OQ1A 1S0CA 3W58A 3KT7A 2VW2A 2QDRA 3CU7A 5GLTA 2WNVA 4PIXA 4S2GA 4B7KA 1APNA 1MS4A 4JCKA 4LBNA 2XVKA 2MNGA 4QGLA 5CVRA 4J1WA 1HQNA 4LE4A 3ZYJB 4H7MA 1LESA 2DWRA 3FUQA 1NY71 4JTNA 3KT4A 1BVVA 3MFCA 2XL7A 3LSDA 4AI3A 1M4WA 2DCZA 1D4M1 4S2HA 2XGXA 1MZ6A 2VVEA 2WA4A 5K0UB 2D6OX 3R4UA 1AYN3 1GQHA 4P9LA 2RJKA 5D8AC 1B35C 5KXDA 1LOAA 4LTAA 2RHPA 4WM7A 4AF9A 1QGLA 2NM1A 5J7MA 1OA3A 2PLV1 3WG3A 1FPN3 3CO2A 2DVAA 3J8F1 1S0IA 1MQTA 2WKKA 1Y43B 1O7FA 2QFEA 3B5LB 2XKOA 1RMU1 1WMEA 1XE7A 3LOBA 3QH7A 2Q5TA 5F9TA 4KQ7A 2A71A 3CJIC 2A75A 3AYAA 1UD1A 3ZSKA 4YM2A 1XNKA 3CF6E 5CB7A 4E27A 4L11A 1FAYA 1W6QB 3NV2A 4OULA 4RA0A 3ZYPA 5EXOA 1CESA 4W6WA 4FTEA 4CEYC 4YW4A 4XMIA 3R6SA 2R30A 3BTAA 1H8TC 1LKNA 1PO12 2AYHA 3MICA 3IN9A 1QMJA 4HETA 1F5FA 4CDQA 1S0FA 2JX9A 3MLJA 2B45X 3VKMA 1UMZA 4LBJA 5KWRA 4IQPA 4UW4A 2GNTA 2FBEA 1RMU2 1F9KA 3QACA 1LHNA 1NCRA 3I7DA 1W6NA 5JIAA 1EP0A 1QQP2 1UW8A 3MIFA 3ZSEA 2Z2SB 2CV6A 3FC0A 1JUIA 1V00A 3WDVA 1RUC1 1PGW1 2R6QA 2JXAA 3WP5A 1MS8A 3DUIA 1WW5A 4ITCA 4FOWA 3IKWA 2IXKA 4UW6A 2ET7A 4Q2FA 1HV1A 1AXYA 1XNCA 4AVVA 5KC6A 4Q0UA 3S7EA 5DUVA 2SLIA 2BEOA 2DUOA 4IESA 1DHKB 1WW6A 3INAA 1X36A 3EHKA 3ME2A 2BW8A 4PLNA 1AF9A 1EAH3 3GBGA 3HR9A 4Q4V3 5EYXA 1S0EA 1OD5A 4YNIA 2ZGUA 4YSFA 1A78A 3S0MA 1T6GC 2ZKLA 3ENRA 2W68A 2ZAHA 1ND3C 5FLJA 4N53B 3E97A 3WG4A 2TNFA 2VMGA 3VKOA 1HRV3 1NA1B 4OI0A 3BIWE 3MW4A 4E4ZA 4WVZA 2Q30A 4Q4W2 2X29A 3JB4C 1TQ5A 4GB31 2CL2A 2HWF3 3IT8A 1RB8G 3GBFA 1GYKA 3MIGA 3MW3A 1LOFC 1TEIA 1UPSA 1EPZA 3B69A 4YGDA 2ZGQA 2JDZA 4BPZA 1AZDA 1VBA2 3D82A 2E7TA 5GLZA 2WNVB 4JV4A 2HWB1 4GKYA 1LCLA 5C4WA 4AE2A 4FXGB 3MLLA 1UL9A 1KRIA 2BFUL 3AKQA 3M1HA 1V6MA 1HKDA 3POYA 1QNYA 1C57A 2A3XA 4C0HA 1AUYA 1OPMA 1RUE3 5CFCC 3VZOA 2DF7A 5FQ0B 4QQLA 2OZJA 5LRSA 1RUG2 1I6XA 1FT9A 5JIUA 3DPRA 1G9FA 1PO23 1KXGA 3MGUA 5K0UA 1LU2A 3JCIA 3VBRC 3M7AA 1VBE3 2PHFA 4AQSA 2WQ4A 4WVVA 4YYOA 1PVXA 4K21A 4DOUA 3W9AA 5FOJB 4AI2A 5JI9A 5BXXA 5HI0A 1RUJ3 3VZKA 4HPKA 5J09A 2VECA 4IEQA 2VNGA 3RYKA 2R042 3V0AB 1WLTA 4K1YA 2VMHA 2BNMA 2BUKA 1YFYA 3B00A 4WM8B 2VMIA 5TSWA 4S2FA 3FFQA 1RUH1 1PO21