2TEPA

Peanut lectin complexed with t-antigenic disaccharide
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
232
structure length
232
Chain Sequence
AETVSFNFNSFSEGNPAINFQGDVTVLSNGNIQLTNLNKVNSVGRVLYAMPVRIWSSATGNVASFLTSFSFEMKDIKDYDPADGIIFFIAPEDTQIPAGSIGGGTLGVSDTKGAGHFVGVEFDTYSNSEYNDPPTDHVGIDVNSVDSVKTVPWNSVSGAVVKVTVIYDSSTKTLSVAVTNDNGDITTIAQVVDLKAKLPERVKFGFSASGSLGGRQIHLIRSWSFTSTLITT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (PEANUT LECTIN)
publication title The Specificity of Peanut Agglutinin for Thomsen-Friedenreich Antigen is Mediated by Water-Bridges
pubmed rcsb
molecule tags Lectin
total genus 55
structure length 232
sequence length 232
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2tepA00
4XJUA 1VAMA 2KM2A 3I8TA 4UW6A 2EXHA 4FPFA 4YM1A 3RMXA 2P2KA 3VKMA 5JDBA 1WD4A 1PZ8A 3B9CA 1GNZA 5KXCA 3BODA 2DVDA 3AYCA 3VKNA 1HQLA 1ONAA 1B09A 2C9AA 1VLNA 1FV2A 2VY0A 5IUQA 3PVNA 4ATEA 2P3KA 1YI7A 2YY1A 3FLPA 4FOQA 1MS1A 1VIWB 3A0KA 4AGRA 1MS3A 1UX6A 1JYIA 1CIWA 2ZHMA 1NXD1 3TAYA 1YYNA 1QF3A 4JCKA 1VAVA 3CNAA 4U36A 3WCRA 1DHKB 1H9PA 1SACA 3MPPG 4DFSA 4Y1YA 1DLLA 3M2MA 1QGLA 1JUIA 3SH3A 2W08A 2ZHLA 4NOTA 4Y1ZA 3FFZA 2E7QA 4WV8A 1W6MB 5IK4A 1UL9A 3IKWA 2A75A 1WUVA 2DUQA 4M00A 1QOOA 1SLLA 3AYDA 3ZVXA 1I3HA 4FQ4A 3USUA 3V0BB 1N3PA 1WLWA 3KQRA 2ZABA 5H9QA 3T1LA 3O0XA 3WG3A 1IKQA 2D7FA 4I30A 2ZA9A 3MW3A 4LBOA 4MYEA 1LU1A 5T50A 3LCPA 2VW2A 1PZ7A 4LBLA 2R0FA 5CA6A 2D6NA 1LTEA 4GWMA 4GKXA 4XXAA 5GZGA 3WG1A 3WOGA 1Q8QA 2D6PA 3AP4A 5IK7A 1O4ZA 1JBCA 2JJ6A 5FREA 1QDOA 4FQZA 2ZKNA 4GALA 1AJKA 4PBPA 1NLSA 3UK9A 4DRVA 3AYAA 1V00A 2GDFA 3WHTA 1F5FA 1JN2P 1N1VA 3FBYA 4YFWA 2CY6A 1KDMA 1PZ9A 2AGSA 3R4UA 1S0FA 2D6KA 1C4RA 3WUCA 3OBRA 1QNYA 3N7LA 1S0DA 3V65A 1QDCA 1ZM1A 1G86A 2JDZA 3R4SA 4UW3A 3T1MA 4Y24A 2W39A 1A8DA 5DZGA 4HANA 1LHVA 1N1TA 3UL2A 3O0VA 2D6LX 2DWRA 2EXJA 2D3SA 5HCAA 3B01A 2EALA 3AX4A 2JKBA 3LSDA 1EPWA 4Y20B 1QMJA 2GN3A 3ASIA 3OYWB 1JYCA 3FUQA 2DVBA 3A4UA 4YW3A 2A6ZA 2D44A 2GNBA 1G9BA 4M01A 3W59A 2JE7A 1GKBA 2R16A 3VKLA 3IPVB 1MVEA 1W0PA 1F31A 4LBJA 3RRDA 5T54A 5GLTA 4KBBA 2DTYA 1SLTA 4ATFA 3VV1A 5IK8A 1W6QA 4ASMB 3ZXLA 1IS6A 1DYKA 1MS4A 1GZWB 1G9AA 1KRIA 4YZ4A 4Z8BA 1CN1A 2AR6A 2WT0A 4Q26A 1JW6A 2LTNA 1QNWA 2EAKA 2ZGKA 3AZZA 4LBQA 1Z78A 4AYUA 5KXEA 1UZZA 3POWA 2PHRA 1DQ2A 3WUDA 1FV3A 5E8AA 1LODA 3JUUA 1TEIA 1LOFC 4FPOB 4AGGA 4XIKA 2AYHA 2R0HA 3AZWA 2ZGSA 3AJYA 2DYCA 5GLZA 3OY8B 4XJAA 4DQAA 4L8QA 4R9DA 4FPLA 3C2UA 4XBQA 4YZ3A 1DYPA 2DVGA 4GXLA 1MS0A 3D6EA 5SV8A 5KXDA 2E6VA 1DQ6A 2WNEA 2EIGA 5E88A 3WDUA 1S0IA 5GALA 3PVOA 1AF9A 2VW1A 4FPEA 1JXNA 2ZHNA 2PELA 3N7MA 5JOYA 1YXWA 1AX1A 3NV1A 4K1ZA 2NN8A 3GALA 1LU2A 1G8WA 1KJLA 3ZXEA 5JOXA 5CBLA 1OFSA 1LJ7A 3AFKA 3POYA 4NO4A 1IS3A 2A3YA 1HLCA 4Y1UA 5T52A 4DS0A 2CL2A 3NWKA 1LESA 3RQ0A 5GZEA 2TEPA 3RMYA 4W65A 2JD4A 2AREA 2G4IA 2ERFA 1Z0HA 4DRRA 3M3EA 1MZ6A 3B00A 4LBMA 4ISRA 4XMIA 2GMPA 2ZMLA 1MZ5A 1MS9A 1FX5A 4YM2A 3ZYPA 5JOWA 2DUOA 3WCSA 2P3JA 1QOTA 1WBFA 4YZ2A 3I4IA 2V5YA 3R05A 4FP2A 4Y22A 5LK5A 4BMEA 3WDXA 2AENA 3U4XA 4M3CA 2ZMKA 2UWCA 2ZGPA 4CTEA 1AZDA 4U2AA 2EF6A 1MACA 2VU9A 4XJWA 2UWAA 2NP0A 1LGCA 1CONA 4BPZA 1V6NA 3FUOA 3PJQA 1OKQA 2E7TA 5HCBA 5HCFA 5IT6A 3NV4A 4AVTA 3OPZA 1V6LA 5CAZA 1N1YA 4SLIA 1Q8VA 2ZGMA 1Q8SA 4FPYA 4XZPA 1APNA 1V6OA 1SCRA 2WKKA 3H0OA 2NM1A 4K1YA 4Y22B 3W58A 3ILFA 1FYUA 3ZXFA 4XHXA 2UWBA 1AXKA 1DQ1A 4BQ1A 1CPNA 1SLIA 2ARBA 2GNMA 3SH5A 1GNHA 1ULCA 4FPJA 3AP6A 1G7YA 5T5LA 1Q8PA 5GJ6A 5KXBA 1A78A 2P34A 3N7JA 2ZMNA 5GZFA 1LOBA 3USUB 1YRZA 1WW7A 3WG2A 3V0AA 3UJOA 3MEPA 5EXOA 3B69A 3RG0A 2YZ4A 1QKQA 1LECA 3OGGA 4LBQD 1SBEA 1X50A 1CR7A 2AH2A 5DUWA 1LULA 1UZYA 2D3PA 5DUXA 3WDYA 1V6JA 3GNEA 3WDTA 3DGTA 1C1LA 4OZXA 5H9RA 3VKFC 1C57A 2CTVA 1LEDA 3AZVA 1IOAA 4RA0A 3M1HA 4K21A 2DVAA 4XE9A 1AXYA 2AUYA 1LHNA 5H9PA 3AZYA 3ILNA 2FMDA 1GV9A 5GZDA 1CJPA 4XTMA 1ENQA 3AP9A 3MW4A 1G9DA 4Q1PA 2CYFA 5EWSA 3V64A 2SBAA 1ENRA 4YZ1A 1SLAA 1DQ5A 2E53A 4ZXKA 2ZHKA 1H9WA 3N7KA 1SFYA 2A6VA 4Q1RA 2ARXA 1RINA 4FPHA 5F5QA 1FNYA 1LGBA 1DIWA 4UW4A 4Y1VA 4JRAA 5F9TA 1N47A 1N1SA 1CQ9A 2NYYA 3A0NA 4BLJA 1DZQA 1W6NA 2WJSA 3OBTA 3KM5A 1FAYA 1S0BA 2FHRA 3AK0A 3AYEA 2GMMA 3IM0A 4YM0A 3N36A 1AXZA 1GSLA 1QOSA 2OUHA 3RSJA 1Y7BA 4WVWA 4FVVA 4XTPA 1CESA 4FPGA 2WSVA 3POSA 1WD3A 2ZGUA 4C1WA 3SISA 2BQPA 1DQ4A 1LHOA 1G9FA 2V73A 1GICA 1W6NB 2W52A 3PVEA 1V6IA 3BOPA 5BYNA 2I2SA 1BZWA 2ZGLA 1WLCA 4LBNA 5DZEA 2ENRA 1W6QB 4XOGA 4XBLA 4XILA 4Y1XA 1A3KA 2DVFA 1AVBA 3O12A 4M3CE 1UPSA 4XYXA 4R9BA 4YGCA 1G9CA 1W0OA 2DU0A 3AP5A 4LBQB 1UMZA 3PMEA 2UU8A 1WLDA 5DG1A 4TZDA 2A5ZA 4RL7A 5T5OA 2ZGRA 3IN9A 2A6YA 3AZXA 1DFQA 1MR5A 1WW6A 1J1TA 4YGDA 1IKPA 2GNDA 4PF5A 1D0HA 1V6MA 1AX0A 3M3QA 4Q27A 1UKGA 4K20A 5T5PA 5IK5A 4XHBA 1S0JA 2CWSA 5AVAA 1SLBA 3OJBA 5GZCA 1SBDA 2YROA 1OQ1A 1C1FA 2PHTA 2E51A 3NV3A 4YW2A 2R1DA 3WLUA 2GMEA 2D6OX 1H30A 1LEMA 2NMNA 1LGNA 2ES3A 2VUAA 2WT1A 4YLZA 5JLVA 1GZ9A 4XJ8A 1MS8A 4HL0A 1BYHA 1URXA 2ZZJA 4FOVA 1DGLA 1WBLA 1YO8A 3IMNA 1FATA 4D69A 3SH4A 1N3QA 1WCSA 2JE9A 4LBKA 1S0CA 3FLRA 4ITCA 1BXHA 2ZBJA 2P3IA 1R1ZA 3HMYA 2CNAA 2PHXA 4IQPA 4YW1A 2A70A 1V6KA 3WNXA 3FLTA 4WZFA 4XMAA 1KITA 5JOZA 1W6PA 1HKDA 1SBFA 2DU1A 1RITA 2XB6C 4FOWA 4YW5A 1ZA4A 2GNTA 2A3XA 1W6MA 3ZSLA 1LOGA 3WDVA 3M3CA 4R9AA 1Q8OA 4M3CB 5DUUA 4Q2FA 4AGVA 2YMZA 4TYSA 1AX2A 2HYKA 2P37A 3N35A 2YXSA 3ZSKA 3V0BA 4XJ9A 4XJZA 5GM0A 5T5JA 1S0EA 3AXDA 1BJQA 4BM8A 3AJZA 2OVUA 2LALA 1Q56A 3O5SA 2WQZC 1W6PB 2W68A 5GLWA 1O4YA 4XDQA 4XIOA 1MVQA 3B3QE 4AVSA 5H9SA 3TB0A 1HQWA 1RIRA 4F83A 3WHUA 1N3OA 4C1XA 1LCLA 3HN1A 1GYKA 3ZXKA 4YZ5A 1CPMA 3APBA 1I1EA 2OUJA 3JU9A 2YV8A 4Q8LA 1LOCA 3Q9OA 1WW4A 2PHFA 4P9YA 3N3HA 4Y26A 3V0AB 1U0AA 2GN7A 3WVJA 3ZXJA 4BLIA 4JC1A 1SLCA 2DTWA 2VXRA 2ZGTA 3DUIA 1ULEA 3MW2A 3WG4A 3L2YA 3AXEA 4P14A 3HR9A 1KJRA 2WT2A 4PCRA 5JVVA 3SITA 1JHNA 3SLIA 2A6WA 5EYYA 1BKZA 1LOAA 5DXDA 2PHUA 4H55A 4AVVA 2EXKA 1ULGA 2A3WA 4YFZA 2ZGNA 2PHWA 2CWMA 1IS5A 5EYXA 4GWNA 3ILRA 3QCWA 3INAA 4YGBA 3UJQA 3ZYRA 4FP3A 3D5OA 1LOFA 1UN1A 4Q8KA 2JECA 1VALA 3ENRA 3LSEA 5JMCA 1KDKA 4YW4A 4YG6A 4YG3A 5GLVA 5DUVA 4Y20A 4YM3A 3OYWA 2ZACA 4UW5A 1S1AA 2A71A 3AP7A 4XBNA 2WSUA 4FPKA 1UAIA 2Q5TA 3RS6A 2ZGQA 4P9XA 2D43A 4WVVA 1SCSA 4BMBA 4ZKTB 3IPVA 1LENA 2ZAAA 2R1BA 4DPNA 1BQPA 2VH9A 3WV6A 2DV9A 2B7YA 4AWDA 5L73A 1ULDA 4ISQA 5DG2A 2XG3A 2DURA 5CNAA 1GZWA 1JOJA 1S0GA 3BTAA 1LHWA 3WDWA 1ENSA 4CRQA 4PBOA 3VUOA 2RHPA 3QLQA 1D2SA 4FOYA 4GA9A 1GLHA 2Z42A 1AJOA 1GBGA 1YIFA 2ZGOA 3ZPYA 5E89A 3T2TA 1IS4A 3BIWE 1ULFA 1GANA 4BOWA 4XXPA 5T55A 1WW5A 3D4KA 5DZFA 3ZSJA 2C5DA 1LOEA 1CVNA 4P9WA 3OY8A 3ATGA 3VKOA 2D6MA 1QU0A 1W6OA 2DUPA 2SLIA 2UURA 5CB7A 1LHUA 1HDKA 2NMOA 2EXIA 2NZ9A 2A7AA 5FRAA 2VW0A 3SNMA 4CZSA 4YGEA 2D3RA 3ZSMA 1F9KA 4YG0A 4PQ9A 4R9CA 4FPCA 3O0WA 1FNZA 3NV2A 2H0BA 4GKYA 1KQRA 5GLUA 1DQ0A 3WZ1A 1DBNA 2GALA 1GZCA 1MS5A 1W6OB 2OW4A 3M3OA 1XQNA 4M3CF 2A6XA 2WLQA 2R49A
chains in the Genus database with same CATH superfamily
4XUTA 4UW6A 2KM2A 4LTAA 1CWPA 4S2GA 1WKYA 5EIYB 4GD4A 3VKMA 1WD4A 2O14A 5FXZA 2BFUS 2VUDA 4PI2A 2WINB 2Y26A 3AYCA 1NYWA 2J42A 4BQXA 1HQLA 4LORA 4PIYA 5DAVA 4D0QA 4CDWB 1UY0A 4MGYE 4AG4A 3DV8A 3NRUA 2DCKA 5A7PA 1RUG1 4OZOA 3LOIA 3KF5A 4BWOA 1AL21 1UX6A 2CV6A 5E1RA 1NE6A 2VQTA 1NXD1 1XYOA 2I74A 4LKDA 4W6XA 2V4VA 4CDUA 1W8UA 4RGAA 4XW3A 2HH9A 4Y1YA 1QGLA 2H6BA 3I2IA 3IDCB 4LIVA 3SH3A 3HEIA 1RUH3 4Y1ZA 2QNKA 3FFZA 3VD3A 5IK4A 3TN91 1TME2 2WAAA 2RDQA 5I8YA 4CUBA 1RUJ1 2DUQA 4M00A 1K5JA 3FFQA 3ZVXA 2VE1A 3QD6A 1N3PA 3ZOIA 4CEWA 2RS31 2ZABA 3RZLA 5H9QA 1AYN1 1QQP3 3EXUA 4CE8A 5C4WA 1GOGA 4O9EA 1AUYA 3OCPA 4AFCA 4S2FA 2ZA9A 1W8NA 2YBKA 5T50A 1D2QA 2B45X 4LBLA 5L9VA 3TEYA 2R0FA 4HSJA 4YVSA 2R063 2BEOA 4KMQA 4GWMA 1PGW2 4HXCA 1W8TA 5I0RA 3ZMNA 1FMD1 5KR7A 5KHKA 1NQJA 3SKJE 3NNGA 3WG1A 3WOGA 4MG2A 1O4ZA 3OTFA 2VNGA 5JIUA 5FREA 4TN7A 4PBPA 1AJKA 3UK9A 1T6GC 3ES4A 1SFNA 3M3IA 3K3OA 1N1VA 2RDSA 3ZO0B 1X9TA 4I0BA 4PDWA 5JMOA 1KDMA 1PZ9A 1SG3A 1RXFA 3C7GA 3JD71 4LUMA 4D6SA 3LOBA 1C4RA 2WUHA 1YQ6A 4I0WB 1JYTA 1O8PA 4KG8A 1QDCA 4NUBA 1ZM1A 1G86A 1I6XA 4XZUG 3KLSA 5LRRA 1UPIA 1UU6A 3LD8A 4NAMA 3VHOA 5IYYA 5HCAA 4BQYA 2P17A 3CU7A 3ACGA 2O8OA 3LSDA 2WNVA 4CEWC 1GMMA 1OF3A 3PNAA 1PVC3 5F37A 2GNBA 2VQ0A 4CXXA 4CCJA 2YDEA 5C3OA 4IUGA 3H1YA 2FCUA 4H7MA 5EV7A 3U37A 1SHWB 3IPVB 1CD3G 1RUD3 2E9QA 2CSGA 5T54A 5GLTA 3KV9A 4IEZA 3RRDA 3R6SA 1QJY1 5FYCA 2RM23 2OT7A 2VUCA 2FDKA 4ASMB 1IS6A 1MS4A 3DPRA 5K9YA 4C0HA 3RI9A 5LW9A 1CN1A 4LA3A 5SV5A 2AR6A 5LA2A 5HI0A 3B02A 3VBHA 1QNWA 2X09A 2E7AA 2EAKA 4GULA 2WBKA 3HNBM 4FSJA 2C1FA 3POWA 1DQ2A 3D8CA 4HG6B 1R083 5E8AA 3THDA 1TMF3 2Q0AA 4ZU7A 1R091 4N90A 3ZYFA 1B35B 4I02A 2Q8OA 2PAEA 3CO2A 3FWEA 3K77A 2R0HA 3AZWA 4XIKA 5FPLA 4FFIA 5IAVA 5LATA 3RJRA 1HQNA 2WO1A 1PM4A 3AJYA 4Y5Z0 4XJAA 4DQAA 3VD4A 4CXYA 4FPLA 1PIV2 1DYPA 3PMSA 3B9IA 5KXDA 2WWUA 1W9FA 4AI3A 4RHV2 5E88A 3P1IA 3GZTB 3P5BA 2F4LA 4NIAA 3PVOA 3WEZA 5CKQA 4UFMA 2DFBA 1JXNA 4XFBA 2PELA 2PLV2 5FYTA 4MGKE 4J25A 3ST7A 4K1ZA 2WWJA 1Y9QA 5EHDA 1W8WA 4I3PA 3TEXA 2VMGA 1OQEA 4RD7A 3M8LA 5FO8B 3WXPA 5CBLA 1OFSA 1YLLA 4NN0A 2MEV2 1IS3A 1CAUB 5T52A 2XJUA 4DS0A 2CL2A 4LHNA 4NROA 1AL23 3SCHA 1GOFA 2JD4A 2XL7A 4L9BA 1CAXB 2AREA 1BMV2 1Z0HA 4A3XA 2J7MA 4LK7A 3ZXDA 4N43C 4ISRA 4B4PA 3W9AA 2GMPA 2FDHA 1MZ5A 1MS9A 1EPZA 3LGRA 3PJYA 3ZYPA 5JOWA 2DUOA 4H3WA 3M7AA 4RS5C 4XFCA 3I4IA 1L3JA 1CAWA 3MI8A 3WNKA 4PT6A 4BMEA 1TNRA 4LXLA 4SBVA 1AR71 1C8NA 2UWCA 1RUJ3 2PN5A 1VRH1 2WFF1 2EF6A 2ZX0A 1MACA 4U2AA 4COYA 5FZIA 2HWD1 1S2EA 1LGCA 1CONA 1R1A2 2RS33 3EO6A 3FUOA 1AYN3 5IT6A 4GZ9A 3NV4A 4MX3A 1Q3EA 4KI5M 4KNCA 4XAEA 4EQVA 3MF9A 4LIUA 4HN1A 3BI3A 1Q8SA 4FPYA 2HWF2 2WKKA 4HVRA 4XZPA 2NM1A 4Y22B 2ARAA 1GQHA 1FYUA 4X6QB 4XHXA 2UWBA 1AXKA 5FZ6A 4DXZA 4UFKA 5C3RA 2EAAA 4CDWC 2Y0OA 3MHZA 1G7YA 1XRUA 2LRPA 1U5YA 3DXUA 4L0PA 3USUB 3WG2A 3V0AA 5FY9A 1O5LA 3UJOA 3MEPA 4QB1A 3DXTA 4W6YA 3I3MA 4JRLA 1JU4A 3H42B 1LECA 4JKKA 3A7QA 2K9ZA 1H0BA 1LULA 1UZYA 1C8M1 1AYM2 1H2MA 3MPBA 3GNEA 5LASA 1O8SA 3WDTA 3KV5A 5FR3A 1VBE2 2CTVA 1M06G 1IOAA 5I0DA 2NLRA 5F39A 1UU4A 3M1HA 4K21A 5FZLA 5FY4A 2WNUB 3J7NA 5H9PA 3ILNA 1WA4A 3PUQA 5FLIA 4FBFA 5FOBB 5GZDA 4XUPA 1X33A 3KHBA 4Q1PA 3UKVA 3E1F1 1ENRA 1RL3A 4E4HA 5I93A 3DYPA 1BBT1 4LLFA 3VBSC 1CX1A 1O5UA 1H2LA 4JHZA 5AC92 2PXJA 5A7OA 4UOJA 2ZX2A 1PK6C 2Q1ZB 5F5QA 1LGBA 3ZR6A 1KFUL 2K2SA 4TSVA 1H4GA 4JRAA 4COWA 3POEA 4Q4Y1 2N7GA 2XDVA 5JI7A 1JI6A 4BQ5A 5F7UA 1J3QA 3LIGA 4BLJA 1TME1 2ZOEB 3KM5A 1S0BA 3AK0A 3MZHA 2GMMA 5FXVA 4A6OA 2PAKA 4XCBA 1XNKA 4WVWA 4FVVA 3RSJA 1S2KA 4CPBD 1CESA 4BK5A 1L7RA 4RR3A 4LO8A 3T3YA 2L9LA 5CKNA 4C1WA 4F8AA 5E16A 4ARYA 1LHOA 3GHMA 2FDGA 1GICA 1W6NB 2JG8C 3PVEA 1R093 4LMFA 2I2SA 2B42B 1BZWA 3HBKA 1XNAA 1SDWA 1QEXA 4LBNA 4KWLA 5DZEA 4WM7C 1OT5A 2XHNA 4ASLA 4AEKA 5LK7B 3OEAA 1K3IA 1UZ0A 4M3CE 1YNAA 2Y33A 4QQOA 3LF7A 3ES1A 4D94A 2YG0A 2OQ6A 1L7LA 2GC0A 3BOWA 4IL7A 5J96B 1RUH2 2WDBA 2BERA 4AR2A 2ORZA 3H7YA 4RL7A 4Z07A 5T5OA 4K40A 1UW8A 5FPVA 4LKSA 4DY3A 1DFQA 3FE5A 1RUI3 1KS4A 2R073 1JZ6A 1W39A 4IE6A 1RGSA 4PF5A 1QQP2 1KEXA 4LO5B 2JENA 3VHNA 3ETQA 1W2AX 4Q27A 4QXCA 1DYOA 4Q0SA 5T5PA 3R4DB 2OXBA 4QPIA 1VMFA 3NNFA 4HZFA 5F3CA 3SCFA 3OGVA 1C1FA 5CZKA 3ZFGC 3MIFA 3U10A 1NA1A 2ADDA 3NV3A 1HV0A 5FIXA 4YARA 5FY5A 2D6OX 1NZCA 1H30A 1LEMA 2EVXA 4JHTA 3UGFA 5LA0A 3KSCA 3WW4A 3DL3A 2CHHA 2WT1A 3AMPA 1QXPA 1TVGA 3K46A 4YLZA 1GZ9A 4IE7A 1YI9A 5FPBA 5I8SA 4CP9A 5A33B 1YFXA 3DKQA 1DGLA 3EJKA 1W06A 5JXIA 1FATA 1J59A 4N53B 4IV3B 1WCSA 4LBKA 1XJAA 2BBVA 1F35A 3S5QA 4XF0A 5FZ1A 4QXHA 2P3IA 2RMU2 1U12A 4FAGA 1R1ZA 2OYZA 1DGWA 2VAUA 2IXJA 4O61A 2WO2A 2CDPA 4NRPA 2VL4A 1JOPA 4WZFA 3S7IA 4OHYA 3VZOA 2MNGA 4MHRA 1HKDA 3DCQA 2WZPP 1F15A 2E31A 1HV1A 1RITA 1RVF3 1ZA4A 5K0UA 5A7QA 3VBFB 4JKMA 1W6MA 5IVCA 2KD7A 3CKHA 1YFYA 1POQA 4M3CB 4Q2FA 4EN6B 2VMHA 1XPWA 5F8PA 1UIKA 3V0BA 2TNFA 4GMP0 5BY5A 1S0EA 2MHFA 3WW2A 2C6SA 2OVUA 1Q56A 4IETA 1W6PB 3BPZA 1R64A 1CZTA 3MICA 2VMCA 5FV3A 4XDQA 2VZPA 1VB2A 4AVSA 1PVC2 3PIGA 5H9SA 3TB0A 4FTEA 4XDPA 4F83A 3ZIWA 1PIV1 5FYZA 3ZN6B 1QJX1 4NR1A 2ORXA 3KV6A 3S30A 3UGGA 4RHV1 4BQWA 4CDXB 5A3NA 3ZXKA 5F6KA 1RUD2 1I1EA 4WM8A 2WL1A 3JU9A 2PLV1 3LEMA 1WW4A 3PTRB 2RM22 4C0BA 1ODMA 1YC61 3ACIA 4J1XA 3VBOC 2WO3A 2WFPA 3GZUC 4JC1A 4DO0A 2DTWA 2VXRA 2ZGTA 4BH9A 4LK6A 4QX7A 4CCDA 4E4DX 4HVQA 1JZ2A 1OVPA 2MEV1 3CL1A 4JX0A 1PO11 4IEXA 1RUNA 1KJRA 1E5HA 1BBT3 4NRMA 3VBUA 2ZEWA 1R082 2QTWB 5FZDA 3SLIA 3O1SA 1TMF2 1BMV1 1JYVA 5FPAA 1ND3B 2EXKA 1ULGA 4KQ7A 1OLRA 1TG7A 2A3WA 2VNVA 3UT0A 4OULA 3AC0A 4LOTA 1ZYBA 1RB8G 2CWMA 3U14A 5EYXA 4OVEA 4YGBA 3QCWA 3INAA 4ZY9A 4Q4Y3 4KWKA 3BCWA 5K0UC 1DZRA 1LOFA 4R4XA 3ZKYA 5JR2A 5C3PA 5G04L 5JMCA 3IIAA 2W94A 2R041 4YW4A 1T6BX 5BNQA 5F5CA 1R1A1 3OYWA 5FQ0B 2ZACA 2W1UA 3WF4A 2Q1MA 4XQ4A 1SDDB 1UAIA 5B2GB 2ZGQA 2HWF1 2OX0A 5CFCB 2K46A 3AMNA 4OUEA 4FFFA 2EIBA 3WV6A 4QKDA 5FUIA 5I8TA 2FCTA 2R6QA 3DYOA 5EFUA 4AWDA 5C3QA 1AL22 2XG3A 4R4ZA 1UO9A 3CJIA 3J4UH 3QH6A 1S0GA 4ZZ5A 1XU1A 3POJA 3ZKUA 1O3TA 3ORJA 5IW0A 3J26N 4TXWA 2Z42A 2Y60A 3K51A 4BK4A 1W8HA 3IAPA 4QGMA 1IS4A 2XKPA 4KWJA 3IAQA 5FPXA 1H1AA 2D98A 1NT0A 3KF3A 1WW5A 1RUJ2 4FXGB 1AYM1 2XMLA 4QHOA 3E5UA 1LOEA 4FFGA 1VBB3 4AAPA 1CVNA 3LE0A 4KGGA 5C8CA 1AYN2 3ATGA 1HN0A 1F4HA 5IJRA 4CTEA 2VUJA 1SPPB 4JDNA 4Q0PA 3B5LB 4GMP3 1GOHA 1HB4A 4ZXEA 2JKXA 2DUPA 2YC4A 1UWWA 1HDKA 1J58A 2EXIA 4I09A 4AEJA 1FOD3 3B7MA 2PQQA 4H7LA 2FBEA 1UCXA 1H1MA 2D3RA 3D0JA 1W2NA 5FZCA 1F9KA 4NPRA 5IWFA 4RQPA 3O7OA 2Y38A 5BNPC 2WYSA 3O0WA 4FPCA 1FNZA 5AC91 3GM8A 1DQ0A 1E5IA 1NQDA 1CAVA 5GLUA 1DBNA 4M3CF 1W6OB 2ET1A 4ES9A 1XQNA 2A6XA 1X8MA 1GWMA 1YIPA 2V4AA 4XF1A 3THCA 3LQCA 2JG9C 3ZN4A 5I0UA 2B39A 4ZPIA 5JDBA 2Y6GA 3B9CA 2VZ3A 4HVOA 1ACCA 1GNZA 2RJKA 3ZYBA 5KXCA 5C70A 1W9WA 1F2NA 3U07A 1F4AA 5A80A 3OPTA 2VY0A 5IUQA 3VB9A 3VDDC 3ACLA 3FHAA 4QKFA 2P3KA 5JPMB 4JGYA 5J3UA 4J6GA 4FOQA 3PUSA 1BK0A 4AGRA 4COUA 2DCYA 4NHKA 4XFFA 2B5HA 4YRDA 1CIWA 2BDRA 2ZHMA 3NMBA 3T30A 4B8EA 3PIJA 3TAYA 1ZREA 1K42A 1YYNA 2AEZA 2YPJA 3ZYGA 4E27A 4LT5A 3CNAA 2A73B 4DFSA 4DOUA 3I54A 4GH4A 3VBRA 1QJX3 2ZHLA 3LA2A 3IWZA 4QGLA 2VR4A 3IKWA 5CU1A 3GBFA 4CUGA 1WUVA 1O91A 1HRI3 4S2HA 1WCQA 3AYDA 3GJBA 1RUF1 4MADA 5HBAA 2JICA 3KQRA 4N53C 4IV3C 4FTSA 3T1LA 4AI1A 4JDMA 4B1LA 2D93A 1OKOA 3RZJA 3FBMA 4YW6A 1QQP1 1BVP1 2VQAA 3MW3A 4G3YC 1PO13 4MYEA 2HEWF 2PAMA 5IVFA 5L7OA 2VW2A 5FP8A 1GQPA 3PUHA 1NCQA 1J3RA 2VBDA 4CEWB 3L2HA 5C4WB 1STMA 3VZNA 3RI8A 2XQRA 2D6PA 3WF0A 5IK7A 1CGPA 5K8SA 4NIGA 2HBTA 3PL0A 4KG0A 4FQZA 4GALA 3HAGA 4HMZA 1D7PM 2QE3A 1W99A 1HB1A 2DFCA 2F17A 2GDFA 2R043 4QX8A 4AZZA 2XVKA 2HEVF 4EZHA 3FBYA 3OEBA 3UKNA 3WQ1A 1R1A3 2HKXA 1YJKA 1S0FA 2D6KA 2RMU1 1QXJA 3KCYA 4JVAA 1RUOA 3HQXA 1NZIA 5A3OA 5CISA 3OBRA 1RUI2 5CVRA 2R072 1RJ7A 4MHUA 5KHHA 2WN2A 1ZRFA 3R4SA 2J1UA 3URFA 4NPLA 2W39A 2XOMA 5D1IA 1A6CA 2W91A 1H8VA 2D6LX 2EXJA 3VL9A 1OFNA 5D21A 3MBWA 2Z2SB 3ON7A 1EPWA 4Y20B 2GC1A 1QMJA 1GQGA 3FUQA 3A4UA 4FO9A 4BQ2A 2BZDA 2GH8A 5EP9A 3W59A 1Y9MA 1HRV3 4BJ0A 1QH6A 1TZOA 3VKLA 5BNNC 1F31A 1WCKA 2V09A 1NCQC 1SLTA 3VV1A 2QQIA 3NJVA 1W6QA 2WNVB 1RUD1 2QQUA 1GZWB 1G9AA 2BOJA 4UAPA 2WQ4A 4BIFA 1OC1A 2X10A 2RM21 1OD5A 2WT0A 1POV0 2PHLA 5IFTA 4JGZC 1OOPA 2ZGKA 3WNLA 1RVF2 1SMVA 5KXEA 2PHRA 3G6JB 3AFGA 5DQ0A 1DGRN 3THTA 2GZWA 2WZR1 1D0GA 1DU3D 4FPOB 3JB8A 5FLHA 2AYHA 4RS5B 4L2NA 1UY1A 1TMF1 1WMFA 3CMGA 2VC9A 2ZGSA 5GLZA 5J09A 4CDQA 4HKOA 3VBHB 1UYYA 2KA3A 2GC2A 3RVHA 4AL9A 1VBA1 5FJKA 1NOVA 4IEVA 1ND2C 2E6VA 1DGRA 2EIGA 3WDUA 2AC1A 1S0IA 5GALA 4LR4A 4FPEA 1OI6A 5FBZA 3VDBA 4LOSA 1H8TA 3K4DA 5IVJA 1C5IA 1OH4A 3TBDA 1YXWA 1AX1A 1GFF2 1VB4A 1W05A 4OI2A 3H8RA 5FDBA 3ZXEA 1G8WA 1UKRA 3ABZA 4INDA 1ZBA2 4LO6B 4OHZA 1UXXX 3LEKA 1LJ7A 3POYA 2A3YA 4X8PA 4Y1UA 5TSWA 3TEZA 1V0AA 1XSRA 4EN8B 5LBFA 2TEPA 4JDOA 3QOPA 3CJXA 4QM8A 5I0TA 3CEWA 3MYXA 2G4IA 4XETA 1LB2A 2ERFA 2XQXA 4OI0A 4N7IA 1UX7A 1W9TA 1UOFA 4Q0UA 4XURA 1BBT2 3B00A 2VO5A 4LBMA 5M0TA 3HD8B 4XMIA 2ZMLA 1U5ZA 2AZ5A 3RZMA 4IE4A 4YM2A 1QJZA 1OPOA 5BPXA 4IEYA 1XE7A 2JB4A 4CPBA 1KFXL 5CADA 3AVSA 1S55A 2VVDA 3U4XA 3WDXA 2AENA 2ZMKA 1OOPC 1XOYA 3OOXA 2WRAA 4TWTA 1YCIA 4Q4Y2 4XJWA 1FT9A 4DIQA 2UWAA 1MZEA 1RUF3 5JAXA 4DXRA 4BPZA 2E7TA 5HCBA 3OPZA 2RS11 5DAXA 1AR93 5CIRA 3M70A 4CDQC 3W58A 4BQ1A 5FBJA 4WVMA 2X5IC 5JXHA 2EIEA 2W46A 1ULCA 3GZAA 2PA7A 5FY0A 3AP6A 5T5LA 3OGSA 5A3WA 3VBSB 1Q8PA 4MGQA 3ZDVA 1O3SA 5KXBA 2VOTA 2P34A 3N7JA 2ZMNA 1JUHA 3H8UA 1PK6B 3BU7A 5C6CA 4CCNA 5HCHA 2WQ8A 1QKQA 2Q8CA 3U4SA 5DDJ3 1SBEA 2LM3A 1X50A 1BCXA 1E5RA 1RXGA 5IHRA 4I3GA 3MLLA 3DGTA 4PLOA 2Y6JA 3VKFC 2C0ZA 2RMU3 2W87A 2Z5WA 4RA0A 1YFWA 3C3VA 4ONUA 4I2OA 1VBB2 4KU7A 4NWVA 5I91A 5K7PA 1J3PA 1AHSA 2QVSB 2WC2A 3DN7A 4E2SA 4XTMA 5EQUA 4AEDA 2JG8B 3NAPA 3TEWA 4CDUC 3ZFEA 4K6BA 2CYFA 4LULA 1YUDA 5EWSA 1JMUB 3TOJA 1XE8A 3I3EA 4WM7B 1FOD2 3RJ2X 3NQHA 2ZXQA 1UD1A 2QQLA 3ECQA 4S2DA 5IVEA 2VZUA 3U1XA 5JSRA 4Q1RA 2ARXA 2J1RA 4KL1A 3ACHA 4H2AA 4MGIE 3F2ZA 4UW4A 1CZSA 5C4WC 1N1SA 2F6BA 3EYPA 5FZGA 4BE3A 4B4RA 3BPSA 1CQ9A 2NYYA 3A0NA 3CHXA 1DZQA 2WJSA 3GZEA 4V1PA 1OLMA 4IGPA 4YM0A 2ETEA 4K8FA 3RZKA 1GSLA 5LCWL 2BYVE 4YVSC 5J7MA 4QAWA 4JQTA 4XTPA 2YBSA 5IVVA 2ZKLA 2VBPA 4OLLA 4MXVA 5BV6A 5FP4A 1S2BA 5BUVA 1WD3A 4UBHA 1UYZA 1DQ4A 1QJU3 3ZFGB 1WGPA 2V73A 2WZR3 5BYNA 3JCIA 4XCAA 4AFMA 3I3QA 2ZGLA 2XVLA 3RNSA 3RYPA 2ENRA 4XBLA 2J22A 2EICA 4HK9A 4PDWC 1VBA3 5FZAA 3O12A 2BU9A 2ZZQA 4RR3B 4YVWA 3W21A 2EA7A 4HLTA 1UPSA 2G9GA 4XYXA 3A23A 4BIOA 3NNLA 3AP5A 3T2PA 3KT4A 5FY7A 4LBQB 1QJX2 1WLDA 2UU8A 4MSVA 4XQWA 2Y6LA 1IHMA 2A5ZA 3RYRA 2ZGRA 1NX9A 4QB2A 5FUNA 4Z1VA 3VD5A 5A32A 1HRI2 5C3SA 4A7KA 4UBGA 4MXWB 2OZJA 4E9KA 1H6YA 2GNDA 3GJAA 4UF0A 1JH5A 1AX0A 2XXZA 2WNVC 1Z7S3 1RUI1 1UKGA 3FHQA 2HBUA 2R071 4XPVA 5JIAA 5KWRA 1PO12 1ZRIA 1OQ1A 3BKZA 4OHWA 4UXAA 1QJEA 5JSOA 2WS93 3HVDA 2NMNA 2XUMA 3GGLA 2VG9A 2VCCA 1FPN3 2BRTA 3UV9A 3IDEA 5JLVA 1GNYA 3CF6E 3DPRC 3NJXA 1PGSA 1MS8A 4QPIB 4FOVA 1WBLA 5ISLA 1QY4A 2JE9A 3VBHC 4QDQA 3FLRA 3HN3A 3S57A 1QXRA 4NHLA 4M4PA 4HKLA 2R042 2JDPA 5CEHA 4IQPA 2RS13 3R0RA 3VBOB 4XF9A 5JXJA 4QGNA 3ZDSA 4XMAA 1KITA 2YGLA 4QXBA 1XYNA 1TE1B 4FOWA 4YW7A 4CCOA 4BQ4A 4CP9B 2VCBA 2GP3A 3HIFA 1JZ5A 2XJQA 5LZ6A 4QD2A 2JX9A 5A3LA 3M3CA 1Q8OA 4Z2WA 5F1RA 1RVF1 2HWC3 1NLRA 3I59B 4P9LA 4Q4W3 5F2SA 3BYWA 3ZSKA 2YXSA 3LZZA 3I2GA 3I7DA 3AMQA 3AXDA 1BJQA 1VBD2 5B4NA 3RZHA 3D82A 3OGJA 1UQXA 2XLGA 3O5SA 2WQZC 4AF9A 1YQ2A 4GAZA 2P6HA 2W68A 3J8F1 4G9SB 4HN0A 1O4YA 5K0UB 4AQSA 1MVQA 3B3QE 3B94A 3WW1A 5A3UA 2JE8A 3LFMA 4UT5A 1HQWA 1RIRA 3Q8CA 4OUSA 4P5YA 1HRV2 1OA4A 4C1XA 3HN1A 1GYKA 4YZ5A 3UESA 2VZ1A 3Q9OA 4LE3A 4P9YA 1UNBA 1VBC1 3K4ZA 5JI9A 5FO9B 2RR11 2IXIA 4DY5A 1JHJA 1ZBA1 4FAHA 4LO7A 3MW2A 3WG4A 5ABJA 5JZGA 4GJYA 3AXEA 3VDCA 4PCRA 1UOJA 1W3XA 1JHNA 2FDJA 4E2GA 4LHKA 2RVAA 4EWEA 1BKZA 1PM7A 3ME2A 4H55A 5T3NA 4AVVA 3C7OA 4R8HA 2TBVA 3OBZA 4D6RA 3I97A 1O6UA 4GWNA 4PIXA 1COV3 2P1BA 1EAH3 4B29A 1EP0A 3M4FA 4ZONA 2HJIA 3H8XA 5G05L 5FK8A 4CVUA 4C91A 2Q4SA 4E8CA 3LSEA 2XUEA 1KDKA 4EN7B 3TNQA 1PX4A 3PVBB 5LBEA 4P9GA 5D8AA 2VOXA 5LBBA 2Y6FA 2YGMA 4UW5A 1OVSA 2BW8A 3AP7A 4XBNA 4FPKA 5EJZB 3QBQA 3RS6A 4P9XA 1SCSA 4NJ4A 5C71A 1XU2A 3D3AA 3IPVA 4MGZE 1VP6A 2VH9A 2DV9A 3WF1A 4W8JA 3BALA 1ULDA 4EV0A 1W2UA 4MGSA 5BNPB 1Y3TA 4IDZA 3NNJA 1W9YA 3WDWA 1LHWA 2YFZA 1ENSA 3AMMA 4B7EA 1OA2A 4QX1A 4FTBA 3VUOA 1NAEA 1HXS3 1RMU3 2ZJCA 4GA9A 1GLHA 4NPMA 2OPWA 1OMIA 3ZXAC 1XB9A 2W95A 2Y8KA 2D5FA 2JG9B 5HXVA 5FZ0A 4BOWA 5ABJC 2JDHA 4JZRA 5JZGC 4DB5A 4HETA 2QJVA 5T55A 1B35A 3CJIB 3K2OA 1ZZ7A 1RUF2 5A1FA 2VZOA 5FY8A 4M0NA 3NNMA 4TLGA 3VDDB 3ZN5A 4BU2A 2XL9A 4Y5SA 3FC0A 5FZ4A 4DUWA 1VBB1 1AR92 4UYBA 2XPJA 2XHKA 4AHZA 2P5BA 1DZTA 4JAAA 2A7AA 2HEYF 3SNMA 5FXWA 4GMP1 4YGEA 4A44A 3K48A 1FOD1 5BNOA 5LA1A 2F4PA 1C5HA 2Q8DA 1FXZA 3NV2A 4GKYA 4OYUA 1O3RA 4LKEA 3LDBA 2HWE3 5KC6A 2GALA 1CAUA 1GZCA 2JDAA 2OW4A 2YHJA 4CU6A 3JZVA 2Z69A 2R49A 4TLFA 4XJUA 5DDJ2 3I8TA 2EXHA 4BYYA 4WBBA 3ZR5A 4RR3C 2P2KA 1PZ8A 3MO4A 2DCJA 5IVYA 3SXWA 3AKQA 4DUVA 3BODA 5FZMA 3UYJA 1OHFA 3EHKA 5BXXA 3VKNA 4RFT0 1QJFA 2B4KA 5FZKA 1CAVB 2GAUA 4LUKA 3LPGA 1FV2A 4CP2A 3VZJA 3WSOA 5LBCA 3PHMA 5JPNB 2BPA2 2XGXA 1H6XA 1YI7A 2UYBA 2QQKA 2JDMA 1H4HA 3FLPA 1VIWB 5JR7B 1PVXA 1EV13 2XVGA 2JIJA 1W2TA 1JYIA 2I07B 4AFDA 2V72A 2BNNA 4JCKA 1PMJX 3J8F3 3ZPOA 4IERA 4CCKA 3MF6A 4QPGA 4QX0A 1H9PA 4U36A 1SACA 4AQTA 3S6PA 5A7WB 5GKAC 1JUIA 4DMIA 1HN1A 2QCSB 3WNOA 4NOTA 4QPYA 1O59A 3LA7A 4LQRA 1VMHA 1QOOA 1SLLA 3RGBA 3SMHA 4NHXA 1HJGA 1I3HA 2VZQA 4QPIC 4ZS2A 3USUA 3OUJA 4B3NA 4P08A 5HPOA 4MGTA 3RDIA 1HRI1 1VBC3 2RE9A 4MOAA 3T2OA 1IKQA 3N4MA 2RR13 1NA1C 3E6BA 2ZAHA 1EUTA 1ZBA3 2JEMA 3AB0A 3PTYA 2BTVC 3CDZB 1LU1A 1E57A 3LCPA 1U5XA 3H1MA 2VBBA 1F5JA 3BB6A 1LTEA 1QWRA 1QJU2 2QFEA 4Z82A 3FJSA 4N9HA 2WZR2 2RS53 2WNUA 4GKXA 4D8MA 4XXAA 4NHMA 5GZGA 1XNBA 5FTTC 3I3BA 5LY2A 1PHMA 3AP4A 3GF6A 2RDNA 2R32A 5BNNB 3P3NA 1VBA2 2VMIA 4LO4B 1NLSA 3IBMA 4DRVA 3AYAA 1V00A 5DAQA 1NCQB 1JU3A 3EBRA 4P9IA 3WHTA 1JN2P 5HV0A 2CGPA 2WA4A 4OFGA 3KZ4C 1HIXA 4GWIA 4CA9A 4HPKA 4LLOA 3POFA 1GP4A 1GP6A 2AGSA 1YWKA 3NO8A 3VZMA 5A3MA 1GWKA 4NMIA 3WUCA 1NCRA 1E5SA 4IV1A 1H2KA 3H50A 1QNYA 1D4M3 2GSYA 3N7LA 4IW3A 1S0DA 4JGZB 4AEMA 4CCEA 2O1QA 3NKGA 2JDZA 2ZEXA 4P9JA 4XUQA 2XWBB 1A8DA 1Z7S2 2ZEYA 3MIHA 5DZGA 4YYOA 1LHVA 1N1TA 2WABA 2IXHA 1OH3A 3O0VA 3UL2A 4AGGA 2DWRA 5FP7A 5A7NA 4BQ3A 1OXCA 2QQVA 3B01A 1BK1A 4A41A 2JKBA 2WS92 1I5ZA 1VBD1 3ASIA 3NJZA 3MIEA 4YW3A 2DVBA 4WM8C 1ND2B 2A6ZA 2D44A 1G9BA 1FPN2 4NRQA 2QDRA 4EYUA 1L7QA 3E6CC 1ST8A 2R16A 3LPFA 2NQYA 1HB3A 2BUKA 1MVEA 2IFRA 5ACA3 2UY8A 3MIGA 3CZJA 1HRV1 1PMHX 2DTYA 4AI9A 4ATFA 5IK8A 4TTGA 4QMAA 4UWDA 4D7SA 1DYKA 3DF0A 2W3JA 4YZ4A 3VBUC 4Z2AA 1NY71 2RS12 1VAKA 3QH7A 2XJVA 4ORFA 3A21A 4EWAA 2YPDA 1JW6A 1ZBE1 3GCXA 4RGKA 3U78A 3I2JA 3AZZA 3L9JT 3JQXA 1LRHA 4AYUA 1XBFA 3UGHA 1IG3A 1UZZA 3J9SA 1MQTA 2BBAA 3HNYM 1FV3A 5J98B 3WUDA 3ZM8A 1VE0A 4XFAA 2HWC2 3JUUA 4Q4W2 1TEIA 1US2A 3VDAA 5L19A 1LOFC 2BVVA 2FDIA 4EWDA 3VGIA 1QH7A 2DYCA 1NCRC 2W9XA 3OY8B 4IV1C 3GBGA 1OOPB 3C2UA 4QU2A 4YZ3A 3MFAA 1MS0A 4Q29A 2BNOA 3ETPA 5AFBA 5C9AA 1DQ6A 5FXXA 4URTA 3WINE 2K0GA 4LEJA 3C7FA 1RC6A 1AF9A 1BVVA 5FZ8A 3N7MA 4V2VA 2DF7A 3WNMA 2DDUA 2GC3A 2E26A 2ZCWA 4Q4V3 5F3IA 1SFPA 3MV11 4BA6A 3GALA 1LU2A 4CDQB 1KJLA 3CJIC 4XFGA 2X5IB 5KHGA 1K12A 4MVTA 3AFKA 1Y9GA 3T08A 3N9QA 4E4SA 3S5AA 3NWKA 3WF3A 5GZEA 1W3VA 3HT1A 2XR4A 3KCXA 5APAA 2A1XA 4DRRA 3M3EA 5IFPA 3O1TA 5CFDA 1MZ6A 4MZUA 2JDNA 4NHYA 3MLKA 3WY6A 5FYSA 4BB3A 4B1MA 5FMDA 4EN0A 3VZKA 3WCSA 1QOTA 3VBFA 4AI2A 4LHSA 4FP2A 3AKPA 3R05A 4HT1T 5C8CC 4OQ8A 4GQ7A 4M3CA 3H8OA 1RTVA 5F3GA 1COV2 4XQDA 1EAH2 1UOGA 5F2WA 3SQOA 4N7UA 2NP0A 2JD9A 1MQTC 5A3TA 3MIBA 4UFHA 5CG9A 1OKQA 5HCFA 1OBNA 1XE0A 1V6LA 5CAZA 1N1YA 4O65A 3HJRA 2YBPA 4FCAA 5FYVA 3T2QA 1V6OA 1SCRA 3H0OA 3ZXFA 1TNFA 2C4XA 4RQPC 4CDUB 2IZWA 1DQ1A 3WT3A 1AR91 2ARBA 2GNMA 3SH5A 4AHYA 4G4FA 4CDXA 4NWWA 2GP5A 3O1UA 2QZ3A 1NKGA 1ZNPA 2BFUL 5FMOL 2DBIA 4F3JA 2ZEZA 1YRZA 3AKTA 2JDYA 4PF1A 2PYTA 1DLCA 3LDRA 2DCZA 5DAPA 3GXUA 2EIDA 4WVMB 3OGGA 4LBQD 1HXS2 1RMU2 4GB33 1LNSA 2AH2A 3B93A 2D5HA 5A6QA 2B9VA 3WDYA 3KV4A 1V6JA 5DDJ1 2RJ2A 1C1LA 2ARCA 4QPWA 2D97A 4YVSB 5ANNA 4JGYC 4NAOA 3LB9A 5CFDC 1UMHA 2DVAA 4XE9A 1AXYA 1MEC3 1LHNA 2AUYA 4XF3A 3AZYA 1AR81 2JXAA 2QBXA 5F3EA 4BCUA 1JZ4A 1CJPA 2WWSA 1DGWX 4RGGA 4UFJA 2B9UA 1ALYA 2PFWA 4P02B 4DEVA 3AP9A 3MW4A 1G9DA 3CQOA 4EROA 2SBAA 4GH4C 4YZ1A 3VBRC 2ZX4A 1SEFA 4ARXA 5KBFA 2BGOA 1VR3A 3O1OA 5JCTA 3RZGA 3N7KA 1VBD3 4PDWB 5AVPA 5HXMA 1BHGA 3VD9A 2XONA 2A6VA 4HONA 2JDUA 4KBZA 1FNYA 3BIEA 1DIWA 2IVIB 4EJRA 5CFCA 1JOBA 3OG2A 2HWE2 4ZS3A 5F9TA 4IXLA 4ASKA 3N9PA 3GHNA 3OBTA 4QM9A 5L7OC 5KHJA 3IMMA 2FHRA 2WAOA 3IM0A 4K9SA 1OUSA 4LHLA 4QX2A 1YEWA 5FFOC 3TWIA 1ZZ9A 2DBNA 3N36A 1AXZA 2OUHA 1QOSA 3JBG3 3OD4A 3USSA 1ZBE3 4QDSA 2VOKA 3KCCA 2QQNA 2ZGUA 2RJLA 2BQPA 2RV9A 1G9FA 2IXLA 2J1SA 2W52A 3OB8A 1T2XA 1V6IA 4XUOA 4D6QA 1JZ7A 1I5PA 4HSLA 2VCAA 1X7NA 4Y3OA 1QJU1 1EV12 1WLCA 4WZCA 5A3PA 1W0NA 3MDPA 5DMYA 3LIHA 1A3KA 3DPRB 1AVBA 2Q1FA 1VJ2A 3J8F2 4R9BA 4AK3A 1BEV1 4YGCA 2DU0A 4QQPA 4AHWA 5FZFA 1UMZA 2TUNA 3PMEA 4JTNA 3NJYA 5DG1A 4TZDA 5KC5A 4X6RB 4Y4YA 3C7HA 2CDOA 5E6HA 3O1VA 1K5MA 3GYDA 4YGDA 1REDA 1IKPA 1W9SA 2W2IA 1D0HA 3C7EA 4L11A 1KD7A 4YVWB 1VBC2 1OURA 1V6MA 3M3QA 1OSGA 2RR12 5DABA 3UKTA 2YUEA 2R7EB 1S0JA 4W50A 5GZCA 2YROA 2JDKA 1Z7S1 4A7ZA 1LR5A 5FYYA 4L92A 2E51A 1YQCA 2ILMA 3GDBA 4QX3A 4XC9A 4A3ZA 1PO23 5FOJB 2YC0A 2WR9A 4YW2A 5L9BA 3WLUA 2GMEA 2RS52 1PNGA 2ES3A 1F8VA 2VUAA 2PTMA 2WS91 3FX3A 3IB3A 3OBAA 5F6LB 4IEPA 3IT8A 4XFIA 1URXA 1FPN1 5ANQA 4D7TA 1YO8A 3IMNA 1ZRRA 5HV4A 4PLMA 2DCTA 4E2QA 2ZX1A 4DEQA 1S0CA 5FMOS 1BXHA 4XEZA 3KGZA 2ZBJA 1P8JA 1IPJA 2LW8A 1RYYA 2YU1A 3WNXA 1EUUA 4IEUA 2ID4A 2IXCA 4XF4A 5JOZA 5J1XA 3MGUA 4KGQA 1S4CA 3EB7A 1ODNA 2DU1A 2XB6C 3FHIB 1D4M2 4YW5A 2GNTA 3ZXGA 1UIJA 2IFWA 3T4HB 2CGNA 1CAWB 1LOGA 5FJHA 3WDVA 3OUHA 3H9AA 4AGVA 3I2OA 2QKDA 4D3WA 2YMZA 5FMBA 1HJFA 2P37A 2HYKA 3N9OA 1DG6A 3E6DA 4OHVA 4OMCA 4XJ9A 4HKWA 5DAWA 1RHI2 4XJZA 5T5JA 4AFAA 5A6XA 1OLQA 5FUPA 4BM8A 2HWC1 4Q4W1 4YSFA 2LALA 3G7DA 1H8TC 5LA9A 2HLEA 1K5MC 1RUE3 5GLWA 1UY2A 1REFA 3CLPA 5F5AA 3T0BA 4IEOA 2X29A 2XJRA 3OUIA 1X82A 1RUC3 1UMIA 1CPMA 1W04A 5ACA2 4PIZA 5FZOA 2OUJA 4Q8LA 1OQDA 1ASJ3 1X9PA 4EZ4A 2CAUA 5L36A 1AR83 1POV3 4Y26A 3V0AB 3N3HA 3AMHA 1U0AA 2LUWA 4UFLA 3OF1A 2GN7A 3WW3A 5FKBA 3ZXJA 1SQ4A 2LS6A 3KT1A 4A7YA 1SLCA 4BLIA 3DUIA 1ULEA 3LDKA 3L2YA 4OUMA 3ZFFA 3HR9A 2WT2A 2XBO2 3SITA 4DXSA 2E63A 3WR0A 1ZRDA 4YFZA 4Q4X3 2PHWA 1UZWA 4KU8A 5ABJB 3UJQA 5JZGB 3T09A 4FP3A 4LKFA 3D5OA 4Q8KA 2JECA 1COV1 1VALA 1EAH1 1AR61 2FQPA 2W1SA 3ENRA 4AW7A 3CBNA 4Y20A 4PQQA 5DUVA 2G19A 1V70A 3X29B 3I2HA 4QX5A 3UETA 2J1VA 4BDVB 4AVAA 3WP4A 4EE2A 2C24A 2A71A 2WIIB 2WSUA 4Q4V2 2QUOA 4P00B 4A2UA 4ZZ8A 2Q5TA 2AEYA 4B4QA 3H3ZA 2D43A 4WVVA 4XABA 3H3UA 4QHZA 4ZKTB 2ZAAA 2R1BA 4DPNA 1US3A 1J1LA 2B7YA 3TNPB 4URAA 5L73A 4ISQA 1WMDA 2R30A 3BGAA 2DURA 2ZPXA 1MPXA 2VTXJ 4FI9A 1CZVA 1GZWA 1JOJA 5CNAA 5D8AB 3KD4A 4CRQA 2GH2A 4AFBA 2G1MA 3RYKA 5J37A 1D2SA 3IZOA 3S0MA 1WCDJ 1BEV3 1AJOA 1GBGA 3DEMA 2BNMA 2UY9A 2W47A 2ZGOA 5E89A 3ZPYA 1HXS1 1RMU1 1ULFA 2FCVA 1GANA 3PU3A 4IGQA 4N43A 4H14A 3ELNA 5DPNA 3T0DA 2FZ2A 3ZFFC 3D4KA 4AEDC 3NAPC 3Q8AA 5DZFA 3ITQA 3ZFEC 4RS5A 1UF2C 1VMJA 3K75B 3N9NA 3H1WA 4C90A 4XUNA 4NIHA 1ZZCA 4FFHA 2W1QA 1PMIA 1KS5A 3TYJA 4CEYA 2O8QA 2NPIA 4ET7A 2SLIA 2UURA 1X8EA 2VZTA 1LHUA 2NMOA 5FRAA 3U75A 5FWJA 1CIYA 1X36A 2QQOA 3IDBB 3OPWA 4Q5OA 3ZX7A 1RJ8A 4MV2A 4YG0A 2CAVA 3PDQA 3TRSB 2XLFA 4R52A 2CU5A 4R9CA 3BU0A 2H0BA 1KQRA 4IESA 3WZ1A 4CDWA 1MS5A 2J1AA 3M3OA 3PU8A 3MUY1 2Y34A 3POBA 1V9U1 1XNDA 1JTZX 1VAMA 3BVCA 4BXFA 4GB32 4META 2HWE1 4FPFA 4QU1A 4O9GA 4YM1A 3RMXA 1PGL2 3ZIXA 4W6WA 2ADEA 4N9IA 2FMYA 5BNOB 2DVDA 5EPAA 1NA1B 1ONAA 4RN5A 1KXGA 1B09A 2C9AA 1IQDC 1RUG3 1VLNA 2YFUA 3VL8A 4ATEA 1MEC2 3BUCA 3PVNA 2VZVA 4OCTA 2E32A 1GZTA 4LITA 4JV4A 3O1MA 1CJDA 1UZVA 2YY1A 2Y0IA 4YVWC 1KGYA 1MS1A 1OA3A 3MUZ1 3A0KA 3PUIA 1MS3A 3JQWA 4A42A 5A6YA 4HBNA 3KMHA 1QF3A 1YQ5A 2LROA 1EV11 1VAVA 4RSUA 3WQ0A 4CU8A 4KH9A 4YPJA 4GIQA 3TN93 3WCRA 1DHKB 3MPPG 1DLLA 3M2MA 4CUCA 2W08A 4CEYC 1YFUA 1A8MA 2E7QA 3AVRA 1W6MB 2WLPA 1UL9A 2ZTNA 4WV8A 3T0AA 3VBSA 2A75A 2OIIA 4DZGA 4ZU4A 4QWNA 3EMRA 3D0SA 4FQ4A 4OHXA 3V0BB 4FXKB 1PK6A 1WLWA 4GWJA 5FZ7A 4E8DA 2G9FA 1ZVFA 4IGOA 4CSWA 3O0XA 1YJLA 4QPGB 5FCCA 1NY72 2D7FA 3JBG2 3WG3A 5LRSA 4QB6A 2UYAA 2BGPA 2Y6HA 1XSQA 4I30A 3I49A 3I2FA 1ZBE2 3RZZA 4LBOA 5FPZA 2BP6A 1PZ7A 1NUKA 2VECA 4AI8A 5IATA 4IE0A 2D6NA 5CA6A 1FMD3 3KB5A 4HOOA 3IIIA 2VZRA 4CCMA 1LAJA 5LB6A 1XXNA 4WM8B 4AVCA 1Q8QA 2RS51 1JBCA 4GJZA 2JJ6A 2JG8A 4DUXA 1QDOA 1JS9A 2JIGA 2ZKNA 3LAGA 5FYBA 4C8DA 1Q43A 1AR63 3JD73 3NSTA 4WM7A 1F5FA 2IC1A 4QXKA 2OPKA 1D4VB 2CY6A 2WN3A 3J7HA 4YFWA 3VBUB 3R4UA 2V5DA 2B8MA 2ET7A 3BTYA 1EY2A 3W20A 1H1IA 3V65A 4D7YA 5F5IA 4M4RA 2J1EA 3OD0A 4F7ZA 4QDRA 3T1MA 2HWB2 4UW3A 2WYFA 4Y24A 1D4M1 4EN9B 2BWCA 4CYDA 4HANA 5IVBA 1CX4A 1WWYA 4QKNA 4QT6A 4HPKB 2D3SA 3LEIA 2EALA 3AX4A 1NCRB 4IV1B 3ZYHA 5A7SA 2ZS6B 1RHI1 2Q8EA 1PO22 4BXSV 2GN3A 3AL5A 3OYWB 1JYCA 2MPFA 3WQ7A 4LPLA 3VN4A 3AL6A 2BGCA 2Z4FA 2KXLA 5A1AA 1JZ8A 2G9ZA 2QQPA 4M01A 5D2AA 2JE7A 3ZFGA 1GKBA 1QJY3 2PHDA 2E33A 2H6CA 1W0PA 4LBJA 3KGLA 1UY4A 4KBBA 1YHFA 4AE2A 2CGOA 3KWVA 1NLQA 2YYOA 3ZXLA 2JWPA 3K3NA 5ACA1 1KRIA 3P3PA 4Z8BA 3RPQA 2VMEA 3Q8BA 2OS2A 4Q26A 5I0SA 4B7KA 2LTNA 3O14A 4PHZA 2VPVA 3PUAA 3FMGA 1JYNA 4LBQA 1Z78A 4AQ6A 5DN2A 3HWJA 2VM9A 4Z92B 3NKTA 2OZ6A 2P6CA 1PGW1 5FZBA 1LODA 2QQJA 2RDRA 3FL7A 3POGA 2XBO1 3PLQA 4MXWA 1HB2A 3ROUA 2FZ1A 2BV4A 1GUIA 5FZHA 5A1LA 1W2OA 5C8CB 3I2KA 4FT8A 4L8QA 4R9DA 4XBQA 5D8AC 1V9U3 2ATFA 2DVGA 1RUE2 3D6EA 4GXLA 5SV8A 4A4AA 1JYXA 4OMDA 3J7LA 2WNEA 1MQTB 2D40A 4HFSA 2VW1A 2FDFA 2ZHNA 1CAXA 4PJYA 5JOYA 5ERLA 3ALQA 1C28A 1RUC2 2QDNA 3NW4A 3NV1A 2NN8A 5C5UA 2IUWA 3EQEA 4RQPB 1ASJ2 1HX6A 3N9MA 5JOXA 1AR82 4XFHA 1JODA 3N9LA 4NO4A 3HNMA 5C9AB 3FZ3A 1HLCA 3LA3A 4Q4V1 4CCCA 5CG8A 1IZ3A 1LESA 3RQ0A 1I9RA 3RMYA 4W65A 2R062 3AKSA 3FN9A 5A70A 3LFIA 3P6BA 1QHDA 3VBOA 5LY1A 3KQ4B 2Q30A 3I3DA 4LA2A 5FP3A 1B35C 1W03A 1FX5A 3HQUA 1AR73 1YQ8A 5C5TA 1VRH3 1WBFA 2JB8A 2P3JA 2WFF3 4Q4X2 5FLJA 4YZ2A 2V5YA 2HWD3 2VNOA 4Y22A 5LK5A 1IPKA 2HYXA 4OI4A 2ZGPA 3I59A 1AZDA 5FO7B 2XJTA 2VU9A 4JGYB 1PX3A 4XDOA 5CFDB 1K45A 1V6NA 3PJQA 1BLZA 4AVTA 3RFRA 4SLIA 2VMDA 1Q8VA 2ZGMA 1QIQA 2VNRA 1APNA 1NG0A 2WZ8A 2YC2A 4K1YA 3SCGA 3ILFA 5BNOC 4NIDA 2XLAA 1CPNA 4CP0A 4GH4B 1SLIA 3VBRB 1GNHA 4FPJA 5GJ6A 4NVPA 1A78A 4PLNA 4NE9A 5JWPA 5GZFA 1LOBA 1WW7A 5EXOA 2VVFA 3B69A 3HOBA 5FMCA 3RG0A 2YZ4A 3A22A 1C8M3 1Q5OA 4K7JA 4QKBA 1Y4WA 1WZXA 4COVA 1CR7A 2VGDA 1BEV2 5DUWA 1XNCA 3HBZA 4JTOA 5JSPA 5L7OB 1U5IA 2D3PA 2OA2A 5DUXA 4OZXA 4GB31 2FD8A 5H9RA 1C57A 3AZVA 1LEDA 4N8MA 4RFRB 1PGL1 1C3HA 1UY3A 4Y33A 3DKWA 4QHBA 2WNOA 3HQRA 3PURA 2VQUA 2YU2A 2ZX3A 4I0AA 3SC7X 3V56A 2FMDA 1GV9A 2KR2A 4L99A 1ZA7A 5FYIA 1DP0A 1MEC1 1WMEA 3AKRA 1ENQA 4QPGC 1ULPA 2AACA 5L9RA 3V64A 2Y6KA 3RWKX 1SLAA 4Y4RA 1DQ5A 2E53A 4XAAA 1RHI3 4L97A 4ZXKA 2ZHKA 3RWNA 1H9WA 1H2NA 1ENXA 4MUVA 1SFYA 4I01A 1EYBA 3KT7A 3WP6A 1RINA 2VTFA 4FPHA 5A6ZA 1GP5A 5KHIA 4QQ2A 3THPA 3BTZA 1TME3 4Y1VA 4YWAA 1W28A 1N47A 3W5NA 1VPHA 3LEGA 3GCWA 1W6NA 1JYWA 5BNPA 4K3UA 1FAYA 2WZEA 3AYEA 5B4XA 5FKCA 5FAXA 1UYXA 1O7FA 4AQ2A 2VULA 3WF2A 5FP9A 3WNNA 1Y7BA 1REEA 4FPGA 2WNUC 3W5MA 2I45A 2J1TA 2JG9A 1RUG2 2VZSA 2WSVA 3JBG1 3POSA 5EJ3A 3O1RA 1ZZBA 3MLJA 3SISA 2OKXA 3T4VA 5C8WA 3K4AA 3GBWA 1DF0A 4AAXA 3H7JA 3BOPA 2XBO3 2W1WA 3ZLIA 1W8FA 4OI1A 3KS7A 4AOCA 4DXTA 3VDDA 1W6QB 4XOGA 4XILA 4Y1XA 1IGOA 2VMFA 5C33A 2DVFA 5FYUA 5FYMA 5FPUA 5J36A 3ZSEA 4DNYA 3Q8EA 4YNIA 2X8KA 1FI2A 1ULOA 3TN92 5JXGA 1VRBA 5LEKA 1G9CA 1W0OA 2VJXA 5CKMA 2BVBA 1ZZ6A 1VBE1 2RS32 4ZU5A 3IN9A 4MO3M 5JUVA 2A6YA 3AZXA 1NXMA 1MR5A 1WW6A 3NL1A 1J1TA 4Q0QA 1TQ5A 2VD7A 3WNPA 2XKOA 3WQBA 4E4ZA 2XWJB 3F95A 3WX5A 4K20A 4UFIA 5IK5A 5A33A 3MV01 4XHBA 3IDAA 2CWSA 5AVAA 1SLBA 3OJBA 2HWB1 3MFCA 1SBDA 4IE5A 4N53A 4IV3A 5F32A 5J48A 2PHTA 1O3QA 3H3LA 3ACFA 2W92A 1H8TB 1FMD2 3VHPA 3SKVA 1K5MB 2R1DA 3SHRA 1LGNA 4AVBA 3DECA 3OGRA 2W5FA 1PO21 4XJ8A 1UOBA 4HL0A 1BYHA 1XC6A 2ZZJA 4XVHA 4D69A 3SH4A 1N3QA 3JXSA 3HT2A 1J84A 4ITCA 3JD72 1AR62 3HMYA 5FZ3A 2CNAA 2PHXA 4YW1A 3ZYIB 2A70A 1V6KA 2X05A 2P3YA 3FLTA 3LKJA 3CZUA 4WVZA 5AFEA 1W6PA 5A7WA 5C7GA 2XH6A 1SBFA 2C26A 3ZYJB 5FWEA 2A3XA 3POIA 3ZSLA 1XYPA 4Y5TA 4Q0VA 1WA6X 4CCLA 4R9AA 1DDLA 5DUUA 3ZN6A 1G6NA 3VD7A 2WA3A 5FZEA 4TYSA 1AX2A 3N35A 1WLTA 2IVJA 3WP5A 4QQLA 4W4ZA 4COZA 5GM0A 5C9AC 1MZFA 3AJZA 1W90A 3SEEA 1PIV3 1J83A 4IEWA 4XIOA 4ES8A 2IWGB 1WMXA 4RHV3 4CP1A 4NIIA 4RYDA 5EZWA 3WHUA 1N3OA 1RUE1 1RUH1 2PLV3 4CUAA 1OLME 1QJY2 1LCLA 1AL0G 3APBA 2XJPA 5CYYA 1DCSA 4ZHNA 2YV8A 2VVEA 1LOCA 1JZ3A 4M0HA 3O1PA 2PHFA 1ND3A 2QZ2A 1RUC1 2W0XA 2MEV3 3WVJA 4OQ9A 5BNNA 4P5HA 3OSDA 4V2WA 1ASJ1 3KHCA 1POV1 4JKLA 3VBFC 1LKNA 2GU9A 4P14A 1R092 2IXKA 5JVVA 3KVBA 1UYPA 1HW5A 5FZOB 4AXOA 2A6WA 5EJ1B 5EYYA 2R061 4CXWA 1LOAA 2WO7A 5DXDA 2PHUA 4IEQA 1UXZA 3J7MA 4XACA 1ZX5A 4JGZA 2ZGNA 5FQ0A 4X8NA 4AI0A 2VCMA 3E97A 1IS5A 3ILRA 3KVAA 4Q4X1 3DYMA 3ZYRA 5LEJA 1GR3A 1V9U2 5FK7A 3ZFFB 4AEDB 2XJSA 3NAPB 1UN1A 3ZFEB 3AM2A 4J1WA 2PQSA 2P4EA 2Y64A 4LE4A 2RG4A 1IG0A 4YG6A 3MIDA 4YG3A 5GLVA 2O0OA 4CDXC 5IAXA 4YM3A 3I2DA 1WCUA 1OD3A 2HWF3 4LJHA 1ND2A 1S1AA 2B46X 3E5QA 4A6SA 1ZZ8A 2QQWA 2QQMA 4AHXA 1GWLA 2VOWA 4BMBA 1LENA 3WP3A 5FY1A 2C9KA 3BTXA 1BQPA 3CIHA 4LNVA 4JQRA 1OPMA 5DG2A 4BZ4A 1PNFA 4CU9A 1A34A 1XNTA 3BTAA 3SEPA 1IPSA 4PBOA 2RHPA 3QLQA 4FOYA 4HK8A 1ND3C 3VLBB 3BN6A 1PVC1 1SPPA 1AR72 1YIFA 4A45A 1AYM3 1VRH2 2WFF2 4MH0E 2YB7A 3T2TA 3ZMOA 3BIWE 4BHPA 3U0ZA 2HWD2 1IQAA 1VBE3 4XXPA 4O7XA 3VZLA 5FYHA 3ZSJA 2VTXA 2C5DA 1OF4A 2BOIA 3HPNA 2X53S 1OUXA 4K8RB 3WD5A 4P9WA 2Z79A 1M4WA 3OY8A 5K4LA 3VKOA 5LWBA 4QQHA 3UNPA 3VHRA 2D6MA 4DINB 2VXJA 3Q8FA 1QU0A 1SZBA 1W6OA 3LWCA 2HWB3 3U11A 4KWUA 4N43B 5CB7A 4CU7A 2NZ9A 4MLOA 2H0VA 3QACA 3C8XA 2VOVA 2VW0A 3S7EA 5CFCC 1NE4A 1GU3A 1R081 4CZSA 3NVCA 5AC93 3JB4C 3ZSMA 1ZRCA 4UI9L 2PMWB 1Y43B 5A32B 4PQ9A 1UU5A 2OQ7A 4PI0A 3E5XA 2X5IA 2BJSA 1W8ZA 4CEYB 5FZ9A 4UF0B 4BISA 1C8M2 1W8OA 1O4TA 2WLQA 2BWAA
chains in the Genus database with same CATH topology
4UW6A 2KM2A 4LTAA 4S2GA 3VKMA 1WD4A 2BFUS 2WINB 2Y26A 3AYCA 1NYWA 1HQLA 4PIYA 4CDWB 4MGYE 4AG4A 3DV8A 2DCKA 1RUG1 3LOIA 4BWOA 1AL21 1UX6A 2CV6A 5E1RA 1NE6A 1NXD1 1XYOA 2I74A 4W6XA 4CDUA 4RGAA 4XW3A 4Y1YA 1QGLA 2H6BA 3IDCB 3SH3A 1RUH3 4Y1ZA 2QNKA 3FFZA 5IK4A 3TN91 1TME2 5I8YA 1RUJ1 2DUQA 4M00A 3FFQA 3ZVXA 3QD6A 1N3PA 4CEWA 2RS31 2ZABA 5H9QA 1AYN1 1QQP3 3EXUA 5C4WA 4O9EA 1AUYA 3OCPA 4AFCA 2ZA9A 5T50A 1D2QA 2B45X 4LBLA 2R0FA 4HSJA 4YVSA 2R063 2BEOA 4GWMA 1PGW2 5I0RA 3ZMNA 1FMD1 5KHKA 1NQJA 3WG1A 3WOGA 1O4ZA 3OTFA 2VNGA 5JIUA 5FREA 3UK9A 4PBPA 1AJKA 1T6GC 3ES4A 1SFNA 3M3IA 1N1VA 3ZO0B 4I0BA 4PDWA 1KDMA 1PZ9A 4LUMA 3JD71 3LOBA 1C4RA 4I0WB 4KG8A 1QDCA 1ZM1A 1G86A 1I6XA 3KLSA 5LRRA 1UPIA 1UU6A 3VHOA 5HCAA 2P17A 3CU7A 2O8OA 3LSDA 2WNVA 4CEWC 3PNAA 1PVC3 2GNBA 2VQ0A 2YDEA 3H1YA 4H7MA 5EV7A 3IPVB 1CD3G 1RUD3 2E9QA 3RRDA 5T54A 5GLTA 4IEZA 3R6SA 1QJY1 2RM23 4ASMB 1IS6A 1MS4A 3DPRA 5K9YA 4C0HA 3RI9A 1CN1A 4LA3A 5SV5A 2AR6A 5HI0A 3B02A 3VBHA 1QNWA 2E7AA 2EAKA 4GULA 4FSJA 2C1FA 3POWA 1DQ2A 3D8CA 1R083 5E8AA 1TMF3 2Q0AA 4ZU7A 1R091 4N90A 1B35B 4I02A 2Q8OA 2PAEA 3CO2A 3FWEA 4XIKA 2R0HA 3AZWA 4AGGA 3RJRA 1HQNA 3AJYA 4Y5Z0 4XJAA 4DQAA 4FPLA 1PIV2 1DYPA 3PMSA 3B9IA 5KXDA 4AI3A 4RHV2 5E88A 3GZTB 3PVOA 2DFBA 1JXNA 4XFBA 2PELA 2PLV2 4MGKE 3ST7A 4K1ZA 1Y9QA 4I3PA 2VMGA 1OQEA 4RD7A 3M8LA 5FO8B 3WXPA 5CBLA 1OFSA 1YLLA 4NN0A 2MEV2 1IS3A 1CAUB 5T52A 2XJUA 4DS0A 2CL2A 4LHNA 1AL23 3SCHA 2JD4A 2XL7A 4L9BA 1CAXB 2AREA 1BMV2 1Z0HA 4A3XA 3ZXDA 4N43C 4ISRA 4B4PA 3W9AA 2GMPA 1MZ5A 1MS9A 1EPZA 3LGRA 3PJYA 3ZYPA 5JOWA 2DUOA 4H3WA 3M7AA 4RS5C 4XFCA 3I4IA 1L3JA 1CAWA 3MI8A 4BMEA 1TNRA 4SBVA 1AR71 1C8NA 2UWCA 1RUJ3 2PN5A 1VRH1 2WFF1 2EF6A 2ZX0A 1MACA 4U2AA 4COYA 2HWD1 1LGCA 1CONA 1R1A2 2RS33 3EO6A 3FUOA 1AYN3 5IT6A 3NV4A 4MX3A 1Q3EA 4KNCA 3MF9A 4HN1A 1Q8SA 4FPYA 2HWF2 2WKKA 4HVRA 4XZPA 2NM1A 4Y22B 1GQHA 1FYUA 4X6QB 4XHXA 2UWBA 1AXKA 4DXZA 2EAAA 4CDWC 2Y0OA 1G7YA 1XRUA 1U5YA 3USUB 3WG2A 3V0AA 1O5LA 3UJOA 3MEPA 4W6YA 4JRLA 1LECA 2K9ZA 1H0BA 1LULA 1UZYA 1C8M1 1AYM2 1H2MA 3MPBA 3GNEA 3WDTA 1VBE2 2CTVA 1M06G 1IOAA 2NLRA 1UU4A 3M1HA 4K21A 2WNUB 5H9PA 3ILNA 1WA4A 5FLIA 4FBFA 5FOBB 5GZDA 1X33A 4Q1PA 3UKVA 1ENRA 1RL3A 5I93A 4LLFA 1BBT1 3VBSC 1O5UA 1H2LA 5AC92 2ZX2A 1PK6C 2Q1ZB 5F5QA 1LGBA 1KFUL 2K2SA 4TSVA 1H4GA 4JRAA 4COWA 4Q4Y1 2N7GA 5JI7A 1J3QA 4BLJA 1TME1 2ZOEB 3KM5A 1S0BA 3AK0A 3MZHA 2GMMA 2PAKA 3RSJA 1XNKA 4WVWA 4FVVA 1S2KA 1CESA 4RR3A 4LO8A 4C1WA 4F8AA 5E16A 1LHOA 3GHMA 1GICA 1W6NB 2JG8C 3PVEA 1R093 2I2SA 2B42B 1BZWA 1SDWA 4LBNA 4ASLA 4KWLA 5DZEA 4WM7C 4AEKA 5LK7B 4M3CE 1YNAA 4QQOA 3ES1A 4D94A 2GC0A 3BOWA 4IL7A 5J96B 1RUH2 3H7YA 4RL7A 5T5OA 4Z07A 4K40A 1UW8A 4DY3A 1DFQA 3FE5A 1RUI3 1KS4A 2R073 1W39A 1RGSA 4PF5A 1QQP2 4LO5B 2JENA 3VHNA 3ETQA 4Q27A 4Q0SA 5T5PA 3R4DB 4QPIA 4HZFA 3SCFA 1C1FA 3ZFGC 3MIFA 3U10A 1NA1A 3NV3A 1HV0A 4YARA 2D6OX 1NZCA 1H30A 1LEMA 2EVXA 3KSCA 3WW4A 3DL3A 2WT1A 3AMPA 4YLZA 1QXPA 1GZ9A 1YI9A 5I8SA 5A33B 1YFXA 1DGLA 3EJKA 1FATA 1J59A 4N53B 4IV3B 1WCSA 4LBKA 2BBVA 4XF0A 2P3IA 2RMU2 1U12A 4FAGA 1R1ZA 2OYZA 1DGWA 2IXJA 4WZFA 3S7IA 4OHYA 3VZOA 2MNGA 1HKDA 2WZPP 1HV1A 1RVF3 1RITA 1ZA4A 5K0UA 3VBFB 1W6MA 1YFYA 4M3CB 4Q2FA 4EN6B 2VMHA 1UIKA 3V0BA 2TNFA 4GMP0 5BY5A 1S0EA 2MHFA 3WW2A 2OVUA 4IETA 1Q56A 1W6PB 3BPZA 3MICA 4XDQA 1VB2A 4AVSA 1PVC2 5H9SA 3TB0A 4FTEA 4F83A 3ZIWA 1PIV1 3ZN6B 1QJX1 4NR1A 3S30A 4CDXB 4RHV1 3ZXKA 5F6KA 1RUD2 1I1EA 4WM8A 2WL1A 3JU9A 2PLV1 1WW4A 2RM22 4C0BA 4J1XA 3VBOC 2WFPA 3GZUC 4JC1A 2DTWA 2VXRA 2ZGTA 4BH9A 4E4DX 4HVQA 2MEV1 3CL1A 1PO11 4IEXA 1RUNA 1KJRA 1BBT3 3VBUA 3SLIA 1R082 1TMF2 1BMV1 1ND3B 2EXKA 1ULGA 4KQ7A 1OLRA 2A3WA 4OULA 1RB8G 1ZYBA 2CWMA 5EYXA 4OVEA 4YGBA 3QCWA 3INAA 4Q4Y3 4KWKA 3BCWA 5K0UC 1DZRA 1LOFA 4R4XA 5JMCA 3IIAA 2R041 4YW4A 5BNQA 1R1A1 3OYWA 5FQ0B 2ZACA 2Q1MA 4XQ4A 1UAIA 5B2GB 2ZGQA 2HWF1 5CFCB 3AMNA 3WV6A 5I8TA 2R6QA 5EFUA 4AWDA 2XG3A 1AL22 4R4ZA 3CJIA 3J4UH 3QH6A 1S0GA 1XU1A 1O3TA 3J26N 2Z42A 3K51A 4QGMA 1IS4A 2XKPA 4KWJA 5FPXA 1H1AA 2D98A 1WW5A 1RUJ2 4FXGB 1AYM1 3E5UA 1LOEA 1VBB3 1CVNA 4KGGA 5C8CA 1AYN2 3ATGA 4CTEA 2VUJA 4JDNA 4Q0PA 3B5LB 4GMP3 2DUPA 1HDKA 1J58A 2EXIA 4I09A 4AEJA 1FOD3 3B7MA 2PQQA 4H7LA 2FBEA 1UCXA 1H1MA 2D3RA 3D0JA 1F9KA 4NPRA 4RQPA 3O7OA 2Y38A 5BNPC 4FPCA 3O0WA 1FNZA 5AC91 5GLUA 1DQ0A 1NQDA 1CAVA 1DBNA 4M3CF 1W6OB 2ET1A 4ES9A 1XQNA 2A6XA 1X8MA 1YIPA 4XF1A 2JG9C 3ZN4A 5I0UA 2B39A 5JDBA 3B9CA 4HVOA 2RJKA 1GNZA 5KXCA 1F2NA 3U07A 2VY0A 5IUQA 3VDDC 3ACLA 5JPMB 2P3KA 4JGYA 5J3UA 4J6GA 4FOQA 4AGRA 4COUA 2DCYA 4NHKA 4XFFA 2B5HA 4YRDA 1CIWA 2ZHMA 4B8EA 3TAYA 1ZREA 1YYNA 2YPJA 3ZYGA 4E27A 4LT5A 3CNAA 2A73B 4DFSA 4DOUA 3I54A 4GH4A 3VBRA 1QJX3 2ZHLA 3LA2A 3IWZA 4QGLA 3IKWA 5CU1A 3GBFA 1WUVA 1O91A 1HRI3 4S2HA 3AYDA 1RUF1 5HBAA 2JICA 3KQRA 4N53C 4IV3C 4FTSA 3T1LA 4AI1A 4JDMA 2D93A 3FBMA 1QQP1 1BVP1 2VQAA 3MW3A 4G3YC 1PO13 4MYEA 2HEWF 2PAMA 5L7OA 2VW2A 1NCQA 1J3RA 4CEWB 3L2HA 5C4WB 3VZNA 3RI8A 2D6PA 5IK7A 1CGPA 5K8SA 4KG0A 4FQZA 4GALA 3HAGA 4HMZA 2QE3A 2DFCA 2GDFA 2R043 2XVKA 2HEVF 3FBYA 3UKNA 3WQ1A 1R1A3 2HKXA 1YJKA 1S0FA 2D6KA 2RMU1 1QXJA 3KCYA 4JVAA 1RUOA 3HQXA 3OBRA 1RUI2 5CVRA 2R072 1RJ7A 5KHHA 3R4SA 3URFA 2W39A 5D1IA 1A6CA 1H8VA 2D6LX 2EXJA 3VL9A 1OFNA 2Z2SB 1EPWA 4Y20B 2GC1A 1QMJA 1GQGA 3FUQA 3A4UA 4FO9A 2GH8A 3W59A 1HRV3 1QH6A 3VKLA 5BNNC 1F31A 1WCKA 2V09A 1NCQC 1SLTA 3VV1A 1W6QA 2WNVB 1RUD1 1GZWB 1G9AA 2WQ4A 4BIFA 2RM21 1OD5A 2WT0A 1POV0 2PHLA 4JGZC 1OOPA 2ZGKA 1RVF2 1SMVA 5KXEA 2PHRA 3G6JB 3AFGA 3THTA 1DGRN 2GZWA 2WZR1 1D0GA 1DU3D 4FPOB 3JB8A 5FLHA 2AYHA 4RS5B 4L2NA 5J09A 1TMF1 1WMFA 2ZGSA 5GLZA 4CDQA 4HKOA 3VBHB 2KA3A 2GC2A 1VBA1 1NOVA 4IEVA 1ND2C 2E6VA 1DGRA 2EIGA 3WDUA 1S0IA 5GALA 4LR4A 4FPEA 1OI6A 5FBZA 1H8TA 1C5IA 3TBDA 1YXWA 1AX1A 1GFF2 1VB4A 4OI2A 5FDBA 3ZXEA 1G8WA 1UKRA 4INDA 1ZBA2 4LO6B 4OHZA 1LJ7A 3POYA 2A3YA 4X8PA 4Y1UA 5TSWA 4EN8B 2TEPA 4JDOA 3QOPA 3CJXA 4QM8A 5I0TA 3CEWA 3MYXA 2G4IA 4XETA 1LB2A 2ERFA 4OI0A 4N7IA 4Q0UA 1BBT2 3B00A 4LBMA 3HD8B 4XMIA 2ZMLA 1U5ZA 2AZ5A 4YM2A 1QJZA 1OPOA 5BPXA 4IEYA 1XE7A 1KFXL 5CADA 1S55A 2VVDA 3U4XA 3WDXA 2AENA 2ZMKA 1OOPC 4TWTA 1YCIA 4Q4Y2 4XJWA 1FT9A 2UWAA 1MZEA 1RUF3 5JAXA 4BPZA 2E7TA 5HCBA 3OPZA 2RS11 1AR93 5CIRA 3M70A 4CDQC 3W58A 4BQ1A 4WVMA 2X5IC 1ULCA 3GZAA 2PA7A 3AP6A 5T5LA 3VBSB 1O3SA 1Q8PA 5KXBA 2P34A 3N7JA 2ZMNA 1JUHA 3H8UA 1PK6B 3BU7A 5C6CA 1QKQA 5DDJ3 1SBEA 2LM3A 1X50A 1BCXA 4I3GA 3MLLA 3DGTA 4PLOA 3VKFC 2C0ZA 2RMU3 2Z5WA 4RA0A 1YFWA 3C3VA 4ONUA 4I2OA 1VBB2 4KU7A 4NWVA 5I91A 5K7PA 1J3PA 1AHSA 2QVSB 2WC2A 3DN7A 4E2SA 4XTMA 4AEDA 2JG8B 3NAPA 4CDUC 3ZFEA 4K6BA 2CYFA 4LULA 1YUDA 5EWSA 3TOJA 1XE8A 4WM7B 1FOD2 3RJ2X 1UD1A 3ECQA 4S2DA 5JSRA 4Q1RA 2ARXA 4KL1A 4MGIE 4UW4A 5C4WC 1N1SA 2F6BA 4BE3A 4B4RA 1CQ9A 2NYYA 3A0NA 1DZQA 2WJSA 4V1PA 4YM0A 2ETEA 4K8FA 1GSLA 2BYVE 4YVSC 5J7MA 4XTPA 2ZKLA 4OLLA 4MXVA 5BV6A 5BUVA 1S2BA 1WD3A 4UBHA 3ZFGB 1DQ4A 1QJU3 1WGPA 2V73A 2WZR3 5BYNA 3JCIA 4AFMA 2ZGLA 2XVLA 3RNSA 3RYPA 2ENRA 4XBLA 4HK9A 4PDWC 1VBA3 3O12A 4RR3B 2ZZQA 4YVWA 2EA7A 4HLTA 1UPSA 2G9GA 4XYXA 4BIOA 3AP5A 3KT4A 4LBQB 1QJX2 1WLDA 2UU8A 4MSVA 4XQWA 1IHMA 2A5ZA 3RYRA 2ZGRA 4Z1VA 5A32A 1HRI2 4A7KA 4UBGA 4MXWB 2OZJA 4E9KA 2GNDA 1JH5A 1AX0A 2WNVC 1Z7S3 1RUI1 1UKGA 4XPVA 2R071 5JIAA 5KWRA 1PO12 1OQ1A 4OHWA 4UXAA 5JSOA 2WS93 2XUMA 2NMNA 2VG9A 1FPN3 3UV9A 3IDEA 5JLVA 3CF6E 3DPRC 1PGSA 1MS8A 4QPIB 4FOVA 1WBLA 1QY4A 2JE9A 3VBHC 3FLRA 1QXRA 4NHLA 4HKLA 2R042 4IQPA 2RS13 3R0RA 3VBOB 4XF9A 4QGNA 3ZDSA 4XMAA 1KITA 2YGLA 1XYNA 1TE1B 4FOWA 3HIFA 2XJQA 4QD2A 2JX9A 5A3LA 3M3CA 1Q8OA 4Z2WA 5F1RA 1RVF1 2HWC3 1NLRA 3I59B 4P9LA 4Q4W3 3ZSKA 2YXSA 3LZZA 3I7DA 3AMQA 3AXDA 1BJQA 1VBD2 3D82A 3OGJA 2XLGA 3O5SA 2WQZC 4AF9A 2W68A 3J8F1 4G9SB 4HN0A 1O4YA 5K0UB 4AQSA 1MVQA 3B3QE