2TEPA

Peanut lectin complexed with t-antigenic disaccharide
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
232
structure length
232
Chain Sequence
AETVSFNFNSFSEGNPAINFQGDVTVLSNGNIQLTNLNKVNSVGRVLYAMPVRIWSSATGNVASFLTSFSFEMKDIKDYDPADGIIFFIAPEDTQIPAGSIGGGTLGVSDTKGAGHFVGVEFDTYSNSEYNDPPTDHVGIDVNSVDSVKTVPWNSVSGAVVKVTVIYDSSTKTLSVAVTNDNGDITTIAQVVDLKAKLPERVKFGFSASGSLGGRQIHLIRSWSFTSTLITT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Specificity of Peanut Agglutinin for Thomsen-Friedenreich Antigen is Mediated by Water-Bridges
pubmed rcsb
molecule tags Lectin
molecule keywords PROTEIN (PEANUT LECTIN)
total genus 55
structure length 232
sequence length 232
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2tepA00
1WUVA 4FPKA 3WDUA 5KXBA 4ISRA 1YRZA 2UWCA 3OYWB 4FOQA 4JCKA 1JBCA 2JE7A 2EXJA 1GZWB 1C1FA 2TEPA 4XTMA 2A70A 4BLJA 1KRIA 2A6XA 2WQZC 2D6LX 5T52A 4YM3A 1G7YA 2CYFA 1LOGA 3APBA 3NV3A 2DU0A 1OQ1A 2D3SA 4Y1XA 1DYKA 1DZQA 2PHUA 1UX6A 4LBLA 3WVJA 1AF9A 2YY1A 2GMPA 3MW2A 3RQ0A 5GZEA 4FPFA 1S1AA 1W0OA 1F31A 1AXZA 3UK9A 1IS3A 1BXHA 1UMZA 1RINA 2VU9A 2VW2A 2W52A 1F9KA 1UL9A 2YROA 3AP5A 4YGBA 3RRDA 3V0BA 2GN3A 3FUOA 1TEIA 4LBKA 4DFSA 5CB7A 1CPNA 2ZABA 2ZHMA 2W08A 1V6KA 3WHTA 2UWBA 1V6LA 2WNEA 2A71A 3AK0A 3N7MA 3O12A 4XIOA 3RG0A 3SLIA 3V65A 1V6MA 4XOGA 3FLRA 2A3YA 5T5JA 4JC1A 4Q8LA 4XBLA 2ZACA 1GLHA 5T5OA 1W6OA 1LESA 1DQ4A 2WSUA 4GWNA 5T54A 5CAZA 1MS4A 1LGNA 4Y22A 3FFZA 1YO8A 3ZXEA 1MZ5A 4YG6A 5GLUA 3R4UA 4FPGA 5JOXA 1LGBA 3TAYA 4JRAA 2VH9A 2GNMA 2CL2A 5IT6A 3ZVXA 2XB6C 1IS6A 1LECA 2ZGNA 4BOWA 2V73A 2HYKA 1FV2A 5CA6A 1QKQA 2JE9A 1G9CA 1CN1A 1UZYA 1JW6A 5HCAA 3KM5A 1DQ6A 3L2YA 5GM0A 4CTEA 2E53A 3WCRA 2WKKA 2P3JA 4UW6A 5E88A 1MS1A 4XIKA 1CONA 1DLLA 3OBRA 4P9WA 4YW4A 4C1WA 2D6OX 3AJZA 2GNBA 3AZZA 5EWSA 3OGGA 5JOZA 1N1TA 2E51A 2R1DA 2ZGQA 3WCSA 3WG1A 4I30A 1CVNA 2UURA 1GICA 4PCRA 2RHPA 4LBNA 1WBLA 4BLIA 3M3OA 4AVSA 3WLUA 5AVAA 4XYXA 3ZSKA 4KBBA 5F5QA 5SV8A 4YZ5A 2DUPA 3ZXJA 3ZXLA 2VXRA 1EPWA 4BM8A 4L8QA 2DUOA 3B01A 3SH4A 1VLNA 3NWKA 4Y22B 4FP3A 1N3PA 1Q8SA 1LHNA 1QU0A 3AZVA 4ATFA 4WVVA 4LBQD 1ONAA 4XJUA 5GALA 4YZ3A 5DXDA 4FVVA 1V6OA 4XE9A 4YW1A 1N1VA 4YM1A 1DQ5A 4YG3A 4P14A 3C2UA 3BOPA 5DG2A 3WOGA 3VKLA 5GZDA 3IM0A 1MS5A 4RL7A 2NP0A 4Y1YA 4D69A 4Y1ZA 3OY8A 1QNWA 1Y7BA 1JXNA 1B09A 1WW6A 2DTYA 1DYPA 2DURA 3PVOA 3PVEA 1A8DA 1S0EA 4M3CA 4IQPA 3ZYPA 1W6MA 2D6MA 1HQWA 4AGGA 4YW2A 3AP9A 1V6IA 2D6KA 1JYIA 3I4IA 4BMBA 3ILFA 2D7FA 4W65A 1N47A 3WDTA 1QMJA 2WT0A 4YM2A 3AP4A 5F9TA 2ARBA 5KXEA 2ZGKA 3OYWA 4Z8BA 4Y1UA 1PZ8A 2G4IA 1CESA 1BKZA 3O5SA 1SFYA 3OBTA 3HR9A 1MZ6A 5E89A 2Z42A 5HCFA 5GZGA 3POWA 2E6VA 3PJQA 1G9BA 2R16A 2D43A 4YGCA 3WHUA 3ZSLA 2DVAA 1AJOA 1A78A 1R1ZA 2ZA9A 2JD4A 2JECA 2DWRA 2W68A 2EXKA 4PBPA 5L73A 1GKBA 3WV6A 3B69A 2JKBA 2ZMNA 1Q8VA 1D0HA 4FP2A 2ZGTA 4YFZA 1BQPA 2ZHLA 4OZXA 1KJLA 3O0XA 5T50A 2VUAA 2A3XA 5DZFA 5FRAA 3ZSMA 1RITA 1N1SA 2OUHA 4Y20B 1FYUA 1MR5A 1SLLA 4ISQA 1MS9A 4M01A 4AVVA 2NMNA 3ZXFA 5IUQA 1DBNA 2B7YA 1WD3A 2FHRA 4AVTA 1VIWB 2AENA 4NO4A 1SLBA 3N36A 4YW5A 3MW4A 4DRRA 1V6JA 1WW5A 4TYSA 4BPZA 5EXOA 3OJBA 3H0OA 2E7TA 2UU8A 2C5DA 1ENQA 4XBNA 1V00A 3CNAA 3VKFC 1MACA 3WDVA 4YZ1A 3VV1A 2ZGUA 5CBLA 4Y24A 4LBQA 2LTNA 5JOYA 1CJPA 1IKPA 3V0AB 2GN7A 3IN9A 4AGRA 3HN1A 1KQRA 3SH5A 3LCPA 1AZDA 3N7KA 4FPLA 1QOOA 3D6EA 1N3QA 3ILRA 3N3HA 3DGTA 1H9WA 3ILNA 3ZXKA 1MVEA 3BTAA 2Q5TA 3SNMA 4LBQB 1JYCA 4WVWA 2NN8A 2WLQA 4FPEA 3MEPA 1AX2A 5T5LA 1JN2P 2VW0A 3POYA 3T1MA 1F5FA 4AYUA 2DUQA 2ZHNA 5H9SA 3ZSJA 4Q1PA 2ZGMA 1Z78A 1XQNA 1LOAA 3AYCA 4XJZA 5H9QA 1AX1A 3T1LA 3AXEA 2D44A 1G9AA 2AUYA 4Y1VA 2SLIA 1LCLA 1W6QB 1AX0A 2AH2A 2PHRA 1AXKA 5IK7A 2NM1A 2A6ZA 5GLTA 3MPPG 2GNDA 2LALA 3HMYA 4R9DA 1LEDA 1LHUA 3WUCA 4DPNA 2DVDA 1LTEA 2AYHA 3PMEA 3SISA 4WV8A 5EYXA 2ZMLA 3VKNA 1JHNA 2YMZA 3AZWA 1JOJA 3ZYRA 5IK5A 5H9PA 1LU1A 3M3CA 1UKGA 3AFKA 3RSJA 1LGCA 1HLCA 3OPZA 1A3KA 1CQ9A 3M3EA 1VAVA 5GLZA 2A7AA 4FPHA 3JUUA 1W6PB 4Q27A 3AYEA 2CWMA 3USUB 3AZXA 3B00A 2JDZA 3OY8B 4BQ1A 3ENRA 1GZCA 2GALA 2PELA 2A75A 2I2SA 1S0IA 1GANA 1QDOA 3AP6A 1D2SA 5JOWA 3WDWA 5T55A 4LBJA 1GNHA 3NV1A 1WLWA 2VW1A 3V0BB 1WW7A 3A4UA 5EYYA 2ZGLA 1ULDA 3ASIA 1UAIA 1N3OA 4FPYA 4GXLA 4MYEA 2YXSA 4U2AA 1AJKA 1BZWA 1MS8A 3N7LA 1WCSA 1FAYA 4FQ4A 4LBOA 3UJQA 4XMIA 1DFQA 4TZDA 3U4XA 2P34A 4K1YA 3FLPA 2ZMKA 4HANA 1KJRA 4GWMA 2BQPA 1AXYA 1BYHA 1LOFA 2YZ4A 4YGDA 3D5OA 3IPVA 1S0DA 3T2TA 2DVFA 3KQRA 3WG3A 1MS0A 1YI7A 2EIGA 2ERFA 5JMCA 2AGSA 1UPSA 1QF3A 3M2MA 1C4RA 1OFSA 1IS5A 2EAKA 4CZSA 1LHVA 1YXWA 2GNTA 2PHTA 1YYNA 5CNAA 2UWAA 3VKMA 1LULA 1QOSA 4YM0A 4FPJA 4C1XA 1MVQA 5JVVA 4P9YA 2ZGOA 4Y26A 1APNA 5DUWA 3SH3A 1ENSA 2A3WA 1SBDA 4GKYA 4K21A 2CWSA 1W6QA 1W0PA 5GLWA 1FX5A 4AWDA 1CIWA 4FOVA 1GZ9A 2R0FA 4XBQA 1W6NA 3FLTA 2NMOA 3B3QE 3IMNA 4HL0A 4M3CB 1GSLA 1GV9A 1YIFA 1SLAA 4ITCA 3IKWA 4XHXA 1LU2A 3PVNA 1DQ1A 4FPCA 1H30A 1Q8OA 1CR7A 4SLIA 4Q1RA 2D6PA 2DTWA 4Q26A 3MW3A 5DUVA 4R9BA 1QNYA 5H9RA 1C1LA 1VALA 2P2KA 4GKXA 1IKQA 2VY0A 3FBYA 1S0GA 1X50A 2DVBA 3AZYA 3W59A 2A6VA 4YGEA 1SLCA 1MS3A 3UL2A 1CPMA 2A6YA 3POSA 4FOWA 3QLQA 4XDQA 5DZEA 1FV3A 3WDXA 2V5YA 4UW5A 1WBFA 4LBMA 2E7QA 3AYDA 2OW4A 5DUXA 4XZPA 5GZCA 1FNZA 3A0KA 4F83A 2WJSA 1J1TA 4FOYA 5DG1A 2PHXA 4PF5A 1ENRA 4YLZA 2CNAA 3TB0A 5E8AA 2ZGRA 4M3CE 5FREA 3NV4A 4GA9A 1S0JA 1NLSA 3LSDA 2A5ZA 3M3QA 3UJOA 3FUQA 5HCBA 3W58A 4YZ4A 1DQ0A 4XHBA 3RMYA 1I1EA 2KM2A 3USUA 4DS0A 1FNYA 3BIWE 1SACA 3INAA 1G86A 1LEMA 1G9DA 2CTVA 2ZGPA 3WZ1A 5IK4A 1ULCA 5GJ6A 4P9XA 4H55A 5T5PA 4YFWA 1LHWA 5IK8A 1G8WA 2WT2A 3QCWA 4Q8KA 1WLCA 2XG3A 4YG0A 5JLVA 2DU1A 1SLTA 3WG2A 1LODA 1AVBA 3V0AA 5LK5A 2C9AA 1I3HA 2WT1A 4PQ9A 1QOTA 4R9AA 4NOTA 4Y20A 3WNXA 3NV2A 1LJ7A 1WLDA 2AREA 2P3IA 2WSVA 1ULFA 3A0NA 1UZZA 1LHOA 1GBGA 1W6MB 1IS4A 1JUIA 1O4YA 1Q8PA 1ZA4A 2OVUA 1H9PA 4U36A 4XJWA 4YZ2A 5DZGA 4ZXKA 3Q9OA 2R49A 2ES3A 3SITA 2ENRA 3AP7A 3AYAA 4K20A 5GZFA 1LOFC 4XILA 1W6PA 2P37A 2EF6A 2YV8A 4R9CA 1RIRA 4ZKTB 5KXDA 1WD4A 2FMDA 3LSEA 1DQ2A 1VAMA 3IPVB 4RA0A 3N7JA 1SBFA 2DVGA 4XJAA 2DYCA 2GDFA 4YW3A 1KITA 2ZHKA 3DUIA 4XXPA 1S0BA 1KDMA 1SCSA 1UN1A 3WDYA 1S0CA 3R4SA 1BJQA 4XMAA 3B9CA 4DQAA 3D4KA 3VUOA 3I8TA 1S0FA 4ASMB 5JDBA 1LOCA 1Q56A 1V6NA 1FATA 3GNEA 1W6NB 3ZPYA 1N1YA 2NZ9A 1LENA 1OKQA 1SCRA 1URXA 2NYYA 2ZGSA 1HDKA 1G9FA 3ATGA 4Q2FA 4BMEA 5KXCA 4UW3A 1PZ9A 1Z0HA 5DUUA 3V64A 1O4ZA 2GMMA 3M1HA 4XJ8A 1ULEA 2W39A 1Q8QA 2JJ6A 3AXDA 4FQZA 3GALA 2DV9A 2ZZJA 1SLIA 1ULGA 1QGLA 4XJ9A 4PBOA 2ARXA 4M00A 1IOAA 1C57A 1NXD1 1DHKB 2D6NA 3AX4A 4GALA 1DIWA 4FPOB 4DRVA 1DGLA 1QDCA 3R05A 2PHWA 2EXHA 4CRQA 1HQLA 4WZFA 3WG4A 4ATEA 2H0BA 1LOBA 4K1ZA 1SBEA 1GYKA 1GZWA 4XXAA 5GLVA 5BYNA 4M3CF 3N35A 3JU9A 1U0AA 1WW4A 2ZAAA 3VKOA 2A6WA 2OUJA 2P3KA 1ZM1A 4XTPA 3BODA 1KDKA 1LOEA 2GMEA 1PZ7A 3O0WA 1W6OB 4UW4A 3AJYA 3O0VA 4AGVA 1HKDA 2PHFA 1GNZA 2R1BA 2EXIA 2ZKNA 2D3RA 3RS6A 2ZBJA 2EALA 2R0HA 2D3PA 2SBAA 3WUDA 3RMXA 2AR6A 2CY6A
chains in the Genus database with same CATH superfamily
3MBWA 2BEOA 4JQRA 4DXTA 3MICA 4AI9A 4UFHA 2UWCA 5J09A 3ZYGA 5CKMA 3CU7A 4JCKA 5KHHA 3VBOB 3B94A 5FP9A 4L0PA 2D6LX 2IFRA 2Y0OA 3WW1A 2CYFA 1LOGA 2J1SA 1EAH3 5LBEA 2D3SA 2PHUA 2R041 4RR3A 3ZYJB 4XF9A 5KXCA 2ZTNA 1DGRN 1X9TA 3DPRA 2PAMA 5C9AC 1QJZA 2W52A 4Z92B 4QU2A 1VBE3 1UL9A 4XQ4A 3VHRA 3X29B 3ZOIA 2GH2A 2JIJA 3FN9A 4DFSA 1SFPA 2ZABA 2ZHMA 4HKWA 2PA7A 4RR3B 3WHTA 4BYYA 3FBMA 3RG0A 5K0UC 4FBFA 3V65A 4FXKB 5I93A 4KL1A 2Y6FA 1KEXA 1YI9A 4A7YA 4JC1A 4EN7B 4CCDA 2VQ0A 1LESA 1GQHA 4GWNA 4PIZA 4CP9A 1MS4A 3AKRA 3LPGA 4X8PA 4FSJA 3VBOC 1YO8A 4YG6A 5GLUA 3R4UA 1IGOA 1K12A 3RDIA 3S6PA 3WQBA 3B9IA 4HETA 1PO23 1S2KA 2XJQA 1IS6A 1LECA 2ZGNA 4R52A 1V0AA 3VDAA 1ODNA 3ITQA 4BOWA 4DO0A 1W2AX 3RZHA 1FV2A 1RVF3 4G9SB 4JGYC 1REDA 2VE1A 2Q8CA 3ZFFC 5CA6A 1G9CA 1CN1A 1I5PA 5EJ1B 1EUUA 2VCBA 3WEZA 3U07A 1QJU1 3WP4A 1JZ3A 2WKKA 1BMV2 1W9TA 2P3JA 4A7ZA 1MS1A 5A3OA 4PIYA 2HWF3 5A3WA 3OBRA 4UF0B 3AFGA 4QWNA 1RYYA 2EIBA 1BLZA 1CX4A 2XLGA 3OGGA 5JOZA 4FTBA 5IVJA 2FCTA 2RS12 3ETPA 1WCKA 4R4XA 1U12A 1VAKA 1CVNA 4IGQA 4PCRA 5EV7A 5FY1A 1GR3A 5FO8B 3IMMA 5CFDA 5AVAA 3CDZB 4XYXA 1KS4A 4KBBA 1VJ2A 4YZ5A 1H1IA 3ALQA 2QQKA 2JE8A 3ZXLA 1CZVA 4GWJA 3U10A 3BI3A 3LFMA 2VMIA 1TE1B 4IEOA 4L8QA 1UZ0A 1MQTB 3I7DA 4LO5B 3LEMA 4LK6A 5HV4A 5FY8A 1X33A 4GWIA 3AZVA 3UKNA 4XJUA 5GALA 1RHI1 2LROA 4FVVA 2P6CA 4CYDA 1HXS1 3GZAA 4WM8C 1TMF1 4XE9A 2J1VA 4YW1A 3ZIXA 1DQ5A 1O8PA 4YG3A 4URAA 1ZZ8A 4XFBA 3T09A 3T30A 3O1TA 1XB9A 3NMBA 3VD9A 4TXWA 1GFF2 1UIJA 4ARXA 1MS5A 4RL7A 1K42A 1FPN1 2Q0AA 5A33B 5IW0A 3WQ1A 1QNWA 2BERA 1H6XA 1UNBA 1B09A 2HWF2 3HNYM 4XZUG 5DAQA 4IL7A 1E57A 1DYPA 2E63A 1RUE2 2W46A 3DXUA 4MGZE 3PVEA 2VCCA 1EP0A 5JI7A 4AFDA 4A3XA 4AFBA 5APAA 5C9AA 3RYRA 2D6MA 1HQWA 2VMDA 2RDRA 2VVEA 4M0HA 2WYFA 4AGGA 1FPN3 3AP9A 1V6IA 2BU9A 3E5QA 1HX6A 2VZUA 4ARYA 4DUVA 4LJHA 2V4VA 3RI9A 1ZX5A 1EY2A 1QMJA 3AP4A 1OSGA 1XU1A 3SCFA 1ZYBA 2J1UA 4Y1UA 4Z8BA 2X09A 1CESA 2VNRA 3O5SA 3OUHA 4IUGA 1SFYA 4QMAA 1MZ6A 3NJXA 2XGXA 3POWA 5C70A 3PJQA 2XJVA 1PM7A 3VD3A 2BGOA 1J1LA 1XC6A 2D43A 3CBNA 1K5MA 3ZSLA 1AJOA 4Z2WA 1JUHA 1A78A 2RS11 1R1ZA 2FCVA 3WF1A 2JECA 2VBDA 4NRMA 3WW4A 2EXKA 4JGYA 3ZFFA 5L73A 1W9YA 1RUF3 5DAVA 1GKBA 2K9ZA 1Q8VA 4MGKE 4NIGA 3ACGA 2ZGTA 3DYMA 3ZYFA 2WO3A 1VBC1 1W8FA 2JXAA 5DZFA 1H2LA 4ZS3A 5FRAA 5IAVA 5HXMA 4QX3A 4JGZA 1R1A3 1LRHA 1IPKA 4KGGA 4A6SA 3P3NA 4Y5TA 1MS9A 2DCTA 2YDEA 1K5JA 2RS33 5FK7A 2NMNA 3I3EA 3VBFC 4GD4A 2VNOA 4C0HA 1DBNA 3B93A 2B7YA 3HD8B 5FYSA 4NRQA 4OHVA 1SLBA 1ZREA 4YW5A 4AE2A 1B35A 1V6JA 2QQWA 4PQQA 1EAH2 4AHWA 4BK4A 4DB5A 1EV12 2DCYA 2E7TA 3H7YA 5JSRA 3VKFC 1UKRA 3FMGA 3WDVA 5FQ0A 1US3A 3O1SA 5I91A 3ACHA 4LBQA 4QPIA 4YNIA 3LA7A 3MIDA 1CJPA 2FD8A 4AZZA 3V0AB 4CDXA 3IN9A 1AR92 1XSQA 2AACA 5JPMB 1RXGA 3ACLA 3FZ3A 1R093 5GKAC 3U11A 1KQRA 3SH5A 3LCPA 3N7KA 2VECA 3KGZA 4YPJA 3OD0A 4EN0A 4MGQA 2ETEA 4QX0A 3DGTA 3ZXKA 1MVEA 1Y43B 1QJY3 2Q5TA 4LBQB 4QPIB 4Z82A 5FP7A 1M06G 4WVWA 3BU0A 4IEWA 4FPEA 5J36A 3ES1A 5T5LA 1JN2P 1SPPA 1AR82 1X9PA 3T1MA 4HKOA 1C8NA 4TSVA 1H1MA 3OGVA 2ZHNA 3E6DA 3ZSJA 3DN7A 4Q1PA 1PGW1 1XOYA 3AYCA 1XQNA 4XFGA 2WZR3 5LB6A 1RUH3 3AXEA 3ME2A 2D44A 2AUYA 3H9AA 4AVCA 1VMFA 3AMHA 3U75A 4EE2A 3GZUC 1H8TA 2HWB1 1R64A 5IK7A 3LA3A 5CG8A 2A6ZA 4BZ4A 2WNUC 3NNGA 1AL23 2ORZA 1R091 1J83A 4A41A 4DZGA 1GQPA 3CLPA 3E6CC 1LTEA 4COYA 2XH6A 5LEJA 2BDRA 1KFUL 4CPBD 1YQ6A 4NHYA 3ZYRA 3TEZA 1UF2C 3WNMA 1PO11 2XJTA 3M3CA 3WINE 1AR73 3GZTB 1UKGA 3PUAA 4HZFA 1LGCA 1HLCA 2JX9A 1CQ9A 3ROUA 2XBO2 4UWDA 3CL1A 3TEYA 1RB8G 1JU4A 4WM8B 4Q27A 1SEFA 3ZKUA 1UYYA 1VBD2 4E8DA 3AYEA 2CWMA 3B00A 1CX1A 2E32A 3SCGA 1JOPA 1Y9GA 3WQ7A 3O1RA 3ENRA 1OH3A 2WZR2 5FCCA 5I0SA 2IXJA 4HFSA 4LQRA 3HPNA 1COV1 3OB8A 1QJX1 2QQVA 5JOWA 3T0DA 5T55A 1AR83 1B35C 4PF1A 4QGNA 1VMHA 1HN1A 2VVFA 4XABA 1QJEA 3ZYIB 2O0OA 3V0BB 4O61A 2ZGLA 4AEMA 4CUAA 1FOD1 4E4DX 3FHIB 4W6YA 4XQWA 4MYEA 4U2AA 1MS8A 4QQHA 1D4M1 3N7LA 3KV5A 1AYM3 1JI6A 3SHRA 1DFQA 1NA1B 2VJXA 4GZ9A 4K1YA 3NW4A 4LKEA 3U0ZA 4HANA 4BU2A 4GWMA 5EQUA 4WM7C 4B8EA 4R8HA 2BV4A 2WABA 3PNAA 3KQRA 1YI7A 4LIUA 3PIGA 2VQTA 4Q0UA 1ND2A 4RHV3 3U14A 2Q1MA 3ZO0B 1EV13 1UPSA 4CCNA 3JBG3 5HCHA 2N7GA 3J26N 1NZCA 4KQ7A 3ZXAC 5ABJC 1LR5A 1MZFA 1YYNA 5C3PA 2DFCA 3WP3A 1PK6B 4AHZA 4PDWA 4ZU7A 4OHYA 2CGNA 1AYN1 1JTZX 2OIIA 3Q8AA 4Y26A 3S57A 4GKYA 5F3CA 1W6QA 5BNPA 2XJUA 4MOAA 5F5IA 4BQ2A 5F8PA 1J3QA 1GZTA 4CCMA 1CIWA 5IHRA 4HMZA 2QTWB 2VNGA 4NPRA 3D82A 1TVGA 3S7IA 1RUF2 2H0VA 4PDWB 4HXCA 3UT0A 1XNKA 1GV9A 3DKQA 5B2GB 2NPIA 1RUC2 3ECQA 4P9JA 3W9AA 2LUWA 3TBDA 1TME1 3PVNA 2MEV1 4FPCA 3HQXA 4O9EA 2D6PA 2HWE2 4XUQA 2WFF2 4PI2A 1ZRIA 1YQ2A 2XDVA 4NPMA 4QQOA 5EHDA 2X53S 5A7OA 5C3SA 1PVC3 3FBYA 4D6QA 3RVHA 4CEWB 1S2EA 5J1XA 1FPN2 1ODMA 2A6YA 1BVVA 2WS91 5HPOA 1PNFA 1WMXA 2A73B 3M3IA 5FXVA 3WDXA 4UW5A 3PUQA 1WBFA 2E7QA 1D0GA 2OW4A 1NZIA 3I59A 3RZKA 1PVC1 3A0KA 4IW3A 3URFA 2ZPXA 3VBRA 2YBKA 5I8SA 5C5UA 5ERLA 3UNPA 2W0XA 4PF5A 3IT8A 3A7QA 5A33A 5J7MA 5FOJB 5F2SA 2ZGRA 3SCHA 1S0JA 2GC0A 3IDCB 3T0AA 3GCWA 3LSDA 2VTXA 3GHNA 4UFJA 2WNUB 3FUQA 4DEVA 1T2XA 5HCBA 3W58A 1W2TA 3H8XA 4HG6B 1FNYA 3BIWE 2ILMA 1OI6A 1SACA 3BU7A 5JI9A 1YFYA 3VD4A 1G86A 1G9DA 2CTVA 2HWB3 2ZGPA 3WZ1A 1HW5A 4H55A 3BB6A 2RMU3 4JDOA 1HB3A 4YFWA 5EFUA 4KWUA 4H3WA 1O5LA 2I45A 3H1WA 1SQ4A 3I2OA 1AUYA 5JLVA 2VOKA 4L11A 4NAOA 5FDBA 2W87A 4Q4X1 3WG2A 1FI2A 3UGGA 5C71A 3LAGA 1OBNA 4JDNA 3ZN6B 4BA6A 3V0AA 2C9AA 1I3HA 4FTEA 1VB4A 2QUOA 5D8AC 1QOTA 5JUVA 4NIHA 3J8F1 3GZEA 1CAVB 1E5SA 2D93A 1JZ2A 2OYZA 2WSVA 4IV1A 5IATA 4RFRB 3DXTA 3DPRC 4W6WA 1E5IA 1O4YA 2UY8A 4XJWA 3ZN6A 2HWC1 3AVRA 4CCCA 5BNPC 4C91A 4MLOA 2UYAA 3QH6A 3VHNA 1RUD1 5A1LA 5BNOC 3AP7A 3AYAA 4YYOA 1PO22 4PLOA 1X7NA 2R042 2JDPA 2AZ5A 4R4ZA 5IVYA 2FDKA 2YV8A 4ZKTB 1DDLA 5AC92 1K3IA 5JXJA 3BIEA 1VAMA 4KI5M 3IPVB 2ZX4A 3OUIA 4RA0A 3N7JA 4XFCA 4Y5SA 3ON7A 5FPLA 1PX4A 5LASA 2GDFA 4YW3A 2VL4A 4ORFA 3KHBA 4QHOA 4XXPA 5FUNA 3LZZA 5FY7A 4MHRA 4XF4A 3IB3A 1S0CA 3ZM8A 1BJQA 3EYPA 1DGRA 1S0FA 4P9IA 5JDBA 1OPOA 1Q56A 3VB9A 5J48A 4ASKA 4GB31 4D7TA 3RPQA 1V6NA 1XYNA 4BQ3A 5DABA 1HV0A 1NCQC 1UOJA 4UFKA 3T2PA 5I8TA 2QQPA 2P4EA 4Q2FA 5BY5A 2BGPA 4QPGB 1Z0HA 3TYJA 4Q4Y1 4K9SA 1PVXA 3M1HA 3W21A 5L36A 2JJ6A 3IDBB 4FQZA 3HAGA 4FTSA 3WSOA 1ULGA 1QGLA 5KC6A 3BTYA 2B9VA 2TBVA 1OVPA 4M00A 2PHLA 2BW8A 4GALA 1DIWA 5FUIA 2VOTA 2F4PA 2W9XA 1XE0A 1OF4A 2NLRA 5FPBA 5BNNA 3GM8A 4MUVA 4AXOA 2YUEA 1SBEA 1ZZBA 2DCZA 5BYNA 1EAH1 3O1UA 3MLKA 3UETA 5F7UA 2WWSA 4M3CF 2JDHA 3N35A 1GNYA 1U0AA 1WW4A 3IWZA 3OSDA 1O3TA 1YHFA 1TQ5A 2OZ6A 4HPKA 4XTPA 3A21A 4QX5A 3U37A 3VKOA 5FPUA 5ISLA 2GMEA 2W3JA 3O0WA 2WBKA 1W6OB 2KXLA 1VBC3 1UW8A 2XWJB 5L7OA 1BHGA 3EHKA 3G6JB 4OI0A 1GNZA 3POIA 3CMGA 3PL0A 1E5RA 5EP9A 3EB7A 1RMU2 1OXCA 5LWBA 2CY6A 2VO5A 3MUY1 3TN92 4FPKA 3HN3A 4MG2A 1HRI1 4ISRA 1AL0G 4FOQA 3VBSB 3UKTA 3VBUC 2JE7A 2TEPA 1GZWB 1C1FA 4MH0E 1KRIA 4LPLA 4YW7A 1PGL2 2WQZC 5T52A 4A2UA 3WNLA 4QAWA 1GQGA 4Y1XA 4ZU5A 3LDBA 1DYKA 3E5UA 4AEDA 3P6BA 2WN3A 2VOXA 2JG9A 2RV9A 3IDEA 3J7HA 3NJZA 3THDA 2YY1A 5IFPA 1WZXA 1WGPA 4H7MA 5DDJ3 1ACCA 4I01A 4FPFA 1F35A 3UK9A 5HCAA 2VW2A 1UMZA 1RINA 4EWEA 2V5DA 4IV3B 3C7GA 1TG7A 2LS6A 2ZX2A 4LBKA 4Q4X3 5FXZA 3V0BA 2FDIA 2W08A 3OUJA 2J1RA 1V6KA 3TEWA 1V6LA 4YVWA 3O12A 1V6MA 3J9SA 3BALA 3FLRA 5T5JA 3I2KA 4B4RA 1QJX2 2OPWA 2ZJCA 5FYYA 4XBLA 4CDUA 4NHMA 1W6OA 2WSUA 5JR2A 3O1VA 1XNDA 2WO7A 5CAZA 5FYCA 1J84A 1XE7A 4GULA 4BHPA 5E6HA 3ZXEA 1MZ5A 3S30A 5JOXA 1LGBA 3LIGA 4XUPA 3DYOA 2RM23 4JRAA 3KF5A 2HWD2 2GNMA 1RUH1 1ZBE2 2O1QA 2WINB 5ACA3 2EA7A 2VZSA 4EWAA 2Z79A 2JE9A 5FP3A 2JG8B 1UD1A 1JW6A 1UZYA 4AI2A 1DQ6A 5JZGB 2VUJA 4KWJA 4CTEA 2E53A 2IWGB 3IZOA 1ASJ1 3IAQA 5KXDA 4Q4V2 4CVUA 4UW6A 5DAPA 5E88A 2VZQA 4MGTA 1BCXA 1X8EA 1DLLA 2V4AA 4XURA 3KD4A 3AJZA 3AZZA 4OI2A 1N1TA 3WCSA 1ZNPA 3WG1A 1MPXA 2RHPA 4LBNA 4IESA 1PIV1 1HRV3 3WLUA 3KCXA 4F7ZA 5F37A 4XACA 5F5QA 1REEA 5SV8A 2ZX1A 1POV3 1NKGA 3ZXDA 3ZFEA 3VDDB 3B01A 3SH4A 3W5MA 3AKPA 5FMDA 1YLLA 3OGRA 4D7SA 5FYBA 5CYYA 4PI0A 2I07B 4QKBA 4NIIA 4JTOA 1QQP2 2VMEA 4HN1A 4WVVA 4PDWC 5FYHA 3WXPA 4LK7A 5DXDA 3WF0A 4Z1VA 5JZGC 3WY6A 3LGRA 4CXWA 4LLOA 3VD5A 4OFGA 1XU2A 3BGAA 2PQQA 5JIUA 4WVMB 3C2UA 1UO9A 3BOPA 1JOBA 1OLMA 1HJGA 1HN0A 4ZZ5A 1C8M2 4Y1YA 4YVSA 2XONA 1W8ZA 3JD73 4QQ2A 4CCLA 2D40A 3DPRB 4UFMA 4XETA 1FOD3 2DTYA 2L9LA 4B4QA 1A8DA 1S0EA 2VQUA 1MZEA 5E1RA 1IHMA 4S2FA 4XFAA 3TEXA 1TME3 2ARCA 3WF4A 2TUNA 2D6KA 2YBPA 2BTVC 3KT7A 4BMBA 2D7FA 1NCQA 4E4HA 5F9TA 3C7EA 4C8DA 4LE4A 1H8TC 4IEUA 4GH4A 3OYWA 3ES4A 2VCMA 1CIYA 4LOTA 1PZ8A 4QDRA 4X6RB 4OQ9A 3TNPB 5FMOL 1W2NA 4CDXB 4X6QB 2WA3A 2LRPA 5HCFA 5GZGA 5D1IA 3HQUA 3ZFEB 2R16A 4KGQA 3WHUA 4AAXA 3D8CA 2DVAA 2C1FA 4W8JA 5FO9B 5LCWL 2ZA9A 4QKDA 2RR11 2JDMA 3VBSC 5C5TA 5FZIA 1RC6A 2OPKA 4Q4W3 3KVBA 4IEZA 5FZDA 5LBFA 5LATA 1D0HA 4RYDA 1IQAA 2IC1A 1W90A 2HBTA 4GMP0 5FYUA 4LHKA 5A7WB 1BQPA 4OZXA 4AFCA 4YFZA 1KJLA 1D4VB 3O0XA 2BFUS 5D2AA 2A3XA 3ZSMA 4BDVB 1RITA 4ZHNA 1N1SA 1XYOA 2XUMA 2ADEA 2R043 2VNVA 1FYUA 4NN0A 4UOJA 4Y4RA 3HBKA 3WQ0A 4YARA 4B29A 1FMD2 5IUQA 1XPWA 1CZTA 5F1RA 1QWRA 3W5NA 1WD3A 2DCJA 2AENA 2PYTA 2WQ4A 3J8F2 3RGBA 1UQXA 5CZKA 5A7WA 4DRRA 1RHI2 2P17A 4A45A 1JYWA 2C5DA 3PUHA 2O14A 5FZBA 4I3PA 4YZ1A 5FZLA 3BTZA 2C4XA 1IG0A 2ZGUA 1VRH2 4FT8A 4Y24A 3B02A 4I0WB 5FFOC 3MIBA 2OXBA 4XF3A 3QOPA 5CADA 4J1WA 1NUKA 2XVLA 2BYVE 1YQ5A 2MPFA 1DP0A 1QOOA 3ZN4A 3ILRA 1S2BA 5FZ1A 1QJFA 2VMHA 1H8VA 1WA4A 2C0ZA 2JDUA 1UY3A 2RMU2 3ILNA 3OBZA 1Q5OA 2WNOA 3HQRA 4LUKA 3VBUB 5A1AA 2CU5A 5FQ0B 5FZ9A 2VCAA 1VR3A 5JAXA 2MNGA 2VTFA 3MV11 4I02A 1F5JA 1NY72 3RWNA 3LEKA 4Q4V1 4AYUA 5B4NA 3O1OA 1VBA3 2F4LA 2BRTA 1UXZA 1LOAA 5C9AB 4XJZA 5H9QA 1UYPA 2W2IA 3C7HA 2RVAA 1L3JA 3H7JA 3PUSA 4Y1VA 4JGZB 3JXSA 4QDSA 2FDFA 3T2QA 1O3QA 2BOIA 1AXKA 2J1EA 2R062 2X5IB 4K3UA 5FZ7A 4DNYA 3SMHA 3CJIB 2LALA 1HXS3 2GNDA 1ZZ7A 1LHUA 3HMYA 3FJSA 3HNMA 5CIRA 2BOJA 3ST7A 2DVDA 1W9SA 1JZ5A 2AYHA 4GJZA 2CGOA 4HKLA 4WV8A 3C7OA 3TWIA 2ZMLA 1OLRA 3AZWA 3VKNA 2B4KA 4N8MA 5H9PA 1QEXA 1AR62 1OUXA 3RSJA 5CVRA 3BTXA 3OPZA 4BIFA 1PVC2 4COWA 2D5HA 2MEV2 1VAVA 1OOPA 3CJIA 5FZ6A 4FPHA 1UY1A 1S55A 2JKXA 1DZTA 4AOCA 2BGCA 4CDUB 3NNFA 4QDQA 3AZXA 4QPYA 4XF1A 1D2QA 1A8MA 1GP6A 1W3VA 4Q4Y2 2YBSA 2BVVA 2C24A 3PTYA 1JU3A 4Y3OA 4COUA 2FZ2A 1H2KA 1QDOA 2P3YA 2WRAA 4EZHA 3WDWA 2WYSA 1GNHA 2BZDA 3W20A 1W8WA 4B1LA 2Q4SA 2VW1A 2W94A 4TLGA 2B8MA 1O7FA 3NNMA 1H1AA 3QD6A 1N3OA 1W03A 2V72A 1ENXA 4FPYA 3WD5A 1W8TA 5KHKA 2J7MA 5JZGA 2B5HA 1BZWA 4NIAA 4HBNA 4OUEA 1FAYA 4FQ4A 4LBOA 3UJQA 1W8OA 1OMIA 2RG4A 1RUG1 1TZOA 4XMIA 4TZDA 2GC3A 3JBG2 1A34A 5FZEA 3I3DA 1KJRA 3TNQA 4FXGB 2BQPA 4RHV2 3VGIA 4D3WA 1ND3A 5FMCA 4CP1A 4LA3A 3NKGA 2YZ4A 4YGDA 4BIOA 1F2NA 1GUIA 4E2QA 1Z7S2 4IE5A 3UGHA 4CPBA 3QBQA 3WG3A 2HYXA 2DDUA 4OUSA 5A3NA 3NKTA 5CKQA 2B45X 3M2MA 1ZA7A 3GJAA 3WP5A 2EAKA 1IS5A 2DFBA 2XLFA 2VBBA 3LD8A 1YXWA 3RJ2X 1AYM2 1VPHA 3JB8A 3H42B 1LULA 1QOSA 2JWPA 2RR13 4LUMA 3K3OA 2QDNA 2WAAA 2UYBA 1ENSA 2A3WA 3KS7A 3V56A 3BPZA 2X5IA 4LLFA 1GWKA 4K21A 2Q1ZB 4CU7A 1FX5A 5A6ZA 3S0MA 1U5XA 3WNPA 1JHJA 1GZ9A 4IGOA 2R0FA 2VPVA 5IVVA 2RJ2A 3FLTA 4QKFA 2NMOA 3B3QE 1VBD1 4URTA 3EQEA 5A7PA 1TNFA 1HRI3 2WAOA 5FPXA 1HB1A 3VBHA 2GP3A 1CR7A 4CEWA 1OC1A 5DUVA 5BNOB 1W99A 2WLPA 1WMEA 2IVIB 1HQNA 2QQJA 2Q30A 4HPKB 5H9RA 2VOVA 2WR9A 1VALA 4FAGA 4GKXA 5C8CB 3RFRA 1OOPC 2R063 4IE7A 1S0GA 5DDJ1 2DVBA 1AR72 3AZYA 2VAUA 4YGEA 3UL2A 1CPMA 1H0BA 4FOWA 4DEQA 2X05A 1PIV2 2XWBB 4XDQA 5L7OC 2HWF1 4JKKA 1FV3A 2V5YA 3CQOA 4LO7A 5FXWA 1FNZA 4M4RA 2IVJA 4CEYB 2GU9A 4FOYA 2JD9A 3HVDA 1W8UA 2PHXA 3NJYA 5FZOA 4CDXC 4QXCA 3I3MA 5SV5A 4QGLA 1OKOA 1OHFA 3CZJA 3NSTA 4M3CE 4GA9A 4XC9A 2JDYA 2R072 3DKWA 3RYPA 3I2FA 1UCXA 3KGLA 3M3QA 4AI1A 4OCTA 3DL3A 1KXGA 3KZ4C 5BNNC 3RMYA 3ZFGC 3I2DA 3INAA 4JHZA 1LEMA 3J4UH 1PMJX 5IK4A 5GJ6A 3VZKA 1C5HA 4BQWA 5FPVA 2FMYA 3MI8A 4QB6A 5IJRA 1MEC1 1Y9MA 4CSWA 4AQ6A 5JSOA 2WT2A 1ASJ3 2YC0A 4N7UA 2GAUA 5FP8A 1JZ7A 5FZ3A 4Q0SA 3ELNA 5C3RA 1W39A 2D98A 2Y6KA 4OMDA 2DU1A 4LHNA 5FYTA 2PMWB 3JBG1 4CDUC 1FMD3 1NLRA 4BXFA 5J96B 2G19A 2HWC3 2EIDA 3WNXA 3THTA 1OQDA 2WFF1 2ZKLA 3RI8A 1P8JA 4N90A 4GB33 5FLJA 1C3HA 5C4WB 1UZZA 1JUIA 1Q8PA 2OVUA 4U36A 4YZ2A 4IGPA 2G1MA 4XDPA 2RS32 3TN91 2WS92 1R1A2 1LOFC 1XBFA 1OPMA 3CJIC 1ND2B 2YB7A 4N43A 1W6PA 2BBAA 4N53A 4R9CA 3KB5A 1RIRA 1YFXA 2YYOA 5FLHA 1WD4A 2FMDA 4P02B 1DQ2A 2Z5WA 3I54A 4NE9A 5FV3A 4QHBA 3SXWA 4IV3C 2RDSA 2DYCA 2RJKA 2OQ6A 4QX2A 4ONUA 3R6SA 3CZUA 1KDMA 5JCTA 3WDYA 5CU1A 4DQAA 1GP5A 1ZBA3 2X10A 3K4ZA 1TME2 4OI4A 1LOCA 4AVBA 4CEYC 1RJ7A 2JB4A 3POJA 1LENA 2LM3A 1URXA 4BMEA 2ZGSA 5FKCA 4JZRA 5ABJB 5AVPA 1QXRA 4AW7A 3JD72 1HIXA 3MLJA 2BNOA 2Z4FA 3KWVA 4Z2AA 1ULEA 2C9KA 3AB0A 4MXWB 2DV9A 1SLIA 5I8YA 2XVGA 5IVEA 2VZPA 3P1IA 4NPLA 1IOAA 1C57A 1NXD1 3AX4A 1QHDA 3JB4C 1DGLA 2PHWA 2XJPA 4CRQA 4WZFA 2EICA 2DBIA 1RUE3 3BUCA 4MGIE 4B3NA 5KC5A 1LOBA 4K1ZA 2CAUA 1MEC2 1D7PM 1GYKA 4WVZA 5LA9A 4E8CA 2XUEA 4QB1A 4LA2A 4AAPA 1IPJA 4YVSC 1C28A 2BJSA 4LIVA 4NHXA 5D8AB 1R083 3A22A 5F2WA 2VZVA 2A6WA 2OUJA 4CUGA 1L7LA 1KDKA 2VZOA 4KMQA 1UY0A 5EPAA 4A7KA 1RUNA 1PZ7A 3AL5A 4OYUA 4E9KA 3O0VA 1YIPA 1COV2 1NG0A 2PHFA 5FY4A 3SKJE 1HRV2 5C8CC 2EXIA 2D3RA 1FT9A 5FPZA 1XSRA 4C0BA 4P9LA 3NVCA 3J7MA 4JRLA 1X8MA 4SBVA 3RMXA 2AR6A 3I49A 1RJ8A 3MV01 4HOOA 4JX0A 3WDUA 5JMOA 5F5CA 1YRZA 2CDOA 4CCOA 4CCJA 1O6UA 1R081 4QHZA 1XNCA 1G7YA 4XVHA 3APBA 4I3GA 4MO3M 1OQ1A 5FTTC 2OT7A 3HBZA 3OG2A 4MGYE 4O7XA 2R7EB 4BQ5A 4DIQA 1NE4A 2GMPA 3GBGA 3MW2A 1D4M3 3RQ0A 5GZEA 4J25A 1S1AA 1W0OA 2Y6JA 3MFAA 1AXZA 5A32B 1BXHA 1RUI1 3WF2A 3AP5A 3WNNA 4DXSA 5LA2A 3RRDA 3O14A 2ARAA 3FUOA 1TEIA 2XKOA 1Y3TA 5CB7A 1CPNA 5FYMA 4CUCA 4BQXA 3MIGA 3RYKA 1W9FA 2VMGA 2A71A 4LULA 3N7MA 3SLIA 4XOGA 2Y8KA 4CU6A 3DCQA 1RVF2 4V2VA 1QJX3 1SHWB 1UY2A 2ZACA 1GLHA 3PU3A 2WDBA 3K46A 1DQ4A 3I2IA 2B46X 1LGNA 4PT6A 5JXGA 4B7EA 4PHZA 1ND3B 1DU3D 3TAYA 4Q4X2 3I2JA 4KG8A 2VH9A 2PLV1 2CL2A 4ASLA 1CJDA 1FXZA 3K75B 1JMUB 3VBHB 2OX0A 3MZHA 2CDPA 2V73A 1DF0A 1QKQA 3OEAA 3OTFA 1VP6A 1J3PA 2ZEZA 4H14A 4L99A 3ZYHA 1O3RA 4IE0A 3MFCA 2YFUA 1YC61 3LE0A 2P1BA 2F17A 4XIKA 4PLNA 1CONA 4P9WA 4YW4A 4C1WA 2D6OX 4DXZA 2E51A 4Q0VA 1RMU3 2HJIA 2ZGQA 4PLMA 3ZIWA 2J1TA 4I30A 3BCWA 5K9YA 5DQ0A 2ZOEB 5IVCA 4BLIA 3M3OA 3ORJA 4CDWB 3PURA 1W2UA 1XNAA 4TLFA 3H8RA 3NJVA 5DMYA 2DUPA 3P5BA 4BM8A 2VBPA 4JTNA 5C8CA 1VLNA 4Y22B 4AK3A 4OVEA 4FP3A 1OH4A 1U5IA 1N3PA 1Q8SA 5BXXA 1JZ8A 2RS52 4BQYA 1LHNA 4CDQC 2R6QA 4HT1T 4YZ3A 1I5ZA 4K6BA 4CDWA 3NL1A 1QH7A 1AHSA 1N1VA 3R0RA 3IDAA 4MADA 4J1XA 2JG9B 5F32A 3ZMNA 4P14A 4P5YA 4F3JA 1PMHX 3HWJA 3LEGA 5DG2A 5FR3A 3KCCA 3VKLA 5GZDA 3OD4A 2NP0A 3MF9A 5TSWA 4BH9A 4IV3A 4Y1ZA 1CAWB 4TN7A 1Y7BA 4CU9A 4QD2A 4WM8A 4FFFA 1LKNA 2DURA 3PVOA 3H1MA 4M3CA 3ZYPA 1W6MA 1W0NA 4NVPA 5FMBA 4YW2A 4NJ4A 2Y38A 3GDBA 1ULOA 5C7GA 1ND2C 3PMSA 3ILFA 4W65A 1U5ZA 1N47A 3E97A 3H1YA 2WT0A 4O9GA 4YM2A 5FZAA 1GWLA 3PLQA 4Q0PA 2ZGKA 2PLV2 3SEPA 2G4IA 3H8OA 2WZ8A 3KV6A 4I0BA 5E89A 4NMIA 2Z42A 2IXIA 2WNVC 1WA6X 4LMFA 2PAKA 2YPJA 1QJU3 4CXXA 5C4WC 4YGCA 4NHLA 3D0JA 2HLEA 2ZX0A 3O1MA 3AC0A 1O5UA 3OF1A 3FHQA 1H6YA 4YSFA 1RVF1 2JD4A 2W68A 1BMV1 2DCKA 4PBPA 4M4PA 3CO2A 4DY5A 5A70A 3WV6A 3B69A 4FP2A 2XKPA 5A80A 2ZHLA 4GH4B 1GOHA 4OHZA 2VUAA 5JR7B 4AI0A 3PUIA 1DGWX 3VZMA 2OUHA 1SLLA 4ISQA 4QKNA 1YWKA 2WWUA 4GMP1 3IBMA 2A1XA 1D4M2 3OPWA 4A6OA 2F6BA 2FHRA 4AVTA 1XYPA 4NO4A 3N36A 1O59A 3MW4A 3KQ4B 5EXOA 5FWJA 3H0OA 4HK9A 1ENQA 1I9RA 1O91A 1UZVA 1BBT1 1V00A 3CNAA 3EJKA 4XBNA 3LDRA 1UY4A 3VBOA 5CBLA 2Q8DA 2LTNA 4LXLA 3USSA 1IKPA 2GN7A 4NR1A 4AEJA 3LWCA 2PXJA 3O7OA 4LNVA 5FOBB 3JQWA 4AGRA 4N9IA 4LTAA 2JG9C 3OOXA 4QGMA 2JIGA 5KHJA 1AZDA 1COV3 1VRBA 4FPLA 4QB2A 5FYZA 3BOWA 1H9WA 5AFEA 4G4FA 3SNMA 1R082 1JYCA 4IDZA 1J58A 4AL9A 3BN6A 1QXJA 1US2A 4E4ZA 2VMCA 2GSYA 3OGJA 4P00B 5FPAA 3R4DB 5A7QA 4JQTA 2VW0A 3POYA 4XAAA 2WWJA 1POV1 4UBGA 1IQDC 5LBBA 3GYDA 2OZJA 1H2MA 4LE3A 1HRV1 2ZGMA 3CF6E 4N43C 2VQAA 4WM7B 2IXCA 5F6LB 3ZR5A 1AX1A 2XQXA 3MLLA 4K8RB 1JODA 5A6YA 4KU8A 2K2SA 2SLIA 4EWDA 4AHXA 1UOGA 4BCUA 3J7LA 1AX0A 3GCXA 2NM1A 3MPPG 1PMIA 4Q29A 1R1A1 4EV0A 1LEDA 4IEQA 3WUCA 1EUTA 4OMCA 1VMJA 1GOGA 2VUDA 2WFF3 3K3NA 3WW2A 3PMEA 4CEWC 2HWE3 4OLLA 2XXZA 3EBRA 4ZU4A 5J3UA 3H3ZA 3N9QA 5IK5A 2YGLA 3VBFB 2ADDA 2WNUA 1VBB2 3MIHA 4XEZA 4RQPA 4A3ZA 2YPDA 3FL7A 1STMA 5AC91 1OFNA 3P3PA 3M3EA 1VBE1 5DN2A 1GWMA 3AMPA 2E26A 4HK8A 3JUUA 2YC2A 1WMFA 1NLQA 1POQA 1W6PB 1CAUB 1UOBA 1DG6A 3HEIA 1WCQA 3UGFA 4DOUA 3USUB 4DXRA 3OY8B 3NRUA 2QQUA 4I0AA 3VLBB 2WS93 1GZCA 5FZMA 1OF3A 4P9GA 1TNRA 2PELA 2A75A 2I2SA 1S0IA 1GANA 3AP6A 3TRSB 1D2SA 4M0NA 1W3XA 1ULPA 4A42A 3NV1A 1CD3G 1WLWA 3UV9A 2EIEA 3MIEA 5M0TA 2GZWA 1EPZA 5J37A 4LHLA 3F2ZA 3ASIA 1UAIA 2Y0IA 2QQIA 4AQ2A 5F3IA 4GXLA 1SFNA 5LZ6A 2HEVF 1PO21 2YXSA 1AJKA 3ZFGA 4UYBA 5JSPA 2QVSB 1BEV1 3FFQA 4ES8A 1ZZ6A 4CP0A 2C6SA 4MXVA 4CP9B 4QPWA 1ST8A 2R32A 2R071 2RMU1 2P34A 2XBO1 3U4XA 4DUXA 5A1FA 1ASJ2 1KFXL 4IE4A 1AXYA 1BYHA 2RDQA 2WZPP 1LOFA 4N53C 5CKNA 2PQSA 3ZFGB 5LRSA 3KT4A 3D5OA 3IPVA 4HVOA 3T2TA 2Y26A 4RQPB 2WZR1 1QY4A 2P6HA 2ERFA 2BNMA 1PX3A 3ZDSA 4HN0A 3MO4A 4DUWA 2AGSA 3VDCA 1NCRB 1NXMA 1QF3A 1RUJ3 4IE6A 4AR2A 1C4RA 1OFSA 4CZSA 3LPFA 2UWAA 1HV1A 4WM7A 1H4GA 3VKMA 3I2GA 1AR71 4YM0A 4FPJA 1NX9A 1MVQA 3ACFA 3C8XA 2RDNA 2ZGOA 4PJYA 4FO9A 1ZBE1 5DUWA 2OS2A 3SH3A 1SBDA 2I74A 3PIJA 5GLWA 1VBD3 1NCRA 2G9FA 3ZSEA 4AG4A 1YJLA 4XPVA 1CWPA 4K8FA 4FOVA 4QPGA 4XFIA 2XBO3 1W6NA 2VZ3A 3IMNA 3LKJA 1YIFA 1SLAA 2XMLA 4YWAA 1TMF2 3IKWA 1RUOA 5A6XA 5HXVA 1DQ1A 1F4HA 1H30A 4ZS2A 2QCSB 4Q1RA 4RQPC 2DTWA 4Q26A 3GHMA 3ZXGA 1BBT3 4KH9A 4R9BA 4L2NA 1SDDB 4LO6B 2PLV3 4EN9B 1IKQA 5K4LA 4D6RA 5I0UA 4HSJA 1X50A 3B5LB 3W59A 4N9HA 2A6VA 2VXJA 1SLCA 5JXIA 3T4HB 1RUH2 3VDDC 2B9UA 3POSA 4LR4A 1NYWA 1HRI2 5D21A 5K7PA 3LOBA 3CEWA 2ORXA 5DZEA 4YVWB 3LEIA 5GZCA 4LBMA 4RS5C 5DUXA 4QXBA 2RS51 5G05L 5A3LA 5HI0A 1UPIA 1PGL1 1PGSA 2W1SA 3JCIA 4F83A 4KNCA 5JXHA 5DG1A 5DPNA 3S5QA 4IXLA 1PGW2 1RUF1 4P08A 3BVCA 1W8HA 2VZRA 5FREA 5FZHA 5A3PA 5FWEA 1H4HA 4WBBA 5FY0A 2VUCA 1F15A 2A5ZA 3ACIA 4Y5Z0 4WZCA 2RR12 4UFIA 4MGSA 3UJOA 5I0DA 4AEDC 1RL3A 1JYVA 4YZ4A 1DQ0A 2CHHA 4XHBA 5IAXA 3USUA 2RS53 4DS0A 1JYNA 3KT1A 5IFTA 2E9QA 4P5HA 2H6BA 3POGA 2BWAA 1J3RA 4I09A 1YUDA 4AFMA 1Z7S3 2HBUA 1W04A 1YNAA 4K7JA 2WA4A 1JYTA 2Y33A 1LHWA 1G8WA 1UWWA 5BUVA 3MF6A 3AL6A 1H8TB 5F3EA 3QCWA 4YVWC 2ZCWA 4BJ0A 4FFGA 2XG3A 1ZRDA 1NA1C 1RTVA 1CAXB 1H2NA 1W06A 1SLTA 2FDHA 1AVBA 2E7AA 2WN2A 2W91A 4XUOA 4H7LA 2QFEA 2QJVA 4NOTA 4S2GA 4Y20A 4BWOA 4META 2XL9A 3NV2A 1LJ7A 4QQPA 1UXXX 1ULFA 4L9BA 3K48A 3HIFA 1GBGA 1IS4A 4D7YA 5DZGA 4ZXKA 2XOMA 3Q9OA 3VZOA 2R49A 3N9MA 5KBFA 2ES3A 4V1PA 2ENRA 3SITA 1KGYA 4K20A 1OLME 3RZJA 5EJZB 5GZFA 1WKYA 1BVP1 1HB4A 2FDGA 1DCSA 2EF6A 1NE6A 4EN8B 4GQ7A 5A3MA 1RUI2 2MEV3 1V9U3 3OCPA 4TWTA 4XJAA 4JHTA 3HT2A 1KITA 1PO12 2ATFA 2ZHKA 3DUIA 4IEXA 3ZX7A 1AR61 3Q8BA 5BPXA 1QJY1 3R4SA 1DZRA 4XMAA 3VUOA 3D4KA 1YFWA 4XF0A 4AFAA 1HB2A 3LA2A 3MDPA 2YHJA 1FATA 3GNEA 1W6NB 3PU8A 3SEEA 1N1YA 2NZ9A 3VDDA 5C3OA 1JYXA 3A23A 2NYYA 4I2OA 1HDKA 1G9FA 4CP2A 2RE9A 3MHZA 1HXS2 2PHDA 4NHKA 1L7QA 4UW3A 5DUUA 3SQOA 3TOJA 2GMMA 3V64A 4RGGA 4XJ8A 4RS5A 3GALA 4CUBA 3VBRB 1W2OA 4AEKA 1X36A 2QQMA 4XJ9A 5F39A 4KWKA 2LW8A 1DHKB 4MZUA 2W1WA 4FPOB 1K5MC 1Q43A 3R05A 4CU8A 2DF7A 3PVBB 4DRVA 4ATEA 2H0BA 4UF0A 1NY71 2ZS6B 2VC9A 4OZOA 4XFHA 1CAVA 1UOFA 2HWD1 3IIIA 1GZWA 4XXAA 4CA9A 3NAPA 1WCUA 3JU9A 1UU5A 1BEV2 4JDMA 5HBAA 4S2DA 3AMMA 2ZAAA 4JV4A 2P3KA 3UYJA 3U4SA 3ZLIA 1Y9QA 3H3UA 4UW4A 1AR93 3AJYA 1W8NA 4AGVA 1WWYA 2XVKA 1F8VA 1NA1A 3K51A 2ZKNA 1J59A 1YFUA 4EROA 3N4MA 2EALA 2R0HA 2D3PA 4CDQA 3OGSA 4HLTA 2RS13 2FZ1A 3JZVA 1WUVA 2J22A 5KXBA 2WO2A 3OYWB 1SDWA 1JBCA 1MEC3 1VRH3 2EXJA 4XTMA 4BLJA 2A70A 4QPIC 2A6XA 5CFCC 4YM3A 5ANNA 5A32A 1NAEA 2R30A 3WNOA 4LO4B 2AC1A 3NV3A 2DU0A 4FCAA 4GMP3 1RHI3 4RD7A 5FZFA 3KHCA 1DZQA 1UX6A 2IXHA 3J8F3 4LBLA 3WVJA 3POBA 2IZWA 1AF9A 1LNSA 1UMHA 1JS9A 3ETQA 1VBB1 3POFA 1F31A 4S2HA 4DY3A 1IS3A 2YROA 4MXWA 2YFZA 2VU9A 5KWRA 1F9KA 4MVTA 4N7IA 4YGBA 3N9LA 2GN3A 3VL8A 2Y34A 2Y6HA 4B1MA 1Y4WA 2FCUA 3I59B 2VGDA 1EV11 1NCRC 2UWBA 2WNEA 2VVDA 3AK0A 4XIOA 1IZ3A 1ZBA2 4AQSA 2A3YA 1Z7S1 1DGWA 4Q8LA 1W28A 1DLCA 1GMMA 5T5OA 2RS31 4UT5A 5T54A 4Q0QA 5LRRA 1OOPB 4XAEA 3FFZA 4Y22A 1RUG3 5T3NA 3FHAA 3M7AA 1RUG2 1YJKA 1SZBA 4FPGA 3VZNA 2HEWF 4HONA 1VBE2 5IT6A 3ZVXA 2XB6C 4W4ZA 3EMRA 3THPA 5L7OB 4XW3A 1FMD1 2HYKA 1ZZ9A 1XNTA 3ZMOA 2QZ2A 3VD7A 4CE8A 1W9WA 2FDJA 3KM5A 3L2YA 5GM0A 1CGPA 2BPA2 4JKLA 4GB32 1QH6A 1OURA 4RHV1 5A7SA 2HWE1 3WCRA 3DECA 2Z69A 2HEYF 2CAVA 2ZEXA 2HWC2 3Q8FA 4D6SA 4QXKA 4LITA 2GNBA 3AKTA 3BYWA 1ZBA1 5EWSA 3O1PA 1EYBA 2R1DA 3HNBM 4IETA 1A6CA 5K8SA 5L9VA 5L9BA 2UURA 2BFUL 3LB9A 3AMNA 1GICA 4AEDB 4QXHA 5JPNB 1WBLA 2MHFA 4AVSA 4RGKA 4J6GA 4UFLA 2ZEYA 5FZKA 3ZSKA 4RS5B 2XPJA 2EAAA 3MPBA 3ZXJA 4JAAA 2VXRA 1EPWA 2CV6A 2DUOA 1M4WA 3AM2A 3CKHA 3IIAA 1QXPA 3NWKA 2B42B 3ZDVA 1CZSA 3M70A 4XUTA 4ES9A 4ZONA 1XRUA 3WP6A 1QU0A 4A4AA 2W47A 4ATFA 4LBQD 1ONAA 5FUPA 5EJ3A 5FYIA 3MGUA 3FC0A 4JVAA 1V6OA 1AL21 5L9RA 3VHPA 4OI1A 4NRPA 1RXFA 3KSCA 4YM1A 3I3BA 1OD5A 2R073 1VE0A 5FZ4A 4CCEA 2JB8A 4RFT0 4E2GA 1O3SA 3LQCA 3WOGA 1BEV3 3IM0A 2O8OA 3OBAA 2RJLA 3I97A 4LKFA 4D69A 3OY8A 4L97A 3EXUA 3RZZA 1JXNA 4LO8A 4XFFA 1B35B 1WW6A 2PTMA 3Q8EA 4Q4V3 3RJRA 3KMHA 2WFPA 3MIFA 1QIQA 4IQPA 1W05A 1PIV3 2WNVA 1JZ4A 3AKSA 3RWKX 1POV0 1JYIA 3I4IA 2RM21 3WDTA 2E31A 5FLIA 1YQCA 2ARBA 5KXEA 3VBSA 2OKXA 4AI3A 2HWD3 4JKMA 5LA0A 3WR0A 1BKZA 3VBUA 2H6CA 4LKDA 3OBTA 3HR9A 4AQTA 5EZWA 5FIXA 4NWVA 2E6VA 1WMDA 1NT0A 1G9BA 3PJYA 4KWLA 2QQLA 3K4AA 4C90A 1S4CA 3GF6A 3U1XA 1SMVA 2XJRA 1XXNA 1VBA1 3PHMA 1PM4A 2DWRA 4ZPIA 1PO13 2V09A 4AVAA 5FZ8A 1REFA 3E1F1 1V9U2 4KU7A 2JKBA 2ZMNA 3N9OA 1RUI3 3K2OA 5DAXA 2NQYA 2QE3A 4IV1B 4W50A 4TTGA 2W92A 1IPSA 4XQDA 1O8SA 5T50A 5B4XA 1IG3A 5BNQA 4Y20B 4M01A 1MR5A 4XDOA 4AVVA 3WX5A 2IXKA 3CJXA 3ZXFA 3D0SA 3MUZ1 4Y33A 5CISA 1ALYA 3H3LA 1VIWB 2ET7A 1OT5A 2JG8C 5CFDC 3T2OA 1WW5A 4MSVA 1AYN3 4TYSA 5DAWA 3OJBA 3ZKYA 4BPZA 5EIYB 5IYYA 2UU8A 3RZMA 4KG0A 4YVSB 3ZYBA 1MACA 4CCKA 1UU6A 3VV1A 5JWPA 2Z2SB 2J1AA 2VMFA 3VHOA 3VL9A 3DEMA 3WW3A 5JOYA 4EYUA 4FFIA 4YW6A 3TN93 2C26A 1RUD3 2GC2A 2JDKA 3E5XA 3NQHA 2VTXJ 3GXUA 1GU3A 3VBRC 3VZLA 4GJYA 5A3UA 3HN1A 2XJSA 4Y4YA 1K5MB 1T6GC 2XLAA 4HVQA 1G6NA 3D6EA 1N3QA 1VBC2 2P5BA 3N9PA 1UIKA 3T4VA 5CG9A 3N3HA 4NWWA 3VBHC 3WNKA 4LKSA 2VD7A 2WL1A 3BTAA 3CHXA 4IEVA 2YGMA 2ZEWA 3T08A 4BXSV 2NN8A 3IAPA 2WLQA 2XL7A 1CAWA 2Q1FA 1OD3A 3J7NA 4QX8A 1JH5A 3MEPA 1AX2A 4UAPA 4G3YC 1F5FA 3ZPOA 2ID4A 5KR7A 3OEBA 5LY2A 2WNVB 2DUQA 5H9SA 3KLSA 4XUNA 1PK6A 2YU1A 5CFCA 1Z78A 1LB2A 2QZ3A 1ZRFA 3B7MA 2Y6LA 4Q4Y3 3HT1A 5FMOS 3T1LA 1BK1A 1G9AA 4YRDA 3LOIA 4NUBA 1WCDJ 3KCYA 1LCLA 1RMU1 1W6QB 2PHRA 2AH2A 2W95A 2WQ8A 2XHKA 3C7FA 5FZOB 2YU2A 5GLTA 4OUMA 1JZ6A 4BISA 1XJAA 4D0QA 4R9DA 3POEA 4BQ4A 1MQTA 4DPNA 1UMIA 3AMQA 1UZWA 5FAXA 5FP4A 1AR63 3SISA 2PAEA 3BKZA 5EYXA 1JHNA 2YMZA 1JOJA 1LU1A 1OA2A 3HJRA 4E2SA 3NO8A 3QACA 3AFKA 4IV1C 1XNBA 4E27A 1A3KA 3UESA 4V2WA 3CIHA 2ZAHA 2VG9A 5GLZA 1OVSA 1VB2A 2A7AA 3LFIA 4IEPA 1BBT2 5FZ0A 5IWFA 5AC93 3M8LA 4N53B 4UBHA 3WT3A 3L9JT 2JDZA 2BWCA 3GGLA 1Q3EA 3KV9A 3FWEA 3GJBA 2WO1A 1NQDA 3HOBA 4QX7A 4QX1A 4BQ1A 5CFDB 1TMF3 2GALA 4AI8A 1RGSA 1VBA2 2YC4A 4ZXEA 5LBCA 3GBWA 2VZTA 3VZJA 2JG8A 2D5FA 1DYOA 2XQRA 4LBJA 5FYVA 4INDA 1RUE1 3PTRB 4IERA 1WW7A 3JQXA 2BVBA 2AEYA 2WIIB 3A4UA 5AFBA 5EYYA 1ULDA 2W1QA 4UXAA 3WF3A 4WVMA 3KV4A 1GOFA 5ACA1 3RZLA 2ZZQA 1PNGA 2QDRA 2QKDA 1WCSA 5IVFA 5I0TA 4GIQA 4BK5A 4EZ4A 1UYXA 4AHYA 4XCBA 4IEYA 1U5YA 4QM9A 2KR2A 4NROA 4MHUA 1RUJ2 3FLPA 2ZMKA 4XCAA 5J98B 5A3TA 5FJHA 4PIXA 1VRH1 5LW9A 4OHWA 1S0DA 2DVFA 2WUHA 3ZN5A 3Q8CA 5KHGA 1MS0A 2EIGA 2HWB2 1O4TA 3NAPB 5JMCA 3VBFA 4RR3C 5K0UB 2K46A 1T6BX 1NCQB 1L7RA 5BNNB 2GP5A 1ZRCA 1LHVA 1KS5A 2GNTA 2PHTA 2E33A 4GH4C 4QPGC 1ND3C 5CNAA 2X29A 2KD7A 3QH7A 5FY5A 4C1XA 2JDNA 1YEWA 2QNKA 2Y6GA 4P9YA 5D8AA 5JVVA 1APNA 2BNNA 2EVXA 2X8KA 1LAJA 2GC1A 5C4WA 3SKVA 3DF0A 1SPPB 4H2AA 4OULA 5KHIA 2YG0A 3F95A 2CWSA 1W0PA 3I3QA 2CSGA 2PN5A 1NOVA 3BPSA 4AWDA 4LORA 4RGAA 3RZGA 3T3YA 5ABJA 4NIDA 4XBQA 5CEHA 4D8MA 4Q4W2 4HL0A 3L2HA 3NNLA 1GSLA 4JGYB 3ZFFB 3VDBA 2G9ZA 2D97A 4ITCA 3D3AA 4XHXA 5FZGA 1X82A 1LU2A 5G04L 5FY9A 2J42A 1Q8OA 4MX3A 4SLIA 2ZX3A 5LEKA 1AR91 3G7DA 4NAMA 5FBZA 3MW3A 2XHNA 4EQVA 5LY1A 5BV6A 1C8M1 1QNYA 1C1LA 3JD71 2P2KA 2W1UA 1BK0A 2WZEA 4A44A 2VY0A 3VN4A 1VBB3 1OUSA 1UU4A 5FBJA 4DMIA 4MV2A 3NNJA 5I0RA 1MS3A 3KVAA 1ZZCA 3QLQA 4B4PA 2VR4A 1RUC3 5A6QA 5FK8A 4L92A 4E4SA 3AYDA 4KBZA 3K77A 1QQP1 4XZPA 3THCA 4F8AA 1UX7A 1FOD2 2JICA 5C6CA 3UKVA 2WJSA 1J1TA 3LIHA 1YCIA 1C8M3 4Q4W1 1ENRA 2IUWA 4YLZA 2CNAA 3TB0A 1KD7A 4B7KA 5E8AA 3EO6A 5LA1A 2Y64A 2G9GA 2IXLA 3NV4A 3H50A 4HSLA 2AEZA 1NLSA 3H8UA 1F4AA 3E6BA 2Y60A 1WLTA 3K4DA 2OQ7A 2JEMA 3T0BA 3DYPA 4LT5A 5F3GA 1OQEA 2BP6A 2GH8A 1I1EA 2KM2A 1QQP3 2BUKA 1OA3A 2VOWA 1CAUA 5FJKA 4OQ8A 4EJRA 1RUD2 3ZR6A 1HJFA 2ZXQA 3NAPC 5IVBA 2OA2A 4GAZA 1ULCA 4P9XA 2FBEA 4K40A 1PHMA 1GP4A 5T5PA 3S5AA 2QQOA 5LK7B 2CGPA 5IK8A 4CXYA 3LDKA 1PK6C 1XE8A 1AYN2 1WLCA 2VULA 4LOSA 4YG0A 4COVA 5HV0A 1C5IA 2QBXA 1LODA 5FO7B 1RUJ1 4AF9A 4QU1A 4ZY9A 5LK5A 2WT1A 4PQ9A 4HVRA 3U78A 4R9AA 4X8NA 3I2HA 1OLQA 5A7NA 4BE3A 1WLDA 2AREA 2P3IA 3A0NA 3RNSA 4DINB 4FAHA 1LHOA 4W6XA 1W6MB 1ZA4A 1H9PA 4FFHA 2K0GA 2JDAA 1CAXA 2DBNA 2R061 4COZA 1ZBE3 5ACA2 1V9U1 2VZ1A 4Z07A 5K0UA 2PFWA 4RN5A 2RM22 4XILA 5C8WA 2P37A 1YQ8A 2IFWA 4FI9A 3LSEA 2Q8OA 1NQJA 2O8QA 1SBFA 2W5FA 3LF7A 2DVGA 5C3QA 4LEJA 2HKXA 2VM9A 3OPTA 5BNOA 2JENA 3SC7X 3KF3A 1S0BA 4EN6B 1SCSA 1UN1A 1MQTC 3B9CA 4QT6A 3I8TA 4ASMB 3PDQA 1QJU2 2Q8EA 4D94A 4QQLA 3ZPYA 4M3CB 1K45A 1OKQA 1SCRA 3ATGA 4Q5OA 1AYM1 1AL22 4RSUA 3AKQA 1PZ9A 4N43B 1O4ZA 2QQNA 1Q8QA 2W39A 3AXDA 4ZZ8A 5BNPB 3FE5A 2ZZJA 5DDJ2 5C33A 1I6XA 4CEYA 5FKBA 5L19A 3N9NA 4BB3A 4PBOA 2ARXA 1UYZA 2D6NA 1ZVFA 4ET7A 4Q8KA 5CFCB 1QDCA 3FX3A 4CDWC 2EXHA 4UI9L 3C3VA 1HQLA 3WG4A 5ANQA 1AR81 4LHSA 5E16A 5F5AA 2B39A 2KA3A 2WC2A 5GLVA 1RUC1 2BBVA 2UY9A 1OA4A 1SG3A 5FZCA 5FXXA 3S7EA 2FQPA 1QJY2 1ZRRA 4QM8A 1ZM1A 4CDQB 3BODA 1LOEA 2TNFA 4JGZC 4OHXA 5JIAA 2X5IC 4O65A 1HKDA 3MYXA 2R1BA 2XR4A 1R092 3M4FA 1E5HA 3RS6A 5F6KA 3ABZA 2HH9A 3ZFEC 3GBFA 2ZBJA 2SBAA 3WUDA 3AVSA 2ET1A 1V70A 3DV8A
chains in the Genus database with same CATH topology
2BEOA 4JQRA 3MICA 5J09A 2UWCA 3ZYGA 3CU7A 4JCKA 5KHHA 3VBOB 3B94A 2D6LX 2IFRA 2Y0OA 3WW1A 2CYFA 1LOGA 1EAH3 2D3SA 2PHUA 2R041 4RR3A 3ZYJB 4XF9A 2ZTNA 1DGRN 3DPRA 2PAMA 5C9AC 1QJZA 2W52A 4Z92B 4QU2A 1VBE3 1UL9A 4XQ4A 3VHRA 3X29B 2GH2A 4DFSA 2ZABA 2ZHMA 4HKWA 2PA7A 4RR3B 3WHTA 4BYYA 3FBMA 3RG0A 5K0UC 4FBFA 3V65A 4FXKB 5I93A 4KL1A 1YI9A 4A7YA 4JC1A 4EN7B 2VQ0A 1LESA 1GQHA 4GWNA 4PIZA 1MS4A 3AKRA 4X8PA 4FSJA 3VBOC 1YO8A 4YG6A 5GLUA 3R4UA 1IGOA 3RDIA 3S6PA 3B9IA 4HETA 1PO23 2XJQA 1S2KA 1IS6A 1LECA 2ZGNA 4R52A 4BOWA 1FV2A 1RVF3 4G9SB 4JGYC 1REDA 3ZFFC 5CA6A 1G9CA 1CN1A 3U07A 1QJU1 3WP4A 2WKKA 1BMV2 2P3JA 4A7ZA 1MS1A 4PIYA 2HWF3 3OBRA 3AFGA 1CX4A 3OGGA 2XLGA 5JOZA 4FTBA 2RS12 1WCKA 4R4XA 1U12A 1VAKA 1CVNA 4PCRA 5EV7A 1GR3A 5FO8B 5CFDA 5AVAA 4XYXA 1KS4A 4KBBA 1VJ2A 4YZ5A 1H1IA 3ALQA 3ZXLA 3U10A 2VMIA 1TE1B 4IEOA 4L8QA 1MQTB 3I7DA 4LO5B 1X33A 3AZVA 3UKNA 4XJUA 5GALA 1RHI1 4FVVA 4CYDA 1HXS1 3GZAA 4WM8C 1TMF1 4XE9A 4YW1A 3ZIXA 1DQ5A 4YG3A 1ZZ8A 4XFBA 1GFF2 1UIJA 1MS5A 4RL7A 1FPN1 2Q0AA 5A33B 3WQ1A 1QNWA 2HWF2 1B09A 4IL7A 1E57A 1DYPA 2E63A 1RUE2 4MGZE 5JI7A 4AFBA 3PVEA 5C9AA 1EP0A 4AFDA 4A3XA 3RYRA 2D6MA 1HQWA 2VVEA 4M0HA 4AGGA 1FPN3 3AP9A 1V6IA 3E5QA 1HX6A 3RI9A 1ZX5A 1EY2A 1QMJA 3AP4A 1OSGA 1XU1A 3SCFA 1ZYBA 4Y1UA 1CESA 2VNRA 3O5SA 4QMAA 1SFYA 1MZ6A 3POWA 2XGXA 3PJQA 2XJVA 1PM7A 1J1LA 2D43A 1K5MA 3ZSLA 1AJOA 4Z2WA 1JUHA 1A78A 2RS11 1R1ZA 2JECA 3WW4A 2EXKA 4JGYA 3ZFFA 5L73A 1RUF3 1GKBA 2K9ZA 1Q8VA 4MGKE 2ZGTA 1VBC1 2JXAA 5DZFA 1H2LA 5FRAA 4JGZA 1R1A3 1LRHA 1IPKA 4KGGA 3P3NA 1MS9A 2DCTA 2YDEA 2RS33 2NMNA 3VBFC 2VNOA 4C0HA 3B93A 1DBNA 2B7YA 3HD8B 4OHVA 1SLBA 1ZREA 4YW5A 4AE2A 1B35A 1V6JA 4AHWA 4DB5A 1EAH2 1EV12 2DCYA 2E7TA 3H7YA 5JSRA 3VKFC 1UKRA 3FMGA 3WDVA 5FQ0A 5I91A 4LBQA 4QPIA 4YNIA 3LA7A 3MIDA 1CJPA 3V0AB 4CDXA 3IN9A 1AR92 5JPMB 3ACLA 3FZ3A 1R093 5GKAC 3U11A 1KQRA 3SH5A 3LCPA 3N7KA 2VECA 3KGZA 3OD0A 4EN0A 2ETEA 3DGTA 3ZXKA 1MVEA 1Y43B 1QJY3 2Q5TA 4LBQB 4QPIB 4Z82A 1M06G 4WVWA 4IEWA 4FPEA 5J36A 3ES1A 5T5LA 1JN2P 1AR82 3T1MA 4HKOA 1C8NA 4TSVA 1H1MA 2ZHNA 3E6DA 3ZSJA 3DN7A 4Q1PA 1PGW1 3AYCA 1XQNA 4XFGA 2WZR3 1RUH3 3AXEA 3ME2A 2D44A 2AUYA 3H9AA 4AVCA 3AMHA 3GZUC 1H8TA 2HWB1 5IK7A 3LA3A 5CG8A 2A6ZA 4BZ4A 2WNUC 1AL23 1R091 4DZGA 3CLPA 3E6CC 1LTEA 4COYA 2XH6A 5LEJA 1KFUL 3ZYRA 1UF2C 1PO11 2XJTA 3M3CA 3WINE 1AR73 3GZTB 1UKGA 4HZFA 1LGCA 1HLCA 2JX9A 1CQ9A 3ROUA 2XBO2 3CL1A 1RB8G 4WM8B 4Q27A 1SEFA 1VBD2 3AYEA 2CWMA 3B00A 3SCGA 3WQ7A 3ENRA 2WZR2 5FCCA 5I0SA 2IXJA 4HFSA 1COV1 1QJX1 5JOWA 5T55A 1AR83 1B35C 4QGNA 2VVFA 3ZYIB 3V0BB 2O0OA 2ZGLA 4AEMA 1FOD1 4E4DX 3FHIB 4W6YA 4XQWA 4MYEA 4U2AA 1MS8A 4QQHA 1D4M1 3N7LA 1AYM3 3SHRA 1DFQA 1NA1B 4K1YA 3NW4A 3U0ZA 4HANA 4GWMA 4WM7C 4B8EA 4R8HA 3PNAA 3KQRA 1YI7A 4Q0UA 4D94A 3ZO0B 1ND2A 4RHV3 2Q1MA 1EV13 1UPSA 3JBG3 2N7GA 3J26N 1NZCA 4KQ7A 3ZXAC 5ABJC 1LR5A 1MZFA 1YYNA 2DFCA 3WP3A 1PK6B 4AHZA 4PDWA 4ZU7A 4OHYA 2CGNA 1AYN1 1JTZX 2OIIA 4Y26A 4GKYA 1W6QA 5BNPA 2XJUA 1J3QA 1CIWA 4HMZA 2VNGA 4NPRA 3D82A 3S7IA 1RUF2 2H0VA 4PDWB 1XNKA 1GV9A 5B2GB 2NPIA 1RUC2 3ECQA 4P9JA 3W9AA 2LUWA 3TBDA 1TME1 3PVNA 2MEV1 4FPCA 3HQXA 4O9EA 2D6PA 2HWE2 2WFF2 4QQOA 2X53S 1PVC3 3FBYA 4CEWB 1FPN2 2A6YA 1BVVA 2WS91 1PNFA 2A73B 3M3IA 3WDXA 4UW5A 1WBFA 2E7QA 1D0GA 2OW4A 3I59A 1PVC1 3A0KA 3URFA 2ZPXA 3VBRA 5I8SA 2W0XA 4PF5A 3IT8A 5A33A 5J7MA 5FOJB 2ZGRA 3SCHA 1S0JA 2GC0A 3IDCB 3LSDA 3GHNA 2WNUB 3FUQA 5HCBA 3W58A 3BIWE 3BU7A 1FNYA 1OI6A 1SACA 2ILMA 5JI9A 1YFYA 1G86A 1G9DA 2CTVA 2HWB3 2ZGPA 3WZ1A 1HW5A 4H55A 3BB6A 2RMU3 4JDOA 4YFWA 5EFUA 4H3WA 1O5LA 2I45A 3H1WA 1SQ4A 1AUYA 5JLVA 2VOKA 4L11A 5FDBA 4Q4X1 3WG2A 1FI2A 3LAGA 4JDNA 4BA6A 3ZN6B 3V0AA 2C9AA 1I3HA 4FTEA 1VB4A 2QUOA 5D8AC 1QOTA 3J8F1 1CAVB 2D93A 2OYZA 2WSVA 4IV1A 4W6WA 3DPRC 1O4YA 2UY8A 4XJWA 5BNPC 3ZN6A 2HWC1 4C91A 4MLOA 2UYAA 3QH6A 3VHNA 1RUD1 5BNOC 3AP7A 3AYAA 4YYOA 1PO22 4PLOA 1X7NA 2R042 2AZ5A 4R4ZA 2YV8A 4ZKTB 1DDLA 5AC92 1VAMA 3IPVB 2ZX4A 4RA0A 3N7JA 4XFCA 2GDFA 4YW3A 4ORFA 4XXPA 3LZZA 4XF4A 1S0CA 1BJQA 1DGRA 1S0FA 4P9IA 5JDBA 1OPOA 1Q56A 5J48A 4GB31 4D7TA 3RPQA 1V6NA 1XYNA 1HV0A 1NCQC 5I8TA 2QQPA 4Q2FA 5BY5A 4QPGB 1Z0HA 3TYJA 4Q4Y1 4K9SA 1PVXA 3M1HA 5L36A 2JJ6A 3IDBB 4FQZA 3HAGA 4FTSA 1ULGA 1QGLA 5KC6A 2TBVA 4M00A 2PHLA 2BW8A 4GALA 1DIWA 2F4PA 2NLRA 5BNNA 4MUVA 4AXOA 2YUEA 1SBEA 1ZZBA 2DCZA 5BYNA 1EAH1 3MLKA 2WWSA 4M3CF 3N35A 3IWZA 1U0AA 1WW4A 1O3TA 1YHFA 1TQ5A 2OZ6A 4HPKA 4XTPA 3VKOA 4QX5A 2GMEA 3O0WA 1W6OB 2KXLA 1VBC3 1UW8A 2XWJB 5L7OA 3EHKA 3G6JB 4OI0A 1GNZA 1RMU2 2CY6A 3TN92 4FPKA 1HRI1 4ISRA 1AL0G 4FOQA 3VBSB 3UKTA 3VBUC 2JE7A 2TEPA 1GZWB 1C1FA 4MH0E 1KRIA 1PGL2 2WQZC 5T52A 4A2UA 1GQGA 4Y1XA 4ZU5A 1DYKA 3E5UA 4AEDA 2VOXA 2JG9A 3IDEA 3NJZA 2YY1A 1WGPA 4H7MA 5DDJ3 4I01A 4FPFA 3UK9A 5HCAA 2VW2A 1UMZA 1RINA 4EWEA 4IV3B 2ZX2A 4Q4X3 3V0BA 4LBKA 2W08A 1V6KA 1V6LA 4YVWA 3O12A 1V6MA 3J9SA 3BALA 3FLRA 5T5JA 4B4RA 1QJX2 2ZJCA 4XBLA 4CDUA 4NHMA 1W6OA 2WSUA 1XNDA 5CAZA 1XE7A 4GULA 4BHPA 3ZXEA 1MZ5A 3S30A 5JOXA 1LGBA 4JRAA 2RM23 2HWD2 2GNMA 1RUH1 1ZBE2 2O1QA 2WINB 5ACA3 2EA7A 4EWAA 2Z79A 2JE9A 2JG8B 1UD1A 1JW6A 1UZYA 4AI2A 1DQ6A 5JZGB 2VUJA 4KWJA 4CTEA 2E53A 2IWGB 1ASJ1 4Q4V2 4UW6A 5E88A 1BCXA 1X8EA 1DLLA 3KD4A 3AJZA 3AZZA 4OI2A 1N1TA 3WCSA 1ZNPA 3WG1A 2RHPA 4LBNA 4IESA 1PIV1 1HRV3 3WLUA 3KCXA 4F7ZA 5F5QA 1REEA 5SV8A 2ZX1A 1POV3 3ZXDA 3ZFEA 3VDDB 3B01A 3SH4A 3AKPA 1YLLA 4D7SA 2I07B 4JTOA 1QQP2 4HN1A 4WVVA 4PDWC 3WXPA 5DXDA 4Z1VA 5JZGC 3WY6A 3LGRA 4LLOA 4OFGA 1XU2A 2PQQA 5JIUA 4WVMB 3C2UA 3BOPA 1C8M2 4Y1YA 4YVSA 4QQ2A 3JD73 2D40A 3DPRB 4XETA 1FOD3 2DTYA 4B4QA 1A8DA 1S0EA 1MZEA 5E1RA 1IHMA 4S2FA 4XFAA 1TME3 2TUNA 2D6KA 2BTVC 3KT7A 4BMBA 2D7FA 1NCQA 5F9TA 4LE4A 1H8TC 4IEUA 4GH4A 3OYWA 3ES4A 4Z8BA 4X6RB 1PZ8A 3TNPB 5FMOL 4CDXB 4X6QB 2WA3A 5HCFA 5GZGA 5D1IA 3ZFEB 2R16A 4KGQA 3WHUA 3D8CA 2DVAA 2C1FA 5FO9B 2ZA9A 2RR11 3VBSC 1RC6A 2OPKA 4Q4W3 4IEZA 1D0HA 1IQAA 2IC1A 4GMP0 4LHKA 4YFZA 1BQPA 4OZXA 4AFCA 1KJLA 1D4VB 3O0XA 2BFUS 2A3XA 3ZSMA 1RITA 1N1SA 1XYOA 2XUMA 2R043 1FYUA 4NN0A 3WQ0A 4YARA 4B29A 1FMD2 5IUQA 5F1RA 1QWRA 1WD3A 2DCJA 2AENA 2PYTA 2WQ4A 3J8F2 4DRRA 1RHI2 2P17A 2C5DA 4I3PA 4YZ1A 2ZGUA 1VRH2 4FT8A 4Y24A 3B02A 4I0WB 5FFOC 3MIBA 4XF3A 3QOPA 5CADA 4J1WA 2XVLA 2BYVE 2MPFA 1QOOA 3ZN4A 3ILRA 1S2BA 2VMHA 1H8VA 1WA4A 2C0ZA 2RMU2 3ILNA 4LUKA 3VBUB 1Q5OA 5FQ0B 1VR3A 5JAXA 2MNGA 4I02A 1F5JA 1NY72 3RWNA 4Q4V1 4AYUA 1VBA3 1LOAA 5C9AB 4XJZA 5H9QA 1L3JA 3H7JA 4Y1VA 4JGZB 1O3QA 1AXKA 2R062 2X5IB 4K3UA 4DNYA 3SMHA 3CJIB 1HXS3 2GNDA 2LALA 1ZZ7A 1LHUA 3HMYA 3FJSA 5CIRA 3ST7A 2DVDA 2AYHA 2CGOA 4HKLA 4WV8A 3TWIA 2ZMLA 1OLRA 3AZWA 3VKNA 5H9PA 1AR62 3RSJA 5CVRA 3OPZA 4BIFA 1PVC2 4COWA 2D5HA 2MEV2 1VAVA 1OOPA 3CJIA 4FPHA 1S55A 1DZTA 2BGCA 4CDUB 4QPYA 3AZXA 4XF1A 1D2QA 1A8MA 4Q4Y2 2BVVA 3PTYA 2FZ2A 4COUA 1H2KA 1QDOA 3WDWA 1GNHA 2Q4SA 2VW1A 2B8MA 1O7FA 1H1AA 3QD6A 1N3OA 4FPYA 1ENXA 3WD5A 5KHKA 5JZGA 2B5HA 1BZWA 4HBNA 1FAYA 4FQ4A 4LBOA 3UJQA 1OMIA 1RUG1 4XMIA 4TZDA 2GC3A 3JBG2 1KJRA 3TNQA 4FXGB 2BQPA 4RHV2 3VGIA 4D3WA 1ND3A 4CP1A 4LA3A 3NKGA 2YZ4A 4YGDA 4BIOA 1F2NA 4E2QA 1Z7S2 3QBQA 3WG3A 4OUSA 3NKTA 2B45X 3M2MA 3WP5A 2EAKA 1IS5A 2DFBA 2XLFA 1YXWA 3RJ2X 1AYM2 3JB8A 1LULA 1QOSA 2RR13 4LUMA 2QDNA 2UYBA 1ENSA 2A3WA 3KS7A 3V56A 3BPZA 2X5IA 4LLFA 4K21A 2Q1ZB 1FX5A 3S0MA 1U5XA 1GZ9A 2R0FA 2VPVA 3FLTA 2NMOA 3B3QE 1VBD1 4URTA 3EQEA 1TNFA 1HRI3 5FPXA 3VBHA 1CR7A 4CEWA 5DUVA 5BNOB 2WLPA 1WMEA 1HQNA 2Q30A 4HPKB 5H9RA 2VOVA 5C8CB 1VALA 4FAGA 4GKXA 1OOPC 2R063 1S0GA 5DDJ1 2DVBA 1AR72 3AZYA 4YGEA 3UL2A 1CPMA 1H0BA 4FOWA 1PIV2 2XWBB 4XDQA 5L7OC 2HWF1 1FV3A 2V5YA 4LO7A 1FNZA 4CEYB 2GU9A 4FOYA 2PHXA 4CDXC 5SV5A 4QGLA 1OHFA 3NSTA 4M3CE 4GA9A 2R072 3DKWA 3RYPA 1UCXA 3KGLA 3M3QA 4AI1A 3DL3A 1KXGA 3KZ4C 5BNNC 3RMYA 3ZFGC