2BWAA

Structure of endoglucanase 12a (cel12a) from rhodothermus marinus in complex with cellopentaose, 20 minute soak.
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
226
structure length
226
Chain Sequence
TVELCGRWDARDVAGGRYRVINNVWGAETAQCIEVGLETGNFTITRADHDNGNNVAAYPAIYFGCHWGACTSNSGLPRRVQELSDVRTSWTLTPITTGRWNAAYDIWFSPVTNSGNGYSGGAELMIWLNWNGGVMPGGSRVATVELAGATWEVWYADWDWNYIAYRRTTPTTSVSELDLKAFIDDAVARGYIRPEWYLHAVETGFELWEGGAGLRSADFSVTVQKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dimerisation and an increase in active site aromatic groups as adaptations to high temperatures: X-ray solution scattering and substrate-bound crystal structures of Rhodothermus marinus endoglucanase Cel12A.
pubmed doi rcsb
source organism Rhodothermus marinus
molecule tags Hydrolase
molecule keywords ENDOGLUCANASE
total genus 62
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2005-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2bwaA00
1QH6A 2B42B 3VHOA 1ENXA 3VZMA 1XNCA 5K9YA 3AKTA 2BVVA 3VHNA 1W2UA 1OLQA 3O7OA 3MF9A 3AKRA 1XYPA 4XPVA 3AMMA 1BK1A 2DCZA 3B5LB 3EXUA 2VULA 3VL9A 1AXKA 1YNAA 2DFBA 1OA2A 1XYOA 1M4WA 1OA3A 1UKRA 2DCKA 1XNBA 2DCJA 2VGDA 4IXLA 3RI9A 1H4HA 1HV0A 2BW8A 1F5JA 3VZLA 3WT3A 3VZNA 4S2HA 2JEMA 3WY6A 1UU4A 4HKLA 1XYNA 2NQYA 1BCXA 2C1FA 3VL8A 3RI8A 3AKSA 4HK8A 1NLRA 3AKPA 3WP5A 1REDA 3VHPA 3VGIA 3VZJA 3VZOA 1H1AA 2F6BA 5K7PA 3WP6A 3AKQA 3WR0A 3AMNA 1HV1A 3B7MA 3AMQA 2VG9A 4HKOA 1T6GC 3WP3A 3WQ0A 4XQDA 3MFAA 1QH7A 1H0BA 4XQ4A 1PVXA 3MFCA 2VUJA 1H8VA 1IGOA 2QZ3A 3WP4A 1KS4A 3AMPA 3M4FA 4S2GA 3VLBB 1BVVA 3WQ7A 1TE1B 5HXVA 4HK9A 4S2DA 4NPRA 4H7MA 1REEA 1OA4A 2BWCA 2BWAA 3AMHA 4S2FA 3HD8B 2D97A 2JENA 1C5HA 3ZSEA 1KS5A 2QZ2A 4HKWA 3WXPA 1C5IA 2B45X 2Z79A 1XNDA 2JICA 2B46X 1H4GA 1UU6A 1REFA 3WQ1A 3VZKA 2D98A 1XNKA 2DFCA 3MF6A 2NLRA 3WX5A 3LB9A 1XXNA 4XQWA 1HIXA 5EJ3A 1UU5A 1OLRA 2DCYA 3LGRA
chains in the Genus database with same CATH superfamily
1Y9QA 2B42B 1OT5A 4N7IA 4LUMA 2E53A 5F32A 3ROUA 3S57A 2FDKA 2JDYA 1R64A 3ETPA 4YG6A 2OQ6A 1OSGA 2XGXA 3VD9A 3K75B 2FMYA 2VCBA 3ALQA 4YARA 1S2BA 4WM7C 4PLMA 2W1QA 2ZEXA 3OD4A 1XYPA 5T52A 4QQOA 5GLVA 2VULA 4MYEA 1SZBA 4P02B 2ZMNA 1IHMA 2VBPA 3D82A 3DKQA 3HR9A 4MZUA 4QHBA 5F3GA 3QACA 1ZZ9A 1AZDA 3MGUA 4CDUC 2SBAA 1ALYA 2D6MA 2WNVB 2W47A 4LLOA 1H6YA 1S2EA 1H4HA 1W9TA 1ULOA 3WW1A 1HRI3 2Z42A 4RS5B 4QPGB 4AAXA 2J1EA 3FUQA 3VZNA 3T0BA 5JOXA 1WD4A 1ZBE3 2R7EB 2X09A 2WZR3 3AL5A 4BK4A 2PHLA 1Q3EA 4XFFA 4L2NA 4YW1A 2NMOA 1WMEA 2R32A 2WRAA 3T2TA 1W6PB 2WA4A 2C9AA 4FXKB 4A2UA 2UYBA 4EE2A 5IVVA 1Y43B 4ZKTB 3N7KA 2VQAA 5C8CB 1CX4A 3HBKA 3U1XA 3USSA 3NW4A 5FXWA 4RGAA 4TWTA 4AI3A 1POV0 5HV0A 5BPXA 1CAWB 2DF7A 1YCIA 3I2FA 3WW2A 5HPOA 3ZIWA 2NM1A 2GMEA 5JSOA 1AHSA 3A22A 1GMMA 4IERA 4OUSA 2G9FA 3HT2A 5FYIA 1AYM1 2FCTA 4HMZA 2DUPA 4XHXA 2ORXA 3RPQA 1WCKA 3E6BA 3MIHA 1HDKA 3VBFB 2D3PA 4D7YA 1BJQA 3RDIA 3UJQA 5C4WC 1F35A 3KVBA 5A3WA 4AI9A 4HLTA 4CEWB 2Y0OA 4A3ZA 3R4SA 3WVJA 3IIAA 3LA3A 4F3JA 1LOEA 3KCXA 4Y5Z0 4FI9A 1B35A 1FOD3 3CQOA 1KQRA 2VM9A 4OI0A 2GMPA 2V4VA 4URTA 4NO4A 4OHVA 1RUNA 5GZEA 2WZR1 4DUWA 1AR61 2WFF1 2DU0A 3SH5A 5K4LA 5DAQA 4NPRA 1SFPA 4JTOA 2WDBA 1REEA 1DYKA 3PVEA 4UYBA 3POSA 3FWEA 2BZDA 4BA6A 5C6CA 4FQZA 4CU7A 4NHLA 2JKXA 5LY1A 2CYFA 4BQ5A 4D6RA 1PO11 3K2OA 5FO9B 2B45X 2XJSA 4XF0A 5CFCA 4XXPA 3ZYIB 3AK0A 2XQXA 2Q8DA 4HVRA 2IVIB 2XR4A 3BALA 1R093 5T5LA 1GICA 5F3EA 1DDLA 2A6YA 4CCOA 1N3OA 1W0PA 2A7AA 2H0VA 3A0NA 3KHCA 1RL3A 4LR4A 2W39A 2YZ4A 5JOZA 3PU8A 1SLIA 2WUHA 4V1PA 4BMEA 5J3UA 4E27A 1FXZA 1MACA 3ZXKA 1GSLA 3AXDA 4MHUA 3ZKYA 3VBSB 4BH9A 1RXGA 4X6QB 1AUYA 3TN92 5FP9A 3U11A 3OYWB 1JU4A 5I8YA 4J25A 5CFDC 3RSJA 2RMU2 4N43B 2KXLA 3EXUA 4CU6A 1A34A 4PLOA 3ZLIA 3KV6A 1GOGA 3SCHA 1JOBA 4RR3B 1YNAA 2TNFA 2WNVA 2CY6A 4IV1B 4BDVB 2QQOA 1NUKA 3J8F1 5SV5A 4MG2A 4JGZA 1PGW2 1QOOA 1G9BA 1BEV3 4W6WA 4YGDA 1QOSA 4WVWA 3OPWA 1AJOA 4JKLA 4CCDA 3I2IA 4MH0E 5JOYA 3KV5A 3VBUA 2FDIA 2P34A 2ADDA 4QHOA 3T2PA 3O1OA 1K12A 4RR3C 4AGGA 2FZ1A 4OYUA 3J8F3 3B93A 3SITA 2WWJA 4FAHA 4ZS2A 3DKWA 3K4AA 1QJZA 2NPIA 2VCMA 1OFSA 3AKSA 5IWFA 2E51A 5C9AA 3N3HA 5A7WA 3MW3A 4PQQA 2PHDA 5AC91 1REDA 5JI7A 5FKBA 4AE2A 3F2ZA 5FJHA 2DURA 1WMFA 1BZWA 4P00B 4CXXA 5C71A 4IV3A 2WQ8A 4OLLA 5F3IA 3Q8EA 4D3WA 4GWIA 1YWKA 3WDUA 1K5MC 4Z07A 3SXWA 2DDUA 1RYYA 1HV1A 3MBWA 4HN0A 4AHXA 4IE7A 4E2GA 1JZ3A 4NJ4A 2ADEA 2ZHLA 4LBLA 2RS51 3CNAA 4DEQA 2XB6C 1RUOA 2VUJA 4COWA 1VBB3 1PVC3 1KDKA 1RMU2 5DZGA 5HCHA 1VR3A 1GV9A 3GM8A 3U37A 5FZOA 3K46A 1D7PM 3AX4A 3L2HA 2ZKNA 3KS7A 1C1LA 3PVNA 4Q5OA 4XAAA 1HXS3 3M4FA 5DAVA 3ACFA 3RZMA 3AP9A 3IDAA 3OEBA 4QB6A 1NOVA 5JSRA 2VY0A 4GA9A 1PO22 3WZ1A 4P9LA 2ZCWA 3R4UA 3MHZA 2WT1A 1MS5A 1PZ8A 1KS5A 4MGZE 1JHNA 1AL0G 4MVTA 1KRIA 3GALA 3IB3A 5CFDB 2VZVA 4WBBA 2GDFA 1PNFA 2WZ8A 2JKBA 1HB3A 3C7GA 3JD71 1G86A 1VBC1 2GP3A 3BU0A 5D21A 3KGZA 5FCCA 4NHKA 2ZZJA 2VAUA 3QD6A 3ZYPA 3VBOC 1O59A 3POWA 3I3MA 2EICA 1YQ8A 5A6ZA 3W5NA 1D4M1 2DUQA 1VMFA 4P9YA 2VC9A 1RUJ3 2YMZA 1W8ZA 4I3GA 3BN6A 3C7EA 2SLIA 3O0VA 5FYYA 5I0SA 4FCAA 3VDDC 3HBZA 3VBRA 3VHOA 5LA1A 1UYPA 1S0CA 1ODMA 2FDJA 2BJSA 2H0BA 1TEIA 2XUMA 3AKRA 4XF9A 4IE4A 3LA7A 1UY3A 3A21A 2EF6A 1ZA7A 4Z2WA 4Q4Y3 2HWC2 3H1YA 1QNYA 1AXKA 2R0HA 2W9XA 4PIYA 4ES9A 1WA6X 4K8FA 2VZUA 4E8DA 2WSVA 5L19A 4Z92B 1ZYBA 1RTVA 1CIWA 1UPSA 4KU7A 1XNAA 5A7QA 1LOFA 5T5OA 3S7IA 1K3IA 5KXEA 4Q4W3 3S6PA 5I91A 1QDOA 3ZM8A 1L3JA 4HVOA 2JG8B 5EYXA 4Q4Y1 3B9IA 1P8JA 1UOBA 3MZHA 3DV8A 5CB7A 3VDDA 2VO5A 3UETA 2ZABA 5KXDA 3CJIA 2WLQA 2JDAA 2R061 4CCKA 5FIXA 4NRPA 5L9BA 3ZR6A 2C9KA 1O4ZA 2BGPA 3SLIA 5J48A 2H6BA 1UYZA 2PAEA 2WJSA 1GYKA 4IEVA 5FZGA 1YYNA 3VV1A 5DAPA 1RC6A 4WVZA 2FBEA 2XXZA 1AYM3 1JYCA 3HT1A 1Y3TA 4TLFA 4V2WA 4COZA 1C8NA 2OZ6A 3UYJA 3ES1A 1R1A2 1EP0A 4QX3A 3AYEA 3WR0A 4CDQA 4OHYA 5FRAA 2IVJA 1GQHA 1WCQA 4Y3OA 2YGMA 1CJPA 3WQ0A 5J36A 1UAIA 4BYYA 1CD3G 2D40A 2TBVA 2ZX4A 3AXEA 4LIUA 2AENA 4N8MA 3WF0A 2XLGA 1VALA 3EBRA 3MEPA 4X8NA 5BXXA 2Q0AA 2WS93 4GJZA 1W8HA 2J7MA 2IUWA 3NKGA 2BOIA 4GMP1 4XYXA 1QHDA 1O4YA 5F5IA 5FYZA 4ZONA 1BKZA 4XFIA 1UMHA 1KD7A 2HWB1 3QCWA 5A1LA 2HWC3 1SFYA 1W0OA 2X05A 2HEYF 5T50A 4J1WA 1FYUA 2W95A 3DF0A 3NMBA 5JIUA 2VU9A 5FZMA 2ZAAA 3SHRA 1K5MA 1DYOA 1HLCA 3AYDA 3WXPA 1S0BA 3PUSA 4H7LA 1DZRA 3I3BA 3U07A 3UGFA 1N3PA 1H4GA 4PF1A 5FMOL 3RFRA 3C3VA 5FZKA 3TWIA 1WLTA 2A6WA 3NRUA 4MXWB 5JXHA 1SEFA 2J1UA 3ME2A 1WW4A 2GNTA 3WF3A 2PYTA 4AFAA 1H8TA 5J7MA 4MGIE 1QKQA 1W2AX 3AP5A 3GYDA 5JZGB 4KQ7A 3NNJA 4LBQD 1O3QA 3VBHA 3CDZB 1YUDA 2ZPXA 3UKTA 2DWRA 3EO6A 4BPZA 1JYIA 4M00A 3E5QA 1JYTA 2RM21 2EVXA 3BODA 2PHUA 4IEZA 4E9KA 1AL22 4JDMA 2YPDA 2GSYA 2DTWA 1MS4A 1LGCA 4RQPC 5CG8A 1ZZ7A 1OLMA 5FYHA 3IN9A 2GMMA 1BK1A 3J7MA 3K3OA 3KV4A 4A45A 4AQSA 3W58A 1FNYA 3KQRA 4EWEA 5FZOB 2YFUA 4LMFA 5FZ6A 3FL7A 1LTEA 2BVBA 3VUOA 1POV3 5G05L 1UKRA 1XNBA 1BEV1 1MS9A 1HV0A 2DCTA 1COV3 2IWGB 5JXGA 3BTYA 1PO21 1S0EA 4FFFA 5I8SA 4GZ9A 2VZOA 1UOJA 4UI9L 4XF3A 4QXCA 4CU9A 2PELA 4RYDA 1U12A 4PI2A 3OGJA 3QLQA 4YNIA 1YIPA 3R4DB 5FLHA 4E4SA 1LENA 1AR93 4BLJA 1ODNA 2X5IC 1NQDA 2VMDA 5FZ9A 2LRPA 2VNGA 2PAKA 1X50A 3VBUB 3HAGA 1A6CA 3VDCA 1DZTA 1EUUA 1IG0A 4P5YA 5K0UB 2OS2A 2XHNA 2E7QA 1SMVA 2R072 2BERA 3AZYA 4J1XA 1Q56A 3J7LA 3LOBA 4D6QA 1OD3A 5FWEA 1IKQA 1DGLA 4AI8A 2VVDA 5FZ8A 1I3HA 2AEZA 1H1AA 1S0GA 3FHAA 5C3RA 5K7PA 2VR4A 3B7MA 4AF9A 3KLSA 5F5QA 3PUAA 3BTAA 5LCWL 1WMXA 2R063 1MZFA 4BLIA 4V2VA 1GU3A 2BEOA 3ABZA 3JB8A 1OD5A 3RMYA 1E57A 2VTXJ 3GZEA 5FBZA 2V5DA 4LXLA 2GALA 3WDWA 3SKVA 3CLPA 1EUTA 3AM2A 1IZ3A 3IPVA 5FZIA 2ZACA 4LBMA 1HXS1 3N36A 4Y4RA 4EQVA 3W5MA 1YFWA 1V9U1 1MEC3 1XU1A 3EQEA 4PQ9A 5IVCA 4TLGA 5I93A 4BQXA 4YGBA 1DG6A 3LDRA 1CONA 4P9WA 1S1AA 1FOD1 4Y33A 3QOPA 3PTRB 1OA4A 1TME2 2I2SA 3J4UH 4QPYA 5JPMB 4AEJA 5H9RA 1C8M1 2JE9A 1LGNA 4OZXA 5F1RA 1PGW1 2YU2A 1X9TA 3MYXA 3T2QA 3OUHA 4UT5A 1VAVA 4M3CA 4XJ9A 1KXGA 2WO2A 2VQUA 1AF9A 1K5JA 3B01A 1UW8A 2XLAA 2K9ZA 4Q29A 5DAXA 1W6NB 2R041 5IYYA 2LTNA 4OUEA 3SCFA 1MEC2 5LBFA 2LALA 1QJX2 3ITQA 4W50A 3FLPA 1JYWA 3MLJA 1UO9A 1D4M3 4BWOA 1OC1A 1O3RA 3ZPOA 1N3QA 1GP4A 3LE0A 4QXHA 5FY1A 5FTTC 4CCEA 3LCPA 5I0RA 5LA0A 1PMJX 1GQGA 2E31A 2RS11 4KU8A 4XILA 2P6HA 1FPN1 3FBYA 4YVWA 3H50A 4BM8A 1W2UA 3A0KA 3JU9A 4AVVA 3BCWA 1UCXA 4COUA 2D3RA 5E88A 4CDUA 3GBGA 1G9DA 4YW2A 3B00A 2K2SA 2WNVC 1LODA 3OD0A 2BTVC 4ZZ8A 4P9XA 2TUNA 1QJFA 4DXZA 3P1IA 4LUKA 3ZYRA 1VAMA 1WBFA 4QX7A 1RGSA 2TEPA 1NLSA 4Q0UA 4J6GA 2VMFA 2WABA 3I3DA 2R1DA 4GWJA 4XFCA 4S2HA 2QQLA 3OSDA 2JEMA 4EYUA 2VXRA 1RINA 4M3CE 2RDNA 2ZHNA 1JZ2A 3PVBB 1QNWA 1QEXA 3KSCA 4EN6B 4CEWC 2OXBA 4XZUG 1W06A 4HVQA 3OPZA 4CDWB 5FYMA 3IWZA 2A5ZA 1ZX5A 4HK8A 1VE0A 4RD7A 2LROA 1VAKA 3H7YA 4QKBA 2XBO3 3RNSA 3GHNA 2DVBA 3RQ0A 4AFBA 3B9CA 3IAQA 4FT8A 4AI1A 3N7MA 2VQ0A 2O0OA 4YLZA 4YM0A 5L9VA 3WSOA 4A42A 4KWLA 5KHHA 4XUTA 5FXZA 5FZEA 2A6XA 1YEWA 2GZWA 5F3CA 1AXYA 3RMXA 5A3MA 1LCLA 1NCRC 2CWMA 4N43A 4EV0A 5JCTA 5A33B 4A6SA 4PDWA 4LOTA 4Y22A 3WP3A 1DQ1A 1CVNA 4FOVA 1BMV1 2QCSB 1GNYA 2QBXA 5J1XA 1N47A 2VJXA 2I74A 1TMF3 1RUF2 1AX0A 5JR7B 4XQ4A 1VP6A 2KA3A 4NAOA 1NA1B 1XSQA 2RG4A 4Q4X3 3ACLA 5A80A 2ET1A 4UFJA 4DOUA 5JI9A 3U0ZA 1NZCA 3POYA 3B3QE 5DABA 1WWYA 4CP2A 2QZ3A 4WVMA 1PK6A 2ES3A 4OFGA 3BU7A 4FP2A 2OW4A 3WUCA 2IXJA 1OPMA 1VMJA 1LOCA 3H3ZA 4L92A 4XTPA 1DQ5A 2A3YA 3SEEA 1WW5A 3KF3A 4INDA 1WCUA 1DP0A 4FPKA 3DXTA 3LZZA 2J22A 1PO23 4A3XA 2J1VA 1DFQA 5EV7A 2JJ6A 1W05A 3ZYFA 1H2KA 2KR2A 4GMP3 3PU3A 5LY2A 1VLNA 3OY8B 1SBDA 4DXRA 4O61A 5IUQA 4BIOA 1W8OA 4FVVA 2WL1A 1W8WA 2EA7A 1A8DA 3RG0A 5BNPC 5C33A 1RUJ1 2YBPA 5FZ4A 2N7GA 4HPKA 4DB5A 5FLJA 5FUPA 4WZCA 1FNZA 1J58A 4BISA 3WX5A 5F9TA 5FOJB 1JW6A 3ATGA 3VB9A 5JSPA 2RS13 5IVYA 2W46A 3GCXA 3J7HA 2VZSA 1TVGA 4IE0A 4RS5C 2ZOEB 5C3QA 2YBKA 1UZVA 1VBC3 5H9PA 1J3PA 1YIFA 3PIGA 5GLZA 1NAEA 3WHUA 4BZ4A 3PUQA 1QH6A 4LBQA 5DAWA 1DU3D 2A3WA 4LEJA 1KFXL 1UIJA 3T1MA 4AQ6A 4B4QA 4BJ0A 5FP8A 2BOJA 2GC1A 2ARAA 1MZEA 1H2LA 2Y33A 4I0BA 5ISLA 2UU8A 4B1MA 1PMHX 4LKDA 1ND2A 1X7NA 3VBFA 5LZ6A 3ZXAC 4A41A 1SHWB 1CIYA 5FZDA 4OI1A 4FXGB 3RRDA 2GH8A 2B9VA 3ZN5A 1C28A 3J26N 3N9OA 4XVHA 2JG9C 5DQ0A 2D6PA 1ND3B 5LB6A 1UZYA 1VBE2 3FJSA 1OA2A 3H8XA 1FV3A 1POV1 2ZX1A 4FPGA 4JKMA 1RUH2 3VKFC 1MQTA 2WFF3 4AQ2A 4K8RB 2P17A 2WYSA 4C0BA 1SG3A 4TSVA 4WM7A 3N9PA 3VZLA 3EYPA 4N9HA 1OVPA 4QDSA 3RZJA 2VPVA 2WT0A 5J09A 4LO7A 3CBNA 1DIWA 4LO8A 1WZXA 5E8AA 4ZS3A 4K3UA 4YZ3A 3DN7A 1OF4A 1WLWA 2R49A 1L7QA 4Y20B 3VBRC 1Y9MA 4I2OA 1NQJA 2GNBA 4A7ZA 3NWKA 5CKQA 1XJAA 3E97A 4NPMA 4Q26A 4D6SA 2MEV1 4OMCA 2Y60A 4K1YA 1JYXA 5A3LA 1XRUA 4UFHA 1CAUA 5CEHA 2BNNA 2D7FA 3Q9OA 3AVSA 2C4XA 1J59A 3IKWA 4XACA 3KZ4C 1POQA 3FMGA 1Q8SA 3QBQA 3VBRB 4FP3A 2YPJA 4CE8A 4Z82A 1F8VA 3O1RA 2ARBA 3DGTA 5FPXA 3OJBA 4PIXA 4YW4A 3MDPA 4FQ4A 3T2OA 3VKNA 3ZSJA 3BIWE 4EN7B 1T2XA 4ZY9A 2EIDA 4LULA 4QU2A 4LOSA 2XBO2 1T6GC 1RJ7A 1KDMA 3MFAA 4LBOA 4KNCA 5A7OA 1ULFA 1ZRIA 1EAH3 4AVCA 5A1AA 4AW7A 1FX5A 5DMYA 2QUOA 1OKQA 5FV3A 3TBDA 4YG3A 3WNMA 4AVSA 5FK7A 1PM4A 2JG9B 1MEC1 2PHFA 2Y6FA 1CAVB 2WFPA 3WF4A 3UNPA 3NJVA 4KG8A 1HB1A 1XE7A 2VZPA 4IV1A 1UPIA 1RUI3 3OGRA 5HCFA 3KMHA 2UY9A 1DLCA 3JB4C 1URXA 3ACGA 1UIKA 2Q8CA 4CDQC 1H30A 3POIA 1F4HA 3H3UA 5CADA 1AR73 1OLME 4YW5A 3SH3A 3D3AA 1M06G 2HWF1 3LSDA 3WNPA 1TME1 5FAXA 4D69A 1OURA 2ZGSA 4XDQA 1QMJA 4CDWA 3HOBA 1KITA 4IV3C 4ASMB 3K4DA 4DO0A 1REFA 3BTXA 3WQ1A 3VZKA 5L7OB 1CR7A 4NPLA 1JYNA 4FPHA 1V9U2 3W21A 3LB9A 4XQWA 5HCBA 1HXS2 2HWF2 1LULA 1H1MA 2VH9A 4COYA 2WNEA 4IGPA 4M4PA 3LEGA 5LATA 4XDOA 2VZ1A 5EJ3A 4LBQB 4XFBA 1EAH2 2WNUA 4D8MA 3JQWA 1UNBA 4N90A 2WS92 4QKNA 5FR3A 1WLCA 1QJX3 1S0DA 1ZVFA 1LHUA 1W9YA 4OI2A 5A33A 1G9AA 3I2JA 3AKTA 4WM8A 4FFGA 3KF5A 1WW6A 3NVCA 1UOFA 4AK3A 4YGEA 3TEWA 3TN93 4LIVA 3V0AA 1GWKA 3N9QA 3T4VA 4MGSA 3OEAA 4OHWA 1OVSA 4QPGA 4YZ1A 3HN3A 5CKMA 5KHGA 4Q0QA 4Y4YA 3I2GA 2WNOA 2UURA 2ZX3A 3M8LA 1BQPA 2AYHA 1BYHA 3LQCA 3E5XA 1CQ9A 1WGPA 1M4WA 1ASJ3 4P08A 3V0BB 2XH6A 1ZZ6A 1I5PA 1ZZCA 1NA1C 3GF6A 3ZFFC 3P3NA 2X10A 1LU2A 1K5MB 1TZOA 2ENRA 1SLBA 4XOGA 3JBG1 1IS5A 4CYDA 5FPLA 4EN8B 2ZX0A 2D3SA 1RB8G 2QQVA 1J83A 3B94A 3PMSA 1GZTA 2Y6JA 5CA6A 1OXCA 4JQTA 1UU4A 5D8AC 3RJ2X 1JBCA 3UGHA 1IG3A 1OF3A 3I59A 2XJRA 5JVVA 1QJU1 2B4KA 5BNPB 2ZGPA 5KXCA 3KV9A 2PN5A 2EXKA 4IUGA 2WN3A 5GJ6A 1E5SA 3N4MA 2B5HA 1HRV2 1QJY3 4IE6A 3HNMA 5BNOC 5IFTA 2JDHA 3WP5A 2WINB 1UYYA 3ZXFA 3WDXA 1SLLA 5FKCA 4QDRA 4M3CF 3VGIA 4ORFA 1J1LA 3OG2A 5T54A 4RHV2 1S0JA 3VBHC 4YRDA 1K42A 3WF2A 1FATA 5M0TA 2QE3A 5FZLA 2DTYA 3AKQA 2PHWA 1RUC2 1W6QB 2Y6KA 2I07B 3AL6A 3FZ3A 5FUNA 1DF0A 2UYAA 4O7XA 3ZKUA 2ZKLA 1HJGA 3L2YA 4AZZA 4SLIA 2PQSA 4RSUA 4XQDA 4FAGA 2AACA 1RUH1 1PX3A 1WCDJ 1ZBE1 2G9ZA 1KFUL 4NIIA 1VBE1 1H0BA 3HPNA 5B2GB 1ZZBA 2JDPA 3H8OA 3T30A 2W3JA 5FO8B 5IK4A 1MZ5A 2R0FA 3D6EA 4LT5A 5BNOA 2QJVA 3AMPA 3GJAA 3KM5A 3TB0A 3LEKA 2IFRA 4YGCA 2WZPP 2PXJA 1AR72 4HT1T 4X8PA 5FY8A 4ZXEA 1UL9A 2Y8KA 4B8EA 1PGL1 1T6BX 2BNMA 4KG0A 4S2FA 4HXCA 5D8AA 4Y20A 1V9U3 1ZZ8A 3DL3A 4NWWA 4UW3A 2QDRA 3U75A 3D5OA 1CESA 1V0AA 2CNAA 2CDOA 1W6PA 4XABA 3RZHA 3O0WA 2IC1A 3GBFA 4ZU4A 3S5AA 2YB7A 2RS32 2GU9A 1RUJ2 1WA4A 5APAA 3UL2A 2C5DA 2JXAA 2D44A 5F2WA 2QQMA 3C7FA 4QM9A 1V00A 2A3XA 2VNRA 4K9SA 4ARXA 1JZ4A 2NP0A 1MS0A 3ACIA 4XMAA 1LHNA 4IEOA 1UU5A 2Q1ZB 1WBLA 1V6KA 1LEDA 1R083 3LD8A 3OOXA 4RR3A 2ZGMA 3BYWA 2V5YA 4ASLA 1FI2A 4QAWA 3MI8A 3LDKA 4NHXA 2HJIA 3M3EA 4NUBA 5HI0A 4DS0A 3T09A 5IAVA 1GQPA 1E5RA 4U2AA 2FCVA 4FPOB 3PJQA 2J42A 2OPKA 3KCYA 4XF1A 4B1LA 1I5ZA 1YXWA 2WYFA 4JRAA 5SV8A 1JXNA 3TRSB 3MICA 4LA2A 1W99A 5FZ3A 5F5CA 4CCMA 1RIRA 1PO13 2NN8A 1JN2P 3CJXA 4RGGA 1RUG2 4ZZ5A 3ZSMA 2FDFA 1BMV2 4C90A 5ACA3 1AR82 4Y5SA 3MW2A 5A7NA 4R9AA 4W6XA 3DEMA 3AJZA 5L36A 1GZ9A 4H55A 4BQ2A 3RS6A 2QQUA 3I59B 5LK5A 5FQ0A 3ELNA 3WY6A 2D5FA 5C3OA 3VDBA 4UWDA 4AGRA 4DMIA 1IS6A 2UY8A 5JUVA 1W28A 1ZREA 4N53A 4IV3B 3FLRA 3S0MA 1C57A 3BUCA 1VBA1 4ITCA 1UY2A 4AAPA 2ZGKA 3ZXJA 4A4AA 3ZOIA 1V70A 2ZGUA 3GBWA 4JGYB 4CP1A 4YW3A 4Z2AA 2R16A 4MADA 2GNMA 1U5XA 1H2MA 1Z78A 1X9PA 2QQNA 1O91A 2VCCA 3I2HA 1W8UA 4Q2FA 2PHXA 4R9BA 4YFZA 1Q8PA 2EXJA 2F6BA 3D4KA 1YFUA 1NCQC 3HNYM 4JTNA 1UXXX 1VB2A 3CO2A 3UV9A 5JZGA 3PMEA 5IVEA 4CUBA 4C8DA 3GZAA 3FFQA 3A7QA 1GP5A 3POJA 4CP0A 4XAEA 5AVAA 2ET7A 1ZBA1 1UY0A 4CEWA 1RVF3 4RN5A 4K1ZA 2YC0A 5FZ1A 1VRH3 3HVDA 4NIDA 4FTSA 1H9WA 5ACA1 1AR63 2JE7A 4NIAA 2PFWA 1KS4A 3ST7A 3I3EA 2PLV3 1HN0A 1O8SA 1S2KA 1VB4A 5LWBA 1QXPA 1FMD1 1VBC2 2RS12 3HJRA 4QXBA 3JD72 2CGNA 5D8AB 4E4HA 4NWVA 1PHMA 2BWCA 2HWB3 2WO1A 1R092 2BWAA 1XOYA 5GKAC 3HD8B 2IXLA 1GNZA 1O4TA 5CISA 2VCAA 4LBNA 5K0UC 2QQJA 2D93A 1PZ7A 3GNEA 2WBKA 4OMDA 1GZWA 1VIWB 2WAOA 3OB8A 4QX1A 4B4PA 5IVBA 2RDQA 5FZBA 4AEKA 2JWPA 1RUI2 1XNDA 2Y0IA 5JPNB 2R042 1U5ZA 1UU6A 2QQIA 4OVEA 3MF6A 5CG9A 1JH5A 2A6VA 2JB8A 2JG8C 1ULPA 5DG2A 2O8QA 4IETA 2XG3A 3ACHA 1XPWA 5DDJ2 2FDHA 2W1WA 4Y22B 1RMU1 1UWWA 3ENRA 1OLRA 5KHIA 2VUAA 4GB32 4RA0A 5DDJ3 4YVSB 2K0GA 4AYUA 3LGRA 3VN4A 3O1MA 5BUVA 1W6QA 1UD1A 1W8FA 3USUB 1FOD2 3ZFEA 1AYN1 4LITA 2ZA9A 4K40A 4NRMA 4XCAA 5T5JA 5EZWA 1XE8A 5LASA 2HKXA 4P14A 5FO7B 5BNNA 1RUF3 2ZS6B 3ON7A 2GP5A 2R043 4WVMB 3THDA 2RR11 3MO4A 2VQTA 3V65A 5FZ7A 4YM1A 4MOAA 5KWRA 3AZZA 3FX3A 4RQPB 1DGRA 2XMLA 4QHZA 1X33A 4EROA 3KHBA 3VDDB 4CTEA 3NNMA 1GR3A 1XYOA 1WKYA 2P6CA 4MV2A 2DCKA 1BHGA 2EAKA 2XVGA 4UAPA 1CZTA 3RI9A 5AC92 5C70A 4XBNA 1J1TA 1VJ2A 2BW8A 3BOPA 4PHZA 4JGZB 3E6CC 4LHNA 4YZ2A 2G9GA 1TNFA 3UKNA 5HCAA 4IE5A 1DQ4A 2RR12 4N53B 1B35C 5DUUA 3NV2A 3ZYHA 1DBNA 4CEYC 3DYPA 2NQYA 2P3IA 2BNOA 4FTEA 4QQLA 2DBNA 4Y1VA 5EHDA 3WOGA 3LPFA 3WINE 4K6BA 2XDVA 2P2KA 3POBA 2HH9A 2VTXA 1OH4A 2F4LA 4MHRA 4FO9A 4IGOA 2E9QA 4UF0B 5GLWA 1CN1A 1AXZA 3T4HB 3RVHA 2D6NA 5JMCA 2VE1A 1BVP1 4LBKA 4YM2A 3TNQA 4Y1YA 4COVA 5L7OC 3AMQA 3TN91 4F8AA 1BEV2 2D5HA 3H8UA 3VKLA 3NAPB 4YW7A 1U5YA 5DZFA 2JIGA 1Z7S1 3M1HA 3PIJA 4HN1A 5F37A 1R091 3MFCA 5FREA 4URAA 5A3PA 1SCSA 4E4DX 2P37A 4FPLA 2ERFA 1H8VA 1ASJ1 3NL1A 5B4XA 4NRQA 2E7TA 4LKEA 3K51A 1GOFA 4AHWA 4LHSA 5T55A 1K45A 3NJXA 1AVBA 3TYJA 5IAXA 4S2DA 3M2MA 1SDDB 4O9GA 2EAAA 5ACA2 1AL21 5EJ1B 5F8PA 1SBEA 5C5UA 2RM22 1PO12 4I09A 4LTAA 2JG8A 1ZBA2 3ILRA 4UBHA 5D2AA 2OUHA 2E6VA 2VOTA 4KWKA 4XJ8A 5FYTA 3OBRA 5A1FA 4ASKA 2A73B 5EQUA 2RM23 4GH4B 1JHJA 2RDRA 5EJZB 5FYCA 1CX1A 4GJYA 4JGYC 4ZPIA 3ZN6B 2DFCA 2RDSA 3AYCA 5C4WA 1LAJA 3PLQA 4XHBA 4NAMA 1SLCA 2JE8A 5CZKA 4CCNA 2GNDA 2VZ3A 3O1PA 1SLTA 2P5BA 5C5TA 3NNLA 2ZEYA 2VMCA 4H3WA 3QH7A 1NZIA 3ZFEC 4YVWC 4IDZA 3WNNA 2OPWA 4QQHA 4DEVA 5LEJA 2J1RA 1OLQA 5DUXA 2ZGNA 4HSJA 5FZFA 2W94A 2X5IA 2CSGA 4LA3A 2F17A 2O1QA 4GAZA 1IPSA 1AYM2 3CZJA 1AR81 1BLZA 1QXJA 2VD7A 3GJBA 2WKKA 3PL0A 4IEUA 1RUG1 4BXFA 1CZVA 3E5UA 4B7EA 3GHMA 3HNBM 1JZ8A 4LLFA 5JR2A 5FMOS 2YC2A 4FFIA 1FMD3 1PK6B 2HWE3 1R1A1 1SQ4A 3DYMA 5FMBA 3ZIXA 4BB3A 3UGGA 4E8CA 4GMP0 1LB2A 2YUEA 3OCPA 4JZRA 4Y5TA 4ONUA 3PUIA 4XW3A 1S0IA 5FP3A 1UQXA 1CAXA 3RYPA 2BYVE 2W0XA 2VW0A 3PUHA 4XE9A 2OVUA 1IS4A 3HEIA 5T3NA 2BFUL 1NLRA 2IXCA 1PK6C 3AKPA 5EP9A 3S7EA 4EZ4A 4PJYA 3OY8A 3ZXGA 1OHFA 1R1ZA 2WN2A 4CZSA 4NR1A 3DYOA 3RJRA 1ENQA 2XVLA 4YG0A 4WM8B 4JX0A 4HSLA 3U4SA 4Q4Y2 4LK7A 1AX1A 1LHWA 2AC1A 1LOAA 2RS31 2YDEA 5K8SA 2BGOA 3USUA 1W6MA 1R082 3CU7A 4CUCA 4N43C 2JDMA 4GWMA 3PVOA 4HONA 4H2AA 1QOTA 4XUNA 4BHPA 4QMAA 2WQZC 5F5AA 4C1WA 2B9UA 2CAUA 4Q0VA 2RJ2A 2A71A 2W92A 3PHMA 1EYBA 2E32A 2WQ4A 1DHKB 1YI7A 3OGGA 4L8QA 1XE0A 3C2UA 4MXVA 4UFKA 2BU9A 4NMIA 1UZZA 1SBFA 2PQQA 3JXSA 1PGL2 4AFDA 1EV11 3I2DA 3HWJA 4P9GA 5A3TA 1AR71 2WSUA 2C0ZA 1OPOA 1US2A 4IQPA 1QJU3 4JKKA 4D7SA 5C3PA 1MS8A 4K21A 2HEVF 4KL1A 5ERLA 5J37A 4OQ8A 4GXLA 5D1IA 4UBGA 1MR5A 3SISA 3I2KA 2ZXQA 4OHXA 2XVKA 2FZ2A 1L7RA 1MQTB 1KJRA 4AWDA 2BBVA 2LW8A 1RVF1 4FSJA 3OF1A 3N7JA 2ORZA 1NXMA 4GH4A 1D4M2 2BV4A 2VUCA 2WO7A 4LQRA 2PLV1 4QPIA 5KR7A 4HKWA 1VBD2 2XJQA 4LJHA 1HQNA 2CU5A 2JICA 1AX2A 1XNTA 2B46X 3CL1A 4FFHA 4QPIC 4QGLA 4TYSA 3H0OA 4BQYA 4IW3A 1HQWA 1V6OA 1ZRRA 4F83A 1VRH1 1X8MA 4NN0A 3VD7A 2V4AA 1ZBA3 4RHV1 5JXIA 2HBTA 3RZGA 2HWD1 1XSRA 4QM8A 4W4ZA 1QJY1 4LO6B 4BMBA 4CP9A 4YPJA 1H8TB 2RHPA 2X29A 4G9SB 1HRV1 2WA3A 3WDYA 3HN1A 4H14A 4QWNA 4WM8C 3ZO0B 1YQ2A 3DPRA 2ZEWA 1TNRA 5F6KA 2BVVA 2V09A 1A8MA 1C1FA 1OOPA 1QJU2 3C7OA 4RHV3 4Y1UA 2JDZA 4CXWA 2WNUC 3S5QA 1YJLA 2WO3A 5FPAA 3T1LA 1OQEA 2DCZA 2GC0A 4D7TA 5L73A 3VL9A 4O65A 1COV1 1ZRFA 3NV4A 3VBSC 5GZCA 3JBG2 4QB2A 3ZDVA 2UWAA 1W03A 4TTGA 3NAPC 3PTYA 2RS52 2BP6A 3V64A 5E16A 2GAUA 3VD4A 1TME3 3WG4A 1PGSA 4MGQA 4IXLA 5C8CC 1QU0A 4CDWC 2PMWB 3WT3A 3ZFGA 4LK6A 5A6XA 5DN2A 3NO8A 4MUVA 4CUAA 1DGWX 4R4XA 4DNYA 4EZHA 1TMF1 5FPBA 3EB7A 4XCBA 1NT0A 5A7PA 5FYBA 2VNOA 4HL0A 3UT0A 2ZAHA 1CAVA 1NE4A 5C9AB 1UMZA 4XFHA 1H6XA 2GH2A 1YQ5A 2C1FA 3IZOA 1ENSA 2CV6A 2PHTA 2WS91 2C24A 4L99A 1Q5OA 2YHJA 1Y9GA 1YO8A 2E7AA 4CUGA 1HB4A 2E26A 2VXJA 1EAH1 4IEYA 2EXHA 5C4WB 2CGPA 2IXIA 3VHRA 1JOPA 1SDWA 1F9KA 3N35A 1WW7A 1ULDA 5CKNA 1HKDA 1VPHA 3ZFGC 2VMHA 2EIEA 4Y1XA 2BQPA 4HBNA 1UXZA 3VZJA 5FWJA 5C8CA 3WV6A 4PLNA 3ZYGA 4LNVA 1FT9A 3AFKA 3IDCB 2R1BA 2D43A 4R9DA 5A70A 2R073 3HMYA 3M70A 4YWAA 4GQ7A 3OPTA 3VBSA 2ZMKA 4CDQB 3OYWA 4NIHA 4X6RB 3DUIA 4XIOA 3I3QA 1V6MA 2AZ5A 2NYYA 1LECA 2WC2A 5ANNA 5IFPA 1RHI3 3UJOA 1ACCA 1QQP1 4QQPA 1ZRCA 4FPFA 1ULGA 4PF5A 3ZSKA 3RYKA 4OUMA 5LEKA 4AL9A 2E63A 3ILNA 3LOIA 2Q8OA 3AZVA 3G6JB 1SACA 4M4RA 4Q27A 2X8KA 3CMGA 3CKHA 5LK7B 2VOKA 2EIBA 1O3TA 3NV3A 4B29A 2QKDA 3ES4A 4R9CA 4C0HA 5A3OA 3SQOA 1VBE3 1VMHA 4QX2A 2AH2A 4MGKE 3SC7X 1RHI2 3Q8AA 1IKPA 5FXVA 4JGYA 3OBZA 5FBJA 2RE9A 4N9IA 2WLPA 1QF3A 4CU8A 1WCSA 4I0AA 1NLQA 3AVRA 1GWLA 1PVC2 4NVPA 3O1SA 4BIFA 1UX7A 4KGQA 3UK9A 5IK7A 1W6NA 2ZHKA 2VNVA 1JZ5A 2YV8A 3RZZA 4UW5A 3PNAA 4QPGC 2HEWF 4AG4A 4XMIA 4META 3AP6A 5E6HA 1GP6A 2FCUA 1RUD1 4KWUA 5H9SA 1H2NA 1LRHA 1HRV3 1QJY2 1XNCA 4NROA 4W65A 3VZMA 5CAZA 2CGOA 3GZTB 1ONAA 2FD8A 1OBNA 1AR62 2ZGRA 1MS3A 3WNLA 5EXOA 4GKYA 3X29B 1VRH2 4EWDA 1Y7BA 3H8RA 4XPVA 3B5LB 2VMEA 1PM7A 5IT6A 2UWBA 2Y64A 1KJLA 4ZHNA 1LOBA 1QY4A 2PLV2 4L11A 3VBOB 1N1TA 3ZFGB 4LHKA 3MV01 4AVBA 4QX5A 5LA9A 4YW6A 4I30A 3DECA 3ZYJB 3JBG3 2ZGQA 3MW4A 3FUOA 2VZRA 3J9SA 1N1YA 2JECA 4HZFA 4Q4X2 1EV12 2BRTA 1SFNA 1G9CA 4IEXA 4LPLA 1GFF2 1EV13 1Z7S3 4BQ3A 5LW9A 1CPNA 3RGBA 3R05A 3AZXA 4TXWA 1GOHA 2LM3A 1FPN3 3VHPA 2W68A 4FBFA 1I6XA 4UW6A 3H7JA 4XUQA 4QDQA 5FY0A 3WG2A 1GZCA 3ZFFA 1R081 5FY4A 5BNNB 1ZRDA 4KMQA 2XJTA 5FOBB 4XFGA 1AR91 5FUIA 2D6OX 2HYXA 2BUKA 1C3HA 5IVFA 3O1TA 2ATFA 2JG9A 1CJDA 4Q4V3 3AP7A 4MLOA 2MNGA 1XC6A 4PDWB 1KEXA 5CU1A 3M3IA 3H9AA 5A32A 5ABJB 1IPJA 3MLKA 1V6NA 1TG7A 3MLLA 2DYCA 4QD2A 5BYNA 5LA2A 4YM3A 4JV4A 1W6MB 3UESA 1AL23 1YQ6A 3MIEA 1IGOA 1OUXA 4UW4A 5BNQA 5KBFA 1IPKA 4DRRA 1OKOA 3WQ7A 2IFWA 1LR5A 3HQRA 1PIV1 1DLLA 4UFIA 1H9PA 4UFMA 1ST8A 3ASIA 3KT4A 4HETA 2XJPA 3D8CA 2BFUS 3WCRA 1RUF1 1YHFA 1BBT1 1Y4WA 2D97A 4A44A 4CCLA 2VBDA 5F7UA 2DVFA 1W9FA 3BOWA 2DVDA 1UX6A 2XLFA 1LOFC 2QZ2A 2XJVA 1LU1A 4HG6B 3ZR5A 5HXMA 1LHOA 5FMCA 2VZTA 3E1F1 4AI2A 3W9AA 4GKXA 4JDNA 2D98A 5F39A 2HYKA 3HIFA 1OQDA 1XXNA 4JDOA 1NY72 2XWBB 2ETEA 1F15A 5CFDA 4GB33 4DXSA 3O5SA 1FAYA 5G04L 5CVRA 2G1MA 5IK5A 3NNGA 2V72A 2CDPA 1RUC3 3K77A 5GZFA 2P1BA 3JD73 2A75A 1W39A 5IATA 3JQXA 1LEMA 4CEYB 2FDGA 2Q1MA 3V56A 1O3SA 3MF9A 1G6NA 4XF4A 1W2OA 4G4FA 4CP9B 3CIHA 4PT6A 2JDUA 3ECQA 3O1VA 4WV8A 2A70A 3VBOA 4F7ZA 5L7OA 1LHVA 1NCRA 3ILFA 1N1SA 3OUIA 1Q8VA 2MPFA 1ND3A 2VGDA 1YFXA 4ATFA 3AJYA 1MS1A 2Z4FA 1F5JA 3I54A 4GD4A 3LDBA 4XIKA 1U0AA 3MUZ1 3DCQA 2QFEA 2DVAA 2BPA2 1NYWA 1XQNA 3ZX7A 5FPZA 4AEMA 4HKLA 1YFYA 1F31A 1UF2C 2W08A 2GC3A 3CHXA 3ZXDA 2DU1A 3APBA 1ASJ2 2KM2A 1FPN2 4DXTA 1LESA 2W2IA 1UN1A 4GULA 2HBUA 2OX0A 2VOWA 4PIZA 3R6SA 3WF1A 1HQLA 1GLHA 2YYOA 2JDKA 2G4IA 3OGSA 1Z7S2 4WVVA 3RWNA 1GZWB 1I9RA 2QQKA 1ULEA 3H1MA 3KCCA 2ZBJA 3A4UA 3KGLA 3LF7A 4KH9A 4OQ9A 3VD3A 2D6LX 4L97A 2QTWB 5FZ0A 4HOOA 3ZFFB 2W5FA 1ZA4A 2CL2A 1QJX1 3D0JA 1HJFA 3U4XA 3W20A 1SPPB 2W52A 4Q4V1 4BOWA 1ULCA 2AUYA 1HRI2 3U14A 4PBOA 3GGLA 2CHHA 2WNUB 2Y26A 2XQRA 4B4RA 4PDWC 4MSVA 3TAYA 2C26A 3WQBA 2P4EA 2P3JA 1LOGA 3R0RA 5J98B 3HQUA 5BNOB 4AXOA 4XFAA 4AI0A 2OUJA 4RFT0 2YY1A 4AFMA 1C8M2 1WMDA 3CF6E 1ND2C 4Q4W1 1MVEA 2B39A 2YU1A 1QH7A 3INAA 2XL7A 4AGVA 1CZSA 2OKXA 5EPAA 4OI4A 3LIHA 2H6CA 3POGA 1BVVA 4AFCA 3EMRA 5HXVA 3V0BA 2YXSA 2DV9A 3KWVA 1SCRA 3U10A 3KQ4B 4IL7A 1AR83 1ND3C 3IMMA 3AYAA 4H7MA 5FZAA 3SH4A 1QWRA 1W0NA 2NMNA 3TEXA 4FPYA 2RJLA 1RUE1 2C6SA 4TN7A 3O12A 2Q4SA 2JENA 4XEZA 2YC4A 1NCQA 4BU2A 5JZGC 4I01A 2GN3A 2Z5WA 4XXAA 4YZ5A 3RZKA 1YI9A 3IDEA 3SEPA 2Y6GA 4DY5A 1JZ6A 3RWKX 1EPWA 2BBAA 3TOJA 2YGLA 2A1XA 3FN9A 2WWSA 3P6BA 2ID4A 2D6KA 4UOJA 3WLUA 1X82A 5K0UA 4AOCA 3N9LA 4AQTA 1UY4A 3N7LA 5FYSA 2R071 5FK8A 4EN9B 4QQ2A 3PDQA 1AYN2 1RXFA 2AR6A 3NV1A 5I0TA 3MPPG 2RJKA 1HN1A 1AYN3 2PAMA 4YVWB 4NHYA 5KC5A 4R52A 3THPA 4GB31 3WUDA 1RUD3 2QQWA 4Q1RA 4CEYA 4CSWA 1GUIA 2Y38A 5DDJ1 1DQ0A 4UF0A 5LBCA 1VBB2 2XKOA 4QGNA 4BQWA 4BCUA 1XB9A 2J1AA 2ZGLA 5DUVA 1JMUB 3O7OA 3IDBB 5FZHA 4CDUB 5A32B 5ABJA 4BQ4A 3TEZA 1O6UA 1HRI1 1QGLA 1RUI1 4Q4V2 4JRLA 4QPWA 4FTBA 5A3UA 1OQ1A 1DQ2A 3LPGA 2VL4A 1YQCA 2RVAA 3MIDA 1MZ6A 3NAPA 4C91A 1C8M3 3MPBA 3SCGA 1D4VB 5IHRA 5A6QA 2QNKA 4Q1PA 5DPNA 1J84A 2EXIA 3EJKA 2RS53 1CWPA 1FMD2 1G8WA 1H1IA 1N1VA 2XUEA 3MV11 4C1XA 2K46A 3DPRC 1V6LA 2YG0A 2P3KA 1IS3A 4CCJA 1UZWA 3IT8A 1W3VA 4N53C 3RI8A 3Q8BA 2VZQA 3NJZA 2ZZQA 3NSTA 4JC1A 1JOJA 4PI0A 3RYRA 5KXBA 4KWJA 4XETA 3VKMA 4A7YA 3IBMA 3SMHA 1SPPA 4FPEA 4QU1A 1W8TA 3LFIA 4Y26A 5FLIA 3DPRB 2E33A 4AEDB 1JS9A 2P3YA 2VOVA 4DFSA 5I0UA 5JAXA 3ZN6A 5KHJA 4XJAA 3FE5A 1ZM1A 5CYYA 2RV9A 4Q0PA 2Q30A 3M3QA 5BV6A 1W3XA 4ET7A 2XWJB 2G19A 2ZEZA 3AMNA 2XJUA 1W6OA 3ZYBA 4EN0A 2JX9A 4IEWA 3S30A 3FHIB 3POFA 2VG9A 2OYZA 1W90A 4Q8KA 1Q8QA 4KBBA 1GNHA 2CWSA 2Q5TA 4DINB 5GLTA 2QQPA 1VBD3 2IZWA 4NHMA 3ZSLA 5JOWA 5A7SA 2HWE1 3GDBA 1CGPA 5LRSA 4NOTA 3Q8CA 1VBA2 2A6ZA 3N9MA 4ARYA 5ANQA 3HQXA 3LEIA 1MPXA 2HWB2 1RUG3 1NY71 3WP4A 4RGKA 4CA9A 4S2GA 5LBBA 2BDRA 2X5IB 3G7DA 5FPVA 2CAVA 1RUE3 4K7JA 4HK9A 2Z2SB 4AVTA 1QQP3 3A23A 3T08A 3BKZA 4DY3A 2WZEA 1OUSA 3KD4A 2JD9A 3WHTA 2RMU3 4HFSA 1NCQB 1UKGA 1DQ6A 1PNGA 3AMHA 3LFMA 4I3PA 1D0HA 5E1RA 2VVFA 3IPVB 3Q8FA 4JHTA 3MIFA 4KGGA 1Z0HA 1GANA 4LE3A 4NE9A 4E4ZA 4CVUA 3BI3A 2W1SA 3WDTA 2HLEA 2ZGTA 1EPZA 1C5IA 2PTMA 2Z79A 4AR2A 4FOYA 5FJKA 4OHZA 3ZMOA 1JU3A 1OH3A 3OBTA 3H3LA 2JB4A 5IVJA 1PMIA 4MO3M 3PJYA 1CAXB 1PIV2 3WDVA 2AREA 2VUDA 3T3YA 3LAGA 3N9NA 2O8OA 4R8HA 4IEPA 4Q8LA 2X53S 4SBVA 3MUY1 3THCA 3ETQA 3ZN4A 2R30A 2RS33 4Q0SA 1VBA3 5CNAA 4IGQA 3O1UA 1HX6A 4RQPA 1U5IA 3LKJA 4UXAA 2QDNA 2HWF3 4B3NA 4I02A 1WD3A 1RJ8A 4YVSC 1GWMA 1X8EA 3B02A 2R062 1ND2B 2AEYA 5K9YA 1GBGA 2ZMLA 2IXKA 2XPJA 1AR92 2HWD3 4A7KA 3CEWA 1TQ5A 4XUPA 1QJEA 1NA1A 1F2NA 3DXUA 1H8TC 1YRZA 4LKSA 5DUWA 5AFEA 2Q1FA 1QXRA 1S4CA 3T0DA 4EWAA 4Y1ZA 2JDNA 3GXUA 4CPBA 5FPUA 2DFBA 3IAPA 2HWE2 2OIIA 4DPNA 5C7GA 2VMGA 4BK5A 4CDXB 1OA3A 1WUVA 2VBBA 2YFZA 4I0WB 4ISQA 1J3RA 3OTFA 3M3CA 4PCRA 3ZDSA 1DGRN 1IQDC 2HWC1 3RZLA 4CPBD 3LIGA 2V73A 3IM0A 2XOMA 1HW5A 4Q4X1 5E89A 1Q43A 5F6LB 3MIBA 1NCRB 4D94A 4JAAA 5F2SA 5JIAA 2W1UA 1A3KA 3E6DA 2VW1A 5FQ0B 3ZXEA 3C8XA 5I0DA 4JCKA 5B4NA 4ZU7A 1CAUB 2DUOA 3WG3A 5JWPA 3NNFA 4K20A 2W87A 3CJIC 4OCTA 3BPSA 4PBPA 1BXHA 4AEDA 3FHQA 1US3A 1ZBE2 1VRBA 4QPIB 3O14A 2RR13 4MGYE 4OULA 4QB1A 3JCIA 2Q8EA 2ZGOA 4YZ4A 4KBZA 4QGMA 4XBLA 2WR9A 5KC6A 2B8MA 3GCWA 1RUC1 3VZOA 5A6YA 1JI6A 5DXDA 1NKGA 1G7YA 4GH4C 4UFLA 3VDAA 1O5UA 5TSWA 1MQTC 4A6OA 5JDBA 3OUJA 3WP6A 1B35B 5FP4A 2WT2A 4CXYA 2KD7A 5DZEA 3EHKA 4Z8BA 5AFBA 4DUXA 4LKFA 3KT7A 3OGVA 4HKOA 2VTFA 1W9WA 2WAAA 1JTZX 3BB6A 2DBIA 4KI5M 3WNXA 5C8WA 3I7DA 1O5LA 1UMIA 3JZVA 2Y34A 1RUD2 3NJYA 3NQHA 4R4ZA 3BGAA 1PVXA 1UOGA 2VECA 3LEMA 1YJKA 5HV4A 5FY7A 3NKTA 1OOPB 4LORA 4U36A 4ES8A 1V6IA 2FMDA 4NIGA 3OBAA 3L9JT 1BBT3 5C9AC 1UYXA 4RFRB 2LUWA 1PVC1 1VBB1 4M01A 4L0PA 3U78A 4RS5A 5FP7A 3WD5A 4ZU5A 1DZQA 2VMIA 1LGBA 3I2OA 4W8JA 3AC0A 2QVSB 1RUH3 1PIV3 4GALA 4XJWA 2AGSA 1E5HA 4W6YA 5H9QA 2ZTNA 1RHI1 3B69A 1C5HA 2EIGA 4YFWA 3ZSEA 5T5PA 3THTA 1GKBA 4FOQA 4LHLA 3WW4A 3D0SA 4E2QA 3I49A 3I4IA 3FC0A 1D0GA 1APNA 3ZPYA 5JXJA 4XTMA 1OMIA 3LSEA 1RITA 1RMU3 2PA7A 1S0FA 3KT1A 1SLAA 2F4PA 4WZFA 4BE3A 4BXSV 3UKVA 1CAWA 3URFA 4LO5B 2NLRA 3CJIB 1JUIA 3FLTA 4LBJA 4XURA 3WG1A 4CDXC 2R6QA 4IV1C 3ZVXA 1W2TA 1HIXA 5IJRA 1ZNPA 1NXD1 1FV2A 2ZJCA 4GWNA 1LJ7A 1QQP2 5FFOC 3AZWA 4JQRA 4O9EA 1RUE2 5DG1A 2J1TA 3KVAA 5FY5A 5EWSA 2ZX2A 1W9SA 1V6JA 5A3NA 3AP4A 4JHZA 1W6OB 4HPKB 2NZ9A 1ENXA 5EYYA 1S55A 1DCSA 2IXHA 2MEV3 4YVSA 5GZDA 3ZXLA 4OZOA 4BQ1A 4E2SA 4AHYA 4N7UA 3VHNA 1JZ7A 3ZFEB 4XDPA 4LO4B 3M7AA 1UZ0A 2VW2A 3PURA 5FYUA 4DZGA 1R1A3 2EALA 2ZHMA 4Z1VA 3KB5A 5FDBA 5L9RA 3LA2A 3AMMA 3FFZA 4CDXA 2Z69A 3F95A 3MIGA 5FZCA 4Q4W2 1C4RA 4XZPA 3AFGA 3K3NA 1LKNA 3H1WA 2DCJA 2OZJA 2YROA 3C7HA 4B7KA 3J8F2 1DYPA 5CFCC 5GM0A 3WNKA 2VOXA 1KGYA 5LRRA 2WIIB 4L9BA 4M3CB 3TNPB 3WNOA 4ATEA 5BNNC 1NE6A 1I1EA 2RMU1 2PHRA 4QKFA 3VKOA 5GALA 1XYNA 2XL9A 2GN7A 2BGCA 2JD4A 3AB0A 3QH6A 5IW0A 4EJRA 5C3SA 3TEYA 1BCXA 4AVAA 5HBAA 1YLLA 3BIEA 3H42B 5BY5A 1TMF2 4FPCA 1XBFA 3IIIA 2XONA 3POEA 2CTVA 4WM7B 4YYOA 3VL8A 5CFCB 4QKDA 4TZDA 1OOPC 4XUOA 4ISRA 5FYVA 4JVAA 2ARXA 3P5BA 1OI6A 4DRVA 1PZ9A 4MX3A 1EY2A 2VVEA 3FBMA 3K4ZA 5LBEA 1F5FA 4YSFA 5EIYB 2XBO1 2Y6LA 1IQAA 1QDCA 4XJZA 5GLUA 2FHRA 2OT7A 1COV2 1CPMA 2OA2A 4D0QA 3CZUA 1JYVA 4MXWA 4P9JA 5CBLA 1Q8OA 2DVGA 4HANA 1O7FA 1YC61 2B7YA 5KHKA 1B09A 5FMDA 3P3PA 4FPJA 3VBHB 4DQAA 3V0AB 5AC93 4IESA 3IMNA 2WWUA 2XKPA 1NX9A 1PX4A 3BTZA 3VBFC 4QXKA 3JUUA 1OFNA 2YBSA 3WCSA 1MVQA 4XJUA 5IK8A 1D2QA 5CIRA 5FXXA 3K48A 3M3OA 2MEV2 3I97A 4M0NA 1F4AA 1W04A 4Y24A 1D2SA 2XHKA 4AEDC 2JIJA 5JMOA 1WLDA 2ARCA 1STMA 2HWD2 2WFF2 2WZR2 4XBQA 3VLBB 5J96B 2MHFA 1TE1B 1QIQA 2O14A 2L9LA 3ORJA 4FOWA 4IEQA 5EFUA 5FY9A 4ZXKA 3ZMNA 4MGTA 1UY1A 4G3YC 2I45A 1LNSA 4QT6A 1O8PA 2FQPA 3GZUC 1VBD1 4P5HA 3I8TA 1L7LA 1J3QA 3BVCA 1G9FA 5GZGA 3VBUC 1JUHA 3WW3A 1HB2A 1E5IA 1RVF2 4P9IA 5AVPA 4CRQA 5BNPA 1IOAA 5I8TA 4GIQA 2ILMA 4DUVA 2J1SA 4DIQA 4AHZA 1NG0A 2OQ7A 4LE4A 2W91A 1ENRA 4JGZC 1JODA 4QX8A 1BK0A 1AJKA 1W2NA 3J7NA 4RL7A 5A7WB 3WEZA 1XNKA 4QX0A 3BPZA 3VD5A 4CCCA 2GC2A 2LS6A 3LWCA 1X36A 1DGWA 3SKJE 5ABJC 1A78A 2UWCA 3O0XA 2Y6HA 4XC9A 1W8NA 3SNMA 1BBT2 4M0HA 3T0AA 1XU2A 2DCYA 3W59A 5JLVA
chains in the Genus database with same CATH topology
1Y9QA 2B42B 4N7IA 4LUMA 2E53A 3ROUA 4YG6A 2XGXA 1OSGA 2FMYA 3ALQA 4YARA 1S2BA 4WM7C 4PLMA 3OD4A 1XYPA 5T52A 4QQOA 5GLVA 2VULA 4MYEA 2ZMNA 1IHMA 3D82A 3HR9A 4MZUA 4QHBA 3QACA 1ZZ9A 1AZDA 3MGUA 4CDUC 2SBAA 1ALYA 2D6MA 2WNVB 4LLOA 1H4HA 3WW1A 1HRI3 2Z42A 4RS5B 4QPGB 3FUQA 3VZNA 5JOXA 1WD4A 1ZBE3 2WZR3 2PHLA 1Q3EA 4XFFA 4L2NA 4YW1A 2NMOA 1WMEA 2R32A 3T2TA 1W6PB 2WA4A 2C9AA 4FXKB 4A2UA 2UYBA 1Y43B 4ZKTB 3N7KA 2VQAA 5C8CB 1CX4A 3USSA 3NW4A 4RGAA 4TWTA 4AI3A 1POV0 5BPXA 1CAWB 2DF7A 1YCIA 3WW2A 3ZIWA 2NM1A 2GMEA 5JSOA 1AHSA 4IERA 4OUSA 2G9FA 3HT2A 1AYM1 4HMZA 2DUPA 4XHXA 3RPQA 1WCKA 3E6BA 3MIHA 1HDKA 3VBFB 2D3PA 4D7YA 1BJQA 3RDIA 3UJQA 5C4WC 4HLTA 4CEWB 2Y0OA 3R4SA 3WVJA 3IIAA 3LA3A 4F3JA 1LOEA 3KCXA 4Y5Z0 1B35A 1FOD3 1KQRA 4OI0A 2GMPA 4URTA 4NO4A 4OHVA 1RUNA 5GZEA 2WZR1 1AR61 2WFF1 2DU0A 3SH5A 4NPRA 4JTOA 1REEA 1DYKA 3PVEA 3POSA 3FWEA 4BA6A 5C6CA 4FQZA 4NHLA 2CYFA 1PO11 5FO9B 2B45X 2XJSA 4XF0A 5CFCA 4XXPA 3ZYIB 3AK0A 4HVRA 3BALA 1R093 5T5LA 1GICA 1DDLA 2A6YA 1N3OA 1W0PA 2A7AA 2H0VA 3A0NA 1RL3A 4LR4A 2W39A 2YZ4A 5JOZA 1SLIA 4V1PA 4BMEA 5J3UA 4E27A 1FXZA 1MACA 3ZXKA 1GSLA 3AXDA 4BH9A 3VBSB 4X6QB 1AUYA 3TN92 3U11A 3OYWB 5I8YA 5CFDC 3RSJA 2RMU2 4N43B 2KXLA 3EXUA 4PLOA 3SCHA 4RR3B 1YNAA 2TNFA 2WNVA 2CY6A 4IV1B 3J8F1 5SV5A 4JGZA 1PGW2 1QOOA 1G9BA 1BEV3 4W6WA 4YGDA 1QOSA 4WVWA 1AJOA 4MH0E 5JOYA 3VBUA 2P34A 4RR3C 4AGGA 2FZ1A 3J8F3 3B93A 3SITA 4FAHA 3DKWA 1QJZA 2NPIA 1OFSA 3AKSA 2E51A 5C9AA 3N3HA 3MW3A 2PHDA 5AC91 1REDA 5JI7A 4AE2A 2DURA 1WMFA 1BZWA 4IV3A 4OLLA 4D3WA 1YWKA 3WDUA 1K5MC 4Z07A 3SXWA 1HV1A 4HN0A 4AHXA 4E2GA 2ZHLA 4LBLA 2RS51 3CNAA 2XB6C 1RUOA 2VUJA 4COWA 1VBB3 1PVC3 1KDKA 1RMU2 5DZGA 1VR3A 1GV9A 3L2HA 3AX4A 2ZKNA 3KS7A 1C1LA 3PVNA 1HXS3 3M4FA 3AP9A 1NOVA 5JSRA 2VY0A 4GA9A 1PO22 3WZ1A 4P9LA 2ZCWA 3R4UA 2WT1A 1MS5A 1PZ8A 1KS5A 4MGZE 1JHNA 1AL0G 4MVTA 1KRIA 3GALA 5CFDB 4WBBA 2GDFA 1PNFA 2JKBA 3JD71 1G86A 1VBC1 3KGZA 5FCCA 4NHKA 2ZZJA 3QD6A 3ZYPA 3VBOC 3POWA 1D4M1 2DUQA 4P9YA 1RUJ3 2YMZA 4I3GA 2SLIA 3O0VA 5I0SA 4FCAA 3VDDC 3HBZA 3VBRA 3VHOA 1S0CA 2H0BA 1TEIA 2XUMA 3AKRA 4XF9A 3LA7A 2EF6A 4Z2WA 4Q4Y3 2HWC2 3H1YA 1QNYA 1AXKA 2R0HA 4PIYA 4ES9A 4K8FA 2WSVA 5L19A 4Z92B 1ZYBA 1RTVA 1CIWA 1UPSA 4KU7A 1LOFA 5T5OA 3S7IA 5KXEA 4Q4W3 3S6PA 5I91A 1QDOA 1L3JA 4HVOA 2JG8B 5EYXA 4Q4Y1 3B9IA 3MZHA 3DV8A 5CB7A 3VDDA 2ZABA 5KXDA 3CJIA 2WLQA 2R061 1O4ZA 3SLIA 5J48A 2H6BA 2WJSA 2PAEA 1GYKA 4IEVA 3VV1A 1YYNA 1RC6A 4WVZA 2FBEA 1AYM3 1JYCA 3HT1A 1Y3TA 4TLFA 4COZA 1C8NA 2OZ6A 3ES1A 1R1A2 1EP0A 3WR0A 3AYEA 4CDQA 4OHYA 5FRAA 1GQHA 2YGMA 1CJPA 3WQ0A 5J36A 1UAIA 4BYYA 1CD3G 2D40A 2TBVA 2ZX4A 3AXEA 2AENA 2XLGA 1VALA 3EBRA 3MEPA 4X8NA 5BXXA 2Q0AA 2WS93 3NKGA 5L7OB 4GMP1 4XYXA 1QHDA 1O4YA 1BKZA 4XFIA 1KD7A 2HWB1 3QCWA 2HWC3 1SFYA 1W0OA 2HEYF 5T50A 4J1WA 1FYUA 3DF0A 5JIUA 2VU9A 2ZAAA 3SHRA 1K5MA 1HLCA 3AYDA 3WXPA 1S0BA 4H7LA 1DZRA 3U07A 1N3PA 1H4GA 5FMOL 3C3VA 3TWIA 1WLTA 2A6WA 4MXWB 1SEFA 3ME2A 1WW4A 2GNTA 5J7MA 2PYTA 4AFAA 1H8TA 5JZGB 4MGIE 1QKQA 3AP5A 3GYDA 4KQ7A 4LBQD 1O3QA 3VBHA 1YUDA 2ZPXA 3UKTA 2DWRA 3EO6A 4BPZA 1JYIA 4M00A 3E5QA 2RM21 2EVXA 3BODA 2PHUA 4IEZA 4E9KA 1AL22 4JDMA 2GSYA 2DTWA 1MS4A 1LGCA 4RQPC 5CG8A 1ZZ7A 3IN9A 2GMMA 1BK1A 4AQSA 3W58A 1FNYA 3KQRA 4EWEA 1LTEA 2BVBA 3VUOA 1POV3 1UKRA 1XNBA 1BEV1 1MS9A 1HV0A 2DCTA 1COV3 2IWGB 1PO21 1S0EA 5I8SA 4XF3A 2PELA 1U12A 3OGJA 3QLQA 4YNIA 1YIPA 3R4DB 5FLHA 4E4SA 1LENA 1AR93 4BLJA 2X5IC 1NQDA 2VNGA 2PAKA 1X50A 3VBUB 3HAGA 1A6CA 1DZTA 5K0UB 2E7QA 1SMVA 2R072 4J1XA 3AZYA 3LOBA 1Q56A 1IKQA 1DGLA 4AI8A 2VVDA 1I3HA 1H1AA 1S0GA 5K7PA 3B7MA 4AF9A 3KLSA 5F5QA 3BTAA 2R063 1MZFA 4BLIA 2BEOA 3JB8A 1OD5A 3RMYA 1E57A 5FBZA 2GALA 3WDWA 3CLPA 3AM2A 1IZ3A 3IPVA 2ZACA 4LBMA 1HXS1 3N36A 1YFWA 1V9U1 1MEC3 1XU1A 3EQEA 4PQ9A 5I93A 4YGBA 1DG6A 1CONA 4P9WA 1S1AA 1FOD1 3QOPA 1OA4A 1TME2 2I2SA 3J4UH 4QPYA 5JPMB 4AEJA 5H9RA 1C8M1 2JE9A 1LGNA 4OZXA 5F1RA 1PGW1 3MYXA 1VAVA 4M3CA 4XJ9A 1KXGA 1AF9A 3B01A 1UW8A 2XLAA 2K9ZA 4Q29A 1W6NB 2R041 2LTNA 3SCFA 1MEC2 2LALA 1QJX2 3FLPA 3MLJA 1D4M3 4BWOA 1O3RA 1N3QA 5FTTC 3LCPA 5I0RA 4YVWA 1GQGA 2RS11 4KU8A 4BM8A 4XILA 3FBYA 1FPN1 3H50A 1W2UA 3A0KA 3JU9A 4AVVA 3BCWA 1UCXA 4COUA 2D3RA 5E88A 4CDUA 3GBGA 1G9DA 4YW2A 3B00A 2K2SA 2WNVC 1LODA 3OD0A 2BTVC 4P9XA 2TUNA 4DXZA 4LUKA 3ZYRA 1VAMA 1WBFA 1RGSA 2TEPA 1NLSA 4Q0UA 4J6GA 2R1DA 4XFCA 4S2HA 2JEMA 2VXRA 1RINA 4M3CE 2ZHNA 3PVBB 1QNWA 4EN6B 3KSCA 4CEWC 4HVQA 3OPZA 4CDWB 3IWZA 2A5ZA 1ZX5A 4HK8A 4RD7A 1VAKA 3H7YA 2XBO3 3RNSA 3GHNA 2DVBA 3RQ0A 4AFBA 3B9CA 4FT8A 4AI1A 3N7MA 2VQ0A 2O0OA 4YLZA 4YM0A 4KWLA 5KHHA 2A6XA 2GZWA 1AXYA 3RMXA 5A3MA 1LCLA 1NCRC 2CWMA 4N43A 4EV0A 5JCTA 5A33B 4PDWA 4Y22A 3WP3A 1DQ1A 1CVNA 4FOVA 1BMV1 2QCSB 1N47A 2I74A 1TMF3 1RUF2 1AX0A 5JR7B 4XQ4A 1VP6A 2KA3A 1NA1B 4Q4X3 4DOUA 5JI9A 3ACLA 3U0ZA 2ET1A 1NZCA 3POYA 3B3QE 4CP2A 2QZ3A 4WVMA 1PK6A 2ES3A 4OFGA 3BU7A 4FP2A 2OW4A 3WUCA 2IXJA 1OPMA 4XTPA 1LOCA 3H3ZA 4L92A 1DQ5A 2A3YA 1WW5A 4INDA 4FPKA 3LZZA 4A3XA 1PO23 5EV7A 1DFQA 2JJ6A 1H2KA 4GMP3 1VLNA 3OY8B 1SBDA 5IUQA 4BIOA 4FVVA 2WL1A 2EA7A 1A8DA 3RG0A 5BNPC 5C33A 1RUJ1 2N7GA 4HPKA 4DB5A 5FLJA 4WZCA 1FNZA 1J58A 3WX5A 5F9TA 5FOJB 1JW6A 3ATGA 5JSPA 2RS13 4RS5C 2ZOEB 5H9PA 1VBC3 1J3PA 1YIFA 5GLZA 3WHUA 4BZ4A 1QH6A 4LBQA 1DU3D 2A3WA 4LEJA 1KFXL 1UIJA 3T1MA 4AQ6A 4B4QA 2GC1A 1MZEA 1H2LA 4I0BA 2UU8A 1ND2A 1X7NA 3VBFA 3ZXAC 4OI1A 4FXGB 3RRDA 2GH8A 3ZN5A 1C28A 3J26N 2JG9C 2D6PA 1ND3B 1UZYA 1VBE2 3FJSA 1OA2A 1FV3A 2ZX1A 1POV1 4FPGA 3VKFC 1RUH2 4AQ2A 1MQTA 2WFF3 2P17A 4C0BA 4TSVA 4WM7A 3VZLA 4N9HA 2VPVA 2WT0A 5J09A 4LO7A 1DIWA 4LO8A 5E8AA 4K3UA 4YZ3A 3DN7A 2R49A 1WLWA 4I2OA 4Y20B 3VBRC 1NQJA 2GNBA 4A7ZA 3NWKA 3E97A 4Q26A 2MEV1 4K1YA 5A3LA 1XRUA 1CAUA 2BNNA 2D7FA 3Q9OA 1J59A 3IKWA 3KZ4C 3FMGA 1Q8SA 3QBQA 3VBRB 4FP3A 2YPJA 4Z82A 1F8VA 2ARBA 3DGTA 5FPXA 3OJBA 4PIXA 4YW4A 3MDPA 4FQ4A 3VKNA 3ZSJA 3BIWE 4EN7B 4LULA 4QU2A 2XBO2 1T6GC 1RJ7A 1KDMA 3MFAA 4LBOA 4KNCA 1ULFA 4AVCA 1EAH3 4AW7A 1FX5A 2QUOA 1OKQA 3TBDA 4YG3A 4AVSA 2JG9B 1MEC1 2PHFA 1CAVB 2WFPA 4KG8A 1XE7A 4IV1A 1UPIA 1RUI3 5HCFA 3KMHA 2UY9A 3JB4C 1URXA 1UIKA 5CADA 4CDQC 1H30A 3H3UA 1AR73 4YW5A 3SH3A 1M06G 2HWF1 3LSDA 4D69A 1TME1 5FAXA 4XDQA 2ZGSA 1QMJA 4CDWA 1KITA 4IV3C 4ASMB 1REFA 3WQ1A 3VZKA 1CR7A 4FPHA 1V9U2 3LB9A 4XQWA 5HCBA 1HXS2 2HWF2 1LULA 1H1MA 2VH9A 4COYA 2WNEA 5EJ3A 4LBQB 4XFBA 1EAH2 2WNUA 3JQWA 4N90A 2WS92 1WLCA 1QJX3 1S0DA 1ZVFA 1LHUA 5A33A 4OI2A 1G9AA 3AKTA 4WM8A 4AK3A 1WW6A 3NVCA 3V0AA 4YGEA 4OHWA 4QPGA 4YZ1A 5KHGA 4Q0QA 4Y4YA 2ZX3A 2UURA 3M8LA 1BQPA 2AYHA 1BYHA 3E5XA 1CQ9A 1WGPA 1M4WA 1ASJ3 3V0BB 2XH6A 1ZZ6A 1ZZCA 1NA1C 3GF6A 3ZFFC 3P3NA 1LU2A 1K5MB 2ENRA 4XOGA 1SLBA 4EN8B 3JBG1 1IS5A 4CYDA 1RB8G 2ZX0A 2D3SA 3B94A 3PMSA 5CA6A 5D8AC 1UU4A 3RJ2X 1JBCA 3I59A 2XJRA 5JVVA 1QJU1 5BNPB 2ZGPA 5KXCA 2PN5A 2EXKA 5GJ6A 3N4MA 2B5HA 1HRV2 1QJY3 5BNOC 3WP5A 2WINB 3ZXFA 3WDXA 1SLLA 4M3CF 3VGIA 4ORFA 1J1LA 5T54A 4RHV2 1S0JA 3VBHC 4YRDA 1FATA 2QE3A 2DTYA 3AKQA 2PHWA 1RUC2 1W6QB 2I07B 3FZ3A 1DF0A 2UYAA 2ZKLA 3L2YA 4SLIA 4RSUA 4XQDA 4FAGA 1RUH1 1WCDJ 1ZBE1 1KFUL 1VBE1 1H0BA 5B2GB 1ZZBA 5FO8B 5IK4A 1MZ5A 2R0FA 3D6EA 4LT5A 5BNOA 2QJVA 3AMPA 3KM5A 3TB0A 2IFRA 4YGCA 2WZPP 1AR72 4HT1T 4X8PA 1UL9A 4B8EA 1PGL1 2BNMA 4KG0A 4S2FA 5D8AA 4Y20A 1V9U3 1ZZ8A 3DL3A 4NWWA 4UW3A 2QDRA 3D5OA 1CESA 2CNAA 1W6PA 3O0WA 2IC1A 3GBFA 4ZU4A 2RS32 2GU9A 1RUJ2 1WA4A 3UL2A 2C5DA 2JXAA 2D44A 4QM9A 1V00A 2A3XA 2VNRA 4K9SA 2NP0A 1MS0A 4XMAA 1LHNA 4IEOA 1UU5A 2Q1ZB 1WBLA 1V6KA 1LEDA 1R083 4RR3A 2ZGMA 2V5YA 4ASLA 1FI2A 3MI8A 2HJIA 3M3EA 5HI0A 4DS0A 4U2AA 4FPOB 3PJQA 2OPKA 3KCYA 4XF1A 1I5ZA 1YXWA 4JRAA 5SV8A 1JXNA 3TRSB 3MICA 4LA2A 1RIRA 3CJXA 1PO13 1JN2P 2NN8A 4RGGA 1RUG2 1BMV2 3ZSMA 4C90A 5ACA3 1AR82 3MW2A 4R9AA 4W6XA 3AJZA 5L36A 1GZ9A 4H55A 3RS6A 3I59B 5LK5A 5FQ0A 3ELNA 3WY6A 2D5FA 4AGRA 4DMIA 1IS6A 2UY8A 1ZREA 4N53A 4IV3B 3FLRA 3S0MA 1C57A 1VBA1 4ITCA 2ZGKA 3ZXJA 1V70A 2ZGUA 3GBWA 4JGYB 4CP1A 4YW3A 2R16A 2GNMA 1U5XA 1H2MA 1Z78A 1O91A 4Q2FA 2PHXA 4R9BA 4YFZA 1Q8PA 2EXJA 2F6BA 3D4KA 1YFUA 1NCQC 4JTNA 5JZGA 3CO2A 1VB2A 3UV9A 3PMEA 3GZAA 3FFQA 4CP0A 5AVAA 2ET7A 1ZBA1 4CEWA 1RVF3 4K1ZA 2YC0A 1VRH3 4FTSA 1H9WA 5ACA1 1AR63 2JE7A 2PFWA 1KS4A 3ST7A 2PLV3 1S2KA 1VB4A 1QXPA 1FMD1 1VBC2 2RS12 3JD72 2CGNA 5D8AB 4NWVA 1PHMA 2BWCA 2HWB3 1R092 2BWAA 5GKAC 5KHKA 3HD8B 2IXLA 1GNZA 1O4TA 5K0UC 4LBNA 2D93A 1PZ7A 3GNEA 1GZWA 1VIWB 4B4PA 4AEKA 1RUI2 1XNDA 2Y0IA 5JPNB 2R042 1U5ZA 1UU6A 4OVEA 3MF6A 5CG9A 1JH5A 2A6VA 2JG8C 5DG2A 2O8QA 4IETA 2XG3A 5DDJ2 4Y22B 1RMU1 3ENRA 1OLRA 5KHIA 2VUAA 4GB32 4RA0A 5DDJ3 4YVSB 2K0GA 4AYUA 3LGRA 3VN4A 5BUVA 1W6QA 1UD1A 3USUB 1FOD2 3ZFEA 1AYN1 2ZA9A 4K40A 5T5JA 5EZWA 1XE8A 2HKXA 4P14A 5FO7B 5BNNA 1RUF3 2ZS6B 4WVMB 2R043 2RR11 3V65A 4YM1A 5KWRA 3AZZA 3FX3A 4RQPB 1DGRA 1X33A 4EROA 3VDDB 4CTEA 1GR3A 1XYOA 4MV2A 2DCKA 2EAKA 2XVGA 3RI9A 5AC92 4XBNA 1J1TA 1VJ2A 2BW8A 3BOPA 3E6CC 4JGZB 4LHNA 4YZ2A 2G9GA 1TNFA 3UKNA 5HCAA 1DQ4A 2RR12 4N53B 1B35C 5DUUA 3NV2A 4CEYC 1DBNA 2NQYA 2P3IA 2BNOA 4FTEA 4QQLA 4Y1VA 3WOGA 3WINE 4K6BA 2P2KA 4FO9A 2E9QA 5GLWA 1CN1A 1AXZA 2D6NA 5JMCA 1BVP1 4LBKA 4YM2A 3TNQA 4Y1YA 4COVA 5L7OC 3AMQA 3TN91 4F8AA 1BEV2 2D5HA 3H8UA 3VKLA 3NAPB 1U5YA 5DZFA 3M1HA 1Z7S1 4HN1A 1R091 3MFCA 5FREA 1SCSA 4E4DX 2P37A 4FPLA 2ERFA 1H8VA 1ASJ1 3NL1A 2E7TA 3K51A 4AHWA 5T55A 3TYJA 1AVBA 4S2DA 3M2MA 4O9GA 2EAAA 5ACA2 1AL21 1SBEA 2RM22 1PO12 4I09A 4LTAA 2JG8A 1ZBA2 3ILRA 4UBHA 2OUHA 2E6VA 4KWKA 4XJ8A 3OBRA 2A73B 2RM23 4GH4B 4JGYC 3ZN6B 2DFCA 3AYCA 5C4WA 3PLQA 4XHBA 1SLCA 2GNDA 1SLTA 4H3WA 3QH7A 3ZFEC 4YVWC 4QQHA 5LEJA 1OLQA 5DUXA 2ZGNA 4HSJA 2X5IA 4LA3A 2O1QA 1AYM2 1AR81 1QXJA 2WKKA 4IEUA 1RUG1 3E5UA 4B7EA 3GHMA 4LLFA 5FMOS 1FMD3 1PK6B 2HWE3 1R1A1 1SQ4A 1LB2A 3ZIXA 4GMP0 2YUEA 3OCPA 4ONUA 4XW3A 1S0IA 3RYPA 1CAXA 2BYVE 2W0XA 2VW0A 4XE9A 2OVUA 1IS4A 5T3NA 2BFUL 1NLRA 2IXCA 1PK6C 3AKPA 3S7EA 4PJYA 3OY8A 3ZXGA 1OHFA 1R1ZA 4CZSA 4NR1A 3RJRA 1ENQA 2XVLA 4YG0A 4WM8B 4HSLA 4Q4Y2 1AX1A 1LHWA 2RS31 1LOAA 5K8SA 2YDEA 3USUA 1W6MA 1R082 3CU7A 4N43C 4GWMA 3PVOA 1QOTA 4CDQB 4BHPA 4QMAA 2WQZC 4C1WA 2B9UA 2CAUA 4Q0VA 2A71A 3PHMA 1EYBA 2WQ4A 1DHKB 1YI7A 3OGGA 4L8QA 3C2UA 4MXVA 1UZZA 1SBFA 2PQQA 1PGL2 4AFDA 1EV11 3I2DA 3HWJA 4P9GA 1AR71 2WSUA 2C0ZA 1OPOA 4IQPA 4D7SA 1QJU3 1MS8A 4K21A 2HEVF 4KL1A 5J37A 4GXLA 5D1IA 4UBGA 1MR5A 3SISA 2FZ2A 4OHXA 2XVKA 1MQTB 1KJRA 4AWDA 2BBVA 1RVF1 4FSJA 3OF1A 3N7JA 1NXMA 4GH4A 1D4M2 4QPIA 2PLV1 4HKWA 1VBD2 2XJQA 1HQNA 2JICA 1AX2A 2B46X 3CL1A 4QPIC 4TYSA 4QGLA 3H0OA 1HQWA 1V6OA 1ZRRA 4F83A 1VRH1 1X8MA 4NN0A 4RHV1 1ZBA3 2HWD1 4QM8A 1QJY1 4LO6B 4BMBA 1H8TB 2RHPA 2X29A 4G9SB 1HRV1 2WA3A 3WDYA 3HN1A 4H14A 4WM8C 3ZO0B 3DPRA 1TNRA 5F6KA 2BVVA 2V09A 1A8MA 1C1FA 1OOPA 1QJU2 4RHV3 4Y1UA 2JDZA 2WNUC 1YJLA 3T1LA 1OQEA 2DCZA 2GC0A 4D7TA 5L73A 3VL9A 1ZRFA 1COV1 3NV4A 3VBSC 5GZCA 3JBG2 2UWAA 3NAPC 3PTYA 2RS52 3V64A 5E16A 2GAUA 1TME3 3WG4A 1PGSA 4IXLA 5C8CC 1QU0A 4CDWC 3WT3A 3ZFGA 3NO8A 4MUVA 1DGWX 4R4XA 4DNYA 1TMF1 2VNOA 4HL0A 2ZAHA 1CAVA 1NE4A 5C9AB 1UMZA 4XFHA 2GH2A 3TN93 2C1FA 4L99A 1ENSA 2CV6A 2PHTA 2WS91 1Q5OA 2YHJA 1YO8A 2E7AA 5C4WB 1EAH1 4IEYA 2EXHA 2CGPA 2IXIA 3VHRA 1SDWA 1F9KA 3N35A 1WW7A 1ULDA 1HKDA 3ZFGC 2VMHA 4Y1XA 2BQPA 4HBNA 3VZJA 5C8CA 3WV6A 4PLNA 3ZYGA 4LNVA 3AFKA 1FT9A 3IDCB 2R1BA 2D43A 4R9DA 2R073 3HMYA 3M70A 4GQ7A 3VBSA 2ZMKA 3OYWA 4X6RB 3DUIA 4XIOA 1V6MA 2AZ5A 2NYYA 1LECA 2WC2A 1RHI3 3UJOA 4QQPA 1QQP1 1ZRCA 4FPFA 1ULGA 4PF5A 3ZSKA 3RYKA 4OUMA 5LEKA 2E63A 3ILNA 3LOIA 2Q8OA 3AZVA 3G6JB 1SACA 4Q27A 2X8KA 5LK7B 2VOKA 1O3TA 3NV3A 4B29A 2QKDA 3ES4A 4R9CA 4C0HA 1VBE3 2AH2A 4MGKE 1RHI2 1IKPA 4JGYA 2RE9A 4N9IA 2WLPA 1QF3A 1WCSA 4I0AA 1PVC2 4NVPA 4BIFA 4KGQA 3UK9A 5IK7A 1W6NA 2ZHKA 2YV8A 3RZZA 4UW5A 3PNAA 4QPGC 2HEWF 4AG4A 4XMIA 4META 3AP6A 1RUD1 5H9SA 1H2NA 1LRHA 1HRV3 1QJY2 1XNCA 4W65A 3VZMA 5CAZA 1ZRDA 2CGOA 3GZTB 1ONAA 1AR62 2ZGRA 1MS3A 5EXOA 4GKYA 3X29B 1VRH2 4EWDA 1Y7BA 4XPVA 3B5LB 1PM7A 5IT6A 2UWBA 1KJLA 1LOBA 1QY4A 2PLV2 4L11A 3VBOB 1N1TA 3ZFGB 4LHKA 4AVBA 4QX5A 4I30A 3ZYJB 3JBG3 2ZGQA 3MW4A 3FUOA 3J9SA 1N1YA 2JECA 4HZFA 4Q4X2 1EV12 1SFNA 1G9CA 4IEXA 1GFF2 1EV13 1Z7S3 1CPNA 3R05A 3AZXA 2LM3A 1FPN3 3VHPA 2W68A 4FBFA 1I6XA 4UW6A 3H7JA 3WG2A 1GZCA 3ZFFA 1R081 5BNNB 2XJTA 5FOBB 4XFGA 1AR91 2D6OX 2BUKA 1C3HA 2ATFA 2JG9A 1CJDA 4Q4V3 3AP7A 4MLOA 2MNGA 4PDWB 5CU1A 3M3IA 3H9AA 5A32A 5ABJB 1IPJA 3MLKA 1V6NA 3MLLA 5BYNA 2DYCA 4QD2A 4YM3A 4JV4A 1W6MB 1AL23 3MIEA 1IGOA 4UW4A 5BNQA 5KBFA 1IPKA 4DRRA 3WQ7A 2IFWA 1LR5A 1PIV1 1DLLA 1H9PA 3ASIA 3KT4A 4HETA 2XJPA 3D8CA 2BFUS 3WCRA 1RUF1 1YHFA 1BBT1 2D97A 2DVFA 3BOWA 2DVDA 1UX6A 2XLFA 1LOFC 2QZ2A 2XJVA 1LU1A 1LHOA 4AI2A 3W9AA 4GKXA 4JDNA 2D98A 2HYKA 3HIFA 1OQDA 1XXNA 4JDOA 1NY72 2XWBB 2ETEA 5CFDA 4GB33 3O5SA 1FAYA 5CVRA 5IK5A 1RUC3 5GZFA 3JD73 2A75A 1W39A 3JQXA 1LEMA 4CEYB 2Q1MA 3V56A 1O3SA 3MF9A 1G6NA 4XF4A 4G4FA 3ECQA 4WV8A 2A70A 3VBOA 4F7ZA 5L7OA 1LHVA 1NCRA