2BWAA

Structure of endoglucanase 12a (cel12a) from rhodothermus marinus in complex with cellopentaose, 20 minute soak.
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
226
structure length
226
Chain Sequence
TVELCGRWDARDVAGGRYRVINNVWGAETAQCIEVGLETGNFTITRADHDNGNNVAAYPAIYFGCHWGACTSNSGLPRRVQELSDVRTSWTLTPITTGRWNAAYDIWFSPVTNSGNGYSGGAELMIWLNWNGGVMPGGSRVATVELAGATWEVWYADWDWNYIAYRRTTPTTSVSELDLKAFIDDAVARGYIRPEWYLHAVETGFELWEGGAGLRSADFSVTVQKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ENDOGLUCANASE
publication title Dimerisation and an increase in active site aromatic groups as adaptations to high temperatures: X-ray solution scattering and substrate-bound crystal structures of Rhodothermus marinus endoglucanase Cel12A.
pubmed doi rcsb
source organism Rhodothermus marinus
total genus 62
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2005-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2bwaA00
1XYOA 1OA4A 1C5HA 1REEA 2BVVA 3RI9A 2DCKA 1H0BA 1XXNA 4S2FA 1TE1B 2DFBA 1XYPA 1REDA 4S2DA 1QH7A 4XPVA 1KS5A 2JENA 1H8VA 1UU5A 3VHNA 1OLQA 1XYNA 3MFAA 3HD8B 4S2HA 3WX5A 1BK1A 2DCJA 2JICA 3MF9A 2QZ3A 2VGDA 3VL9A 2C1FA 3LB9A 3WY6A 4HK8A 3AMQA 3WP4A 1XNCA 4H7MA 3AKRA 1AXKA 1HV1A 3LGRA 1XNBA 3VGIA 2VG9A 3MFCA 3AKQA 2B46X 4HKWA 2F6BA 2NQYA 3WP5A 3VLBB 3VZNA 3VHPA 4S2GA 2B42B 2D97A 2JEMA 1NLRA 1XNKA 3M4FA 1HV0A 1M4WA 3WP6A 3AKPA 1T6GC 2NLRA 2B45X 2BWAA 1YNAA 3MF6A 1UKRA 1H4GA 3AKSA 5K9YA 1C5IA 2D98A 1QH6A 1IGOA 1PVXA 2DCYA 3VZKA 1UU6A 5EJ3A 1OA2A 3WQ0A 3B7MA 2BW8A 1BCXA 3RI8A 3WT3A 1ENXA 1UU4A 3AMHA 2DCZA 1F5JA 3O7OA 3VHOA 3WXPA 1KS4A 4XQ4A 3AMNA 4HKLA 3WP3A 3VL8A 3VZOA 3B5LB 1H1AA 3VZMA 3WQ7A 1H4HA 2VUJA 1HIXA 4XQWA 5K7PA 2DFCA 3WR0A 1XNDA 1REFA 1OLRA 3AMPA 3WQ1A 1BVVA 3ZSEA 1W2UA 4IXLA 4NPRA 3AMMA 3AKTA 2BWCA 4XQDA 3VZJA 3EXUA 2VULA 2QZ2A 4HKOA 5HXVA 3VZLA 2Z79A 4HK9A 1OA3A
chains in the Genus database with same CATH superfamily
3WW4A 1OA4A 2RMU3 5LK7B 2HWD3 1ZZ6A 5FREA 2BDRA 4K7JA 2VNRA 4JTNA 1RTVA 1V9U1 2FDJA 2Z5WA 2Q5TA 1O59A 3ILNA 1WCDJ 3B02A 1ZRIA 5FZ9A 3WG2A 4COVA 1MEC3 3WOGA 5CAZA 1RMU2 4GALA 3GZUC 4MO3M 4A45A 2RM22 2VU9A 4PBOA 3I4IA 3KF5A 2JENA 3VBSC 4UFMA 4WBBA 4EZ4A 5LWBA 4XTPA 5FPBA 1PGL2 3J8F1 1OLQA 2BQPA 5FOJB 2JD4A 4QXBA 2B39A 4S2HA 3PTYA 1S2BA 1UYYA 2ET7A 1OURA 4XHBA 1SLTA 1YLLA 1ZZCA 4I3PA 4A2UA 5EV7A 1XE7A 2LUWA 1ND2A 3O1SA 2JX9A 4P00B 4AEMA 5CFDA 3P6BA 2EIBA 1DGWX 3IZOA 4H7MA 5FPUA 4LO8A 1PIV1 3T2PA 2WL1A 3CJIA 5D8AA 2XL9A 3D0JA 1AR92 5FZFA 4CDXC 1VR3A 4FXGB 4LITA 4XZUG 2WQZC 3PUIA 2WZR2 2RVAA 1JN2P 2W94A 3NQHA 5E1RA 1AR72 3ACGA 4FPHA 4CCCA 3SISA 2KD7A 4Z07A 5JUVA 3FHAA 3ACHA 4NIHA 3HQRA 3NAPC 4KG8A 5FZLA 1X8EA 1EAH3 1WCUA 2B4KA 1F15A 4Q0QA 5C8CC 1QJX3 2PLV1 5F37A 3AZZA 2LRPA 5GLWA 5LCWL 4O65A 4KMQA 2EAAA 1KITA 5HPOA 1SPPA 1TNRA 2X5IA 2E9QA 1ZX5A 1FMD1 2BNNA 3JBG3 3MO4A 1LJ7A 5DZEA 2JDAA 3FBMA 4TZDA 2VBDA 2Y6JA 4N7IA 2AUYA 5E88A 1UF2C 1MVEA 4R9DA 1WLWA 2FDHA 5FZ4A 2BJSA 2D6LX 1QH6A 5JLVA 1DZTA 3ECQA 1MZEA 2WO2A 5FMOL 2JIGA 3PIGA 1US2A 2CAUA 1UU6A 1W6MB 3VKOA 1YRZA 3WQ0A 4Y22B 1XNAA 4LBMA 5FXVA 1HXS1 2WIIB 3RWNA 4AAXA 4QPGB 2A6VA 5FZMA 4KWKA 4YM2A 4RGAA 4YGBA 3K75B 2GH2A 2ZGSA 1N1SA 3K3NA 4QKBA 4WM7C 5FPZA 3ZYBA 3MI8A 1C8NA 1GWKA 1POV1 4GWMA 1S0IA 1SG3A 1AYN2 1X36A 4XQWA 5A70A 2GP3A 2DFCA 2P6CA 1ZBA3 3HNBM 2ZX3A 3ZSEA 2O8OA 5L7OB 4QDSA 3FN9A 1AJKA 3WNPA 1ODMA 2WZR3 3TWIA 5IFTA 5E89A 4OZOA 3IB3A 3KV9A 2ZEZA 4W6YA 2XJUA 2E51A 2EAKA 2XUEA 2ZEWA 2W3JA 4YLZA 1PGL1 3EXUA 2XLGA 3AL6A 2JG9A 3U07A 1QJZA 2R7EB 3K3OA 2J42A 2R063 4LT5A 1BXHA 1J3QA 1KGYA 1WKYA 4WM8C 4A4AA 4D3WA 5FQ0A 3ITQA 2K46A 1A6CA 1QY4A 1OFSA 3PL0A 3NNGA 1JBCA 1S0GA 2DCKA 2XBO1 1HB3A 4W6XA 5K0UA 4TLFA 1L7RA 1HRV2 3NV1A 1YFYA 5JIAA 5JOXA 4IEUA 2R0FA 3H1MA 5IHRA 4LO7A 4RHV3 1GBGA 2EALA 4IUGA 1TME2 3ON7A 2YC0A 2RS12 2YBKA 3RYPA 2EF6A 1HLCA 3TEZA 3ZDVA 1YC61 1VMJA 4BDVB 1I9RA 2WQ4A 1L3JA 1COV1 1TQ5A 5FZ8A 1MR5A 5JSOA 2OYZA 2NYYA 4GJYA 4HLTA 4K21A 4X8PA 3I8TA 3FLPA 4C1WA 2OPKA 4E8DA 5FZBA 3W21A 2Q1ZB 4EN0A 3VBHB 4AAPA 5C5UA 3I3MA 5AFEA 5C33A 1DGLA 4IEZA 2FDFA 3WP4A 3ZXDA 1ZRFA 2R061 3AKRA 3POSA 1Z7S1 4AHWA 2HWE1 2X8KA 1QOSA 4JHTA 1I6XA 1QJFA 5DPNA 4X8NA 2CTVA 5K4LA 4AHXA 5FJHA 5JMCA 1CGPA 1W0NA 1CAVA 2XVGA 1NQJA 2MNGA 2R042 4FOVA 4I3GA 3WP5A 2NPIA 2WZEA 1B35B 3OUIA 3VN4A 5DAWA 2BFUS 1QXJA 3GXUA 1K12A 1W8OA 2D43A 3AKPA 2WN2A 2YC2A 3AP5A 3K46A 5CYYA 5BV6A 2ZZJA 3I2DA 4HPKB 1ZVFA 2W1WA 3HOBA 1DG6A 3H42B 5BNPA 4XBLA 1TME3 5DG1A 4J1WA 5A6XA 4DY5A 4LOSA 5C6CA 4AEKA 2DCYA 4DUVA 1IGOA 1S1AA 1CAXA 1L7QA 3OD4A 5HV4A 1R082 3AZVA 1AR81 4OFGA 2XQRA 1YJKA 3I2HA 3WNXA 2A73B 2NMNA 4R9AA 3SCFA 1ZZ8A 3LIGA 5CIRA 1C1FA 3PUAA 4UFLA 4L2NA 3O5SA 4QU2A 2XJRA 4B4RA 4CSWA 3L9JT 5DMYA 5JPMB 1AYM2 4AHZA 3VV1A 4INDA 1VBD1 1W6NA 3DXTA 2YFZA 4FFFA 1IS3A 1HQWA 1QEXA 5K7PA 2HWB1 3WR0A 3UNPA 2ZCWA 5A7WB 1O3RA 1R64A 3ZPYA 5KR7A 4SBVA 5APAA 2ZHKA 4MHRA 3OOXA 3I7DA 3BTXA 1Y9MA 1Q8PA 3OGVA 3B94A 4GH4C 2WLPA 4CEYB 3C3VA 4ASLA 1UIKA 4XOGA 5FCCA 2RS32 3EB7A 2XH6A 4QM9A 2QBXA 5KBFA 4K9SA 1AR62 1MS5A 1U12A 5GLZA 3W5MA 3GF6A 2QQUA 4A7YA 2JDNA 4GWIA 4PT6A 1C57A 3RG0A 5KHKA 1RB8G 3GALA 3U37A 2WS92 4CU7A 5ERLA 3WSOA 1BMV2 1C4RA 2IC1A 1K5MA 1RUC2 1WD4A 2ZX4A 4L8QA 1R1A2 3CL1A 3IPVA 3OB8A 1LOEA 1RL3A 2WO7A 3THCA 1FPN3 4AVAA 1JZ7A 5FZOA 2AEYA 1RUI1 4XURA 2JDPA 1XYPA 4CCJA 1REDA 4Y1YA 1CAUB 3BCWA 4CEWB 1KFUL 3I3DA 1KS5A 1GV9A 3IDCB 1RYYA 4XVHA 3ROUA 3MFAA 1LODA 3QCWA 4E9KA 3SH4A 1SQ4A 1H1IA 3LIHA 5FKBA 1I5ZA 2CDPA 2IXLA 4IQPA 3MIFA 2VZRA 3GYDA 2Q4SA 5FY4A 1B35C 2WT0A 2PQQA 3TRSB 4D0QA 4E4HA 1UYPA 4Y5Z0 2CHHA 4DEVA 4PLMA 3LDRA 4QB2A 4XUOA 5GKAC 5H9QA 2UU8A 3ZFEC 4Q8KA 3TOJA 5DAQA 4XF4A 5C9AA 3THDA 1O8PA 4E4ZA 3VBRB 5DXDA 4YYOA 4IE0A 2F4LA 2WNVC 1XNBA 1PGW1 2LALA 2X29A 3J4UH 3T4HB 1RVF2 3MW3A 5IK8A 4XFHA 1O5UA 2ENRA 2WFF1 5FYBA 2WBKA 4FBFA 3ZR5A 3GGLA 4BLJA 4MGQA 1DZRA 1POQA 1PK6A 3IMMA 1OUSA 3VBSA 4L9BA 3VD7A 3MIBA 1XNKA 2PA7A 3I2GA 3ZYGA 4M3CE 3CF6E 2WYSA 3BB6A 5JIUA 1EUTA 2P2KA 3D5OA 1W9TA 2BVBA 3ACIA 4I0BA 4L99A 1G8WA 5A7OA 2RHPA 4IGQA 4P9WA 1YNAA 1MS0A 1SLCA 1X8MA 3LKJA 3HQUA 1WW4A 1VRH2 5FMOS 3O1RA 5JR2A 1DBNA 4OVEA 4P9LA 3SH3A 2ZGPA 1DCSA 2ETEA 3WZ1A 5A3TA 2W0XA 1CONA 1RHI1 2QQVA 4CEYC 1NXMA 2AR6A 4XZPA 4D94A 1UN1A 1BCXA 3KS7A 3KT7A 2YU2A 2NM1A 3MEPA 4CDXA 4Y20A 1W9SA 2V5DA 2JE8A 5J09A 5C3OA 4PQ9A 3WXPA 3RZHA 4XQ4A 3MV11 4PLNA 5CKQA 4ZS2A 1F5FA 2XKPA 3NAPA 4DO0A 3VZMA 1W9WA 5C8CA 4FPCA 2JJ6A 3AP7A 1GANA 1OLRA 3H3ZA 3HNMA 3WQ1A 2WLQA 1J1TA 3R6SA 1NCQB 1ASJ2 1PHMA 4NPRA 4CU9A 4Z2WA 2IXCA 5ABJB 1NCRB 4Q5OA 2JB8A 4IEXA 4CEWC 4LLFA 1FYUA 3ZDSA 3UGGA 2XOMA 4NN0A 4IEWA 3VDBA 3VZJA 3SCGA 4BK5A 2DBIA 4M3CF 1PVC2 1QIQA 5CKMA 1JYNA 2HWF2 4QQPA 4Y24A 5KXEA 4Q0PA 1RUE3 1CJPA 3AM2A 4H55A 3AK0A 2DU1A 3FMGA 4JRLA 1TG7A 3AXDA 5F3GA 1O4TA 4YW3A 3IAQA 4Q4Y1 5BPXA 4Z2AA 2BP6A 3CDZB 4WM7A 3WUCA 5C8WA 3HEIA 3VBRC 2RDRA 3BIEA 3POYA 3O14A 2ZGUA 3VHRA 3HR9A 3OGRA 1H9WA 1UY3A 1VALA 3EQEA 5T55A 1GP6A 5LEJA 2UY9A 2W1UA 4R9CA 3LA7A 4HL0A 4Q4V3 1LCLA 5FYIA 3N7LA 3S7EA 4GWNA 2XUMA 2BGCA 4UFKA 1V6JA 3J26N 3MHZA 4Q8LA 5FJKA 1HDKA 2Q8EA 3WX5A 4A6SA 2XJVA 2EXIA 1V6MA 3C7HA 3T4VA 3GDBA 4A42A 1JOJA 2VPVA 2QZ3A 3WG1A 2BBAA 3ASIA 2QE3A 3O1PA 4RGKA 1V6NA 1NKGA 4AYUA 1BYHA 1VRBA 2WO3A 5D8AC 4DRVA 3TN91 4IEOA 1ZRDA 3OF1A 1VBA2 3OG2A 1AXKA 1WBFA 4MGYE 1D2QA 2DVBA 2FHRA 3KV6A 1V6OA 5IW0A 5JZGB 2WZPP 2H6BA 4KWLA 5KXDA 1ULGA 3RZKA 4Q27A 5LY1A 2H0BA 1S55A 1AX0A 4IE5A 5A7NA 4XUNA 2B42B 2RR11 5IAVA 5HXMA 4WVZA 4UW6A 4ZXEA 4OULA 5G05L 4W65A 4LUKA 1AL21 4CXXA 1QJY1 4AL9A 3H0OA 1XQNA 2VNVA 3NJYA 3AB0A 3OPTA 3BI3A 4BM8A 3GJAA 4Q4W3 1H2LA 4XFBA 5FY5A 1DZQA 1PO22 4LO4B 3ZYPA 1ZA4A 2PHWA 4CE8A 5CFCC 1UZVA 4BISA 2QNKA 1S0EA 1NCQC 3DL3A 4O61A 3HT1A 4NO4A 5ABJC 4R4ZA 4URAA 1DGRA 1FOD2 1NCRC 1OUXA 3ZPOA 1C8M2 5KHGA 1JXNA 5DG2A 1OA2A 1NG0A 1W8WA 2V72A 3AP9A 4K1YA 5FMBA 3LZZA 4AI3A 5L73A 5SV5A 3BPSA 3MDPA 4GA9A 4Q26A 5CU1A 3CBNA 3GCXA 3LSDA 2QUOA 3EHKA 4NAOA 2WZ8A 5CZKA 5FZ1A 4IGPA 1A34A 1Q5OA 4UF0A 1W6MA 5FMCA 2D6OX 4NPLA 3I49A 3KQ4B 4MHUA 1TVGA 3L2HA 2EXKA 1XNDA 5C4WB 1GWMA 3D82A 5LBBA 5BNOB 3ETQA 2QQIA 4FCAA 4XBNA 5DDJ3 4ZHNA 1CIYA 2VJXA 4GWJA 4FFGA 5FY1A 4M3CA 4QB6A 3AKTA 4G4FA 5I91A 1LHWA 2XDVA 4C8DA 5FR3A 5IK5A 1JS9A 2GDFA 1FX5A 5JXGA 2OT7A 2VQTA 1IKQA 3P5BA 1RUD2 1JYCA 4PJYA 3U1XA 4B4PA 5KWRA 2DU0A 3WNKA 3NO8A 5FZIA 5FYCA 3ZFFB 2JB4A 1LOCA 2Z79A 4ASKA 4E27A 3ZM8A 1S0CA 2MEV1 2P3IA 1O8SA 4HFSA 1NQDA 2L9LA 3GNEA 1KD7A 2BVVA 2Z69A 3VBUB 3ZFGB 4BA6A 3V0BB 4Q0VA 4FSJA 1RUH1 2A3WA 1CESA 4JGYB 5JXHA 2KR2A 3G6JB 2Y34A 4RSUA 4W6WA 1QMJA 5A1AA 2YGLA 1QKQA 1BBT2 3I54A 3MPPG 4B3NA 2A6WA 1QH7A 3H9AA 4FAGA 4EN7B 3A0NA 2F17A 2R16A 1O7FA 1RUNA 2ZHMA 1XYNA 2V73A 2W46A 3JQWA 2V5YA 4RFT0 3LWCA 3VD4A 3D4KA 1YQ5A 2ILMA 4GH4A 5FYYA 5I0DA 2BBVA 3IWZA 3MF9A 5C3PA 5M0TA 1YQ2A 5J7MA 4AG4A 5EHDA 1VBB3 1LEDA 4BQWA 4BMBA 3ZXJA 3W9AA 4QQHA 3W5NA 2K9ZA 2PHTA 2YPJA 2JXAA 3IM0A 1GZCA 3ZIWA 4Y4YA 5FTTC 2DVGA 1XNCA 4FPYA 5LEKA 3GZEA 3ENRA 4N43B 4BHPA 2FDKA 2YG0A 2J7MA 3VBOB 2VAUA 2E63A 4BLIA 2XONA 4IV1B 3VBHA 5GZCA 1KDKA 1UKGA 2GAUA 3EBRA 4YM3A 5ISLA 2XL7A 1RUD3 4HKWA 3GBWA 4O7XA 3S6PA 1JW6A 3T08A 5IYYA 5I8YA 4Z1VA 3M3CA 3VHPA 1U5ZA 2D97A 1W8FA 2WINB 5FO8B 5JMOA 2TUNA 3RGBA 1F4AA 1M4WA 2VR4A 4AGGA 2IFRA 3UKNA 3RPQA 5FZ6A 2ZX1A 3S57A 4M4RA 1ZRCA 1V9U2 2FCUA 4JGZB 4DS0A 2BPA2 4AOCA 2Y0IA 3RVHA 2H0VA 1Q8QA 1B35A 1C28A 1SFYA 1SHWB 2BYVE 1VBB1 2PTMA 4JDOA 1VB2A 2QJVA 1VP6A 3BYWA 5ACA1 5C4WC 5IVYA 1BEV3 5BNOC 4NVPA 1LEMA 3ZFEA 1JYVA 1OKOA 4GB32 1AXZA 2PHUA 4HPKA 2RS51 2P3KA 4A41A 4PDWB 5FRAA 3KT1A 4N8MA 2WNVA 1NZCA 4Q2FA 1E5RA 4XDOA 1H30A 5T5JA 2FDIA 1SFPA 3V0AB 3F2ZA 4U2AA 4FFIA 2W92A 5I0TA 5DN2A 3UJQA 2WO1A 1M06G 4QD2A 4NRPA 3ZFFC 4JRAA 4GZ9A 4XXAA 3WP3A 3FJSA 3VBUC 3ZFGC 1GOFA 4ONUA 1H4HA 3WF0A 2BFUL 1PIV2 1LB2A 2BNOA 3O12A 3AMPA 2RMU2 1GU3A 5FZKA 1D4M1 4QKNA 2ZMNA 3F95A 2HWD2 1QU0A 1CPNA 2QQWA 2W9XA 3NV3A 2XJPA 1QJU1 1PX3A 3MBWA 3B3QE 1RUG1 3GHNA 3OUJA 3KHCA 1GP5A 1UW8A 3JZVA 3OBRA 4URTA 5LY2A 4MGIE 4QPIC 3OGGA 1MEC2 2OQ6A 2VMHA 3KGZA 4LKDA 1DQ5A 5F6KA 4I2OA 2YHJA 2ZAHA 2XJSA 3FZ3A 5FPXA 1UXZA 2ES3A 1K5MC 1A3KA 2XJQA 3OY8B 3LA2A 5FYSA 4R9BA 1O91A 3OSDA 4CEYA 1JI6A 4WVWA 1JZ2A 2GZWA 3LPFA 1OHFA 1ONAA 2VMDA 1YYNA 5HCBA 1H0BA 3THPA 2VC9A 4YW4A 3IT8A 3TYJA 5A6ZA 5AC93 3I97A 3J8F3 5A3WA 4EE2A 3ZSKA 4QU1A 2WT1A 4KI5M 4P5YA 5DZGA 3W58A 2XGXA 3R4UA 4ITCA 5LA9A 4AK3A 1BJQA 4ET7A 4G9SB 4PLOA 1XC6A 1HXS2 4IV1C 1MZ6A 2DYCA 1ZM1A 5E8AA 4YPJA 1NAEA 2JDKA 3B9IA 3JQXA 4LBQD 4XUPA 2VW1A 1E5SA 3J7HA 4AFCA 1MS8A 3ZXKA 5F1RA 1YJLA 2DVFA 5EQUA 1OQ1A 4CEWA 2JE9A 5L9VA 1RITA 2EICA 3I3QA 1YO8A 4V2VA 1K3IA 1RUF1 2VUAA 3VL9A 1PIV3 5DABA 3W20A 4BCUA 4BMEA 1QJX2 4ES8A 2EIEA 3NJVA 1GMMA 1C3HA 4NR1A 5KXCA 1DDLA 2QDRA 3JBG2 2BOJA 4AW7A 1BHGA 2KA3A 3FC0A 4MXVA 1PK6C 2VZPA 1GYKA 2FZ2A 1F8VA 5AC91 2B8MA 3DPRB 4NRQA 1PZ8A 2PLV3 1ULFA 1UY4A 2WWJA 2YXSA 3BOPA 4ZS3A 5T50A 4KNCA 4OMDA 2CNAA 3LF7A 3VBRA 3VLBB 1ZRRA 3DYPA 1S0DA 4CZSA 4X6RB 3O0VA 4LBJA 1FMD3 1IG0A 3ZYJB 1DQ1A 1LGBA 2BV4A 2XBO2 3C7EA 3N35A 5EWSA 1NY71 3MLKA 2VW0A 2Q8DA 2V4VA 4XCAA 3H3UA 3VKMA 3ZN6B 4HVQA 1N3OA 2A3XA 4XUQA 1PGSA 1F35A 1W05A 1H2MA 4HVRA 3ZO0B 1MQTB 1LRHA 1DYPA 3C7OA 2DDUA 1BLZA 1VBC1 2WABA 4UW4A 3JXSA 1HXS3 4BH9A 1ZBA2 1MS9A 1LOFA 3HQXA 4LOTA 4XYXA 3OJBA 2VZTA 1W8ZA 1WMDA 3LQCA 5FYMA 2P34A 1DGRN 4LK6A 3PDQA 4EZHA 3U10A 2AGSA 1POV3 4META 1KJRA 5LBEA 5IVCA 2C9KA 1UAIA 4HZFA 1OF3A 3J7MA 3N7MA 5FLJA 3O7OA 1YFUA 1PZ9A 3A0KA 4IE7A 5IATA 2R062 2QQPA 1G6NA 1HQNA 3LEIA 3D6EA 3SXWA 2UWAA 4EQVA 5FZ3A 5BNNA 4NWWA 1LU2A 2AC1A 2XVKA 3LEGA 2O1QA 2VD7A 4YVWB 5FLHA 2AEZA 3AJZA 2Z2SB 1AUYA 4RHV2 5CFCA 1RXGA 3MIEA 1J3PA 1NCQA 1ST8A 2QZ2A 2XBO3 4IGOA 4MOAA 3VZLA 2RDQA 1NCRA 5ABJA 5A3PA 5B2GB 5A1FA 1LGCA 4LKFA 4FVVA 1GLHA 3PVEA 3KMHA 1G9CA 5CBLA 1WMFA 4CDQB 4KQ7A 1JOBA 2G9GA 1XXNA 4Y4RA 2ARBA 4IETA 5GLVA 1IPKA 4ZZ5A 4DZGA 3S5AA 1YCIA 4LBNA 3ACLA 5IVJA 1KQRA 1SLIA 4Y1VA 4GIQA 5A6QA 4UT5A 2X09A 1AR82 3LAGA 1COV3 4ZKTB 4LBOA 4OHYA 3USUB 1Q8VA 2ZGOA 3A4UA 2KXLA 4OYUA 4AFAA 2Y26A 2AACA 2FCVA 5F5AA 4ZXKA 3DPRC 4NHLA 1UZWA 4RYDA 5LASA 1OF4A 5DUUA 5B4NA 1UPSA 5IJRA 4IL7A 1W90A 5FZHA 2FBEA 2C6SA 3O0XA 4N90A 1Z7S3 3PMSA 1STMA 2VGDA 3U75A 2HWE3 2FD8A 2ZHNA 4UBHA 2C26A 5T5OA 2VVDA 3OBZA 3PTRB 2CV6A 3GM8A 3GCWA 4AI0A 2VZ3A 3LGRA 1MQTC 1GQHA 2GMMA 3SCHA 1FNYA 1TNFA 5FZGA 3EO6A 1X9TA 1RMU1 1CZTA 1RXFA 1G9BA 2X10A 2YGMA 2RM21 2ZEYA 5KHHA 3IAPA 4FP2A 4BQYA 3KLSA 1CAWB 2NQYA 5FIXA 5FXZA 4CXWA 1ZBE1 4DXSA 4R52A 1W39A 5FP4A 4YFZA 3DYMA 3WDTA 5JZGA 1W6OB 2NN8A 2V09A 5EXOA 1G86A 1H6YA 1UZYA 5F3EA 1H1MA 3WW3A 1NOVA 3MLJA 4MH0E 4Q0UA 2ZABA 4D6SA 2AREA 2JD9A 4DUWA 2R073 2RJLA 1AR83 2VXRA 3LOBA 2J1RA 4LBQB 4LIUA 4HONA 1GUIA 2JDUA 1OH3A 2HJIA 3ELNA 5JOWA 1NA1B 2B7YA 1W2OA 1ENSA 1RGSA 1W3VA 4YWAA 5EJ3A 3WW1A 4LR4A 3TEXA 2E32A 1J1LA 3KHBA 4J25A 1AR71 1YQ6A 1XBFA 1K5JA 1VBD3 4WM8B 5D21A 2QQJA 4XHXA 3RQ0A 3WCRA 3AVRA 4QMAA 5J98B 4QPGC 4WVMB 1XE8A 5FMDA 2HWB3 3FLRA 5FY8A 4YM0A 3UV9A 1CD3G 2P4EA 1MS3A 2ID4A 3VL8A 1N3QA 3EMRA 3WQ7A 1YXWA 2VZQA 2XVLA 1DU3D 3G7DA 2R49A 4AXOA 2ZMLA 4CDQC 5J3UA 3WF2A 3HPNA 4H14A 1PGW2 5LZ6A 4BQ1A 1URXA 2IWGB 4LO5B 5FZAA 4YZ5A 3LDBA 2WR9A 4FOWA 3OTFA 1FPN2 2V4AA 3INAA 1O5LA 3SNMA 4CP0A 2VE1A 3KVBA 5L7OC 1PM7A 3N9NA 2RDNA 4FPOB 2BWCA 3QBQA 3RSJA 2VW2A 3DXUA 4BE3A 2VMEA 1EV11 2R071 1W3XA 4Y1XA 5C4WA 1LOGA 3WVJA 5BNOA 2D6PA 1D4VB 1S4CA 1ACCA 1PNGA 1VBE1 2VULA 4QWNA 3E5QA 4UOJA 5SV8A 2ARCA 4YZ3A 3TB0A 4P9JA 2OS2A 4C1XA 3D0SA 1WA6X 4XDQA 1HN0A 1UO9A 2ZEXA 1RUI3 4QKFA 3MUY1 1V00A 4NUBA 1UQXA 1WW7A 2XKOA 1IPJA 2YPDA 3WINE 3EJKA 1AYN1 3IIAA 3KCYA 4KH9A 3ZFFA 4ZPIA 5FO7B 2OQ7A 4FPLA 4K3UA 4H3WA 4XACA 4AQSA 4UFHA 5HCAA 3VBUA 3ZFGA 5JXIA 2TEPA 2IVJA 5JPNB 3V0BA 3RJ2X 3JCIA 4OMCA 4LTAA 3KGLA 2WJSA 5EJZB 3K4ZA 2GU9A 4H7LA 5EPAA 3FBYA 4CDUB 2A6YA 1YQ8A 3K2OA 3VBFB 2BGPA 2DCJA 3ZXGA 4QPIA 3KWVA 4MVTA 1LR5A 1D0GA 4QX5A 3CLPA 4XUTA 4XW3A 3FE5A 4MV2A 1QJEA 3HN3A 1YQCA 4QDQA 3QLQA 4XABA 4F8AA 4HK8A 1VAMA 2I74A 2PQSA 3VBHC 2A3YA 4DPNA 2WFF3 1LTEA 2ZGTA 4YNIA 3I59B 2A1XA 3IBMA 3C8XA 1LOAA 1Y3TA 3VGIA 5IVEA 1Y9GA 2FMYA 1BVP1 4BQ4A 4CXYA 3UGHA 4XMAA 5JWPA 4NROA 2XJTA 5FYZA 4QQLA 4N43A 4ARYA 2JEMA 4FTBA 1IHMA 4IV1A 3HBZA 3HIFA 4MGKE 3ACFA 1HV0A 4KBBA 1EY2A 1OXCA 3KQRA 4TN7A 1HW5A 1OPOA 4YM1A 1WLDA 2JWPA 2XLFA 4AVTA 4LHKA 4KGQA 4XFFA 1RHI3 5F7UA 1OVSA 2DVDA 3KV5A 3X29B 4YSFA 3AZYA 5A33A 4IESA 4UAPA 1TMF3 3WDVA 4JCKA 3AX4A 5JI7A 4JDMA 3SKVA 4Q1RA 3ZMNA 3PIJA 3VDAA 5HBAA 1UU4A 3DCQA 1IQDC 4K8RB 1QDCA 1OPMA 3HT2A 1CZVA 3POWA 5CKNA 3TEWA 5E6HA 3BALA 4XF1A 1W0PA 3VZOA 5CISA 3NKTA 5IWFA 4P02B 4QXHA 5CA6A 1RUE2 2OXBA 1QXRA 4IW3A 1GZ9A 3U14A 5C3RA 3FUQA 1GNZA 5JSPA 1YI7A 4J1XA 3W59A 2CU5A 2WDBA 1LHVA 1D7PM 1QOTA 2A7AA 3R4DB 4COWA 5BXXA 4QDRA 3L2YA 1C1LA 4KGGA 1Z78A 4YFWA 4D7TA 2GNMA 4LUMA 2JIJA 1R081 1CVNA 1ND2B 5C3QA 4ZY9A 2RR12 4DXZA 4XFGA 2VM9A 4LULA 3PU3A 3T3YA 5CFDB 4HKOA 4YVSB 1AL22 2RE9A 5HXVA 1QJY2 2DUOA 1TMF1 3ZLIA 4Q4Y3 4Q4V2 3ZXFA 1RIRA 1CWPA 1E5IA 2Q8CA 3ATGA 4W4ZA 4JTOA 2UURA 1A8MA 3SEPA 2B9UA 4LLOA 2HWC1 3KV4A 3OBTA 1I3HA 2Y8KA 1GZWB 1UMZA 3OY8A 4CCKA 2ZKNA 3MUZ1 3E5XA 4BJ0A 3SLIA 1MACA 4A7ZA 4P9YA 1SDWA 3GZAA 4FT8A 2CGNA 2UY8A 3KF3A 3T2QA 1IKPA 2RS31 1SPPB 2LROA 5T54A 1AR61 1SZBA 3OEAA 3HD8B 4XF0A 3T0AA 1D0HA 4ATFA 1CPMA 1W2AX 4NHMA 5C71A 2HBUA 3AFGA 4GD4A 2XHNA 4FPGA 3M70A 5FP7A 2XLAA 3SHRA 1XE0A 3TN93 2LW8A 2WS91 2DURA 1Y9QA 1W0OA 3KVAA 4QB1A 3WNNA 3H7YA 1FNZA 4Y5TA 1HRI3 1BMV1 4CPBD 1ZZ7A 2WNOA 2ARXA 1R1A1 1S0JA 2XQXA 1JYTA 4EWDA 1XPWA 2P5BA 2VG9A 3DUIA 4Q4W2 1MZ5A 5I8TA 1DF0A 2RR13 3AKQA 3GZTB 5T3NA 5LB6A 3GJBA 1VJ2A 2F6BA 4YGEA 1AL23 1MS1A 2D7FA 1QJY3 3A22A 5DAVA 5DUWA 4FQZA 5CG8A 2I07B 3E97A 3WF3A 3DPRA 4RL7A 1OH4A 3ZX7A 4FP3A 4XBQA 4FTEA 1DQ2A 1PZ7A 1H8TB 3PJQA 2D93A 4LIVA 1LOFC 2J1SA 1UY0A 4QHZA 1N1VA 5AFBA 2IXKA 2JG9B 1GWLA 1HRI1 1GQGA 2A70A 2VNOA 3P3NA 3UJOA 3E1F1 1EUUA 3OUHA 3LEMA 4JKMA 4KG0A 5DDJ2 3ZN6A 1NXD1 2GMEA 2WN3A 2YB7A 3PHMA 4LK7A 1JTZX 3NL1A 1MQTA 1I5PA 1US3A 5JOZA 5K0UB 1HKDA 4IDZA 3POBA 5DAPA 2YYOA 4KWUA 2W08A 4W8JA 5HV0A 1ZREA 1MS4A 1ENXA 4YVSC 3SQOA 2ZPXA 4NIAA 3T2OA 4PF5A 1RUJ3 5GZFA 4AHYA 2QQNA 2WRAA 4LJHA 3H1WA 1T2XA 3AMNA 1H1AA 3KCCA 3ZN4A 1AJOA 1HJGA 4JAAA 1PMJX 5JCTA 1F31A 4YG3A 4Y26A 1QQP3 1ULEA 3MZHA 1Y43B 5H9RA 2KM2A 5FO9B 4A7KA 2W1SA 4IXLA 1VRH1 2XMLA 5BYNA 4GAZA 3B69A 1UIJA 5T5PA 4CP9B 4OQ8A 4K40A 3VKFC 2ARAA 1GOGA 2DTWA 3O1MA 4O9GA 3E6BA 4OHWA 1J58A 3ME2A 1JZ5A 2DUQA 4MUVA 2JDMA 2MEV3 4L11A 4ORFA 2VCCA 4CDWB 4CVUA 4PIYA 3JD71 2P3YA 1BKZA 3B93A 5FBJA 4BIFA 1RUH3 3SMHA 2ZBJA 3I2FA 3PU8A 4I09A 4DXRA 4MZUA 3AVSA 4RFRB 3BTZA 2FDGA 1XYOA 2WC2A 4QHOA 5LBCA 2CWMA 4Y22A 4F83A 1VBB2 1WA4A 1UYXA 4QPGA 1U5YA 5FZ0A 2VOWA 4HANA 5F32A 2CAVA 1RUJ1 2VZ1A 5GJ6A 5KHIA 1VAVA 2RS52 4NAMA 4TXWA 4CUGA 5L19A 4MX3A 4OQ9A 1SBEA 1WGPA 4CDQA 1ASJ1 1LKNA 1UNBA 1WMEA 2CDOA 1UU5A 1QQP1 3B01A 5F2SA 1YUDA 1ALYA 1PO11 2HEWF 3K4DA 3VDDB 5L7OA 4LBLA 4JKKA 1WWYA 3ZYHA 3HBKA 1B09A 2J1UA 2QQMA 4JHZA 1DLCA 1PVC1 1UY2A 2HWF1 2WSUA 2C1FA 4O9EA 3UK9A 5FZ7A 2EIGA 2WUHA 1R1ZA 2DCTA 3VKNA 2AZ5A 2RJKA 1NUKA 1OBNA 1UYZA 1H8TC 1O4ZA 1RUG2 4ZONA 1JUHA 4QGNA 1W9YA 2VO5A 3U4XA 5FUPA 4UYBA 3VUOA 1AHSA 3DEMA 1LNSA 4ATEA 1AX2A 2JDHA 2JG8B 2XB6C 3MFCA 4AWDA 1JYIA 4KU8A 1BEV2 5JZGC 1HQLA 2HEYF 1POV0 1W6NB 2D6MA 4YW2A 5F3IA 1W8UA 2C5DA 4ISRA 2I45A 2YC4A 3RMXA 3WUDA 3PUHA 4C0HA 3I2JA 3FWEA 5ACA3 1CAWA 2HLEA 3IN9A 4FPEA 4FPFA 4UXAA 5FKCA 4YW5A 4C91A 2BWAA 4B29A 1W6QB 2PELA 1NT0A 2SBAA 1LOBA 2RS53 3MF6A 1LENA 2I2SA 3OEBA 4NHKA 5CADA 3DKWA 4XCBA 3QD6A 5FYVA 1VBA1 5K9YA 2VZUA 2Q0AA 3T1MA 5IK4A 5F8PA 4QPWA 1UD1A 2VUDA 4EN9B 1UL9A 1J3RA 3B7MA 5FUIA 4LNVA 4LBQA 4OUSA 2DVAA 1UZZA 4JZRA 1O4YA 2IZWA 4RS5B 2VVEA 1NA1A 4W50A 4XJZA 3OBAA 5FZOB 4DXTA 2VMIA 3LDKA 2ZAAA 2QQLA 4RN5A 5FUNA 3VHOA 1D4M3 3CMGA 1Y4WA 4A3XA 3H8XA 3CQOA 3M3QA 4GMP1 5FY0A 2XR4A 1QJU3 2VCMA 3VDCA 1RUG3 4WM8A 5KC6A 1GP4A 5FP8A 3NVCA 1JYXA 5FPAA 1DIWA 5IFPA 1REFA 4WVMA 4KBZA 1MVQA 1BVVA 4OHVA 3OPZA 4IV3B 3NWKA 2BGOA 2PFWA 4DIQA 5BUVA 3RZGA 4YW7A 1PO21 3S0MA 4PI0A 5AC92 2WA4A 2X53S 3FLTA 3J8F2 3USSA 4TTGA 5FP3A 3IMNA 1EP0A 3ZSJA 1C8M1 2J22A 4V2WA 1OQDA 1R091 4XFCA 1HN1A 2MPFA 4BIOA 5C9AB 1Z0HA 5FPVA 4D7SA 2HEVF 2TBVA 1QNWA 4XJ8A 2AH2A 3VDDC 1NY72 1XRUA 2AYHA 2E26A 3UYJA 3UL2A 1OSGA 3RI9A 4FTSA 4JVAA 4AFMA 4EWEA 4X6QB 1VPHA 4XFAA 1TE1B 2J1EA 1AVBA 4JQTA 2Y60A 4NE9A 3Q8FA 5H9SA 4WVVA 4QX2A 5A32B 4JGYC 5JR7B 1EYBA 2Y6FA 4S2DA 3MIHA 2YBPA 3WQBA 1W2NA 4D69A 1Q43A 3QH6A 3POEA 1H8VA 4LE4A 4OI2A 5I93A 2IXIA 2W87A 4Y33A 1QWRA 1RUF3 5A7WA 1ULDA 3A23A 5FY7A 5JI9A 1SBFA 5GLUA 2GSYA 5HI0A 2F4PA 2PLV2 1BK1A 3POJA 3VKLA 5LA1A 5LK5A 3H8RA 2DBNA 3PMEA 5FP9A 4MGTA 3LEKA 1E57A 1FMD2 3E6CC 3WDXA 3LB9A 4CDUA 3UKTA 3CNAA 2UWCA 2QCSB 1DQ0A 3RS6A 2HBTA 1V0AA 1KEXA 2PHLA 2ZGLA 1UOFA 1JMUB 3KB5A 3RYRA 3KCXA 2NP0A 4COZA 1BBT1 2JE7A 1SBDA 4N43C 1J83A 3VBOC 3K51A 2ZKLA 1FV2A 3C2UA 4CCEA 3I59A 2CY6A 2ZGNA 1A78A 4EROA 4S2GA 2FQPA 5C8CB 5EIYB 1AXYA 1EPWA 5FZEA 1FATA 1CAUA 4BQ5A 4DMIA 4P08A 5GZGA 2CGPA 4V1PA 4IEYA 3MGUA 4AF9A 1CQ9A 4TWTA 1VBC3 2D3RA 2ATFA 2IVIB 4G3YC 3JUUA 2GH8A 4GXLA 4E2GA 2NLRA 2B45X 1PM4A 1JZ4A 2JECA 2VXJA 4JGZC 3THTA 3PVNA 3ZYFA 4K8FA 3OYWB 1IOAA 1H4GA 1MZFA 2JDZA 1H6XA 2OZJA 4JKLA 5AVPA 5FK7A 4IV3C 4Q4X3 3WNLA 1JU3A 4BXSV 1PVXA 4HG6B 4AFBA 3HN1A 3K4AA 3ZOIA 5A7SA 5D2AA 2YBSA 4IEVA 2G9ZA 1UX7A 3O1TA 4AE2A 4NOTA 3AXEA 4CCMA 4PDWC 3RWKX 2OIIA 2ZJCA 4IEPA 3B00A 1S0BA 4ES9A 2G9FA 4BWOA 5F5QA 2BRTA 3B9CA 3N36A 3PJYA 1OC1A 1H9PA 2DV9A 2P3JA 4N9IA 2ZGMA 2IFWA 1DHKB 2Q30A 3IDBB 1IZ3A 2D5HA 2IUWA 2Y64A 2R30A 1XU1A 2WKKA 3AYEA 3BPZA 3FHIB 3NJXA 4QM8A 3RNSA 1OVPA 2VZSA 1QDOA 1YFXA 3DN7A 4EYUA 2OPWA 2HH9A 3N3HA 2XWJB 1K45A 1Q8SA 3RYKA 4LPLA 4GB31 4N53B 3VD9A 1ZBE2 4AVCA 5G04L 4BOWA 5CG9A 1UXXX 1GSLA 3A7QA 1COV2 4IE6A 2YFUA 2DTYA 4Q4X1 4QHBA 3ZN5A 2OVUA 2VZOA 1WMXA 2EA7A 1W99A 3HAGA 3V0AA 3H1YA 1JZ6A 3ABZA 1C5HA 1REEA 2W39A 3BU7A 4QT6A 2OKXA 4YVSA 1GZTA 1Z7S2 1XNTA 3MW4A 3WG4A 4Q1PA 2HWE2 4EJRA 2YROA 1PMHX 2PAMA 2RMU1 5LA0A 2DUPA 4B7KA 2HWD1 1LHOA 4XTMA 3CEWA 4PF1A 2R1BA 2VL4A 2R1DA 1F4HA 1GZWA 3HWJA 4DINB 1SLBA 1CX1A 1MEC1 1ULOA 4OI1A 3UESA 3ZKUA 3N7JA 3MPBA 4B7EA 3N9LA 2E31A 4QGLA 4SLIA 1RJ8A 2JICA 2ORXA 3AYAA 2XHKA 3FHQA 4GULA 4YG6A 4YW6A 3N4MA 2UYAA 4LBKA 1H2KA 3HVDA 4AQ2A 4CP1A 3I2OA 4PBPA 3NNFA 4UFIA 4D6RA 3T0DA 3NKGA 1IS6A 5FFOC 1RMU3 1W6PB 3BGAA 2CGOA 2RM23 4NIGA 2WAAA 3S5QA 3P3PA 3TBDA 1T6BX 1ZBE3 5FLIA 1WD3A 1EV12 2R072 2J1TA 4UF0B 4AQ6A 3RJRA 3TNPB 1OI6A 1VBE2 2GC2A 2PHRA 5GM0A 1K42A 1JU4A 4XF3A 3GHMA 3WDWA 3ZVXA 4RQPB 1NLRA 4GJZA 3WP6A 4LHLA 1VBD2 2ADEA 3CZJA 2WYFA 4M3CB 5CEHA 2GN3A 4UWDA 1WCQA 1T6GC 2HWB2 2Y6GA 2YV8A 1ND3B 4PCRA 4XJAA 5F39A 1EAH1 4GQ7A 4XMIA 1JHNA 1HJFA 1QJX1 3ZSMA 2GP5A 1AR93 4COUA 2RJ2A 3BTAA 1W04A 5EP9A 1AR73 3JBG1 4M0HA 2P6HA 4QAWA 4P9GA 4AFDA 1W06A 1VMHA 2XG3A 1H8TA 5C5TA 4N53C 5C70A 5J37A 3RFRA 5ANQA 2VTXA 2EVXA 4M01A 3ST7A 1OOPB 2K2SA 3ES1A 5LRSA 3ZXLA 2O14A 4NHYA 5A1LA 4KL1A 4OLLA 3AMHA 3RZZA 5J96B 5LW9A 1UPIA 3WW2A 5GZDA 4I0WB 1L7LA 3B5LB 4YRDA 4OI4A 1RUI2 2E7QA 5FPLA 4HOOA 1WUVA 4NWVA 3BODA 3AYCA 3OPWA 1EV13 2EXHA 2C4XA 2WNUB 3EYPA 1GQPA 3CU7A 1W2UA 2W5FA 4GH4B 3R05A 5FYTA 2QQOA 2WWUA 3AYDA 5GALA 1QOOA 1VBE3 3BIWE 2VCAA 2O8QA 2N7GA 1Q3EA 4MADA 1ZBA1 4XFIA 4YVWC 3VD3A 5A3MA 4FPJA 4NIDA 4LMFA 2Y6KA 1AR91 5JXJA 3UETA 3T0BA 2H6CA 1DQ4A 2WZR1 3H8UA 2Y0OA 3LCPA 1XU2A 3AZWA 3MLLA 4JDNA 1V6LA 5I8SA 3RMYA 4CP9A 3M1HA 5EJ1B 1N1YA 1SLLA 2W2IA 4MG2A 1AYN3 2BEOA 1JODA 3NJZA 4NJ4A 5HCFA 3O0WA 5K8SA 2ZZQA 1VE0A 5DZFA 5BY5A 4CDWA 4BPZA 3M2MA 1UX6A 3WHTA 3AP4A 1FAYA 1P8JA 3LSEA 1S0FA 1A8DA 5FY9A 3WV6A 3E6DA 3ZKYA 4CYDA 2BUKA 1E5HA 4TYSA 5D1IA 3U0ZA 4EN6B 2WFF2 3LPGA 4LORA 2IXJA 4QX7A 4MXWB 4C90A 4OUMA 5FYUA 3SH5A 4AEDB 3PVBB 1VMFA 1HB2A 2BZDA 2UWBA 2G1MA 3APBA 4RHV1 4AQTA 5I0UA 2VECA 4HN1A 4NIIA 3JU9A 3M3OA 2VMFA 4HETA 1S2KA 1ZYBA 2OUHA 3OD0A 1LULA 4QX1A 4RQPC 3TAYA 4IEQA 1NZIA 3ZFEB 3ZSLA 3Q8EA 1HRV3 1NE4A 1DQ6A 1O3SA 1WW5A 2NMOA 4XC9A 4Z82A 2D44A 3VDDA 4K1ZA 3AZXA 4HVOA 1TEIA 4FI9A 3NV4A 4UW5A 1TZOA 3AMQA 2PHFA 1Y7BA 2WNVB 1ND3C 4OCTA 4U36A 3ZIXA 3NNLA 1ZA7A 2RS13 4HSLA 4JC1A 4PI2A 1HB4A 4DRRA 1RHI2 1SEFA 2NZ9A 3KD4A 4HT1T 1ZNPA 1W03A 4L97A 2FMDA 3U11A 4QX3A 4B1MA 1O6UA 4YG0A 1J59A 2ZACA 4JGYA 5FZDA 1YFWA 1TMF2 2ZXQA 4GKXA 5A3LA 4C0BA 1WBLA 4N7UA 1U5XA 3I3EA 3DF0A 4Z8BA 1OOPC 2JG8A 1ZZBA 4AEJA 3Q9OA 4AI9A 3BU0A 3LA3A 2HWC2 2WAOA 5T5LA 4PHZA 3NNMA 5EYYA 5DQ0A 4LKSA 3BN6A 4DY3A 4CU6A 2FCTA 3DKQA 3N9PA 3R0RA 4L92A 4RR3B 5L36A 1GKBA 3WEZA 2VTXJ 4CP2A 1HRV1 3DV8A 2R043 1NX9A 2B5HA 4A44A 2WNUC 3FL7A 1C5IA 2A5ZA 2D98A 2P1BA 1FI2A 2VVFA 5DAXA 3NNJA 4DEQA 3BKZA 4Y1ZA 1W6QA 1OQEA 4LE3A 4RD7A 2Z4FA 1NA1C 1UZ0A 1TME1 2ERFA 2RS11 2QFEA 1G9AA 2D6NA 5GZEA 4RGGA 2C0ZA 4R4XA 3CIHA 3WDUA 1VB4A 2ZOEB 3VBOA 4LHNA 2DCZA 3N9QA 2Q1FA 4IERA 4J6GA 3T30A 1KS4A 3LE0A 4BXFA 1VIWB 2PAEA 4EWAA 2IXHA 4Q4Y2 5EZWA 1V70A 1MPXA 1WLCA 4UBGA 4TLGA 4CPBA 1X50A 1NLSA 2EIDA 4RS5A 3DECA 1YIPA 3QH7A 1W8TA 1R083 2UYBA 1WW6A 1ENQA 3Q8AA 2ET1A 1F2NA 2WWSA 4MSVA 4YZ2A 3DYOA 1XSRA 1UMHA 4JGZA 4YARA 3GBFA 5F9TA 4AEDC 2MHFA 3FFZA 1SCSA 4IV3A 4M00A 5JOYA 1AYM3 2R041 2Q1MA 4Q0SA 1OMIA 2HWC3 4OZXA 3DGTA 1UMIA 2RDSA 5IAXA 5BNNB 1FT9A 4PDWA 4K20A 1N1TA 2FZ1A 2VOKA 2W1QA 1N47A 1QXPA 3PLQA 3TN92 4D6QA 5FBZA 1CX4A 3WG3A 2GALA 4PQQA 5A7PA 2ZX2A 1HRI2 5EYXA 2BERA 3CJXA 2RS33 1AR63 1QGLA 3V56A 4AGRA 1X7NA 1AZDA 2QQKA 4HN0A 4XPVA 3K77A 5FXWA 1FPN1 3WD5A 4GMP0 2E6VA 4CCLA 2JKXA 3POGA 4XAAA 5BNQA 3V65A 4TSVA 2Y38A 5CVRA 3VHNA 4AZZA 2WS93 2E33A 4B8EA 4E2QA 5C7GA 1NLQA 4XDPA 2AENA 4H2AA 5A32A 4CUCA 5A3NA 2CYFA 3ILRA 1RUC3 5FV3A 2G4IA 4CDUC 1R1A3 4QXCA 4LXLA 2XPJA 3VBFC 1G9DA 4UW3A 3NRUA 1WZXA 3CJIB 5D8AB 4ZZ8A 1ENRA 3LFIA 1AYM1 1X33A 4Y1UA 1QF3A 3ZYIB 4XJ9A 1O3TA 3ORJA 2YZ4A 5IVVA 3J7LA 1SDDB 2DF7A 3J7NA 3N7KA 2R0HA 2PN5A 4D8MA 3C7FA 4RR3C 4PIZA 5IUQA 1WLTA 2GN7A 2HYKA 1G7YA 2XXZA 1O3QA 1GICA 4CU8A 4LA2A 3RZLA 4FOYA 4CTEA 3H3LA 4XF9A 1ZZ9A 5LRRA 1LHUA 4M4PA 4XE9A 4BQ3A 3UT0A 3JD72 1OD5A 3LFMA 2WSVA 5T52A 2PHDA 2X5IB 2P37A 1YIFA 4HXCA 5IVFA 2OZ6A 1ULPA 1SMVA 4YW1A 5J48A 3POFA 1DLLA 2RG4A 4I02A 4L0PA 3ZYRA 2A71A 1SACA 4E8CA 1RC6A 1SLAA 3KZ4C 4E4SA 3M3IA 1RUJ2 5E16A 5CFCB 1RUC1 4ZU4A 3RZMA 3QACA 1RVF3 3CHXA 3E5UA 3I2KA 4GKYA 4Q29A 2E53A 3URFA 5FWEA 1OKQA 1S2EA 2GC0A 1QQP2 3S7IA 3VZKA 4B4QA 3MICA 3RDIA 3U78A 1PO12 4LEJA 4B1LA 4K6BA 3FFQA 2YU1A 3OYWA 5EFUA 5KXBA 2JDYA 4QX8A 2OA2A 3SKJE 1CZSA 2HYXA 3KM5A 1Q8OA 2YMZA 2MEV2 2W52A 3R4SA 4ARXA 1BQPA 2CL2A 2VQAA 5BNNC 4DNYA 2J1VA 1F9KA 1LESA 4DUXA 1ODNA 4OUEA 1VRH3 1RUH2 3WF1A 1YI9A 4ZU5A 3SC7X 2A75A 1RINA 2OUJA 2GNBA 3LOIA 4EN8B 1X82A 3BVCA 1LECA 5KC5A 3AMMA 5A7QA 1I1EA 3JD73 4CCNA 3AC0A 4QX0A 4FFHA 5A3UA 4N9HA 5FQ0B 1RVF1 2VBBA 5J36A 1W2TA 3WLUA 2D6KA 3O1VA 4LHSA 1RUOA 4MLOA 1G9FA 4XAEA 3WDYA 4AVBA 1ND2C 4CUAA 1JZ8A 1UOBA 1QNYA 2LS6A 4N53A 5CFDC 3BTYA 5H9PA 4IE4A 4NRMA 4NHXA 4DFSA 5TSWA 1YEWA 5IK7A 2VMCA 3CJIC 4YZ1A 2VQ0A 4S2FA 1ASJ3 2Y6HA 5A6YA 4CA9A 3J9SA 2VZVA 2JKBA 4DB5A 1RUE1 3O1OA 4KU7A 1JOPA 2DFBA 4QQOA 4P5HA 1CJDA 2BU9A 2PXJA 2R32A 2WNEA 3H7JA 4ASMB 1GNYA 1PO13 4AVSA 1W8NA 5JAXA 3OGJA 4WV8A 3NMBA 1VAKA 4RA0A 5DUXA 4CCOA 4F3JA 3ES4A 1V6KA 3IDEA 1DYOA 1PVC3 1Q56A 2HWF3 2VCBA 3K48A 1XSQA 5JDBA 2GNDA 4LKEA 4AI8A 2YUEA 5FYHA 4CCDA 2WFPA 2X5IC 4YVWA 1U5IA 2CSGA 3T1LA 4XJUA 2Y6LA 4Q4V1 5ANNA 5F5IA 2Q8OA 3JB8A 2VBPA 4XEZA 1AL0G 1OLME 3AP6A 3MIGA 2PHXA 3GBGA 4JX0A 1CAVB 3CKHA 4LQRA 5ACA2 1U0AA 1WCKA 2ORZA 2ZHLA 5LATA 3ALQA 4MYEA 2PYTA 2OW4A 2RV9A 3AFKA 1W9FA 3IIIA 5L9RA 3RZJA 1DGWA 5FZCA 1DP0A 3AL5A 3NV2A 2TNFA 1KFXL 4E4DX 2B46X 1W6PA 1R092 3MW2A 1DYKA 1APNA 4FPKA 3RRDA 2LTNA 1HB1A 5AVAA 4BK4A 1KRIA 4AI2A 1GR3A 4BU2A 2VOVA 5F5CA 1LHNA 3M4FA 2VOTA 3USUA 1YWKA 4A3ZA 5BNPB 4BZ4A 4P9XA 3HMYA 2GC1A 2BOIA 2WA3A 3V64A 1VBA3 1CR7A 5F6LB 1CAXB 2R6QA 3SITA 1D4M2 4RQPA 3LD8A 1QJU2 5LBFA 3WHUA 3POIA 2CWSA 4I0AA 4P14A 1XJAA 2QTWB 1JYWA 1GFF2 3BUCA 1LAJA 2JG9C 1PMIA 1ND3A 5F3CA 3P1IA 4Q4W1 3Q8CA 5A80A 1IQAA 3ZR6A 4OHZA 4ISQA 3N9OA 4GMP3 3JB4C 1IG3A 3ZMOA 2O0OA 2QKDA 2VTFA 4XXPA 5K0UC 3TEYA 2ZA9A 4HBNA 4ZU7A 3N9MA 5JSRA 1KXGA 5HCHA 3PVOA 4I01A 1UWWA 1PO23 1OOPA 4FO9A 2VUJA 1HIXA 1OD3A 2PMWB 2Z42A 2W47A 4YGCA 4M0NA 1W6OA 2VQUA 3ILFA 1FOD3 3I2IA 3M8LA 1C8M3 3A21A 4R8HA 1R093 4QPIB 1H2NA 1LU1A 1FV3A 3HNYM 1KJLA 4Y3OA 3NW4A 4NPMA 2X05A 5IVBA 1AX1A 5DDJ1 4QXKA 1K5MB 4WZCA 3FX3A 1IS5A 3VB9A 2WNUA 3IPVB 2BNMA 4A6OA 1D2SA 2ZMKA 2W95A 2Y33A 4CDWC 3OGSA 1RUF2 5DUVA 1WCSA 3PNAA 2C9AA 5L9BA 1CN1A 1SFNA 3M3EA 4HK9A 4P9IA 1OFNA 2W68A 3WNOA 2ADDA 4BQ2A 1W28A 1GOHA 1UOGA 4FAHA 1X9PA 2W91A 1XOYA 3ZXAC 3OCPA 3QOPA 4KWJA 5FOBB 1J84A 2BTVC 2HKXA 1JUIA 2A6XA 4F7ZA 1QHDA 2DWRA 4FXKB 5F2WA 2ZTNA 5FWJA 2WQ8A 3T09A 2ZX0A 1CIWA 3PUSA 4JQRA 1N3PA 4LO6B 4BB3A 4EV0A 4QKDA 1FXZA 1PX4A 4MGZE 1FOD1 3PURA 4Z92B 4WZFA 3U4SA 2VH9A 5I0SA 1KDMA 2YDEA 4MXWA 4UI9L 5GLTA 4AEDA 2GMPA 5A33B 1JHJA 5BNPC 1DFQA 4AI1A 4HSJA 1JH5A 2GC3A 2VNGA 3WY6A 2QDNA 1IPSA 1BBT3 4Y5SA 1AF9A 1HX6A 1VBC2 2VUCA 4E2SA 2VY0A 3WCSA 4MGSA 4PIXA 2C24A 4XILA 1HV1A 4AGVA 4AR2A 1PK6B 4YZ4A 5CB7A 3VBSB 3UKVA 1VLNA 2EXJA 3IDAA 4I30A 1W8HA 4XIOA 1EPZA 5A3OA 2PAKA 3UGFA 3NSTA 3SEEA 5FK8A 4Q4X2 1NE6A 2JG8C 4QGMA 3ZXEA 3WF4A 5J1XA 4D7YA 1IS4A 1PNFA 4XIKA 3VZNA 1BK0A 3FUOA 3H8OA 2D40A 2E7TA 1RJ7A 1RUD1 3C7GA 3PUQA 4LA3A 3VD5A 3AJYA 2ZGKA 4HMZA 1OT5A 2D3SA 2A6ZA 3VBFA 1GNHA 1UKRA 3KT4A 4COYA 3AKSA 1LGNA 4QPYA 3MV01 4CDXB 4XETA 4Y20B 1JZ3A 3CO2A 2QVSB 3D8CA 5LA2A 2LM3A 5CNAA 3WNMA 4RR3A 4QQ2A 3M7AA 1BEV1 3H50A 5I0RA 1UOJA 2B9VA 1OLMA 2BW8A 2J1AA 3I3BA 3NAPB 3ETPA 4FOQA 3RI8A 2OX0A 4CRQA 3WT3A 1XB9A 3D3AA 4FQ4A 1YHFA 5C3SA 1V9U3 2ZGRA 1F5JA 1NYWA 2ZS6B 2VMGA 4RS5C 5B4XA 4DOUA 4YGDA 5JVVA 5FDBA 1UCXA 2G19A 4HKLA 4OHXA 4NMIA 3S30A 5FAXA 5KHJA 2K0GA 4GB33 5IT6A 2D5FA 2VOXA 4AVVA 1ULCA 5FXXA 1BZWA 2ZGQA 4BYYA 2D3PA 3CZUA 3Q8BA 3BOWA 4CUBA 3MIDA 2SLIA 3IKWA 3KSCA 1V6IA 2XWBB 4UFJA 4XQDA 3O1UA 4JV4A 4OI0A 4DQAA 2E7AA 1UY1A 3MYXA 3HJRA 2GNTA 2P17A 3T2TA 4BQXA 5C9AC 1SCRA 4XJWA 2YY1A 4WM7B 2WT2A 3TNQA 1OA3A 1EAH2
chains in the Genus database with same CATH topology
3WW4A 1OA4A 2RMU3 5LK7B 2HWD3 1ZZ6A 5FREA 4K7JA 2VNRA 4JTNA 1RTVA 1V9U1 2Z5WA 3ILNA 2Q5TA 5BNNA 3WG2A 1WCDJ 3B02A 5CAZA 4COVA 1MEC3 3WOGA 1RMU2 4GALA 3GZUC 2RM22 2VU9A 4PBOA 3I4IA 2JENA 3VBSC 4WBBA 4XTPA 3J8F1 1OLQA 2BQPA 5FOJB 2JD4A 2B39A 4S2HA 3PTYA 1S2BA 2ET7A 4XHBA 1SLTA 1YLLA 1ZZCA 4I3PA 4A2UA 5EV7A 1XE7A 2LUWA 1ND2A 2JX9A 4AEMA 5CFDA 1DGWX 4H7MA 4LO8A 1PIV1 2WL1A 3CJIA 5D8AA 2XL9A 3D0JA 1AR92 4CDXC 1VR3A 4FXGB 2WQZC 2WZR2 1JN2P 5E1RA 1AR72 4FPHA 3SISA 4Z07A 3NAPC 4KG8A 1X8EA 1EAH3 5C8CC 4Q0QA 1QJX3 2PLV1 3AZZA 5GLWA 2EAAA 1KITA 1TNRA 2X5IA 2E9QA 1ZX5A 1FMD1 2BNNA 3JBG3 1LJ7A 5DZEA 3FBMA 4TZDA 4N7IA 2AUYA 5E88A 1UF2C 1MVEA 4R9DA 1WLWA 2D6LX 1QH6A 5JLVA 1DZTA 3ECQA 1MZEA 5FMOL 2CAUA 1UU6A 1W6MB 3VKOA 1YRZA 3WQ0A 4Y22B 4LBMA 3RWNA 1HXS1 2WIIB 4QPGB 2A6VA 4KWKA 4YM2A 4RGAA 4YGBA 2GH2A 2ZGSA 1N1SA 4WM7C 5FPZA 3MI8A 1C8NA 1POV1 4GWMA 1S0IA 1AYN2 1X36A 4XQWA 2DFCA 1ZBA3 2ZX3A 3ZSEA 2O8OA 5L7OB 1AJKA 2WZR3 3TWIA 5E89A 4W6YA 2XJUA 2E51A 2EAKA 4YLZA 1PGL1 3EXUA 2XLGA 2JG9A 3U07A 1QJZA 2R063 4LT5A 1BXHA 1J3QA 5FQ0A 4D3WA 1A6CA 1QY4A 1OFSA 1JBCA 1S0GA 2DCKA 2XBO1 4W6XA 5K0UA 4TLFA 5JOXA 1HRV2 3NV1A 1YFYA 5JIAA 4IEUA 2R0FA 3H1MA 4LO7A 4RHV3 1GBGA 2EALA 1TME2 2YC0A 2RS12 3RYPA 2EF6A 1HLCA 1I9RA 2WQ4A 1L3JA 1COV1 1TQ5A 5JSOA 1MR5A 2OYZA 2NYYA 4HLTA 4K21A 4X8PA 4C1WA 3I8TA 3FLPA 2OPKA 2Q1ZB 4EN0A 3VBHB 5AFEA 5C33A 1DGLA 4IEZA 3WP4A 3ZXDA 1ZRFA 2R061 3AKRA 3POSA 1Z7S1 4AHWA 2HWE1 2X8KA 1QOSA 1I6XA 4AHXA 4X8NA 2CTVA 5JMCA 1CGPA 1CAVA 2XVGA 1NQJA 2MNGA 2R042 4FOVA 4I3GA 3WP5A 2NPIA 1B35B 3VN4A 2BFUS 1QXJA 2D43A 3AKPA 3AP5A 5BV6A 2ZZJA 3I2DA 4HPKB 1ZVFA 1DG6A 5BNPA 4XBLA 1TME3 5DG1A 4J1WA 4DY5A 5C6CA 4AEKA 2DCYA 1IGOA 1S1AA 1CAXA 3OD4A 1R082 3AZVA 1AR81 4OFGA 1YJKA 3WNXA 2A73B 2NMNA 4R9AA 3SCFA 1ZZ8A 5CIRA 1C1FA 4L2NA 3O5SA 4QU2A 2XJRA 4B4RA 5JPMB 3L9JT 1AYM2 4AHZA 3VV1A 4INDA 1VBD1 1W6NA 1IS3A 1HQWA 5K7PA 2HWB1 3WR0A 2ZCWA 1O3RA 3ZPYA 4SBVA 2ZHKA 3I7DA 1Q8PA 3B94A 4GH4C 2WLPA 4CEYB 3C3VA 4ASLA 1UIKA 4XOGA 5FCCA 2RS32 5KBFA 2XH6A 4QM9A 1AR62 4K9SA 1MS5A 1U12A 5GLZA 3GF6A 4A7YA 1C57A 3RG0A 5KHKA 1RB8G 3GALA 2WS92 1BMV2 1C4RA 2IC1A 1K5MA 1RUC2 1WD4A 2ZX4A 4L8QA 1R1A2 3CL1A 3IPVA 1LOEA 1RL3A 1FPN3 4AVAA 1RUI1 1XYPA 1REDA 4Y1YA 1CAUB 3BCWA 4CEWB 1KFUL 1KS5A 1GV9A 3IDCB 3ROUA 3MFAA 1LODA 3QCWA 4E9KA 3SH4A 1SQ4A 1H1IA 1I5ZA 2IXLA 4IQPA 3MIFA 3GYDA 2Q4SA 1B35C 2WT0A 2PQQA 3TRSB 4Y5Z0 4PLMA 5H9QA 5GKAC 4Q8KA 2UU8A 3ZFEC 3TOJA 4XF4A 5C9AA 4E4ZA 3VBRB 5DXDA 4YYOA 2WNVC 1XNBA 1PGW1 2LALA 2X29A 3J4UH 1RVF2 3MW3A 5IK8A 4XFHA 1O5UA 2ENRA 2WFF1 4FBFA 4BLJA 1DZRA 1PK6A 3VBSA 4L9BA 3ZYGA 3MIBA 1XNKA 2PA7A 4M3CE 3CF6E 3BB6A 5JIUA 2P2KA 3D5OA 2BVBA 4I0BA 4L99A 1G8WA 2RHPA 4P9WA 1YNAA 1MS0A 1SLCA 1X8MA 3LKJA 1WW4A 1VRH2 5FMOS 1DBNA 4OVEA 4P9LA 3SH3A 2ZGPA 2ETEA 3WZ1A 2W0XA 1CONA 1RHI1 4CEYC 1NXMA 2AR6A 4XZPA 4D94A 1UN1A 1BCXA 3KS7A 3KT7A 2NM1A 3MEPA 4CDXA 4Y20A 5J09A 4PQ9A 3WXPA 4XQ4A 4PLNA 1F5FA 2XKPA 3NAPA 3VZMA 5C8CA 4FPCA 2JJ6A 3AP7A 1GANA 1OLRA 3H3ZA 3WQ1A 2WLQA 1J1TA 3R6SA 1NCQB 1ASJ2 1PHMA 4NPRA 4Z2WA 5ABJB 2IXCA 1NCRB 4IEXA 4CEWC 4LLFA 1FYUA 3ZDSA 4NN0A 4IEWA 3VZJA 3SCGA 4M3CF 1PVC2 2HWF2 4QQPA 4Y24A 5KXEA 4Q0PA 1RUE3 1CJPA 3AM2A 4H55A 3AK0A 2DU1A 3FMGA 4JRLA 3AXDA 1O4TA 4YW3A 4Q4Y1 5BPXA 3WUCA 4WM7A 5C8WA 3VBRC 3POYA 3O14A 2ZGUA 3VHRA 3HR9A 1H9WA 1VALA 3EQEA 5T55A 5LEJA 2UY9A 4R9CA 3LA7A 4HL0A 4Q4V3 1LCLA 3N7LA 3S7EA 4GWNA 2XUMA 2BGCA 1V6JA 3J26N 3WX5A 4Q8LA 5CBLA 1HDKA 2XJVA 2EXIA 1V6MA 1JOJA 2VPVA 2QZ3A 3WG1A 3ASIA 2QE3A 1V6NA 4AYUA 1BYHA 5D8AC 4DRVA 3TN91 4IEOA 1ZRDA 3OF1A 1VBA2 1AXKA 1WBFA 4MGYE 1D2QA 2DVBA 2FHRA 1V6OA 5JZGB 2WZPP 2H6BA 4KWLA 5KXDA 1ULGA 4Q27A 2H0BA 1S55A 1AX0A 2B42B 2RR11 4WVZA 4UW6A 4OULA 4W65A 4LUKA 1AL21 1QJY1 3H0OA 1XQNA 3AB0A 4BM8A 4Q4W3 1H2LA 4XFBA 1DZQA 1PO22 4LO4B 3ZYPA 1ZA4A 2PHWA 5CFCC 2QNKA 1S0EA 1NCQC 3DL3A 3HT1A 4NO4A 5ABJC 4R4ZA 1DGRA 1FOD2 1NCRC 1C8M2 5KHGA 1JXNA 5DG2A 1OA2A 1NG0A 4K1YA 3AP9A 4AI3A 3LZZA 5L73A 5SV5A 4Q26A 3MDPA 4GA9A 5CU1A 3LSDA 2QUOA 3EHKA 1Q5OA 1W6MA 2D6OX 3L2HA 2EXKA 1XNDA 5C4WB 3D82A 5BNOB 3ETQA 4FCAA 4XBNA 5DDJ3 4M3CA 3AKTA 4G4FA 5I91A 1LHWA 5IK5A 2GDFA 1FX5A 1IKQA 1RUD2 1JYCA 4PJYA 4B4PA 5KWRA 2DU0A 3NO8A 3ZFFB 1LOCA 2Z79A 4E27A 2MEV1 1S0CA 2P3IA 5AVPA 4HFSA 1NQDA 3GNEA 3VBUB 1KD7A 2BVVA 2Z69A 3ZFGB 4BA6A 3V0BB 4Q0VA 4FSJA 1RUH1 2A3WA 1CESA 4JGYB 3G6JB 4RSUA 4W6WA 1QMJA 2YGLA 1QKQA 1BBT2 3I54A 3MPPG 4B3NA 2A6WA 1QH7A 3H9AA 4FAGA 4EN7B 3A0NA 2R16A 1O7FA 1RUNA 2ZHMA 1XYNA 2V73A 1O3QA 3JQWA 2V5YA 4RFT0 3LWCA 3D4KA 2ILMA 4GH4A 2BBVA 3IWZA 3MF9A 5J7MA 4AG4A 1VBB3 1LEDA 4BMBA 3ZXJA 3W9AA 4QQHA 2K9ZA 2PHTA 2YPJA 2JXAA 3IM0A 1GZCA 3ZIWA 4Y4YA 5FTTC 2DVGA 1XNCA 4FPYA 5LEKA 3ENRA 4N43B 4BHPA 5GZCA 3VBOB 2E63A 4BLIA 4IV1B 3VBHA 1KDKA 1UKGA 2GAUA 3EBRA 4YM3A 2XL7A 1RUD3 4HKWA 3GBWA 3S6PA 1JW6A 5I8YA 4Z1VA 3M3CA 3VHPA 1U5ZA 2D97A 2WINB 5FO8B 2TUNA 4AGGA 1M4WA 2IFRA 3UKNA 3RPQA 2ZX1A 1ZRCA 1V9U2 4JGZB 4DS0A 2BPA2 2Y0IA 2H0VA 1Q8QA 1B35A 1C28A 1SFYA 2BYVE 2PTMA 1VBB1 4JDOA 1VB2A 2QJVA 1VP6A 5ACA1 5C4WC 5BNOC 1BEV3 4NVPA 1LEMA 3ZFEA 4GB32 1AXZA 2PHUA 4HPKA 2RS51 2P3KA 4PDWB 5FRAA 3KT1A 4Q2FA 2WNVA 1NZCA 5T5JA 1H30A 4U2AA 5I0TA 3UJQA 1M06G 4QD2A 3ZFFC 4JRAA 4XXAA 3WP3A 3FJSA 3VBUC 3ZFGC 4ONUA 1H4HA 2BFUL 1PIV2 1LB2A 2BNOA 3O12A 3AMPA 2RMU2 1D4M1 2ZMNA 2HWD2 1QU0A 1CPNA 3NV3A 2XJPA 1QJU1 3B3QE 1RUG1 3GHNA 1UW8A 3JZVA 3OBRA 4URTA 4MGIE 4QPIC 3OGGA 1MEC2 2VMHA 3KGZA 1DQ5A 5F6KA 4I2OA 2YHJA 2ZAHA 2XJSA 3FZ3A 5FPXA 2ES3A 1K5MC 1A3KA 2XJQA 3OY8B 3LA2A 4R9BA 1O91A 4CEYA 4WVWA 2GZWA 1OHFA 1ONAA 1YYNA 5HCBA 1H0BA 3THPA 4YW4A 3TYJA 3IT8A 5AC93 3J8F3 3ZSKA 2WT1A 5DZGA 3W58A 2XGXA 3R4UA 4ITCA 4AK3A 1BJQA 4G9SB 4PLOA 1HXS2 4IV1C 1MZ6A 2DYCA 1ZM1A 5E8AA 3B9IA 3JQXA 4LBQD 2VW1A 4AFCA 1MS8A 3ZXKA 5F1RA 1YJLA 2DVFA 1OQ1A 4CEWA 2JE9A 1RITA 1YO8A 1RUF1 2VUAA 3VL9A 1PIV3 4BCUA 4BMEA 1QJX2 4ES8A 1C3HA 4NR1A 5KXCA 1DDLA 2QDRA 3JBG2 4AW7A 2KA3A 3FC0A 4MXVA 1PK6C 2FZ2A 1GYKA 1F8VA 5AC91 2B8MA 3DPRB 1PZ8A 2PLV3 1ULFA 2YXSA 3BOPA 3VBRA 1PGL2 5T50A 4KNCA 2CNAA 3VLBB 1ZRRA 1S0DA 4CZSA 4X6RB 3O0VA 4LBJA 1FMD3 3ZYJB 1DQ1A 1LGBA 2XBO2 5EWSA 3N35A 1NY71 3MLKA 2VW0A 3H3UA 3VKMA 3ZN6B 4HVQA 1N3OA 2A3XA 1PGSA 4HVRA 1H2MA 3ZO0B 1MQTB 1LRHA 1DYPA 1VBC1 4UW4A 1HXS3 4BH9A 1ZBA2 1MS9A 1LOFA 3HQXA 4XYXA 3OJBA 1WMDA 2P34A 1DGRN 3U10A 2AGSA 1POV3 4META 1KJRA 1UAIA 4HZFA 3N7MA 5FLJA 3O7OA 1YFUA 1PZ9A 3A0KA 2R062 2QQPA 1G6NA 1HQNA 3D6EA 3SXWA 2UWAA 4NWWA 1LU2A 2XVKA 2O1QA 4YVWB 5FLHA 3AJZA 2Z2SB 1AUYA 4RHV2 5CFCA 3MIEA 1J3PA 1NCQA 2QZ2A 2XBO3 5ABJA 3VZLA 1NCRA 1LGCA 4FVVA 1GLHA 3PVEA 3KMHA 1G9CA 1WMFA 4CDQB 4KQ7A 2G9GA 1XXNA 2ARBA 4IETA 5GLVA 1IPKA 4DZGA 1YCIA 4LBNA 3ACLA 1KQRA 1SLIA 4Y1VA 4GIQA 3LAGA 1AR82 4OHYA 1COV3 4ZKTB 4LBOA 3USUB 1Q8VA 2ZGOA 3A4UA 2KXLA 4AFAA 2Y26A 4ZXKA 3DPRC 4NHLA 5DUUA 1UPSA 4IL7A 2FBEA 3O0XA 4N90A 1Z7S3 3PMSA 2VGDA 2HWE3 2ZHNA 4UBHA 5T5OA 2VVDA 2CV6A 4AI0A 3LGRA 1MQTC 1GQHA 2GMMA 3SCHA 1FNYA 1TNFA 3EO6A 1RMU1 1G9BA 2YGMA 2RM21 5KHHA 4FP2A 3KLSA 1CAWB 2NQYA 1ZBE1 4R52A 1W39A 4YFZA 5JZGA 3WDTA 1W6OB 2NN8A 2V09A 5EXOA 1G86A 1UZYA 1H1MA 3WW3A 1NOVA 3MLJA 4MH0E 4Q0UA 2ZABA 2AREA 2R073 2RJLA 1AR83 2VXRA 3LOBA 4LBQB 2HJIA 3ELNA 5JOWA 1NA1B 2B7YA 1ENSA 1RGSA 5EJ3A 3WW1A 4LR4A 1J1LA 1AR71 4YSFA 4WM8B 1VBD3 3RQ0A 3WCRA 4XHXA 4QMAA 5J98B 4QPGC 4WVMB 1XE8A 2HWB3 3FLRA 3UV9A 4YM0A 1CD3G 1MS3A 3VL8A 1N3QA 3WQ7A 1YXWA 2XVLA 4CDQC 1DU3D 3G7DA 2R49A 4AXOA 2ZMLA 5J3UA 4H14A 1PGW2 4BQ1A 1URXA 2IWGB 4LO5B 4YZ5A 4FOWA 3OTFA 1FPN2 3INAA 1O5LA 3SNMA 4CP0A 5L7OC 1PM7A 3RSJA 4FPOB 2BWCA 3QBQA 2VW2A 4BE3A 5C4WA 1EV11 2R071 4Y1XA 5BNOA 3WVJA 1LOGA 2D6PA 1D4VB 1PNGA 1VBE1 2VULA 5SV8A 3E5QA 4YZ3A 3TB0A 4P9JA 4C1XA 3D0SA 4XDQA 1RUI3 1V00A 1WW7A 2XKOA 1IPJA 3WINE 3EJKA 1AYN1 3IIAA 3KCYA 4KH9A 3ZFFA 5FO7B 4K3UA 4FPLA 4H3WA 4AQSA 5HCAA 3VBUA 3ZFGA 2TEPA 5JPNB 3V0BA 3RJ2X 3JCIA 4LTAA 3KGLA 2WJSA 2GU9A 4H7LA 4CDUB 3FBYA 2A6YA 3VBFB 2DCJA 3ZXGA 4QPIA 4MVTA 1LR5A 1D0GA 4QX5A 3CLPA 4XW3A 3FE5A 4MV2A 3QLQA 4F8AA 4HK8A 1VAMA 2I74A 3VBHC 4DPNA 2A3YA 2WFF3 1LTEA 2ZGTA 4YNIA 3I59B 3IBMA 1LOAA 1Y3TA 3VGIA 2FMYA 1BVP1 4XMAA 5JWPA 2XJTA 4QQLA 4N43A 2JEMA 4FTBA 1IHMA 4IV1A 3HBZA 3HIFA 4MGKE 4KBBA 1HV0A 4WM8C 1EY2A 3KQRA 1HW5A 1OPOA 4YM1A 1WLDA 2XLFA 4AVTA 4LHKA 4KGQA 4XFFA 1RHI3 2DVDA 3X29B 3AZYA 5A33A 4IESA 1TMF3 3WDVA 4JCKA 3AX4A 5JI7A 4JDMA 4Q1RA 3ZMNA 5HBAA 1UU4A 1QDCA 1OPMA 3HT2A 3POWA 3BALA 4XF1A 1W0PA 3VZOA 3NKTA 5CA6A 1RUE2 1QXRA 1GZ9A 3FUQA 1GNZA 5JSPA 1YI7A 4J1XA 3W59A 1LHVA 1QOTA 2A7AA 3R4DB 4COWA 5BXXA 3L2YA 1C1LA 4KGGA 1Z78A 4YFWA 4D7TA 2GNMA 4LUMA 3V0AB 1R081 1CVNA 1ND2B 2RR12 4DXZA 4XFGA 4LULA 5CFDB 4HKOA 4YVSB 1AL22 2RE9A 5HXVA 1QJY2 2DUOA 1TMF1 3ZXFA 4Q4Y3 4Q4V2 1RIRA 3ATGA 4JTOA 2UURA 1A8MA 2B9UA 4LLOA 2HWC1 3OBTA 1I3HA 1GZWB 1UMZA 3OY8A 2ZKNA 3E5XA 3SLIA 1MACA 4A7ZA 4P9YA 1SDWA 3GZAA 4FT8A 2CGNA 2UY8A 1IKPA 2RS31 5T54A 1AR61 4XF0A 3HD8B 1D0HA 4ATFA 1CPMA 4NHMA 3AFGA 4FPGA 3M70A 3SHRA 2XLAA 3TN93 2WS91 2DURA 1Y9QA 1W0OA 3H7YA 1FNZA 1HRI3 1BMV1 1ZZ7A 2ARXA 1R1A1 1S0JA 4EWDA 2VG9A 3DUIA 4Q4W2 1MZ5A 5I8TA 1DF0A 2RR13 3AKQA 3GZTB 5T3NA 1VJ2A 2F6BA 4YGEA 1AL23 1MS1A 2D7FA 1QJY3 5DUWA 4FQZA 5CG8A 2I07B 3E97A 3DPRA 4RL7A 3ZX7A 4FP3A 4XBQA 4FTEA 1DQ2A 1PZ7A 1H8TB 3PJQA 2D93A 1LOFC 1N1VA 5AFBA 2IXKA 2JG9B 1HRI1 1GQGA 2A70A 2VNOA 3P3NA 3UJOA 4KG0A 5DDJ2 3ZN6A 1NXD1 2GMEA 3PHMA 1JTZX 3NL1A 1MQTA 5JOZA 5K0UB 1HKDA 2YYOA 2W08A 1ZREA 1MS4A 1ENXA 4YVSC 2ZPXA 4AHYA 4PF5A 1RUJ3 5GZFA 3H1WA 3AMNA 1H1AA 3KCCA 3ZN4A 1AJOA 4JAAA 5JCTA 1F31A 4YG3A 4Y26A 1QQP3 1ULEA 3MZHA 1Y43B 5H9RA 2KM2A 5FO9B 4A7KA 4IXLA 5BYNA 1VRH1 3B69A 1UIJA 5T5PA 4K40A 3VKFC 2DTWA 4O9GA 3E6BA 4OHWA 1J58A 3ME2A 2DUQA 4MUVA 2MEV3 4L11A 4ORFA 4CDWB 4PIYA 3JD71 1BKZA 3B93A 4BIFA 1RUH3 3SMHA 2ZBJA 4I09A 4MZUA 1XYOA 2WC2A 2CWMA 4Y22A 4F83A 1VBB2 1WA4A 4QPGA 1U5YA 2VOWA 4HANA 2CAVA 1RUJ1 5GJ6A 5KHIA 1VAVA 2RS52 5L19A 4MX3A 1SBEA 1WGPA 4CDQA 1ASJ1 1LKNA 1WMEA 1UU5A 1QQP1 3B01A 1YUDA 1ALYA 1PO11 2HEWF 3VDDB 5L7OA 4LBLA 1B09A 1PVC1 2HWF1 2WSUA 2C1FA 4O9EA 3UK9A 2EIGA 1R1ZA 2DCTA 3VKNA 2AZ5A 2RJKA 1H8TC 1O4ZA 1RUG2 1JUHA 4QGNA 3U4XA 3VUOA 1AHSA 4ATEA 4AWDA 1AX2A 2XB6C 2JG8B 3MFCA 1JYIA 4KU8A 1BEV2 5JZGC 1HQLA 2HEYF 1POV0 1W6NB 2D6MA 4YW2A 2C5DA 4ISRA 2I45A 3RMXA 3WUDA 4C0HA 3FWEA 5ACA3 1CAWA 3IN9A 4FPEA 4FPFA 4UXAA 4YW5A 4C91A 2BWAA 4B29A 1W6QB 2PELA 2SBAA 1LOBA 2RS53 3MF6A 1LENA 2I2SA 4NHKA 5CADA 3DKWA 3QD6A 1VBA1 5K9YA 2Q0AA 3T1MA 5IK4A 1UD1A 4EN9B 1UL9A 1J3RA 3B7MA 4LNVA 4LBQA 4OUSA 2DVAA 1UZZA 1O4YA 2IZWA 4RS5B 2VVEA 1NA1A 4XJZA 2VMIA 2ZAAA 3VHOA 1D4M3 4A3XA 3M3QA 4GMP1 1QJU3 1RUG3 4WM8A 5KC6A 3NVCA 1DIWA 1REFA 4WVMA 1MVQA 1BVVA 4OHVA 3OPZA 4IV3B 3NWKA 2PFWA 5BUVA 1PO21 3S0MA 5AC92 2WA4A 2X53S 3FLTA 3J8F2 3USSA 3IMNA 1EP0A 3ZSJA 1C8M1 1OQDA 1R091 4XFCA 2MPFA 4BIOA 5C9AB 1Z0HA 4D7SA 2HEVF 2TBVA 1QNWA 4XJ8A 2AH2A 3VDDC 1NY72 1XRUA 2AYHA 3UL2A 1OSGA 3RI9A 4FTSA 4JVAA 4AFMA 4EWEA 4X6QB 4XFAA 1TE1B 1AVBA 5H9SA 4WVVA 5A32B 4JGYC 5JR7B 1EYBA 4S2DA 3MIHA 4D69A 1Q43A 3QH6A 1H8VA 4LE4A 4OI2A 5I93A 2IXIA 1QWRA 1RUF3 1ULDA 5JI9A 1SBFA 5GLUA 2GSYA 5HI0A 2F4PA 2PLV2 1BK1A 3VKLA 5LK5A 3PMEA 1E57A 1FMD2 3E6CC 3WDXA 3LB9A 4CDUA 3UKTA 3CNAA 2UWCA 2QCSB 1DQ0A 3RS6A 2ZGLA 2PHLA 3KB5A 3RYRA 3KCXA 2NP0A 4COZA 1BBT1 2JE7A 1SBDA 4N43C 3VBOC 3K51A 2ZKLA 1FV2A 3C2UA 3I59A 2CY6A 2ZGNA 1A78A 4EROA 4S2GA 2FQPA 5C8CB 1AXYA 1EPWA 1FATA 1CAUA 4DMIA 5GZGA 2CGPA 4V1PA 4IEYA 3MGUA 4AF9A 1CQ9A 4TWTA 1VBC3 2D3RA 2ATFA 4G3YC 4GXLA 3JUUA 2GH8A 4E2GA 2NLRA 2B45X 2JECA 4JGZC 3THTA 3PVNA 4K8FA 3OYWB 1IOAA 1H4GA 1MZFA 2JDZA 2OZJA 4IV3C 4Q4X3 1PVXA 4AFBA 3HN1A 4IEVA 4AE2A 4NOTA 3AXEA 4PDWC 2OIIA 2ZJCA 4IEPA 3B00A 1S0BA 4ES9A 2G9FA 4BWOA 5F5QA 3B9CA 3N36A 3PJYA 1H9PA 2DV9A 2P3JA 4N9IA 2ZGMA 2IFWA 1DHKB 2Q30A 3IDBB 1IZ3A 2D5HA 2R30A 1XU1A 2WKKA 3AYEA 3BPZA 3FHIB 4QM8A 3RNSA 1QDOA 1YFXA 3DN7A 3N3HA 2XWJB 1Q8SA 3RYKA 4GB31 4N53B 1ZBE2 4AVCA 5CG9A 4BOWA 1GSLA 1COV2 2DTYA 4Q4X1 4QHBA 3ZN5A 2OVUA 2EA7A 3HAGA 3V0AA 3H1YA 1C5HA 1REEA 2W39A 3BU7A 4QT6A 4YVSA 1Z7S2 3MW4A 3WG4A 4Q1PA 2HWE2 4EJRA 2YROA 2PAMA 2RMU1 2DUPA 4B7KA 2HWD1 1LHOA 4XTMA 3CEWA 2R1BA 2R1DA 1GZWA 3HWJA 4DINB 1SLBA 1MEC1 4OI1A 3N7JA 3MPBA 4B7EA 4QGLA 4SLIA 1RJ8A 2JICA 3AYAA 4GULA 2XHKA 4YG6A 3N4MA 2UYAA 4LBKA 1H2KA 4AQ2A 4CP1A 4PBPA 3NKGA 1IS6A 5FFOC 1RMU3 1W6PB 2CGOA 2RM23 3P3PA 3TBDA 1ZBE3 5FLIA 1WD3A 1EV12 2R072 4AQ6A 3RJRA 3TNPB 1OI6A 1VBE2 2GC2A 2PHRA 5GM0A 4XF3A 3GHMA 3WDWA 3ZVXA 4RQPB 1NLRA 3WP6A 4LHLA 1VBD2 4M3CB 2GN3A 4XJAA 1T6GC 2HWB2 2YV8A 1ND3B 4PCRA 1EAH1 4GQ7A 4XMIA 1JHNA 1QJX1 3ZSMA 1AR93 4COUA 3BTAA 1AR73 3JBG1 4M0HA 4P9GA 4AFDA 2XG3A 1H8TA 4N53C 5J37A 2EVXA 4M01A 3ST7A 1OOPB 2K2SA 3ES1A 5LRSA 3ZXLA 4KL1A 4OLLA 3AMHA 3RZZA 5J96B 1UPIA 3WW2A 5GZDA 4I0WB 3B5LB 4YRDA 4OI4A 1RUI2 2E7QA 1WUVA 4NWVA 3BODA 3AYCA 1EV13 2EXHA 2WNUB 3CU7A 4GH4B 1W2UA 3R05A