2BWAA

Structure of endoglucanase 12a (cel12a) from rhodothermus marinus in complex with cellopentaose, 20 minute soak.
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
226
structure length
226
Chain Sequence
TVELCGRWDARDVAGGRYRVINNVWGAETAQCIEVGLETGNFTITRADHDNGNNVAAYPAIYFGCHWGACTSNSGLPRRVQELSDVRTSWTLTPITTGRWNAAYDIWFSPVTNSGNGYSGGAELMIWLNWNGGVMPGGSRVATVELAGATWEVWYADWDWNYIAYRRTTPTTSVSELDLKAFIDDAVARGYIRPEWYLHAVETGFELWEGGAGLRSADFSVTVQKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE
publication title Dimerisation and an increase in active site aromatic groups as adaptations to high temperatures: X-ray solution scattering and substrate-bound crystal structures of Rhodothermus marinus endoglucanase Cel12A.
pubmed doi rcsb
source organism Rhodothermus marinus
molecule tags Hydrolase
total genus 62
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2005-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2bwaA00
1YNAA 1XNKA 3AKPA 3VHNA 1H8VA 1H1AA 4S2HA 3VLBB 3AKSA 1HIXA 3HD8B 3MFAA 3VL8A 3WQ0A 2JEMA 5HXVA 1M4WA 2VGDA 3RI8A 1KS5A 4S2DA 3VZLA 3AMQA 3MFCA 4XQ4A 1XNCA 1H4GA 3RI9A 3VL9A 4HKLA 2JENA 2BW8A 3WP5A 2DCZA 1OLRA 2VG9A 3VHPA 1XYOA 4S2FA 3WP4A 1PVXA 1OA3A 2D97A 3MF6A 4HK9A 3AMPA 1QH7A 1HV0A 4XQDA 5K7PA 3WX5A 1IGOA 2BWCA 1OA2A 2BWAA 3VZMA 1HV1A 2DCKA 3AMHA 2B46X 3M4FA 2F6BA 1REFA 2NLRA 3WP3A 2VUJA 3MF9A 3WXPA 3LB9A 3EXUA 1H0BA 3WR0A 4HKOA 3ZSEA 1BVVA 3VZKA 1BCXA 1OLQA 2VULA 1H4HA 1AXKA 1REEA 3WQ1A 1UKRA 2D98A 4HKWA 1TE1B 5EJ3A 5K9YA 2QZ3A 2BVVA 3AMNA 2DCYA 4XPVA 3VZOA 1XYNA 1C5IA 1XNBA 3B5LB 1OA4A 1REDA 2JICA 1KS4A 4S2GA 4NPRA 2DCJA 1F5JA 1BK1A 2NQYA 4HK8A 4XQWA 1UU4A 3VZNA 1T6GC 3VHOA 2DFCA 3VGIA 3AKQA 1UU5A 3WY6A 2QZ2A 3AKTA 3AKRA 2DFBA 1XXNA 1XYPA 4IXLA 3WT3A 2Z79A 1ENXA 3WQ7A 3LGRA 1UU6A 1W2UA 2C1FA 3O7OA 1XNDA 2B45X 3B7MA 1C5HA 1QH6A 3AMMA 3VZJA 3WP6A 2B42B 4H7MA 1NLRA
chains in the Genus database with same CATH superfamily
4UWDA 5FYBA 2J1RA 1S4CA 2WC2A 3EQEA 1ENQA 1QWRA 4Q4W2 5M0TA 4YZ3A 4QB6A 1C8NA 5IJRA 4YYOA 3Q8CA 5ACA3 1NX9A 2OUJA 2WUHA 2XR4A 1IPKA 2YYOA 4AGVA 5FXXA 4YW5A 1SMVA 2FDHA 3FHIB 3KZ4C 5KXDA 5LA0A 3KV6A 1ULEA 3R4DB 5FY8A 4AI9A 2VZOA 1S2EA 1RL3A 5ERLA 2GAUA 3GALA 4H55A 3SH4A 1AXYA 2AR6A 1KEXA 2UY8A 2A3WA 3ZSMA 2RE9A 1LJ7A 1QJX2 1WD3A 5EXOA 1BEV2 3VDBA 3WNPA 2R30A 1QDOA 3C7HA 2W1QA 2YGMA 3IMMA 3J7MA 5EQUA 3ZKYA 5IHRA 2J1UA 3E5XA 4JRAA 4LNVA 4E4ZA 3N7JA 1GZWA 5SV8A 4BLJA 4TLGA 4X8NA 3ZKUA 4L92A 4QPIC 4XQDA 4EQVA 1BVP1 1OD5A 5C3QA 3VKNA 2G9FA 5FLJA 1DF0A 2XQRA 2ZX0A 1RB8G 2JDPA 4IGPA 1UN1A 3CDZB 3NV3A 1PZ8A 1OMIA 1V6LA 4YSFA 1HXS1 5HV0A 3THCA 5FLHA 3U4XA 1J58A 2JIJA 1ND3A 3LA2A 1QJX3 1AX0A 1BEV3 3QBQA 2WYSA 2R062 2Y6JA 1W8HA 1D2SA 4NROA 4A6SA 2E7AA 5IATA 1LU1A 2TNFA 2W68A 4OFGA 4XUTA 4EWDA 1NA1C 4IV1C 2HWD1 4BQ1A 3JD71 3ZSEA 2VZ1A 2ZX3A 4KU8A 5GZDA 1KFXL 3WW4A 3B93A 4EN8B 5FO9B 3WQ1A 1WWYA 4FPKA 4CDUB 1AJKA 1W6PB 5A7PA 4O9GA 5JCTA 4UF0A 1PO12 4CP1A 4M3CA 1AX1A 4DEVA 1VBC1 3J7HA 4BB3A 4P9YA 4BQ3A 1VMHA 3MO4A 2V09A 2XLFA 3BTZA 3BPSA 2CDOA 5KC5A 4WM8B 3CU7A 1OURA 2HJIA 3H3LA 3IIAA 2R063 4LBMA 3SITA 4CP2A 4EZHA 1RUI1 2BNOA 3BCWA 3VB9A 1WLDA 2AEYA 1DYOA 4YFZA 3KWVA 2ZMLA 2HKXA 2RS11 3MIBA 3S7EA 1Y3TA 2ZA9A 5IVEA 1PVC1 1KDKA 5K0UA 3VV1A 1IS6A 2MPFA 3AKRA 1XNTA 4QGMA 5DAVA 4GH4C 1I6XA 2D43A 1G9FA 3OEAA 5FPZA 1QDCA 1SLAA 4BH9A 4XF4A 1M06G 2JE9A 3K75B 4R9DA 1LOGA 1GP4A 1ULPA 1PO13 2ZGNA 3Q8BA 3WP6A 5C8CA 5C8CC 3IIIA 1FNYA 5BPXA 2XL9A 5BNOA 1D0HA 3LA7A 5KHGA 2Y6FA 3BPZA 1QQP1 3I7DA 4JZRA 4DXTA 3W20A 1ZZ8A 2ZX1A 1B35C 2VTXA 4LBQA 2GP5A 3VHNA 2RG4A 5LY2A 1AUYA 3V0BA 2E6VA 1OPOA 3FZ3A 3OF1A 5EZWA 3ZYJB 3C8XA 4PIYA 4TSVA 1UWWA 2J7MA 1MEC2 3QACA 3OSDA 3BI3A 1VRH2 4R52A 2BERA 1M4WA 5H9SA 2CTVA 4CEYA 3K4ZA 1RUG3 3THDA 2IVJA 1GMMA 3H7JA 5A1FA 1XNCA 1X82A 3MHZA 1OPMA 3VBHC 4CDQB 5FPBA 2QQPA 5EV7A 3VL9A 4BQ5A 4LEJA 3AYCA 3J26N 4QPYA 5CFDC 3ME2A 4O9EA 5AVPA 2NMNA 5F8PA 5FZ7A 4EYUA 5LATA 5BNPA 5BNPC 1W6OB 2WZEA 3AMPA 2WAOA 5FKBA 5LA1A 3UKVA 3E1F1 5LBBA 2V4VA 4KG0A 3RGBA 2CGNA 2IXIA 2OKXA 4OQ8A 1EUUA 1RUC1 1YHFA 2Y34A 4X6QB 5FR3A 3N9NA 4Q29A 3AJZA 2WRAA 2VMIA 3I2IA 1KGYA 4MVTA 4YZ4A 2BRTA 5DUWA 3HT1A 2PQSA 1W6NB 3GM8A 3TNPB 1MEC3 3CL1A 4AHYA 3VBUA 1VRH3 4GALA 4W50A 5ISLA 2VZ3A 3TRSB 4KU7A 3ZSLA 3ALQA 4MLOA 1URXA 5T5PA 5L9BA 4UBHA 2XXZA 2PAMA 3RJ2X 1PIV1 1YIFA 1ZBE1 1C8M2 1AR72 4LK6A 5H9QA 3RZZA 2FMYA 1ODNA 2PAKA 4QHZA 5I0SA 5LW9A 5CNAA 4ORFA 3ZXJA 2H0VA 5F37A 2OYZA 2G9GA 1GWKA 2YY1A 3NRUA 5JDBA 1AR81 1UXXX 3KCCA 3BKZA 2W5FA 1YI7A 1W6QB 1I5ZA 2VMEA 3CF6E 3SXWA 4BOWA 4K8RB 2X5IA 3OUHA 3B69A 3PVBB 4FOVA 4MGZE 4P9XA 2WT0A 3HR9A 4HSLA 4JGZC 2BZDA 4MADA 3B5LB 2VE1A 4DFSA 1REDA 4HLTA 1FPN3 3KV4A 1C4RA 1T6BX 1DDLA 1XC6A 2DWRA 2VBDA 4NWWA 1H6YA 1GQPA 5FJKA 2YMZA 3NV2A 1CX4A 4AFAA 4NIGA 1WGPA 5FP4A 1C8M3 1AR73 1Y4WA 2VUAA 4MXWB 1HB4A 5GLWA 5IT6A 1NCRA 5TSWA 4HVQA 1C57A 1GZTA 2VZVA 5FYSA 4YPJA 4BMBA 3AC0A 1JU4A 2DFBA 4NOTA 5F5AA 4F3JA 4F7ZA 1O3QA 4P14A 3W5NA 1UMHA 1K3IA 1R1A1 2RJKA 4CEWB 5JMCA 3VD3A 4AAPA 2NN8A 5DAPA 4SBVA 1QXPA 1JS9A 5IWFA 2X09A 2PTMA 1RHI3 1W8TA 2X53S 4GD4A 1I1EA 3ORJA 3O0XA 4NHMA 4CPBA 3FLPA 4PI0A 2XLGA 4FQ4A 3S57A 1BZWA 4XJWA 2JJ6A 3ZMOA 1JOPA 5C70A 1YCIA 2PHTA 4IGOA 2P4EA 4COZA 2OUHA 5ANNA 3RS6A 3LDBA 2XWBB 1B09A 1RITA 5JVVA 3RWNA 1JYWA 2VMCA 4BA6A 1ST8A 3S6PA 3UKNA 2WAAA 4D0QA 2WSUA 4PJYA 2ARCA 5D2AA 5CADA 1JXNA 2X8KA 3DN7A 3VD7A 5JR2A 4P9IA 1GZWB 4GWNA 4LHLA 4CDWA 4FVVA 1W39A 4CCMA 4FPOB 4O7XA 3D0JA 4QPIB 2P1BA 3QLQA 3K3NA 3M2MA 2AENA 4HANA 5DG2A 4FPFA 2VNRA 3A4UA 5EFUA 3PJYA 3LOIA 5FXWA 2BJSA 5J37A 2ZEYA 2XUEA 1COV2 1QH7A 2Y6HA 3RDIA 3MDPA 1O4YA 4UFJA 5C3OA 5JOXA 3IB3A 3N9MA 4XBLA 5FP9A 2O1QA 2XJUA 1SFNA 3NNLA 1FOD3 1YJLA 1LOBA 2YBPA 4L99A 1FT9A 4RQPA 4XFGA 5FZFA 1UQXA 4YZ2A 2XL7A 4FCAA 2F6BA 2YC0A 5FPAA 3RZLA 2D6NA 1DQ6A 1NA1B 4IV1B 1QJY2 1W05A 1LHUA 3KVAA 1Y9QA 1XRUA 4IV3C 4NPMA 5KBFA 1BLZA 1WD4A 2HBTA 4I0BA 5FYYA 1W2NA 2EXIA 1H8TA 4J1WA 1UKGA 3GZEA 4P08A 3H1MA 4Q8KA 3LQCA 1BYHA 1Q3EA 4MHRA 4UF0B 4HKOA 3W9AA 3WF2A 3WR0A 4TTGA 1X36A 1RGSA 3WHUA 1WCKA 3HJRA 4PLOA 1COV3 1LODA 1SCSA 5JSPA 1U5IA 1ASJ2 1MS8A 3WDVA 5ACA1 4BQYA 3KD4A 3FLTA 3M8LA 1F15A 1O4TA 1N1TA 1LULA 1TVGA 2VVEA 2XVKA 3QD6A 4PDWA 4PDWC 4XF9A 4TYSA 1SZBA 4J25A 4LBQD 3BIEA 3URFA 4ARYA 4NRQA 2BPA2 2UY9A 5C4WC 1IS4A 4XC9A 4F83A 1N1VA 4HBNA 1DP0A 4I0WB 4Q1PA 1QJY3 4WVZA 4AVCA 2VZSA 4LUKA 2W1UA 5KXBA 1UZZA 4LKFA 2PA7A 3POGA 4MXVA 2ET1A 2OZ6A 3BN6A 4Q8LA 4XQWA 4GH4B 5JZGC 3WINE 3M1HA 3RRDA 3VHOA 5KR7A 4L0PA 3INAA 2QDNA 3K77A 4B4PA 2WO2A 3AKTA 4OUEA 5C8CB 4IEOA 3ZSKA 2WNUA 1O3TA 4HT1T 4BPZA 4MUVA 2ZMKA 4AEDC 1JZ4A 1ASJ3 4CTEA 5BNNC 2VCAA 3CNAA 3BALA 5F2SA 5DAQA 2RVAA 1B35B 3SCHA 4CP9B 2DUQA 1DHKB 4YWAA 2BP6A 1CONA 1VB2A 3AZXA 4HZFA 3ZFFA 1JHJA 4FTEA 4H7MA 1HRI2 1DGWA 5T50A 1U5YA 1JH5A 1QMJA 4WVMA 3VN4A 1X8EA 1G9BA 1ZRFA 3SQOA 1ULDA 5LBCA 1GOFA 1ND2C 1VMJA 3N7MA 1DZQA 3D4KA 4D6QA 4Z2AA 1QJX1 1A8DA 1JW6A 1BEV1 2RHPA 1V6NA 1H30A 1Q8SA 1QOSA 3VBHB 1F4AA 4COVA 1YWKA 3JQXA 2VXJA 4GWJA 1WMXA 2J1TA 1RUF3 2DUPA 4A6OA 3TAYA 2P3YA 5T54A 5A1LA 5CFDB 3M3OA 4OHYA 1WUVA 1PO22 1KS5A 4E8CA 1G7YA 1SLTA 1RUD2 1WLWA 1DU3D 5A7NA 1QF3A 4K20A 4ZS3A 5BNPB 5FMDA 2EA7A 2RDNA 3M3EA 3U37A 5F39A 3KQRA 4FAGA 3WP5A 3HWJA 4GB32 5KHIA 3VKFC 5C7GA 1PZ9A 4RN5A 2D3PA 3M3CA 1QXRA 2WN2A 3UGHA 5J09A 4JKMA 2E33A 3H3ZA 5DAXA 3FMGA 3D8CA 1HRI3 3DF0A 4AI1A 3EB7A 3L9JT 2WQ8A 1UZ0A 2JWPA 4F8AA 1Z7S2 2R061 5IVFA 3IDAA 3PUAA 1VE0A 2UWAA 3DL3A 3VKLA 3H8RA 2FDKA 2VUDA 1CN1A 4ITCA 1NT0A 1PO23 4TWTA 3DXTA 2FCTA 1TME3 2D6KA 1RUD3 2WQZC 3NVCA 3NNFA 4NUBA 4QGLA 5CYYA 5LK7B 3NKTA 4FFHA 4JQRA 4LLOA 5ANQA 2VD7A 5IK4A 4XABA 4DPNA 4UW6A 1NE4A 2RR12 3V0AB 3APBA 4GB33 4P9JA 1PO11 3GF6A 5BV6A 5DUVA 3OUJA 4AI0A 3I2GA 3LIHA 1QXJA 4HG6B 3SEEA 1ENRA 1UY2A 4XETA 4JGZB 5LRSA 2C9KA 5T3NA 4CPBD 5IVBA 1WLCA 4TZDA 3BTXA 2AREA 2YC2A 1W9YA 4XILA 1FAYA 4Y22A 5EJ3A 4QPGC 4EWAA 2QVSB 3AMNA 2OPWA 5FOBB 1YFWA 1Z7S3 3ASIA 1K12A 4XE9A 4YW4A 4B29A 2P2KA 3OGVA 4LORA 4Q2FA 3AXDA 3WW1A 1K5MA 1K5MC 5EYYA 1GNZA 1RUG1 4YG0A 4NAOA 4CU7A 5JXJA 4CCNA 4UT5A 4BXFA 1X8MA 3P6BA 2K46A 1WA4A 4LPLA 2J42A 4AQ6A 1AJOA 2VY0A 4YZ5A 1DYKA 2IXLA 2YUEA 2RR13 4Q4V2 2IXCA 3MIGA 4PLNA 3FBMA 4GKXA 4RSUA 3T09A 3VBOC 1CIWA 1UZWA 3H9AA 2QZ2A 1NY72 3T2QA 4CCJA 5CA6A 1ZYBA 1ZZ6A 1XXNA 3ZR5A 2ZX2A 4TN7A 5GZCA 3KM5A 5F5IA 5FQ0B 1ZZ7A 1N3OA 3T30A 3WQ7A 4WM7C 1MVEA 4HL0A 1YC61 3WCRA 1QY4A 4H7LA 3HBZA 3DPRC 2WR9A 2BNNA 1YLLA 4FOYA 4GZ9A 1JHNA 5FMOL 4XDOA 1Q5OA 1MEC1 2IXKA 1VRH1 4HXCA 3OOXA 5FZGA 2WT1A 4ZU5A 1LOCA 4DY3A 1W8UA 4BMEA 3VBFA 3OPWA 2PN5A 4JTOA 1H1AA 2Y38A 3TBDA 3KCXA 2BOIA 5I93A 4AFDA 3MFAA 4Q0PA 3VL8A 1CAUB 4L8QA 2WNOA 2P34A 3WDUA 5FPVA 4Q4V3 4DNYA 5C71A 1PGL2 3W59A 4AW7A 4DO0A 4RS5C 3OCPA 3GZUC 2ADEA 4S2DA 3SISA 4KBZA 4IEPA 3MFCA 2WL1A 5L73A 4Z1VA 4MOAA 1IQDC 5EIYB 2VO5A 3ETPA 3NO8A 4OYUA 2VMFA 3LE0A 1S2KA 3ENRA 1OLRA 5HV4A 1CAXB 1O59A 4ASMB 3PVEA 4Q26A 3H7YA 2EXKA 1NUKA 4Z2WA 1MACA 4QPWA 5HCAA 1FPN1 1YEWA 2VQUA 1VPHA 2W95A 3O1PA 2C9AA 4N43A 2XONA 4V2WA 2FD8A 2BWCA 4ASKA 3FUQA 3OB8A 3IT8A 1SG3A 4IV3B 2ZCWA 1C8M1 1AR71 4LHSA 1WW7A 2QDRA 4ZONA 3QH7A 4AEMA 2XOMA 1E5RA 2BYVE 3I59A 3MW4A 4ZXKA 2E7TA 3E5UA 3ZN6B 3SLIA 1OOPC 2BNMA 2ZEXA 1NLSA 1R1ZA 5LBEA 2ZHLA 1RHI1 2DVFA 1ACCA 4PBPA 1O7FA 5LASA 1EAH2 4XMAA 2DBNA 2VMDA 2HWE2 4L2NA 2W91A 1RXGA 1C1LA 4FQZA 3TEYA 1ULGA 4QX0A 4BQ4A 1AVBA 5L7OA 4QKBA 5C4WB 2E7QA 4QHOA 5GZEA 2VBPA 1XSQA 2VJXA 1OUSA 2UURA 3P3PA 4KG8A 4BYYA 2D98A 1TE1B 1V6MA 2JD9A 3VBSC 4YRDA 1GOHA 2Y33A 1H2NA 4Q4X3 1YFYA 3VZOA 1VIWB 2GNMA 4LKSA 5ABJC 5JZGB 5FDBA 3I97A 2KXLA 1CIYA 4L97A 4FTSA 2C24A 4ZY9A 2GP3A 1MR5A 1HQWA 4AGRA 5A3TA 3WCSA 4YFWA 2F4LA 3KHCA 1ZNPA 4AEDB 4IE7A 2Q5TA 5BNNB 2SLIA 1UPSA 1JYCA 2DFCA 1PK6A 1PK6C 2LUWA 2E51A 2R6QA 2C0ZA 4IEWA 4UYBA 4QQLA 4IEUA 5LZ6A 4DB5A 5CG8A 4CCCA 5FZBA 2HWE3 2GNDA 1QKQA 4IE6A 1CPNA 2IXJA 4KWLA 2Y0OA 3JB4C 4HETA 2W3JA 4PQ9A 5JPMB 1LB2A 4CP0A 1ND2B 1PMHX 3HOBA 1H2MA 2W08A 2ZGKA 1FOD1 1JMUB 1JZ6A 1UZYA 1VALA 4RGKA 3AZYA 3C7OA 3ZXEA 1SLCA 3KGZA 4FXKB 2BBAA 1APNA 3BIWE 3T1LA 4CA9A 3U0ZA 5DAWA 1AR62 2V5YA 2GZWA 1MS0A 1W06A 4QQOA 4IESA 4R9BA 4NHXA 4X8PA 2DYCA 4ZZ5A 3WQ0A 5F2WA 3OPZA 1UF2C 3LSDA 4UAPA 1AX2A 4ZXEA 5JOZA 1YO8A 1BJQA 4D7SA 3ZYFA 1COV1 2VQAA 4XQ4A 5F3GA 2DVAA 1LRHA 4Y1ZA 1G6NA 2EALA 3MLJA 1AL22 2VW2A 3CIHA 3ZFEC 5IVVA 3KT7A 5JOYA 1O3SA 4HOOA 1VBE2 3HIFA 2C5DA 1H1IA 2ZX4A 4WVWA 4Z82A 5GJ6A 1RMU2 4S2FA 2D97A 1F5FA 2PELA 3WG3A 2RJ2A 1R64A 3LD8A 2LRPA 2ZGUA 4XZUG 1MS3A 3ZLIA 3NKGA 1QJY1 2FBEA 2GSYA 2YU2A 3C3VA 3OJBA 1GU3A 3PIGA 1AR63 5I8YA 3GYDA 2VC9A 2D6LX 1S0CA 3D82A 4GULA 4LUMA 4UFLA 1W90A 5FPUA 2ZAHA 3V0BB 3N9OA 1ZRCA 3OG2A 2W0XA 2AEZA 2J1AA 4ONUA 4ES8A 1HLCA 1SHWB 1E5HA 4XURA 1IQAA 4GWMA 3GXUA 5JUVA 5A7WA 2GC0A 2NLRA 2D6MA 4QQPA 2WWUA 1XE0A 1ASJ1 1AL23 2IFWA 2XJQA 1TMF2 4FOQA 4JGYB 4PT6A 3ZIXA 5A32A 1W99A 3RVHA 1VBE3 2VM9A 3T2TA 2B9VA 1H9WA 3O5SA 2BBVA 1PGW2 1RMU3 4QPGB 4Y20B 5LA2A 4A42A 2JG8A 2JG8C 2HYXA 5CKQA 1QIQA 4QB2A 5E8AA 1UY3A 1X50A 3C7GA 3TEZA 4Q4W3 2WZR2 2BTVC 1RUH2 1H4HA 1AXKA 3USUB 1K5MB 3WEZA 2XJVA 4XFFA 2XHNA 2VZRA 4XYXA 3IZOA 4LTAA 4KQ7A 4P5YA 1VAMA 5IUQA 3CKHA 5C5TA 3RZMA 3AFKA 4XDQA 1PHMA 5FZOA 1LU2A 3BODA 4MX3A 2E31A 1RUF1 4UXAA 4K21A 4N53A 1NZIA 1ZX5A 4XCBA 1V00A 4C0HA 1ND3C 2D44A 2EICA 2JKXA 1IS5A 1J3QA 3VBOB 3ZN4A 4YM3A 4ZU4A 1W2AX 4P9GA 1UMIA 4DUXA 4NN0A 5DZEA 1OFNA 1TMF3 1TQ5A 3A21A 4WM7B 2ZGPA 3VDCA 3DPRB 4IE4A 4NIDA 1LESA 1HRI1 3BTAA 2YGLA 2WZR3 1RUH3 2D93A 4MG2A 1ENXA 3I2DA 1S0BA 1SLLA 4E8DA 4JDMA 2XJSA 3ZFGA 3LGRA 1QU0A 4MGQA 4CSWA 1JUIA 3FL7A 2VW0A 3HVDA 4QDQA 4CDXA 3I3DA 3RZJA 1WCUA 3VZJA 4JV4A 3S7IA 3J8F2 3NJXA 2WINB 1OQ1A 3Q8FA 4I09A 1K45A 2JX9A 4Q27A 1YFUA 2Z4FA 5FY0A 3BYWA 3IPVB 1EV12 3FHQA 4ZU7A 1E5IA 1PO21 4AHZA 3BVCA 1TME1 1RUD1 4RS5B 3SHRA 3TEWA 4B1LA 4URAA 3LEGA 2RM22 3ACLA 1UXZA 4LULA 2WN3A 4GB31 4PIZA 2HEWF 1TG7A 4GJZA 3ZMNA 5FLIA 5K0UC 2CL2A 4DXZA 1WCSA 3LDKA 3KF3A 3M7AA 3AMQA 1OQEA 4CXWA 3WNMA 2RS32 1QOTA 3GHMA 5FP7A 5LA9A 4D7YA 1YXWA 2EAKA 2WYFA 1V6KA 3AK0A 2ATFA 2WA3A 2D3SA 1Z7S1 4ZZ8A 4ZS2A 5BNOC 3H1WA 3WF0A 3ZOIA 5C3PA 5IK5A 3I49A 4D94A 3MF6A 1W8FA 4YVWA 1IG3A 4HK9A 3I4IA 1QJZA 1NYWA 4QX8A 2TUNA 3WG2A 1EV13 4R4XA 1S0EA 2A6YA 1JYNA 1DIWA 3VD5A 3CZJA 2PLV2 3GZAA 3I59B 4FP3A 2RM23 3ZDVA 2WFF2 3MV11 2F17A 1OOPB 4RR3A 1DLLA 3PVNA 5FY5A 3M4FA 2NP0A 2RR11 5FBJA 4AQSA 4YG6A 4LBKA 4CEYC 2W39A 4PF5A 3E97A 2GDFA 2YBKA 1V6JA 5GKAC 4YGBA 4P00B 2VUJA 5FZ1A 3ZVXA 3POEA 2RS33 1ALYA 1J84A 2R042 4OZXA 3VHRA 3HMYA 4JDOA 3JBG2 3MIHA 1V70A 1FATA 1DFQA 1EUTA 1YFXA 4OLLA 3ZX7A 2CAUA 4DUVA 3LB9A 3OD4A 4BQ2A 5GLZA 4IL7A 4BWOA 3LIGA 3VBSB 1U0AA 3FE5A 5FZLA 4XJZA 1QJEA 3ZYPA 1GQHA 1AZDA 2D7FA 3B3QE 3E6DA 4RFT0 2JG9A 3RMYA 2HLEA 5ABJB 1N1SA 1JN2P 2R0FA 1A8MA 2PLV3 1OFSA 4IUGA 2ZGRA 2WFF3 3E6CC 2QQVA 3A0NA 5F32A 1SQ4A 2Q8OA 2QCSB 3VBUC 4Q4V1 2A6VA 1H9PA 3V65A 4DMIA 2KD7A 1PK6B 3SC7X 1NY71 1TNFA 5L36A 4ZHNA 2AZ5A 4JC1A 5CU1A 4QWNA 2EF6A 3JXSA 2R043 1CR7A 4AOCA 4ATEA 4AEJA 3JBG3 1J83A 2X05A 3N9QA 1HB1A 2YV8A 2CYFA 1DG6A 3NNMA 3WDYA 4LBJA 4BLIA 5J3UA 3IKWA 4CUAA 4MGYE 2PHRA 5LRRA 2FZ1A 2VR4A 5FP8A 3DEMA 4WZFA 4OHZA 3SH3A 4BZ4A 1UY1A 1ZRRA 4FPEA 3T2OA 5I0RA 4BK5A 2AUYA 4JKKA 1Q43A 2X5IC 2WLQA 1WBFA 4J6GA 1YUDA 4NHYA 3UKTA 5EWSA 3HN1A 1QH6A 2C26A 4QX5A 1JZ3A 2CSGA 2X29A 3PTYA 4LA2A 5A7QA 4Y5Z0 1POV0 1AL0G 5CEHA 5FYUA 4YW3A 5JIUA 4OI0A 1PGL1 1KRIA 1KD7A 3U07A 2QJVA 5FWJA 5JR7B 4FFGA 1OLMA 1H8VA 1DBNA 1CZSA 2GC2A 4E4HA 4S2HA 4GMP0 3ZSJA 4COUA 3HD8B 4Z92B 1NCRC 3T0DA 2FDGA 3ZFEB 4AG4A 4CU8A 3HEIA 1LR5A 2WFPA 3ES4A 4I30A 2JDKA 3RYKA 3FFQA 4CRQA 4P5HA 4E4SA 2DV9A 2CGOA 1GYKA 2QQKA 2UYBA 1MZ5A 4LK7A 3BU0A 2VECA 4Z8BA 5CKMA 4QXKA 1FYUA 4HKLA 1D4VB 3CHXA 4Y4YA 2UWBA 2OQ6A 3O1OA 2JD4A 5A1AA 2ZKNA 4AQTA 3NQHA 4Q4X1 2O8OA 2K2SA 2P3JA 3WDXA 3ACIA 1DGRN 3MV01 1CAVA 1IGOA 1SPPA 5FZ0A 3ST7A 5JPNB 3BUCA 1W9TA 5GALA 1WA6X 4B1MA 1UL9A 5FK7A 2OS2A 4ZKTB 1LEMA 4Y1VA 2QKDA 3O1TA 4LKDA 5F9TA 3WUCA 1OVSA 2HWE1 3ES1A 4CDWC 5HBAA 1O5UA 2ES3A 1L7LA 2HWF2 2JG8B 3D0SA 3DCQA 4PI2A 4CU9A 4YM2A 2N7GA 1VAVA 5FXVA 4AZZA 1POV3 3ZR6A 4YZ1A 2QBXA 2UWCA 1NKGA 5LWBA 1ZRIA 2DF7A 3LOBA 3BTYA 1UYPA 1XBFA 4QAWA 3I2KA 4NHLA 1JYXA 2YFUA 5JXGA 2XB6C 1DGLA 1SFYA 2WNVA 1N3QA 4CXXA 3RYPA 2Q1FA 4OI1A 1ULCA 4IEYA 3WDTA 2DURA 4IE0A 3SCFA 4OCTA 1NLQA 3R0RA 5GZFA 1ND3B 3HPNA 1ZA4A 5K9YA 3UYJA 4RQPC 3FN9A 3VD9A 2DCYA 2F4PA 5FYMA 2PHXA 2HWB2 2QQUA 1LOFA 3O0VA 2DCJA 2ZZJA 1FX5A 1PM7A 3WZ1A 1AYN2 2NM1A 1H2LA 2HWF3 2NQYA 3B01A 4Q0QA 1H8TC 2TEPA 4K1ZA 4G9SB 3B94A 1MPXA 4OHVA 4PIXA 5K4LA 3B9IA 5FRAA 2ZGSA 4M3CB 1CGPA 2I74A 2Q8EA 3VGIA 2GALA 3NWKA 1AXZA 2IXHA 4RGGA 1NAEA 4NAMA 1UYZA 1QOOA 1MQTA 4GAZA 2RS52 4AI2A 3M3QA 2A70A 1QJU2 2D40A 1IPSA 2D6PA 2YXSA 4LJHA 2Q1ZB 1AR61 3OTFA 3A7QA 3PMEA 5FYHA 2EIDA 4QDSA 1NCQA 3AMMA 1ZM1A 2PFWA 2G4IA 2HWB3 2SBAA 3ZDSA 2K0GA 3KQ4B 5K0UB 2EXJA 1F2NA 2FQPA 2ZXQA 4XAEA 3SMHA 2QQOA 4FT8A 1QJFA 4QX1A 4DS0A 4EJRA 3NJZA 3NAPA 3NAPC 1AYN3 5JAXA 1AL21 3LEIA 4QQHA 4Y5SA 1VBE1 2A1XA 5IFTA 5IAVA 1RMU1 4LHKA 4FP2A 4WZCA 5BNOB 2WNUC 3G7DA 3KHBA 1X9TA 3LEKA 3PU3A 4UFHA 2NPIA 3VZLA 3VUOA 1O3RA 4Q4W1 5J96B 4HN1A 1RUE2 3BGAA 2C4XA 5A6XA 2RS53 1SFPA 3K4DA 2VZTA 4RL7A 1QJU3 1S0FA 2FCVA 4LBQB 5FMOS 5A7OA 1GBGA 1KITA 1LTEA 1GQGA 2AC1A 2A73B 4Q0UA 4YW2A 5A3OA 3ZFFC 3VDAA 3L2HA 4UW4A 4AVVA 3UGFA 3VHPA 4C90A 4JDNA 4IEQA 3WP4A 1Y9MA 2EVXA 4N9HA 5A70A 3DGTA 4HVRA 4Q4Y2 4XXAA 3JZVA 4C0BA 4CEYB 3B9CA 3CEWA 5K7PA 2UU8A 3GNEA 4N90A 3OYWA 3S5QA 3WX5A 1PM4A 4QXHA 4O65A 4GXLA 3CJXA 5JXHA 1IZ3A 4XIKA 1TMF1 2YPJA 3OUIA 2Q8DA 1HDKA 2QQMA 1X9PA 5FZ6A 1C3HA 2NYYA 1W6MA 3IBMA 5HI0A 4NPLA 2OIIA 2ZGOA 4AHXA 2FDJA 1PGW1 5LEKA 4COYA 5FREA 3POIA 2RMU2 2O14A 2IWGB 2WZR1 4XHBA 1RUE3 3POYA 1RUH1 3IDEA 3MF9A 4K7JA 1ZZCA 4I3PA 1TEIA 4B3NA 1BBT2 5JSOA 4A4AA 2W1SA 3CJIA 3ZYRA 1XE8A 1H0BA 1LAJA 3GCWA 2RDSA 5CVRA 1VBD2 4W4ZA 5CFCA 3WF4A 5CFCC 1JTZX 2HBUA 4P02B 4LO6B 3VBUB 2WIIB 5FZ4A 4QMAA 5FZEA 4Q4Y3 1OSGA 3AL5A 3V64A 4IERA 4TXWA 3VDDC 3VDDA 4META 5FV3A 3UGGA 1W0PA 2BFUL 5FIXA 4NMIA 2ADDA 1CAWA 1F8VA 4HFSA 5J98B 4CUBA 3ECQA 1Y7BA 3AM2A 4OMCA 4AK3A 4D69A 4N7IA 1HN1A 1LOEA 1OA4A 1RXFA 3DYMA 4Q0SA 4D7TA 2MHFA 2YHJA 3KMHA 2VOXA 4FPHA 5CAZA 1UZVA 2Y6LA 1F5JA 4IDZA 2RMU3 3MGUA 5A3MA 4JVAA 3UJQA 2QQNA 3NJVA 3RWKX 4C1XA 1BBT3 3UETA 5HCHA 2CY6A 3LPGA 3KV5A 2X5IB 4E27A 4Y33A 4FO9A 2VNVA 3CLPA 2WNEA 1UU5A 3J8F1 3NJYA 1EPWA 1VBD3 5EP9A 1GKBA 1X7NA 2A6WA 1XYPA 5FUIA 1H2KA 1UPIA 3GJBA 5T5LA 1EV11 4QGNA 2JDNA 3RMXA 4GJYA 2ETEA 3NL1A 2RM21 3BU7A 4XUNA 1XNDA 2OQ7A 4P9WA 3UJOA 5AC92 1C28A 1HX6A 4FFFA 3THTA 2B42B 3WG4A 2ZHMA 5T52A 1NCRB 3R6SA 1IHMA 2VPVA 1ZBA2 2PHUA 2VNOA 3V56A 2GMPA 4XUQA 2VZPA 4DY5A 2RDQA 2YC4A 4LO5B 2Y6KA 1BHGA 2VUCA 4AVSA 2RS31 3F2ZA 1DQ1A 4RA0A 1HN0A 1W8NA 1N47A 2PHDA 3KT4A 3T0BA 1XU1A 1Z78A 2JEMA 5FFOC 2ORXA 4KMQA 3ZXKA 4FPJA 3T1MA 3TN92 1DGRA 5E89A 2G9ZA 4W6YA 4LLFA 1GP6A 1NG0A 1LECA 1OF3A 1UOGA 2Z5WA 4ISRA 4BK4A 4M01A 1RUC2 5IVCA 4YM1A 2PLV1 1FMD2 1WMFA 1J3RA 4UI9L 1EP0A 2WFF1 5AFEA 4Y1UA 1HQNA 3R4UA 2WWJA 5AC93 1PVXA 3HNMA 3D6EA 1SCRA 5K8SA 1G8WA 1DZRA 3C7EA 3HNYM 4I3GA 1ZBA3 3VBFC 5FOJB 5KHKA 5E88A 2QFEA 1L7RA 3H8OA 1OA2A 3VZMA 4CDWB 3S0MA 3GHNA 1UY4A 1QNWA 4XIOA 3E6BA 1XOYA 2R041 3WNXA 4EZ4A 3JBG1 3LSEA 1QGLA 1Q8VA 2P3IA 2VAUA 3AZVA 4D8MA 4B7EA 4D6SA 5C3RA 1I5PA 1BMV2 5AFBA 3SEPA 3TN93 2CNAA 1T2XA 3ETQA 5B4XA 4A45A 2XJPA 4CDUA 4XMIA 2QE3A 4XDPA 2W52A 4NE9A 4M3CE 3HQUA 1ZRDA 1ENSA 4OUSA 4UW5A 1VBA2 1HQLA 3EXUA 2ZABA 1FMD3 3K3OA 2ZZQA 2AACA 5FY9A 2BUKA 1LHNA 4RQPB 3VZKA 3IMNA 4N43C 2VOWA 3P3NA 4DQAA 2H6BA 2HH9A 2UYAA 2ZEWA 1KDMA 2XWJB 4OUMA 4QD2A 3WG1A 2GN3A 4WM8A 3VBRA 3VBRC 4AVBA 4V1PA 3UK9A 2JXAA 4IGQA 5JI9A 4DRRA 3RYRA 4XUOA 2OW4A 3MYXA 4XPVA 1H8TB 2P37A 5FWEA 4BHPA 4KBBA 5FZCA 2DTWA 4LBNA 4C8DA 4YG3A 5JI7A 3TOJA 3HT2A 3JQWA 3RG0A 4XJ9A 1DZTA 2GH2A 2Z42A 3I2JA 1JYTA 1CJDA 4ISQA 3TYJA 1OHFA 1CZVA 2GNBA 3VZNA 1YQCA 4PDWB 1WW4A 3I3MA 1VBA3 4ES9A 3K48A 4FOWA 2CGPA 2DVDA 1BK0A 3ZN5A 2VVDA 1ZA7A 2P3KA 3SKJE 1X33A 4QX3A 2ET7A 3WY6A 1W8WA 4BCUA 5L7OC 1BXHA 5EYXA 2R1DA 1V9U2 1AYM2 1UOBA 2HYKA 4JAAA 3MZHA 4FTBA 1O4ZA 3WOGA 4JCKA 3CZUA 3OY8A 4LITA 5FUNA 2J1SA 3O7OA 4XFCA 1UYYA 1LHWA 4CVUA 4B4QA 1D7PM 3NAPB 2R0HA 4AEKA 2LM3A 3JB8A 1PNFA 3PUQA 3CO2A 4HPKA 1YNAA 1F4HA 3DV8A 4PLMA 2O8QA 3LAGA 4V2VA 4CDQA 3S5AA 1W9SA 2QQJA 2Y0IA 2WNUB 2IZWA 2PHLA 1R082 1W2OA 2R49A 5BNQA 1WMDA 1POV1 3GBWA 5FY4A 5FK8A 1EAH3 5I0DA 3J9SA 3AX4A 4EE2A 4OVEA 1DLCA 1W6OA 1DCSA 4MH0E 5FZIA 4WV8A 2WA4A 1YQ6A 3SNMA 3ZFFB 4A41A 1LOAA 3RI8A 3UESA 3USSA 1RIRA 2L9LA 3RJRA 4XW3A 1V9U3 1AYM3 2XBO2 4WVMB 2J22A 3MPBA 3WW3A 1R092 4XFHA 3EYPA 1JOBA 3RI9A 3I2OA 2JENA 3WUDA 2FCUA 3OYWB 4IE5A 1W6NA 3MPPG 1FV3A 1OKQA 1DGWX 5L19A 4MZUA 1RTVA 3QH6A 1YQ2A 2OA2A 2IUWA 4LKEA 1OH4A 1WW6A 1MS9A 5HXMA 4UW3A 4AQ2A 4M0NA 3VKMA 1E5SA 2C6SA 2DCKA 2HWF1 1OI6A 3M3IA 3WNNA 3AJYA 1R083 2VBBA 1FXZA 4XCAA 3ELNA 4YW6A 1XB9A 4W65A 3ZXGA 3ILNA 2XH6A 1Q8OA 1V6IA 1NE6A 3MBWA 2FZ2A 2ZMNA 1REFA 1GZCA 2Q4SA 2BGCA 3PU8A 4OI4A 2WBKA 5CFCB 3K4AA 4JKLA 4XBQA 1FNZA 2XBO3 1QHDA 5DDJ2 4DRVA 1G9DA 5GM0A 1R093 4YVSA 2D5FA 4YVSC 2IFRA 1A6CA 3VDDB 1KJRA 4XHXA 3WDWA 3N9PA 3AVRA 4NR1A 1CAWB 2DVBA 4U2AA 4XFAA 5DN2A 1W0OA 2AGSA 2BU9A 1Y9GA 2HWB1 5D21A 4LOTA 4E2GA 2VOVA 4KI5M 3MI8A 4MHUA 2E26A 2ZKLA 1W0NA 1AYN1 4MXWA 5A3WA 1S55A 2WZPP 3O14A 4JHZA 3FUOA 1C5IA 1RVF2 1S0IA 1XNAA 3NNJA 2Y60A 4S2GA 1CPMA 2IVIB 5C6CA 5FYTA 4CEWA 2EIEA 2ZOEB 5E6HA 1Q8PA 5CBLA 3DYOA 2P17A 3H0OA 2RS51 3OGSA 5DDJ3 5DQ0A 1L3JA 1QJU1 1WBLA 2B5HA 5F1RA 2A3YA 4IEXA 3FFZA 4KWUA 4Y22B 2VQTA 3H42B 1W8OA 3AKQA 3HNBM 3NV4A 4LIUA 3I3QA 2XG3A 2QQLA 3OEBA 1POQA 5F3IA 4OHWA 3AYEA 1JZ5A 1BKZA 4LIVA 3U78A 1ZZ9A 2W46A 2DU1A 1KJLA 1GNHA 2LTNA 4XEZA 5IVYA 1PGSA 4K6BA 3N7KA 5DG1A 4A3ZA 4CUCA 4AF9A 1SDWA 4NRPA 5G05L 4A7ZA 4XUPA 1J1LA 4B8EA 5LY1A 1RVF3 3H1YA 4N53C 5BYNA 4M3CF 5F3CA 4QHBA 2G19A 3UNPA 4IW3A 4XF0A 4BIOA 2P6CA 2JECA 2V72A 2ZHNA 4EV0A 4QPIA 4Y24A 4H2AA 3O1MA 1RUE1 1PMIA 3K46A 1H6XA 1HIXA 1UD1A 2GC3A 3O1VA 2X10A 2XDVA 3AZWA 3LKJA 1GICA 3JCIA 2DU0A 4FPYA 3KVBA 5FYVA 5HPOA 3RZHA 4AWDA 2YROA 1JU3A 4HSJA 4Q4Y1 2H0BA 4MV2A 1D2QA 4WVVA 4Y3OA 3ZFGC 1GNYA 3VBFB 2FHRA 4CDXC 4PCRA 3AFGA 4CCLA 5JLVA 1WKYA 2BW8A 2ILMA 3MLLA 4R4ZA 3RNSA 2ZBJA 5IW0A 1HKDA 4CCDA 1NA1A 4IV1A 4XBNA 4YLZA 4MO3M 4UFMA 1LCLA 3FX3A 3P1IA 4KL1A 5FTTC 4AL9A 1DQ5A 5FYCA 2ZGQA 1HV0A 1MZ6A 3GCXA 4AI8A 3N35A 4XJ8A 2RMU1 2ZPXA 5FPXA 1Q56A 2OT7A 2I07B 3OBRA 1BBT1 2B46X 3DYPA 2DVGA 1HW5A 5CIRA 4C91A 3PIJA 3WF3A 1AR92 2WS92 4GWIA 1G9AA 4QX7A 1VBD1 3OBZA 4N7UA 4FPGA 4CU6A 3PDQA 4N43B 2DTYA 2WDBA 3EO6A 2XVGA 4K8FA 5JOWA 3WD5A 2YB7A 1VMFA 3LFMA 3AVSA 1W3XA 2ZAAA 3VBRB 3J8F3 4KWJA 3WNKA 4QQ2A 4YVWC 5FZAA 4KGGA 1FI2A 1OQDA 1UIKA 2O0OA 1BVVA 3I2HA 4YGEA 5A7SA 2XKPA 4RGAA 1V6OA 2W2IA 3PLQA 5FY1A 4D3WA 1RUG2 2EIBA 4PF1A 4A7YA 2GMEA 4EN9B 2EIGA 1EPZA 5KHJA 3MW2A 4ATFA 4XACA 4GH4A 3MLKA 1ULFA 2WQ4A 3HQRA 4Y4RA 1A78A 4RR3C 2AH2A 1XU2A 2WKKA 1TNRA 1WZXA 1ULOA 1W8ZA 4AYUA 1A34A 1IG0A 2R072 4DXRA 3POBA 3U1XA 4X6RB 5B4NA 2K9ZA 3IN9A 2CAVA 1AR93 2WS93 4K1YA 3KSCA 4Z07A 4H3WA 3K2OA 4XTMA 1OKOA 5BUVA 5L7OB 4CP9A 3D5OA 1B35A 2MNGA 2WO7A 2YFZA 3T4HB 3W5MA 2BGOA 1GSLA 3O1SA 4GA9A 3WV6A 2WWSA 3ACGA 1J1TA 1O6UA 3PNAA 1WLTA 3LDRA 3AYAA 3OY8B 5AC91 2VMHA 5AVAA 3U11A 3POFA 3TNQA 2JG9C 3AP5A 3KLSA 2TBVA 3PURA 2WO3A 3KGLA 2Z69A 3QCWA 1ZBA1 3R05A 4KGQA 3T08A 4LO7A 5H9PA 3PVOA 4L9BA 1VB4A 3I8TA 4HPKB 4JHTA 4LO4B 4QM9A 4ARXA 1LHVA 3T0AA 3VBHA 2H6CA 4EN7B 3MIDA 5GLVA 2B45X 3DUIA 5CFDA 2ZGLA 2R073 2ARXA 2JE7A 4G3YC 3H50A 1K42A 3DXUA 3TN91 1P8JA 3K51A 1N3PA 1JZ8A 2DBIA 1ODMA 2G1MA 5H9RA 1D4M2 2ARBA 2JIGA 5DZFA 2A6ZA 5CG9A 3ZYHA 1G86A 2Q30A 1F9KA 5CB7A 3ZYBA 1FMD1 2E32A 2A7AA 3EHKA 2Q1MA 3POSA 5FZMA 1QNYA 1FPN2 3ACFA 4WBBA 5JMOA 1RUJ2 2DCTA 2W9XA 4JTNA 4GKYA 3A23A 4NO4A 4YM0A 3RPQA 4MGKE 4IETA 2PQQA 1UNBA 4A2UA 1XYOA 3Q8AA 3R4SA 2KA3A 1CQ9A 2D3RA 2VW1A 4NIIA 2A75A 4E4DX 2XJRA 5B2GB 1DYPA 3H3UA 1BMV1 1XSRA 1EY2A 5HCFA 2JDUA 4OI2A 2Y8KA 3ZM8A 4YW7A 2BWAA 2J1EA 2VQ0A 1RINA 1D4M3 1UY0A 5FKCA 4DOUA 1YQ5A 5A3PA 3WHTA 3WNLA 3V0AA 3ITQA 3WVJA 1RHI2 1XPWA 1IKQA 1E57A 3BOWA 1VBA1 5CKNA 5FBZA 5FAXA 4YVSB 2ZACA 4JGZA 3LZZA 2LALA 1LKNA 1VBB2 2JDHA 1PMJX 1CZTA 2ZGMA 3PUSA 4B7KA 1RUJ3 4QB1A 1HB3A 3AP6A 3O0WA 4R8HA 3O1RA 1S2BA 1UOFA 1S0GA 3HQXA 1YI9A 2DDUA 3QOPA 4LO8A 3NV1A 2B8MA 3LCPA 2HWC2 5EJZB 3PMSA 1BCXA 4IEZA 4XAAA 4A7KA 5FZHA 5A7WB 4H14A 1REEA 4QDRA 5J7MA 1UIJA 3OBTA 3T4VA 4ASLA 3ATGA 5LB6A 5FZKA 4Q5OA 5I8TA 3FLRA 5EPAA 5A32B 1EAH1 1XYNA 2OZJA 3OGJA 4QT6A 2XQXA 2JICA 1UX7A 2XHKA 1Q8QA 2B7YA 4XFIA 5KXCA 1SACA 3MUY1 4A44A 2PMWB 3ZYIB 2QUOA 2CDPA 3DKWA 1VBB3 1HB2A 5FQ0A 1K5JA 3U10A 1V9U1 1AYM1 4Q0VA 3ZPYA 2PHWA 4GQ7A 1BK1A 1PX4A 1OXCA 2XJTA 3KT1A 4AFCA 4HK8A 1KFUL 1YYNA 1UU4A 1SLBA 1ZZBA 2E53A 1UW8A 3KCYA 4XZPA 1FOD2 2D6OX 3AZZA 1MZFA 3GZTB 3PHMA 4GMP3 4OMDA 5F6LB 4NIAA 1KXGA 4AXOA 2MEV2 1IPJA 2BFUS 3OD0A 5FZOB 2WNVC 4AFBA 2HWC3 3PJQA 1SDDB 5IVJA 1OVPA 5BXXA 4N53B 4LT5A 4LE3A 5DABA 1UO9A 2AYHA 5A80A 2XPJA 3RSJA 1OC1A 5C3SA 5I91A 3ZXAC 2R16A 1CAUA 1YIPA 3PUHA 1R081 2C1FA 2PHFA 4NHKA 2CU5A 3B7MA 5J36A 1LOFC 4AE2A 3UT0A 4BIFA 5APAA 3B02A 3MIFA 3OPTA 4D6RA 1HRV2 3VD4A 1XNKA 1NZCA 2E63A 2Z2SB 2ARAA 3FC0A 1F31A 3PL0A 3EMRA 2PYTA 3ZIWA 3N7LA 2XVLA 2XBO1 2R32A 5C9AA 5C9AC 1CAXA 3AKSA 1R091 2QQIA 4K40A 2NZ9A 3ZFGB 4RHV2 2BEOA 1O5LA 4CDXB 3O12A 1S0DA 3N36A 4LHNA 1US3A 2MEV3 1LGCA 3PTRB 1YRZA 4YGCA 4LMFA 4FBFA 1MQTC 2VTFA 4I2OA 3ROUA 2OXBA 3LF7A 4AFMA 3RZGA 4E9KA 1MVQA 4IV3A 4AR2A 1LGBA 3AL6A 3MUZ1 4MSVA 4XF3A 1NCQC 3POJA 3NNGA 1GWLA 2ZS6B 1RJ8A 2GN7A 4LBOA 1W28A 4XFBA 2DUOA 4XJUA 3LPFA 5EHDA 4BJ0A 3I54A 4J1XA 4EROA 5IAXA 3HAGA 2W94A 3ZN6A 1HRV3 5A33A 1I9RA 3UL2A 5DDJ1 3CQOA 4LR4A 4OZOA 3C7FA 5JWPA 3CMGA 4FAHA 5IYYA 3P5BA 4M4PA 4QM8A 4RHV3 2JDAA 2VZQA 2RDRA 3DECA 3ON7A 4Y1XA 4XF1A 5FO8B 3T3YA 2XKOA 5C4WA 4YVWB 1CD3G 3FWEA 4XTPA 4NRMA 4JX0A 3GJAA 3U4SA 1WW5A 1SBFA 1GR3A 1VR3A 1Z0HA 2NMOA 4DXSA 4BU2A 1CJPA 2GNTA 3KB5A 5JZGA 2BGPA 3T2PA 4RR3B 1RUF2 1RVF1 4R9AA 5A3UA 4HVOA 1HXS2 1EYBA 3IWZA 5C5UA 3ILFA 4CE8A 2ORZA 3LA3A 2CV6A 2W92A 1OF4A 2ZGTA 4LA3A 2VCMA 1U12A 4DUWA 1GP5A 2HEVF 4AEDA 5BNNA 4I02A 4AAXA 4EN6B 2HWD2 2JDZA 5J1XA 3JD72 4BQWA 2PXJA 4K3UA 3LEMA 2RJLA 3OBAA 4BXSV 4E2QA 5C33A 4NPRA 1DQ2A 1C1FA 2VCCA 2VOTA 1GFF2 3LFIA 1RJ7A 2JG9B 2WSVA 2Y64A 3DKQA 5FYIA 3U14A 1ND2A 3CJIC 3JU9A 3OGGA 4SLIA 4UOJA 3D3AA 3GDBA 4INDA 1VBC2 2ID4A 1VAKA 3WW2A 1T6GC 5KWRA 1GWMA 1W9WA 5DPNA 4G4FA 4CZSA 1RC6A 4OULA 5G04L 4CCEA 2XMLA 4QKNA 2XUMA 1VJ2A 1HXS3 2J1VA 2ZEZA 3L2YA 4QU2A 3ZXDA 1D0GA 3Q9OA 1W9FA 3MEPA 3E5QA 4YW1A 1TME2 1Y43B 5D8AA 5D8AC 2WJSA 2XLAA 5FP3A 5FUPA 2BQPA 1RUI2 1UU6A 2A5ZA 2WO1A 3ABZA 1XQNA 4NVPA 4BISA 1A3KA 2HWD3 1C5HA 2RS12 4LE4A 4N9IA 1NQJA 3JD73 4XOGA 1PVC2 1H1MA 2VOKA 1W03A 3OGRA 5BY5A 1IS3A 4Y1YA 3MW3A 3N4MA 3AP7A 2LROA 4EN0A 5HCBA 1JZ2A 2EAAA 1CWPA 1U5ZA 3G6JB 1BQPA 4IQPA 2OPKA 2B39A 4UFKA 4N8MA 3ZYGA 1J59A 1VBC3 4UFIA 5CZKA 1GOGA 2XGXA 3BB6A 2VGDA 1QQP2 2GH8A 2WABA 4MGIE 2QNKA 1U5XA 5FPLA 2RV9A 5F5QA 5GZGA 5D1IA 2BDRA 1O8PA 3I3EA 4W6XA 1H4GA 1MS4A 1UMZA 2JKBA 4QKFA 2FDIA 5CISA 1JODA 1RUI3 2DCZA 5FXZA 2WLPA 2VG9A 3SCGA 3C2UA 3JUUA 4CXYA 3NMBA 4FPLA 1QEXA 4ZPIA 2RS13 4W6WA 1PVC3 5LBFA 3H8UA 4BE3A 1AR91 2YBSA 1JOJA 2WS91 5IK8A 2ZHKA 3KV9A 1OD3A 5A6ZA 4JGYA 4JGYC 1HV1A 1WMEA 1N1YA 3AMHA 3N9LA 3NSTA 1STMA 4IEVA 4QPGA 1LENA 4Y20A 5F3EA 2YZ4A 1SEFA 3F95A 2GMMA 3ZXFA 4A3XA 2VCBA 4AI3A 2BV4A 4TLFA 4M00A 1QQP3 1US2A 2B9UA 1W3VA 3USUA 1CVNA 4R9CA 3WP3A 1VP6A 1OBNA 1HJGA 4B4RA 4XVHA 1MZEA 1CAVB 2VXRA 1SPPB 3MICA 5F5CA 5FZ3A 3ZXLA 3WXPA 2Y26A 3J7NA 4AVTA 1OUXA 4OHXA 1WCDJ 4C1WA 3IAQA 3KF5A 3WQBA 5KXEA 3NW4A 2P6HA 5F7UA 2LW8A 4HMZA 2R071 3VBOA 4LOSA 5JIAA 1OLQA 1ONAA 3WSOA 4DZGA 3AYDA 1GANA 1PIV2 1ZBE2 5IFPA 5JSRA 3BOPA 2WT2A 4WM7A 2QZ3A 5KHHA 2BVBA 5FMBA 5A6YA 1CX1A 2A6XA 3DPRA 4FXGB 1JZ7A 4QXCA 1AR82 1W2TA 1PNGA 4Y5TA 1L7QA 1FV2A 1W6PA 1XJAA 2JDYA 1KQRA 4U36A 2VU9A 4URTA 3TEXA 4CDUC 5LCWL 1RUOA 3W21A 3PUIA 3POWA 2WNVB 3HBKA 4RYDA 1RUC3 3LWCA 3FHAA 3A22A 4XXPA 4MGSA 4CCOA 3Q8EA 5A6QA 4OQ9A 3IPVA 4E2SA 2IC1A 3I2FA 1VRBA 4QKDA 4UBGA 4IXLA 4L11A 4RS5A 2VTXJ 4WM8C 5F6KA 4ET7A 5LEJA 1WCQA 3TB0A 2Z79A 1PIV3 2CHHA 5GLTA 1JBCA 3AB0A 3AP9A 1ZBE3 2ZJCA 3IDBB 4FSJA 1D4M1 2FDFA 2OX0A 5DXDA 3X29B 1OH3A 3U75A 3I3BA 4PBOA 5C9AB 4M0HA 1NXD1 2VH9A 1NLRA 2YU1A 2R7EB 4LQRA 5T55A 1AR83 3GGLA 1ZREA 1R1A2 4JRLA 3W58A 4DINB 1SLIA 4JQTA 3H8XA 3FJSA 2VMGA 2FMDA 1V0AA 1UYXA 3AKPA 4FI9A 4MGTA 4YARA 1MQTB 1RUJ1 5FZ8A 3SKVA 3VLBB 4HN0A 5I0UA 5FYZA 1GV9A 1IOAA 4HONA 3GBGA 4LBLA 2V73A 4M4RA 4Q4X2 5I0TA 1AF9A 1CESA 3CBNA 5HXVA 1NCQB 2CWMA 3J7LA 1SBEA 4FPCA 1JYIA 4COWA 2VNGA 3HN3A 3RQ0A 5SV5A 2QQWA 2YPDA 3THPA 5IK7A 5DMYA 1W04A 1GLHA 4QU1A 1LHOA 1OOPA 2YG0A 4KWKA 4RFRB 1O8SA 2W87A 1NQDA 5A33B 3S30A 4KNCA 3TWIA 5C8WA 1PX3A 2ERFA 1GUIA 5FZDA 1OA3A 3ZO0B 4AHWA 1RUNA 1PZ7A 1SBDA 1UAIA 2V5DA 4AVAA 4CDQC 4DIQA 3IM0A 4QXBA 1R1A3 1GZ9A 3B00A 2JB8A 1VBB1 3M70A 5KC6A 5E1RA 1JUHA 5DUXA 2V4AA 2A71A 4PHZA 4Y26A 1J3PA 3ACHA 1ZVFA 3VBSA 4YGDA 1HJFA 4GMP1 3MIEA 2I2SA 2I45A 2VVFA 2B4KA 2GC1A 5ABJA 4CCKA 2Y6GA 5GLUA 2GU9A 2HWC1 3WF1A 5JXIA 2ENRA 3RZKA 3RFRA 2CWSA 3J4UH 1S0JA 2WZ8A 2HEYF 3IAPA 2A3XA 4GIQA 5FCCA 1G9CA 5I8SA 2VZUA 2R1BA 5DUUA 2QTWB 1UOJA 4QX2A 3A0KA 5A3NA 5DZGA 4RD7A 5E16A 4K9SA 5FO7B 4AGGA 1JYVA 3AXEA 4P9LA 5LK5A 3ILRA 1W6MB 2W47A 1NXMA 2JDMA 4KH9A 1JI6A 2VULA 3EJKA 2EXHA 2OVUA 4NWVA 3IDCB 1NOVA 1UX6A 1IKPA 3WLUA 1UKRA 3WNOA 4I0AA 1RYYA 4BQXA 4HKWA 1MS5A 4DEQA 2BVVA 4XJAA 5L9RA 5T5OA 1LNSA 3CJIB 1UCXA 1XNBA 3UV9A 5FMCA 1W6QA 1KS4A 5FJHA 2MEV1 4W8JA 1DQ4A 3N3HA 4O61A 2YDEA 4BDVB 1DQ0A 2JB4A 5EJ1B 5ACA2 2D5HA 5J48A 3FBYA 4MYEA 1O91A 3KS7A 1VLNA 3SH5A 1OT5A 2KM2A 3ZPOA 5D8AB 1F35A 2VL4A 5A3LA 2Q0AA 2BOJA 4EWEA 5FZ9A 1AHSA 2JE8A 1XE7A 3EBRA 4LXLA 2E9QA 3VKOA 1TZOA 5L9VA 4YNIA 4NJ4A 5T5JA 3O1UA 3WT3A 4FFIA 4CUGA 1OLME 4CYDA 1HRV1 1YJKA 4NIHA 1LEDA 4BM8A 2Q8CA 5FY7A 1S1AA 3ZFEA 1W2UA 2P5BA 2W1WA 4I01A 1LGNA 2PAEA 4Q1RA 4RHV1 1I3HA 2LS6A 2KR2A 3AP4A 4PQQA 1MS1A 4CEWC 2ZTNA 1YQ8A 3GBFA
chains in the Genus database with same CATH topology
2WC2A 3EQEA 1ENQA 1QWRA 4Q4W2 4YZ3A 1C8NA 4YYOA 5ACA3 2OUJA 1IPKA 2YYOA 4AGVA 4YW5A 1SMVA 3FHIB 3KZ4C 5KXDA 1ULEA 3R4DB 1RL3A 2GAUA 3GALA 4H55A 3SH4A 1AXYA 2AR6A 2UY8A 2A3WA 3ZSMA 2RE9A 1LJ7A 1QJX2 1WD3A 5EXOA 1BEV2 2R30A 1QDOA 2YGMA 3E5XA 4JRAA 4LNVA 4E4ZA 3N7JA 1GZWA 5SV8A 4BLJA 4X8NA 4L92A 4QPIC 4XQDA 1BVP1 1OD5A 3VKNA 2G9FA 5FLJA 1DF0A 2ZX0A 1RB8G 1UN1A 3NV3A 1PZ8A 1OMIA 1V6LA 4YSFA 1HXS1 5FLHA 3U4XA 1J58A 1ND3A 3LA2A 1QJX3 1AX0A 1BEV3 3QBQA 2R062 1D2SA 2E7AA 1LU1A 2TNFA 2W68A 4OFGA 4EWDA 1NA1C 4IV1C 2HWD1 4BQ1A 3JD71 3ZSEA 2ZX3A 4KU8A 5GZDA 1KFXL 3WW4A 3B93A 4EN8B 5FO9B 3WQ1A 4FPKA 4CDUB 1AJKA 1W6PB 4O9GA 5JCTA 1PO12 4CP1A 4M3CA 1AX1A 1VBC1 4P9YA 2V09A 2XLFA 5KC5A 4WM8B 3CU7A 3IIAA 2HJIA 4CP2A 2R063 4LBMA 3SITA 1RUI1 2BNOA 3BCWA 1WLDA 4YFZA 2ZMLA 2HKXA 2RS11 3MIBA 3S7EA 1Y3TA 2ZA9A 1PVC1 1KDKA 5K0UA 3VV1A 2MPFA 1IS6A 3AKRA 4QGMA 4GH4C 1I6XA 2D43A 1G9FA 5FPZA 1QDCA 1SLAA 4BH9A 4XF4A 1M06G 2JE9A 4R9DA 1LOGA 1PO13 2ZGNA 3WP6A 5C8CA 5C8CC 1FNYA 5BPXA 2XL9A 5BNOA 1D0HA 3LA7A 5KHGA 3BPZA 1QQP1 3I7DA 1ZZ8A 2ZX1A 1B35C 4LBQA 3VHNA 1AUYA 3V0BA 2E6VA 1OPOA 3FZ3A 3OF1A 5EZWA 3ZYJB 4PIYA 4TSVA 1MEC2 3QACA 1VRH2 4R52A 1M4WA 5H9SA 2CTVA 4CEYA 1RUG3 3H7JA 1X82A 1XNCA 1OPMA 3VBHC 4CDQB 2QQPA 5EV7A 3VL9A 4LEJA 3AYCA 3J26N 4QPYA 5CFDC 3ME2A 4O9EA 5AVPA 2NMNA 5BNPA 5BNPC 1W6OB 3AMPA 3UKVA 4KG0A 2CGNA 2IXIA 1RUC1 1YHFA 4X6QB 4Q29A 3AJZA 2VMIA 4MVTA 4YZ4A 5DUWA 3HT1A 1W6NB 3TNPB 1MEC3 3CL1A 4AHYA 3VBUA 1VRH3 4GALA 3TRSB 4KU7A 3ZSLA 3ALQA 4MLOA 1URXA 5T5PA 4UBHA 2PAMA 3RJ2X 1PIV1 1YIFA 1ZBE1 1C8M2 1AR72 5H9QA 3RZZA 2FMYA 2PAKA 5I0SA 5CNAA 4ORFA 3ZXJA 2H0VA 2OYZA 2G9GA 2YY1A 5JDBA 1AR81 3KCCA 1YI7A 1W6QB 1I5ZA 3CF6E 3SXWA 4BOWA 2X5IA 3B69A 3PVBB 4FOVA 4MGZE 4P9XA 2WT0A 3HR9A 4HSLA 4JGZC 3B5LB 4DFSA 1REDA 4HLTA 1FPN3 1C4RA 1DDLA 2DWRA 4NWWA 2YMZA 3NV2A 1CX4A 4AFAA 1WGPA 1C8M3 1AR73 5GLWA 2VUAA 4MXWB 5IT6A 1NCRA 5TSWA 4HVQA 1C57A 4BMBA 1O3QA 2DFBA 4F3JA 4NOTA 4F7ZA 2FZ2A 4P14A 1R1A1 2RJKA 4CEWB 5JMCA 2NN8A 4SBVA 1QXPA 2PTMA 1RHI3 2X53S 1I1EA 4NHMA 3O0XA 3FLPA 2XLGA 4FQ4A 1BZWA 4XJWA 2JJ6A 3ZMOA 1YCIA 2PHTA 4COZA 2OUHA 3RS6A 2XWBB 1B09A 1RITA 5JVVA 3RWNA 4BA6A 3S6PA 3UKNA 2WSUA 4PJYA 5CADA 1JXNA 2X8KA 3DN7A 4P9IA 1GZWB 4GWNA 4LHLA 4CDWA 4FVVA 1W39A 4FPOB 3D0JA 4QPIB 3QLQA 3M2MA 4HANA 2AENA 5DG2A 4FPFA 2VNRA 3A4UA 5EFUA 3PJYA 3LOIA 5J37A 1COV2 1QH7A 3RDIA 3MDPA 1O4YA 5JOXA 4XBLA 2O1QA 2XJUA 1SFNA 1FOD3 1YJLA 1LOBA 4L99A 4RQPA 1FT9A 4XFGA 4YZ2A 2XL7A 4FCAA 2F6BA 2YC0A 1DQ6A 1NA1B 2D6NA 4IV1B 1QJY2 1LHUA 1Y9QA 1XRUA 4IV3C 5KBFA 1WD4A 4I0BA 2EXIA 1H8TA 4J1WA 1UKGA 3H1MA 4Q8KA 1BYHA 1Q3EA 3W9AA 4HKOA 3WR0A 1X36A 1RGSA 3WHUA 1WCKA 4PLOA 1COV3 1LODA 1SCSA 5JSPA 1U5IA 1ASJ2 1MS8A 3WDVA 5ACA1 3KD4A 3FLTA 3M8LA 3QD6A 1O4TA 1N1TA 1LULA 2XVKA 2VVEA 4PDWA 4PDWC 4XF9A 4TYSA 4LBQD 3URFA 2BPA2 2UY9A 5C4WC 1IS4A 4F83A 1N1VA 4HBNA 4I0WB 4Q1PA 1QJY3 4WVZA 4AVCA 4LUKA 5KXBA 1UZZA 2PA7A 4MXVA 2ET1A 2OZ6A 4Q8LA 4XQWA 4GH4B 5JZGC 3WINE 3M1HA 3RRDA 3VHOA 3INAA 2QDNA 4B4PA 3AKTA 5C8CB 4IEOA 3ZSKA 2WNUA 1O3TA 4HT1T 4BPZA 4MUVA 2ZMKA 4AEDC 1ASJ3 4CTEA 5BNNC 3CNAA 3BALA 3SCHA 1B35B 2DUQA 1DHKB 1CONA 1VB2A 3AZXA 4HZFA 3ZFFA 4FTEA 4H7MA 1HRI2 1DGWA 5T50A 1U5YA 1JH5A 1QMJA 4WVMA 3VN4A 1X8EA 1G9BA 1ZRFA 1ULDA 1ND2C 3N7MA 1DZQA 3D4KA 1QJX1 1A8DA 1JW6A 1BEV1 2RHPA 1V6NA 1H30A 1Q8SA 1QOSA 3VBHB 4COVA 1YWKA 3JQXA 1RUF3 2DUPA 3TAYA 5T54A 5CFDB 3M3OA 4OHYA 1WUVA 1PO22 1KS5A 1G7YA 1SLTA 1RUD2 1WLWA 1DU3D 1QF3A 4K20A 5BNPB 2EA7A 3M3EA 3KQRA 4FAGA 3WP5A 3HWJA 4GB32 5KHIA 3VKFC 1PZ9A 2D3PA 3M3CA 1QXRA 5J09A 3H3ZA 3FMGA 3D8CA 1HRI3 3DF0A 4AI1A 3L9JT 4F8AA 1Z7S2 2R061 2UWAA 3DL3A 3VKLA 1CN1A 4ITCA 1PO23 4TWTA 1TME3 2D6KA 1RUD3 2WQZC 3NVCA 4QGLA 5LK7B 3NKTA 4JQRA 4LLOA 5IK4A 4DPNA 4UW6A 1NE4A 2RR12 3V0AB 3APBA 4GB33 4P9JA 1PO11 3GF6A 5BV6A 5DUVA 4AI0A 1QXJA 1ENRA 4XETA 4JGZB 5LRSA 5T3NA 4TZDA 1WLCA 2AREA 4XILA 1FAYA 4Y22A 5EJ3A 4QPGC 4EWAA 2QVSB 3AMNA 5FOBB 1YFWA 1Z7S3 3ASIA 4YW4A 4XE9A 4B29A 2P2KA 4Q2FA 3AXDA 3WW1A 1K5MA 1K5MC 5EYYA 1GNZA 1RUG1 4YG0A 1X8MA 1WA4A 4AQ6A 1AJOA 2VY0A 4YZ5A 1DYKA 2IXLA 2YUEA 2RR13 4Q4V2 2IXCA 3MIGA 4PLNA 3FBMA 4GKXA 4RSUA 3VBOC 1CIWA 3H9AA 2QZ2A 1NY72 5CA6A 1ZYBA 1ZZ6A 1XXNA 2ZX2A 5GZCA 3KM5A 5FQ0B 1ZZ7A 1N3OA 3WQ7A 4WM7C 1MVEA 4HL0A 3WCRA 1QY4A 4H7LA 3HBZA 3DPRC 2BNNA 1YLLA 4FOYA 1JHNA 5FMOL 1Q5OA 1MEC1 2IXKA 1VRH1 2WT1A 4ZU5A 1LOCA 4DY3A 4BMEA 3VBFA 4JTOA 2PN5A 1H1AA 2Y38A 3TBDA 3KCXA 5I93A 4AFDA 3MFAA 4Q0PA 3VL8A 1CAUB 4L8QA 2P34A 3WDUA 4Q4V3 4DNYA 1PGL2 3W59A 4AW7A 4RS5C 3OCPA 3GZUC 4S2DA 3SISA 4IEPA 3MFCA 2WL1A 5L73A 4Z1VA 3NO8A 1S2KA 3ENRA 1OLRA 1CAXB 4ASMB 3PVEA 4Q26A 3H7YA 2EXKA 4Z2WA 1MACA 5HCAA 1FPN1 2C9AA 4N43A 2BWCA 3FUQA 3IT8A 4IV3B 2ZCWA 1C8M1 1AR71 1WW7A 2QDRA 3QH7A 4AEMA 2BYVE 3I59A 3MW4A 4ZXKA 2E7TA 3E5UA 3ZN6B 3SLIA 1OOPC 2BNMA 1NLSA 1R1ZA 2ZHLA 1RHI1 2DVFA 4PBPA 1O7FA 1EAH2 4XMAA 2HWE2 4L2NA 4FQZA 1C1LA 1ULGA 5L7OA 1AVBA 5C4WB 2E7QA 5GZEA 3P3PA 4KG8A 4BYYA 2UURA 2D98A 1TE1B 1V6MA 3VBSC 4YRDA 1H2NA 4Q4X3 1YFYA 3VZOA 1VIWB 2GNMA 5ABJC 5JZGB 5FDBA 2KXLA 4L97A 4FTSA 1MR5A 1HQWA 4AGRA 3WCSA 4YFWA 1ZNPA 4AEDB 2Q5TA 5BNNB 2SLIA 1UPSA 1JYCA 2DFCA 1PK6A 1PK6C 2LUWA 2E51A 2R6QA 2C0ZA 4IEWA 4QQLA 4IEUA 4DB5A 5CG8A 2HWE3 2GNDA 1QKQA 1CPNA 2IXJA 4KWLA 2Y0OA 3JB4C 4HETA 4PQ9A 5JPMB 1LB2A 4CP0A 1ND2B 1H2MA 2W08A 2ZGKA 1FOD1 1UZYA 1VALA 3AZYA 3ZXEA 1SLCA 3KGZA 4FXKB 3BIWE 1APNA 3T1LA 3U0ZA 1AR62 2V5YA 2GZWA 1MS0A 4QQOA 4IESA 4R9BA 4X8PA 2DYCA 3WQ0A 3OPZA 1UF2C 3LSDA 1AX2A 5JOZA 1YO8A 1BJQA 4D7SA 1COV1 2VQAA 4XQ4A 2DVAA 1LRHA 4Y1ZA 1G6NA 2EALA 3MLJA 1AL22 2VW2A 3ZFEC 5JOYA 3KT7A 1O3SA 1VBE2 3HIFA 2C5DA 1H1IA 2ZX4A 4WVWA 4Z82A 5GJ6A 1RMU2 4S2FA 2D97A 1F5FA 2PELA 3WG3A 2ZGUA 1MS3A 3NKGA 1QJY1 2FBEA 2GSYA 3C3VA 3OJBA 1AR63 5I8YA 3GYDA 2D6LX 1S0CA 3D82A 4GULA 4LUMA 1ZRCA 2ZAHA 2W0XA 4ONUA 4ES8A 1HLCA 1IQAA 4GWMA 2GC0A 2NLRA 2D6MA 4QQPA 1ASJ1 1AL23 2IFWA 2XJQA 1TMF2 4FOQA 4JGYB 3ZIXA 5A32A 1VBE3 3T2TA 1H9WA 3O5SA 2BBVA 1PGW2 1RMU3 4QPGB 4Y20B 2JG8A 2JG8C 5E8AA 1X50A 4Q4W3 2WZR2 2BTVC 1RUH2 1H4HA 1AXKA 3USUB 1K5MB 2XJVA 4XFFA 4XYXA 4LTAA 4KQ7A 1VAMA 5IUQA 3AFKA 4XDQA 1PHMA 1LU2A 3BODA 4MX3A 1RUF1 4UXAA 4K21A 4N53A 1ZX5A 4C0HA 1V00A 1ND3C 2D44A 3VBOB 1IS5A 1J3QA 3ZN4A 4YM3A 4ZU4A 4P9GA 4NN0A 5DZEA 1OFNA 1TMF3 1TQ5A 4WM7B 2ZGPA 3DPRB 1LESA 1HRI1 3BTAA 2YGLA 2WZR3 1RUH3 2D93A 1ENXA 3I2DA 1S0BA 1SLLA 4JDMA 2XJSA 3ZFGA 3LGRA 1QU0A 1JUIA 2VW0A 4CDXA 3VZJA 4JV4A 3S7IA 3J8F2 4I09A 2WINB 1OQ1A 4Q27A 2JX9A 1YFUA 3IPVB 1EV12 4ZU7A 1PO21 4AHZA 1TME1 1RUD1 4RS5B 3SHRA 2RM22 3ACLA 4LULA 4GB31 4PIZA 2HEWF 3ZMNA 5FLIA 5K0UC 2CL2A 4DXZA 1WCSA 3M7AA 3AMQA 1OQEA 2RS32 1QOTA 3GHMA 4D7YA 1YXWA 2EAKA 1V6KA 3AK0A 2ATFA 2WA3A 2D3SA 1Z7S1 5BNOC 5IK5A 2XPJA 3H1WA 4D94A 3MF6A 4YVWA 4HK9A 3I4IA 1QJZA 1NYWA 2TUNA 3WG2A 1EV13 4R4XA 1S0EA 2A6YA 1DIWA 2PLV2 3GZAA 3I59B 4FP3A 2RM23 2WFF2 1OOPB 4RR3A 1DLLA 3PVNA 2NP0A 3M4FA 2RR11 4AQSA 4CEYC 4YG6A 4LBKA 2W39A 4PF5A 3E97A 2GDFA 1V6JA 5GKAC 4YGBA 2VUJA 3ZVXA 2RS33 1ALYA 3VHRA 2R042 4OZXA 3HMYA 4JDOA 3JBG2 3MIHA 1V70A 1FATA 1DFQA 1YFXA 4OLLA 3ZX7A 2CAUA 3LB9A 3OD4A 5GLZA 4IL7A 4BWOA 3VBSB 1U0AA 3FE5A 4XJZA 3ZYPA 1GQHA 1AZDA 2D7FA 3B3QE 3E6DA 4RFT0 2JG9A 3RMYA 5ABJB 1N1SA 1JN2P 2R0FA 1A8MA 2PLV3 1OFSA 2ZGRA 2WFF3 3E6CC 3A0NA 3VBUC 2Q8OA 1SQ4A 2QCSB 4Q4V1 2A6VA 1H9PA 3V65A 4DMIA 1PK6B 1NY71 1TNFA 5L36A 2AZ5A 4JC1A 5CU1A 2EF6A 2R043 1CR7A 4ATEA 4AEJA 3JBG3 2YV8A 2CYFA 1DG6A 3WDYA 4LBJA 4BLIA 5J3UA 3IKWA 4MGYE 2PHRA 5LRRA 2FZ1A 3SH3A 4OHZA 4WZFA 4BZ4A 1ZRRA 4FPEA 5I0RA 2AUYA 1Q43A 2X5IC 2WLQA 1WBFA 4J6GA 1YUDA 3UKTA 5EWSA 3HN1A 1QH6A 4QX5A 2X29A 3PTYA 4LA2A 4Y5Z0 1POV0 1AL0G 1PGL1 5JIUA 4YW3A 4OI0A 1KRIA 1KD7A 3U07A 2QJVA 5JR7B 1H8VA 1DBNA 2GC2A 4S2HA 4GMP0 3ZSJA 4COUA 3HD8B 4Z92B 1NCRC 3ZFEB 4AG4A 1LR5A 2WFPA 3ES4A 4I30A 3RYKA 4CRQA 3FFQA 4P5HA 4E4SA 2DV9A 2CGOA 1GYKA 2UYBA 1MZ5A 2VECA 4Z8BA 4QXKA 1FYUA 4HKLA 1D4VB 4Y4YA 2UWBA 2JD4A 2ZKNA 4AQTA 4Q4X1 2O8OA 2K2SA 2P3JA 3WDXA 1DGRN 1CAVA 1IGOA 3ST7A 5JPNB 5GALA 1UL9A 4ZKTB 1LEMA 4Y1VA 2QKDA 5F9TA 3WUCA 2HWE1 3ES1A 4CDWC 5HBAA 1O5UA 2ES3A 2HWF2 2JG8B 3D0SA 4YM2A 2N7GA 1VAVA 1POV3 4YZ1A 2UWCA 2DF7A 3LOBA 4NHLA 2XB6C 1DGLA 1SFYA 2WNVA 1N3QA 3RYPA 4OI1A 1ULCA 4IEYA 3WDTA 2DURA 3SCFA 3R0RA 5GZFA 1ND3B 1ZA4A 5K9YA 4RQPC 2DCYA 2F4PA 2PHXA 2HWB2 1LOFA 3O0VA 2DCJA 2ZZJA 1FX5A 1PM7A 3WZ1A 1AYN2 2NM1A 1H2LA 2HWF3 2NQYA 3B01A 4Q0QA 1H8TC 2TEPA 4K1ZA 4G9SB 3B94A 4OHVA 5CB7A 4PIXA 3B9IA 5FRAA 2ZGSA 4M3CB 1CGPA 2I74A 3VGIA 2GALA 3NWKA 1AXZA 2IXHA 4RGGA 1QOOA 1MQTA 4AI2A 2RS52 3M3QA 2A70A 1QJU2 2D40A 2D6PA 2YXSA 2Q1ZB 1AR61 3OTFA 3PMEA 1NCQA 3AMMA 1ZM1A 2PFWA 2G4IA 2SBAA 2HWB3 3ZDSA 2K0GA 5K0UB 2EXJA 1F2NA 2FQPA 3SMHA 4EJRA 4FT8A 4DS0A 3NJZA 3NAPA 3NAPC 1AYN3 5JAXA 1AL21 4QQHA 1VBE1 1RMU1 4LHKA 4FP2A 4WZCA 5BNOB 2WNUC 3G7DA 1O3RA 3VZLA 2NPIA 3VUOA 4Q4W1 5J96B 4HN1A 1RUE2 2RS53 4RL7A 1QJU3 1S0FA 4LBQB 5FMOS 1GBGA 1KITA 1LTEA 1GQGA 4Q0UA 2A73B 4YW2A 3ZFFC 4AVVA 3V0BB 3L2HA 4UW4A 3VHPA 4C90A 4JDNA 4IEQA 3WP4A 2EVXA 4N9HA 3DGTA 4HVRA 4Q4Y2 4XXAA 3JZVA 4C0BA 4CEYB 3B9CA 3CEWA 5K7PA 2UU8A 3GNEA 4N90A 3OYWA 3WX5A 4GXLA 3CJXA 1IZ3A 4XIKA 1TMF1 2YPJA 1HDKA 1C3HA 2NYYA 1W6MA 3IBMA 5HI0A 2OIIA 2ZGOA 4AHXA 1PGW1 5LEKA 4COYA 5FREA 2RMU2 2IWGB 2WZR1 4XHBA 1RUE3 3POYA 1RUH1 3IDEA 3MF9A 4K7JA 1ZZCA 4I3PA 1TEIA 4B3NA 1BBT2 5JSOA 3CJIA 3ZYRA 1XE8A 1H0BA 5CVRA 1VBD2 5CFCA 5CFCC 1JTZX 4LO6B 3VBUB 2WIIB 4QMAA 4Q4Y3 1OSGA 3V64A 4IERA 3VDDA 3VDDC 4META 1W0PA 2BFUL 1CAWA 1F8VA 4HFSA 5J98B 3ECQA 1Y7BA 3AM2A 4AK3A 4D69A 4N7IA 1LOEA 1OA4A 4Q0SA 4D7TA 2MHFA 2YHJA 3KMHA 2VOXA 4FPHA 5CAZA 1F5JA 2RMU3 3MGUA 5A3MA 4JVAA 3UJQA 4C1XA 1BBT3 2CY6A 2X5IB 4E27A 4FO9A 3CLPA 2WNEA 1UU5A 3J8F1 1EPWA 1VBD3 1GKBA 1X7NA 2A6WA 1XYPA 5T5LA 1H2KA 1UPIA 1EV11 4QGNA 3RMXA 2ETEA 3NL1A 2RM21 3BU7A 1XNDA 4P9WA 3UJOA 5AC92 1C28A 1HX6A 3THTA 2B42B 3WG4A 2ZHMA 5T52A 1NCRB 3R6SA 1IHMA 2VPVA 1ZBA2 2PHUA 2VNOA 3V56A 2GMPA 4DY5A 4LO5B 4AVSA 2RS31 1DQ1A 4RA0A 1N47A 2PHDA 3KT4A 1XU1A 1Z78A 2JEMA 5FFOC 3ZXKA 4FPJA 3T1MA 3TN92 1DGRA 5E89A 4W6YA 4LLFA 1NG0A 1LECA 2Z5WA 4ISRA 4M01A 1RUC2 4YM1A 2PLV1 1FMD2 1WMFA 1J3RA 1EP0A 2WFF1 5AFEA 4Y1UA 1HQNA 3R4UA 5AC93 1PVXA 3D6EA 1SCRA 5K8SA 1G8WA 1DZRA 3VBFC 4I3GA 5FOJB 1ZBA3 5KHKA 5E88A 2QFEA 1OA2A 3VZMA 4CDWB 3S0MA 3GHNA 1QNWA 4XIOA 3E6BA 2R041 3WNXA 3JBG1 3LSEA 1QGLA 1Q8VA 2P3IA 3AZVA 4B7EA 1BMV2 5AFBA 3TN93 2CNAA 3ETQA 4CDUA 2XJPA 4XMIA 2QE3A 2W52A 4M3CE 1ZRDA 1ENSA 4OUSA 4UW5A 1VBA2 1HQLA 3EXUA 2ZABA 1FMD3 2ZZQA 2BUKA 1LHNA 4RQPB 3VZKA 3IMNA 4N43C 2VOWA 3P3NA 4DQAA 2H6BA 2UYAA 1KDMA 2XWJB 4OUMA 4QD2A 3WG1A 2GN3A 4WM8A 3VBRA 3VBRC 4AVBA 4V1PA 3UK9A 2JXAA 5JI9A 4DRRA 3RYRA 2OW4A 3MYXA 4XPVA 1H8TB 2P37A 4BHPA 4KBBA 2DTWA 4LBNA 4YG3A 5JI7A 3TOJA 3HT2A 3JQWA 3RG0A 4XJ9A 1DZTA 2GH2A 2Z42A 1CJDA 4ISQA 3TYJA 1OHFA 2GNBA 3VZNA 4PDWB 1WW4A 1VBA3 4ES9A 3K48A 4FOWA 2CGPA 2DVDA 3ZN5A 2VVDA 2P3KA 4BCUA 1X33A 2ET7A 3WY6A 5L7OC 1BXHA 5EYXA 2R1DA 1V9U2 1AYM2 2HYKA 4JAAA 3MZHA 4FTBA 1O4ZA 3WOGA 4JCKA 3OY8A 3O7OA 4XFCA 1LHWA 4B4QA 3NAPB 2R0HA 4AEKA 2LM3A 3JB8A 1PNFA 3CO2A 4HPKA 1YNAA 3DV8A 4PLMA 2O8QA 3LAGA 4CDQA 2Y0IA 2WNUB 2IZWA 2PHLA 1R082 2R49A 5BNQA 1WMDA 1POV1 3GBWA 1EAH3 3J9SA 3AX4A 4OVEA 1W6OA 4MH0E 3ZFFB 3SNMA 4WV8A 2WA4A 1LOAA 3RI8A 3USSA 1RIRA 3RJRA 4XW3A 1V9U3 1AYM3 2XBO2 4WVMB 3MPBA 3WW3A 1R092 4XFHA 3RI9A 2JENA 3WUDA 3OYWB 1W6NA 3MPPG 1FV3A 1OKQA 1DGWX 5L19A 4MZUA 1RTVA 3QH6A 2OA2A 1WW6A 1MS9A 4UW3A 4AQ2A 4M0NA 3VKMA 2DCKA 2HWF1 1OI6A 3M3IA 3AJYA 1R083 1FXZA 3ELNA 4W65A 3ZXGA 3ILNA 2XH6A 1Q8OA 1V6IA 1NE6A 2ZMNA 1REFA 1GZCA 2Q4SA 2BGCA 5CFCB 4OI4A 5DDJ2 4XBQA 1FNZA 2XBO3 1QHDA 4DRVA 1G9DA 5GM0A 1R093 4YVSA 2D5FA 4YVSC 2IFRA 1A6CA 3VDDB 1KJRA 4XHXA 3WDWA 4NR1A 1CAWB 2DVBA 4U2AA 4XFAA 1W0OA 2AGSA 2HWB1 4E2GA 2VOVA 3MI8A 2ZKLA 1AYN1 4MXWA 1S55A 2WZPP 3O14A 3FUOA 1C5IA 1RVF2 1S0IA 4S2GA 1CPMA 5C6CA 4CEWA 2ZOEB 1Q8PA 5CBLA 2P17A 3H0OA 2RS51 5DDJ3 1L3JA 1QJU1 1WBLA 2B5HA 5F1RA 2A3YA 4IEXA 3FFZA 4Y22B 3AKQA 3NV4A 2XG3A 4OHWA 3AYEA 1BKZA 1ZZ9A 2DU1A 1KJLA 1GNHA 2LTNA 4XEZA 1PGSA 4K6BA 3N7KA 5DG1A 4AF9A 1SDWA 4A7ZA 1J1LA 4B8EA 1RVF3 3H1YA 4N53C 5BYNA 4M3CF 4QHBA 4XF0A 4BIOA 2JECA 4EV0A 2ZHNA 4QPIA 4Y24A 1RUE1 1PMIA 1HIXA 1UD1A 2GC3A 3AZWA 3LKJA 1GICA 3JCIA 2DU0A 4FPYA 4AWDA 2YROA 4HSJA 4Q4Y1 2H0BA 4MV2A 1D2QA 4WVVA 3ZFGC 3VBFB 2FHRA 4CDXC 4PCRA 3AFGA 5JLVA 2ILMA 2BW8A 3MLLA 4R4ZA 3RNSA 2ZBJA 1HKDA 1NA1A 4IV1A 4XBNA 4YLZA 1LCLA 3FX3A 4KL1A 5FTTC 1DQ5A 2ZGQA 1HV0A 1MZ6A 4AI8A 3N35A 4XJ8A 2RMU1 2ZPXA 5FPXA 1Q56A 2I07B 3OBRA 1BBT1 2B46X 2DVGA 1HW5A 5CIRA 4C91A 1AR92 2WS92 1G9AA 1VBD1 4N7UA 4FPGA 4N43B 2DTYA 3EO6A 2XVGA 4K8FA 5JOWA 3WD5A 2ZAAA 3VBRB 3J8F3 4KWJA 4QQ2A 4YVWC 4KGGA 1FI2A 1OQDA 1UIKA 2O0OA 1BVVA 4YGEA 2XKPA 4RGAA 1V6OA 4D3WA 3PLQA 1RUG2 4A7YA 2GMEA 4EN9B 2EIGA 1EPZA 5KHJA 3MW2A 4ATFA 4GH4A 3MLKA 1ULFA 2WQ4A 1A78A <