2BWAA

Structure of endoglucanase 12a (cel12a) from rhodothermus marinus in complex with cellopentaose, 20 minute soak.
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
226
structure length
226
Chain Sequence
TVELCGRWDARDVAGGRYRVINNVWGAETAQCIEVGLETGNFTITRADHDNGNNVAAYPAIYFGCHWGACTSNSGLPRRVQELSDVRTSWTLTPITTGRWNAAYDIWFSPVTNSGNGYSGGAELMIWLNWNGGVMPGGSRVATVELAGATWEVWYADWDWNYIAYRRTTPTTSVSELDLKAFIDDAVARGYIRPEWYLHAVETGFELWEGGAGLRSADFSVTVQKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE
publication title Dimerisation and an increase in active site aromatic groups as adaptations to high temperatures: X-ray solution scattering and substrate-bound crystal structures of Rhodothermus marinus endoglucanase Cel12A.
pubmed doi rcsb
source organism Rhodothermus marinus
molecule tags Hydrolase
total genus 62
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2005-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2bwaA00
1YNAA 4XPVA 3MF9A 2B45X 5K7PA 3B7MA 3WP3A 3VZJA 1C5IA 3WT3A 3WP4A 4H7MA 4S2DA 3WY6A 1BK1A 3VGIA 2F6BA 4NPRA 3AKRA 2VULA 5HXVA 3WQ7A 2DCYA 5K9YA 3WR0A 1HV1A 4S2GA 3VZNA 3VL8A 2QZ2A 4XQ4A 3ZSEA 3O7OA 2DFCA 3RI8A 1XYOA 4XQDA 3WP6A 2VGDA 1XYNA 2QZ3A 3VL9A 3VHNA 1NLRA 3VZKA 3AMHA 3LGRA 2Z79A 3LB9A 2B42B 1UKRA 1KS4A 2JEMA 1XXNA 4HKOA 3VZOA 3WP5A 3WQ1A 2BWCA 1H1AA 1UU6A 1C5HA 3VHPA 2C1FA 1KS5A 1OA4A 1OLRA 1REEA 1UU4A 4S2HA 1M4WA 1IGOA 4HK8A 3MFAA 1W2UA 3AKTA 1REFA 3EXUA 2VG9A 2BW8A 3AKSA 1OLQA 1QH6A 2VUJA 3AMNA 1TE1B 2NQYA 2B46X 4S2FA 1XNDA 3WQ0A 1H8VA 2D98A 3VZLA 3AKPA 2DCJA 1XNBA 3AMQA 1HV0A 1UU5A 3AMPA 3VHOA 2BVVA 1REDA 3WX5A 1PVXA 4HK9A 1H4GA 3MFCA 1ENXA 3VLBB 2JICA 3AKQA 4HKLA 4XQWA 1QH7A 1BCXA 3B5LB 1XNKA 2BWAA 1XYPA 1AXKA 4IXLA 3M4FA 3RI9A 3HD8B 3VZMA 1XNCA 3WXPA 2DCKA 1HIXA 1OA2A 1OA3A 2D97A 5EJ3A 1H4HA 3MF6A 1H0BA 1BVVA 3AMMA 1T6GC 1F5JA 2DFBA 2NLRA 2DCZA 4HKWA 2JENA
chains in the Genus database with same CATH superfamily
3CHXA 4WV8A 5K7PA 4XMIA 1QHDA 3PUHA 5FYZA 3LEMA 2VQTA 4YZ2A 1AJKA 1BXHA 1ZBA2 2GAUA 3GF6A 3K75B 1KXGA 2KA3A 2V5YA 3I59A 4KWLA 1V9U3 2PELA 3EO6A 2RG4A 4UBGA 5FP7A 3WUCA 1PK6C 1WMEA 2A6VA 2R32A 4QMAA 1PGL1 1VBB3 5IVVA 3KV4A 3N9NA 1BYHA 3HN1A 2BOJA 3J7NA 3S57A 3LFMA 4NRPA 2QCSB 3TRSB 1QIQA 3I4IA 1HV1A 1XE7A 3ALQA 4B4QA 4QD2A 4PIXA 1DBNA 3I2FA 4YRDA 2WA4A 3KV5A 1SCSA 4XFIA 1QY4A 5FY1A 4P5YA 3URFA 1VBD1 4BLJA 5IAVA 4QX1A 2EICA 4LMFA 1YFWA 2NZ9A 3KSCA 1SLIA 3O1TA 3VDBA 1I3HA 3KQ4B 5JVVA 2BYVE 3VKFC 5IAXA 1IKPA 2AREA 2BZDA 5AC92 4COVA 2OVUA 1F9KA 1RVF1 4JKMA 3VD9A 2VZOA 2WABA 3AP5A 3MYXA 1HJGA 4MADA 5GKAC 3KCYA 2UURA 2JG9B 4AQSA 3POYA 1NY71 3MV11 2C9AA 4IUGA 4CP9B 4Q27A 4INDA 2VCBA 4PHZA 3HNBM 5I8YA 4S2HA 2E9QA 4RD7A 5EJZB 2Y8KA 2DVAA 5IVBA 4YG0A 4I3PA 2FD8A 4Y5TA 3O1UA 1YCIA 4MHRA 1X82A 1QDOA 1PNGA 5T52A 3DKWA 3DV8A 1UZZA 3DF0A 2FCTA 3LPGA 4JCKA 5A3TA 5EHDA 4AHZA 2QQKA 2D98A 4KU7A 2HKXA 4O61A 4NAOA 4PDWA 5GLZA 3KS7A 3RQ0A 3PU8A 4CU8A 4I0WB 3T4VA 2ORXA 3WNXA 3AC0A 1NE6A 2MPFA 2DURA 1QJX1 4R9CA 3MHZA 1TMF3 4D6QA 4K20A 1UIJA 3RZZA 4D7YA 4E2GA 2F4LA 2ETEA 2HWE3 5IVFA 3GZAA 1S0JA 5ERLA 3U37A 2XJUA 5BNNB 1AYN3 2JDMA 4WM7A 5FCCA 5H9PA 3SH5A 2WAOA 1W8WA 4YW1A 4YVWC 5FV3A 1UWWA 3B94A 1QH7A 3MIEA 4N53B 4LA3A 1K5MC 4A6OA 5CADA 2CV6A 4FT8A 3PUIA 1AJOA 1PGW2 1U5YA 4XABA 1IHMA 4ZXKA 5A6YA 1OF4A 2VTXJ 2ZEZA 1XYPA 4HN0A 4XF0A 4BA6A 3NAPC 4SLIA 4CUAA 2ZHKA 3VBUA 4Q0SA 2BFUL 5FY7A 2XPJA 3POIA 1O4ZA 4EN8B 3WXPA 3AX4A 3AXEA 1V6LA 2JD4A 5C5TA 1H2LA 5JI9A 1OA3A 3A7QA 4YLZA 5H9RA 3VN4A 4Q4W1 2XJRA 5C9AB 2G19A 3IM0A 5DG2A 4CCKA 2ZGNA 1AXYA 3T0DA 4OHXA 5FY9A 3D82A 3JU9A 1VLNA 2IFRA 2P37A 4GULA 1WCQA 2PA7A 2R073 3MEPA 4AAXA 5A1FA 5JXHA 2B45X 2LTNA 1C5IA 4Y24A 4P02B 3WT3A 5JZGB 4H7MA 2QUOA 2VCAA 4LBJA 3S5AA 1NXD1 4H55A 4QPIA 5JUVA 2OPWA 4GMP0 3CLPA 1FV2A 2ZABA 4CDXB 3O1SA 5JOWA 2X09A 2WQ8A 4CEWC 4XURA 1MS4A 5FLJA 4AEMA 4S2GA 1ST8A 4AK3A 1SG3A 4OHZA 1JYNA 3IDAA 3RJ2X 1S0BA 3PIGA 2F4PA 3NV2A 2XHNA 1W6MA 4ITCA 3L9JT 4A2UA 5C3OA 3OSDA 5IVYA 3ZDSA 3UL2A 3X29B 2A7AA 1MQTC 3SISA 4CDWC 5FYYA 2A6WA 2RVAA 2QZ3A 5T55A 3ME2A 2PLV2 1NLRA 1YQ2A 5F5AA 4Q4Y2 3PVEA 2D3SA 3LSEA 5SV8A 4AI1A 5FZ8A 3GYDA 1N47A 4DY3A 4XYXA 4AFMA 4TZDA 3RS6A 4LEJA 1EV11 2Y60A 3R4UA 5D1IA 4L11A 4GJYA 4FAHA 5KR7A 2RR12 4MLOA 3OF1A 4MYEA 5DAXA 1F4HA 2WAAA 1QJU2 3ACLA 2FDJA 2YB7A 3K2OA 4LBQB 5T5OA 2GNMA 2ZMKA 3C2UA 1JTZX 1NCQA 3CBNA 1IG3A 1ULGA 3JBG1 2WS93 1PO21 3PHMA 2VOKA 1UF2C 4LO8A 1RUH2 5DXDA 5F8PA 5L36A 3A21A 2MEV3 5AFBA 3SEEA 4CCMA 3KF5A 1FT9A 2N7GA 4RQPA 3TN91 1BVP1 1W8NA 2NQYA 2AEZA 1ZZ6A 2WZR1 4S2FA 1BZWA 5DUWA 1RUC2 3AFKA 1NOVA 3WCSA 4Q8KA 3N7KA 3ZXDA 4OI2A 5JXJA 3V0BB 1EP0A 2XOMA 3B9IA 1DIWA 2VZSA 4D7SA 1R083 2HWF2 3WNNA 4M3CF 1GP5A 1Y9QA 5AFEA 2AENA 1CZTA 3UGHA 2BGPA 1LU1A 3VLBB 1H9PA 1ASJ3 4Q5OA 5A80A 5DDJ1 5BNOB 1E57A 5CIRA 4G4FA 3UJQA 3TWIA 3ZYRA 2ATFA 1EUUA 3K4AA 2JG9C 5FZGA 4LIUA 1UOJA 1XE8A 1MS5A 4BXSV 1HLCA 4BH9A 1VMFA 2VMDA 2IXIA 3I2IA 1G9BA 4XJZA 3RI9A 4AFBA 3VZMA 2R043 4XE9A 5FZ3A 4AVBA 4PF1A 2UY9A 3HR9A 1OOPB 1CAWA 1MZ5A 4DXRA 4HVRA 2XWJB 1PX3A 2OQ6A 1W03A 2NP0A 5LA0A 2PYTA 3D0JA 1PMIA 1UY3A 4LA2A 2VBDA 2ERFA 4A45A 1N1SA 3CZUA 4HPKB 1UIKA 3M1HA 4MOAA 5DPNA 2ZGRA 3IAQA 4NUBA 4U36A 4DNYA 1YWKA 1YNAA 3MUY1 3ZFEB 4Q0PA 4GWIA 4LE3A 1M06G 2ENRA 4RFT0 1V6IA 4A3ZA 3ZSLA 5L7OA 4OUEA 4BB3A 4M0HA 5CKNA 2BFUS 4QX7A 4XJ9A 5AVPA 1QOOA 3MZHA 4EROA 4P9JA 1L3JA 2NMOA 1NA1A 1RUF2 2XGXA 4MXWA 4BHPA 5FMOL 1GP6A 2WZ8A 3TNQA 4Z8BA 2DBIA 1DP0A 3B01A 4YVSA 4YG6A 3DGTA 4K1YA 1JUHA 1MVEA 2FMYA 4P9GA 3IB3A 2P34A 1BMV1 4QQOA 2K46A 3WW4A 1XYOA 2ZACA 3VUOA 3AZVA 4U2AA 3NV3A 2DCTA 2E6VA 3KVBA 3NV1A 4FPJA 1PIV3 1HB2A 1JU3A 5C9AC 1PVC1 2P3KA 1S0GA 1QDCA 1JZ2A 1VBC2 2QBXA 4QXKA 4XVHA 5T5PA 4CDQB 5GALA 5FZKA 1KS4A 1HX6A 5FYTA 4R9BA 1OUSA 3H8OA 3MIGA 3THDA 2R16A 4FXGB 1UU6A 4QPYA 4XF4A 1N3QA 2JX9A 4DUXA 3WUDA 2DVBA 3NWKA 4UT5A 2HWD1 1MS1A 1NCRB 1AL23 4CPBA 2WR9A 4YFZA 5DAPA 2DBNA 3PUQA 4AVAA 1M4WA 2YC2A 2IWGB 3POBA 1SHWB 2RM22 3ETPA 4OHVA 3R6SA 5C5UA 3GZEA 4B7KA 4TLGA 4FPCA 1JXNA 5FYBA 4NIDA 1GZCA 1H8TA 3OBAA 3ATGA 3HT1A 2PXJA 3N9LA 5C4WA 3ZXEA 5KBFA 3WD5A 1GBGA 1XU1A 4FPKA 3CU7A 3HEIA 1AXZA 5M0TA 3EQEA 2DCJA 4XJWA 4GH4B 3OUJA 4K3UA 2D3RA 3FN9A 5FXWA 4CCCA 1J1TA 3D6EA 2R49A 5FKCA 4IQPA 2HWB1 1GANA 2TEPA 1Q8QA 1SLLA 3SCHA 3NNMA 5CBLA 1U12A 2FHRA 1STMA 2YPDA 4JGZC 5FPXA 3AJZA 5A1LA 4V2VA 2HWC2 2V4AA 5KHKA 5GZGA 2C0ZA 2WWJA 4LJHA 5DQ0A 4B7EA 2ADEA 5FXZA 4AOCA 4E2QA 2A6ZA 4LUMA 5G04L 4MGQA 3MIBA 4FOYA 4CDUC 4LPLA 4XQWA 3MIFA 2VAUA 4GMP1 1VBD3 5A7SA 2FDHA 3ZIWA 4L0PA 3B5LB 3ZXJA 4BE3A 3WDTA 2GC0A 1K5JA 3POWA 3I97A 3WDXA 2RS52 3CIHA 2WFF2 3HAGA 3ZKUA 4QHOA 1IPSA 2H6BA 4MXVA 4QGLA 1V9U1 4QDQA 2PHUA 3JUUA 1XSQA 4LIVA 1OI6A 4NIHA 2D40A 3H7YA 4XIOA 5EJ3A 3VDDC 2W0XA 5F2SA 5C3QA 4AFAA 3POSA 4CCLA 1DLLA 2RDSA 3G6JB 5FOJB 4RGKA 1FMD2 1MPXA 1JYTA 1R1A2 1R1A1 1Q8OA 2NLRA 5FZ9A 2R1DA 2VQUA 3GDBA 4FPOB 2Q4SA 1GSLA 4AEDC 4I0BA 3O0WA 1AR81 2B8MA 3I59B 2E51A 3B7MA 5CA6A 5FZOA 3USUB 1WCDJ 1V70A 4N53A 4BQWA 4UFIA 4HBNA 4V2WA 1V00A 5FY0A 3UT0A 1BK1A 3KWVA 2YFZA 3TEXA 2WLPA 4AI0A 3OB8A 4E4HA 2IXHA 5LATA 4XF9A 1SLBA 1FNZA 5IVCA 1GQPA 4C0BA 4BQ1A 1DGLA 3CO2A 3LA7A 5A7OA 3OPWA 5B2GB 3C7GA 3BTAA 5JMOA 3HQUA 3SKJE 4E8DA 2L9LA 2R30A 1SZBA 3WDVA 3H3UA 1A3KA 5T3NA 3J7LA 3ZDVA 5F5QA 1V6KA 2WBKA 3WNKA 2HYXA 4UFKA 5HCHA 5E6HA 1E5IA 3VHNA 2Z2SB 4JHZA 2XKOA 4K8RB 1C1FA 4P9XA 4ZZ8A 1PGSA 2B42B 3ZO0B 2J7MA 1Z7S2 5E1RA 3WQ1A 5FMOS 3ELNA 2XR4A 1MVQA 2QQOA 1W0OA 1VJ2A 3ZYIB 1LOGA 3TEZA 1ENSA 2BP6A 1EYBA 1TMF1 3J8F2 5FUPA 3OBZA 4Q4W3 3H1WA 3SHRA 4CDXA 1QXJA 1S0FA 2HWE1 1W2TA 2VCMA 3JXSA 1RHI1 1QOSA 3OUHA 5FP8A 5H9SA 3RRDA 5FYMA 1O3SA 2QNKA 3OGJA 1FOD1 4JGYA 4N43A 1FATA 2VZPA 5J3UA 1J59A 5SV5A 2WWSA 1REFA 1OXCA 2ID4A 5GLUA 4GWNA 1W39A 1GFF2 1JS9A 2GDFA 4HETA 3T09A 4PDWB 4LORA 3GJAA 3HQXA 4ASMB 1O7FA 3AMNA 2WC2A 2VZUA 3WQ0A 4XDQA 1I6XA 4D0QA 3AVSA 3VZLA 4XUNA 1N1YA 5DAWA 3U78A 1UY2A 3ES1A 4DO0A 3BN6A 4YG3A 4YZ1A 1OLME 1YQ8A 1BK0A 4QM9A 5KWRA 4CU7A 3BVCA 1CJDA 1PVXA 3J7HA 4GXLA 4BIFA 4CXWA 4LKFA 4XW3A 2JG8A 3BCWA 5C6CA 2R0FA 4CDQC 2MHFA 3ZPYA 1QJFA 3KF3A 1NLQA 5HPOA 1D4M1 4LBQA 2W68A 4BJ0A 1H1IA 2PQSA 2R071 3I2DA 4XETA 2Q8OA 1RUOA 4KL1A 1R092 4HLTA 1LOFC 3V0AB 2PLV3 3DYPA 3VBUB 4WZCA 3HVDA 1OQEA 4HG6B 4UOJA 1W2OA 1QMJA 2PQQA 3A23A 5FTTC 2PMWB 2CL2A 2F17A 2W94A 3ACIA 1NYWA 2ZGMA 1QJY1 2X5IA 2XVLA 3GNEA 1Y4WA 2RDQA 5DAVA 3PMEA 5LRSA 1W6OA 2YXSA 1H4HA 1SQ4A 4CP1A 2CDOA 1HW5A 2RR13 3CNAA 1LB2A 1QJU3 1HRV1 2D44A 2XBO2 2XBO1 4QX5A 3BOPA 1DQ2A 5JDBA 4N90A 2ZHLA 5DN2A 4GH4C 3J9SA 4K9SA 4UW6A 1X9TA 4QPWA 1YLLA 1IPJA 4B4RA 5JOZA 4ZU4A 4Z2WA 1HQLA 5E8AA 4NO4A 5BNPC 3I2GA 3IMMA 1A6CA 3LOIA 2JDKA 1E5HA 1MS3A 1RUC3 4FPGA 1CX4A 3E1F1 3PNAA 2ARAA 4NN0A 1YEWA 3LEGA 3ZYJB 2EXIA 1AL0G 3LA3A 1RMU1 3QLQA 1SFNA 3E6DA 1WUVA 3RYKA 2HWF3 2LALA 5DZFA 1HXS2 1QKQA 2VMHA 1I5ZA 1O91A 3G7DA 5EXOA 1UX6A 4PF5A 3BIWE 1W6MB 4F8AA 1OOPA 5FMBA 2EIEA 3ZFFC 4NIGA 2JDPA 2WS91 5DDJ3 2FDKA 2WUHA 2D6KA 4XQDA 1KD7A 2ZGTA 1RTVA 2BNMA 2YDEA 3MLLA 2GSYA 5BPXA 2MEV1 4GB32 4ZY9A 1D4VB 4DUWA 5HXMA 3AMHA 4DPNA 2NM1A 3BYWA 4XXAA 5K4LA 3SMHA 3QACA 5FPBA 3N7LA 2X10A 1V6JA 1GWMA 3ZMOA 1WZXA 1O5LA 2C1FA 2E31A 4FOQA 5BNQA 5LA1A 5EJ1B 1R081 1YQCA 1SBDA 3WDWA 1UU4A 3AZXA 1B35A 1NCQB 5FPZA 3VBHA 3UYJA 4IV3A 2FZ1A 1RINA 4JDMA 1TME1 3N9QA 1RXGA 1S2KA 4LO6B 1ZA4A 1ZM1A 4XBLA 3MFAA 3NRUA 5T54A 3AKTA 5EZWA 4QX2A 1ASJ1 1H9WA 3EXUA 5DMYA 4OI0A 2GNBA 4RQPB 3M70A 3FHQA 3AP4A 3IAPA 1ULPA 1Q8VA 5ISLA 3AB0A 4XF3A 2VUJA 1F2NA 4IEQA 1JYVA 1O3TA 4E4DX 1H8VA 4IEVA 3B00A 1UCXA 3O0VA 2QQPA 3K48A 3CJIA 2WNUA 2ZA9A 1RUE2 1UY4A 2Y26A 3K77A 2J1UA 2R041 4LOSA 4N9IA 4YM1A 4Y4YA 1KQRA 4XEZA 1DZRA 5FJHA 5FZ1A 3VHOA 3WX5A 4FTEA 1PM7A 1V0AA 2ZX0A 5CFDA 2DVDA 4JHTA 3IDCB 3WW3A 2B7YA 2JJ6A 3HT2A 3FWEA 5D8AC 4META 2JICA 4QKNA 4LBOA 3BKZA 1WLDA 2WQ4A 4NRQA 3AZYA 3ZVXA 5IK5A 4RR3A 2ZX3A 1VALA 2YY1A 1ND2A 4UBHA 2O1QA 4OMCA 1IQDC 2WT1A 3WF0A 5FPLA 5C7GA 1FYUA 1VBC3 5FP4A 1ZRDA 1X8EA 3ZR5A 4BQ4A 5KC5A 1AUYA 3PVOA 1CAWB 4OUSA 1C8M2 4R8HA 1QQP2 5FMCA 2FMDA 3TNPB 1UY1A 2D97A 2VU9A 4PDWC 2VL4A 5CVRA 3IDEA 5DUUA 2QKDA 1SDDB 2WO3A 5DG1A 4RS5C 3MO4A 4BQ3A 3HPNA 5BY5A 1NZIA 4ZU5A 3BTXA 2PHRA 2AGSA 3N7MA 2RM23 4JAAA 3PURA 5L7OB 3FUOA 2W47A 1BHGA 3ZR6A 1YXWA 3KV6A 1GNZA 1GLHA 1AR71 3BB6A 2YV8A 3ITQA 4FOWA 4CEYA 4AQ6A 2G1MA 4WM7C 2EVXA 3CF6E 4BIOA 3JD72 4I30A 2VOTA 1NA1B 1W6QA 4YSFA 1AX2A 4MXWB 3BOWA 2ZS6B 3OD0A 5HXVA 3B69A 3WQ7A 4WM8A 3UK9A 2OZ6A 1MEC2 3H3LA 5LK7B 4PT6A 1B09A 3GJBA 5I0TA 3VZNA 1JYIA 2HWC3 5IATA 3PIJA 4AQ2A 1OQDA 5IT6A 1AL21 5E88A 1G7YA 4OLLA 4BYYA 5EPAA 4YM2A 3FFZA 3NKTA 4FO9A 1JI6A 4GMP3 1GKBA 1EPWA 2JIJA 2VBBA 2BTVC 2Y6KA 2DVFA 5LA9A 1XYNA 4JVAA 4RL7A 4DY5A 2B39A 1FV3A 4BLIA 4RGAA 2RS53 3MV01 1ZBA1 1WD4A 3UGFA 5FZBA 4F7ZA 2QQMA 1DYKA 4AQTA 3K51A 3USUA 3W20A 5G05L 4AEKA 2DU0A 3WHUA 4G9SB 4OI1A 4RGGA 4AVVA 4FQ4A 2GMMA 4QPIC 3MUZ1 4QKBA 3IKWA 1WKYA 1FMD3 2EXJA 2B9UA 1R1A3 2J22A 1UYXA 2Z5WA 1HJFA 1H8TB 3ZXFA 4Y1XA 5J48A 3U75A 2PAKA 3KGZA 2YBSA 5C4WB 1AR83 3VBSC 1RUG2 1C57A 4QU1A 2LROA 4Y1ZA 5FUNA 1RUD2 5LBBA 2JE7A 2AC1A 1XNDA 3KM5A 4C1WA 3NSTA 1SBEA 3M3OA 4LLOA 4ISQA 3IN9A 1V6NA 2PTMA 4UW4A 1RL3A 3RG0A 3W59A 4JV4A 1QNYA 3N7JA 4BU2A 5AC91 1DGWA 3E5XA 5FWJA 5FBJA 2YYOA 3AMPA 1RUJ2 1BQPA 1RUJ1 2ARCA 3UKVA 4CSWA 5L9VA 1ZZBA 3OY8B 1JOJA 2G9GA 2IXKA 1Y9GA 2UYAA 1X50A 4JX0A 4M3CE 3WG3A 2HJIA 2XVKA 4QGNA 2ZGKA 3OEAA 2RS12 3ZKYA 1OH4A 4PBOA 1F5FA 1ALYA 1DQ4A 2HH9A 3AYCA 5T5LA 1NCQC 2ZBJA 1QWRA 1LODA 3ZOIA 3T30A 2JIGA 2CWMA 3DXTA 1Z7S3 3M4FA 4YGEA 2OW4A 3H42B 1XNCA 2ZOEB 2HEVF 4MG2A 4RQPC 4B29A 4AI9A 2ZX1A 3PUAA 3AP7A 4MGSA 3ZN5A 2Q1MA 1YYNA 3BTYA 3I3DA 5L73A 5IFTA 1RHI3 2UWCA 1EY2A 2YGMA 3I2JA 1LEMA 1GWLA 1CAXA 1FOD3 4HMZA 2JWPA 5GJ6A 2R062 2AH2A 5JOXA 1UPSA 4KWJA 2UY8A 2XLAA 4AYUA 4BQ5A 4YGBA 4NE9A 2Y6GA 3ENRA 4X8NA 5C8CA 5FZOB 4COWA 1PZ9A 3KT1A 3UNPA 1OHFA 1PGW1 1XSRA 2A5ZA 1JZ7A 2H6CA 3N9MA 1XU2A 3BU0A 3VGIA 3V0AA 5K0UA 2X8KA 3K3NA 3W58A 4O65A 1YUDA 2A70A 2XB6C 3LFIA 5HCBA 1DQ6A 4ORFA 3WLUA 4DIQA 4K7JA 3WOGA 4NIAA 4ASKA 1LOCA 4BQYA 5JR2A 5IUQA 1ZREA 3SCFA 3JCIA 1D4M3 5EQUA 3HQRA 2E53A 4QPGC 1H2NA 1VBA2 1N3OA 1K12A 1KGYA 3OPTA 4FP3A 1JBCA 3W9AA 4ET7A 1NX9A 1RC6A 4FVVA 2BU9A 2EXKA 3WHTA 2FZ2A 1S55A 2RMU2 2RMU1 2Y6HA 1QJY3 1CGPA 1HRI2 4HVOA 4DUVA 5GM0A 1JN2P 1KS5A 5JSOA 1REEA 1VBE2 3PVNA 1V6OA 4UF0A 4YARA 1DQ1A 3ZYGA 3R4DB 4JGYB 4IV1C 4N43B 3RDIA 4YWAA 1HRV3 2XBO3 3EB7A 1NA1C 3ECQA 3SKVA 3W5MA 5CG9A 5HV4A 1CD3G 4OVEA 2QQVA 1ZBE2 1IS5A 1XNTA 5LK5A 1GMMA 3RNSA 1PK6A 4ZONA 3V64A 3SLIA 4DB5A 4YVSC 5I93A 5KHGA 2G4IA 1WBFA 1S0DA 3I2KA 4W8JA 4P9WA 3FLTA 4R9AA 4HANA 5CNAA 1WW6A 2B46X 2A3YA 2PLV1 3F2ZA 4IGPA 5F6LB 4Q4Y1 3T3YA 5CG8A 3AKPA 5F7UA 5I0SA 2V73A 4JQRA 1KRIA 3AMQA 3UETA 4KU8A 1GNYA 1RMU3 1LCLA 5IHRA 2JG8B 3H1YA 4GJZA 5A3NA 3AYDA 3O1MA 1SFYA 5FYCA 1QF3A 2RR11 4LBNA 3I2HA 1QJU1 2I45A 1ENXA 5IK8A 4BMEA 2W1UA 2OT7A 3D5OA 1OPOA 4Y5Z0 2YHJA 2XONA 2WIIB 4LO5B 4M01A 1W8HA 2DUPA 3LZZA 1UXXX 1BEV2 2JDNA 2P3YA 5E16A 4CXYA 2VUDA 1RUH1 4AW7A 4C1XA 4EWAA 1JH5A 1GOFA 1GNHA 1SFPA 4JTNA 1OBNA 1RXFA 1ZRIA 1C3HA 1VRH2 4QT6A 5FJKA 5T50A 5J36A 2XL7A 3U11A 1AXKA 2X5IB 1KEXA 4FOVA 1RUC1 3U10A 3WNMA 2ZGQA 1W6OB 4UFMA 2WN2A 1LR5A 3I8TA 4YZ5A 4PLOA 4EN7B 3T0BA 1HB3A 1WW7A 4L97A 2VBPA 4AVTA 5A1AA 4QKDA 2HWF1 2P3JA 4IEWA 2HBTA 4G3YC 2V09A 1TME3 3AMMA 1VE0A 4LHNA 3RYRA 1T6GC 3ZX7A 4BDVB 1GOGA 2EXHA 5C70A 1BBT2 4YM0A 1J1LA 4HKWA 2CYFA 1K3IA 4AE2A 4RA0A 1KDMA 4CRQA 2BERA 2GH8A 4W6XA 5CZKA 5FMDA 2GP5A 1C8NA 1ZVFA 4UFJA 2VMCA 4QX8A 5LBFA 3LIGA 2XJTA 3FJSA 2D6NA 4J1XA 2CGPA 1OPMA 1SLCA 4P5HA 5A6XA 1V6MA 3KT4A 5ABJA 3S7EA 4IE7A 4RFRB 3AKRA 1RUE3 4BM8A 3E5QA 3U14A 1POV0 4PQ9A 1W8ZA 5IFPA 4EWEA 1APNA 1K5MA 1J58A 1GZWA 3SQOA 2YGLA 1L7RA 1UYYA 1LRHA 2JKXA 2K2SA 3J26N 3O7OA 3NNJA 2KM2A 3GBWA 3RWNA 2I07B 2OPKA 1O3RA 4M3CA 4ATEA 1OKOA 2W5FA 4OULA 4IE4A 1GZTA 2WN3A 4YGDA 4E4ZA 1AR62 5D21A 5LEJA 3LB9A 5DZGA 5BNNC 3ZMNA 3RGBA 2P6HA 4Y4RA 3IMNA 5L9RA 3L2YA 1F31A 1LULA 1QOTA 1WLTA 1B35B 1RUF1 2UU8A 1J3RA 1C8M3 1TZOA 2YC0A 2VVFA 3AZZA 4Q4X2 3VBHB 4IV3B 4N53C 3DPRA 3LWCA 5I0RA 2VNOA 3M7AA 5FO9B 2H0VA 5HV0A 2W9XA 4EV0A 1DGRA 5FZAA 4JRLA 1EAH2 2YROA 2OX0A 1W2UA 5LY2A 5D2AA 2VG9A 2JXAA 3ACFA 2BNOA 2WYFA 1ZA7A 3AK0A 3H50A 4P9LA 2DWRA 1KFUL 2BBVA 3P6BA 1AR73 3GZUC 4AVCA 2DYCA 4CEWA 3FBMA 3NV4A 2Y38A 1OKQA 3JD73 3CJIB 2WNUB 4Z92B 4P9IA 1DQ0A 1VBC1 1U0AA 3EYPA 1AHSA 2AR6A 4FBFA 4HOOA 1L7LA 2ZMLA 3P5BA 4LKEA 1G8WA 1D0GA 4XMAA 4CXXA 2ADDA 1RJ8A 4M4RA 4IEXA 2W92A 5CFDB 2W46A 4JDNA 1ACCA 5CKMA 1I5PA 1ND3A 4TYSA 1WLWA 3SCGA 3OGVA 5DUVA 4HVQA 1A8MA 5FZIA 5JZGC 2JDZA 4JKKA 4AF9A 1CQ9A 3THPA 3W5NA 2D6MA 3ZYFA 3VHRA 4RR3B 2Q0AA 4QDRA 1ND2B 2RM21 4GAZA 1LENA 3IIIA 4I09A 1ULCA 4MGZE 4UFLA 4CDXC 4KWKA 3M3IA 3P3PA 4BQ2A 2WRAA 4JGYC 4N43C 4GKXA 5A70A 1JYWA 1E5RA 3CMGA 3DN7A 1ZBA3 4IXLA 1CN1A 1J3QA 3U1XA 2W1QA 3VDAA 4DOUA 4QWNA 2ZX2A 3WF4A 1RIRA 5I8SA 1AR92 1ZRFA 1NE4A 4MHUA 5FK7A 3D0SA 2XXZA 1W99A 1T6BX 4CCOA 2FCUA 5KHJA 3FLPA 2IXJA 2HWC1 4XZUG 1HQWA 3PJYA 1F5JA 3OY8A 1UQXA 2QDNA 2VZ3A 2XLGA 1WMDA 4CEYB 2RJLA 1KDKA 3PUSA 2JG8C 1ENRA 3OGGA 4QDSA 1W6QB 2ZAAA 3KCXA 1AYM2 4BOWA 1DYPA 1NKGA 1RUD3 4LTAA 3S6PA 4EQVA 1UAIA 2QQLA 2V5DA 3WP4A 1CPNA 3QOPA 1ZZ7A 2DV9A 1XBFA 1W2AX 2RS51 2WFF1 2BJSA 2KD7A 2PAMA 3LEKA 4H14A 4WM8B 3WY6A 3BI3A 3D4KA 4NPRA 5AC93 1CESA 2GN3A 3O12A 1K42A 1SBFA 2DCYA 2WDBA 3RYPA 1RUJ3 1TNRA 1S0CA 4NHLA 1GOHA 3VBRA 1VB2A 1LGNA 4TSVA 3VL8A 2A1XA 4XIKA 3PVBB 2VZRA 1D2SA 1FMD1 2BBAA 3C7FA 1WLCA 4KBZA 2LW8A 4H2AA 4YZ3A 5IYYA 3GBGA 5EYYA 1DDLA 2RS13 4A41A 4AGVA 3TEYA 2VQAA 1UMHA 1JYXA 1CIYA 3LGRA 5FQ0B 1AF9A 1S2BA 2QTWB 1MS8A 1OD3A 3VKNA 1VBB2 5FZ4A 4N8MA 3CQOA 5AVAA 5TSWA 1H1AA 2YPJA 3IWZA 4AGRA 5BNOC 1OLRA 1CWPA 4QQLA 2VTXA 2A3WA 4LR4A 1SACA 3ST7A 3LDBA 4D6RA 4UW3A 4GA9A 5ANNA 4FTSA 4D8MA 2VMEA 3VV1A 1OF3A 1AZDA 4P14A 2OQ7A 4Q0QA 5A32A 5F3CA 3FZ3A 2DTYA 5I8TA 2J1TA 2W3JA 1VR3A 1O4YA 1OOPC 3Q8CA 5GLWA 2VMFA 3H3ZA 5A7QA 3HN3A 3OOXA 1RUNA 1COV2 4CUBA 1CIWA 2HEWF 1W8FA 1Z7S1 3A4UA 4LHSA 5FKBA 3RPQA 1OD5A 4DINB 1UU5A 1Q8PA 1NAEA 3OPZA 3ZXKA 4IE6A 5BUVA 5F5CA 3O1PA 3AXDA 5FZEA 4HK9A 5FPVA 3ZFEC 4K8FA 3J8F1 5F6KA 1XNAA 3KD4A 3N9OA 1LESA 5A3OA 1E5SA 2YU1A 2ZMNA 5KXDA 3MLKA 1ONAA 1FXZA 4W6WA 2EALA 5F3EA 1JZ6A 4MH0E 4COZA 1B35C 3WW1A 3UKTA 3VBHC 1W6PA 5JWPA 1QXRA 2J1EA 1UYZA 1VBA3 2VNRA 2PHXA 4KBBA 2BWAA 3WV6A 1POV1 3ASIA 1SCRA 2VXJA 1O59A 4IGQA 4QAWA 2RMU3 2CTVA 3BUCA 1UN1A 2AYHA 3HNMA 4HFSA 1IG0A 2ZKLA 5HCFA 2XLFA 4JRAA 4XBQA 1X36A 1VBE3 2E63A 3WNPA 1WCSA 5LBEA 3MIHA 1O6UA 2SBAA 1CAXB 1AYN2 5IW0A 1QEXA 4NMIA 3TAYA 4L92A 1ZZ9A 3KV9A 4Q4V2 4Q4V1 2ARBA 5C8CB 4MX3A 4C8DA 2PFWA 4AR2A 5F3GA 3T4HB 3ZSMA 4XTMA 5CFDC 3OBRA 4LKDA 1RB8G 1ODMA 3K4DA 3WQBA 3NQHA 3WP3A 2D7FA 3IT8A 1W3XA 3CJXA 1R091 1YIPA 2VZVA 5CFCA 4E4SA 2IXLA 4JGZA 4BZ4A 2BGCA 5K0UB 1NCRC 4Q4Y3 3VBOB 4NR1A 2W1SA 3GBFA 3AYEA 4PJYA 4RR3C 2D3PA 1F4AA 2G9FA 1X7NA 4CDUA 2XJVA 3ETQA 4AWDA 2BNNA 5DUXA 2PHDA 1JW6A 2Z4FA 4LXLA 5FLIA 2RJKA 3ZLIA 2ZEXA 3AFGA 3KZ4C 4SBVA 5HCAA 4CYDA 4X8PA 2XVGA 3HWJA 1BEV3 3H0OA 1RUH3 5LWBA 3TYJA 2WFPA 5IJRA 2Y0IA 3RZHA 2JD9A 3Q8AA 4IEZA 4ASLA 5JXGA 2UWAA 3ZPOA 3PTYA 5FYVA 3VDDA 4ATFA 1UD1A 4OZXA 1UKRA 1H6XA 4HKOA 5CYYA 4UF0B 2BWCA 1GUIA 2Y64A 4W65A 5F39A 1POQA 2VPVA 3WZ1A 5ACA2 1US3A 4AEDA 3T2TA 4W6YA 4URTA 2A6YA 2RS32 1HXS1 2Y0OA 3DUIA 4IEUA 4XFHA 2RE9A 1PK6B 5L19A 4KH9A 3LCPA 4UWDA 3QD6A 1BBT3 1U5IA 5J7MA 4WBBA 2BW8A 1A34A 2W95A 3AP6A 3I7DA 3LKJA 5DZEA 3VD4A 4Y22A 4LO4B 1W28A 1QH6A 4NRMA 4HXCA 3ZSJA 3CZJA 3WDYA 3ZYHA 3TEWA 4GB31 1K45A 5IVJA 4FFFA 1F15A 4CUGA 1CJPA 3U4XA 3DECA 5F5IA 3S5QA 4JC1A 1W9FA 1URXA 1UX7A 2C9KA 1NQDA 2ZX4A 4IEOA 3NNGA 1H6YA 4LNVA 4WVMA 4XFFA 4E27A 1LKNA 3NJXA 1LTEA 2CAUA 2YZ4A 2W91A 1JUIA 3UESA 2VXRA 3LE0A 1WGPA 3LF7A 2GU9A 4QM8A 4M00A 4AI8A 4A7ZA 3WF3A 3AKQA 1G9FA 2IFWA 3FFQA 1YQ6A 2H0BA 4QQ2A 3QH6A 3IDBB 2XQXA 4AFCA 5FWEA 4A6SA 5JPMB 5FFOC 2RDNA 3WNOA 1ZRCA 1H2KA 2P2KA 1CONA 4OHWA 4UW5A 2FDGA 4IE5A 3QCWA 3U4SA 1CZSA 5J09A 5HI0A 4YW3A 5GZCA 2ZZQA 2BQPA 3HD8B 1S1AA 3IIAA 1RUF3 3HNYM 1IS4A 4Q4X3 1RUE1 3SC7X 4AEJA 3WVJA 3DXUA 2ZGOA 4F83A 1PZ7A 2BV4A 4EWDA 5A33B 4NAMA 5CISA 5K8SA 3T2PA 3O1VA 5JXIA 2NPIA 3ABZA 1ULDA 2UWBA 1EAH3 1JHNA 1FNYA 3D3AA 4NHXA 5EV7A 2ORZA 5EIYB 4QKFA 2E7AA 3O5SA 4I02A 4A4AA 2C6SA 3NNFA 3WEZA 5KC6A 5FP9A 1PX4A 3VZJA 1FI2A 4AAPA 2BRTA 2FDFA 2FQPA 2EF6A 5ABJB 4S2DA 3W21A 2WWUA 5EYXA 4NPMA 5A7WB 2W08A 2BUKA 2R0HA 4YVWB 4KG8A 3VKLA 1RITA 4CTEA 2NN8A 1IKQA 1K5MB 2C5DA 4LULA 3VBFA 1GZWB 2WL1A 3HBZA 1C8M1 1W6NB 1QQP1 4W50A 3ZXLA 4ONUA 1GV9A 5FREA 4C0HA 3NAPB 3MW3A 1LOFA 2WO7A 1W9TA 3AL5A 2DFCA 4M3CB 4IW3A 3RI8A 1W9SA 4JQTA 1Q5OA 2Y6FA 4O7XA 4YW7A 3ZFGA 3A0NA 1JZ5A 4FPYA 4M4PA 3T1LA 4P9YA 1RUI2 1Y9MA 3O14A 3AVRA 3BALA 3MICA 3JD71 4IE0A 5F2WA 3VZOA 1HB4A 4RHV2 5FRAA 1AR93 3RSJA 4LBKA 3DPRB 4E9KA 1O3QA 2W1WA 5LASA 1YO8A 3TOJA 1MEC1 5DAQA 5BXXA 1SMVA 5FIXA 3LEIA 3M8LA 3FUQA 1PMHX 3VBUC 2XHKA 4Z82A 1IGOA 4KWUA 5FY4A 1ODNA 2WNVA 1GQGA 3MPBA 3ES4A 4HK8A 5J96B 3C7OA 3HOBA 1JYCA 4CEWB 3DL3A 2P4EA 1PIV2 5EFUA 3TBDA 1OLQA 1ULEA 2WA3A 3WG1A 1AYM3 3CDZB 4GWMA 5GLVA 4QQHA 4ZZ5A 2YU2A 1OT5A 3BPZA 1BLZA 2YG0A 1W04A 2O0OA 4QX3A 1XRUA 1PNFA 2WFF3 5FYHA 2CWSA 3NNLA 4L2NA 1FPN2 3J4UH 4DS0A 3ZFFA 5FQ0A 1ND3B 4AZZA 1QJEA 1REDA 4GWJA 1W2NA 1Q43A 3PDQA 2YUEA 3I3EA 4NPLA 1T2XA 3S0MA 1C4RA 4LBQD 1XJAA 5KXCA 1W9WA 2TUNA 4Q0VA 3MW4A 4H7LA 3M3CA 1DZQA 2Q8EA 4LK6A 4WVZA 3I49A 1VIWB 1NG0A 4TXWA 3R4SA 4NHMA 4Z1VA 5LZ6A 2AACA 4OYUA 1RUG1 2VUAA 3H9AA 4QHBA 1RUD1 2HLEA 2WO1A 2WQZC 4AHWA 1OVPA 2YMZA 3FMGA 4DXSA 1PGL2 3HIFA 1UZWA 5FBZA 2ARXA 2RV9A 1LNSA 3FX3A 3O1OA 2W87A 5FP3A 1CAUA 3MF6A 1LU2A 2LRPA 5LCWL 2TNFA 1PM4A 3M2MA 2OZJA 5J98B 3OTFA 4Y20A 2CAVA 1NLSA 3SXWA 2VW0A 2W39A 5JMCA 4EJRA 3ZYBA 2HEYF 4KI5M 2RHPA 1MS9A 1U5XA 1VBD2 3GHNA 3LSDA 4FTBA 2OXBA 4OQ8A 1NT0A 2VMIA 4X6RB 1LHVA 2GMEA 2VVDA 2RS11 2DUOA 3T08A 1YI9A 2GH2A 1Y7BA 4LQRA 4YW4A 4Q29A 4HONA 2KXLA 3EBRA 2MNGA 5FAXA 1O8SA 2VCCA 2CGNA 1COV3 4YW5A 4COUA 2ET1A 1F8VA 3AZWA 1IOAA 1BKZA 1RVF2 1W8TA 4MZUA 1O5UA 2D5FA 1D7PM 2J42A 2DU1A 2Y34A 4XILA 5D8AA 4EN9B 1OC1A 4BQXA 3VBRB 2QQWA 3LA2A 1NY72 4KGGA 4CCNA 5FOBB 4M0NA 1G9DA 4ZXEA 2ZKNA 3J8F3 4KGQA 5C3RA 4DEVA 5EWSA 4ZKTB 1IZ3A 3EJKA 1GICA 2VY0A 1W0NA 4H3WA 3NVCA 5GLTA 3U0ZA 2R061 4L8QA 3CL1A 3GM8A 4AVSA 2XUEA 3N35A 1TEIA 1GWKA 4Y5SA 3N9PA 4K21A 1POV3 4NROA 3NL1A 3JB4C 5F9TA 4XFBA 3OCPA 3DYOA 4RS5A 2VOXA 4HSLA 1QJX2 3TB0A 1DYOA 4QU2A 1C5HA 1O4TA 4B4PA 5F37A 5A6QA 4NWVA 3VBOA 1W05A 2PAEA 3POFA 5C3SA 5C71A 1SLTA 2OS2A 2X05A 2BOIA 3ZXAC 2WINB 2C26A 2BVBA 2X53S 5A7PA 3E97A 4AL9A 2Y6JA 5A32B 3J7MA 5ABJC 4Q4V3 1KJRA 2ZAHA 5APAA 3APBA 3ZSKA 4FPFA 1F35A 4I0AA 3O1RA 2XG3A 2AEYA 1UKGA 3OD4A 3IBMA 3T2OA 1OH3A 1ZZ8A 3RFRA 1JU4A 1DF0A 1Q8SA 4AXOA 5T5JA 4CP2A 1HN1A 3O0XA 1AX1A 1VBA1 2VZ1A 3UV9A 1MZ6A 1TE1B 1R093 1WW4A 2VD7A 2VQ0A 2EIDA 1CVNA 1OSGA 1YIFA 3INAA 3C7EA 2BGOA 2D6PA 3AM2A 3M3EA 2Q8CA 2ZHMA 5JAXA 3NKGA 4GKYA 1J84A 4N7IA 4DFSA 2TBVA 1XNBA 4I01A 2XJPA 3DCQA 3ZN6A 1HRI1 1QGLA 1W9YA 1O8PA 2FCVA 4Q4W2 4HN1A 1VBE1 5GZEA 5L7OC 4FI9A 3LOBA 3RVHA 2KR2A 1H4GA 4BWOA 1S0IA 4LUKA 4UAPA 3LPFA 2K9ZA 2GZWA 4W4ZA 1W6PB 2W2IA 4D3WA 5J1XA 2QFEA 3FE5A 1ZBE1 4D6SA 3DPRC 1GQHA 3FL7A 5JIAA 3I3QA 3H8RA 5JIUA 1SDWA 2QQUA 1CX1A 2GC2A 3ILRA 5JR7B 2DUQA 4DMIA 1WCKA 2A6XA 2E32A 4QB1A 4B3NA 3HJRA 4I2OA 1H1MA 2EAKA 2ZEYA 4YW2A 3VD5A 1UNBA 2A71A 1DCSA 2NMNA 1OMIA 2OIIA 5ACA3 1S0EA 2Q1ZB 3ILNA 4A7YA 5LRRA 3DKQA 4FSJA 2VE1A 3HBKA 2RS33 3FHIB 1HXS3 3VBSA 1ENQA 1Z78A 2VUCA 3WF2A 1LGBA 2IC1A 1SLAA 1I9RA 1FX5A 1WA4A 2IVIB 2QQJA 4WZFA 4DXZA 3BU7A 3MIDA 1NXMA 4XOGA 5BYNA 3GCXA 1VP6A 3KLSA 3VD7A 1ND3C 1UO9A 4I3GA 4NHYA 1BEV1 1UW8A 1RJ7A 3MF9A 5CFCB 4PQQA 4JGZB 2RJ2A 1WW5A 1LOAA 4L9BA 1UMZA 5FK8A 4GB33 2ZGLA 5FZCA 1VRH1 2Z42A 4V1PA 4LKSA 4F3JA 1W8OA 5A7NA 1HN0A 4CDUB 1CZVA 5JLVA 3PLQA 2B9VA 5IK7A 2ZXQA 1EV12 1H8TC 4FXKB 1XPWA 5JSRA 4BMBA 4EE2A 5K9YA 3WR0A 1G9AA 5C4WC 5FXXA 3OBTA 2NYYA 2CNAA 3JBG2 4Y33A 1PO22 5A33A 4NIIA 2CU5A 3ILFA 3OUIA 4PLMA 4BK5A 4OI4A 2O14A 1BBT1 1XQNA 4O9GA 2VOVA 1WA6X 3AP9A 4Q1PA 2DTWA 5FY8A 3T1MA 2P3IA 2XJSA 3H7JA 4HZFA 4WVVA 4XHBA 5FZ6A 3TN92 4OCTA 3VDDB 1SPPA 2EA7A 2WZR2 3QBQA 4PI0A 4R9DA 1EPZA 5E89A 4C91A 5B4NA 3SEPA 5CU1A 2P6CA 4IEPA 4BCUA 1PO12 1PO11 5KHHA 3RMXA 3WP5A 4NJ4A 3KHCA 2D6OX 4AEDB 3WW2A 3LQCA 3K3OA 4IESA 5A7WA 1Q56A 4IEYA 4YVWA 4KNCA 3E6BA 3LDKA 3VB9A 5FPAA 5FZLA 3VKMA 5KXEA 2GALA 1YC61 1W6NA 2PHTA 5C33A 1WBLA 5DDJ2 3NJZA 5LW9A 3NJYA 4Y22B 3WINE 1KJLA 1VMJA 3NAPA 3THTA 3ZYPA 3VBRC 3K46A 1KFXL 3C3VA 1AX0A 3IPVA 3ZXGA 1UZVA 4P08A 2ET7A 4UFHA 4URAA 4LLFA 2WJSA 4DRVA 4J1WA 1LHNA 2ILMA 3JQWA 3P1IA 4YFWA 4CE8A 1AR61 1U5ZA 4XUTA 3OYWA 1VAMA 2YBKA 4WVMB 1CAVA 2D43A 3SH3A 1HV0A 1MZFA 1D2QA 3B3QE 4PLNA 4Q4X1 4QPGA 1QQP3 1WCUA 2XL9A 4MSVA 3KMHA 4AGGA 3WDUA 4NWWA 3R0RA 5FR3A 5A3UA 1XOYA 4XTPA 4IGOA 4XAAA 2J1VA 3ROUA 1MR5A 4HKLA 1EAH1 3WG2A 4AHYA 2E7QA 3T2QA 1JZ4A 4CA9A 4Q26A 2VC9A 3N36A 5FUIA 1DQ5A 4ZS3A 4X6QB 4OMDA 4NVPA 1NQJA 4XCBA 4AI3A 1VRBA 4Q8LA 4UXAA 1WD3A 1RUI3 2QQIA 5CKQA 2VJXA 4IV1A 5FLHA 1YRZA 4B1MA 4UYBA 1LOBA 2V72A 1TQ5A 3KQRA 2WZPP 1C1LA 5IVEA 1ULOA 4RHV3 4MGTA 3C8XA 2R6QA 2EAAA 1OA2A 2ZHNA 2GP3A 1MEC3 4MV2A 1MQTA 2QJVA 4CDWA 4Z2AA 2V4VA 2JE9A 3H8XA 2LUWA 1UYPA 1LHWA 1BMV2 1CPMA 3VKOA 5B4XA 1W8UA 4YYOA 3RZKA 4XJUA 2DCZA 2XDVA 2VNVA 5FYIA 1VMHA 3SITA 2I74A 4B8EA 2O8OA 1PVC2 4XPVA 3LDRA 1A8DA 4YPJA 1ULFA 2GC1A 2JB8A 1DFQA 4KMQA 1OVSA 1UZYA 3AYAA 5A3WA 1KITA 1HB1A 2CHHA 4GIQA 2WSUA 3C7HA 4LBLA 3VBFB 2ES3A 3Q8BA 1FPN3 2ZGPA 5GZDA 2VNGA 1EUTA 2PHLA 3ZN4A 3GXUA 2GMPA 3FLRA 3LAGA 4D7TA 5A6ZA 4ZHNA 1AR91 1UL9A 4LITA 1TNFA 4CP0A 1WWYA 2HWD2 4DQAA 2A3XA 4GD4A 2EIBA 4XACA 2D5HA 4XFCA 2ZEWA 2VMGA 3VDCA 4EZHA 3I3MA 3ZFGB 3KHBA 1PHMA 2QVSB 4FQZA 4BPZA 3LD8A 4XAEA 4A42A 1UOBA 3NW4A 2LS6A 4QXCA 4E2SA 1JOBA 1LHUA 4QX0A 3ZM8A 3MBWA 5LEKA 5A3LA 2GNDA 1RUG3 2WSVA 1AYM1 4P00B 4XZPA 2QDRA 4CU6A 4YGCA 3LIHA 3JQXA 1H30A 2VO5A 1MACA 3E5UA 3ON7A 4LK7A 4O9EA 4LO7A 2WNOA 3KVAA 3Q8FA 3Q9OA 4TWTA 2HWB2 2IUWA 3K4ZA 5CB7A 2WNEA 1DGRN 5BNPB 5CFCC 2Q5TA 4D69A 4QXBA 3Q8EA 1LAJA 2WNVB 2JG9A 4Q2FA 2VECA 1US2A 4CP9A 3QH7A 2X5IC 4FAGA 2WT2A 4PIZA 1OQ1A 1W0PA 3S7IA 4QXHA 3A22A 4IETA 4N9HA 3OGSA 1MS0A 1P8JA 1UPIA 4CCDA 4R4ZA 4R4XA 4GQ7A 4FFIA 2QQNA 1W90A 1V9U2 2DVGA 3ZFFB 2VM9A 4LHKA 4PBPA 4A7KA 2WZEA 1RVF3 4ES9A 4OUMA 2J1AA 1VBB1 4BK4A 1DHKB 4YM3A 3BIEA 3V65A 1JMUB 4JTOA 4AG4A 1JZ8A 2R1BA 2JDUA 4HSJA 1D0HA 3MDPA 4XCAA 1PZ8A 1W3VA 4MO3M 2OYZA 3RZMA 4K1ZA 3UGGA 4LBMA 5BNNA 1YFYA 2R063 2BPA2 5C3PA 2VW1A 1RYYA 3GCWA 1AR82 2C4XA 1BCXA 1DGWX 4K40A 4DZGA 2W52A 2ZZJA 3D8CA 2OKXA 3RMYA 3PU3A 4XUPA 1COV1 1XB9A 2CSGA 4HT1T 1YJLA 1QJX3 5I0UA 4AFDA 3B9CA 4TN7A 5IK4A 4Y1YA 1CAUB 5FO8B 2DCKA 2WYSA 4JZRA 3MLJA 2WLQA 2J1SA 3V56A 4CVUA 4Y20B 1H0BA 5FDBA 1BVVA 3AL6A 5C9AA 3MPPG 2PHWA 1QNWA 3KGLA 4KG0A 1UOGA 5FYSA 4J6GA 3THCA 4XFGA 3IZOA 2UYBA 3BODA 3HMYA 4XJ8A 3UJOA 5A3PA 3I54A 2OUHA 3EMRA 4EN0A 2WO2A 4IV3C 3NMBA 2JKBA 3GALA 2P5BA 1X9PA 4FFGA 5D8AB 4MUVA 1AVBA 2Y33A 3OJBA 2IXCA 4AI2A 4KQ7A 5C8WA 4QGMA 5JZGA 2X29A 2XMLA 2VULA 3RJRA 1HRI3 1TMF2 2YBPA 2O8QA 4OQ9A 2HWE2 1YFUA 1RHI2 3H1MA 1X33A 1VAVA 1FOD2 2XWBB 3EHKA 1AYN1 4ARXA 3CJIC 2E26A 2WNUC 3CEWA 4TLFA 1DG6A 3ZSEA 1SEFA 4QB2A 5I0DA 2Q1FA 4TTGA 4OZOA 1ZBE3 3GHMA 2P17A 4YNIA 1TVGA 3FBYA 3WP6A 4Y1UA 4EYUA 4RS5B 1LHOA 4XJAA 4UI9L 2AZ5A 3VZKA 2FDIA 1JHJA 2E7TA 1L7QA 2Z79A 5F3IA 2ZPXA 3MI8A 2JEMA 5FZFA 1XXNA 2OUJA 4PCRA 1UZ0A 4CU9A 1UXZA 3VHPA 4COYA 4E8CA 4ARYA 1GYKA 3KB5A 4FCAA 1DLCA 1ND2C 4R52A 5IWFA 3USSA 4WM7B 3DEMA 4LHLA 3POGA 3WNLA 5FZ0A 4BXFA 3WG4A 1WMXA 2IZWA 1D4M2 3VBFC 1VAKA 1OUXA 4CZSA 2QE3A 2R072 2ZTNA 1N3PA 4B1LA 5FZMA 2WKKA 1C28A 3A0KA 5LY1A 3S30A 3PMSA 4WVWA 5FO7B 4DXTA 1LOEA 4K6BA 3N3HA 4FPEA 1VRH3 1JODA 1LGCA 3H8UA 4XHXA 1DZTA 5JI7A 2JB4A 1QJY2 3ZN6B 3JB8A 3ZFGC 1MZEA 4LE4A 2I2SA 4CEYC 3V0BA 1EV13 4XC9A 4FP2A 3POJA 3WSOA 4AHXA 5ACA1 4CPBD 2Q8DA 1HRV2 3JBG3 3JZVA 1OFSA 2A75A 2RS31 3MFCA 5DABA 1ZRRA 2JDYA 4OHYA 4XUQA 1PO23 1OURA 4RSUA 1GP4A 3I3BA 4ES8A 4WM8C 4PIYA 1OFNA 5ANQA 4QQPA 5FPUA 2CDPA 5CEHA 3OG2A 1ZYBA 2XH6A 5BNOA 2ZGUA 4QPIB 3TN93 1XNKA 1QJZA 2WZR3 2Z69A 1YI7A 2D93A 2WNVC 2YC4A 3SNMA 4XFAA 3I2OA 4MGIE 3RZJA 1PO13 4DEQA 1G9CA 4ISRA 3B02A 1RMU2 4RN5A 5F32A 1GR3A 3M3QA 3ORJA 3OEBA 1S4CA 3T0AA 3POEA 4JDOA 3VBSB 1H2MA 2VVEA 1HDKA 1X8MA 3BPSA 2XUMA 3OGRA 3RZGA 4XF1A 5JSPA 1WMFA 2WS92 4D94A 2DFBA 3N4MA 2EIGA 4Z07A 5FZHA 4HPKA 1Y3TA 3GZTB 1VPHA 1Y43B 3ZIXA 3WCRA 4LT5A 2MEV2 3RZLA 5KHIA 1J3PA 3ZFEA 2SLIA 1GZ9A 2K0GA 3E6CC 1N1VA 1AR63 2VR4A 5I91A 4NHKA 2XKPA 5HBAA 1LECA 4Q1RA 2F6BA 4IL7A 1HKDA 4Y3OA 2BEOA 2JE8A 4RYDA 5LA2A 1R082 1ZZCA 2JECA 2BDRA 3DYMA 1BJQA 3P3NA 1Q3EA 3PL0A 4IDZA 3KCCA 2AUYA 2D6LX 4XBNA 5KXBA 1I1EA 4EZ4A 4PI2A 1TME2 2A73B 2QZ2A 1YFXA 3FHAA 1N1TA 4ZPIA 2VW2A 4XQ4A 1NUKA 1Z0HA 4QHZA 1ASJ2 4GZ9A 1VB4A 3L2HA 3R05A 2DDUA 4N7UA 1SPPB 1YHFA 2G9ZA 2XQRA 3F95A 4XXPA 4Y1VA 4QB6A 4ZS2A 3RWKX 5CAZA 2VGDA 2P1BA 1A78A 1G6NA 1S2EA 3VL9A 2HYKA 3PJQA 2GC3A 5EP9A 4NOTA 2E33A 4EN6B 4ZU7A 4MGYE 2JDAA 5J37A 4MVTA 1UY0A 4L99A 3KT7A 4Y26A 3BGAA 2VZQA 4CDQA 2R042 3ACHA 4FPLA 4YW6A 2DF7A 1OA4A 1PMJX 2PN5A 1UOFA 5H9QA 5FZ7A 3UKNA 4A3XA 2CGOA 2Q30A 4CUCA 2HBUA 3B93A 5FXVA 1IS6A 1IS3A 2ZGSA 5FYUA 1NCRA 3IPVB 5JOYA 4CCEA 1XE0A 2VTFA 4C90A 2CY6A 3AKSA 1TG7A 5LBCA 1PVC3 4BISA 2PHFA 3WF1A 3OYWB 4FFHA 2Y6LA 1JOPA 1FAYA 1CAVB 1LJ7A 3NO8A 4HL0A 1RUI1 2FBEA 5JCTA 2WT0A 2J1RA 3VD3A 1W06A 2IVJA 1R1ZA 1RGSA 2YFUA 3CKHA 2ZJCA 3MW2A 4QPGB 5C8CC 5FZDA 1R64A 1YQ5A 4LOTA 4RHV1 4XDOA 2XJQA 2BVVA 2C24A 4GH4A 4J25A 2B4KA 1JZ3A 1IQAA 2HWD3 4FPHA 5L9BA 1ZX5A 3GGLA 4DRRA 4Q0UA 5BNPA 4JKLA 5K0UC 4YZ4A 5A3MA 2GNTA 3VBOC 5GZFA 3BTZA 2GN7A 1AR72 5F1RA 3SH4A 1XC6A 1DU3D 4GALA 4IERA 1PIV1 3PTRB 3U07A 4IV1B 5BV6A 1NZCA 2VZTA 2VH9A 4A44A 1ZNPA 3AJYA 4CCJA 5FY5A 2R7EB 4YVSB 1FPN1 1HQNA 2HWB3 1HIXA 1MQTB 4CDWB 2VOWA 1OLMA 2ZCWA 4XUOA 1G86A 1IPKA 1QU0A 1CR7A 2JDHA 1AL22 2LM3A 5LB6A 3FC0A 3MGUA 4XDPA 2RDRA 2OA2A 1J83A 1QXPA 2B5HA 4OFGA 3NJVA 5JPNB 3ACGA 1GU3A 4MGKE 1YJKA 1UMIA 1LEDA 2JENA
chains in the Genus database with same CATH topology
4WV8A 5K7PA 4XMIA 1QHDA 4YZ2A 1AJKA 1BXHA 1ZBA2 2GAUA 3GF6A 1KXGA 2KA3A 2V5YA 3I59A 4KWLA 1V9U3 2PELA 3EO6A 4UBGA 3WUCA 1PK6C 1WMEA 2A6VA 2R32A 4QMAA 1PGL1 1VBB3 1BYHA 3HN1A 2QCSB 3TRSB 3I4IA 1HV1A 1XE7A 3ALQA 4B4QA 4QD2A 4PIXA 1DBNA 4YRDA 2WA4A 4XFIA 1SCSA 1QY4A 3URFA 1VBD1 4BLJA 1YFWA 2NZ9A 3KSCA 1SLIA 1I3HA 3VKFC 5JVVA 2BYVE 1IKPA 2AREA 5AC92 4COVA 2OVUA 1F9KA 1RVF1 3AP5A 3MYXA 5GKAC 3KCYA 2UURA 2JG9B 4AQSA 3POYA 1NY71 2C9AA 4Q27A 4INDA 5I8YA 4S2HA 2E9QA 4RD7A 2DVAA 4YG0A 4I3PA 1YCIA 1X82A 1QDOA 1PNGA 5T52A 3DKWA 3DV8A 1UZZA 3DF0A 4JCKA 4AHZA 2D98A 4KU7A 2HKXA 4PDWA 5GLZA 3RQ0A 3KS7A 4I0WB 3WNXA 1NE6A 2MPFA 2DURA 1QJX1 4R9CA 1TMF3 4K20A 1UIJA 3RZZA 4D7YA 4E2GA 2ETEA 2HWE3 3GZAA 1S0JA 2XJUA 5BNNB 1AYN3 4WM7A 5FCCA 5H9PA 3SH5A 4YW1A 4YVWC 3B94A 1QH7A 3MIEA 4N53B 4LA3A 1K5MC 5CADA 2CV6A 4FT8A 1AJOA 1PGW2 1U5YA 1IHMA 4ZXKA 4BA6A 4HN0A 1XYPA 4XF0A 3NAPC 4SLIA 2ZHKA 3VBUA 4Q0SA 2BFUL 2XPJA 1O4ZA 4EN8B 3WXPA 3AX4A 3AXEA 1V6LA 2JD4A 5JI9A 1H2LA 1OA3A 4YLZA 5H9RA 3VN4A 4Q4W1 2XJRA 5C9AB 3IM0A 5DG2A 2ZGNA 1AXYA 4OHXA 3D82A 3JU9A 1VLNA 2IFRA 2P37A 4GULA 2PA7A 2R073 3MEPA 2B45X 2LTNA 1C5IA 4Y24A 3WT3A 5JZGB 4H7MA 2QUOA 4LBJA 1NXD1 4H55A 4QPIA 4GMP0 3CLPA 1FV2A 2ZABA 4CDXB 5JOWA 4CEWC 1MS4A 5FLJA 4AEMA 4S2GA 4AK3A 4OHZA 3RJ2X 1S0BA 2F4PA 3NV2A 4ITCA 1W6MA 4A2UA 3L9JT 3ZDSA 3UL2A 3X29B 2A7AA 1MQTC 3SISA 4CDWC 2A6WA 2QZ3A 5T55A 3ME2A 2PLV2 1NLRA 4Q4Y2 3PVEA 2D3SA 3LSEA 5SV8A 4AI1A 3GYDA 1N47A 4DY3A 4XYXA 4AFMA 4TZDA 3RS6A 4LEJA 1EV11 4FAHA 3R4UA 5D1IA 4L11A 2RR12 4MLOA 3OF1A 4MYEA 4FBFA 3ACLA 1QJU2 5T5OA 4LBQB 2GNMA 2ZMKA 3C2UA 1JTZX 1NCQA 3JBG1 1ULGA 2WS93 1PO21 3PHMA 2VOKA 1UF2C 4LO8A 1RUH2 5DXDA 5L36A 2MEV3 5AFBA 4RQPA 1FT9A 2N7GA 3TN91 1BVP1 2NQYA 1ZZ6A 2WZR1 4S2FA 1BZWA 5DUWA 1RUC2 3AFKA 1NOVA 3WCSA 4Q8KA 3N7KA 3ZXDA 4OI2A 3V0BB 1EP0A 3B9IA 1DIWA 4D7SA 1R083 2HWF2 4M3CF 1Y9QA 5AFEA 2AENA 1LU1A 3VLBB 1H9PA 1ASJ3 5DDJ1 5BNOB 1E57A 5CIRA 4G4FA 3UJQA 3TWIA 3ZYRA 2ATFA 2JG9C 1XE8A 1MS5A 1HLCA 4BH9A 2IXIA 1G9BA 4XJZA 3RI9A 4AFBA 3VZMA 2R043 4XE9A 4AVBA 2UY9A 3HR9A 1OOPB 1CAWA 1MZ5A 4HVRA 2XWJB 2NP0A 2PYTA 3D0JA 1PMIA 4LA2A 2ERFA 1N1SA 4HPKB 1UIKA 3M1HA 2ZGRA 4U36A 4DNYA 1YWKA 1YNAA 3ZFEB 4Q0PA 1M06G 4LE3A 2ENRA 4RFT0 1V6IA 5L7OA 3ZSLA 4M0HA 2BFUS 4XJ9A 5AVPA 1QOOA 3MZHA 4EROA 4P9JA 1L3JA 2NMOA 1NA1A 1RUF2 2XGXA 4MXWA 4BHPA 5FMOL 3TNQA 4Z8BA 3B01A 4YVSA 4YG6A 3DGTA 4K1YA 1JUHA 1MVEA 2FMYA 4P9GA 1BMV1 2P34A 4QQOA 3WW4A 1XYOA 2ZACA 3VUOA 3AZVA 4U2AA 3NV3A 2DCTA 2E6VA 3NV1A 4FPJA 1PIV3 5C9AC 1PVC1 2P3KA 1S0GA 1QDCA 1VBC2 4QXKA 4CDQB 5T5PA 5GALA 1KS4A 1HX6A 4R9BA 3MIGA 2R16A 4FXGB 1UU6A 4QPYA 4XF4A 1N3QA 2JX9A 3WUDA 2DVBA 3NWKA 2HWD1 1MS1A 1NCRB 1AL23 4YFZA 4AVAA 1M4WA 2IWGB 2RM22 4OHVA 3R6SA 4B7KA 4FPCA 1JXNA 1GZCA 1H8TA 3ATGA 3HT1A 3ZXEA 5KBFA 5C4WA 3WD5A 1GBGA 1XU1A 4FPKA 3CU7A 1AXZA 3EQEA 2DCJA 4XJWA 4GH4B 4K3UA 2D3RA 1J1TA 3D6EA 2R49A 4IQPA 2HWB1 1GANA 2TEPA 1Q8QA 1SLLA 3SCHA 5CBLA 5FPXA 1U12A 2FHRA 4JGZC 3AJZA 2HWC2 5KHKA 5GZGA 2C0ZA 4B7EA 4E2QA 2A6ZA 4LUMA 3MIBA 4FOYA 4CDUC 4XQWA 3MIFA 4GMP1 1VBD3 3ZIWA 3B5LB 3ZXJA 4BE3A 3WDTA 2GC0A 3POWA 3WDXA 2RS52 3HAGA 2WFF2 2H6BA 4MXVA 4QGLA 1V9U1 2PHUA 3JUUA 1OI6A 2D40A 3H7YA 4XIOA 5EJ3A 3VDDC 2W0XA 4AFAA 3POSA 1DLLA 3G6JB 5FOJB 1FMD2 1R1A2 1R1A1 1Q8OA 2NLRA 2R1DA 4FPOB 4AEDC 2Q4SA 1GSLA 4I0BA 3O0WA 1AR81 2B8MA 3I59B 2E51A 3B7MA 5CA6A 3USUB 1WCDJ 1V70A 4N53A 4HBNA 1V00A 1BK1A 4AI0A 2WLPA 2IXHA 4XF9A 1SLBA 1FNZA 4C0BA 4BQ1A 1DGLA 3CO2A 3LA7A 5B2GB 3BTAA 2R30A 3WDVA 3H3UA 1A3KA 5T3NA 5F5QA 1V6KA 3VHNA 2Z2SB 2XKOA 4P9XA 1C1FA 1PGSA 2B42B 3ZO0B 1Z7S2 5E1RA 3WQ1A 5FMOS 3ELNA 1MVQA 1W0OA 1VJ2A 3ZYIB 1LOGA 1ENSA 1EYBA 1TMF1 3J8F2 4Q4W3 3H1WA 3SHRA 4CDXA 1QXJA 1S0FA 2HWE1 5H9SA 3RRDA 1RHI1 1QOSA 2QNKA 3OGJA 1FOD1 4JGYA 4N43A 1FATA 5J3UA 1J59A 5SV5A 2WWSA 1REFA 5GLUA 4GWNA 1W39A 1GFF2 2GDFA 4HETA 4PDWB 4ASMB 3HQXA 1O7FA 3AMNA 2WC2A 3WQ0A 4XDQA 1I6XA 3VZLA 1N1YA 3ES1A 4YG3A 4YZ1A 5KWRA 4QM9A 1CJDA 1PVXA 4GXLA 4BIFA 4XW3A 2JG8A 3BCWA 5C6CA 2R0FA 4CDQC 2MHFA 3ZPYA 1D4M1 4LBQA 2W68A 1H1IA 2R071 3I2DA 4XETA 2Q8OA 1RUOA 4KL1A 1R092 4HLTA 1LOFC 3V0AB 2PLV3 3VBUB 4WZCA 1OQEA 1QMJA 2PQQA 5FTTC 2CL2A 1NYWA 2ZGMA 1QJY1 2X5IA 2XVLA 3GNEA 3PMEA 5LRSA 1W6OA 2YXSA 1H4HA 1SQ4A 4CP1A 2RR13 1HW5A 3CNAA 1LB2A 1QJU3 2XBO2 2XBO1 1HRV1 2D44A 4QX5A 3BOPA 1DQ2A 5JDBA 4N90A 2ZHLA 4GH4C 3J9SA 4K9SA 4UW6A 1IPJA 1YLLA 4B4RA 5JOZA 4ZU4A 4Z2WA 1HQLA 5E8AA 4NO4A 5BNPC 1A6CA 3LOIA 1MS3A 1RUC3 4FPGA 1CX4A 3PNAA 4NN0A 3ZYJB 2EXIA 1AL0G 3LA3A 1RMU1 3QLQA 1SFNA 3E6DA 1WUVA 3RYKA 2HWF3 2LALA 5DZFA 1HXS2 1QKQA 2VMHA 1I5ZA 1O91A 3G7DA 5EXOA 1UX6A 4PF5A 3BIWE 1W6MB 4F8AA 1OOPA 3ZFFC 2WS91 5DDJ3 2D6KA 4XQDA 1KD7A 2ZGTA 1RTVA 2BNMA 2YDEA 3MLLA 2GSYA 5BPXA 2MEV1 4GB32 1D4VB 3AMHA 4DPNA 2NM1A 4XXAA 3SMHA 3QACA 3N7LA 1V6JA 3ZMOA 5BNQA 2C1FA 1O5LA 4FOQA 1R081 1SBDA 3WDWA 1UU4A 3AZXA 1B35A 1NCQB 5FPZA 3VBHA 4IV3A 2FZ1A 1RINA 4JDMA 1TME1 1S2KA 4LO6B 1ZA4A 1ZM1A 4XBLA 3MFAA 5T54A 3AKTA 5EZWA 1ASJ1 1H9WA 3EXUA 4OI0A 2GNBA 4RQPB 3M70A 3AP4A 1Q8VA 3AB0A 4XF3A 2VUJA 1F2NA 4IEQA 1O3TA 4E4DX 1H8VA 4IEVA 3B00A 1UCXA 3O0VA 2QQPA 3K48A 3CJIA 2WNUA 2ZA9A 1RUE2 4YM1A 2Y26A 2R041 4N9IA 4Y4YA 1KQRA 4XEZA 1DZRA 3VHOA 3WX5A 4FTEA 1PM7A 2ZX0A 5CFDA 2DVDA 3WW3A 3IDCB 2B7YA 2JJ6A 3HT2A 3FWEA 5D8AC 4META 2JICA 4LBOA 1WLDA 2WQ4A 3AZYA 3ZVXA 5IK5A 4RR3A 2ZX3A 1VALA 2YY1A 1ND2A 4UBHA 2O1QA 2WT1A 1FYUA 1VBC3 1ZRDA 1X8EA 5KC5A 1AUYA 3PVOA 1CAWB 4OUSA 1C8M2 4R8HA 1QQP2 2FMDA 3TNPB 2D97A 2VU9A 4PDWC 5CVRA 3IDEA 5DUUA 2QKDA 5DG1A 4RS5C 5BY5A 4ZU5A 2PHRA 2AGSA 3N7MA 2RM23 4JAAA 5L7OB 3FUOA 1YXWA 4CEYA 1GNZA 1GLHA 1AR71 3BB6A 2YV8A 4FOWA 4AQ6A 4BIOA 4WM7C 2EVXA 3CF6E 3JD72 4I30A 4YSFA 1NA1B 1W6QA 1AX2A 4MXWB 3BOWA 2ZS6B 3OD0A 5HXVA 3B69A 3WQ7A 4WM8A 3UK9A 2OZ6A 1MEC2 5LK7B 1B09A 5I0TA 3VZNA 1JYIA 2HWC3 4AQ2A 1OQDA 5IT6A 1AL21 5E88A 1G7YA 4OLLA 4BYYA 4YM2A 3FFZA 3NKTA 4FO9A 4GMP3 1GKBA 1EPWA 2BTVC 2DVFA 1XYNA 4JVAA 4RL7A 4DY5A 2B39A 1FV3A 4BLIA 4RGAA 2RS53 1ZBA1 1WD4A 4F7ZA 1DYKA 4AQTA 3K51A 3USUA 4AEKA 2DU0A 3WHUA 4G9SB 4OI1A 4RGGA 4AVVA 4FQ4A 2GMMA 4QPIC 3IKWA 1FMD3 2EXJA 2B9UA 1R1A3 2Z5WA 1H8TB 3ZXFA 4Y1XA 5J48A 2PAKA 3KGZA 5C4WB 1AR83 3VBSC 1RUG2 1C57A 4Y1ZA 1RUD2 2JE7A 1XNDA 3KM5A 4C1WA 3NSTA 1SBEA 3M3OA 4LLOA 4ISQA 3IN9A 1V6NA 2PTMA 4UW4A 1RL3A 3RG0A 3W59A 4JV4A 1QNYA 3N7JA 5AC91 1DGWA 3E5XA 2YYOA 3AMPA 1RUJ2 1BQPA 1RUJ1 3UKVA 1ZZBA 3OY8B 1JOJA 2G9GA 2IXKA 2UYAA 1X50A 4M3CE 3WG3A 2HJIA 2XVKA 4QGNA 2ZGKA 2RS12 4PBOA 1F5FA 1ALYA 1DQ4A 3AYCA 5T5LA 1NCQC 2ZBJA 1QWRA 1LODA 2CWMA 1Z7S3 3M4FA 4YGEA 2OW4A 1XNCA 2ZOEB 2HEVF 4RQPC 4B29A 2ZX1A 3AP7A 3ZN5A 2Q1MA 1YYNA 5L73A 1RHI3 2UWCA 1EY2A 2YGMA 1LEMA 1CAXA 1FOD3 4HMZA 5GJ6A 2R062 2AH2A 5JOXA 1UPSA 4KWJA 2UY8A 2XLAA 4AYUA 4YGBA 3ENRA 4X8NA 5C8CA 4COWA 1PZ9A 3KT1A 1OHFA 1PGW1 2A5ZA 2H6CA 1XU2A 3VGIA 3V0AA 5K0UA 2X8KA 3W58A 1YUDA 2A70A 2XB6C 5HCBA 1DQ6A 4ORFA 3WLUA 4K7JA 3WOGA 1LOCA 5IUQA 1ZREA 3SCFA 3JCIA 1D4M3 4QPGC 2E53A 1H2NA 1VBA2 1N3OA 4FP3A 3W9AA 1JBCA 4FVVA 1RC6A 2EXKA 3WHTA 2FZ2A 1S55A 2RMU2 2RMU1 1QJY3 1CGPA 1HRI2 4HVOA 5GM0A 1JN2P 1KS5A 5JSOA 1REEA 1VBE2 3PVNA 1V6OA 4YARA 1DQ1A 3ZYGA 3R4DB 4JGYB 4IV1C 4N43B 3RDIA 1HRV3 2XBO3 1NA1C 3ECQA 5CG9A 1CD3G 4OVEA 1ZBE2 1IS5A 5LK5A 3RNSA 1PK6A 3V64A 5KHGA 3SLIA 4DB5A 4YVSC 5I93A 2G4IA 1WBFA 1S0DA 4P9WA 3FLTA 4R9AA 4HANA 5CNAA 1WW6A 2B46X 2A3YA 2PLV1 5F6LB 4Q4Y1 5CG8A 3AKPA 5I0SA 1KRIA 2V73A 4JQRA 3AMQA 4KU8A 1RMU3 1LCLA 2JG8B 3H1YA 3AYDA 1SFYA 1QF3A 2RR11 4LBNA 1QJU1 2I45A 1ENXA 5IK8A 4BMEA 3D5OA 1OPOA 4Y5Z0 2YHJA 2WIIB 4LO5B 4M01A 2DUPA 3LZZA 1BEV2 5E16A 4AW7A 1RUH1 4C1XA 4EWAA 1JH5A 1GNHA 4JTNA 1C3HA 1VRH2 4QT6A 5T50A 5J36A 2XL7A 3U11A 1AXKA 2X5IB 4FOVA 1RUC1 3U10A 2ZGQA 1W6OB 1LR5A 3I8TA 4YZ5A 4PLOA 4EN7B 4L97A 1WW7A 4AVTA 2HWF1 2P3JA 4IEWA 4G3YC 2V09A 1TME3 3AMMA 4LHNA 3RYRA 1T6GC 3ZX7A 2EXHA 1BBT2 4YM0A 1J1LA 4HKWA 2CYFA 4AE2A 4RA0A 1KDMA 4CRQA 2GH8A 4W6XA 1C8NA 1ZVFA 2XJTA 3FJSA 2D6NA 4J1XA 2CGPA 1OPMA 1SLCA 4P5HA 1V6MA 3KT4A 5ABJA 3S7EA 3AKRA 1RUE3 4BM8A 3E5QA 1POV0 4PQ9A 4EWEA 1APNA 1K5MA 1J58A 1GZWA 2YGLA 1LRHA 2K2SA 3J26N 3O7OA 2KM2A 3GBWA 3RWNA 2I07B 2OPKA 1O3RA 4M3CA 4ATEA 4OULA 4YGDA 4E4ZA 1AR62 5LEJA 3LB9A 5DZGA 5BNNC 3ZMNA 3IMNA 3L2YA 1F31A 1LULA 1QOTA 1B35B 1RUF1 1WLTA 2UU8A 2YC0A 1J3RA 1C8M3 3AZZA 2VVFA 4Q4X2 3VBHB 4IV3B 4N53C 3DPRA 3LWCA 5I0RA 2VNOA 3M7AA 5FO9B 2H0VA 4EV0A 1DGRA 4JRLA 1EAH2 2YROA 1W2UA 2VG9A 2JXAA 4P9LA 2BNOA 3H50A 3AK0A 2BBVA 2DWRA 1KFUL 1AR73 3GZUC 4AVCA 2DYCA 4CEWA 3FBMA 3NV4A 2Y38A 1OKQA 3JD73 3CJIB 2WNUB 4Z92B 4P9IA 1DQ0A 1VBC1 1U0AA 1AHSA 2AR6A 2ZMLA 4XMAA 1G8WA 1D0GA 5CFDB 1RJ8A 4IEXA 4JDNA 1ND3A 4TYSA 1WLWA 3SCGA 5DUVA 4HVQA 1A8MA 5JZGC 2JDZA 4AF9A 1CQ9A 3THPA 2D6MA 3VHRA 4RR3B 2Q0AA 1ND2B 2RM21 4CDXC 1LENA 4I09A 4MGZE 1ULCA 4KWKA 3M3IA 3P3PA 4JGYC 4N43C 4GKXA 3DN7A 1ZBA3 4IXLA 1CN1A 1J3QA 4DOUA 2ZX2A 1RIRA 5I8SA 1AR92 1ZRFA 1NE4A 3D0SA 5KHJA 3FLPA 2IXJA 2HWC1 1HQWA 3PJYA 1F5JA 3OY8A 2QDNA 2XLGA 4CEYB 1WMDA 2RJLA 1KDKA 2JG8C 1ENRA 3OGGA 1W6QB 2ZAAA 3KCXA 1AYM2 4BOWA 1DYPA 4LTAA 1RUD3 3S6PA 1UAIA 3WP4A 1CPNA 3QOPA 1ZZ7A 2DV9A 2RS51 4AG4A 2WFF1 4H14A 3WY6A 2PAMA 4WM8B 3D4KA 4NPRA 5AC93 1CESA 2GN3A 3O12A 1SBFA 2DCYA 3RYPA 1RUJ3 1TNRA 1S0CA 4NHLA 3VBRA 1VB2A 1LGNA 4TSVA 3VL8A 4XIKA 3PVBB 1D2SA 1FMD1 1WLCA 3GBGA 5EYYA 1DDLA 2RS13 4AGVA 2VQAA 3LGRA 5FQ0B 1AF9A 1S2BA 3VKNA 1MS8A 1VBB2 5AVAA 5TSWA 1H1AA 2YPJA 3IWZA 4AGRA 5BNOC 1OLRA 4QQLA 2A3WA 4LR4A 1SACA 3ST7A 4FTSA 4UW3A 4GA9A 3VV1A 1AZDA 4P14A 4Q0QA 5A32A 3FZ3A 2DTYA 5I8TA 1VR3A 1O4YA 1OOPC 5GLWA 3H3ZA 1RUNA 1COV2 1CIWA 2HEWF 3A4UA 1Z7S1 5KXDA 3RPQA 1OD5A 4DINB 1UU5A 1Q8PA 3ZXKA 3OPZA 5BUVA 3AXDA 4HK9A 3ZFEC 4K8FA 3J8F1 5F6KA 3KD4A 1LESA 2ZMNA 3MLKA 1ONAA 1FXZA 4W6WA 2EALA 4MH0E 4COZA 1B35C 3WW1A 3UKTA 3VBHC 1W6PA 5JWPA 1QXRA 1VBA3 2VNRA 2PHXA 4KBBA 2BWAA 3WV6A 1POV1 3ASIA 1SCRA 2RMU3 2CTVA 1UN1A 2AYHA 4HFSA 2ZKLA 5HCFA 2XLFA 4JRAA 4XBQA 1X36A 1VBE3 2E63A 1WCSA 3MIHA 2SBAA 1CAXB 1AYN2 3TAYA 4L92A 1ZZ9A 4Q4V2 4Q4V1 2ARBA 5C8CB 4MX3A 2PFWA 3ZSMA 4XTMA 5CFDC 3OBRA 1RB8G 3WP3A 2D7FA 3IT8A 3CJXA 1R091 1YIPA 5CFCA 4E4SA 2IXLA 4JGZA 4BZ4A 2BGCA 5K0UB 1NCRC 4Q4Y3 3VBOB 4NR1A 3GBFA 3AYEA 4PJYA 4RR3C 2D3PA 4CDUA 2G9FA 1X7NA 2XJVA 3ETQA 4AWDA 2BNNA 5DUXA 2PHDA 1JW6A 5FLIA 2RJKA 3AFGA 3KZ4C 4SBVA 5HCAA 4CYDA 4X8PA 2XVGA 3HWJA 1BEV3 3H0OA 1RUH3 3TYJA 2WFPA 2Y0IA 4IEZA 4ASLA 2UWAA 3PTYA 3VDDA 4ATFA 1UD1A 4OZXA 1UKRA 4HKOA 4W65A 2BWCA 2VPVA 3WZ1A 5ACA2 4AEDA 3T2TA 4W6YA 4URTA 2A6YA 2RS32 1HXS1 2Y0OA 3DUIA 4IEUA 4XFHA 2RE9A 1PK6B 5L19A 4KH9A 3LCPA 3QD6A 1BBT3 1U5IA 5J7MA 4WBBA 2BW8A 3AP6A 3I7DA 3LKJA 5DZEA 4Y22A 4LO4B 1QH6A 3ZSJA 3WDYA 4GB31 1CJPA 3U4XA 4JC1A 1URXA 1NQDA 2ZX4A 4IEOA 4LNVA 4WVMA 4XFFA 4E27A 1LKNA 1LTEA 2CAUA 2YZ4A 1JUIA 2VXRA 4QM8A 1WGPA 2GU9A 4M00A 4AI8A 4A7ZA 3AKQA 1G9FA 2IFWA 3FFQA 2H0BA 4QQ2A 3QH6A 3IDBB 4AFCA 5JPMB 5FFOC 1ZRCA 1H2KA 2P2KA 1CONA 4OHWA 4UW5A 3QCWA 5J09A 5HI0A 4YW3A 5GZCA 2ZZQA 2BQPA 3HD8B 1S1AA 3IIAA 1RUF3 1IS4A 4Q4X3 1RUE1 4AEJA 3WVJA 4F83A 2ZGOA 1PZ7A 4EWDA 5A33B 5K8SA 2NPIA 1ULDA 2UWBA 1EAH3 1JHNA 1FNYA 5EV7A 2E7AA 3O5SA 4I02A 5KC6A 3VZJA 1FI2A 2FQPA 2EF6A 5ABJB 4S2DA 5EYXA 2W08A 2BUKA 2R0HA 4YVWB 4KG8A 3VKLA 1RITA 4CTEA 2NN8A 1IKQA 1K5MB 2C5DA 4LULA 3VBFA 1GZWB 2WL1A 3HBZA 1C8M1 1W6NB 1QQP1 3ZXLA 4ONUA 1GV9A 5FREA 4C0HA 3NAPB 3MW3A 1LOFA 2DFCA 4M3CB 3RI8A 1Q5OA 3ZFGA 3A0NA 4FPYA 3T1LA 4P9YA 1RUI2 3O14A 3BALA 3MICA 3JD71 3VZOA 4RHV2 5FRAA 1AR93 3RSJA 4LBKA 3DPRB 4E9KA 1O3QA 1YO8A 3TOJA 1MEC1 5BXXA 1SMVA 3M8LA 3FUQA 3VBUC 2XHKA 4Z82A 1IGOA 2WNVA 4HK8A 1GQGA 3MPBA 3ES4A 5J96B 1JYCA 4CEWB 3DL3A 1PIV2 5EFUA 3TBDA 1OLQA 1ULEA 2WA3A 3WG1A 1AYM3 4GWMA 5GLVA 4QQHA 3BPZA 2O0OA 1XRUA 1PNFA 2WFF3 2CWSA 4L2NA 1FPN2 3J4UH 4DS0A 3ZFFA 5FQ0A 1ND3B 1REDA 1Q43A 2YUEA 3S0MA 1C4RA 4LBQD 5KXCA 2TUNA 4Q0VA 3MW4A 4H7LA 3M3CA 1DZQA 4WVZA 1VIWB 1NG0A 3R4SA 4NHMA 4Z1VA 1RUG1 2VUAA 3H9AA 4QHBA 1RUD1 2WQZC 4AHWA 2YMZA 3FMGA 1PGL2 3HIFA 5FBZA 2ARXA 3FX3A 1CAUA 3MF6A 1LU2A 2TNFA 3M2MA 2OZJA 5J98B 3OTFA 4Y20A 2CAVA 1NLSA 3SXWA 2VW0A 2W39A 5JMCA 4EJRA 2HEYF 2RHPA 1MS9A 1U5XA 1VBD2 3GHNA 3LSDA 4FTBA 2VMIA 4X6RB 1LHVA 2GMEA 2VVDA 2RS11 2DUOA 1YI9A 2GH2A 1Y7BA 4YW4A 4Q29A 2KXLA 3EBRA 2MNGA 5FAXA 2CGNA 1COV3 4YW5A 4COUA 2ET1A 1F8VA 3AZWA 1IOAA 1BKZA 1RVF2 4MZUA 1O5UA 2D5FA 4XILA 5D8AA 2DU1A 4EN9B 3VBRB 3LA2A 1NY72 4KGGA 5FOBB 4M0NA 1G9DA 2ZKNA 3J8F3 4KGQA 4ZKTB 5EWSA 1IZ3A 3EJKA 1GICA 2VY0A 4H3WA 3NVCA 5GLTA 3U0ZA 2R061 4L8QA 3CL1A 4AVSA 3N35A 1TEIA 4K21A 1POV3 3NL1A 3JB4C 5F9TA 4XFBA 3OCPA 4RS5A 2VOXA 4HSLA 1QJX2 3TB0A 4QU2A 1C5HA 1O4TA 4B4PA 4NWVA 3VBOA 2PAEA 1SLTA 3ZXAC 2WINB 2X53S 2BVBA 3E97A 5A32B 5ABJC 4Q4V3 1KJRA 2ZAHA 3ZSKA 3APBA 4FPFA 4I0AA 2XG3A 3OD4A 1UKGA 3IBMA 1ZZ8A 1DF0A 1Q8SA 4AXOA 5T5JA 4CP2A 3O0XA 1AX1A 1VBA1 3UV9A 1MZ6A 1TE1B 1R093 1WW4A 2VQ0A 1OSGA 1CVNA 1YIFA <