5A7WA

Crystal structure of human jmjd2a in complex with compound 35
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
345
structure length
345
Chain Sequence
NPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 4A
publication title Docking and Linking of Fragments to Discover Jumonji Histone Demethylase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 96
structure length 345
sequence length 345
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5a7wA01
2XMLA 5LW9A 4HOOA 5FZCA 5FYTA 5FJKA 5FYMA 2XDVA 3PURA 5FZ7A 5FXZA 5FZBA 5A7QA 4V2VA 3RVHA 5A1LA 5FXWA 5A3PA 5K4LA 3OPWA 4NUBA 4Y3OA 5FYIA 5FP8A 5FZLA 4Y4RA 3KV5A 5F3EA 5FZ9A 3U78A 3ZPOA 5FY1A 5FJHA 2Q8DA 5FYYA 3KV6A 5FWEA 5F39A 5FZOA 5F37A 4QU1A 3KV4A 5FZGA 4QX7A 5FYVA 2GP3A 3KV9A 4CCNA 2WWUA 4C8DA 3PUAA 5F3CA 3PDQA 5IVEA 2YBPA 5FPVA 5FPBA 5LY2A 4BISA 2VD7A 2Q8EA 4IGPA 3LDBA 4LXLA 4EZHA 5ANQA 5FV3A 4GJYA 5FZ3A 4D6QA 5FY9A 2P5BA 5IVJA 5FZ1A 5IVYA 5FZ4A 4BU2A 4IGQA 3AVSA 3K3OA 2PXJA 2OX0A 5FZOB 3N9QA 5FY4A 5F2SA 5FY0A 4XDOA 4DO0A 5A3WA 3AVRA 4QWNA 4TN7A 5FUNA 4GD4A 4BXFA 4D6SA 4EYUA 5FYBA 2YBSA 5IVFA 5F3GA 3N9OA 3PUQA 5FZEA 3PU8A 4LIVA 5LWBA 4GAZA 4QX8A 5A3NA 4CSWA 4HONA 2YPDA 5E6HA 4EZ4A 5F2WA 3N9LA 5FZKA 5FZHA 5A7NA 4URAA 3KVAA 3DXUA 4UF0A 5LY1A 4DIQA 3PU3A 5FXXA 3U4SA 5FY7A 5KR7A 4IGOA 4QXHA 5FZ8A 5A7PA 4CUGA 4QXBA 3PUSA 2YBKA 5FP3A 5F32A 4CCMA 1VRBA 5IVCA 5FBJA 5FY5A 5FZMA 2WWJA 5A3TA 5FZAA 5FP4A 4LIUA 5FYHA 4CCJA 5F3IA 4XDPA 3N9NA 5FP7A 3KVBA 5A1FA 4LITA 3AL5A 2XUEA 4V2WA 5IVVA 4D6RA 4E4HA 2W2IA 5FP9A 5FUPA 5A7WA 4CCKA 5FPUA 3K3NA 5FXVA 3PTRB 2OQ7A 3N9MA 2XXZA 2YU2A 5FYUA 4CCLA 4UF0B 4CCOA 5FZIA 5FYZA 5F5IA 3AL6A 3K2OA 2OQ6A 3N9PA 5FY8A 5FYSA 5FWJA 5A7OA 4GJZA 5FZFA 2OS2A 3LD8A 3NJYA 5FZ6A 5FZ0A 3ZLIA 5FZDA 2YU1A 4Y33A 4ASKA 4AAPA 4AI9A 3DXTA 2Q8CA 5CEHA 5FPAA 5A7SA 5FPLA 2OT7A 5FYCA 5IW0A 5A7WB 2GP5A 4QXCA 5F5CA 3UYJA 5IWFA 5A80A 5IVBA 5F5AA 5ISLA 3OPTA
chains in the Genus database with same CATH superfamily
2PHWA 3WQ7A 3PVOA 1IQAA 2VZ3A 2LM3A 2ES3A 2TUNA 5A7QA 1VRH3 1W6PA 1VBD3 1O4YA 2JB4A 2R32A 3NNFA 3QOPA 4TLFA 5I0TA 3SHRA 2VGDA 3J4UH 1H6XA 1QJY3 1ZZBA 2GNBA 3ZXKA 3R6SA 3SNMA 1GICA 2ZGSA 5A6QA 5LB6A 5FJHA 1YCIA 2Q8DA 5FWEA 5FMOL 4WVZA 3KF3A 5IFPA 1NAEA 1UY3A 3I59A 3DV8A 3RSJA 5CFDB 4PQQA 4H7MA 2KD7A 3J7HA 4MH0E 5HXVA 1O6UA 3E97A 2VD7A 5C5TA 4YG6A 2XBO3 1IKPA 4D6QA 1QH7A 1VBC3 3GDBA 2W1WA 4XZUG 4Q2FA 4ET7A 1DP0A 1UAIA 3NAPC 3VD4A 4RGAA 1W9WA 3AVSA 1PGW2 2WO3A 1COV1 2Y6GA 3E5QA 2BYVE 4GWJA 4H7LA 4OFGA 3VZJA 3WDUA 1RMU3 4AR2A 1RYYA 1SPPB 4CCDA 2CDPA 2R16A 3A21A 4Y1ZA 2ADDA 2HH9A 5C7GA 2O8QA 1RGSA 1WMEA 4K9SA 3WHTA 5JVVA 1O7FA 2ILMA 1GKBA 3AFKA 3OYWB 5LA2A 2F4PA 4LIVA 1F31A 4CP1A 2VE1A 5IHRA 1SFPA 4V1PA 4INDA 1LOAA 3AYCA 1QHDA 4BLJA 2R1DA 5F2WA 4KNCA 4WV8A 4C1WA 4DXTA 1UU4A 1UYYA 4LBLA 4CDWC 2C26A 2J1SA 2YB7A 1J3PA 2RMU3 4ISQA 2LW8A 2WYSA 3GXUA 4Y4YA 2JE9A 4I0AA 1YJLA 3LCPA 4M3CB 3VHNA 1W99A 3CF6E 3O7OA 5FP3A 3ST7A 3MDPA 3BUCA 2MHFA 3RWNA 5DAWA 4IUGA 4PT6A 2WWJA 3IPVB 2VJXA 3FHAA 3IWZA 2HWD3 3O14A 3OPZA 5A6YA 5GZCA 3O1SA 2Y38A 1KS4A 2R1BA 4P02B 1HLCA 2ENRA 4X8NA 4AEJA 3OD4A 5FPUA 3AKPA 4BQWA 4CCKA 5FR3A 1PK6C 1ZRFA 3IMNA 4KI5M 1PM4A 5T52A 5C6CA 4MADA 4CCLA 4IEQA 5FYUA 4JDMA 3T4VA 1QJZA 2GC1A 2E31A 4IL7A 5E89A 4JRLA 4WZFA 4PQ9A 4QGNA 3WNPA 1GOGA 3H42B 2X5IA 1F35A 3PVEA 3LEMA 1H4GA 2VMHA 4JAAA 4LKFA 2RM22 3ZLIA 2VPVA 3PMEA 5FZDA 4MGSA 4COVA 1CIYA 1MACA 4WM8C 5ACA2 3IIAA 5AFEA 1NKGA 1ULCA 2ZACA 3EHKA 4ZS3A 1HRV3 1UWWA 2WT0A 2XJTA 2K9ZA 3B01A 3WQ0A 1LU1A 4AFDA 5IK7A 1S0FA 5JPNB 3S5AA 4MGKE 1M4WA 4JGZC 1I6XA 1DG6A 3OD0A 3RJ2X 1RB8G 4UFHA 4NIDA 4N43C 5BUVA 2VO5A 5FOBB 3CO2A 2XOMA 4QB1A 5FZBA 4W4ZA 1FOD3 1W9SA 1DZQA 4NWVA 3POBA 2E33A 1VBE3 3LA3A 3AZZA 3R0RA 1U5IA 4LOTA 3SH3A 3O0WA 5I8TA 3PIGA 1L3JA 1UY2A 2W1SA 3CDZB 4Q4X2 1O3RA 3B3QE 1HQNA 2PAEA 4QX7A 4L92A 4X6RB 4XQDA 3HWJA 1RIRA 2NLRA 5F3CA 1B09A 1PVC2 1LCLA 2W5FA 4CDXB 2ZEWA 3OEBA 3UJOA 4Y22A 3WNNA 4DRVA 4FFGA 5FIXA 5A32A 1KDKA 2GC3A 3AC0A 4AVCA 4RS5B 3KWVA 1J1TA 1UMHA 3SKVA 3ELNA 5T54A 1ZREA 4MLOA 1Q56A 3ILNA 3N7MA 4N9HA 4E2SA 1V6MA 1U0AA 4B7KA 4XJWA 3WG4A 5IFTA 1UW8A 2ZAAA 2DCJA 3AZVA 5A33B 2WBKA 4K7JA 4Y26A 1URXA 4FFIA 5T50A 1YFYA 3PJYA 4P9IA 3AKRA 1G9CA 1V9U2 3H0OA 4L11A 4MXWB 3SISA 3DKWA 4QGLA 2Q4SA 4FOQA 3FFQA 2ORZA 3RMXA 3MLLA 3NNGA 4A2UA 4Q26A 1FV3A 4S2HA 4CE8A 4W6XA 1ENRA 4RFRB 4IV1B 4AHYA 2JG8A 4EN7B 2EIEA 1HB1A 3O1VA 3DPRA 3QACA 3T09A 4A6OA 4GALA 5JUVA 1UCXA 5C33A 1H8TC 4IGOA 3HVDA 2VCMA 4H14A 3ZFGC 2RJLA 1OUSA 5A7PA 4B4PA 5CISA 1R093 4YVSC 3OBRA 5GZEA 4TTGA 1YRZA 3NWKA 4Q27A 4ASMB 3BALA 1WW6A 5FZMA 4K6BA 5E8AA 3FHQA 3HBZA 3M3EA 3T08A 1H4HA 1SG3A 4FT8A 4XETA 2JDAA 1BBT3 2DDUA 3IPVA 4P00B 1OOPB 5C5UA 2A71A 5J7MA 1DDLA 2P3JA 1RTVA 4LO8A 5FKBA 2W2IA 2OYZA 5CKQA 3U37A 3NJVA 3T2PA 1Q43A 2VQUA 4GB33 1VRH2 5GALA 3KLSA 2YZ4A 5KBFA 1J3QA 1LENA 1RUJ3 2A6YA 1S2EA 2AACA 4NAOA 4KG8A 3VD7A 1C3HA 1R64A 1X9TA 4P9GA 5F5IA 1HRI3 3OF1A 1PNGA 1ZYBA 2YG0A 2YROA 3J8F1 5JXGA 1SZBA 1VPHA 1AR72 3FWEA 2K46A 4NAMA 3KQ4B 2XVLA 3HBKA 1W3XA 2NZ9A 3S7EA 1EAH3 4AEKA 1UYZA 1O5UA 5A7SA 2OT7A 4CP9B 3NW4A 1WA6X 1MVQA 1YYNA 2VXJA 4CEYA 1QWRA 3WNKA 5D8AA 4Q1RA 1WWYA 4FPLA 5JPMB 3M8LA 1QF3A 3VBFC 3UJQA 3V56A 1U12A 4X6QB 2XMLA 4LNVA 4XC9A 3RYPA 4HL0A 5FYTA 4A7ZA 3Q8CA 3VBSA 5DXDA 3T2TA 1LKNA 4Q29A 4URTA 2P4EA 2YGMA 4FOWA 2BWAA 3N35A 1J83A 1V0AA 2A7AA 1CPMA 1ASJ3 3KCYA 1W06A 4XIKA 5FZLA 1SCRA 4YM1A 1POV1 2VQAA 3ZPOA 2ZGQA 5EFUA 4CZSA 4DUVA 5BNPB 1GWLA 1F15A 2PLV3 3LPFA 1BCXA 2ZPXA 4HN1A 1GLHA 1RUE1 1REFA 1RUH2 3LOIA 4KL1A 4XFAA 5HCAA 4AHZA 5CADA 2Q0AA 2GN7A 5HV0A 3I2FA 3WF2A 3M2MA 3ZXLA 4Q4V3 1SFNA 4M0HA 3RI8A 4YLZA 4KQ7A 2ORXA 1A8DA 1YEWA 1A34A 4HMZA 2ZXQA 4WVVA 1PGL1 4OYUA 4CTEA 3JD72 1B35B 1OF3A 1W6OA 4S2GA 3VBRC 5FZOB 1PO22 5FPZA 4BMEA 3S7IA 1AR63 1CQ9A 2R6QA 2V72A 3BKZA 1EV11 1QOTA 1PZ8A 1FMD3 2HWD2 4CDQC 4EYUA 3AVRA 5C3SA 2VVDA 4BXFA 2WDBA 2PHLA 1RUD1 1GU3A 2HWC1 3APBA 3KT7A 4QX8A 5JWPA 1NZCA 2RS52 3IAPA 4EN0A 4QKNA 2OPWA 3WXPA 2RDSA 3IKWA 1K42A 1CAUA 4CPBA 1YQ5A 2PQSA 1JHJA 1HN1A 5A7NA 1UYXA 5JZGB 5DAPA 2BV4A 3M1HA 4K20A 2Y0OA 2B8MA 1YXWA 5L7OB 4JHTA 2FDGA 1S0IA 5EHDA 4BQYA 1XE7A 2PN5A 3KGLA 4HN0A 1JHNA 1Y9QA 3LQCA 2PELA 3OG2A 1O4ZA 1ZBA3 1RVF2 2Y6HA 3MW2A 4Q0UA 2YMZA 1BXHA 3LFMA 1HRV2 3HT2A 3BIWE 4IETA 4JQTA 1UQXA 4BCUA 3T0DA 2JENA 2VUCA 1I5PA 2XUEA 3N7JA 2WJSA 4E4HA 3C7FA 3ABZA 2VZUA 4KH9A 5DN2A 4E8CA 3MIFA 4BLIA 3AB0A 3ZYFA 3UNPA 2WS92 5CKMA 4C1XA 3D8CA 1AX0A 2CSGA 2Q30A 2V4VA 3HAGA 4XAEA 3FC0A 2WSVA 4B29A 1VAKA 1UKRA 1IGOA 1SLTA 1VBA1 1YNAA 1C8NA 2RS11 3KMHA 2WN3A 3VDDC 2WSUA 5KHKA 5A7OA 1DQ5A 3C3VA 1KFUL 1MQTA 4FPEA 1R083 4TXWA 5FZ0A 4DUXA 5KHIA 3Q8AA 1BVVA 2DTYA 2R062 3BPSA 5LBEA 2C9AA 1JOBA 3DXTA 1YHFA 1J1LA 4OUSA 1EP0A 1TQ5A 2Z42A 1T2XA 3WW4A 1WD4A 5FYCA 2HWF3 4NIAA 2AEZA 4Q5OA 2NP0A 5CFCA 5IW0A 5DUVA 2EXKA 3QD6A 3LEKA 3DECA 3M3IA 4COYA 2XPJA 1OQ1A 2XQXA 4GH4B 5BNNC 5LASA 1T6BX 3OOXA 4AEDA 4BIOA 4YW3A 1DQ2A 2W9XA 1HKDA 3FFZA 1QJX1 4DXRA 1ZBE3 1RINA 1K5JA 4LBQB 1VMHA 1ZZ6A 5A1LA 4DMIA 2A73B 3RMYA 2AREA 1JYVA 1NA1B 2MNGA 2D6LX 1S0EA 2B4KA 1VBB1 1AR82 3M70A 3MV01 1H2NA 4H2AA 3BPZA 5ANNA 1QQP3 5FP8A 4AGRA 4CUCA 2QKDA 3U78A 1JYWA 1DFQA 1OUXA 4UAPA 2XVGA 4XBNA 3SQOA 1PM7A 5KHHA 3SCHA 3BI3A 5DDJ3 2ZGOA 1CR7A 4ZY9A 3RYKA 5FZGA 4FI9A 2UWCA 3IDAA 5HPOA 4GKXA 4C8DA 4C0BA 5IATA 4BQ5A 4GIQA 1QOOA 3AP5A 5FPVA 4CXWA 5FPBA 3JQWA 4JZRA 1LESA 1QDCA 4IEPA 4FTEA 4E8DA 4NPMA 3O5SA 4QPGC 3UK9A 3WZ1A 1TMF2 3QH7A 2JDPA 3RYRA 1HN0A 1GQHA 1DQ4A 1G86A 2LUWA 2VMEA 3NAPA 1PIV3 4LR4A 2EXJA 1W8HA 2IFWA 2XHNA 3AMPA 4Q8LA 3GBFA 5CG9A 2J1VA 4IE5A 1RUG1 3W20A 2FBEA 4ZU4A 3M3QA 1KRIA 4UWDA 5FMOS 5FY4A 3TN93 2PHRA 3TBDA 3ZFFC 1H8VA 3JBG3 4GULA 4XDOA 4YZ3A 2XJVA 3FL7A 1OQDA 3TB0A 1BBT2 3OGGA 4E2GA 5TSWA 1UMZA 4R8HA 1CAWA 3MW4A 1G9BA 4PDWB 4J6GA 2VZQA 1C8M3 3NL1A 4GWIA 2D6OX 5G04L 3ZSJA 5C3QA 3V65A 1CZVA 3I2GA 3MF6A 1HX6A 2VOWA 2JX9A 1QGLA 4CDWA 1HRI2 4HZFA 3KVAA 4OUEA 3U0ZA 3DXUA 3POWA 4DIQA 3ILRA 1IOAA 1QEXA 1LOBA 2IXCA 3NNJA 5KR7A 5F5QA 4YGBA 4AAXA 3IAQA 2ZGMA 4KWJA 4COWA 5IK5A 2YBKA 3LSDA 4LKSA 3CBNA 4NR1A 3RI9A 4FOYA 1GZ9A 2NMOA 5IK4A 1OSGA 5FP4A 2XL9A 1BJQA 1ZZCA 1W9TA 3KVBA 4CUBA 1KITA 4D6RA 3M7AA 4AQTA 4EV0A 1JW6A 2WFF2 5LZ6A 1MEC2 3K3NA 2XXZA 3KD4A 2BPA2 3FUOA 3B02A 5C9AB 2FMYA 3LEIA 3SEEA 1PO11 1ASJ2 2D7FA 1ND3C 1XNDA 1RHI2 2EAAA 1I9RA 4FPYA 4G4FA 2IUWA 3UV9A 1ONAA 1W2NA 4ASLA 5K0UB 4NRPA 4DEVA 3TEXA 1XNTA 3LIHA 5JR2A 4XZPA 2WNUC 4NVPA 4HKWA 2G4IA 1ZZ7A 1J3RA 1MS0A 1Q8VA 1PX4A 4FTBA 1UY4A 3LIGA 2G1MA 4WM8A 5FLHA 3VN4A 3WUCA 5ABJB 3AMQA 5A7WB 4QXCA 3ES4A 4F7ZA 4FTSA 3C7OA 4Q4V2 3RZHA 2NN8A 1HXS1 2G9GA 2HWB1 3POJA 3IT8A 2JJ6A 4JGZA 4ZZ5A 4PIXA 3RDIA 1LB2A 1EYBA 4N43A 2VZTA 2QQKA 3RGBA 4NHYA 2BZDA 2GC2A 1AR91 4V2VA 2WT2A 1AHSA 1UU6A 1WMFA 4WM7B 5CB7A 5A3PA 4UXAA 4BDVB 1W6QA 1RXGA 2A5ZA 2GC0A 3BYWA 4COUA 2D6NA 4JDNA 1FT9A 4N7UA 3I3DA 1T6GC 2XJUA 4FOVA 5F39A 3DKQA 4N90A 1JS9A 1YFUA 3POEA 3RZZA 1M06G 4MGTA 1DYPA 1SHWB 2DU0A 2DVDA 4BQ4A 3VUOA 2Q8OA 1NCQB 4WZCA 4RR3C 3DYPA 4BH9A 3PUAA 4A7YA 1AZDA 4IESA 3MF9A 4D0QA 5HCFA 2AZ5A 3I4IA 1UX7A 4OMCA 5FQ0A 2FMDA 1RUI2 2IVJA 5SV8A 1AL22 1W6PB 4AF9A 1GWKA 4QQ2A 4WVMA 3I2IA 4QDRA 1F2NA 3SXWA 4FBFA 1F9KA 2WC2A 4HT1T 2YUEA 4OQ9A 5FKCA 1MZEA 2XWBB 3AJZA 4FQZA 2DTWA 2ZKLA 1AXKA 1PZ9A 1XNBA 5EYXA 2E26A 2QUOA 1JZ4A 3CNAA 3I59B 1S2KA 2RM23 1FPN1 2JB8A 3FX3A 4M4PA 1OH4A 2WLPA 4XJZA 3VDCA 3WOGA 5ACA3 5HBAA 3POIA 3WY6A 1AYM2 3T3YA 4B7EA 2DVBA 4CRQA 4XACA 3ORJA 3EMRA 3IDCB 2QDNA 5LRSA 3HD8B 2IXKA 2BOIA 2VVFA 4AI0A 4UF0A 4LT5A 5ERLA 4P9YA 4PF5A 4XE9A 4HKLA 3AX4A 2XG3A 1K12A 1QXJA 1H8TA 4JDOA 4QXBA 2PHXA 1W9YA 2ZZQA 3ZFGA 3ZR6A 4AHXA 5EP9A 1BVP1 1ND2C 4QHBA 1H9WA 2VU9A 4ATEA 3B69A 4YVSA 3MICA 1CGPA 1EUTA 2VUAA 4RD7A 4Q4X3 2BQPA 3VHPA 1W03A 4FXGB 1DBNA 4AE2A 3ZO0B 3VBHC 1ZBE2 2UURA 4IV3C 4BMBA 4CP0A 2VNGA 4DZGA 1PVC3 2D3PA 3N9MA 1VBD1 1FX5A 3G6JB 3D0SA 4I3GA 4ARXA 2NM1A 5KWRA 3INAA 4ZPIA 1QJY1 3CJIC 2DV9A 2CWSA 2WKKA 3JB8A 1IPJA 2ZX1A 5JCTA 3H3ZA 2CYFA 3MI8A 1DLLA 4XJ8A 2VMCA 3I97A 4CUAA 1SQ4A 1NQDA 4A44A 1LGCA 2JKXA 3SCGA 4XFFA 5GLZA 2E7QA 3MW3A 2QQIA 2ZGTA 3OGSA 4KBZA 5D2AA 4HVOA 2MEV2 4XJAA 2VG9A 1J84A 2L9LA 4B1LA 5JOZA 3ZYIB 1WBFA 2XBO1 2XR4A 1VBC1 4QU2A 3I3QA 5ISLA 2R0HA 4XUQA 3VBFA 2E7TA 3EJKA 2YDEA 4UFLA 4LHKA 3JQXA 5GJ6A 1PIV2 4LBJA 2X5IB 4HVRA 2JKBA 4YG0A 1DCSA 3U10A 1RMU1 2ZZJA 4LORA 1IS3A 3TN92 4A7KA 3KF5A 5FZ9A 1KDMA 3DGTA 1D4VB 2CTVA 2RR12 4P9WA 5J1XA 5FYYA 2JICA 2YC2A 3ECQA 5IK8A 4HXCA 4UW6A 3NNLA 2CGNA 4FPGA 5GZFA 3L2YA 2ID4A 4Z07A 3T30A 3WDYA 4UFIA 3WP5A 4BE3A 2FQPA 5FLIA 3WINE 1OLQA 2RMU1 4IGPA 5FMCA 3M3CA 4YVWC 1TEIA 3BOWA 4LE4A 4XBQA 1J58A 1CX4A 2Q1MA 1W6NA 3H1YA 4QPIC 5DZEA 5FZ4A 4ATFA 3VV1A 5E88A 1Z78A 4IEZA 3FN9A 4OHWA 3ZMOA 2D3SA 4XCAA 4EN8B 3VBRA 5FY0A 3WEZA 4NJ4A 1AR73 5A3WA 4QWNA 4ZONA 4XTPA 4E4DX 5FYBA 2DCTA 4CDQA 2EAKA 2QZ3A 1JODA 4P14A 1F4AA 4MO3M 4Y22B 4FAGA 3VDBA 5A32B 4UFMA 5I0DA 4N8MA 1ULEA 1BLZA 2D6MA 1SLIA 3OBZA 1KJLA 4M4RA 3B94A 4NOTA 5EJ3A 4BHPA 3VZNA 1LEMA 3WQ1A 2QNKA 2V73A 1YO8A 2WAOA 4PI0A 5AFBA 2YYOA 5F6LB 4ZU7A 4XUNA 4D7SA 3HQXA 3U4SA 2UYBA 4NHKA 2J42A 1ZX5A 1RUC1 5CG8A 3KHBA 3PUSA 1CAVA 2D98A 1CZSA 1JU3A 1ZRRA 5LCWL 3UKNA 2HLEA 3LA2A 2WZPP 1I3HA 3QH6A 4JCKA 4KGGA 4QDQA 3NV2A 4Q0PA 4AYUA 1DLCA 1UO9A 1NY72 3SCFA 1SBDA 3ZDSA 4AFAA 4XVHA 1LHVA 2IXJA 1UNBA 1GZTA 2GDFA 5FFOC 1OFSA 4YSFA 3AMMA 2W92A 4GXLA 5FUPA 4A45A 2JG8B 1QXRA 1RUH3 2H6CA 4PJYA 3DUIA 1L7RA 4XIOA 3DPRB 1LJ7A 4LK7A 3WQBA 1FOD1 1LECA 4MSVA 4CCOA 2IXIA 2YHJA 4LMFA 3SH5A 1VBE1 4WBBA 5FY8A 2WNVC 2ZEXA 2WQZC 3B9IA 5CU1A 3VDDA 4LHLA 4FPHA 2C4XA 5FTTC 2VZRA 5BNOC 4OHYA 2BJSA 1GQPA 1YFWA 4XF9A 4Y5TA 4BQ1A 4Y33A 4QHOA 4Y5SA 4AAPA 3JD73 4MV2A 2R072 2IXLA 2Q8CA 2VVEA 4Q4Y2 1PO23 2Y60A 3BB6A 3D6EA 3GBWA 3RJRA 1OPMA 1O8PA 1SLBA 4FPCA 3AP7A 4UW5A 4AVTA 2D6PA 5F8PA 1X50A 5A3OA 5BNNA 4D3WA 2OA2A 5KHJA 5DQ0A 2VR4A 1PGSA 4RQPC 4DOUA 2RS53 3AKQA 5IUQA 5FJKA 1BKZA 2X8KA 1VB2A 2BVBA 3A7QA 1LEDA 1SBFA 1GWMA 5I0UA 3WG2A 2VZ1A 5LA1A 3A22A 4Q0QA 4CU6A 5DG1A 2GNTA 2P3KA 2RS32 1YQ2A 2O1QA 5A6ZA 3M4FA 3WW1A 2CAUA 3H9AA 5SV5A 1JTZX 1QDOA 1CX1A 3OGJA 4CEYB 4D69A 5D8AB 5FYVA 3FJSA 2WL1A 2A3WA 3VGIA 3IMMA 5JLVA 1RVF3 4E4ZA 3PUHA 3HJRA 1R1A1 5DMYA 1C4RA 1W2OA 4MGQA 4EWDA 5IVEA 5A1AA 4MX3A 2X10A 5LATA 1YIPA 4D7TA 2SBAA 4YW1A 2XB6C 4U36A 1BEV2 5J96B 1ZRIA 2JDZA 3VBSB 5FV3A 4CYDA 4MGIE 4QPGA 2XWJB 1CIWA 2WS93 2HEVF 4JKKA 5G05L 3PIJA 3O0VA 1JI6A 3LF7A 1R091 4MHRA 3MIBA 5H9RA 1CJPA 3U1XA 3K3OA 1ZA7A 3HNYM 3JCIA 2Y6JA 2VXRA 5LK5A 4K21A 2F6BA 1X8EA 3VD3A 2J1AA 4UFKA 1PX3A 3ZFFA 5H9PA 1ZNPA 3T1MA 2R063 4CVUA 1WA4A 3D5OA 1OF4A 2EVXA 4GAZA 1Q8SA 4GB31 4CSWA 1H2KA 3UT0A 1QNWA 2CGPA 2B46X 1RUJ1 1UOFA 3SEPA 4NMIA 2WN2A 4CDUC 1KJRA 5AVAA 3WP6A 1WW4A 5LY1A 4I09A 1IS6A 1DZRA 4AVSA 2FZ2A 1W6OB 4UOJA 1N47A 4OMDA 4GQ7A 5FZ8A 3LSEA 1EAH1 3ACGA 5JIUA 3UKTA 4O65A 2ZTNA 1AR83 1K45A 4Q4W2 2JG9C 1OHFA 5CVRA 3RG0A 5BY5A 3C8XA 3VBUC 5FY5A 3TNQA 1GNYA 2HBTA 2GNDA 3O1RA 3U14A 2Z69A 4IEUA 1UYPA 3RZLA 2HKXA 2ZOEB 3QBQA 3MO4A 3WVJA 5KC5A 1HDKA 1CAUB 4RFT0 2C9KA 3USUA 2DCKA 2W91A 2WNOA 1WCSA 3NJZA 4BOWA 1XYPA 1O4TA 4CEWC 4OCTA 3RRDA 1TMF3 4W6WA 2BWCA 3K2OA 4HETA 3Q8EA 4OHZA 1ND3A 2XLAA 5HI0A 3I3EA 2CNAA 1K5MC 2RDQA 2PLV1 3LAGA 2VOXA 3AJYA 3BN6A 4YW4A 3H3LA 4UT5A 2VZPA 2R043 2WNUA 4N53C 4L97A 3AMNA 2C6SA 3I3BA 4OI1A 2ZAHA 1WLDA 3NKTA 3PNAA 5GLUA 1UY0A 5FK8A 2CGOA 4R9CA 5A3MA 1UMIA 4FXKB 3HEIA 4HOOA 2NMNA 1JMUB 2D5FA 3SC7X 4JKLA 1TVGA 1MS5A 1RITA 1W04A 5EXOA 4DINB 1REEA 2DUQA 2OIIA 2W1UA 2A6VA 4P5HA 1MQTB 2DVGA 3OPWA 1AR61 2B45X 1SLLA 3H1MA 4CCCA 4LLFA 4NRMA 4IEYA 4FO9A 1FMD1 3TOJA 3ZIWA 3BVCA 4AHWA 4BIFA 3H8XA 5F9TA 3VHRA 1HQWA 1TE1B 2D44A 4H3WA 4M3CF 4QU1A 1EY2A 4ZXEA 2D5HA 2Y6KA 1U5XA 2IWGB 1OQEA 2WLQA 3KM5A 3OTFA 4QB2A 3NVCA 3D4KA 1XXNA 1POQA 2FCTA 2YBPA 1D4M2 1W05A 4RR3A 3MV11 4AEDB 3E5XA 3T4HB 4LKEA 3LDBA 5A70A 2VZOA 5C4WC 3S30A 2WFF3 2Q5TA 2WFPA 3J26N 1KS5A 2WO7A 1CVNA 1GP6A 1MEC3 4K1YA 5CFCB 4MVTA 2FCUA 3EO6A 2ARCA 1TNFA 4JGYC 4R9BA 3ITQA 5T5PA 3D0JA 3GBGA 1ZBA1 3OY8A 1V6JA 5JSOA 2PXJA 5JAXA 1ZM1A 3I49A 3N9QA 3ZR5A 1RHI3 2UU8A 4CP2A 4FPJA 3WNOA 4EJRA 2K2SA 4DO0A 4AEMA 3ME2A 2BDRA 4PI2A 1OLMA 3O1PA 1JYXA 1DYKA 1OLRA 2FDKA 3W59A 3WDTA 2VTXJ 3NNMA 2JIJA 4RHV1 2B42B 4XQWA 4CXYA 3KQRA 3N7LA 5CIRA 2UWAA 4EROA 2YPDA 1NCRC 2WZR2 1QJU2 2JDYA 3AKSA 4XF4A 5J48A 5JMCA 3C7EA 2DCZA 3NAPB 1G9AA 1GNZA 1BK0A 1R081 4JRAA 3ZFEC 1FAYA 1MR5A 1OA2A 1C1LA 1STMA 5FY7A 5BXXA 2VTFA 3VL9A 2OVUA 3EB7A 3BU7A 4Z82A 5FPXA 3WLUA 2HWF1 1L7QA 3WDWA 2HWE2 1ND2A 3MUY1 1CAWB 5FBJA 3D82A 3DEMA 4B1MA 2ADEA 1Z7S2 5AC92 1BMV1 4O9EA 5L9VA 1PMIA 4HSJA 4D8MA 2AYHA 1OFNA 2AH2A 2VOKA 3T2OA 5K7PA 4BK4A 1NZIA 4D7YA 1US3A 3N36A 4CDWB 1BQPA 1QU0A 3VBHA 4IV3A 5C3RA 5IT6A 4N7IA 1QY4A 2BTVC 1RUI3 2C1FA 1QQP1 3TEWA 4LK6A 2H6BA 3MIGA 3MYXA 1AL23 2YXSA 2Y0IA 3CJIA 3NV4A 4AFCA 4QX2A 1TZOA 2GMMA 4IERA 5DDJ1 1XPWA 2IFRA 2NQYA 3I3MA 1BK1A 1H0BA 2ETEA 2WO1A 2YU1A 3AYDA 3GZAA 4I3PA 3VBOC 3WD5A 1YLLA 5BYNA 1BYHA 1ENXA 3ZSMA 4NHMA 4FCAA 5HV4A 2ZCWA 3HQRA 5DUUA 5L19A 1W2TA 3ZKUA 3HIFA 4E2QA 2QQUA 4P08A 1TME1 2GP5A 3TNPB 5IWFA 4Q8KA 1RUF1 2DURA 3H1WA 3K51A 1PK6B 2GZWA 1GV9A 2JWPA 4KWKA 3AK0A 4XHXA 2I45A 4LO4B 1TNRA 4FPOB 5FYMA 1AYM3 1PIV1 4YPJA 1G8WA 3HOBA 4HK8A 3Q8BA 5KHGA 1COV2 1K3IA 3LZZA 4Y3OA 3OGVA 5I8YA 3JBG1 2TNFA 2VMIA 3ALQA 4FQ4A 1VP6A 4QM8A 4AI3A 2QCSB 3ACLA 1KD7A 2GSYA 1POV3 4WM8B 5JIAA 3T0BA 1C8M1 4IE0A 4C91A 4S2FA 2RDNA 3DYOA 5FY9A 4Z92B 3AKTA 3KSCA 2VC9A 3WW2A 2QQNA 2JDNA 3NQHA 2J22A 4A42A 3MIHA 5HXMA 1VALA 4JGZB 3ZIXA 2P37A 1QNYA 5I91A 2K0GA 4EN9B 4N43B 4O61A 4DQAA 1MS1A 5C3OA 4YVWA 2RG4A 3MPBA 1X36A 3L9JT 4LTAA 5FRAA 2W0XA 1YWKA 1LGBA 2R0FA 1W6QB 2DF7A 2FDJA 4KU8A 4C0HA 4E4SA 1IHMA 4QPIA 4CXXA 3B5LB 1XU2A 4KMQA 2OX0A 2DYCA 5KXCA 2VM9A 1XBFA 3AZXA 1GR3A 4GMP0 4XMAA 2J1RA 3BTXA 1VMFA 5APAA 5HCHA 3E6CC 4LBKA 1UD1A 3ILFA 4XPVA 4MHUA 1LOFC 3N9OA 4DB5A 3VKLA 3PU8A 1O59A 1RJ7A 5FQ0B 3RQ0A 2EALA 3I2KA 2MEV3 5LK7B 4QDSA 3D3AA 5E6HA 3VL8A 1GSLA 3A0KA 4WVMB 4BXSV 4XHBA 4FP2A 2QQWA 4DRRA 3AZWA 3AXDA 4JV4A 5C8CC 3POGA 4CPBD 2BFUL 3UESA 1RJ8A 4KBBA 2EF6A 1YC61 1XRUA 4FVVA 3ZXFA 1LOGA 1PGW1 3VKFC 5B2GB 4B3NA 2PTMA 5F32A 1YI7A 2R042 1CAXA 1W6MA 4IE7A 2W52A 2VL4A 3CL1A 3IM0A 4Y20A 1C28A 1VAMA 3VB9A 1AVBA 3AM2A 2C24A 2XQRA 2RR13 5FZAA 2IC1A 5F3IA 4CCJA 4HVQA 1O3QA 1A6CA 1CONA 1NX9A 2XH6A 3AL5A 5IVVA 4MG2A 1JZ2A 4KGQA 2Q1FA 4P5YA 5FXVA 3PTRB 4J1XA 1D0HA 2J1UA 1WW5A 2DUOA 2E32A 2YFUA 2ZGNA 4UF0B 1FXZA 3WF1A 4FP3A 1WUVA 3AMHA 3I2JA 3ZSEA 3U4XA 1LAJA 1XB9A 1H8TB 3ZFGB 3OEAA 2WNVA 4YVSB 3N4MA 3WSOA 4L0PA 2FD8A 5BNOA 3WNMA 5D21A 4F8AA 1JZ7A 2BOJA 4K3UA 5J37A 3H7YA 5F6KA 3TRSB 4LPLA 2A70A 4ZHNA 4K1ZA 1A8MA 1Y9MA 3OGRA 1ULOA 4Y1YA 1SMVA 2VY0A 5CFDC 5A80A 1CJDA 1P8JA 2I2SA 3IDEA 4F3JA 1W8NA 4YFWA 1PK6A 1H2MA 1XOYA 5FXZA 3CJXA 1G9FA 3T2QA 3OB8A 5KXEA 1ODMA 2R49A 4ES8A 4QPWA 2DWRA 2WWSA 2UY8A 2WNEA 5EPAA 4DY3A 1UPSA 3USSA 2VMGA 5GKAC 1SBEA 2RM21 4UFJA 3LOBA 3KV6A 1DHKB 4M00A 2I07B 1OURA 5JOWA 2PFWA 1OC1A 5ACA1 5E16A 3IZOA 4OHXA 1JYCA 2VMDA 1G9DA 4JQRA 3GJAA 5H9QA 5LY2A 1CESA 3VBFB 1VE0A 4YFZA 1G6NA 1S0DA 4RYDA 1DQ1A 1XNCA 3ON7A 4A3XA 3AYEA 3DCQA 4ZXKA 4WVWA 1LGNA 5JSRA 2CHHA 2YC4A 1XE0A 2PHUA 2Q1ZB 1YFXA 5JOYA 1GUIA 3MFAA 2QFEA 4YW6A 3G7DA 3THCA 2EIDA 4H55A 3TWIA 3FLPA 2JE7A 1ENSA 2ERFA 1UKGA 1CD3G 1BHGA 2RVAA 4NPRA 2BW8A 4AI1A 1RUG3 2E51A 4F83A 4BWOA 3V0AA 3FUQA 3LDKA 4Q4X1 5FK7A 2GMPA 4TN7A 5EJ1B 1UZWA 2QQJA 2R073 2F17A 1ZA4A 1W8WA 4Q4Y3 2AEYA 1UZZA 1PVC1 4AQ6A 3WDXA 2W94A 3V0BA 4LHNA 4YNIA 1OA3A 2WIIB 3WDVA 1Y43B 1OD3A 1W6NB 3N9LA 3PLQA 2PQQA 3IDBB 5DAXA 5FZKA 4HKOA 2JDKA 3PVBB 4LBNA 5CNAA 3B9CA 4LO6B 4UW4A 4CDUA 1SFYA 1D7PM 1OBNA 1RC6A 2LS6A 3J8F2 1UN1A 3VBRB 2WQ8A 1QOSA 3KZ4C 5T5JA 3ETPA 4RN5A 3WF3A 4CCMA 4QAWA 4EQVA 3OUJA 2DVAA 1AXYA 2RS33 4CDQB 1ALYA 1QJEA 2JG9A 1UOJA 2QVSB 4OULA 2R30A 3T1LA 3VBUA 4P9XA 1V9U1 2PAMA 4QM9A 4CU9A 2EICA 2VBDA 3EYPA 4YGCA 1WZXA 2VCBA 5FP9A 3WF4A 2XVKA 4Q0VA 1GZWA 3U07A 4XJUA 2BBVA 2WT1A 2ZGLA 3KGZA 2XJQA 2BVVA 4KWUA 3KT1A 1OI6A 2Y33A 3ZXEA 4EWAA 4GMP3 4I0WB 1BEV3 2ZX2A 5B4NA 2VECA 2JXAA 3AYAA 4CEWA 2VAUA 4Y5Z0 5FYSA 5FWJA 1H2LA 1CAVB 3RNSA 1DIWA 1XC6A 5C70A 2OS2A 3Q9OA 2GMEA 4XOGA 5FZ6A 5LA0A 1CWPA 1K5MA 3WX5A 3DL3A 5J09A 1MPXA 1NE4A 2XJRA 5CEHA 1GOFA 4JVAA 1PVXA 1SLAA 1FATA 1RUE2 3H8RA 4RL7A 4W65A 1KGYA 4N53A 4PLOA 1NXMA 1PZ7A 4DXZA 5JXJA 2XGXA 3OCPA 4CDXC 5D1IA 4YM0A 1US2A 5JOXA 3VZOA 1WMXA 4FSJA 2HWB3 2ZKNA 3I2DA 4RS5C 2FDIA 1VRH1 5BPXA 1R1ZA 5FZCA 3KCXA 3TYJA 2KA3A 3ACIA 4AWDA 3VD9A 2V4AA 3VDDB 3N3HA 2DVFA 1IG0A 2VUDA 1PGL2 4RGGA 2W46A 3S6PA 4BA6A 2ZA9A 4LBQD 1NLSA 2P34A 1ZZ9A 1MS4A 1HB4A 1AR71 3A0NA 1KFXL 4JX0A 1EV12 1V6OA 4XABA 3KV4A 2GP3A 3KV9A 3K4ZA 3MUZ1 4IEXA 1OLME 4Q4W3 1JZ8A 1RUD2 5GZDA 2HWC2 3ZN6A 2X53S 2Z79A 3H3UA 1IS5A 4AGGA 2BU9A 3B93A 4LA2A 5BNNB 4FFHA 5CFCC 1KXGA 4XXPA 5C71A 1CPNA 2BNMA 4B4RA 4YW7A 1X9PA 4IV1C 5ANQA 2J1EA 2P6HA 3GZUC 3GHNA 4HG6B 5C4WA 3ZXAC 3EQEA 4AW7A 1JH5A 3HNBM 3O1TA 4QT6A 2BEOA 3BIEA 1MVEA 2P17A 1YUDA 3GM8A 4IGQA 5DPNA 2VOTA 5IAXA 1JU4A 4JGYA 2RV9A 5LA9A 3X29B 1U5YA 3ACFA 2O0OA 1OMIA 5CAZA 2XUMA 4NE9A 3URFA 2A3YA 2ATFA 1X82A 5BNQA 5CYYA 4C90A 5LBCA 3WF0A 1RUH1 2WR9A 2TBVA 3J9SA 3PVNA 3ZYBA 2W47A 1OOPC 3GNEA 2F4LA 2J1TA 2TEPA 4EZ4A 4QPGB 1J59A 4DFSA 1OA4A 1C57A 1NCRA 4OVEA 3K48A 1O91A 1OVPA 2ZMKA 2C0ZA 4IE6A 4QD2A 3VKOA 3CU7A 4OZXA 1VBA2 4MUVA 2RS12 1ODNA 1NT0A 2LRPA 4AZZA 2AC1A 1O3SA 3WHUA 1EUUA 4QXHA 3ZFEA 4KG0A 3BCWA 3JD71 4XXAA 5FBZA 1O5LA 4DNYA 3ZYRA 3ACHA 1GNHA 1PO21 1V70A 3HPNA 5FAXA 5IAVA 3ZFFB 1VRBA 1OPOA 3OUIA 1I5ZA 1N1TA 3LE0A 2YC0A 2HWD1 3OBAA 5A3TA 2Z5WA 4RGKA 2BNNA 1ULPA 2CY6A 1LODA 4XF3A 2Y34A 4FPKA 2D97A 1UIJA 3JB4C 1AYN3 4K8RB 1JZ3A 2ZMNA 3MIDA 2BNOA 3NO8A 4DPNA 4TSVA 1MZ5A 2GH2A 2RS51 2CU5A 2ZGKA 3RZJA 3LGRA 4AVBA 4OI0A 1LULA 2OQ7A 2ZABA 5IJRA 1QJX2 4L9BA 1D4M3 4GZ9A 1D2QA 1OT5A 2P6CA 4QQPA 2DBNA 3RZGA 1W8UA 5L9BA 2W68A 1GP4A 1ST8A 2FZ1A 5CZKA 4Y1VA 1VBB2 3R4UA 4YZ2A 4XDQA 1VAVA 3NJYA 3ZXJA 2WA3A 4BB3A 4K40A 2UWBA 3SLIA 3ENRA 4XFIA 2WZEA 1RVF1 4Z2AA 2BGOA 4AI9A 3WNLA 1WLCA 5BNPC 2Z2SB 1HRV1 3VBOA 5CA6A 2VULA 1GQGA 1UX6A 4YW5A 5F1RA 2QQLA 3NSTA 1EPWA 3UYJA 2VQ0A 3QLQA 2HJIA 2UYAA 5JI7A 3USUB 2VW0A 3POYA 5T55A 4AOCA 3BTZA 2WS91 2RHPA 2ET7A 3QCWA 1WCUA 2VMFA 2OUJA 3H7JA 4HPKA 2Y6FA 2W1QA 3PURA 5FZ7A 2WZR3 1ND3B 1QJU3 3HR9A 3WP3A 2W3JA 1KQRA 2G9FA 1RUG2 1XSRA 4LHSA 1AX2A 2RJ2A 1B35C 1V6NA 2JEMA 3WCRA 4OI2A 2W95A 4NIGA 5FUIA 2R061 2WNUB 3DN7A 2QJVA 4AI8A 1FYUA 1NLRA 3BTAA 1ZRDA 2WYFA 4ITCA 4YW2A 1S1AA 3NRUA 5L73A 1X7NA 2HWE3 1LHUA 1IPSA 1NG0A 1Z7S3 2B7YA 1SCSA 4NHXA 1HB2A 1WCKA 2A6WA 3ZSLA 5AC93 3IN9A 4AI2A 4EZHA 3W9AA 1Q8OA 2P1BA 3KB5A 5FZ1A 5JZGC 5LEJA 5L7OC 1FV2A 2IXHA 1AR81 1H1AA 2VNVA 4PHZA 4DXSA 4UBHA 3BGAA 1OKQA 3UKVA 1QIQA 1W2AX 3IIIA 1N3PA 5JMOA 1S4CA 4XTMA 3NMBA 3LPGA 1QMJA 1E5HA 4GD4A 4OLLA 4RR3B 1E57A 2BUKA 4XFGA 3VKMA 2ZBJA 3PUIA 2WRAA 1LOFA 3GZTB 2P2KA 4YWAA 1IPKA 2SLIA 3GGLA 3WNXA 4HONA 4AVVA 1DQ0A 2A6XA 3WR0A 3MIEA 1WLTA 4AQ2A 2ZHMA 4IEOA 5FO9B 1ENQA 3NJXA 1TMF1 4FPFA 5FZHA 1HV0A 1PO12 1QH6A 4ZZ8A 5C8CA 2GH8A 2RDRA 1OXCA 2W87A 1GYKA 3C2UA 1W0OA 3OJBA 3OY8B 3R4DB 1GANA 1MS9A 3THDA 3UGGA 1ZRCA 2B9VA 3A23A 4AFBA 1HIXA 2R041 4QX0A 1RUC3 4I0BA 4TLGA 1W3VA 1COV3 3MLJA 5GLTA 1DGWX 5L36A 4D94A 1BBT1 1JZ5A 3N9NA 4QX3A 1WBLA 1UY1A 4LUKA 2ZX0A 3BU0A 1MZ6A 3S5QA 1Q8PA 1HXS2 2HWB2 4GH4C 1IG3A 1MS8A 3RWKX 4QB6A 5J3UA 2PHTA 2ZEYA 3POFA 5HCBA 2BFUS 2LTNA 1GMMA 4QHZA 1XNKA 5T3NA 1D2SA 1HRI1 2X05A 1AR92 1YQCA 3L2HA 1TG7A 1NA1C 1IS4A 1ULGA 2JDMA 3O12A 3R4SA 3FMGA 1ND2B 4AXOA 1VIWB 2V09A 3HQUA 5FPAA 5LRRA 3LA7A 3MBWA 5EWSA 1UPIA 1JXNA 4LKDA 1WCDJ 4YYOA 2PYTA 3WP4A 4HANA 2WAAA 3ZM8A 3VBHB 2WFF1 1POV0 4IV3B 3K77A 2E7AA 1ULDA 2ZGPA 2EIGA 1VJ2A 1MEC1 1F4HA 3PMSA 5CFDA 3ZYJB 1L7LA 1S0GA 3GZEA 4PLNA 4G3YC 5KXBA 4NRQA 5FOJB 3ZYHA 2E9QA 3CJIB 2XDVA 2B39A 2VZSA 1HQLA 4FAHA 1ASJ1 5FXWA 3HMYA 4QPYA 3K4DA 1RHI1 5K4LA 1W8FA 2WABA 4Y4RA 2A3XA 1NXD1 1V6IA 4SBVA 2I74A 4Z2WA 2AGSA 3O1OA 1ZVFA 3J7LA 2HYKA 2DCYA 2D40A 3IBMA 1REDA 4R4ZA 1RUOA 1FPN2 1SPPA 4AG4A 3JU9A 3WG3A 1CN1A 2H0BA 3PHMA 3GYDA 4PDWC 4MZUA 1S55A 2C5DA 3PDQA 4A4AA 4COZA 3OYWA 4R52A 4EWEA 1R1A3 4Q4V1 5LBBA 4UW3A 3VD5A 4BISA 4W50A 3MLKA 2DBIA 5FZ3A 1W0PA 1WMDA 2HEWF 2YGLA 3ZMNA 4BU2A 2DFBA 4XF0A 1WGPA 5JDBA 5M0TA 5L9RA 3GALA 3K46A 1W9FA 4HBNA 1LU2A 2DUPA 4M3CA 4OZOA 1V00A 5F2SA 3LDRA 5GLVA 2RJKA 4NN0A 1JUHA 2QQMA 1PHMA 3ZSKA 1AYN2 1NOVA 1D0GA 2GAUA 3PTYA 4Z8BA 2E63A 2LALA 2XLFA 5JSPA 1OD5A 4R9AA 5A3NA 2JDHA 4GA9A 3P1IA 1FNYA 2JIGA 3THTA 1RUI1 1VBD2 3DF0A 4PIZA 4YVWB 1AL21 4QKFA 4I30A 1AJOA 5C9AC 1QJY2 4PLMA 4QPIB 2OKXA 4URAA 1AF9A 3CIHA 2QQVA 4UYBA 4YZ1A 5FDBA 2YPJA 1AX1A 2EXHA 2BGCA 1W8OA 3FBYA 3R05A 2G9ZA 4LBMA 4YM2A 5C3PA 5K0UC 4CUGA 2WO2A 4XILA 3OSDA 2CL2A 4W6YA 2Y64A 4NHLA 4BQ3A 2D93A 2A1XA 4O9GA 3ZN5A 4AGVA 1EPZA 3S57A 5FMBA 3UGHA 1A78A 5GLWA 4N9IA 5FLJA 1X8MA 4LITA 4V2WA 1RL3A 3NV1A 4QMAA 1F5FA 3WG1A 5ABJC 5GZGA 3ZVXA 3H8OA 1UXZA 1XYNA 4BZ4A 1JZ6A 1PNFA 2XBO2 2ARAA 2X29A 4ZU5A 1VBC2 3ES1A 1AYM1 1LNSA 1LR5A 5GM0A 3IB3A 4P9LA 1WW7A 2QDRA 4A3ZA 4DUWA 2PHDA 2ZHLA 5FYZA 1DU3D 1GP5A 2KM2A 1MS3A 2VZVA 4LOSA 2JDUA 1RMU2 2O8OA 4WM7C 4XF1A 5KXDA 1E5SA 1JYIA 2ZMLA 2J7MA 1CAXB 1S0JA 1W6MB 2OXBA 3I8TA 4XURA 4Y20B 2QBXA 5FO7B 4QQOA 1QKQA 1Q5OA 4ZKTB 3OUHA 3GJBA 1GOHA 4XUPA 2FCVA 3PL0A 4HK9A 3TAYA 1NCQC 3AP9A 4X8PA 5FMDA 2QTWB 2P3IA 3TEYA 4BK5A 2XKPA 2RMU2 1ZBE1 3WUDA 2WA4A 4I02A 4CDXA 3CHXA 3DYMA 3UETA 5LW9A 4JC1A 4M0NA 2HBUA 4RS5A 1KEXA 4KWLA 5I8SA 3RPQA 2XLGA 2WNVB 1H30A 4NUBA 3LFIA 3FHIB 1XSQA 4J25A 4YGEA 5F3EA 4DEQA 5BNOB 2ET1A 4XBLA 1W8TA 3CZJA 4IXLA 2CWMA 3J8F3 4FFFA 2BRTA 5A33A 1N3OA 3LEGA 4B8EA 2ZHNA 2BERA 3J7MA 3ZXDA 3ZYGA 1LOEA 4QX5A 2VCCA 1C1FA 2MEV1 4ZS2A 1UXXX 1RUNA 3P3NA 4MXWA 4QXKA 2KXLA 1HW5A 3VZLA 1DGLA 2YFZA 3B00A 4IEWA 1JBCA 2QQPA 1WLWA 2BBAA 2XONA 3BTYA 4LXLA 4I2OA 4RQPB 4E9KA 3KS7A 2VBBA 5KC6A 2VUJA 3E5UA 3E6BA 3FLRA 2VBPA 4XEZA 4IV1A 4IW3A 4Z1VA 2GNMA 3FBMA 4TZDA 4XW3A 2E6VA 1RUC2 1F5JA 1OH3A 3TN91 3I2OA 2ZEZA 4YRDA 2DFCA 2RR11 5A3UA 1CZTA 4BYYA 3MGUA 3GCXA 2N7GA 2B9UA 4S2DA 2HYXA 2MPFA 4KU7A 2BGPA 2G19A 2LROA 4Q1PA 1FI2A 2VNRA 5LWBA 4RHV3 1RUE3 1OOPA 4O7XA 4W8JA 1H1MA 3VLBB 4AK3A 1YQ6A 3CMGA 2BP6A 3S0MA 5LEKA 1FOD2 3ZDVA 2AUYA 1Q8QA 1VBE2 4QKDA 5T5LA 3SH4A 1Y3TA 1LHNA 3CEWA 3PJQA 4GWMA 5AVPA 5FXXA 4LE3A 1VLNA 3RZKA 3V0AB 4HLTA 2ARBA 5DAQA 1W0NA 3AFGA 4PCRA 2FDFA 5FYHA 3A4UA 1EV13 5FP7A 4CP9A 3V0BB 1O8SA 2WQ4A 4YZ5A 1W2UA 1UZVA 3EBRA 4G9SB 1RUD3 4MGZE 2HWC3 3ZPYA 2Y26A 4CDUB 1I1EA 1VR3A 1DYOA 3KCCA 1HJGA 3VKNA 2X5IC 1UOGA 1Y9GA 1XNAA 4IQPA 4RA0A 4XAAA 4EN6B 2OQ6A 1HB3A 4QQHA 1SLCA 4BQXA 1V6KA 4XMIA 1UZYA 5JXHA 4OHVA 3ASIA 4MOAA 4META 2JG9B 4ASKA 5IYYA 3VBUB 2DU1A 3CKHA 2VQTA 4PBOA 3VZMA 5BNPA 1NY71 2AENA 2XKOA 4GKYA 1R1A2 5JI9A 2W39A 4HFSA 2QZ2A 1GZWB 3I2HA 3C7GA 1TME3 3ZOIA 5DZFA 4NO4A 1RUF3 5EQUA 4JHZA 3OPTA 4UI9L 5EIYB 4XFCA 1LHOA 3FZ3A 1QJFA 5C8WA 1SDWA 4CEWB 3NKGA 2WZ8A 1R092 2GALA 2XHKA 2V5DA 4ES9A 5FYIA 2XL7A 1VBA3 2VW2A 3KV5A 1K5MB 1ZZ8A 2RS13 3KT4A 4UBGA 4M01A 1GFF2 1B35A 5I0RA 5FZOA 2VTXA 5F37A 2R071 3GHMA 1AL0G 4N53B 1JOPA 4Q4Y1 4CCNA 2D43A 2R7EB 1DGRN 2WWUA 4B4QA 4LO5B 4Y24A 4U2AA 3UL2A 3W5NA 4GB32 3HT1A 1AUYA 3O1UA 3SMHA 2KR2A 3CQOA 2Q8EA 1RUJ2 4TWTA 3K75B 3T0AA 4EE2A 4LEJA 5LBFA 2H0VA 1LTEA 3ATGA 5EV7A 4RQPA 1QJX3 4SLIA 1N1SA 5JZGA 1EAH2 5L7OA 5B4XA 2RS31 4XCBA 3HN3A 1VBB3 4JTOA 3MHZA 2CDOA 2P3YA 1X33A 1LHWA 4LQRA 1N3QA 3ZN6B 5FUNA 4PF1A 3POSA 4HSLA 5F3GA 5FZEA 5IVFA 2PHFA 1PMJX 2ZX3A 3AXEA 3LKJA 3VZKA 3TEZA 1PMHX 1UF2C 3J7NA 3SITA 2JG8C 2OZ6A 3E1F1 5C4WB 1W90A 1Y7BA 1BEV1 4GMP1 4ISRA 4J1WA 3DPRC 1O3TA 2VW1A 2B5HA 2ZX4A 2AR6A 5DUXA 4JGYB 2GU9A 3PU3A 1APNA 3I54A 4IEVA 2ZHKA 2VNOA 1UZ0A 4NROA 1XJAA 3U75A 4BQ2A 2PLV2 1Z0HA 3MFCA 3CLPA 4R9DA 4YG3A 4AQSA 2OW4A 5IVCA 2X09A 3JZVA 5FREA 3ZX7A 5I93A 2ZS6B 4TYSA 5EJZB 3VHOA 4R4XA 5A1FA 2NPIA 2Y8KA 4AL9A 5FO8B 3F2ZA 4PBPA 1OVSA 1NCRB 1SEFA 4QQLA 5DZGA 1LOCA 1UOBA 4GH4A 2Y6LA 2FDHA 2YU2A 1YQ8A 1W39A 1NE6A 1VB4A 1YJKA 4MGYE 3AP4A 5FZIA 3ZFEB 1JOJA 4LBQA 3AL6A 3N9PA 1AR62 2VCAA 3ETQA 1S2BA 4GJZA 3GCWA 2E53A 1DGWA 1NA1A 1FMD2 3LD8A 2EA7A 4MXVA 4XUOA 4AFMA 2EXIA 5JXIA 1HJFA 1C5HA 1Q3EA 3V64A 1QXPA 5DABA 4CA9A 4OQ8A 4GWNA 1NUKA 4Q4W1 3UGFA 3F95A 3O0XA 5FPLA 4ARYA 2JECA 4BPZA 5E1RA 5D8AC 4CEYC 1MZFA 2D3RA 5EZWA 1JYNA 4A6SA 2OPKA 3H8UA 4YGDA 1VMJA 1NQJA 4RSUA 3KHCA 3P5BA 5F5CA 5K8SA 2V5YA 3AP6A 1H6YA 3THPA 5F5AA 4LBOA 2XJPA 5F7UA 3W21A 2HEYF 4CCEA 2EIBA 3VBSC 2O14A 4JKMA 1V6LA 1N1VA 2QQOA 5EYYA 4DS0A 2ZGRA 2YY1A 4K8FA 3FE5A 3RVHA 5T5OA 1N1YA 5J36A 5DUWA 1ZBA2 3AZYA 1PO13 1Y4WA 4CU7A 2QE3A 3LB9A 3ROUA 4LLOA 5FY1A 3VBOB 1E5IA 1XYOA 5H9SA 4M3CE 4CU8A 4QX1A 5DAVA 2A75A 4RHV2 2VH9A 4P9JA 4OUMA 3RFRA 4ORFA 1UU5A 4Y1UA 3HNMA 4LA3A 1IKQA 2IVIB 4PDWA 1C5IA 1OKOA 2OZJA 2PA7A 4AVAA 4NIIA 3N7KA 1HV1A 3VDAA 1RXFA 2WINB 4HPKB 4BJ0A 1H1IA 1XU1A 1HXS3 4GJYA 3W58A 2CAVA 3SKJE 1DF0A 1UL9A 2P5BA 1JUIA 4PIYA 5IVJA 3K4AA 3O1MA 5IVYA 4YM3A 1R082 4NIHA 1XE8A 3H50A 1SACA 3RS6A 2XJSA 2CV6A 5K9YA 1AR93 5J98B 2VOVA 4L2NA 3JUUA 5FCCA 3ZXGA 2HWF2 2Z4FA 3MPPG 2JD9A 4E27A 4IDZA 1S0BA 2JD4A 3ZYPA 1AYN1 4ONUA 4D6SA 1BMV2 1WKYA 4NPLA 1W28A 2YBSA 3BOPA 3PUQA 1YI9A 4LO7A 1UIKA 1NLQA 2D6KA 2A6ZA 5BV6A 3WCSA 1D4M1 1FNZA 3MEPA 1DQ6A 2IZWA 3P6BA 3JXSA 2UY9A 1F8VA 3W5MA 2JE8A 1QQP2 4BM8A 3LWCA 5A6XA 4OI4A 5C9AA 1GZCA 2PMWB 3HN1A 3ZKYA 3P3PA 3CZUA 5DDJ2 3WV6A 5A3LA 5K0UA 2ZGUA 3EXUA 1S0CA 3M3OA 4XYXA 3BODA 4L99A 1GBGA 1AXZA 3RZMA 3NV3A 4LIUA 4XDPA 1W8ZA 1TME2 2RE9A 4DY5A 1A3KA 1V9U3 1FPN3 1RUF2 5ABJA 2GN3A 3B7MA 5A7WA 2FHRA 3I7DA 3Q8FA 4LULA 4MYEA 4XUTA 4XQ4A 3WT3A 3MZHA 1DZTA 3U11A 3WW3A 2WZR1 1QJU1 1AJKA 1H9PA 2WUHA 1ULFA 1WCQA 1IZ3A 2NYYA 3E6DA 4Q0SA 5C8CB 1ACCA 4IE4A 4A41A 4LUMA 3GF6A 1MQTC 4L8QA 4QGMA 1JYTA 1WD3A 3JBG2 4WM7A 1DGRA 4I01A 1XQNA 5FZFA 5CKNA 1YIFA 1IQDC 1JN2P 1SDDB 1LRHA 1NYWA 2OUHA 3OBTA 4XFBA 2ZJCA 4YZ4A 1G7YA 4YARA 1E5RA 3ZN4A 1BZWA 1C8M2 2HWE1 4XJ9A 4NWWA 4XFHA 1Z7S1 5AC91 4QKBA 5JR7B 3FLTA 5DG2A 2YV8A 1NCQA 5I0SA 4LJHA 2PAKA 4JTNA 4AEDC 3C7HA 4Y1XA 5CBLA 2W08A 5IVBA 2ARXA 1U5ZA
chains in the Genus database with same CATH topology
2XMLA 5LW9A 4HOOA 5FZCA 5FYTA 5FJKA 5FYMA 2XDVA 3PURA 5FZ7A 5FXZA 5FZBA 5A7QA 4V2VA 3RVHA 5A1LA 5FXWA 5A3PA 5K4LA 3OPWA 4NUBA 4Y3OA 5FYIA 5FP8A 5FZLA 4Y4RA 3KV5A 5F3EA 5FZ9A 3U78A 3ZPOA 5FY1A 5FJHA 2Q8DA 5FYYA 3KV6A 5FWEA 5F39A 5FZOA 5F37A 4QU1A 3KV4A 5FZGA 4QX7A 5FYVA 2GP3A 3KV9A 4CCNA 2WWUA 4C8DA 3PUAA 5F3CA 3PDQA 5IVEA 2YBPA 5FPVA 5FPBA 5LY2A 4BISA 2VD7A 2Q8EA 4IGPA 3LDBA 4LXLA 4EZHA 5ANQA 5FV3A 4GJYA 5FZ3A 4D6QA 5FY9A 2P5BA 5IVJA 5FZ1A 5IVYA 5FZ4A 4BU2A 4IGQA 3AVSA 3K3OA 2PXJA 2OX0A 5FZOB 3N9QA 5FY4A 5F2SA 5FY0A 4XDOA 4DO0A 5A3WA 3AVRA 4QWNA 4TN7A 5FUNA 4GD4A 4BXFA 4D6SA 4EYUA 5FYBA 2YBSA 5IVFA 5F3GA 3N9OA 3PUQA 5FZEA 3PU8A 4LIVA 5LWBA 4GAZA 4QX8A 5A3NA 4CSWA 4HONA 2YPDA 5E6HA 4EZ4A 5F2WA 3N9LA 5FZKA 5FZHA 5A7NA 4URAA 3KVAA 3DXUA 4UF0A 5LY1A 4DIQA 3PU3A 5FXXA 3U4SA 5FY7A 5KR7A 4IGOA 4QXHA 5FZ8A 5A7PA 4CUGA 4QXBA 3PUSA 2YBKA 5FP3A 5F32A 4CCMA 1VRBA 5IVCA 5FBJA 5FY5A 5FZMA 2WWJA 5A3TA 5FZAA 5FP4A 4LIUA 5FYHA 4CCJA 5F3IA 4XDPA 3N9NA 5FP7A 3KVBA 5A1FA 4LITA 3AL5A 2XUEA 4V2WA 5IVVA 4D6RA 4E4HA 2W2IA 5FP9A 5FUPA 5A7WA 4CCKA 5FPUA 3K3NA 5FXVA 3PTRB 2OQ7A 3N9MA 2XXZA 2YU2A 5FYUA 4CCLA 4UF0B 4CCOA 5FZIA 5FYZA 5F5IA 3AL6A 3K2OA 2OQ6A 3N9PA 5FY8A 5FYSA 5FWJA 5A7OA 4GJZA 5FZFA 2OS2A 3LD8A 3NJYA 5FZ6A 5FZ0A 3ZLIA 5FZDA 2YU1A 4Y33A 4ASKA 4AAPA 4AI9A 3DXTA 2Q8CA 5CEHA 5FPAA 5A7SA 5FPLA 2OT7A 5FYCA 5IW0A 5A7WB 2GP5A 4QXCA 5F5CA 3UYJA 5IWFA 5A80A 5IVBA 5F5AA 5ISLA 3OPTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XML A;  5LW9 A;  4HOO A;  5FZC A;  5FYT A;  5FJK A;  5FYM A;  2XDV A;  3PUR A;  5FZ7 A;  5FXZ A;  5FZB A;  5A7Q A;  4V2V A;  3RVH A;  5A1L A;  5FXW A;  5A3P A;  5K4L A;  3OPW A;  4NUB A;  4Y3O A;  5FYI A;  5FP8 A;  5FZL A;  4Y4R A;  3KV5 A;  5F3E A;  5FZ9 A;  3U78 A;  3ZPO A;  5FY1 A;  5FJH A;  2Q8D A;  5FYY A;  3KV6 A;  5FWE A;  5F39 A;  5FZO A;  5F37 A;  4QU1 A;  3KV4 A;  5FZG A;  4QX7 A;  5FYV A;  2GP3 A;  3KV9 A;  4CCN A;  2WWU A;  4C8D A;  3PUA A;  5F3C A;  3PDQ A;  5IVE A;  2YBP A;  5FPV A;  5FPB A;  5LY2 A;  4BIS A;  2VD7 A;  2Q8E A;  4IGP A;  3LDB A;  4LXL A;  4EZH A;  5ANQ A;  5FV3 A;  4GJY A;  5FZ3 A;  4D6Q A;  5FY9 A;  2P5B A;  5IVJ A;  5FZ1 A;  5IVY A;  5FZ4 A;  4BU2 A;  4IGQ A;  3AVS A;  3K3O A;  2PXJ A;  2OX0 A;  5FZO B;  3N9Q A;  5FY4 A;  5F2S A;  5FY0 A;  4XDO A;  4DO0 A;  5A3W A;  3AVR A;  4QWN A;  4TN7 A;  5FUN A;  4GD4 A;  4BXF A;  4D6S A;  4EYU A;  5FYB A;  2YBS A;  5IVF A;  5F3G A;  3N9O A;  3PUQ A;  5FZE A;  3PU8 A;  4LIV A;  5LWB A;  4GAZ A;  4QX8 A;  5A3N A;  4CSW A;  4HON A;  2YPD A;  5E6H A;  4EZ4 A;  5F2W A;  3N9L A;  5FZK A;  5FZH A;  5A7N A;  4URA A;  3KVA A;  3DXU A;  4UF0 A;  5LY1 A;  4DIQ A;  3PU3 A;  5FXX A;  3U4S A;  5FY7 A;  5KR7 A;  4IGO A;  4QXH A;  5FZ8 A;  5A7P A;  4CUG A;  4QXB A;  3PUS A;  2YBK A;  5FP3 A;  5F32 A;  4CCM A;  1VRB A;  5IVC A;  5FBJ A;  5FY5 A;  5FZM A;  2WWJ A;  5A3T A;  5FZA A;  5FP4 A;  4LIU A;  5FYH A;  4CCJ A;  5F3I A;  4XDP A;  3N9N A;  5FP7 A;  3KVB A;  5A1F A;  4LIT A;  3AL5 A;  2XUE A;  4V2W A;  5IVV A;  4D6R A;  4E4H A;  2W2I A;  5FP9 A;  5FUP A;  5A7W A;  4CCK A;  5FPU A;  3K3N A;  5FXV A;  3PTR B;  2OQ7 A;  3N9M A;  2XXZ A;  2YU2 A;  5FYU A;  4CCL A;  4UF0 B;  4CCO A;  5FZI A;  5FYZ A;  5F5I A;  3AL6 A;  3K2O A;  2OQ6 A;  3N9P A;  5FY8 A;  5FYS A;  5FWJ A;  5A7O A;  4GJZ A;  5FZF A;  2OS2 A;  3LD8 A;  3NJY A;  5FZ6 A;  5FZ0 A;  3ZLI A;  5FZD A;  2YU1 A;  4Y33 A;  4ASK A;  4AAP A;  4AI9 A;  3DXT A;  2Q8C A;  5CEH A;  5FPA A;  5A7S A;  5FPL A;  2OT7 A;  5FYC A;  5IW0 A;  5A7W B;  2GP5 A;  4QXC A;  5F5C A;  3UYJ A;  5IWF A;  5A80 A;  5IVB A;  5F5A A;  5ISL A;  3OPT A; 
#chains in the Genus database with same CATH topology
 2PHW A;  3WQ7 A;  3PVO A;  1IQA A;  2VZ3 A;  2LM3 A;  2ES3 A;  2TUN A;  5A7Q A;  1VRH 3;  1W6P A;  1VBD 3;  1O4Y A;  2JB4 A;  2R32 A;  3NNF A;  3QOP A;  4TLF A;  5I0T A;  3SHR A;  2VGD A;  3J4U H;  1H6X A;  1QJY 3;  1ZZB A;  2GNB A;  3ZXK A;  3R6S A;  3SNM A;  1GIC A;  2ZGS A;  5A6Q A;  5LB6 A;  5FJH A;  1YCI A;  2Q8D A;  5FWE A;  5FMO L;  4WVZ A;  3KF3 A;  5IFP A;  1NAE A;  1UY3 A;  3I59 A;  3DV8 A;  3RSJ A;  5CFD B;  4PQQ A;  4H7M A;  2KD7 A;  3J7H A;  4MH0 E;  5HXV A;  1O6U A;  3E97 A;  2VD7 A;  5C5T A;  4YG6 A;  2XBO 3;  1IKP A;  4D6Q A;  1QH7 A;  1VBC 3;  3GDB A;  2W1W A;  4XZU G;  4Q2F A;  4ET7 A;  1DP0 A;  1UAI A;  3NAP C;  3VD4 A;  4RGA A;  1W9W A;  3AVS A;  1PGW 2;  2WO3 A;  1COV 1;  2Y6G A;  3E5Q A;  2BYV E;  4GWJ A;  4H7L A;  4OFG A;  3VZJ A;  3WDU A;  1RMU 3;  4AR2 A;  1RYY A;  1SPP B;  4CCD A;  2CDP A;  2R16 A;  3A21 A;  4Y1Z A;  2ADD A;  2HH9 A;  5C7G A;  2O8Q A;  1RGS A;  1WME A;  4K9S A;  3WHT A;  5JVV A;  1O7F A;  2ILM A;  1GKB A;  3AFK A;  3OYW B;  5LA2 A;  2F4P A;  4LIV A;  1F31 A;  4CP1 A;  2VE1 A;  5IHR A;  1SFP A;  4V1P A;  4IND A;  1LOA A;  3AYC A;  1QHD A;  4BLJ A;  2R1D A;  5F2W A;  4KNC A;  4WV8 A;  4C1W A;  4DXT A;  1UU4 A;  1UYY A;  4LBL A;  4CDW C;  2C26 A;  2J1S A;  2YB7 A;  1J3P A;  2RMU 3;  4ISQ A;  2LW8 A;  2WYS A;  3GXU A;  4Y4Y A;  2JE9 A;  4I0A A;  1YJL A;  3LCP A;  4M3C B;  3VHN A;  1W99 A;  3CF6 E;  3O7O A;  5FP3 A;  3ST7 A;  3MDP A;  3BUC A;  2MHF A;  3RWN A;  5DAW A;  4IUG A;  4PT6 A;  2WWJ A;  3IPV B;  2VJX A;  3FHA A;  3IWZ A;  2HWD 3;  3O14 A;  3OPZ A;  5A6Y A;  5GZC A;  3O1S A;  2Y38 A;  1KS4 A;  2R1B A;  4P02 B;  1HLC A;  2ENR A;  4X8N A;  4AEJ A;  3OD4 A;  5FPU A;  3AKP A;  4BQW A;  4CCK A;  5FR3 A;  1PK6 C;  1ZRF A;  3IMN A;  4KI5 M;  1PM4 A;  5T52 A;  5C6C A;  4MAD A;  4CCL A;  4IEQ A;  5FYU A;  4JDM A;  3T4V A;  1QJZ A;  2GC1 A;  2E31 A;  4IL7 A;  5E89 A;  4JRL A;  4WZF A;  4PQ9 A;  4QGN A;  3WNP A;  1GOG A;  3H42 B;  2X5I A;  1F35 A;  3PVE A;  3LEM A;  1H4G A;  2VMH A;  4JAA A;  4LKF A;  2RM2 2;  3ZLI A;  2VPV A;  3PME A;  5FZD A;  4MGS A;  4COV A;  1CIY A;  1MAC A;  4WM8 C;  5ACA 2;  3IIA A;  5AFE A;  1NKG A;  1ULC A;  2ZAC A;  3EHK A;  4ZS3 A;  1HRV 3;  1UWW A;  2WT0 A;  2XJT A;  2K9Z A;  3B01 A;  3WQ0 A;  1LU1 A;  4AFD A;  5IK7 A;  1S0F A;  5JPN B;  3S5A A;  4MGK E;  1M4W A;  4JGZ C;  1I6X A;  1DG6 A;  3OD0 A;  3RJ2 X;  1RB8 G;  4UFH A;  4NID A;  4N43 C;  5BUV A;  2VO5 A;  5FOB B;  3CO2 A;  2XOM A;  4QB1 A;  5FZB A;  4W4Z A;  1FOD 3;  1W9S A;  1DZQ A;  4NWV A;  3POB A;  2E33 A;  1VBE 3;  3LA3 A;  3AZZ A;  3R0R A;  1U5I A;  4LOT A;  3SH3 A;  3O0W A;  5I8T A;  3PIG A;  1L3J A;  1UY2 A;  2W1S A;  3CDZ B;  4Q4X 2;  1O3R A;  3B3Q E;  1HQN A;  2PAE A;  4QX7 A;  4L92 A;  4X6R B;  4XQD A;  3HWJ A;  1RIR A;  2NLR A;  5F3C A;  1B09 A;  1PVC 2;  1LCL A;  2W5F A;  4CDX B;  2ZEW A;  3OEB A;  3UJO A;  4Y22 A;  3WNN A;  4DRV A;  4FFG A;  5FIX A;  5A32 A;  1KDK A;  2GC3 A;  3AC0 A;  4AVC A;  4RS5 B;  3KWV A;  1J1T A;  1UMH A;  3SKV A;  3ELN A;  5T54 A;  1ZRE A;  4MLO A;  1Q56 A;  3ILN A;  3N7M A;  4N9H A;  4E2S A;  1V6M A;  1U0A A;  4B7K A;  4XJW A;  3WG4 A;  5IFT A;  1UW8 A;  2ZAA A;  2DCJ A;  3AZV A;  5A33 B;  2WBK A;  4K7J A;  4Y26 A;  1URX A;  4FFI A;  5T50 A;  1YFY A;  3PJY A;  4P9I A;  3AKR A;  1G9C A;  1V9U 2;  3H0O A;  4L11 A;  4MXW B;  3SIS A;  3DKW A;  4QGL A;  2Q4S A;  4FOQ A;  3FFQ A;  2ORZ A;  3RMX A;  3MLL A;  3NNG A;  4A2U A;  4Q26 A;  1FV3 A;  4S2H A;  4CE8 A;  4W6X A;  1ENR A;  4RFR B;  4IV1 B;  4AHY A;  2JG8 A;  4EN7 B;  2EIE A;  1HB1 A;  3O1V A;  3DPR A;  3QAC A;  3T09 A;  4A6O A;  4GAL A;  5JUV A;  1UCX A;  5C33 A;  1H8T C;  4IGO A;  3HVD A;  2VCM A;  4H14 A;  3ZFG C;  2RJL A;  1OUS A;  5A7P A;  4B4P A;  5CIS A;  1R09 3;  4YVS C;  3OBR A;  5GZE A;  4TTG A;  1YRZ A;  3NWK A;  4Q27 A;  4ASM B;  3BAL A;  1WW6 A;  5FZM A;  4K6B A;  5E8A A;  3FHQ A;  3HBZ A;  3M3E A;  3T08 A;  1H4H A;  1SG3 A;  4FT8 A;  4XET A;  2JDA A;  1BBT 3;  2DDU A;  3IPV A;  4P00 B;  1OOP B;  5C5U A;  2A71 A;  5J7M A;  1DDL A;  2P3J A;  1RTV A;  4LO8 A;  5FKB A;  2W2I A;  2OYZ A;  5CKQ A;  3U37 A;  3NJV A;  3T2P A;  1Q43 A;  2VQU A;  4GB3 3;  1VRH 2;  5GAL A;  3KLS A;  2YZ4 A;  5KBF A;  1J3Q A;  1LEN A;  1RUJ 3;  2A6Y A;  1S2E A;  2AAC A;  4NAO A;  4KG8 A;  3VD7 A;  1C3H A;  1R64 A;  1X9T A;  4P9G A;  5F5I A;  1HRI 3;  3OF1 A;  1PNG A;  1ZYB A;  2YG0 A;  2YRO A;  3J8F 1;  5JXG A;  1SZB A;  1VPH A;  1AR7 2;  3FWE A;  2K46 A;  4NAM A;  3KQ4 B;  2XVL A;  3HBK A;  1W3X A;  2NZ9 A;  3S7E A;  1EAH 3;  4AEK A;  1UYZ A;  1O5U A;  5A7S A;  2OT7 A;  4CP9 B;  3NW4 A;  1WA6 X;  1MVQ A;  1YYN A;  2VXJ A;  4CEY A;  1QWR A;  3WNK A;  5D8A A;  4Q1R A;  1WWY A;  4FPL A;  5JPM B;  3M8L A;  1QF3 A;  3VBF C;  3UJQ A;  3V56 A;  1U12 A;  4X6Q B;  2XML A;  4LNV A;  4XC9 A;  3RYP A;  4HL0 A;  5FYT A;  4A7Z A;  3Q8C A;  3VBS A;  5DXD A;  3T2T A;  1LKN A;  4Q29 A;  4URT A;  2P4E A;  2YGM A;  4FOW A;  2BWA A;  3N35 A;  1J83 A;  1V0A A;  2A7A A;  1CPM A;  1ASJ 3;  3KCY A;  1W06 A;  4XIK A;  5FZL A;  1SCR A;  4YM1 A;  1POV 1;  2VQA A;  3ZPO A;  2ZGQ A;  5EFU A;  4CZS A;  4DUV A;  5BNP B;  1GWL A;  1F15 A;  2PLV 3;  3LPF A;  1BCX A;  2ZPX A;  4HN1 A;  1GLH A;  1RUE 1;  1REF A;  1RUH 2;  3LOI A;  4KL1 A;  4XFA A;  5HCA A;  4AHZ A;  5CAD A;  2Q0A A;  2GN7 A;  5HV0 A;  3I2F A;  3WF2 A;  3M2M A;  3ZXL A;  4Q4V 3;  1SFN A;  4M0H A;  3RI8 A;  4YLZ A;  4KQ7 A;  2ORX A;  1A8D A;  1YEW A;  1A34 A;  4HMZ A;  2ZXQ A;  4WVV A;  1PGL 1;  4OYU A;  4CTE A;  3JD7 2;  1B35 B;  1OF3 A;  1W6O A;  4S2G A;  3VBR C;  5FZO B;  1PO2 2;  5FPZ A;  4BME A;  3S7I A;  1AR6 3;  1CQ9 A;  2R6Q A;  2V72 A;  3BKZ A;  1EV1 1;  1QOT A;  1PZ8 A;  1FMD 3;  2HWD 2;  4CDQ C;  4EYU A;  3AVR A;  5C3S A;  2VVD A;  4BXF A;  2WDB A;  2PHL A;  1RUD 1;  1GU3 A;  2HWC 1;  3APB A;  3KT7 A;  4QX8 A;  5JWP A;  1NZC A;  2RS5 2;  3IAP A;  4EN0 A;  4QKN A;  2OPW A;  3WXP A;  2RDS A;  3IKW A;  1K42 A;  1CAU A;  4CPB A;  1YQ5 A;  2PQS A;  1JHJ A;  1HN1 A;  5A7N A;  1UYX A;  5JZG B;  5DAP A;  2BV4 A;  3M1H A;  4K20 A;  2Y0O A;  2B8M A;  1YXW A;  5L7O B;  4JHT A;  2FDG A;  1S0I A;  5EHD A;  4BQY A;  1XE7 A;  2PN5 A;  3KGL A;  4HN0 A;  1JHN A;  1Y9Q A;  3LQC A;  2PEL A;  3OG2 A;  1O4Z A;  1ZBA 3;  1RVF 2;  2Y6H A;  3MW2 A;  4Q0U A;  2YMZ A;  1BXH A;  3LFM A;  1HRV 2;  3HT2 A;  3BIW E;  4IET A;  4JQT A;  1UQX A;  4BCU A;  3T0D A;  2JEN A;  2VUC A;  1I5P A;  2XUE A;  3N7J A;  2WJS A;  4E4H A;  3C7F A;  3ABZ A;  2VZU A;  4KH9 A;  5DN2 A;  4E8C A;  3MIF A;  4BLI A;  3AB0 A;  3ZYF A;  3UNP A;  2WS9 2;  5CKM A;  4C1X A;  3D8C A;  1AX0 A;  2CSG A;  2Q30 A;  2V4V A;  3HAG A;  4XAE A;  3FC0 A;  2WSV A;  4B29 A;  1VAK A;  1UKR A;  1IGO A;  1SLT A;  1VBA 1;  1YNA A;  1C8N A;  2RS1 1;  3KMH A;  2WN3 A;  3VDD C;  2WSU A;  5KHK A;  5A7O A;  1DQ5 A;  3C3V A;  1KFU L;  1MQT A;  4FPE A;  1R08 3;  4TXW A;  5FZ0 A;  4DUX A;  5KHI A;  3Q8A A;  1BVV A;  2DTY A;  2R06 2;  3BPS A;  5LBE A;  2C9A A;  1JOB A;  3DXT A;  1YHF A;  1J1L A;  4OUS A;  1EP0 A;  1TQ5 A;  2Z42 A;  1T2X A;  3WW4 A;  1WD4 A;  5FYC A;  2HWF 3;  4NIA A;  2AEZ A;  4Q5O A;  2NP0 A;  5CFC A;  5IW0 A;  5DUV A;  2EXK A;  3QD6 A;  3LEK A;  3DEC A;  3M3I A;  4COY A;  2XPJ A;  1OQ1 A;  2XQX A;  4GH4 B;  5BNN C;  5LAS A;  1T6B X;  3OOX A;  4AED A;  4BIO A;  4YW3 A;  1DQ2 A;  2W9X A;  1HKD A;  3FFZ A;  1QJX 1;  4DXR A;  1ZBE 3;  1RIN A;  1K5J A;  4LBQ B;  1VMH A;  1ZZ6 A;  5A1L A;  4DMI A;  2A73 B;  3RMY A;  2ARE A;  1JYV A;  1NA1 B;  2MNG A;  2D6L X;  1S0E A;  2B4K A;  1VBB 1;  1AR8 2;  3M70 A;  3MV0 1;  1H2N A;  4H2A A;  3BPZ A;  5ANN A;  1QQP 3;  5FP8 A;  4AGR A;  4CUC A;  2QKD A;  3U78 A;  1JYW A;  1DFQ A;  1OUX A;  4UAP A;  2XVG A;  4XBN A;  3SQO A;  1PM7 A;  5KHH A;  3SCH A;  3BI3 A;  5DDJ 3;  2ZGO A;  1CR7 A;  4ZY9 A;  3RYK A;  5FZG A;  4FI9 A;  2UWC A;  3IDA A;  5HPO A;  4GKX A;  4C8D A;  4C0B A;  5IAT A;  4BQ5 A;  4GIQ A;  1QOO A;  3AP5 A;  5FPV A;  4CXW A;  5FPB A;  3JQW A;  4JZR A;  1LES A;  1QDC A;  4IEP A;  4FTE A;  4E8D A;  4NPM A;  3O5S A;  4QPG C;  3UK9 A;  3WZ1 A;  1TMF 2;  3QH7 A;  2JDP A;  3RYR A;  1HN0 A;  1GQH A;  1DQ4 A;  1G86 A;  2LUW A;  2VME A;  3NAP A;  1PIV 3;  4LR4 A;  2EXJ A;  1W8H A;  2IFW A;  2XHN A;  3AMP A;  4Q8L A;  3GBF A;  5CG9 A;  2J1V A;  4IE5 A;  1RUG 1;  3W20 A;  2FBE A;  4ZU4 A;  3M3Q A;  1KRI A;  4UWD A;  5FMO S;  5FY4 A;  3TN9 3;  2PHR A;  3TBD A;  3ZFF C;  1H8V A;  3JBG 3;  4GUL A;  4XDO A;  4YZ3 A;  2XJV A;  3FL7 A;  1OQD A;  3TB0 A;  1BBT 2;  3OGG A;  4E2G A;  5TSW A;  1UMZ A;  4R8H A;  1CAW A;  3MW4 A;  1G9B A;  4PDW B;  4J6G A;  2VZQ A;  1C8M 3;  3NL1 A;  4GWI A;  2D6O X;  5G04 L;  3ZSJ A;  5C3Q A;  3V65 A;  1CZV A;  3I2G A;  3MF6 A;  1HX6 A;  2VOW A;  2JX9 A;  1QGL A;  4CDW A;  1HRI 2;  4HZF A;  3KVA A;  4OUE A;  3U0Z A;  3DXU A;  3POW A;  4DIQ A;  3ILR A;  1IOA A;  1QEX A;  1LOB A;  2IXC A;  3NNJ A;  5KR7 A;  5F5Q A;  4YGB A;  4AAX A;  3IAQ A;  2ZGM A;  4KWJ A;  4COW A;  5IK5 A;  2YBK A;  3LSD A;  4LKS A;  3CBN A;  4NR1 A;  3RI9 A;  4FOY A;  1GZ9 A;  2NMO A;  5IK4 A;  1OSG A;  5FP4 A;  2XL9 A;  1BJQ A;  1ZZC A;  1W9T A;  3KVB A;  4CUB A;  1KIT A;  4D6R A;  3M7A A;  4AQT A;  4EV0 A;  1JW6 A;  2WFF 2;  5LZ6 A;  1MEC 2;  3K3N A;  2XXZ A;  3KD4 A;  2BPA 2;  3FUO A;  3B02 A;  5C9A B;  2FMY A;  3LEI A;  3SEE A;  1PO1 1;  1ASJ 2;  2D7F A;  1ND3 C;  1XND A;  1RHI 2;  2EAA A;  1I9R A;  4FPY A;  4G4F A;  2IUW A;  3UV9 A;  1ONA A;  1W2N A;  4ASL A;  5K0U B;  4NRP A;  4DEV A;  3TEX A;  1XNT A;  3LIH A;  5JR2 A;  4XZP A;  2WNU C;  4NVP A;  4HKW A;  2G4I A;  1ZZ7 A;  1J3R A;  1MS0 A;  1Q8V A;  1PX4 A;  4FTB A;  1UY4 A;  3LIG A;  2G1M A;  4WM8 A;  5FLH A;  3VN4 A;  3WUC A;  5ABJ B;  3AMQ A;  5A7W B;  4QXC A;  3ES4 A;  4F7Z A;  4FTS A;  3C7O A;  4Q4V 2;  3RZH A;  2NN8 A;  1HXS 1;  2G9G A;  2HWB 1;  3POJ A;  3IT8 A;  2JJ6 A;  4JGZ A;  4ZZ5 A;  4PIX A;  3RDI A;  1LB2 A;  1EYB A;  4N43 A;  2VZT A;  2QQK A;  3RGB A;  4NHY A;  2BZD A;  2GC2 A;  1AR9 1;  4V2V A;  2WT2 A;  1AHS A;  1UU6 A;  1WMF A;  4WM7 B;  5CB7 A;  5A3P A;  4UXA A;  4BDV B;  1W6Q A;  1RXG A;  2A5Z A;  2GC0 A;  3BYW A;  4COU A;  2D6N A;  4JDN A;  1FT9 A;  4N7U A;  3I3D A;  1T6G C;  2XJU A;  4FOV A;  5F39 A;  3DKQ A;  4N90 A;  1JS9 A;  1YFU A;  3POE A;  3RZZ A;  1M06 G;  4MGT A;  1DYP A;  1SHW B;  2DU0 A;  2DVD A;  4BQ4 A;  3VUO A;  2Q8O A;  1NCQ B;  4WZC A;  4RR3 C;  3DYP A;  4BH9 A;  3PUA A;  4A7Y A;  1AZD A;  4IES A;  3MF9 A;  4D0Q A;  5HCF A;  2AZ5 A;  3I4I A;  1UX7 A;  4OMC A;  5FQ0 A;  2FMD A;  1RUI 2;  2IVJ A;  5SV8 A;  1AL2 2;  1W6P B;  4AF9 A;  1GWK A;  4QQ2 A;  4WVM A;  3I2I A;  4QDR A;  1F2N A;  3SXW A;  4FBF A;  1F9K A;  2WC2 A;  4HT1 T;  2YUE A;  4OQ9 A;  5FKC A;  1MZE A;  2XWB B;  3AJZ A;  4FQZ A;  2DTW A;  2ZKL A;  1AXK A;  1PZ9 A;  1XNB A;  5EYX A;  2E26 A;  2QUO A;  1JZ4 A;  3CNA A;  3I59 B;  1S2K A;  2RM2 3;  1FPN 1;  2JB8 A;  3FX3 A;  4M4P A;  1OH4 A;  2WLP A;  4XJZ A;  3VDC A;  3WOG A;  5ACA 3;  5HBA A;  3POI A;  3WY6 A;  1AYM 2;  3T3Y A;  4B7E A;  2DVB A;  4CRQ A;  4XAC A;  3ORJ A;  3EMR A;  3IDC B;  2QDN A;  5LRS A;  3HD8 B;  2IXK A;  2BOI A;  2VVF A;  4AI0 A;  4UF0 A;  4LT5 A;  5ERL A;  4P9Y A;  4PF5 A;  4XE9 A;  4HKL A;  3AX4 A;  2XG3 A;  1K12 A;  1QXJ A;  1H8T A;  4JDO A;  4QXB A;  2PHX A;  1W9Y A;  2ZZQ A;  3ZFG A;  3ZR6 A;  4AHX A;  5EP9 A;  1BVP 1;  1ND2 C;  4QHB A;  1H9W A;  2VU9 A;  4ATE A;  3B69 A;  4YVS A;  3MIC A;  1CGP A;  1EUT A;  2VUA A;  4RD7 A;  4Q4X 3;  2BQP A;  3VHP A;  1W03 A;  4FXG B;  1DBN A;  4AE2 A;  3ZO0 B;  3VBH C;  1ZBE 2;  2UUR A;  4IV3 C;  4BMB A;  4CP0 A;  2VNG A;  4DZG A;  1PVC 3;  2D3P A;  3N9M A;  1VBD 1;  1FX5 A;  3G6J B;  3D0S A;  4I3G A;  4ARX A;  2NM1 A;  5KWR A;  3INA A;  4ZPI A;  1QJY 1;  3CJI C;  2DV9 A;  2CWS A;  2WKK A;  3JB8 A;  1IPJ A;  2ZX1 A;  5JCT A;  3H3Z A;  2CYF A;  3MI8 A;  1DLL A;  4XJ8 A;  2VMC A;  3I97 A;  4CUA A;  1SQ4 A;  1NQD A;  4A44 A;  1LGC A;  2JKX A;  3SCG A;  4XFF A;  5GLZ A;  2E7Q A;  3MW3 A;  2QQI A;  2ZGT A;  3OGS A;  4KBZ A;  5D2A A;  4HVO A;  2MEV 2;  4XJA A;  2VG9 A;  1J84 A;  2L9L A;  4B1L A;  5JOZ A;  3ZYI B;  1WBF A;  2XBO 1;  2XR4 A;  1VBC 1;  4QU2 A;  3I3Q A;  5ISL A;  2R0H A;  4XUQ A;  3VBF A;  2E7T A;  3EJK A;  2YDE A;  4UFL A;  4LHK A;  3JQX A;  5GJ6 A;  1PIV 2;  4LBJ A;  2X5I B;  4HVR A;  2JKB A;  4YG0 A;  1DCS A;  3U10 A;  1RMU 1;  2ZZJ A;  4LOR A;  1IS3 A;  3TN9 2;  4A7K A;  3KF5 A;  5FZ9 A;  1KDM A;  3DGT A;  1D4V B;  2CTV A;  2RR1 2;  4P9W A;  5J1X A;  5FYY A;  2JIC A;  2YC2 A;  3ECQ A;  5IK8 A;  4HXC A;  4UW6 A;  3NNL A;  2CGN A;  4FPG A;  5GZF A;  3L2Y A;  2ID4 A;  4Z07 A;  3T30 A;  3WDY A;  4UFI A;  3WP5 A;  4BE3 A;  2FQP A;  5FLI A;  3WIN E;  1OLQ A;  2RMU 1;  4IGP A;  5FMC A;  3M3C A;  4YVW C;  1TEI A;  3BOW A;  4LE4 A;  4XBQ A;  1J58 A;  1CX4 A;  2Q1M A;  1W6N A;  3H1Y A;  4QPI C;  5DZE A;  5FZ4 A;  4ATF A;  3VV1 A;  5E88 A;  1Z78 A;  4IEZ A;  3FN9 A;  4OHW A;  3ZMO A;  2D3S A;  4XCA A;  4EN8 B;  3VBR A;  5FY0 A;  3WEZ A;  4NJ4 A;  1AR7 3;  5A3W A;  4QWN A;  4ZON A;  4XTP A;  4E4D X;  5FYB A;  2DCT A;  4CDQ A;  2EAK A;  2QZ3 A;  1JOD A;  4P14 A;  1F4A A;  4MO3 M;  4Y22 B;  4FAG A;  3VDB A;  5A32 B;  4UFM A;  5I0D A;  4N8M A;  1ULE A;  1BLZ A;  2D6M A;  1SLI A;  3OBZ A;  1KJL A;  4M4R A;  3B94 A;  4NOT A;  5EJ3 A;  4BHP A;  3VZN A;  1LEM A;  3WQ1 A;  2QNK A;  2V73 A;  1YO8 A;  2WAO A;  4PI0 A;  5AFB A;  2YYO A;  5F6L B;  4ZU7 A;  4XUN A;  4D7S A;  3HQX A;  3U4S A;  2UYB A;  4NHK A;  2J42 A;  1ZX5 A;  1RUC 1;  5CG8 A;  3KHB A;  3PUS A;  1CAV A;  2D98 A;  1CZS A;  1JU3 A;  1ZRR A;  5LCW L;  3UKN A;  2HLE A;  3LA2 A;  2WZP P;  1I3H A;  3QH6 A;  4JCK A;  4KGG A;  4QDQ A;  3NV2 A;  4Q0P A;  4AYU A;  1DLC A;  1UO9 A;  1NY7 2;  3SCF A;  1SBD A;  3ZDS A;  4AFA A;  4XVH A;  1LHV A;  2IXJ A;  1UNB A;  1GZT A;  2GDF A;  5FFO C;  1OFS A;  4YSF A;  3AMM A;  2W92 A;  4GXL A;  5FUP A;  4A45 A;  2JG8 B;  1QXR A;  1RUH 3;  2H6C A;  4PJY A;  3DUI A;  1L7R A;  4XIO A;  3DPR B;  1LJ7 A;  4LK7 A;  3WQB A;  1FOD 1;  1LEC A;  4MSV A;  4CCO A;  2IXI A;  2YHJ A;  4LMF A;  3SH5 A;  1VBE 1;  4WBB A;  5FY8 A;  2WNV C;  2ZEX A;  2WQZ C;  3B9I A;  5CU1 A;  3VDD A;  4LHL A;  4FPH A;  2C4X A;  5FTT C;  2VZR A;  5BNO C;  4OHY A;  2BJS A;  1GQP A;  1YFW A;  4XF9 A;  4Y5T A;  4BQ1 A;  4Y33 A;  4QHO A;  4Y5S A;  4AAP A;  3JD7 3;  4MV2 A;  2R07 2;  2IXL A;  2Q8C A;  2VVE A;  4Q4Y 2;  1PO2 3;  2Y60 A;  3BB6 A;  3D6E A;  3GBW A;  3RJR A;  1OPM A;  1O8P A;  1SLB A;  4FPC A;  3AP7 A;  4UW5 A;  4AVT A;  2D6P A;  5F8P A;  1X50 A;  5A3O A;  5BNN A;  4D3W A;  2OA2 A;  5KHJ A;  5DQ0 A;  2VR4 A;  1PGS A;  4RQP C;  4DOU A;  2RS5 3;  3AKQ A;  5IUQ A;  5FJK A;  1BKZ A;  2X8K A;  1VB2 A;  2BVB A;  3A7Q A;  1LED A;  1SBF A;  1GWM A;  5I0U A;  3WG2 A;  2VZ1 A;  5LA1 A;  3A22 A;  4Q0Q A;  4CU6 A;  5DG1 A;  2GNT A;  2P3K A;  2RS3 2;  1YQ2 A;  2O1Q A;  5A6Z A;  3M4F A;  3WW1 A;  2CAU A;  3H9A A;  5SV5 A;  1JTZ X;  1QDO A;  1CX1 A;  3OGJ A;  4CEY B;  4D69 A;  5D8A B;  5FYV A;  3FJS A;  2WL1 A;  2A3W A;  3VGI A;  3IMM A;  5JLV A;  1RVF 3;  4E4Z A;  3PUH A;  3HJR A;  1R1A 1;  5DMY A;  1C4R A;  1W2O A;  4MGQ A;  4EWD A;  5IVE A;  5A1A A;  4MX3 A;  2X10 A;  5LAT A;  1YIP A;  4D7T A;  2SBA A;  4YW1 A;  2XB6 C;  4U36 A;  1BEV 2;  5J96 B;  1ZRI A;  2JDZ A;  3VBS B;  5FV3 A;  4CYD A;  4MGI E;  4QPG A;  2XWJ B;  1CIW A;  2WS9 3;  2HEV F;  4JKK A;  5G05 L;  3PIJ A;  3O0V A;  1JI6 A;  3LF7 A;  1R09 1;  4MHR A;  3MIB A;  5H9R A;  1CJP A;  3U1X A;  3K3O A;  1ZA7 A;  3HNY M;  3JCI A;  2Y6J A;  2VXR A;  5LK5 A;  4K21 A;  2F6B A;  1X8E A;  3VD3 A;  2J1A A;  4UFK A;  1PX3 A;  3ZFF A;  5H9P A;  1ZNP A;  3T1M A;  2R06 3;  4CVU A;  1WA4 A;  3D5O A;  1OF4 A;  2EVX A;  4GAZ A;  1Q8S A;  4GB3 1;  4CSW A;  1H2K A;  3UT0 A;  1QNW A;  2CGP A;  2B46 X;  1RUJ 1;  1UOF A;  3SEP A;  4NMI A;  2WN2 A;  4CDU C;  1KJR A;  5AVA A;  3WP6 A;  1WW4 A;  5LY1 A;  4I09 A;  1IS6 A;  1DZR A;  4AVS A;  2FZ2 A;  1W6O B;  4UOJ A;  1N47 A;  4OMD A;  4GQ7 A;  5FZ8 A;  3LSE A;  1EAH 1;  3ACG A;  5JIU A;  3UKT A;  4O65 A;  2ZTN A;  1AR8 3;  1K45 A;  4Q4W 2;  2JG9 C;  1OHF A;  5CVR A;  3RG0 A;  5BY5 A;  3C8X A;  3VBU C;  5FY5 A;  3TNQ A;  1GNY A;  2HBT A;  2GND A;  3O1R A;  3U14 A;  2Z69 A;  4IEU A;  1UYP A;  3RZL A;  2HKX A;  2ZOE B;  3QBQ A;  3MO4 A;  3WVJ A;  5KC5 A;  1HDK A;  1CAU B;  4RFT 0;  2C9K A;  3USU A;  2DCK A;  2W91 A;  2WNO A;  1WCS A;  3NJZ A;  4BOW A;  1XYP A;  1O4T A;  4CEW C;  4OCT A;  3RRD A;  1TMF 3;  4W6W A;  2BWC A;  3K2O A;  4HET A;  3Q8E A;  4OHZ A;  1ND3 A;  2XLA A;  5HI0 A;  3I3E A;  2CNA A;  1K5M C;  2RDQ A;  2PLV 1;  3LAG A;  2VOX A;  3AJY A;  3BN6 A;  4YW4 A;  3H3L A;  4UT5 A;  2VZP A;  2R04 3;  2WNU A;  4N53 C;  4L97 A;  3AMN A;  2C6S A;  3I3B A;  4OI1 A;  2ZAH A;  1WLD A;  3NKT A;  3PNA A;  5GLU A;  1UY0 A;  5FK8 A;  2CGO A;  4R9C A;  5A3M A;  1UMI A;  4FXK B;  3HEI A;  4HOO A;  2NMN A;  1JMU B;  2D5F A;  3SC7 X;  4JKL A;  1TVG A;  1MS5 A;  1RIT A;  1W04 A;  5EXO A;  4DIN B;  1REE A;  2DUQ A;  2OII A;  2W1U A;  2A6V A;  4P5H A;  1MQT B;  2DVG A;  3OPW A;  1AR6 1;  2B45 X;  1SLL A;  3H1M A;  4CCC A;  4LLF A;  4NRM A;  4IEY A;  4FO9 A;  1FMD 1;  3TOJ A;  3ZIW A;  3BVC A;  4AHW A;  4BIF A;  3H8X A;  5F9T A;  3VHR A;  1HQW A;  1TE1 B;  2D44 A;  4H3W A;  4M3C F;  4QU1 A;  1EY2 A;  4ZXE A;  2D5H A;  2Y6K A;  1U5X A;  2IWG B;  1OQE A;  2WLQ A;  3KM5 A;  3OTF A;  4QB2 A;  3NVC A;  3D4K A;  1XXN A;  1POQ A;  2FCT A;  2YBP A;  1D4M 2;  1W05 A;  4RR3 A;  3MV1 1;  4AED B;  3E5X A;  3T4H B;  4LKE A;  3LDB A;  5A70 A;  2VZO A;  5C4W C;  3S30 A;  2WFF 3;  2Q5T A;  2WFP A;  3J26 N;  1KS5 A;  2WO7 A;  1CVN A;  1GP6 A;  1MEC 3;  4K1Y A;  5CFC B;  4MVT A;  2FCU A;  3EO6 A;  2ARC A;  1TNF A;  4JGY C;  4R9B A;  3ITQ A;  5T5P A;  3D0J A;  3GBG A;  1ZBA 1;  3OY8 A;  1V6J A;  5JSO A;  2PXJ A;  5JAX A;  1ZM1 A;  3I49 A;  3N9Q A;  3ZR5 A;  1RHI 3;  2UU8 A;  4CP2 A;  4FPJ A;  3WNO A;  4EJR A;  2K2S A;  4DO0 A;  4AEM A;  3ME2 A;  2BDR A;  4PI2 A;  1OLM A;  3O1P A;  1JYX A;  1DYK A;  1OLR A;  2FDK A;  3W59 A;  3WDT A;  2VTX J;  3NNM A;  2JIJ A;  4RHV 1;  2B42 B;  4XQW A;  4CXY A;  3KQR A;  3N7L A;  5CIR A;  2UWA A;  4ERO A;  2YPD A;  1NCR C;  2WZR 2;  1QJU 2;  2JDY A;  3AKS A;  4XF4 A;  5J48 A;  5JMC A;  3C7E A;  2DCZ A;  3NAP B;  1G9A A;  1GNZ A;  1BK0 A;  1R08 1;  4JRA A;  3ZFE C;  1FAY A;  1MR5 A;  1OA2 A;  1C1L A;  1STM A;  5FY7 A;  5BXX A;  2VTF A;  3VL9 A;  2OVU A;  3EB7 A;  3BU7 A;  4Z82 A;  5FPX A;  3WLU A;  2HWF 1;  1L7Q A;  3WDW A;  2HWE 2;  1ND2 A;  3MUY 1;  1CAW B;  5FBJ A;  3D82 A;  3DEM A;  4B1M A;  2ADE A;  1Z7S 2;  5AC9 2;  1BMV 1;  4O9E A;  5L9V A;  1PMI A;  4HSJ A;  4D8M A;  2AYH A;  1OFN A;  2AH2 A;  2VOK A;  3T2O A;  5K7P A;  4BK4 A;  1NZI A;  4D7Y A;  1US3 A;  3N36 A;  4CDW B;  1BQP A;  1QU0 A;  3VBH A;  4IV3 A;  5C3R A;  5IT6 A;  4N7I A;  1QY4 A;  2BTV C;  1RUI 3;  2C1F A;  1QQP 1;  3TEW A;  4LK6 A;  2H6B A;  3MIG A;  3MYX A;  1AL2 3;  2YXS A;  2Y0I A;  3CJI A;  3NV4 A;  4AFC A;  4QX2 A;  1TZO A;  2GMM A;  4IER A;  5DDJ 1;  1XPW A;  2IFR A;  2NQY A;  3I3M A;  1BK1 A;  1H0B A;  2ETE A;  2WO1 A;  2YU1 A;  3AYD A;  3GZA A;  4I3P A;  3VBO C;  3WD5 A;  1YLL A;  5BYN A;  1BYH A;  1ENX A;  3ZSM A;  4NHM A;  4FCA A;  5HV4 A;  2ZCW A;  3HQR A;  5DUU A;  5L19 A;  1W2T A;  3ZKU A;  3HIF A;  4E2Q A;  2QQU A;  4P08 A;  1TME 1;  2GP5 A;  3TNP B;  5IWF A;  4Q8K A;  1RUF 1;  2DUR A;  3H1W A;  3K51 A;  1PK6 B;  2GZW A;  1GV9 A;  2JWP A;  4KWK A;  3AK0 A;  4XHX A;  2I45 A;  4LO4 B;  1TNR A;  4FPO B;  5FYM A;  1AYM 3;  1PIV 1;  4YPJ A;  1G8W A;  3HOB A;  4HK8 A;  3Q8B A;  5KHG A;  1COV 2;  1K3I A;  3LZZ A;  4Y3O A;  3OGV A;  5I8Y A;  3JBG 1;  2TNF A;  2VMI A;  3ALQ A;  4FQ4 A;  1VP6 A;  4QM8 A;  4AI3 A;  2QCS B;  3ACL A;  1KD7 A;  2GSY A;  1POV 3;  4WM8 B;  5JIA A;  3T0B A;  1C8M 1;  4IE0 A;  4C91 A;  4S2F A;  2RDN A;  3DYO A;  5FY9 A;  4Z92 B;  3AKT A;  3KSC A;  2VC9 A;  3WW2 A;  2QQN A;  2JDN A;  3NQH A;  2J22 A;  4A42 A;  3MIH A;  5HXM A;  1VAL A;  4JGZ B;  3ZIX A;  2P37 A;  1QNY A;  5I91 A;  2K0G A;  4EN9 B;  4N43 B;  4O61 A;  4DQA A;  1MS1 A;  5C3O A;  4YVW A;  2RG4 A;  3MPB A;  1X36 A;  3L9J T;  4LTA A;  5FRA A;  2W0X A;  1YWK A;  1LGB A;  2R0F A;  1W6Q B;  2DF7 A;  2FDJ A;  4KU8 A;  4C0H A;  4E4S A;  1IHM A;  4QPI A;  4CXX A;  3B5L B;  1XU2 A;  4KMQ A;  2OX0 A;  2DYC A;  5KXC A;  2VM9 A;  1XBF A;  3AZX A;  1GR3 A;  4GMP 0;  4XMA A;  2J1R A;  3BTX A;  1VMF A;  5APA A;  5HCH A;  3E6C C;  4LBK A;  1UD1 A;  3ILF A;  4XPV A;  4MHU A;  1LOF C;  3N9O A;  4DB5 A;  3VKL A;  3PU8 A;  1O59 A;  1RJ7 A;  5FQ0 B;  3RQ0 A;  2EAL A;  3I2K A;  2MEV 3;  5LK7 B;  4QDS A;  3D3A A;  5E6H A;  3VL8 A;  1GSL A;  3A0K A;  4WVM B;  4BXS V;  4XHB A;  4FP2 A;  2QQW A;  4DRR A;  3AZW A;  3AXD A;  4JV4 A;  5C8C C;  3POG A;  4CPB D;  2BFU L;  3UES A;  1RJ8 A;  4KBB A;  2EF6 A;  1YC6 1;  1XRU A;  4FVV A;  3ZXF A;  1LOG A;  1PGW 1;  3VKF C;  5B2G B;  4B3N A;  2PTM A;  5F32 A;  1YI7 A;  2R04 2;  1CAX A;  1W6M A;  4IE7 A;  2W52 A;  2VL4 A;  3CL1 A;  3IM0 A;  4Y20 A;  1C28 A;  1VAM A;  3VB9 A;  1AVB A;  3AM2 A;  2C24 A;  2XQR A;  2RR1 3;  5FZA A;  2IC1 A;  5F3I A;  4CCJ A;  4HVQ A;  1O3Q A;  1A6C A;  1CON A;  1NX9 A;  2XH6 A;  3AL5 A;  5IVV A;  4MG2 A;  1JZ2 A;  4KGQ A;  2Q1F A;  4P5Y A;  5FXV A;  3PTR B;  4J1X A;  1D0H A;  2J1U A;  1WW5 A;  2DUO A;  2E32 A;  2YFU A;  2ZGN A;  4UF0 B;  1FXZ A;  3WF1 A;  4FP3 A;  1WUV A;  3AMH A;  3I2J A;  3ZSE A;  3U4X A;  1LAJ A;  1XB9 A;  1H8T B;  3ZFG B;  3OEA A;  2WNV A;  4YVS B;  3N4M A;  3WSO A;  4L0P A;  2FD8 A;  5BNO A;  3WNM A;  5D21 A;  4F8A A;  1JZ7 A;  2BOJ A;  4K3U A;  5J37 A;  3H7Y A;  5F6K A;  3TRS B;  4LPL A;  2A70 A;  4ZHN A;  4K1Z A;  1A8M A;  1Y9M A;  3OGR A;  1ULO A;  4Y1Y A;  1SMV A;  2VY0 A;  5CFD C;  5A80 A;  1CJD A;  1P8J A;  2I2S A;  3IDE A;  4F3J A;  1W8N A;  4YFW A;  1PK6 A;  1H2M A;  1XOY A;  5FXZ A;  3CJX A;  1G9F A;  3T2Q A;  3OB8 A;  5KXE A;  1ODM A;  2R49 A;  4ES8 A;  4QPW A;  2DWR A;  2WWS A;  2UY8 A;  2WNE A;  5EPA A;  4DY3 A;  1UPS A;  3USS A;  2VMG A;  5GKA C;  1SBE A;  2RM2 1;  4UFJ A;  3LOB A;  3KV6 A;  1DHK B;  4M00 A;  2I07 B;  1OUR A;  5JOW A;  2PFW A;  1OC1 A;  5ACA 1;  5E16 A;  3IZO A;  4OHX A;  1JYC A;  2VMD A;  1G9D A;  4JQR A;  3GJA A;  5H9Q A;  5LY2 A;  1CES A;  3VBF B;  1VE0 A;  4YFZ A;  1G6N A;  1S0D A;  4RYD A;  1DQ1 A;  1XNC A;  3ON7 A;  4A3X A;  3AYE A;  3DCQ A;  4ZXK A;  4WVW A;  1LGN A;  5JSR A;  2CHH A;  2YC4 A;  1XE0 A;  2PHU A;  2Q1Z B;  1YFX A;  5JOY A;  1GUI A;  3MFA A;  2QFE A;  4YW6 A;  3G7D A;  3THC A;  2EID A;  4H55 A;  3TWI A;  3FLP A;  2JE7 A;  1ENS A;  2ERF A;  1UKG A;  1CD3 G;  1BHG A;  2RVA A;  4NPR A;  2BW8 A;  4AI1 A;  1RUG 3;  2E51 A;  4F83 A;  4BWO A;  3V0A A;  3FUQ A;  3LDK A;  4Q4X 1;  5FK7 A;  2GMP A;  4TN7 A;  5EJ1 B;  1UZW A;  2QQJ A;  2R07 3;  2F17 A;  1ZA4 A;  1W8W A;  4Q4Y 3;  2AEY A;  1UZZ A;  1PVC 1;  4AQ6 A;  3WDX A;  2W94 A;  3V0B A;  4LHN A;  4YNI A;  1OA3 A;  2WII B;  3WDV A;  1Y43 B;  1OD3 A;  1W6N B;  3N9L A;  3PLQ A;  2PQQ A;  3IDB B;  5DAX A;  5FZK A;  4HKO A;  2JDK A;  3PVB B;  4LBN A;  5CNA A;  3B9C A;  4LO6 B;  4UW4 A;  4CDU A;  1SFY A;  1D7P M;  1OBN A;  1RC6 A;  2LS6 A;  3J8F 2;  1UN1 A;  3VBR B;  2WQ8 A;  1QOS A;  3KZ4 C;  5T5J A;  3ETP A;  4RN5 A;  3WF3 A;  4CCM A;  4QAW A;  4EQV A;  3OUJ A;  2DVA A;  1AXY A;  2RS3 3;  4CDQ B;  1ALY A;  1QJE A;  2JG9 A;  1UOJ A;  2QVS B;  4OUL A;  2R30 A;  3T1L A;  3VBU A;  4P9X A;  1V9U 1;  2PAM A;  4QM9 A;  4CU9 A;  2EIC A;  2VBD A;  3EYP A;  4YGC A;  1WZX A;  2VCB A;  5FP9 A;  3WF4 A;  2XVK A;  4Q0V A;  1GZW A;  3U07 A;  4XJU A;  2BBV A;  2WT1 A;  2ZGL A;  3KGZ A;  2XJQ A;  2BVV A;  4KWU A;  3KT1 A;  1OI6 A;  2Y33 A;  3ZXE A;  4EWA A;  4GMP 3;  4I0W B;  1BEV 3;  2ZX2 A;  5B4N A;  2VEC A;  2JXA A;  3AYA A;  4CEW A;  2VAU A;  4Y5Z 0;  5FYS A;  5FWJ A;  1H2L A;  1CAV B;  3RNS A;  1DIW A;  1XC6 A;  5C70 A;  2OS2 A;  3Q9O A;  2GME A;  4XOG A;  5FZ6 A;  5LA0 A;  1CWP A;  1K5M A;  3WX5 A;  3DL3 A;  5J09 A;  1MPX A;  1NE4 A;  2XJR A;  5CEH A;  1GOF A;  4JVA A;  1PVX A;  1SLA A;  1FAT A;  1RUE 2;  3H8R A;  4RL7 A;  4W65 A;  1KGY A;  4N53 A;  4PLO A;  1NXM A;  1PZ7 A;  4DXZ A;  5JXJ A;  2XGX A;  3OCP A;  4CDX C;  5D1I A;  4YM0 A;  1US2 A;  5JOX A;  3VZO A;  1WMX A;  4FSJ A;  2HWB 3;  2ZKN A;  3I2D A;  4RS5 C;  2FDI A;  1VRH 1;  5BPX A;  1R1Z A;  5FZC A;  3KCX A;  3TYJ A;  2KA3 A;  3ACI A;  4AWD A;  3VD9 A;  2V4A A;  3VDD B;  3N3H A;  2DVF A;  1IG0 A;  2VUD A;  1PGL 2;  4RGG A;  2W46 A;  3S6P A;  4BA6 A;  2ZA9 A;  4LBQ D;  1NLS A;  2P34 A;  1ZZ9 A;  1MS4 A;  1HB4 A;  1AR7 1;  3A0N A;  1KFX L;  4JX0 A;  1EV1 2;  1V6O A;  4XAB A;  3KV4 A;  2GP3 A;  3KV9 A;  3K4Z A;  3MUZ 1;  4IEX A;  1OLM E;  4Q4W 3;  1JZ8 A;  1RUD 2;  5GZD A;  2HWC 2;  3ZN6 A;  2X53 S;  2Z79 A;  3H3U A;  1IS5 A;  4AGG A;  2BU9 A;  3B93 A;  4LA2 A;  5BNN B;  4FFH A;  5CFC C;  1KXG A;  4XXP A;  5C71 A;  1CPN A;  2BNM A;  4B4R A;  4YW7 A;  1X9P A;  4IV1 C;  5ANQ A;  2J1E A;  2P6H A;  3GZU C;  3GHN A;  4HG6 B;  5C4W A;  3ZXA C;  3EQE A;  4AW7 A;  1JH5 A;  3HNB M;  3O1T A;  4QT6 A;  2BEO A;  3BIE A;  1MVE A;  2P17 A;  1YUD A;  3GM8 A;  4IGQ A;  5DPN A;  2VOT A;  5IAX A;  1JU4 A;  4JGY A;  2RV9 A;  5LA9 A;  3X29 B;  1U5Y A;  3ACF A;  2O0O A;  1OMI A;  5CAZ A;  2XUM A;  4NE9 A;  3URF A;  2A3Y A;  2ATF A;  1X82 A;  5BNQ A;  5CYY A;  4C90 A;  5LBC A;  3WF0 A;  1RUH 1;  2WR9 A;  2TBV A;  3J9S A;  3PVN A;  3ZYB A;  2W47 A;  1OOP C;  3GNE A;  2F4L A;  2J1T A;  2TEP A;  4EZ4 A;  4QPG B;  1J59 A;  4DFS A;  1OA4 A;  1C57 A;  1NCR A;  4OVE A;  3K48 A;  1O91 A;  1OVP A;  2ZMK A;  2C0Z A;  4IE6 A;  4QD2 A;  3VKO A;  3CU7 A;  4OZX A;  1VBA 2;  4MUV A;  2RS1 2;  1ODN A;  1NT0 A;  2LRP A;  4AZZ A;  2AC1 A;  1O3S A;  3WHU A;  1EUU A;  4QXH A;  3ZFE A;  4KG0 A;  3BCW A;  3JD7 1;  4XXA A;  5FBZ A;  1O5L A;  4DNY A;  3ZYR A;  3ACH A;  1GNH A;  1PO2 1;  1V70 A;  3HPN A;  5FAX A;  5IAV A;  3ZFF B;  1VRB A;  1OPO A;  3OUI A;  1I5Z A;  1N1T A;  3LE0 A;  2YC0 A;  2HWD 1;  3OBA A;  5A3T A;  2Z5W A;  4RGK A;  2BNN A;  1ULP A;  2CY6 A;  1LOD A;  4XF3 A;  2Y34 A;  4FPK A;  2D97 A;  1UIJ A;  3JB4 C;  1AYN 3;  4K8R B;  1JZ3 A;  2ZMN A;  3MID A;  2BNO A;  3NO8 A;  4DPN A;  4TSV A;  1MZ5 A;  2GH2 A;  2RS5 1;  2CU5 A;  2ZGK A;  3RZJ A;  3LGR A;  4AVB A;  4OI0 A;  1LUL A;  2OQ7 A;  2ZAB A;  5IJR A;  1QJX 2;  4L9B A;  1D4M 3;  4GZ9 A;  1D2Q A;  1OT5 A;  2P6C A;  4QQP A;  2DBN A;  3RZG A;  1W8U A;  5L9B A;  2W68 A;  1GP4 A;  1ST8 A;  2FZ1 A;  5CZK A;  4Y1V A;  1VBB 2;  3R4U A;  4YZ2 A;  4XDQ A;  1VAV A;  3NJY A;  3ZXJ A;  2WA3 A;  4BB3 A;  4K40 A;  2UWB A;  3SLI A;  3ENR A;  4XFI A;  2WZE A;  1RVF 1;  4Z2A A;  2BGO A;  4AI9 A;  3WNL A;  1WLC A;  5BNP C;  2Z2S B;  1HRV 1;  3VBO A;  5CA6 A;  2VUL A;  1GQG A;  1UX6 A;  4YW5 A;  5F1R A;  2QQL A;  3NST A;  1EPW A;  3UYJ A;  2VQ0 A;  3QLQ A;  2HJI A;  2UYA A;  5JI7 A;  3USU B;  2VW0 A;  3POY A;  5T55 A;  4AOC A;  3BTZ A;  2WS9 1;  2RHP A;  2ET7 A;  3QCW A;  1WCU A;  2VMF A;  2OUJ A;  3H7J A;  4HPK A;  2Y6F A;  2W1Q A;  3PUR A;  5FZ7 A;  2WZR 3;  1ND3 B;  1QJU 3;  3HR9 A;  3WP3 A;  2W3J A;  1KQR A;  2G9F A;  1RUG 2;  1XSR A;  4LHS A;  1AX2 A;  2RJ2 A;  1B35 C;  1V6N A;  2JEM A;  3WCR A;  4OI2 A;  2W95 A;  4NIG A;  5FUI A;  2R06 1;  2WNU B;  3DN7 A;  2QJV A;  4AI8 A;  1FYU A;  1NLR A;  3BTA A;  1ZRD A;  2WYF A;  4ITC A;  4YW2 A;  1S1A A;  3NRU A;  5L73 A;  1X7N A;  2HWE 3;  1LHU A;  1IPS A;  1NG0 A;  1Z7S 3;  2B7Y A;  1SCS A;  4NHX A;  1HB2 A;  1WCK A;  2A6W A;  3ZSL A;  5AC9 3;  3IN9 A;  4AI2 A;  4EZH A;  3W9A A;  1Q8O A;  2P1B A;  3KB5 A;  5FZ1 A;  5JZG C;  5LEJ A;  5L7O C;  1FV2 A;  2IXH A;  1AR8 1;  1H1A A;  2VNV A;  4PHZ A;  4DXS A;  4UBH A;  3BGA A;  1OKQ A;  3UKV A;  1QIQ A;  1W2A X;  3III A;  1N3P A;  5JMO A;  1S4C A;  4XTM A;  3NMB A;  3LPG A;  1QMJ A;  1E5H A;  4GD4 A;  4OLL A;  4RR3 B;  1E57 A;  2BUK A;  4XFG A;  3VKM A;  2ZBJ A;  3PUI A;  2WRA A;  1LOF A;  3GZT B;  2P2K A;  4YWA A;  1IPK A;  2SLI A;  3GGL A;  3WNX A;  4HON A;  4AVV A;  1DQ0 A;  2A6X A;  3WR0 A;  3MIE A;  1WLT A;  4AQ2 A;  2ZHM A;  4IEO A;  5FO9 B;  1ENQ A;  3NJX A;  1TMF 1;  4FPF A;  5FZH A;  1HV0 A;  1PO1 2;  1QH6 A;  4ZZ8 A;  5C8C A;  2GH8 A;  2RDR A;  1OXC A;  2W87 A;  1GYK A;  3C2U A;  1W0O A;  3OJB A;  3OY8 B;  3R4D B;  1GAN A;  1MS9 A;  3THD A;  3UGG A;  1ZRC A;  2B9V A;  3A23 A;  4AFB A;  1HIX A;  2R04 1;  4QX0 A;  1RUC 3;  4I0B A;  4TLG A;  1W3V A;  1COV 3;  3MLJ A;  5GLT A;  1DGW X;  5L36 A;  4D94 A;  1BBT 1;  1JZ5 A;  3N9N A;  4QX3 A;  1WBL A;  1UY1 A;  4LUK A;  2ZX0 A;  3BU0 A;  1MZ6 A;  3S5Q A;  1Q8P A;  1HXS 2;  2HWB 2;  4GH4 C;  1IG3 A;  1MS8 A;  3RWK X;  4QB6 A;  5J3U A;  2PHT A;  2ZEY A;  3POF A;  5HCB A;  2BFU S;  2LTN A;  1GMM A;  4QHZ A;  1XNK A;  5T3N A;  1D2S A;  1HRI 1;  2X05 A;  1AR9 2;  1YQC A;  3L2H A;  1TG7 A;  1NA1 C;  1IS4 A;  1ULG A;  2JDM A;  3O12 A;  3R4S A;  3FMG A;  1ND2 B;  4AXO A;  1VIW B;  2V09 A;  3HQU A;  5FPA A;  5LRR A;  3LA7 A;  3MBW A;  5EWS A;  1UPI A;  1JXN A;  4LKD A;  1WCD J;  4YYO A;  2PYT A;  3WP4 A;  4HAN A;  2WAA A;  3ZM8 A;  3VBH B;  2WFF 1;  1POV 0;  4IV3 B;  3K77 A;  2E7A A;  1ULD A;  2ZGP A;  2EIG A;  1VJ2 A;  1MEC 1;  1F4H A;  3PMS A;  5CFD A;  3ZYJ B;  1L7L A;  1S0G A;  3GZE A;  4PLN A;  4G3Y C;  5KXB A;  4NRQ A;  5FOJ B;  3ZYH A;  2E9Q A;  3CJI B;  2XDV A;  2B39 A;  2VZS A;  1HQL A;  4FAH A;  1ASJ 1;  5FXW A;  3HMY A;  4QPY A;  3K4D A;  1RHI 1;  5K4L A;  1W8F A;  2WAB A;  4Y4R A;  2A3X A;  1NXD 1;  1V6I A;  4SBV A;  2I74 A;  4Z2W A;  2AGS A;  3O1O A;  1ZVF A;  3J7L A;  2HYK A;  2DCY A;  2D40 A;  3IBM A;  1RED A;  4R4Z A;  1RUO A;  1FPN 2;  1SPP A;  4AG4 A;  3JU9 A;  3WG3 A;  1CN1 A;  2H0B A;  3PHM A;  3GYD A;  4PDW C;  4MZU A;  1S55 A;  2C5D A;  3PDQ A;  4A4A A;  4COZ A;  3OYW A;  4R52 A;  4EWE A;  1R1A 3;  4Q4V 1;  5LBB A;  4UW3 A;  3VD5 A;  4BIS A;  4W50 A;  3MLK A;  2DBI A;  5FZ3 A;  1W0P A;  1WMD A;  2HEW F;  2YGL A;  3ZMN A;  4BU2 A;  2DFB A;  4XF0 A;  1WGP A;  5JDB A;  5M0T A;  5L9R A;  3GAL A;  3K46 A;  1W9F A;  4HBN A;  1LU2 A;  2DUP A;  4M3C A;  4OZO A;  1V00 A;  5F2S A;  3LDR A;  5GLV A;  2RJK A;  4NN0 A;  1JUH A;  2QQM A;  1PHM A;  3ZSK A;  1AYN 2;  1NOV A;  1D0G A;  2GAU A;  3PTY A;  4Z8B A;  2E63 A;  2LAL A;  2XLF A;  5JSP A;  1OD5 A;  4R9A A;  5A3N A;  2JDH A;  4GA9 A;  3P1I A;  1FNY A;  2JIG A;  3THT A;  1RUI 1;  1VBD 2;  3DF0 A;  4PIZ A;  4YVW B;  1AL2 1;  4QKF A;  4I30 A;  1AJO A;  5C9A C;  1QJY 2;  4PLM A;  4QPI B;  2OKX A;  4URA A;  1AF9 A;  3CIH A;  2QQV A;  4UYB A;  4YZ1 A;  5FDB A;  2YPJ A;  1AX1 A;  2EXH A;  2BGC A;  1W8O A;  3FBY A;  3R05 A;  2G9Z A;  4LBM A;  4YM2 A;  5C3P A;  5K0U C;  4CUG A;  2WO2 A;  4XIL A;  3OSD A;  2CL2 A;  4W6Y A;  2Y64 A;  4NHL A;  4BQ3 A;  2D93 A;  2A1X A;  4O9G A;  3ZN5 A;  4AGV A;  1EPZ A;  3S57 A;  5FMB A;  3UGH A;  1A78 A;  5GLW A;  4N9I A;  5FLJ A;  1X8M A;  4LIT A;  4V2W A;  1RL3 A;  3NV1 A;  4QMA A;  1F5F A;  3WG1 A;  5ABJ C;  5GZG A;  3ZVX A;  3H8O A;  1UXZ A;  1XYN A;  4BZ4 A;  1JZ6 A;  1PNF A;  2XBO 2;  2ARA A;  2X29 A;  4ZU5 A;  1VBC 2;  3ES1 A;  1AYM 1;  1LNS A;  1LR5 A;  5GM0 A;  3IB3 A;  4P9L A;  1WW7 A;  2QDR A;  4A3Z A;  4DUW A;  2PHD A;  2ZHL A;  5FYZ A;  1DU3 D;  1GP5 A;  2KM2 A;  1MS3 A;  2VZV A;  4LOS A;  2JDU A;  1RMU 2;  2O8O A;  4WM7 C;  4XF1 A;  5KXD A;  1E5S A;  1JYI A;  2ZML A;  2J7M A;  1CAX B;  1S0J A;  1W6M B;  2OXB A;  3I8T A;  4XUR A;  4Y20 B;  2QBX A;  5FO7 B;  4QQO A;  1QKQ A;  1Q5O A;  4ZKT B;  3OUH A;  3GJB A;  1GOH A;  4XUP A;  2FCV A;  3PL0 A;  4HK9 A;  3TAY A;  1NCQ C;  3AP9 A;  4X8P A;  5FMD A;  2QTW B;  2P3I A;  3TEY A;  4BK5 A;  2XKP A;  2RMU 2;  1ZBE 1;  3WUD A;  2WA4 A;  4I02 A;  4CDX A;  3CHX A;  3DYM A;  3UET A;  5LW9 A;  4JC1 A;  4M0N A;  2HBU A;  4RS5 A;  1KEX A;  4KWL A;  5I8S A;  3RPQ A;  2XLG A;  2WNV B;  1H30 A;  4NUB A;  3LFI A;  3FHI B;  1XSQ A;  4J25 A;  4YGE A;  5F3E A;  4DEQ A;  5BNO B;  2ET1 A;  4XBL A;  1W8T A;  3CZJ A;  4IXL A;  2CWM A;  3J8F 3;  4FFF A;  2BRT A;  5A33 A;  1N3O A;  3LEG A;  4B8E A;  2ZHN A;  2BER A;  3J7M A;  3ZXD A;  3ZYG A;  1LOE A;  4QX5 A;  2VCC A;  1C1F A;  2MEV 1;  4ZS2 A;  1UXX X;  1RUN A;  3P3N A;  4MXW A;  4QXK A;  2KXL A;  1HW5 A;  3VZL A;  1DGL A;  2YFZ A;  3B00 A;  4IEW A;  1JBC A;  2QQP A;  1WLW A;  2BBA A;  2XON A;  3BTY A;  4LXL A;  4I2O A;  4RQP B;  4E9K A;  3KS7 A;  2VBB A;  5KC6 A;  2VUJ A;  3E5U A;  3E6B A;  3FLR A;  2VBP A;  4XEZ A;  4IV1 A;  4IW3 A;  4Z1V A;  2GNM A;  3FBM A;  4TZD A;  4XW3 A;  2E6V A;  1RUC 2;  1F5J A;  1OH3 A;  3TN9 1;  3I2O A;  2ZEZ A;  4YRD A;  2DFC A;  2RR1 1;  5A3U A;  1CZT A;  4BYY A;  3MGU A;  3GCX A;  2N7G A;  2B9U A;  4S2D A;  2HYX A;  2MPF A;  4KU7 A;  2BGP A;  2G19 A;  2LRO A;  4Q1P A;  1FI2 A;  2VNR A;  5LWB A;  4RHV 3;  1RUE 3;  1OOP A;  4O7X A;  4W8J A;  1H1M A;  3VLB B;  4AK3 A;  1YQ6 A;  3CMG A;  2BP6 A;  3S0M A;  5LEK A;  1FOD 2;  3ZDV A;  2AUY A;  1Q8Q A;  1VBE 2;  4QKD A;  5T5L A;  3SH4 A;  1Y3T A;  1LHN A;  3CEW A;  3PJQ A;  4GWM A;  5AVP A;  5FXX A;  4LE3 A;  1VLN A;  3RZK A;  3V0A B;  4HLT A;  2ARB A;  5DAQ A;  1W0N A;  3AFG A;  4PCR A;  2FDF A;  5FYH A;  3A4U A;  1EV1 3;  5FP7 A;  4CP9 A;  3V0B B;  1O8S A;  2WQ4 A;  4YZ5 A;  1W2U A;  1UZV A;  3EBR A;  4G9S B;  1RUD 3;  4MGZ E;  2HWC 3;  3ZPY A;  2Y26 A;  4CDU B;  1I1E A;  1VR3 A;  1DYO A;  3KCC A;  1HJG A;  3VKN A;  2X5I C;  1UOG A;  1Y9G A;  1XNA A;  4IQP A;  4RA0 A;  4XAA A;  4EN6 B;  2OQ6 A;  1HB3 A;  4QQH A;  1SLC A;  4BQX A;  1V6K A;  4XMI A;  1UZY A;  5JXH A;  4OHV A;  3ASI A;  4MOA A;  4MET A;  2JG9 B;  4ASK A;  5IYY A;  3VBU B;  2DU1 A;  3CKH A;  2VQT A;  4PBO A;  3VZM A;  5BNP A;  1NY7 1;  2AEN A;  2XKO A;  4GKY A;  1R1A 2;  5JI9 A;  2W39 A;  4HFS A;  2QZ2 A;  1GZW B;  3I2H A;  3C7G A;  1TME 3;  3ZOI A;  5DZF A;  4NO4 A;  1RUF 3;  5EQU A;  4JHZ A;  3OPT A;  4UI9 L;  5EIY B;  4XFC A;  1LHO A;  3FZ3 A;  1QJF A;  5C8W A;  1SDW A;  4CEW B;  3NKG A;  2WZ8 A;  1R09 2;  2GAL A;  2XHK A;  2V5D A;  4ES9 A;  5FYI A;  2XL7 A;  1VBA 3;  2VW2 A;  3KV5 A;  1K5M B;  1ZZ8 A;  2RS1 3;  3KT4 A;  4UBG A;  4M01 A;  1GFF 2;  1B35 A;  5I0R A;  5FZO A;  2VTX A;  5F37 A;  2R07 1;  3GHM A;  1AL0 G;  4N53 B;  1JOP A;  4Q4Y 1;  4CCN A;  2D43 A;  2R7E B;  1DGR N;  2WWU A;  4B4Q A;  4LO5 B;  4Y24 A;  4U2A A;  3UL2 A;  3W5N A;  4GB3 2;  3HT1 A;  1AUY A;  3O1U A;  3SMH A;  2KR2 A;  3CQO A;  2Q8E A;  1RUJ 2;  4TWT A;  3K75 B;  3T0A A;  4EE2 A;  4LEJ A;  5LBF A;  2H0V A;  1LTE A;  3ATG A;  5EV7 A;  4RQP A;  1QJX 3;  4SLI A;  1N1S A;  5JZG A;  1EAH 2;  5L7O A;  5B4X A;  2RS3 1;  4XCB A;  3HN3 A;  1VBB 3;  4JTO A;  3MHZ A;  2CDO A;  2P3Y A;  1X33 A;  1LHW A;  4LQR A;  1N3Q A;  3ZN6 B;  5FUN A;  4PF1 A;  3POS A;  4HSL A;  5F3G A;  5FZE A;  5IVF A;  2PHF A;  1PMJ X;  2ZX3 A;  3AXE A;  3LKJ A;  3VZK A;  3TEZ A;  1PMH X;  1UF2 C;  3J7N A;  3SIT A;  2JG8 C;  2OZ6 A;  3E1F 1;  5C4W B;  1W90 A;  1Y7B A;  1BEV 1;  4GMP 1;  4ISR A;  4J1W A;  3DPR C;  1O3T A;  2VW1 A;  2B5H A;  2ZX4 A;  2AR6 A;  5DUX A;  4JGY B;  2GU9 A;  3PU3 A;  1APN A;  3I54 A;  4IEV A;  2ZHK A;  2VNO A;  1UZ0 A;  4NRO A;  1XJA A;  3U75 A;  4BQ2 A;  2PLV 2;  1Z0H A;  3MFC A;  3CLP A;  4R9D A;  4YG3 A;  4AQS A;  2OW4 A;  5IVC A;  2X09 A;  3JZV A;  5FRE A;  3ZX7 A;  5I93 A;  2ZS6 B;  4TYS A;  5EJZ B;  3VHO A;  4R4X A;  5A1F A;  2NPI A;  2Y8K A;  4AL9 A;  5FO8 B;  3F2Z A;  4PBP A;  1OVS A;  1NCR B;  1SEF A;  4QQL A;  5DZG A;  1LOC A;  1UOB A;  4GH4 A;  2Y6L A;  2FDH A;  2YU2 A;  1YQ8 A;  1W39 A;  1NE6 A;  1VB4 A;  1YJK A;  4MGY E;  3AP4 A;  5FZI A;  3ZFE B;  1JOJ A;  4LBQ A;  3AL6 A;  3N9P A;  1AR6 2;  2VCA A;  3ETQ A;  1S2B A;  4GJZ A;  3GCW A;  2E53 A;  1DGW A;  1NA1 A;  1FMD 2;  3LD8 A;  2EA7 A;  4MXV A;  4XUO A;  4AFM A;  2EXI A;  5JXI A;  1HJF A;  1C5H A;  1Q3E A;  3V64 A;  1QXP A;  5DAB A;  4CA9 A;  4OQ8 A;  4GWN A;  1NUK A;  4Q4W 1;  3UGF A;  3F95 A;  3O0X A;  5FPL A;  4ARY A;  2JEC A;  4BPZ A;  5E1R A;  5D8A C;  4CEY C;  1MZF A;  2D3R A;  5EZW A;  1JYN A;  4A6S A;  2OPK A;  3H8U A;  4YGD A;  1VMJ A;  1NQJ A;  4RSU A;  3KHC A;  3P5B A;  5F5C A;  5K8S A;  2V5Y A;  3AP6 A;  1H6Y A;  3THP A;  5F5A A;  4LBO A;  2XJP A;  5F7U A;  3W21 A;  2HEY F;  4CCE A;  2EIB A;  3VBS C;  2O14 A;  4JKM A;  1V6L A;  1N1V A;  2QQO A;  5EYY A;  4DS0 A;  2ZGR A;  2YY1 A;  4K8F A;  3FE5 A;  3RVH A;  5T5O A;  1N1Y A;  5J36 A;  5DUW A;  1ZBA 2;  3AZY A;  1PO1 3;  1Y4W A;  4CU7 A;  2QE3 A;  3LB9 A;  3ROU A;  4LLO A;  5FY1 A;  3VBO B;  1E5I A;  1XYO A;  5H9S A;  4M3C E;  4CU8 A;  4QX1 A;  5DAV A;  2A75 A;  4RHV 2;  2VH9 A;  4P9J A;  4OUM A;  3RFR A;  4ORF A;  1UU5 A;  4Y1U A;  3HNM A;  4LA3 A;  1IKQ A;  2IVI B;  4PDW A;  1C5I A;  1OKO A;  2OZJ A;  2PA7 A;  4AVA A;  4NII A;  3N7K A;  1HV1 A;  3VDA A;  1RXF A;  2WIN B;  4HPK B;  4BJ0 A;  1H1I A;  1XU1 A;  1HXS 3;  4GJY A;  3W58 A;  2CAV A;  3SKJ E;  1DF0 A;  1UL9 A;  2P5B A;  1JUI A;  4PIY A;  5IVJ A;  3K4A A;  3O1M A;  5IVY A;  4YM3 A;  1R08 2;  4NIH A;  1XE8 A;  3H50 A;  1SAC A;  3RS6 A;  2XJS A;  2CV6 A;  5K9Y A;  1AR9 3;  5J98 B;  2VOV A;  4L2N A;  3JUU A;  5FCC A;  3ZXG A;  2HWF 2;  2Z4F A;  3MPP G;  2JD9 A;  4E27 A;  4IDZ A;  1S0B A;  2JD4 A;  3ZYP A;  1AYN 1;  4ONU A;  4D6S A;  1BMV 2;  1WKY A;  4NPL A;  1W28 A;  2YBS A;  3BOP A;  3PUQ A;  1YI9 A;  4LO7 A;  1UIK A;  1NLQ A;  2D6K A;  2A6Z A;  5BV6 A;  3WCS A;  1D4M 1;  1FNZ A;  3MEP A;  1DQ6 A;  2IZW A;  3P6B A;  3JXS A;  2UY9 A;  1F8V A;  3W5M A;  2JE8 A;  1QQP 2;  4BM8 A;  3LWC A;  5A6X A;  4OI4 A;  5C9A A;  1GZC A;  2PMW B;  3HN1 A;  3ZKY A;  3P3P A;  3CZU A;  5DDJ 2;  3WV6 A;  5A3L A;  5K0U A;  2ZGU A;  3EXU A;  1S0C A;  3M3O A;  4XYX A;  3BOD A;  4L99 A;  1GBG A;  1AXZ A;  3RZM A;  3NV3 A;  4LIU A;  4XDP A;  1W8Z A;  1TME 2;  2RE9 A;  4DY5 A;  1A3K A;  1V9U 3;  1FPN 3;  1RUF 2;  5ABJ A;  2GN3 A;  3B7M A;  5A7W A;  2FHR A;  3I7D A;  3Q8F A;  4LUL A;  4MYE A;  4XUT A;  4XQ4 A;  3WT3 A;  3MZH A;  1DZT A;  3U11 A;  3WW3 A;  2WZR 1;  1QJU 1;  1AJK A;  1H9P A;  2WUH A;  1ULF A;  1WCQ A;  1IZ3 A;  2NYY A;  3E6D A;  4Q0S A;  5C8C B;  1ACC A;  4IE4 A;  4A41 A;  4LUM A;  3GF6 A;  1MQT C;  4L8Q A;  4QGM A;  1JYT A;  1WD3 A;  3JBG 2;  4WM7 A;  1DGR A;  4I01 A;  1XQN A;  5FZF A;  5CKN A;  1YIF A;  1IQD C;  1JN2 P;  1SDD B;  1LRH A;  1NYW A;  2OUH A;  3OBT A;  4XFB A;  2ZJC A;  4YZ4 A;  1G7Y A;  4YAR A;  1E5R A;  3ZN4 A;  1BZW A;  1C8M 2;  2HWE 1;  4XJ9 A;  4NWW A;  4XFH A;  1Z7S 1;  5AC9 1;  4QKB A;  5JR7 B;  3FLT A;  5DG2 A;  2YV8 A;  1NCQ A;  5I0S A;  4LJH A;  2PAK A;  4JTN A;  4AED C;  3C7H A;  4Y1X A;  5CBL A;  2W08 A;  5IVB A;  2ARX A;  1U5Z A; 
#chains in the Genus database with same CATH homology
 2XML A;  5LW9 A;  4HOO A;  5FZC A;  5FYT A;  5FJK A;  5FYM A;  2XDV A;  3PUR A;  5FZ7 A;  5FXZ A;  5FZB A;  5A7Q A;  4V2V A;  3RVH A;  5A1L A;  5FXW A;  5A3P A;  5K4L A;  3OPW A;  4NUB A;  4Y3O A;  5FYI A;  5FP8 A;  5FZL A;  4Y4R A;  3KV5 A;  5F3E A;  5FZ9 A;  3U78 A;  3ZPO A;  5FY1 A;  5FJH A;  2Q8D A;  5FYY A;  3KV6 A;  5FWE A;  5F39 A;  5FZO A;  5F37 A;  4QU1 A;  3KV4 A;  5FZG A;  4QX7 A;  5FYV A;  2GP3 A;  3KV9 A;  4CCN A;  2WWU A;  4C8D A;  3PUA A;  5F3C A;  3PDQ A;  5IVE A;  2YBP A;  5FPV A;  5FPB A;  5LY2 A;  4BIS A;  2VD7 A;  2Q8E A;  4IGP A;  3LDB A;  4LXL A;  4EZH A;  5ANQ A;  5FV3 A;  4GJY A;  5FZ3 A;  4D6Q A;  5FY9 A;  2P5B A;  5IVJ A;  5FZ1 A;  5IVY A;  5FZ4 A;  4BU2 A;  4IGQ A;  3AVS A;  3K3O A;  2PXJ A;  2OX0 A;  5FZO B;  3N9Q A;  5FY4 A;  5F2S A;  5FY0 A;  4XDO A;  4DO0 A;  5A3W A;  3AVR A;  4QWN A;  4TN7 A;  5FUN A;  4GD4 A;  4BXF A;  4D6S A;  4EYU A;  5FYB A;  2YBS A;  5IVF A;  5F3G A;  3N9O A;  3PUQ A;  5FZE A;  3PU8 A;  4LIV A;  5LWB A;  4GAZ A;  4QX8 A;  5A3N A;  4CSW A;  4HON A;  2YPD A;  5E6H A;  4EZ4 A;  5F2W A;  3N9L A;  5FZK A;  5FZH A;  5A7N A;  4URA A;  3KVA A;  3DXU A;  4UF0 A;  5LY1 A;  4DIQ A;  3PU3 A;  5FXX A;  3U4S A;  5FY7 A;  5KR7 A;  4IGO A;  4QXH A;  5FZ8 A;  5A7P A;  4CUG A;  4QXB A;  3PUS A;  2YBK A;  5FP3 A;  5F32 A;  4CCM A;  1VRB A;  5IVC A;  5FBJ A;  5FY5 A;  5FZM A;  2WWJ A;  5A3T A;  5FZA A;  5FP4 A;  4LIU A;  5FYH A;  4CCJ A;  5F3I A;  4XDP A;  3N9N A;  5FP7 A;  3KVB A;  5A1F A;  4LIT A;  3AL5 A;  2XUE A;  4V2W A;  5IVV A;  4D6R A;  4E4H A;  2W2I A;  5FP9 A;  5FUP A;  5A7W A;  4CCK A;  5FPU A;  3K3N A;  5FXV A;  3PTR B;  2OQ7 A;  3N9M A;  2XXZ A;  2YU2 A;  5FYU A;  4CCL A;  4UF0 B;  4CCO A;  5FZI A;  5FYZ A;  5F5I A;  3AL6 A;  3K2O A;  2OQ6 A;  3N9P A;  5FY8 A;  5FYS A;  5FWJ A;  5A7O A;  4GJZ A;  5FZF A;  2OS2 A;  3LD8 A;  3NJY A;  5FZ6 A;  5FZ0 A;  3ZLI A;  5FZD A;  2YU1 A;  4Y33 A;  4ASK A;  4AAP A;  4AI9 A;  3DXT A;  2Q8C A;  5CEH A;  5FPA A;  5A7S A;  5FPL A;  2OT7 A;  5FYC A;  5IW0 A;  5A7W B;  2GP5 A;  4QXC A;  5F5C A;  3UYJ A;  5IWF A;  5A80 A;  5IVB A;  5F5A A;  5ISL A;  3OPT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...