5A7WA

Crystal structure of human jmjd2a in complex with compound 35
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
345
structure length
345
Chain Sequence
b'NPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 4A
publication title Docking and Linking of Fragments to Discover Jumonji Histone Demethylase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 96
structure length 345
sequence length 345
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5a7wA01
2YBKA 5FXXA 4XDPA 5FY1A 3KVAA 5CEHA 2YU1A 4NUBA 5FP4A 2Q8CA 5FXVA 5FV3A 3LDBA 5F2WA 5FZFA 3PDQA 2W2IA 5A7QA 5IVEA 4GJYA 2XDVA 5A3TA 5F5CA 4BXFA 4C8DA 4UF0A 5A7WB 2Q8DA 1VRBA 5FZHA 4AI9A 3PTRB 5FUPA 3NJYA 4D6QA 4QWNA 4GJZA 5A80A 4CSWA 3KV4A 2WWJA 3RVHA 2OT7A 5FY8A 5FZOA 5FWJA 5FZ6A 3N9PA 2YBPA 2XXZA 4CUGA 5FYZA 5K4LA 3AVSA 4Y3OA 5A3WA 5IVYA 3PURA 5A7WA 3N9OA 5A7NA 2P5BA 5FZ4A 5F37A 5LWBA 3PUAA 5FYVA 5FZMA 5FP7A 3UYJA 5FZDA 3U4SA 4DO0A 5FPLA 5F3CA 5FZBA 4GD4A 5FZ8A 5FZ3A 3KV5A 5FY5A 4URAA 2YBSA 2VD7A 5F5AA 5FZAA 2Q8EA 4LITA 4IGOA 4QX7A 5F3GA 4BU2A 5FY9A 4EZHA 5FPBA 5A3PA 5FZ0A 2PXJA 3N9NA 3PUSA 5LY2A 5FYMA 4Y33A 4AAPA 2WWUA 3OPWA 4IGQA 5FY4A 5FZ9A 5FXWA 4V2VA 4D6SA 2GP5A 5FZCA 4LXLA 4CCOA 3ZPOA 5IVVA 5FPAA 3AL5A 3DXUA 2YPDA 2OS2A 4CCKA 4HOOA 3PU3A 4QXBA 4ASKA 3PUQA 4CCLA 3KVBA 2OQ7A 5F5IA 5FYIA 4CCMA 3K3NA 5FZ7A 4QX8A 5F32A 4DIQA 3LD8A 3N9LA 5FJKA 5FY0A 4CCJA 2OQ6A 3K3OA 5ANQA 5F3EA 5FPVA 4CCNA 3U78A 5FZ1A 5FXZA 5LY1A 5FPUA 5IVFA 5FBJA 2XMLA 5FZLA 5A7OA 4EZ4A 3K2OA 2GP3A 3AL6A 5FZIA 5FYUA 2XUEA 5ISLA 4LIUA 5FZGA 3KV6A 5FJHA 5FYHA 5FYTA 4TN7A 5FYBA 5A7SA 5A1FA 4BISA 4E4HA 5FYSA 4QXHA 3OPTA 5FZEA 4GAZA 4EYUA 5F39A 5IW0A 5LW9A 3ZLIA 5FWEA 5FP3A 5FYCA 4LIVA 5F3IA 5FZKA 3N9QA 2YU2A 3DXTA 3KV9A 2OX0A 3N9MA 4QXCA 4QU1A 5IVCA 3PU8A 5FUNA 4UF0B 5IVJA 5A7PA 4HONA 3AVRA 4Y4RA 5FYYA 5A1LA 5FP9A 5FY7A 4XDOA 5KR7A 5F2SA 4V2WA 4D6RA 4IGPA 5FZOB 5IWFA 5IVBA 5FP8A 5E6HA 5A3NA
chains in the Genus database with same CATH superfamily
3PJQA 3PUIA 4OZXA 2YG0A 5HCFA 1UD1A 3HEIA 5K9YA 1AR92 5F2WA 4QKBA 4BMEA 2HYKA 3OGVA 4BXFA 4QPGC 1WW6A 4YPJA 1IQDC 2R6QA 4JC1A 2BWCA 2ZCWA 3HD8B 2C26A 2RMU3 2Y0IA 3PTRB 4GJZA 4OUMA 1H30A 1PO22 1V6LA 3KV4A 4AGGA 1V6IA 3M2MA 5FFOC 3VGIA 4WM7A 1VBB3 3FJSA 1RUF2 2OA2A 3LFIA 3T4HB 4Y20A 3IIIA 3AMNA 2FCTA 3LQCA 1PNGA 1EAH3 2XGXA 3GM8A 4CA9A 2A71A 3ZM8A 2J22A 1Y4WA 2H0VA 1N1YA 3UKVA 1MVQA 2QVSB 1R083 2VMHA 5GLTA 1O8PA 1X9TA 2D7FA 4CDUC 5JSPA 4CDQA 1UIJA 1K42A 2LTNA 1SFPA 2IC1A 4MHRA 2A3XA 1PO11 1WCUA 2RDSA 4CYDA 5I0SA 2MEV1 2P3KA 2J1AA 3AZXA 5KHJA 2D3SA 1W6PA 3B00A 1V9U1 2VMDA 2BVVA 2F17A 2QQVA 1LKNA 4UW3A 3WEZA 4J1WA 3AJZA 2WDBA 2RDRA 5FK7A 1UMZA 4P9WA 1JYNA 1C28A 2QQUA 4U36A 3HNMA 2IVJA 3O7OA 4QM8A 4Y33A 1GWMA 2WWUA 1RUE2 2R073 1VB2A 3UGFA 3FX3A 3I8TA 4PF1A 4KMQA 1UOJA 4PDWA 2ZS6B 4AEDC 1JUHA 1AYM1 4EE2A 1N1TA 1ZZ7A 1JOPA 3USUB 3BN6A 3VZKA 5LA0A 2XPJA 1CN1A 4BYYA 1W8TA 1YI7A 3PUQA 3S57A 4G9SB 1EPWA 2WINB 3KD4A 4LK7A 4YWAA 4MO3M 4XURA 1S0CA 5C9AC 5EP9A 3AMPA 4FOWA 4ZXKA 4D7YA 5JPNB 3JCIA 2HLEA 1VRH3 2JDKA 2EXJA 3PVNA 1QWRA 3WCRA 3GDBA 3SCGA 4XABA 3MLJA 3R6SA 3VZMA 1LNSA 3O1VA 1UX6A 3I2JA 1LOGA 2ADEA 4XFGA 2CU5A 4FFIA 1MEC1 3AP6A 4DXSA 3OBRA 4NPLA 1UOGA 2DWRA 1BYHA 4RGAA 3BYWA 4OQ9A 5FOBB 5FYTA 1RHI1 3I2GA 1PVXA 2BGOA 5JDBA 1DDLA 4CU9A 5FZEA 2J1UA 1S0JA 2QZ2A 4GAZA 3GALA 5JZGB 4UW5A 4AWDA 1D0HA 4FP2A 2EALA 5KXBA 5FP3A 4B1MA 3RZJA 1ND3A 2W95A 4FAGA 1Q8OA 2DF7A 2YU2A 3FMGA 2DURA 2GNBA 1GZ9A 2HWD1 4MUVA 2OZJA 5A7PA 4BQ5A 1F15A 4YW1A 3ZX7A 2B7YA 1KGYA 4Y4RA 4NN0A 3VKOA 4Q0VA 3HQRA 1TZOA 2AEYA 4P9YA 5A32A 1QJX1 4BQXA 4WM8B 4JGZA 1LJ7A 1MZ6A 4RN5A 1T6BX 1MS0A 3ZXJA 3BKZA 1XB9A 3RMYA 3O14A 4LKDA 1QU0A 1Q56A 3HQUA 5FO8B 3RZGA 1QKQA 1LHOA 1PM7A 3MUZ1 4AVCA 3LKJA 1IGOA 1NG0A 5IJRA 1ZBA3 2WT2A 5DQ0A 4E2SA 4L9BA 4MSVA 4O9GA 3KQ4B 4A4AA 2PQSA 2KA3A 1J58A 4OHYA 3VZLA 2EXKA 3I49A 4YFZA 3IM0A 3HBKA 4H7MA 1N47A 2VQUA 3NO8A 4YFWA 5HXVA 5LA9A 3ZFEC 1TNRA 2WQ4A 4XAAA 3WP3A 2OPKA 1CAWB 3VBOC 2HH9A 3T2PA 5LEKA 2VOXA 2WFF3 2VNGA 2XB6C 4H7LA 1VIWB 3PVBB 5FKCA 3T08A 1WA4A 4PQQA 4RGKA 5LCWL 4XXAA 5FZDA 4TLGA 3NJXA 4B7KA 4JGYC 2RS12 5DPNA 2JECA 3DEMA 5J1XA 3CLPA 4NIGA 2XQRA 1CJPA 5JOZA 3DN7A 3ACGA 3LDRA 2XH6A 2WAOA 3LEKA 4KGGA 1PGSA 3WNPA 3POGA 4EZHA 3ACHA 3OF1A 2C6SA 4LUMA 5CADA 1K5MC 2Z5WA 3WG4A 1AXYA 5I0DA 3P3NA 4AAPA 1C8M1 1FYUA 2VU9A 2DVGA 2XBO3 4K40A 4KWLA 1RUD1 1W9SA 4A3ZA 5DABA 3ZDVA 4AI3A 3O1PA 3T0DA 2JG8C 3MI8A 4UFHA 3ZIWA 3DXUA 4YW5A 4URTA 2QJVA 5BNPB 2OS2A 1PIV2 2UY9A 1X33A 4J25A 2GMMA 1PVC2 1FX5A 1UYYA 4GIQA 4V1PA 1Y9GA 2GNMA 3KVBA 4CCLA 1MZEA 1QJY3 5FMCA 2Y6KA 2UY8A 4JTNA 3WXPA 2ZAAA 1XU1A 4Q0SA 2DYCA 2RJ2A 4A7KA 4HKWA 1CAXB 4L8QA 2Y8KA 1CQ9A 4PIXA 3U14A 3VBUA 2DCKA 3CBNA 5LBFA 3VV1A 5FPUA 5LY1A 1B35C 4YZ2A 2IXKA 3KB5A 3LSDA 1LU1A 2EIGA 3ME2A 1OA2A 1C8NA 1VP6A 2CWSA 3BALA 2IXJA 3I3BA 3DYOA 1RGSA 4IEWA 2BZDA 5A7SA 1E5IA 1FOD2 1H9PA 1H1AA 5FYSA 2VBDA 1VPHA 2WR9A 5DAQA 4W6YA 4MGIE 1TNFA 4NIIA 4BWOA 3TWIA 1UY0A 4KNCA 3DKWA 4LBKA 5FZKA 3KGZA 4LIVA 1UZZA 4QB6A 4RGGA 1RMU3 1LOFA 3O5SA 2ZAHA 3ILRA 2B42B 3VBHC 3VBSC 1W6MA 4YM2A 1R091 2WQ8A 1NYWA 4AGVA 2KR2A 2ADDA 3AKSA 2A75A 2D3PA 3AZVA 4LHKA 1UAIA 2HWB2 1WBLA 1ZZCA 3APBA 1U5YA 2WA4A 3SH3A 1G8WA 4Q27A 1CGPA 1AF9A 2XONA 4IE5A 1MS9A 2XVKA 3LA2A 1JYWA 2Q1FA 4CP9A 4K7JA 1PNFA 4I30A 3GGLA 4IESA 4K21A 3LEGA 4KWJA 3S5QA 4QM9A 3OB8A 1TMF1 4R8HA 2YU1A 3WUDA 1HB4A 1RUH3 5J7MA 1KEXA 4N9IA 4GJYA 2R1DA 4MXWA 3NNFA 4OVEA 4AE2A 3ZYRA 1POV3 2AGSA 3ECQA 1U5XA 1O8SA 2R49A 4QWNA 4S2DA 4AI1A 2HWF1 4BQWA 1IHMA 2P17A 4RD7A 3AP5A 5CKNA 2IVIB 2DFCA 3NNLA 2JKXA 5BV6A 1WMFA 3EMRA 3ZFFC 5EIYB 5JSOA 4CEWC 5DDJ2 4IEVA 4LKEA 5FYZA 3U75A 1VBC3 2VUDA 5BNNA 1UY2A 2FDFA 4KL1A 4LO6B 1O3SA 1FNZA 2ZKNA 3CHXA 2ZKLA 3EXUA 1YO8A 3N9OA 4QT6A 5DXDA 3RDIA 5A7NA 4AR2A 5F37A 5LWBA 3BGAA 1ODNA 2NN8A 1J3QA 5E8AA 5BNOA 2JDHA 2QNKA 2GAUA 2A7AA 1W99A 2WNUA 4JX0A 5FZ8A 1EUTA 5JXHA 1LOAA 1H9WA 2Y64A 4UWDA 5T50A 5C8CB 2PHTA 3WD5A 4BU2A 3RZHA 4COZA 4AF9A 3NJVA 1RUI2 1ALYA 2RE9A 3SCHA 4KQ7A 1V70A 3FFQA 3OEAA 5GZDA 3DYMA 1D2SA 2PLV1 5FZ9A 5FY4A 4NHLA 2W1WA 4FPHA 4RQPA 1F8VA 4LOTA 4QB1A 4IEOA 4O9EA 4N90A 4YVWA 2ORXA 1W2TA 5C3SA 4LE4A 3JBG3 1XOYA 3GBGA 2ZMNA 2HBUA 2LUWA 4QQPA 4YRDA 3RSJA 1VJ2A 1I5PA 3E6CC 1VBA1 4KU8A 3H8OA 1LOCA 4M3CF 5FOJB 4Q4W1 4DMIA 4CPBD 4MV2A 4U2AA 5JIAA 3MDPA 4MYEA 3TEWA 5F3EA 4CDXB 4D69A 1NUKA 3F2ZA 1SEFA 3U78A 3CJXA 4ZPIA 4BQ4A 2JDMA 3AMQA 1S0EA 4JHTA 1PO13 1U5IA 1LHUA 5FZLA 5A7OA 2QQPA 2V5YA 5K0UA 2MEV3 4SBVA 1PM4A 3H7JA 4AVTA 3IDCB 5KC6A 1V9U3 2RS32 1R1A1 2RHPA 2ZOEB 1Y43B 4Q4Y2 1QXPA 3OG2A 3OY8B 4FPLA 2CV6A 3AP9A 1YJKA 2YFZA 3M3EA 4L0PA 4HK8A 1UL9A 1UQXA 2ZA9A 4JDMA 1G7YA 2JDYA 2DVAA 3H3LA 4E8DA 5LW9A 4GH4A 3U0ZA 4CE8A 5SV8A 1CIYA 1KDMA 1UZ0A 3B5LB 4Z8BA 3RNSA 1YYNA 3ZSKA 1AYM3 3FLTA 2I74A 2FZ1A 1DCSA 3J8F1 2KD7A 4E4DX 4XQDA 1LAJA 2PFWA 4NHXA 4HLTA 4XDOA 2ZJCA 3NW4A 4QXKA 1K3IA 2DVBA 3V0AA 2W94A 5EV7A 4CU6A 5ANNA 1OLRA 3ST7A 3ILNA 4PF5A 2YYOA 1IQAA 2VXJA 3R05A 5FZFA 4KI5M 5A6YA 1ZBE1 3WDYA 2Q0AA 1AX0A 3RS6A 5CG9A 2WO2A 1W6NA 3O1RA 3N3HA 5CG8A 3WQ0A 4EN7B 2P37A 4XZUG 1NCQA 4TTGA 1UPSA 3M3CA 2IXHA 1SQ4A 2QKDA 5KHGA 1SZBA 2Y6HA 1MEC3 1OKOA 2NP0A 5G05L 4HSJA 2FMYA 2TEPA 4XF0A 1J3PA 5CBLA 4M3CB 1RHI3 4JQTA 2WSUA 1MQTA 2V5DA 1RUNA 3VDCA 1T2XA 1OFNA 1AVBA 3OYWA 3T0AA 2XXZA 4KU7A 5EQUA 5A3WA 2R062 1D0GA 1H0BA 1UXXX 2XJVA 4XEZA 3TEZA 1DBNA 3FWEA 4YGBA 1AYN1 1NT0A 2A6YA 2HWD3 3TOJA 4XJUA 3IN9A 2ZX4A 2LRPA 1IG0A 4DB5A 1HB1A 3KV5A 1LEMA 2P2KA 1US3A 1QJX3 2PHRA 1T6GC 3WINE 4IGOA 2B4KA 1AR82 5FY9A 4RYDA 1L3JA 1QH7A 3JZVA 3OTFA 4XW3A 1DIWA 4AAXA 1HB3A 5LK5A 4ZZ8A 3ZFGB 2YY1A 5IHRA 3LOIA 4LR4A 4QU2A 1VBE2 4KBZA 1C4RA 1E5HA 4NRPA 4K8RB 4V2VA 4D6SA 4IEZA 1J3RA 3NNMA 2J1SA 3JD71 3ZN4A 2R0FA 4Q2FA 1XBFA 1YNAA 2WABA 1AUYA 1PZ9A 4AQTA 5JZGC 3KS7A 5CFDA 2E51A 1JHJA 1QJU2 2XG3A 3MUY1 2L9LA 4DPNA 2C4XA 2PA7A 1F4HA 4YGDA 1FAYA 3ATGA 5CB7A 4LTAA 4XVHA 4DIQA 1HDKA 2CGOA 1DHKB 4ORFA 2EVXA 4BLJA 5CISA 3LIHA 4GWMA 1UZVA 2WBKA 4EQVA 1Q5OA 4XBNA 4NR1A 3WY6A 1UU4A 1W0PA 2IFWA 1BKZA 3DPRB 3AYEA 4WM8C 4DFSA 5CFCB 5AFBA 2R041 5C4WA 3ROUA 5FYUA 4QPIC 2RV9A 3ORJA 3HBZA 3I59A 2SLIA 5FYBA 5GLUA 4C1XA 5L7OB 2A73B 4AFDA 4QXHA 2CNAA 4BMBA 5LRRA 4HXCA 1G9AA 2P1BA 1UOFA 4DINB 2V09A 5F39A 4D94A 3A21A 4COYA 2VTXJ 1C8M3 2BNMA 1FXZA 3AYAA 3D0JA 4JQRA 2RS51 3PIJA 2EIEA 4QQHA 1H8TB 1RUD3 4QX0A 5AVPA 1ZA4A 2OX0A 3GBWA 1F5FA 4IV1A 2NMNA 4R9CA 3V0BA 1FT9A 2C5DA 3KGLA 1PZ8A 4XOGA 1AR72 4FTBA 1K5MB 3N36A 4AFCA 3VD5A 4IGPA 1GP6A 2JEMA 1RINA 1YUDA 3HR9A 4E9KA 1XRUA 1WKYA 4RHV1 4ATEA 4META 2PHDA 3AKPA 5FY1A 2HWC1 2JG8B 2W2IA 1QDCA 3IPVA 2BU9A 2JDNA 2ES3A 3I2FA 2Q8DA 3JB8A 2ZGUA 5FUPA 3E5XA 5A80A 3EYPA 5DUXA 3FE5A 1ND2A 5DG2A 3ETPA 4AI8A 3VBRA 2Q5TA 3N4MA 1YQ8A 3GHMA 2EXHA 3GNEA 1HV1A 4N43B 1O5UA 1U12A 3EJKA 4XJAA 1PZ7A 1UXZA 4JZRA 5FKBA 1E5SA 4X6RB 3D5OA 4FPFA 5CZKA 3WHTA 1SMVA 1NA1A 3ZXDA 1QJEA 5BNPC 3H8RA 1PO21 3WP5A 3EO6A 4CP0A 2QDRA 5E1RA 4Q4X1 1NLRA 1R093 2G1MA 4FVVA 4M3CE 1LODA 2BOJA 3B3QE 1D4M3 1DLCA 3ES4A 3HJRA 2VW0A 5FLIA 2BWAA 3ENRA 3CEWA 3E5UA 4GD4A 2FCUA 1QIQA 4W65A 1VBD2 1GZCA 5FMDA 5T5PA 5B4XA 1VBB2 3THPA 1E57A 1BBT1 5LASA 2XOMA 1QNYA 4AVVA 1UX7A 1ULPA 4H14A 1TMF3 5A3PA 5L9VA 3C8XA 2E9QA 3N9NA 4ES8A 1QQP2 2F4LA 3USUA 4WM7C 5FPXA 4FPGA 3B94A 2W52A 4IGQA 4L11A 2RR12 3SEPA 4MOAA 4AL9A 1YHFA 1JZ4A 3PNAA 3W5NA 4XYXA 2RDNA 2HWF3 2BBAA 2Q1ZB 5FPAA 3SNMA 5CKQA 3N7JA 1HW5A 4C0BA 4GA9A 2GU9A 1QF3A 1JU3A 4P9GA 2XR4A 4ASLA 3BU0A 1XE0A 2VNRA 2AYHA 1L7LA 1RUE1 3SEEA 4CCJA 4KG8A 1IOAA 2DTYA 1EP0A 2VZRA 2VC9A 3A23A 3A22A 3LF7A 1XE8A 3IKWA 4HN1A 4IEYA 2DCTA 1GZWA 1OURA 1WCQA 1HJFA 4UOJA 5LA2A 1PK6A 1WA6X 1OH3A 2DTWA 1CZTA 2QQMA 4OUSA 2ZGRA 2R072 3OD4A 5GKAC 1NLQA 5HI0A 4LT5A 1F31A 5DMYA 4GWIA 3OBTA 5H9RA 4ISRA 1WGPA 4BQ2A 1WUVA 4QHBA 4YW7A 1PGW2 5A33B 1C1FA 1GNZA 2ZGNA 3ZFFB 1BHGA 4CEWB 3KV6A 1V00A 4IEXA 1FMD2 4BISA 1UY3A 3ASIA 1H2LA 2E32A 2QQOA 1IPSA 4NROA 2VO5A 3BODA 4WZFA 5DUVA 2VOKA 2RVAA 1CR7A 4EYUA 4XFBA 3HN3A 3W20A 1ENXA 1P8JA 2PLV3 2V4VA 2SBAA 5GLWA 5SV5A 1UCXA 4XACA 4CRQA 2D6PA 3Q8EA 2CWMA 1W6OA 2ZMLA 4BHPA 3J4UH 5DAXA 1QJFA 4EWEA 4B7EA 5KXEA 2D40A 2CGNA 2W3JA 3IAQA 1RVF2 1DQ5A 5F6LB 4FI9A 1AR61 2BGCA 4IEQA 3H9AA 4FOVA 4Q4V1 4BQ3A 4RA0A 1ULDA 1QH6A 1VBA3 2PHWA 1Y9MA 2VZUA 3FN9A 2ENRA 1CAUA 2B46X 1MZ5A 3NV4A 4Q4W3 5FP8A 4AXOA 2KM2A 2X10A 5FMBA 2TNFA 4XDPA 3O1UA 1O91A 2BBVA 1NE6A 5FV3A 1W28A 1X8MA 4DNYA 5FQ0A 1F5JA 4FQZA 3ZSMA 5C8CC 4DY3A 4UFMA 4FFHA 2TBVA 2FDKA 3IB3A 4CU8A 3H8XA 5FR3A 4JKLA 3LWCA 3K4DA 4CSWA 2E7QA 2WWJA 1RIRA 1ND3C 1R1A3 3VL8A 2ZHNA 4WVZA 5FZOA 4HANA 2XQXA 1WW4A 4PIZA 3WP6A 2A6ZA 5ACA2 3N9PA 4HK9A 4BIFA 5D8AB 3ZN6A 1TEIA 4XE9A 1SCRA 4CP1A 5KWRA 5K4LA 5J96B 3FLPA 2YMZA 3BPZA 5IVYA 4A45A 4D7TA 4AQ2A 4BK5A 3VBFA 1Q43A 3UGHA 2QQKA 4A7ZA 5A6ZA 3PUAA 4CXYA 5IFTA 2P3YA 1CIWA 4PBPA 3SH5A 3J8F3 3SLIA 4QDQA 2JENA 4CDWA 2W39A 2ORZA 4OHWA 1RUG2 2VNVA 4EWDA 5FO7B 1H1IA 4RSUA 4W6WA 2OW4A 3K51A 2HYXA 4LITA 1OLQA 4CDXC 4XQWA 1O3TA 2WAAA 3DYPA 3IT8A 3GZTB 3JB4C 1BEV2 2ET7A 3B69A 4GKXA 4NO4A 1ZBE3 4PT6A 1JXNA 3JBG1 1GICA 4P9LA 1YEWA 5GM0A 2VBBA 2G9GA 1KQRA 3PVOA 4XCAA 3I2IA 2DV9A 3KHBA 4LMFA 1N3QA 1YJLA 2ZEYA 1YWKA 3SC7X 2BP6A 2CSGA 2X5IA 3B01A 1SACA 1UY1A 3I3MA 2IXLA 2DVDA 1NQDA 3CKHA 4YM1A 3LCPA 4UBGA 3UL2A 2PHUA 4WV8A 1WD4A 4HPKA 4ARXA 2YPDA 4ZS2A 1O5LA 2C0ZA 4CUCA 4HOOA 4XDQA 2XJQA 4YW3A 1RUOA 5EJ1B 4EV0A 3WNKA 3HWJA 4N7UA 1L7QA 1Q8VA 1ZZBA 2OQ7A 3ACFA 3WT3A 1LU2A 2C9AA 5FDBA 2VW2A 3OD0A 2K46A 1W03A 4B29A 3ZO0B 2IZWA 3GHNA 1O6UA 2GZWA 4R9AA 5FLHA 1AYN3 3ZYJB 2ZBJA 2QTWB 4Y1ZA 5J3UA 3LPGA 4Q0UA 3VUOA 2VGDA 4QGMA 3LA3A 5FRAA 1QY4A 5FBZA 1UYZA 5FZGA 4AG4A 4BE3A 1WLTA 4TN7A 1FNYA 5EXOA 1SPPA 2YHJA 5C7GA 5JI7A 1CPNA 2WT0A 5DG1A 1XXNA 2CDPA 1R64A 5C3RA 2IXIA 5FYCA 4KG0A 5F3IA 1EV11 1ZZ6A 2K2SA 1GSLA 4DRVA 5EYXA 1RL3A 3KV9A 1BJQA 2CAUA 2YGMA 2BEOA 3JD73 2VL4A 3L2HA 2HKXA 4TLFA 1FATA 3GJBA 3CNAA 2XL7A 4IEPA 2CTVA 1HIXA 2BFUL 4RS5A 2RDQA 3AVRA 5CNAA 1Z7S2 3S7EA 4EN0A 4JTOA 2ZZJA 4IQPA 2VY0A 4N53B 4CU7A 5F2SA 4XFAA 5JXIA 2NLRA 2P6HA 4PIYA 3CJIB 5IFPA 1OOPA 2JG9B 2ZTNA 1GMMA 1ENSA 2EAKA 2XHKA 2VZVA 3HNBM 3VHOA 5IUQA 3POFA 4QD2A 5A3NA 2WZR2 1Z0HA 2YBKA 4FOQA 1STMA 2OVUA 5APAA 3BTAA 5CEHA 4YG6A 1WLDA 4YW6A 3W21A 3UV9A 1Q8QA 2QQIA 2D5FA 2FHRA 3WCSA 3WR0A 5ABJB 4UF0A 1HKDA 3V64A 2UYBA 1OD5A 1OA4A 1VALA 3HPNA 4M0HA 2R043 2K0GA 1S55A 3MW4A 1RTVA 2ID4A 1FV2A 3OUJA 3I2HA 3I3DA 2P3IA 4TWTA 1O4YA 4H3WA 4QDSA 4XBQA 5FY8A 3TEXA 4OI1A 3A0KA 4L99A 3S30A 2JE7A 3M4FA 3WW2A 3ZFGC 3ZYIB 3BU7A 3EQEA 3ALQA 1RUJ2 1Y3TA 4QMAA 5E88A 1JOJA 4CUGA 2PHLA 2FCVA 4OCTA 2B5HA 1MVEA 2WNVB 5A6XA 2D6NA 1ZRIA 2RS53 4A6SA 4DY5A 1SFNA 2VPVA 4R9BA 1ULOA 5FZ4A 4LBQA 1W9YA 4Q1RA 3OUHA 4QPIB 3VZJA 4A3XA 1LB2A 1XNBA 5FP7A 1ULGA 1HRI1 4JRAA 2GC2A 5FPLA 1CAVA 1OLMA 1SCSA 1W8FA 2KXLA 4NE9A 4QGNA 3Q8CA 3PJYA 4YVSB 4EROA 1LESA 2YV8A 1BMV2 2XJRA 5FZAA 5CVRA 4Z07A 4RHV3 3LEMA 3NAPA 5DZEA 2PYTA 5FPBA 4HVQA 3GBFA 3DPRC 2PXJA 1WLCA 2HWC3 5CFCC 1AJKA 2YC0A 1G6NA 2R7EB 2WIIB 3DGTA 4NAOA 2JICA 1VBC2 5F6KA 2XJTA 3UKNA 4UW6A 1O4TA 1XU2A 1NCRB 3TNPB 1OHFA 2IUWA 4I0WB 1ZNPA 3UK9A 1UNBA 4ZS3A 5L7OC 4CCOA 2YC2A 2VOTA 3ZSLA 1I9RA 2ARXA 2CL2A 1A78A 2BJSA 4QPGA 4JV4A 4QXBA 3I97A 1SBDA 2DUOA 2VZQA 5F5IA 2W1SA 4CCMA 3WF0A 1H8TC 1QEXA 2VQAA 5IAVA 4Z1VA 2WZEA 2WNUC 4DS0A 1GOHA 1UU6A 2W9XA 3CF6E 1PO23 2WWSA 5EYYA 4ARYA 2ZGOA 2PHFA 4Q4X3 1W9WA 2D6KA 4BQYA 2O0OA 1V6MA 2JDUA 3MV01 4CXXA 4FPKA 1XNAA 5FBJA 4CDUA 3W59A 3H3ZA 4XIOA 3EBRA 4E2QA 4QKFA 4DUWA 4MADA 2Y60A 2YFUA 3VHRA 5FYHA 1BBT3 1COV2 4LHLA 3ZXLA 5HPOA 4FOYA 3IWZA 5E16A 2J1VA 3MBWA 1S0IA 4XTPA 1OD3A 4AYUA 1WLWA 3R4DB 4XXPA 2OYZA 2VJXA 5DN2A 3WP4A 3FHIB 2XJUA 4LE3A 3O0WA 5LBEA 3VD3A 4Y1YA 3OOXA 3I54A 1MS1A 3RI9A 2CYFA 3VZNA 4OUEA 2RS31 4Q4Y1 4EWAA 4Y22A 3TAYA 4N43C 2I2SA 4AK3A 3ZPYA 1OT5A 4FP3A 3T09A 1PO12 2D93A 4CEYB 1JU4A 2DVFA 3RGBA 2GH2A 2XUMA 4AEDA 4XFFA 2MEV2 4XPVA 2BW8A 3AC0A 2V73A 1V9U2 1W2OA 2Z42A 4WM7B 1J1LA 1RUE3 4GMP0 4K9SA 4S2GA 1SLLA 5JI9A 3JU9A 4Y20B 3CU7A 3J7NA 3QLQA 4QDRA 5EPAA 5IWFA 5FREA 1F35A 5FXXA 2VZTA 5F7UA 1JW6A 1H4HA 2PELA 1AXKA 3GZAA 4GKYA 4NUBA 5FP4A 4Z2WA 3RWNA 5C9AA 2XDVA 1GWLA 4AHZA 1YQ2A 4AFMA 2VMGA 4MLOA 3NV3A 4RL7A 3WDVA 5FZHA 4CDQB 1DGRN 4GH4C 1WWYA 3LDKA 4M00A 3WNNA 1REDA 1ZVFA 1VLNA 4FQ4A 3C7FA 3D3AA 4FFFA 2E33A 5I93A 1D4M1 2MNGA 3RZLA 1W6PB 4GB31 2QQLA 4QQOA 3POYA 2VW1A 5E89A 2FDJA 4Y1VA 1OVPA 1V6OA 1OQ1A 2YC4A 5J48A 5T5LA 1H6YA 5A7WA 2FMDA 3ZXEA 2JJ6A 1F9KA 4PDWB 1REEA 1NY71 1TME2 2AH2A 2GMPA 4FXKB 4XHBA 3WUCA 4DO0A 5J09A 1SHWB 2ARAA 1AR63 3EHKA 2E26A 4UFLA 3ZDSA 5F5AA 1NCQC 2R061 3OGSA 4Q4V3 3ZXKA 3E97A 4YZ5A 3LIGA 4NHYA 1H2MA 4PI2A 4H2AA 5F3GA 5LBBA 4B4QA 5I8YA 3ZMNA 1OMIA 2W91A 3CIHA 4F3JA 1W90A 3PMEA 4Q29A 5H9QA 3KMHA 3MYXA 4HKLA 3OPWA 5FXWA 4Y5SA 4C91A 2BV4A 2WT1A 2VOWA 5LRSA 1W8HA 2HWD2 1AR81 3VZOA 1Z78A 3C7OA 2UWBA 3NKGA 1DZQA 1YIFA 1SLBA 4AQSA 2J7MA 3RJ2X 3M3OA 3LZZA 1J83A 3IIAA 2QQNA 1N1SA 2BNNA 2QFEA 4YZ3A 3ZIXA 4Y4YA 1OBNA 1VBE1 4AVAA 5F32A 5FMOS 4ZHNA 3N9LA 4YM3A 3BOWA 1ZRCA 1GKBA 3C7GA 1M4WA 4XAEA 3O1OA 4DOUA 2V72A 4IV3A 1DLLA 3IAPA 3ZFEA 4UYBA 5FXZA 3WDXA 4A7YA 5I8TA 5JMOA 4AI0A 1ND3B 2BGPA 3C7EA 2CGPA 3VBOA 3B7MA 5KHHA 3AL6A 5IT6A 2J1EA 1JUIA 4JGYA 3E6DA 1JYCA 2JDPA 5A32B 1KFXL 1XC6A 2X8KA 4FSJA 4JGZB 4LNVA 2JE8A 4FPCA 2CAVA 4HETA 3RJRA 1HX6A 2VG9A 3BVCA 5IK7A 1JHNA 3ZLIA 3PMSA 2Y0OA 2IXCA 3ZR6A 4I09A 3DXTA 5EHDA 4BIOA 3KCXA 1FPN2 1QGLA 3AJYA 1HXS2 1YFYA 5D8AC 4HONA 5I8SA 3DV8A 3O1MA 2X09A 5A1LA 5FP9A 3MICA 4KWUA 4ZZ5A 2WS92 2VCAA 4FPOB 1CESA 5HCAA 4FT8A 1XSRA 4LO7A 1US2A 5GZFA 1EY2A 2G4IA 2ZGMA 3H0OA 3OUIA 5CYYA 4LULA 3IMNA 1CD3G 3M3QA 1AX2A 3KLSA 5F5CA 4I01A 4YW4A 1VRBA 2PAKA 2X05A 1GZTA 2XWBB 4DUXA 4I02A 3OCPA 2WNEA 2FD8A 5G04L 5HBAA 1DG6A 2A3WA 2J1RA 1B35A 2BYVE 4QX1A 3LFMA 1L7RA 1PHMA 3MFCA 4LBMA 1JN2P 4OZOA 3UT0A 3QD6A 3C7HA 1KJLA 4LO5B 1KITA 1RUC1 4AHXA 2ARCA 1OQDA 1TG7A 3AVSA 1VAMA 5C3OA 1H6XA 2A70A 3ILFA 4YGCA 5JAXA 1ENQA 5JCTA 1EV13 1HJGA 3AKRA 1W8OA 5FAXA 2VMCA 3GCXA 4RR3A 2J42A 3VBSA 3VBHA 2ARBA 3NQHA 4QQ2A 4IETA 3UJQA 3VKFC 3SQOA 2W0XA 4ES9A 4P5YA 1UZWA 4UI9L 4WVMA 2GC3A 3PTYA 1KRIA 2B45X 3TNQA 1S2EA 3I2OA 2G9ZA 2XHNA 4P08A 2ZGTA 2ZX0A 3TN91 1LCLA 2XLGA 5L36A 2VUAA 4M01A 2DCJA 4MGQA 4XUQA 1TE1B 3CO2A 3VBUB 1VBD1 2GP5A 5CU1A 5D1IA 5FZCA 1R092 2DU1A 4J1XA 2IWGB 4HFSA 1H2NA 4S2FA 5DAVA 1S1AA 1LEDA 1QQP1 2VUJA 2VZOA 3SMHA 2ZX3A 2Z69A 3K77A 3ITQA 1GWKA 2RR11 1D7PM 1DF0A 4R4ZA 5EWSA 3WNMA 1GLHA 2O8QA 4XUPA 2XLAA 3KT1A 3QBQA 4DEQA 1VB4A 3OEBA 3ZKUA 2AENA 4UT5A 2RJLA 4N53C 4CCNA 1PGL2 4YARA 5K7PA 4ET7A 5FUIA 5IVFA 1F4AA 2P4EA 1HRI3 1HQWA 2JG9C 3CJIC 3JQXA 2XMLA 4AFBA 1W6MB 4FBFA 3MIEA 1DQ0A 3K2OA 5T5OA 3V65A 4PI0A 3ZR5A 4I0AA 4AZZA 4LO8A 1W6QA 4X6QB 5K8SA 1VMHA 1XJAA 1VMFA 4P00B 1X82A 3ES1A 1PMIA 3FBYA 5B4NA 5ABJC 1ASJ1 1DZTA 2VAUA 4CP9B 3KZ4C 5IATA 4XMAA 1LGNA 2NMOA 5AC91 4NHMA 2TUNA 3MLLA 1PGW1 1XE7A 4GZ9A 4BA6A 1AL21 1H8VA 1DU3D 2MHFA 2WZ8A 2W92A 3OBZA 1FMD1 4MXWB 3T2OA 2OUJA 3MO4A 1ST8A 1Q8PA 2DBNA 1RUI3 2AEZA 2ZX1A 4UXAA 3WQ1A 2P6CA 3ZSEA 2WNVC 5L73A 1JZ8A 2VECA 1C5HA 4XCBA 1W3VA 1Y9QA 2LW8A 1W2AX 3NVCA 4QPYA 4YG0A 4LJHA 4DXRA 4E8CA 4NWVA 2VTFA 3HVDA 3KVAA 3E6BA 3RZKA 5C5UA 2VCCA 4YVSC 1RVF1 5BNNB 3M70A 4FPJA 2PLV2 2Q30A 1OQEA 4TZDA 3VDDC 5HV4A 3AYDA 4LORA 3WVJA 4D6QA 3NJYA 5BNOB 3H42B 2WNUB 3I3EA 4BDVB 1JZ3A 5AVAA 1NCRC 1POQA 5FZ6A 2HWE1 5A3LA 2IFRA 3IDBB 3M1HA 5BY5A 1VBA2 4L2NA 4COWA 3SITA 2JWPA 1DGWX 4PLMA 4HN0A 4KH9A 4Y3OA 1V6JA 3ZYHA 3MW3A 1BVVA 4HVOA 3FBMA 4NRQA 1DYKA 1DP0A 2RS33 2V4AA 4Q4Y3 4E2GA 1HRV2 1YFUA 2NPIA 2VCMA 2MPFA 2D97A 1RXGA 1S0DA 1W8ZA 3RMXA 1GNYA 2RM22 5ACA1 4N8MA 4RQPB 1K5JA 5FZ3A 4YVWB 5FY5A 4BJ0A 1KJRA 1R1A2 4HZFA 3C2UA 1ONAA 4KWKA 1MACA 5JR7B 1JZ2A 4I3GA 4UBHA 3BPSA 1U0AA 4R4XA 3AYCA 3HN1A 2EF6A 3LGRA 1AR91 5GJ6A 1WMDA 2BFUS 3KM5A 2ZGPA 3V56A 3AZYA 2E53A 1ZZ8A 1RUG1 2O14A 4H55A 3GZUC 3B9IA 3LSEA 4L92A 4QQLA 3ZPOA 3P1IA 1LHWA 1V6NA 2B9VA 4JRLA 2WA3A 1BEV1 1I5ZA 2DFBA 3WF2A 5EFUA 4XETA 2HEYF 1RUF1 5K0UB 3LOBA 1Q3EA 3A7QA 4GB33 4K1ZA 5JOYA 2RMU2 4N9HA 2GSYA 1IS4A 1SBEA 5AFEA 1EYBA 1ZBE2 1A8MA 3ZXGA 3R4SA 1CVNA 2C9KA 2R0HA 2Y6FA 4R52A 4CEYC 4GH4B 2OPWA 5FZ1A 3ZYPA 4W4ZA 3PIGA 1EAH2 2P34A 3O0XA 5CKMA 4EZ4A 4C1WA 1IS3A 3MV11 1CZVA 3DL3A 1R082 3O1SA 4XF4A 2R063 4KGQA 3ZYBA 5FJHA 3FUQA 3NWKA 5A1FA 1JZ6A 1G86A 2YZ4A 3MFAA 3URFA 3V0AB 3W5MA 4P02B 3P5BA 1JI6A 5M0TA 3ON7A 3FL7A 4CDQC 4A41A 1O59A 4ZU4A 3BCWA 4XMIA 1DGLA 3AP4A 1UOBA 1W6NB 1HLCA 2VR4A 1URXA 3O12A 1S0GA 1NCQB 1AR83 1WMXA 4O7XA 5C33A 3AMMA 5A6QA 3WZ1A 2ZACA 1VBE3 4UAPA 1MQTB 4PQ9A 5JZGA 5A3MA 1EUUA 3OYWB 4MGYE 4FO9A 2BOIA 1JTZX 3BTZA 4PDWC 2D6LX 1UF2C 3T2TA 3LE0A 3LDBA 2OIIA 1GUIA 3ETQA 3PDQA 1Z7S1 1DGRA 1SLIA 4BOWA 1JYIA 4C8DA 3POEA 1OUSA 1C3HA 3ACIA 1X7NA 3TBDA 4CUAA 1VRH2 3JD72 5DUUA 5LATA 3U37A 2ZEZA 5C71A 2WZR1 1MR5A 3WF4A 3WNXA 4WM8A 2OT7A 2EA7A 2D44A 3DECA 2JIGA 1DGWA 4OHZA 1OF4A 2NQYA 2YBPA 1C5IA 1DQ4A 2Q1MA 1KS4A 4Q1PA 4IL7A 2ZABA 1SG3A 1RXFA 4I2OA 4UW4A 2Q4SA 3VD7A 4L97A 2JIJA 3EB7A 4LBQD 1IZ3A 2D43A 3ZXAC 4IXLA 2P5BA 3UYJA 3GYDA 1LGBA 4R9DA 1SLCA 2ZEXA 4QAWA 3N7KA 1RUJ1 1APNA 1JMUB 1XNDA 1AXZA 2XJSA 3PL0A 1RJ7A 1HV0A 1SDWA 2FZ2A 2W87A 5CFDB 4CCCA 2OKXA 4FTSA 3J26N 3KT4A 4OQ8A 2GNTA 5LZ6A 3WG2A 1DYOA 1CAWA 1UWWA 2VUCA 1MS3A 1GQGA 3VHNA 4D7SA 2WC2A 3I3QA 2WQZC 2ZEWA 5LB6A 4IE0A 3RPQA 4ASMB 1BMV1 1AR73 1GOGA 2O1QA 3QCWA 4QHOA 4YGEA 1ZX5A 2HBTA 1AX1A 4CTEA 2ZHMA 2NZ9A 4JGZC 4Q0PA 1DQ2A 5C4WB 5F5QA 2RJKA 4CVUA 2EIDA 4JKMA 5GLVA 3VLBB 1ZYBA 3I59B 4YYOA 1RUC3 1N1VA 1ZBA2 1YCIA 4I0BA 4WBBA 4AVBA 4ZY9A 2PQQA 4RHV2 3HMYA 3MEPA 3JQWA 4FPEA 1JYXA 1MS5A 2UU8A 2HWC2 1XSQA 5ANQA 4O65A 3OGRA 2FDIA 5FPVA 3IZOA 1LOBA 2VE1A 1UKRA 2WYSA 5BNPA 2RS11 3DUIA 4OMDA 4IV1B 2WFF2 4EN8B 1X9PA 4X8PA 3V0BB 3I7DA 4FXGB 1A8DA 3K48A 3TEYA 3TYJA 3U10A 1CAXA 1NE4A 4DQAA 3TN93 3DF0A 5GZEA 3RFRA 2HEWF 3K46A 4HBNA 5T5JA 3WLUA 1VBD3 4LOSA 4XUTA 4Q4X2 3H1WA 2A1XA 3CMGA 3IPVB 5IVCA 4UFKA 5IVJA 1COV1 3AFKA 3HOBA 1PIV1 3LEIA 5T52A 2W46A 2WL1A 1WCDJ 1PVC1 1QQP3 2ZXQA 5FY7A 5KR7A 4D0QA 3HT1A 1ND2B 2XBO2 3FLRA 3VBRB 4P9XA 5JXJA 1BBT2 1BK1A 2RR13 5JPMB 4CP2A 2ET1A 4A2UA 5FXVA 4E4SA 2LM3A 4XUNA 1NA1B 1QJY2 3H1MA 4NIAA 3OBAA 3FZ3A 2WKKA 5BNQA 3RZMA 5IYYA 1H4GA 5KHIA 3RRDA 1OFSA 1XYNA 2VXRA 1BVP1 2YPJA 4LBNA 4LHSA 2VNOA 3T1MA 1OI6A 4HL0A 4NHKA 2QQJA 3WOGA 1FOD1 1O7FA 1QXJA 3DCQA 4CCDA 3BTYA 4GWNA 1ASJ3 1DYPA 1OPMA 2JXAA 1PX3A 4LO4B 3Q9OA 3AKTA 5DZFA 5I0UA 3VBUC 3KSCA 4JCKA 1IG3A 2GMEA 3DKQA 5AC93 4B8EA 4CZSA 2WFPA 5BPXA 1GP4A 1AL23 1LTEA 2A5ZA 5LBCA 1FMD3 3ACLA 3AK0A 4K8FA 5FZMA 3U4SA 3VB9A 4BM8A 3CZUA 2HWB1 3NL1A 2WN2A 1OPOA 4GMP1 4JDNA 5FIXA 3KCYA 4URAA 5KBFA 3RG0A 1RMU2 3RWKX 4LA3A 2ZPXA 4JDOA 4NIHA 1POV0 1A34A 3NV2A 5DAPA 1LOFC 1UMIA 1W04A 4QHZA 1NKGA 2Y26A 2ILMA 1J84A 3PUSA 3S5AA 2W5FA 1BZWA 4LBJA 1RVF3 4WVWA 5FYMA 1TME1 3MF6A 4OMCA 1I6XA 5FPZA 1GFF2 1NAEA 2H0BA 1GZWB 2W1QA 4AVSA 1PX4A 1PK6B 1DQ6A 3MIGA 1W39A 4JVAA 4XC9A 1RUH2 4AEJA 1ULEA 2YGLA 4X8NA 5C8CA 4NVPA 3D6EA 4SLIA 4NPRA 1AR62 3PLQA 3ZXFA 2HWE3 2VOVA 4Q4V2 3PHMA 4QX8A 5DDJ1 1JH5A 1UKGA 3VDDB 1B09A 4Y5TA 4FAHA 1X50A 3WDTA 3HQXA 4LLOA 1G9FA 2VCBA 2E31A 4B1LA 5IK4A 1UMHA 2J1TA 1HB2A 1X8EA 2CHHA 5ACA3 2FDGA 3Q8AA 1W6OB 5HV0A 1TVGA 2GP3A 1SFYA 4Z92B 2ZX2A 1R1ZA 3IDAA 2DBIA 4M4PA 3LAGA 4MGZE 2O8OA 5BNNC 4GWJA 3VL9A 3WDUA 3ZOIA 4BH9A 1HQNA 1RUI1 1S2BA 1W2UA 2WO1A 1O3QA 4Q26A 4B4RA 1AR93 1CAUB 4CDXA 4LKSA 4NWWA 2PTMA 5FWEA 2VMEA 2WLQA 1ZRDA 2LROA 3NJZA 5BNOC 1RUG3 3BI3A 5FQ0B 3AMHA 1KFUL 2PAMA 4ISQA 4IW3A 1BEV3 2BPA2 1OXCA 4MXVA 5FYYA 4NOTA 1RUF3 3OY8A 4IV3C 4Z82A 2PN5A 5BYNA 4ZU7A 3WF1A 4D6RA 2DCZA 2ZGLA 4P5HA 5BXXA 5FZOB 4LKFA 1YQCA 4WZCA 4AQ6A 4G4FA 2BTVC 5E6HA 3E5QA 4OLLA 1V0AA 3KQRA 1FPN1 3JBG2 4FTEA 3ZN6B 1OF3A 1CPMA 1HXS1 4RQPC 1JOBA 1LHVA 3G7DA 2Q8CA 3T30A 3T4VA 3U11A 4YVWC 5A7QA 5IVEA 1GP5A 3AFGA 5KHKA 5C8WA 4YSFA 4CCEA 3BB6A 2WN3A 3VBFB 5IK8A 2WS91 3R4UA 5A3OA 3RYRA 4DEVA 4XJWA 2ZZQA 4LBLA 4XJZA 3UJOA 4W6XA 4ZU5A 4WVVA 4CDWB 4Q8KA 3L9JT 1UIKA 3G6JB 5JR2A 3L2YA 5FWJA 2R16A 1PMHX 1LHNA 4P9IA 2VZPA 1ODMA 1XNKA 1QHDA 3LPFA 3IMMA 4MZUA 1CWPA 3VN4A 2CY6A 4AEKA 2W47A 3IDEA 5K0UC 3T2QA 2X5IB 3POJA 1KD7A 5H9SA 4XJ9A 4XF3A 2R32A 4C0HA 5F3CA 4M3CA 1YXWA 4PLOA 1KDKA 4HPKB 1UO9A 3HNYM 4E27A 1ULFA 1VR3A 5T54A 3WF3A 1AYM2 4YM0A 1CJDA 3D8CA 2W08A 4OYUA 5LA1A 4FFGA 1BLZA 1GOFA 4COVA 2VQ0A 5JOWA 4ONUA 2W68A 2VMIA 1EPZA 1XNCA 1Z7S3 2WSVA 5FTTC 3THTA 1EV12 1UN1A 3WG3A 3KWVA 5B2GB 4IE4A 1M06G 3J7MA 3CQOA 4AI9A 2WZR3 1W8UA 1QOTA 1WW5A 4QKNA 4CCKA 5JSRA 5HCBA 2QDNA 1RB8G 2Y33A 2JE9A 1NXMA 1XYPA 5L9BA 4AOCA 3POSA 4RR3C 5FYIA 1MEC2 1ZM1A 2AR6A 5EZWA 3N35A 1SPPB 1XNTA 3ZFGA 1AHSA 1O4ZA 1OA3A 1XPWA 3K3OA 1RHI2 4PHZA 4OFGA 3WNOA 3Q8FA 1H1MA 1YQ5A 4F8AA 1SLTA 5CA6A 1UY4A 3KF3A 4XUOA 3SKVA 3ZKYA 1MQTC 1MZFA 3S6PA 4B3NA 1D2QA 1RUJ3 1VE0A 2PMWB 3WQBA 3WG1A 4EN9B 5FZIA 4IE6A 4ITCA 2VTXA 4RS5B 4MH0E 5JOXA 4MHUA 4IEUA 4LK6A 3IBMA 5I0RA 1PGL1 3Q8BA 2WLPA 2GDFA 1OOPB 1KXGA 1CX4A 3OPTA 2YXSA 4MVTA 2LALA 2VZ1A 1QOSA 4YW2A 1QJX2 2EIBA 3J7HA 3AX4A 2R30A 3DPRA 1SBFA 3LA7A 3N9QA 5DZGA 1S0FA 5CFCA 3N9MA 3ZVXA 4YNIA 1IKQA 2PHXA 4QU1A 2UWCA 4UF0B 5FUNA 3JUUA 4GALA 1HRI2 4GULA 3ZN5A 4BZ4A 4XFIA 3GXUA 2JB8A 1QJU1 2WO7A 2WJSA 4Y5Z0 3ZSJA 4V2WA 1GANA 4IE7A 4CEYA 2A6WA 4INDA 1QNWA 5GLZA 3KCCA 3WHUA 1GNHA 2JD4A 1BXHA 1OUXA 4MGSA 3QH7A 4W50A 3UNPA 4K3UA 1H8TA 2X29A 3MZHA 2D98A 3B02A 4HT1T 2VULA 1J59A 1RITA 2E6VA 2BVBA 3ABZA 2ZGSA 2GC1A 2UURA 2H6BA 1ZA7A 4E4ZA 5CFDC 4BCUA 2RS13 1J1TA 2WO3A 4LBQB 2OZ6A 3ELNA 3RI8A 4XZPA 4DXTA 3S0MA 4IUGA 1CONA 2WYFA 3RVHA 1K5MA 3MLKA 1CAVB 3PUHA 3A4UA 1VAKA 4ATFA 2E7AA 4LEJA 4NRMA 4XF9A 3WW4A 2JDAA 3O0VA 5JMCA 3W9AA 1OC1A 4A42A 1GQHA 1RYYA 4FPYA 3NAPB 1H2KA 2P3JA 1W8WA 1W0OA 2JG8A 3MPBA 3W58A 4COUA 1C57A 3I2DA 4LBOA 2W1UA 4TYSA 1MS8A 3PURA 4EN6B 3RYKA 5C4WC 3NSTA 3LB9A 4CXWA 5I91A 4AGRA 2VVDA 4UFIA 1COV3 2Z79A 1UPIA 2XKOA 3FUOA 1PIV3 4UFJA 3THDA 5KXCA 2QQWA 3QH6A 4PJYA 1PVC3 4P14A 1C8M2 4OI4A 2GNDA 3CZJA 2XKPA 5J98B 3SKJE 4N43A 1AR71 2YBSA 1RUD2 1WZXA 2VZ3A 4QPGB 1XYOA 4QX7A 3MIFA 4ZONA 2ZGQA 3WV6A 1DZRA 2FBEA 1HRV1 1QXRA 3BIEA 5T3NA 3MIDA 3WW3A 4OULA 3UESA 2RM21 5DAWA 2X53S 4IV1C 2YUEA 1ULCA 5KC5A 2D3RA 2NM1A 3FFZA 3OPZA 4LXLA 4ZKTB 5JWPA 3M3IA 2N7GA 5IVVA 5KXDA 4C90A 1XQNA 2K9ZA 1WW7A 4CDUB 2PAEA 2JKBA 1FOD3 4J6GA 5L7OA 4ZXEA 1X36A 2OUHA 1AJOA 3K3NA 5FZ7A 1WMEA 3MGUA 3O1TA 5FY0A 3D0SA 1N3OA 2OQ6A 3I2KA 3M8LA 5CIRA 3T3YA 4M4RA 4Q0QA 1ND2C 3I4IA 4Q8LA 3VBRC 3AM2A 2GN3A 2Y6GA 1VMJA 2HWB3 2I07B 4OHXA 1JS9A 4QKDA 4Y22B 4GMP3 2RMU1 3D4KA 4XBLA 4QX2A 1LRHA 2DUQA 3JXSA 5IK5A 3QOPA 1VBB1 3WW1A 4AEDB 1HQLA 1OVSA 2GALA 1D4M2 4KBBA 4OI2A 3AZZA 1NA1C 2DU0A 4XIKA 4GB32 1UW8A 3FC0A 4N7IA 5CAZA 3K4AA 1DFQA 2AUYA 3AB0A 1EAH1 3VHPA 5C5TA 2GH8A 3AXDA 2QCSB 1GR3A 3SCFA 2B9UA 1TME3 3F95A 4Y24A 3WX5A 3X29B 2Z4FA 1R081 2ETEA 1TMF2 3B93A 5C9AB 2JDZA 3CL1A 5JLVA 5A33A 2GN7A 3K4ZA 3ZFFA 1NY72 4AFAA 4CEWA 2A6XA 1GU3A 1NXD1 5A70A 1IPKA 1NZCA 2WRAA 1HN0A 3H50A 1IKPA 4YZ4A 1W9TA 2AC1A 2HWF2 5DDJ3 5IVBA 2FDHA 5JVVA 4XFHA 1S2KA 1LULA 5T55A 3E1F1 4D8MA 3MW2A 5A1AA 2XVGA 3POWA 1MS4A 2JD9A 3S7IA 1YFWA 4BQ1A 3PVEA 5F9TA 3CDZB 5L9RA 3NV1A 2XJPA 5A3TA 2R071 5A7WB 5C6CA 5J37A 1QJZA 1NLSA 1D4VB 3AXEA 3D82A 4K20A 3TB0A 3KF5A 5J36A 2F4PA 2A6VA 1UYXA 2AACA 3H3UA 2EICA 3ZYFA 3POBA 5I0TA 4QGLA 3WDWA 1REFA 4AW7A 5GZCA 2BRTA 2ZMKA 1S4CA 3R0RA 4F7ZA 1PK6C 1W06A 3U07A 3KHCA 1VRH1 3OSDA 3BOPA 2Y38A 1IPJA 4QB2A 4F83A 3BTXA 4XQ4A 1OLME 5FYVA 1QMJA 4Y1UA 2I45A 2NYYA 3T0BA 2QUOA 4JKKA 4BPZA 3P3PA 2C24A 4FCAA 2VVFA 4G3YC 4XFCA 5FZBA 5C70A 5DUWA 4AHWA 2VD7A 3WSOA 5GALA 5D8AA 4GXLA 1GQPA 1ZZ9A 2EXIA 3VD9A 1KS5A 1FPN3 5FZ0A 2UYAA 2Y6JA 2GC0A 3UGGA 1K45A 1JODA 1HXS3 5LY2A 1OH4A 3AZWA 2Y6LA 1QDOA 3H8UA 1Q8SA 5FCCA 2D5HA 2FQPA 1GV9A 4TSVA 3TRSB 2WS93 3OGJA 4PCRA 4Q4W2 2XVLA 3FHAA 4IV3B 3RYPA 3ZFEB 2JB4A 5EJZB 3H7YA 3VBOB 1IS5A 1JYTA 3VKMA 4LA2A 2WZPP 3PU3A 1O3RA 5JXGA 4LLFA 5GZGA 5ERLA 4BK4A 2BUKA 3MIHA 4JGYB 5TSWA 5FK8A 1NQJA 3N7LA 4S2HA 4JHZA 1LECA 1SLAA 2AREA 3J9SA 5H9PA 4CPBA 3B9CA 5C3PA 3K75B 3QACA 4B4PA 1W0NA 4HG6B 3N7MA 4LUKA 2DDUA 1YLLA 4PLNA 4MGTA 3HAGA 2YROA 3MIBA 1LOEA 4JAAA 1ZBA1 4D3WA 2YB7A 4AEMA 5D2AA 1ZRFA 2OXBA 2WUHA 3HT2A 3P6BA 5ISLA 4LIUA 1G9CA 3GCWA 5BUVA 4E4HA 4QX3A 3J8F2 3WQ7A 5JIUA 3OJBA 3VBFC 1RUC2 4TXWA 1BQPA 5FMOL 4NPMA 3GJAA 2LS6A 1SDDB 4YZ1A 4PBOA 2XWJB 5LEJA 1Y7BA 2WFF1 4CDWC 3MF9A 2ZHLA 1DQ1A 3ZMOA 5HXMA 4NAMA 1AL0G 4QXCA 4A6OA 1MPXA 3NKTA 1OSGA 2D6OX 3UKTA 1W05A 1K12A 5C3QA 2VMFA 1ZREA 4LPLA 1B35B 3U4XA 5HCHA 4HKOA 2HJIA 3AKQA 4HMZA 2X5IC 1N3PA 1NOVA 3M7AA 3THCA 3VKNA 3C3VA 2QBXA 1UZYA 3TN92 2HEVF 3ZYGA 3MHZA 2C1FA 4GQ7A 4DRRA 4K6BA 2E63A 2XBO1 1UU5A 4MG2A 4AHYA 2Z2SB 1ZRRA 3WNLA 1PMJX 4MGKE 1NZIA 4N53A 1YFXA 4RR3B 5A3UA 1S0BA 3GF6A 2G9FA 1YC61 3CJIA 4XJ8A 1UYPA 2JG9A 3VBHB 1AYN2 3VBSB 4M0NA 4A44A 1V6KA 2YDEA 2QE3A 4YLZA 4Z2AA 1GBGA 1TQ5A 3VDBA 4O61A 5D21A 1YI9A 1QJY1 1E5RA 1WD3A 4BB3A 1JZ7A 1ACCA 2ERFA 4WVMB 2H6CA 3VDAA 3MPPG 2XLFA 2R1BA 1A3KA 5ABJA 4DUVA 5L19A 3SH4A 1JZ5A 3FHQA 1W9FA 4OHVA 1NX9A 3POIA 2Q8OA 3U1XA 4DXZA 4EJRA 2EAAA 3UETA 2ZHKA 3BUCA 1WCKA 1QJU3 2UWAA 1RC6A 2Y34A 4HSLA 3SISA 4XHXA 1W2NA 2BQPA 1RJ8A 2Q8EA 3OGGA 5F8PA 4QPWA 4RFRB 3NNGA 1LR5A 4W8JA 5LK7B 1GYKA 1FV3A 1ASJ2 2WNVA 1AZDA 2QZ3A 4I3PA 1F2NA 3NRUA 4BXSV 1FI2A 4NIDA 5AC92 2BDRA 4MX3A 4P9JA 4QPIA 4DZGA 4RS5C 4QX5A 2VZSA 1RMU1 1W8NA 1AL22 3KT7A 4YVSA 3GZEA 1IS6A 1YIPA 3AL5A 1OOPC 1YQ6A 3VDDA 3H1YA 3RQ0A 3RZZA 4ASKA 2AZ5A 2B39A 1W6QB 1C1LA 1WCSA 2R042 4Y26A 3LD8A 5FJKA 4BLIA 1CZSA 1BK0A 5FO9B 2RG4A 1NCRA 1HN1A 1RUH1 5JUVA 1JYVA 2ATFA 1I1EA 4NMIA 1LGCA 2DUPA 4Q5OA 4YG3A 1G9DA 5FLJA 3T1LA 4OI0A 1POV1 1A6CA 2XL9A 2A3YA 4XILA 3HIFA 2E7TA 2RS52 1LENA 2B8MA 2XUEA 1WBFA 3A0NA 3NNJA 1CX1A 3SXWA 1U5ZA 1YRZA 2ZGKA 3NMBA 3SHRA 1HRV3 3AP7A 2HWE2 3VKLA 5F1RA 3J7LA 4AI2A 4XF1A 2VM9A 2RM23 1I3HA 4IDZA 2VBPA 2DCYA 1VBC1 4Y1XA 5EJ3A 1QOOA 5IW0A 4LHNA 4CUBA 3BIWE 2VH9A 4LQRA 3USSA 1G9BA 1JBCA 2CDOA 1VAVA 2VVEA 3PU8A 1OKQA 4RFT0 2BERA 4XTMA 4K1YA 4IERA 1BCXA 2WNOA 3NAPC 5IAXA 2F6BA 2JX9A 2D6MA 4NJ4A 2G19A 2BNOA 3VD4A 2VQTA 4HVRA 3INAA 1W3XA 1ENRA
chains in the Genus database with same CATH topology
2YBKA 5FXXA 4XDPA 5FY1A 3KVAA 5CEHA 2YU1A 4NUBA 5FP4A 2Q8CA 5FXVA 5FV3A 3LDBA 5F2WA 5FZFA 3PDQA 2W2IA 5A7QA 5IVEA 4GJYA 2XDVA 5A3TA 5F5CA 4BXFA 4C8DA 4UF0A 5A7WB 2Q8DA 1VRBA 5FZHA 4AI9A 3PTRB 5FUPA 3NJYA 4D6QA 4QWNA 4GJZA 5A80A 4CSWA 3KV4A 2WWJA 3RVHA 2OT7A 5FY8A 5FZOA 5FWJA 5FZ6A 3N9PA 2YBPA 2XXZA 4CUGA 5FYZA 5K4LA 3AVSA 4Y3OA 5A3WA 5IVYA 3PURA 5A7WA 3N9OA 5A7NA 2P5BA 5FZ4A 5F37A 5LWBA 3PUAA 5FYVA 5FZMA 5FP7A 3UYJA 5FZDA 3U4SA 4DO0A 5FPLA 5F3CA 5FZBA 4GD4A 5FZ8A 5FZ3A 3KV5A 5FY5A 4URAA 2YBSA 2VD7A 5F5AA 5FZAA 2Q8EA 4LITA 4IGOA 4QX7A 5F3GA 4BU2A 5FY9A 4EZHA 5FPBA 5A3PA 5FZ0A 2PXJA 3N9NA 3PUSA 5LY2A 5FYMA 4Y33A 4AAPA 2WWUA 3OPWA 4IGQA 5FY4A 5FZ9A 5FXWA 4V2VA 4D6SA 2GP5A 5FZCA 4LXLA 4CCOA 3ZPOA 5IVVA 5FPAA 3AL5A 3DXUA 2YPDA 2OS2A 4CCKA 4HOOA 3PU3A 4QXBA 4ASKA 3PUQA 4CCLA 3KVBA 2OQ7A 5F5IA 5FYIA 4CCMA 3K3NA 5FZ7A 4QX8A 5F32A 4DIQA 3LD8A 3N9LA 5FJKA 5FY0A 4CCJA 2OQ6A 3K3OA 5ANQA 5F3EA 5FPVA 4CCNA 3U78A 5FZ1A 5FXZA 5LY1A 5FPUA 5IVFA 5FBJA 2XMLA 5FZLA 5A7OA 4EZ4A 3K2OA 2GP3A 3AL6A 5FZIA 5FYUA 2XUEA 5ISLA 4LIUA 5FZGA 3KV6A 5FJHA 5FYHA 5FYTA 4TN7A 5FYBA 5A7SA 5A1FA 4BISA 4E4HA 5FYSA 4QXHA 3OPTA 5FZEA 4GAZA 4EYUA 5F39A 5IW0A 5LW9A 3ZLIA 5FWEA 5FP3A 5FYCA 4LIVA 5F3IA 5FZKA 3N9QA 2YU2A 3DXTA 3KV9A 2OX0A 3N9MA 4QXCA 4QU1A 5IVCA 3PU8A 5FUNA 4UF0B 5IVJA 5A7PA 4HONA 3AVRA 4Y4RA 5FYYA 5A1LA 5FP9A 5FY7A 4XDOA 5KR7A 5F2SA 4V2WA 4D6RA 4IGPA 5FZOB 5IWFA 5IVBA 5FP8A 5E6HA 5A3NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YBK A;  5FXX A;  4XDP A;  5FY1 A;  3KVA A;  5CEH A;  2YU1 A;  4NUB A;  5FP4 A;  2Q8C A;  5FXV A;  5FV3 A;  3LDB A;  5F2W A;  5FZF A;  3PDQ A;  2W2I A;  5A7Q A;  5IVE A;  4GJY A;  2XDV A;  5A3T A;  5F5C A;  4BXF A;  4C8D A;  4UF0 A;  5A7W B;  2Q8D A;  1VRB A;  5FZH A;  4AI9 A;  3PTR B;  5FUP A;  3NJY A;  4D6Q A;  4QWN A;  4GJZ A;  5A80 A;  4CSW A;  3KV4 A;  2WWJ A;  3RVH A;  2OT7 A;  5FY8 A;  5FZO A;  5FWJ A;  5FZ6 A;  3N9P A;  2YBP A;  2XXZ A;  4CUG A;  5FYZ A;  5K4L A;  3AVS A;  4Y3O A;  5A3W A;  5IVY A;  3PUR A;  5A7W A;  3N9O A;  5A7N A;  2P5B A;  5FZ4 A;  5F37 A;  5LWB A;  3PUA A;  5FYV A;  5FZM A;  5FP7 A;  3UYJ A;  5FZD A;  3U4S A;  4DO0 A;  5FPL A;  5F3C A;  5FZB A;  4GD4 A;  5FZ8 A;  5FZ3 A;  3KV5 A;  5FY5 A;  4URA A;  2YBS A;  2VD7 A;  5F5A A;  5FZA A;  2Q8E A;  4LIT A;  4IGO A;  4QX7 A;  5F3G A;  4BU2 A;  5FY9 A;  4EZH A;  5FPB A;  5A3P A;  5FZ0 A;  2PXJ A;  3N9N A;  3PUS A;  5LY2 A;  5FYM A;  4Y33 A;  4AAP A;  2WWU A;  3OPW A;  4IGQ A;  5FY4 A;  5FZ9 A;  5FXW A;  4V2V A;  4D6S A;  2GP5 A;  5FZC A;  4LXL A;  4CCO A;  3ZPO A;  5IVV A;  5FPA A;  3AL5 A;  3DXU A;  2YPD A;  2OS2 A;  4CCK A;  4HOO A;  3PU3 A;  4QXB A;  4ASK A;  3PUQ A;  4CCL A;  3KVB A;  2OQ7 A;  5F5I A;  5FYI A;  4CCM A;  3K3N A;  5FZ7 A;  4QX8 A;  5F32 A;  4DIQ A;  3LD8 A;  3N9L A;  5FJK A;  5FY0 A;  4CCJ A;  2OQ6 A;  3K3O A;  5ANQ A;  5F3E A;  5FPV A;  4CCN A;  3U78 A;  5FZ1 A;  5FXZ A;  5LY1 A;  5FPU A;  5IVF A;  5FBJ A;  2XML A;  5FZL A;  5A7O A;  4EZ4 A;  3K2O A;  2GP3 A;  3AL6 A;  5FZI A;  5FYU A;  2XUE A;  5ISL A;  4LIU A;  5FZG A;  3KV6 A;  5FJH A;  5FYH A;  5FYT A;  4TN7 A;  5FYB A;  5A7S A;  5A1F A;  4BIS A;  4E4H A;  5FYS A;  4QXH A;  3OPT A;  5FZE A;  4GAZ A;  4EYU A;  5F39 A;  5IW0 A;  5LW9 A;  3ZLI A;  5FWE A;  5FP3 A;  5FYC A;  4LIV A;  5F3I A;  5FZK A;  3N9Q A;  2YU2 A;  3DXT A;  3KV9 A;  2OX0 A;  3N9M A;  4QXC A;  4QU1 A;  5IVC A;  3PU8 A;  5FUN A;  4UF0 B;  5IVJ A;  5A7P A;  4HON A;  3AVR A;  4Y4R A;  5FYY A;  5A1L A;  5FP9 A;  5FY7 A;  4XDO A;  5KR7 A;  5F2S A;  4V2W A;  4D6R A;  4IGP A;  5FZO B;  5IWF A;  5IVB A;  5FP8 A;  5E6H A;  5A3N A; 
#chains in the Genus database with same CATH topology
 3PJQ A;  3PUI A;  4OZX A;  2YG0 A;  5HCF A;  1UD1 A;  3HEI A;  5K9Y A;  1AR9 2;  5F2W A;  4QKB A;  4BME A;  2HYK A;  3OGV A;  4BXF A;  4QPG C;  1WW6 A;  4YPJ A;  1IQD C;  2R6Q A;  4JC1 A;  2BWC A;  2ZCW A;  3HD8 B;  2C26 A;  2RMU 3;  2Y0I A;  3PTR B;  4GJZ A;  4OUM A;  1H30 A;  1PO2 2;  1V6L A;  3KV4 A;  4AGG A;  1V6I A;  3M2M A;  5FFO C;  3VGI A;  4WM7 A;  1VBB 3;  3FJS A;  1RUF 2;  2OA2 A;  3LFI A;  3T4H B;  4Y20 A;  3III A;  3AMN A;  2FCT A;  3LQC A;  1PNG A;  1EAH 3;  2XGX A;  3GM8 A;  4CA9 A;  2A71 A;  3ZM8 A;  2J22 A;  1Y4W A;  2H0V A;  1N1Y A;  3UKV A;  1MVQ A;  2QVS B;  1R08 3;  2VMH A;  5GLT A;  1O8P A;  1X9T A;  2D7F A;  4CDU C;  5JSP A;  4CDQ A;  1UIJ A;  1K42 A;  2LTN A;  1SFP A;  2IC1 A;  4MHR A;  2A3X A;  1PO1 1;  1WCU A;  2RDS A;  4CYD A;  5I0S A;  2MEV 1;  2P3K A;  2J1A A;  3AZX A;  5KHJ A;  2D3S A;  1W6P A;  3B00 A;  1V9U 1;  2VMD A;  2BVV A;  2F17 A;  2QQV A;  1LKN A;  4UW3 A;  3WEZ A;  4J1W A;  3AJZ A;  2WDB A;  2RDR A;  5FK7 A;  1UMZ A;  4P9W A;  1JYN A;  1C28 A;  2QQU A;  4U36 A;  3HNM A;  2IVJ A;  3O7O A;  4QM8 A;  4Y33 A;  1GWM A;  2WWU A;  1RUE 2;  2R07 3;  1VB2 A;  3UGF A;  3FX3 A;  3I8T A;  4PF1 A;  4KMQ A;  1UOJ A;  4PDW A;  2ZS6 B;  4AED C;  1JUH A;  1AYM 1;  4EE2 A;  1N1T A;  1ZZ7 A;  1JOP A;  3USU B;  3BN6 A;  3VZK A;  5LA0 A;  2XPJ A;  1CN1 A;  4BYY A;  1W8T A;  1YI7 A;  3PUQ A;  3S57 A;  4G9S B;  1EPW A;  2WIN B;  3KD4 A;  4LK7 A;  4YWA A;  4MO3 M;  4XUR A;  1S0C A;  5C9A C;  5EP9 A;  3AMP A;  4FOW A;  4ZXK A;  4D7Y A;  5JPN B;  3JCI A;  2HLE A;  1VRH 3;  2JDK A;  2EXJ A;  3PVN A;  1QWR A;  3WCR A;  3GDB A;  3SCG A;  4XAB A;  3MLJ A;  3R6S A;  3VZM A;  1LNS A;  3O1V A;  1UX6 A;  3I2J A;  1LOG A;  2ADE A;  4XFG A;  2CU5 A;  4FFI A;  1MEC 1;  3AP6 A;  4DXS A;  3OBR A;  4NPL A;  1UOG A;  2DWR A;  1BYH A;  4RGA A;  3BYW A;  4OQ9 A;  5FOB B;  5FYT A;  1RHI 1;  3I2G A;  1PVX A;  2BGO A;  5JDB A;  1DDL A;  4CU9 A;  5FZE A;  2J1U A;  1S0J A;  2QZ2 A;  4GAZ A;  3GAL A;  5JZG B;  4UW5 A;  4AWD A;  1D0H A;  4FP2 A;  2EAL A;  5KXB A;  5FP3 A;  4B1M A;  3RZJ A;  1ND3 A;  2W95 A;  4FAG A;  1Q8O A;  2DF7 A;  2YU2 A;  3FMG A;  2DUR A;  2GNB A;  1GZ9 A;  2HWD 1;  4MUV A;  2OZJ A;  5A7P A;  4BQ5 A;  1F15 A;  4YW1 A;  3ZX7 A;  2B7Y A;  1KGY A;  4Y4R A;  4NN0 A;  3VKO A;  4Q0V A;  3HQR A;  1TZO A;  2AEY A;  4P9Y A;  5A32 A;  1QJX 1;  4BQX A;  4WM8 B;  4JGZ A;  1LJ7 A;  1MZ6 A;  4RN5 A;  1T6B X;  1MS0 A;  3ZXJ A;  3BKZ A;  1XB9 A;  3RMY A;  3O14 A;  4LKD A;  1QU0 A;  1Q56 A;  3HQU A;  5FO8 B;  3RZG A;  1QKQ A;  1LHO A;  1PM7 A;  3MUZ 1;  4AVC A;  3LKJ A;  1IGO A;  1NG0 A;  5IJR A;  1ZBA 3;  2WT2 A;  5DQ0 A;  4E2S A;  4L9B A;  4MSV A;  4O9G A;  3KQ4 B;  4A4A A;  2PQS A;  2KA3 A;  1J58 A;  4OHY A;  3VZL A;  2EXK A;  3I49 A;  4YFZ A;  3IM0 A;  3HBK A;  4H7M A;  1N47 A;  2VQU A;  3NO8 A;  4YFW A;  5HXV A;  5LA9 A;  3ZFE C;  1TNR A;  2WQ4 A;  4XAA A;  3WP3 A;  2OPK A;  1CAW B;  3VBO C;  2HH9 A;  3T2P A;  5LEK A;  2VOX A;  2WFF 3;  2VNG A;  2XB6 C;  4H7L A;  1VIW B;  3PVB B;  5FKC A;  3T08 A;  1WA4 A;  4PQQ A;  4RGK A;  5LCW L;  4XXA A;  5FZD A;  4TLG A;  3NJX A;  4B7K A;  4JGY C;  2RS1 2;  5DPN A;  2JEC A;  3DEM A;  5J1X A;  3CLP A;  4NIG A;  2XQR A;  1CJP A;  5JOZ A;  3DN7 A;  3ACG A;  3LDR A;  2XH6 A;  2WAO A;  3LEK A;  4KGG A;  1PGS A;  3WNP A;  3POG A;  4EZH A;  3ACH A;  3OF1 A;  2C6S A;  4LUM A;  5CAD A;  1K5M C;  2Z5W A;  3WG4 A;  1AXY A;  5I0D A;  3P3N A;  4AAP A;  1C8M 1;  1FYU A;  2VU9 A;  2DVG A;  2XBO 3;  4K40 A;  4KWL A;  1RUD 1;  1W9S A;  4A3Z A;  5DAB A;  3ZDV A;  4AI3 A;  3O1P A;  3T0D A;  2JG8 C;  3MI8 A;  4UFH A;  3ZIW A;  3DXU A;  4YW5 A;  4URT A;  2QJV A;  5BNP B;  2OS2 A;  1PIV 2;  2UY9 A;  1X33 A;  4J25 A;  2GMM A;  1PVC 2;  1FX5 A;  1UYY A;  4GIQ A;  4V1P A;  1Y9G A;  2GNM A;  3KVB A;  4CCL A;  1MZE A;  1QJY 3;  5FMC A;  2Y6K A;  2UY8 A;  4JTN A;  3WXP A;  2ZAA A;  1XU1 A;  4Q0S A;  2DYC A;  2RJ2 A;  4A7K A;  4HKW A;  1CAX B;  4L8Q A;  2Y8K A;  1CQ9 A;  4PIX A;  3U14 A;  3VBU A;  2DCK A;  3CBN A;  5LBF A;  3VV1 A;  5FPU A;  5LY1 A;  1B35 C;  4YZ2 A;  2IXK A;  3KB5 A;  3LSD A;  1LU1 A;  2EIG A;  3ME2 A;  1OA2 A;  1C8N A;  1VP6 A;  2CWS A;  3BAL A;  2IXJ A;  3I3B A;  3DYO A;  1RGS A;  4IEW A;  2BZD A;  5A7S A;  1E5I A;  1FOD 2;  1H9P A;  1H1A A;  5FYS A;  2VBD A;  1VPH A;  2WR9 A;  5DAQ A;  4W6Y A;  4MGI E;  1TNF A;  4NII A;  4BWO A;  3TWI A;  1UY0 A;  4KNC A;  3DKW A;  4LBK A;  5FZK A;  3KGZ A;  4LIV A;  1UZZ A;  4QB6 A;  4RGG A;  1RMU 3;  1LOF A;  3O5S A;  2ZAH A;  3ILR A;  2B42 B;  3VBH C;  3VBS C;  1W6M A;  4YM2 A;  1R09 1;  2WQ8 A;  1NYW A;  4AGV A;  2KR2 A;  2ADD A;  3AKS A;  2A75 A;  2D3P A;  3AZV A;  4LHK A;  1UAI A;  2HWB 2;  1WBL A;  1ZZC A;  3APB A;  1U5Y A;  2WA4 A;  3SH3 A;  1G8W A;  4Q27 A;  1CGP A;  1AF9 A;  2XON A;  4IE5 A;  1MS9 A;  2XVK A;  3LA2 A;  1JYW A;  2Q1F A;  4CP9 A;  4K7J A;  1PNF A;  4I30 A;  3GGL A;  4IES A;  4K21 A;  3LEG A;  4KWJ A;  3S5Q A;  4QM9 A;  3OB8 A;  1TMF 1;  4R8H A;  2YU1 A;  3WUD A;  1HB4 A;  1RUH 3;  5J7M A;  1KEX A;  4N9I A;  4GJY A;  2R1D A;  4MXW A;  3NNF A;  4OVE A;  4AE2 A;  3ZYR A;  1POV 3;  2AGS A;  3ECQ A;  1U5X A;  1O8S A;  2R49 A;  4QWN A;  4S2D A;  4AI1 A;  2HWF 1;  4BQW A;  1IHM A;  2P17 A;  4RD7 A;  3AP5 A;  5CKN A;  2IVI B;  2DFC A;  3NNL A;  2JKX A;  5BV6 A;  1WMF A;  3EMR A;  3ZFF C;  5EIY B;  5JSO A;  4CEW C;  5DDJ 2;  4IEV A;  4LKE A;  5FYZ A;  3U75 A;  1VBC 3;  2VUD A;  5BNN A;  1UY2 A;  2FDF A;  4KL1 A;  4LO6 B;  1O3S A;  1FNZ A;  2ZKN A;  3CHX A;  2ZKL A;  3EXU A;  1YO8 A;  3N9O A;  4QT6 A;  5DXD A;  3RDI A;  5A7N A;  4AR2 A;  5F37 A;  5LWB A;  3BGA A;  1ODN A;  2NN8 A;  1J3Q A;  5E8A A;  5BNO A;  2JDH A;  2QNK A;  2GAU A;  2A7A A;  1W99 A;  2WNU A;  4JX0 A;  5FZ8 A;  1EUT A;  5JXH A;  1LOA A;  1H9W A;  2Y64 A;  4UWD A;  5T50 A;  5C8C B;  2PHT A;  3WD5 A;  4BU2 A;  3RZH A;  4COZ A;  4AF9 A;  3NJV A;  1RUI 2;  1ALY A;  2RE9 A;  3SCH A;  4KQ7 A;  1V70 A;  3FFQ A;  3OEA A;  5GZD A;  3DYM A;  1D2S A;  2PLV 1;  5FZ9 A;  5FY4 A;  4NHL A;  2W1W A;  4FPH A;  4RQP A;  1F8V A;  4LOT A;  4QB1 A;  4IEO A;  4O9E A;  4N90 A;  4YVW A;  2ORX A;  1W2T A;  5C3S A;  4LE4 A;  3JBG 3;  1XOY A;  3GBG A;  2ZMN A;  2HBU A;  2LUW A;  4QQP A;  4YRD A;  3RSJ A;  1VJ2 A;  1I5P A;  3E6C C;  1VBA 1;  4KU8 A;  3H8O A;  1LOC A;  4M3C F;  5FOJ B;  4Q4W 1;  4DMI A;  4CPB D;  4MV2 A;  4U2A A;  5JIA A;  3MDP A;  4MYE A;  3TEW A;  5F3E A;  4CDX B;  4D69 A;  1NUK A;  3F2Z A;  1SEF A;  3U78 A;  3CJX A;  4ZPI A;  4BQ4 A;  2JDM A;  3AMQ A;  1S0E A;  4JHT A;  1PO1 3;  1U5I A;  1LHU A;  5FZL A;  5A7O A;  2QQP A;  2V5Y A;  5K0U A;  2MEV 3;  4SBV A;  1PM4 A;  3H7J A;  4AVT A;  3IDC B;  5KC6 A;  1V9U 3;  2RS3 2;  1R1A 1;  2RHP A;  2ZOE B;  1Y43 B;  4Q4Y 2;  1QXP A;  3OG2 A;  3OY8 B;  4FPL A;  2CV6 A;  3AP9 A;  1YJK A;  2YFZ A;  3M3E A;  4L0P A;  4HK8 A;  1UL9 A;  1UQX A;  2ZA9 A;  4JDM A;  1G7Y A;  2JDY A;  2DVA A;  3H3L A;  4E8D A;  5LW9 A;  4GH4 A;  3U0Z A;  4CE8 A;  5SV8 A;  1CIY A;  1KDM A;  1UZ0 A;  3B5L B;  4Z8B A;  3RNS A;  1YYN A;  3ZSK A;  1AYM 3;  3FLT A;  2I74 A;  2FZ1 A;  1DCS A;  3J8F 1;  2KD7 A;  4E4D X;  4XQD A;  1LAJ A;  2PFW A;  4NHX A;  4HLT A;  4XDO A;  2ZJC A;  3NW4 A;  4QXK A;  1K3I A;  2DVB A;  3V0A A;  2W94 A;  5EV7 A;  4CU6 A;  5ANN A;  1OLR A;  3ST7 A;  3ILN A;  4PF5 A;  2YYO A;  1IQA A;  2VXJ A;  3R05 A;  5FZF A;  4KI5 M;  5A6Y A;  1ZBE 1;  3WDY A;  2Q0A A;  1AX0 A;  3RS6 A;  5CG9 A;  2WO2 A;  1W6N A;  3O1R A;  3N3H A;  5CG8 A;  3WQ0 A;  4EN7 B;  2P37 A;  4XZU G;  1NCQ A;  4TTG A;  1UPS A;  3M3C A;  2IXH A;  1SQ4 A;  2QKD A;  5KHG A;  1SZB A;  2Y6H A;  1MEC 3;  1OKO A;  2NP0 A;  5G05 L;  4HSJ A;  2FMY A;  2TEP A;  4XF0 A;  1J3P A;  5CBL A;  4M3C B;  1RHI 3;  4JQT A;  2WSU A;  1MQT A;  2V5D A;  1RUN A;  3VDC A;  1T2X A;  1OFN A;  1AVB A;  3OYW A;  3T0A A;  2XXZ A;  4KU7 A;  5EQU A;  5A3W A;  2R06 2;  1D0G A;  1H0B A;  1UXX X;  2XJV A;  4XEZ A;  3TEZ A;  1DBN A;  3FWE A;  4YGB A;  1AYN 1;  1NT0 A;  2A6Y A;  2HWD 3;  3TOJ A;  4XJU A;  3IN9 A;  2ZX4 A;  2LRP A;  1IG0 A;  4DB5 A;  1HB1 A;  3KV5 A;  1LEM A;  2P2K A;  1US3 A;  1QJX 3;  2PHR A;  1T6G C;  3WIN E;  4IGO A;  2B4K A;  1AR8 2;  5FY9 A;  4RYD A;  1L3J A;  1QH7 A;  3JZV A;  3OTF A;  4XW3 A;  1DIW A;  4AAX A;  1HB3 A;  5LK5 A;  4ZZ8 A;  3ZFG B;  2YY1 A;  5IHR A;  3LOI A;  4LR4 A;  4QU2 A;  1VBE 2;  4KBZ A;  1C4R A;  1E5H A;  4NRP A;  4K8R B;  4V2V A;  4D6S A;  4IEZ A;  1J3R A;  3NNM A;  2J1S A;  3JD7 1;  3ZN4 A;  2R0F A;  4Q2F A;  1XBF A;  1YNA A;  2WAB A;  1AUY A;  1PZ9 A;  4AQT A;  5JZG C;  3KS7 A;  5CFD A;  2E51 A;  1JHJ A;  1QJU 2;  2XG3 A;  3MUY 1;  2L9L A;  4DPN A;  2C4X A;  2PA7 A;  1F4H A;  4YGD A;  1FAY A;  3ATG A;  5CB7 A;  4LTA A;  4XVH A;  4DIQ A;  1HDK A;  2CGO A;  1DHK B;  4ORF A;  2EVX A;  4BLJ A;  5CIS A;  3LIH A;  4GWM A;  1UZV A;  2WBK A;  4EQV A;  1Q5O A;  4XBN A;  4NR1 A;  3WY6 A;  1UU4 A;  1W0P A;  2IFW A;  1BKZ A;  3DPR B;  3AYE A;  4WM8 C;  4DFS A;  5CFC B;  5AFB A;  2R04 1;  5C4W A;  3ROU A;  5FYU A;  4QPI C;  2RV9 A;  3ORJ A;  3HBZ A;  3I59 A;  2SLI A;  5FYB A;  5GLU A;  4C1X A;  5L7O B;  2A73 B;  4AFD A;  4QXH A;  2CNA A;  4BMB A;  5LRR A;  4HXC A;  1G9A A;  2P1B A;  1UOF A;  4DIN B;  2V09 A;  5F39 A;  4D94 A;  3A21 A;  4COY A;  2VTX J;  1C8M 3;  2BNM A;  1FXZ A;  3AYA A;  3D0J A;  4JQR A;  2RS5 1;  3PIJ A;  2EIE A;  4QQH A;  1H8T B;  1RUD 3;  4QX0 A;  5AVP A;  1ZA4 A;  2OX0 A;  3GBW A;  1F5F A;  4IV1 A;  2NMN A;  4R9C A;  3V0B A;  1FT9 A;  2C5D A;  3KGL A;  1PZ8 A;  4XOG A;  1AR7 2;  4FTB A;  1K5M B;  3N36 A;  4AFC A;  3VD5 A;  4IGP A;  1GP6 A;  2JEM A;  1RIN A;  1YUD A;  3HR9 A;  4E9K A;  1XRU A;  1WKY A;  4RHV 1;  4ATE A;  4MET A;  2PHD A;  3AKP A;  5FY1 A;  2HWC 1;  2JG8 B;  2W2I A;  1QDC A;  3IPV A;  2BU9 A;  2JDN A;  2ES3 A;  3I2F A;  2Q8D A;  3JB8 A;  2ZGU A;  5FUP A;  3E5X A;  5A80 A;  3EYP A;  5DUX A;  3FE5 A;  1ND2 A;  5DG2 A;  3ETP A;  4AI8 A;  3VBR A;  2Q5T A;  3N4M A;  1YQ8 A;  3GHM A;  2EXH A;  3GNE A;  1HV1 A;  4N43 B;  1O5U A;  1U12 A;  3EJK A;  4XJA A;  1PZ7 A;  1UXZ A;  4JZR A;  5FKB A;  1E5S A;  4X6R B;  3D5O A;  4FPF A;  5CZK A;  3WHT A;  1SMV A;  1NA1 A;  3ZXD A;  1QJE A;  5BNP C;  3H8R A;  1PO2 1;  3WP5 A;  3EO6 A;  4CP0 A;  2QDR A;  5E1R A;  4Q4X 1;  1NLR A;  1R09 3;  2G1M A;  4FVV A;  4M3C E;  1LOD A;  2BOJ A;  3B3Q E;  1D4M 3;  1DLC A;  3ES4 A;  3HJR A;  2VW0 A;  5FLI A;  2BWA A;  3ENR A;  3CEW A;  3E5U A;  4GD4 A;  2FCU A;  1QIQ A;  4W65 A;  1VBD 2;  1GZC A;  5FMD A;  5T5P A;  5B4X A;  1VBB 2;  3THP A;  1E57 A;  1BBT 1;  5LAS A;  2XOM A;  1QNY A;  4AVV A;  1UX7 A;  1ULP A;  4H14 A;  1TMF 3;  5A3P A;  5L9V A;  3C8X A;  2E9Q A;  3N9N A;  4ES8 A;  1QQP 2;  2F4L A;  3USU A;  4WM7 C;  5FPX A;  4FPG A;  3B94 A;  2W52 A;  4IGQ A;  4L11 A;  2RR1 2;  3SEP A;  4MOA A;  4AL9 A;  1YHF A;  1JZ4 A;  3PNA A;  3W5N A;  4XYX A;  2RDN A;  2HWF 3;  2BBA A;  2Q1Z B;  5FPA A;  3SNM A;  5CKQ A;  3N7J A;  1HW5 A;  4C0B A;  4GA9 A;  2GU9 A;  1QF3 A;  1JU3 A;  4P9G A;  2XR4 A;  4ASL A;  3BU0 A;  1XE0 A;  2VNR A;  2AYH A;  1L7L A;  1RUE 1;  3SEE A;  4CCJ A;  4KG8 A;  1IOA A;  2DTY A;  1EP0 A;  2VZR A;  2VC9 A;  3A23 A;  3A22 A;  3LF7 A;  1XE8 A;  3IKW A;  4HN1 A;  4IEY A;  2DCT A;  1GZW A;  1OUR A;  1WCQ A;  1HJF A;  4UOJ A;  5LA2 A;  1PK6 A;  1WA6 X;  1OH3 A;  2DTW A;  1CZT A;  2QQM A;  4OUS A;  2ZGR A;  2R07 2;  3OD4 A;  5GKA C;  1NLQ A;  5HI0 A;  4LT5 A;  1F31 A;  5DMY A;  4GWI A;  3OBT A;  5H9R A;  4ISR A;  1WGP A;  4BQ2 A;  1WUV A;  4QHB A;  4YW7 A;  1PGW 2;  5A33 B;  1C1F A;  1GNZ A;  2ZGN A;  3ZFF B;  1BHG A;  4CEW B;  3KV6 A;  1V00 A;  4IEX A;  1FMD 2;  4BIS A;  1UY3 A;  3ASI A;  1H2L A;  2E32 A;  2QQO A;  1IPS A;  4NRO A;  2VO5 A;  3BOD A;  4WZF A;  5DUV A;  2VOK A;  2RVA A;  1CR7 A;  4EYU A;  4XFB A;  3HN3 A;  3W20 A;  1ENX A;  1P8J A;  2PLV 3;  2V4V A;  2SBA A;  5GLW A;  5SV5 A;  1UCX A;  4XAC A;  4CRQ A;  2D6P A;  3Q8E A;  2CWM A;  1W6O A;  2ZML A;  4BHP A;  3J4U H;  5DAX A;  1QJF A;  4EWE A;  4B7E A;  5KXE A;  2D40 A;  2CGN A;  2W3J A;  3IAQ A;  1RVF 2;  1DQ5 A;  5F6L B;  4FI9 A;  1AR6 1;  2BGC A;  4IEQ A;  3H9A A;  4FOV A;  4Q4V 1;  4BQ3 A;  4RA0 A;  1ULD A;  1QH6 A;  1VBA 3;  2PHW A;  1Y9M A;  2VZU A;  3FN9 A;  2ENR A;  1CAU A;  2B46 X;  1MZ5 A;  3NV4 A;  4Q4W 3;  5FP8 A;  4AXO A;  2KM2 A;  2X10 A;  5FMB A;  2TNF A;  4XDP A;  3O1U A;  1O91 A;  2BBV A;  1NE6 A;  5FV3 A;  1W28 A;  1X8M A;  4DNY A;  5FQ0 A;  1F5J A;  4FQZ A;  3ZSM A;  5C8C C;  4DY3 A;  4UFM A;  4FFH A;  2TBV A;  2FDK A;  3IB3 A;  4CU8 A;  3H8X A;  5FR3 A;  4JKL A;  3LWC A;  3K4D A;  4CSW A;  2E7Q A;  2WWJ A;  1RIR A;  1ND3 C;  1R1A 3;  3VL8 A;  2ZHN A;  4WVZ A;  5FZO A;  4HAN A;  2XQX A;  1WW4 A;  4PIZ A;  3WP6 A;  2A6Z A;  5ACA 2;  3N9P A;  4HK9 A;  4BIF A;  5D8A B;  3ZN6 A;  1TEI A;  4XE9 A;  1SCR A;  4CP1 A;  5KWR A;  5K4L A;  5J96 B;  3FLP A;  2YMZ A;  3BPZ A;  5IVY A;  4A45 A;  4D7T A;  4AQ2 A;  4BK5 A;  3VBF A;  1Q43 A;  3UGH A;  2QQK A;  4A7Z A;  5A6Z A;  3PUA A;  4CXY A;  5IFT A;  2P3Y A;  1CIW A;  4PBP A;  3SH5 A;  3J8F 3;  3SLI A;  4QDQ A;  2JEN A;  4CDW A;  2W39 A;  2ORZ A;  4OHW A;  1RUG 2;  2VNV A;  4EWD A;  5FO7 B;  1H1I A;  4RSU A;  4W6W A;  2OW4 A;  3K51 A;  2HYX A;  4LIT A;  1OLQ A;  4CDX C;  4XQW A;  1O3T A;  2WAA A;  3DYP A;  3IT8 A;  3GZT B;  3JB4 C;  1BEV 2;  2ET7 A;  3B69 A;  4GKX A;  4NO4 A;  1ZBE 3;  4PT6 A;  1JXN A;  3JBG 1;  1GIC A;  4P9L A;  1YEW A;  5GM0 A;  2VBB A;  2G9G A;  1KQR A;  3PVO A;  4XCA A;  3I2I A;  2DV9 A;  3KHB A;  4LMF A;  1N3Q A;  1YJL A;  2ZEY A;  1YWK A;  3SC7 X;  2BP6 A;  2CSG A;  2X5I A;  3B01 A;  1SAC A;  1UY1 A;  3I3M A;  2IXL A;  2DVD A;  1NQD A;  3CKH A;  4YM1 A;  3LCP A;  4UBG A;  3UL2 A;  2PHU A;  4WV8 A;  1WD4 A;  4HPK A;  4ARX A;  2YPD A;  4ZS2 A;  1O5L A;  2C0Z A;  4CUC A;  4HOO A;  4XDQ A;  2XJQ A;  4YW3 A;  1RUO A;  5EJ1 B;  4EV0 A;  3WNK A;  3HWJ A;  4N7U A;  1L7Q A;  1Q8V A;  1ZZB A;  2OQ7 A;  3ACF A;  3WT3 A;  1LU2 A;  2C9A A;  5FDB A;  2VW2 A;  3OD0 A;  2K46 A;  1W03 A;  4B29 A;  3ZO0 B;  2IZW A;  3GHN A;  1O6U A;  2GZW A;  4R9A A;  5FLH A;  1AYN 3;  3ZYJ B;  2ZBJ A;  2QTW B;  4Y1Z A;  5J3U A;  3LPG A;  4Q0U A;  3VUO A;  2VGD A;  4QGM A;  3LA3 A;  5FRA A;  1QY4 A;  5FBZ A;  1UYZ A;  5FZG A;  4AG4 A;  4BE3 A;  1WLT A;  4TN7 A;  1FNY A;  5EXO A;  1SPP A;  2YHJ A;  5C7G A;  5JI7 A;  1CPN A;  2WT0 A;  5DG1 A;  1XXN A;  2CDP A;  1R64 A;  5C3R A;  2IXI A;  5FYC A;  4KG0 A;  5F3I A;  1EV1 1;  1ZZ6 A;  2K2S A;  1GSL A;  4DRV A;  5EYX A;  1RL3 A;  3KV9 A;  1BJQ A;  2CAU A;  2YGM A;  2BEO A;  3JD7 3;  2VL4 A;  3L2H A;  2HKX A;  4TLF A;  1FAT A;  3GJB A;  3CNA A;  2XL7 A;  4IEP A;  2CTV A;  1HIX A;  2BFU L;  4RS5 A;  2RDQ A;  3AVR A;  5CNA A;  1Z7S 2;  3S7E A;  4EN0 A;  4JTO A;  2ZZJ A;  4IQP A;  2VY0 A;  4N53 B;  4CU7 A;  5F2S A;  4XFA A;  5JXI A;  2NLR A;  2P6H A;  4PIY A;  3CJI B;  5IFP A;  1OOP A;  2JG9 B;  2ZTN A;  1GMM A;  1ENS A;  2EAK A;  2XHK A;  2VZV A;  3HNB M;  3VHO A;  5IUQ A;  3POF A;  4QD2 A;  5A3N A;  2WZR 2;  1Z0H A;  2YBK A;  4FOQ A;  1STM A;  2OVU A;  5APA A;  3BTA A;  5CEH A;  4YG6 A;  1WLD A;  4YW6 A;  3W21 A;  3UV9 A;  1Q8Q A;  2QQI A;  2D5F A;  2FHR A;  3WCS A;  3WR0 A;  5ABJ B;  4UF0 A;  1HKD A;  3V64 A;  2UYB A;  1OD5 A;  1OA4 A;  1VAL A;  3HPN A;  4M0H A;  2R04 3;  2K0G A;  1S55 A;  3MW4 A;  1RTV A;  2ID4 A;  1FV2 A;  3OUJ A;  3I2H A;  3I3D A;  2P3I A;  4TWT A;  1O4Y A;  4H3W A;  4QDS A;  4XBQ A;  5FY8 A;  3TEX A;  4OI1 A;  3A0K A;  4L99 A;  3S30 A;  2JE7 A;  3M4F A;  3WW2 A;  3ZFG C;  3ZYI B;  3BU7 A;  3EQE A;  3ALQ A;  1RUJ 2;  1Y3T A;  4QMA A;  5E88 A;  1JOJ A;  4CUG A;  2PHL A;  2FCV A;  4OCT A;  2B5H A;  1MVE A;  2WNV B;  5A6X A;  2D6N A;  1ZRI A;  2RS5 3;  4A6S A;  4DY5 A;  1SFN A;  2VPV A;  4R9B A;  1ULO A;  5FZ4 A;  4LBQ A;  1W9Y A;  4Q1R A;  3OUH A;  4QPI B;  3VZJ A;  4A3X A;  1LB2 A;  1XNB A;  5FP7 A;  1ULG A;  1HRI 1;  4JRA A;  2GC2 A;  5FPL A;  1CAV A;  1OLM A;  1SCS A;  1W8F A;  2KXL A;  4NE9 A;  4QGN A;  3Q8C A;  3PJY A;  4YVS B;  4ERO A;  1LES A;  2YV8 A;  1BMV 2;  2XJR A;  5FZA A;  5CVR A;  4Z07 A;  4RHV 3;  3LEM A;  3NAP A;  5DZE A;  2PYT A;  5FPB A;  4HVQ A;  3GBF A;  3DPR C;  2PXJ A;  1WLC A;  2HWC 3;  5CFC C;  1AJK A;  2YC0 A;  1G6N A;  2R7E B;  2WII B;  3DGT A;  4NAO A;  2JIC A;  1VBC 2;  5F6K A;  2XJT A;  3UKN A;  4UW6 A;  1O4T A;  1XU2 A;  1NCR B;  3TNP B;  1OHF A;  2IUW A;  4I0W B;  1ZNP A;  3UK9 A;  1UNB A;  4ZS3 A;  5L7O C;  4CCO A;  2YC2 A;  2VOT A;  3ZSL A;  1I9R A;  2ARX A;  2CL2 A;  1A78 A;  2BJS A;  4QPG A;  4JV4 A;  4QXB A;  3I97 A;  1SBD A;  2DUO A;  2VZQ A;  5F5I A;  2W1S A;  4CCM A;  3WF0 A;  1H8T C;  1QEX A;  2VQA A;  5IAV A;  4Z1V A;  2WZE A;  2WNU C;  4DS0 A;  1GOH A;  1UU6 A;  2W9X A;  3CF6 E;  1PO2 3;  2WWS A;  5EYY A;  4ARY A;  2ZGO A;  2PHF A;  4Q4X 3;  1W9W A;  2D6K A;  4BQY A;  2O0O A;  1V6M A;  2JDU A;  3MV0 1;  4CXX A;  4FPK A;  1XNA A;  5FBJ A;  4CDU A;  3W59 A;  3H3Z A;  4XIO A;  3EBR A;  4E2Q A;  4QKF A;  4DUW A;  4MAD A;  2Y60 A;  2YFU A;  3VHR A;  5FYH A;  1BBT 3;  1COV 2;  4LHL A;  3ZXL A;  5HPO A;  4FOY A;  3IWZ A;  5E16 A;  2J1V A;  3MBW A;  1S0I A;  4XTP A;  1OD3 A;  4AYU A;  1WLW A;  3R4D B;  4XXP A;  2OYZ A;  2VJX A;  5DN2 A;  3WP4 A;  3FHI B;  2XJU A;  4LE3 A;  3O0W A;  5LBE A;  3VD3 A;  4Y1Y A;  3OOX A;  3I54 A;  1MS1 A;  3RI9 A;  2CYF A;  3VZN A;  4OUE A;  2RS3 1;  4Q4Y 1;  4EWA A;  4Y22 A;  3TAY A;  4N43 C;  2I2S A;  4AK3 A;  3ZPY A;  1OT5 A;  4FP3 A;  3T09 A;  1PO1 2;  2D93 A;  4CEY B;  1JU4 A;  2DVF A;  3RGB A;  2GH2 A;  2XUM A;  4AED A;  4XFF A;  2MEV 2;  4XPV A;  2BW8 A;  3AC0 A;  2V73 A;  1V9U 2;  1W2O A;  2Z42 A;  4WM7 B;  1J1L A;  1RUE 3;  4GMP 0;  4K9S A;  4S2G A;  1SLL A;  5JI9 A;  3JU9 A;  4Y20 B;  3CU7 A;  3J7N A;  3QLQ A;  4QDR A;  5EPA A;  5IWF A;  5FRE A;  1F35 A;  5FXX A;  2VZT A;  5F7U A;  1JW6 A;  1H4H A;  2PEL A;  1AXK A;  3GZA A;  4GKY A;  4NUB A;  5FP4 A;  4Z2W A;  3RWN A;  5C9A A;  2XDV A;  1GWL A;  4AHZ A;  1YQ2 A;  4AFM A;  2VMG A;  4MLO A;  3NV3 A;  4RL7 A;  3WDV A;  5FZH A;  4CDQ B;  1DGR N;  4GH4 C;  1WWY A;  3LDK A;  4M00 A;  3WNN A;  1RED A;  1ZVF A;  1VLN A;  4FQ4 A;  3C7F A;  3D3A A;  4FFF A;  2E33 A;  5I93 A;  1D4M 1;  2MNG A;  3RZL A;  1W6P B;  4GB3 1;  2QQL A;  4QQO A;  3POY A;  2VW1 A;  5E89 A;  2FDJ A;  4Y1V A;  1OVP A;  1V6O A;  1OQ1 A;  2YC4 A;  5J48 A;  5T5L A;  1H6Y A;  5A7W A;  2FMD A;  3ZXE A;  2JJ6 A;  1F9K A;  4PDW B;  1REE A;  1NY7 1;  1TME 2;  2AH2 A;  2GMP A;  4FXK B;  4XHB A;  3WUC A;  4DO0 A;  5J09 A;  1SHW B;  2ARA A;  1AR6 3;  3EHK A;  2E26 A;  4UFL A;  3ZDS A;  5F5A A;  1NCQ C;  2R06 1;  3OGS A;  4Q4V 3;  3ZXK A;  3E97 A;  4YZ5 A;  3LIG A;  4NHY A;  1H2M A;  4PI2 A;  4H2A A;  5F3G A;  5LBB A;  4B4Q A;  5I8Y A;  3ZMN A;  1OMI A;  2W91 A;  3CIH A;  4F3J A;  1W90 A;  3PME A;  4Q29 A;  5H9Q A;  3KMH A;  3MYX A;  4HKL A;  3OPW A;  5FXW A;  4Y5S A;  4C91 A;  2BV4 A;  2WT1 A;  2VOW A;  5LRS A;  1W8H A;  2HWD 2;  1AR8 1;  3VZO A;  1Z78 A;  3C7O A;  2UWB A;  3NKG A;  1DZQ A;  1YIF A;  1SLB A;  4AQS A;  2J7M A;  3RJ2 X;  3M3O A;  3LZZ A;  1J83 A;  3IIA A;  2QQN A;  1N1S A;  2BNN A;  2QFE A;  4YZ3 A;  3ZIX A;  4Y4Y A;  1OBN A;  1VBE 1;  4AVA A;  5F32 A;  5FMO S;  4ZHN A;  3N9L A;  4YM3 A;  3BOW A;  1ZRC A;  1GKB A;  3C7G A;  1M4W A;  4XAE A;  3O1O A;  4DOU A;  2V72 A;  4IV3 A;  1DLL A;  3IAP A;  3ZFE A;  4UYB A;  5FXZ A;  3WDX A;  4A7Y A;  5I8T A;  5JMO A;  4AI0 A;  1ND3 B;  2BGP A;  3C7E A;  2CGP A;  3VBO A;  3B7M A;  5KHH A;  3AL6 A;  5IT6 A;  2J1E A;  1JUI A;  4JGY A;  3E6D A;  1JYC A;  2JDP A;  5A32 B;  1KFX L;  1XC6 A;  2X8K A;  4FSJ A;  4JGZ B;  4LNV A;  2JE8 A;  4FPC A;  2CAV A;  4HET A;  3RJR A;  1HX6 A;  2VG9 A;  3BVC A;  5IK7 A;  1JHN A;  3ZLI A;  3PMS A;  2Y0O A;  2IXC A;  3ZR6 A;  4I09 A;  3DXT A;  5EHD A;  4BIO A;  3KCX A;  1FPN 2;  1QGL A;  3AJY A;  1HXS 2;  1YFY A;  5D8A C;  4HON A;  5I8S A;  3DV8 A;  3O1M A;  2X09 A;  5A1L A;  5FP9 A;  3MIC A;  4KWU A;  4ZZ5 A;  2WS9 2;  2VCA A;  4FPO B;  1CES A;  5HCA A;  4FT8 A;  1XSR A;  4LO7 A;  1US2 A;  5GZF A;  1EY2 A;  2G4I A;  2ZGM A;  3H0O A;  3OUI A;  5CYY A;  4LUL A;  3IMN A;  1CD3 G;  3M3Q A;  1AX2 A;  3KLS A;  5F5C A;  4I01 A;  4YW4 A;  1VRB A;  2PAK A;  2X05 A;  1GZT A;  2XWB B;  4DUX A;  4I02 A;  3OCP A;  2WNE A;  2FD8 A;  5G04 L;  5HBA A;  1DG6 A;  2A3W A;  2J1R A;  1B35 A;  2BYV E;  4QX1 A;  3LFM A;  1L7R A;  1PHM A;  3MFC A;  4LBM A;  1JN2 P;  4OZO A;  3UT0 A;  3QD6 A;  3C7H A;  1KJL A;  4LO5 B;  1KIT A;  1RUC 1;  4AHX A;  2ARC A;  1OQD A;  1TG7 A;  3AVS A;  1VAM A;  5C3O A;  1H6X A;  2A70 A;  3ILF A;  4YGC A;  5JAX A;  1ENQ A;  5JCT A;  1EV1 3;  1HJG A;  3AKR A;  1W8O A;  5FAX A;  2VMC A;  3GCX A;  4RR3 A;  2J42 A;  3VBS A;  3VBH A;  2ARB A;  3NQH A;  4QQ2 A;  4IET A;  3UJQ A;  3VKF C;  3SQO A;  2W0X A;  4ES9 A;  4P5Y A;  1UZW A;  4UI9 L;  4WVM A;  2GC3 A;  3PTY A;  1KRI A;  2B45 X;  3TNQ A;  1S2E A;  3I2O A;  2G9Z A;  2XHN A;  4P08 A;  2ZGT A;  2ZX0 A;  3TN9 1;  1LCL A;  2XLG A;  5L36 A;  2VUA A;  4M01 A;  2DCJ A;  4MGQ A;  4XUQ A;  1TE1 B;  3CO2 A;  3VBU B;  1VBD 1;  2GP5 A;  5CU1 A;  5D1I A;  5FZC A;  1R09 2;  2DU1 A;  4J1X A;  2IWG B;  4HFS A;  1H2N A;  4S2F A;  5DAV A;  1S1A A;  1LED A;  1QQP 1;  2VUJ A;  2VZO A;  3SMH A;  2ZX3 A;  2Z69 A;  3K77 A;  3ITQ A;  1GWK A;  2RR1 1;  1D7P M;  1DF0 A;  4R4Z A;  5EWS A;  3WNM A;  1GLH A;  2O8Q A;  4XUP A;  2XLA A;  3KT1 A;  3QBQ A;  4DEQ A;  1VB4 A;  3OEB A;  3ZKU A;  2AEN A;  4UT5 A;  2RJL A;  4N53 C;  4CCN A;  1PGL 2;  4YAR A;  5K7P A;  4ET7 A;  5FUI A;  5IVF A;  1F4A A;  2P4E A;  1HRI 3;  1HQW A;  2JG9 C;  3CJI C;  3JQX A;  2XML A;  4AFB A;  1W6M B;  4FBF A;  3MIE A;  1DQ0 A;  3K2O A;  5T5O A;  3V65 A;  4PI0 A;  3ZR5 A;  4I0A A;  4AZZ A;  4LO8 A;  1W6Q A;  4X6Q B;  5K8S A;  1VMH A;  1XJA A;  1VMF A;  4P00 B;  1X82 A;  3ES1 A;  1PMI A;  3FBY A;  5B4N A;  5ABJ C;  1ASJ 1;  1DZT A;  2VAU A;  4CP9 B;  3KZ4 C;  5IAT A;  4XMA A;  1LGN A;  2NMO A;  5AC9 1;  4NHM A;  2TUN A;  3MLL A;  1PGW 1;  1XE7 A;  4GZ9 A;  4BA6 A;  1AL2 1;  1H8V A;  1DU3 D;  2MHF A;  2WZ8 A;  2W92 A;  3OBZ A;  1FMD 1;  4MXW B;  3T2O A;  2OUJ A;  3MO4 A;  1ST8 A;  1Q8P A;  2DBN A;  1RUI 3;  2AEZ A;  2ZX1 A;  4UXA A;  3WQ1 A;  2P6C A;  3ZSE A;  2WNV C;  5L73 A;  1JZ8 A;  2VEC A;  1C5H A;  4XCB A;  1W3V A;  1Y9Q A;  2LW8 A;  1W2A X;  3NVC A;  4QPY A;  4YG0 A;  4LJH A;  4DXR A;  4E8C A;  4NWV A;  2VTF A;  3HVD A;  3KVA A;  3E6B A;  3RZK A;  5C5U A;  2VCC A;  4YVS C;  1RVF 1;  5BNN B;  3M70 A;  4FPJ A;  2PLV 2;  2Q30 A;  1OQE A;  4TZD A;  3VDD C;  5HV4 A;  3AYD A;  4LOR A;  3WVJ A;  4D6Q A;  3NJY A;  5BNO B;  3H42 B;  2WNU B;  3I3E A;  4BDV B;  1JZ3 A;  5AVA A;  1NCR C;  1POQ A;  5FZ6 A;  2HWE 1;  5A3L A;  2IFR A;  3IDB B;  3M1H A;  5BY5 A;  1VBA 2;  4L2N A;  4COW A;  3SIT A;  2JWP A;  1DGW X;  4PLM A;  4HN0 A;  4KH9 A;  4Y3O A;  1V6J A;  3ZYH A;  3MW3 A;  1BVV A;  4HVO A;  3FBM A;  4NRQ A;  1DYK A;  1DP0 A;  2RS3 3;  2V4A A;  4Q4Y 3;  4E2G A;  1HRV 2;  1YFU A;  2NPI A;  2VCM A;  2MPF A;  2D97 A;  1RXG A;  1S0D A;  1W8Z A;  3RMX A;  1GNY A;  2RM2 2;  5ACA 1;  4N8M A;  4RQP B;  1K5J A;  5FZ3 A;  4YVW B;  5FY5 A;  4BJ0 A;  1KJR A;  1R1A 2;  4HZF A;  3C2U A;  1ONA A;  4KWK A;  1MAC A;  5JR7 B;  1JZ2 A;  4I3G A;  4UBH A;  3BPS A;  1U0A A;  4R4X A;  3AYC A;  3HN1 A;  2EF6 A;  3LGR A;  1AR9 1;  5GJ6 A;  1WMD A;  2BFU S;  3KM5 A;  2ZGP A;  3V56 A;  3AZY A;  2E53 A;  1ZZ8 A;  1RUG 1;  2O14 A;  4H55 A;  3GZU C;  3B9I A;  3LSE A;  4L92 A;  4QQL A;  3ZPO A;  3P1I A;  1LHW A;  1V6N A;  2B9V A;  4JRL A;  2WA3 A;  1BEV 1;  1I5Z A;  2DFB A;  3WF2 A;  5EFU A;  4XET A;  2HEY F;  1RUF 1;  5K0U B;  3LOB A;  1Q3E A;  3A7Q A;  4GB3 3;  4K1Z A;  5JOY A;  2RMU 2;  4N9H A;  2GSY A;  1IS4 A;  1SBE A;  5AFE A;  1EYB A;  1ZBE 2;  1A8M A;  3ZXG A;  3R4S A;  1CVN A;  2C9K A;  2R0H A;  2Y6F A;  4R52 A;  4CEY C;  4GH4 B;  2OPW A;  5FZ1 A;  3ZYP A;  4W4Z A;  3PIG A;  1EAH 2;  2P34 A;  3O0X A;  5CKM A;  4EZ4 A;  4C1W A;  1IS3 A;  3MV1 1;  1CZV A;  3DL3 A;  1R08 2;  3O1S A;  4XF4 A;  2R06 3;  4KGQ A;  3ZYB A;  5FJH A;  3FUQ A;  3NWK A;  5A1F A;  1JZ6 A;  1G86 A;  2YZ4 A;  3MFA A;  3URF A;  3V0A B;  3W5M A;  4P02 B;  3P5B A;  1JI6 A;  5M0T A;  3ON7 A;  3FL7 A;  4CDQ C;  4A41 A;  1O59 A;  4ZU4 A;  3BCW A;  4XMI A;  1DGL A;  3AP4 A;  1UOB A;  1W6N B;  1HLC A;  2VR4 A;  1URX A;  3O12 A;  1S0G A;  1NCQ B;  1AR8 3;  1WMX A;  4O7X A;  5C33 A;  3AMM A;  5A6Q A;  3WZ1 A;  2ZAC A;  1VBE 3;  4UAP A;  1MQT B;  4PQ9 A;  5JZG A;  5A3M A;  1EUU A;  3OYW B;  4MGY E;  4FO9 A;  2BOI A;  1JTZ X;  3BTZ A;  4PDW C;  2D6L X;  1UF2 C;  3T2T A;  3LE0 A;  3LDB A;  2OII A;  1GUI A;  3ETQ A;  3PDQ A;  1Z7S 1;  1DGR A;  1SLI A;  4BOW A;  1JYI A;  4C8D A;  3POE A;  1OUS A;  1C3H A;  3ACI A;  1X7N A;  3TBD A;  4CUA A;  1VRH 2;  3JD7 2;  5DUU A;  5LAT A;  3U37 A;  2ZEZ A;  5C71 A;  2WZR 1;  1MR5 A;  3WF4 A;  3WNX A;  4WM8 A;  2OT7 A;  2EA7 A;  2D44 A;  3DEC A;  2JIG A;  1DGW A;  4OHZ A;  1OF4 A;  2NQY A;  2YBP A;  1C5I A;  1DQ4 A;  2Q1M A;  1KS4 A;  4Q1P A;  4IL7 A;  2ZAB A;  1SG3 A;  1RXF A;  4I2O A;  4UW4 A;  2Q4S A;  3VD7 A;  4L97 A;  2JIJ A;  3EB7 A;  4LBQ D;  1IZ3 A;  2D43 A;  3ZXA C;  4IXL A;  2P5B A;  3UYJ A;  3GYD A;  1LGB A;  4R9D A;  1SLC A;  2ZEX A;  4QAW A;  3N7K A;  1RUJ 1;  1APN A;  1JMU B;  1XND A;  1AXZ A;  2XJS A;  3PL0 A;  1RJ7 A;  1HV0 A;  1SDW A;  2FZ2 A;  2W87 A;  5CFD B;  4CCC A;  2OKX A;  4FTS A;  3J26 N;  3KT4 A;  4OQ8 A;  2GNT A;  5LZ6 A;  3WG2 A;  1DYO A;  1CAW A;  1UWW A;  2VUC A;  1MS3 A;  1GQG A;  3VHN A;  4D7S A;  2WC2 A;  3I3Q A;  2WQZ C;  2ZEW A;  5LB6 A;  4IE0 A;  3RPQ A;  4ASM B;  1BMV 1;  1AR7 3;  1GOG A;  2O1Q A;  3QCW A;  4QHO A;  4YGE A;  1ZX5 A;  2HBT A;  1AX1 A;  4CTE A;  2ZHM A;  2NZ9 A;  4JGZ C;  4Q0P A;  1DQ2 A;  5C4W B;  5F5Q A;  2RJK A;  4CVU A;  2EID A;  4JKM A;  5GLV A;  3VLB B;  1ZYB A;  3I59 B;  4YYO A;  1RUC 3;  1N1V A;  1ZBA 2;  1YCI A;  4I0B A;  4WBB A;  4AVB A;  4ZY9 A;  2PQQ A;  4RHV 2;  3HMY A;  3MEP A;  3JQW A;  4FPE A;  1JYX A;  1MS5 A;  2UU8 A;  2HWC 2;  1XSQ A;  5ANQ A;  4O65 A;  3OGR A;  2FDI A;  5FPV A;  3IZO A;  1LOB A;  2VE1 A;  1UKR A;  2WYS A;  5BNP A;  2RS1 1;  3DUI A;  4OMD A;  4IV1 B;  2WFF 2;  4EN8 B;  1X9P A;  4X8P A;  3V0B B;  3I7D A;  4FXG B;  1A8D A;  3K48 A;  3TEY A;  3TYJ A;  3U10 A;  1CAX A;  1NE4 A;  4DQA A;  3TN9 3;  3DF0 A;  5GZE A;  3RFR A;  2HEW F;  3K46 A;  4HBN A;  5T5J A;  3WLU A;  1VBD 3;  4LOS A;  4XUT A;  4Q4X 2;  3H1W A;  2A1X A;  3CMG A;  3IPV B;  5IVC A;  4UFK A;  5IVJ A;  1COV 1;  3AFK A;  3HOB A;  1PIV 1;  3LEI A;  5T52 A;  2W46 A;  2WL1 A;  1WCD J;  1PVC 1;  1QQP 3;  2ZXQ A;  5FY7 A;  5KR7 A;  4D0Q A;  3HT1 A;  1ND2 B;  2XBO 2;  3FLR A;  3VBR B;  4P9X A;  5JXJ A;  1BBT 2;  1BK1 A;  2RR1 3;  5JPM B;  4CP2 A;  2ET1 A;  4A2U A;  5FXV A;  4E4S A;  2LM3 A;  4XUN A;  1NA1 B;  1QJY 2;  3H1M A;  4NIA A;  3OBA A;  3FZ3 A;  2WKK A;  5BNQ A;  3RZM A;  5IYY A;  1H4G A;  5KHI A;  3RRD A;  1OFS A;  1XYN A;  2VXR A;  1BVP 1;  2YPJ A;  4LBN A;  4LHS A;  2VNO A;  3T1M A;  1OI6 A;  4HL0 A;  4NHK A;  2QQJ A;  3WOG A;  1FOD 1;  1O7F A;  1QXJ A;  3DCQ A;  4CCD A;  3BTY A;  4GWN A;  1ASJ 3;  1DYP A;  1OPM A;  2JXA A;  1PX3 A;  4LO4 B;  3Q9O A;  3AKT A;  5DZF A;  5I0U A;  3VBU C;  3KSC A;  4JCK A;  1IG3 A;  2GME A;  3DKQ A;  5AC9 3;  4B8E A;  4CZS A;  2WFP A;  5BPX A;  1GP4 A;  1AL2 3;  1LTE A;  2A5Z A;  5LBC A;  1FMD 3;  3ACL A;  3AK0 A;  4K8F A;  5FZM A;  3U4S A;  3VB9 A;  4BM8 A;  3CZU A;  2HWB 1;  3NL1 A;  2WN2 A;  1OPO A;  4GMP 1;  4JDN A;  5FIX A;  3KCY A;  4URA A;  5KBF A;  3RG0 A;  1RMU 2;  3RWK X;  4LA3 A;  2ZPX A;  4JDO A;  4NIH A;  1POV 0;  1A34 A;  3NV2 A;  5DAP A;  1LOF C;  1UMI A;  1W04 A;  4QHZ A;  1NKG A;  2Y26 A;  2ILM A;  1J84 A;  3PUS A;  3S5A A;  2W5F A;  1BZW A;  4LBJ A;  1RVF 3;  4WVW A;  5FYM A;  1TME 1;  3MF6 A;  4OMC A;  1I6X A;  5FPZ A;  1GFF 2;  1NAE A;  2H0B A;  1GZW B;  2W1Q A;  4AVS A;  1PX4 A;  1PK6 B;  1DQ6 A;  3MIG A;  1W39 A;  4JVA A;  4XC9 A;  1RUH 2;  4AEJ A;  1ULE A;  2YGL A;  4X8N A;  5C8C A;  4NVP A;  3D6E A;  4SLI A;  4NPR A;  1AR6 2;  3PLQ A;  3ZXF A;  2HWE 3;  2VOV A;  4Q4V 2;  3PHM A;  4QX8 A;  5DDJ 1;  1JH5 A;  1UKG A;  3VDD B;  1B09 A;  4Y5T A;  4FAH A;  1X50 A;  3WDT A;  3HQX A;  4LLO A;  1G9F A;  2VCB A;  2E31 A;  4B1L A;  5IK4 A;  1UMH A;  2J1T A;  1HB2 A;  1X8E A;  2CHH A;  5ACA 3;  2FDG A;  3Q8A A;  1W6O B;  5HV0 A;  1TVG A;  2GP3 A;  1SFY A;  4Z92 B;  2ZX2 A;  1R1Z A;  3IDA A;  2DBI A;  4M4P A;  3LAG A;  4MGZ E;  2O8O A;  5BNN C;  4GWJ A;  3VL9 A;  3WDU A;  3ZOI A;  4BH9 A;  1HQN A;  1RUI 1;  1S2B A;  1W2U A;  2WO1 A;  1O3Q A;  4Q26 A;  4B4R A;  1AR9 3;  1CAU B;  4CDX A;  4LKS A;  4NWW A;  2PTM A;  5FWE A;  2VME A;  2WLQ A;  1ZRD A;  2LRO A;  3NJZ A;  5BNO C;  1RUG 3;  3BI3 A;  5FQ0 B;  3AMH A;  1KFU L;  2PAM A;  4ISQ A;  4IW3 A;  1BEV 3;  2BPA 2;  1OXC A;  4MXV A;  5FYY A;  4NOT A;  1RUF 3;  3OY8 A;  4IV3 C;  4Z82 A;  2PN5 A;  5BYN A;  4ZU7 A;  3WF1 A;  4D6R A;  2DCZ A;  2ZGL A;  4P5H A;  5BXX A;  5FZO B;  4LKF A;  1YQC A;  4WZC A;  4AQ6 A;  4G4F A;  2BTV C;  5E6H A;  3E5Q A;  4OLL A;  1V0A A;  3KQR A;  1FPN 1;  3JBG 2;  4FTE A;  3ZN6 B;  1OF3 A;  1CPM A;  1HXS 1;  4RQP C;  1JOB A;  1LHV A;  3G7D A;  2Q8C A;  3T30 A;  3T4V A;  3U11 A;  4YVW C;  5A7Q A;  5IVE A;  1GP5 A;  3AFG A;  5KHK A;  5C8W A;  4YSF A;  4CCE A;  3BB6 A;  2WN3 A;  3VBF B;  5IK8 A;  2WS9 1;  3R4U A;  5A3O A;  3RYR A;  4DEV A;  4XJW A;  2ZZQ A;  4LBL A;  4XJZ A;  3UJO A;  4W6X A;  4ZU5 A;  4WVV A;  4CDW B;  4Q8K A;  3L9J T;  1UIK A;  3G6J B;  5JR2 A;  3L2Y A;  5FWJ A;  2R16 A;  1PMH X;  1LHN A;  4P9I A;  2VZP A;  1ODM A;  1XNK A;  1QHD A;  3LPF A;  3IMM A;  4MZU A;  1CWP A;  3VN4 A;  2CY6 A;  4AEK A;  2W47 A;  3IDE A;  5K0U C;  3T2Q A;  2X5I B;  3POJ A;  1KD7 A;  5H9S A;  4XJ9 A;  4XF3 A;  2R32 A;  4C0H A;  5F3C A;  4M3C A;  1YXW A;  4PLO A;  1KDK A;  4HPK B;  1UO9 A;  3HNY M;  4E27 A;  1ULF A;  1VR3 A;  5T54 A;  3WF3 A;  1AYM 2;  4YM0 A;  1CJD A;  3D8C A;  2W08 A;  4OYU A;  5LA1 A;  4FFG A;  1BLZ A;  1GOF A;  4COV A;  2VQ0 A;  5JOW A;  4ONU A;  2W68 A;  2VMI A;  1EPZ A;  1XNC A;  1Z7S 3;  2WSV A;  5FTT C;  3THT A;  1EV1 2;  1UN1 A;  3WG3 A;  3KWV A;  5B2G B;  4IE4 A;  1M06 G;  3J7M A;  3CQO A;  4AI9 A;  2WZR 3;  1W8U A;  1QOT A;  1WW5 A;  4QKN A;  4CCK A;  5JSR A;  5HCB A;  2QDN A;  1RB8 G;  2Y33 A;  2JE9 A;  1NXM A;  1XYP A;  5L9B A;  4AOC A;  3POS A;  4RR3 C;  5FYI A;  1MEC 2;  1ZM1 A;  2AR6 A;  5EZW A;  3N35 A;  1SPP B;  1XNT A;  3ZFG A;  1AHS A;  1O4Z A;  1OA3 A;  1XPW A;  3K3O A;  1RHI 2;  4PHZ A;  4OFG A;  3WNO A;  3Q8F A;  1H1M A;  1YQ5 A;  4F8A A;  1SLT A;  5CA6 A;  1UY4 A;  3KF3 A;  4XUO A;  3SKV A;  3ZKY A;  1MQT C;  1MZF A;  3S6P A;  4B3N A;  1D2Q A;  1RUJ 3;  1VE0 A;  2PMW B;  3WQB A;  3WG1 A;  4EN9 B;  5FZI A;  4IE6 A;  4ITC A;  2VTX A;  4RS5 B;  4MH0 E;  5JOX A;  4MHU A;  4IEU A;  4LK6 A;  3IBM A;  5I0R A;  1PGL 1;  3Q8B A;  2WLP A;  2GDF A;  1OOP B;  1KXG A;  1CX4 A;  3OPT A;  2YXS A;  4MVT A;  2LAL A;  2VZ1 A;  1QOS A;  4YW2 A;  1QJX 2;  2EIB A;  3J7H A;  3AX4 A;  2R30 A;  3DPR A;  1SBF A;  3LA7 A;  3N9Q A;  5DZG A;  1S0F A;  5CFC A;  3N9M A;  3ZVX A;  4YNI A;  1IKQ A;  2PHX A;  4QU1 A;  2UWC A;  4UF0 B;  5FUN A;  3JUU A;  4GAL A;  1HRI 2;  4GUL A;  3ZN5 A;  4BZ4 A;  4XFI A;  3GXU A;  2JB8 A;  1QJU 1;  2WO7 A;  2WJS A;  4Y5Z 0;  3ZSJ A;  4V2W A;  1GAN A;  4IE7 A;  4CEY A;  2A6W A;  4IND A;  1QNW A;  5GLZ A;  3KCC A;  3WHU A;  1GNH A;  2JD4 A;  1BXH A;  1OUX A;  4MGS A;  3QH7 A;  4W50 A;  3UNP A;  4K3U A;  1H8T A;  2X29 A;  3MZH A;  2D98 A;  3B02 A;  4HT1 T;  2VUL A;  1J59 A;  1RIT A;  2E6V A;  2BVB A;  3ABZ A;  2ZGS A;  2GC1 A;  2UUR A;  2H6B A;  1ZA7 A;  4E4Z A;  5CFD C;  4BCU A;  2RS1 3;  1J1T A;  2WO3 A;  4LBQ B;  2OZ6 A;  3ELN A;  3RI8 A;  4XZP A;  4DXT A;  3S0M A;  4IUG A;  1CON A;  2WYF A;  3RVH A;  1K5M A;  3MLK A;  1CAV B;  3PUH A;  3A4U A;  1VAK A;  4ATF A;  2E7A A;  4LEJ A;  4NRM A;  4XF9 A;  3WW4 A;  2JDA A;  3O0V A;  5JMC A;  3W9A A;  1OC1 A;  4A42 A;  1GQH A;  1RYY A;  4FPY A;  3NAP B;  1H2K A;  2P3J A;  1W8W A;  1W0O A;  2JG8 A;  3MPB A;  3W58 A;  4COU A;  1C57 A;  3I2D A;  4LBO A;  2W1U A;  4TYS A;  1MS8 A;  3PUR A;  4EN6 B;  3RYK A;  5C4W C;  3NST A;  3LB9 A;  4CXW A;  5I91 A;  4AGR A;  2VVD A;  4UFI A;  1COV 3;  2Z79 A;  1UPI A;  2XKO A;  3FUO A;  1PIV 3;  4UFJ A;  3THD A;  5KXC A;  2QQW A;  3QH6 A;  4PJY A;  1PVC 3;  4P14 A;  1C8M 2;  4OI4 A;  2GND A;  3CZJ A;  2XKP A;  5J98 B;  3SKJ E;  4N43 A;  1AR7 1;  2YBS A;  1RUD 2;  1WZX A;  2VZ3 A;  4QPG B;  1XYO A;  4QX7 A;  3MIF A;  4ZON A;  2ZGQ A;  3WV6 A;  1DZR A;  2FBE A;  1HRV 1;  1QXR A;  3BIE A;  5T3N A;  3MID A;  3WW3 A;  4OUL A;  3UES A;  2RM2 1;  5DAW A;  2X53 S;  4IV1 C;  2YUE A;  1ULC A;  5KC5 A;  2D3R A;  2NM1 A;  3FFZ A;  3OPZ A;  4LXL A;  4ZKT B;  5JWP A;  3M3I A;  2N7G A;  5IVV A;  5KXD A;  4C90 A;  1XQN A;  2K9Z A;  1WW7 A;  4CDU B;  2PAE A;  2JKB A;  1FOD 3;  4J6G A;  5L7O A;  4ZXE A;  1X36 A;  2OUH A;  1AJO A;  3K3N A;  5FZ7 A;  1WME A;  3MGU A;  3O1T A;  5FY0 A;  3D0S A;  1N3O A;  2OQ6 A;  3I2K A;  3M8L A;  5CIR A;  3T3Y A;  4M4R A;  4Q0Q A;  1ND2 C;  3I4I A;  4Q8L A;  3VBR C;  3AM2 A;  2GN3 A;  2Y6G A;  1VMJ A;  2HWB 3;  2I07 B;  4OHX A;  1JS9 A;  4QKD A;  4Y22 B;  4GMP 3;  2RMU 1;  3D4K A;  4XBL A;  4QX2 A;  1LRH A;  2DUQ A;  3JXS A;  5IK5 A;  3QOP A;  1VBB 1;  3WW1 A;  4AED B;  1HQL A;  1OVS A;  2GAL A;  1D4M 2;  4KBB A;  4OI2 A;  3AZZ A;  1NA1 C;  2DU0 A;  4XIK A;  4GB3 2;  1UW8 A;  3FC0 A;  4N7I A;  5CAZ A;  3K4A A;  1DFQ A;  2AUY A;  3AB0 A;  1EAH 1;  3VHP A;  5C5T A;  2GH8 A;  3AXD A;  2QCS B;  1GR3 A;  3SCF A;  2B9U A;  1TME 3;  3F95 A;  4Y24 A;  3WX5 A;  3X29 B;  2Z4F A;  1R08 1;  2ETE A;  1TMF 2;  3B93 A;  5C9A B;  2JDZ A;  3CL1 A;  5JLV A;  5A33 A;  2GN7 A;  3K4Z A;  3ZFF A;  1NY7 2;  4AFA A;  4CEW A;  2A6X A;  1GU3 A;  1NXD 1;  5A70 A;  1IPK A;  1NZC A;  2WRA A;  1HN0 A;  3H50 A;  1IKP A;  4YZ4 A;  1W9T A;  2AC1 A;  2HWF 2;  5DDJ 3;  5IVB A;  2FDH A;  5JVV A;  4XFH A;  1S2K A;  1LUL A;  5T55 A;  3E1F 1;  4D8M A;  3MW2 A;  5A1A A;  2XVG A;  3POW A;  1MS4 A;  2JD9 A;  3S7I A;  1YFW A;  4BQ1 A;  3PVE A;  5F9T A;  3CDZ B;  5L9R A;  3NV1 A;  2XJP A;  5A3T A;  2R07 1;  5A7W B;  5C6C A;  5J37 A;  1QJZ A;  1NLS A;  1D4V B;  3AXE A;  3D82 A;  4K20 A;  3TB0 A;  3KF5 A;  5J36 A;  2F4P A;  2A6V A;  1UYX A;  2AAC A;  3H3U A;  2EIC A;  3ZYF A;  3POB A;  5I0T A;  4QGL A;  3WDW A;  1REF A;  4AW7 A;  5GZC A;  2BRT A;  2ZMK A;  1S4C A;  3R0R A;  4F7Z A;  1PK6 C;  1W06 A;  3U07 A;  3KHC A;  1VRH 1;  3OSD A;  3BOP A;  2Y38 A;  1IPJ A;  4QB2 A;  4F83 A;  3BTX A;  4XQ4 A;  1OLM E;  5FYV A;  1QMJ A;  4Y1U A;  2I45 A;  2NYY A;  3T0B A;  2QUO A;  4JKK A;  4BPZ A;  3P3P A;  2C24 A;  4FCA A;  2VVF A;  4G3Y C;  4XFC A;  5FZB A;  5C70 A;  5DUW A;  4AHW A;  2VD7 A;  3WSO A;  5GAL A;  5D8A A;  4GXL A;  1GQP A;  1ZZ9 A;  2EXI A;  3VD9 A;  1KS5 A;  1FPN 3;  5FZ0 A;  2UYA A;  2Y6J A;  2GC0 A;  3UGG A;  1K45 A;  1JOD A;  1HXS 3;  5LY2 A;  1OH4 A;  3AZW A;  2Y6L A;  1QDO A;  3H8U A;  1Q8S A;  5FCC A;  2D5H A;  2FQP A;  1GV9 A;  4TSV A;  3TRS B;  2WS9 3;  3OGJ A;  4PCR A;  4Q4W 2;  2XVL A;  3FHA A;  4IV3 B;  3RYP A;  3ZFE B;  2JB4 A;  5EJZ B;  3H7Y A;  3VBO B;  1IS5 A;  1JYT A;  3VKM A;  4LA2 A;  2WZP P;  3PU3 A;  1O3R A;  5JXG A;  4LLF A;  5GZG A;  5ERL A;  4BK4 A;  2BUK A;  3MIH A;  4JGY B;  5TSW A;  5FK8 A;  1NQJ A;  3N7L A;  4S2H A;  4JHZ A;  1LEC A;  1SLA A;  2ARE A;  3J9S A;  5H9P A;  4CPB A;  3B9C A;  5C3P A;  3K75 B;  3QAC A;  4B4P A;  1W0N A;  4HG6 B;  3N7M A;  4LUK A;  2DDU A;  1YLL A;  4PLN A;  4MGT A;  3HAG A;  2YRO A;  3MIB A;  1LOE A;  4JAA A;  1ZBA 1;  4D3W A;  2YB7 A;  4AEM A;  5D2A A;  1ZRF A;  2OXB A;  2WUH A;  3HT2 A;  3P6B A;  5ISL A;  4LIU A;  1G9C A;  3GCW A;  5BUV A;  4E4H A;  4QX3 A;  3J8F 2;  3WQ7 A;  5JIU A;  3OJB A;  3VBF C;  1RUC 2;  4TXW A;  1BQP A;  5FMO L;  4NPM A;  3GJA A;  2LS6 A;  1SDD B;  4YZ1 A;  4PBO A;  2XWJ B;  5LEJ A;  1Y7B A;  2WFF 1;  4CDW C;  3MF9 A;  2ZHL A;  1DQ1 A;  3ZMO A;  5HXM A;  4NAM A;  1AL0 G;  4QXC A;  4A6O A;  1MPX A;  3NKT A;  1OSG A;  2D6O X;  3UKT A;  1W05 A;  1K12 A;  5C3Q A;  2VMF A;  1ZRE A;  4LPL A;  1B35 B;  3U4X A;  5HCH A;  4HKO A;  2HJI A;  3AKQ A;  4HMZ A;  2X5I C;  1N3P A;  1NOV A;  3M7A A;  3THC A;  3VKN A;  3C3V A;  2QBX A;  1UZY A;  3TN9 2;  2HEV F;  3ZYG A;  3MHZ A;  2C1F A;  4GQ7 A;  4DRR A;  4K6B A;  2E63 A;  2XBO 1;  1UU5 A;  4MG2 A;  4AHY A;  2Z2S B;  1ZRR A;  3WNL A;  1PMJ X;  4MGK E;  1NZI A;  4N53 A;  1YFX A;  4RR3 B;  5A3U A;  1S0B A;  3GF6 A;  2G9F A;  1YC6 1;  3CJI A;  4XJ8 A;  1UYP A;  2JG9 A;  3VBH B;  1AYN 2;  3VBS B;  4M0N A;  4A44 A;  1V6K A;  2YDE A;  2QE3 A;  4YLZ A;  4Z2A A;  1GBG A;  1TQ5 A;  3VDB A;  4O61 A;  5D21 A;  1YI9 A;  1QJY 1;  1E5R A;  1WD3 A;  4BB3 A;  1JZ7 A;  1ACC A;  2ERF A;  4WVM B;  2H6C A;  3VDA A;  3MPP G;  2XLF A;  2R1B A;  1A3K A;  5ABJ A;  4DUV A;  5L19 A;  3SH4 A;  1JZ5 A;  3FHQ A;  1W9F A;  4OHV A;  1NX9 A;  3POI A;  2Q8O A;  3U1X A;  4DXZ A;  4EJR A;  2EAA A;  3UET A;  2ZHK A;  3BUC A;  1WCK A;  1QJU 3;  2UWA A;  1RC6 A;  2Y34 A;  4HSL A;  3SIS A;  4XHX A;  1W2N A;  2BQP A;  1RJ8 A;  2Q8E A;  3OGG A;  5F8P A;  4QPW A;  4RFR B;  3NNG A;  1LR5 A;  4W8J A;  5LK7 B;  1GYK A;  1FV3 A;  1ASJ 2;  2WNV A;  1AZD A;  2QZ3 A;  4I3P A;  1F2N A;  3NRU A;  4BXS V;  1FI2 A;  4NID A;  5AC9 2;  2BDR A;  4MX3 A;  4P9J A;  4QPI A;  4DZG A;  4RS5 C;  4QX5 A;  2VZS A;  1RMU 1;  1W8N A;  1AL2 2;  3KT7 A;  4YVS A;  3GZE A;  1IS6 A;  1YIP A;  3AL5 A;  1OOP C;  1YQ6 A;  3VDD A;  3H1Y A;  3RQ0 A;  3RZZ A;  4ASK A;  2AZ5 A;  2B39 A;  1W6Q B;  1C1L A;  1WCS A;  2R04 2;  4Y26 A;  3LD8 A;  5FJK A;  4BLI A;  1CZS A;  1BK0 A;  5FO9 B;  2RG4 A;  1NCR A;  1HN1 A;  1RUH 1;  5JUV A;  1JYV A;  2ATF A;  1I1E A;  4NMI A;  1LGC A;  2DUP A;  4Q5O A;  4YG3 A;  1G9D A;  5FLJ A;  3T1L A;  4OI0 A;  1POV 1;  1A6C A;  2XL9 A;  2A3Y A;  4XIL A;  3HIF A;  2E7T A;  2RS5 2;  1LEN A;  2B8M A;  2XUE A;  1WBF A;  3A0N A;  3NNJ A;  1CX1 A;  3SXW A;  1U5Z A;  1YRZ A;  2ZGK A;  3NMB A;  3SHR A;  1HRV 3;  3AP7 A;  2HWE 2;  3VKL A;  5F1R A;  3J7L A;  4AI2 A;  4XF1 A;  2VM9 A;  2RM2 3;  1I3H A;  4IDZ A;  2VBP A;  2DCY A;  1VBC 1;  4Y1X A;  5EJ3 A;  1QOO A;  5IW0 A;  4LHN A;  4CUB A;  3BIW E;  2VH9 A;  4LQR A;  3USS A;  1G9B A;  1JBC A;  2CDO A;  1VAV A;  2VVE A;  3PU8 A;  1OKQ A;  4RFT 0;  2BER A;  4XTM A;  4K1Y A;  4IER A;  1BCX A;  2WNO A;  3NAP C;  5IAX A;  2F6B A;  2JX9 A;  2D6M A;  4NJ4 A;  2G19 A;  2BNO A;  3VD4 A;  2VQT A;  4HVR A;  3INA A;  1W3X A;  1ENR A; 
#chains in the Genus database with same CATH homology
 2YBK A;  5FXX A;  4XDP A;  5FY1 A;  3KVA A;  5CEH A;  2YU1 A;  4NUB A;  5FP4 A;  2Q8C A;  5FXV A;  5FV3 A;  3LDB A;  5F2W A;  5FZF A;  3PDQ A;  2W2I A;  5A7Q A;  5IVE A;  4GJY A;  2XDV A;  5A3T A;  5F5C A;  4BXF A;  4C8D A;  4UF0 A;  5A7W B;  2Q8D A;  1VRB A;  5FZH A;  4AI9 A;  3PTR B;  5FUP A;  3NJY A;  4D6Q A;  4QWN A;  4GJZ A;  5A80 A;  4CSW A;  3KV4 A;  2WWJ A;  3RVH A;  2OT7 A;  5FY8 A;  5FZO A;  5FWJ A;  5FZ6 A;  3N9P A;  2YBP A;  2XXZ A;  4CUG A;  5FYZ A;  5K4L A;  3AVS A;  4Y3O A;  5A3W A;  5IVY A;  3PUR A;  5A7W A;  3N9O A;  5A7N A;  2P5B A;  5FZ4 A;  5F37 A;  5LWB A;  3PUA A;  5FYV A;  5FZM A;  5FP7 A;  3UYJ A;  5FZD A;  3U4S A;  4DO0 A;  5FPL A;  5F3C A;  5FZB A;  4GD4 A;  5FZ8 A;  5FZ3 A;  3KV5 A;  5FY5 A;  4URA A;  2YBS A;  2VD7 A;  5F5A A;  5FZA A;  2Q8E A;  4LIT A;  4IGO A;  4QX7 A;  5F3G A;  4BU2 A;  5FY9 A;  4EZH A;  5FPB A;  5A3P A;  5FZ0 A;  2PXJ A;  3N9N A;  3PUS A;  5LY2 A;  5FYM A;  4Y33 A;  4AAP A;  2WWU A;  3OPW A;  4IGQ A;  5FY4 A;  5FZ9 A;  5FXW A;  4V2V A;  4D6S A;  2GP5 A;  5FZC A;  4LXL A;  4CCO A;  3ZPO A;  5IVV A;  5FPA A;  3AL5 A;  3DXU A;  2YPD A;  2OS2 A;  4CCK A;  4HOO A;  3PU3 A;  4QXB A;  4ASK A;  3PUQ A;  4CCL A;  3KVB A;  2OQ7 A;  5F5I A;  5FYI A;  4CCM A;  3K3N A;  5FZ7 A;  4QX8 A;  5F32 A;  4DIQ A;  3LD8 A;  3N9L A;  5FJK A;  5FY0 A;  4CCJ A;  2OQ6 A;  3K3O A;  5ANQ A;  5F3E A;  5FPV A;  4CCN A;  3U78 A;  5FZ1 A;  5FXZ A;  5LY1 A;  5FPU A;  5IVF A;  5FBJ A;  2XML A;  5FZL A;  5A7O A;  4EZ4 A;  3K2O A;  2GP3 A;  3AL6 A;  5FZI A;  5FYU A;  2XUE A;  5ISL A;  4LIU A;  5FZG A;  3KV6 A;  5FJH A;  5FYH A;  5FYT A;  4TN7 A;  5FYB A;  5A7S A;  5A1F A;  4BIS A;  4E4H A;  5FYS A;  4QXH A;  3OPT A;  5FZE A;  4GAZ A;  4EYU A;  5F39 A;  5IW0 A;  5LW9 A;  3ZLI A;  5FWE A;  5FP3 A;  5FYC A;  4LIV A;  5F3I A;  5FZK A;  3N9Q A;  2YU2 A;  3DXT A;  3KV9 A;  2OX0 A;  3N9M A;  4QXC A;  4QU1 A;  5IVC A;  3PU8 A;  5FUN A;  4UF0 B;  5IVJ A;  5A7P A;  4HON A;  3AVR A;  4Y4R A;  5FYY A;  5A1L A;  5FP9 A;  5FY7 A;  4XDO A;  5KR7 A;  5F2S A;  4V2W A;  4D6R A;  4IGP A;  5FZO B;  5IWF A;  5IVB A;  5FP8 A;  5E6H A;  5A3N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...