5A7WA

Crystal structure of human jmjd2a in complex with compound 35
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
345
structure length
345
Chain Sequence
NPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 4A
publication title Docking and Linking of Fragments to Discover Jumonji Histone Demethylase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 96
structure length 345
sequence length 345
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5a7wA01
5FPBA 3N9MA 4QU1A 2XMLA 4QWNA 4Y3OA 4QX8A 5F5CA 4CCNA 5FZAA 5A7QA 4AI9A 5LWBA 4GD4A 4XDOA 4BISA 3RVHA 3OPWA 5IVBA 4QXHA 5FY8A 5FXVA 5FZIA 5F37A 3N9NA 5F2SA 3LD8A 4CCKA 3N9PA 3PUSA 3U78A 5A7WB 3K3NA 5FZ0A 3KV5A 5FP7A 5FZ6A 5FYIA 4DO0A 5FPLA 3K3OA 5FY9A 5FPAA 5FZ1A 3PUAA 4EYUA 3PURA 5A80A 4Y4RA 4QXBA 4V2VA 4Y33A 5FZ8A 3KVBA 4URAA 5FJKA 2YPDA 2GP3A 4LXLA 5CEHA 5FY4A 2WWUA 2GP5A 2OT7A 5IVCA 5F3IA 4GAZA 5FXZA 5A1FA 5FXWA 5FZGA 5E6HA 5FY0A 5FP3A 5FZDA 4BXFA 4CCOA 5ISLA 2XUEA 5KR7A 5A1LA 5F3EA 5A7WA 5F32A 5A7PA 5F3CA 2OQ7A 5FZOB 4D6SA 5FYBA 5IVEA 5FYZA 4BU2A 5FP8A 4D6RA 4LIVA 5A3WA 2Q8EA 5FYMA 4ASKA 2Q8DA 5A3TA 5FYUA 5LY2A 5FYSA 3NJYA 5F39A 3AVRA 4NUBA 5A7NA 4XDPA 3PUQA 2W2IA 3PU3A 5ANQA 4QX7A 5FYHA 3PTRB 4TN7A 5FPVA 3DXTA 5FY5A 5K4LA 4AAPA 2VD7A 5LY1A 2YU2A 3ZPOA 5FYYA 4IGOA 5FUPA 2P5BA 5FZ9A 5FJHA 3N9QA 5FZ4A 5LW9A 4CCMA 3KV4A 3K2OA 5F3GA 5FZOA 4IGQA 2OX0A 2Q8CA 5IVVA 5A7OA 1VRBA 4GJZA 5FY7A 3KVAA 5IVYA 2PXJA 3DXUA 5A3PA 3N9LA 4EZ4A 4LITA 3U4SA 4UF0B 5FZ3A 3AL5A 4LIUA 5FWEA 4CCJA 4D6QA 5FPUA 5IWFA 5F5IA 3UYJA 5FZBA 5IVFA 5FXXA 2OS2A 5FYTA 4EZHA 5F2WA 5FV3A 3N9OA 5FZCA 5FP4A 5FP9A 4CUGA 3LDBA 4IGPA 2XDVA 3ZLIA 5FYVA 5IVJA 5FBJA 3PDQA 5FZFA 5FZHA 2XXZA 5FYCA 5FZLA 5A7SA 5FZMA 2OQ6A 3OPTA 5IW0A 4E4HA 5FZEA 5FWJA 3AVSA 4CSWA 4HONA 2YBPA 5FZKA 5FUNA 4C8DA 2WWJA 3AL6A 4UF0A 4GJYA 4CCLA 4DIQA 2YBSA 5A3NA 4HOOA 2YU1A 5F5AA 3KV6A 3PU8A 4V2WA 5FY1A 3KV9A 5FZ7A 2YBKA 4QXCA
chains in the Genus database with same CATH superfamily
2W1UA 4HZFA 4W6XA 4AL9A 2WYSA 3WG3A 1AR82 2PELA 3MYXA 1PZ8A 1FX5A 1Z0HA 1LKNA 3I7DA 4UW4A 5A7QA 3R05A 3ZSJA 5LWBA 1DGRN 3Q8FA 2BNNA 3QH7A 4LK6A 4LHKA 5K0UC 4QX2A 1F4HA 2JKXA 3HQUA 4KQ7A 1O91A 3PUSA 2VO5A 5F7UA 4AEKA 1AL21 3K3NA 2X8KA 5BNOA 1AL0G 3SKJE 4ZKTB 3WT3A 1EPWA 4I30A 2ORZA 3VBSB 2PTMA 3ACFA 4MGKE 2NP0A 1VE0A 3KF5A 5J36A 3FBYA 2V5YA 3KT1A 4URAA 1X36A 4XJAA 2OKXA 2WNVB 3THPA 3IMNA 2WNVC 3LCPA 2VBDA 4FCAA 1YCIA 2BBVA 1OURA 2ZS6B 2JG9B 5FY0A 2BZDA 2BFUS 2XG3A 3BYWA 1ENRA 2XUEA 3MW4A 4LBJA 4AXOA 2A5ZA 1UY0A 2AGSA 3E5UA 1AR93 5DZFA 4QPGC 4PHZA 1COV1 4E8DA 1JYCA 4QX0A 4OI2A 2DV9A 2WSUA 2E7QA 1DCSA 2WT1A 4NROA 4DNYA 5I0SA 1URXA 1WA6X 1ND3B 4XEZA 1GZTA 3AXEA 3C2UA 5H9PA 1ND3C 5GLTA 1VBB2 1FPN3 3H3UA 2DWRA 4XDPA 5L36A 1H2MA 2WS91 4R9AA 1LOCA 2G19A 4IE4A 2WJSA 4CVUA 3S57A 4H55A 3OGVA 4ISQA 1WMFA 2VD7A 1JW6A 1VBD1 2YG0A 1R64A 4IGOA 1CAWB 1Z7S1 3ZXGA 1IG3A 5GZDA 2HYKA 4QXKA 1CWPA 1HRI2 4AEDA 4AVVA 2X5IA 4IGQA 4AEDC 5CZKA 4AHZA 2Q5TA 4QQHA 2E51A 3OD0A 1G7YA 1Q8QA 2AYHA 3DXUA 2JD9A 1NE4A 3GJBA 2JEMA 1W0PA 4JX0A 4LIUA 4UFMA 4FP2A 4GMP1 3WF1A 1WD4A 1KFUL 1NUKA 2HWB3 3IWZA 3N9OA 1CAUB 4FXKB 4QKNA 4XURA 4CP0A 4CUGA 5BY5A 3OGSA 3VHPA 1F15A 3VD4A 3VD3A 3FHIB 5J96B 5LK7B 4LHLA 1W6MA 1QIQA 1VB4A 3FFQA 1AJKA 1S0GA 3S5QA 4DEVA 1UZ0A 2JE7A 3WDWA 1HXS1 4B4RA 4BWOA 1VBE3 1BHGA 4YW5A 3VBUA 3ZYFA 2ZX3A 1UMZA 2BFUL 4H3WA 4XFCA 4YZ2A 3HBKA 2R043 1S2KA 2RDRA 4GMP0 4YLZA 2BNOA 3VBUC 4NPLA 4S2DA 2TUNA 3KMHA 2E6VA 3UK9A 4A7YA 1FXZA 1RMU2 2YBKA 3NVCA 1US2A 3OF1A 4YGEA 2P6HA 1CX1A 1H2LA 3BALA 4QWNA 4XBNA 4XW3A 4E4DX 3RYPA 1N3PA 2BTVC 4N43A 2JDKA 5IK5A 2BW8A 4LLFA 5JVVA 1BEV3 1J59A 1Q8OA 2D40A 1NCQA 2BGOA 2XLFA 5FTTC 1CONA 3N7LA 2Q0AA 2PMWB 4JDOA 3K4ZA 1ASJ3 1TG7A 5C6CA 1VMFA 3MUY1 1HRV2 2R073 1FOD1 2PLV2 3FE5A 4MHRA 4E2SA 4JKKA 2XPJA 3DCQA 4DB5A 1WLCA 2XQXA 1SLAA 1PVC3 1SPPB 2GP3A 3OGGA 1BK0A 1QEXA 3A7QA 1X9PA 2D6LX 2OT7A 3AZWA 1RC6A 2H6BA 1MZ6A 3ES1A 2I45A 4IETA 5TSWA 2IXCA 2CTVA 4OQ9A 1ZBE2 1FV2A 4Q4W1 5C3RA 4FPGA 5JAXA 3WXPA 2C9AA 3WV6A 4XC9A 4AVAA 4LNVA 4IDZA 5ISLA 5T54A 5F3EA 3M70A 3VKMA 4JHTA 4HKWA 5FUIA 1EY2A 4WBBA 5LK5A 3A0NA 3HNYM 2Y0OA 3BGAA 1IS3A 2BP6A 4KL1A 4LHNA 4LR4A 4XZUG 2Q8EA 1ULCA 3DKWA 2ZACA 4Y5Z0 5FYUA 2J1EA 4QB6A 4Y1YA 3AZVA 2A3WA 4YM2A 4A3ZA 4HPKA 1JZ2A 1QMJA 2J7MA 1QKQA 1DG6A 2DTWA 3J26N 2JB4A 4YGCA 4ZXKA 1O5LA 1C1LA 1X7NA 1JN2P 1TMF1 2PHLA 3ZYBA 3S5AA 2ZTNA 3K46A 1DZRA 4RR3B 2B42B 2DFCA 1RUG3 1AYN1 2Z79A 5EPAA 3E6DA 2W39A 2ZX0A 4ZHNA 5GZCA 5FJHA 4C1XA 3I2IA 5M0TA 4AQTA 4GB32 1NA1B 4ES9A 4LO5B 5FZOA 1JI6A 5JOWA 4XUPA 1FI2A 1XC6A 2OX0A 1POQA 1YJLA 4LOTA 2LROA 5IVYA 3FUOA 2ZMKA 1GMMA 1E5HA 4LITA 1C8NA 1X50A 2W52A 4QKFA 4FXGB 3H0OA 2ARCA 2WFF3 3UV9A 2E63A 1XNTA 2PYTA 4M3CA 2KD7A 1LOAA 5J98B 4COZA 4FVVA 2QNKA 5CG9A 2WR9A 3DKQA 1ULPA 4IV3A 3KLSA 5GZFA 2Z4FA 2W47A 1LODA 1WCQA 4OYUA 4QDRA 5FZHA 5IHRA 3ILRA 4LBMA 3O0VA 3ITQA 1AVBA 5JXIA 3LPFA 1JYWA 3RG0A 4QX5A 2VXRA 4L9BA 4CUCA 2IWGB 1NT0A 2VUDA 2R30A 2WWJA 2ZPXA 3INAA 2CU5A 4F3JA 4MVTA 2RS51 2VZSA 5T5PA 2C9KA 5A3NA 3J9SA 5GALA 3TYJA 3WP3A 4V2WA 4AEJA 1EPZA 1W6NA 5FZ7A 3ZFGB 1MEC3 2E9QA 4IUGA 2WKKA 5F9TA 1OD3A 1VMHA 3RYKA 3VD7A 2B8MA 3S7IA 3VZJA 3WNOA 4EV0A 1O8SA 1UYZA 5AC91 3NV3A 2IUWA 2P34A 3DEMA 1K3IA 1KQRA 3N7KA 4GKXA 1MQTA 5A7WB 1GWLA 1Q5OA 4XFGA 4QHZA 4TWTA 3KT4A 1DYOA 1XSRA 1MQTC 4YVSA 5FPLA 5FY9A 3ST7A 5CFCA 2A6ZA 2QQNA 1J3RA 1WZXA 4BLIA 5A80A 4DRVA 3UT0A 1NCRB 3HMYA 2DU1A 4QPWA 5C33A 1US3A 4P9IA 4AFMA 1LHOA 1ZZ9A 5IK7A 1CESA 4XFAA 3V0AA 4IV1A 3RZJA 5IVCA 2D5FA 2RS13 5F3IA 1KFXL 2A3XA 4GWMA 3MPBA 1R081 4I3PA 1SZBA 2WNUA 1KITA 2BV4A 2VMFA 1VBC2 3OTFA 1PK6A 1WW5A 2WNUC 2WBKA 1W8WA 3UKVA 1J58A 1DU3D 1ZVFA 1PK6C 4BMEA 4AZZA 3A21A 4R9CA 3MHZA 1OLRA 3MW2A 2HWC1 5A6ZA 1V9U3 1VBA3 5LRRA 3VKNA 4E9KA 2PHTA 4JGYB 5FQ0A 1GUIA 4XPVA 3DV8A 5A6YA 3ALQA 4BQ5A 4JCKA 1OLMA 3KZ4C 4CDUC 3NJZA 4G9SB 4JKLA 3ETPA 3LWCA 4WVMB 4MGYE 5FZ9A 1BQPA 1JS9A 5FMDA 3UETA 3ZSEA 5CU1A 3ECQA 5LA9A 3U14A 2B45X 5LW9A 4IESA 1TZOA 3D5OA 3ZXAC 3JCIA 5DDJ3 1PVXA 3I2KA 2Q8CA 3QBQA 3J4UH 1IS4A 1TQ5A 5FY7A 1UIKA 3GBGA 2PXJA 2YC0A 3RMYA 1B35A 2ZX2A 1YIFA 1OOPB 2HWE2 3PJYA 5LB6A 1GP6A 4CDXB 3B7MA 5CKNA 4QU2A 4W50A 4A41A 4AVSA 4EWEA 4FQZA 1RTVA 4OHYA 4ATEA 4MH0E 2QUOA 1NXD1 1LECA 1YHFA 2R32A 2XL9A 4XJWA 4DZGA 2GNMA 4N53C 5FPZA 5C3SA 2B9VA 2RE9A 2WNOA 3CZJA 2CDOA 1V6OA 5A33B 1Q8PA 5DAPA 2XJVA 2JDAA 4JDMA 1GP5A 5FMBA 3E5QA 1PO21 2O14A 1RHI3 2R062 2YBPA 4OUMA 4Y1ZA 4BOWA 1ULDA 4AF9A 4A4AA 4H7MA 5A3LA 2VQUA 1G6NA 4NHMA 3VLBB 2XVKA 4GH4A 1EV13 4AVTA 4UT5A 3KGLA 1UXXX 3NAPA 5DAVA 3WDUA 4GH4C 4QU1A 2JE9A 5EQUA 3PVNA 4MGSA 1SBDA 3JD71 3ZYRA 1OMIA 2P6CA 1J3PA 2RR11 2Y6FA 3I54A 1Y4WA 5FPXA 5FXVA 4B8EA 4I0AA 2IFRA 5FZIA 4BQYA 5J48A 1A8MA 1D2QA 1LJ7A 3HPNA 3WHTA 3PMEA 4NIHA 5HCHA 1JXNA 3PVOA 5FP7A 4GWJA 1RVF1 3LB9A 1SBEA 1AL22 2BNMA 3OY8A 4MXWA 4RS5C 1KGYA 3HQXA 5BUVA 5CKQA 3K3OA 4K1ZA 4LO4B 4TYSA 3SC7X 5LA1A 1GQHA 2FCVA 4Z92B 5A3UA 4P9GA 1CD3G 1POV3 1CJPA 3LDKA 1E5SA 3WZ1A 3T1LA 2GSYA 1REFA 4XACA 2ID4A 4YVWB 3U1XA 3V65A 4EN0A 3I59A 1ULEA 3OBAA 1QH6A 3AZXA 4XJUA 3AFGA 4O9EA 2ZMLA 4AQ2A 1YNAA 1UKGA 3H8OA 3UJOA 3LPGA 2ADEA 2QQJA 3OYWB 4QAWA 3PIJA 5C4WC 2P17A 5F32A 1UO9A 4FP3A 4ZS2A 3VBFA 1HQLA 4M4RA 1XNBA 1YQCA 3DUIA 3ORJA 5EXOA 5FYBA 3H42B 1JZ8A 2CV6A 1COV2 1VRH2 1K42A 2Z5WA 2DVAA 1U5ZA 1BK1A 2ES3A 2D3PA 2WABA 3FL7A 4YRDA 3ZYPA 5DUWA 4D7YA 2JENA 5C70A 3WQ1A 2ARXA 3MFAA 1EUUA 1UYPA 2FMDA 4HN1A 3ZN6A 5C8CB 3EBRA 2WS92 5C8CC 2W3JA 3WNNA 5LY1A 4NHXA 3UESA 1W6OA 3HT2A 4QX1A 3N4MA 3AP5A 4PF5A 1VBD2 3ZFEB 3B02A 5FLJA 1U5YA 1Z7S2 2XL7A 3BCWA 3OCPA 2EICA 1HB2A 1T2XA 2D7FA 4K8RB 2GC0A 4NOTA 4P9WA 4I01A 2WZPP 4CEYC 4DFSA 4INDA 4AK3A 2PHUA 3KVAA 4PI2A 5C3PA 3OEBA 1UXZA 5DUXA 2UYAA 1LOFA 1S4CA 3OJBA 4D6QA 3NO8A 2VC9A 4XTPA 5C9AC 3Q9OA 3I3EA 3UYJA 3GZUC 1KJLA 3ILFA 3D3AA 3OGJA 1S55A 1OQDA 3FMGA 3E6BA 1GNZA 1OKOA 1TEIA 3SCFA 4LQRA 3IIIA 4QPIA 5KHIA 4BLJA 2WIIB 2WDBA 2VMHA 2GALA 3M3EA 3BU0A 1R1A1 2D6PA 3ILNA 3BI3A 3S7EA 3WQ7A 4CU6A 2HWD3 1HKDA 2LTNA 1LCLA 1W9YA 1JZ7A 1JBCA 1HRI3 4O9GA 1CAVB 4E4HA 2ZEWA 4DUVA 3Q8EA 1MZ5A 2GDFA 5HCAA 1HXS2 3SISA 1LU1A 1C1FA 3AM2A 3NJVA 4FPFA 4C8DA 2HYXA 1F5FA 3A22A 3ZO0B 1H1MA 1YLLA 1QJU3 1VAKA 4OUSA 4FSJA 4WVWA 3HJRA 3JQWA 2QTWB 4FOVA 3BU7A 1GOHA 4HVOA 4IEZA 5E89A 3VZNA 5IK8A 4NPMA 4L97A 5GLVA 3NV1A 4LKFA 3J7MA 3BTXA 1Q3EA 4PIZA 1PO11 1TME1 3ROUA 4CA9A 2K2SA 2WYFA 4N9IA 3BUCA 2C0ZA 3LD8A 4Y20A 5GZGA 3GHNA 2WRAA 2NMOA 3R0RA 3VBHA 5FO9B 2CGNA 3QLQA 4G4FA 3MLLA 3VBHC 1CIYA 4EWDA 1DQ1A 2C4XA 3E97A 3IPVA 5EJ1B 4XCBA 3U0ZA 2JECA 4HBNA 3RJ2X 2C24A 4P5HA 2HEWF 1WBLA 2VVEA 3PURA 5D8AA 4E4ZA 5K8SA 2PHRA 3PIGA 4XQ4A 1DGWX 1LENA 4YM1A 5FZ8A 5J09A 1FOD2 2YZ4A 2ZX1A 2WO7A 5FLHA 4XAEA 2GH8A 3M3IA 2K0GA 5CEHA 5A6QA 1RXFA 3H3ZA 2VMGA 2R0HA 4I0WB 2HWF1 5B4XA 3VD5A 5ABJC 1OKQA 5D1IA 1RMU3 5J1XA 5L9VA 1C8M3 2Q30A 4XYXA 1SEFA 1UZWA 5JPNB 3LKJA 1YJKA 1RUI1 2DF7A 3M2MA 1H4GA 3AKSA 4Q4W2 2W46A 2DVBA 2AENA 5A7PA 1C3HA 1ND2B 2ZGUA 3IDBB 5AFEA 3AP7A 1W8UA 4I3GA 5CG8A 1KDMA 3AX4A 4RQPB 2FBEA 1H8TB 3HEIA 3KSCA 4HG6B 4GKYA 4CRQA 3PHMA 3CJIA 4DINB 4IE7A 3IAQA 5JMCA 3JB4C 4LPLA 4RYDA 5IUQA 2NM1A 5FO7B 4EROA 5JCTA 3RQ0A 4AGVA 5IK4A 2W2IA 2ZGPA 3CJIC 2PLV3 4QX7A 4M3CE 2GN7A 4O7XA 4P9LA 5FK8A 4NVPA 4BJ0A 5L7OA 1I3HA 1HJFA 3APBA 3H1MA 3POIA 2ARBA 3FX3A 4Y22A 1TMF2 3J8F3 3HNMA 4DUXA 4QDQA 4CEWA 5A32A 1JYTA 1RUD3 1AYN2 4HKOA 1O5UA 1A3KA 1ZBE3 1XJAA 1L7QA 1UZZA 1AR71 1IQDC 4XJ9A 2WQ8A 5JI7A 5LBEA 2D93A 2WQZC 3SH5A 1GOFA 2WLPA 4WZFA 5FMCA 4JV4A 2XONA 5BNNB 1MS9A 3HBZA 5HCFA 1GOGA 4FFFA 2RVAA 1EYBA 4IEOA 1RUE1 2FDGA 3RPQA 3GNEA 2UU8A 1DBNA 5L73A 5FWEA 3DPRA 3WSOA 5IWFA 1CN1A 4KG8A 1QH7A 4NIAA 2EIEA 4RHV1 4Q4Y2 5HV4A 1SFNA 3KCXA 2ZEXA 2ZJCA 2WA4A 3IT8A 3HAGA 1UX7A 2VL4A 1AX0A 1H4HA 2JG8A 3A0KA 5FRAA 3RGBA 4S2GA 5ERLA 1VP6A 2CY6A 5FAXA 2CHHA 2QCSB 3AP6A 4EJRA 1OT5A 1I5PA 1H6YA 2JG8C 2NLRA 1MS5A 5FYCA 1AXZA 1CZTA 1UD1A 3FHAA 3GHMA 4GB33 3VDDC 1FPN1 2YGLA 4BPZA 1AR61 2IZWA 4JHZA 3GM8A 1O6UA 4WM8B 1I1EA 3N3HA 3H1WA 4LKSA 3VZLA 2Y6JA 3VKLA 2MEV3 1HW5A 1SFPA 5DPNA 3HWJA 3KQRA 3PVEA 3VZMA 2GNDA 2IXJA 2QZ3A 5KXDA 1EAH3 3POYA 4OQ8A 3MV01 3FUQA 2W94A 3GCXA 4JGZB 3ASIA 3KCCA 2PQSA 1RUJ1 2RMU3 3JXSA 1GICA 1UOBA 2BWCA 5AVAA 3ZIXA 1EP0A 1HV1A 1UX6A 3ES4A 3N9NA 5AC92 4XIKA 1YQ5A 4QX3A 1LU2A 3CHXA 1DLLA 3GBWA 2HWB1 2FDKA 2XOMA 4LKEA 1V6LA 4A7KA 1ULFA 3MGUA 4PQQA 3ZDSA 4YFWA 2YV8A 2ZZJA 2WZ8A 4QXBA 4XFFA 1RUC2 3MO4A 4V2VA 5CFDB 2VGDA 1N1TA 5F1RA 2YPDA 3TEYA 4YARA 2RM23 3IDCB 2E32A 2JXAA 4L2NA 4MO3M 3ZIWA 3AZZA 2ZAHA 1NY71 1VBE1 4U36A 1IS6A 3L2YA 4KWJA 5K0UA 5FR3A 3OBRA 5BNPB 3S0MA 3H8XA 3Q8BA 2C26A 2GC2A 4BXFA 4KWKA 3ZXEA 5BNPC 1R082 1QOTA 1DDLA 3P5BA 1RB8G 4P9YA 2R041 1QJFA 1OH4A 2AEYA 2DCYA 1KS5A 3ZYJB 4I02A 3OSDA 4AFCA 4ES8A 2QVSB 4JTOA 3WDYA 5A3MA 1F31A 3VBSC 1APNA 3LSEA 4A2UA 2HWC2 3K4AA 4Q4V1 5A7NA 3BTYA 1KJRA 2YHJA 1PMHX 2WNVA 2IC1A 5EZWA 1HN1A 3AKPA 4LULA 4IL7A 2UWCA 1W99A 3POEA 4Y1XA 1WW6A 5JMOA 1NQJA 2VR4A 3N36A 2GC3A 1OPOA 3IM0A 2JG9A 4JZRA 2W95A 3T2TA 1PM4A 3VBOB 4AYUA 3NV2A 1DYPA 2UWBA 4FPCA 2JG9C 4QPGA 3VBOC 3AK0A 5BNOB 2R071 5F3GA 3MLJA 3I2GA 4CCDA 5A3OA 4DRRA 1VBC3 5IJRA 1K5MB 2Y26A 1D0GA 1W3XA 2Y8KA 1K5MC 2PHDA 4CPBA 1ND3A 1UOGA 4D8MA 4OHWA 2ENRA 2QE3A 2ZX4A 3GBFA 3LSDA 5FZBA 5IVFA 4XFHA 2E53A 4XUTA 1FNYA 1CAXB 1S1AA 1WUVA 2EF6A 4XOGA 3MIHA 3AJZA 3WCRA 3V0BB 1CAWA 2P2KA 2PHXA 5DUUA 3WNPA 1XPWA 1S0CA 4UW3A 4Q0UA 1HB1A 5FZFA 1N47A 3RFRA 4UXAA 3ZMNA 2ZZQA 3K4DA 5FZMA 5A70A 4OI1A 4XMAA 4LK7A 3SH4A 2V4VA 5AFBA 4LJHA 4EWAA 1JOBA 3AVSA 3W21A 3BOWA 1WCKA 1JYIA 1NLRA 3BODA 4XF9A 3ZPYA 5J37A 1OVSA 4GJYA 1JHNA 5F5AA 1RUG1 3KF3A 3SNMA 2RJ2A 3EXUA 3ZFFB 4IEWA 2HWE3 2VULA 3ZFFC 1UN1A 1OBNA 1QJY1 1WKYA 3DF0A 4PF1A 1YFYA 2WAAA 4PDWB 2E26A 2UURA 3TWIA 2VZPA 2VZ1A 5H9QA 3JD72 1VAVA 2RR12 2X5IB 5FZ0A 5JSPA 4LLOA 2VG9A 5B2GB 2XJSA 5CVRA 2A7AA 2B7YA 1GP4A 1RUF3 2RDNA 2VH9A 2YGMA 3EYPA 4W4ZA 1RVF2 2BGCA 1JZ5A 3WDTA 2SBAA 4B1LA 1ULGA 4ATFA 4EN6B 1YFXA 5JPMB 4MG2A 2R063 4Y4RA 1GQGA 2UYBA 3DYMA 1MS0A 3PUIA 4Q0PA 3USUA 1SHWB 5FJKA 4YW2A 3RZZA 1OA3A 4R4XA 2DCKA 1JZ4A 4DQAA 5A1FA 1DQ0A 3ZSMA 4DUWA 3J7NA 1HQNA 2VNGA 1W6MB 4M3CF 4R9BA 3C7EA 4YW6A 1IGOA 3PL0A 3T2PA 1LHNA 3R4SA 1XYOA 4CUBA 1OA4A 4JTNA 4L99A 1CPNA 3H50A 4FPKA 2H0BA 2BVBA 1JUHA 1RUH1 2WZR1 3DECA 2YPJA 5CB7A 5LCWL 2VM9A 4D6RA 4CP1A 2G1MA 3E1F1 5AVPA 2Q8DA 3EJKA 1AL23 1RIRA 1ZZBA 3SCGA 3NSTA 3AMMA 3KHCA 2ZGQA 3UKTA 3U4XA 2R7EB 2PHFA 2WA3A 5H9RA 4CU9A 1H8VA 1H9PA 4LO7A 2VMDA 3JB8A 5DAQA 5E8AA 4KU8A 2OZ6A 2G9GA 4CXWA 5K4LA 4YZ3A 1UZVA 1OVPA 5FUPA 3Q8AA 4BZ4A 2KM2A 4IEPA 4WM7B 3O1VA 4BA6A 2P3YA 2VOWA 3DN7A 2WUHA 2EALA 2HJIA 1NCQB 4UYBA 3W59A 4S2HA 3K2OA 3B00A 3URFA 1RJ7A 3HT1A 3WDXA 3BKZA 4ASMB 5ACA3 3ZM8A 3H7JA 3E6CC 1D4M2 3W5NA 1J83A 1BJQA 1J3QA 4UF0B 3AKQA 1VRH3 3K77A 1BBT1 1REEA 1GWMA 1IQAA 3GJAA 5A1AA 2OVUA 4FFGA 4PIYA 3SKVA 3DL3A 1VIWB 4NAMA 5CNAA 1AJOA 1R1ZA 1YIPA 3HQRA 3NKTA 4Y1UA 4XUQA 5DAXA 3ZR5A 5FCCA 1IPJA 3ZLIA 3P1IA 2WS93 4RR3C 1GQPA 1GU3A 3POWA 3OBTA 4FOQA 4A42A 1IOAA 1F4AA 1V9U1 4COVA 3TRSB 4FTEA 1VBA1 3I2FA 5FZLA 1R1A2 1VBD3 3CIHA 4A45A 2WO1A 4AQ6A 1W90A 1NA1C 3G7DA 1Z7S3 3LEKA 2VOXA 5FZEA 3IZOA 3B5LB 3M3QA 2GAUA 2BBAA 1TE1B 2OYZA 3PVBB 5FUNA 1SQ4A 4K21A 3ZXJA 4BQ1A 2VW2A 2X29A 3UGFA 3QD6A 1FATA 2YBSA 4LE3A 5I0RA 4HPKB 1HIXA 1AYM1 1REDA 2EAKA 1PGL2 1UY3A 3VUOA 1HB3A 3MEPA 4QKDA 2ARAA 4QX8A 4JC1A 4CDWB 4XDOA 4TSVA 1WBFA 4DXTA 5C7GA 1X8EA 2VQTA 3K51A 4CDWC 4BCUA 1SDWA 4TXWA 1UKRA 3VL9A 1PO12 1TME2 1OHFA 3N9PA 2QBXA 2ZKNA 3AKTA 2A6VA 2VW1A 3RZLA 4PLOA 4FTBA 1PGW1 4CU8A 2DUOA 5JZGB 4IEQA 4FOYA 1OUSA 3BTZA 2FZ2A 4QB2A 5JZGC 1BCXA 4FPHA 3PUAA 4TLGA 4Z2AA 3M1HA 4MADA 2VZRA 1HXS3 2AREA 4J1WA 1ZYBA 4XIOA 3UGHA 3X29B 3KVBA 4AOCA 3WUCA 2NQYA 3FLTA 1WLWA 5FY4A 5FMOL 3VHOA 2R6QA 1VJ2A 2WSVA 3ZFGC 4M00A 4IV3B 1A6CA 2E7AA 2HWF2 4SBVA 2WWSA 3WW4A 2Y33A 5FP3A 3ZX7A 2W1WA 2YC2A 1RHI1 3MIEA 4M01A 4BHPA 2Q1ZB 4R52A 1AXKA 2GU9A 2RJKA 2XWBB 5A7WA 1RUI2 1Y43B 2Q4SA 4OLLA 2D97A 2VU9A 5GM0A 3SQOA 4BQ4A 5KXCA 1EV11 4L0PA 4WVZA 4E27A 2HEYF 1W6PA 2EXIA 2JDPA 1AX1A 4Q26A 3ZSLA 1NAEA 4MGIE 4OI0A 2I74A 5T3NA 1YFUA 3P3NA 4NRQA 1LOGA 1PNGA 2LRPA 5LY2A 4YPJA 1X82A 4HXCA 4AW7A 4PBPA 1O3SA 2VMIA 1NCRA 3LZZA 4DXZA 1W6NB 3T4VA 4HVQA 5J3UA 2FDHA 4Y24A 1NCRC 4JRAA 5IYYA 3RI9A 3B9CA 5L9BA 3KHBA 3VD9A 1FOD3 1MS3A 5EFUA 4D7SA 2W0XA 5FLIA 1JYXA 2ZOEB 2QQOA 2WINB 3KCYA 3P6BA 3LAGA 2YC4A 1C28A 1DYKA 3MIDA 4BMBA 1OA2A 1UL9A 2QQPA 1XYPA 4FPEA 4YZ5A 4AEMA 5KHKA 1FV3A 1DFQA 1NOVA 2W92A 2Y0IA 4Q4W3 1AR72 1VRBA 3W9AA 2IXIA 3RMXA 1QQP1 5CFCB 4XHBA 1UPIA 2VAUA 2XBO3 5FZ3A 2JDUA 2ZHLA 1QJEA 4KU7A 2ZA9A 1RUE2 1IZ3A 3TEZA 3IDEA 1W8FA 2QDNA 4YZ4A 5FYTA 4XETA 3O0XA 3OUIA 2ZGMA 4JGYC 4P9JA 4CDUA 5FZCA 5FP4A 4IV1B 2AR6A 1AHSA 4RHV2 3NNLA 1M06G 1GLHA 1WMEA 3IN9A 4YM3A 1D4VB 2XDVA 4P14A 1GYKA 1LNSA 1LHUA 3I49A 5SV8A 3B9IA 3CU7A 1X9TA 1TMF3 2VE1A 4HN0A 3PDQA 2JICA 1N1VA 3QOPA 4C90A 2OQ6A 2UWAA 1UY2A 1AYN3 2VVDA 3H8RA 3WNKA 3JBG1 4YGDA 4MYEA 4HLTA 1FPN2 1MR5A 3R4DB 1W6QB 4AI3A 1AR62 2D3SA 1V0AA 1J1LA 4CCLA 4CP9A 4DIQA 1LOBA 1WLDA 2YUEA 3KB5A 4L92A 4YM0A 1RYYA 5FQ0B 3WNXA 3ZXFA 4D7TA 1OOPC 1CIWA 3KD4A 2LM3A 3B93A 4LA3A 4Z82A 1MPXA 1A34A 4CDXC 3N9MA 4BE3A 1IKPA 3RZKA 4N53A 4ZZ5A 2WN3A 4Q4Y3 4DMIA 3S30A 3WNLA 4AI9A 4GD4A 5C71A 2XGXA 5IVBA 2OZJA 4H14A 4XF4A 5A33A 1PIV1 1JHJA 1QOOA 3MIFA 4UBHA 1RUJ2 3L9JT 4PLMA 3U78A 1MS4A 2O8QA 3FC0A 4UW5A 5I0TA 4ZZ8A 4LT5A 3ZKYA 4DO0A 1EUTA 2AACA 1SDDB 4QQ2A 4Y1VA 1B35B 1MACA 1W8NA 2BVVA 1JTZX 3LA7A 3PUHA 4META 2HWB2 4UW6A 1FMD1 5LBFA 2DCTA 2VCCA 4NIGA 2ZGLA 2FMYA 5LATA 3V56A 4AHYA 1YI7A 3OBZA 4DOUA 2ET1A 3IBMA 4BB3A 1ZA7A 2JX9A 1XE7A 3P3PA 3F95A 2HWD1 1H2NA 2BRTA 1Y9MA 3IIAA 4DS0A 5T5JA 1XYNA 3MFCA 5HXMA 4NHYA 1WA4A 1VAMA 4PQ9A 1XBFA 4CYDA 3VGIA 1NY72 1VBE2 1ZRRA 4CCOA 1QXJA 2V73A 4P5YA 4UFLA 3WG1A 4B4PA 5E1RA 1QJU1 4OVEA 4FPYA 4RS5A 3ON7A 5AC93 1BLZA 4P02B 3RI8A 3HN3A 2R042 2J1TA 2DVFA 1ZZ7A 5FP8A 4ARYA 4Z8BA 4E4SA 4Q4X1 2OUHA 1DGRA 3BPZA 1W2OA 1R091 1W2NA 4IEVA 2RS31 2AZ5A 2JIJA 3ZXDA 4IE5A 3AC0A 4Q0QA 3NAPB 4XF1A 4YVWA 4U2AA 5APAA 5DG1A 4Q4V2 1QJX1 3WOGA 1RUC3 1HLCA 4YVWC 1V00A 2L9LA 4KNCA 4NHLA 4O65A 3RZMA 4NIDA 4P00B 4V1PA 5G04L 4HANA 1ENSA 5C4WA 3OYWA 1H6XA 1AR83 1S2BA 3RZHA 1CX4A 4BQ3A 2XUMA 1RL3A 4FFHA 1ZZ8A 1J1TA 2CL2A 2Q1MA 2BUKA 3C7GA 1MS1A 4R4ZA 1QXPA 3OY8B 3WNMA 2EAAA 2R072 3EO6A 4OZOA 2IFWA 3LA2A 3AP4A 5JSRA 3O1PA 5LA2A 2FDFA 3KS7A 1RMU1 5JOYA 1C8M1 3WW1A 2HKXA 3FHQA 1ZZ6A 1F9KA 3I59B 4IE6A 5FXXA 3TN91 5JIUA 4K9SA 5C8CA 1ZRDA 1L3JA 4ZPIA 4GWIA 3LDRA 4J25A 3WQBA 1JU3A 3NW4A 5J7MA 1WGPA 3LIHA 5K7PA 2YFZA 1TNRA 2NMNA 4KBBA 2VZUA 2R49A 4QHOA 4K1YA 2H6CA 2FZ1A 2FCUA 2K9ZA 2OA2A 2QQVA 2Z69A 3K75B 4CEYA 2UY9A 1ACCA 4IQPA 3ZFEC 3VBFB 1W9WA 4NAOA 4HSJA 4XAAA 4O61A 5JXHA 4AGRA 2WFPA 1LGNA 1RITA 3GDBA 3TNQA 3AL6A 1UQXA 5C9AA 3CZUA 3M7AA 3A23A 1N3QA 3J8F1 4YFZA 2XJPA 4IEYA 3T1MA 2FDIA 1RUD1 1RUG2 1LESA 3ZN6B 5A6XA 2VTXJ 1RUNA 1ZNPA 1SLTA 4QXCA 3WCSA 2DBNA 3KQ4B 1VBB3 3WF2A 1QJY2 4FBFA 4AI1A 2FD8A 1QDCA 2VNVA 4OMCA 4W6WA 3BN6A 4XABA 1YUDA 3GZTB 3WDVA 3CJXA 3EQEA 4XBQA 3C7HA 2CGPA 2F17A 3KV5A 3LQCA 1SFYA 2NPIA 3HOBA 3BB6A 5FBZA 3C7FA 1G86A 1NQDA 3MICA 4YG0A 4COYA 3LEMA 4ITCA 4EYUA 3U37A 1W0OA 3OB8A 1ZREA 2C1FA 4BIFA 4LE4A 3VV1A 3H3LA 3VZKA 4LXLA 2PQQA 4Q1RA 1OUXA 2KA3A 1D7PM 4DY3A 4FTSA 1GNYA 4LBQB 5JR2A 4CU7A 3OUHA 1Y9QA 3ACIA 1XOYA 1XU2A 4UOJA 3VHRA 5HBAA 4PCRA 3IKWA 1ZBA1 4I0BA 3JD73 4QDSA 3N7JA 2RR13 5F3CA 1IS5A 2FDJA 2MEV1 3JUUA 3OEAA 2WN2A 2YB7A 1DGWA 4LIVA 5F6LB 1GFF2 1RXGA 3NKGA 4YGBA 2WZR2 1RUH2 3USSA 3VN4A 1AF9A 1QDOA 1EAH1 2EIBA 4GIQA 5EWSA 2DVDA 5EIYB 4QT6A 3R4UA 1QY4A 1DZQA 1RVF3 1U5XA 2Y34A 3CKHA 3C8XA 3NNMA 4RA0A 5FK7A 3U11A 4A6SA 2RMU1 4ZU7A 5KWRA 3PUQA 3PU3A 5ABJA 2YDEA 2DU0A 3PTRB 3DXTA 3ACLA 3PLQA 1Q8VA 3T4HB 1NZIA 2AH2A 2WT0A 3KWVA 1DQ4A 2J1SA 4Y20B 1O7FA 2VQ0A 3EB7A 1WWYA 4OHVA 3LOIA 4CP2A 2ATFA 2G9FA 5HPOA 1LGCA 1GKBA 4OCTA 5IVVA 1ZRFA 4MZUA 1ND2C 4JDNA 4Y4YA 2QQKA 1UW8A 1ZA4A 3POGA 4BH9A 4NRPA 4PI0A 2RM21 1LEMA 2RDSA 2XB6C 2E33A 2GNTA 4RQPC 4KGGA 1H8TC 3VZOA 2P3IA 5F5QA 2R0FA 1QJZA 1BBT2 4K20A 4HSLA 1HRV3 5SV5A 4D3WA 3DYPA 1UNBA 4HKLA 5G05L 1JODA 1T6GC 1HQWA 3O1RA 2J42A 1HB4A 4LUMA 1ZX5A 5GLWA 4IE0A 3THTA 3GF6A 2XHNA 1CJDA 3ZYIB 1OLQA 4Q0SA 4Q29A 1QOSA 4ZS3A 2RHPA 1VBA2 1S0DA 5JUVA 5BNNA 2FHRA 4RSUA 3LIGA 2PAMA 2VZ3A 2Y60A 2DDUA 3CEWA 3SLIA 3WF3A 3WX5A 3A4UA 5BNNC 1YEWA 4P9XA 2VNRA 1D4M3 2A73B 3KV6A 4JAAA 3D4KA 1L7LA 4CUAA 5C3QA 2Y38A 1AYM2 2QDRA 3CLPA 5L7OB 2IVIB 1LULA 4Y22B 3U10A 3OD4A 2ZCWA 1AR91 3N35A 5FZAA 5A32B 5CIRA 3CF6E 1CGPA 2HLEA 4J1XA 3MF9A 4XFBA 2BDRA 2IXHA 5E88A 2SLIA 1PMJX 3BTAA 3VDDA 5CAZA 4TZDA 1NLSA 1O4ZA 3G6JB 5FYIA 2X53S 1CPMA 4FT8A 1GZWB 1R1A3 4N8MA 1PGW2 3MI8A 1Q56A 5FPAA 3NWKA 3O1TA 2VCMA 5KXBA 4Y5TA 2EXHA 1HV0A 4WM8C 2PN5A 4QPYA 4B1MA 4MOAA 1N3OA 1OD5A 2J1RA 2XJTA 3AMQA 4UFHA 2RS52 5JR7B 4YZ1A 1WMDA 4CDQB 1FNZA 1K5JA 5JI9A 2WWUA 1D2SA 1XNAA 1PHMA 1V6NA 3D6EA 1NZCA 2JWPA 3I3QA 5KBFA 5FZGA 4BQ2A 3O0WA 4BXSV 3O12A 1XRUA 1LEDA 2DVGA 4JGZC 3WF0A 1KRIA 3OUJA 2ADDA 3CNAA 2CNAA 3T09A 1K45A 3NRUA 1RHI2 2OQ7A 3RSJA 1UZYA 1PO13 4K3UA 1TME3 1UIJA 1UY4A 3MBWA 2BJSA 1EV12 4LA2A 5KXEA 3KT7A 3TOJA 3R6SA 1JU4A 2XJQA 3RJRA 1DF0A 1DZTA 3AVRA 2QZ2A 4XXPA 4FO9A 3JZVA 1TVGA 2D44A 1UMIA 4DPNA 5CFDC 4OULA 5F8PA 2DUQA 1UOJA 3B3QE 3IMMA 4FQ4A 4AAPA 4AVBA 2WQ4A 5C8WA 1ZRIA 4H2AA 2VZQA 2WNEA 3RZGA 4G3YC 2J22A 5BNPA 4AGGA 1O3TA 1E5RA 1RUF1 2DURA 5CKMA 2V72A 1KXGA 2HWF3 1UYYA 2XVGA 5BNQA 1WW4A 5DG2A 1PNFA 3GXUA 4B7EA 1YQ6A 1YRZA 4XHXA 3LOBA 3O7OA 2Y6GA 3NNGA 4QD2A 3VBRB 2DTYA 4E2QA 1G8WA 1LHWA 2OXBA 1RUI3 3VBRC 2ERFA 3AYDA 4MXVA 1F35A 3M4FA 5HV0A 3O1MA 3VBSA 4M0NA 2CWSA 1GZ9A 4AQSA 1YC61 1QQP2 1XNDA 3GCWA 4LBKA 5C5UA 4COWA 2YY1A 1W9FA 5T5LA 3UGGA 3SEEA 4YG6A 1BEV1 2XWJB 5DZEA 2FCTA 3WG4A 3CDZB 1O3RA 1QHDA 4IW3A 3ZDVA 1KDKA 5K0UB 1XQNA 3HN1A 1AUYA 4A7ZA 4K6BA 3VBOA 2ET7A 1NLQA 1ASJ1 2BOJA 4MGZE 2A75A 1JMUB 1K5MA 3O1OA 3AJYA 2Z2SB 5BNOC 1OC1A 4CSWA 4LO6B 4NMIA 1BXHA 3FLPA 3JBG2 1PVC1 1AR73 1S0IA 4HETA 3ZN4A 3TB0A 1E57A 2R1DA 3WINE 3GGLA 2B46X 2VECA 1CAXA 1C5IA 1IPSA 1RUE3 1O8PA 2WL1A 1ZM1A 2VPVA 3AZYA 4PIXA 3THCA 5HXVA 4Y3OA 4HK8A 2HBTA 3V0BA 3WY6A 5ACA1 4RHV3 1P8JA 5JXJA 3SCHA 3GALA 1BYHA 4QPGB 4CCKA 1V6IA 1LRHA 3MV11 1PIV2 3HD8B 1VRH1 4AVCA 3WW3A 2R16A 3VKFC 4QMAA 3POBA 2VZTA 4LBQD 3MLKA 1G9AA 2WLQA 1UWWA 3ABZA 4X8NA 1JOPA 1ST8A 3CQOA 2DBIA 4AG4A 2Y6LA 1PO22 1YXWA 4Q2FA 5FKBA 1XB9A 3ZFFA 1FMD2 1AR63 4F83A 2F6BA 3VDCA 2GZWA 1CZVA 1GSLA 1CAUA 4PDWA 4XXAA 1TNFA 1OH3A 2QFEA 2VW0A 5FXZA 1NXMA 2HWD2 2CDPA 4PDWC 5E6HA 5HI0A 1UMHA 5LBBA 2VXJA 4ZXEA 5T50A 2W91A 1SCRA 4AEDB 3MZHA 5T52A 1RGSA 1W0NA 4HFSA 2X5IC 4CE8A 1RUJ3 1KD7A 5FYZA 2EXJA 1QJU2 2WFF1 2EVXA 2PAEA 5A3WA 5KHGA 5IATA 2O8OA 2EIGA 4L11A 2E31A 4Q4X2 5FYSA 4KBZA 4JQTA 1R092 3M8LA 2RS32 5B4NA 2D43A 2BQPA 5LEJA 4OZXA 1HX6A 1S0FA 4N9HA 5FYHA 4MX3A 5FPVA 1U12A 1QJX2 1UCXA 3ZPOA 2VMEA 4LBLA 4XF0A 1VR3A 2VUJA 5I0UA 4N7IA 3T3YA 3HVDA 3LA3A 4D69A 2D6NA 2GMMA 4QB1A 5JSOA 3C3VA 3FBMA 3HNBM 4QQLA 4PJYA 2I07B 4BK4A 4Z07A 2OPKA 4YW3A 3VBUB 2EXKA 1OI6A 1MEC1 1H0BA 5L9RA 3ZMOA 4YG3A 4CXYA 2R1BA 4FI9A 1GWKA 3K48A 2ZGSA 4NR1A 3T08A 1H1IA 2DCZA 3USUB 2VUAA 4RD7A 1N1SA 4QM9A 4XDQA 1C8M2 4QKBA 2C6SA 1BVVA 2JDHA 5F2WA 4BM8A 1SPPA 1BVP1 5FP9A 1FYUA 3TN92 3Q8CA 3AMNA 3GYDA 2VZVA 3PTYA 3HIFA 4Q4V3 3BIWE 2BGPA 4N43B 4WM7A 4Z1VA 5FOBB 4N43C 1ULOA 3SXWA 3ZVXA 4WM7C 2WO3A 2A1XA 5A7SA 3ZN5A 1ALYA 5K9YA 1V6JA 3DGTA 2A70A 5DUVA 1OFNA 5IW0A 1NCQC 2DFBA 1U0AA 4MUVA 1UU6A 1OQ1A 1GANA 4RL7A 4ZY9A 5FMOS 3B01A 1J84A 1PM7A 3B69A 4UF0A 4AI2A 5GLZA 1W05A 2AUYA 2RS11 3POSA 4HOOA 1COV3 1ENQA 4QGNA 4LORA 4BDVB 1G9CA 4MGQA 1CQ9A 3J8F2 2F4LA 1W2AX 2TEPA 4RFT0 3WP6A 2XJRA 1OFSA 2JDYA 4NN0A 4E2GA 1RUD2 1W06A 4NJ4A 1SCSA 2Q8OA 4RR3A 4ZU4A 3VL8A 4GXLA 2OIIA 5LASA 3I3BA 4QGLA 1S0EA 3RVHA 4QXHA 4FPLA 4CZSA 3T0AA 4UI9L 2ZEYA 2B9UA 1AZDA 1NA1A 1QNYA 2XBO1 2ZGTA 3V64A 4OHXA 5FZ6A 3WG2A 4CCCA 2Z42A 2CGOA 2DCJA 3GZEA 5FZ1A 4OFGA 4Q8LA 2QQMA 1MZFA 4UFKA 2N7GA 5LEKA 2CAVA 4PLNA 3TEXA 5BXXA 1X33A 3NQHA 3U75A 1X8MA 5JWPA 4OI4A 3FWEA 3AB0A 4NHKA 4NO4A 5GKAC 2HBUA 3NNFA 2MNGA 4KH9A 2VJXA 3NL1A 5DZGA 4BYYA 4CDWA 2V4AA 5DDJ1 5KC6A 4GMP3 5KHJA 2XKOA 1GBGA 1QJY3 4J6GA 4ET7A 3AYCA 3WVJA 5KR7A 1SLCA 2AEZA 3VDAA 5FZOB 4LUKA 4D6SA 1ZBA2 3D8CA 4GALA 5GZEA 3M3CA 4KWUA 5JZGA 4Y5SA 2DUPA 2MEV2 2ZKLA 4AHXA 2F4PA 2GMEA 5D2AA 1QF3A 4DEQA 5IT6A 3CL1A 1BZWA 1NE6A 3ACHA 2ORXA 3BVCA 2IXLA 4Q4Y1 2C5DA 3O1SA 3FFZA 1EAH2 3NJYA 4NUBA 4UAPA 4DY5A 5ANQA 2QQLA 2GN3A 3ZFGA 4YSFA 4IERA 2ZAAA 4UFIA 3WW2A 2RMU2 4W8JA 4DXRA 5FY5A 1C5HA 4M3CB 3C7OA 2PFWA 3EHKA 2J1VA 2P5BA 4HVRA 2X10A 4AFAA 2YMZA 3POJA 3WD5A 4IV3C 3U07A 4X6QB 1VPHA 5FIXA 2CAUA 3O1UA 4CCMA 4RGAA 4MGTA 5I91A 2LS6A 2WAOA 5LRSA 2W68A 4HK9A 3OPZA 4XQWA 4OHZA 2JIGA 1FAYA 5FFOC 4MSVA 5A3PA 4CCJA 3MW3A 1OPMA 2RV9A 3VKOA 2WZR3 1RUH3 4S2FA 2ZMNA 4QQPA 2B39A 2RM22 1JYVA 1JYNA 4EZHA 3D0JA 2BEOA 2VBPA 1PZ9A 4AHWA 4CCEA 2CSGA 5KC5A 4XZPA 3HR9A 3SMHA 1I6XA 1PGSA 2VY0A 3MPPG 2H0VA 1L7RA 2OW4A 5ANNA 1OF3A 2BU9A 2XXZA 1MQTB 1POV1 1W2UA 1Q8SA 3CMGA 4Q0VA 2XVLA 1Y9GA 4SLIA 1O59A 2PAKA 1W6PB 1QU0A 2MHFA 2VZOA 4YVSB 4YWAA 5I8YA 2A71A 4XE9A 2Y6KA 4XILA 4YVSC 1RUC1 4ARXA 1W03A 5CBLA 2GMPA 2BPA2 1YI9A 4AWDA 5CFCC 1BMV1 4K40A 1HJGA 4JGYA 1LHVA 3PU8A 5FY1A 3O5SA 1AR81 5KHHA 3OG2A 4CPBD 4YW7A 3V0AB 3I8TA 1BBT3 4MHUA 3ZYHA 1NYWA 1XE8A 4IV1C 2LUWA 2VOKA 4WVMA 4XVHA 2WNUB 1G9BA 1AR92 4W65A 5T55A 3WP5A 1STMA 1POV0 1S0BA 4M4PA 4AFBA 1UF2C 4XUNA 2D3RA 4F8AA 1PK6B 1UOFA 4NIIA 2KXLA 3FLRA 3T30A 5FDBA 5GJ6A 2ZHKA 1JZ3A 1W6QA 2PHWA 2W08A 4URTA 4WZCA 3E5XA 3ZXKA 4LEJA 1G9FA 2K46A 1OOPA 4RGGA 3ZYGA 4FOWA 4CDXA 1UY1A 3DYOA 4XFIA 5JIAA 3T2QA 3UKNA 1W9SA 4CDUB 1D0HA 5LA0A 4KI5M 5JXGA 3NNJA 3QCWA 1OXCA 1W04A 2X09A 2J1AA 2YXSA 1AYM3 3AXDA 3H9AA 3J7HA 3RWNA 4AR2A 3IB3A 5FXWA 3TAYA 1OF4A 2GH2A 2VBBA 1O4YA 4ORFA 3BOPA 1W8OA 1BKZA 3RDIA 3WR0A 4Y26A 3BPSA 1SG3A 2GNBA 2O0OA 4ISRA 1W8HA 2G4IA 4BU2A 4YW1A 5I0DA 3ETQA 3OOXA 2W87A 4AFDA 4E8CA 1VBB1 4CP9B 3W5MA 1LAJA 4HL0A 2V5DA 1VMJA 1B35C 3RNSA 1IG0A 2WT2A 3TEWA 4R9DA 5EV7A 1Y3TA 2JDNA 2JKBA 1YWKA 4COUA 5JLVA 1ODNA 2A3YA 4GQ7A 2QJVA 2VCBA 4N53B 5E16A 1WCSA 1LB2A 2RS53 1T6BX 1H2KA 2TBVA 5H9SA 1HRI1 3ELNA 4LKDA 4EN8B 3W58A 4N90A 3VHNA 4BK5A 1OQEA 1RUF2 4UFJA 1QGLA 3QACA 2VMCA 2ZGRA 2QKDA 4ZU5A 1QNWA 5JDBA 1F8VA 3F2ZA 4RGKA 4DXSA 2GC1A 4X6RB 2IXKA 3T2OA 5F5IA 2XH6A 3I2HA 4QQOA 2P1BA 4GH4B 3UNPA 2J1UA 1WLTA 4R8HA 5DABA 2VNOA 2JDZA 3ME2A 5EYYA 3VB9A 1W3VA 2NYYA 4C0HA 3NAPC 4CXXA 3LFMA 2A6XA 1AXYA 1ONAA 3RWKX 5C5TA 5I8TA 1Z78A 1RINA 1BEV2 4A44A 3NMBA 5T5OA 3LEIA 2LALA 3JQXA 5FYVA 5FBJA 1DQ2A 4BQXA 3AFKA 2ZGKA 3FN9A 4I2OA 2W1QA 2DYCA 2D98A 4NWWA 4RS5B 5EJZB 3T0DA 4ZONA 3OPTA 4FPJA 1ASJ2 2XKPA 5FWJA 1R083 2HH9A 3LFIA 4MXWB 4GWNA 4D94A 1MZEA 3EMRA 1H1AA 1PMIA 1SACA 1A8DA 4XUOA 4OMDA 5I8SA 1YO8A 1PX3A 1PVC2 2JB8A 4LBOA 5BPXA 5CADA 1WCDJ 3LEGA 1QQP3 1SLLA 3AMPA 4NPRA 2MPFA 2HWC3 5EYXA 4CTEA 3LF7A 5CISA 2W1SA 2XMLA 3MIBA 4CCNA 4F7ZA 3D0SA 4BISA 3OPWA 5C4WB 5FY8A 1YQ8A 3MDPA 1IHMA 2I2SA 3ZFEA 2A6WA 5F2SA 5ACA2 3WQ0A 1WCUA 1DQ6A 4XQDA 3NJXA 5BV6A 2VCAA 1S2EA 2RDQA 3IDAA 4WV8A 2VOTA 5DXDA 1ZRCA 3VBFC 1N1YA 1HRV1 2PLV1 1NX9A 3H1YA 2G9ZA 3N7MA 1C4RA 4NRMA 3JBG3 2YYOA 5IFTA 3SH3A 3B94A 1DGLA 2XLGA 5DN2A 3H7YA 2GP5A 1Q43A 2OUJA 1ZBE1 2A6YA 4JVAA 4PT6A 4GAZA 1VALA 4EN7B 4EE2A 4C1WA 3I97A 1W6OB 4N7UA 4UWDA 1DLCA 5FZDA 2BWAA 2QQIA 2Y64A 1WW7A 4CEYB 1ENXA 1XSQA 4QM8A 2W9XA 1D4M1 2ZHMA 1C57A 2BYVE 3TBDA 1H30A 2ZGNA 5IVEA 1CAVA 3L2HA 1W8TA 1PIV3 1RUOA 2JDMA 4ASKA 1GR3A 5A3TA 1K12A 1SLBA 2WFF2 3I2JA 3WLUA 1XNCA 2P3KA 5C9AB 3VDBA 1WMXA 1ZZCA 3ATGA 4TTGA 2JJ6A 1LOFC 1UU4A 3ZKUA 5F39A 1F2NA 4HMZA 2XLAA 3FJSA 4IEUA 4UBGA 1PO23 1YFWA 4TN7A 1FMD3 2E7TA 3WEZA 5FO8B 2ZGOA 2FQPA 4XCAA 3ZSKA 2WO2A 4LBQA 3ZOIA 3PJQA 3QH6A 5FYYA 3FZ3A 4GB31 4M0HA 1MVEA 1JUIA 4QPIB 4A3XA 2VQAA 3ENRA 3N9QA 3S6PA 4Z2WA 4QPIC 3GZAA 5FZ4A 5IFPA 4RFRB 4XJ8A 1HN0A 4C91A 1Y7BA 5A7OA 4LHSA 4RN5A 1LGBA 5JOXA 4Q8KA 3N9LA 4EZ4A 5EJ3A 1NKGA 3U4SA 1MEC2 3I4IA 1PGL1 2RJLA 4FPOB 1S0JA 3JU9A 4Q27A 3POFA 5F6KA 4Q4X3 1DP0A 4Q1PA 2BOIA 1QXRA 1R093 5FV3A 2RS33 1UPSA 1LTEA 4KGQA 1UU5A 3WUDA 1V6MA 2TNFA 1KS4A 2NN8A 4K7JA 4Q5OA 4XJZA 5FOJB 2O1QA 3M3OA 5IVJA 1QJX3 2AC1A 3LGRA 2BERA 1FT9A 1NG0A 4AI0A 2OPWA 2VVFA 3CO2A 2CWMA 3VBHB 4FAGA 1W28A 1ND2A 4ASLA 2ETEA 3O14A 5IAVA 4TLFA 1B09A 3RS6A 2ZXQA 2JE8A 2WZEA 2P37A 3IPVB 2ZBJA 4RQPA 3UL2A 5GLUA 1H8TA 4XMIA 2Y6HA 3PMSA 5D8AB 1GZCA 2D6MA 2YU1A 4YNIA 3AYEA 3MF6A 5D8AC 1YYNA 4WVVA 2RS12 5ABJB 1XU1A 4FFIA 2LW8A 2D6KA 5FPBA 2Q1FA 4H7LA 3ZXLA 5F5CA 5D21A 1UAIA 2VTFA 3NV4A 4B3NA 3TN93 1JZ6A 1A78A 5F37A 4MV2A 5CYYA 1GNHA 2HEVF 2XBO2 1V9U2 4LTAA 2RG4A 3SHRA 5EHDA 4LOSA 3RYRA 2EIDA 2QQWA 4L8QA 3J7LA 4XF3A 1OSGA 1PX4A 2P3JA 3CJIB 3OGRA 4GA9A 1VB2A 4W6YA 4Y33A 4C0BA 3D82A 4NWVA 1JOJA 1DQ5A 1W2TA 2KR2A 2V09A 4IXLA 1W39A 2WC2A 4B4QA 5C3OA 1V6KA 3AYAA 1SMVA 3AMHA 4P08A 1W9TA 1IKQA 1QWRA 3MIGA 4I09A 4XTMA 5DMYA 5L7OC 1VLNA 2B5HA 2VTXA 1VBC1 1RJ8A 1JH5A 4K8FA 3WP4A 4CEWB 2QQUA 5DDJ2 2YFUA 3PNAA 4CEWC 4X8PA 5JOZA 4D0QA 5A1LA 4A6OA 4HT1T 5LBCA 2D6OX 4JRLA 5I93A 1M4WA 3TNPB 1GZWA 3I2DA 2IVJA 1LOEA 5IAXA 3AKRA 5FYMA 4OUEA 2ZEZA 4WM8A 1LR5A 2ZABA 4JKMA 1CZSA 3DPRB 2NZ9A 1E5IA 3ACGA 4GULA 5DAWA 4QHBA 4LMFA 4AE2A 5L19A 3DPRC 3WF4A 1ODMA 4KMQA 1IPKA 4CDQA 3SEPA 5BYNA 1HDKA 2YROA 3I3DA 3RRDA 1XE0A 4CDQC 2YU2A 3I2OA 4JGZA 2JG8B 3W20A 4BIOA 2X05A 4FAHA 5FKCA 4IEXA 2XR4A 3VDDB 3KV4A 5HCBA 4LBNA 1H9WA 2JD4A 4QGMA 1UYXA 3T0BA 3AP9A 4AI8A 4GJZA 4ONUA 3ZR6A 2HWE1 2ZHNA 1XXNA 1ZBA3 2UY8A 1DIWA 2D5HA 1U5IA 4AAXA 1CR7A 3AL5A 5FPUA 2XHKA 4NE9A 4LO8A 5CFDA 1SBFA 2B4KA 2W5FA 2OS2A 2CYFA 3H8UA 1AX2A 2XQRA 3KGZA 5DQ0A 4YYOA 4EQVA 1O3QA 3IAPA 1DHKB 4KWLA 3LDBA 1YQ2A 4IGPA 3LE0A 2EA7A 1G9DA 5FREA 2VUCA 1XNKA 4KG0A 2P4EA 4GZ9A 4XBLA 3BIEA 2PA7A 4MLOA 4B7KA 1I9RA 3WHUA 5EP9A 2XJUA 1MVQA 3SITA 3VBRA 2R061 1CVNA 2VOVA 3I3MA 4HONA 1V70A 3CBNA 3MUZ1 1MS8A 1I5ZA 1KEXA 5FZKA 3KM5A 3UJQA 1PZ7A 4BQWA 1F5JA 1GV9A 2ILMA 4EN9B 5LZ6A 1W8ZA 3THDA 1O4TA 5CA6A 3KV9A 1SLIA 1WD3A 4YW4A 1BMV2 4JQRA 1OLME 4PBOA 4B29A
chains in the Genus database with same CATH topology
5FPBA 3N9MA 4QU1A 2XMLA 4QWNA 4Y3OA 4QX8A 5F5CA 4CCNA 5FZAA 5A7QA 4AI9A 5LWBA 4GD4A 4XDOA 4BISA 3RVHA 3OPWA 5IVBA 4QXHA 5FY8A 5FXVA 5FZIA 5F37A 3N9NA 5F2SA 3LD8A 4CCKA 3N9PA 3PUSA 3U78A 5A7WB 3K3NA 5FZ0A 3KV5A 5FP7A 5FZ6A 5FYIA 4DO0A 5FPLA 3K3OA 5FY9A 5FPAA 5FZ1A 3PUAA 4EYUA 3PURA 5A80A 4Y4RA 4QXBA 4V2VA 4Y33A 5FZ8A 3KVBA 4URAA 5FJKA 2YPDA 2GP3A 4LXLA 5CEHA 5FY4A 2WWUA 2GP5A 2OT7A 5IVCA 5F3IA 4GAZA 5FXZA 5A1FA 5FXWA 5FZGA 5E6HA 5FY0A 5FP3A 5FZDA 4BXFA 4CCOA 5ISLA 2XUEA 5KR7A 5A1LA 5F3EA 5A7WA 5F32A 5A7PA 5F3CA 2OQ7A 5FZOB 4D6SA 5FYBA 5IVEA 5FYZA 4BU2A 5FP8A 4D6RA 4LIVA 5A3WA 2Q8EA 5FYMA 4ASKA 2Q8DA 5A3TA 5FYUA 5LY2A 5FYSA 3NJYA 5F39A 3AVRA 4NUBA 5A7NA 4XDPA 3PUQA 2W2IA 3PU3A 5ANQA 4QX7A 5FYHA 3PTRB 4TN7A 5FPVA 3DXTA 5FY5A 5K4LA 4AAPA 2VD7A 5LY1A 2YU2A 3ZPOA 5FYYA 4IGOA 5FUPA 2P5BA 5FZ9A 5FJHA 3N9QA 5FZ4A 5LW9A 4CCMA 3KV4A 3K2OA 5F3GA 5FZOA 4IGQA 2OX0A 2Q8CA 5IVVA 5A7OA 1VRBA 4GJZA 5FY7A 3KVAA 5IVYA 2PXJA 3DXUA 5A3PA 3N9LA 4EZ4A 4LITA 3U4SA 4UF0B 5FZ3A 3AL5A 4LIUA 5FWEA 4CCJA 4D6QA 5FPUA 5IWFA 5F5IA 3UYJA 5FZBA 5IVFA 5FXXA 2OS2A 5FYTA 4EZHA 5F2WA 5FV3A 3N9OA 5FZCA 5FP4A 5FP9A 4CUGA 3LDBA 4IGPA 2XDVA 3ZLIA 5FYVA 5IVJA 5FBJA 3PDQA 5FZFA 5FZHA 2XXZA 5FYCA 5FZLA 5A7SA 5FZMA 2OQ6A 3OPTA 5IW0A 4E4HA 5FZEA 5FWJA 3AVSA 4CSWA 4HONA 2YBPA 5FZKA 5FUNA 4C8DA 2WWJA 3AL6A 4UF0A 4GJYA 4CCLA 4DIQA 2YBSA 5A3NA 4HOOA 2YU1A 5F5AA 3KV6A 3PU8A 4V2WA 5FY1A 3KV9A 5FZ7A 2YBKA 4QXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FPB A;  3N9M A;  4QU1 A;  2XML A;  4QWN A;  4Y3O A;  4QX8 A;  5F5C A;  4CCN A;  5FZA A;  5A7Q A;  4AI9 A;  5LWB A;  4GD4 A;  4XDO A;  4BIS A;  3RVH A;  3OPW A;  5IVB A;  4QXH A;  5FY8 A;  5FXV A;  5FZI A;  5F37 A;  3N9N A;  5F2S A;  3LD8 A;  4CCK A;  3N9P A;  3PUS A;  3U78 A;  5A7W B;  3K3N A;  5FZ0 A;  3KV5 A;  5FP7 A;  5FZ6 A;  5FYI A;  4DO0 A;  5FPL A;  3K3O A;  5FY9 A;  5FPA A;  5FZ1 A;  3PUA A;  4EYU A;  3PUR A;  5A80 A;  4Y4R A;  4QXB A;  4V2V A;  4Y33 A;  5FZ8 A;  3KVB A;  4URA A;  5FJK A;  2YPD A;  2GP3 A;  4LXL A;  5CEH A;  5FY4 A;  2WWU A;  2GP5 A;  2OT7 A;  5IVC A;  5F3I A;  4GAZ A;  5FXZ A;  5A1F A;  5FXW A;  5FZG A;  5E6H A;  5FY0 A;  5FP3 A;  5FZD A;  4BXF A;  4CCO A;  5ISL A;  2XUE A;  5KR7 A;  5A1L A;  5F3E A;  5A7W A;  5F32 A;  5A7P A;  5F3C A;  2OQ7 A;  5FZO B;  4D6S A;  5FYB A;  5IVE A;  5FYZ A;  4BU2 A;  5FP8 A;  4D6R A;  4LIV A;  5A3W A;  2Q8E A;  5FYM A;  4ASK A;  2Q8D A;  5A3T A;  5FYU A;  5LY2 A;  5FYS A;  3NJY A;  5F39 A;  3AVR A;  4NUB A;  5A7N A;  4XDP A;  3PUQ A;  2W2I A;  3PU3 A;  5ANQ A;  4QX7 A;  5FYH A;  3PTR B;  4TN7 A;  5FPV A;  3DXT A;  5FY5 A;  5K4L A;  4AAP A;  2VD7 A;  5LY1 A;  2YU2 A;  3ZPO A;  5FYY A;  4IGO A;  5FUP A;  2P5B A;  5FZ9 A;  5FJH A;  3N9Q A;  5FZ4 A;  5LW9 A;  4CCM A;  3KV4 A;  3K2O A;  5F3G A;  5FZO A;  4IGQ A;  2OX0 A;  2Q8C A;  5IVV A;  5A7O A;  1VRB A;  4GJZ A;  5FY7 A;  3KVA A;  5IVY A;  2PXJ A;  3DXU A;  5A3P A;  3N9L A;  4EZ4 A;  4LIT A;  3U4S A;  4UF0 B;  5FZ3 A;  3AL5 A;  4LIU A;  5FWE A;  4CCJ A;  4D6Q A;  5FPU A;  5IWF A;  5F5I A;  3UYJ A;  5FZB A;  5IVF A;  5FXX A;  2OS2 A;  5FYT A;  4EZH A;  5F2W A;  5FV3 A;  3N9O A;  5FZC A;  5FP4 A;  5FP9 A;  4CUG A;  3LDB A;  4IGP A;  2XDV A;  3ZLI A;  5FYV A;  5IVJ A;  5FBJ A;  3PDQ A;  5FZF A;  5FZH A;  2XXZ A;  5FYC A;  5FZL A;  5A7S A;  5FZM A;  2OQ6 A;  3OPT A;  5IW0 A;  4E4H A;  5FZE A;  5FWJ A;  3AVS A;  4CSW A;  4HON A;  2YBP A;  5FZK A;  5FUN A;  4C8D A;  2WWJ A;  3AL6 A;  4UF0 A;  4GJY A;  4CCL A;  4DIQ A;  2YBS A;  5A3N A;  4HOO A;  2YU1 A;  5F5A A;  3KV6 A;  3PU8 A;  4V2W A;  5FY1 A;  3KV9 A;  5FZ7 A;  2YBK A;  4QXC A; 
#chains in the Genus database with same CATH topology
 2W1U A;  4HZF A;  4W6X A;  4AL9 A;  2WYS A;  3WG3 A;  1AR8 2;  2PEL A;  3MYX A;  1PZ8 A;  1FX5 A;  1Z0H A;  1LKN A;  3I7D A;  4UW4 A;  5A7Q A;  3R05 A;  3ZSJ A;  5LWB A;  1DGR N;  3Q8F A;  2BNN A;  3QH7 A;  4LK6 A;  4LHK A;  5K0U C;  4QX2 A;  1F4H A;  2JKX A;  3HQU A;  4KQ7 A;  1O91 A;  3PUS A;  2VO5 A;  5F7U A;  4AEK A;  1AL2 1;  3K3N A;  2X8K A;  5BNO A;  1AL0 G;  3SKJ E;  4ZKT B;  3WT3 A;  1EPW A;  4I30 A;  2ORZ A;  3VBS B;  2PTM A;  3ACF A;  4MGK E;  2NP0 A;  1VE0 A;  3KF5 A;  5J36 A;  3FBY A;  2V5Y A;  3KT1 A;  4URA A;  1X36 A;  4XJA A;  2OKX A;  2WNV B;  3THP A;  3IMN A;  2WNV C;  3LCP A;  2VBD A;  4FCA A;  1YCI A;  2BBV A;  1OUR A;  2ZS6 B;  2JG9 B;  5FY0 A;  2BZD A;  2BFU S;  2XG3 A;  3BYW A;  1ENR A;  2XUE A;  3MW4 A;  4LBJ A;  4AXO A;  2A5Z A;  1UY0 A;  2AGS A;  3E5U A;  1AR9 3;  5DZF A;  4QPG C;  4PHZ A;  1COV 1;  4E8D A;  1JYC A;  4QX0 A;  4OI2 A;  2DV9 A;  2WSU A;  2E7Q A;  1DCS A;  2WT1 A;  4NRO A;  4DNY A;  5I0S A;  1URX A;  1WA6 X;  1ND3 B;  4XEZ A;  1GZT A;  3AXE A;  3C2U A;  5H9P A;  1ND3 C;  5GLT A;  1VBB 2;  1FPN 3;  3H3U A;  2DWR A;  4XDP A;  5L36 A;  1H2M A;  2WS9 1;  4R9A A;  1LOC A;  2G19 A;  4IE4 A;  2WJS A;  4CVU A;  3S57 A;  4H55 A;  3OGV A;  4ISQ A;  1WMF A;  2VD7 A;  1JW6 A;  1VBD 1;  2YG0 A;  1R64 A;  4IGO A;  1CAW B;  1Z7S 1;  3ZXG A;  1IG3 A;  5GZD A;  2HYK A;  4QXK A;  1CWP A;  1HRI 2;  4AED A;  4AVV A;  2X5I A;  4IGQ A;  4AED C;  5CZK A;  4AHZ A;  2Q5T A;  4QQH A;  2E51 A;  3OD0 A;  1G7Y A;  1Q8Q A;  2AYH A;  3DXU A;  2JD9 A;  1NE4 A;  3GJB A;  2JEM A;  1W0P A;  4JX0 A;  4LIU A;  4UFM A;  4FP2 A;  4GMP 1;  3WF1 A;  1WD4 A;  1KFU L;  1NUK A;  2HWB 3;  3IWZ A;  3N9O A;  1CAU B;  4FXK B;  4QKN A;  4XUR A;  4CP0 A;  4CUG A;  5BY5 A;  3OGS A;  3VHP A;  1F15 A;  3VD4 A;  3VD3 A;  3FHI B;  5J96 B;  5LK7 B;  4LHL A;  1W6M A;  1QIQ A;  1VB4 A;  3FFQ A;  1AJK A;  1S0G A;  3S5Q A;  4DEV A;  1UZ0 A;  2JE7 A;  3WDW A;  1HXS 1;  4B4R A;  4BWO A;  1VBE 3;  1BHG A;  4YW5 A;  3VBU A;  3ZYF A;  2ZX3 A;  1UMZ A;  2BFU L;  4H3W A;  4XFC A;  4YZ2 A;  3HBK A;  2R04 3;  1S2K A;  2RDR A;  4GMP 0;  4YLZ A;  2BNO A;  3VBU C;  4NPL A;  4S2D A;  2TUN A;  3KMH A;  2E6V A;  3UK9 A;  4A7Y A;  1FXZ A;  1RMU 2;  2YBK A;  3NVC A;  1US2 A;  3OF1 A;  4YGE A;  2P6H A;  1CX1 A;  1H2L A;  3BAL A;  4QWN A;  4XBN A;  4XW3 A;  4E4D X;  3RYP A;  1N3P A;  2BTV C;  4N43 A;  2JDK A;  5IK5 A;  2BW8 A;  4LLF A;  5JVV A;  1BEV 3;  1J59 A;  1Q8O A;  2D40 A;  1NCQ A;  2BGO A;  2XLF A;  5FTT C;  1CON A;  3N7L A;  2Q0A A;  2PMW B;  4JDO A;  3K4Z A;  1ASJ 3;  1TG7 A;  5C6C A;  1VMF A;  3MUY 1;  1HRV 2;  2R07 3;  1FOD 1;  2PLV 2;  3FE5 A;  4MHR A;  4E2S A;  4JKK A;  2XPJ A;  3DCQ A;  4DB5 A;  1WLC A;  2XQX A;  1SLA A;  1PVC 3;  1SPP B;  2GP3 A;  3OGG A;  1BK0 A;  1QEX A;  3A7Q A;  1X9P A;  2D6L X;  2OT7 A;  3AZW A;  1RC6 A;  2H6B A;  1MZ6 A;  3ES1 A;  2I45 A;  4IET A;  5TSW A;  2IXC A;  2CTV A;  4OQ9 A;  1ZBE 2;  1FV2 A;  4Q4W 1;  5C3R A;  4FPG A;  5JAX A;  3WXP A;  2C9A A;  3WV6 A;  4XC9 A;  4AVA A;  4LNV A;  4IDZ A;  5ISL A;  5T54 A;  5F3E A;  3M70 A;  3VKM A;  4JHT A;  4HKW A;  5FUI A;  1EY2 A;  4WBB A;  5LK5 A;  3A0N A;  3HNY M;  2Y0O A;  3BGA A;  1IS3 A;  2BP6 A;  4KL1 A;  4LHN A;  4LR4 A;  4XZU G;  2Q8E A;  1ULC A;  3DKW A;  2ZAC A;  4Y5Z 0;  5FYU A;  2J1E A;  4QB6 A;  4Y1Y A;  3AZV A;  2A3W A;  4YM2 A;  4A3Z A;  4HPK A;  1JZ2 A;  1QMJ A;  2J7M A;  1QKQ A;  1DG6 A;  2DTW A;  3J26 N;  2JB4 A;  4YGC A;  4ZXK A;  1O5L A;  1C1L A;  1X7N A;  1JN2 P;  1TMF 1;  2PHL A;  3ZYB A;  3S5A A;  2ZTN A;  3K46 A;  1DZR A;  4RR3 B;  2B42 B;  2DFC A;  1RUG 3;  1AYN 1;  2Z79 A;  5EPA A;  3E6D A;  2W39 A;  2ZX0 A;  4ZHN A;  5GZC A;  5FJH A;  4C1X A;  3I2I A;  5M0T A;  4AQT A;  4GB3 2;  1NA1 B;  4ES9 A;  4LO5 B;  5FZO A;  1JI6 A;  5JOW A;  4XUP A;  1FI2 A;  1XC6 A;  2OX0 A;  1POQ A;  1YJL A;  4LOT A;  2LRO A;  5IVY A;  3FUO A;  2ZMK A;  1GMM A;  1E5H A;  4LIT A;  1C8N A;  1X50 A;  2W52 A;  4QKF A;  4FXG B;  3H0O A;  2ARC A;  2WFF 3;  3UV9 A;  2E63 A;  1XNT A;  2PYT A;  4M3C A;  2KD7 A;  1LOA A;  5J98 B;  4COZ A;  4FVV A;  2QNK A;  5CG9 A;  2WR9 A;  3DKQ A;  1ULP A;  4IV3 A;  3KLS A;  5GZF A;  2Z4F A;  2W47 A;  1LOD A;  1WCQ A;  4OYU A;  4QDR A;  5FZH A;  5IHR A;  3ILR A;  4LBM A;  3O0V A;  3ITQ A;  1AVB A;  5JXI A;  3LPF A;  1JYW A;  3RG0 A;  4QX5 A;  2VXR A;  4L9B A;  4CUC A;  2IWG B;  1NT0 A;  2VUD A;  2R30 A;  2WWJ A;  2ZPX A;  3INA A;  2CU5 A;  4F3J A;  4MVT A;  2RS5 1;  2VZS A;  5T5P A;  2C9K A;  5A3N A;  3J9S A;  5GAL A;  3TYJ A;  3WP3 A;  4V2W A;  4AEJ A;  1EPZ A;  1W6N A;  5FZ7 A;  3ZFG B;  1MEC 3;  2E9Q A;  4IUG A;  2WKK A;  5F9T A;  1OD3 A;  1VMH A;  3RYK A;  3VD7 A;  2B8M A;  3S7I A;  3VZJ A;  3WNO A;  4EV0 A;  1O8S A;  1UYZ A;  5AC9 1;  3NV3 A;  2IUW A;  2P34 A;  3DEM A;  1K3I A;  1KQR A;  3N7K A;  4GKX A;  1MQT A;  5A7W B;  1GWL A;  1Q5O A;  4XFG A;  4QHZ A;  4TWT A;  3KT4 A;  1DYO A;  1XSR A;  1MQT C;  4YVS A;  5FPL A;  5FY9 A;  3ST7 A;  5CFC A;  2A6Z A;  2QQN A;  1J3R A;  1WZX A;  4BLI A;  5A80 A;  4DRV A;  3UT0 A;  1NCR B;  3HMY A;  2DU1 A;  4QPW A;  5C33 A;  1US3 A;  4P9I A;  4AFM A;  1LHO A;  1ZZ9 A;  5IK7 A;  1CES A;  4XFA A;  3V0A A;  4IV1 A;  3RZJ A;  5IVC A;  2D5F A;  2RS1 3;  5F3I A;  1KFX L;  2A3X A;  4GWM A;  3MPB A;  1R08 1;  4I3P A;  1SZB A;  2WNU A;  1KIT A;  2BV4 A;  2VMF A;  1VBC 2;  3OTF A;  1PK6 A;  1WW5 A;  2WNU C;  2WBK A;  1W8W A;  3UKV A;  1J58 A;  1DU3 D;  1ZVF A;  1PK6 C;  4BME A;  4AZZ A;  3A21 A;  4R9C A;  3MHZ A;  1OLR A;  3MW2 A;  2HWC 1;  5A6Z A;  1V9U 3;  1VBA 3;  5LRR A;  3VKN A;  4E9K A;  2PHT A;  4JGY B;  5FQ0 A;  1GUI A;  4XPV A;  3DV8 A;  5A6Y A;  3ALQ A;  4BQ5 A;  4JCK A;  1OLM A;  3KZ4 C;  4CDU C;  3NJZ A;  4G9S B;  4JKL A;  3ETP A;  3LWC A;  4WVM B;  4MGY E;  5FZ9 A;  1BQP A;  1JS9 A;  5FMD A;  3UET A;  3ZSE A;  5CU1 A;  3ECQ A;  5LA9 A;  3U14 A;  2B45 X;  5LW9 A;  4IES A;  1TZO A;  3D5O A;  3ZXA C;  3JCI A;  5DDJ 3;  1PVX A;  3I2K A;  2Q8C A;  3QBQ A;  3J4U H;  1IS4 A;  1TQ5 A;  5FY7 A;  1UIK A;  3GBG A;  2PXJ A;  2YC0 A;  3RMY A;  1B35 A;  2ZX2 A;  1YIF A;  1OOP B;  2HWE 2;  3PJY A;  5LB6 A;  1GP6 A;  4CDX B;  3B7M A;  5CKN A;  4QU2 A;  4W50 A;  4A41 A;  4AVS A;  4EWE A;  4FQZ A;  1RTV A;  4OHY A;  4ATE A;  4MH0 E;  2QUO A;  1NXD 1;  1LEC A;  1YHF A;  2R32 A;  2XL9 A;  4XJW A;  4DZG A;  2GNM A;  4N53 C;  5FPZ A;  5C3S A;  2B9V A;  2RE9 A;  2WNO A;  3CZJ A;  2CDO A;  1V6O A;  5A33 B;  1Q8P A;  5DAP A;  2XJV A;  2JDA A;  4JDM A;  1GP5 A;  5FMB A;  3E5Q A;  1PO2 1;  2O14 A;  1RHI 3;  2R06 2;  2YBP A;  4OUM A;  4Y1Z A;  4BOW A;  1ULD A;  4AF9 A;  4A4A A;  4H7M A;  5A3L A;  2VQU A;  1G6N A;  4NHM A;  3VLB B;  2XVK A;  4GH4 A;  1EV1 3;  4AVT A;  4UT5 A;  3KGL A;  1UXX X;  3NAP A;  5DAV A;  3WDU A;  4GH4 C;  4QU1 A;  2JE9 A;  5EQU A;  3PVN A;  4MGS A;  1SBD A;  3JD7 1;  3ZYR A;  1OMI A;  2P6C A;  1J3P A;  2RR1 1;  2Y6F A;  3I54 A;  1Y4W A;  5FPX A;  5FXV A;  4B8E A;  4I0A A;  2IFR A;  5FZI A;  4BQY A;  5J48 A;  1A8M A;  1D2Q A;  1LJ7 A;  3HPN A;  3WHT A;  3PME A;  4NIH A;  5HCH A;  1JXN A;  3PVO A;  5FP7 A;  4GWJ A;  1RVF 1;  3LB9 A;  1SBE A;  1AL2 2;  2BNM A;  3OY8 A;  4MXW A;  4RS5 C;  1KGY A;  3HQX A;  5BUV A;  5CKQ A;  3K3O A;  4K1Z A;  4LO4 B;  4TYS A;  3SC7 X;  5LA1 A;  1GQH A;  2FCV A;  4Z92 B;  5A3U A;  4P9G A;  1CD3 G;  1POV 3;  1CJP A;  3LDK A;  1E5S A;  3WZ1 A;  3T1L A;  2GSY A;  1REF A;  4XAC A;  2ID4 A;  4YVW B;  3U1X A;  3V65 A;  4EN0 A;  3I59 A;  1ULE A;  3OBA A;  1QH6 A;  3AZX A;  4XJU A;  3AFG A;  4O9E A;  2ZML A;  4AQ2 A;  1YNA A;  1UKG A;  3H8O A;  3UJO A;  3LPG A;  2ADE A;  2QQJ A;  3OYW B;  4QAW A;  3PIJ A;  5C4W C;  2P17 A;  5F32 A;  1UO9 A;  4FP3 A;  4ZS2 A;  3VBF A;  1HQL A;  4M4R A;  1XNB A;  1YQC A;  3DUI A;  3ORJ A;  5EXO A;  5FYB A;  3H42 B;  1JZ8 A;  2CV6 A;  1COV 2;  1VRH 2;  1K42 A;  2Z5W A;  2DVA A;  1U5Z A;  1BK1 A;  2ES3 A;  2D3P A;  2WAB A;  3FL7 A;  4YRD A;  3ZYP A;  5DUW A;  4D7Y A;  2JEN A;  5C70 A;  3WQ1 A;  2ARX A;  3MFA A;  1EUU A;  1UYP A;  2FMD A;  4HN1 A;  3ZN6 A;  5C8C B;  3EBR A;  2WS9 2;  5C8C C;  2W3J A;  3WNN A;  5LY1 A;  4NHX A;  3UES A;  1W6O A;  3HT2 A;  4QX1 A;  3N4M A;  3AP5 A;  4PF5 A;  1VBD 2;  3ZFE B;  3B02 A;  5FLJ A;  1U5Y A;  1Z7S 2;  2XL7 A;  3BCW A;  3OCP A;  2EIC A;  1HB2 A;  1T2X A;  2D7F A;  4K8R B;  2GC0 A;  4NOT A;  4P9W A;  4I01 A;  2WZP P;  4CEY C;  4DFS A;  4IND A;  4AK3 A;  2PHU A;  3KVA A;  4PI2 A;  5C3P A;  3OEB A;  1UXZ A;  5DUX A;  2UYA A;  1LOF A;  1S4C A;  3OJB A;  4D6Q A;  3NO8 A;  2VC9 A;  4XTP A;  5C9A C;  3Q9O A;  3I3E A;  3UYJ A;  3GZU C;  1KJL A;  3ILF A;  3D3A A;  3OGJ A;  1S55 A;  1OQD A;  3FMG A;  3E6B A;  1GNZ A;  1OKO A;  1TEI A;  3SCF A;  4LQR A;  3III A;  4QPI A;  5KHI A;  4BLJ A;  2WII B;  2WDB A;  2VMH A;  2GAL A;  3M3E A;  3BU0 A;  1R1A 1;  2D6P A;  3ILN A;  3BI3 A;  3S7E A;  3WQ7 A;  4CU6 A;  2HWD 3;  1HKD A;  2LTN A;  1LCL A;  1W9Y A;  1JZ7 A;  1JBC A;  1HRI 3;  4O9G A;  1CAV B;  4E4H A;  2ZEW A;  4DUV A;  3Q8E A;  1MZ5 A;  2GDF A;  5HCA A;  1HXS 2;  3SIS A;  1LU1 A;  1C1F A;  3AM2 A;  3NJV A;  4FPF A;  4C8D A;  2HYX A;  1F5F A;  3A22 A;  3ZO0 B;  1H1M A;  1YLL A;  1QJU 3;  1VAK A;  4OUS A;  4FSJ A;  4WVW A;  3HJR A;  3JQW A;  2QTW B;  4FOV A;  3BU7 A;  1GOH A;  4HVO A;  4IEZ A;  5E89 A;  3VZN A;  5IK8 A;  4NPM A;  4L97 A;  5GLV A;  3NV1 A;  4LKF A;  3J7M A;  3BTX A;  1Q3E A;  4PIZ A;  1PO1 1;  1TME 1;  3ROU A;  4CA9 A;  2K2S A;  2WYF A;  4N9I A;  3BUC A;  2C0Z A;  3LD8 A;  4Y20 A;  5GZG A;  3GHN A;  2WRA A;  2NMO A;  3R0R A;  3VBH A;  5FO9 B;  2CGN A;  3QLQ A;  4G4F A;  3MLL A;  3VBH C;  1CIY A;  4EWD A;  1DQ1 A;  2C4X A;  3E97 A;  3IPV A;  5EJ1 B;  4XCB A;  3U0Z A;  2JEC A;  4HBN A;  3RJ2 X;  2C24 A;  4P5H A;  2HEW F;  1WBL A;  2VVE A;  3PUR A;  5D8A A;  4E4Z A;  5K8S A;  2PHR A;  3PIG A;  4XQ4 A;  1DGW X;  1LEN A;  4YM1 A;  5FZ8 A;  5J09 A;  1FOD 2;  2YZ4 A;  2ZX1 A;  2WO7 A;  5FLH A;  4XAE A;  2GH8 A;  3M3I A;  2K0G A;  5CEH A;  5A6Q A;  1RXF A;  3H3Z A;  2VMG A;  2R0H A;  4I0W B;  2HWF 1;  5B4X A;  3VD5 A;  5ABJ C;  1OKQ A;  5D1I A;  1RMU 3;  5J1X A;  5L9V A;  1C8M 3;  2Q30 A;  4XYX A;  1SEF A;  1UZW A;  5JPN B;  3LKJ A;  1YJK A;  1RUI 1;  2DF7 A;  3M2M A;  1H4G A;  3AKS A;  4Q4W 2;  2W46 A;  2DVB A;  2AEN A;  5A7P A;  1C3H A;  1ND2 B;  2ZGU A;  3IDB B;  5AFE A;  3AP7 A;  1W8U A;  4I3G A;  5CG8 A;  1KDM A;  3AX4 A;  4RQP B;  2FBE A;  1H8T B;  3HEI A;  3KSC A;  4HG6 B;  4GKY A;  4CRQ A;  3PHM A;  3CJI A;  4DIN B;  4IE7 A;  3IAQ A;  5JMC A;  3JB4 C;  4LPL A;  4RYD A;  5IUQ A;  2NM1 A;  5FO7 B;  4ERO A;  5JCT A;  3RQ0 A;  4AGV A;  5IK4 A;  2W2I A;  2ZGP A;  3CJI C;  2PLV 3;  4QX7 A;  4M3C E;  2GN7 A;  4O7X A;  4P9L A;  5FK8 A;  4NVP A;  4BJ0 A;  5L7O A;  1I3H A;  1HJF A;  3APB A;  3H1M A;  3POI A;  2ARB A;  3FX3 A;  4Y22 A;  1TMF 2;  3J8F 3;  3HNM A;  4DUX A;  4QDQ A;  4CEW A;  5A32 A;  1JYT A;  1RUD 3;  1AYN 2;  4HKO A;  1O5U A;  1A3K A;  1ZBE 3;  1XJA A;  1L7Q A;  1UZZ A;  1AR7 1;  1IQD C;  4XJ9 A;  2WQ8 A;  5JI7 A;  5LBE A;  2D93 A;  2WQZ C;  3SH5 A;  1GOF A;  2WLP A;  4WZF A;  5FMC A;  4JV4 A;  2XON A;  5BNN B;  1MS9 A;  3HBZ A;  5HCF A;  1GOG A;  4FFF A;  2RVA A;  1EYB A;  4IEO A;  1RUE 1;  2FDG A;  3RPQ A;  3GNE A;  2UU8 A;  1DBN A;  5L73 A;  5FWE A;  3DPR A;  3WSO A;  5IWF A;  1CN1 A;  4KG8 A;  1QH7 A;  4NIA A;  2EIE A;  4RHV 1;  4Q4Y 2;  5HV4 A;  1SFN A;  3KCX A;  2ZEX A;  2ZJC A;  2WA4 A;  3IT8 A;  3HAG A;  1UX7 A;  2VL4 A;  1AX0 A;  1H4H A;  2JG8 A;  3A0K A;  5FRA A;  3RGB A;  4S2G A;  5ERL A;  1VP6 A;  2CY6 A;  5FAX A;  2CHH A;  2QCS B;  3AP6 A;  4EJR A;  1OT5 A;  1I5P A;  1H6Y A;  2JG8 C;  2NLR A;  1MS5 A;  5FYC A;  1AXZ A;  1CZT A;  1UD1 A;  3FHA A;  3GHM A;  4GB3 3;  3VDD C;  1FPN 1;  2YGL A;  4BPZ A;  1AR6 1;  2IZW A;  4JHZ A;  3GM8 A;  1O6U A;  4WM8 B;  1I1E A;  3N3H A;  3H1W A;  4LKS A;  3VZL A;  2Y6J A;  3VKL A;  2MEV 3;  1HW5 A;  1SFP A;  5DPN A;  3HWJ A;  3KQR A;  3PVE A;  3VZM A;  2GND A;  2IXJ A;  2QZ3 A;  5KXD A;  1EAH 3;  3POY A;  4OQ8 A;  3MV0 1;  3FUQ A;  2W94 A;  3GCX A;  4JGZ B;  3ASI A;  3KCC A;  2PQS A;  1RUJ 1;  2RMU 3;  3JXS A;  1GIC A;  1UOB A;  2BWC A;  5AVA A;  3ZIX A;  1EP0 A;  1HV1 A;  1UX6 A;  3ES4 A;  3N9N A;  5AC9 2;  4XIK A;  1YQ5 A;  4QX3 A;  1LU2 A;  3CHX A;  1DLL A;  3GBW A;  2HWB 1;  2FDK A;  2XOM A;  4LKE A;  1V6L A;  4A7K A;  1ULF A;  3MGU A;  4PQQ A;  3ZDS A;  4YFW A;  2YV8 A;  2ZZJ A;  2WZ8 A;  4QXB A;  4XFF A;  1RUC 2;  3MO4 A;  4V2V A;  5CFD B;  2VGD A;  1N1T A;  5F1R A;  2YPD A;  3TEY A;  4YAR A;  2RM2 3;  3IDC B;  2E32 A;  2JXA A;  4L2N A;  4MO3 M;  3ZIW A;  3AZZ A;  2ZAH A;  1NY7 1;  1VBE 1;  4U36 A;  1IS6 A;  3L2Y A;  4KWJ A;  5K0U A;  5FR3 A;  3OBR A;  5BNP B;  3S0M A;  3H8X A;  3Q8B A;  2C26 A;  2GC2 A;  4BXF A;  4KWK A;  3ZXE A;  5BNP C;  1R08 2;  1QOT A;  1DDL A;  3P5B A;  1RB8 G;  4P9Y A;  2R04 1;  1QJF A;  1OH4 A;  2AEY A;  2DCY A;  1KS5 A;  3ZYJ B;  4I02 A;  3OSD A;  4AFC A;  4ES8 A;  2QVS B;  4JTO A;  3WDY A;  5A3M A;  1F31 A;  3VBS C;  1APN A;  3LSE A;  4A2U A;  2HWC 2;  3K4A A;  4Q4V 1;  5A7N A;  3BTY A;  1KJR A;  2YHJ A;  1PMH X;  2WNV A;  2IC1 A;  5EZW A;  1HN1 A;  3AKP A;  4LUL A;  4IL7 A;  2UWC A;  1W99 A;  3POE A;  4Y1X A;  1WW6 A;  5JMO A;  1NQJ A;  2VR4 A;  3N36 A;  2GC3 A;  1OPO A;  3IM0 A;  2JG9 A;  4JZR A;  2W95 A;  3T2T A;  1PM4 A;  3VBO B;  4AYU A;  3NV2 A;  1DYP A;  2UWB A;  4FPC A;  2JG9 C;  4QPG A;  3VBO C;  3AK0 A;  5BNO B;  2R07 1;  5F3G A;  3MLJ A;  3I2G A;  4CCD A;  5A3O A;  4DRR A;  1VBC 3;  5IJR A;  1K5M B;  2Y26 A;  1D0G A;  1W3X A;  2Y8K A;  1K5M C;  2PHD A;  4CPB A;  1ND3 A;  1UOG A;  4D8M A;  4OHW A;  2ENR A;  2QE3 A;  2ZX4 A;  3GBF A;  3LSD A;  5FZB A;  5IVF A;  4XFH A;  2E53 A;  4XUT A;  1FNY A;  1CAX B;  1S1A A;  1WUV A;  2EF6 A;  4XOG A;  3MIH A;  3AJZ A;  3WCR A;  3V0B B;  1CAW A;  2P2K A;  2PHX A;  5DUU A;  3WNP A;  1XPW A;  1S0C A;  4UW3 A;  4Q0U A;  1HB1 A;  5FZF A;  1N47 A;  3RFR A;  4UXA A;  3ZMN A;  2ZZQ A;  3K4D A;  5FZM A;  5A70 A;  4OI1 A;  4XMA A;  4LK7 A;  3SH4 A;  2V4V A;  5AFB A;  4LJH A;  4EWA A;  1JOB A;  3AVS A;  3W21 A;  3BOW A;  1WCK A;  1JYI A;  1NLR A;  3BOD A;  4XF9 A;  3ZPY A;  5J37 A;  1OVS A;  4GJY A;  1JHN A;  5F5A A;  1RUG 1;  3KF3 A;  3SNM A;  2RJ2 A;  3EXU A;  3ZFF B;  4IEW A;  2HWE 3;  2VUL A;  3ZFF C;  1UN1 A;  1OBN A;  1QJY 1;  1WKY A;  3DF0 A;  4PF1 A;  1YFY A;  2WAA A;  4PDW B;  2E26 A;  2UUR A;  3TWI A;  2VZP A;  2VZ1 A;  5H9Q A;  3JD7 2;  1VAV A;  2RR1 2;  2X5I B;  5FZ0 A;  5JSP A;  4LLO A;  2VG9 A;  5B2G B;  2XJS A;  5CVR A;  2A7A A;  2B7Y A;  1GP4 A;  1RUF 3;  2RDN A;  2VH9 A;  2YGM A;  3EYP A;  4W4Z A;  1RVF 2;  2BGC A;  1JZ5 A;  3WDT A;  2SBA A;  4B1L A;  1ULG A;  4ATF A;  4EN6 B;  1YFX A;  5JPM B;  4MG2 A;  2R06 3;  4Y4R A;  1GQG A;  2UYB A;  3DYM A;  1MS0 A;  3PUI A;  4Q0P A;  3USU A;  1SHW B;  5FJK A;  4YW2 A;  3RZZ A;  1OA3 A;  4R4X A;  2DCK A;  1JZ4 A;  4DQA A;  5A1F A;  1DQ0 A;  3ZSM A;  4DUW A;  3J7N A;  1HQN A;  2VNG A;  1W6M B;  4M3C F;  4R9B A;  3C7E A;  4YW6 A;  1IGO A;  3PL0 A;  3T2P A;  1LHN A;  3R4S A;  1XYO A;  4CUB A;  1OA4 A;  4JTN A;  4L99 A;  1CPN A;  3H50 A;  4FPK A;  2H0B A;  2BVB A;  1JUH A;  1RUH 1;  2WZR 1;  3DEC A;  2YPJ A;  5CB7 A;  5LCW L;  2VM9 A;  4D6R A;  4CP1 A;  2G1M A;  3E1F 1;  5AVP A;  2Q8D A;  3EJK A;  1AL2 3;  1RIR A;  1ZZB A;  3SCG A;  3NST A;  3AMM A;  3KHC A;  2ZGQ A;  3UKT A;  3U4X A;  2R7E B;  2PHF A;  2WA3 A;  5H9R A;  4CU9 A;  1H8V A;  1H9P A;  4LO7 A;  2VMD A;  3JB8 A;  5DAQ A;  5E8A A;  4KU8 A;  2OZ6 A;  2G9G A;  4CXW A;  5K4L A;  4YZ3 A;  1UZV A;  1OVP A;  5FUP A;  3Q8A A;  4BZ4 A;  2KM2 A;  4IEP A;  4WM7 B;  3O1V A;  4BA6 A;  2P3Y A;  2VOW A;  3DN7 A;  2WUH A;  2EAL A;  2HJI A;  1NCQ B;  4UYB A;  3W59 A;  4S2H A;  3K2O A;  3B00 A;  3URF A;  1RJ7 A;  3HT1 A;  3WDX A;  3BKZ A;  4ASM B;  5ACA 3;  3ZM8 A;  3H7J A;  3E6C C;  1D4M 2;  3W5N A;  1J83 A;  1BJQ A;  1J3Q A;  4UF0 B;  3AKQ A;  1VRH 3;  3K77 A;  1BBT 1;  1REE A;  1GWM A;  1IQA A;  3GJA A;  5A1A A;  2OVU A;  4FFG A;  4PIY A;  3SKV A;  3DL3 A;  1VIW B;  4NAM A;  5CNA A;  1AJO A;  1R1Z A;  1YIP A;  3HQR A;  3NKT A;  4Y1U A;  4XUQ A;  5DAX A;  3ZR5 A;  5FCC A;  1IPJ A;  3ZLI A;  3P1I A;  2WS9 3;  4RR3 C;  1GQP A;  1GU3 A;  3POW A;  3OBT A;  4FOQ A;  4A42 A;  1IOA A;  1F4A A;  1V9U 1;  4COV A;  3TRS B;  4FTE A;  1VBA 1;  3I2F A;  5FZL A;  1R1A 2;  1VBD 3;  3CIH A;  4A45 A;  2WO1 A;  4AQ6 A;  1W90 A;  1NA1 C;  3G7D A;  1Z7S 3;  3LEK A;  2VOX A;  5FZE A;  3IZO A;  3B5L B;  3M3Q A;  2GAU A;  2BBA A;  1TE1 B;  2OYZ A;  3PVB B;  5FUN A;  1SQ4 A;  4K21 A;  3ZXJ A;  4BQ1 A;  2VW2 A;  2X29 A;  3UGF A;  3QD6 A;  1FAT A;  2YBS A;  4LE3 A;  5I0R A;  4HPK B;  1HIX A;  1AYM 1;  1RED A;  2EAK A;  1PGL 2;  1UY3 A;  3VUO A;  1HB3 A;  3MEP A;  4QKD A;  2ARA A;  4QX8 A;  4JC1 A;  4CDW B;  4XDO A;  4TSV A;  1WBF A;  4DXT A;  5C7G A;  1X8E A;  2VQT A;  3K51 A;  4CDW C;  4BCU A;  1SDW A;  4TXW A;  1UKR A;  3VL9 A;  1PO1 2;  1TME 2;  1OHF A;  3N9P A;  2QBX A;  2ZKN A;  3AKT A;  2A6V A;  2VW1 A;  3RZL A;  4PLO A;  4FTB A;  1PGW 1;  4CU8 A;  2DUO A;  5JZG B;  4IEQ A;  4FOY A;  1OUS A;  3BTZ A;  2FZ2 A;  4QB2 A;  5JZG C;  1BCX A;  4FPH A;  3PUA A;  4TLG A;  4Z2A A;  3M1H A;  4MAD A;  2VZR A;  1HXS 3;  2ARE A;  4J1W A;  1ZYB A;  4XIO A;  3UGH A;  3X29 B;  3KVB A;  4AOC A;  3WUC A;  2NQY A;  3FLT A;  1WLW A;  5FY4 A;  5FMO L;  3VHO A;  2R6Q A;  1VJ2 A;  2WSV A;  3ZFG C;  4M00 A;  4IV3 B;  1A6C A;  2E7A A;  2HWF 2;  4SBV A;  2WWS A;  3WW4 A;  2Y33 A;  5FP3 A;  3ZX7 A;  2W1W A;  2YC2 A;  1RHI 1;  3MIE A;  4M01 A;  4BHP A;  2Q1Z B;  4R52 A;  1AXK A;  2GU9 A;  2RJK A;  2XWB B;  5A7W A;  1RUI 2;  1Y43 B;  2Q4S A;  4OLL A;  2D97 A;  2VU9 A;  5GM0 A;  3SQO A;  4BQ4 A;  5KXC A;  1EV1 1;  4L0P A;  4WVZ A;  4E27 A;  2HEY F;  1W6P A;  2EXI A;  2JDP A;  1AX1 A;  4Q26 A;  3ZSL A;  1NAE A;  4MGI E;  4OI0 A;  2I74 A;  5T3N A;  1YFU A;  3P3N A;  4NRQ A;  1LOG A;  1PNG A;  2LRP A;  5LY2 A;  4YPJ A;  1X82 A;  4HXC A;  4AW7 A;  4PBP A;  1O3S A;  2VMI A;  1NCR A;  3LZZ A;  4DXZ A;  1W6N B;  3T4V A;  4HVQ A;  5J3U A;  2FDH A;  4Y24 A;  1NCR C;  4JRA A;  5IYY A;  3RI9 A;  3B9C A;  5L9B A;  3KHB A;  3VD9 A;  1FOD 3;  1MS3 A;  5EFU A;  4D7S A;  2W0X A;  5FLI A;  1JYX A;  2ZOE B;  2QQO A;  2WIN B;  3KCY A;  3P6B A;  3LAG A;  2YC4 A;  1C28 A;  1DYK A;  3MID A;  4BMB A;  1OA2 A;  1UL9 A;  2QQP A;  1XYP A;  4FPE A;  4YZ5 A;  4AEM A;  5KHK A;  1FV3 A;  1DFQ A;  1NOV A;  2W92 A;  2Y0I A;  4Q4W 3;  1AR7 2;  1VRB A;  3W9A A;  2IXI A;  3RMX A;  1QQP 1;  5CFC B;  4XHB A;  1UPI A;  2VAU A;  2XBO 3;  5FZ3 A;  2JDU A;  2ZHL A;  1QJE A;  4KU7 A;  2ZA9 A;  1RUE 2;  1IZ3 A;  3TEZ A;  3IDE A;  1W8F A;  2QDN A;  4YZ4 A;  5FYT A;  4XET A;  3O0X A;  3OUI A;  2ZGM A;  4JGY C;  4P9J A;  4CDU A;  5FZC A;  5FP4 A;  4IV1 B;  2AR6 A;  1AHS A;  4RHV 2;  3NNL A;  1M06 G;  1GLH A;  1WME A;  3IN9 A;  4YM3 A;  1D4V B;  2XDV A;  4P14 A;  1GYK A;  1LNS A;  1LHU A;  3I49 A;  5SV8 A;  3B9I A;  3CU7 A;  1X9T A;  1TMF 3;  2VE1 A;  4HN0 A;  3PDQ A;  2JIC A;  1N1V A;  3QOP A;  4C90 A;  2OQ6 A;  2UWA A;  1UY2 A;  1AYN 3;  2VVD A;  3H8R A;  3WNK A;  3JBG 1;  4YGD A;  4MYE A;  4HLT A;  1FPN 2;  1MR5 A;  3R4D B;  1W6Q B;  4AI3 A;  1AR6 2;  2D3S A;  1V0A A;  1J1L A;  4CCL A;  4CP9 A;  4DIQ A;  1LOB A;  1WLD A;  2YUE A;  3KB5 A;  4L92 A;  4YM0 A;  1RYY A;  5FQ0 B;  3WNX A;  3ZXF A;  4D7T A;  1OOP C;  1CIW A;  3KD4 A;  2LM3 A;  3B93 A;  4LA3 A;  4Z82 A;  1MPX A;  1A34 A;  4CDX C;  3N9M A;  4BE3 A;  1IKP A;  3RZK A;  4N53 A;  4ZZ5 A;  2WN3 A;  4Q4Y 3;  4DMI A;  3S30 A;  3WNL A;  4AI9 A;  4GD4 A;  5C71 A;  2XGX A;  5IVB A;  2OZJ A;  4H14 A;  4XF4 A;  5A33 A;  1PIV 1;  1JHJ A;  1QOO A;  3MIF A;  4UBH A;  1RUJ 2;  3L9J T;  4PLM A;  3U78 A;  1MS4 A;  2O8Q A;  3FC0 A;  4UW5 A;  5I0T A;  4ZZ8 A;  4LT5 A;  3ZKY A;  4DO0 A;  1EUT A;  2AAC A;  1SDD B;  4QQ2 A;  4Y1V A;  1B35 B;  1MAC A;  1W8N A;  2BVV A;  1JTZ X;  3LA7 A;  3PUH A;  4MET A;  2HWB 2;  4UW6 A;  1FMD 1;  5LBF A;  2DCT A;  2VCC A;  4NIG A;  2ZGL A;  2FMY A;  5LAT A;  3V56 A;  4AHY A;  1YI7 A;  3OBZ A;  4DOU A;  2ET1 A;  3IBM A;  4BB3 A;  1ZA7 A;  2JX9 A;  1XE7 A;  3P3P A;  3F95 A;  2HWD 1;  1H2N A;  2BRT A;  1Y9M A;  3IIA A;  4DS0 A;  5T5J A;  1XYN A;  3MFC A;  5HXM A;  4NHY A;  1WA4 A;  1VAM A;  4PQ9 A;  1XBF A;  4CYD A;  3VGI A;  1NY7 2;  1VBE 2;  1ZRR A;  4CCO A;  1QXJ A;  2V73 A;  4P5Y A;  4UFL A;  3WG1 A;  4B4P A;  5E1R A;  1QJU 1;  4OVE A;  4FPY A;  4RS5 A;  3ON7 A;  5AC9 3;  1BLZ A;  4P02 B;  3RI8 A;  3HN3 A;  2R04 2;  2J1T A;  2DVF A;  1ZZ7 A;  5FP8 A;  4ARY A;  4Z8B A;  4E4S A;  4Q4X 1;  2OUH A;  1DGR A;  3BPZ A;  1W2O A;  1R09 1;  1W2N A;  4IEV A;  2RS3 1;  2AZ5 A;  2JIJ A;  3ZXD A;  4IE5 A;  3AC0 A;  4Q0Q A;  3NAP B;  4XF1 A;  4YVW A;  4U2A A;  5APA A;  5DG1 A;  4Q4V 2;  1QJX 1;  3WOG A;  1RUC 3;  1HLC A;  4YVW C;  1V00 A;  2L9L A;  4KNC A;  4NHL A;  4O65 A;  3RZM A;  4NID A;  4P00 B;  4V1P A;  5G04 L;  4HAN A;  1ENS A;  5C4W A;  3OYW A;  1H6X A;  1AR8 3;  1S2B A;  3RZH A;  1CX4 A;  4BQ3 A;  2XUM A;  1RL3 A;  4FFH A;  1ZZ8 A;  1J1T A;  2CL2 A;  2Q1M A;  2BUK A;  3C7G A;  1MS1 A;  4R4Z A;  1QXP A;  3OY8 B;  3WNM A;  2EAA A;  2R07 2;  3EO6 A;  4OZO A;  2IFW A;  3LA2 A;  3AP4 A;  5JSR A;  3O1P A;  5LA2 A;  2FDF A;  3KS7 A;  1RMU 1;  5JOY A;  1C8M 1;  3WW1 A;  2HKX A;  3FHQ A;  1ZZ6 A;  1F9K A;  3I59 B;  4IE6 A;  5FXX A;  3TN9 1;  5JIU A;  4K9S A;  5C8C A;  1ZRD A;  1L3J A;  4ZPI A;  4GWI A;  3LDR A;  4J25 A;  3WQB A;  1JU3 A;  3NW4 A;  5J7M A;  1WGP A;  3LIH A;  5K7P A;  2YFZ A;  1TNR A;  2NMN A;  4KBB A;  2VZU A;  2R49 A;  4QHO A;  4K1Y A;  2H6C A;  2FZ1 A;  2FCU A;  2K9Z A;  2OA2 A;  2QQV A;  2Z69 A;  3K75 B;  4CEY A;  2UY9 A;  1ACC A;  4IQP A;  3ZFE C;  3VBF B;  1W9W A;  4NAO A;  4HSJ A;  4XAA A;  4O61 A;  5JXH A;  4AGR A;  2WFP A;  1LGN A;  1RIT A;  3GDB A;  3TNQ A;  3AL6 A;  1UQX A;  5C9A A;  3CZU A;  3M7A A;  3A23 A;  1N3Q A;  3J8F 1;  4YFZ A;  2XJP A;  4IEY A;  3T1M A;  2FDI A;  1RUD 1;  1RUG 2;  1LES A;  3ZN6 B;  5A6X A;  2VTX J;  1RUN A;  1ZNP A;  1SLT A;  4QXC A;  3WCS A;  2DBN A;  3KQ4 B;  1VBB 3;  3WF2 A;  1QJY 2;  4FBF A;  4AI1 A;  2FD8 A;  1QDC A;  2VNV A;  4OMC A;  4W6W A;  3BN6 A;  4XAB A;  1YUD A;  3GZT B;  3WDV A;  3CJX A;  3EQE A;  4XBQ A;  3C7H A;  2CGP A;  2F17 A;  3KV5 A;  3LQC A;  1SFY A;  2NPI A;  3HOB A;  3BB6 A;  5FBZ A;  3C7F A;  1G86 A;  1NQD A;  3MIC A;  4YG0 A;  4COY A;  3LEM A;  4ITC A;  4EYU A;  3U37 A;  1W0O A;  3OB8 A;  1ZRE A;  2C1F A;  4BIF A;  4LE4 A;  3VV1 A;  3H3L A;  3VZK A;  4LXL A;  2PQQ A;  4Q1R A;  1OUX A;  2KA3 A;  1D7P M;  4DY3 A;  4FTS A;  1GNY A;  4LBQ B;  5JR2 A;  4CU7 A;  3OUH A;  1Y9Q A;  3ACI A;  1XOY A;  1XU2 A;  4UOJ A;  3VHR A;  5HBA A;  4PCR A;  3IKW A;  1ZBA 1;  4I0B A;  3JD7 3;  4QDS A;  3N7J A;  2RR1 3;  5F3C A;  1IS5 A;  2FDJ A;  2MEV 1;  3JUU A;  3OEA A;  2WN2 A;  2YB7 A;  1DGW A;  4LIV A;  5F6L B;  1GFF 2;  1RXG A;  3NKG A;  4YGB A;  2WZR 2;  1RUH 2;  3USS A;  3VN4 A;  1AF9 A;  1QDO A;  1EAH 1;  2EIB A;  4GIQ A;  5EWS A;  2DVD A;  5EIY B;  4QT6 A;  3R4U A;  1QY4 A;  1DZQ A;  1RVF 3;  1U5X A;  2Y34 A;  3CKH A;  3C8X A;  3NNM A;  4RA0 A;  5FK7 A;  3U11 A;  4A6S A;  2RMU 1;  4ZU7 A;  5KWR A;  3PUQ A;  3PU3 A;  5ABJ A;  2YDE A;  2DU0 A;  3PTR B;  3DXT A;  3ACL A;  3PLQ A;  1Q8V A;  3T4H B;  1NZI A;  2AH2 A;  2WT0 A;  3KWV A;  1DQ4 A;  2J1S A;  4Y20 B;  1O7F A;  2VQ0 A;  3EB7 A;  1WWY A;  4OHV A;  3LOI A;  4CP2 A;  2ATF A;  2G9F A;  5HPO A;  1LGC A;  1GKB A;  4OCT A;  5IVV A;  1ZRF A;  4MZU A;  1ND2 C;  4JDN A;  4Y4Y A;  2QQK A;  1UW8 A;  1ZA4 A;  3POG A;  4BH9 A;  4NRP A;  4PI0 A;  2RM2 1;  1LEM A;  2RDS A;  2XB6 C;  2E33 A;  2GNT A;  4RQP C;  4KGG A;  1H8T C;  3VZO A;  2P3I A;  5F5Q A;  2R0F A;  1QJZ A;  1BBT 2;  4K20 A;  4HSL A;  1HRV 3;  5SV5 A;  4D3W A;  3DYP A;  1UNB A;  4HKL A;  5G05 L;  1JOD A;  1T6G C;  1HQW A;  3O1R A;  2J42 A;  1HB4 A;  4LUM A;  1ZX5 A;  5GLW A;  4IE0 A;  3THT A;  3GF6 A;  2XHN A;  1CJD A;  3ZYI B;  1OLQ A;  4Q0S A;  4Q29 A;  1QOS A;  4ZS3 A;  2RHP A;  1VBA 2;  1S0D A;  5JUV A;  5BNN A;  2FHR A;  4RSU A;  3LIG A;  2PAM A;  2VZ3 A;  2Y60 A;  2DDU A;  3CEW A;  3SLI A;  3WF3 A;  3WX5 A;  3A4U A;  5BNN C;  1YEW A;  4P9X A;  2VNR A;  1D4M 3;  2A73 B;  3KV6 A;  4JAA A;  3D4K A;  1L7L A;  4CUA A;  5C3Q A;  2Y38 A;  1AYM 2;  2QDR A;  3CLP A;  5L7O B;  2IVI B;  1LUL A;  4Y22 B;  3U10 A;  3OD4 A;  2ZCW A;  1AR9 1;  3N35 A;  5FZA A;  5A32 B;  5CIR A;  3CF6 E;  1CGP A;  2HLE A;  4J1X A;  3MF9 A;  4XFB A;  2BDR A;  2IXH A;  5E88 A;  2SLI A;  1PMJ X;  3BTA A;  3VDD A;  5CAZ A;  4TZD A;  1NLS A;  1O4Z A;  3G6J B;  5FYI A;  2X53 S;  1CPM A;  4FT8 A;  1GZW B;  1R1A 3;  4N8M A;  1PGW 2;  3MI8 A;  1Q56 A;  5FPA A;  3NWK A;  3O1T A;  2VCM A;  5KXB A;  4Y5T A;  2EXH A;  1HV0 A;  4WM8 C;  2PN5 A;  4QPY A;  4B1M A;  4MOA A;  1N3O A;  1OD5 A;  2J1R A;  2XJT A;  3AMQ A;  4UFH A;  2RS5 2;  5JR7 B;  4YZ1 A;  1WMD A;  4CDQ B;  1FNZ A;  1K5J A;  5JI9 A;  2WWU A;  1D2S A;  1XNA A;  1PHM A;  1V6N A;  3D6E A;  1NZC A;  2JWP A;  3I3Q A;  5KBF A;  5FZG A;  4BQ2 A;  3O0W A;  4BXS V;  3O12 A;  1XRU A;  1LED A;  2DVG A;  4JGZ C;  3WF0 A;  1KRI A;  3OUJ A;  2ADD A;  3CNA A;  2CNA A;  3T09 A;  1K45 A;  3NRU A;  1RHI 2;  2OQ7 A;  3RSJ A;  1UZY A;  1PO1 3;  4K3U A;  1TME 3;  1UIJ A;  1UY4 A;  3MBW A;  2BJS A;  1EV1 2;  4LA2 A;  5KXE A;  3KT7 A;  3TOJ A;  3R6S A;  1JU4 A;  2XJQ A;  3RJR A;  1DF0 A;  1DZT A;  3AVR A;  2QZ2 A;  4XXP A;  4FO9 A;  3JZV A;  1TVG A;  2D44 A;  1UMI A;  4DPN A;  5CFD C;  4OUL A;  5F8P A;  2DUQ A;  1UOJ A;  3B3Q E;  3IMM A;  4FQ4 A;  4AAP A;  4AVB A;  2WQ4 A;  5C8W A;  1ZRI A;  4H2A A;  2VZQ A;  2WNE A;  3RZG A;  4G3Y C;  2J22 A;  5BNP A;  4AGG A;  1O3T A;  1E5R A;  1RUF 1;  2DUR A;  5CKM A;  2V72 A;  1KXG A;  2HWF 3;  1UYY A;  2XVG A;  5BNQ A;  1WW4 A;  5DG2 A;  1PNF A;  3GXU A;  4B7E A;  1YQ6 A;  1YRZ A;  4XHX A;  3LOB A;  3O7O A;  2Y6G A;  3NNG A;  4QD2 A;  3VBR B;  2DTY A;  4E2Q A;  1G8W A;  1LHW A;  2OXB A;  1RUI 3;  3VBR C;  2ERF A;  3AYD A;  4MXV A;  1F35 A;  3M4F A;  5HV0 A;  3O1M A;  3VBS A;  4M0N A;  2CWS A;  1GZ9 A;  4AQS A;  1YC6 1;  1QQP 2;  1XND A;  3GCW A;  4LBK A;  5C5U A;  4COW A;  2YY1 A;  1W9F A;  5T5L A;  3UGG A;  3SEE A;  4YG6 A;  1BEV 1;  2XWJ B;  5DZE A;  2FCT A;  3WG4 A;  3CDZ B;  1O3R A;  1QHD A;  4IW3 A;  3ZDV A;  1KDK A;  5K0U B;  1XQN A;  3HN1 A;  1AUY A;  4A7Z A;  4K6B A;  3VBO A;  2ET7 A;  1NLQ A;  1ASJ 1;  2BOJ A;  4MGZ E;  2A75 A;  1JMU B;  1K5M A;  3O1O A;  3AJY A;  2Z2S B;  5BNO C;  1OC1 A;  4CSW A;  4LO6 B;  4NMI A;  1BXH A;  3FLP A;  3JBG 2;  1PVC 1;  1AR7 3;  1S0I A;  4HET A;  3ZN4 A;  3TB0 A;  1E57 A;  2R1D A;  3WIN E;  3GGL A;  2B46 X;  2VEC A;  1CAX A;  1C5I A;  1IPS A;  1RUE 3;  1O8P A;  2WL1 A;  1ZM1 A;  2VPV A;  3AZY A;  4PIX A;  3THC A;  5HXV A;  4Y3O A;  4HK8 A;  2HBT A;  3V0B A;  3WY6 A;  5ACA 1;  4RHV 3;  1P8J A;  5JXJ A;  3SCH A;  3GAL A;  1BYH A;  4QPG B;  4CCK A;  1V6I A;  1LRH A;  3MV1 1;  1PIV 2;  3HD8 B;  1VRH 1;  4AVC A;  3WW3 A;  2R16 A;  3VKF C;  4QMA A;  3POB A;  2VZT A;  4LBQ D;  3MLK A;  1G9A A;  2WLQ A;  1UWW A;  3ABZ A;  4X8N A;  1JOP A;  1ST8 A;  3CQO A;  2DBI A;  4AG4 A;  2Y6L A;  1PO2 2;  1YXW A;  4Q2F A;  5FKB A;  1XB9 A;  3ZFF A;  1FMD 2;  1AR6 3;  4F83 A;  2F6B A;  3VDC A;  2GZW A;  1CZV A;  1GSL A;  1CAU A;  4PDW A;  4XXA A;  1TNF A;  1OH3 A;  2QFE A;  2VW0 A;  5FXZ A;  1NXM A;  2HWD 2;  2CDP A;  4PDW C;  5E6H A;  5HI0 A;  1UMH A;  5LBB A;  2VXJ A;  4ZXE A;  5T50 A;  2W91 A;  1SCR A;  4AED B;  3MZH A;  5T52 A;  1RGS A;  1W0N A;  4HFS A;  2X5I C;  4CE8 A;  1RUJ 3;  1KD7 A;  5FYZ A;  2EXJ A;  1QJU 2;  2WFF 1;  2EVX A;  2PAE A;  5A3W A;  5KHG A;  5IAT A;  2O8O A;  2EIG A;  4L11 A;  2E31 A;  4Q4X 2;  5FYS A;  4KBZ A;  4JQT A;  1R09 2;  3M8L A;  2RS3 2;  5B4N A;  2D43 A;  2BQP A;  5LEJ A;  4OZX A;  1HX6 A;  1S0F A;  4N9H A;  5FYH A;  4MX3 A;  5FPV A;  1U12 A;  1QJX 2;  1UCX A;  3ZPO A;  2VME A;  4LBL A;  4XF0 A;  1VR3 A;  2VUJ A;  5I0U A;  4N7I A;  3T3Y A;  3HVD A;  3LA3 A;  4D69 A;  2D6N A;  2GMM A;  4QB1 A;  5JSO A;  3C3V A;  3FBM A;  3HNB M;  4QQL A;  4PJY A;  2I07 B;  4BK4 A;  4Z07 A;  2OPK A;  4YW3 A;  3VBU B;  2EXK A;  1OI6 A;  1MEC 1;  1H0B A;  5L9R A;  3ZMO A;  4YG3 A;  4CXY A;  2R1B A;  4FI9 A;  1GWK A;  3K48 A;  2ZGS A;  4NR1 A;  3T08 A;  1H1I A;  2DCZ A;  3USU B;  2VUA A;  4RD7 A;  1N1S A;  4QM9 A;  4XDQ A;  1C8M 2;  4QKB A;  2C6S A;  1BVV A;  2JDH A;  5F2W A;  4BM8 A;  1SPP A;  1BVP 1;  5FP9 A;  1FYU A;  3TN9 2;  3Q8C A;  3AMN A;  3GYD A;  2VZV A;  3PTY A;  3HIF A;  4Q4V 3;  3BIW E;  2BGP A;  4N43 B;  4WM7 A;  4Z1V A;  5FOB B;  4N43 C;  1ULO A;  3SXW A;  3ZVX A;  4WM7 C;  2WO3 A;  2A1X A;  5A7S A;  3ZN5 A;  1ALY A;  5K9Y A;  1V6J A;  3DGT A;  2A70 A;  5DUV A;  1OFN A;  5IW0 A;  1NCQ C;  2DFB A;  1U0A A;  4MUV A;  1UU6 A;  1OQ1 A;  1GAN A;  4RL7 A;  4ZY9 A;  5FMO S;  3B01 A;  1J84 A;  1PM7 A;  3B69 A;  4UF0 A;  4AI2 A;  5GLZ A;  1W05 A;  2AUY A;  2RS1 1;  3POS A;  4HOO A;  1COV 3;  1ENQ A;  4QGN A;  4LOR A;  4BDV B;  1G9C A;  4MGQ A;  1CQ9 A;  3J8F 2;  2F4L A;  1W2A X;  2TEP A;  4RFT 0;  3WP6 A;  2XJR A;  1OFS A;  2JDY A;  4NN0 A;  4E2G A;  1RUD 2;  1W06 A;  4NJ4 A;  1SCS A;  2Q8O A;  4RR3 A;  4ZU4 A;  3VL8 A;  4GXL A;  2OII A;  5LAS A;  3I3B A;  4QGL A;  1S0E A;  3RVH A;  4QXH A;  4FPL A;  4CZS A;  3T0A A;  4UI9 L;  2ZEY A;  2B9U A;  1AZD A;  1NA1 A;  1QNY A;  2XBO 1;  2ZGT A;  3V64 A;  4OHX A;  5FZ6 A;  3WG2 A;  4CCC A;  2Z42 A;  2CGO A;  2DCJ A;  3GZE A;  5FZ1 A;  4OFG A;  4Q8L A;  2QQM A;  1MZF A;  4UFK A;  2N7G A;  5LEK A;  2CAV A;  4PLN A;  3TEX A;  5BXX A;  1X33 A;  3NQH A;  3U75 A;  1X8M A;  5JWP A;  4OI4 A;  3FWE A;  3AB0 A;  4NHK A;  4NO4 A;  5GKA C;  2HBU A;  3NNF A;  2MNG A;  4KH9 A;  2VJX A;  3NL1 A;  5DZG A;  4BYY A;  4CDW A;  2V4A A;  5DDJ 1;  5KC6 A;  4GMP 3;  5KHJ A;  2XKO A;  1GBG A;  1QJY 3;  4J6G A;  4ET7 A;  3AYC A;  3WVJ A;  5KR7 A;  1SLC A;  2AEZ A;  3VDA A;  5FZO B;  4LUK A;  4D6S A;  1ZBA 2;  3D8C A;  4GAL A;  5GZE A;  3M3C A;  4KWU A;  5JZG A;  4Y5S A;  2DUP A;  2MEV 2;  2ZKL A;  4AHX A;  2F4P A;  2GME A;  5D2A A;  1QF3 A;  4DEQ A;  5IT6 A;  3CL1 A;  1BZW A;  1NE6 A;  3ACH A;  2ORX A;  3BVC A;  2IXL A;  4Q4Y 1;  2C5D A;  3O1S A;  3FFZ A;  1EAH 2;  3NJY A;  4NUB A;  4UAP A;  4DY5 A;  5ANQ A;  2QQL A;  2GN3 A;  3ZFG A;  4YSF A;  4IER A;  2ZAA A;  4UFI A;  3WW2 A;  2RMU 2;  4W8J A;  4DXR A;  5FY5 A;  1C5H A;  4M3C B;  3C7O A;  2PFW A;  3EHK A;  2J1V A;  2P5B A;  4HVR A;  2X10 A;  4AFA A;  2YMZ A;  3POJ A;  3WD5 A;  4IV3 C;  3U07 A;  4X6Q B;  1VPH A;  5FIX A;  2CAU A;  3O1U A;  4CCM A;  4RGA A;  4MGT A;  5I91 A;  2LS6 A;  2WAO A;  5LRS A;  2W68 A;  4HK9 A;  3OPZ A;  4XQW A;  4OHZ A;  2JIG A;  1FAY A;  5FFO C;  4MSV A;  5A3P A;  4CCJ A;  3MW3 A;  1OPM A;  2RV9 A;  3VKO A;  2WZR 3;  1RUH 3;  4S2F A;  2ZMN A;  4QQP A;  2B39 A;  2RM2 2;  1JYV A;  1JYN A;  4EZH A;  3D0J A;  2BEO A;  2VBP A;  1PZ9 A;  4AHW A;  4CCE A;  2CSG A;  5KC5 A;  4XZP A;  3HR9 A;  3SMH A;  1I6X A;  1PGS A;  2VY0 A;  3MPP G;  2H0V A;  1L7R A;  2OW4 A;  5ANN A;  1OF3 A;  2BU9 A;  2XXZ A;  1MQT B;  1POV 1;  1W2U A;  1Q8S A;  3CMG A;  4Q0V A;  2XVL A;  1Y9G A;  4SLI A;  1O59 A;  2PAK A;  1W6P B;  1QU0 A;  2MHF A;  2VZO A;  4YVS B;  4YWA A;  5I8Y A;  2A71 A;  4XE9 A;  2Y6K A;  4XIL A;  4YVS C;  1RUC 1;  4ARX A;  1W03 A;  5CBL A;  2GMP A;  2BPA 2;  1YI9 A;  4AWD A;  5CFC C;  1BMV 1;  4K40 A;  1HJG A;  4JGY A;  1LHV A;  3PU8 A;  5FY1 A;  3O5S A;  1AR8 1;  5KHH A;  3OG2 A;  4CPB D;  4YW7 A;  3V0A B;  3I8T A;  1BBT 3;  4MHU A;  3ZYH A;  1NYW A;  1XE8 A;  4IV1 C;  2LUW A;  2VOK A;  4WVM A;  4XVH A;  2WNU B;  1G9B A;  1AR9 2;  4W65 A;  5T55 A;  3WP5 A;  1STM A;  1POV 0;  1S0B A;  4M4P A;  4AFB A;  1UF2 C;  4XUN A;  2D3R A;  4F8A A;  1PK6 B;  1UOF A;  4NII A;  2KXL A;  3FLR A;  3T30 A;  5FDB A;  5GJ6 A;  2ZHK A;  1JZ3 A;  1W6Q A;  2PHW A;  2W08 A;  4URT A;  4WZC A;  3E5X A;  3ZXK A;  4LEJ A;  1G9F A;  2K46 A;  1OOP A;  4RGG A;  3ZYG A;  4FOW A;  4CDX A;  1UY1 A;  3DYO A;  4XFI A;  5JIA A;  3T2Q A;  3UKN A;  1W9S A;  4CDU B;  1D0H A;  5LA0 A;  4KI5 M;  5JXG A;  3NNJ A;  3QCW A;  1OXC A;  1W04 A;  2X09 A;  2J1A A;  2YXS A;  1AYM 3;  3AXD A;  3H9A A;  3J7H A;  3RWN A;  4AR2 A;  3IB3 A;  5FXW A;  3TAY A;  1OF4 A;  2GH2 A;  2VBB A;  1O4Y A;  4ORF A;  3BOP A;  1W8O A;  1BKZ A;  3RDI A;  3WR0 A;  4Y26 A;  3BPS A;  1SG3 A;  2GNB A;  2O0O A;  4ISR A;  1W8H A;  2G4I A;  4BU2 A;  4YW1 A;  5I0D A;  3ETQ A;  3OOX A;  2W87 A;  4AFD A;  4E8C A;  1VBB 1;  4CP9 B;  3W5M A;  1LAJ A;  4HL0 A;  2V5D A;  1VMJ A;  1B35 C;  3RNS A;  1IG0 A;  2WT2 A;  3TEW A;  4R9D A;  5EV7 A;  1Y3T A;  2JDN A;  2JKB A;  1YWK A;  4COU A;  5JLV A;  1ODN A;  2A3Y A;  4GQ7 A;  2QJV A;  2VCB A;  4N53 B;  5E16 A;  1WCS A;  1LB2 A;  2RS5 3;  1T6B X;  1H2K A;  2TBV A;  5H9S A;  1HRI 1;  3ELN A;  4LKD A;  4EN8 B;  3W58 A;  4N90 A;  3VHN A;  4BK5 A;  1OQE A;  1RUF 2;  4UFJ A;  1QGL A;  3QAC A;  2VMC A;  2ZGR A;  2QKD A;  4ZU5 A;  1QNW A;  5JDB A;  1F8V A;  3F2Z A;  4RGK A;  4DXS A;  2GC1 A;  4X6R B;  2IXK A;  3T2O A;  5F5I A;  2XH6 A;  3I2H A;  4QQO A;  2P1B A;  4GH4 B;  3UNP A;  2J1U A;  1WLT A;  4R8H A;  5DAB A;  2VNO A;  2JDZ A;  3ME2 A;  5EYY A;  3VB9 A;  1W3V A;  2NYY A;  4C0H A;  3NAP C;  4CXX A;  3LFM A;  2A6X A;  1AXY A;  1ONA A;  3RWK X;  5C5T A;  5I8T A;  1Z78 A;  1RIN A;  1BEV 2;  4A44 A;  3NMB A;  5T5O A;  3LEI A;  2LAL A;  3JQX A;  5FYV A;  5FBJ A;  1DQ2 A;  4BQX A;  3AFK A;  2ZGK A;  3FN9 A;  4I2O A;  2W1Q A;  2DYC A;  2D98 A;  4NWW A;  4RS5 B;  5EJZ B;  3T0D A;  4ZON A;  3OPT A;  4FPJ A;  1ASJ 2;  2XKP A;  5FWJ A;  1R08 3;  2HH9 A;  3LFI A;  4MXW B;  4GWN A;  4D94 A;  1MZE A;  3EMR A;  1H1A A;  1PMI A;  1SAC A;  1A8D A;  4XUO A;  4OMD A;  5I8S A;  1YO8 A;  1PX3 A;  1PVC 2;  2JB8 A;  4LBO A;  5BPX A;  5CAD A;  1WCD J;  3LEG A;  1QQP 3;  1SLL A;  3AMP A;  4NPR A;  2MPF A;  2HWC 3;  5EYX A;  4CTE A;  3LF7 A;  5CIS A;  2W1S A;  2XML A;  3MIB A;  4CCN A;  4F7Z A;  3D0S A;  4BIS A;  3OPW A;  5C4W B;  5FY8 A;  1YQ8 A;  3MDP A;  1IHM A;  2I2S A;  3ZFE A;  2A6W A;  5F2S A;  5ACA 2;  3WQ0 A;  1WCU A;  1DQ6 A;  4XQD A;  3NJX A;  5BV6 A;  2VCA A;  1S2E A;  2RDQ A;  3IDA A;  4WV8 A;  2VOT A;  5DXD A;  1ZRC A;  3VBF C;  1N1Y A;  1HRV 1;  2PLV 1;  1NX9 A;  3H1Y A;  2G9Z A;  3N7M A;  1C4R A;  4NRM A;  3JBG 3;  2YYO A;  5IFT A;  3SH3 A;  3B94 A;  1DGL A;  2XLG A;  5DN2 A;  3H7Y A;  2GP5 A;  1Q43 A;  2OUJ A;  1ZBE 1;  2A6Y A;  4JVA A;  4PT6 A;  4GAZ A;  1VAL A;  4EN7 B;  4EE2 A;  4C1W A;  3I97 A;  1W6O B;  4N7U A;  4UWD A;  1DLC A;  5FZD A;  2BWA A;  2QQI A;  2Y64 A;  1WW7 A;  4CEY B;  1ENX A;  1XSQ A;  4QM8 A;  2W9X A;  1D4M 1;  2ZHM A;  1C57 A;  2BYV E;  3TBD A;  1H30 A;  2ZGN A;  5IVE A;  1CAV A;  3L2H A;  1W8T A;  1PIV 3;  1RUO A;  2JDM A;  4ASK A;  1GR3 A;  5A3T A;  1K12 A;  1SLB A;  2WFF 2;  3I2J A;  3WLU A;  1XNC A;  2P3K A;  5C9A B;  3VDB A;  1WMX A;  1ZZC A;  3ATG A;  4TTG A;  2JJ6 A;  1LOF C;  1UU4 A;  3ZKU A;  5F39 A;  1F2N A;  4HMZ A;  2XLA A;  3FJS A;  4IEU A;  4UBG A;  1PO2 3;  1YFW A;  4TN7 A;  1FMD 3;  2E7T A;  3WEZ A;  5FO8 B;  2ZGO A;  2FQP A;  4XCA A;  3ZSK A;  2WO2 A;  4LBQ A;  3ZOI A;  3PJQ A;  3QH6 A;  5FYY A;  3FZ3 A;  4GB3 1;  4M0H A;  1MVE A;  1JUI A;  4QPI B;  4A3X A;  2VQA A;  3ENR A;  3N9Q A;  3S6P A;  4Z2W A;  4QPI C;  3GZA A;  5FZ4 A;  5IFP A;  4RFR B;  4XJ8 A;  1HN0 A;  4C91 A;  1Y7B A;  5A7O A;  4LHS A;  4RN5 A;  1LGB A;  5JOX A;  4Q8K A;  3N9L A;  4EZ4 A;  5EJ3 A;  1NKG A;  3U4S A;  1MEC 2;  3I4I A;  1PGL 1;  2RJL A;  4FPO B;  1S0J A;  3JU9 A;  4Q27 A;  3POF A;  5F6K A;  4Q4X 3;  1DP0 A;  4Q1P A;  2BOI A;  1QXR A;  1R09 3;  5FV3 A;  2RS3 3;  1UPS A;  1LTE A;  4KGQ A;  1UU5 A;  3WUD A;  1V6M A;  2TNF A;  1KS4 A;  2NN8 A;  4K7J A;  4Q5O A;  4XJZ A;  5FOJ B;  2O1Q A;  3M3O A;  5IVJ A;  1QJX 3;  2AC1 A;  3LGR A;  2BER A;  1FT9 A;  1NG0 A;  4AI0 A;  2OPW A;  2VVF A;  3CO2 A;  2CWM A;  3VBH B;  4FAG A;  1W28 A;  1ND2 A;  4ASL A;  2ETE A;  3O14 A;  5IAV A;  4TLF A;  1B09 A;  3RS6 A;  2ZXQ A;  2JE8 A;  2WZE A;  2P37 A;  3IPV B;  2ZBJ A;  4RQP A;  3UL2 A;  5GLU A;  1H8T A;  4XMI A;  2Y6H A;  3PMS A;  5D8A B;  1GZC A;  2D6M A;  2YU1 A;  4YNI A;  3AYE A;  3MF6 A;  5D8A C;  1YYN A;  4WVV A;  2RS1 2;  5ABJ B;  1XU1 A;  4FFI A;  2LW8 A;  2D6K A;  5FPB A;  2Q1F A;  4H7L A;  3ZXL A;  5F5C A;  5D21 A;  1UAI A;  2VTF A;  3NV4 A;  4B3N A;  3TN9 3;  1JZ6 A;  1A78 A;  5F37 A;  4MV2 A;  5CYY A;  1GNH A;  2HEV F;  2XBO 2;  1V9U 2;  4LTA A;  2RG4 A;  3SHR A;  5EHD A;  4LOS A;  3RYR A;  2EID A;  2QQW A;  4L8Q A;  3J7L A;  4XF3 A;  1OSG A;  1PX4 A;  2P3J A;  3CJI B;  3OGR A;  4GA9 A;  1VB2 A;  4W6Y A;  4Y33 A;  4C0B A;  3D82 A;  4NWV A;  1JOJ A;  1DQ5 A;  1W2T A;  2KR2 A;  2V09 A;  4IXL A;  1W39 A;  2WC2 A;  4B4Q A;  5C3O A;  1V6K A;  3AYA A;  1SMV A;  3AMH A;  4P08 A;  1W9T A;  1IKQ A;  1QWR A;  3MIG A;  4I09 A;  4XTM A;  5DMY A;  5L7O C;  1VLN A;  2B5H A;  2VTX A;  1VBC 1;  1RJ8 A;  1JH5 A;  4K8F A;  3WP4 A;  4CEW B;  2QQU A;  5DDJ 2;  2YFU A;  3PNA A;  4CEW C;  4X8P A;  5JOZ A;  4D0Q A;  5A1L A;  4A6O A;  4HT1 T;  5LBC A;  2D6O X;  4JRL A;  5I93 A;  1M4W A;  3TNP B;  1GZW A;  3I2D A;  2IVJ A;  1LOE A;  5IAX A;  3AKR A;  5FYM A;  4OUE A;  2ZEZ A;  4WM8 A;  1LR5 A;  2ZAB A;  4JKM A;  1CZS A;  3DPR B;  2NZ9 A;  1E5I A;  3ACG A;  4GUL A;  5DAW A;  4QHB A;  4LMF A;  4AE2 A;  5L19 A;  3DPR C;  3WF4 A;  1ODM A;  4KMQ A;  1IPK A;  4CDQ A;  3SEP A;  5BYN A;  1HDK A;  2YRO A;  3I3D A;  3RRD A;  1XE0 A;  4CDQ C;  2YU2 A;  3I2O A;  4JGZ A;  2JG8 B;  3W20 A;  4BIO A;  2X05 A;  4FAH A;  5FKC A;  4IEX A;  2XR4 A;  3VDD B;  3KV4 A;  5HCB A;  4LBN A;  1H9W A;  2JD4 A;  4QGM A;  1UYX A;  3T0B A;  3AP9 A;  4AI8 A;  4GJZ A;  4ONU A;  3ZR6 A;  2HWE 1;  2ZHN A;  1XXN A;  1ZBA 3;  2UY8 A;  1DIW A;  2D5H A;  1U5I A;  4AAX A;  1CR7 A;  3AL5 A;  5FPU A;  2XHK A;  4NE9 A;  4LO8 A;  5CFD A;  1SBF A;  2B4K A;  2W5F A;  2OS2 A;  2CYF A;  3H8U A;  1AX2 A;  2XQR A;  3KGZ A;  5DQ0 A;  4YYO A;  4EQV A;  1O3Q A;  3IAP A;  1DHK B;  4KWL A;  3LDB A;  1YQ2 A;  4IGP A;  3LE0 A;  2EA7 A;  1G9D A;  5FRE A;  2VUC A;  1XNK A;  4KG0 A;  2P4E A;  4GZ9 A;  4XBL A;  3BIE A;  2PA7 A;  4MLO A;  4B7K A;  1I9R A;  3WHU A;  5EP9 A;  2XJU A;  1MVQ A;  3SIT A;  3VBR A;  2R06 1;  1CVN A;  2VOV A;  3I3M A;  4HON A;  1V70 A;  3CBN A;  3MUZ 1;  1MS8 A;  1I5Z A;  1KEX A;  5FZK A;  3KM5 A;  3UJQ A;  1PZ7 A;  4BQW A;  1F5J A;  1GV9 A;  2ILM A;  4EN9 B;  5LZ6 A;  1W8Z A;  3THD A;  1O4T A;  5CA6 A;  3KV9 A;  1SLI A;  1WD3 A;  4YW4 A;  1BMV 2;  4JQR A;  1OLM E;  4PBO A;  4B29 A; 
#chains in the Genus database with same CATH homology
 5FPB A;  3N9M A;  4QU1 A;  2XML A;  4QWN A;  4Y3O A;  4QX8 A;  5F5C A;  4CCN A;  5FZA A;  5A7Q A;  4AI9 A;  5LWB A;  4GD4 A;  4XDO A;  4BIS A;  3RVH A;  3OPW A;  5IVB A;  4QXH A;  5FY8 A;  5FXV A;  5FZI A;  5F37 A;  3N9N A;  5F2S A;  3LD8 A;  4CCK A;  3N9P A;  3PUS A;  3U78 A;  5A7W B;  3K3N A;  5FZ0 A;  3KV5 A;  5FP7 A;  5FZ6 A;  5FYI A;  4DO0 A;  5FPL A;  3K3O A;  5FY9 A;  5FPA A;  5FZ1 A;  3PUA A;  4EYU A;  3PUR A;  5A80 A;  4Y4R A;  4QXB A;  4V2V A;  4Y33 A;  5FZ8 A;  3KVB A;  4URA A;  5FJK A;  2YPD A;  2GP3 A;  4LXL A;  5CEH A;  5FY4 A;  2WWU A;  2GP5 A;  2OT7 A;  5IVC A;  5F3I A;  4GAZ A;  5FXZ A;  5A1F A;  5FXW A;  5FZG A;  5E6H A;  5FY0 A;  5FP3 A;  5FZD A;  4BXF A;  4CCO A;  5ISL A;  2XUE A;  5KR7 A;  5A1L A;  5F3E A;  5A7W A;  5F32 A;  5A7P A;  5F3C A;  2OQ7 A;  5FZO B;  4D6S A;  5FYB A;  5IVE A;  5FYZ A;  4BU2 A;  5FP8 A;  4D6R A;  4LIV A;  5A3W A;  2Q8E A;  5FYM A;  4ASK A;  2Q8D A;  5A3T A;  5FYU A;  5LY2 A;  5FYS A;  3NJY A;  5F39 A;  3AVR A;  4NUB A;  5A7N A;  4XDP A;  3PUQ A;  2W2I A;  3PU3 A;  5ANQ A;  4QX7 A;  5FYH A;  3PTR B;  4TN7 A;  5FPV A;  3DXT A;  5FY5 A;  5K4L A;  4AAP A;  2VD7 A;  5LY1 A;  2YU2 A;  3ZPO A;  5FYY A;  4IGO A;  5FUP A;  2P5B A;  5FZ9 A;  5FJH A;  3N9Q A;  5FZ4 A;  5LW9 A;  4CCM A;  3KV4 A;  3K2O A;  5F3G A;  5FZO A;  4IGQ A;  2OX0 A;  2Q8C A;  5IVV A;  5A7O A;  1VRB A;  4GJZ A;  5FY7 A;  3KVA A;  5IVY A;  2PXJ A;  3DXU A;  5A3P A;  3N9L A;  4EZ4 A;  4LIT A;  3U4S A;  4UF0 B;  5FZ3 A;  3AL5 A;  4LIU A;  5FWE A;  4CCJ A;  4D6Q A;  5FPU A;  5IWF A;  5F5I A;  3UYJ A;  5FZB A;  5IVF A;  5FXX A;  2OS2 A;  5FYT A;  4EZH A;  5F2W A;  5FV3 A;  3N9O A;  5FZC A;  5FP4 A;  5FP9 A;  4CUG A;  3LDB A;  4IGP A;  2XDV A;  3ZLI A;  5FYV A;  5IVJ A;  5FBJ A;  3PDQ A;  5FZF A;  5FZH A;  2XXZ A;  5FYC A;  5FZL A;  5A7S A;  5FZM A;  2OQ6 A;  3OPT A;  5IW0 A;  4E4H A;  5FZE A;  5FWJ A;  3AVS A;  4CSW A;  4HON A;  2YBP A;  5FZK A;  5FUN A;  4C8D A;  2WWJ A;  3AL6 A;  4UF0 A;  4GJY A;  4CCL A;  4DIQ A;  2YBS A;  5A3N A;  4HOO A;  2YU1 A;  5F5A A;  3KV6 A;  3PU8 A;  4V2W A;  5FY1 A;  3KV9 A;  5FZ7 A;  2YBK A;  4QXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...