5A7WA

Crystal structure of human jmjd2a in complex with compound 35
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
345
structure length
345
Chain Sequence
NPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Docking and Linking of Fragments to Discover Jumonji Histone Demethylase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 4A
total genus 96
structure length 345
sequence length 345
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5a7wA01
4QU1A 3PDQA 4GD4A 1VRBA 2OT7A 2YU2A 5E6HA 3NJYA 5F2SA 3PUSA 5FPLA 2Q8DA 4QX8A 4XDOA 5IVYA 3K2OA 3LD8A 2YU1A 5FZ4A 4EZ4A 3PU3A 2XXZA 3K3NA 4BU2A 4D6SA 5FYCA 5IWFA 5FXWA 5LW9A 5FWEA 5FJKA 4IGQA 5IVCA 5FZ3A 5A3PA 3N9MA 4HOOA 5FZLA 5FZGA 2VD7A 3PUQA 3LDBA 5FZ8A 5IVFA 3OPWA 4CCLA 4ASKA 5FP8A 5FZBA 5K4LA 4QWNA 5F5CA 3ZLIA 4CCMA 4UF0A 3DXTA 3KVBA 5FY1A 5FBJA 5FZ9A 5A80A 5FY7A 5A3TA 5IVBA 4IGOA 4CSWA 4EZHA 4V2WA 4DIQA 5FXXA 5FP9A 2OQ6A 5FZAA 5FYSA 4QX7A 3KV6A 5FUPA 4C8DA 5FYZA 4QXHA 4CUGA 3AVSA 5CEHA 5A7WA 4D6RA 3KV9A 4Y4RA 4IGPA 3N9LA 2PXJA 5A7OA 5A7PA 3U4SA 3UYJA 5FWJA 4LIVA 4GJZA 5IVJA 2YPDA 5FY5A 5FY4A 5FZ1A 2OQ7A 3PURA 5F3IA 5FZ6A 2Q8CA 5FYYA 4HONA 2XUEA 4D6QA 5FUNA 3PU8A 5FZOB 5FYVA 5A3WA 4E4HA 5ISLA 2OX0A 5FYTA 3U78A 5F3EA 3PTRB 5FP7A 5FXZA 3KV5A 5LY2A 5FZMA 5FY8A 5FZCA 3RVHA 4BISA 4TN7A 5A7SA 3N9QA 3DXUA 5FZ0A 2XDVA 2GP3A 2YBSA 3KV4A 5KR7A 4CCJA 3N9PA 4LXLA 5FYIA 5FYUA 5A1FA 5FJHA 5FY9A 5FZOA 5A1LA 5FY0A 2GP5A 3PUAA 4DO0A 5FYBA 2WWUA 5F3CA 3K3OA 5F5AA 2WWJA 5FZFA 3N9NA 4EYUA 4LITA 4V2VA 5FZIA 4AAPA 4URAA 5FPAA 5FZ7A 4QXCA 4CCNA 5F32A 5FP3A 2YBPA 4BXFA 2YBKA 5FYMA 5A7WB 5IW0A 5FV3A 5A3NA 4CCKA 5A7NA 2OS2A 4NUBA 5F2WA 5A7QA 5FPBA 5FZDA 5IVEA 3OPTA 5F39A 5LWBA 4LIUA 5FZKA 5LY1A 5FXVA 5FP4A 3KVAA 3AVRA 4UF0B 5FYHA 5IVVA 4GAZA 5ANQA 3AL6A 3ZPOA 5FPVA 4XDPA 2XMLA 3N9OA 5F3GA 2W2IA 4GJYA 2Q8EA 4Y3OA 5FZHA 5F37A 4AI9A 4Y33A 4QXBA 5FPUA 4CCOA 3AL5A 5F5IA 5FZEA 2P5BA
chains in the Genus database with same CATH superfamily
1AR73 2OKXA 4ORFA 4BM8A 1X82A 4IEVA 4P02B 3VHNA 3PUSA 1DGLA 5T52A 4Q4X1 2VOVA 4JX0A 4LOSA 3R6SA 3RZZA 5T5JA 2NZ9A 2Q5TA 4P9IA 3UGFA 3UV9A 3VGIA 4CEWA 5FPXA 3I49A 4QM9A 1RHI2 1MEC2 2EAKA 2UWAA 4AE2A 2YFUA 1DLLA 4QX1A 3PVBB 3LFMA 1KRIA 4IGQA 5GZFA 4AHYA 2WNUA 3JD73 5FZLA 2Z79A 3JZVA 4Y1ZA 2ZKNA 3UETA 4EROA 2PQSA 1JZ2A 3VKMA 5CFDC 3QH6A 5FMDA 1ZVFA 2WIIB 4ASKA 2RR13 2AYHA 3RYPA 4AHXA 2RMU3 1BBT3 1OOPC 4RGGA 2ZA9A 4GWNA 3OGJA 1SG3A 2JDMA 4Q1RA 2ZHMA 5A80A 4BQWA 2FCVA 4IGOA 4XFCA 1W6QB 1RUH3 2XJPA 4ES9A 3RG0A 5A32A 5B4XA 2YC4A 5DZEA 1VBA2 1COV3 1MZ5A 1QDCA 3B93A 3N3HA 4BQ1A 1W2UA 2R061 4RQPA 1RB8G 2E7AA 3LOIA 1OQEA 3JU9A 3KSCA 4IV1B 4DY5A 5A7WA 1XB9A 3MIGA 1LTEA 2ORXA 3WLUA 1GP6A 2ZPXA 1EV12 4GWJA 4YSFA 2VE1A 1W04A 2AREA 3PURA 5FKBA 1ZZ8A 2IVIB 4FPGA 4NHXA 1RMU2 4AF9A 1D4M1 3IBMA 1MS5A 4JGYA 4GA9A 1CJPA 1H0BA 2ZEZA 3GJBA 5H9SA 4CDUB 2GN7A 5ABJA 1JYXA 4JGZA 4ZU4A 4IUGA 3AMNA 5FZMA 2JEMA 4TN7A 4LUKA 3N9QA 4AVVA 5FZ0A 2X8KA 1XYNA 1LODA 4QPIA 4QHZA 3H42B 1H6XA 3UK9A 3O1UA 4DO0A 1LOEA 2GNTA 4P5YA 4DNYA 1MS9A 4MADA 1VALA 2LUWA 2WNVA 2WO3A 3MUZ1 5GZEA 1FOD3 3H8OA 5L9RA 2P3KA 3IMMA 4K6BA 1S0DA 1CN1A 2G1MA 3MIFA 3NV3A 4XUNA 2E7TA 4QB2A 1ULCA 5KC5A 3PIJA 2G9FA 5CKNA 1GSLA 2DBIA 3O0VA 3PUHA 4RSUA 3SCFA 1OVPA 3GXUA 2YC0A 4ZKTB 4OHXA 1QJU2 2BFUL 5JOWA 1UMZA 3BCWA 4OHWA 2D44A 3OG2A 3ZOIA 2W0XA 4NPRA 1O5LA 1PZ9A 1ENSA 2A3YA 2ETEA 5IJRA 1SLAA 1RUF3 2W94A 4MSVA 1UY2A 3VZMA 4XDPA 1NX9A 1W6MB 4CUAA 4CUBA 3N4MA 3USSA 2FD8A 4HT1T 2Y0OA 3ASIA 2HWB3 4BK5A 4OHVA 4XHBA 3V0BB 1RJ8A 3SMHA 2FZ2A 4N53A 4UW5A 4BWOA 1R64A 1QXJA 1OA3A 1W8OA 1DGWX 3Q8BA 2ET7A 2G9ZA 5JZGB 4TTGA 3K77A 1LAJA 1WA4A 2VMCA 5J1XA 1W9SA 3IDAA 5ABJC 3WOGA 2C24A 1W0NA 1PX3A 2RS31 2DCTA 1X50A 4MGIE 4X6RB 4COVA 4LULA 2XJTA 2YY1A 4YG3A 4P9LA 1ALYA 1XNKA 1XBFA 2AEZA 4YM2A 1Q8PA 1MEC3 3Q8EA 3U14A 3MICA 4COYA 5JDBA 3IPVA 4CP9B 3RWKX 4ASMB 3M3QA 4FPJA 2ZEWA 4OI0A 2JDPA 1WMXA 4YW4A 3WXPA 5T54A 4AEDB 3ZSJA 2VQ0A 1RUD1 3M3IA 5FP8A 1SBDA 1UX6A 2EXIA 4NAMA 2QQPA 1UZWA 2IFWA 1UAIA 4CXYA 4CCMA 2A7AA 4DXSA 4UF0A 3CF6E 2AR6A 3HBZA 5L7OB 3WQ1A 5DPNA 2ZACA 5KHJA 2AEYA 3AMPA 2FCTA 3IDEA 1BYHA 1X8EA 2CV6A 3T1MA 2PHFA 4LO5B 1ND2B 5FMCA 2ATFA 4AI1A 3BPZA 1CWPA 3T4HB 1YJLA 2BTVC 1UYPA 2IFRA 5FYSA 2D5FA 1RUF1 5C70A 2QZ3A 5FUPA 4MO3M 2PA7A 4N43C 4KWUA 2E31A 3BKZA 1R082 2VECA 2WINB 3NJZA 1JYNA 1AL23 4IGPA 3W5NA 2PXJA 4QXKA 1JZ5A 3HQUA 2QQOA 3LEGA 2XVGA 3NRUA 4U36A 3JQXA 3OGRA 5F3IA 1YWKA 5FYYA 5FMOS 2HWF3 2Y26A 3ZR6A 3O14A 5BNOB 1FT9A 1RMU1 4SLIA 3WG3A 1WUVA 1O7FA 3QD6A 1PMIA 4PF5A 5FXZA 4LBLA 1YFXA 2W3JA 1HB2A 1V6JA 1H1AA 3KV5A 2YB7A 2DCYA 5FCCA 1IG0A 2GP3A 1F5JA 1JZ6A 3KGLA 3OEBA 2QQJA 4UFHA 4UWDA 4AQSA 4ATEA 2JDKA 5FY9A 3GYDA 3PUIA 4OULA 4QX0A 2ARCA 1WW4A 1XNDA 4RFT0 3VBFC 1PVC2 1H2KA 2UY8A 1GNZA 1QXRA 2XB6C 2Q1ZB 4IV1C 4YGDA 3MIBA 5C3QA 2WABA 5FZFA 5AFEA 4N9IA 3N9NA 1ZA7A 1YQ2A 1SFPA 4Q5OA 2I74A 3I8TA 2RS32 1GQGA 2X5IC 4QQ2A 1LU1A 2WO7A 3TNQA 4PIZA 2R16A 3H8RA 1AR83 4RR3B 4Y1YA 2V4AA 3GCXA 4AYUA 5B4NA 1WMFA 1VPHA 3TN92 4A42A 3VZLA 1AR71 2X10A 1MZEA 3AKPA 1RUD3 3VKFC 1HV1A 1UXZA 4TZDA 1OD3A 4L8QA 1LU2A 4HFSA 4Q4Y3 4EN0A 1H8TB 1WLCA 3R4DB 1H1IA 3MFAA 4YLZA 3IM0A 4JGZB 5JXJA 5ANQA 5FPZA 5T55A 3FUOA 1OA2A 3VBFB 3WX5A 1IPSA 5FBZA 4AHZA 5JSOA 1HX6A 1V6NA 2Y6KA 3OSDA 4UW6A 1ZNPA 5ISLA 4LTAA 3DL3A 1LB2A 3UKTA 5KHIA 3PDQA 3RYKA 4XFFA 1AYN1 3GALA 2BV4A 2B46X 1OH4A 4FQZA 2B8MA 5AFBA 1O3RA 1URXA 1F4HA 2C6SA 2XHNA 3TRSB 1C8M1 2Y6GA 4IERA 2DUPA 1NY71 2BYVE 1WCDJ 1QJY1 3POYA 4YVWB 3VBOB 4A6SA 1CAXB 2UU8A 4O7XA 4Y20B 4JTOA 1AR93 4D7SA 2Y64A 2ZX4A 4XJZA 3LCPA 1YXWA 2VM9A 4LPLA 4M3CA 4MX3A 3AMMA 4WZCA 2AZ5A 4ATFA 5CAZA 1BVP1 5JMCA 2BJSA 5I8TA 1G7YA 2A5ZA 1VAVA 3BTXA 2C5DA 5JOZA 1QXPA 3AZVA 4XPVA 4Z82A 4DFSA 3UNPA 4NRMA 1XE0A 1HDKA 1VRH2 5ACA1 4XTMA 1IZ3A 1YQ6A 4RFRB 1ZZ6A 4IESA 2J1VA 3P1IA 1H9WA 1XQNA 2VZTA 1S0GA 5DZFA 5LB6A 5E8AA 4E2QA 2C0ZA 3NAPC 3V0BA 2OQ6A 2MEV3 2DCKA 2JDUA 3ZDSA 5A3LA 2R0HA 3FLTA 1S2EA 3AJZA 2VR4A 1LCLA 3PJQA 3HR9A 4TLGA 3VBOC 4R4XA 2XONA 4LOTA 3SH5A 3N9LA 5IVJA 1LGCA 5A7PA 3LOBA 2WNUC 3WDWA 5DAXA 5BNNB 1AYM1 1ZBA3 2WNVC 1J1TA 2D93A 3ETQA 3RI9A 4BA6A 1VB2A 1ZRRA 3FLPA 4CDUC 2X53S 1AJKA 1NT0A 2FMDA 5E89A 4DZGA 4GWIA 5EWSA 1NCQC 1V9U3 2MNGA 3LGRA 1OUSA 3ZYIB 1HKDA 4H14A 3KV4A 2B7YA 4PHZA 4AEDA 4WM8A 4LXLA 4I0AA 4PDWB 4R52A 2DBNA 4JGZC 4J1XA 1HJFA 5IHRA 4Q1PA 5FLJA 2VL4A 5BYNA 2CYFA 2JG9A 2W1UA 2GSYA 2JE8A 4RR3C 2BP6A 4KWLA 3K48A 3C7FA 2X5IA 2HWC2 4K3UA 4NRPA 5BNQA 3JQWA 2E53A 3B94A 3AYEA 3EYPA 5A1FA 3ZSEA 1JOBA 4HPKA 2BOJA 5J98B 1GR3A 4Z2WA 2YBKA 2ZMLA 1E57A 3T08A 4FPCA 1AR61 1V6OA 1WMEA 3MFCA 1F9KA 3HD8B 4F8AA 1KDKA 3HN3A 2OS2A 3ZFEC 1AYN3 1WZXA 1RJ7A 4H3WA 4HXCA 4HBNA 4NAOA 4Q0SA 2ZHLA 2RR11 1RC6A 2VMEA 1RUI1 2Q1FA 5LY1A 4E27A 3BIWE 2WS91 2FBEA 3GZEA 2DVAA 1W3VA 3KVAA 3NAPA 4QD2A 2W95A 3WW4A 4A7ZA 4Q29A 3HVDA 2WYSA 2J1RA 2RM23 5DMYA 4M01A 3ZN6B 2XMLA 4QKNA 5BNPA 2E33A 3MF9A 3FL7A 3POWA 3EJKA 5KHHA 1YC61 4LKDA 1KGYA 4XZPA 5IAVA 1H9PA 3QOPA 3IAPA 4ZXEA 1T6GC 1VIWB 2F4PA 4ISQA 4YYOA 1WMDA 3B9IA 3NKGA 3SH3A 1POV3 2W5FA 1MQTA 3TWIA 3CBNA 5E88A 1HRI1 1G9FA 1NCQA 1XYPA 1CZSA 3LA3A 5FQ0B 2TEPA 4Z92B 1DZRA 5DDJ2 5DXDA 1CPMA 1LOGA 3VKNA 5HV0A 3C3VA 4NVPA 3LAGA 5LW9A 4R9DA 2E6VA 2ZGMA 5C8CA 2JX9A 5FOBB 2XJUA 3ILRA 3RYRA 2WYFA 4GALA 4M0HA 5A32B 1W8NA 3O0WA 3MO4A 2CGPA 1ONAA 2RS52 4WM7C 5LRRA 1GU3A 1SLCA 1XNTA 1I3HA 1E5HA 2FHRA 5JR7B 3PVOA 2HWD3 3ZFFA 1PGSA 1JUHA 2XLGA 1PO22 2YGLA 4NIIA 2CGNA 3WV6A 3G7DA 1UO9A 2F17A 2I07B 4CSWA 5DAVA 1ODMA 3IMNA 4FTBA 1J1LA 3I59B 5FO9B 4H7LA 2E32A 4P08A 1MS1A 2XBO2 5HBAA 2ZZJA 3VZOA 2D3PA 1ENRA 1F4AA 4N7IA 4QHBA 2A71A 2JB8A 1W8UA 4GH4C 5JUVA 1ZRCA 4KWKA 5FYZA 3AVSA 5ABJB 1V6LA 1POQA 1Q5OA 2HWD1 3I2IA 3I2GA 3KQ4B 4JAAA 1I9RA 3ZIXA 5I8YA 3DYOA 4F83A 4Q0QA 2YPDA 4XUOA 4E4ZA 1Q56A 3G6JB 2KR2A 4XFIA 4NWVA 2TNFA 4QPGB 1VBA1 2XR4A 5EJ3A 4AZZA 1UF2C 4QU2A 4WVMA 5F3EA 2DVFA 2WS92 2VW1A 2HJIA 4M4PA 2ZKLA 1DYOA 4IEXA 4M3CB 4NIHA 3RRDA 2WNVB 2CNAA 4I3PA 1JN2P 2RE9A 3LDRA 2VCBA 2R6QA 4COWA 4CCJA 2A73B 1MVEA 1SHWB 5AVAA 4YW1A 3WG4A 3I54A 5KHKA 3IB3A 1LOAA 2CAVA 3POEA 5DUVA 5EXOA 2D3SA 1C8M2 2DFBA 3POFA 3BGAA 3K4AA 3NVCA 5I0SA 1O6UA 1RHI1 3ZXGA 1UYYA 2EXKA 3DV8A 2PHUA 3UGHA 2AGSA 4HVRA 3WZ1A 5IK8A 4A6OA 5HCHA 2CY6A 1XRUA 2DURA 2GMMA 2Y6HA 2Y38A 3VD4A 3RJRA 2FCUA 2OW4A 3BN6A 3CKHA 2KXLA 1W6MA 1R1A1 4QPGC 4AG4A 2XWBB 3D82A 1LOBA 5CZKA 3DUIA 4O9GA 4H2AA 5IATA 1ZRIA 4EN7B 3AP9A 4LE4A 4EQVA 4CEWC 1IPKA 4M00A 4AW7A 3DYPA 1S1AA 4FAHA 3KS7A 4N8MA 5FYHA 2J7MA 1M4WA 2VZOA 3SNMA 3T2QA 3T0BA 3D0JA 4RHV2 5A6QA 4XCAA 1UIJA 3LFIA 4GJYA 5JLVA 2QZ2A 5M0TA 5KXBA 3AFGA 3S0MA 2W1WA 3BU7A 4PDWA 3RS6A 4WV8A 5A3UA 2OVUA 2RS12 3VHPA 2NPIA 3S6PA 2GALA 2V09A 4QU1A 2SBAA 4AGVA 2D6OX 1HQNA 3WHTA 1XOYA 1G9CA 5JXGA 3IPVB 3BOPA 4CP0A 4CP9A 2Y8KA 5CISA 4RGAA 2X5IB 5FMBA 4Q4W1 4CDXB 1AXZA 2YU1A 4EZ4A 2G9GA 1QU0A 4I09A 4CVUA 5TSWA 3K3NA 1UPIA 1CJDA 1GWKA 2PFWA 2VCCA 3WF1A 5KHGA 5L7OC 2FZ1A 5FLHA 1K45A 4COZA 1BLZA 2PAMA 2VZPA 3N9MA 1OOPA 2W52A 2WQ4A 2VUDA 4XIOA 3VBHC 2QQIA 4YVSA 1HB4A 2VY0A 2H6CA 4MXWA 2YPJA 1NA1C 5C33A 1W6PB 2D98A 4AQ6A 4A3XA 4QWNA 3CHXA 4UYBA 1UY0A 2GMEA 1B35A 1QHDA 2A6XA 4FT8A 2VJXA 4B1MA 1NA1B 4LO7A 4NIAA 4Z2AA 2MPFA 2BZDA 2H0BA 2R49A 5FBJA 5FY1A 5FR3A 5EHDA 4LHLA 3THPA 4FOWA 1AX0A 1PO13 4RQPC 3SCHA 4NIDA 2ZAHA 4MOAA 5BNPB 3KCYA 2VVEA 3CEWA 3MI8A 2JKBA 4CDWB 1W9WA 1D4M3 4Y22B 1QJFA 2A6ZA 1FYUA 1VP6A 4YWAA 4AFCA 3UGGA 4WZFA 4P9JA 4JCKA 4OQ9A 2GC1A 5LBEA 4CEYB 5A3MA 1YQ5A 1OLME 3DEMA 4LMFA 4JGYC 4GJZA 1DQ1A 1NCQB 1ACCA 4QB1A 1O91A 4LA2A 3M3EA 4GQ7A 5FZ1A 1COV2 1KD7A 3FN9A 5T5LA 4LUMA 1J3PA 1YIFA 4FXKB 5FZOB 1GWLA 2GH2A 3OGGA 3HBKA 3U78A 4BHPA 4FPEA 5FO7B 5C8CB 2IZWA 2WNUB 5BNNC 4QAWA 1EV13 2R32A 2UYAA 3UESA 2A3WA 4PBOA 1RMU3 1W39A 1VMJA 4MUVA 1RUJ1 1CAVA 1W8WA 1F5FA 5FY0A 3MLLA 4FXGB 1FPN3 2YGMA 4KGGA 5K0UC 1HRI2 3N7MA 4RD7A 3M8LA 4XE9A 2XPJA 4IETA 3LZZA 5FREA 3WNPA 2BBVA 2D7FA 2VZQA 2WLQA 3HMYA 2EIEA 4V2VA 1PIV1 2Z4FA 2EAAA 4AAPA 3M3CA 1BEV1 1GANA 1NE4A 1W3XA 2B45X 4JKKA 1NLQA 4BMEA 1QQP2 4J6GA 2JG8A 1RHI3 2CWSA 2ZGQA 1H8TA 4YG0A 3VZNA 4CDQC 1AL22 1W8TA 2BGOA 5A7WB 5A6ZA 4DEQA 5A6XA 2X09A 4Q4X3 3SCGA 1DZTA 4AK3A 1DU3D 2F4LA 4KQ7A 4YG6A 3O1VA 2VULA 2HWF2 4OI2A 5FPBA 1CX4A 2RDQA 4WVZA 1SBFA 1V6IA 1OC1A 4QPGA 4MZUA 4BE3A 5KWRA 3D5OA 2L9LA 2RR12 3LSEA 3MW3A 2Y60A 2WT1A 4YW3A 1AVBA 1FPN2 2RV9A 4W50A 1ND3A 3APBA 3S5AA 1KDMA 1W2TA 1XU2A 4Y3OA 3O12A 4E8DA 2D6NA 2B39A 3B5LB 3HNYM 1VBE1 4YVWA 3KM5A 1CAXA 4Y5SA 1M06G 4K1YA 2JG9C 2PTMA 4AOCA 1UW8A 2BPA2 2O1QA 2P6CA 4FO9A 5E6HA 4CP2A 3NJYA 1VBB3 1L7RA 2LW8A 1FMD1 3POSA 3ORJA 4XZUG 2NLRA 4AFMA 3J7LA 3I2FA 3O5SA 2HWB1 2JDZA 4FOVA 4XCBA 4PCRA 4K7JA 5LA9A 4FFIA 3R05A 4CYDA 3P5BA 5FZ3A 2VBDA 5LBCA 2AENA 5GLZA 1BK1A 1UCXA 4UAPA 1S2KA 3VV1A 2PYTA 5JXIA 4KG0A 4META 1PM7A 4B29A 1SZBA 1OA4A 2PAKA 3E6BA 3OPWA 2WN2A 1TMF3 3ZXAC 4UFIA 5JI7A 1JZ3A 4I01A 1JMUB 4QKFA 4BIFA 1Q8QA 4EN9B 4UFKA 4DIQA 4K8FA 4GIQA 4NROA 1D7PM 5HXVA 4IE4A 3O1MA 3ES1A 1ULPA 4UFJA 5FP9A 1YJKA 1HW5A 5T5PA 3AYCA 1DLCA 1VB4A 3NNGA 3PMSA 2VMFA 2V5DA 2QQWA 4N53C 1UXXX 2VNOA 3LQCA 2ADEA 5I91A 3ZXJA 4BQ2A 3WP6A 3DECA 3K46A 4CDXA 1NLSA 4LBMA 4NPMA 2Q8CA 5T50A 4AHWA 1OVSA 2VU9A 4MHUA 2BBAA 1NOVA 2VG9A 3GCWA 4FQ4A 4Z07A 1E5SA 4JKLA 4DRRA 4N9HA 4XAEA 4P9WA 3CJIC 3JB8A 4QDRA 1WBFA 3I2OA 1LGBA 3B00A 1OOPB 4BISA 1I6XA 1UZYA 1F35A 3W58A 1F2NA 2WO2A 4YZ1A 3ABZA 1UL9A 3OYWB 1K5MC 1UU4A 3ZFFC 2HWB2 4IE7A 2HWC1 5FJHA 4CPBD 4N90A 2VQUA 2XJRA 3UKNA 5C9AA 3OBZA 1Y9GA 1W28A 1TQ5A 1AR63 4LNVA 4C90A 1N1SA 4S2FA 1XE8A 3H0OA 4E9KA 5F9TA 1IPJA 3POGA 5DUUA 5GALA 1XNAA 5IAXA 2A6VA 3J8F2 2VTXJ 4PLOA 4I02A 4AFAA 3KF3A 1RUE3 2WN3A 1HXS3 1POV0 2E9QA 4FI9A 4FOQA 3JB4C 3LE0A 1WD3A 1ULDA 1ZYBA 2CWMA 2WR9A 4NO4A 2HWF1 1PMJX 2OZJA 4PQ9A 5F2WA 2WZPP 4O61A 3WUDA 3POIA 4Y24A 3K75B 5I0RA 5F39A 3D6EA 1J59A 2VW0A 2Y34A 2IXIA 1AL21 3NO8A 5FMOL 5FRAA 5GKAC 3KLSA 2V73A 3WNLA 3E6DA 1UZZA 4V1PA 4FBFA 3E5XA 4BPZA 3WNOA 2BNMA 4YM0A 5FPVA 1W8ZA 2D43A 3S7IA 2YC2A 2JDNA 3GF6A 5AC91 1IOAA 5FQ0A 1PGW1 1G9BA 3HEIA 1JZ7A 1L7LA 3N35A 3SKVA 1ND2C 1NUKA 5F5IA 4BYYA 4YPJA 1LULA 1GFF2 3LB9A 3GHMA 1BK0A 2YU2A 4JRAA 3WP3A 2ZS6B 1RUG3 5BXXA 1RITA 2HWC3 4GH4B 2XL7A 1JHJA 1HRV3 3WDYA 4BLJA 3J7NA 4JHZA 3AZWA 3PU3A 3MGUA 3GJAA 1FV3A 5ANNA 4BU2A 4D6SA 5FYCA 5FK8A 3W20A 5IK5A 3VD3A 4L11A 5HXMA 1OFNA 4YW6A 4Z8BA 3O7OA 2ET1A 3I59A 3WDVA 2VZUA 5IVFA 1S0IA 3VBRC 1TE1B 3LIGA 3Q8AA 4FPKA 2XBO1 4YM1A 2MEV2 4CU8A 3ZYHA 3HQXA 5LA0A 1WCQA 1SFNA 3KVBA 2EIGA 1TMF1 3LA2A 1JTZX 2OXBA 3ATGA 5J7MA 3T2TA 3RNSA 1OFSA 4N7UA 1RINA 2WA3A 3ACLA 3VBUA 3V0AA 3NV4A 1SLLA 1IS5A 2NMNA 5I0UA 4CDUA 5J09A 1S2BA 4DS0A 2H0VA 2ZCWA 3H9AA 3KV9A 4MGQA 1H30A 4OUMA 2VOXA 1ST8A 1NZIA 2PLV3 2YXSA 5FY5A 5I93A 4LT5A 1UPSA 4NJ4A 3RFRA 4QKDA 3P6BA 4HONA 2IWGB 4D6QA 2XG3A 3ME2A 3PU8A 3TEYA 3ITQA 1GQHA 4IE6A 3ETPA 1SCRA 2JDHA 1CGPA 4XAAA 1IG3A 5LY2A 4LBKA 4RYDA 3ZDVA 4XJ9A 2R043 1H8VA 2VMGA 3CZJA 2ZOEB 3SQOA 3WD5A 3GHNA 2HYXA 4HLTA 3NWKA 4EN8B 1EAH3 1VAKA 3DPRC 3EXUA 2CSGA 2Y33A 1VBE3 2LRPA 4K8RB 1J83A 2UYBA 4ITCA 1E5RA 3CDZB 3E5QA 2R1BA 2DCZA 3H50A 4LKSA 4MVTA 2Q0AA 3WDXA 3U37A 4NPLA 4CCNA 1QOOA 1SLIA 1AXKA 5JAXA 5T3NA 3LEMA 3RZMA 4MGZE 3S5QA 3AMQA 4XMIA 3OUJA 3W5MA 3C7OA 2RM22 1AJOA 3N7LA 3WW3A 3P3PA 4FCAA 3ILFA 1SEFA 4BJ0A 4OMCA 3AMHA 1RUI3 2K46A 3MIEA 4QQOA 1YUDA 2IUWA 1PZ7A 3J8F1 2VAUA 3INAA 1QJU1 1LOFA 2AC1A 3ZIWA 3USUA 2WAOA 1CQ9A 1WCSA 1R1A2 2EXJA 4LEJA 5LBBA 1A34A 1NCRB 3AL6A 4XIKA 4DQAA 3MBWA 1Y9QA 3FLRA 4F7ZA 1UYXA 2JE7A 1AXYA 2P3IA 4DRVA 2KA3A 1IKQA 1PK6B 1VLNA 1C4RA 1RYYA 2DWRA 3SKJE 3ZN4A 1EY2A 4IEYA 4NHYA 4TWTA 2P5BA 3I7DA 2VVFA 5CVRA 5CFCA 4YGBA 3TEXA 3RZLA 2WC2A 2NN8A 2BW8A 2UWCA 5C9AB 4QX8A 3WT3A 3ACIA 3VHRA 1BMV1 1KS4A 1ZBA2 2VXRA 1CAUA 4AGGA 5CFDB 1PGW2 5BV6A 2YMZA 3E97A 4QPYA 2D40A 4HETA 5D8AC 1HQLA 2FDGA 1DGRA 5FWEA 2NQYA 4L97A 3ZO0B 3E6CC 2VNGA 4XTPA 1R091 2VD7A 1JBCA 2XKOA 4XURA 5K9YA 1LHNA 5L73A 4E2GA 5K4LA 3GGLA 4RGKA 4Y22A 1BBT2 4W4ZA 5FO8B 4FFFA 3ZFEA 3HN1A 4ZONA 3ACHA 2CGOA 3CNAA 3KHBA 5FZ9A 5HPOA 4CEYA 5K7PA 5A33A 4MLOA 2YHJA 2CHHA 4QDSA 1C3HA 2BRTA 4L2NA 4EV0A 1GP4A 3KCXA 4FPFA 3QACA 3AKTA 5ERLA 1OMIA 1GOFA 1LHOA 1R081 5IK7A 4XEZA 1QY4A 1UY1A 4LKFA 2G19A 1QJX3 4BK4A 4D7YA 5A7OA 2YUEA 4KGQA 3K4ZA 1UOBA 5G04L 1ZX5A 4LIVA 3U4SA 2XJSA 4DXTA 2BNOA 2J1EA 1WLTA 1A3KA 1QF3A 3C7GA 1YQCA 3NMBA 4E8CA 4YW7A 3NNLA 4WBBA 1ASJ2 2HWE3 2ARBA 3VB9A 4ZS3A 4RA0A 5FYVA 3OCPA 5K0UA 1Y4WA 1MZ6A 4QT6A 5DN2A 2BWCA 5E1RA 1SLTA 1KXGA 3J4UH 2XVLA 4A2UA 1FMD2 1MR5A 4CCEA 1X7NA 3BALA 3B7MA 3MPBA 3KT7A 2YBSA 3FFZA 4Q26A 3WW1A 2XWJB 2WZR1 2HKXA 1JHNA 2QCSB 4XUTA 3VDDC 2P4EA 2C4XA 4Y1VA 2B4KA 5FYBA 1ZA4A 4F3JA 2VO5A 3I2JA 1OURA 2FMYA 3FWEA 1F15A 3AZZA 1KJRA 1DFQA 2P34A 2VW2A 4JV4A 3IDCB 4WM7B 2BFUS 3BTYA 2MHFA 4OFGA 1RUNA 5JR2A 3K51A 2RJKA 3SEEA 3FJSA 4XFGA 1NXMA 3WDUA 1C28A 2IXJA 3TN91 4KI5M 3WSOA 3AP5A 1AX1A 1Q8SA 1ND3B 4JC1A 3PLQA 3ZYJB 3PL0A 5A7QA 4CCDA 2DU1A 1GQPA 4PLMA 5FZDA 2E51A 2A70A 5KC6A 4X8NA 1RUI2 1VE0A 5LRSA 1TZOA 5EJ1B 3GZUC 2WLPA 4DMIA 2A75A 2HWD2 4I3GA 1WW6A 4MGKE 1Z7S1 2VUAA 1PO23 2PAEA 1AR81 3T0DA 4NHLA 2JIJA 2Q8EA 5CA6A 1VBD3 2DCJA 2WZ8A 4YVSC 1TNFA 4OHZA 1HLCA 1DYKA 1H2MA 2YV8A 1PNFA 2ZGRA 4Q0PA 1X9TA 3VBOA 1MS0A 4CE8A 3WINE 4AVAA 3POJA 4XQ4A 4ES8A 3H1WA 2AH2A 1HRI3 4CCCA 1G9AA 3DKQA 1H6YA 2P1BA 2ZABA 5FPLA 1C5HA 3WVJA 4AFDA 5EPAA 2Q8DA 1NAEA 1PGL1 4QPIC 4XDOA 3WNNA 2RS51 4HK9A 5CIRA 5FZ4A 1W06A 3NNMA 1QGLA 3BPSA 1NQDA 4GULA 4XOGA 1FNYA 4KG8A 1BEV3 3WNXA 4FSJA 1GMMA 5IWFA 3ZN5A 3O1SA 2WNOA 1J3RA 2CTVA 5IVCA 2RM21 1XJAA 2C9AA 4G9SB 4HOOA 5JPMB 1QMJA 2HH9A 3H8XA 1IQAA 1CAWB 2VH9A 5T5OA 4WVWA 3RGBA 4IEQA 3P3NA 3WCRA 1Z78A 1C5IA 2DTWA 3MIHA 4OZOA 2P3JA 4BB3A 1OD5A 4HMZA 3I3DA 1LESA 5FIXA 5FY7A 2QUOA 1XSRA 2Y6JA 1PX4A 4LHSA 2K2SA 5BNNA 1JYIA 3M1HA 3NL1A 1S55A 1QEXA 5FXXA 4IEOA 4PDWC 3RDIA 1SACA 3H1YA 1W9FA 1Y43B 3R4SA 2HBTA 4IE5A 2XUMA 2EF6A 3H3ZA 1O4TA 3RZKA 1VBB2 3GNEA 3T09A 4CUCA 1QJX2 4RS5C 5H9RA 1VBB1 1SPPB 3ELNA 3ZYRA 4R4ZA 5CYYA 1U5ZA 1N47A 3ZKYA 4DOUA 4WM8B 4Y4YA 5CFDA 3BI3A 5B2GB 2ZGOA 1VMFA 4LBJA 3PHMA 3ZVXA 4ASLA 2HEYF 1A6CA 4XXPA 2H6BA 1C8NA 1YIPA 2A6WA 2WA4A 5A7SA 1Z0HA 1VBD1 1NY72 3KT1A 4A7YA 4PJYA 1N3OA 2FQPA 3ZSLA 5J36A 4MXWB 3ZXKA 5BNPC 2O0OA 3OD4A 3I3QA 3FUQA 1B35C 1PNGA 3J9SA 4RL7A 4XFHA 1K12A 3ALQA 2NM1A 3I3MA 1Q3EA 4HL0A 1NA1A 2WBKA 3OTFA 1LOFC 3OBTA 3THCA 4QGMA 3WR0A 1PM4A 3B02A 1Q8OA 2TBVA 1XNCA 4A4AA 1IS6A 5A33B 1JUIA 3VLBB 2EIBA 4GMP0 4TSVA 4DUWA 3HJRA 3U4XA 1JXNA 2XOMA 3ACFA 1JOJA 4LK7A 4XC9A 4QGNA 3WDTA 1UU6A 3VBRA 2VBPA 3U11A 5JOXA 1HIXA 1RVF3 4AI8A 1KJLA 2W08A 4YGCA 2B9UA 1DGRN 2HBUA 3QLQA 4QX3A 3ZN6A 1R1ZA 5J37A 3HQRA 4L9BA 1ULEA 4FFGA 1O3SA 3NSTA 4GMP3 4LBOA 2D6LX 1HXS1 3HOBA 2J1UA 4JQRA 4NMIA 3RWNA 1JYVA 3K4DA 1MQTB 4GAZA 5JI9A 1HB3A 1OI6A 3UL2A 4EWDA 1W6NA 4GH4A 4NR1A 1QJZA 3PNAA 4QMAA 5F37A 1GOHA 1O8SA 4AI9A 1VBD2 4QXBA 3LEKA 4Y33A 5EFUA 5LZ6A 5CG8A 3LDKA 4Q4W2 1V9U1 3BTAA 2NMOA 3EO6A 1PVC1 2VZVA 4DUXA 2RDRA 3I2DA 5A70A 5I8SA 4ISRA 4NE9A 1RVF2 5F2SA 3VZKA 4AVSA 4N43B 1W0PA 1WLWA 1QJX1 2KM2A 1AYM3 2ZAAA 3A4UA 1XYOA 3CZUA 3LD8A 3BIEA 2WL1A 2ZX3A 4XUQA 3VHOA 1DYPA 4BDVB 1RUE2 3AXEA 1DCSA 4ARXA 1SDWA 3KCCA 2AUYA 2GMPA 3IKWA 4CDQA 1QJY2 1DDLA 2GC0A 1EPZA 5LASA 5FZBA 3VBUB 2R0FA 3NNJA 4MH0E 3V0AB 5GZCA 1KFUL 2I45A 4FPHA 1EAH1 1DIWA 5DQ0A 1EP0A 2P6HA 3AZYA 4XDQA 1G86A 4LQRA 3U10A 5LEKA 3WY6A 5IVBA 1TVGA 5FAXA 1H1MA 3FZ3A 4R9AA 1S0JA 5HCBA 1LEMA 2VNVA 1AYM2 4Q27A 4W8JA 2YDEA 1T6BX 1ZBE1 2YG0A 2ZJCA 1JI6A 1GLHA 4WVMB 3M70A 2DF7A 2VQTA 5D8AB 2P37A 2OPWA 4D6RA 2QVSB 3ZYPA 3T0AA 1PGL2 1HRV2 3KZ4C 5FY4A 5D21A 3TOJA 1CONA 1GNHA 4YGEA 1GZWA 2J1TA 3UKVA 2YZ4A 1DQ5A 1CZVA 3DPRA 3VN4A 4CU9A 1REDA 4EJRA 1G9DA 4AEKA 4XF0A 4HVQA 1RVF1 4FVVA 4OMDA 4Q4V1 1N1TA 3S57A 3VBSA 2C1FA 1YNAA 1RUH1 2BOIA 4WM8C 5H9PA 3C2UA 4KU8A 5A6YA 1VJ2A 3DXUA 4QQPA 1DF0A 2XDVA 1CAWA 1Q43A 1YFWA 4YW5A 2NP0A 1APNA 4JDOA 3AX4A 2RMU1 2QQNA 3HT1A 4XJWA 3LIHA 4YZ3A 4Y1UA 3J8F3 5FLIA 5KXCA 4IE0A 4CPBA 2O8OA 1DP0A 1REEA 4AWDA 4CU6A 3ACGA 2RVAA 2ZXQA 5DUXA 1GZCA 5C4WB 4CZSA 2ZMKA 1QQP1 5DZGA 4Y1XA 4LBQD 1J3QA 4TYSA 3BODA 2AACA 2Z42A 1EYBA 3JCIA 4G4FA 3VD5A 4E2SA 1NCRA 1PO21 3BTZA 1HQWA 3H7JA 1OHFA 1AR62 2PHXA 1H4HA 3U1XA 2JB4A 2QDRA 4LJHA 2JIGA 1OKQA 4P9XA 1JU3A 3VL8A 3GBGA 2GN3A 2WKKA 4XF9A 1HV0A 1LHUA 1NE6A 4KBBA 4KL1A 1RIRA 4CXWA 2DFCA 2XH6A 3H8UA 3ZSMA 4DB5A 1JH5A 1O4ZA 2R063 3JBG1 5F3GA 1HN0A 2VOTA 2F6BA 4ZY9A 3RJ2X 2WFF2 3JBG2 5AC93 3KHCA 2RDSA 1CAUB 1FX5A 1AL0G 2D5HA 4Q4V3 4FP3A 2RS33 1QNYA 5LK5A 5HCAA 5DG2A 1SDDB 1US3A 1ASJ1 2Q1MA 1UY3A 1NG0A 4QM8A 1FPN1 1JOPA 5C3SA 4YVSB 4A41A 2ZEYA 3TN93 2QQVA 3BB6A 2DV9A 1W6PA 1YI9A 4NOTA 5LK7B 1YRZA 4FTEA 4AEJA 4LKEA 4XVHA 3RZGA 3QBQA 5GZGA 5I0DA 2XLAA 5HCFA 5LA1A 2VGDA 3B69A 4XJUA 3GM8A 2VMIA 1S0EA 3ENRA 3O0XA 4CDWA 1O3TA 4JVAA 3FHAA 2JD4A 4AFBA 2NYYA 4SBVA 4IXLA 1J84A 2LROA 2QQKA 3NJVA 2ES3A 2R30A 3KF5A 3VBHB 1R1A3 1IHMA 4X8PA 1YFUA 3D4KA 2XKPA 1QOSA 3WG1A 3ZYGA 1ZZCA 1W6NB 1TNRA 5JCTA 3B9CA 1R092 1ZM1A 4K21A 4DXZA 4YW2A 1ZZBA 4B1LA 3FHIB 3O1PA 1ENXA 4QX7A 3WQBA 5F8PA 4O9EA 3N36A 1HRV1 2BVBA 4D3WA 3GBFA 4R8HA 4DINB 4MGSA 3VD9A 2R042 1ZBA1 1W2OA 2OQ7A 2DTYA 2OZ6A 4BIOA 1PHMA 2D97A 4PI2A 4Q2FA 3SH4A 4IEWA 4W65A 2XUEA 1QIQA 3TNPB 5C3RA 1P8JA 4XYXA 1CPNA 3OPZA 3VBSC 4FPLA 5FP7A 1MS3A 2R071 1MEC1 2VXJA 5JVVA 1NLRA 2PLV2 1AYN2 4RHV1 4IDZA 1OF3A 1VBE2 1Y7BA 2XQXA 5DAQA 4CA9A 4LBQB 2JWPA 3ZXEA 1LNSA 4JQTA 1O3QA 1W2AX 4UFMA 3RZJA 1JZ4A 2GP5A 4UBGA 4NHMA 3PUAA 3KT4A 1JODA 1OBNA 4M0NA 2CDPA 4S2GA 1PVC3 4LO6B 3IN9A 5LA2A 5IT6A 3MEPA 2Y0IA 2WT0A 4XJAA 2WZR3 5C71A 2WQZC 1QWRA 2XGXA 3EHKA 5C4WC 5DABA 3ZR5A 1PMHX 1W8HA 2D3RA 3SEPA 1I1EA 1RUE1 2UWBA 3DF0A 2BGPA 1OSGA 2XHKA 2VMHA 2XVKA 3CJXA 4L99A 1K3IA 4K9SA 3VD7A 4AQ2A 2WSVA 5FYMA 5DAWA 4MGTA 3TYJA 4GB31 2BQPA 5FV3A 5JXHA 5ACA2 4GXLA 4NUBA 4QQHA 3AFKA 3ZYBA 5L9VA 1K5JA 5FZKA 4FP2A 4W6WA 4HG6B 1CIWA 3I97A 3AVRA 4OI4A 1F8VA 5IVVA 5JZGC 4JZRA 4RHV3 5GLTA 1KS5A 5IK4A 5IFTA 4ZU5A 4CEYC 4ZXKA 5GLVA 2WZR2 1FI2A 2XL9A 3WG2A 1WCKA 3JBG3 4OI1A 4AR2A 2YROA 1STMA 2P3YA 1W99A 1I5ZA 1OLRA 3OB8A 4Q4V2 1H8TC 3W21A 2R1DA 2SLIA 5LATA 4A3ZA 1YCIA 5SV8A 2VMDA 2ZX0A 3W59A 4ZZ8A 5A1AA 1UD1A 4H7MA 3AP7A 3MF6A 3PVEA 2XQRA 4UT5A 2VOKA 1WA6X 5CNAA 4MHRA 5F1RA 1X33A 2DUOA 4N53B 4INDA 1YYNA 4UOJA 3LF7A 1UN1A 4FOYA 4UXAA 4K1ZA 3CQOA 3R0RA 4YZ4A 3WEZA 3OGVA 5A3PA 1SMVA 1DQ4A 1N1YA 3CJIA 4HZFA 4ZPIA 5JZGA 3KD4A 3OUIA 1RUC3 4HVOA 1G8WA 4NN0A 1OT5A 1XU1A 4BQ4A 4CDQB 3IZOA 3WF0A 4EWAA 4HN1A 5DG1A 1K5MB 2J22A 4LE3A 3USUB 1EAH2 3EB7A 3AKRA 3IT8A 4GB33 4MXVA 5EQUA 4BZ4A 2R041 4EZHA 1L3JA 1UYZA 1OXCA 3MPPG 2IVJA 3OUHA 1Y9MA 3V65A 1AR91 1EV11 1PK6A 5C6CA 2PHWA 5F6KA 5JSRA 2QQLA 1IKPA 2DUQA 5CFCB 1YQ8A 1UOFA 3MIDA 4R9CA 5LBFA 4NWWA 3ZPYA 3UYJA 1HJGA 3J7MA 3O1OA 2K9ZA 1X36A 3HNMA 1XNBA 1ND2A 1EUUA 3AYAA 1WW5A 3OYWA 3EBRA 4JDNA 4K20A 2WNEA 3AC0A 1GICA 1Z7S2 1ZBE3 1S0CA 3IDBB 1REFA 4P5HA 4YZ5A 4XQWA 5CG9A 1LRHA 5CKMA 3JD72 3WF4A 3Q8FA 2GNMA 4BQ3A 3ZFGB 3NJXA 3H7YA 4QX5A 3RVHA 2W1SA 3ILNA 1B09A 1U0AA 1MQTC 4NIGA 1VBC2 4UBHA 2ERFA 4HSJA 2HWE1 5FYUA 1ULGA 3TBDA 2ARXA 2XBO3 5BNOA 3WHUA 3WF3A 1NQJA 3IWZA 5H9QA 3A23A 3ON7A 2VZ3A 4LLOA 4MYEA 4C0BA 2VUJA 3LPFA 2UY9A 3ECQA 3S30A 4AVBA 3WW2A 2EVXA 3ES4A 1DQ0A 3MLKA 1V6KA 2Q8OA 3VDDB 2MEV1 4CEWB 2VPVA 2Y6LA 1QQP3 1BXHA 2RDNA 3S7EA 5F32A 2HYKA 3HWJA 4BXFA 2W68A 1PIV3 1Z7S3 2X05A 3I3EA 4MGYE 1OKOA 2WS93 4LK6A 1V0AA 2GAUA 3FX3A 5IW0A 4CP1A 2OA2A 1CD3G 5A3NA 2OPKA 5ACA3 4XBNA 1RXFA 2IXHA 3OPTA 5LWBA 2A3XA 5GLUA 4HKLA 1OQ1A 4UI9L 1W03A 3ROUA 5C9AC 4N43A 2VC9A 3MDPA 5J48A 3KB5A 2BUKA 5CBLA 1LR5A 2KD7A 1LHVA 2VVDA 3LEIA 4J25A 4LBQA 3WNMA 5L36A 2Q30A 4COUA 3AL5A 1E5IA 4QKBA 3SISA 4DEVA 1AHSA 4RS5A 5FZEA 1UOJA 1XE7A 2W87A 1VAMA 4GD4A 1VRBA 4IV1A 4X6QB 1PO12 2VZSA 1JYWA 3I4IA 1UQXA 1NCRC 2IC1A 1FOD2 4TXWA 3VBFA 5IUQA 1SFYA 2XJQA 4WM7A 3NW4A 4OLLA 4XJ8A 2DU0A 2ZGPA 3K2OA 5IVYA 1D4M2 1C57A 3AB0A 2DDUA 2XXZA 3KQRA 2JKXA 2HWE2 3FMGA 5CU1A 2RMU2 5FTTC 5GJ6A 2WFPA 4IV3B 4UW3A 5EYXA 2R073 4AL9A 1UKGA 3B3QE 1RUH2 2X29A 4LO4B 1GNYA 5FZ8A 3CLPA 3A21A 4L92A 1UMIA 4AAXA 4XMAA 3FHQA 5G05L 4S2HA 3DGTA 2EICA 1YEWA 3T1LA 1POV1 5D8AA 1RUF2 4QPWA 3U07A 3W9AA 5EJZB 4BLIA 5APAA 4V2WA 4DPNA 2FDKA 4M3CE 4E4SA 1RXGA 4KWJA 2OUHA 3T30A 2ARAA 1XPWA 1ULOA 1GZWB 4NRQA 4XILA 5FZAA 1PVXA 2VZ1A 4XW3A 5BPXA 1SBEA 2J42A 3Q8CA 5HV4A 1A78A 4QXHA 3IIAA 5CEHA 1O4YA 2O14A 4Y4RA 2QFEA 3VBSB 3MHZA 5D1IA 5FWJA 1KITA 1JYCA 4GZ9A 2EA7A 2BU9A 3DKWA 4CU7A 1YO8A 3LKJA 3MLJA 5E16A 4IEUA 2JE9A 5L9BA 2ZGLA 3NV1A 3DYMA 2CAUA 3IIIA 3PTYA 2C9KA 3WP5A 4E4HA 3CO2A 4XFAA 4XF3A 5FYTA 3RSJA 1LOCA 2JDAA 5FDBA 2O8QA 4Q4X2 4YARA 1TME1 1BHGA 5FY8A 4A44A 1QJY3 2PN5A 4DY3A 3MUY1 4A45A 5DAPA 3M3OA 1OF4A 1VBC3 4Y26A 5FYIA 3JUUA 3SXWA 4JDMA 5KBFA 1K5MA 2ZGUA 3FE5A 1N1VA 4GKXA 2D6PA 1V6MA 1UY4A 2OIIA 2WWUA 1GKBA 1ND3C 4GKYA 2QE3A 1S0FA 2I2SA 2ZZQA 5F3CA 4P14A 1OH3A 1W05A 1C1FA 3OJBA 4HKWA 4LITA 5GZDA 4EYUA 1KFXL 3LWCA 4QXCA 4LBNA 3AKQA 4C0HA 2A1XA 1BEV2 3M2MA 3KWVA 2W39A 4UFLA 4XHXA 4BCUA 5A3OA 4B4QA 3HT2A 5J96B 2QBXA 4LO8A 1SPPA 3I3BA 1YLLA 5KXDA 2GZWA 2LS6A 2YYOA 1Y3TA 1NKGA 2GNBA 2PHTA 2RS11 4HPKB 2IXKA 1MPXA 5CADA 1WD4A 2JENA 4UF0B 1BVVA 4PIYA 3A22A 4XXAA 3A0NA 3THTA 2FDHA 3AZXA 4D8MA 4QGLA 1H2LA 1UU5A 1Q8VA 4PLNA 1O59A 5C4WA 3V64A 4I30A 1BQPA 1MZFA 2V72A 4CCOA 1VBA3 2ZGNA 4QQLA 2RS13 2W92A 3NAPB 4URTA 1U5XA 4W6XA 5I0TA 2OT7A 1ODNA 1UZVA 1W8FA 1UIKA 2C26A 2Y6FA 4NHKA 4QHOA 3TAYA 1MS4A 1U12A 2VQAA 3T3YA 2VCAA 2G4IA 4B7EA 2ID4A 5CKQA 3RMYA 2JD9A 3LA7A 3ZFEB 2RG4A 2WWSA 5GM0A 3VBRB 1N3PA 2JXAA 4ONUA 3VBHA 1TEIA 4BOWA 4OHYA 1SLBA 4U2AA 3FC0A 4AXOA 2WT2A 1D2SA 1GWMA 3OEAA 3QCWA 3M7AA 4Q0VA 3SLIA 4YVWC 3MV01 2OYZA 3C7EA 2ENRA 3L2YA 4IV3C 4LLFA 3JXSA 1S0BA 2R062 5FKCA 3RI8A 3AP4A 1OLQA 3WNKA 3CU7A 5JPNB 1OUXA 2WFF3 4A7KA 4IL7A 3GBWA 2GH8A 4LR4A 1U5IA 4AVCA 1RUC1 2W46A 2W9XA 2BGCA 1U5YA 1VR3A 3BYWA 4MV2A 1H4GA 4Y5TA 1VRH1 4I0BA 5EZWA 5K0UB 4RS5B 4HK8A 4EN6B 1SCSA 3KV6A 3OF1A 3A7QA 4JTNA 3NQHA 3N7KA 1W6QA 2DVGA 3E5UA 1DBNA 1BCXA 1WLDA 5JSPA 2JICA 2V5YA 1RUG1 3R4UA 4LORA 1QDOA 2EXHA 2Z69A 3T2PA 3J26N 1WGPA 3OGSA 4XACA 5FUNA 3VDAA 5CB7A 4BMBA 1HB1A 4Z1VA 1R083 1HXS2 1TME2 2EIDA 3AM2A 2OUJA 1IGOA 3H3LA 2P17A 5J3UA 3POBA 2HEWF 3V56A 1PO11 3HAGA 1V70A 2DVDA 3BUCA 1K42A 1EPWA 2EALA 4L0PA 1BZWA 4HKOA 4Q4W3 1IS4A 3OY8B 2J1AA 4CXXA 5EYYA 4BQYA 4M3CF 1BKZA 4LA3A 1A8MA 1X9PA 3OOXA 1SQ4A 4RN5A 1UOGA 1R093 3WF2A 4G3YC 5F5AA 2WWJA 2GC2A 4QB6A 1UNBA 2E7QA 2R7EB 1AUYA 2E63A 4URAA 5FPAA 4QPIB 1QKQA 3CL1A 2IXCA 3FFQA 4PBPA 5DDJ1 3AXDA 1RUD2 1DG6A 2PHLA 1ZZ9A 1C1LA 3H3UA 4BQXA 3O1RA 4P9YA 2A6YA 2VBBA 4PT6A 1JW6A 4CCKA 5C7GA 1F31A 1DQ2A 1LEDA 1XXNA 5C3PA 3ZKUA 2QJVA 1KQRA 2BNNA 1ULFA 1LECA 1OLMA 3HIFA 3OD0A 3M4FA 4GWMA 4H55A 1WWYA 5D2AA 1JS9A 3VKOA 1UWWA 1PK6C 5FP4A 3ZFGC 3MZHA 1V9U2 1AR82 1JZ8A 2BVVA 4M4RA 3LSDA 2VNRA 5EV7A 1ZREA 3H1MA 3OBAA 3AKSA 1VMHA 3L9JT 1NYWA 4YFWA 3THDA 3N7JA 1WCUA 4XF1A 1L7QA 3PJYA 4PIXA 5F5QA 2V4VA 4AGRA 4Y5Z0 4R9BA 4Q4Y2 1O8PA 1J58A 1LENA 2D6KA 1WKYA 5CFCC 3CJIB 2LALA 4ZS2A 1QJEA 2CU5A 1BMV2 3AP6A 2W1QA 4PF1A 3VBUC 3O1TA 2GNDA 5HI0A 4B3NA 4YNIA 1FXZA 5BUVA 3A0KA 1LJ7A 2DYCA 3KMHA 5FXWA 4KBZA 4D7TA 3U75A 4UW4A 1VRH3 2FDIA 3IAQA 4ARYA 3PUQA 3LDBA 2JECA 5LCWL 1W9TA 1RUJ2 2VTXA 4J1WA 4CCLA 4KH9A 3NNFA 3ZX7A 1N3QA 1UKRA 4YM3A 4HANA 1AR92 1D4VB 3NV2A 1TMF2 5F6LB 3ZLIA 5JOYA 1GZ9A 2BDRA 3DXTA 2JJ6A 4HSLA 2B5HA 4IW3A 5A3TA 2JG9B 4YRDA 3WCSA 2VZRA 4OZXA 3TEWA 2QTWB 2W47A 4JRLA 1RUG2 2ZHNA 3BOWA 4IEZA 1GP5A 4AEDC 1GV9A 2WFF1 3U0ZA 2PMWB 3FBYA 2XLFA 3ZXDA 2J1SA 1US2A 1V00A 2WZEA 3LPGA 4XETA 1H2NA 3ZFGA 2WDBA 4PI0A 4DUVA 4CTEA 3Q9OA 5EP9A 4XBQA 5FZ6A 1ASJ3 2YFZA 1FNZA 1RUJ3 3L2HA 3UJOA 1VBC1 2BWAA 3I2HA 1A8DA 2GC3A 2OX0A 2RJ2A 3AK0A 1TME3 2VUCA 2ZBJA 1AF9A 3I2KA 3PIGA 5FZCA 4XUPA 1ENQA 3T4VA 1DGWA 4PQQA 5KR7A 3F95A 1IS3A 2RS53 4OYUA 3ZMNA 1FOD1 5AC92 3VDDA 3N9PA 3TEZA 1CR7A 2Z5WA 2Z2SB 3E1F1 5C8WA 2CL2A 2QQUA 5FZOA 5A1LA 1DHKB 5KXEA 4P00B 1I5PA 1W6OA 5L19A 1RTVA 4Q4Y1 4CDWC 3SITA 4YZ2A 5DUWA 3VDBA 2WSUA 5IFPA 2ZX2A 5JWPA 4I2OA 4OCTA 3NKTA 3MW2A 3AJYA 2QKDA 1DZQA 1CAVB 3AYDA 3RQ0A 3ZM8A 3MW4A 5FUIA 2PHDA 1ZRFA 4B7KA 4Q8KA 4DXRA 1IQDC 3C7HA 3QH7A 2PQQA 1OPMA 2ZMNA 1XSQA 5C8CC 2N7GA 2VTFA 5JIUA 4Q8LA 4JHTA 1T2XA 3T2OA 3ZYFA 3RPQA 4C1WA 3URFA 4AQTA 5JIAA 5IVEA 1YI7A 5IYYA 2WJSA 3F2ZA 4LIUA 5FXVA 2VCMA 4AEMA 2PELA 3ZFFB 4IEPA 1OQDA 2HEVF 2JG8B 2LM3A 2Q4SA 4BXSV 3D0SA 1D0HA 4FTSA 5LEJA 1JU4A 1NZCA 4RR3A 4CRQA 4XQDA 3HPNA 4P9GA 1COV1 2VOWA 2ZX1A 5EIYB 1G6NA 5FZHA 1ZZ7A 3D8CA 3SC7X 4ZU7A 3PMEA 5FPUA 1AR72 2ZHKA 3OY8A 4RQPB 4KU7A 4XABA 2P2KA 2ZGKA 3FBMA 4K40A 2ZEXA 4IV3A 2PLV1 4XFBA 2ILMA 4E4DX 4ZHNA 3OBRA 1GZTA 1QOTA 3ZXLA 1DQ6A 1W0OA 4OUSA 3CMGA 3HNBM 1MVQA 1D0GA 1RGSA 1RL3A 1PIV2 2WQ8A 3JD71 3J7HA 4I0WB 5GLWA 4AI2A 4JGYB 1GUIA 4ZZ5A 1CESA 5FJKA 2RHPA 5K8SA 4BQ5A 5FZGA 2JG8C 1W2NA 5C3OA 1CX1A 3SHRA 3VDCA 2ORZA 1GOGA 4CDXC 5AVPA 3RZHA 1YHFA 1GYKA 4FAGA 5F5CA 4B4RA 2WRAA 4Y20A 5C5TA 1ZRDA 2BEOA 4LHNA 2BERA 1RUC2 2K0GA 2GDFA 1HN1A 4OVEA 3RMXA 4HN0A 4C91A 3CIHA 1X8MA 1PZ8A 4C1XA 3WP4A 3GZTB 2JDYA 5BNOC 3DPRB 3ZMOA 2PHRA 1AX2A 1QNWA 3DCQA 4XF4A 1ZBE2 1FAYA 3ST7A 3ZXFA 1MS8A 4BH9A 4C8DA 4CUGA 4B4PA 3BU0A 1MACA 4Q0UA 4AI0A 2GU9A 3WQ7A 1BJQA 1CZTA 4AVTA 1NXD1 1QH7A 2IXLA 5F7UA 1WW7A 4QDQA 1TG7A 4FFHA 4IQPA 2LTNA 2CDOA 5A3WA 2QNKA 2XJVA 2ZGTA 3WUCA 3UT0A 3DN7A 3PTRB 2HLEA 3TB0A 2R072 3PVNA 3VKLA 3VUOA 1LHWA 4KMQA 4S2DA 1AZDA 4W6YA 2TUNA 4XBLA 1FV2A 2WUHA 1W9YA 2B9VA 3KGZA 4EE2A 2ZTNA 3UJQA 1OPOA 1W90A 3WQ0A 1LGNA 2D6MA 1BBT1 2WAAA 3GZAA 4GMP1 4KNCA 4D0QA 5C5UA 4AI3A 1XC6A 2ZGSA 3B01A 4FPOB 1EUTA 2E26A 3K3OA 1D2QA 1UZ0A 3MV11 4LHKA 2QDNA 5FZIA 1O5UA 1YFYA 5FZ7A 4YFZA 5DDJ3 4OQ8A 2ADDA 1QH6A 5FP3A 2YBPA 4OUEA 2WO1A 5JMOA 2UURA 4QX2A 2FDJA 5FK7A 1C8M3 1S4CA 3EMRA 1RUOA 5FFOC 4D94A 2FDFA 4EWEA 4TLFA 5A7NA 4B8EA 1FMD3 1QJU3 4D69A 4WVVA 1LKNA 4ET7A 2B42B 2QQMA 5FOJB 1B35B 4JKMA 1CIYA 5SV5A 3X29B 1UMHA 3VZJA 3ZSKA 5L7OA 2DVBA 3BVCA 3ZPOA 1FATA 1WBLA 1UX7A 1JYTA 1GBGA 4GB32 3N9OA 2W91A 4O65A 3VL9A 4MG2A 1KEXA 2W2IA 3MYXA 5BY5A 3D3AA 3GDBA 3C8XA 1CVNA 4FPYA 2RJLA 3EQEA 1W6OB
chains in the Genus database with same CATH topology
4QU1A 3PDQA 4GD4A 1VRBA 2OT7A 2YU2A 5E6HA 3NJYA 5F2SA 3PUSA 5FPLA 2Q8DA 4QX8A 4XDOA 5IVYA 3K2OA 3LD8A 2YU1A 5FZ4A 4EZ4A 3PU3A 2XXZA 3K3NA 4BU2A 4D6SA 5FYCA 5IWFA 5FXWA 5LW9A 5FWEA 5FJKA 4IGQA 5IVCA 5FZ3A 5A3PA 3N9MA 4HOOA 5FZLA 5FZGA 2VD7A 3PUQA 3LDBA 5FZ8A 5IVFA 3OPWA 4CCLA 4ASKA 5FP8A 5FZBA 5K4LA 4QWNA 5F5CA 3ZLIA 4CCMA 4UF0A 3DXTA 3KVBA 5FY1A 5FBJA 5FZ9A 5A80A 5FY7A 5A3TA 5IVBA 4IGOA 4CSWA 4EZHA 4V2WA 4DIQA 5FXXA 5FP9A 2OQ6A 5FZAA 5FYSA 4QX7A 3KV6A 5FUPA 4C8DA 5FYZA 4QXHA 4CUGA 3AVSA 5CEHA 5A7WA 4D6RA 3KV9A 4Y4RA 4IGPA 3N9LA 2PXJA 5A7OA 5A7PA 3U4SA 3UYJA 5FWJA 4LIVA 4GJZA 5IVJA 2YPDA 5FY5A 5FY4A 5FZ1A 2OQ7A 3PURA 5F3IA 5FZ6A 2Q8CA 5FYYA 4HONA 2XUEA 4D6QA 5FUNA 3PU8A 5FZOB 5FYVA 5A3WA 4E4HA 5ISLA 2OX0A 5FYTA 3U78A 5F3EA 3PTRB 5FP7A 5FXZA 3KV5A 5LY2A 5FZMA 5FY8A 5FZCA 3RVHA 4BISA 4TN7A 5A7SA 3N9QA 3DXUA 5FZ0A 2XDVA 2GP3A 2YBSA 3KV4A 5KR7A 4CCJA 3N9PA 4LXLA 5FYIA 5FYUA 5A1FA 5FJHA 5FY9A 5FZOA 5A1LA 5FY0A 2GP5A 3PUAA 4DO0A 5FYBA 2WWUA 5F3CA 3K3OA 5F5AA 2WWJA 5FZFA 3N9NA 4EYUA 4LITA 4V2VA 5FZIA 4AAPA 4URAA 5FPAA 5FZ7A 4QXCA 4CCNA 5F32A 5FP3A 2YBPA 4BXFA 2YBKA 5FYMA 5A7WB 5IW0A 5FV3A 5A3NA 4CCKA 5A7NA 2OS2A 4NUBA 5F2WA 5A7QA 5FPBA 5FZDA 5IVEA 3OPTA 5F39A 5LWBA 4LIUA 5FZKA 5LY1A 5FXVA 5FP4A 3KVAA 3AVRA 4UF0B 5FYHA 5IVVA 4GAZA 5ANQA 3AL6A 3ZPOA 5FPVA 4XDPA 2XMLA 3N9OA 5F3GA 2W2IA 4GJYA 2Q8EA 4Y3OA 5FZHA 5F37A 4AI9A 4Y33A 4QXBA 5FPUA 4CCOA 3AL5A 5F5IA 5FZEA 2P5BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QU1 A;  3PDQ A;  4GD4 A;  1VRB A;  2OT7 A;  2YU2 A;  5E6H A;  3NJY A;  5F2S A;  3PUS A;  5FPL A;  2Q8D A;  4QX8 A;  4XDO A;  5IVY A;  3K2O A;  3LD8 A;  2YU1 A;  5FZ4 A;  4EZ4 A;  3PU3 A;  2XXZ A;  3K3N A;  4BU2 A;  4D6S A;  5FYC A;  5IWF A;  5FXW A;  5LW9 A;  5FWE A;  5FJK A;  4IGQ A;  5IVC A;  5FZ3 A;  5A3P A;  3N9M A;  4HOO A;  5FZL A;  5FZG A;  2VD7 A;  3PUQ A;  3LDB A;  5FZ8 A;  5IVF A;  3OPW A;  4CCL A;  4ASK A;  5FP8 A;  5FZB A;  5K4L A;  4QWN A;  5F5C A;  3ZLI A;  4CCM A;  4UF0 A;  3DXT A;  3KVB A;  5FY1 A;  5FBJ A;  5FZ9 A;  5A80 A;  5FY7 A;  5A3T A;  5IVB A;  4IGO A;  4CSW A;  4EZH A;  4V2W A;  4DIQ A;  5FXX A;  5FP9 A;  2OQ6 A;  5FZA A;  5FYS A;  4QX7 A;  3KV6 A;  5FUP A;  4C8D A;  5FYZ A;  4QXH A;  4CUG A;  3AVS A;  5CEH A;  5A7W A;  4D6R A;  3KV9 A;  4Y4R A;  4IGP A;  3N9L A;  2PXJ A;  5A7O A;  5A7P A;  3U4S A;  3UYJ A;  5FWJ A;  4LIV A;  4GJZ A;  5IVJ A;  2YPD A;  5FY5 A;  5FY4 A;  5FZ1 A;  2OQ7 A;  3PUR A;  5F3I A;  5FZ6 A;  2Q8C A;  5FYY A;  4HON A;  2XUE A;  4D6Q A;  5FUN A;  3PU8 A;  5FZO B;  5FYV A;  5A3W A;  4E4H A;  5ISL A;  2OX0 A;  5FYT A;  3U78 A;  5F3E A;  3PTR B;  5FP7 A;  5FXZ A;  3KV5 A;  5LY2 A;  5FZM A;  5FY8 A;  5FZC A;  3RVH A;  4BIS A;  4TN7 A;  5A7S A;  3N9Q A;  3DXU A;  5FZ0 A;  2XDV A;  2GP3 A;  2YBS A;  3KV4 A;  5KR7 A;  4CCJ A;  3N9P A;  4LXL A;  5FYI A;  5FYU A;  5A1F A;  5FJH A;  5FY9 A;  5FZO A;  5A1L A;  5FY0 A;  2GP5 A;  3PUA A;  4DO0 A;  5FYB A;  2WWU A;  5F3C A;  3K3O A;  5F5A A;  2WWJ A;  5FZF A;  3N9N A;  4EYU A;  4LIT A;  4V2V A;  5FZI A;  4AAP A;  4URA A;  5FPA A;  5FZ7 A;  4QXC A;  4CCN A;  5F32 A;  5FP3 A;  2YBP A;  4BXF A;  2YBK A;  5FYM A;  5A7W B;  5IW0 A;  5FV3 A;  5A3N A;  4CCK A;  5A7N A;  2OS2 A;  4NUB A;  5F2W A;  5A7Q A;  5FPB A;  5FZD A;  5IVE A;  3OPT A;  5F39 A;  5LWB A;  4LIU A;  5FZK A;  5LY1 A;  5FXV A;  5FP4 A;  3KVA A;  3AVR A;  4UF0 B;  5FYH A;  5IVV A;  4GAZ A;  5ANQ A;  3AL6 A;  3ZPO A;  5FPV A;  4XDP A;  2XML A;  3N9O A;  5F3G A;  2W2I A;  4GJY A;  2Q8E A;  4Y3O A;  5FZH A;  5F37 A;  4AI9 A;  4Y33 A;  4QXB A;  5FPU A;  4CCO A;  3AL5 A;  5F5I A;  5FZE A;  2P5B A; 
#chains in the Genus database with same CATH topology
 1AR7 3;  2OKX A;  4ORF A;  4BM8 A;  1X82 A;  4IEV A;  4P02 B;  3VHN A;  3PUS A;  1DGL A;  5T52 A;  4Q4X 1;  2VOV A;  4JX0 A;  4LOS A;  3R6S A;  3RZZ A;  5T5J A;  2NZ9 A;  2Q5T A;  4P9I A;  3UGF A;  3UV9 A;  3VGI A;  4CEW A;  5FPX A;  3I49 A;  4QM9 A;  1RHI 2;  1MEC 2;  2EAK A;  2UWA A;  4AE2 A;  2YFU A;  1DLL A;  4QX1 A;  3PVB B;  3LFM A;  1KRI A;  4IGQ A;  5GZF A;  4AHY A;  2WNU A;  3JD7 3;  5FZL A;  2Z79 A;  3JZV A;  4Y1Z A;  2ZKN A;  3UET A;  4ERO A;  2PQS A;  1JZ2 A;  3VKM A;  5CFD C;  3QH6 A;  5FMD A;  1ZVF A;  2WII B;  4ASK A;  2RR1 3;  2AYH A;  3RYP A;  4AHX A;  2RMU 3;  1BBT 3;  1OOP C;  4RGG A;  2ZA9 A;  4GWN A;  3OGJ A;  1SG3 A;  2JDM A;  4Q1R A;  2ZHM A;  5A80 A;  4BQW A;  2FCV A;  4IGO A;  4XFC A;  1W6Q B;  1RUH 3;  2XJP A;  4ES9 A;  3RG0 A;  5A32 A;  5B4X A;  2YC4 A;  5DZE A;  1VBA 2;  1COV 3;  1MZ5 A;  1QDC A;  3B93 A;  3N3H A;  4BQ1 A;  1W2U A;  2R06 1;  4RQP A;  1RB8 G;  2E7A A;  3LOI A;  1OQE A;  3JU9 A;  3KSC A;  4IV1 B;  4DY5 A;  5A7W A;  1XB9 A;  3MIG A;  1LTE A;  2ORX A;  3WLU A;  1GP6 A;  2ZPX A;  1EV1 2;  4GWJ A;  4YSF A;  2VE1 A;  1W04 A;  2ARE A;  3PUR A;  5FKB A;  1ZZ8 A;  2IVI B;  4FPG A;  4NHX A;  1RMU 2;  4AF9 A;  1D4M 1;  3IBM A;  1MS5 A;  4JGY A;  4GA9 A;  1CJP A;  1H0B A;  2ZEZ A;  3GJB A;  5H9S A;  4CDU B;  2GN7 A;  5ABJ A;  1JYX A;  4JGZ A;  4ZU4 A;  4IUG A;  3AMN A;  5FZM A;  2JEM A;  4TN7 A;  4LUK A;  3N9Q A;  4AVV A;  5FZ0 A;  2X8K A;  1XYN A;  1LOD A;  4QPI A;  4QHZ A;  3H42 B;  1H6X A;  3UK9 A;  3O1U A;  4DO0 A;  1LOE A;  2GNT A;  4P5Y A;  4DNY A;  1MS9 A;  4MAD A;  1VAL A;  2LUW A;  2WNV A;  2WO3 A;  3MUZ 1;  5GZE A;  1FOD 3;  3H8O A;  5L9R A;  2P3K A;  3IMM A;  4K6B A;  1S0D A;  1CN1 A;  2G1M A;  3MIF A;  3NV3 A;  4XUN A;  2E7T A;  4QB2 A;  1ULC A;  5KC5 A;  3PIJ A;  2G9F A;  5CKN A;  1GSL A;  2DBI A;  3O0V A;  3PUH A;  4RSU A;  3SCF A;  1OVP A;  3GXU A;  2YC0 A;  4ZKT B;  4OHX A;  1QJU 2;  2BFU L;  5JOW A;  1UMZ A;  3BCW A;  4OHW A;  2D44 A;  3OG2 A;  3ZOI A;  2W0X A;  4NPR A;  1O5L A;  1PZ9 A;  1ENS A;  2A3Y A;  2ETE A;  5IJR A;  1SLA A;  1RUF 3;  2W94 A;  4MSV A;  1UY2 A;  3VZM A;  4XDP A;  1NX9 A;  1W6M B;  4CUA A;  4CUB A;  3N4M A;  3USS A;  2FD8 A;  4HT1 T;  2Y0O A;  3ASI A;  2HWB 3;  4BK5 A;  4OHV A;  4XHB A;  3V0B B;  1RJ8 A;  3SMH A;  2FZ2 A;  4N53 A;  4UW5 A;  4BWO A;  1R64 A;  1QXJ A;  1OA3 A;  1W8O A;  1DGW X;  3Q8B A;  2ET7 A;  2G9Z A;  5JZG B;  4TTG A;  3K77 A;  1LAJ A;  1WA4 A;  2VMC A;  5J1X A;  1W9S A;  3IDA A;  5ABJ C;  3WOG A;  2C24 A;  1W0N A;  1PX3 A;  2RS3 1;  2DCT A;  1X50 A;  4MGI E;  4X6R B;  4COV A;  4LUL A;  2XJT A;  2YY1 A;  4YG3 A;  4P9L A;  1ALY A;  1XNK A;  1XBF A;  2AEZ A;  4YM2 A;  1Q8P A;  1MEC 3;  3Q8E A;  3U14 A;  3MIC A;  4COY A;  5JDB A;  3IPV A;  4CP9 B;  3RWK X;  4ASM B;  3M3Q A;  4FPJ A;  2ZEW A;  4OI0 A;  2JDP A;  1WMX A;  4YW4 A;  3WXP A;  5T54 A;  4AED B;  3ZSJ A;  2VQ0 A;  1RUD 1;  3M3I A;  5FP8 A;  1SBD A;  1UX6 A;  2EXI A;  4NAM A;  2QQP A;  1UZW A;  2IFW A;  1UAI A;  4CXY A;  4CCM A;  2A7A A;  4DXS A;  4UF0 A;  3CF6 E;  2AR6 A;  3HBZ A;  5L7O B;  3WQ1 A;  5DPN A;  2ZAC A;  5KHJ A;  2AEY A;  3AMP A;  2FCT A;  3IDE A;  1BYH A;  1X8E A;  2CV6 A;  3T1M A;  2PHF A;  4LO5 B;  1ND2 B;  5FMC A;  2ATF A;  4AI1 A;  3BPZ A;  1CWP A;  3T4H B;  1YJL A;  2BTV C;  1UYP A;  2IFR A;  5FYS A;  2D5F A;  1RUF 1;  5C70 A;  2QZ3 A;  5FUP A;  4MO3 M;  2PA7 A;  4N43 C;  4KWU A;  2E31 A;  3BKZ A;  1R08 2;  2VEC A;  2WIN B;  3NJZ A;  1JYN A;  1AL2 3;  4IGP A;  3W5N A;  2PXJ A;  4QXK A;  1JZ5 A;  3HQU A;  2QQO A;  3LEG A;  2XVG A;  3NRU A;  4U36 A;  3JQX A;  3OGR A;  5F3I A;  1YWK A;  5FYY A;  5FMO S;  2HWF 3;  2Y26 A;  3ZR6 A;  3O14 A;  5BNO B;  1FT9 A;  1RMU 1;  4SLI A;  3WG3 A;  1WUV A;  1O7F A;  3QD6 A;  1PMI A;  4PF5 A;  5FXZ A;  4LBL A;  1YFX A;  2W3J A;  1HB2 A;  1V6J A;  1H1A A;  3KV5 A;  2YB7 A;  2DCY A;  5FCC A;  1IG0 A;  2GP3 A;  1F5J A;  1JZ6 A;  3KGL A;  3OEB A;  2QQJ A;  4UFH A;  4UWD A;  4AQS A;  4ATE A;  2JDK A;  5FY9 A;  3GYD A;  3PUI A;  4OUL A;  4QX0 A;  2ARC A;  1WW4 A;  1XND A;  4RFT 0;  3VBF C;  1PVC 2;  1H2K A;  2UY8 A;  1GNZ A;  1QXR A;  2XB6 C;  2Q1Z B;  4IV1 C;  4YGD A;  3MIB A;  5C3Q A;  2WAB A;  5FZF A;  5AFE A;  4N9I A;  3N9N A;  1ZA7 A;  1YQ2 A;  1SFP A;  4Q5O A;  2I74 A;  3I8T A;  2RS3 2;  1GQG A;  2X5I C;  4QQ2 A;  1LU1 A;  2WO7 A;  3TNQ A;  4PIZ A;  2R16 A;  3H8R A;  1AR8 3;  4RR3 B;  4Y1Y A;  2V4A A;  3GCX A;  4AYU A;  5B4N A;  1WMF A;  1VPH A;  3TN9 2;  4A42 A;  3VZL A;  1AR7 1;  2X10 A;  1MZE A;  3AKP A;  1RUD 3;  3VKF C;  1HV1 A;  1UXZ A;  4TZD A;  1OD3 A;  4L8Q A;  1LU2 A;  4HFS A;  4Q4Y 3;  4EN0 A;  1H8T B;  1WLC A;  3R4D B;  1H1I A;  3MFA A;  4YLZ A;  3IM0 A;  4JGZ B;  5JXJ A;  5ANQ A;  5FPZ A;  5T55 A;  3FUO A;  1OA2 A;  3VBF B;  3WX5 A;  1IPS A;  5FBZ A;  4AHZ A;  5JSO A;  1HX6 A;  1V6N A;  2Y6K A;  3OSD A;  4UW6 A;  1ZNP A;  5ISL A;  4LTA A;  3DL3 A;  1LB2 A;  3UKT A;  5KHI A;  3PDQ A;  3RYK A;  4XFF A;  1AYN 1;  3GAL A;  2BV4 A;  2B46 X;  1OH4 A;  4FQZ A;  2B8M A;  5AFB A;  1O3R A;  1URX A;  1F4H A;  2C6S A;  2XHN A;  3TRS B;  1C8M 1;  2Y6G A;  4IER A;  2DUP A;  1NY7 1;  2BYV E;  1WCD J;  1QJY 1;  3POY A;  4YVW B;  3VBO B;  4A6S A;  1CAX B;  2UU8 A;  4O7X A;  4Y20 B;  4JTO A;  1AR9 3;  4D7S A;  2Y64 A;  2ZX4 A;  4XJZ A;  3LCP A;  1YXW A;  2VM9 A;  4LPL A;  4M3C A;  4MX3 A;  3AMM A;  4WZC A;  2AZ5 A;  4ATF A;  5CAZ A;  1BVP 1;  5JMC A;  2BJS A;  5I8T A;  1G7Y A;  2A5Z A;  1VAV A;  3BTX A;  2C5D A;  5JOZ A;  1QXP A;  3AZV A;  4XPV A;  4Z82 A;  4DFS A;  3UNP A;  4NRM A;  1XE0 A;  1HDK A;  1VRH 2;  5ACA 1;  4XTM A;  1IZ3 A;  1YQ6 A;  4RFR B;  1ZZ6 A;  4IES A;  2J1V A;  3P1I A;  1H9W A;  1XQN A;  2VZT A;  1S0G A;  5DZF A;  5LB6 A;  5E8A A;  4E2Q A;  2C0Z A;  3NAP C;  3V0B A;  2OQ6 A;  2MEV 3;  2DCK A;  2JDU A;  3ZDS A;  5A3L A;  2R0H A;  3FLT A;  1S2E A;  3AJZ A;  2VR4 A;  1LCL A;  3PJQ A;  3HR9 A;  4TLG A;  3VBO C;  4R4X A;  2XON A;  4LOT A;  3SH5 A;  3N9L A;  5IVJ A;  1LGC A;  5A7P A;  3LOB A;  2WNU C;  3WDW A;  5DAX A;  5BNN B;  1AYM 1;  1ZBA 3;  2WNV C;  1J1T A;  2D93 A;  3ETQ A;  3RI9 A;  4BA6 A;  1VB2 A;  1ZRR A;  3FLP A;  4CDU C;  2X53 S;  1AJK A;  1NT0 A;  2FMD A;  5E89 A;  4DZG A;  4GWI A;  5EWS A;  1NCQ C;  1V9U 3;  2MNG A;  3LGR A;  1OUS A;  3ZYI B;  1HKD A;  4H14 A;  3KV4 A;  2B7Y A;  4PHZ A;  4AED A;  4WM8 A;  4LXL A;  4I0A A;  4PDW B;  4R52 A;  2DBN A;  4JGZ C;  4J1X A;  1HJF A;  5IHR A;  4Q1P A;  5FLJ A;  2VL4 A;  5BYN A;  2CYF A;  2JG9 A;  2W1U A;  2GSY A;  2JE8 A;  4RR3 C;  2BP6 A;  4KWL A;  3K48 A;  3C7F A;  2X5I A;  2HWC 2;  4K3U A;  4NRP A;  5BNQ A;  3JQW A;  2E53 A;  3B94 A;  3AYE A;  3EYP A;  5A1F A;  3ZSE A;  1JOB A;  4HPK A;  2BOJ A;  5J98 B;  1GR3 A;  4Z2W A;  2YBK A;  2ZML A;  1E57 A;  3T08 A;  4FPC A;  1AR6 1;  1V6O A;  1WME A;  3MFC A;  1F9K A;  3HD8 B;  4F8A A;  1KDK A;  3HN3 A;  2OS2 A;  3ZFE C;  1AYN 3;  1WZX A;  1RJ7 A;  4H3W A;  4HXC A;  4HBN A;  4NAO A;  4Q0S A;  2ZHL A;  2RR1 1;  1RC6 A;  2VME A;  1RUI 1;  2Q1F A;  5LY1 A;  4E27 A;  3BIW E;  2WS9 1;  2FBE A;  3GZE A;  2DVA A;  1W3V A;  3KVA A;  3NAP A;  4QD2 A;  2W95 A;  3WW4 A;  4A7Z A;  4Q29 A;  3HVD A;  2WYS A;  2J1R A;  2RM2 3;  5DMY A;  4M01 A;  3ZN6 B;  2XML A;  4QKN A;  5BNP A;  2E33 A;  3MF9 A;  3FL7 A;  3POW A;  3EJK A;  5KHH A;  1YC6 1;  4LKD A;  1KGY A;  4XZP A;  5IAV A;  1H9P A;  3QOP A;  3IAP A;  4ZXE A;  1T6G C;  1VIW B;  2F4P A;  4ISQ A;  4YYO A;  1WMD A;  3B9I A;  3NKG A;  3SH3 A;  1POV 3;  2W5F A;  1MQT A;  3TWI A;  3CBN A;  5E88 A;  1HRI 1;  1G9F A;  1NCQ A;  1XYP A;  1CZS A;  3LA3 A;  5FQ0 B;  2TEP A;  4Z92 B;  1DZR A;  5DDJ 2;  5DXD A;  1CPM A;  1LOG A;  3VKN A;  5HV0 A;  3C3V A;  4NVP A;  3LAG A;  5LW9 A;  4R9D A;  2E6V A;  2ZGM A;  5C8C A;  2JX9 A;  5FOB B;  2XJU A;  3ILR A;  3RYR A;  2WYF A;  4GAL A;  4M0H A;  5A32 B;  1W8N A;  3O0W A;  3MO4 A;  2CGP A;  1ONA A;  2RS5 2;  4WM7 C;  5LRR A;  1GU3 A;  1SLC A;  1XNT A;  1I3H A;  1E5H A;  2FHR A;  5JR7 B;  3PVO A;  2HWD 3;  3ZFF A;  1PGS A;  1JUH A;  2XLG A;  1PO2 2;  2YGL A;  4NII A;  2CGN A;  3WV6 A;  3G7D A;  1UO9 A;  2F17 A;  2I07 B;  4CSW A;  5DAV A;  1ODM A;  3IMN A;  4FTB A;  1J1L A;  3I59 B;  5FO9 B;  4H7L A;  2E32 A;  4P08 A;  1MS1 A;  2XBO 2;  5HBA A;  2ZZJ A;  3VZO A;  2D3P A;  1ENR A;  1F4A A;  4N7I A;  4QHB A;  2A71 A;  2JB8 A;  1W8U A;  4GH4 C;  5JUV A;  1ZRC A;  4KWK A;  5FYZ A;  3AVS A;  5ABJ B;  1V6L A;  1POQ A;  1Q5O A;  2HWD 1;  3I2I A;  3I2G A;  3KQ4 B;  4JAA A;  1I9R A;  3ZIX A;  5I8Y A;  3DYO A;  4F83 A;  4Q0Q A;  2YPD A;  4XUO A;  4E4Z A;  1Q56 A;  3G6J B;  2KR2 A;  4XFI A;  4NWV A;  2TNF A;  4QPG B;  1VBA 1;  2XR4 A;  5EJ3 A;  4AZZ A;  1UF2 C;  4QU2 A;  4WVM A;  5F3E A;  2DVF A;  2WS9 2;  2VW1 A;  2HJI A;  4M4P A;  2ZKL A;  1DYO A;  4IEX A;  4M3C B;  4NIH A;  3RRD A;  2WNV B;  2CNA A;  4I3P A;  1JN2 P;  2RE9 A;  3LDR A;  2VCB A;  2R6Q A;  4COW A;  4CCJ A;  2A73 B;  1MVE A;  1SHW B;  5AVA A;  4YW1 A;  3WG4 A;  3I54 A;  5KHK A;  3IB3 A;  1LOA A;  2CAV A;  3POE A;  5DUV A;  5EXO A;  2D3S A;  1C8M 2;  2DFB A;  3POF A;  3BGA A;  3K4A A;  3NVC A;  5I0S A;  1O6U A;  1RHI 1;  3ZXG A;  1UYY A;  2EXK A;  3DV8 A;  2PHU A;  3UGH A;  2AGS A;  4HVR A;  3WZ1 A;  5IK8 A;  4A6O A;  5HCH A;  2CY6 A;  1XRU A;  2DUR A;  2GMM A;  2Y6H A;  2Y38 A;  3VD4 A;  3RJR A;  2FCU A;  2OW4 A;  3BN6 A;  3CKH A;  2KXL A;  1W6M A;  1R1A 1;  4QPG C;  4AG4 A;  2XWB B;  3D82 A;  1LOB A;  5CZK A;  3DUI A;  4O9G A;  4H2A A;  5IAT A;  1ZRI A;  4EN7 B;  3AP9 A;  4LE4 A;  4EQV A;  4CEW C;  1IPK A;  4M00 A;  4AW7 A;  3DYP A;  1S1A A;  4FAH A;  3KS7 A;  4N8M A;  5FYH A;  2J7M A;  1M4W A;  2VZO A;  3SNM A;  3T2Q A;  3T0B A;  3D0J A;  4RHV 2;  5A6Q A;  4XCA A;  1UIJ A;  3LFI A;  4GJY A;  5JLV A;  2QZ2 A;  5M0T A;  5KXB A;  3AFG A;  3S0M A;  2W1W A;  3BU7 A;  4PDW A;  3RS6 A;  4WV8 A;  5A3U A;  2OVU A;  2RS1 2;  3VHP A;  2NPI A;  3S6P A;  2GAL A;  2V09 A;  4QU1 A;  2SBA A;  4AGV A;  2D6O X;  1HQN A;  3WHT A;  1XOY A;  1G9C A;  5JXG A;  3IPV B;  3BOP A;  4CP0 A;  4CP9 A;  2Y8K A;  5CIS A;  4RGA A;  2X5I B;  5FMB A;  4Q4W 1;  4CDX B;  1AXZ A;  2YU1 A;  4EZ4 A;  2G9G A;  1QU0 A;  4I09 A;  4CVU A;  5TSW A;  3K3N A;  1UPI A;  1CJD A;  1GWK A;  2PFW A;  2VCC A;  3WF1 A;  5KHG A;  5L7O C;  2FZ1 A;  5FLH A;  1K45 A;  4COZ A;  1BLZ A;  2PAM A;  2VZP A;  3N9M A;  1OOP A;  2W52 A;  2WQ4 A;  2VUD A;  4XIO A;  3VBH C;  2QQI A;  4YVS A;  1HB4 A;  2VY0 A;  2H6C A;  4MXW A;  2YPJ A;  1NA1 C;  5C33 A;  1W6P B;  2D98 A;  4AQ6 A;  4A3X A;  4QWN A;  3CHX A;  4UYB A;  1UY0 A;  2GME A;  1B35 A;  1QHD A;  2A6X A;  4FT8 A;  2VJX A;  4B1M A;  1NA1 B;  4LO7 A;  4NIA A;  4Z2A A;  2MPF A;  2BZD A;  2H0B A;  2R49 A;  5FBJ A;  5FY1 A;  5FR3 A;  5EHD A;  4LHL A;  3THP A;  4FOW A;  1AX0 A;  1PO1 3;  4RQP C;  3SCH A;  4NID A;  2ZAH A;  4MOA A;  5BNP B;  3KCY A;  2VVE A;  3CEW A;  3MI8 A;  2JKB A;  4CDW B;  1W9W A;  1D4M 3;  4Y22 B;  1QJF A;  2A6Z A;  1FYU A;  1VP6 A;  4YWA A;  4AFC A;  3UGG A;  4WZF A;  4P9J A;  4JCK A;  4OQ9 A;  2GC1 A;  5LBE A;  4CEY B;  5A3M A;  1YQ5 A;  1OLM E;  3DEM A;  4LMF A;  4JGY C;  4GJZ A;  1DQ1 A;  1NCQ B;  1ACC A;  4QB1 A;  1O91 A;  4LA2 A;  3M3E A;  4GQ7 A;  5FZ1 A;  1COV 2;  1KD7 A;  3FN9 A;  5T5L A;  4LUM A;  1J3P A;  1YIF A;  4FXK B;  5FZO B;  1GWL A;  2GH2 A;  3OGG A;  3HBK A;  3U78 A;  4BHP A;  4FPE A;  5FO7 B;  5C8C B;  2IZW A;  2WNU B;  5BNN C;  4QAW A;  1EV1 3;  2R32 A;  2UYA A;  3UES A;  2A3W A;  4PBO A;  1RMU 3;  1W39 A;  1VMJ A;  4MUV A;  1RUJ 1;  1CAV A;  1W8W A;  1F5F A;  5FY0 A;  3MLL A;  4FXG B;  1FPN 3;  2YGM A;  4KGG A;  5K0U C;  1HRI 2;  3N7M A;  4RD7 A;  3M8L A;  4XE9 A;  2XPJ A;  4IET A;  3LZZ A;  5FRE A;  3WNP A;  2BBV A;  2D7F A;  2VZQ A;  2WLQ A;  3HMY A;  2EIE A;  4V2V A;  1PIV 1;  2Z4F A;  2EAA A;  4AAP A;  3M3C A;  1BEV 1;  1GAN A;  1NE4 A;  1W3X A;  2B45 X;  4JKK A;  1NLQ A;  4BME A;  1QQP 2;  4J6G A;  2JG8 A;  1RHI 3;  2CWS A;  2ZGQ A;  1H8T A;  4YG0 A;  3VZN A;  4CDQ C;  1AL2 2;  1W8T A;  2BGO A;  5A7W B;  5A6Z A;  4DEQ A;  5A6X A;  2X09 A;  4Q4X 3;  3SCG A;  1DZT A;  4AK3 A;  1DU3 D;  2F4L A;  4KQ7 A;  4YG6 A;  3O1V A;  2VUL A;  2HWF 2;  4OI2 A;  5FPB A;  1CX4 A;  2RDQ A;  4WVZ A;  1SBF A;  1V6I A;  1OC1 A;  4QPG A;  4MZU A;  4BE3 A;  5KWR A;  3D5O A;  2L9L A;  2RR1 2;  3LSE A;  3MW3 A;  2Y60 A;  2WT1 A;  4YW3 A;  1AVB A;  1FPN 2;  2RV9 A;  4W50 A;  1ND3 A;  3APB A;  3S5A A;  1KDM A;  1W2T A;  1XU2 A;  4Y3O A;  3O12 A;  4E8D A;  2D6N A;  2B39 A;  3B5L B;  3HNY M;  1VBE 1;  4YVW A;  3KM5 A;  1CAX A;  4Y5S A;  1M06 G;  4K1Y A;  2JG9 C;  2PTM A;  4AOC A;  1UW8 A;  2BPA 2;  2O1Q A;  2P6C A;  4FO9 A;  5E6H A;  4CP2 A;  3NJY A;  1VBB 3;  1L7R A;  2LW8 A;  1FMD 1;  3POS A;  3ORJ A;  4XZU G;  2NLR A;  4AFM A;  3J7L A;  3I2F A;  3O5S A;  2HWB 1;  2JDZ A;  4FOV A;  4XCB A;  4PCR A;  4K7J A;  5LA9 A;  4FFI A;  3R05 A;  4CYD A;  3P5B A;  5FZ3 A;  2VBD A;  5LBC A;  2AEN A;  5GLZ A;  1BK1 A;  1UCX A;  4UAP A;  1S2K A;  3VV1 A;  2PYT A;  5JXI A;  4KG0 A;  4MET A;  1PM7 A;  4B29 A;  1SZB A;  1OA4 A;  2PAK A;  3E6B A;  3OPW A;  2WN2 A;  1TMF 3;  3ZXA C;  4UFI A;  5JI7 A;  1JZ3 A;  4I01 A;  1JMU B;  4QKF A;  4BIF A;  1Q8Q A;  4EN9 B;  4UFK A;  4DIQ A;  4K8F A;  4GIQ A;  4NRO A;  1D7P M;  5HXV A;  4IE4 A;  3O1M A;  3ES1 A;  1ULP A;  4UFJ A;  5FP9 A;  1YJK A;  1HW5 A;  5T5P A;  3AYC A;  1DLC A;  1VB4 A;  3NNG A;  3PMS A;  2VMF A;  2V5D A;  2QQW A;  4N53 C;  1UXX X;  2VNO A;  3LQC A;  2ADE A;  5I91 A;  3ZXJ A;  4BQ2 A;  3WP6 A;  3DEC A;  3K46 A;  4CDX A;  1NLS A;  4LBM A;  4NPM A;  2Q8C A;  5T50 A;  4AHW A;  1OVS A;  2VU9 A;  4MHU A;  2BBA A;  1NOV A;  2VG9 A;  3GCW A;  4FQ4 A;  4Z07 A;  1E5S A;  4JKL A;  4DRR A;  4N9H A;  4XAE A;  4P9W A;  3CJI C;  3JB8 A;  4QDR A;  1WBF A;  3I2O A;  1LGB A;  3B00 A;  1OOP B;  4BIS A;  1I6X A;  1UZY A;  1F35 A;  3W58 A;  1F2N A;  2WO2 A;  4YZ1 A;  3ABZ A;  1UL9 A;  3OYW B;  1K5M C;  1UU4 A;  3ZFF C;  2HWB 2;  4IE7 A;  2HWC 1;  5FJH A;  4CPB D;  4N90 A;  2VQU A;  2XJR A;  3UKN A;  5C9A A;  3OBZ A;  1Y9G A;  1W28 A;  1TQ5 A;  1AR6 3;  4LNV A;  4C90 A;  1N1S A;  4S2F A;  1XE8 A;  3H0O A;  4E9K A;  5F9T A;  1IPJ A;  3POG A;  5DUU A;  5GAL A;  1XNA A;  5IAX A;  2A6V A;  3J8F 2;  2VTX J;  4PLO A;  4I02 A;  4AFA A;  3KF3 A;  1RUE 3;  2WN3 A;  1HXS 3;  1POV 0;  2E9Q A;  4FI9 A;  4FOQ A;  3JB4 C;  3LE0 A;  1WD3 A;  1ULD A;  1ZYB A;  2CWM A;  2WR9 A;  4NO4 A;  2HWF 1;  1PMJ X;  2OZJ A;  4PQ9 A;  5F2W A;  2WZP P;  4O61 A;  3WUD A;  3POI A;  4Y24 A;  3K75 B;  5I0R A;  5F39 A;  3D6E A;  1J59 A;  2VW0 A;  2Y34 A;  2IXI A;  1AL2 1;  3NO8 A;  5FMO L;  5FRA A;  5GKA C;  3KLS A;  2V73 A;  3WNL A;  3E6D A;  1UZZ A;  4V1P A;  4FBF A;  3E5X A;  4BPZ A;  3WNO A;  2BNM A;  4YM0 A;  5FPV A;  1W8Z A;  2D43 A;  3S7I A;  2YC2 A;  2JDN A;  3GF6 A;  5AC9 1;  1IOA A;  5FQ0 A;  1PGW 1;  1G9B A;  3HEI A;  1JZ7 A;  1L7L A;  3N35 A;  3SKV A;  1ND2 C;  1NUK A;  5F5I A;  4BYY A;  4YPJ A;  1LUL A;  1GFF 2;  3LB9 A;  3GHM A;  1BK0 A;  2YU2 A;  4JRA A;  3WP3 A;  2ZS6 B;  1RUG 3;  5BXX A;  1RIT A;  2HWC 3;  4GH4 B;  2XL7 A;  1JHJ A;  1HRV 3;  3WDY A;  4BLJ A;  3J7N A;  4JHZ A;  3AZW A;  3PU3 A;  3MGU A;  3GJA A;  1FV3 A;  5ANN A;  4BU2 A;  4D6S A;  5FYC A;  5FK8 A;  3W20 A;  5IK5 A;  3VD3 A;  4L11 A;  5HXM A;  1OFN A;  4YW6 A;  4Z8B A;  3O7O A;  2ET1 A;  3I59 A;  3WDV A;  2VZU A;  5IVF A;  1S0I A;  3VBR C;  1TE1 B;  3LIG A;  3Q8A A;  4FPK A;  2XBO 1;  4YM1 A;  2MEV 2;  4CU8 A;  3ZYH A;  3HQX A;  5LA0 A;  1WCQ A;  1SFN A;  3KVB A;  2EIG A;  1TMF 1;  3LA2 A;  1JTZ X;  2OXB A;  3ATG A;  5J7M A;  3T2T A;  3RNS A;  1OFS A;  4N7U A;  1RIN A;  2WA3 A;  3ACL A;  3VBU A;  3V0A A;  3NV4 A;  1SLL A;  1IS5 A;  2NMN A;  5I0U A;  4CDU A;  5J09 A;  1S2B A;  4DS0 A;  2H0V A;  2ZCW A;  3H9A A;  3KV9 A;  4MGQ A;  1H30 A;  4OUM A;  2VOX A;  1ST8 A;  1NZI A;  2PLV 3;  2YXS A;  5FY5 A;  5I93 A;  4LT5 A;  1UPS A;  4NJ4 A;  3RFR A;  4QKD A;  3P6B A;  4HON A;  2IWG B;  4D6Q A;  2XG3 A;  3ME2 A;  3PU8 A;  3TEY A;  3ITQ A;  1GQH A;  4IE6 A;  3ETP A;  1SCR A;  2JDH A;  1CGP A;  4XAA A;  1IG3 A;  5LY2 A;  4LBK A;  4RYD A;  3ZDV A;  4XJ9 A;  2R04 3;  1H8V A;  2VMG A;  3CZJ A;  2ZOE B;  3SQO A;  3WD5 A;  3GHN A;  2HYX A;  4HLT A;  3NWK A;  4EN8 B;  1EAH 3;  1VAK A;  3DPR C;  3EXU A;  2CSG A;  2Y33 A;  1VBE 3;  2LRP A;  4K8R B;  1J83 A;  2UYB A;  4ITC A;  1E5R A;  3CDZ B;  3E5Q A;  2R1B A;  2DCZ A;  3H50 A;  4LKS A;  4MVT A;  2Q0A A;  3WDX A;  3U37 A;  4NPL A;  4CCN A;  1QOO A;  1SLI A;  1AXK A;  5JAX A;  5T3N A;  3LEM A;  3RZM A;  4MGZ E;  3S5Q A;  3AMQ A;  4XMI A;  3OUJ A;  3W5M A;  3C7O A;  2RM2 2;  1AJO A;  3N7L A;  3WW3 A;  3P3P A;  4FCA A;  3ILF A;  1SEF A;  4BJ0 A;  4OMC A;  3AMH A;  1RUI 3;  2K46 A;  3MIE A;  4QQO A;  1YUD A;  2IUW A;  1PZ7 A;  3J8F 1;  2VAU A;  3INA A;  1QJU 1;  1LOF A;  2AC1 A;  3ZIW A;  3USU A;  2WAO A;  1CQ9 A;  1WCS A;  1R1A 2;  2EXJ A;  4LEJ A;  5LBB A;  1A34 A;  1NCR B;  3AL6 A;  4XIK A;  4DQA A;  3MBW A;  1Y9Q A;  3FLR A;  4F7Z A;  1UYX A;  2JE7 A;  1AXY A;  2P3I A;  4DRV A;  2KA3 A;  1IKQ A;  1PK6 B;  1VLN A;  1C4R A;  1RYY A;  2DWR A;  3SKJ E;  3ZN4 A;  1EY2 A;  4IEY A;  4NHY A;  4TWT A;  2P5B A;  3I7D A;  2VVF A;  5CVR A;  5CFC A;  4YGB A;  3TEX A;  3RZL A;  2WC2 A;  2NN8 A;  2BW8 A;  2UWC A;  5C9A B;  4QX8 A;  3WT3 A;  3ACI A;  3VHR A;  1BMV 1;  1KS4 A;  1ZBA 2;  2VXR A;  1CAU A;  4AGG A;  5CFD B;  1PGW 2;  5BV6 A;  2YMZ A;  3E97 A;  4QPY A;  2D40 A;  4HET A;  5D8A C;  1HQL A;  2FDG A;  1DGR A;  5FWE A;  2NQY A;  4L97 A;  3ZO0 B;  3E6C C;  2VNG A;  4XTP A;  1R09 1;  2VD7 A;  1JBC A;  2XKO A;  4XUR A;  5K9Y A;  1LHN A;  5L73 A;  4E2G A;  5K4L A;  3GGL A;  4RGK A;  4Y22 A;  1BBT 2;  4W4Z A;  5FO8 B;  4FFF A;  3ZFE A;  3HN1 A;  4ZON A;  3ACH A;  2CGO A;  3CNA A;  3KHB A;  5FZ9 A;  5HPO A;  4CEY A;  5K7P A;  5A33 A;  4MLO A;  2YHJ A;  2CHH A;  4QDS A;  1C3H A;  2BRT A;  4L2N A;  4EV0 A;  1GP4 A;  3KCX A;  4FPF A;  3QAC A;  3AKT A;  5ERL A;  1OMI A;  1GOF A;  1LHO A;  1R08 1;  5IK7 A;  4XEZ A;  1QY4 A;  1UY1 A;  4LKF A;  2G19 A;  1QJX 3;  4BK4 A;  4D7Y A;  5A7O A;  2YUE A;  4KGQ A;  3K4Z A;  1UOB A;  5G04 L;  1ZX5 A;  4LIV A;  3U4S A;  2XJS A;  4DXT A;  2BNO A;  2J1E A;  1WLT A;  1A3K A;  1QF3 A;  3C7G A;  1YQC A;  3NMB A;  4E8C A;  4YW7 A;  3NNL A;  4WBB A;  1ASJ 2;  2HWE 3;  2ARB A;  3VB9 A;  4ZS3 A;  4RA0 A;  5FYV A;  3OCP A;  5K0U A;  1Y4W A;  1MZ6 A;  4QT6 A;  5DN2 A;  2BWC A;  5E1R A;  1SLT A;  1KXG A;  3J4U H;  2XVL A;  4A2U A;  1FMD 2;  1MR5 A;  4CCE A;  1X7N A;  3BAL A;  3B7M A;  3MPB A;  3KT7 A;  2YBS A;  3FFZ A;  4Q26 A;  3WW1 A;  2XWJ B;  2WZR 1;  2HKX A;  1JHN A;  2QCS B;  4XUT A;  3VDD C;  2P4E A;  2C4X A;  4Y1V A;  2B4K A;  5FYB A;  1ZA4 A;  4F3J A;  2VO5 A;  3I2J A;  1OUR A;  2FMY A;  3FWE A;  1F15 A;  3AZZ A;  1KJR A;  1DFQ A;  2P34 A;  2VW2 A;  4JV4 A;  3IDC B;  4WM7 B;  2BFU S;  3BTY A;  2MHF A;  4OFG A;  1RUN A;  5JR2 A;  3K51 A;  2RJK A;  3SEE A;  3FJS A;  4XFG A;  1NXM A;  3WDU A;  1C28 A;  2IXJ A;  3TN9 1;  4KI5 M;  3WSO A;  3AP5 A;  1AX1 A;  1Q8S A;  1ND3 B;  4JC1 A;  3PLQ A;  3ZYJ B;  3PL0 A;  5A7Q A;  4CCD A;  2DU1 A;  1GQP A;  4PLM A;  5FZD A;  2E51 A;  2A70 A;  5KC6 A;  4X8N A;  1RUI 2;  1VE0 A;  5LRS A;  1TZO A;  5EJ1 B;  3GZU C;  2WLP A;  4DMI A;  2A75 A;  2HWD 2;  4I3G A;  1WW6 A;  4MGK E;  1Z7S 1;  2VUA A;  1PO2 3;  2PAE A;  1AR8 1;  3T0D A;  4NHL A;  2JIJ A;  2Q8E A;  5CA6 A;  1VBD 3;  2DCJ A;  2WZ8 A;  4YVS C;  1TNF A;  4OHZ A;  1HLC A;  1DYK A;  1H2M A;  2YV8 A;  1PNF A;  2ZGR A;  4Q0P A;  1X9T A;  3VBO A;  1MS0 A;  4CE8 A;  3WIN E;  4AVA A;  3POJ A;  4XQ4 A;  4ES8 A;  3H1W A;  2AH2 A;  1HRI 3;  4CCC A;  1G9A A;  3DKQ A;  1H6Y A;  2P1B A;  2ZAB A;  5FPL A;  1C5H A;  3WVJ A;  4AFD A;  5EPA A;  2Q8D A;  1NAE A;  1PGL 1;  4QPI C;  4XDO A;  3WNN A;  2RS5 1;  4HK9 A;  5CIR A;  5FZ4 A;  1W06 A;  3NNM A;  1QGL A;  3BPS A;  1NQD A;  4GUL A;  4XOG A;  1FNY A;  4KG8 A;  1BEV 3;  3WNX A;  4FSJ A;  1GMM A;  5IWF A;  3ZN5 A;  3O1S A;  2WNO A;  1J3R A;  2CTV A;  5IVC A;  2RM2 1;  1XJA A;  2C9A A;  4G9S B;  4HOO A;  5JPM B;  1QMJ A;  2HH9 A;  3H8X A;  1IQA A;  1CAW B;  2VH9 A;  5T5O A;  4WVW A;  3RGB A;  4IEQ A;  3P3N A;  3WCR A;  1Z78 A;  1C5I A;  2DTW A;  3MIH A;  4OZO A;  2P3J A;  4BB3 A;  1OD5 A;  4HMZ A;  3I3D A;  1LES A;  5FIX A;  5FY7 A;  2QUO A;  1XSR A;  2Y6J A;  1PX4 A;  4LHS A;  2K2S A;  5BNN A;  1JYI A;  3M1H A;  3NL1 A;  1S55 A;  1QEX A;  5FXX A;  4IEO A;  4PDW C;  3RDI A;  1SAC A;  3H1Y A;  1W9F A;  1Y43 B;  3R4S A;  2HBT A;  4IE5 A;  2XUM A;  2EF6 A;  3H3Z A;  1O4T A;  3RZK A;  1VBB 2;  3GNE A;  3T09 A;  4CUC A;  1QJX 2;  4RS5 C;  5H9R A;  1VBB 1;  1SPP B;  3ELN A;  3ZYR A;  4R4Z A;  5CYY A;  1U5Z A;  1N47 A;  3ZKY A;  4DOU A;  4WM8 B;  4Y4Y A;  5CFD A;  3BI3 A;  5B2G B;  2ZGO A;  1VMF A;  4LBJ A;  3PHM A;  3ZVX A;  4ASL A;  2HEY F;  1A6C A;  4XXP A;  2H6B A;  1C8N A;  1YIP A;  2A6W A;  2WA4 A;  5A7S A;  1Z0H A;  1VBD 1;  1NY7 2;  3KT1 A;  4A7Y A;  4PJY A;  1N3O A;  2FQP A;  3ZSL A;  5J36 A;  4MXW B;  3ZXK A;  5BNP C;  2O0O A;  3OD4 A;  3I3Q A;  3FUQ A;  1B35 C;  1PNG A;  3J9S A;  4RL7 A;  4XFH A;  1K12 A;  3ALQ A;  2NM1 A;  3I3M A;  1Q3E A;  4HL0 A;  1NA1 A;  2WBK A;  3OTF A;  1LOF C;  3OBT A;  3THC A;  4QGM A;  3WR0 A;  1PM4 A;  3B02 A;  1Q8O A;  2TBV A;  1XNC A;  4A4A A;  1IS6 A;  5A33 B;  1JUI A;  3VLB B;  2EIB A;  4GMP 0;  4TSV A;  4DUW A;  3HJR A;  3U4X A;  1JXN A;  2XOM A;  3ACF A;  1JOJ A;  4LK7 A;  4XC9 A;  4QGN A;  3WDT A;  1UU6 A;  3VBR A;  2VBP A;  3U11 A;  5JOX A;  1HIX A;  1RVF 3;  4AI8 A;  1KJL A;  2W08 A;  4YGC A;  2B9U A;  1DGR N;  2HBU A;  3QLQ A;  4QX3 A;  3ZN6 A;  1R1Z A;  5J37 A;  3HQR A;  4L9B A;  1ULE A;  4FFG A;  1O3S A;  3NST A;  4GMP 3;  4LBO A;  2D6L X;  1HXS 1;  3HOB A;  2J1U A;  4JQR A;  4NMI A;  3RWN A;  1JYV A;  3K4D A;  1MQT B;  4GAZ A;  5JI9 A;  1HB3 A;  1OI6 A;  3UL2 A;  4EWD A;  1W6N A;  4GH4 A;  4NR1 A;  1QJZ A;  3PNA A;  4QMA A;  5F37 A;  1GOH A;  1O8S A;  4AI9 A;  1VBD 2;  4QXB A;  3LEK A;  4Y33 A;  5EFU A;  5LZ6 A;  5CG8 A;  3LDK A;  4Q4W 2;  1V9U 1;  3BTA A;  2NMO A;  3EO6 A;  1PVC 1;  2VZV A;  4DUX A;  2RDR A;  3I2D A;  5A70 A;  5I8S A;  4ISR A;  4NE9 A;  1RVF 2;  5F2S A;  3VZK A;  4AVS A;  4N43 B;  1W0P A;  1WLW A;  1QJX 1;  2KM2 A;  1AYM 3;  2ZAA A;  3A4U A;  1XYO A;  3CZU A;  3LD8 A;  3BIE A;  2WL1 A;  2ZX3 A;  4XUQ A;  3VHO A;  1DYP A;  4BDV B;  1RUE 2;  3AXE A;  1DCS A;  4ARX A;  1SDW A;  3KCC A;  2AUY A;  2GMP A;  3IKW A;  4CDQ A;  1QJY 2;  1DDL A;  2GC0 A;  1EPZ A;  5LAS A;  5FZB A;  3VBU B;  2R0F A;  3NNJ A;  4MH0 E;  3V0A B;  5GZC A;  1KFU L;  2I45 A;  4FPH A;  1EAH 1;  1DIW A;  5DQ0 A;  1EP0 A;  2P6H A;  3AZY A;  4XDQ A;  1G86 A;  4LQR A;  3U10 A;  5LEK A;  3WY6 A;  5IVB A;  1TVG A;  5FAX A;  1H1M A;  3FZ3 A;  4R9A A;  1S0J A;  5HCB A;  1LEM A;  2VNV A;  1AYM 2;  4Q27 A;  4W8J A;  2YDE A;  1T6B X;  1ZBE 1;  2YG0 A;  2ZJC A;  1JI6 A;  1GLH A;  4WVM B;  3M70 A;  2DF7 A;  2VQT A;  5D8A B;  2P37 A;  2OPW A;  4D6R A;  2QVS B;  3ZYP A;  3T0A A;  1PGL 2;  1HRV 2;  3KZ4 C;  5FY4 A;  5D21 A;  3TOJ A;  1CON A;  1GNH A;  4YGE A;  1GZW A;  2J1T A;  3UKV A;  2YZ4 A;  1DQ5 A;  1CZV A;  3DPR A;  3VN4 A;  4CU9 A;  1RED A;  4EJR A;  1G9D A;  4AEK A;  4XF0 A;  4HVQ A;  1RVF 1;  4FVV A;  4OMD A;  4Q4V 1;  1N1T A;  3S57 A;  3VBS A;  2C1F A;  1YNA A;  1RUH 1;  2BOI A;  4WM8 C;  5H9P A;  3C2U A;  4KU8 A;  5A6Y A;  1VJ2 A;  3DXU A;  4QQP A;  1DF0 A;  2XDV A;  1CAW A;  1Q43 A;  1YFW A;  4YW5 A;  2NP0 A;  1APN A;  4JDO A;  3AX4 A;  2RMU 1;  2QQN A;  3HT1 A;  4XJW A;  3LIH A;  4YZ3 A;  4Y1U A;  3J8F 3;  5FLI A;  5KXC A;  4IE0 A;  4CPB A;  2O8O A;  1DP0 A;  1REE A;  4AWD A;  4CU6 A;  3ACG A;  2RVA A;  2ZXQ A;  5DUX A;  1GZC A;  5C4W B;  4CZS A;  2ZMK A;  1QQP 1;  5DZG A;  4Y1X A;  4LBQ D;  1J3Q A;  4TYS A;  3BOD A;  2AAC A;  2Z42 A;  1EYB A;  3JCI A;  4G4F A;  3VD5 A;  4E2S A;  1NCR A;  1PO2 1;  3BTZ A;  1HQW A;  3H7J A;  1OHF A;  1AR6 2;  2PHX A;  1H4H A;  3U1X A;  2JB4 A;  2QDR A;  4LJH A;  2JIG A;  1OKQ A;  4P9X A;  1JU3 A;  3VL8 A;  3GBG A;  2GN3 A;  2WKK A;  4XF9 A;  1HV0 A;  1LHU A;  1NE6 A;  4KBB A;  4KL1 A;  1RIR A;  4CXW A;  2DFC A;  2XH6 A;  3H8U A;  3ZSM A;  4DB5 A;  1JH5 A;  1O4Z A;  2R06 3;  3JBG 1;  5F3G A;  1HN0 A;  2VOT A;  2F6B A;  4ZY9 A;  3RJ2 X;  2WFF 2;  3JBG 2;  5AC9 3;  3KHC A;  2RDS A;  1CAU B;  1FX5 A;  1AL0 G;  2D5H A;  4Q4V 3;  4FP3 A;  2RS3 3;  1QNY A;  5LK5 A;  5HCA A;  5DG2 A;  1SDD B;  1US3 A;  1ASJ 1;  2Q1M A;  1UY3 A;  1NG0 A;  4QM8 A;  1FPN 1;  1JOP A;  5C3S A;  4YVS B;  4A41 A;  2ZEY A;  3TN9 3;  2QQV A;  3BB6 A;  2DV9 A;  1W6P A;  1YI9 A;  4NOT A;  5LK7 B;  1YRZ A;  4FTE A;  4AEJ A;  4LKE A;  4XVH A;  3RZG A;  3QBQ A;  5GZG A;  5I0D A;  2XLA A;  5HCF A;  5LA1 A;  2VGD A;  3B69 A;  4XJU A;  3GM8 A;  2VMI A;  1S0E A;  3ENR A;  3O0X A;  4CDW A;  1O3T A;  4JVA A;  3FHA A;  2JD4 A;  4AFB A;  2NYY A;  4SBV A;  4IXL A;  1J84 A;  2LRO A;  2QQK A;  3NJV A;  2ES3 A;  2R30 A;  3KF5 A;  3VBH B;  1R1A 3;  1IHM A;  4X8P A;  1YFU A;  3D4K A;  2XKP A;  1QOS A;  3WG1 A;  3ZYG A;  1ZZC A;  1W6N B;  1TNR A;  5JCT A;  3B9C A;  1R09 2;  1ZM1 A;  4K21 A;  4DXZ A;  4YW2 A;  1ZZB A;  4B1L A;  3FHI B;  3O1P A;  1ENX A;  4QX7 A;  3WQB A;  5F8P A;  4O9E A;  3N36 A;  1HRV 1;  2BVB A;  4D3W A;  3GBF A;  4R8H A;  4DIN B;  4MGS A;  3VD9 A;  2R04 2;  1ZBA 1;  1W2O A;  2OQ7 A;  2DTY A;  2OZ6 A;  4BIO A;  1PHM A;  2D97 A;  4PI2 A;  4Q2F A;  3SH4 A;  4IEW A;  4W65 A;  2XUE A;  1QIQ A;  3TNP B;  5C3R A;  1P8J A;  4XYX A;  1CPN A;  3OPZ A;  3VBS C;  4FPL A;  5FP7 A;  1MS3 A;  2R07 1;  1MEC 1;  2VXJ A;  5JVV A;  1NLR A;  2PLV 2;  1AYN 2;  4RHV 1;  4IDZ A;  1OF3 A;  1VBE 2;  1Y7B A;  2XQX A;  5DAQ A;  4CA9 A;  4LBQ B;  2JWP A;  3ZXE A;  1LNS A;  4JQT A;  1O3Q A;  1W2A X;  4UFM A;  3RZJ A;  1JZ4 A;  2GP5 A;  4UBG A;  4NHM A;  3PUA A;  3KT4 A;  1JOD A;  1OBN A;  4M0N A;  2CDP A;  4S2G A;  1PVC 3;  4LO6 B;  3IN9 A;  5LA2 A;  5IT6 A;  3MEP A;  2Y0I A;  2WT0 A;  4XJA A;  2WZR 3;  5C71 A;  2WQZ C;  1QWR A;  2XGX A;  3EHK A;  5C4W C;  5DAB A;  3ZR5 A;  1PMH X;  1W8H A;  2D3R A;  3SEP A;  1I1E A;  1RUE 1;  2UWB A;  3DF0 A;  2BGP A;  1OSG A;  2XHK A;  2VMH A;  2XVK A;  3CJX A;  4L99 A;  1K3I A;  4K9S A;  3VD7 A;  4AQ2 A;  2WSV A;  5FYM A;  5DAW A;  4MGT A;  3TYJ A;  4GB3 1;  2BQP A;  5FV3 A;  5JXH A;  5ACA 2;  4GXL A;  4NUB A;  4QQH A;  3AFK A;  3ZYB A;  5L9V A;  1K5J A;  5FZK A;  4FP2 A;  4W6W A;  4HG6 B;  1CIW A;  3I97 A;  3AVR A;  4OI4 A;  1F8V A;  5IVV A;  5JZG C;  4JZR A;  4RHV 3;  5GLT A;  1KS5 A;  5IK4 A;  5IFT A;  4ZU5 A;  4CEY C;  4ZXK A;  5GLV A;  2WZR 2;  1FI2 A;  2XL9 A;  3WG2 A;  1WCK A;  3JBG 3;  4OI1 A;  4AR2 A;  2YRO A;  1STM A;  2P3Y A;  1W99 A;  1I5Z A;  1OLR A;  3OB8 A;  4Q4V 2;  1H8T C;  3W21 A;  2R1D A;  2SLI A;  5LAT A;  4A3Z A;  1YCI A;  5SV8 A;  2VMD A;  2ZX0 A;  3W59 A;  4ZZ8 A;  5A1A A;  1UD1 A;  4H7M A;  3AP7 A;  3MF6 A;  3PVE A;  2XQR A;  4UT5 A;  2VOK A;  1WA6 X;  5CNA A;  4MHR A;  5F1R A;  1X33 A;  2DUO A;  4N53 B;  4IND A;  1YYN A;  4UOJ A;  3LF7 A;  1UN1 A;  4FOY A;  4UXA A;  4K1Z A;  3CQO A;  3R0R A;  4YZ4 A;  3WEZ A;  3OGV A;  5A3P A;  1SMV A;  1DQ4 A;  1N1Y A;  3CJI A;  4HZF A;  4ZPI A;  5JZG A;  3KD4 A;  3OUI A;  1RUC 3;  4HVO A;  1G8W A;  4NN0 A;  1OT5 A;  1XU1 A;  4BQ4 A;  4CDQ B;  3IZO A;  3WF0 A;  4EWA A;  4HN1 A;  5DG1 A;  1K5M B;  2J22 A;  4LE3 A;  3USU B;  1EAH 2;  3EB7 A;  3AKR A;  3IT8 A;  4GB3 3;  4MXV A;  5EQU A;  4BZ4 A;  2R04 1;  4EZH A;  1L3J A;  1UYZ A;  1OXC A;  3MPP G;  2IVJ A;  3OUH A;  1Y9M A;  3V65 A;  1AR9 1;  1EV1 1;  1PK6 A;  5C6C A;  2PHW A;  5F6K A;  5JSR A;  2QQL A;  1IKP A;  2DUQ A;  5CFC B;  1YQ8 A;  1UOF A;  3MID A;  4R9C A;  5LBF A;  4NWW A;  3ZPY A;  3UYJ A;  1HJG A;  3J7M A;  3O1O A;  2K9Z A;  1X36 A;  3HNM A;  1XNB A;  1ND2 A;  1EUU A;  3AYA A;  1WW5 A;  3OYW A;  3EBR A;  4JDN A;  4K20 A;  2WNE A;  3AC0 A;  1GIC A;  1Z7S 2;  1ZBE 3;  1S0C A;  3IDB B;  1REF A;  4P5H A;  4YZ5 A;  4XQW A;  5CG9 A;  1LRH A;  5CKM A;  3JD7 2;  3WF4 A;  3Q8F A;  2GNM A;  4BQ3 A;  3ZFG B;  3NJX A;  3H7Y A;  4QX5 A;  3RVH A;  2W1S A;  3ILN A;  1B09 A;  1U0A A;  1MQT C;  4NIG A;  1VBC 2;  4UBH A;  2ERF A;  4HSJ A;  2HWE 1;  5FYU A;  1ULG A;  3TBD A;  2ARX A;  2XBO 3;  5BNO A;  3WHU A;  3WF3 A;  1NQJ A;  3IWZ A;  5H9Q A;  3A23 A;  3ON7 A;  2VZ3 A;  4LLO A;  4MYE A;  4C0B A;  2VUJ A;  3LPF A;  2UY9 A;  3ECQ A;  3S30 A;  4AVB A;  3WW2 A;  2EVX A;  3ES4 A;  1DQ0 A;  3MLK A;  1V6K A;  2Q8O A;  3VDD B;  2MEV 1;  4CEW B;  2VPV A;  2Y6L A;  1QQP 3;  1BXH A;  2RDN A;  3S7E A;  5F32 A;  2HYK A;  3HWJ A;  4BXF A;  2W68 A;  1PIV 3;  1Z7S 3;  2X05 A;  3I3E A;  4MGY E;  1OKO A;  2WS9 3;  4LK6 A;  1V0A A;  2GAU A;  3FX3 A;  5IW0 A;  4CP1 A;  2OA2 A;  1CD3 G;  5A3N A;  2OPK A;  5ACA 3;  4XBN A;  1RXF A;  2IXH A;  3OPT A;  5LWB A;  2A3X A;  5GLU A;  4HKL A;  1OQ1 A;  4UI9 L;  1W03 A;  3ROU A;  5C9A C;  4N43 A;  2VC9 A;  3MDP A;  5J48 A;  3KB5 A;  2BUK A;  5CBL A;  1LR5 A;  2KD7 A;  1LHV A;  2VVD A;  3LEI A;  4J25 A;  4LBQ A;  3WNM A;  5L36 A;  2Q30 A;  4COU A;  3AL5 A;  1E5I A;  4QKB A;  3SIS A;  4DEV A;  1AHS A;  4RS5 A;  5FZE A;  1UOJ A;  1XE7 A;  2W87 A;  1VAM A;  4GD4 A;  1VRB A;  4IV1 A;  4X6Q B;  1PO1 2;  2VZS A;  1JYW A;  3I4I A;  1UQX A;  1NCR C;  2IC1 A;  1FOD 2;  4TXW A;  3VBF A;  5IUQ A;  1SFY A;  2XJQ A;  4WM7 A;  3NW4 A;  4OLL A;  4XJ8 A;  2DU0 A;  2ZGP A;  3K2O A;  5IVY A;  1D4M 2;  1C57 A;  3AB0 A;  2DDU A;  2XXZ A;  3KQR A;  2JKX A;  2HWE 2;  3FMG A;  5CU1 A;  2RMU 2;  5FTT C;  5GJ6 A;  2WFP A;  4IV3 B;  4UW3 A;  5EYX A;  2R07 3;  4AL9 A;  1UKG A;  3B3Q E;  1RUH 2;  2X29 A;  4LO4 B;  1GNY A;  5FZ8 A;  3CLP A;  3A21 A;  4L92 A;  1UMI A;  4AAX A;  4XMA A;  3FHQ A;  5G05 L;  4S2H A;  3DGT A;  2EIC A;  1YEW A;  3T1L A;  1POV 1;  5D8A A;  1RUF 2;  4QPW A;  3U07 A;  3W9A A;  5EJZ B;  4BLI A;  5APA A;  4V2W A;  4DPN A;  2FDK A;  4M3C E;  4E4S A;  1RXG A;  4KWJ A;  2OUH A;  3T30 A;  2ARA A;  1XPW A;  1ULO A;  1GZW B;  4NRQ A;  4XIL A;  5FZA A;  1PVX A;  2VZ1 A;  4XW3 A;  5BPX A;  1SBE A;  2J42 A;  3Q8C A;  5HV4 A;  1A78 A;  4QXH A;  3IIA A;  5CEH A;  1O4Y A;  2O14 A;  4Y4R A;  2QFE A;  3VBS B;  3MHZ A;  5D1I A;  5FWJ A;  1KIT A;  1JYC A;  4GZ9 A;  2EA7 A;  2BU9 A;  3DKW A;  4CU7 A;  1YO8 A;  3LKJ A;  3MLJ A;  5E16 A;  4IEU A;  2JE9 A;  5L9B A;  2ZGL A;  3NV1 A;  3DYM A;  2CAU A;  3III A;  3PTY A;  2C9K A;  3WP5 A;  4E4H A;  3CO2 A;  4XFA A;  4XF3 A;  5FYT A;  3RSJ A;  1LOC A;  2JDA A;  5FDB A;  2O8Q A;  4Q4X 2;  4YAR A;  1TME 1;  1BHG A;  5FY8 A;  4A44 A;  1QJY 3;  2PN5 A;  4DY3 A;  3MUY 1;  4A45 A;  5DAP A;  3M3O A;  1OF4 A;  1VBC 3;  4Y26 A;  5FYI A;  3JUU A;  3SXW A;  4JDM A;  5KBF A;  1K5M A;  2ZGU A;  3FE5 A;  1N1V A;  4GKX A;  2D6P A;  1V6M A;  1UY4 A;  2OII A;  2WWU A;  1GKB A;  1ND3 C;  4GKY A;  2QE3 A;  1S0F A;  2I2S A;  2ZZQ A;  5F3C A;  4P14 A;  1OH3 A;  1W05 A;  1C1F A;  3OJB A;  4HKW A;  4LIT A;  5GZD A;  4EYU A;  1KFX L;  3LWC A;  4QXC A;  4LBN A;  3AKQ A;  4C0H A;  2A1X A;  1BEV 2;  3M2M A;  3KWV A;  2W39 A;  4UFL A;  4XHX A;  4BCU A;  5A3O A;  4B4Q A;  3HT2 A;  5J96 B;  2QBX A;  4LO8 A;  1SPP A;  3I3B A;  1YLL A;  5KXD A;  2GZW A;  2LS6 A;  2YYO A;  1Y3T A;  1NKG A;  2GNB A;  2PHT A;  2RS1 1;  4HPK B;  2IXK A;  1MPX A;  5CAD A;  1WD4 A;  2JEN A;  4UF0 B;  1BVV A;  4PIY A;  3A22 A;  4XXA A;  3A0N A;  3THT A;  2FDH A;  3AZX A;  4D8M A;  4QGL A;  1H2L A;  1UU5 A;  1Q8V A;  4PLN A;  1O59 A;  5C4W A;  3V64 A;  4I30 A;  1BQP A;  1MZF A;  2V72 A;  4CCO A;  1VBA 3;  2ZGN A;  4QQL A;  2RS1 3;  2W92 A;  3NAP B;  4URT A;  1U5X A;  4W6X A;  5I0T A;  2OT7 A;  1ODN A;  1UZV A;  1W8F A;  1UIK A;  2C26 A;  2Y6F A;  4NHK A;  4QHO A;  3TAY A;  1MS4 A;  1U12 A;  2VQA A;  3T3Y A;  2VCA A;  2G4I A;  4B7E A;  2ID4 A;  5CKQ A;  3RMY A;  2JD9 A;  3LA7 A;  3ZFE B;  2RG4 A;  2WWS A;  5GM0 A;  3VBR B;  1N3P A;  2JXA A;  4ONU A;  3VBH A;  1TEI A;  4BOW A;  4OHY A;  1SLB A;  4U2A A;  3FC0 A;  4AXO A;  2WT2 A;  1D2S A;  1GWM A;  3OEA A;  3QCW A;  3M7A A;  4Q0V A;  3SLI A;  4YVW C;  3MV0 1;  2OYZ A;  3C7E A;  2ENR A;  3L2Y A;  4IV3 C;  4LLF A;  3JXS A;  1S0B A;  2R06 2;  5FKC A;  3RI8 A;  3AP4 A;  1OLQ A;  3WNK A;  3CU7 A;  5JPN B;  1OUX A;  2WFF 3;  4A7K A;  4IL7 A;  3GBW A;  2GH8 A;  4LR4 A;  1U5I A;  4AVC A;  1RUC 1;  2W46 A;  2W9X A;  2BGC A;  1U5Y A;  1VR3 A;  3BYW A;  4MV2 A;  1H4G A;  4Y5T A;  1VRH 1;  4I0B A;  5EZW A;  5K0U B;  4RS5 B;  4HK8 A;  4EN6 B;  1SCS A;  3KV6 A;  3OF1 A;  3A7Q A;  4JTN A;  3NQH A;  3N7K A;  1W6Q A;  2DVG A;  3E5U A;  1DBN A;  1BCX A;  1WLD A;  5JSP A;  2JIC A;  2V5Y A;  1RUG 1;  3R4U A;  4LOR A;  1QDO A;  2EXH A;  2Z69 A;  3T2P A;  3J26 N;  1WGP A;  3OGS A;  4XAC A;  5FUN A;  3VDA A;  5CB7 A;  4BMB A;  1HB1 A;  4Z1V A;  1R08 3;  1HXS 2;  1TME 2;  2EID A;  3AM2 A;  2OUJ A;  1IGO A;  3H3L A;  2P17 A;  5J3U A;  3POB A;  2HEW F;  3V56 A;  1PO1 1;  3HAG A;  1V70 A;  2DVD A;  3BUC A;  1K42 A;  1EPW A;  2EAL A;  4L0P A;  1BZW A;  4HKO A;  4Q4W 3;  1IS4 A;  3OY8 B;  2J1A A;  4CXX A;  5EYY A;  4BQY A;  4M3C F;  1BKZ A;  4LA3 A;  1A8M A;  1X9P A;  3OOX A;  1SQ4 A;  4RN5 A;  1UOG A;  1R09 3;  3WF2 A;  4G3Y C;  5F5A A;  2WWJ A;  2GC2 A;  4QB6 A;  1UNB A;  2E7Q A;  2R7E B;  1AUY A;  2E63 A;  4URA A;  5FPA A;  4QPI B;  1QKQ A;  3CL1 A;  2IXC A;  3FFQ A;  4PBP A;  5DDJ 1;  3AXD A;  1RUD 2;  1DG6 A;  2PHL A;  1ZZ9 A;  1C1L A;  3H3U A;  4BQX A;  3O1R A;  4P9Y A;  2A6Y A;  2VBB A;  4PT6 A;  1JW6 A;  4CCK A;  5C7G A;  1F31 A;  1DQ2 A;  1LED A;  1XXN A;  5C3P A;  3ZKU A;  2QJV A;  1KQR A;  2BNN A;  1ULF A;  1LEC A;  1OLM A;  3HIF A;  3OD0 A;  3M4F A;  4GWM A;  4H55 A;  1WWY A;  5D2A A;  1JS9 A;  3VKO A;  1UWW A;  1PK6 C;  5FP4 A;  3ZFG C;  3MZH A;  1V9U 2;  1AR8 2;  1JZ8 A;  2BVV A;  4M4R A;  3LSD A;  2VNR A;  5EV7 A;  1ZRE A;  3H1M A;  3OBA A;  3AKS A;  1VMH A;  3L9J T;  1NYW A;  4YFW A;  3THD A;  3N7J A;  1WCU A;  4XF1 A;  1L7Q A;  3PJY A;  4PIX A;  5F5Q A;  2V4V A;  4AGR A;  4Y5Z 0;  4R9B A;  4Q4Y 2;  1O8P A;  1J58 A;  1LEN A;  2D6K A;  1WKY A;  5CFC C;  3CJI B;  2LAL A;  4ZS2 A;  1QJE A;  2CU5 A;  1BMV 2;  3AP6 A;  2W1Q A;  4PF1 A;  3VBU C;  3O1T A;  2GND A;  5HI0 A;  4B3N A;  4YNI A;  1FXZ A;  5BUV A;  3A0K A;  1LJ7 A;  2DYC A;  3KMH A;  5FXW A;  4KBZ A;  4D7T A;  3U75 A;  4UW4 A;  1VRH 3;  2FDI A;  3IAQ A;  4ARY A;  3PUQ A;  3LDB A;  2JEC A;  5LCW L;  1W9T A;  1RUJ 2;  2VTX A;  4J1W A;  4CCL A;  4KH9 A;  3NNF A;  3ZX7 A;  1N3Q A;  1UKR A;  4YM3 A;  4HAN A;  1AR9 2;  1D4V B;  3NV2 A;  1TMF 2;  5F6L B;  3ZLI A;  5JOY A;  1GZ9 A;  2BDR A;  3DXT A;  2JJ6 A;  4HSL A;  2B5H A;  4IW3 A;  5A3T A;  2JG9 B;  4YRD A;  3WCS A;  2VZR A;  4OZX A;  3TEW A;  2QTW B;  2W47 A;  4JRL A;  1RUG 2;  2ZHN A;  3BOW A;  4IEZ A;  1GP5 A;  4AED C;  1GV9 A;  2WFF 1;  3U0Z A;  2PMW B;  3FBY A;  2XLF A;  3ZXD A;  2J1S A;  1US2 A;  1V00 A;  2WZE A;  3LPG A;  4XET A;  1H2N A;  3ZFG A;  2WDB A;  4PI0 A;  4DUV A;  4CTE A;  3Q9O A;  5EP9 A;  4XBQ A;  5FZ6 A;  1ASJ 3;  2YFZ A;  1FNZ A;  1RUJ 3;  3L2H A;  3UJO A;  1VBC 1;  2BWA A;  3I2H A;  1A8D A;  2GC3 A;  2OX0 A;  2RJ2 A;  3AK0 A;  1TME 3;  2VUC A;  2ZBJ A;  1AF9 A;  3I2K A;  3PIG A;  5FZC A;  4XUP A;  1ENQ A;  3T4V A;  1DGW A;  4PQQ A;  5KR7 A;  3F95 A;  1IS3 A;  2RS5 3;  4OYU A;  3ZMN A;  1FOD 1;  5AC9 2;  3VDD A;  3N9P A;  3TEZ A;  1CR7 A;  2Z5W A;  2Z2S B;  3E1F 1;  5C8W A;  2CL2 A;  2QQU A;  5FZO A;  5A1L A;  1DHK B;  5KXE A;  4P00 B;  1I5P A;  1W6O A;  5L19 A;  1RTV A;  4Q4Y 1;  4CDW C;  3SIT A;  4YZ2 A;  5DUW A;  3VDB A;  2WSU A;  5IFP A;  2ZX2 A;  5JWP A;  4I2O A;  4OCT A;  3NKT A;  3MW2 A;  3AJY A;  2QKD A;  1DZQ A;  1CAV B;  3AYD A;  3RQ0 A;  3ZM8 A;  3MW4 A;  5FUI A;  2PHD A;  1ZRF A;  4B7K A;  4Q8K A;  4DXR A;  1IQD C;  3C7H A;  3QH7 A;  2PQQ A;  1OPM A;  2ZMN A;  1XSQ A;  5C8C C;  2N7G A;  2VTF A;  5JIU A;  4Q8L A;  4JHT A;  1T2X A;  3T2O A;  3ZYF A;  3RPQ A;  4C1W A;  3URF A;  4AQT A;  5JIA A;  5IVE A;  1YI7 A;  5IYY A;  2WJS A;  3F2Z A;  4LIU A;  5FXV A;  2VCM A;  4AEM A;  2PEL A;  3ZFF B;  4IEP A;  1OQD A;  2HEV F;  2JG8 B;  2LM3 A;  2Q4S A;  4BXS V;  3D0S A;  1D0H A;  4FTS A;  5LEJ A;  1JU4 A;  1NZC A;  4RR3 A;  4CRQ A;  4XQD A;  3HPN A;  4P9G A;  1COV 1;  2VOW A;  2ZX1 A;  5EIY B;  1G6N A;  5FZH A;  1ZZ7 A;  3D8C A;  3SC7 X;  4ZU7 A;  3PME A;  5FPU A;  1AR7 2;  2ZHK A;  3OY8 A;  4RQP B;  4KU7 A;  4XAB A;  2P2K A;  2ZGK A;  3FBM A;  4K40 A;  2ZEX A;  4IV3 A;  2PLV 1;  4XFB A;  2ILM A;  4E4D X;  4ZHN A;  3OBR A;  1GZT A;  1QOT A;  3ZXL A;  1DQ6 A;  1W0O A;  4OUS A;  3CMG A;  3HNB M;  1MVQ A;  1D0G A;  1RGS A;  1RL3 A;  1PIV 2;  2WQ8 A;  3JD7 1;  3J7H A;  4I0W B;  5GLW A;  4AI2 A;  4JGY B;  1GUI A;  4ZZ5 A;  1CES A;  5FJK A;  2RHP A;  5K8S A;  4BQ5 A;  5FZG A;  2JG8 C;  1W2N A;  5C3O A;  1CX1 A;  3SHR A;  3VDC A;  2ORZ A;  1GOG A;  4CDX C;  5AVP A;  3RZH A;  1YHF A;  1GYK A;  4FAG A;  5F5C A;  4B4R A;  2WRA A;  4Y20 A;  5C5T A;  1ZRD A;  2BEO A;  4LHN A;  2BER A;  1RUC 2;  2K0G A;  2GDF A;  1HN1 A;  4OVE A;  3RMX A;  4HN0 A;  4C91 A;  3CIH A;  1X8M A;  1PZ8 A;  4C1X A;  3WP4 A;  3GZT B;  2JDY A;  5BNO C;  3DPR B;  3ZMO A;  2PHR A;  1AX2 A;  1QNW A;  3DCQ A;  4XF4 A;  1ZBE 2;  1FAY A;  3ST7 A;  3ZXF A;  1MS8 A;  4BH9 A;  4C8D A;  4CUG A;  4B4P A;  3BU0 A;  1MAC A;  4Q0U A;  4AI0 A;  2GU9 A;  3WQ7 A;  1BJQ A;  1CZT A;  4AVT A;  1NXD 1;  1QH7 A;  2IXL A;  5F7U A;  1WW7 A;  4QDQ A;  1TG7 A;  4FFH A;  4IQP A;  2LTN A;  2CDO A;  5A3W A;  2QNK A;  2XJV A;  2ZGT A;  3WUC A;  3UT0 A;  3DN7 A;  3PTR B;  2HLE A;  3TB0 A;  2R07 2;  3PVN A;  3VKL A;  3VUO A;  1LHW A;  4KMQ A;  4S2D A;  1AZD A;  4W6Y A;  2TUN A;  4XBL A;  1FV2 A;  2WUH A;  1W9Y A;  2B9V A;  3KGZ A;  4EE2 A;  2ZTN A;  3UJQ A;  1OPO A;  1W90 A;  3WQ0 A;  1LGN A;  2D6M A;  1BBT 1;  2WAA A;  3GZA A;  4GMP 1;  4KNC A;  4D0Q A;  5C5U A;  4AI3 A;  1XC6 A;  2ZGS A;  3B01 A;  4FPO B;  1EUT A;  2E26 A;  3K3O A;  1D2Q A;  1UZ0 A;  3MV1 1;  4LHK A;  2QDN A;  5FZI A;  1O5U A;  1YFY A;  5FZ7 A;  4YFZ A;  5DDJ 3;  4OQ8 A;  2ADD A;  1QH6 A;  5FP3 A;  2YBP A;  4OUE A;  2WO1 A;  5JMO A;  2UUR A;  4QX2 A;  2FDJ A;  5FK7 A;  1C8M 3;  1S4C A;  3EMR A;  1RUO A;  5FFO C;  4D94 A;  2FDF A;  4EWE A;  4TLF A;  5A7N A;  4B8E A;  1FMD 3;  1QJU 3;  4D69 A;  4WVV A;  1LKN A;  4ET7 A;  2B42 B;  2QQM A;  5FOJ B;  1B35 B;  4JKM A;  1CIY A;  5SV5 A;  3X29 B;  1UMH A;  3VZJ A;  3ZSK A;  5L7O A;  2DVB A;  3BVC A;  3ZPO A;  1FAT A;  1WBL A;  1UX7 A;  1JYT A;  1GBG A;  4GB3 2;  3N9O A;  2W91 A;  4O65 A;  3VL9 A;  4MG2 A;  1KEX A;  2W2I A;  3MYX A;  5BY5 A;  3D3A A;  3GDB A;  3C8X A;  1CVN A;  4FPY A;  2RJL A;  3EQE A;  1W6O B; 
#chains in the Genus database with same CATH homology
 4QU1 A;  3PDQ A;  4GD4 A;  1VRB A;  2OT7 A;  2YU2 A;  5E6H A;  3NJY A;  5F2S A;  3PUS A;  5FPL A;  2Q8D A;  4QX8 A;  4XDO A;  5IVY A;  3K2O A;  3LD8 A;  2YU1 A;  5FZ4 A;  4EZ4 A;  3PU3 A;  2XXZ A;  3K3N A;  4BU2 A;  4D6S A;  5FYC A;  5IWF A;  5FXW A;  5LW9 A;  5FWE A;  5FJK A;  4IGQ A;  5IVC A;  5FZ3 A;  5A3P A;  3N9M A;  4HOO A;  5FZL A;  5FZG A;  2VD7 A;  3PUQ A;  3LDB A;  5FZ8 A;  5IVF A;  3OPW A;  4CCL A;  4ASK A;  5FP8 A;  5FZB A;  5K4L A;  4QWN A;  5F5C A;  3ZLI A;  4CCM A;  4UF0 A;  3DXT A;  3KVB A;  5FY1 A;  5FBJ A;  5FZ9 A;  5A80 A;  5FY7 A;  5A3T A;  5IVB A;  4IGO A;  4CSW A;  4EZH A;  4V2W A;  4DIQ A;  5FXX A;  5FP9 A;  2OQ6 A;  5FZA A;  5FYS A;  4QX7 A;  3KV6 A;  5FUP A;  4C8D A;  5FYZ A;  4QXH A;  4CUG A;  3AVS A;  5CEH A;  5A7W A;  4D6R A;  3KV9 A;  4Y4R A;  4IGP A;  3N9L A;  2PXJ A;  5A7O A;  5A7P A;  3U4S A;  3UYJ A;  5FWJ A;  4LIV A;  4GJZ A;  5IVJ A;  2YPD A;  5FY5 A;  5FY4 A;  5FZ1 A;  2OQ7 A;  3PUR A;  5F3I A;  5FZ6 A;  2Q8C A;  5FYY A;  4HON A;  2XUE A;  4D6Q A;  5FUN A;  3PU8 A;  5FZO B;  5FYV A;  5A3W A;  4E4H A;  5ISL A;  2OX0 A;  5FYT A;  3U78 A;  5F3E A;  3PTR B;  5FP7 A;  5FXZ A;  3KV5 A;  5LY2 A;  5FZM A;  5FY8 A;  5FZC A;  3RVH A;  4BIS A;  4TN7 A;  5A7S A;  3N9Q A;  3DXU A;  5FZ0 A;  2XDV A;  2GP3 A;  2YBS A;  3KV4 A;  5KR7 A;  4CCJ A;  3N9P A;  4LXL A;  5FYI A;  5FYU A;  5A1F A;  5FJH A;  5FY9 A;  5FZO A;  5A1L A;  5FY0 A;  2GP5 A;  3PUA A;  4DO0 A;  5FYB A;  2WWU A;  5F3C A;  3K3O A;  5F5A A;  2WWJ A;  5FZF A;  3N9N A;  4EYU A;  4LIT A;  4V2V A;  5FZI A;  4AAP A;  4URA A;  5FPA A;  5FZ7 A;  4QXC A;  4CCN A;  5F32 A;  5FP3 A;  2YBP A;  4BXF A;  2YBK A;  5FYM A;  5A7W B;  5IW0 A;  5FV3 A;  5A3N A;  4CCK A;  5A7N A;  2OS2 A;  4NUB A;  5F2W A;  5A7Q A;  5FPB A;  5FZD A;  5IVE A;  3OPT A;  5F39 A;  5LWB A;  4LIU A;  5FZK A;  5LY1 A;  5FXV A;  5FP4 A;  3KVA A;  3AVR A;  4UF0 B;  5FYH A;  5IVV A;  4GAZ A;  5ANQ A;  3AL6 A;  3ZPO A;  5FPV A;  4XDP A;  2XML A;  3N9O A;  5F3G A;  2W2I A;  4GJY A;  2Q8E A;  4Y3O A;  5FZH A;  5F37 A;  4AI9 A;  4Y33 A;  4QXB A;  5FPU A;  4CCO A;  3AL5 A;  5F5I A;  5FZE A;  2P5B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...