4FSJA

Crystal structure of the virus like particle of flock house virus
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
343
structure length
315
Chain Sequence
QTAPVPQQTRLSQPGLAFLKCAFAPPDFNTDPGKGIPDRFEGKVVSRKDVLNQSISFTAGQDTFILIAPTPGVAYWSASVPAGTFPTSATTFNPVNYPGFTSMFGTTSTSRSDQVSSFRYASMNVGIYPTSNLMQFAGSITVWKCPVKLSTVQFPVATDPATSSLVHTLVGLDGVLAVGPDNFSESFIKGVFSQSACNEPDFEFNDILEGIQTLPPANVSLGSTGQPFTMDSGAEATSGVVGWGNMDTIVIRVSAPEGAVNSAILKAWSCIEYRPNPNAMLYQFGHDSPPLDEVALQEYRTVARSLPVAVIAAQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural study of virus assembly intermediates reveals maturation event sequence and a staging position for externalized lytic peptides
rcsb
source organism Flock house virus
molecule tags Virus
molecule keywords Capsid protein beta
total genus 67
structure length 315
sequence length 343
chains with identical sequence B, C
ec nomenclature ec 3.4.23.44: Nodavirus endopeptidase.
pdb deposition date 2012-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4fsjA00
1B35C 1F2NA 4RS5B 4CDXB 1MQTB 4GMP0 2XBO1 5AC91 2RS11 1POV3 4YVWA 5A33A 4N53B 1VBD1 1R083 3CJIB 1DDLA 2WZR3 1VB4A 4JGZB 1PGL2 1QJU3 4GH4C 4AEDC 5JZGC 4SBVA 4LLFA 5D8AA 2RMU3 1AR81 2RR11 1PGL1 1AR82 2RR12 1OOPA 3VBSB 5C8CB 1RUF3 3JD71 1RMU3 4RR3B 4RHV3 4IV3C 3TN91 1D4M3 1V9U1 2XBO2 1RUE2 1AR93 2HWF3 1RUF2 2WFF2 1TMF1 4QPIB 4RHV2 1TMF2 1HRV1 5ABJB 5BNNC 1D4M2 1PVC1 4RQPA 4YVWB 5CFCA 5L7OA 1AYM2 4RS5C 1C8M3 5D8AB 4RHV1 4CDXC 5CFDB 1EV12 1QJX1 2WFF1 2FZ2A 5ACA2 1R092 3DPRA 3VBFB 1IHMA 4CDWC 1RB8G 1BBT3 1ASJ1 4WM8A 1A6CA 1EV13 5BNNA 2VQ0A 4JGZC 2WZR2 4BCUA 3JBG2 4CDUA 1MEC2 1RUH2 2HWD1 1VBC2 2R041 3FBMA 2BUKA 3NAPA 4Q4X1 3VBSC 4FTEA 3DPRC 1K5MB 5J98B 1MEC3 4Q4V1 1NCQA 3ZFFB 1RUG1 1TME3 1RUI3 4N43C 1EAH1 1NA1A 1PGW1 4Q4W3 1PVC3 1V9U2 1NCQB 1VBA2 2WFF3 1COV2 3VBOA 4CDQA 1PO11 1FMD3 3HAGA 4YVWC 1NY71 5CFDA 1Z7S3 1RMU1 2DF7A 5LK7B 1VBD3 4Y4YA 1EAH3 1VBE2 4GH4A 1X36A 1E57A 2RS52 1RUE3 1QJZA 3ZFEB 1M06G 1ND3A 4PDWA 4Z92B 1MQTC 5BNPA 3JBG3 1BEV1 1NCRA 4FSJA 1GFF2 1FPN1 4N53C 4QPGB 3TN92 1K5MC 3ZXAC 4Q4Y1 1RVF2 1QJY2 2BPA2 2RS51 1QJU1 1RHI2 2R071 3J8F1 1BBT1 1ZBE3 1W39A 1BMV2 1QQP2 2R063 4PDWB 5JZGB 4CEWC 1X33A 1RUJ2 1NCQC 1AR61 4Q4Y2 3CJIA 5BNOA 5C8CA 4N53A 1QQP3 2R062 2HWB2 1FMD2 4JGYA 4FTBA 2R043 1COV3 1BMV1 4CDXA 2WWSA 4QPIC 1AYM1 4RQPC 3VBHC 1TMF3 5ABJC 1RUI2 1EAH2 1VBE3 3ZFGC 5A33B 1HQNA 1RUH1 4NWWA 4Q4V2 2X5IC 3JB4C 1RUC1 2RMU2 3VBRB 4EJRA 1FOD1 2RM21 2HWC2 1RMU2 1QJX3 1NA1C 2HWE1 5ACA3 1H8TC 1MEC1 4QPGC 1ND2A 2XBO3 2RS32 2HWB1 1BBT2 1PO12 1QJY3 4GB33 4N43A 2BFUL 4PDWC 1R091 1ZBE2 4CEWB 1QQP1 1RHI3 5K0UB 1HXS3 3VBFA 1CJDA 3DPRB 1ND3B 1H8TA 1R1A2 4Q4X3 1RVF1 2HWE3 5AC92 2HWB3 1ASJ3 1TME2 2HWD2 1RUG2 3TN93 1ZBA3 1B35A 4RQPB 5ABJA 1VAKA 2RM23 1FOD3 1ZBE1 3ZFGB 4CEYA 4GMP1 5DDJ2 1VBB1 1PIV2 1AUYA 1PO22 1VRH2 1RUJ3 4IV1C 4WM7A 5FOJB 1NA1B 1VBD2 2Y26A 1PO23 1VRH3 3ZFFA 1AR91 4WM8C 3ZFEC 1VB2A 1C8M2 1K5MA 1AYM3 3IDEA 1PO13 1HRV3 1F8VA 1AR63 3LOBA 4IV3A 1FPN3 4RFT0 1Z7S2 1AL21 5FMOS 1OOPC 2MEV1 1NCRC 3M8LA 2WZR1 1AYN3 1POV0 1R1A3 4Q4X2 1RUE1 3VDDB 4IV1A 4AEDA 1ASJ2 2XPJA 1AR73 2RS53 1RUG3 5DDJ1 1VBB3 2WLPA 1WCDJ 3JBG1 5C4WA 4GB31 5CFCB 4GB32 3VBOC 4CDQC 5L7OB 5BNOB 1RUC3 2RS31 2BFUS 1QJU2 1RHI1 2ZZQA 1VBB2 5C9AC 4QPIA 1HRI3 5ACA1 1D4M1 1PVC2 1V9U3 4YVSC 1AYN1 5A32B 1C8NA 1NG0A 1SMVA 3VBHB 3ZFGA 1Z7S1 5J96B 3ZFEA 1VBA3 4QPGA 1AR92 2X5IB 3VBRC 2ZAHA 5BNPB 1HRI1 1H8TB 2GSYA 1R082 3VBUB 2WS92 2HWC1 3VDDC 2MEV2 4CDUC 2GH8A 4JGYC 3JB8A 2IZWA 1OHFA 5K0UC 1R093 4GMP3 4CDWA 1ND3C 5CFCC 4WM7C 2PLV2 3VBOB 4CDQB 1AL0G 1HRV2 1OPOA 5K0UA 5L7OC 3NAPB 1RUC2 2RMU1 1RVF3 2RS12 3VBRA 1TME1 1RUI1 4YVSB 2PLV3 1HX6A 4Q4Y3 3CJIC 1ZBA2 1RUD2 1R1A1 3JD72 2FZ1A 5DDJ3 4AEDB 1FMD1 4IV1B 1PIV3 1VBE1 1NOVA 1RUD1 4CEYC 1NY72 5AC93 1AL23 4Q4W1 4IV3B 4WM8B 1BEV2 3VBUC 5JZGA 3VDDA 1FOD2 2RM22 4JGYB 5C9AA 1RUH3 2RS33 1BEV3 2QQPA 4YVSA 4RR3A 4WM7B 1RUF1 1OOPB 3NAPC 2PLV1 5D8AC 1NCRB 5CFDC 2ZTNA 2BBVA 1HXS2 1AR72 2HWF1 5C4WC 1AR71 3VBFC 4Q4W2 1ND2C 2R061 4CDWB 1PIV1 2WS93 4Y5Z0 2HWE2 1B35B 1QJY1 5BNOC 1AR83 1ZBA1 2RR13 3VBSA 1AR62 1RUD3 3JD73 2HWD3 3S6PA 5C9AB 3VBUA 1HXS1 1VBC3 1COV1 4NWVA 4CEYB 4RS5A 4JGZA 1AYN2 2TBVA 3ZFFC 1PGW2 2R042 2RS13 1POV1 4GH4B 4N43B 2X5IA 5FMOL 1C8M1 1MQTA 5BNPC 5C8CC 1VBC1 3VBHA 4RR3C 5GKAC 1RUJ1 5A32A 1HRI2 2HWF2 4CEWA 2R072 3J8F2 4Q4V3 4FTSA 1VBA1 1EV11 2WS91 1QJX2 1AL22 1R081 4CDUB 2HWC3 1PO21 1VRH1 2MEV3 1CD3G 2R073 5C4WB 1ND2B 5BNNB 1FPN2 3J8F3
chains in the Genus database with same CATH superfamily
4XAEA 1B35C 1HV0A 1F2NA 1LOAA 2I45A 4RS5B 4EN7B 4XC9A 1OH3A 3UK9A 2CYFA 2YPJA 4SLIA 1F9KA 4L9BA 4PT6A 3SC7X 1ACCA 4GMP0 2ZGUA 2JE8A 3B94A 3UGGA 2VOVA 2VMHA 3AMNA 2R1BA 2VL4A 2PTMA 3IIIA 3WNNA 4BDVB 4QKFA 4W65A 4ATFA 5A33A 2IXHA 4XXAA 2WSVA 4YWAA 3FWEA 1PZ8A 5KXCA 3RZLA 3H1MA 4LQRA 5IYYA 2E32A 4JGZB 1PGL2 2B5HA 5JXGA 1O3QA 3TRSB 1CZSA 2VNVA 4CCLA 4FOQA 5KR7A 1JZ7A 1F15A 3B01A 3CLPA 4AQSA 2OS2A 5FYHA 4HOOA 5D8AA 4MUVA 2RMU3 3NJVA 2Z42A 1Y9QA 1AR81 2NM1A 4KBZA 1PGL1 3NKGA 3IPVA 3V64A 3SH3A 1RMU3 4RR3B 1KGYA 2V5DA 2VZSA 5FCCA 1X7NA 5APAA 4BPZA 3K48A 4NRQA 5F6LB 3CKHA 1D4M3 2VQUA 1J59A 2XBO2 1RUE2 1FNZA 1GSLA 4O7XA 1G9AA 1NX9A 1F31A 1WA6X 1RUF2 3AMMA 2BWCA 2WLQA 3CO2A 3EHKA 2P6HA 1JU4A 3J9SA 1U5IA 4OYUA 4AXOA 2C5DA 3GJAA 4BQ3A 1YQ6A 5ABJB 3VZLA 4QQPA 1SCSA 2JDPA 4UFKA 2WNUC 1WCUA 3WD5A 5EXOA 1CZVA 2AACA 5HCBA 1DLLA 4RS5C 5T54A 2QQOA 1UY4A 4RHV1 1H2NA 3WG1A 3AVSA 5CFDB 2RDNA 5A7OA 3ZKUA 3ZXKA 2DU1A 3VN4A 4EN9B 3J7LA 4LA2A 1W2UA 1JW6A 1EP0A 2EXKA 5JIUA 3GDBA 3WW2A 4CDWC 4WVMB 4AGRA 1BBT3 4PJYA 2PMWB 1S0GA 3JUUA 1ASJ1 2YG0A 3Q8CA 5LY2A 4OHVA 1UOJA 4AL9A 5EPAA 4BM8A 5ERLA 4XQ4A 1MEC2 2W0XA 2R7EB 4AI3A 4B4RA 4CA9A 2KXLA 1UKGA 4GJZA 2PFWA 5C6CA 3B9CA 2Z79A 3H1WA 4I0WB 4Y1XA 3NAPA 4YYOA 1U12A 2DYCA 3LEMA 5ANNA 4OQ8A 1K5MB 3TYJA 1XE0A 3WP4A 5J98B 2QQJA 3GXUA 1GZCA 4M3CB 4QU2A 4FFGA 1RUG1 1TME3 4HSJA 1W2TA 1XE8A 4N43C 3T0AA 2DTWA 1QIQA 1N3OA 1PVC3 1V9U2 3CU7A 3WNXA 3RZMA 4NHXA 5FAXA 4Q27A 1NCQB 1NLQA 2OUJA 1TZOA 1ZRDA 5JI9A 2EAKA 1W9FA 5C71A 3E5UA 1JZ8A 5LBCA 1COV2 3VBOA 2XXZA 4JKKA 4KU7A 1H8VA 4YARA 3RZJA 4I3PA 1GQGA 2JDKA 3D82A 1OF3A 5EWSA 1K5JA 2WAOA 3ON7A 3PUSA 3WNPA 2YXSA 1RMU1 5A7NA 4BXSV 4BE3A 3CF6E 1VBD3 4NIAA 1VBE2 5AFEA 3UKNA 2GAUA 2BV4A 3NSTA 2BQPA 1GKBA 1HW5A 4FPGA 3B5LB 3ZIWA 1GV9A 2W87A 2ZX0A 4EYUA 4WVMA 3ZYIB 2ZX3A 2BVBA 1GANA 3LKJA 1KS4A 3ZYRA 2VZOA 3VUOA 5JPNB 1KJLA 3JBG3 3NW4A 2ERFA 4HN0A 1KS5A 2VZTA 1J1TA 1UY1A 4IEOA 2JECA 4XPVA 4M01A 4DUWA 4XMAA 2PELA 4CYDA 1FPN1 2WO3A 3TN92 4G3YC 5FXXA 3SLIA 1YQ2A 5DG2A 1Q56A 5KHJA 4K1YA 1QJY2 4A7KA 4A4AA 4FAHA 3DXTA 1NLSA 3DF0A 1QJU1 1AX0A 1NQDA 1BBT1 1ZBE3 4TSVA 5DXDA 5FKCA 4PDWB 1BMV2 2PQQA 2CHHA 3ASIA 3IMMA 4JHTA 2Y64A 4CXWA 5TSWA 3RYKA 5JZGB 2W46A 2Y34A 2FDFA 3KWVA 1YXWA 2ARXA 2JDNA 4GALA 3BTXA 3AX4A 1PNFA 3CJIA 5D21A 1JBCA 4N53A 5BNOA 5C8CA 4YRDA 4XCBA 5DQ0A 3W9AA 1BVVA 1QQP3 1LJ7A 1S0FA 1FMD2 1RUNA 1COV3 2JB8A 1PK6C 2J1SA 4FOYA 1CIWA 3O0XA 1X82A 3T1LA 2IXKA 3LFIA 5L19A 2D43A 2VW1A 1LB2A 3DYMA 2D6OX 4CDXA 4RFRB 5DMYA 3K3NA 5I8TA 1AYM1 4CDWA 2DDUA 5JCTA 3HT1A 1AXKA 1VBE3 3OB8A 4RGAA 4IEVA 4C8DA 2PHFA 4XUQA 4Q4V2 5FZ1A 3JB4C 2O1QA 2VTXJ 4N9HA 2DCKA 2H6BA 3VZKA 3RPQA 5JOWA 1N3PA 4LKDA 3EBRA 1OKQA 2J1UA 1NA1C 5E88A 5I0SA 5DZEA 5GLWA 1MEC1 3KS7A 2OQ7A 3THTA 1ND2A 1BBT2 3JZVA 1PO12 2KD7A 4OI2A 2G9FA 4FOWA 4BYYA 2LW8A 2Q0AA 4XURA 1Q8QA 3ZYHA 3ZR6A 3W21A 3OOXA 1J3RA 2Y38A 3ZVXA 4PDWC 5K8SA 2K2SA 5C5TA 2VZVA 1HV1A 4GWNA 3N9OA 3UYJA 1HXS3 2DUOA 1CJDA 2CV6A 3DPRB 4XJ8A 1R1A2 2CAUA 3LWCA 3RZZA 5IK8A 2QTWB 3WX5A 5AC92 3VHRA 3MW4A 1SDWA 5FZ0A 1PK6B 2A5ZA 2HWB3 1TME2 1DQ0A 2ZGRA 4X6QB 5HCFA 4CU7A 5I0RA 2W3JA 4B4QA 1CJPA 2XHKA 1BVP1 1ZBA3 2WR9A 4Q1RA 2ZJCA 4HPKB 5ABJA 4XF0A 4B1LA 1DZTA 5EFUA 5F7UA 2WQ8A 4LJHA 3C7GA 1ZBE1 4XHBA 2SBAA 4XE9A 1I9RA 1W06A 1SLLA 2PHWA 4KG0A 3HOBA 1EYBA 3VZJA 4GWIA 1AUYA 4Q2FA 3A23A 1RUJ3 4IV1C 5JI7A 5JUVA 2WNVB 1VMHA 4XDQA 3WOGA 1PZ7A 4CU6A 2DUPA 4WM7A 4CCMA 2ZHNA 1NA1B 1VBD2 4LBQA 4YG3A 2JG8B 3ZN5A 1RTVA 1PO23 3AL6A 2WQ4A 4PQQA 4M3CA 3T2PA 3WP6A 3WHTA 1RXFA 5A3MA 3OPTA 1GICA 1UYZA 4XJ9A 3T3YA 1RYYA 1C8M2 2BYVE 3N9LA 4QGMA 1AYM3 1WKYA 3NV1A 3KF5A 4HKWA 2JDUA 3S30A 1PO13 4XQDA 5T52A 1W9TA 4JHZA 1S0JA 3KLSA 4CP0A 3HNBM 4LBKA 3MIFA 4YSFA 2GC0A 1Y4WA 1UU4A 2ZGPA 3ZPYA 5A6ZA 2A71A 2Y6KA 3M3OA 5KXBA 1OOPC 1JUHA 1W3XA 1WLDA 3AXEA 1R1A3 2XVLA 4C0BA 3VDAA 4AEDA 4P08A 2XPJA 1BZWA 3ENRA 1DGLA 1RUG3 3FLPA 1OFSA 1VBB3 2EXIA 2WLPA 4LUMA 5DDJ1 4XJZA 5JVVA 4NR1A 3O1OA 3S7IA 3KB5A 4XBQA 1GLHA 1V00A 3UGFA 3W20A 1OI6A 1GWLA 3VHNA 2VVEA 5F5AA 4NVPA 1RUC3 2IXJA 2RS31 3RVHA 2XQXA 4BIOA 3CL1A 1YIFA 3V65A 1RHI1 4XFHA 5FUNA 3O1MA 5FY7A 2DVDA 4HMZA 1NXD1 4F3JA 3O0VA 1C8NA 2PXJA 1CR7A 2XH6A 1EPWA 5D1IA 4OUSA 4RGGA 4D7SA 3APBA 3UT0A 4AG4A 3DN7A 1ZNPA 3IAPA 4TLGA 3POEA 1HB2A 4GA9A 5F2WA 1HB4A 1DGRN 4LIVA 2VCCA 3WY6A 5F8PA 1DFQA 1DZRA 2J1RA 1A8MA 5BNPB 1IKPA 1JMUB 4OLLA 1H0BA 1LOFA 2ARBA 4IGQA 3DXUA 2XDVA 4JKMA 2VULA 2ZGMA 3BTZA 5CG9A 1VALA 3CBNA 4QM8A 4I3GA 5CADA 1JN2P 4JAAA 1KDKA 2AREA 3O5SA 2QQIA 3C7EA 4AFCA 5LW9A 5FJHA 4TLFA 2MEV2 2XUEA 4IQPA 4LUKA 4M0NA 3Q9OA 3KT7A 2FDHA 4LO7A 3A0KA 1F4HA 4EV0A 5I91A 4JKLA 1C1FA 1OVPA 3PVBB 1GP4A 1ND3C 4ONUA 1LOFC 2YHJA 4QX0A 2D7FA 2PLV2 4CDQB 1OPOA 4GXLA 1PHMA 5CU1A 4XAAA 2RMU1 4N9IA 1RVF3 4COYA 4PF5A 3AKSA 2Y33A 4UW4A 4Y20B 1TME1 3WNOA 1YFXA 2B8MA 2OXBA 1O3TA 5FPUA 5J09A 1HX6A 3AYAA 4AQ6A 4Z2WA 1IS4A 1ZBA2 2E33A 1R1A1 1U5XA 1ZRIA 1OQ1A 4PLNA 4MVTA 3H3LA 1WD3A 1XPWA 4QWNA 4Q0SA 2VBBA 2Q8DA 5KHIA 1VBE1 1YEWA 2DBNA 4AR2A 4HONA 1NOVA 5FXZA 1AVBA 4LBJA 1IG3A 2VOWA 4FQZA 3K46A 5J7MA 1LHWA 2WC2A 2ZCWA 4QGNA 4Q4W1 4MGIE 4BWOA 5JDBA 4WM8B 3QCWA 2AC1A 2JIJA 1YNAA 4FP3A 2QBXA 4IEYA 2WABA 1IZ3A 5FMBA 3SHRA 4ZS3A 4I30A 2DVBA 1GUIA 2BTVC 3RYPA 1HB3A 1ZX5A 4D69A 5FYCA 3THCA 3EYPA 4QKDA 5KHKA 1VRBA 5BYNA 4D94A 3VKFC 3WNMA 3J26N 1C3HA 5C3QA 4Y33A 3FUQA 1DBNA 1SBFA 4RR3A 3ZXFA 1A34A 4Y1UA 2B7YA 3HWJA 3E1F1 3NNJA 4D7YA 1NCRB 1W6NA 3U07A 4W6YA 5CFDC 4AI9A 3RQ0A 2BBVA 4K7JA 3MIBA 1W0OA 1WW4A 2VVFA 3USUB 3KV6A 4UFMA 2P3YA 4M4PA 4WBBA 1AR71 2UY9A 2R061 3NRUA 5FPLA 4FCAA 2AR6A 5CKQA 3ZSEA 3BIWE 1QHDA 5JXIA 4N90A 5FO9B 1ZBA1 3AYEA 5FO8B 1AR62 3MIGA 1UF2C 5JR7B 5C9AB 3VBUA 2WZEA 4FPEA 2PHLA 1HXS1 1JZ5A 4P9LA 5A80A 1XB9A 4CTEA 5AFBA 2EALA 4CEYB 1UPIA 4E8CA 1BK0A 4DFSA 2E9QA 3KV9A 3IKWA 2QZ2A 2R042 2RS13 1WCQA 3OUIA 3LSDA 2X5IA 5CAZA 2VMCA 3P3NA 2WNEA 3JU9A 3NNFA 5LB6A 3WQ7A 5BY5A 4NIHA 2ZKLA 1O8PA 2QNKA 2GALA 2CNAA 2VM9A 2WWUA 4LXLA 2EXJA 2I74A 4V2WA 5FQ0A 4K20A 1LNSA 3OUJA 1MR5A 3ZSKA 4AI0A 5HI0A 3VBHA 1UCXA 3VKOA 3ZYGA 5LEJA 1CAXA 3ZXGA 3TEXA 3KGLA 4NJ4A 5A32A 1WMDA 4OUMA 3PVOA 3SEEA 4AHXA 4AE2A 2HWF2 4KGGA 4NHYA 5T5JA 4IE5A 4WV8A 4FTSA 3OGRA 3ZPOA 3HMYA 1QJX2 1AL22 1R081 2YV8A 2MEV3 2LALA 2PAKA 3IBMA 4H14A 4IE0A 3T08A 1YFUA 4AVCA 3WZ1A 3S5AA 4IEUA 3J7NA 5BNNB 1WMEA 3HBZA 4JZRA 3V56A 1WBLA 5D2AA 2J7MA 1JUIA 2BJSA 2PAMA 3UJQA 4FFFA 4R9AA 3ETQA 1JS9A 1VJ2A 4QXCA 1SLCA 1W0PA 4UT5A 1OD5A 3DYPA 1UZZA 5KHGA 1NT0A 4ZHNA 4WZFA 3LQCA 2XL9A 1S2EA 5IAVA 3B9IA 1POV3 2W95A 1SFNA 4XACA 4Q8LA 4N53B 5FZAA 2WA4A 4UFJA 1DDLA 3B93A 2PHXA 3KV5A 1NZIA 2FDKA 4BQWA 1QJU3 1F35A 2CDPA 4XJWA 2VH9A 4C90A 4RL7A 2WT1A 4JQRA 5F37A 4LMFA 5A6XA 4QDQA 3RJRA 4AI2A 4FBFA 2VMFA 2WA3A 1XXNA 1QXRA 3DYOA 3O1UA 5C33A 3VL8A 3THPA 1JOJA 3I3MA 1HDKA 3SH5A 4IGPA 1IQAA 2RR12 2Y8KA 3KMHA 3VKNA 2XOMA 3FJSA 4FI9A 4OQ9A 1RC6A 3KVAA 3THDA 4A45A 4NAMA 5FZLA 3TN91 2Z69A 4XBNA 3GJBA 3WUDA 4Y1YA 3J7MA 1AR93 4CCNA 3AMPA 4MLOA 2ZGNA 2HWF3 1W3VA 4INDA 3R4SA 5LBBA 1TNFA 2LM3A 3M3QA 2HYXA 2VD7A 3LFMA 2W52A 2K9ZA 2XJPA 3OEAA 1D4M2 4RQPA 4XF3A 3SCGA 3WDVA 5BNNC 5LEKA 2V73A 2JDZA 1LOBA 3ZXEA 5JAXA 3FFZA 1GOFA 1ODMA 2VZPA 1ALYA 3WG3A 2VE1A 4FPKA 5C5UA 5D8AB 3U4SA 2P6CA 2ZBJA 4L8QA 3ALQA 4CDXC 2XL7A 3P1IA 3I2GA 4E4DX 4HG6B 2ATFA 1BLZA 3WINE 4YGEA 5FZ4A 4O9EA 2TNFA 3P5BA 4I02A 5KXDA 1R092 3GM8A 3O1TA 4C1XA 2JG9B 1IHMA 1I3HA 3VBFB 1RB8G 3N9NA 3OG2A 1H6XA 4Y5SA 4XF9A 5FPXA 1A6CA 1Q8OA 3A7QA 3GBGA 1DHKB 2VQ0A 1JOPA 3T2OA 2R16A 2WZR2 1BJQA 1I5PA 4CCEA 3JBG2 4OFGA 1OF4A 1PVXA 4CDUA 1H4HA 4S2GA 4DEVA 2ET7A 4CU8A 1CAWB 1TVGA 5IK7A 1CN1A 3OCPA 1W90A 4CP9B 3FBMA 2VUJA 3OD0A 3B3QE 5BXXA 4B3NA 4Q4X1 4CUCA 4EROA 3WF1A 3DPRC 5I93A 3OPWA 2WBKA 1H2LA 1MEC3 1OFNA 2ETEA 3Q8BA 2CWSA 5FLJA 3ZFFB 5GZEA 4Z2AA 2EIDA 3IAQA 4IEXA 1EAH1 2VOXA 1PGW1 2XQRA 1LRHA 4JDOA 3N9QA 4NHKA 1QMJA 1UL9A 1UY3A 2XG3A 5A3LA 1GOGA 3NNLA 2V5YA 2CDOA 3KCCA 4ASMB 2CWMA 1S4CA 5FZCA 1NAEA 2A6WA 1VBA2 4M00A 5J36A 4B29A 4CDQA 1PO11 3HPNA 2B4KA 1FMD3 1HN1A 1KDMA 2CTVA 4JVAA 3UKVA 4E9KA 2JD4A 4HL0A 2E53A 1O4TA 1SQ4A 2C6SA 1NY71 5J3UA 5CFDA 1C5IA 2OX0A 2DCZA 2DF7A 4GH4A 3SISA 4NROA 2JG8C 1E57A 1X36A 1PMIA 1OBNA 1ULCA 2VZUA 3EQEA 1SLIA 1UY0A 2H0VA 4MSVA 4UF0A 3K51A 1M06G 5GLTA 1ND3A 1JU3A 3ILRA 4OZOA 3SQOA 4BXFA 5I0TA 2CY6A 3LCPA 4XOGA 1QU0A 1WBFA 2WYSA 3KZ4C 4YZ1A 1EUUA 2AUYA 3H42B 2VNRA 1JZ2A 5CZKA 2D6LX 4QPGB 3DECA 2GC1A 4DY5A 3POFA 3QLQA 3WF0A 2CGPA 5FLIA 5A7WB 3RJ2X 1UW8A 3WG2A 3HQXA 1ZZBA 2OT7A 1RHI2 3MW2A 1H30A 2A6VA 2R063 2LTNA 1SPPA 2HLEA 5CEHA 2B46X 2QJVA 4KBBA 1VR3A 4LHSA 4NPRA 3CZJA 1O59A 2E6VA 5CNAA 3WV6A 2QUOA 1A8DA 2A1XA 4JC1A 2JENA 3I49A 1WWYA 4AHYA 5HV4A 2HWB2 2EF6A 4JGYA 4BK4A 2D98A 1DYOA 4W6XA 3UL2A 5E16A 1AF9A 2WWSA 3MF9A 4XABA 1CZTA 4E4SA 1W6MB 2QQUA 1LGNA 3LZZA 2E63A 4LOTA 4D6QA 3C7OA 1RUI2 4B4PA 2ADEA 5J48A 1OT5A 2QCSB 2DVAA 4GZ9A 4P02B 1REDA 3I8TA 1H6YA 3AP5A 2OKXA 4Y20A 2W5FA 1WMXA 2HEVF 3PVEA 4IEQA 4E2SA 4E4HA 3ELNA 3U10A 4CU9A 1ZRFA 4WVWA 2VCMA 4AHZA 4UW3A 3PUQA 1QEXA 3AK0A 4Y3OA 5DZGA 3RMXA 4F83A 2JG8A 4CPBD 1XBFA 4CPBA 2Z4FA 3SCFA 5H9RA 4BA6A 3V0BB 4DRVA 4GB33 3EO6A 5FZBA 3LIGA 2TUNA 2W39A 4QQ2A 2BDRA 3POJA 3WHUA 3LAGA 1R091 3AKPA 3AP9A 4ISQA 4L11A 2VMEA 1QQP1 4CEWB 1RHI3 4KWLA 1PZ9A 3OGGA 5K0UB 2YY1A 1R64A 4COVA 2JG9A 3VBFA 4P9GA 4BISA 4Y26A 5KHHA 1H8TA 2IVIB 1RVF1 2HWE3 2WO1A 5CIRA 3VZMA 4HVRA 2PHRA 1ENQA 5FQ0B 5FYMA 4TYSA 5I8SA 1QJFA 4HPKA 5JMOA 2WZPP 2FDGA 5H9PA 2VUDA 1RUG2 2YDEA 1OSGA 3WQ0A 2GNBA 3IIAA 4P00B 1Q43A 1B35A 5JOXA 1VAKA 2PHUA 4A2UA 2BOJA 1YC61 2EIBA 3GZTB 3WDTA 1DQ2A 5T3NA 1VLNA 4R4ZA 1AX1A 4Z07A 4XZPA 4GMP1 3ZFGB 1MS5A 3Q8AA 4MH0E 2NQYA 3MBWA 1VRH2 1F5FA 3ZOIA 2PYTA 2XWBB 1W6OB 3ZMOA 1QF3A 3ZN6A 3M70A 4DXSA 4YW7A 5JOZA 3HIFA 1DGWA 3NJXA 2YU1A 2AENA 1EY2A 4LA3A 2HEYF 2Y26A 4EN6B 4QU1A 4QPYA 2P2KA 3BALA 3HT2A 1AR91 2EVXA 3K4DA 1O8SA 1VB2A 3NV3A 3WVJA 3ZFEC 1G9BA 1SCRA 2AEYA 3O1RA 5LA2A 2ZHKA 1HRV3 4HK8A 1AR63 1REEA 2QVSB 1UY2A 2GZWA 4GWJA 4JTOA 1QXJA 5F3EA 2WNUA 2L9LA 1POQA 1H9PA 1QDOA 4EWEA 3U78A 4NPLA 1I1EA 4MGYE 1Z7S2 2KR2A 5F3IA 2OYZA 1UOBA 3N7JA 1NCRC 4QMAA 3M8LA 4QDSA 3V0AA 2WZR1 4XIKA 2GU9A 2X29A 1RUE1 4IV1A 2VZRA 4BQYA 1UX7A 1AR73 2RS53 4HFSA 3G7DA 3DV8A 4ARXA 1XNAA 3ACFA 2A73B 2GMEA 4FOVA 3OBTA 5A3TA 4GB31 4UFIA 3CJXA 1NQJA 2DU0A 5BNOB 3AB0A 2BFUS 4LBQB 2YC0A 1BK1A 3EB7A 3LSEA 5CKNA 4YZ3A 4YFWA 1VBB2 2HKXA 3GHNA 5C9AC 3UNPA 4HVOA 4UI9L 1W28A 5A7QA 4PI2A 1PVC2 1V9U3 5ACA1 2VQAA 1AYN1 4YVSC 5A32B 3ACLA 1SMVA 2WAAA 3VD4A 4IE4A 1E5SA 2PA7A 2VG9A 3R05A 5KXEA 5J96B 2R32A 3H3UA 1DGRA 2D3RA 4QX8A 1UN1A 3H7JA 3FLTA 2D3PA 3GNEA 4J1WA 1JHJA 3B7MA 2RVAA 3ORJA 3PMEA 5IVFA 2RHPA 4E2QA 1PMHX 3P3PA 1E5IA 3WNKA 4FPHA 3LDBA 4BJ0A 1LEMA 1YCIA 3AMQA 5KWRA 4PBPA 1ULDA 4MOAA 4NO4A 3I2JA 2ZKNA 4FVVA 5FP3A 1GBGA 1VAMA 3K2OA 1DQ6A 2WS92 2A75A 1RJ8A 1UZWA 2OIIA 3KT1A 2DVGA 1V6NA 4KWJA 2VU9A 4YLZA 2XR4A 1VIWB 4PBOA 1G7YA 5DUUA 5GZFA 1IS3A 2JX9A 1O6UA 2IZWA 2D6KA 3O1SA 3POWA 4NHLA 2NYYA 2BZDA 2ZMNA 5CA6A 3DEMA 3FX3A 5A6QA 2IXIA 4FPOB 3TNQA 5L7OC 1W6QA 5K0UA 1SZBA 4LPLA 4YZ5A 4MHUA 5IUQA 1IS6A 3B69A 1C1LA 3BTYA 4D3WA 1LECA 5BV6A 4KMQA 5FTTC 3IT8A 4AEMA 4DUXA 4YVSB 2PLV3 4LR4A 1YJLA 2VXRA 3CJIC 1LESA 1V6IA 3OY8A 4LBOA 4UWDA 5A3PA 1S55A 2WDBA 2C24A 2FZ1A 3PJQA 1CAXB 3VKMA 4ATEA 4RYDA 1GP6A 1J1LA 2GNTA 4R9BA 2NP0A 3BN6A 3K4ZA 1K12A 1W99A 1FMD1 4FFIA 2CSGA 1FAYA 2QQNA 2HBTA 4A44A 3IMNA 2JE7A 3PU3A 1QDCA 3VL9A 2E51A 2EIEA 2YB7A 1ENXA 4LNVA 2QE3A 1GZ9A 2VBPA 1Y43B 3I4IA 3K4AA 5AVAA 4E4ZA 3BGAA 5I0DA 1RUD1 3BVCA 4HSLA 1ODNA 3A4UA 2WQZC 4B7EA 3VD7A 1QKQA 5FOBB 1UZYA 2DCJA 2WT2A 3AKRA 5A1FA 5HXMA 4IV3B 5IFTA 5IVJA 1UX6A 4QDRA 2NMNA 5FZDA 4YPJA 4BMEA 2ARAA 3WQ1A 3VBUC 1ENRA 5JZGA 3VDDA 1ZREA 4CUBA 1SLTA 4IE6A 1KFUL 1O3SA 3USSA 4W6WA 1UOGA 2VAUA 4WZCA 1YFYA 4YGBA 5IATA 4ZONA 5E89A 2VY0A 4GAZA 1UZ0A 4K40A 1CGPA 1O5LA 4YZ4A 1CONA 1DYKA 2WYFA 3MV11 1W2OA 3CIHA 3LA7A 3MIDA 1QNYA 1UXXX 4HN1A 1OOPB 2XVGA 4M3CF 4META 5LBEA 1KXGA 2P1BA 2YFUA 1BYHA 4BQ4A 3X29B 4BQ1A 5FZHA 2W1SA 2ZEZA 4EWAA 3MEPA 1HQLA 4NIIA 3AZWA 5FY8A 2WO7A 4DO0A 5GALA 4XFIA 1HXS2 1AR72 2RJLA 4LO5B 1XNTA 5C4WC 2JG9C 5GM0A 3VBFC 1ND2C 4KWKA 1MVEA 4CP2A 3OF1A 1PIV1 1RXGA 4Y5Z0 1UXZA 2P3JA 1J58A 3IN9A 3E6CC 3RRDA 1D0HA 4JCKA 2JDAA 4LTAA 1Y9MA 3LEGA 3JXSA 3S6PA 1LR5A 1TG7A 1STMA 2FHRA 2B39A 1LGBA 1VBC3 1OLMA 1NE6A 1RGSA 2VZ3A 3BCWA 3VV1A 1WZXA 1O4ZA 3CDZB 5FZMA 1URXA 4Z1VA 2Y6LA 5FPVA 3WF4A 1VE0A 4UF0B 4FO9A 5F39A 5C3SA 3I54A 2Q4SA 3ZFFC 2W1QA 4LKFA 1G6NA 2GC3A 3S0MA 4GH4B 4O9GA 1XNCA 2AYHA 3CMGA 1FT9A 5EYYA 1X8EA 4ZS2A 5EJ3A 1YUDA 1H2KA 2J1AA 4LULA 2JKXA 2J1EA 3U75A 4EN8B 2C9KA 2WN2A 2BGPA 4QX3A 1YI9A 5C8CC 4A42A 1XE7A 1YI7A 2VNGA 3SCHA 3M1HA 3TOJA 1LTEA 2BGCA 3MFAA 1HRI2 1OPMA 1N1SA 1W8NA 3MI8A 3J8F2 3AP4A 3ZSLA 1VBA1 3AZZA 5DPNA 1OUXA 2WS91 3BPZA 5T5OA 1OVSA 3GHMA 3TBDA 1LEDA 2HWC3 1VRH1 3OBZA 5FPZA 2F4PA 1CD3G 1S1AA 3AJYA 5C4WB 2ADDA 3HNYM 1LGCA 1ND2B 3ACGA 1JH5A 4NE9A 5FZOA 4QB6A 4AF9A 4PF1A 1H4GA 1TQ5A 3GCWA 1CX4A 3H3ZA 1MQTB 1OUSA 4L0PA 2ZPXA 1P8JA 2ZX4A 3MYXA 3NVCA 1GYKA 1QH7A 2J42A 4AOCA 2XBO1 2RJ2A 2XLGA 3NQHA 3BU0A 4XFGA 3QACA 3A0NA 1ONAA 1HIXA 1W8FA 2RS11 2XONA 4YG0A 3WR0A 1DP0A 1KEXA 3AFGA 4YVWA 2JD9A 3AYDA 3W5NA 1VBD1 1R083 2ZGTA 1KRIA 1APNA 1GZTA 3ZYPA 4XUOA 5GZDA 2WZR3 1S2KA 3WUCA 4R9CA 2ZAAA 4FXGB 4DOUA 2V4AA 2GH2A 4GH4C 1VAVA 1LULA 3MV01 4AEDC 3ZDVA 4IEWA 4MXWB 2ZX1A 4KH9A 5JPMB 5LRRA 1W8WA 4R9DA 1FV3A 1XQNA 1AR82 2GP3A 3FMGA 3I3QA 1NZCA 2R49A 4K9SA 4Y1VA 3VBSB 5C8CB 5DAQA 2LROA 2X09A 4MX3A 4LO4B 4RHV3 3S5QA 3O1PA 3GZEA 5FZ3A 4NIDA 1JODA 1YWKA 4D8MA 2DWRA 1V9U1 3I3EA 1EUTA 4QXBA 5LATA 1YLLA 1AZDA 1JI6A 1IGOA 1NXMA 1VMFA 3AZVA 3KCXA 3LDRA 4LORA 1UMIA 1IPJA 2WZ8A 5FZKA 5K9YA 3ZIXA 1PNGA 2WFPA 5F2SA 2HJIA 4QPIB 1TMF2 2TEPA 1RUOA 5DUXA 1HRV1 3ETPA 3H0OA 3HVDA 3UESA 1ZZCA 3MPPG 1ZRCA 1HN0A 3I2DA 2CU5A 3FE5A 3ZLIA 4YVWB 4I0AA 5FYTA 3I2HA 3VZOA 3TNPB 4A7YA 2OW4A 4QAWA 5CFCA 5HPOA 1LOGA 2D6PA 5CG8A 5FZEA 3VHPA 4I01A 4BQXA 2YBKA 1EV12 1C28A 2WFF1 1JYNA 2FZ2A 2A7AA 2B9VA 2A3XA 4X6RB 2WL1A 2R0FA 2ZHLA 1PM7A 3HN3A 3DPRA 3MLKA 2ARCA 5IVBA 5FWEA 5FXVA 2BGOA 3R6SA 2RV9A 5FMDA 2BEOA 3WQBA 1DGWX 4JGZC 4L99A 3MIHA 4MO3M 4P9IA 1GNHA 3PNAA 3QOPA 4KNCA 4QX1A 1QXPA 3WW1A 4Q1PA 2D5HA 3PJYA 5FYBA 3M3IA 1FNYA 1RUH2 1WLWA 5T5LA 3HEIA 5FWJA 4COWA 1DCSA 1VBC2 2ZEWA 4W8JA 5E8AA 5FBZA 1ULOA 2BUKA 3OPZA 5EZWA 3VBSC 5EQUA 5FY0A 4FPFA 4DPNA 4HLTA 1UIKA 4Q0VA 4RA0A 4Q4V1 1NCQA 3DUIA 2Z2SB 1ULFA 4IEZA 5DG1A 2PAEA 1MS1A 1NA1A 4Q4W3 4XYXA 3UGHA 3I59B 4X8PA 2SLIA 1FATA 5FXWA 4A41A 4D6RA 1W6QB 3H8RA 4KGQA 1EPZA 4PIXA 2PHDA 3GYDA 4HKLA 1U5ZA 2VVDA 4Q5OA 4YVWC 1DIWA 2WINB 3PUIA 4HK9A 3ES4A 1CAVA 4UYBA 3ZM8A 2IFRA 1RITA 4IUGA 4AK3A 2EICA 1Z7S3 1GZWA 3LA2A 3R0RA 4ZZ5A 2OA2A 3N9MA 1T6GC 5LK7B 5E6HA 5F5QA 4A6SA 1NLRA 2NMOA 1JYWA 1AX2A 2VNOA 2RS52 4K21A 1RUE3 3ZFEB 4J6GA 4D6SA 4NIGA 4I09A 4PDWA 4MADA 4AI1A 3JQWA 3P6BA 1Q8VA 1H1AA 4QHOA 2ZGOA 4Z92B 1OLME 1JZ3A 1SDDB 2C4XA 1GMMA 3SNMA 1MZ5A 4IXLA 5LZ6A 1YO8A 4R8HA 3WDXA 4N53C 4O61A 5FR3A 1WLCA 4OUEA 3H8XA 1K5MC 1AJKA 3ILFA 3ZXAC 4H55A 3POBA 3ME2A 5LA0A 2LRPA 5J1XA 4MGZE 1MS8A 2DV9A 2RS51 1XC6A 3J8F1 4CCOA 3VZNA 5JLVA 1AJOA 1Z0HA 3ZYBA 1I5ZA 3PIJA 2JXAA 1RUJ2 1NCQC 2I2SA 4DZGA 4AZZA 1AR61 3PHMA 3CQOA 4M4RA 2XKOA 2YGMA 4Q4Y2 2W91A 3B02A 1XYOA 5DUVA 3MDPA 3Q8FA 1XNDA 1SG3A 4JV4A 2WIIB 2DVFA 3BB6A 4F7ZA 4A7ZA 2R062 4V1PA 1QWRA 1SBDA 3MZHA 4P5HA 1UU5A 2R043 5IWFA 5L9BA 4MXWA 5FPBA 1V6MA 1N1YA 3AKQA 4ORFA 4MGKE 4MGSA 4K6BA 4XHXA 4D7TA 2HYKA 5LA1A 1GR3A 1L7RA 1IPSA 3NV2A 3D0JA 3KSCA 1US3A 3V0AB 2ZMKA 3NL1A 2YGLA 3VBHC 1TMF3 4E8DA 2V72A 3FFQA 2IUWA 3ECQA 4XMIA 5FKBA 1TEIA 1UD1A 5A33B 2D5FA 2UYBA 4W50A 1HQNA 4KG8A 5FY9A 1RUH1 4NWWA 1G9CA 1JXNA 2VO5A 2X5IC 4HXCA 1RUC1 1VMJA 2DURA 3PU8A 3WP5A 2ZHMA 2FD8A 4EJRA 1FOD1 1AXYA 1NYWA 2RM21 3E6BA 2IXCA 2F6BA 4I0BA 1QJX3 2WJSA 4AVBA 5FP4A 2DCYA 3I3DA 4CCDA 2CL2A 2OZJA 2FDIA 4L92A 4QD2A 2GNDA 2RS32 1CWPA 4ARYA 1SLBA 3W59A 4XTPA 5HV0A 1WA4A 2ZMLA 3RWKX 3RFRA 3AXDA 3H9AA 5EHDA 4QX2A 4LBNA 4N43A 5FZ9A 2BFUL 1UKRA 3T4HB 1CAUB 2JDMA 5F5IA 4EWDA 3OEBA 5GZGA 4Y24A 1XNBA 1US2A 1KQRA 1JZ6A 1JYIA 1KITA 1NUKA 1CVNA 1W0NA 5JXHA 4Y1ZA 3C7HA 5SV8A 5I0UA 3GF6A 1AHSA 3WCSA 4B8EA 4CCJA 3RZKA 4YNIA 2W47A 5C3OA 3TEZA 2VMGA 1HB1A 4B7KA 2HWD2 5A7SA 3KGZA 2E26A 3BPSA 2VJXA 3TN93 1ZZ8A 5IVCA 2W1UA 2QQVA 4P5YA 2UWBA 2JDHA 4FPJA 1S0EA 3A21A 3ES1A 2J22A 2Q8CA 2XVKA 4NRPA 3QH6A 4XJAA 4Y22B 4S2DA 3INAA 4BZ4A 1JYCA 1VBB1 2VGDA 5DAXA 3WLUA 4KL1A 4RGKA 4YM2A 2Q8OA 2XB6C 3WT3A 4COZA 5C8WA 5IVEA 4AVVA 1LENA 3I59A 5F6KA 1I6XA 4NPMA 3CZUA 2VMIA 4XETA 5C3PA 3V0BA 4NMIA 4JTNA 3WDWA 5FOJB 5L36A 2ZA9A 4LE3A 3IPVB 2VTFA 1LHUA 1VRH3 2VZQA 2R6QA 4FFHA 3MW3A 4MYEA 2VCBA 3LF7A 4K8FA 1K5MA 3U11A 3OBRA 3ZXJA 1ZRRA 1UOFA 1LAJA 5LWBA 3IDEA 4IETA 4LHKA 1QJEA 2Y60A 3KHCA 4Q29A 4AYUA 3POIA 5KC6A 2IXLA 4Q0QA 1SEFA 3ROUA 4MHRA 2OPKA 1FPN3 4RFT0 2X8KA 4YW4A 5KC5A 2G19A 1IKQA 5FMOS 1DQ5A 4EZ4A 5BUVA 3NWKA 1POV0 2NZ9A 2K46A 3FBYA 4BMBA 3VDDB 1OD3A 3NO8A 1UQXA 1ASJ2 2BNMA 1WUVA 3OSDA 4YW5A 1OLQA 4Q0UA 4AVTA 2JWPA 2JDYA 1N1TA 4HETA 1WCDJ 4YZ2A 4ZU7A 5LASA 2Q1FA 1XYPA 4ZXKA 5C4WA 5KBFA 4FQ4A 1CPMA 4LHLA 4CDQC 2F17A 5CFCB 2X10A 4AAXA 3O12A 4TWTA 2ZXQA 2PHTA 5FY4A 1L7QA 5EIYB 3MPBA 3T4VA 5F9TA 4GKXA 4QPIA 3ZN6B 1ENSA 1HRI3 3ZR5A 1XJAA 3H1YA 5J37A 3JCIA 2BNOA 4MXVA 4AGGA 3TEWA 4U2AA 2XLFA 3ZFGA 4QKNA 2YFZA 3ZFEA 1VBA3 1YHFA 4CCCA 5A3OA 1FI2A 4LT5A 5FO7B 5FRAA 1ZZ6A 4QPGA 3ZXLA 4CXYA 2QQMA 4RN5A 2Q8EA 5A70A 4A3XA 1GQHA 1Y7BA 5FYVA 5GLZA 3F95A 3VBRC 5H9SA 2ZAHA 3W5MA 4AFAA 4P14A 3VD5A 1UAIA 3OGJA 3ACHA 5FZFA 3U14A 5K7PA 3HBKA 1H8TB 1W8ZA 1O91A 4XILA 1G9DA 3OJBA 2GSYA 1LU1A 5AVPA 3SH4A 2QQLA 3L2YA 4MG2A 1X8MA 5FZ6A 4A3ZA 1R082 5FUIA 4P9JA 1QNWA 2HWC1 2YC2A 3O0WA 4CCKA 3VDDC 3RI8A 2QDNA 3NKTA 3LPGA 2GH8A 4YW2A 3JB8A 2P5BA 3ITQA 5K0UC 3PTYA 4WVVA 5A7PA 3D0SA 5CFCC 3GZAA 1LCLA 4WM7C 3D6EA 2B42B 3CHXA 3NAPB 3IZOA 3TAYA 3OD4A 2WN3A 4PIYA 4XBLA 2W68A 3T1MA 4C0HA 2YBPA 2RS12 3VBRA 2ZZJA 4CUAA 1RUI1 3LGRA 4GD4A 4PHZA 4OHWA 5A3UA 4XIOA 2GP5A 4LK7A 1RUD2 2BERA 2LS6A 2W94A 3IB3A 3HN1A 3QD6A 3JD72 1QGLA 2UURA 2A6YA 2FMYA 1SBEA 2ZX2A 4TTGA 1W6MA 1U5YA 3D5OA 4NAOA 5H9QA 3ZKYA 4AEDB 5C7GA 4ZXEA 1H1IA 4OI4A 5CYYA 4Z8BA 1ZA4A 2BOIA 1UNBA 4H7LA 4CEYC 1UO9A 4YM3A 5CISA 3R4UA 4P9WA 2VC9A 2QDRA 4AAPA 1AL23 4XFBA 4NHMA 5FIXA 4WVZA 2MHFA 1LOCA 4LITA 3ZSJA 5IK5A 1BEV2 1GP5A 4IEPA 2R0HA 1SFYA 3KT4A 2O8QA 4LLOA 1O7FA 2XJRA 3AL5A 1FOD2 2RM22 5DAWA 5F3CA 4BIFA 2G9ZA 1G8WA 4CXXA 5EYXA 1LHNA 2NN8A 2C0ZA 1RUH3 3GBWA 3KHBA 4JDNA 1ZM1A 1XSQA 4QQOA 2WNUB 3GGLA 2P37A 1RINA 3FL7A 4NN0A 3OBAA 4YVSA 3BIEA 4WM7B 1O3RA 1CESA 1N47A 2VMDA 1HJGA 3M4FA 3NAPC 4FXKB 4PIZA 5FZ7A 5SV5A 3C3VA 4TN7A 2WNVA 2ZTNA 1AXZA 5DAVA 2KA3A 4KWUA 3FUOA 3ZYFA 2Y0IA 5FYIA 1FX5A 2XJSA 2HWF1 3PIGA 4LBMA 5T5PA 4CDWB 4Q4W2 4DQAA 4IDZA 4XUNA 1YJKA 2HWE2 1QOOA 1TE1B 2C26A 5LA9A 1QJY1 5BNOC 2RR13 1OQEA 3EMRA 1RUD3 1UZVA 2V4VA 2Q1MA 3JD73 1LOEA 2VOKA 4OMCA 3MUZ1 1PK6A 2WWJA 2D44A 1Y3TA 1D0GA 2YZ4A 3MLLA 4HKOA 1OA4A 1S0IA 2ZEXA 3RDIA 4PCRA 5F5CA 4LHNA 4RS5A 1N3QA 1TNRA 5FPAA 1MZEA 1AYN2 3FHIB 3FN9A 1GWKA 3VD3A 1YQ8A 1C5HA 3AYCA 4HANA 1PGW2 4OMDA 4XF1A 4HVQA 1POV1 3U37A 3QH7A 4XXPA 4AQ2A 2VZ1A 4N43B 4CVUA 3PDQA 5C3RA 4BK5A 5IAXA 2O14A 4QB2A 3SMHA 1C8M1 4N7IA 1IOAA 2K0GA 2WRAA 2DTYA 4CZSA 2IFWA 1PX4A 4URTA 2E7AA 3HNMA 5GKAC 5FYUA 2PQSA 3WEZA 3OGSA 3NJZA 2YU2A 4XQWA 4CEWA 4TXWA 5FZIA 2VUCA 2R072 4Q4V3 4XDPA 5E1RA 3Q8EA 1CAWA 1XNKA 1C57A 2JB4A 1J3PA 1DQ4A 4KU8A 3D8CA 2BBAA 1JZ4A 1W2AX 4QM9A 4CDUB 5FFOC 4IW3A 1JYVA 3TEYA 3I2OA 1YRZA 3K77A 4J1XA 3GZUC 2ES3A 2GMPA 1ZYBA 2P34A 5A3NA 3J8F3 3RZHA 3VD9A 4V2VA 3DGTA 3CEWA 3MF6A 4CDXB 5GJ6A 5EJZB 5B4XA 2QQWA 1PMJX 3N7LA 3FC0A 3U1XA 1W04A 5I8YA 1SACA 5GLVA 4GJYA 5AC91 2RG4A 4YG6A 4DNYA 3KM5A 3CJIB 1OURA 4ZPIA 5L9RA 4IL7A 5LK5A 1W6PA 4XZUG 1VB4A 1GQPA 1VP6A 4P9YA 3T09A 3L9JT 3OYWB 3POSA 1MVQA 1K3IA 3N7MA 3BOWA 3VDBA 3OTFA 2JJ6A 4SBVA 2BRTA 5JZGC 1XU2A 1YQ5A 4LLFA 5FJKA 1PGSA 4AI8A 1V70A 3TWIA 2RR11 1OOPA 2ZGLA 1RUF3 3JD71 1OQDA 4LEJA 4RSUA 5HBAA 4QXKA 5C70A 4IV3C 3AC0A 1UU6A 4ES9A 5DABA 3LDKA 1JOBA 1W9YA 2UWAA 3MO4A 2ILMA 3SKJE 4K3UA 5ANQA 5FK7A 5JSOA 4UBGA 2R30A 1TMF1 2WFF2 5A3WA 1OH4A 2ORZA 4RHV2 1LKNA 3WSOA 1HLCA 3KCYA 3WCRA 4JX0A 3PUHA 1PVC1 5GLUA 4AVSA 4AVAA 4TZDA 4XVHA 5CBLA 5L7OA 1AYM2 5M0TA 5FK8A 1GNZA 2LUWA 1C8M3 1ZVFA 3MIEA 1GZWB 1MZFA 3OUHA 1ZA7A 1QJX1 4XFCA 3T0DA 1CAVB 2G9GA 1W03A 2OPWA 2A3YA 4Q0PA 4U36A 4UW6A 3W58A 5ACA2 4S2HA 3DKQA 5LY1A 4URAA 2ID4A 1WD4A 3RMYA 4EN0A 5FYYA 2JE9A 3LEIA 4WM8A 3KQ4B 1EV13 5BNNA 3DL3A 4CUGA 2Y6GA 1MZ6A 1GU3A 2RE9A 3ACIA 3KV4A 3NNMA 5DN2A 4GQ7A 4M0HA 4AQTA 4BCUA 4OVEA 1XOYA 2OZ6A 3M3CA 2JKBA 2ZGQA 5CVRA 4JRLA 2HWD1 2OQ6A 2XGXA 1HJFA 2F4LA 4L2NA 2R041 2JEMA 4YW1A 2IC1A 2QFEA 5JIAA 4ASKA 4FTEA 5IFPA 1MS9A 2VOTA 5CKMA 3PMSA 4NOTA 1D2QA 3KQRA 5FZOB 2O0OA 4GWMA 4Q8KA 1UMZA 1QOTA 1RUI3 3PL0A 4LOSA 1ULGA 4AFMA 5F32A 3A22A 3UJOA 4XFAA 3HR9A 1GWMA 1JYTA 2FBEA 4YM1A 3QBQA 2DFBA 2XKPA 3LD8A 1L3JA 2A6XA 2EIGA 1J3QA 1LU2A 2WFF3 3AZXA 3AZYA 3VGIA 2XLAA 3HAGA 2I07B 3AP6A 2BNNA 3SEPA 1X9TA 3NNGA 1ZZ9A 3WG4A 5FUPA 4Q26A 1H2MA 2HEWF 3WF2A 2WNVC 1Q8SA 1WGPA 2FMDA 3SXWA 3ZYJB 4Y4YA 1EAH3 1S0BA 5HCAA 1KD7A 2W2IA 3IWZA 3PTRB 1QJZA 4BLIA 1SPPB 1W9WA 4OI0A 3T0BA 1MACA 4IESA 1MQTC 1WMFA 5BNPA 4ISRA 1GOHA 2J1VA 2W08A 2ZGKA 4LO6B 4AGVA 5BNQA 2CGOA 1XU1A 2D6MA 5FY1A 1BEV1 1NCRA 4FSJA 1GFF2 3G6JB 3MLJA 1WCKA 3MGUA 3I3BA 1W8HA 1SLAA 3I2FA 4Q4Y1 1RVF2 2VQTA 2BU9A 5L9VA 4QB1A 2BPA2 1GNYA 2R071 3I7DA 4PQ9A 1WW6A 3HQUA 4O65A 4C91A 1W39A 3BI3A 1QQP2 1M4WA 5A6YA 4CEWC 3PURA 1X33A 2ZABA 4YGDA 3T2QA 3VLBB 2Q30A 1S0CA 2XJTA 3M2MA 2KM2A 4H7MA 1LODA 1DYPA 4R4XA 2GDFA 1VPHA 1S0DA 3PLQA 1BXHA 3D3AA 3MICA 1REFA 4N7UA 3T30A 4QGLA 4ZU4A 4DINB 3N4MA 4FTBA 1BMV1 5DZFA 3OYWA 1CPNA 4F8AA 2W92A 5IVVA 2XUMA 4BQ5A 3BKZA 4FPYA 2MPFA 1R1ZA 2B45X 2JICA 4M3CE 4QPIC 1XSRA 2VPVA 3EXUA 4BH9A 4RQPC 4DXZA 4J25A 3NJYA 5FP7A 1W6PB 3LB9A 3UV9A 5FREA 5G05L 2E31A 5ABJC 2FCVA 1K45A 1EAH2 3ZFGC 4QKBA 1F4AA 1S2BA 2DUQA 2Y6FA 3S57A 2VW2A 3PUAA 4IE7A 2H0BA 2RMU2 3FHQA 3IDCB 3VBRB 4ZKTB 5FY5A 4UXAA 1L7LA 2HWC2 5FP9A 2A6ZA 4DUVA 4YW3A 1RMU2 2H6CA 4UFLA 5FBJA 1QH6A 1ST8A 1W6OA 3LE0A 3RNSA 1YFWA 2HWE1 3M7AA 4JDMA 3RGBA 4ASLA 5ACA3 1H8TC 1H9WA 4GIQA 3SITA 3RZGA 2UU8A 3KVBA 2XBO3 2Y0OA 4QPGC 3WNLA 2HWB1 3FHAA 1RL3A 3H8OA 4C1WA 2BP6A 1OLRA 1E5RA 5T55A 4G4FA 1RJ7A 1QJY3 4RD7A 2EAAA 1MS3A 1MS4A 2EXHA 1NE4A 1ZBE2 2ZGSA 3LEKA 2ET1A 4YW6A 4BOWA 1UYXA 5F3GA 3RI9A 3F2ZA 3NV4A 2ZS6B 2X53S 3C8XA 2FCTA 2P3IA 3I2KA 4UOJA 1ND3B 1WCSA 4Q4X3 4PI0A 4HBNA 4LO8A 5JSRA 3O14A 3DKWA 3BOPA 4BB3A 5JOYA 1ASJ3 4A6OA 1UYYA 4YM0A 3GALA 3WW3A 2ZEYA 4NUBA 1Q8PA 2WKKA 4AEJA 2CGNA 4H2AA 4R52A 1OA3A 1XYNA 4RQPB 2XJVA 4MZUA 4ZZ8A 2RDRA 3N36A 5IJRA 2ZACA 2P17A 1FOD3 2RM23 4KQ7A 4EZHA 1O5UA 4MGQA 1CIYA 4CEYA 1U0AA 5DDJ2 4NRMA 4QHZA 2OUHA 3VHOA 1PIV2 1UWWA 1X9PA 2D40A 1PO22 2RDSA 3E6DA 5EP9A 1CAUA 4I2OA 3FLRA 1UPSA 4DB5A 3N9PA 3E97A 1W8OA 1BHGA 5FYZA 2E7QA 5A1AA 2GMMA 3RYRA 3L2HA 3RG0A 5G04L 2UYAA 2A3WA 5JR2A 4Y4RA 2R1DA 3ZFFA 3LPFA 4WM8C 3BTAA 5GZCA 1KJRA 2UY8A 1PM4A 3AFKA 4Z82A 1W8TA 3SKVA 2HBUA 1BQPA 4P9XA 4YGCA 1QOSA 3J7HA 3ZX7A 3POGA 2VBDA 1ULPA 1F8VA 4FPCA 1UYPA 3LOBA 4JRAA 1HQWA 1N1VA 2V09A 4AWDA 4UAPA 4IV3A 4N8MA 1O4YA 2BW8A 3EJKA 4HZFA 1SHWB 4AFBA 1AL21 2N7GA 1V6OA 3C2UA 4EQVA 2MEV1 1Q5OA 3URFA 1AYN3 3E5XA 3T2TA 4Q4X2 4L97A 4OHXA 4W4ZA 4XDOA 1OMIA 1T2XA 4B1MA 2WO2A 4AFDA 2GC2A 3E5QA 2QKDA 4OHZA 3OY8B 1D4VB 3B00A 3WW4A 2AH2A 3JBG1 5FV3A 3O7OA 1LHOA 5L7OB 4GB32 3VBOC 5JWPA 3BODA 4PLOA 3IM0A 1WW7A 2YBSA 3I2IA 1QJU2 5FLHA 3ZN4A 2ZZQA 3LA3A 5JXJA 4FT8A 2IVJA 1W2NA 2IWGB 2YPDA 1MPXA 4AW7A 3KF3A 1D4M1 1DF0A 5BPXA 1DU3D 1NG0A 2Q1ZB 3J4UH 4FP2A 4OZXA 4PLMA 4Y5TA 5EJ1B 2YC4A 3VBHB 3WDUA 1DQ1A 4Y22A 3JQXA 5HCHA 1Z7S1 2XMLA 4S2FA 5LCWL 5B2GB 4CE8A 1IG0A 1QY4A 4XEZA 2E7TA 1AR92 2W1WA 2DBIA 2X5IB 3CNAA 5IVYA 2ORXA 3U4XA 4MV2A 4MGTA 4QXHA 1OC1A 1FV2A 4XJUA 3NMBA 5EV7A 3HD8B 3UETA 3ST7A 4LBQD 2A70A 2JIGA 4QX7A 5FYSA 2DCTA 1HRI1 2RDQA 5B4NA 4EE2A 1W9SA 4BU2A 4QQLA 1J84A 2VCAA 3FZ3A 3VKLA 3VBUB 4DXRA 1V6LA 3GBFA 2X05A 4FAGA 2CAVA 4DY3A 1YIPA 2XJUA 4CDUC 5IT6A 5LRSA 3BUCA 1LHVA 2G1MA 4JGYC 1OHFA 4OI1A 1R093 4K1ZA 4LBLA 2BVVA 2D97A 3MHZA 2G4IA 2D6NA 1T6BX 2VECA 3KD4A 4GMP3 5T50A 1MS0A 2VR4A 4OHYA 2ZOEB 2QZ3A 3VBOB 1AL0G 1B09A 1HRV2 2FDJA 4OCTA 4XF4A 4DRRA 2EA7A 4ET7A 3ZDSA 1RUC2 2D3SA 4XW3A 2DFCA 3I97A 2Q5TA 2C1FA 4CP9A 1SFPA 3WP3A 3IDBB 2D93A 2VXJA 1V6JA 3PVNA 3BU7A 4ZU5A 1BKZA 4LE4A 1FXZA 4BHPA 3WF3A 3LIHA 4LIUA 1F5JA 4BLJA 1XRUA 4Q4Y3 2FCUA 5ISLA 4DEQA 3ZSMA 4E27A 4IERA 1WW5A 4QT6A 3GCXA 5FMCA 1D7PM 2Z5WA 3N3HA 1HKDA 5DDJ3 1BCXA 5IW0A 4IV1B 3ILNA 1PIV3 1PX3A 3WXPA 4AHWA 2NPIA 1FYUA 2YROA 4KI5M 1G86A 4D0QA 3HJRA 4CP1A 1V0AA 2WT0A 5CB7A 1NY72 4CRQA 1NKGA 5AC93 2HH9A 3U0ZA 3AMHA 3RS6A 4UFHA 5FZ8A 5JMCA 1K42A 4BQ2A 2XWJB 1H1MA 1Z78A 3K75B 2BWAA 2VW0A 1IPKA 1YYNA 1KFXL 2WSUA 3N7KA 1D2SA 4JGYB 5HXVA 4ZY9A 5C9AA 1WLTA 2ENRA 4GKYA 1IQDC 1BEV3 2J1TA 2RJKA 2RS33 3ZO0B 2Y6JA 3ZXDA 2QQPA 2C9AA 2GN3A 4XCAA 2AEZA 1RUF1 4COUA 3MFCA 3TB0A 2PLV1 5D8AC 3RSJA 4DS0A 5K4LA 1CX1A 2B9UA 4DIQA 2O8OA 3USUA 2GN7A 3ZMNA 5IK4A 2QQKA 1ULEA 1OXCA 3WDYA 3O1VA 3N35A 5IHRA 2YUEA 4GULA 1RIRA 3M3EA 5A7WA 1W6NB 2WS93 1IS5A 4HT1T 4IGOA 1B35B 1A3KA 2PN5A 1Q3EA 4LKSA 1AR83 1W8UA 3VBSA 1CQ9A 4FPLA 1A78A 3IDAA 4XFFA 2HWD3 2P3KA 1YQCA 1UIJA 3ABZA 3MUY1 2GNMA 1DLCA 3VDCA 1OKOA 1COV1 2UWCA 4NWVA 2MNGA 2XHNA 4E2GA 2AZ5A 1X50A 3AJZA 4JGZA 4OULA 4DXTA 2TBVA 2WUHA 1UMHA 3HQRA 4G9SB 3R4DB 3AVRA 2NLRA 4QPWA 3RWNA 2WNOA 1JYXA 1Y9GA 3H50A 5LBFA 2OVUA 1OA2A 4QHBA 4H3WA 4XUPA 2Y6HA 3AP7A 1W05A 4JQTA 2AGSA 4QX5A 5FMOL 5A1LA 5JSPA 4ES8A 1MQTA 5BNPC 3AKTA 3BYWA 4K8RB 3VB9A 1VBC1 2YYOA 5F1RA 2P4EA 5FP8A 1C4RA 4RR3C 4UW5A 4DMIA 3D4KA 1RUJ1 5DAPA 3AM2A 4XTMA 4LKEA 5L73A 2XJQA 5FDBA 2FQPA 3H8UA 1ZZ7A 2W9XA 3H7YA 3DCQA 4ITCA 4LK6A 4UBHA 5DUWA 2VTXA 3POYA 1EV11 1E5HA 4X8NA 5FZGA 4AEKA 4CSWA 1G9FA 2VUAA 1V6KA 4QQHA 4XUTA 1PO21 1DG6A 1J83A 3ATGA 3K3OA 3S7EA 4YFZA 1JHNA 2YMZA 3OGVA 3LOIA 1FPN2 3UKTA 3C7FA 2R073 1JTZX 1DZQA
chains in the Genus database with same CATH topology
1B35C 1HV0A 1F2NA 1LOAA 2I45A 4RS5B 4EN7B 3UK9A 2CYFA 2YPJA 4SLIA 1F9KA 4L9BA 4GMP0 2ZGUA 3B94A 2VOVA 2VMHA 3AMNA 2R1BA 2PTMA 4W65A 4ATFA 5A33A 2IXHA 4XXAA 2WSVA 3FWEA 1PZ8A 5KXCA 3H1MA 4JGZB 1PGL2 2B5HA 1O3QA 3TRSB 4FOQA 3B01A 3CLPA 4AQSA 5D8AA 4MUVA 2RMU3 2Z42A 1Y9QA 1AR81 2NM1A 1PGL1 3NKGA 3IPVA 3V64A 3SH3A 1RMU3 4RR3B 5FCCA 1X7NA 4BPZA 3K48A 5F6LB 1D4M3 1J59A 2XBO2 1RUE2 1FNZA 1GSLA 1G9AA 1F31A 1RUF2 3AMMA 2BWCA 2WLQA 3CO2A 3EHKA 3J9SA 1U5IA 4AXOA 2C5DA 5ABJB 3VZLA 4QQPA 1SCSA 2WNUC 3WD5A 5EXOA 5HCBA 1DLLA 4RS5C 5T54A 4RHV1 1H2NA 3WG1A 5CFDB 3ZXKA 2DU1A 3VN4A 4EN9B 4LA2A 1W2UA 1JW6A 1EP0A 2EXKA 5JIUA 3WW2A 4CDWC 4WVMB 4AGRA 1BBT3 4PJYA 1S0GA 3JUUA 1ASJ1 4OHVA 4BM8A 4XQ4A 1MEC2 2W0XA 4AI3A 4B4RA 4ZU7A 2KXLA 1UKGA 2PFWA 5C6CA 3B9CA 2Z79A 3H1WA 4I0WB 4Y1XA 3NAPA 4YYOA 1U12A 2DYCA 1K5MB 3TYJA 3WP4A 5J98B 1GZCA 4M3CB 4QU2A 1RUG1 1TME3 4HSJA 1XE8A 4N43C 2DTWA 1N3OA 1PVC3 1V9U2 3CU7A 3WNXA 5FAXA 4Q27A 1NCQB 2OUJA 1ZRDA 5JI9A 2EAKA 3E5UA 1COV2 3VBOA 4KU7A 1H8VA 4YARA 4I3PA 1GQGA 3D82A 5EWSA 2YXSA 1RMU1 4BE3A 3CF6E 1VBD3 1VBE2 5AFEA 3UKNA 2GAUA 3NSTA 4FPGA 1GKBA 2BQPA 1HW5A 3B5LB 1GV9A 2ZX0A 4WVMA 3ZYIB 2ZX3A 2BVBA 1GANA 3LKJA 1KS4A 3ZYRA 3VUOA 5JPNB 1KJLA 3JBG3 3NW4A 2ERFA 4HN0A 1KS5A 1J1TA 4IEOA 2JECA 4XPVA 4M01A 4XMAA 2PELA 4CYDA 1FPN1 3TN92 4G3YC 3SLIA 5KHJA 5DG2A 1Q56A 4K1YA 1QJY2 4A7KA 4FAHA 1NLSA 3DF0A 1QJU1 1AX0A 1NQDA 1BBT1 1ZBE3 4TSVA 5DXDA 1BMV2 4PDWB 2PQQA 3ASIA 5JZGB 5TSWA 3RYKA 1YXWA 2ARXA 4GALA 3AX4A 1PNFA 3CJIA 5BNOA 1JBCA 4N53A 5C8CA 4YRDA 3W9AA 1BVVA 1QQP3 1LJ7A 1S0FA 1FMD2 1RUNA 1COV3 1PK6C 4FOYA 3T1LA 1CIWA 3O0XA 1X82A 5L19A 2IXKA 2D43A 2VW1A 1LB2A 2D6OX 4CDXA 5I8TA 1AYM1 5JCTA 3HT1A 1AXKA 1VBE3 4RGAA 4IEVA 2PHFA 4Q4V2 3JB4C 2O1QA 4N9HA 2DCKA 2H6BA 3VZKA 3RPQA 5JOWA 1N3PA 3EBRA 1OKQA 5I0SA 1NA1C 5E88A 5DZEA 5GLWA 1MEC1 3KS7A 3THTA 1ND2A 1BBT2 3JZVA 1PO12 4OI2A 2G9FA 4FOWA 4BYYA 2Q0AA 1Q8QA 1J3RA 2Y38A 3ZVXA 4PDWC 5K8SA 2K2SA 4GWNA 1HV1A 1HXS3 2DUOA 1CJDA 2CV6A 3DPRB 4XJ8A 1R1A2 2CAUA 3LWCA 3RZZA 5IK8A 3WX5A 5AC92 3VHRA 3MW4A 1SDWA 1PK6B 2A5ZA 2HWB3 1TME2 1DQ0A 2ZGRA 4X6QB 5HCFA 5I0RA 4B4QA 1CJPA 2XHKA 1BVP1 1ZBA3 4Q1RA 2ZJCA 4HPKB 5ABJA 4XF0A 1DZTA 5EFUA 1ZBE1 4XHBA 2SBAA 4XE9A 1I9RA 2PHWA 1SLLA 4KG0A 3VZJA 1EYBA 1AUYA 4Q2FA 1RUJ3 4IV1C 5JI7A 2WNVB 4XDQA 3WOGA 1PZ7A 2DUPA 4WM7A 2ZHNA 1NA1B 1VBD2 4LBQA 4YG3A 2JG8B 3ZN5A 1RTVA 1PO23 2WQ4A 3WP6A 4M3CA 5A3MA 3WHTA 1GICA 4XJ9A 1C8M2 2BYVE 4QGMA 1AYM3 3NV1A 4HKWA 3S30A 1PO13 4XQDA 5T52A 1S0JA 3KLSA 4CP0A 4LBKA 3MIFA 4YSFA 2GC0A 1UU4A 2ZGPA 3ZPYA 2A71A 3M3OA 5KXBA 1OOPC 1JUHA 3AXEA 1WLDA 1R1A3 2XVLA 4C0BA 4AEDA 2XPJA 1BZWA 3ENRA 1DGLA 1RUG3 3FLPA 1OFSA 1VBB3 2EXIA 2WLPA 4LUMA 5DDJ1 4XJZA 5JVVA 4NR1A 3S7IA 3KB5A 4XBQA 1GLHA 1V00A 1OI6A 3VHNA 2VVEA 4BIOA 4NVPA 1RUC3 2IXJA 2RS31 3CL1A 1YIFA 3V65A 1RHI1 4XFHA 2DVDA 4HMZA 1NXD1 4F3JA 3O0VA 1C8NA 1CR7A 2XH6A 1EPWA 5D1IA 4OUSA 4RGGA 4D7SA 3APBA 4AG4A 3DN7A 1ZNPA 4GA9A 3WY6A 1DGRN 1DFQA 1DZRA 1A8MA 5BNPB 1IKPA 4OLLA 1H0BA 1LOFA 2ARBA 5CG9A 2VULA 2ZGMA 1VALA 4QM8A 4I3GA 5CADA 1JN2P 4JAAA 1KDKA 2AREA 3O5SA 4AFCA 4TLFA 2MEV2 4IQPA 4LUKA 4M0NA 3Q9OA 3KT7A 4LO7A 3A0KA 4EV0A 5I91A 1C1FA 3PVBB 4ONUA 1ND3C 2YHJA 1LOFC 2D7FA 2PLV2 4CDQB 1OPOA 4GXLA 1PHMA 5CU1A 2RMU1 4N9IA 1RVF3 4COYA 4PF5A 3AKSA 4UW4A 4Y20B 1TME1 1YFXA 2B8MA 1O3TA 5J09A 1HX6A 3AYAA 4AQ6A 4Z2WA 1IS4A 1ZBA2 1R1A1 1U5XA 1OQ1A 4PLNA 4MVTA 1WD3A 4Q0SA 5KHIA 1VBE1 1NOVA 1AVBA 4LBJA 2VOWA 4FQZA 5J7MA 1LHWA 2WC2A 2ZCWA 4QGNA 4Q4W1 4MGIE 4BWOA 5JDBA 4WM8B 3QCWA 4FP3A 1YNAA 4IEYA 1IZ3A 3SHRA 4I30A 2DVBA 2BTVC 3RYPA 4D69A 1ZX5A 5KHKA 5BYNA 4D94A 3VKFC 3J26N 1C3HA 3FUQA 1DBNA 1SBFA 4RR3A 3ZXFA 4Y1UA 2B7YA 3HWJA 4D7YA 1NCRB 1W6NA 3U07A 4W6YA 5CFDC 3RQ0A 2BBVA 4K7JA 3MIBA 1W0OA 1WW4A 2VVFA 3USUB 4WBBA 1AR71 2UY9A 2R061 4FCAA 2AR6A 3ZSEA 3BIWE 1QHDA 4N90A 5FO9B 1ZBA1 3AYEA 5FO8B 1AR62 3MIGA 1UF2C 5JR7B 5C9AB 3VBUA 4FPEA 2PHLA 1HXS1 4P9LA 4CTEA 5AFBA 2EALA 4CEYB 1UPIA 4DFSA 2E9QA 3IKWA 2QZ2A 2R042 2RS13 3LSDA 2X5IA 5CAZA 3P3NA 2WNEA 3JU9A 3WQ7A 5BY5A 2ZKLA 2QNKA 2GALA 2CNAA 5FQ0A 2EXJA 2I74A 4K20A 1MR5A 3ZSKA 4AI0A 5HI0A 3VBHA 1UCXA 3VKOA 3ZYGA 5LEJA 1CAXA 3ZXGA 3KGLA 5A32A 1WMDA 4OUMA 3PVOA 4AHXA 4AE2A 2HWF2 4KGGA 5T5JA 4WV8A 4FTSA 3HMYA 1QJX2 2YV8A 1AL22 1R081 2MEV3 2LALA 2PAKA 3IBMA 4H14A 4AVCA 1YFUA 3WZ1A 4IEUA 5BNNB 1WMEA 3HBZA 3V56A 1WBLA 1JUIA 2PAMA 3UJQA 4R9AA 3ETQA 1VJ2A 1SLCA 1W0PA 1OD5A 1UZZA 5KHGA 4WZFA 2XL9A 3B9IA 1POV3 1SFNA 4Q8LA 4N53B 2WA4A 1DDLA 3B93A 2PHXA 1QJU3 4XJWA 2VH9A 4C90A 4RL7A 2WT1A 4JQRA 3RJRA 4AI2A 4FBFA 2WA3A 1XXNA 1QXRA 5C33A 3VL8A 3THPA 1JOJA 1HDKA 3SH5A 1IQAA 2RR12 3KMHA 3VKNA 3FJSA 1RC6A 3TN91 2Z69A 4XBNA 3WUDA 4Y1YA 1AR93 3AMPA 4MLOA 2ZGNA 2HWF3 4INDA 3R4SA 1TNFA 2LM3A 3M3QA 2W52A 2K9ZA 2XJPA 4XF3A 1D4M2 4RQPA 3WDVA 3SCGA 5BNNC 5LEKA 2V73A 2JDZA 1LOBA 3ZXEA 5JAXA 3FFZA 3WG3A 1ALYA 4FPKA 5D8AB 4CDXC 2ZBJA 4L8QA 3ALQA 2XL7A 4E4DX 2ATFA 3WINE 4YGEA 4O9EA 2TNFA 4I02A 5KXDA 1R092 4C1XA 2JG9B 1IHMA 1I3HA 3VBFB 1RB8G 4XF9A 5FPXA 1A6CA 1Q8OA 3GBGA 1DHKB 2VQ0A 2R16A 2WZR2 1BJQA 3JBG2 4OFGA 1PVXA 4CDUA 1H4HA 4S2GA 2ET7A 1CAWB 5IK7A 1CN1A 3OCPA 3FBMA 2VUJA 3OD0A 3B3QE 5BXXA 4B3NA 4Q4X1 4EROA 3DPRC 5I93A 1H2LA 1MEC3 1OFNA 2ETEA 5FLJA 2CWSA 3ZFFB 5GZEA 4IEXA 1EAH1 2VOXA 1PGW1 4JDOA 1LRHA 4NHKA 1QMJA 1UL9A 2XG3A 5A3LA 2V5YA 3KCCA 4ASMB 2CWMA 2A6WA 1VBA2 4M00A 5J36A 4B29A 4CDQA 1PO11 1FMD3 1KDMA 2CTVA 4JVAA 3UKVA 4E9KA 2JD4A 4HL0A 2E53A 1O4TA 1SQ4A 1NY71 5J3UA 5CFDA 1C5IA 2DCZA 2DF7A 4GH4A 3SISA 2JG8C 1E57A 1X36A 1PMIA 1ULCA 3EQEA 1SLIA 2H0VA 4MSVA 3K51A 1M06G 5GLTA 1ND3A 3ILRA 5I0TA 2CY6A 3LCPA 4XOGA 1QU0A 1WBFA 3KZ4C 4YZ1A 2AUYA 2VNRA 2D6LX 4QPGB 2GC1A 4DY5A 3QLQA 2CGPA 5FLIA 1UW8A 3WG2A 3HQXA 1ZZBA 3MW2A 1RHI2 1H30A 2A6VA 2R063 2LTNA 2B46X 2QJVA 4KBBA 1VR3A 4NPRA 3WV6A 2E6VA 5CNAA 2QUOA 1A8DA 4JC1A 2JENA 4AHYA 2HWB2 2EF6A 4JGYA 2D98A 4W6XA 3UL2A 5E16A 1AF9A 2WWSA 3MF9A 4E4SA 1W6MB 1LGNA 3LZZA 2E63A 1RUI2 4B4PA 5J48A 2QCSB 2DVAA 1REDA 3I8TA 3AP5A 4Y20A 2HEVF 3PVEA 4IEQA 4E2SA 3ELNA 3U10A 1ZRFA 4WVWA 4AHZA 4UW3A 3AK0A 5DZGA 3RMXA 4F83A 2JG8A 3SCFA 5H9RA 4BA6A 3V0BB 4DRVA 4GB33 3EO6A 2TUNA 2W39A 4QQ2A 3WHUA 3LAGA 1R091 3AKPA 3AP9A 4ISQA 4L11A 4CEWB 1QQP1 1RHI3 4KWLA 1PZ9A 3OGGA 5K0UB 2YY1A 4COVA 2JG9A 3VBFA 4P9GA 4Y26A 5KHHA 1H8TA 3VZMA 1RVF1 2HWE3 5CIRA 4HVRA 2PHRA 1ENQA 5FQ0B 5I8SA 4TYSA 4HPKA 2WZPP 5H9PA 1RUG2 2YDEA 1OSGA 3WQ0A 2GNBA 3IIAA 1Q43A 1B35A 5JOXA 1VAKA 2PHUA 4A2UA 3GZTB 3WDTA 1DQ2A 5T3NA 1VLNA 4R4ZA 1AX1A 4Z07A 4XZPA 4GMP1 3ZFGB 1MS5A 4MH0E 2NQYA 1VRH2 1F5FA 2PYTA 2XWBB 1W6OB 3ZMOA 1QF3A 3ZN6A 3M70A 5JOZA 3HIFA 1DGWA 2AENA 1EY2A 4LA3A 2HEYF 2Y26A 4EN6B 4QPYA 2P2KA 3BALA 3HT2A 1AR91 2EVXA 3NV3A 1VB2A 3WVJA 3ZFEC 1G9BA 1SCRA 2ZHKA 1HRV3 4HK8A 1AR63 1REEA 2QVSB 2GZWA 4JTOA 1QXJA 2WNUA 1H9PA 1QDOA 4EWEA 1I1EA 4MGYE 1Z7S2 2OYZA 3N7JA 1NCRC 4QMAA 3M8LA 3V0AA 2WZR1 4XIKA 2GU9A 2X29A 1RUE1 4IV1A 1AR73 2RS53 4HFSA 3G7DA 3DV8A 2A73B 2GMEA 4FOVA 3OBTA 4GB31 3CJXA 1NQJA 2DU0A 5BNOB 3AB0A 2BFUS 4LBQB 2YC0A 1BK1A 3LSEA 4YZ3A 4YFWA 1VBB2 2HKXA 3GHNA 5C9AC 4HVOA 5ACA1 1PVC2 1V9U3 2VQAA 1AYN1 4YVSC 5A32B 3ACLA 1SMVA 2PA7A 2VG9A 3R05A 5KXEA 5J96B 2R32A 3H3UA 1DGRA 2D3RA 1UN1A 3H7JA 3FLTA 2D3PA 3GNEA 4J1WA 3B7MA 3PMEA 2RHPA 4E2QA 3P3PA 4FPHA 1LEMA 1YCIA 3AMQA 5KWRA 4PBPA 1ULDA 4NO4A 2ZKNA 4FVVA 1GBGA 1VAMA 1DQ6A 2WS92 2A75A 1RJ8A 2OIIA 3KT1A 2DVGA 1V6NA 4KWJA 2VU9A 4YLZA 1VIWB 4PBOA 1G7YA 5DUUA 5GZFA 1IS3A 2JX9A 2IZWA 2D6KA 3POWA 4NHLA 2NYYA 5CA6A 2ZMNA 3FX3A 2IXIA 4FPOB 3TNQA 5L7OC 1W6QA 5K0UA 4YZ5A 5IUQA 1IS6A 3B69A 1C1LA 4D3WA 1LECA 5FTTC 3IT8A 4AEMA 4YVSB 2PLV3 4LR4A 1YJLA 2VXRA 3CJIC 1LESA 1V6IA 3OY8A 4LBOA 1S55A 2FZ1A 3PJQA 1CAXB 3VKMA 4ATEA 2GNTA 1J1LA 4R9BA 2NP0A 1FMD1 1FAYA 3IMNA 2JE7A 1QDCA 3VL9A 2E51A 1ENXA 4LNVA 2QE3A 1GZ9A 3I4IA 1Y43B 5AVAA 4E4ZA 1RUD1 4HSLA 3A4UA 2WQZC 4B7EA 1QKQA 5FOBB 1UZYA 2DCJA 2WT2A 3AKRA 4IV3B 1UX6A 2NMNA 4BMEA 3WQ1A 3VBUC 1ENRA 5JZGA 3VDDA 1ZREA 1SLTA 1KFUL 1O3SA 3USSA 4W6WA 4WZCA 1YFYA 4YGBA 5E89A 2VY0A 4K40A 1CGPA 1O5LA 4YZ4A 1CONA 1DYKA 4P9YA 3LA7A 3MIDA 4HN1A 4META 1QNYA 3RJ2X 4M3CF 1OOPB 2XVGA 1KXGA 1BYHA 3X29B 4BQ1A 4EWAA 3MEPA 1HQLA 3AZWA 5GALA 4XFIA 1HXS2 1AR72 2RJLA 4LO5B 5C4WC 2JG9C 5GM0A 3VBFC 1ND2C 4KWKA 1MVEA 4CP2A 3OF1A 1PIV1 4Y5Z0 2P3JA 1J58A 3IN9A 3RRDA 1D0HA 4JCKA 4LTAA 3S6PA 1LR5A 2FHRA 2B39A 1LGBA 1VBC3 3BCWA 1NE6A 1RGSA 3VV1A 1O4ZA 4Z1VA 1URXA 4FO9A 3I54A 2Q4SA 3ZFFC 1G6NA 2GC3A 3S0MA 4GH4B 4O9GA 1XNCA 2AYHA 1FT9A 5EYYA 1X8EA 5EJ3A 1YUDA 1H2KA 4LULA 4EN8B 5C8CC 1YI9A 1XE7A 1YI7A 2VNGA 3SCHA 3M1HA 3TOJA 1LTEA 2BGCA 3MFAA 1HRI2 1OPMA 1N1SA 3MI8A 3J8F2 3AP4A 3ZSLA 1VBA1 3AZZA 2WS91 3BPZA 5T5OA 3TBDA 3GHMA 1LEDA 2HWC3 1VRH1 5FPZA 2F4PA 1CD3G 1S1AA 3AJYA 5C4WB 1LGCA 1ND2B 1JH5A 4AF9A 1H4GA 1TQ5A 1CX4A 3H3ZA 1MQTB 2ZPXA 3MYXA 2ZX4A 3NVCA 1GYKA 1QH7A 2XBO1 2XLGA 4XFGA 3QACA 3A0NA 1ONAA 1HIXA 2RS11 4YG0A 3WR0A 3AFGA 4YVWA 3AYDA 1KRIA 1VBD1 1R083 2ZGTA 1APNA 3ZYPA 5GZDA 2WZR3 1S2KA 3WUCA 4R9CA 2ZAAA 4FXGB 4DOUA 2GH2A 4GH4C 1VAVA 1LULA 4AEDC 4IEWA 4MXWB 2ZX1A 4KH9A 5JPMB 5LRRA 4R9DA 1FV3A 1XQNA 1AR82 3FMGA 3VBSB 4K9SA 1NZCA 2R49A 4Y1VA 5C8CB 4MX3A 4LO4B 4RHV3 1YWKA 2DWRA 1V9U1 3ZIWA 1YLLA 1AZDA 1NXMA 1IGOA 3AZVA 3KCXA 1IPJA 5K9YA 3ZIXA 1PNGA 2WFPA 2HJIA 4QPIB 1TMF2 2TEPA 1RUOA 5DUXA 1HRV1 3H0OA 1ZZCA 3MPPG 1ZRCA 3I2DA 3FE5A 4YVWB 4I0AA 5CFCA 3VZOA 3TNPB 4A7YA 2OW4A 1LOGA 2D6PA 5CG8A 3VHPA 4I01A 1EV12 1C28A 2WFF1 2FZ2A 2A7AA 2A3XA 4X6RB 2WL1A 2R0FA 2ZHLA 1PM7A 3DPRA 3MLKA 3R6SA 2BEOA 1DGWX 4JGZC 4L99A 3MIHA 4P9IA 1GNHA 3PNAA 3QOPA 4KNCA 3WW1A 1QXPA 4Q1PA 2D5HA 3PJYA 3M3IA 1FNYA 1RUH2 1WLWA 5T5LA 4COWA 1VBC2 5E8AA 5FBZA 2BUKA 3OPZA 5EZWA 3VBSC 4FPFA 4DPNA 4HLTA 1UIKA 4Q0VA 4RA0A 4Q4V1 1NCQA 3DUIA 2Z2SB 1ULFA 4IEZA 5DG1A 2PAEA 1MS1A 1NA1A 4Q4W3 4XYXA 3I59B 4X8PA 2SLIA 1FATA 1W6QB 4KGQA 1EPZA 4PIXA 2PHDA 3GYDA 4HKLA 1U5ZA 2VVDA 4YVWC 1DIWA 2WINB 4HK9A 3ES4A 1CAVA 4AK3A 2IFRA 1RITA 1Z7S3 1GZWA 3LA2A 3R0RA 2OA2A 1T6GC 5LK7B 5F5QA 1NLRA 2NMOA 1AX2A 2VNOA 2RS52 4K21A 1RUE3 3ZFEB 4J6GA 4I09A 4PDWA 4AI1A 3JQWA 1Q8VA 1H1AA 2ZGOA 4Z92B 3SNMA 1MZ5A 4IXLA 1YO8A 4R8HA 3WDXA 4N53C 1WLCA 1K5MC 1AJKA 3ILFA 3ZXAC 4H55A 3ME2A 4MGZE 1MS8A 2DV9A 2RS51 3J8F1 3VZNA 5JLVA 1AJOA 1Z0HA 1I5ZA 2JXAA 1RUJ2 1NCQC 2I2SA 4DZGA 1AR61 3PHMA 2XKOA 2YGMA 4Q4Y2 3B02A 1XYOA 5DUVA 3MDPA 1XNDA 4JV4A 2WIIB 2DVFA 3BB6A