4FSJA

Crystal structure of the virus like particle of flock house virus
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
343
structure length
315
Chain Sequence
QTAPVPQQTRLSQPGLAFLKCAFAPPDFNTDPGKGIPDRFEGKVVSRKDVLNQSISFTAGQDTFILIAPTPGVAYWSASVPAGTFPTSATTFNPVNYPGFTSMFGTTSTSRSDQVSSFRYASMNVGIYPTSNLMQFAGSITVWKCPVKLSTVQFPVATDPATSSLVHTLVGLDGVLAVGPDNFSESFIKGVFSQSACNEPDFEFNDILEGIQTLPPANVSLGSTGQPFTMDSGAEATSGVVGWGNMDTIVIRVSAPEGAVNSAILKAWSCIEYRPNPNAMLYQFGHDSPPLDEVALQEYRTVARSLPVAVIAAQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords Capsid protein beta
publication title Structural study of virus assembly intermediates reveals maturation event sequence and a staging position for externalized lytic peptides
rcsb
source organism Flock house virus
total genus 67
structure length 315
sequence length 343
chains with identical sequence B, C
ec nomenclature ec 3.4.23.44: Nodavirus endopeptidase.
pdb deposition date 2012-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4fsjA00
3JD71 2WZR2 1RUD2 1VBE3 4GH4A 1ND3A 3NAPA 1E57A 2RS51 2R071 4CDUA 1BEV2 5L7OC 1CD3G 4RS5B 2XBO1 1TME2 2WZR1 5D8AC 1QJY1 1FMD1 5DDJ3 2ZTNA 1NA1C 3VBRB 2GH8A 4QPIB 4SBVA 1K5MB 1PIV3 3JB8A 4GB31 4IV3A 1ASJ2 4Q4V3 5BNOC 4WM7B 1NY72 2HWE3 1QJX2 1VBA1 1FPN2 1Z7S2 1OOPA 1R091 5K0UC 2RMU2 4WM8B 4Y5Z0 1VBE1 1AUYA 2X5IB 3VBUB 2PLV2 1X36A 4GMP3 2MEV3 1NCRA 3ZFGA 1C8M2 4PDWA 1AYN2 4CDXC 4RQPB 1HQNA 3JBG3 3VDDC 1DDLA 1EAH2 1V9U2 5CFDB 1C8M1 2HWB3 4Q4V1 2HWE1 3ZFFB 4GH4C 1ND3C 2RS12 3NAPC 4Q4W2 5ABJA 4N43B 4CDUC 1PVC3 1V9U1 1RUF2 1RVF3 4CEWA 4YVWA 2MEV1 1RUE2 2RS11 4AEDA 2WFF3 1WCDJ 4Y4YA 3ZFEB 2DF7A 4JGZA 2HWB1 1OOPC 4CDQB 1MQTA 1R082 2WS92 2RS33 1PVC1 3ZFGC 1NCRC 1RVF1 4PDWC 5C4WA 1R081 2WFF1 2R063 2RR12 2WLPA 2WS91 1AYM3 3JB4C 4CDWB 3VBOC 5CFCB 1RHI3 4RS5A 1AR82 1B35B 4N53B 2BBVA 4Q4Y2 1M06G 1QJU2 3VBRA 4QPIA 1RMU2 1ZBA2 4RFT0 1F2NA 1HRV2 1VB2A 2BPA2 5BNPC 1QQP3 4WM7A 1QJZA 4YVWC 2HWF2 4Q4Y1 2R042 4JGYB 1QJU1 4QPGB 4WM8A 1ZBA1 4AEDC 1HRV1 2X5IA 3VBUA 3VBFB 2R061 1AYM1 1COV3 1AL22 4JGZC 1RHI1 2FZ2A 2R041 4IV1C 3JD72 4RQPA 1FOD2 5J96B 2HWD3 1RB8G 1MQTC 2RS52 3CJIC 1HRI3 1AL21 5CFDA 5C9AB 2XBO2 3ZFFA 4YVSA 1R1A3 1FOD1 4RR3A 5AC93 1QJY2 1FMD2 1HXS3 2HWC2 5C4WC 4N43A 1BBT2 3DPRB 2RM22 2HWD2 5FMOS 1AL0G 4GB32 4RS5C 4CEYB 1VBA2 1RUJ3 1R092 2HWC1 2WWSA 3VBRC 1BBT1 4QPIC 2RM21 1VBE2 1K5MC 2HWD1 5AC92 1RUG3 1VRH3 3ZFEA 3VBHB 2FZ1A 4NWVA 1HRI1 4WM7C 1F8VA 4BCUA 5J98B 4WM8C 1R1A1 1RUJ2 1SMVA 5AC91 5L7OB 1VBC3 1PO13 2X5IC 5DDJ2 3VBUC 1C8NA 1PIV2 3VBSB 1RUC3 5ACA3 4Q4V2 2HWE2 4Q4X3 1RUJ1 4RQPC 5JZGB 5DDJ1 1VBB3 4CDWA 1PIV1 3VBOA 1RUG1 1OHFA 5CFDC 1B35A 4N53A 2MEV2 3ZFFC 4YVSC 1ND2B 4RR3C 5ACA2 1VBD3 4N43C 5A32B 1VBC1 3JBG2 5BNPA 1RUH3 4GMP1 1NCQB 4JGYA 2HWB2 5ACA1 4QPGA 4Q4X1 2TBVA 3VBFA 1PGW2 2BFUL 3JBG1 3ZFEC 5BNNB 1PVC2 5A33A 1AR73 1RVF2 4IV1A 3NAPB 2Y26A 3HAGA 1AR63 1PGW1 1VBD1 3CJIA 2WFF2 1RUI3 1AR93 1MEC3 1AR72 3J8F3 4NWWA 4IV3B 4CDWC 4CEYA 1B35C 1RUI2 2RS32 4N53C 1AR71 2XPJA 1H8TB 1K5MA 2BFUS 1AR61 3VBHA 5GKAC 2R062 1AYM2 1RUI1 1TMF3 2RS31 4PDWB 1RHI2 4JGYC 1MEC1 4QPGC 1W39A 3VBFC 3J8F1 2VQ0A 1X33A 2BUKA 1EV13 1QQP2 5ABJB 1PO23 5JZGA 4CEWB 1D4M3 1OPOA 1QQP1 1TMF1 4FSJA 2R073 1VAKA 1COV2 1ND2A 4RHV3 3TN93 1VB4A 3DPRC 3LOBA 2WZR3 1RUD3 4CEYC 1NG0A 3IDEA 1CJDA 1D4M2 1HRI2 1NCQA 1COV1 5C8CB 4FTEA 1BEV3 1EV11 3FBMA 5LK7B 1R1A2 1PO21 4Z92B 2QQPA 1TME3 1HXS2 4LLFA 3VBHC 5BNNA 1D4M1 1POV0 1A6CA 5C4WB 1ASJ3 2ZAHA 4CDQA 4RHV1 1HXS1 1QJX3 3TN91 1FPN3 1Z7S3 3ZXAC 2RMU3 5D8AB 3VBSC 1RUG2 1RUD1 1VRH2 1NA1B 2PLV3 2GSYA 5JZGC 1BEV1 3M8LA 1C8M3 5BNOB 1TME1 1AYN3 1VBC2 1PO12 5CFCA 1VRH1 5K0UB 1RUC2 1ND2C 1EAH3 1H8TA 1V9U3 4Q4X2 1ASJ1 1NY71 1QJX1 1PO11 1VBB2 1FPN1 1Z7S1 2RS13 4Q4W3 2RMU1 4CDXB 1NCQC 1RUC1 1RUF3 2PLV1 3VDDB 1RUE3 1POV3 1GFF2 1VBD2 1VBB1 5BNNC 1AYN1 4YVSB 4RR3B 4GH4B 1ND3B 1RUH2 4CDUB 4CDQC 1EAH1 5C9AA 1NOVA 1BMV2 1RUH1 4Q4W1 1R083 2WS93 1RUF1 3DPRA 4IV3C 2IZWA 1AR62 1RUE1 1POV1 5CFCC 1BMV1 1OOPB 2RR13 5C8CA 1AR92 1PGL2 1IHMA 1MEC2 1AR83 1H8TC 4FTSA 3ZFGB 1NCRB 3J8F2 4Q4Y3 1QJU3 1RMU3 1ZBA3 1HRV3 1AR91 1PGL1 5L7OA 3VBOB 2HWF3 2R043 5D8AA 3VBSA 1ZBE3 1NA1A 1TMF2 5ABJC 2RR11 1AL23 3S6PA 1AR81 5FMOL 4CEWC 5BNPB 5BNOA 3JD73 4YVWB 4FTBA 1FOD3 5C9AC 5K0UA 2RS53 4AEDB 1RMU1 1ZBE2 1EV12 1HX6A 5A32A 1PO22 2XBO3 5A33B 4JGZB 2HWF1 1QJY3 1FMD3 4IV1B 2HWC3 4CDXA 4GMP0 1BBT3 1ZBE1 2RM23 5C8CC 1MQTB 3VDDA 4GB33 2R072 3CJIB 5FOJB 4RHV2 1VBA3 3TN92 2ZZQA 4EJRA 1R093
chains in the Genus database with same CATH superfamily
3V56A 2WZR2 2OVUA 1HN1A 1V6IA 2VNVA 3IDCB 3NAPA 1ZVFA 1H4HA 2RS51 4A3XA 5A1LA 5L7OC 1W6PB 2GNTA 3AL6A 1B09A 1UXZA 4PQQA 3AZYA 4LNVA 4GKXA 4DOUA 2VTXJ 5FY5A 1TME2 2WZR1 5IT6A 1V6KA 2IWGB 2Y8KA 3ZSKA 2IXJA 4ZU4A 1HN0A 3PL0A 1EP0A 4BIOA 2VZSA 2NP0A 2D6PA 2CSGA 3GYDA 1PK6B 1Y9MA 2QE3A 4L9BA 4Q4V3 5LBBA 2HWE3 1WBFA 2XJTA 1QJX2 4MO3M 4JKKA 3WV6A 2QVSB 2YG0A 1Z7S2 2YY1A 1R091 4V2VA 4Y1ZA 3WW2A 5K0UC 4ORFA 1JYXA 1ULOA 1OPMA 4B29A 1PX4A 1H2NA 1SLTA 1VBE1 4HONA 5FZKA 3W58A 4XW3A 1GWKA 1JXNA 1OC1A 1QNWA 2PLV2 3VBUB 3BYWA 3VDAA 2RJLA 1X36A 1YXWA 5L9BA 3S7EA 1DQ4A 4Y1XA 4Z1VA 3THTA 2A7AA 1ZRFA 3RS6A 1C8M2 5KC5A 5A6ZA 4PDWA 3ZIXA 1AHSA 4CDXC 2DVBA 2R6QA 4QX3A 1YRZA 3I97A 4JVAA 1HQNA 1ZM1A 4LBKA 3HT1A 2W3JA 3GALA 3VDDC 3AZWA 2BV4A 3Q8BA 5CZKA 1IGOA 4EV0A 3H8OA 3RI9A 1DDLA 5CFDB 3C7FA 1C8M1 1KXGA 2ETEA 2XG3A 3ZFFB 2ZXQA 4GH4C 2QCSB 4LK6A 2VOVA 1UX7A 4MZUA 1FAYA 2BGCA 1I6XA 4P9XA 1VMFA 3TBDA 5IFTA 1QIQA 1PVC3 4LA2A 3KCYA 4W50A 3BUCA 1TVGA 4XAAA 5FYTA 4YZ5A 5AFBA 5JPMB 2ZHLA 4TTGA 2QDNA 2PQQA 2MEV1 2ZX4A 2IVJA 4E8DA 2BERA 1GQGA 1WCDJ 1XPWA 4XJWA 4QB6A 2DUQA 1LOGA 2QZ3A 3ZO0B 1W3XA 4QKFA 3ZSJA 5J09A 2E63A 3CO2A 4NRQA 4R4XA 3ZFEB 1U5XA 4MH0E 4JCKA 5HPOA 3HNMA 4FPFA 3LPGA 4N9HA 4NOTA 2QQLA 2YMZA 2HWB1 3L2HA 3O14A 4GWNA 2K46A 2ZBJA 1MQTA 4WV8A 4YG0A 5C7GA 3H8UA 4NE9A 5C8WA 4R8HA 2D5FA 5FPBA 5A3UA 3C7OA 3THDA 4AQ2A 3ZFGC 4F83A 3F95A 4FFHA 1VAMA 2GC1A 2P37A 1K3IA 4AXOA 3WDTA 1W8NA 4CCOA 1DGWX 3AXDA 3RFRA 3ZN6B 3SQOA 3CHXA 4L2NA 1W05A 1GBGA 2WFF1 1DQ6A 2R063 3JB4C 1UN1A 2C9KA 4CDWB 2XLFA 5DZEA 4CCDA 1WZXA 5CFCB 1RHI3 3OPTA 4KWLA 2X8KA 4D0QA 4URAA 1S2EA 2CGOA 4N53B 5GZEA 3D4KA 1QHDA 2ZX0A 4D6SA 3HN1A 3MUY1 4C0HA 1BVVA 1VB2A 5F37A 1S0GA 2UU8A 2W92A 2LS6A 4QQ2A 3O1MA 1RUNA 2WNOA 4GULA 1QJZA 3VZNA 4XABA 2R042 2EF6A 3I2JA 4JGYB 4C91A 3RZLA 2NN8A 1AX2A 4DY3A 4OYUA 3LE0A 2Q1MA 2LM3A 2X5IA 4HBNA 3WW3A 1SCSA 4X6RB 1AYM1 3HBKA 3FN9A 4XVHA 2OW4A 4PI0A 3ACGA 3KS7A 4R4ZA 3WNOA 4JGZC 5I8YA 3ECQA 2FZ2A 2R041 4IV1C 3VZLA 3JD72 1IS4A 2H0BA 2ZMNA 1QJFA 4L99A 5J96B 2WN3A 3W20A 3OYWB 3HOBA 5JOWA 2XMLA 1GZWB 3BOPA 3NV1A 4YNIA 3UGGA 3HVDA 5T54A 4Q0SA 2A70A 5AC93 1UMIA 5C4WC 2A3WA 3KCXA 1BBT2 3AP4A 3AVSA 3KB5A 4X8PA 1Q8SA 2PMWB 2HWD2 2RM22 4YW4A 4LBMA 4IE6A 5FMOS 5FP8A 4MGZE 4GB32 3H7JA 4NR1A 3SHRA 5FJHA 2WNVB 2LTNA 1O8PA 2VBDA 3MLJA 5LA9A 1VBA2 1RUJ3 2JDZA 3WDVA 1Q43A 4COWA 5A6YA 5C71A 3R4SA 1C57A 2ARXA 2WWSA 1DQ0A 4J6GA 3L9JT 4MX3A 1EY2A 1BBT1 3UJQA 3BTXA 2RM21 1PM4A 2HWD1 3BGAA 5CISA 2OQ6A 5FO8B 3NKTA 2XJRA 3VBHB 1REDA 2QBXA 2OS2A 4NWVA 3ST7A 2BU9A 4G4FA 1S0DA 2WRAA 1W28A 4BCUA 1HDKA 2W95A 2VZTA 5DDJ2 1GOHA 2J1AA 5GLVA 3VBUC 2ZGUA 1ZZ9A 3NJZA 3VHNA 3EB7A 4LKDA 2J1RA 1V6JA 1G86A 3I3QA 3LFMA 5A3TA 1U0AA 4QX5A 1GR3A 5DDJ1 2VQAA 1FV3A 5FK8A 1YYNA 4OI0A 3R0RA 3GBGA 4QX1A 1RUG1 3AYEA 5FZ1A 1OHFA 5E16A 5CFDC 5FY7A 1SDWA 3VV1A 3FLTA 4YW5A 5HCAA 4PBPA 5CB7A 1UPIA 4NHYA 4YVSC 3ZFFC 4IE0A 4R52A 4HVRA 4YFWA 5FKCA 5FZIA 4I0AA 4XHBA 4BQ5A 2GNMA 4DUXA 1XNKA 5A32B 5FRAA 2J7MA 1CAXA 1GWLA 1VBC1 2FDJA 1ENQA 4LHLA 2YFUA 4QB2A 4BDVB 4MXWB 1RUH3 4OVEA 3D5OA 4IW3A 4QQLA 3UV9A 4LO7A 5FQ0A 1K45A 1NCQB 3MW2A 1JYIA 4A7KA 2HYKA 2NZ9A 4J1XA 4LE3A 2GNBA 2BOJA 2D3PA 2TBVA 1QOSA 3T4VA 1W8ZA 3D6EA 1PGW2 3MIEA 4JDMA 4LE4A 4V2WA 4XZUG 2R1BA 3GF6A 3WZ1A 5FZ0A 1DLLA 3ZFEC 4YYOA 1CESA 4DY5A 1RJ7A 3M4FA 1RVF2 4IV1A 1D0HA 4HPKB 2G9GA 4IE5A 5FYBA 3AFKA 3HAGA 4DZGA 4E2QA 4QD2A 5DAQA 3A23A 1PGW1 3S30A 5IVJA 1VBD1 3JZVA 2JB4A 2IXHA 4RSUA 3OPWA 3L2YA 4DUWA 2HJIA 4LO5B 2O1QA 3M3CA 1DHKB 1VIWB 1AR93 4HETA 4CP0A 1MEC3 2NQYA 3AYCA 2R0FA 4HK9A 4D7SA 3GHMA 1D2SA 1VE0A 3AMHA 5EYYA 3B3QE 3ZYFA 1T2XA 5FY0A 4CP9B 4CDWC 1WD4A 1W6PA 2LROA 3VL8A 3T2PA 1RC6A 2DVFA 3AP5A 2RS32 4HKOA 4N53C 2WO1A 4XOGA 2E51A 3I2HA 1NX9A 3GJAA 2A6XA 4HMZA 4JRAA 2FCVA 3T08A 1EYBA 4A45A 1NKGA 3HWJA 2DFBA 1PK6A 1CAWA 2WL1A 2DTWA 2RS31 4QDRA 4YM2A 5DAWA 4XIOA 4D7YA 4JGYC 5FYMA 1N1YA 1N47A 4QQPA 1DFQA 2ZGMA 3N9NA 2RHPA 2AREA 3EYPA 1JW6A 1W9FA 2JX9A 2VMDA 4IXLA 1W9YA 2XJUA 2YC0A 4ISRA 1E5IA 1JU4A 2VVDA 2BUKA 4M0NA 1EV13 3MICA 3V0AB 3DF0A 5A3NA 1JUHA 4E2SA 1PNFA 4YZ2A 3UESA 4XACA 3KGZA 2VOTA 4XDOA 3P3NA 4KWUA 4W6XA 4FXKB 4UFKA 5EYXA 4OHXA 3WD5A 3GHNA 5DZFA 2JB8A 2GH2A 2P6HA 2WYFA 3P5BA 5FMCA 5FOBB 1TMF1 1LTEA 4E4ZA 3MHZA 4MHUA 1HLCA 2J42A 1GV9A 1W6OB 1UYXA 1UAIA 2XOMA 2J1UA 1VB4A 2EIEA 2Y6JA 1BYHA 5KHJA 1HIXA 2WZR3 3HQUA 4MGKE 4YLZA 5CADA 1D4M2 2WNVC 5F5IA 1US2A 1OVPA 2EICA 1FX5A 2I07B 1LU2A 4IESA 4R9DA 1CR7A 2VOWA 1ULFA 3KMHA 1DQ2A 3E6DA 1R1A2 2QQPA 1TME3 1BK1A 1HXS2 1LJ7A 3B5LB 2QNKA 3VBHC 3BALA 2W46A 3CMGA 1D4M1 4XMIA 3WP6A 1POV0 1QWRA 2IXLA 3KT1A 2FDKA 2AEZA 3H42B 1A6CA 3PLQA 4XFAA 3FZ3A 3U07A 3ZXGA 1KGYA 3LWCA 4FPGA 2R0HA 2ZAHA 4I01A 5T5JA 4RHV1 3O1PA 1HXS1 1NXMA 1QJX3 3TN91 3ZYGA 2ZMKA 3DYOA 3H7YA 1O8SA 1Z7S3 3I2DA 4W65A 5D8AB 4LBNA 4CPBD 1XSQA 2JIJA 4I3GA 1W8TA 1NA1B 3NKGA 4XJAA 4FCAA 2PLV3 3M2MA 2GSYA 2BGPA 3BODA 2FDFA 2ZGQA 1BJQA 3B00A 1GOFA 2P1BA 3ME2A 1C8M3 3ORJA 2W47A 1LULA 4JRLA 5BNOB 4FFFA 2VNOA 4QX0A 5CFCA 3PNAA 3OTFA 3DEMA 2EA7A 1N1SA 1XE0A 3LQCA 1C4RA 4AFBA 5A7NA 2B42B 4L0PA 2A6YA 1DLCA 3AMNA 4QGNA 3H8XA 1ASJ1 4Q29A 2WLQA 1OA2A 1NY71 1ULGA 4OULA 3RZZA 1DZTA 2CL2A 4EN0A 3K2OA 1NCQC 3WEZA 4XQDA 1XU2A 5KHKA 5T55A 4O9GA 3U11A 4DXZA 3KHCA 4X8NA 4Y3OA 2D98A 3P1IA 3EMRA 2ZGOA 1J1LA 5DAVA 1IPSA 3IT8A 2R16A 1AYN1 2OZJA 5FMBA 5B4XA 3WNLA 2VMFA 1C28A 3MO4A 2Q8CA 4EZ4A 4HKWA 5DABA 1XJAA 4BM8A 4FI9A 5FK7A 5JI7A 3T4HB 2AACA 5FO9B 4K20A 5F8PA 2ZJCA 5JVVA 2D93A 3RRDA 4CDQC 1EAH1 5JOXA 3OYWA 3ZYPA 4YWAA 1SDDB 1XE7A 4H7MA 4QPYA 3R4DB 3MEPA 5F5QA 5FUNA 5SV5A 3I2OA 3I2FA 1W9TA 1CVNA 3FLRA 5BXXA 1H6XA 1JZ7A 4BH9A 4EN9B 4AAXA 3SCFA 3VGIA 3UKNA 1DYOA 3CZJA 3MIBA 4XQ4A 4E2GA 3DV8A 4D69A 3QH6A 1PM7A 1BVP1 1QY4A 3DYPA 2ADEA 1OT5A 2DCTA 4UFMA 2Y0OA 4KMQA 3PVBB 1X7NA 5GALA 4CCJA 3TEWA 2IVIB 2LALA 4GJZA 4BK4A 1C1FA 3NO8A 1PGL2 1EUTA 2GMPA 3BTYA 3E97A 1WW7A 1OQDA 1X8EA 4FTSA 3WP3A 3ZN4A 4NIHA 3J8F2 1CZTA 5FZCA 1OKOA 1HKDA 2EIGA 1F9KA 2W52A 3HR9A 4N90A 1LHVA 5A3WA 3JUUA 4IGPA 4MVTA 2XL9A 2YC2A 3TB0A 3A0NA 1PGL1 1UYYA 1YFWA 2ZHNA 4QXBA 1YIFA 4W6YA 4L92A 4K9SA 2R043 3RNSA 1WLCA 2XVKA 3CU7A 3GBWA 4NIDA 2VO5A 4NIGA 1RINA 4LO4B 5EXOA 2WBKA 4AF9A 4B7EA 2KD7A 4JKLA 1PMHX 2FCTA 3OEAA 2WZEA 5JSRA 4MLOA 1YC61 5FYZA 1H2KA 3N9LA 5LA0A 5BNPB 1AXYA 3JD73 3AM2A 1FV2A 2QQWA 2ORZA 2UY8A 3A21A 1OLQA 1UO9A 2DUOA 3CF6E 5T50A 3I54A 5C9AC 1RMU1 2FQPA 2FDHA 3K4AA 2AR6A 4BQWA 5FO7B 1HX6A 3OBAA 5A32A 3SKJE 1UPSA 4UFHA 3KQRA 3O0XA 4FAGA 2JDHA 3IPVA 5A33B 2HWF1 4MXWA 1F5FA 1LESA 3ELNA 1QU0A 5AFEA 1BBT3 5FPAA 4AG4A 2RM23 4YM1A 4AVVA 5JIUA 1ZRDA 4JTOA 1MQTB 2VD7A 3R4UA 4GB33 3CJIB 5HXMA 1RTVA 1VBA3 4GWJA 5A6XA 2RDNA 1W6QB 3B9CA 3O0VA 1DCSA 3VHRA 3BU0A 1RUD2 1ND3A 2CAUA 3WNPA 4HPKA 1UW8A 1ENRA 1OD5A 1W6MA 4AOCA 3WX5A 4CDUA 3MYXA 1J83A 3POIA 3RJ2X 3NV4A 4XF9A 1S1AA 4HG6B 5FBJA 3ZLIA 4BXSV 2OQ7A 5D8AC 5E89A 3WCRA 4YW1A 5FPXA 1STMA 4XBNA 1QJY1 5DDJ3 1NA1C 3UETA 4EROA 3HBZA 5H9SA 4D8MA 1W2OA 2GH8A 4W8JA 2GMEA 5J7MA 1VR3A 1GQHA 3M3OA 3NJVA 1O3TA 4HXCA 1HV1A 1WBLA 3JB8A 5IK4A 1RYYA 2Z5WA 2Q0AA 4LKEA 1REEA 5BNOC 3S57A 5FZGA 3MF9A 5LBFA 1Z0HA 2VBBA 4IEQA 4K1ZA 3T1LA 4Y1UA 3VL9A 4A42A 2A6ZA 2A6WA 2X5IB 2XKPA 1V6NA 2OXBA 4H3WA 3KHBA 3AC0A 5FZHA 5K7PA 2NPIA 1SLLA 5BPXA 2ET7A 4AYUA 4A44A 1WD3A 2HBTA 1YQ6A 2GAUA 5J3UA 3WW4A 1S0CA 3R05A 1G9DA 1QOOA 1ST8A 1I1EA 2D3RA 1H2MA 3WG3A 2XKOA 3I3DA 4RL7A 3N9MA 4HSLA 3D8CA 4ZY9A 4UF0A 3O1VA 1SCRA 2HEVF 4TSVA 2ZACA 4QGMA 4TYSA 3KM5A 3VDCA 3V0AA 2JENA 3IM0A 2RS12 3NAPC 2PHTA 4Q4W2 3IAPA 4CP1A 4BXFA 1C5IA 2VZVA 1KS5A 2YXSA 3DKWA 1RVF3 2JDAA 2VQTA 2BQPA 4YVWA 3BTZA 1RUE2 5JOYA 2OZ6A 2RS11 1A78A 3KV9A 1MS5A 3ENRA 1UU5A 5CVRA 2G4IA 1W6OA 5FREA 1H1IA 5FY8A 3VBRB 1DGRA 2F6BA 4BPZA 3SISA 1ZZ6A 2CWMA 3IKWA 2CDOA 2JKXA 4MSVA 4AI8A 1M4WA 1ZA4A 3CKHA 4EE2A 4F8AA 1LHNA 3H8RA 1BQPA 3BIWE 4BMBA 5DUVA 3EO6A 3LEIA 2XH6A 1MACA 4EWEA 1FATA 1TNRA 1JMUB 2W91A 4GWIA 4YGDA 5FZ4A 2RS33 3S5QA 3N4MA 1RL3A 2CWSA 5I0SA 1QGLA 4LK7A 5JIAA 4CU8A 1H1MA 5FZMA 5LA1A 3OB8A 1GYKA 4PDWC 4YZ1A 2OUHA 5HV4A 1MZEA 4LEJA 3DL3A 4CSWA 5I91A 3MIFA 5DAXA 5GLUA 3AJYA 5E88A 1XXNA 5A3LA 5HXVA 1AR82 4OHWA 4NJ4A 3FL7A 3QBQA 2BBVA 4C90A 4Y1VA 1OQ1A 2Q30A 4HN1A 3DYMA 4UW3A 1W9WA 4B1MA 4AGRA 1MS0A 1NLQA 4ZXEA 2VG9A 2Y34A 4P9YA 3J7MA 2EALA 1CAXB 3ES4A 1DF0A 3NJYA 4QHBA 5A3PA 3NVCA 1KRIA 1J58A 4AR2A 1O3QA 5BNPC 1BK0A 3ACHA 1BKZA 4WM7A 1IKQA 3N7LA 4KWJA 5FQ0B 3WP5A 4NVPA 1W8HA 2BP6A 2WZPP 3V0BB 2A75A 4FOYA 1TEIA 3PUSA 3KT7A 4WVWA 3U75A 1ZRRA 2XVGA 4LXLA 2WN2A 3PVEA 3LA7A 3KF3A 1OBNA 2YV8A 4IQPA 3O1TA 1JN2P 1AL22 3IN9A 2L9LA 1RITA 1OLMA 1CZVA 3CDZB 3KV6A 3WG4A 3DUIA 4BLJA 2VUAA 2VOXA 5BNQA 1A34A 4RQPA 2NLRA 2RJKA 5BY5A 5FYIA 2XGXA 1MQTC 1FYUA 2RS52 4YW3A 2VU9A 3CJIC 1GNYA 2P17A 4IE4A 4OZOA 3AB0A 1KJRA 1AL21 3NRUA 4C1XA 1YWKA 1JHJA 4LKFA 2XQRA 1R1A3 2WQ4A 2GC2A 2A1XA 1HXS3 3BI3A 1L3JA 4N43A 1TZOA 1X50A 4M4RA 4JX0A 4QWNA 5J37A 2SLIA 3B02A 2XONA 3KSCA 2WAAA 1YQ5A 5AVPA 5I0TA 5J48A 4FP3A 5FY1A 4YM3A 1GP6A 1KITA 1R092 1NAEA 1H9PA 2YUEA 1S0FA 1VBE2 2E7TA 4OHZA 4C1WA 5JCTA 3NL1A 3USUB 1EPWA 1CAWB 3RPQA 1HRI1 4O7XA 4HL0A 3WDXA 2E31A 3ZKYA 1W04A 2P3KA 2AEYA 4DXSA 2X5IC 3PVNA 2LW8A 1JUIA 4F3JA 1PIV2 2J1EA 3ZYBA 1JHNA 5F5AA 1UY0A 5ACA3 1IQAA 1AX1A 4LOSA 4UOJA 1ZNPA 3NMBA 4OI1A 2FD8A 2X29A 1UU4A 5FZ3A 5LB6A 2D6MA 1MZ6A 2ARAA 1XNAA 3VKMA 2IFWA 1PIV1 2GALA 2W9XA 4I02A 3K51A 1VJ2A 1B35A 2VAUA 1OUSA 2DV9A 1QKQA 2MEV2 2BYVE 2VM9A 2WYSA 2DWRA 5HCFA 3POBA 2VPVA 2PTMA 2FMYA 4DIQA 3U10A 1LHWA 4LBQD 2ZGSA 2JE9A 5BNPA 2VTXA 1NT0A 1YFUA 4IEZA 3LD8A 2JWPA 2VW1A 2W39A 1ENSA 1AZDA 2B7YA 2HWB2 4QPGA 4Y5SA 4Q4X1 3LA2A 2CV6A 2WO3A 2ZX2A 4BHPA 5LW9A 2WT1A 1JYVA 1D0GA 2UURA 2QQOA 2BFUL 2YHJA 1X9TA 2ZOEB 4QQOA 3VZMA 5LCWL 3AKTA 1SQ4A 1H4GA 3HNBM 5A33A 1AR73 1JOJA 2ERFA 4HOOA 2Y26A 4META 4S2DA 1WMXA 4P5HA 4LUKA 4AEMA 1UXXX 5IK7A 5APAA 1OVSA 1OQEA 5DN2A 5A6QA 3CJIA 1LRHA 2DU1A 2PAEA 2WFF2 3LOIA 1RUI3 4S2GA 1TNFA 3RGBA 2OT7A 3WHTA 3F2ZA 1JS9A 4XUTA 3WDYA 4B8EA 3WQ0A 3T1MA 1UZWA 1W6QA 4QQHA 4CU9A 3SEEA 3UL2A 5FXWA 4FOWA 1ZA7A 2O14A 3GZTB 4XJZA 4Y26A 3J8F3 1IS3A 4IV3B 2C1FA 4OUSA 4COUA 3PUQA 1N1VA 1REFA 3Q8CA 2DCKA 1AXKA 4OMCA 4XF0A 1K5JA 1DYPA 4PLOA 4XXPA 3ZYJB 4AZZA 5FMDA 1GNZA 3IWZA 3N36A 3AP6A 4YZ4A 4P5YA 2JDKA 4A2UA 4QXCA 4BK5A 4XIKA 2VY0A 2XR4A 1DGLA 4YARA 3K75B 4URTA 3ZVXA 1FXZA 5IVYA 3SITA 4AE2A 4YG3A 5DXDA 3MLLA 4CRQA 2BFUS 1AR61 5EJ3A 3H9AA 4KWKA 1NE4A 1LGCA 4S2HA 4M3CF 3VD7A 2FDGA 1AYM2 5JXGA 5FXXA 3WDUA 5JMOA 1SZBA 2A5ZA 1CWPA 3CL1A 4MV2A 3RI8A 1CJPA 1MS4A 2GN7A 3NNLA 4YW2A 2WABA 4KU8A 1GP4A 5H9PA 2VQ0A 1P8JA 4LT5A 4UFLA 4P08A 2VZRA 4LIVA 1ZZCA 2O0OA 3E6CC 5IK5A 1V0AA 4DMIA 3PIJA 4I3PA 2Z69A 4HZFA 5JZGA 2ZEYA 4K21A 4H55A 2VUDA 4NRMA 4O61A 3FFQA 4QXKA 1UMZA 1G9BA 2DCJA 1Q8OA 3LDKA 2ZMLA 4IE7A 4XAEA 3T2TA 2V4VA 2LUWA 3FE5A 4XUQA 1VAKA 4YW6A 4AEKA 2YC4A 5FIXA 5CKNA 1ND2A 1W3VA 3W59A 4XCAA 2D3SA 2HEWF 4Q27A 3VZKA 2AUYA 3AKRA 1SLIA 1SEFA 1RUD3 3ABZA 5IVEA 1JZ3A 2WUHA 2E53A 4R9CA 4XDQA 3FHQA 1ACCA 3ZSEA 2W1WA 3A7QA 3VN4A 5EJ1B 4FTEA 1L7QA 1JH5A 3BTAA 4AGVA 4LBJA 3DGTA 3ON7A 2V73A 1PO21 1WMEA 3GXUA 1I9RA 5AVAA 1MVEA 5F1RA 4LLFA 2YYOA 1PK6C 5JR2A 1FI2A 3S0MA 1LB2A 4K3UA 4LR4A 5GLTA 2VECA 1DYKA 1KFUL 3FUQA 2B9UA 5K9YA 5LBCA 1YLLA 3HJRA 1H0BA 4XCBA 3POYA 1XRUA 4TLFA 3POEA 3ZXAC 4ARYA 1GKBA 3B01A 1RUG2 4ITCA 3H3ZA 4BE3A 5FLIA 5JI9A 3ASIA 3KVBA 4RD7A 1BEV1 2OKXA 1W0NA 3ZXEA 4YPJA 4QXHA 4CCNA 1JOPA 3NJXA 3NW4A 1VBC2 2VOKA 3WXPA 4AI9A 4CE8A 5I8TA 5L9RA 4TXWA 4XYXA 3U4XA 1OSGA 3G7DA 5FYVA 1J3PA 3IAQA 3PU8A 5F3GA 1D2QA 5L19A 2WNEA 1A8MA 2Y6GA 4XTMA 4ATEA 4I2OA 4IEOA 3WG1A 2XXZA 4PF1A 3MZHA 3IPVB 2TUNA 1FPN1 2VUCA 2RS13 2VW0A 4L8QA 4LITA 4Q4W3 5JUVA 2RMU1 3CNAA 2E7QA 3LB9A 3OGJA 3V0BA 2NYYA 2JDNA 2W1QA 1GZCA 2BVBA 3SH4A 4NPMA 4HSJA 4XEZA 4XJ8A 1PVXA 1RUE3 1VBD2 2RG4A 3ILNA 4L11A 4FFIA 1ULDA 2ZGLA 2PHLA 4QHOA 2PXJA 4RR3B 3H1WA 1ND3B 2VL4A 5A7WB 1W6MB 1UKRA 4FFGA 3RYKA 4CDUB 4DEVA 1CONA 4M3CA 4RGKA 1TE1B 2H6CA 5F2SA 5FWJA 2OYZA 4I0WB 1OLRA 3LEMA 1K12A 4Q8LA 1W2TA 3I49A 1YI7A 4B1LA 3AX4A 1VP6A 3HT2A 4GALA 5IYYA 4DRVA 5D1IA 1WLDA 5FYHA 2AYHA 3K3OA 3JCIA 4AEJA 1MS9A 1S2KA 1QXJA 1SPPA 1RUF1 1UIJA 4WZFA 2ENRA 2BRTA 4IV3C 4NUBA 2WAOA 5LZ6A 4K40A 1Y7BA 1G6NA 2ARBA 1POV1 3HIFA 3LCPA 4H2AA 1WWYA 3DXUA 2GP5A 1UOBA 5CFCC 4Y20B 4CCMA 5C8CA 2A71A 2CYFA 2R30A 1Y3TA 1UY1A 1IHMA 2VUJA 3IZOA 3VKLA 1AR83 1GWMA 1OI6A 4A7ZA 1F5JA 4BA6A 3J4UH 4YGBA 3FLPA 1LOFA 4UYBA 2F4LA 3USUA 1I5PA 3ZXJA 1WA4A 4EZHA 4FQ4A 3CEWA 1QXPA 4OZXA 3U4SA 1YJKA 1MS1A 2V09A 5FUPA 5A7QA 5FFOC 1QXRA 2RDQA 4PQ9A 1H30A 1U5IA 2OUJA 5FYUA 3OGGA 1J84A 1IG0A 1RJ8A 1W2UA 3VBOB 2X53S 1W90A 1GICA 2B4KA 2XQXA 3ATGA 3AZXA 5T5PA 4UF0B 2ZHMA 4XUNA 2B39A 4Q26A 2HYXA 5FP4A 1TMF2 3I2GA 2IFRA 2RR11 2JKBA 1IKPA 2YU1A 2D6OX 3PMEA 4P9LA 1AL23 2VULA 2N7GA 3MDPA 1LOAA 1E5RA 1OD3A 4KI5M 4YVWB 1HV0A 3KD4A 3HPNA 3WUCA 3POGA 5ERLA 1AJOA 1NUKA 2RS53 3MBWA 5L73A 1ZBE2 1GUIA 4CPBA 2DDUA 2R32A 4GAZA 4H7LA 1ULPA 1K42A 1U5ZA 5FZDA 4CP2A 4CU6A 1D4VB 2VTFA 4Q2FA 1KDKA 1S4CA 2KXLA 2OX0A 5JR7B 3O1SA 1ZBE1 3ETQA 5C33A 2XLAA 3A4UA 1DZQA 1WMFA 2FCUA 2OPKA 2R072 1ZRCA 4XXAA 3SC7X 3EBRA 3SCGA 4RHV2 3ZOIA 3TN92 5FZAA 4Y4RA 1R093 2FHRA 3LKJA 4Y22A 5IAXA 2ZZJA 4RFRB 3E1F1 1VBE3 5FAXA 1KFXL 4FPOB 5FZOA 1QF3A 5EIYB 1E57A 2R071 2Q8EA 4BQXA 3ACIA 3AZZA 2XHNA 1TQ5A 4QX8A 4P9JA 1JTZX 2X10A 2XBO1 5E1RA 1FMD1 3S7IA 4CUBA 3GGLA 3W5NA 4DB5A 3QOPA 1K5MB 1PIV3 1AJKA 2ILMA 1OH4A 4IV3A 4KBZA 1ASJ2 3ES1A 4WM7B 1NY72 3M7AA 1W6NA 1XU1A 2CU5A 5T5OA 4MOAA 3ZR6A 4EN8B 3JU9A 1OOPA 5FUIA 3O0WA 5GZCA 3GBFA 1X82A 4PHZA 4W6WA 4Y5Z0 1AUYA 1LGNA 2KM2A 4YG6A 3BPZA 3D0JA 3W21A 5LEKA 2MEV3 1NCRA 5FPVA 3THCA 2R1DA 2FMDA 2NMOA 4ISQA 4OHVA 4AFMA 1AYN2 4RQPB 2V4AA 3KV5A 4AQ6A 3SKVA 1MR5A 5FR3A 2G19A 4NHXA 3ZYRA 5IHRA 5JXIA 2EIBA 2XJVA 1BXHA 1EAH2 5F9TA 5DUXA 1NZIA 3O5SA 2HWB3 2JDMA 4Q4V1 3AKQA 2HWE1 3GZUC 1C3HA 2XVLA 4LO6B 3MI8A 4P9GA 2DU0A 1ND3C 1WA6X 2RDRA 4N43B 3IIAA 4XDPA 4OQ8A 2O8OA 4CDUC 3LA3A 1MS3A 2I74A 3AYAA 3NNJA 5FKBA 1ENXA 3ZPOA 4K6BA 1OLME 2YZ4A 4W4ZA 4CUGA 4COZA 5C8CB 4AEDA 2WFF3 2OIIA 2P3JA 1CIYA 1QJEA 5CU1A 1XNTA 2BVVA 4CCEA 1ZYBA 1SHWB 4OLLA 1O3RA 3N7MA 2VMEA 1EUUA 1JYCA 5K4LA 3FBYA 3NNFA 1XYNA 2Q1FA 4QB1A 4BQ3A 1NQDA 1ONAA 3J7HA 4NHKA 1R082 1DG6A 2E32A 1H8VA 3NWKA 2WS92 4ET7A 3RYRA 3TAYA 4E4DX 2BJSA 1PVC1 1YNAA 1J3RA 3MW3A 4FBFA 1GNHA 4PIZA 3OOXA 1UIKA 5FTTC 3BPSA 3N7KA 5GZGA 1HQWA 3MPBA 5JWPA 5A1AA 5KC6A 2Y6FA 3CZUA 4NPLA 4QKNA 4OQ9A 1R081 2ZGTA 4YGCA 2BWCA 1YFXA 2WLPA 2WS91 1AYM3 3UYJA 2MPFA 3VBOC 5JSPA 3NV2A 3H1MA 4RS5A 4JDOA 2JG9A 1B35B 2VGDA 3J9SA 4OFGA 5D2AA 3C7HA 3WHUA 4Q4Y2 4INDA 1GOGA 3IB3A 3GDBA 3LEGA 3NQHA 3VBRA 4N7UA 2K0GA 1DQ1A 1RMU2 4QPIA 4RFT0 4LIUA 1HRV2 2J22A 2JECA 1QOTA 3JQXA 5BUVA 3TEXA 2Q8DA 3CIHA 4HKLA 2PAKA 4YVWC 1JZ8A 2A3YA 3OUJA 2HWF2 4Q4Y1 4CU7A 3ITQA 4QPGB 4WM8A 4CZSA 1HRV1 5KXDA 3INAA 2QQUA 4G9SB 2PA7A 2WR9A 4YM0A 2R061 1YUDA 4M4PA 1J1TA 2IXIA 3IBMA 2WINB 5DQ0A 2DVGA 1RHI1 4C8DA 5IVVA 4MGTA 3A22A 3OPZA 3GJBA 2VW2A 4QKDA 2VH9A 2HWD3 3ZSLA 2ID4A 3FWEA 4UW6A 1OFSA 3HQRA 4K1YA 1F4HA 1POQA 1LKNA 2XUEA 3M3EA 3HMYA 4GJYA 2FBEA 4EN6B 1UYZA 3FFZA 2GC3A 2BEOA 1WMDA 1WW4A 4BQ2A 2P3IA 3VD9A 4RR3A 4ZZ8A 1QJY2 2VE1A 3M3IA 3BIEA 2K9ZA 5A7WA 1YFYA 1YHFA 2JD4A 2VNGA 3H50A 4AQSA 2GP3A 3I7DA 1LODA 2WDBA 1AL0G 2WO2A 3LDBA 3AFGA 3POWA 5C3SA 1CX1A 4AHYA 3T30A 4FPYA 5CAZA 5DZGA 5AC92 1K5MC 3J26N 4BU2A 5HCHA 1QDCA 1RUG3 4IEXA 1N3QA 2FZ1A 1BHGA 1CGPA 5DUWA 1KDMA 2VZUA 4WM7C 1F31A 2C26A 2EIDA 2TEPA 3QACA 3ZXDA 4JV4A 4Y20A 4LHKA 1IZ3A 3RWKX 1RUJ2 4FPEA 5AC91 1SFNA 5L7OB 1VBC3 5FY9A 2D97A 3FMGA 3WF4A 5IJRA 5FYCA 4DPNA 2QQNA 3FJSA 2DURA 4M01A 1EPZA 2P4EA 3WNMA 1BLZA 1NZCA 1YQ2A 1RUJ1 4RQPC 5JZGB 3LIGA 4DO0A 5IAVA 4TZDA 4G3YC 2V5YA 5IATA 2E26A 2Y6LA 1PGSA 1Q56A 2Q4SA 3VBOA 3P3PA 1GZ9A 3M3QA 4A7YA 4XC9A 1HB3A 4PI2A 2JD9A 3PIGA 4NN0A 1NQJA 5DUUA 3WSOA 1ND2B 4TN7A 3VKFC 1VBD3 3TEYA 3OBTA 4N43C 4NRPA 2JICA 3AJZA 1U5YA 4J1WA 5EWSA 4AI3A 3U0ZA 4B7KA 4UXAA 3JBG2 2R7EB 5DG2A 1CZSA 1L7RA 3RG0A 4EN7B 1CAUB 4GMP1 1VMJA 1KQRA 1LOBA 1G9AA 3I4IA 1H9WA 2WO7A 1HW5A 5HCBA 3EXUA 4YGEA 3VBFA 1QH6A 3WG2A 4YSFA 2ZHKA 3JBG1 4P02B 1PX3A 5FZ9A 2YDEA 3RDIA 4BQYA 5LEJA 3RMXA 4XFGA 3KF5A 1N3PA 4DQAA 2ZPXA 4B4QA 2WNUB 3O1OA 4ZHNA 2W94A 2WSVA 3E5UA 1H1AA 3X29B 2B5HA 4E27A 3MFAA 2ZEXA 5I0DA 3WQ1A 1LHUA 3ZXKA 2PELA 1JZ5A 4ES9A 3AKPA 2JE7A 2D5HA 2VXJA 2ZGKA 4FXGB 1LGBA 2G9FA 2QTWB 3FHAA 1LHOA 1QNYA 2K2SA 1QEXA 3VLBB 2A3XA 4Y24A 5HV0A 1JI6A 1HJGA 5G05L 5IW0A 1UOFA 3FX3A 4NWWA 3G6JB 4NMIA 2UYAA 3AVRA 3T0BA 5JLVA 4ES8A 1UZYA 2JDYA 4CEYA 1YCIA 1B35C 4P00B 4ZS2A 4CUCA 5JSOA 1Q8VA 3FHIB 3RZHA 3WNKA 3EHKA 5FZ7A 3WUDA 2XPJA 2E6VA 3WT3A 4Y5TA 1K5MA 4UAPA 4K7JA 5GLZA 4Q0VA 3C7EA 5A7SA 5JXHA 5FBZA 3WLUA 1TMF3 5F5CA 2QJVA 1O5LA 2UY9A 4BLIA 4XFFA 3BU7A 1MEC1 1DQ5A 4QPGC 3PTYA 3JXSA 3VD5A 4GQ7A 2PHUA 4Z2AA 3E5QA 4QU2A 4AHXA 5IVCA 5IUQA 1UNBA 3POJA 3I3MA 3VKOA 2NMNA 5F3EA 5DPNA 1UY2A 4FQZA 4JDNA 2VXRA 5C70A 3AP7A 1QQP2 5ABJB 3BVCA 2X09A 4BYYA 1N3OA 4RA0A 4XTPA 3LSDA 5FZEA 2WKKA 1SBEA 2YFZA 4M3CB 4QX7A 4CEWB 5FDBA 2JIGA 3KV4A 1D4M3 2W08A 2XUMA 1UQXA 2OA2A 4FAHA 3NSTA 1HB1A 5C3OA 2JG8A 1QQP1 2LRPA 4BISA 2R073 2CGNA 3ZDSA 1COV2 4RHV3 4D7TA 3ZXFA 3TN93 3K48A 1SPPB 1S0IA 2VCMA 4LORA 2PHFA 3TWIA 3UNPA 2YB7A 3CJXA 3VD4A 3RZGA 3CLPA 1NG0A 4HN0A 1CN1A 1HRI2 2VMGA 1COV1 3RSJA 3GCXA 1VALA 1EV11 3FBMA 3ZIWA 4D94A 2XHKA 2IUWA 1KD7A 5LK7B 2BW8A 4NPRA 4Z92B 2ARCA 1WUVA 5FXVA 4BWOA 5IVFA 3ZYHA 3J7LA 3T09A 4AW7A 1WLWA 5BNNA 5DMYA 3RZKA 4LBQA 3OY8A 2XJSA 5GZFA 3OCPA 5C4WB 3KT4A 5FP3A 3MV01 4QMAA 1BCXA 1ASJ3 2QQMA 5B4NA 2WQ8A 3LSEA 1OFNA 5D21A 4NO4A 4A41A 4Z8BA 2CDPA 2W68A 3B69A 3ILRA 5EHDA 3R6SA 2F17A 3SLIA 1VRH2 1Q3EA 5H9QA 4JQTA 2HH9A 4QKBA 4AI1A 4V1PA 4AK3A 2PHRA 2C4XA 1G9FA 1LR5A 2BOIA 3LFIA 1J3QA 3BN6A 2VMCA 3M8LA 3QH7A 4FPKA 1SBFA 4HK8A 4I30A 5GLWA 5JZGC 1UCXA 4IEUA 4DS0A 5LY1A 2UWCA 1PMIA 1TME1 4PCRA 1AYN3 1PO12 1VRH1 2BNNA 4AHZA 5HI0A 2VZPA 5J1XA 4FOVA 3AYDA 4KGGA 4J25A 1I5ZA 1O6UA 1RUC2 1ND2C 1EAH3 3MPPG 4E4SA 1H8TA 4IDZA 4Q4X2 4AVCA 5A1FA 4LPLA 2VCCA 1QJX1 1PO11 2RDSA 4MXVA 5I8SA 3C2UA 1VBB2 1XNDA 1Z7S1 5TSWA 3ROUA 4QU1A 1RUC1 3OGVA 4PT6A 1SLAA 2PLV1 2W0XA 5H9RA 4HLTA 5FZFA 1LCLA 1JZ6A 3OSDA 2ZABA 1GFF2 5GM0A 1VBB1 2PHDA 1O91A 4Y22B 5KR7A 4YVSB 2WT2A 4Q0QA 5FZOB 3U78A 2WNUC 2VZ3A 4ZZ5A 3LPFA 4U2AA 3S5AA 3N7JA 4XBQA 5I0UA 3WNNA 5FV3A 5CBLA 3WW1A 3APBA 3K4ZA 3N9OA 3K3NA 3IIIA 1DGRN 3I3BA 3VD3A 5JOZA 5F39A 3SH3A 1NOVA 4D3WA 1BMV2 2XL7A 2C9AA 1CPMA 1X8MA 1XB9A 1R083 3T0AA 1O4YA 4GA9A 2WS93 1W06A 4GKYA 3MF6A 5FWEA 5KBFA 4QX2A 3NV3A 5T3NA 3LF7A 3ACFA 2RE9A 4FOQA 2HEYF 2QQJA 4MUVA 1AR62 5CA6A 3UKTA 1W6NB 1G7YA 1BMV1 3LIHA 5C5UA 3WP4A 1OOPB 3VZOA 3ZM8A 3RVHA 1LOEA 3UK9A 2WSUA 4UFJA 4BQ4A 4JC1A 4JAAA 5K8SA 2RVAA 3VZJA 5C3PA 2YGMA 3MIGA 2QFEA 1NCRB 1C5HA 4UFIA 2E9QA 1HQLA 2ZGPA 4Q4Y3 3PVOA 1Q5OA 1OA3A 1RMU3 1XQNA 2KA3A 2PHWA 1HRV3 3GCWA 2J1VA 1NXD1 5F6KA 3ACLA 3OBZA 2Z79A 3PUHA 4YW7A 5SV8A 4Z2WA 2CTVA 3OBRA 5L7OA 1BZWA 2HWF3 1S0EA 4QAWA 1JZ4A 2HKXA 3KGLA 4KU7A 2YU2A 4QM8A 4UW5A 5FP7A 1CPNA 2G1MA 4N8MA 1WCUA 5ABJC 2E33A 5ANQA 1LNSA 2QQVA 1XYPA 3WCSA 4BMEA 5A70A 3I2IA 2BTVC 2SBAA 5FMOL 3S6PA 3WF2A 4CEWC 4KGQA 1ZZBA 4FTBA 4B4PA 4X6QB 3TEZA 3V64A 5K0UA 4KL1A 3IMNA 4PIXA 3OGSA 4AEDB 1W2AX 2UWBA 4AI0A 5ISLA 3O12A 2C5DA 4XFCA 4QDSA 3AMPA 1IG3A 3EQEA 5LASA 5LBEA 1PO22 3BOWA 2GN3A 2NM1A 1LEMA 3EJKA 1QJY3 4TWTA 4COYA 4CCCA 1FT9A 2YPJA 4CDXA 1CAUA 2XWBB 5F32A 3T2OA 3MIHA 3W5MA 5C8CC 1JODA 3VDDA 4DNYA 2BNMA 1RUOA 3IMMA 2Y60A 4ASLA 4LTAA 1ZX5A 4E9KA 2CNAA 2ZZQA 1LOFC 1ALYA 4XF4A 4AVAA 4WVMA 4EJRA 4JTNA 2ZAAA 5FP9A 2FDIA 1VRBA 3JD71 5LRRA 1CIWA 3UGHA 4GH4A 2PFWA 2QQIA 3I2KA 1Y9GA 2GDFA 2WNUA 1O3SA 3ZSMA 2WC2A 4XJ9A 3WR0A 4E4HA 1GU3A 1BEV2 3D3AA 1CD3G 4Q0UA 1LOCA 3LGRA 1SBDA 2JG9B 2WFPA 4ONUA 4R9BA 4RS5B 3WINE 2VCAA 4DRRA 3C8XA 3OD4A 3K77A 2ZTNA 1XSRA 2QZ2A 1DZRA 1NLRA 2WA3A 2VVEA 2YPDA 3LAGA 4IEVA 3GZAA 3N3HA 1Y43B 4QPIB 4SBVA 1O5UA 2ET1A 4CCLA 1F15A 2Y33A 5A80A 3K46A 5LY2A 3B94A 4XPVA 3VHPA 4GB31 3ZDVA 4CTEA 2QQKA 3Q8AA 3SMHA 1VBA1 4QM9A 5C3QA 3VKNA 4Y1YA 1FPN2 4A6SA 2V72A 2Z42A 1W8WA 2RMU2 4WM8B 2J1SA 3MV11 2E7AA 3ZR5A 4GIQA 5KXBA 3M1HA 5KXEA 2PQSA 3MGUA 4GMP3 3WDWA 3ZFGA 1NYWA 1DBNA 4OI4A 2KR2A 1FNZA 3ZN5A 1UL9A 3AZVA 1OF3A 5FYSA 4P9WA 3JBG3 1MVQA 1ODMA 3WQBA 2O8QA 1ZREA 3BCWA 4AFAA 1V9U2 1L7LA 4LOTA 2EXJA 4YFZA 5LATA 5FPLA 2Y6HA 3C3VA 4LJHA 1V6OA 2YROA 4CVUA 5ABJA 4IERA 2VZQA 4QGLA 2B46X 1V9U1 1RUF2 4L97A 4CEWA 3C7GA 5BYNA 2JJ6A 3KWVA 1GZTA 4FPCA 4GZ9A 3TRSB 4LO8A 3VUOA 5EPAA 3WNXA 3MIDA 5T5LA 3WQ7A 4IL7A 4QDQA 3RMYA 4P9IA 4Y4YA 3KLSA 3QD6A 2GU9A 2XB6C 1ODNA 1F4AA 2DF7A 1R64A 3D0SA 4HVOA 1Z78A 4AHWA 2VC9A 4JGZA 1IQDC 3VB9A 4NAMA 2EXKA 2Z4FA 1OOPC 4XFIA 2DTYA 2VNRA 3KQ4B 3WF0A 5CKMA 4K8FA 4CDQB 2VZOA 4BIFA 4PJYA 1GP5A 1LENA 1YQCA 1NCRC 1LU1A 4IGQA 5FLHA 1RVF1 1XE8A 1OUXA 5B2GB 4RN5A 3KCCA 4Q8KA 2ZX1A 5IWFA 1CAVB 2BGOA 5C4WA 3Q9OA 1Y4WA 4FP2A 4TLGA 2RR12 2WWUA 3PUAA 2W1SA 4N7IA 4HFSA 5GJ6A 4KQ7A 1UWWA 3NNMA 4QT6A 1O4ZA 4ARXA 2H0VA 2WA4A 3P6BA 1M06G 4AVTA 4XURA 1QJU2 2Y64A 1RGSA 1ZBA2 5J36A 4ZONA 4NHLA 3VHOA 1F2NA 4AI2A 4O65A 2JDPA 2BPA2 1QQP3 3PTRB 2PHXA 4PIYA 2ZX3A 2C24A 4FPLA 4MGIE 2EXHA 1QJU1 4LQRA 5F3IA 1ZBA1 4AEDC 2BZDA 5IVBA 4WBBA 2RJ2A 2PYTA 5EQUA 5A7OA 4MADA 3VBUA 2OPWA 3VBFB 4EWDA 3U14A 3K4DA 1OXCA 1SLBA 4JQRA 2WQZC 1COV3 4JHTA 4BZ4A 2DVDA 3RZMA 4S2FA 4HT1T 4KG8A 5KHIA 1O4TA 2GC0A 4UBHA 1FOD2 3B7MA 3Q8FA 1RB8G 1JU3A 4OHYA 4CCKA 2ORXA 3QCWA 3T0DA 1HRI3 1PNGA 4FVVA 5JDBA 1O7FA 2WT0A 5CFDA 1CX4A 3AMQA 5GZDA 5CKQA 2XWJB 5C9AB 5JMCA 5KXCA 1DP0A 2XBO2 3ZFFA 3O7OA 4YVSA 1FOD1 2CHHA 4O9EA 1WW6A 1FMD2 5FYYA 1OA4A 2P2KA 2HWC2 5A7PA 4COVA 2P5BA 1F35A 4IUGA 3IDBB 3DPRB 4LKSA 2A6VA 3TNPB 4XUOA 4Q1PA 1UD1A 4RS5C 4CEYB 1ULEA 2JG9C 1YI9A 5I0RA 2ZEWA 1GQPA 4PBOA 1Y9QA 2HWC1 2JXAA 3WF3A 4CXYA 3VBRC 5LK5A 2P6CA 2EAAA 4QPIC 1LECA 1NE6A 3TYJA 1VRH3 3MUZ1 3ZFEA 1XNBA 5EZWA 4XBLA 4YZ3A 1UZVA 3I59B 1J59A 3FC0A 2ZGRA 5DG1A 4BOWA 5JXJA 4AFDA 1F8VA 4OCTA 4CA9A 2D7FA 5J98B 3RQ0A 4WM8C 1R1A1 1SMVA 5FZLA 2PN5A 4XF3A 2Y0IA 2JEMA 1PO13 3N9QA 4M0HA 1C8NA 5IFPA 4LBLA 3VBSB 1RUC3 4ZS3A 4Q4V2 4H14A 1JYWA 2HWE2 4Q4X3 4C0BA 3ZN6A 2MHFA 1S0BA 3DKQA 1VBB3 1E5HA 2D6LX 1VPHA 3WY6A 4CDWA 5C6CA 1KJLA 2UWAA 1Q8QA 2EXIA 4XZPA 2BWAA 4N53A 2JG8B 1ZZ8A 4CYDA 4RR3C 5ACA2 2B45X 1AF9A 4OUMA 2Z2SB 1JOBA 3SCHA 1FNYA 1DGWA 5CEHA 3A0KA 4KNCA 1UOGA 4PF5A 4Z07A 3PMSA 3SNMA 3OUIA 1WCSA 2XJQA 4D6QA 3N35A 2WJSA 3LDRA 4JGYA 5ACA1 3B9IA 3FUOA 2EVXA 4IEWA 4F7ZA 4NIIA 1W8FA 2WZ8A 1HB4A 5BNNB 5FXZA 5JPNB 1V6MA 1PVC2 1WKYA 2ZS6B 4LBQB 3PUIA 3N9PA 2V5DA 4GWMA 3I3EA 2D44A 3NAPB 3OY8B 4XQWA 1V00A 1RXFA 3AMMA 1AX0A 3PJYA 4IGOA 3DN7A 2ATFA 1AR63 2CY6A 4RGGA 3IDAA 5FCCA 4ZKTB 3OF1A 1KS4A 4KBBA 1GZWA 2MNGA 4LA3A 3LZZA 4LHSA 4XF1A 3O1UA 2QKDA 1KEXA 3PDQA 4DUVA 2VCBA 1AR72 3DCQA 2Y38A 2ZEZA 3UT0A 5A3MA 3ILFA 1UKGA 1UF2C 1YQ8A 2VMHA 1OKQA 3WVJA 1W99A 3URFA 2XJPA 3ZPYA 5C3RA 1SFPA 2VBPA 1RUI2 2WNVA 2UYBA 1O59A 2I2SA 1UX6A 3H3LA 1YIPA 1AR71 1E5SA 1HB2A 2RV9A 2C6SA 1URXA 1WW5A 1ZZ7A 5F3CA 3RZJA 4Q5OA 1H8TB 2I45A 2QUOA 3WF1A 1XYOA 4RGAA 2ZKLA 4EWAA 3I8TA 1W0OA 1V6LA 4XHXA 5F2WA 2D6KA 5FY4A 5IK8A 3VBHA 1I3HA 1S2BA 1SFYA 2R062 5GKAC 1RUI1 2X05A 4PDWB 2AZ5A 4GD4A 4JKMA 5E6HA 5KHHA 1SG3A 1RHI2 3HQXA 3Q8EA 4DXRA 1OH3A 1OURA 4N9IA 1W39A 4ATFA 3T3YA 1CQ9A 2W87A 3VBFC 3J8F1 4MHRA 3SH5A 1X33A 5CNAA 2DBNA 3QLQA 3HN3A 2IC1A 3M70A 3OD0A 2ES3A 1G8WA 4IETA 4RYDA 1PO23 4BB3A 4SLIA 1WCKA 3AKSA 5FZ6A 2EAKA 4AVBA 1GSLA 3ZXLA 4LHNA 1QH7A 3AL5A 3W9AA 1JZ2A 1UZZA 3H3UA 1W03A 3UJOA 2VJXA 4FPHA 2ADDA 3HD8B 1HJFA 1W8OA 5BV6A 2DBIA 2AENA 4WVVA 2ZGNA 3BKZA 1OPOA 1MS8A 2TNFA 4UBGA 4ZU7A 4FSJA 3ALQA 2DVAA 4YRDA 4AFCA 4UWDA 4EYUA 4XETA 3OEBA 1V70A 3DPRC 3LOBA 4ZU5A 2Q8OA 5T52A 5FZBA 4KG0A 4UI9L 1MPXA 1VLNA 4CEYC 3IDEA 1CJDA 4ZXKA 1NCQA 4Q0PA 2GNDA 4Y33A 3E5XA 4A4AA 1BEV3 2P34A 5FZ8A 2IXCA 5LWBA 3BB6A 1PHMA 3OUHA 4I0BA 4AL9A 2B8MA 2F4PA 3CQOA 1W2NA 4HVQA 2BNOA 5FLJA 5A3OA 4R9AA 1AVBA 1X9PA 3SEPA 3V65A 4LUMA 3KZ4C 4LULA 4WVZA 5CG8A 1IOAA 4DINB 3UKVA 2H6BA 2J1TA 4PLMA 4UT5A 4CDQA 3OG2A 4B3NA 3PURA 3E6BA 3OGRA 5L36A 1FPN3 1W0PA 1DU3D 2XDVA 4OUEA 5FPZA 2VR4A 5FJKA 2RMU3 3VDBA 3VBSC 5EV7A 1RUD1 3RJRA 1XNCA 3GM8A 3USSA 4NHMA 3MLKA 1YO8A 2VVFA 4JZRA 3KVAA 4OI2A 2P3YA 1CAVA 1PMJX 3U1XA 3HEIA 1SACA 4EQVA 1QMJA 5KHGA 1LAJA 3POFA 4CP9A 4FPJA 5M0TA 4IEYA 1T6BX 2IXKA 5K0UB 2JG8C 1IPKA 1DIWA 5CG9A 1H2LA 3D82A 2WWJA 3HNYM 4FO9A 4I09A 1V9U3 4CXWA 2AGSA 5C5TA 2DUPA 1G9CA 1IS5A 1XOYA 1ULCA 2W5FA 2AH2A 2VMIA 4QPWA 4P14A 2CGPA 4A3ZA 3ZKUA 1IS6A 3DXTA 3AXEA 3H1YA 4NROA 1IPJA 4MGYE 4CDXB 1T6GC 2GZWA 1RXGA 2R49A 4XFHA 4AQTA 4E8CA 1RUF3 3VDDB 5CIRA 1UYPA 4LLOA 1GMMA 1POV3 4MYEA 2WIIB 4U36A 3WOGA 4MG2A 1JYTA 4WVMB 1S0JA 4BQ1A 5BNNC 1H6YA 2JE8A 4MGQA 5EP9A 1JBCA 2W2IA 3PHMA 4GH4B 4OMDA 1RUH2 4Q1RA 2VQUA 4LBOA 2VZ1A 3MW4A 2YBPA 2DFCA 1UY4A 1XC6A 2QDRA 1YEWA 3MFCA 2B9VA 2HBUA 2Q1ZB 2A73B 4NAOA 4DFSA 4DXTA 5C9AA 2ZCWA 1RUH1 4Q4W1 1A3KA 4GXLA 4XE9A 1QDOA 3O1RA 3ZMOA 5LRSA 5F6LB 1S55A 1UOJA 1YJLA 2ZKNA 3DPRA 1D7PM 4AAPA 2IZWA 3TOJA 1RUE1 2D43A 4B4RA 1W8UA 4M00A 3U37A 1MZFA 4D6RA 2RR13 2ZA9A 3AK0A 1AR92 2YBSA 5DAPA 3POSA 5G04L 3RYPA 1PZ9A 1MEC2 3B93A 4IEPA 1H8TC 4AWDA 1UMHA 4CXXA 4UW4A 5JAXA 5E8AA 3ZFGB 3OJBA 4CUAA 2BDRA 3PJQA 1APNA 2DYCA 5LA2A 1RIRA 3RWNA 2DCYA 5I93A 1SLCA 1N1TA 1QJU3 2GMMA 3DECA 3I59A 1ZBA3 4JHZA 3ZMNA 1WCQA 1AR91 4KH9A 5EFUA 4LMFA 4MGSA 5FPUA 1WGPA 1WLTA 5L9VA 1A8DA 4FT8A 3GZEA 3THPA 1TG7A 1OMIA 4XMAA 4ZPIA 4XJUA 2DCZA 2Y6KA 1MZ5A 1Q8PA 5CYYA 3ZYIB 1UU6A 5D8AA 3VBSA 1ZBE3 1US3A 4ASKA 3CBNA 3T2QA 3GNEA 1NA1A 1VAVA 4DEQA 1JYNA 2C0ZA 2YBKA 2W1UA 1R1ZA 1PZ8A 2PAMA 2HLEA 4QHZA 2D40A 2BBAA 4XFBA 1AR81 5HBAA 4XUPA 1C1LA 5BNOA 2Q5TA 3ETPA 1FOD3 2XLGA 1AXZA 1LEDA 5KWRA 2AC1A 4AGGA 5EJZB 3H0OA 1NLSA 4A6OA 3SXWA 1EV12 1W9SA 1GLHA 2D6NA 3LEKA 1U12A 5ANNA 2XBO3 4K8RB 3AP9A 3JQWA 4HANA 4JGZB 1UY3A 1VMHA 1FMD3 5F7UA 3J7NA 4IV1B 2HWC3 1PZ7A 2CAVA 3TNQA 1ZRIA 2JDUA 4GMP0 4ASMB 4AVSA 4BJ0A 4Z82A 1XBFA 2YGLA 2G9ZA 4WZCA 4XILA 4PLNA 3PU3A 1OF4A 1UZ0A 5FOJB 4M3CE 3UGFA 3NNGA 1GANA 4NIAA 3ZX7A
chains in the Genus database with same CATH topology
3V56A 2WZR2 2OVUA 1V6IA 3IDCB 3NAPA 1ZVFA 1H4HA 2RS51 4A3XA 5L7OC 1W6PB 2GNTA 1B09A 4LNVA 5FDBA 3AZYA 4DOUA 4GKXA 1TME2 2WZR1 5IT6A 1V6KA 2IWGB 3ZSKA 2IXJA 4ZU4A 1EP0A 4BIOA 2NP0A 2D6PA 3GYDA 1PK6B 2QE3A 4L9BA 4Q4V3 2HWE3 1WBFA 2XJTA 1QJX2 3WV6A 2QVSB 2YY1A 1Z7S2 4Y1ZA 1R091 3WW2A 5K0UC 4ORFA 1OPMA 4B29A 1H2NA 1SLTA 1VBE1 5CAZA 3W58A 4XW3A 1JXNA 1QNWA 3VBUB 2PLV2 2RJLA 1X36A 1YXWA 3S7EA 1ZRFA 1DQ4A 4Y1XA 4Z1VA 3THTA 2A7AA 3RS6A 1C8M2 5KC5A 4PDWA 3ZIXA 1AHSA 4CDXC 2DVBA 2R6QA 1YRZA 4JVAA 1HQNA 1ZM1A 4LBKA 3HT1A 3GALA 3VDDC 3AZWA 1DDLA 1IGOA 4EV0A 3RI9A 5CFDB 1C8M1 1KXGA 2ETEA 2XG3A 3ZFFB 4GH4C 2QCSB 2VOVA 4MZUA 1FAYA 2BGCA 1I6XA 4P9XA 3TBDA 1PVC3 4LA2A 3KCYA 5AFBA 4YZ5A 5JPMB 2ZHLA 2QDNA 2PQQA 2MEV1 2ZX4A 1GQGA 1WCDJ 4XJWA 2DUQA 1LOGA 2QZ3A 3ZO0B 3ZSJA 5J09A 2E63A 3CO2A 4R4XA 3ZFEB 1U5XA 4MH0E 4JCKA 4N9HA 4FPFA 4NOTA 2YMZA 2HWB1 3L2HA 3O14A 4GWNA 2ZBJA 1MQTA 4WV8A 4YG0A 3H8UA 5C8WA 4R8HA 2D5FA 4AQ2A 3ZFGC 4F83A 1VAMA 2GC1A 2P37A 4AXOA 3WDTA 1DGWX 3AXDA 3ZN6B 4L2NA 1GBGA 2WFF1 1DQ6A 2R063 3JB4C 1UN1A 4CDWB 2XLFA 5DZEA 5CFCB 1RHI3 4KWLA 2X8KA 2CGOA 4N53B 5GZEA 3D4KA 1QHDA 2ZX0A 3HN1A 4C0HA 1BVVA 1VB2A 1S0GA 2UU8A 4QQ2A 1RUNA 4GULA 1QJZA 3VZNA 2R042 2EF6A 4JGYB 4C91A 2NN8A 1AX2A 4DY3A 2Q1MA 2LM3A 2X5IA 4HBNA 3WW3A 1SCSA 4X6RB 1AYM1 2OW4A 3KS7A 4R4ZA 4JGZC 5I8YA 3ECQA 2FZ2A 2R041 4IV1C 3VZLA 3JD72 1IS4A 2H0BA 2ZMNA 4L99A 5J96B 3OYWB 5JOWA 1GZWB 3BOPA 3NV1A 4YNIA 5T54A 4Q0SA 2A70A 5AC93 5C4WC 2A3WA 3KCXA 1BBT2 3AP4A 3KB5A 4X8PA 1Q8SA 2RM22 2HWD2 4YW4A 5FMOS 4LBMA 4MGZE 4GB32 3H7JA 4NR1A 3SHRA 2WNVB 2LTNA 3MLJA 4COWA 1VBA2 1RUJ3 2JDZA 3WDVA 1Q43A 3R4SA 1C57A 2ARXA 2WWSA 1DQ0A 4J6GA 3L9JT 4MX3A 1EY2A 1BBT1 3UJQA 2RM21 2HWD1 5FO8B 3NKTA 2XJRA 3VBHB 1REDA 4NWVA 3ST7A 4G4FA 1S0DA 4BCUA 1HDKA 5DDJ2 5GLVA 3VBUC 2ZGUA 1ZZ9A 3NJZA 3VHNA 1V6JA 1G86A 1U0AA 4QX5A 1GR3A 5DDJ1 2VQAA 1FV3A 1YYNA 4OI0A 3R0RA 3GBGA 1RUG1 3AYEA 1OHFA 5E16A 5CFDC 3VV1A 1SDWA 5HCAA 3FLTA 4YW5A 4PBPA 5CB7A 1UPIA 3ZFFC 4YVSC 4R52A 4HVRA 4YFWA 4I0AA 4XHBA 2GNMA 1XNKA 5A32B 5FRAA 1CAXA 4LHLA 1VBC1 1ENQA 4MXWB 1RUH3 4OVEA 3D5OA 4QQLA 3UV9A 4LO7A 5FQ0A 1NCQB 3MW2A 1JYIA 4A7KA 2HYKA 2NZ9A 4J1XA 4LE3A 2GNBA 2D3PA 2TBVA 1QOSA 3D6EA 1PGW2 3MIEA 4JDMA 4LE4A 3WZ1A 2R1BA 3GF6A 3ZFEC 1DLLA 4YYOA 1CESA 4DY5A 1RJ7A 3M4FA 1RVF2 4IV1A 1D0HA 4HPKB 2G9GA 3AFKA 3HAGA 4DZGA 4E2QA 4QD2A 1PGW1 3S30A 1VBD1 3JZVA 2IXHA 4RSUA 3L2YA 2HJIA 4LO5B 2O1QA 3M3CA 1DHKB 1VIWB 1AR93 4HETA 4CP0A 1MEC3 2NQYA 3AYCA 2R0FA 4HK9A 4D7SA 3GHMA 1D2SA 3AMHA 5EYYA 3B3QE 4CDWC 1WD4A 1W6PA 3VL8A 1RC6A 2DVFA 3AP5A 2RS32 4HKOA 4N53C 4XOGA 2E51A 2A6XA 4HMZA 4JRAA 1EYBA 3HWJA 2DFBA 1PK6A 1CAWA 2WL1A 2DTWA 2RS31 4YM2A 4XIOA 4D7YA 4JGYC 1N1YA 1N47A 4QQPA 1DFQA 2ZGMA 2RHPA 2AREA 1JW6A 2JX9A 4IXLA 2XJUA 4ISRA 2YC0A 2VVDA 2BUKA 4M0NA 1EV13 3MICA 3V0AB 3DF0A 1JUHA 4E2SA 1PNFA 4YZ2A 3KGZA 3P3NA 4W6XA 4FXKB 5EYXA 4OHXA 3WD5A 3GHNA 5DZFA 2GH2A 5FOBB 1TMF1 1LTEA 4E4ZA 1HLCA 1GV9A 1W6OB 1UAIA 1VB4A 5KHJA 1BYHA 1HIXA 2WZR3 4MGKE 4YLZA 5CADA 1D4M2 2WNVC 1FX5A 2I07B 1LU2A 4IESA 4R9DA 1CR7A 2VOWA 1ULFA 3KMHA 1DQ2A 3E6DA 1R1A2 2QQPA 1TME3 1BK1A 1HXS2 1LJ7A 3B5LB 2QNKA 3VBHC 3BALA 4XMIA 1D4M1 3WP6A 1POV0 1QWRA 2IXLA 3KT1A 1A6CA 3PLQA 4XFAA 3FZ3A 3U07A 3ZXGA 3LWCA 4FPGA 2R0HA 2ZAHA 4I01A 5T5JA 4RHV1 1HXS1 1NXMA 1QJX3 3TN91 3ZYGA 2ZMKA 3H7YA 3I2DA 1Z7S3 4W65A 5D8AB 4LBNA 4I3GA 4XJAA 1NA1B 3NKGA 4FCAA 2PLV3 3M2MA 2GSYA 3BODA 2ZGQA 1BJQA 3B00A 3ME2A 1C8M3 1LULA 4JRLA 5BNOB 2VNOA 5CFCA 3PNAA 3OTFA 2EA7A 1N1SA 1C4RA 4AFBA 2B42B 2A6YA 3AMNA 4QGNA 1ASJ1 4Q29A 2WLQA 1OA2A 1NY71 1ULGA 4OULA 3RZZA 1DZTA 2CL2A 4EN0A 1NCQC 4XQDA 1XU2A 5KHKA 5T55A 4O9GA 3U11A 4DXZA 4X8NA 2D98A 2ZGOA 1J1LA 3IT8A 2R16A 1AYN1 2OZJA 1C28A 4HKWA 4BM8A 5FO9B 5JI7A 4K20A 2ZJCA 5JVVA 2D93A 3RRDA 4CDQC 1EAH1 5JOXA 3OYWA 3ZYPA 5F5QA 4H7MA 1XE7A 4QPYA 3R4DB 3MEPA 5SV5A 1CVNA 3FLRA 5BXXA 4BH9A 4EN9B 3SCFA 3VGIA 3UKNA 3MIBA 4XQ4A 4E2GA 3DV8A 4D69A 3QH6A 1PM7A 1BVP1 1QY4A 2DCTA 2Y0OA 3PVBB 1X7NA 5GALA 2LALA 1C1FA 3NO8A 1PGL2 2GMPA 3E97A 1WW7A 1OQDA 1X8EA 4FTSA 3WP3A 3ZN4A 3J8F2 1HKDA 2EIGA 1F9KA 2W52A 3HR9A 4N90A 1LHVA 3JUUA 4MVTA 2XL9A 3TB0A 3A0NA 1PGL1 1YFWA 2ZHNA 4W6YA 1YIFA 4L92A 4K9SA 2R043 3RNSA 1WLCA 2XVKA 3CU7A 3GBWA 1RINA 4LO4B 5EXOA 4AF9A 4B7EA 5JSRA 4MLOA 1H2KA 5BNPB 1AXYA 3JD73 3AM2A 1FV2A 2UY8A 5C9AC 1OLQA 2DUOA 3CF6E 5T50A 3I54A 1RMU1 2FQPA 2AR6A 5FO7B 1HX6A 5A32A 4FAGA 1UPSA 3KQRA 3O0XA 3IPVA 5A33B 2HWF1 4MXWA 1F5FA 1LESA 3ELNA 1QU0A 5AFEA 1BBT3 4AG4A 2RM23 4YM1A 4AVVA 5JIUA 1ZRDA 4JTOA 1MQTB 3R4UA 4GB33 3CJIB 1RTVA 1VBA3 3B9CA 1W6QB 3O0VA 3VHRA 1RUD2 1ND3A 2CAUA 4HPKA 1UW8A 1ENRA 1OD5A 1W6MA 3WX5A 4CDUA 3MYXA 3RJ2X 3NV4A 4XF9A 1S1AA 5E89A 5D8AC 3WCRA 4YW1A 5FPXA 4XBNA 1QJY1 5DDJ3 1NA1C 4EROA 3HBZA 5H9SA 2GH8A 2GMEA 5J7MA 1VR3A 1GQHA 3M3OA 1O3TA 1HV1A 1WBLA 3JB8A 5IK4A 2Z5WA 2Q0AA 1REEA 5BNOC 3MF9A 1Z0HA 4IEQA 3T1LA 4K1ZA 3VL9A 4Y1UA 2A6ZA 2A6WA 2X5IB 2XKPA 1V6NA 4H3WA 5K7PA 2NPIA 1SLLA 5BPXA 2ET7A 4AYUA 1WD3A 2GAUA 5J3UA 3WW4A 1S0CA 3R05A 1G9DA 1QOOA 1I1EA 2D3RA 1H2MA 3WG3A 2XKOA 4RL7A 4HSLA 3D8CA 1SCRA 2HEVF 4TSVA 2ZACA 4QGMA 4TYSA 3KM5A 3V0AA 2JENA 3IM0A 2RS12 3NAPC 2PHTA 4Q4W2 4CP1A 1C5IA 1KS5A 2YXSA 3DKWA 1RVF3 2BQPA 4YVWA 1RUE2 5JOYA 2OZ6A 2RS11 1A78A 1MS5A 3ENRA 1UU5A 5CVRA 2G4IA 1W6OA 5FREA 1H1IA 1DGRA 2F6BA 4BPZA 3SISA 1ZZ6A 2CWMA 3IKWA 4MSVA 4AI8A 1M4WA 1ZA4A 4F8AA 1LHNA 1BQPA 3BIWE 4BMBA 5DUVA 3EO6A 2XH6A 1MACA 4EWEA 1FATA 1TNRA 3N4MA 4YGDA 2RS33 1RL3A 2CWSA 5I0SA 1QGLA 5JIAA 1H1MA 4PDWC 1GYKA 4YZ1A 2OUHA 1MZEA 4LEJA 3DL3A 5I91A 3MIFA 5GLUA 3AJYA 5E88A 1XXNA 5A3LA 5HXVA 1AR82 4OHWA 3QBQA 2BBVA 4C90A 4Y1VA 1OQ1A 2Q30A 4HN1A 4UW3A 4AGRA 1MS0A 2VG9A 4P9YA 2EALA 1CAXB 3ES4A 1DF0A 4QHBA 1KRIA 3NVCA 1J58A 1O3QA 5BNPC 1BKZA 4WM7A 1IKQA 3N7LA 4KWJA 5FQ0B 3WP5A 4NVPA 3V0BB 2WZPP 2A75A 4FOYA 1TEIA 3KT7A 4WVWA 1ZRRA 2XVGA 3PVEA 3LA7A 4IQPA 2YV8A 1JN2P 1AL22 3IN9A 3WG4A 1RITA 3DUIA 4BLJA 2VUAA 2VOXA 5BNQA 4RQPA 2NLRA 2RJKA 5BY5A 2XGXA 1MQTC 1FYUA 2RS52 4YW3A 2VU9A 3CJIC 2P17A 3AB0A 1KJRA 1AL21 4C1XA 1YWKA 1R1A3 2WQ4A 2GC2A 1HXS3 1L3JA 4N43A 1X50A 5J37A 2SLIA 3B02A 3KSCA 5AVPA 5I0TA 5J48A 4FP3A 4YM3A 1KITA 1R092 1H9PA 2YUEA 1S0FA 1VBE2 2E7TA 4OHZA 4C1WA 5JCTA 3NL1A 3USUB 1EPWA 1CAWB 3RPQA 1HRI1 4HL0A 3WDXA 2P3KA 2X5IC 3PVNA 1JUIA 4F3JA 1PIV2 1JHNA 5ACA3 1IQAA 1AX1A 4OI1A 1ZNPA 2X29A 1UU4A 2D6MA 1MZ6A 3VKMA 2IFWA 1PIV1 2GALA 4I02A 3K51A 1VJ2A 1B35A 2DV9A 1QKQA 2MEV2 2BYVE 2DWRA 5HCFA 2VPVA 2PTMA 2FMYA 3U10A 1LHWA 4LBQD 2ZGSA 2JE9A 5BNPA 1YFUA 4IEZA 2VW1A 2W39A 1ENSA 1AZDA 2B7YA 2HWB2 4QPGA 4Q4X1 3LA2A 2CV6A 2ZX2A 4BHPA 2WT1A 1D0GA 2UURA 2BFUL 2YHJA 2ZOEB 4QQOA 3VZMA 3AKTA 1SQ4A 1H4GA 5A33A 1AR73 1JOJA 2ERFA 2Y26A 4META 4S2DA 4P5HA 4LUKA 4AEMA 5IK7A 1OQEA 3CJIA 1LRHA 2DU1A 2PAEA 2WFF2 3LOIA 1RUI3 4S2GA 1TNFA 3WHTA 4B8EA 3WDYA 3WQ0A 3T1MA 1W6QA 4QQHA 3UL2A 4FOWA 3GZTB 4XJZA 4Y26A 3J8F3 1IS3A 4IV3B 2C1FA 4OUSA 4COUA 1N1VA 1REFA 2DCKA 1AXKA 4XF0A 4XXPA 3ZYJB 1DYPA 4PLOA 1GNZA 3IWZA 3N36A 3AP6A 4YZ4A 4A2UA 4YARA 4XIKA 2VY0A 1DGLA 4URTA 3ZVXA 1FXZA 4AE2A 3SITA 4CRQA 4YG3A 5DXDA 3MLLA 2BFUS 1AR61 5EJ3A 3H9AA 4KWKA 1NE4A 1LGCA 4S2HA 4M3CF 1AYM2 3WDUA 2A5ZA 3CL1A 4MV2A 3RI8A 1CJPA 1MS4A 2GN7A 4YW2A 4KU8A 5H9PA 2VQ0A 4LT5A 1ZZCA 2O0OA 3E6CC 5IK5A 4DMIA 4I3PA 2Z69A 4HZFA 5JZGA 4K21A 4H55A 4QXKA 3FFQA 1UMZA 1G9BA 2DCJA 1Q8OA 2ZMLA 3T2TA 2LUWA 3FE5A 1VAKA 4AEKA 1ND2A 3W59A 2D3SA 2HEWF 4Q27A 3VZKA 2AUYA 3AKRA 1SLIA 1SEFA 1RUD3 2E53A 4R9CA 4XDQA 3ZSEA 3VN4A 4FTEA 3BTAA 1JH5A 4AGVA 4LBJA 3DGTA 2V73A 1PO21 1WMEA 1I9RA 5AVAA 1MVEA 5F1RA 4LLFA 2YYOA 1PK6C 1FI2A 3S0MA 1LB2A 4K3UA 4LR4A 5GLTA 2VECA 1DYKA 1KFUL 3FUQA 2B9UA 5K9YA 1YLLA 1H0BA 3POYA 1XRUA 4TLFA 3ZXAC 1GKBA 3B01A 1RUG2 4ITCA 3H3ZA 4BE3A 5FLIA 5JI9A 3ASIA 4RD7A 1BEV1 3ZXEA 3NW4A 3WXPA 1VBC2 2VOKA 5I8TA 3U4XA 4XYXA 1OSGA 3G7DA 1J3PA 1D2QA 5L19A 2WNEA 1A8MA 4XTMA 4ATEA 4I2OA 4IEOA 3WG1A 3MZHA 3IPVB 2TUNA 1FPN1 2RS13 2VW0A 4L8QA 4Q4W3 2RMU1 3CNAA 2E7QA 3LB9A 3OGJA 3V0BA 2NYYA 1GZCA 2BVBA 3SH4A 4HSJA 4XEZA 4XJ8A 1PVXA 1RUE3 1VBD2 4L11A 3ILNA 1ULDA 2ZGLA 2PHLA 4RR3B 3H1WA 1ND3B 1W6MB 1UKRA 3RYKA 4CDUB 1CONA 4M3CA 1TE1B 2H6CA 2OYZA 4I0WB 1OLRA 4Q8LA 1YI7A 3AX4A 1VP6A 3HT2A 4GALA 4DRVA 5D1IA 1WLDA 2AYHA 4AEJA 3JCIA 1MS9A 1S2KA 1QXJA 1RUF1 1UIJA 4WZFA 2ENRA 4IV3C 4K40A 1G6NA 1Y7BA 1POV1 2ARBA 3HIFA 3LCPA 5CFCC 4Y20B 5C8CA 2A71A 2CYFA 2R30A 1Y3TA 1IHMA 2VUJA 3VKLA 4A7ZA 1AR83 1OI6A 4BA6A 1F5JA 3J4UH 4YGBA 3FLPA 1LOFA 3USUA 3ZXJA 1WA4A 4FQ4A 3CEWA 1QXPA 4OZXA 1YJKA 1MS1A 2V09A 5FFOC 1QXRA 4PQ9A 1H30A 1U5IA 2OUJA 3OGGA 1RJ8A 1W2UA 3VBOB 2X53S 1GICA 3ATGA 3AZXA 5T5PA 2ZHMA 2B39A 4Q26A 1TMF2 2IFRA 2RR11 2JKBA 1IKPA 4P9LA 2D6OX 3PMEA 1AL23 2VULA 2N7GA 3MDPA 1LOAA 4YVWB 1HV0A 3KD4A 3WUCA 1AJOA 2RS53 5L73A 1ZBE2 2R32A 4H7LA 1U5ZA 4CP2A 1D4VB 4Q2FA 1KDKA 2KXLA 5JR7B 1ZBE1 3ETQA 5C33A 2XLAA 3A4UA 1DZQA 1WMFA 2OPKA 2R072 1ZRCA 4XXAA 3EBRA 3SCGA 4RHV2 3TN92 1R093 2FHRA 3LKJA 4Y22A 2ZZJA 1VBE3 5FAXA 1KFXL 4FPOB 1QF3A 1E57A 2R071 3AZZA 1TQ5A 4P9JA 1JTZX 2XBO1 5E1RA 1FMD1 3S7IA 4DB5A 3QOPA 1K5MB 1PIV3 1AJKA 2ILMA 4IV3A 1ASJ2 3ES1A 4WM7B 1NY72 3M7AA 1W6NA 1XU1A 5T5OA 4EN8B 5GZCA 3JU9A 1OOPA 3O0WA 3GBFA 1X82A 4W6WA 4Y5Z0 1AUYA 1LGNA 2KM2A 4YG6A 3BPZA 3D0JA 5LEKA 2MEV3 1NCRA 2R1DA 2FMDA 2NMOA 4ISQA 4OHVA 4AFMA 1AYN2 4RQPB 4AQ6A 1MR5A 3ZYRA 2XJVA 1BXHA 1EAH2 5F9TA 5DUXA 3O5SA 2HWB3 4Q4V1 3AKQA 2HWE1 3GZUC 1C3HA 2XVLA 4LO6B 3MI8A 4P9GA 2DU0A 1ND3C 4N43B 3IIAA 2O8OA 4CDUC 3LA3A 1MS3A 2I74A 3AYAA 1ENXA 4K6BA 2YZ4A 4COZA 4AEDA 2WFF3 2OIIA 2P3JA 5CU1A 2BVVA 1ZYBA 4OLLA 1O3RA 3N7MA 1JYCA 3FBYA 1XYNA 1NQDA 1ONAA 4NHKA 1R082 1DG6A 1H8VA 3NWKA 2WS92 3RYRA 3TAYA 4E4DX 1PVC1 1YNAA 1J3RA 3MW3A 4FBFA 1GNHA 4PIZA 1UIKA 5FTTC 3N7KA 5GZGA 1HQWA 3MPBA 5JWPA 5KC6A 1R081 2ZGTA 4YGCA 2BWCA 1YFXA 2WLPA 2WS91 1AYM3 2MPFA 3VBOC 5JSPA 3NV2A 3H1MA 4RS5A 4JDOA 2JG9A 1B35B 2VGDA 3J9SA 4OFGA 3WHUA 4Q4Y2 4INDA 3VBRA 4N7UA 2K0GA 1DQ1A 1RMU2 4QPIA 4RFT0 1HRV2 2JECA 1QOTA 3JQXA 5BUVA 4HKLA 2PAKA 4YVWC 2A3YA 2HWF2 4Q4Y1 4QPGB 4WM8A 4CZSA 1HRV1 5KXDA 3INAA 4G9SB 2PA7A 4YM0A 2R061 1YUDA 1J1TA 2IXIA 3IBMA 2WINB 2DVGA 1RHI1 3OPZA 2VW2A 2VH9A 2HWD3 3ZSLA 3FWEA 4UW6A 1OFSA 4K1YA 3M3EA 1LKNA 3HMYA 2FBEA 4EN6B 3FFZA 2GC3A 2BEOA 1WMDA 1WW4A 2P3IA 4RR3A 1QJY2 3M3IA 2K9ZA 1YFYA 1YHFA 2JD4A 2VNGA 3H50A 4AQSA 3I7DA 1LODA 1AL0G 3AFGA 3POWA 4AHYA 4FPYA 5DZGA</