1WA4A

Crystal structure of the m131f l135a evad double mutant
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
205
structure length
205
Chain Sequence
MQARKLAVDGAIEFTPRVFADDRGLLILPYQEEAFVEAHGGPLFRVAQTIHSMSKRGVVRGIHYTVTPPGTAKYVYCARGKAMDIVIDIRVGSPTFGQWDSVLMDQQDPRAVYLPVGVGHAFVALEDDTVFSYMASRSYVTQDELALSALDPALGLPIDIGVEPIVSDRDRVAITLAEAQRQGLLPDYTTSQEIERRLTAVPVST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the M131F L135A Evad Double Mutant
rcsb
source organism Amycolatopsis orientalis
molecule tags Epimerase
molecule keywords PCZA361.16
total genus 49
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2004-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00908 dTDP_sugar_isom dTDP-4-dehydrorhamnose 3,5-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1wa4A00
4LA2A 2EAAA 2ET7A 4MGYE 2VPVA 4X6QB 3H1WA 3RYKA 4AQ2A 5BY5A 1O5LA 3CO2A 1OFNA 1ZRRA 4MZUA 4ONUA 2PQQA 2XLAA 4XEZA 4TLFA 1EYBA 1RTVA 3EBRA 3KSCA 2EVXA 2D40A 2OZ6A 2MPFA 1U12A 5CVRA 3RNSA 2MHFA 2D93A 2XHKA 1ZZ6A 4HN0A 4KL1A 4HN1A 4MV2A 2I45A 3U0ZA 5EZWA 1OD5A 2QNKA 2UYAA 3TNQA 1VR3A 3RPQA 4E2QA 4XFFA 1O3SA 3H3ZA 2DCTA 3IWZA 4KWKA 4AVCA 2PHDA 4XFGA 3WW3A 3WW2A 4Z82A 4WZCA 1CAWA 1EY2A 5KHIA 3PNAA 4UXAA 3R6SA 4B29A 1X8EA 1UD1A 1GQHA 2BNOA 5EFUA 5C6CA 5JAXA 1XRUA 4EROA 2BYVE 4L2NA 1FI2A 3UKVA 3DV8A 1ZZ7A 4AVAA 2VQAA 2PAMA 2ET1A 4Q0UA 4AQ6A 1X7NA 4XETA 2XL7A 4I01A 5JSRA 3E6CC 3BU7A 4Q0VA 4R8HA 2ETEA 1J3RA 1L3JA 1QWRA 3H1MA 3LA3A 3SCHA 1Q5OA 4Q0QA 1XE7A 3CL1A 5JSPA 1I5ZA 4KU8A 1YUDA 1GQGA 2CAVA 4GULA 2N7GA 2VECA 1J58A 2Q1ZB 5FLJA 3EQEA 3LWCA 4F7ZA 2OPKA 3IDCB 1ZRDA 2UY9A 4META 5KHGA 1ZREA 1PM7A 4I09A 1ZRFA 1CAXA 2PAKA 5I0RA 3I7DA 2PHLA 4EWEA 3WW1A 5LRSA 2KXLA 1SEFA 3D82A 4QXKA 3H3UA 5BUVA 3NL1A 2HJIA 3OCPA 4IESA 5E16A 4PIYA 1UPIA 2H6CA 2C0ZA 3FJSA 2B9UA 2PA7A 1H1MA 5FPZA 1CAVB 4QM8A 4AVBA 3S7IA 2E9QA 3UKTA 1RUOA 2PAEA 3SXWA 4QX5A 2CV6A 3E5UA 3OGJA 4LEJA 4JTOA 3NVCA 1I6XA 1NE4A 1O4TA 2Q4SA 4IEQA 4UBGA 5I91A 3BALA 3SCGA 3FWEA 3QOPA 4J1WA 3DL3A 4MGZE 1VJ2A 4KU7A 3I59A 3ROUA 4YRDA 5KHHA 5LEKA 4WVZA 2IXHA 2Z2SB 1FXZA 2GC3A 1ZZ8A 3ES4A 4IEUA 1CAUB 4E2SA 4ZU7A 1JUHA 4D7TA 3KMHA 3USSA 4I2OA 2EA7A 1UCXA 4O9EA 4QGLA 5K8SA 5KBFA 3LAGA 5LEJA 4YYOA 2QJVA 3E5XA 1UIKA 3OTFA 1RC6A 1X8MA 2F4PA 3OF1A 4LUKA 2IXCA 5I8SA 2OYZA 1LRHA 2Z69A 3M70A 4E2GA 5FQ0A 1J3PA 4YARA 5I8YA 1G6NA 3ELNA 2GC1A 2GZWA 2BNMA 3S7EA 4BH9A 2CAUA 2D5HA 1WLTA 1DGRA 1YHFA 1ZVFA 5FCCA 1J1LA 4J1XA 4XF4A 3MZHA 3E6BA 1YFXA 3MYXA 4DINB 1H1IA 4UBHA 1V70A 1ZZCA 3D0JA 1NXMA 2D5FA 1TQ5A 3HQXA 4XF9A 5CU1A 3VHRA 4AXOA 4BIFA 4IEOA 2K0GA 1UW8A 4L11A 5C8WA 4XFAA 3CJXA 2IXKA 3I59B 3MPBA 1YFUA 2XLFA 4KWLA 5I0SA 4PIZA 2B5HA 3H1YA 4XFCA 3ETQA 4FAHA 2GC2A 3L2HA 4QGMA 2ATFA 5BXXA 2QCSB 3UKNA 2QDRA 1O7FA 4H7LA 1DZRA 3FX3A 4X6RB 4R52A 3FFQA 3CEWA 4LUMA 2GH2A 3EO6A 4HVOA 1VP6A 1SFNA 5T3NA 1CAXB 3SMHA 2GAUA 4F8AA 4MGIE 2WFPA 1DGWA 4MX3A 4EV0A 3H50A 4ORFA 1O5UA 4KWJA 3JZVA 4YSFA 3B02A 1YLLA 4FBFA 4HBNA 3D0SA 1ZRCA 2XKOA 1EP0A 3HIFA 3NKTA 4BYYA 3FE5A 3TNPB 2Y0OA 5JSOA 1J3QA 5CADA 4IEPA 2K9ZA 4IEVA 2Q30A 4Q0PA 2OZJA 2B8MA 3U11A 1NZCA 3KGLA 1Q3EA 3G7DA 4CYDA 4OLLA 1NYWA 4P9GA 2WC2A 3NJZA 4MUVA 1HW5A 1SQ4A 5I8TA 3DKWA 5HI0A 4JTNA 2IC1A 5FLHA 5FDBA 4Q29A 5J48A 2BGCA 2PTMA 5I0UA 3FZ3A 5BV6A 1CX4A 3PLQA 3ST7A 1YFWA 1FT9A 2XLGA 2UY8A 4EWAA 4QMAA 3HT2A 2IXIA 3E5QA 1X82A 4HZFA 3IIAA 2IXLA 4HSLA 4FAGA 3S0MA 3LZZA 4QM9A 4XFHA 5BPXA 2BNNA 4RD7A 3H7JA 4ZU4A 5JCTA 5J7MA 4XFBA 2XL9A 2CGPA 5JR7B 1CAUA 4I3PA 3RYPA 1IPKA 3H8UA 1YWKA 4I0BA 5KHKA 2H0VA 4IEYA 4N9HA 4FT8A 3WW4A 4I02A 1OI6A 4IEXA 1DZTA 1ZZ9A 4IEZA 3CF6E 3E6DA 1CAVA 1Q43A 4IEWA 4PIXA 3LA2A 4QGNA 2V09A 1J59A 3HT1A 5I93A 1EPZA 4IERA 1Y3TA 1QXJA 1YFYA 1O3QA 4PJYA 2O1QA 3SHRA 4O9GA 2ZKLA 4LULA 4D7SA 4YNIA 4K8FA 3SCFA 4NVPA 4Q0SA 1CGPA 4WBBA 4N9IA 1ZZBA 1IPJA 3PVBB 3DN7A 1O3TA 3ACLA 2QVSB 4ZU5A 3RDIA 2IXJA 3I54A 3MDPA 2BEOA 4HVQA 2OA2A 1LKNA 1PMIA 3NW4A 2PYTA 3ES1A 3GYDA 4LA3A 3U10A 3LA7A 4Z07A 2ZCWA 5FPXA 1LR5A 3LOIA 1WA4A 4XF1A 2GC0A 1UIJA 4EWDA 4JV4A 1XE8A 3KCCA 3O14A 3M3IA 3CLPA 2P17A 3BCWA 5J3UA 1WGPA 1Y9QA 2GU9A 3QACA 4MGKE 4JVAA 3GBFA 4HVRA 5D1IA 2H6BA 3N4MA 2MNGA 1RGSA 5FQ0B 5I0TA 4A2UA 2FQPA 3EJKA 4LLOA 5KHJA 5FLIA 3BPZA 1NE6A 1O3RA 3RZZA 4HMZA 1CAWB 3OD0A 5LRRA 1RUNA 3H7YA 3C3VA 4LTAA 3H9AA 4MH0E 2UYBA 3BB6A 3FHIB 3RYRA 5F1RA 4IETA 2O8QA 2Q0AA 3EHKA 4OFGA 4BHPA 3ZDSA 1OMIA 1ZNPA 2FMYA 4HLTA 5E1RA 4I0AA 3IDBB 1RL3A 2HKXA 2XGXA 2XKPA 4XF0A 3NSTA 4XFIA 1QY4A 1ZX5A 1QXRA 1LB2A 5AVPA 4XF3A 4HSJA 2PFWA 3IBMA 3E97A 3KGZA
chains in the Genus database with same CATH superfamily
4Q2FA 2EAAA 4GWMA 5DZFA 3RMXA 2ET7A 4UFIA 5ABJC 4MGYE 4AI2A 4NJ4A 3D6EA 5C5UA 3H1WA 4XBNA 2IVJA 3JB4C 5T5PA 5EIYB 4OI1A 1AX2A 2ZAHA 2R6QA 3ZPYA 4Y20B 1NXD1 1W8WA 2UWCA 2BQPA 2RS52 4GXLA 3CO2A 4LLFA 3ZX7A 4IXLA 5FP8A 5K4LA 3ZXLA 5A7PA 3FLRA 3WDTA 3JBG3 4Y4YA 1XYOA 3KSCA 2EVXA 2ZX2A 2D40A 2OZ6A 1NA1A 2O14A 2A6XA 2MPFA 1IQDC 3MLKA 1XU1A 4OCTA 4M3CB 4DPNA 1VAKA 1G9BA 3JQXA 1YYNA 2J1RA 1XSQA 4PI0A 3OYWA 3NAPA 1K3IA 1HRV2 1SLTA 1UPSA 1ZZ6A 4Y33A 2CWSA 4IV1B 1ULOA 4MV2A 1LHNA 2GMPA 3U0ZA 1CZTA 1S2EA 2BJSA 4QDSA 5EZWA 4HXCA 4PQQA 5FZHA 2VM9A 3LFIA 2JG8A 3DPRB 3S5QA 3V56A 2VAUA 4AZZA 4CE8A 3HPNA 1ODMA 3VZMA 1JOJA 5FFOC 3ZFGB 2R043 1PX4A 3WQBA 1LECA 4JGZA 1AR83 1O3SA 4Q4X3 3AYEA 5LB6A 4CCKA 1SLLA 2C1FA 4DRVA 1AX0A 4CEYB 4XFGA 3WCSA 2LM3A 4GMP0 4KBZA 2ZGQA 1XSRA 3WW3A 1JZ3A 3B93A 3T30A 4N90A 2I2SA 5A32B 3BGAA 4XC9A 5C8CC 5CAZA 5IK4A 5KHIA 2QQIA 3E1F1 3RG0A 2RVAA 1UYXA 5CKNA 4KGQA 1HX6A 3WVJA 4Q8LA 1J1TA 3OEBA 5JAXA 3HMYA 1I3HA 2BYVE 1N3PA 2ZPXA 2J1VA 2E33A 1FX5A 1SDWA 5CFCC 4K9SA 1UF2C 1OQDA 3CHXA 4OI4A 4AFBA 2XUMA 5HXMA 2O8OA 2VZ1A 3AXDA 1AZDA 2EAKA 4Q4W2 4QDQA 1X7NA 4XETA 3ZYBA 3LDRA 5JIUA 5E8AA 3UV9A 3WG1A 2VW1A 5J36A 1WA6X 5AC92 4Q0VA 4LBOA 3L9JT 4SBVA 3NNMA 3MICA 4C0HA 3USUA 5A70A 2SBAA 2AENA 1L3JA 1QWRA 1W28A 2XHNA 1BLZA 3QH6A 3VBRC 2NZ9A 4CZSA 2P2KA 3ZDVA 5IUQA 4QQPA 1UZVA 3ZYGA 2JX9A 3KM5A 3TYJA 1GQGA 5C3SA 1RUC3 4GULA 1NLSA 2NMOA 1V6JA 5A3WA 4XQWA 1RUI2 5FR3A 2VECA 3BODA 4P9WA 2VMIA 2WQ4A 1AYN3 3IM0A 3I2FA 2PELA 3P1IA 3Q8FA 1B35C 1BEV2 1SLBA 3VBFA 4D6RA 5C4WB 3EQEA 5IVVA 5JLVA 4XJWA 4M01A 3TN91 2EXJA 3O5SA 5FZBA 3R05A 4CA9A 3BTYA 2RJKA 1LU2A 2QQMA 4B7KA 2PHUA 4MLOA 4QU1A 4DUVA 3ZN4A 1ZRFA 4V1PA 5A6ZA 1FOD3 1MS5A 1AR91 3Q8CA 3CIHA 1XXNA 2Q1MA 1OVSA 4OHVA 4MGSA 3AMMA 1VE0A 2WZR2 1KD7A 1SEFA 2KXLA 3AYAA 4CEYC 3I3EA 4UF0A 2WNUC 2ZTNA 2HWF3 3POGA 1COV1 1RINA 1QNWA 4IESA 4LORA 4P9IA 3EB7A 3FJSA 1JHNA 2PA7A 3KT1A 4UW6A 5T50A 4B4RA 4QM8A 4FTEA 2XH6A 5GZCA 3UKTA 4D7YA 2PAEA 5FJHA 4YG3A 1FPN3 5DAWA 4AFAA 1R091 3ZM8A 3OY8B 3SH4A 1JYTA 5T52A 5D8AB 1XQNA 2JDKA 4RSUA 3K77A 1XBFA 1VJ2A 4CU6A 4XAEA 3ACGA 4Z92B 4LHNA 2X09A 1POQA 3ROUA 3HOBA 5LEKA 2R062 2P34A 5FXZA 1CZVA 2Z2SB 4WM8C 1H1AA 1ND3C 1WMEA 1ZZ8A 4IEUA 5FPAA 4Y24A 2WNOA 5C9AA 5F9TA 5A6QA 3N36A 4V2WA 1RJ7A 4BIOA 4Y3OA 2ZGSA 4C8DA 3IKWA 5L7OB 5A6YA 5CG9A 3OB8A 4LQRA 2QDNA 3BOWA 4Q4V2 5C8CB 1MS0A 1S1AA 1NCRC 1BEV3 1L7RA 4TSVA 4BZ4A 4URAA 2JE7A 4QX3A 4D94A 4YYOA 3KCYA 1SG3A 2VUDA 2Y60A 3R4SA 4OHZA 1X8MA 1Y43B 3HBZA 2OYZA 3VBSA 5JMCA 1JN2P 1VLNA 1B35B 4JRAA 5C4WC 2JDAA 4M4RA 3POYA 2ARAA 5IVFA 5FYHA 4E2GA 3OGVA 3SH5A 2JKXA 1HLCA 1BBT1 2BVVA 4Q4Y1 4YARA 5I8YA 3ELNA 3S7EA 3LSDA 2VQTA 4YVSC 1QJX1 2Y8KA 2B45X 3JUUA 3UGFA 3MLLA 1W2NA 1YI7A 2TEPA 2OS2A 2UU8A 3O1UA 1OOPA 3EXUA 5FCCA 3U07A 1W2TA 2BWCA 2R1DA 4KGGA 3ZSKA 1FMD2 2W0XA 1RMU1 4DXSA 3F2ZA 4DRRA 2WYSA 5ABJA 1AL23 1W6PA 1X9TA 4P9JA 3D4KA 3MW2A 1UMHA 1DG6A 5FV3A 4N53C 3MO4A 4Q4V1 1RUF1 4WM7C 3WUDA 2OQ7A 3VD4A 4LOTA 1QNYA 1APNA 5A3OA 3MIHA 4Y1ZA 2YBKA 4BIFA 1YI9A 3NJYA 2QQOA 2K0GA 1ASJ1 2DVDA 3P3PA 3FBYA 1AF9A 2IXKA 1HRV1 1WW7A 5H9SA 1YFUA 1QQP2 3OGGA 3PURA 1QJU2 4NO4A 1E57A 2E31A 2IWGB 4FPCA 3NRUA 1MR5A 4FOYA 5FMDA 1Q8VA 4YM2A 3H1YA 4XFCA 2IZWA 3S30A 3OGSA 4QGMA 2YU2A 4WZFA 1D7PM 1GBGA 1XYPA 5FZEA 1QJY1 2QDRA 1MZFA 2HWE3 3RJRA 5IVEA 1AYN1 2W08A 3FMGA 1O7FA 2P6CA 4H7LA 3ZKYA 4BQWA 2YV8A 4E4SA 4PDWB 3FLTA 3VBOC 4K8RB 2CTVA 4Q26A 1PM4A 1DFQA 2NLRA 1ENSA 2R0FA 5C3OA 3VL9A 2DVBA 5GZDA 1PHMA 4EN6B 1KFXL 5JZGA 4XBQA 1A6CA 1QKQA 2XBO2 3LGRA 3ZFGC 4CP9B 1VP6A 3AJZA 3JXSA 4FOVA 1WWYA 2EXKA 3SMHA 2GAUA 1VBA1 4HK8A 2IUWA 5AVAA 1XE0A 2OKXA 4EV0A 2YBSA 2YZ4A 3JU9A 5CKMA 4HPKA 1RYYA 3HN1A 3WDVA 4KWJA 1FYUA 4XHBA 2NPIA 4YFZA 4GJZA 5A7WB 1AR81 5HXVA 2BZDA 2D98A 1F4HA 4WVWA 3KVBA 3J9SA 2YPJA 3WF0A 3ZFFC 3PUIA 2CDPA 2JE8A 4AE2A 1TNRA 3NKTA 4BJ0A 2XJSA 4JCKA 4BYYA 4HKWA 2ES3A 3FE5A 1X33A 2VW2A 5HV0A 5CADA 2FCUA 3CDZB 5FYYA 3VGIA 5C3PA 2D6KA 3BIWE 3GBGA 4CEWB 1RUF2 4AFDA 1OQ1A 2Y64A 4AAXA 3KT4A 1Q3EA 2YC4A 4XW3A 2QQUA 2RS13 5JI7A 1UXXX 3OD4A 3LE0A 4FP3A 2R30A 4AK3A 1US3A 1BMV1 1VBA2 2YGMA 3EYPA 2BERA 1OLQA 5FDBA 4HONA 5JOYA 5ISLA 5J48A 1D2SA 2W92A 3AP6A 3FZ3A 1HB1A 3OBRA 2WNVB 1J84A 3OPZA 2JECA 3VBUC 1AR92 1JOPA 4QT6A 2R073 5FZDA 4AEKA 2C26A 3AZZA 1FT9A 3N9NA 2UY8A 2X5IA 2IXIA 3ZXDA 4AAPA 5A7QA 5CFDC 1PVXA 4NAOA 4HZFA 1DQ5A 1JU3A 2WZ8A 2IXLA 1W6OA 1W2AX 2CDOA 4QB1A 5FO7B 4Q1RA 5LZ6A 1WMDA 4PQ9A 4QM9A 3OUHA 1A3KA 1RUC2 4C90A 5FY1A 4RD7A 1HRV3 4TN7A 4UYBA 3UYJA 4L0PA 4AG4A 4FOWA 2QTWB 4XFBA 3VHNA 1D0GA 3O1PA 4FPJA 1UKGA 2CGPA 4D0QA 1POV0 4IW3A 4MHUA 4QPIA 2JICA 3H8UA 3U14A 4YW1A 3N9QA 1F8VA 1UYZA 2H0VA 4RS5C 4CTEA 1S4CA 5IVCA 1SCSA 3ZYRA 1DCSA 3R4DB 1DBNA 3TRSB 2OVUA 1DQ6A 1T6GC 1VBD2 4I02A 3OJBA 4QQLA 3M1HA 5FZ0A 1W0OA 4JRLA 2E7TA 2V4AA 3OUIA 5CFCA 4EZ4A 4Y5Z0 4H3WA 4AVSA 1AL22 3KF3A 2FBEA 4PI2A 1Q43A 1W39A 2EIBA 4M3CF 3LA2A 1LODA 2VR4A 3H0OA 3AM2A 4PIXA 3R4UA 3VKOA 4JGZC 2K2SA 1WCDJ 2B39A 3O12A 2VNVA 3DKQA 4M0NA 5F3IA 5FK7A 4AHWA 5I93A 1Y9MA 3T1LA 2D97A 4IERA 1Y3TA 4BLIA 4NWWA 1PIV1 1YFYA 2RDRA 4PJYA 3SHRA 5IFTA 3DCQA 3ACIA 3D3AA 3MFCA 4YZ1A 1EV12 3CNAA 4OYUA 1BBT2 5GZEA 1UY1A 2B46X 3HBKA 3THDA 5FZMA 4K8FA 2V4VA 2P3YA 5APAA 4GALA 4WBBA 3A4UA 1H8TA 1ZZBA 1IPJA 2BGPA 2P3KA 3GZTB 4QHZA 3DN7A 1PO12 1O3TA 2VO5A 3M3CA 3GXUA 3RDIA 2XBO3 5FY0A 3FC0A 3K3OA 3A7QA 4LK6A 4UWDA 3ZXEA 4LBQD 3V0AA 2OA2A 4U36A 1PO13 5ANQA 3RGBA 5DUXA 1VRH2 1VMFA 3NW4A 2E7QA 4ASLA 4W50A 2P3IA 2Q8DA 5FUIA 4L97A 2DF7A 4GA9A 4Z07A 4B4QA 4LOSA 3WX5A 2ZCWA 3BN6A 5BNPA 4WM7A 5FPXA 4Y1YA 1LR5A 1C8NA 2D3RA 3VZLA 4WVVA 2CNAA 2E6VA 4P02B 1BK1A 4NN0A 5JVVA 1V9U3 4EWDA 5M0TA 1XE8A 2X53S 4OHXA 2X5IB 3ZVXA 1OH3A 1I1EA 3O14A 2B4KA 5LA1A 1CESA 4L9BA 4NPMA 1WGPA 4RS5B 5F32A 5JMOA 3HQUA 3MIBA 1VAMA 1SACA 4JVAA 4K6BA 3GBFA 2RHPA 2MNGA 1RGSA 5L73A 3KHCA 4QX8A 1JOBA 1BKZA 2VXJA 3POIA 5FZ1A 2WLQA 5KHJA 5GLWA 4FPOB 1RUF3 4BMEA 2VL4A 1P8JA 2WS92 4LO7A 3DPRC 5A7SA 4W4ZA 1CAWB 1W04A 1RHI1 5LRRA 1RUNA 4BOWA 5BNNC 4AGGA 2QFEA 3H9AA 4MH0E 1JUIA 2YPDA 3AKTA 5GLVA 4XCBA 3JQWA 1V0AA 4QPGB 1SMVA 1W6MA 2PHWA 1UL9A 4MXVA 5E6HA 4FTBA 3ABZA 4OZXA 1WCKA 4RN5A 5CYYA 3O1OA 4CU8A 2YC0A 5LW9A 2A5ZA 4CDUA 1Z0HA 2RM21 1LOFA 1HRI2 1GU3A 3VZOA 5EWSA 2VCAA 1FATA 2XGXA 4V2VA 5FYCA 2BBAA 2YB7A 4QX0A 4YVWC 2Z42A 1GWKA 5EV7A 1JZ8A 4XFIA 1QY4A 4CDQA 1ZX5A 3VDDA 3GGLA 3I4IA 2J7MA 5HCFA 4HPKB 4LXLA 2BU9A 2GNDA 3VBRA 4XF3A 3POBA 4HSJA 3X29B 3IBMA 3E97A 5K0UC 3NO8A 2VZRA 5FXWA 2VOVA 1EV13 2Y6LA 1WKYA 2JENA 3NQHA 2ILMA 2TBVA 4XDQA 3NV2A 1PGW1 3RYKA 4AQ2A 2W3JA 3NV4A 3N7LA 1AR63 3RZMA 4XUNA 1RUJ1 1Y7BA 5DMYA 1OFNA 1AJOA 3K4DA 1H30A 2EIDA 3ME2A 5FY7A 1AJKA 3VZNA 2XVKA 1WCUA 5A3TA 3KV5A 2CYFA 2Y6GA 4JQRA 4CCDA 1U12A 2KM2A 2JEMA 5CVRA 3RNSA 4FFHA 4FXGB 3SITA 4O7XA 3VLBB 1L7LA 2FZ1A 5CIRA 3N9MA 4BISA 2DBIA 3KT7A 3RZKA 2A70A 5BNOB 1ULDA 3C7OA 1W3XA 3VDAA 2PHFA 4FPLA 4HN1A 4R9AA 1OD3A 2ZHMA 3O0VA 5GKAC 1C3HA 4CEWC 4L8QA 3B9CA 3SKJE 3CZJA 3M3EA 4FPYA 1KJRA 2X10A 4ZXKA 3TNQA 4CDQC 3WF3A 1IG3A 2RR13 2V5DA 2ZJCA 4P14A 1WLCA 3LDBA 5D21A 4LBQA 4IE7A 2DCTA 2HWF2 3PJYA 4KWKA 3VDDC 2ZGNA 4RYDA 4NIDA 3WF4A 2QZ3A 1XNCA 1MZ6A 4RGGA 4Z82A 3WW2A 4E4DX 1M06G 4WZCA 3CJIB 1J83A 1YQCA 4XUPA 4XXAA 4AEDB 5C9AC 4B7EA 2DV9A 4UXAA 3R6SA 4DIQA 1X8EA 4DOUA 3OGRA 4YM0A 2WDBA 4A3XA 1JXNA 5KXCA 2D3SA 1LEDA 3P3NA 1WMXA 1US2A 2RMU1 1GQHA 1KDKA 3MV11 2VZTA 2OXBA 5EFUA 2EIEA 4QKBA 1YJKA 3WNKA 5C6CA 3MI8A 3VBUA 1PO11 2HYXA 4QHBA 1FI2A 3UKVA 2RDNA 3I3QA 1HB4A 5EJ1B 4JDNA 1ZZ7A 4AVAA 1PX3A 2HWE2 5F5CA 1GOGA 2CY6A 4RFRB 4BQ5A 2O0OA 3FHQA 1LHUA 1PNGA 2XL7A 2VOXA 3LEKA 1YQ8A 5JSRA 5ACA2 1IS5A 1C5HA 2KD7A 1AR93 1FV3A 4AEDA 5HPOA 2YFZA 3CQOA 3OPTA 2X05A 1WW6A 4R8HA 4BQ4A 1KEXA 2ETEA 3FL7A 1J3RA 1PK6C 2VOTA 3H1MA 3SCHA 1VBC2 3DXUA 4Q0QA 4CDXC 2VU9A 3K51A 2OPWA 4LBQB 3ZSJA 5JSPA 3BTAA 4LIVA 3VBOA 2ZEWA 5JIAA 4AR2A 4BU2A 1ENXA 2OUHA 2RDSA 5L7OA 1OH4A 2JDYA 2N7GA 1VBE2 3IT8A 1OF3A 4WV8A 4XXPA 4LBLA 2ZA9A 1EAH2 2G9ZA 2NYYA 4E27A 1LU1A 1LOEA 3OOXA 5AFEA 3ZSLA 1YNAA 2PN5A 2W1SA 1UAIA 4F7ZA 4JKKA 2OPKA 4X8PA 3K48A 3J8F1 5BNOA 3Q9OA 2LRPA 2WAOA 5FP3A 1TMF1 4GMP1 5KHGA 5J98B 1RUH3 3BUCA 5L19A 4AQSA 4BQXA 1KXGA 2HEWF 2JE9A 2PAKA 3S57A 5IVJA 1YIFA 3U78A 3LB9A 5LBEA 2G4IA 1SLCA 2W52A 5FMCA 3WW1A 4HANA 5LRSA 2PQSA 3B69A 1ENRA 3D82A 3AFKA 1MACA 1GNYA 2FDKA 4JZRA 5HCHA 3KB5A 2ZAAA 1OA2A 1NLRA 4NR1A 4R4ZA 4QAWA 5E16A 4PIYA 1UPIA 1VBC1 2C0ZA 3DEMA 4XQ4A 5FPZA 1XYNA 4AVBA 4COYA 3WT3A 5BNPB 2A6VA 2HWF1 1MVEA 2D6MA 3E5UA 3ORJA 4K1YA 4JTOA 5CA6A 2VOKA 3I8TA 3WNPA 1I6XA 1O4TA 1PVC1 3I2IA 4IEQA 1RJ8A 3WQ1A 3NNFA 3Q8EA 3BALA 3WY6A 4ZZ8A 4PCRA 1U5IA 3UT0A 1DP0A 3I97A 1RUG3 1W3VA 5DUVA 3RWKX 1W2OA 4YZ2A 4CCEA 1W9WA 3B9IA 2ZGOA 4J1WA 3MW3A 5FMOS 3TEXA 2WFF2 4CDQB 3I59A 2ZX3A 1KDMA 4LMFA 1GKBA 2ZOEB 3LCPA 1ND3B 4PLNA 5EPAA 4COZA 2HBTA 2R072 1QJY2 1FMD1 4E2SA 3ZLIA 3WNNA 4ZU7A 1GLHA 2JG9A 1VBD1 4GH4C 1YQ2A 1ST8A 5FZOA 4IQPA 2EA7A 5D2AA 4NHKA 1QJU3 3V0BA 1UCXA 5GJ6A 3CJIC 4CUAA 1CN1A 4QGLA 5DZEA 5K8SA 2GMEA 2VBPA 5E88A 2J1TA 2QJVA 3T4VA 3OTFA 4LUKA 5I8SA 1UOFA 1N1VA 1QDCA 2IXCA 4OHWA 4XVHA 1UU6A 1GNZA 5KXEA 3VKMA 4IGQA 3TEZA 2Z69A 2A3YA 1SLAA 1AR82 3IAPA 1G9CA 1MPXA 1WUVA 4LITA 4JKMA 5F3CA 4NE9A 2GZWA 2XJVA 4M00A 3T2TA 2GP3A 4CCCA 3B7MA 4P9YA 4DXTA 4LKFA 5CZKA 5JI9A 1XJAA 4RR3B 4NPRA 4FXKB 4RS5A 1ZVFA 4LPLA 1ZM1A 1GZTA 2NN8A 2A73B 5DUUA 2OX0A 2WWJA 1W8OA 4FPGA 4MO3M 1LOAA 5K0UA 1ZYBA 2OIIA 5IYYA 1F15A 3E6BA 2VD7A 3NKGA 1YFXA 4QDRA 4ZXEA 3WSOA 1N47A 1V6IA 1WCQA 1HXS3 1ZBE3 2MEV1 4QXBA 3MPPG 4XBLA 4YVWB 4DINB 2YROA 2JWPA 2PLV3 1RUJ2 4WM7B 4Y26A 4UFJA 5JXJA 4XE9A 1CONA 3M3QA 5T54A 1TQ5A 1DQ2A 3HQXA 1O4ZA 4IE6A 4AHXA 5CU1A 1NKGA 3R0RA 3PTYA 4AXOA 2QUOA 1IOAA 1R1A1 4FQZA 3V0AB 3O7OA 2YDEA 4BQ1A 3GF6A 1UO9A 4XFAA 3J7MA 3DXTA 2XXZA 3KF5A 4X8NA 2VUAA 2XMLA 2Y6HA 3KCXA 3BKZA 1KRIA 2P3JA 3BPSA 1JYNA 1BVVA 1KQRA 4INDA 3MPBA 1RUD3 4IV1A 3I2OA 2VXRA 2XLFA 5J1XA 3WEZA 2WIIB 3FN9A 3KQ4B 3NAPB 4N7IA 2XR4A 2CSGA 2XDVA 2YBPA 1C8M1 1GYKA 2WQZC 4AGRA 1JI6A 1AXKA 1LOBA 3ETQA 4MYEA 4CRQA 4FAHA 3INAA 1N1SA 2GC2A 4AF9A 5BXXA 5FZIA 4AHZA 2R071 4C91A 2RS53 2R0HA 4EN9B 1SFYA 3H8OA 3CZUA 1DZRA 4Y20A 4D8MA 4K7JA 1Y4WA 2RS31 4N43C 4X6RB 5FZ3A 5A80A 5HBAA 3T09A 3FFQA 3CEWA 4LUMA 2HEYF 2XVLA 4QQOA 4ZONA 3VV1A 5B4NA 5CFCB 1LAJA 4ZS2A 2ID4A 2JXAA 2Q8EA 1R083 1SFNA 1E5IA 1CAXB 3ZYJB 4F8AA 3LKJA 1DGWA 4BA6A 4ATEA 4MX3A 4QPWA 3T4HB 3TEYA 4OHYA 1YO8A 1NQDA 3RMYA 3JZVA 1DGWX 3UGGA 2BWAA 5LA2A 3B02A 4QXHA 4KG0A 3MIGA 4Q4W1 3M7AA 1URXA 3TOJA 4CPBD 1QJU1 4B8EA 1D4M3 3A23A 4QPIB 4PHZA 4LO8A 1SPPA 1BJQA 2ZACA 3M4FA 3C7GA 1ZRCA 4IL7A 2ZHNA 3UL2A 1W6NA 3KVAA 2XKOA 3JB8A 3WNLA 5A3NA 5IVBA 5FPBA 1EP0A 2WNUA 3Q8AA 1T2XA 4W6WA 1MQTA 4LO4B 3K2OA 1MZ5A 3FBMA 2Y0OA 3OPWA 4RGAA 1U5YA 5JSOA 4Z1VA 2RDQA 1AYM2 4CDXA 2HWC2 1LHVA 4UFMA 2Q30A 4JGYC 1W6OB 2RS32 3K75B 4BQ2A 1DIWA 5H9QA 4P00B 1VBE1 3I2HA 3UETA 2LALA 2JB4A 2JDPA 4AGVA 4BCUA 4OLLA 4OZOA 3PIJA 2A7AA 3SNMA 4MUVA 1SQ4A 3GZAA 1HV1A 3NAPC 5I8TA 1G86A 3J8F2 2YGLA 4JTNA 2QQVA 4LKEA 1C1FA 2WL1A 2Y33A 2X5IC 4YWAA 5GLZA 2FDHA 4Z8BA 1RUE3 1RVF2 2BGCA 4HK9A 3H42B 5I0UA 3T3YA 3VKNA 2VE1A 2HWB3 4XTPA 1TEIA 2Y26A 3AXEA 3PLQA 3T2QA 2W39A 1YFWA 1VALA 5AC93 1JZ4A 2XLGA 3MV01 3ASIA 4O65A 3NNGA 4QMAA 4EWAA 2AUYA 3TWIA 4QD2A 5G04L 2ZGMA 1KS4A 1X82A 5FBJA 3IIAA 3KS7A 4CEWA 4A4AA 1O91A 4Y1VA 5JXHA 3FUOA 4NRMA 1QF3A 4DY3A 2VZPA 1O6UA 1LEMA 3V0BB 4GKXA 3H7JA 1CPMA 4ZU4A 3WCRA 1IG0A 1VPHA 5JCTA 5J7MA 5FZOB 4OMDA 3ZO0B 4AFMA 2XB6C 2XL9A 2JG9B 2F6BA 3PMSA 1WD4A 4XABA 5JR7B 3UJQA 3VZKA 1OF4A 1GANA 1BYHA 5CISA 1YQ6A 4HETA 2WABA 3I2DA 1ND3A 4XDOA 3ZSEA 5IK7A 2DWRA 4OI0A 2WO1A 4I0BA 2VC9A 3JD73 3WP5A 3WQ0A 5KHKA 2BVBA 1ULEA 3P5BA 4QPIC 3MUY1 1UZWA 4KWUA 5L9VA 3WW4A 4FFGA 1MS3A 1S0BA 1TG7A 1D4M2 1VMJA 4CVUA 3J7LA 4IEXA 5DABA 3VDBA 1CX1A 4YG0A 1NCQA 2BFUS 3GALA 4U2AA 4JDOA 5JZGB 1ZBE2 3J7NA 4IEZA 4E4ZA 3ZSMA 1O8PA 4QGNA 5FP4A 2V09A 3B3QE 3QCWA 1J59A 2EXIA 2Q8OA 3PVNA 4BQ3A 3M8LA 3N35A 1ULPA 1QXJA 4RFT0 3PVOA 1RUH1 5DPNA 2DCZA 1TNFA 4AQTA 1HQNA 1V9U1 1HJFA 1W9YA 4H14A 3PU8A 5EJ3A 4Q4W3 3W9AA 1YEWA 5DG1A 4GKYA 1KS5A 4YNIA 2ARCA 4D6SA 2XWJB 4TWTA 4Q0SA 1JZ6A 1CGPA 2FDFA 1W8ZA 1X50A 1DLLA 5FP7A 4QPYA 3AP5A 5EJZB 3WG3A 3AC0A 4CXYA 4OMCA 2VGDA 1BMV2 1QOTA 4NHMA 2EF6A 2VG9A 2QVSB 2HWD1 3C7HA 1I5PA 1MEC2 4JKLA 4C1WA 1ZRIA 3P6BA 2Y34A 1Q56A 3I54A 3J26N 1X9PA 3MDPA 1GZCA 4PF1A 5A7OA 4HVQA 5BNOC 4QB6A 3K4ZA 4R9BA 1JYXA 1PMIA 5LBFA 3SH3A 2PYTA 1VBE3 2BV4A 1ASJ3 3GYDA 1O59A 3U10A 3I49A 4YLZA 4YGCA 3LEIA 1I9RA 4ZPIA 4YFWA 1RUG1 3PHMA 4RL7A 3VKFC 1DQ1A 3OBTA 1XNDA 3WNMA 2VY0A 1W6PB 2WZEA 4XF1A 5EYYA 4ARYA 2IFWA 3RWNA 3VZJA 1WZXA 1UIJA 3WHUA 2VMCA 1VRBA 4FSJA 5A33A 3UGHA 3WQ7A 3M3IA 3CLPA 1VBD3 2P17A 5J3UA 3C7EA 2VBDA 4AVTA 5A7NA 1XU2A 2VNOA 1OUXA 2WT2A 2GU9A 2ORZA 3O1SA 2VTXA 2W9XA 5J09A 2VZQA 5JPMB 1HB3A 5I0TA 1SLIA 4A2UA 1Q8OA 2CWMA 3AJYA 2FQPA 4MG2A 1PGSA 3RQ0A 3NV3A 4PDWC 3HEIA 3MUZ1 1OKOA 3BPZA 4FOQA 1B35A 1NLQA 1MEC1 2VVDA 4JQTA 5A1LA 1UXZA 3AKQA 1N1TA 2BTVC 3V65A 1VBA3 2UYBA 3BB6A 5F1RA 4ZY9A 4IETA 5C3QA 2O8QA 1YCIA 2JG9C 2W1WA 4BHPA 5LBCA 3WNOA 3ZDSA 4NIIA 5A3UA 1OMIA 1H9WA 1VMHA 1Q8PA 4DUXA 3U75A 4XILA 4MSVA 1AL0G 2FMYA 2BGOA 2XPJA 4QKFA 1LULA 4I0AA 4CUCA 3IDBB 2FHRA 1G8WA 5C9AB 3U4XA 2HWE1 4NRPA 2XKPA 4XF0A 3ZMNA 4XMIA 4QX1A 1UMZA 1B09A 2P6HA 1ZBA3 5FWEA 5AVPA 3BTZA 3N7KA 3BU0A 2RMU3 2YMZA 3OBAA 2HWB2 2XJRA 5JOZA 3SLIA 1OPOA 4P5YA 5DAQA 4FPEA 3LSEA 1QOSA 1W8UA 4AI1A 3GZUC 1W9SA 3HN3A 1S0JA 4FTSA 2R1BA 4K21A 2W87A 5A1AA 3W21A 4UW5A 5FYIA 4Q8KA 2WYFA 2ZGTA 1ZRRA 3WOGA 4ONUA 4A7YA 2HEVF 2PQQA 2XLAA 2XG3A 4RQPA 4TLFA 1N3OA 4XEZA 1RTVA 2Q1FA 4ARXA 5FZCA 5BYNA 1GQPA 1C8M3 1K5MC 2PXJA 2YYOA 4XCAA 4FVVA 3ILRA 1DGLA 3AKPA 4TTGA 3I2KA 2RJLA 4NUBA 2Y38A 5FY4A 2DUPA 1G9AA 1QU0A 2VNRA 2MHFA 1JZ7A 2D93A 2DDUA 2TUNA 1V6NA 2VTFA 2Y6JA 5FZKA 5AFBA 3W5MA 3ACHA 1AR71 4QWNA 1SCRA 3OSDA 3VDDB 1BHGA 3I3BA 4CPBA 1RUI3 5HCBA 1VBB1 5C4WA 1G9DA 4PLMA 4OULA 4DY5A 1RUD1 4LR4A 1QJX2 4JHZA 2QNKA 4NPLA 4YW2A 4CDUB 2D7FA 3TAYA 5A6XA 2TNFA 1BBT3 4K20A 4LBJA 4UFLA 1W6MB 2VNGA 3NJXA 3JCIA 2E63A 1IKQA 3V64A 1S55A 5FAXA 1Z7S2 4QQHA 1H0BA 4RA0A 2C4XA 1CAWA 3DYMA 2VUCA 1S0GA 3AMNA 3PNAA 4XJUA 1FPN2 4XIKA 2WA4A 4B29A 4CP2A 2C24A 1A8MA 1W8FA 2WLPA 1XNBA 2WKKA 3ZXKA 1GV9A 3HWJA 1NUKA 5FIXA 2R061 1XRUA 1ASJ2 1JMUB 1LESA 2LROA 1N3QA 4L2NA 3TN93 4E8CA 1PZ7A 1CIWA 3ZR5A 2ZXQA 4YZ4A 3MGUA 4A6OA 1V6KA 1HN1A 2PAMA 2ET1A 4Q0UA 3GJAA 2K46A 4Q1PA 4LHKA 1FOD1 3QBQA 5DAPA 2V73A 1W99A 2LTNA 1G7YA 3HVDA 2WT1A 3OEAA 1RITA 1QOOA 4CDXB 1Q8QA 2XJUA 3KWVA 3PL0A 3POEA 3O1MA 1DU3D 2HLEA 4AEDC 1IS6A 4QX7A 2FMDA 1MQTB 4EQVA 1V00A 1PGW2 4Y4RA 2WNUB 1NT0A 1AYN2 4JX0A 2XOMA 2CAVA 4N7UA 3ZYPA 2Q5TA 2ZGRA 4XMAA 2JG8B 3A22A 4LHSA 1J58A 3CBNA 4TZDA 1QIQA 1R64A 5FLJA 5FPVA 5JOWA 4CCJA 2XBO1 3LWCA 3ZR6A 3ZYIB 1H8TB 2PHRA 2W1UA 2YY1A 3T2OA 3IB3A 1IZ3A 3OYWB 1UQXA 4R4XA 1RVF1 3LFMA 2WQ8A 3HJRA 4YW7A 5FWJA 1ZREA 1CAXA 3KLSA 1SFPA 5BNQA 5I0RA 1NA1B 4EWEA 4S2FA 5CFDA 3WP4A 5T5LA 2ARBA 1ND2B 5FYTA 4LHLA 5AC91 2A3WA 3ALQA 1FNYA 4LT5A 3H3UA 5DXDA 4Q4X1 3MIEA 5KC6A 3HQRA 5C71A 2HJIA 5KXDA 3RVHA 1JODA 1GOFA 2H6CA 1BVP1 4AVVA 2WSUA 3MBWA 4QX5A 5JXGA 3S5AA 3HD8B 3OGJA 1UU5A 2Q4SA 1NE4A 4UBGA 4URTA 1ALYA 3D5OA 1RUI1 3LD8A 1EAH1 2GDFA 2ZMKA 5FZ6A 2W95A 1BXHA 4PBPA 3CKHA 5FBZA 3FWEA 4YGDA 1LJ7A 3WF1A 1FV2A 1QHDA 1UN1A 3TBDA 3WDXA 2IXHA 3ES4A 2BBVA 3JD71 5IATA 1JUHA 4NHYA 2RS11 4D7TA 3USSA 3C2UA 5FZ8A 4A3ZA 5T5JA 1QJY3 4D69A 3MLJA 4NROA 1T6BX 1O4YA 3PDQA 5LATA 3IAQA 1AL21 2BRTA 2MEV3 2W94A 5DQ0A 5F7UA 2DU1A 1AR62 3K46A 5LEJA 1UNBA 3LAGA 4K40A 4YVWA 1UIKA 3SKVA 1RC6A 2F4PA 1GZ9A 1JYCA 1R093 1LRHA 2VMDA 1HQLA 1DF0A 4KG8A 4EE2A 5K0UB 1DQ0A 4IGOA 1CVNA 4JGYB 1HV0A 1LNSA 5DDJ1 4BWOA 1C57A 5FQ0A 2EALA 4RR3A 2C9KA 5C5TA 4KBBA 1QQP1 1W8NA 2ZZQA 4FPFA 4UW3A 2JD4A 1C8M2 2GNMA 4MXWA 1DGRA 4PLOA 1AUYA 1OA3A 3J4UH 4IV3C 1YHFA 3A0NA 1QMJA 1LGBA 2AGSA 1UMIA 3ZN5A 3GHNA 2DUOA 3URFA 1GP5A 2RS12 1W90A 3MYXA 3QH7A 5FZ9A 3ZFEB 1JW6A 2P5BA 1QDOA 1VRH1 4BB3A 3OBZA 3UJOA 3POJA 4LE4A 1ZZCA 3D0JA 3ZXGA 1NXMA 1F35A 2D5FA 3HNMA 1ZBE1 3KZ4C 4P08A 4DB5A 2VULA 1UX6A 3PTRB 2DURA 2DVFA 4NRQA 2J1AA 2R32A 1Y9GA 4L11A 1UW8A 5C8WA 2I07B 2QQPA 4DXRA 3ON7A 2A6WA 1YQ5A 4W6XA 3BI3A 1H2KA 4QQ2A 4CDUC 4G9SB 4RHV1 3IDEA 5A7WA 3I59B 4KWLA 4Y22A 5C33A 5I0SA 2A1XA 4XDPA 3POFA 1ND2C 1WBLA 2VZ3A 2D6OX 3G6JB 4CUGA 2C9AA 1WW4A 2EICA 2JIGA 2VZUA 3IMNA 4NOTA 3VN4A 3KQRA 4FPHA 3RZLA 1OQEA 1V6OA 1W9TA 1RXFA 2GN7A 4COWA 2VQUA 2QCSB 4AI9A 1OC1A 3UKNA 3IN9A 1PO21 3U37A 5FUNA 4LNVA 2HWC1 1DYOA 4PDWA 3MIFA 4GJYA 3DF0A 4AI0A 1EUTA 2WWUA 1LOCA 1ODNA 3FX3A 4G3YC 5DAVA 1BZWA 1HKDA 4R52A 3WD5A 2W46A 5CG8A 1H8VA 2V72A 4KI5M 1MS1A 4NIAA 2GH2A 3EO6A 4HVOA 3VBHB 1UY0A 2DUQA 5FYVA 4DXZA 4N43A 1KGYA 2XWBB 5T3NA 4OUMA 2F4LA 1TME1 5A3PA 5BNPC 5LBBA 3IIIA 2XQRA 3KHBA 4YSFA 4QU2A 5DDJ2 3DUIA 4AL9A 2DFBA 1HN0A 1YLLA 4W65A 2WZR1 1W0NA 2RR12 1MQTC 2WA3A 3H8RA 3N7JA 4JC1A 4D3WA 1AHSA 2FDGA 2Y0IA 2Y6KA 3ENRA 3HIFA 3VBOB 3ZXAC 4NHXA 5IT6A 1H2LA 3O1TA 2SLIA 2KA3A 4EYUA 4OQ8A 1DGRN 1J3QA 2VZOA 2GN3A 4IEPA 3WG2A 5FPUA 1JZ2A 3N9OA 4IEVA 3POWA 2W91A 5FYSA 1GP4A 5ABJB 1MS4A 4Q0PA 2OZJA 2ERFA 4I30A 1ZBA2 3KV6A 4OQ9A 1ENQA 1WLWA 2DYCA 3KGLA 1LENA 5DG2A 2R041 2XJQA 1REDA 3G7DA 1N1YA 3WDUA 4GAZA 4GB32 4CYDA 1A34A 1KITA 2WC2A 5FMBA 1UYPA 1TME2 3AP7A 5DAXA 1MS9A 3DKWA 3WLUA 5HI0A 2G9GA 1HRI1 4CXWA 1W2UA 2VVFA 3AYDA 3UNPA 1GNHA 5HV4A 3W5NA 4XAAA 1OHFA 1UYYA 4ZHNA 3VBUB 1K5JA 1AXZA 3VDCA 3AZXA 3K4AA 3RZGA 1PGL2 4IE5A 5ACA3 5LY1A 1POV3 2R49A 3ZFEC 3ST7A 4AI3A 5IAXA 2HH9A 3GHMA 4Y5SA 5F5IA 1LGNA 4W6YA 5LWBA 3CJIA 3E5QA 4AI8A 3MIDA 4OUSA 3THPA 5H9PA 4HSLA 2ZX0A 4Q4V3 4IV1C 4FAGA 2D43A 3W20A 4JHTA 3S0MA 2JDUA 5F8PA 1GFF2 1H9PA 2ZEXA 1GZWA 5ERLA 4QX2A 2A6ZA 4XFHA 5KC5A 1W8TA 1LHWA 4WVMB 3ZYFA 1V6MA 5C7GA 1QGLA 3QLQA 5FO9B 3DYOA 4YW4A 4CDWB 1R092 4XYXA 3ATGA 4ET7A 4BDVB 4S2DA 5FOJB 4YPJA 4I3PA 3RYPA 4ITCA 1HXS2 2D6PA 5J37A 3VB9A 1QH6A 1K45A 2X29A 3AFGA 4Y1XA 4MGTA 5D8AA 2AC1A 1NX9A 4N9HA 5IK5A 1C5IA 4FT8A 3JD72 1QJFA 1AR73 2J1SA 3NJVA 4WM8A 1OI6A 2XONA 4GD4A 3C7FA 1DZTA 1ZZ9A 3Q8BA 5CNAA 1H6XA 2ZGPA 5LCWL 2PMWB 3CF6E 1U5ZA 4IEWA 2ZHLA 1PMJX 4LK7A 3VKLA 4Y1UA 5DZGA 3RZJA 2CHHA 2W1QA 2WBKA 3KD4A 1HQWA 2DVAA 3BVCA 4DS0A 5IK8A 1EPZA 2Z79A 1YC61 3FLPA 1GSLA 5FZ4A 1PMHX 4K1ZA 4XOGA 1UOBA 1O3QA 1RVF3 2O1QA 3WHTA 3ZYHA 1H2MA 4O9GA 1DYKA 2VTXJ 4BK4A 2E51A 2WFF3 4LULA 3VBRB 2CGNA 4NVPA 4E4HA 2CL2A 3BOPA 1E5RA 3AL5A 1RUE2 1SBFA 3PVBB 4UAPA 3THCA 1GP6A 3KV4A 3ACFA 3AVRA 4XIOA 4S2HA 2W47A 4SLIA 4ZU5A 3O0XA 4A42A 2IXJA 1DDLA 2MEV2 4C1XA 2YUEA 1GICA 2AZ5A 5FXXA 4LA3A 2OQ6A 1AXYA 1CPNA 1F9KA 4M3CE 4QPGA 1GZWB 1HIXA 2A75A 4N53A 2B42B 3QD6A 1SDDB 2Z5WA 1IGOA 1W6QA 4UT5A 4XJAA 5H9RA 3ILFA 4BMBA 5L36A 4IGPA 1WA4A 2VCMA 3J7HA 2L9LA 2JJ6A 1XNKA 2GC0A 4XACA 5F5AA 4P9LA 2VMFA 4JV4A 3W58A 2WWSA 3KCCA 4IUGA 5F6LB 1RUH2 4BM8A 4IE0A 3BCWA 4XHXA 1JS9A 4FFIA 1IS4A 3POSA 1OVPA 5LK5A 1SZBA 3N7MA 3QACA 1DZQA 1R1ZA 4GZ9A 4IV3A 4ISRA 2LW8A 1YJLA 2VQ0A 2XJPA 2H6BA 4HVRA 1H4HA 3AK0A 4BQYA 3O1RA 1WBFA 2VJXA 3M2MA 2JDHA 5IW0A 1GR3A 3PMEA 4GIQA 3EJKA 4LLOA 4UOJA 1XNAA 4XJ9A 1OPMA 2E26A 2F17A 1NE6A 3N9LA 4FFFA 4DZGA 2IVIB 2D44A 4R9CA 3RSJA 5FY8A 3WINE 3OD0A 5JR2A 1CQ9A 1F4AA 2QBXA 4HOOA 3RYRA 3FHIB 4RGKA 2WS93 3J8F3 2Q8CA 3MF9A 4FP2A 1OKQA 2ZGLA 3AP4A 3D8CA 3SEEA 4OFGA 3T0BA 4CEYA 1VB4A 1W06A 2J1UA 1RB8G 1WCSA 1AR61 4RHV3 1RUG2 1ZNPA 1VAVA 4GB31 5CBLA 1ZA4A 1ZA7A 3NV1A 1UX7A 2DCKA 5I0DA 3ZFGA 1STMA 4CP1A 1E5HA 2G1MA 1CD3G 1AYM3 3MF6A 1OURA 3PU3A 5KR7A 1OBNA 2JIJA 3NSTA 3T08A 4QKDA 4YGBA 1QXRA 1LB2A 1VRH3 1UZZA 4GWIA 4EJRA 2NM1A 5LA9A 1RUD2 4PF5A 4XUOA 4M3CA 1GUIA 1M4WA 5BPXA 3AKSA 3VHOA 1CIYA 4LBMA 1ONAA 3BYWA 4LA2A 1S0IA 5FY9A 3VBHA 3AVSA 2YC2A 5EYXA 2W5FA 2BP6A 4J25A 2VPVA 4DUWA 4X6QB 4GWNA 5FZ7A 4D6QA 3JBG1 4L99A 4NHLA 1DYPA 1O5LA 1TVGA 3FHAA 3T2PA 5BY5A 3MW4A 4S2GA 2VH9A 4MZUA 2AR6A 1EYBA 4CSWA 3EBRA 4H2AA 5FKBA 1U0AA 3VBSC 1H2NA 2RM22 2VVEA 2WO2A 2ZX1A 4XJ8A 3L2YA 1PZ8A 4RQPC 4XURA 4A6SA 3VD7A 1PVC3 1C4RA 1D2QA 4EN7B 1S0FA 1R082 2JG8C 2XHKA 3GBWA 4Y22B 3RI8A 1OLMA 2ZEYA 5F6KA 5J96B 4HN0A 2AYHA 4LBKA 4KL1A 2UURA 2I45A 2ZEZA 4GMP3 2UWAA 4L92A 5FZAA 2PHTA 1CWPA 1OD5A 3VL8A 3DECA 4O61A 2G19A 4YW5A 2HBUA 3PUAA 2BPA2 4LKDA 2UYAA 4Q4X2 1FMD3 1K12A 1VR3A 2J1EA 3RPQA 4E2QA 1UY3A 2YHJA 4BK5A 4KMQA 3F95A 1FNZA 3H3ZA 4XFFA 4A45A 4DFSA 1SBDA 2QQLA 3IWZA 1Z7S3 4ASMB 2DTYA 1QJEA 1Z78A 2PHDA 3A21A 3I2JA 4AVCA 2XUEA 2JDNA 2ZHKA 4XTMA 5A1FA 3VUOA 1XB9A 1OFSA 4XUTA 3WG4A 1EY2A 3MHZA 3AX4A 2ZABA 3SC7X 4KH9A 2FD8A 2IFRA 1VIWB 5F3GA 4UW4A 1HXS1 3VD5A 2D6NA 1UD1A 5CKQA 4AYUA 2ZGKA 3U4SA 2BNOA 2WNVA 5F37A 3GDBA 4MXWB 1ULGA 4FPKA 4EROA 5JZGC 5KXBA 1JYVA 1XNTA 1TMF2 3DV8A 3PUQA 5GZGA 5JPNB 3RJ2X 5FYMA 1NY71 2VQAA 3FFZA 1BQPA 4AQ6A 4LKSA 4IDZA 4I01A 1E5SA 4MVTA 2XVGA 3E6CC 2RE9A 3BU7A 3PVEA 4Q5OA 1VB2A 4G4FA 3UK9A 5CEHA 1CZSA 5EP9A 4MGQA 4ZKTB 5FK8A 3LA3A 5K7PA 1Q5OA 2FDIA 1XE7A 2DVGA 2VZSA 2VCBA 3CL1A 3TB0A 4CUBA 5DN2A 4DEQA 1AYM1 1I5ZA 2OW4A 5EHDA 4KU8A 1IQAA 4OVEA 3WZ1A 3BTXA 1YUDA 3B00A 3JBG2 5FZFA 2LUWA 3U1XA 2D6LX 2WSVA 2GP5A 3HR9A 2BW8A 1REEA 3SISA 1OT5A 2Q1ZB 2H0BA 5FJKA 4YW6A 4AEJA 1EAH3 3IDCB 4H7MA 3SEPA 1XPWA 2UY9A 2ZX4A 1ZRDA 5DDJ3 4META 2QQNA 2WS91 1C28A 1OA4A 3ZXJA 2GSYA 5HCAA 1CR7A 1PM7A 1UZ0A 2WAAA 2LS6A 4I09A 3IMMA 1NA1C 2A71A 3CMGA 3I7DA 3ZIXA 4CP9A 1PK6B 1S0CA 2PHLA 5FY5A 2WR9A 1A78A 2RM23 5SV5A 2WO7A 5ACA1 2OT7A 2RR11 1U5XA 4QXKA 5F2WA 5BUVA 5FUPA 5FOBB 3GJBA 3NL1A 4B3NA 3OCPA 1QJZA 4FQ4A 2B9UA 4FI9A 2HYKA 1H1MA 5FO8B 1CAVB 5IVYA 2RS33 3S7IA 1ND2A 5C70A 2E9QA 2BOIA 1RUOA 1CJDA 3SXWA 3NMBA 3FUQA 2EXHA 4C0BA 2CV6A 4AFCA 5CFDB 2AEZA 4LEJA 3NVCA 1LGCA 1YRZA 4XQDA 1QH7A 2PLV2 3N3HA 1H8TC 4HT1T 5I91A 1JH5A 5B4XA 4YM3A 1S0DA 1WW5A 3WDWA 4MOAA 1MZEA 3SCGA 3K3NA 4YM1A 3QOPA 1XC6A 3DL3A 4KU7A 4MGZE 1GWMA 4YRDA 5BNNB 5KHHA 1HRI3 4WVZA 1F5FA 1FXZA 3LDKA 1JHJA 2GC3A 3THTA 5JUVA 1UWWA 1CAUB 3DYPA 4CP0A 4F83A 2BFUL 1NCQC 4TYSA 3KMHA 3WP3A 4AWDA 3HNYM 4I2OA 1S2KA 2RS51 2W68A 1ULFA 5IWFA 1COV3 4XJZA 4M4PA 3GCWA 4O9EA 3UESA 2GNTA 2B7YA 4NAMA 4P9XA 5DUWA 5F3EA 3VHPA 5IFPA 3WP6A 5KBFA 1NCRB 1COV2 3AMPA 1R1A2 2ARXA 1X36A 2P37A 3E5XA 2JD9A 3AMHA 4Z2AA 3OF1A 4A44A 1HDKA 3O0WA 4JAAA 4IE4A 5F5QA 4KQ7A 2Y6FA 3ZXFA 1R081 5JOXA 1JYIA 2EIGA 1AR72 2QZ2A 3M70A 1OOPB 1V9U2 1PVC2 3LIGA 4OI2A 4AW7A 1J3PA 1VBB2 1FAYA 1G6NA 4HL0A 1TZOA 2GC1A 3I3MA 2BNMA 4BH9A 1OLME 1UZYA 2CAUA 2WNEA 3ZN6A 2D5HA 4IV3B 1WLTA 1V6LA 3I3DA 4GH4B 1RUE1 4RR3C 5FXVA 5F39A 1J1LA 4W8JA 3ZPOA 4J1XA 1NQJA 1F2NA 4YVSA 4XF4A 3OG2A 3MZHA 1K5MB 1IHMA 3T1MA 3LEGA 2BUKA 1DQ4A 2ZBJA 3VBSB 2ZKNA 2BOJA 1H1IA 4GWJA 4UBHA 1V70A 1W6QB 1ZBA1 3GCXA 4N53B 1FPN1 3HNBM 5LK7B 2FCVA 5C8CA 2I74A 4XF9A 2R042 1UKRA 3VHRA 4HKOA 4ISQA 3WUCA 1L7QA 4IEOA 4EN8B 5IJRA 1WMFA 2AEYA 3CJXA 4R9DA 1MVQA 2RG4A 1H4GA 1WD3A 4CDWC 1UY2A 3ETPA 1TMF3 4Q4Y2 5E89A 1AVBA 4ES8A 4CU7A 1LTEA 5LASA 1NZIA 4PIZA 1EPWA 2AACA 3OY8A 2B5HA 1GOHA 5IHRA 1OXCA 1BCXA 3NNLA 3L2HA 1A8DA 3KV9A 5FTTC 2ATFA 2GALA 1POV1 3LEMA 4RQPB 3AB0A 2X8KA 5TSWA 4B1MA 4EN0A 3IPVB 2UWBA 4LIUA 2DBNA 4DO0A 1OLRA 3B01A 3RZHA 4EZHA 3IPVA 3LPFA 4UF0B 2ENRA 1VBB3 1R1A3 2R063 4HFSA 5D8AC 5ANNA 4N8MA 4OUEA 4CCMA 2C6SA 5GLUA 1JZ5A 1RIRA 2WN3A 1RHI3 2WINB 2WZPP 1K42A 2GNBA 4WM8B 4MGIE 2WFPA 4NMIA 1DLCA 4MADA 3H50A 4ORFA 2DFCA 3H8XA 1O5UA 1QXPA 1KJLA 5B2GB 3N9PA 2ORXA 5G05L 2NQYA 3ILNA 1NOVA 1REFA 3DGTA 3VBFB 2BDRA 3MEPA 2HWB1 4AEMA 4FBFA 1FOD2 4LBNA 4HBNA 5JWPA 3D0SA 2HWD3 1RXGA 4YG6A 4CDWA 2VZVA 2WZR3 3WNXA 3H3LA 3B94A 2ZZJA 2PHXA 3EMRA 4WVMA 3TNPB 1PIV2 4BXSV 1RUC1 2CGOA 4Z2WA 3IDAA 1GMMA 1RMU2 1UOGA 5FKCA 2K9ZA 3VBHC 3WF2A 1JU4A 1PNFA 2JB8A 3LIHA 5FZGA 1EV11 1OOPC 5FP9A 2P4EA 2YU1A 3PIGA 5EXOA 3USUB 1S0EA 1K5MA 2B8MA 3U11A 3T0AA 1AX1A 1DHKB 1NZCA 2WT0A 2VOWA 4YVSB 2VMHA 4LO5B 4PBOA 1IS3A 5JDBA 3AL6A 1NYWA 4P9GA 1GWLA 4GH4A 4CXXA 3NJZA 1HW5A 3RS6A 3ZN6B 1O8SA 1RUJ3 2IC1A 5FLHA 3CU7A 4Q29A 4BXFA 4CCNA 2PTMA 4RHV2 5BV6A 1D4M1 4M0HA 4YW3A 4ASKA 1CX4A 1XOYA 2V5YA 2VW0A 3RRDA 3IZOA 3LPGA 1D0HA 5A33B 2VBBA 4UFHA 1NG0A 2W2IA 3HT2A 2YXSA 3VD9A 2AREA 3HAGA 2AH2A 5A32A 3LOBA 3ZMOA 1WLDA 2JKBA 1NCRA 3AKRA 4KNCA 4JDMA 4ATFA 3LZZA 1D4VB 5LA0A 4BLJA 1CJPA 2J22A 2WRAA 1QEXA 2YG0A 2QQKA 2BNNA 4QXCA 1Q8SA 4XZUG 4JGZB 3WDYA 4K3UA 2ADEA 4BPZA 1Z7S1 4XUQA 3MFAA 5LY2A 5KWRA 1CAUA 3DPRA 2J42A 3GNEA 1IPKA 4ZS3A 1QJX3 2A6YA 5F2SA 5CB7A 5BNNA 4LE3A 1YWKA 2WFF1 2ADDA 4PT6A 4QB2A 3VBFC 5T55A 2JDMA 4IEYA 5FMOL 3GZEA 1IKPA 2JDZA 3NWKA 4E9KA 1SHWB 3AMQA 1RMU3 1OSGA 2NMNA 5A3MA 4N43B 5T5OA 3ZIWA 1W05A 4Q27A 2Z4FA 3ECQA 4AOCA 1IPSA 4H55A 3WXPA 1NAEA 1CAVA 2QQWA 3E6DA 1C1LA 4A41A 4NWVA 4B1LA 3BIEA 3PJQA 3HT1A 1QQP3 2RJ2A 4COVA 4CCLA 3B5LB 2CU5A 4MHRA 2YFUA 5FYUA 3WR0A 2E53A 4AHYA 3VD3A 4TLGA 4YZ3A 4DEVA 1PK6A 1NCQB 3OUJA 4XPVA 3TEWA 3A0KA 2NP0A 3T0DA 2ZKLA 1MS8A 4D7SA 3M3OA 2R16A 1BEV1 3SCFA 3ZFFB 4N9IA 2WNVC 4DQAA 3TN92 2DCJA 5IAVA 5A3LA 3ZKUA 1UU4A 1W9FA 4FCAA 2RMU2 3W59A 5FZLA 2XJTA 1JYWA 2QQJA 5K9YA 4I3GA 4DMIA 3PUHA 2DCYA 2DU0A 3ACLA 1PO22 5GM0A 1YIPA 2ZMNA 3C8XA 3LF7A 2FDJA 1RHI2 2BEOA 4QHOA 1NY72 3AP9A 5GLTA 1LKNA 4Q4Y3 1JBCA 3RI9A 4I0WB 3ES1A 1OUSA 3LA7A 4NIHA 4QKNA 4CCOA 4NIGA 1HB2A 2VMGA 4UI9L 5FPLA 3S6PA 1JTZX 1F5JA 2G9FA 2WJSA 3LOIA 3ZFEA 4GQ7A 1LHOA 2QKDA 4QPGC 2VMEA 4YGEA 1H6YA 3RFRA 4Y5TA 5FRAA 3NNJA 5L7OC 4FO9A 3ITQA 2KR2A 4A7ZA 1ACCA 2VUJA 3APBA 2D3PA 4LJHA 2A3XA 1Y9QA 4CU9A 1HJGA 3AZYA 4MGKE 4DNYA 1VBC3 5GALA 5FREA 1LOGA 5L9RA 3N4MA 3I2GA 5D1IA 3GM8A 5EQUA 2HWC3 1YXWA 2WO3A 2C5DA 2WUHA 5FQ0B 4E8DA 2ZMLA 3LQCA 5L9BA 4JGYA 4YZ5A 1EUUA 4B4PA 5FLIA 1O3RA 3RZZA 2HWD2 1UY4A 4COUA 4HMZA 4XZPA 1BK0A 1ULCA 4A7KA 3H7YA 5GZFA 2XQXA 1G9FA 3C3VA 4HG6B 4F3JA 4LTAA 3O1VA 4ES9A 1PZ9A 1PIV3 1TME3 4UFKA 2GMMA 3EHKA 2Q0AA 2FZ2A 1W8HA 3AZVA 1LOFC 2P1BA 1W0PA 2QE3A 2ZGUA 1TE1B 2OUJA 3WV6A 2GH8A 5FYZA 4TXWA 1W6NB 5C3RA 5FYBA 4J6GA 2FCTA 4HLTA 1F31A 5E1RA 2DTWA 4BE3A 1SPPB 1LCLA 3AZWA 4HKLA 1SBEA 4LO6B 4GB33 1RL3A 2HKXA 2B9VA 3AYCA 2ZS6B 1PO23 1PGL1 1UOJA 2RV9A 3ZOIA 4P5HA 3PUSA 2PLV1 3ZFFA 5JXIA 1S2BA 1W03A 2E7AA 3SQOA 2E32A 2R7EB 5SV8A 4ZZ5A 2PFWA 1KFUL 2VCCA 3KGZA 2WN2A 1MEC3
chains in the Genus database with same CATH topology
4Q2FA 2EAAA 4GWMA 5DZFA 3RMXA 2ET7A 5ABJC 4MGYE 4AI2A 3D6EA 3H1WA 4XBNA 3JB4C 5T5PA 4OI1A 1AX2A 2ZAHA 2R6QA 3ZPYA 4Y20B 1NXD1 2UWCA 2BQPA 2RS52 4GXLA 3CO2A 4LLFA 3ZX7A 4IXLA 3ZXLA 3FLRA 3WDTA 3JBG3 4Y4YA 1XYOA 3KSCA 2EVXA 2ZX2A 2D40A 2OZ6A 1NA1A 2A6XA 2MPFA 3MLKA 4DPNA 1XU1A 1G9BA 4M3CB 1VAKA 3JQXA 1YYNA 3OYWA 3NAPA 1HRV2 1SLTA 1UPSA 1ZZ6A 2CWSA 4IV1B 4MV2A 1LHNA 2GMPA 3U0ZA 5EZWA 2JG8A 3DPRB 3V56A 3ZFGB 3VZMA 1JOJA 5FFOC 2R043 1LECA 4JGZA 1AR83 1O3SA 4Q4X3 3AYEA 1SLLA 2C1FA 4DRVA 1AX0A 4CEYB 4XFGA 3WCSA 2LM3A 4GMP0 3WW3A 3B93A 4N90A 2I2SA 5A32B 5C8CC 5IK4A 5CAZA 5KHIA 3RG0A 4KGQA 1HX6A 3WVJA 4Q8LA 1J1TA 5JAXA 3HMYA 1I3HA 2BYVE 1N3PA 2ZPXA 1FX5A 1SDWA 5CFCC 4K9SA 1UF2C 1OQDA 4OI4A 4AFBA 2XUMA 2O8OA 3AXDA 1AZDA 2EAKA 4Q4W2 1X7NA 4XETA 5JIUA 5E8AA 3UV9A 3WG1A 2VW1A 5J36A 5AC92 4Q0VA 4LBOA 3L9JT 4SBVA 3MICA 4C0HA 3USUA 2SBAA 2AENA 1L3JA 1QWRA 3QH6A 3VBRC 4CZSA 2NZ9A 2P2KA 5IUQA 4QQPA 3ZYGA 2JX9A 3KM5A 3TYJA 1GQGA 1RUC3 4GULA 1NLSA 2NMOA 1V6JA 4XQWA 1RUI2 2VECA 3BODA 4P9WA 2WQ4A 2VMIA 1AYN3 3IM0A 2PELA 1B35C 1BEV2 1SLBA 3VBFA 5C4WB 3EQEA 5JLVA 4XJWA 4M01A 3TN91 2EXJA 3O5SA 3R05A 2RJKA 1LU2A 4B7KA 2PHUA 4MLOA 3ZN4A 1ZRFA 4V1PA 1FOD3 1MS5A 1AR91 1XXNA 2Q1MA 4OHVA 3AMMA 2WZR2 1KD7A 1SEFA 2KXLA 3AYAA 4CEYC 2WNUC 2ZTNA 2HWF3 1COV1 1RINA 1QNWA 4IESA 4P9IA 3FJSA 1JHNA 2PA7A 3KT1A 4UW6A 5T50A 4B4RA 4QM8A 4FTEA 2XH6A 5GZCA 3UKTA 4D7YA 2PAEA 4YG3A 1FPN3 4AFAA 1R091 3OY8B 3SH4A 5T52A 5D8AB 1XQNA 4RSUA 1VJ2A 4Z92B 4LHNA 3ROUA 5LEKA 2R062 2P34A 2Z2SB 4WM8C 1H1AA 1ND3C 1WMEA 1ZZ8A 4IEUA 5C9AA 4Y24A 5KC6A 5F9TA 3N36A 1RJ7A 4BIOA 2ZGSA 3IKWA 5L7OB 5CG9A 2QDNA 3BOWA 4Q4V2 5C8CB 1MS0A 1S1AA 1NCRC 1BEV3 4TSVA 4BZ4A 2JE7A 4D94A 4YYOA 3KCYA 4OHZA 3VBSA 3R4SA 2OYZA 1X8MA 1Y43B 3HBZA 5JMCA 1JN2P 1VLNA 1B35B 4JRAA 5C4WC 3POYA 4E2GA 3SH5A 1HLCA 1BBT1 2BVVA 4Q4Y1 4YARA 5I8YA 3ELNA 3S7EA 3LSDA 4YVSC 1QJX1 2B45X 3JUUA 3MLLA 1YI7A 2TEPA 2UU8A 1OOPA 3EXUA 5FCCA 3U07A 2BWCA 2R1DA 4KGGA 3ZSKA 1FMD2 2W0XA 1RMU1 4DRRA 5ABJA 1AL23 1W6PA 4P9JA 3D4KA 3MW2A 1DG6A 4N53C 4Q4V1 1RUF1 4WM7C 3WUDA 1QNYA 1APNA 3MIHA 4Y1ZA 4BIFA 1YI9A 2K0GA 1ASJ1 2DVDA 3P3PA 3FBYA 1AF9A 2IXKA 1HRV1 1WW7A 5H9SA 1YFUA 1QQP2 3OGGA 1QJU2 4NO4A 1E57A 2IWGB 4FPCA 1MR5A 4FOYA 1Q8VA 4YM2A 3H1YA 4XFCA 2IZWA 3S30A 4QGMA 4WZFA 1GBGA 1XYPA 1QJY1 2QDRA 1MZFA 2HWE3 3RJRA 1AYN1 2W08A 3FMGA 1O7FA 4H7LA 2YV8A 4E4SA 4PDWB 3FLTA 3VBOC 2CTVA 4Q26A 1DFQA 2NLRA 1ENSA 2R0FA 3VL9A 2DVBA 5GZDA 1PHMA 4EN6B 1KFXL 5JZGA 4XBQA 1A6CA 1QKQA 2XBO2 3LGRA 3ZFGC 1VP6A 3AJZA 4FOVA 2EXKA 3SMHA 2GAUA 1VBA1 4HK8A 5AVAA 4EV0A 2YZ4A 3JU9A 4HPKA 3WDVA 3HN1A 4KWJA 1FYUA 4XHBA 2NPIA 4YFZA 1AR81 5HXVA 2D98A 4WVWA 3J9SA 2YPJA 3ZFFC 4AE2A 1TNRA 3NKTA 2XJSA 4JCKA 4BYYA 4HKWA 2ES3A 3FE5A 1X33A 2VW2A 5CADA 3VGIA 2D6KA 3BIWE 3GBGA 4CEWB 1RUF2 4AFDA 1OQ1A 3KT4A 1Q3EA 4XW3A 2RS13 5JI7A 3OD4A 4AK3A 4FP3A 2R30A 1BMV1 1VBA2 2YGMA 1OLQA 5FDBA 5JOYA 5J48A 1D2SA 3AP6A 3FZ3A 3OBRA 3VBUC 2WNVB 3OPZA 4AEKA 2JECA 1AR92 4QT6A 2R073 3AZZA 1FT9A 2UY8A 2X5IA 2IXIA 3ZXDA 5CFDC 1PVXA 4HZFA 1DQ5A 5FO7B 2IXLA 1W6OA 4Q1RA 1WMDA 4PQ9A 4QM9A 1A3KA 1RUC2 4C90A 4RD7A 1HRV3 4AG4A 4FOWA 4XFBA 3VHNA 1D0GA 4FPJA 1UKGA 2CGPA 1POV0 4QPIA 2JICA 3H8UA 4YW1A 1F8VA 2H0VA 4RS5C 4CTEA 1SCSA 3ZYRA 3R4DB 1DBNA 3TRSB 2OVUA 1DQ6A 1T6GC 1VBD2 4I02A 3OJBA 4QQLA 3M1HA 1W0OA 4JRLA 2E7TA 5CFCA 4Y5Z0 4H3WA 4AVSA 1AL22 2FBEA 1Q43A 1W39A 4M3CF 4PIXA 3LA2A 1LODA 3H0OA 3AM2A 3VKOA 3R4UA 4JGZC 2K2SA 1WCDJ 2B39A 3O12A 4M0NA 4AHWA 5I93A 3T1LA 2D97A 4IERA 1Y3TA 4BLIA 4NWWA 1PIV1 1YFYA 4PJYA 3SHRA 4YZ1A 3MFCA 1EV12 3CNAA 1BBT2 5GZEA 2B46X 4K8FA 4GALA 4WBBA 3A4UA 1H8TA 1ZZBA 1IPJA 2P3KA 3GZTB 3DN7A 1PO12 1O3TA 3M3CA 3RDIA 2XBO3 3FC0A 3ZXEA 4LBQD 3V0AA 2OA2A 4U36A 1PO13 5DUXA 1VRH2 3NW4A 2E7QA 4ASLA 2P3IA 4L97A 2DF7A 4GA9A 4Z07A 4B4QA 5BNPA 3WX5A 2ZCWA 4WM7A 5FPXA 4Y1YA 1LR5A 1C8NA 2D3RA 3VZLA 4WVVA 2CNAA 2E6VA 1BK1A 4NN0A 5JVVA 1V9U3 4EWDA 1XE8A 2X53S 4OHXA 2X5IB 3ZVXA 3O14A 1CESA 4L9BA 1WGPA 4RS5B 3MIBA 1VAMA 1SACA 4JVAA 4K6BA 3GBFA 2RHPA 2MNGA 1RGSA 5L73A 1BKZA 2WLQA 5KHJA 5GLWA 4FPOB 1RUF3 4BMEA 4LO7A 2WS92 3DPRC 1CAWB 1RHI1 5LRRA 1RUNA 4BOWA 5BNNC 4AGGA 2QFEA 3H9AA 4MH0E 1JUIA 3AKTA 5GLVA 3JQWA 4QPGB 1SMVA 1W6MA 2PHWA 1UL9A 4MXVA 4FTBA 4OZXA 1WCKA 2YC0A 2A5ZA 4CDUA 1Z0HA 2RM21 1LOFA 1HRI2 3VZOA 5EWSA 2XGXA 1FATA 1I1EA 5EV7A 4YVWC 2Z42A 4XFIA 1QY4A 4CDQA 1ZX5A 3VDDA 3I4IA 5HCFA 4HPKB 3VBRA 2GNDA 4XF3A 4HSJA 3X29B 3IBMA 3E97A 5K0UC 3NO8A 2VOVA 1EV13 2JENA 2ILMA 2TBVA 4XDQA 3NV2A 1PGW1 3RYKA 4AQ2A 3NV4A 3N7LA 1AR63 1RUJ1 1Y7BA 1OFNA 1AJOA 1H30A 3ME2A 1AJKA 3VZNA 2XVKA 2CYFA 4JQRA 1U12A 2KM2A 2JEMA 5CVRA 3RNSA 3SITA 4FXGB 3VLBB 2FZ1A 5CIRA 3KT7A 2A70A 5BNOB 1ULDA 2PHFA 4FPLA 4HN1A 4R9AA 5GKAC 2ZHMA 3O0VA 1C3HA 4CEWC 4L8QA 3B9CA 3M3EA 4FPYA 4ZXKA 1KJRA 3TNQA 4CDQC 2RR13 2ZJCA 4P14A 1WLCA 4LBQA 2DCTA 2HWF2 3PJYA 4KWKA 2ZGNA 2QZ3A 1XNCA 1MZ6A 4RGGA 4Z82A 3WW2A 4E4DX 1M06G 4WZCA 3CJIB 4XXAA 4AEDB 5C9AC 4B7EA 2DV9A 4UXAA 3R6SA 4DOUA 1X8EA 4YM0A 5KXCA 4A3XA 1JXNA 2D3SA 1LEDA 3P3NA 2RMU1 1GQHA 1KDKA 5EFUA 1YJKA 5C6CA 3MI8A 3VBUA 1PO11 4QHBA 1FI2A 3UKVA 4JDNA 1ZZ7A 4AVAA 2HWE2 2CY6A 2O0OA 1LHUA 1PNGA 2XL7A 2VOXA 5JSRA 5ACA2 1IS5A 1C5HA 1AR93 1FV3A 4AEDA 1WW6A 4R8HA 2ETEA 1J3RA 1PK6C 3H1MA 3SCHA 1VBC2 4Q0QA 4CDXC 2VU9A 3K51A 4LBQB 3ZSJA 5JSPA 3BTAA 3VBOA 5JIAA 1ENXA 2OUHA 5L7OA 2N7GA 3IT8A 1VBE2 4WV8A 4XXPA 4LBLA 2ZA9A 1EAH2 2NYYA 4E27A 1LU1A 1LOEA 5AFEA 3ZSLA 1YNAA 2PN5A 1UAIA 4F7ZA 2OPKA 4X8PA 3K48A 3J8F1 5BNOA 3Q9OA 1TMF1 4GMP1 5KHGA 5J98B 1RUH3 5L19A 4AQSA 1KXGA 2HEWF 2JE9A 2PAKA 1YIFA 3LB9A 2G4IA 1SLCA 2W52A 3WW1A 4HANA 5LRSA 3B69A 1ENRA 3D82A 3AFKA 1MACA 3KB5A 2ZAAA 1OA2A 1NLRA 4NR1A 4R4ZA 5E16A 4PIYA 1UPIA 1VBC1 2C0ZA 4XQ4A 5FPZA 1XYNA 4AVBA 4COYA 3WT3A 2A6VA 2HWF1 1MVEA 2D6MA 3E5UA 4K1YA 4JTOA 5CA6A 2VOKA 3I8TA 1I6XA 1O4TA 1PVC1 4IEQA 1RJ8A 3WQ1A 3BALA 3WY6A 4PCRA 1U5IA 1RUG3 5DUVA 4YZ2A 3B9IA 2ZGOA 4J1WA 3MW3A 5FMOS 2WFF2 4CDQB 3I59A 2ZX3A 1KDMA 1GKBA 2ZOEB 3LCPA 1ND3B 4PLNA 4COZA 2R072 1QJY2 1FMD1 4E2SA 4ZU7A 1GLHA 2JG9A 1VBD1 4GH4C 4IQPA 2EA7A 4NHKA 1QJU3 3V0BA 1UCXA 5GJ6A 3CJIC 1CN1A 4QGLA 5DZEA 5K8SA 2GMEA 5E88A 2QJVA 3OTFA 4LUKA 5I8SA 1N1VA 1QDCA 2IXCA 4OHWA 1UU6A 1GNZA 5KXEA 3VKMA 2Z69A 2A3YA 1SLAA 1AR82 1G9CA 1WUVA 2GZWA 2XJVA 4M00A 3T2TA 3B7MA 4P9YA 5JI9A 4RR3B 4NPRA 4FXKB 4RS5A 1ZVFA 1ZM1A 2NN8A 2A73B 5DUUA 4FPGA 5K0UA 1LOAA 1ZYBA 2OIIA 3E6BA 3NKGA 1YFXA 1N47A 1V6IA 1ZBE3 1HXS3 2MEV1 4YVWB 3MPPG 4XBLA 4DINB 2YROA 4WM7B 2PLV3 1RUJ2 4Y26A 4XE9A 1CONA 3M3QA 5T54A 1TQ5A 1DQ2A 3HQXA 1O4ZA 4AHXA 5CU1A 3R0RA 3PTYA 4AXOA 2QUOA 1IOAA 1R1A1 4FQZA 3V0AB 3O7OA 2YDEA 4BQ1A 3GF6A 4XFAA 4X8NA 2VUAA 3KCXA 1KRIA 2P3JA 1BVVA 1KQRA 4INDA 3MPBA 1RUD3 4IV1A 2VXRA 2XLFA 2WIIB 3NAPB 4N7IA 1C8M1 1GYKA 2WQZC 4AGRA 1AXKA 1LOBA 3ETQA 4MYEA 4CRQA 4FAHA 3INAA 1N1SA 2GC2A 4AF9A 5BXXA 4AHZA 2R071 4C91A 2RS53 2R0HA 4EN9B 1SFYA 1DZRA 4Y20A 4K7JA 2RS31 4N43C 4X6RB 5HBAA 3FFQA 3CEWA 4LUMA 2HEYF 2XVLA 4QQOA 3VV1A 5CFCB 2JXAA 1R083 1SFNA 1CAXB 3ZYJB 4F8AA 3LKJA 1DGWA 4BA6A 4ATEA 4MX3A 4OHYA 1YO8A 1NQDA 3RMYA 3JZVA 1DGWX 2BWAA 3B02A 4KG0A 3MIGA 4Q4W1 3M7AA 1URXA 3TOJA 1QJU1 4B8EA 1D4M3 4QPIB 4LO8A 1BJQA 2ZACA 3M4FA 1ZRCA 4IL7A 2ZHNA 3UL2A 1W6NA 2XKOA 3JB8A 1EP0A 2WNUA 4W6WA 1MQTA 4LO4B 1MZ5A 3FBMA 2Y0OA 4RGAA 1U5YA 5JSOA 4Z1VA 1AYM2 4CDXA 2HWC2 1LHVA 2Q30A 4JGYC 1W6OB 2RS32 1DIWA 5H9QA 1VBE1 2LALA 4AGVA 4BCUA 4OLLA 2A7AA 3SNMA 4MUVA 1SQ4A 3GZAA 1HV1A 3NAPC 5I8TA 1G86A 3J8F2 2YGLA 4JTNA 1C1FA 2WL1A 2X5IC 5GLZA 4Z8BA 1RUE3 1RVF2 2BGCA 4HK9A 5I0UA 3VKNA 2HWB3 4XTPA 3AXEA 1TEIA 2Y26A 3PLQA 5AC93 2W39A 1YFWA 1VALA 2XLGA 3ASIA 4EWAA 4QMAA 2AUYA 3TWIA 4QD2A 2ZGMA 1KS4A 1X82A 3IIAA 3KS7A 4CEWA 1O91A 4Y1VA 3FUOA 1QF3A 4DY3A 1LEMA 3V0BB 4GKXA 3H7JA 1CPMA 4ZU4A 3WCRA 5JCTA 5J7MA 3ZO0B 4AFMA 2XB6C 2XL9A 2JG9B 2F6BA 3PMSA 1WD4A 5JR7B 3UJQA 3VZKA 4AEJA 1GANA 1BYHA 4HETA 3I2DA 1ND3A 3ZSEA 5IK7A 2DWRA 4OI0A 4I0BA 3WP5A 3JD73 3WQ0A 5KHKA 2BVBA 1ULEA 4QPIC 3WW4A 1MS3A 1S0BA 1D4M2 4IEXA 4YG0A 1NCQA 2BFUS 3GALA 4U2AA 4JDOA 5JZGB 1ZBE2 4IEZA 4E4ZA 3ZSMA 4QGNA 2V09A 3B3QE 3QCWA 1J59A 2EXIA 2Q8OA 3PVNA 3M8LA 3N35A 1QXJA 4RFT0 3PVOA 1RUH1 2DCZA 1TNFA 4AQTA 1HQNA 1V9U1 4H14A 5EJ3A 4Q4W3 3W9AA 5DG1A 4GKYA 1KS5A 4YNIA 2XWJB 4TWTA 4Q0SA 1CGPA 1X50A 1DLLA 4QPYA 3AP5A 3WG3A 2VGDA 1BMV2 1QOTA 4NHMA 2EF6A 2VG9A 2QVSB 2HWD1 1MEC2 4C1WA 1Q56A 3I54A 3J26N 3MDPA 1GZCA 4HVQA 5BNOC 4R9BA 1PMIA 3SH3A 2PYTA 1VBE3 3GYDA 1ASJ3 3U10A 4YLZA 4YGCA 1I9RA 4YFWA 1RUG1 3PHMA 4RL7A 3VKFC 1DQ1A 3OBTA 1XNDA 2VY0A 1W6PB 4XF1A 5EYYA 2IFWA 3RWNA 3VZJA 1UIJA 3WHUA 4FSJA 5A33A 3WQ7A 3M3IA 3CLPA 1VBD3 2P17A 5J3UA 4AVTA 1XU2A 2VNOA 2WT2A 2GU9A 5J09A 5JPMB 5I0TA 4A2UA 1SLIA 1Q8OA 2CWMA 3AJYA 2FQPA 1PGSA 3RQ0A 3NV3A 4PDWC 3BPZA 4FOQA 1B35A 1MEC1 2VVDA 3AKQA 1N1TA 2BTVC 3V65A 1VBA3 2UYBA 3BB6A 5F1RA 4IETA 2O8QA 1YCIA 2JG9C 4BHPA 3ZDSA 1OMIA 1H9WA 1Q8PA 4XILA 4MSVA 1AL0G 2FMYA 2XPJA 1LULA 4I0AA 3IDBB 1G8WA 2FHRA 5C9AB 3U4XA 2HWE1 2XKPA 4XF0A 3ZMNA 4XMIA 1UMZA 1B09A 1ZBA3 5AVPA 3N7KA 2RMU3 2YMZA 2HWB2 2XJRA 5JOZA 3SLIA 1OPOA 4FPEA 3LSEA 1QOSA 4AI1A 3GZUC 1S0JA 4FTSA 2R1BA 4K21A 4UW5A 4Q8KA 2ZGTA 1ZRRA 3WOGA 4ONUA 4A7YA 2HEVF 2PQQA 2XLAA 2XG3A 4RQPA 4TLFA 1N3OA 4XEZA 1RTVA 5BYNA 1C8M3 1K5MC 2YYOA 4FVVA 3ILRA 1DGLA 3AKPA 2RJLA 1G9AA 2Y38A 2DUPA 1QU0A 2VNRA 2MHFA 2D93A 2TUNA 1V6NA 5AFBA 1AR71 1SCRA 3VDDB 1RUI3 5HCBA 1VBB1 5C4WA 1G9DA 4PLMA 4OULA 4DY5A 1RUD1 4LR4A 1QJX2 2QNKA 4YW2A 4CDUB 2D7FA 3TAYA 2TNFA 1BBT3 4K20A 4LBJA 1W6MB 2VNGA 3JCIA 2E63A 1IKQA 3V64A 1S55A 5FAXA 1Z7S2 4QQHA 1H0BA 4RA0A 1CAWA 1S0GA 3AMNA 3PNAA 4XJUA 1FPN2 4XIKA 2WA4A 4B29A 4CP2A 1A8MA 2WLPA 1XNBA 2WKKA 3ZXKA 1GV9A 3HWJA 2R061 1XRUA 1ASJ2 1LESA 1N3QA 4L2NA 3TN93 1PZ7A 1CIWA 4YZ4A 3MGUA 1V6KA 2PAMA 2ET1A 4Q0UA 4Q1PA 4LHKA 1FOD1 3QBQA 2V73A 2LTNA 1G7YA 2WT1A 1RITA 1QOOA 4CDXB 1Q8QA 2XJUA 1DU3D 4AEDC 1IS6A 2FMDA 1MQTB 1V00A 1PGW2 2WNUB 1AYN2 2CAVA 4N7UA 3ZYPA 2ZGRA 2Q5TA 4XMAA 2JG8B 4TZDA 1J58A 5FLJA 5JOWA 2XBO1 3LWCA 3ZYIB 1H8TB 2PHRA 2YY1A 1IZ3A 3OYWB 4R4XA 1RVF1 1ZREA 1CAXA 3KLSA 5I0RA 5BNQA 1NA1B 4EWEA 4S2FA 5CFDA 3WP4A 5T5LA