1WA4A

Crystal structure of the m131f l135a evad double mutant
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
205
structure length
205
Chain Sequence
MQARKLAVDGAIEFTPRVFADDRGLLILPYQEEAFVEAHGGPLFRVAQTIHSMSKRGVVRGIHYTVTPPGTAKYVYCARGKAMDIVIDIRVGSPTFGQWDSVLMDQQDPRAVYLPVGVGHAFVALEDDTVFSYMASRSYVTQDELALSALDPALGLPIDIGVEPIVSDRDRVAITLAEAQRQGLLPDYTTSQEIERRLTAVPVST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Epimerase
molecule keywords PCZA361.16
publication title Crystal Structure of the M131F L135A Evad Double Mutant
rcsb
source organism Amycolatopsis orientalis
total genus 49
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2004-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00908 dTDP_sugar_isom dTDP-4-dehydrorhamnose 3,5-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1wa4A00
3CJXA 3EJKA 1TQ5A 4IEXA 3U0ZA 1WLTA 3O14A 1EPZA 1CGPA 1ZRFA 1DZRA 2V09A 4MGYE 4KU7A 4LLOA 4XF1A 4JVAA 2XL9A 3R6SA 2VPVA 2Y0OA 4Q0QA 4MGIE 4EWAA 1CAXB 5JSPA 3IDBB 3RPQA 4WZCA 1ZRDA 3E6BA 3ETQA 3L2HA 1ZZBA 4HSLA 3E6DA 1SQ4A 5BXXA 4HZFA 3I59B 1CAUA 4KU8A 4EWDA 2PYTA 4Z82A 3H7JA 3ACLA 3WW4A 2BNOA 4UXAA 4Q0PA 3S0MA 1VR3A 4EV0A 4AVCA 1CX4A 1NE6A 5I93A 3EHKA 3WW1A 3S7EA 2UY8A 1RC6A 3MDPA 1DGWA 3H9AA 4D7TA 4IEZA 4IETA 2OYZA 2Q4SA 4QGLA 3FX3A 4QX5A 1CAXA 5C8WA 4H7LA 3I7DA 4MX3A 4JV4A 5FPZA 3NJZA 3IDCB 1DGRA 5J3UA 5I0TA 1O3RA 2OZ6A 5JSRA 1LKNA 3G7DA 3ROUA 1NZCA 4UBGA 4J1WA 1DZTA 4AVBA 3M70A 1ZX5A 3IWZA 3FJSA 5J48A 3I59A 5HI0A 4QM9A 1CAVB 1J58A 2B8MA 4P9GA 1ZZ8A 4YRDA 1PMIA 1QXRA 4LULA 2IC1A 2K9ZA 5EFUA 2WC2A 1EY2A 3I54A 3UKTA 4XFFA 5BPXA 1O3QA 2P17A 3MYXA 3H50A 3ST7A 3FHIB 3FE5A 1O3TA 2PQQA 2BNNA 2MHFA 5FCCA 4BIFA 2QNKA 1L3JA 1UPIA 4FAHA 1FXZA 1UCXA 2PAMA 2QDRA 3EBRA 3KGLA 4LTAA 2EA7A 2KXLA 2UY9A 3NVCA 4I2OA 4XFBA 3OGJA 4IEYA 5FLIA 3RNSA 4A2UA 3D82A 3H3ZA 3SHRA 4I01A 3BPZA 1JUHA 4LEJA 4I02A 4HVOA 4HSJA 2UYBA 1CAVA 3RYRA 2Q1ZB 3E6CC 4E2GA 4F8AA 5JAXA 2E9QA 3CEWA 5D1IA 3OTFA 4I3PA 3MPBA 1Q5OA 3N4MA 5KBFA 4KL1A 3LOIA 2FQPA 3TNPB 4JTNA 2ZKLA 2H6CA 3PVBB 4RD7A 4XFIA 3NSTA 5KHJA 4L2NA 2ET7A 3KMHA 3DL3A 5J7MA 1VP6A 1XRUA 4E2QA 2GC3A 5AVPA 4LA3A 4Q0UA 5I0SA 2XLAA 3PNAA 2GZWA 3GYDA 2OZJA 3OCPA 4XF0A 3DN7A 2ZCWA 2BGCA 1SEFA 2BYVE 2XL7A 3NKTA 5FLHA 2CGPA 5FPXA 2N7GA 4FAGA 4LUMA 4Q29A 1X82A 1RL3A 1UIKA 4BH9A 3FFQA 1I5ZA 4IEVA 3FZ3A 3QACA 3LZZA 3E97A 1O4TA 4ZU7A 2PFWA 4QGMA 3PLQA 3HT1A 3QOPA 4Z07A 3FWEA 1J59A 4I0AA 1OI6A 3D0SA 5I0RA 3ES1A 5T3NA 3C3VA 2ET1A 4ONUA 4R52A 2C0ZA 4EROA 3BB6A 4LA2A 3ELNA 2IXKA 2PAEA 3HIFA 1O5UA 1X8MA 4UBHA 1Y3TA 2PHDA 4HN1A 4F7ZA 1RUOA 1H1MA 3CLPA 4PIXA 4O9GA 3MZHA 4HVRA 1X7NA 4AQ2A 5EZWA 1EP0A 5BY5A 1J1LA 4YNIA 4MGZE 2XLFA 4KWLA 1ZZCA 4ZU5A 1QXJA 4CYDA 2EVXA 1H1IA 2GH2A 2GC1A 5JCTA 2IXHA 1YFUA 4YYOA 1ZVFA 5JSOA 4IERA 4HMZA 4BHPA 3LAGA 3NW4A 4EWEA 3HQXA 1IPJA 4IEQA 5I8TA 2H6BA 4AXOA 2GU9A 2BEOA 1ZRCA 3GBFA 5KHIA 3H1MA 5LEJA 4QXKA 2CV6A 5KHKA 3EQEA 3OD0A 3VHRA 3EO6A 5LRSA 1GQGA 2XKPA 1LR5A 3CO2A 2DCTA 4FT8A 4YSFA 3UKNA 3H8UA 1VJ2A 1RUNA 2D5HA 1YFWA 3WW3A 3U11A 1OD5A 1NXMA 1ZZ7A 1YUDA 4MV2A 1X8EA 2XLGA 1G6NA 3SMHA 2HKXA 5KHHA 1EYBA 3TNQA 4META 1Q43A 2CAVA 4L11A 1YLLA 1QWRA 1IPKA 1UIJA 2QJVA 4MH0E 4AQ6A 4IEUA 2I45A 2WFPA 5CU1A 2MPFA 4I09A 2ETEA 1O5LA 2B5HA 4XFAA 5JR7B 3SCGA 4IEPA 1YFYA 1ZNPA 1O7FA 2IXJA 3CF6E 5KHGA 5FDBA 5C6CA 2B9UA 4ZU4A 4LUKA 5FQ0B 2O1QA 5E1RA 2XHKA 1ZRRA 2IXIA 3SCHA 4QMAA 4R8HA 3S7IA 4B29A 1YWKA 3KSCA 4NVPA 2H0VA 1J3QA 3LA2A 3IBMA 2ATFA 5I8YA 4O9EA 4OFGA 5K8SA 3NL1A 4XFGA 4XETA 4Q0SA 4MUVA 4XF4A 4XF9A 2D40A 3BCWA 4KWKA 4JTOA 2HJIA 4XFHA 3BU7A 2VECA 4BYYA 3HT2A 4IEWA 3ES4A 2MNGA 3B02A 2QVSB 1QY4A 5LEKA 1I6XA 4D7SA 1J3PA 2VQAA 3H7YA 1XE7A 5FQ0A 4GULA 4X6QB 3U10A 2PAKA 3JZVA 1ZREA 2Z69A 1YFXA 2GAUA 2OA2A 4IESA 4I0BA 2Q0AA 1RGSA 1OMIA 1UD1A 4HN0A 3USSA 1O3SA 5F1RA 3DV8A 4X6RB 1CAWB 2XGXA 2PA7A 1OFNA 3CL1A 1FI2A 3SCFA 3E5QA 3IIAA 3RYPA 4FBFA 4N9IA 1J3RA 2D93A 2Q30A 4HVQA 2CAUA 4PIYA 2PHLA 4Q0VA 1PM7A 4MGKE 2OPKA 4XEZA 4YARA 1WGPA 3ZDSA 1ZZ9A 4DINB 2FMYA 5BV6A 1SFNA 2F4PA 4N9HA 4QM8A 1UW8A 5BUVA 3LA3A 5I8SA 3LWCA 1WA4A 1U12A 2IXLA 3H3UA 1FT9A 1ZZ6A 3H1YA 3LA7A 4TLFA 1YHFA 4J1XA 1NE4A 3E5XA 1CAWA 4WVZA 3M3IA 2QCSB 4XFCA 4OLLA 4E2SA 4XF3A 3BALA 1RTVA 4PJYA 1NYWA 3KGZA 1Q3EA 5I0UA 1GQHA 4IEOA 3E5UA 3RYKA 3H1WA 2O8QA 2BNMA 1LB2A 2IXCA 2K0GA 5CVRA 2GC2A 1V70A 4WBBA 3KCCA 3UKVA 1XE8A 2EAAA 3WW2A 4HBNA 2GC0A 4QGNA 2XKOA 4KWJA 1HW5A 4PIZA 3D0JA 2PTMA 4MZUA 3SXWA 1Y9QA 1LRHA 4HLTA 2Z2SB 5LRRA 4K8FA 3RDIA 2UYAA 5E16A 3DKWA 4ORFA 3RZZA 4AVAA 5I91A 3OF1A 5FLJA 5CADA 1CAUB 2D5FA
chains in the Genus database with same CATH superfamily
5GLVA 1W2UA 3ZVXA 4COZA 4IEXA 4TTGA 1B35C 5JPMB 4WM7B 2VY0A 3O14A 2LRPA 1EPZA 1BZWA 4XJ9A 4ATEA 2AEYA 5JXGA 1ZRFA 1XBFA 1MQTA 1DZRA 1NUKA 4Q4Y2 2ERFA 5FMOL 1GP4A 3LOBA 3NJVA 5IK7A 5DZGA 2RS11 1IZ3A 1W9TA 1QKQA 2RJLA 2DFCA 4IV1B 1UX6A 1WKYA 2GALA 2XL9A 2VPVA 2ZGOA 4OHZA 4YZ2A 5FV3A 4Q0QA 3TAYA 1PMJX 4J6GA 4C0HA 4AI9A 1US2A 2FCVA 3FLRA 4LHNA 2RS33 1UY1A 3MIBA 4FOWA 4Q2FA 1IG0A 5IAVA 3WNKA 4PF1A 4XTMA 2VJXA 1DGLA 4AGVA 2JDYA 1GLHA 2ZX2A 3N9PA 1RXFA 3I4IA 4XXAA 2V72A 2J22A 1OT5A 3E6BA 5A6ZA 4DPNA 1S0GA 5AFEA 1HJGA 2L9LA 3W58A 3WF0A 2W5FA 1QMJA 4D8MA 3B00A 5IVBA 3VD4A 3AKRA 2YGMA 3WLUA 3ZYIB 4AF9A 2ZGLA 4KU8A 4EWDA 2V5DA 3WW4A 3LIHA 4Q0PA 3VLBB 2XMLA 3BODA 4WM7A 5C3QA 1DHKB 4E4DX 1ND2C 1CX4A 1NE6A 1XU1A 5FPAA 5I93A 1GOHA 3K2OA 3AFKA 4JDOA 3WW1A 3ZR5A 1JZ7A 2UY8A 2JDKA 2W3JA 4A41A 3WOGA 2ZJCA 3IPVA 4IV1A 4OMCA 2VZUA 3GCXA 1PNGA 2EALA 1IS3A 3POIA 4O65A 4OI1A 1GP6A 1POV0 5IK8A 3M8LA 1NXD1 2Q4SA 2WS92 4ASKA 1W0NA 2BRTA 2EXJA 2VZQA 4XUOA 1NA1A 4AVVA 2G1MA 2VCAA 3K51A 2BBAA 3OUHA 1AX0A 1PVXA 1JZ6A 3NJZA 5FZIA 3BTXA 2QKDA 2ZMKA 1DGRA 1V6IA 4UI9L 4YZ4A 5A80A 5I0TA 3GZUC 4BQ1A 1D4M3 4CCDA 4DB5A 2V73A 4JCKA 4BIOA 2E26A 1GBGA 2WAOA 5FZ4A 3L9JT 3K4AA 1H4HA 1BMV2 1C1LA 4RFT0 3VBRB 5J48A 5A3TA 1DU3D 4QM9A 1MACA 2A70A 1CAVB 1J58A 2B8MA 3VGIA 4P9GA 4U36A 1N1SA 1PMIA 1QXRA 1YQCA 4AFDA 5IT6A 5T50A 2RS32 1EY2A 1BQPA 1W9SA 1QJZA 3RFRA 1YQ8A 1VBB3 5CAZA 2DCYA 3MYXA 1CPMA 1NLRA 1Z7S1 4B7EA 4QKFA 4XZUG 1COV1 2C24A 3FHIB 3K3NA 4ZZ5A 3FE5A 1Y9MA 3TYJA 4XABA 4Y24A 1O3TA 2BNNA 2MHFA 1IQDC 4JGYB 2PLV3 4V1PA 5A6QA 1UPIA 2B45X 1V6OA 4M4RA 3VBOB 2Y6FA 3T4VA 3EBRA 4LTAA 3WQ1A 1G9DA 2KXLA 2UY9A 3W59A 5FOBB 4XFBA 4C91A 3FBYA 4H2AA 4TZDA 5FLIA 3RNSA 3SLIA 1P8JA 3H3ZA 3FN9A 3T0DA 1R1A1 4FI9A 1KJLA 4WM8B 1BBT3 5FY1A 4CDXB 1K5JA 1LOFC 1Z0HA 2D7FA 1Q56A 3VBRA 4AEDC 2SLIA 2WYFA 4QX1A 1OF4A 4CUBA 2UYBA 1XQNA 1F2NA 4H7MA 1CAVA 3RYRA 2Q1ZB 1QOSA 2ZPXA 2C26A 5I0DA 2FD8A 2Q8DA 1KGYA 4F8AA 3WT3A 1WMFA 2HWB3 2XJTA 2G4IA 2VBPA 3K3OA 1Y4WA 2VGDA 1OQDA 2FCTA 3HD8B 3OTFA 1UWWA 3MPBA 4LO8A 3NNGA 5DQ0A 1GNZA 1JUIA 3ZIWA 1WWYA 3T30A 1FAYA 2FQPA 3LFIA 4HXCA 3WNXA 4JTNA 2R30A 3UT0A 3PVBB 1FV2A 4GMP1 5KHJA 4E9KA 1O91A 2DUPA 2NP0A 1CONA 4NIDA 4JGYA 2WNVC 1XRUA 1TNRA 2HBUA 3KB5A 3VBOA 3RJ2X 4CXYA 1VMHA 3KLSA 1I5PA 4AFBA 2Y8KA 4KGQA 1J1TA 4LKSA 4N90A 1OC1A 3T2TA 1NCRC 5IATA 1DQ4A 3GYDA 4XF0A 2JG8C 3POJA 4WM8A 4AWDA 1CWPA 4CDXA 3NKTA 5FLHA 1VBB2 2CGPA 2N7GA 4LUMA 4Q29A 4B8EA 4ZPIA 2XONA 1X82A 1E57A 3MPPG 3GXUA 1KS5A 2RJ2A 1DQ1A 3FFQA 1PVC3 3KF3A 1I5ZA 2PLV2 3KCXA 1C4RA 4Q4V1 3AKQA 4B1LA 2JENA 2X05A 4AGGA 4YM3A 5K9YA 5GLWA 5BNNC 1VBA1 4INDA 4QGMA 4ES8A 1HIXA 5H9PA 3QOPA 4Z07A 3ZSEA 3WINE 1UOFA 2J1EA 2JDAA 2Y33A 3MGUA 1PO22 3OUJA 5DABA 1ENQA 1ALYA 1BBT2 3B9IA 3HR9A 1XNCA 5I0RA 3BIEA 3IKWA 4MGQA 4HFSA 1XE0A 2CGOA 5FZEA 2ES3A 2XDVA 4CP9A 4ONUA 4YSFA 2HWB2 5HXMA 5LZ6A 3O1PA 1LECA 3DPRC 4EJRA 1AR91 2ZGSA 1OVPA 4OYUA 4URTA 5DAWA 5ANNA 5LK5A 5KR7A 1VRH3 4FFIA 1XSRA 3ELNA 2IXKA 4Y26A 4XPVA 2PAEA 3HIFA 2Q8OA 1PGL2 4YW7A 3WDTA 1OOPC 1K42A 2I07B 2XJUA 2QDNA 3LEKA 2QQPA 5T5PA 4HN1A 1H1MA 1JYTA 3EMRA 1UKGA 1C8NA 2ARAA 1W04A 3VZKA 3ZYFA 5EZWA 4AQ2A 5JDBA 2BTVC 2JD9A 4H55A 4JQTA 2Q8CA 4XJ8A 5C5UA 4V2VA 5C4WC 2JXAA 4MVTA 4MGZE 2XLFA 4FTEA 1YQ2A 1R1A3 4I30A 2A6ZA 1A34A 2BOIA 3MIHA 3WUCA 4YW1A 5D8AC 5FK8A 3HWJA 3PTYA 4IGOA 3WNNA 1UAIA 3H8RA 4D6RA 3WCSA 3BU0A 2GC1A 1XB9A 1H1AA 1RVF1 2NMOA 4XAAA 5IYYA 1ZVFA 3AZXA 4ZXKA 1UYPA 4HMZA 4N7IA 4BHPA 4XILA 4XMIA 3H8XA 3LAGA 4CDUC 4QX7A 5IK5A 3HQXA 3ZLIA 2WINB 1PVC2 4GWJA 1IS6A 5KHIA 1O4ZA 4NAMA 2QZ3A 3MFAA 2ZGQA 3H1MA 1HN1A 2YZ4A 2P6HA 5EV7A 1QNWA 3OD0A 3VHRA 1DYOA 5CFCC 2XBO1 1UU4A 3EO6A 4GMP3 1GQGA 5F3GA 2A75A 2B9VA 5HXVA 1V6LA 3LEGA 2A3YA 4QT6A 3MICA 5A3OA 1OVSA 2G9GA 1RMU1 3ZYBA 1XNTA 3WF4A 3AC0A 3B5LB 3UKNA 1Y43B 3ZYGA 2QQLA 5G04L 1ST8A 1H8VA 1TZOA 1VJ2A 3T3YA 3VZMA 3BUCA 1RUNA 2WT2A 4IE7A 1NY72 4QKBA 5DUUA 3MLKA 3B01A 3WW3A 3RQ0A 1X36A 4YZ5A 1PZ7A 1ZM1A 4LKFA 4QX8A 4OUSA 2ZX3A 4MV2A 5EWSA 3PIGA 1W9YA 1G6NA 4CEYC 1HKDA 3B93A 4A6SA 2JWPA 4NMIA 3WG1A 3KT1A 5CG9A 1SLAA 5FYVA 1VRH2 3I2HA 1YNAA 4RYDA 4XBLA 4PT6A 1XC6A 3WNMA 4FOYA 4MH0E 1RUF1 1LOCA 3J4UH 3OBRA 2WFPA 1MVQA 1LOGA 3W5NA 1AR81 5F9TA 4QPGB 1GZWB 1VAKA 4M3CE 1RUH1 1R081 1VBA3 3LPFA 4MADA 4BQ2A 1YEWA 4M00A 2ZGPA 4R4XA 3ZFFC 1R64A 1YFYA 2ZXQA 3VDDB 2RDNA 5A1AA 1W8WA 1O7FA 1XPWA 4PCRA 3Q8CA 2VMGA 2ZGRA 3ZXAC 4QDRA 4LBQD 1UY0A 2WWJA 4HK9A 5L7OC 5CBLA 3WF1A 2WLPA 5C6CA 3WP4A 2W9XA 4ZU4A 5FZGA 4CVUA 1C5IA 5AFBA 4BK5A 2O1QA 4QXCA 1DF0A 4HKLA 2VUAA 1HRV1 5E1RA 1ULOA 4HT1T 1AR93 2P2KA 5IFTA 1AX2A 3HOBA 4R8HA 4XUQA 3KSCA 1X9TA 3LQCA 2G9FA 4K9SA 3R4DB 2H0VA 2XJRA 4Y1UA 4MXVA 4NIIA 2D6KA 3LA2A 4DEQA 3RWNA 2VCCA 2ATFA 2Z42A 3AXEA 1B35B 4ISQA 4AI3A 3WNOA 1SFPA 4XJZA 4CDWB 3NL1A 5K8SA 1JMUB 1RUC1 2DCJA 2DVFA 4CPBA 1LGNA 1AR63 1NQDA 1W90A 2VTFA 1GZWA 4LOTA 4QPGA 1W99A 4GH4C 1OUXA 2R061 3GJBA 4XFHA 2DVDA 3ZN6B 2WZR1 3VDDA 2P6CA 1OQEA 1U5IA 4BPZA 1KEXA 5GZGA 1US3A 4LORA 5F3EA 5T5JA 2AUYA 2OT7A 3GZTB 3LE0A 1I6XA 1YIPA 1W8FA 3OB8A 5FYHA 3ZPYA 4YZ1A 5JXJA 3PU8A 1K5MC 5GKAC 1XNBA 4XMAA 2QQUA 3N36A 4AEMA 2EXHA 2VQAA 5FP7A 3WP6A 5FO8B 1XE7A 1IKPA 4GULA 1LHNA 3JZVA 2J1RA 2QQMA 4RGAA 5DZFA 5JUVA 1ZREA 1YFXA 2GAUA 1VBA2 4IESA 2D3PA 4NPMA 2XBO3 2Q0AA 1OMIA 1W8ZA 2WN2A 3USSA 3VZLA 3GGLA 1O3SA 2ZMNA 2B4KA 4YW3A 4DRRA 1B35A 1CAWB 1FPN1 1RMU3 1OLMA 2JDZA 2ZTNA 3HPNA 4GKYA 1ND2B 2HWE1 4XDQA 4CDWA 3C7EA 3ZYPA 1AJKA 4FFHA 2HYKA 3H8OA 5FYTA 2AZ5A 2JDPA 2WO3A 3FLTA 1LTEA 4GKXA 2E51A 1TEIA 4W4ZA 5DPNA 4HETA 3ZN6A 3UESA 5FZLA 1MS8A 1J3RA 1G86A 2D6OX 2YDEA 4N9IA 4DNYA 5FJKA 4EN9B 1QOOA 2VZPA 1AR92 1OPOA 4DXZA 3ACIA 4Q0VA 5FXWA 1VB4A 5CIRA 1MEC3 4MOAA 1XYOA 2IWGB 5IVFA 3AM2A 3N3HA 1WGPA 4DRVA 4YARA 3T0BA 3H42B 2BP6A 3CHXA 4NHXA 1SMVA 2FZ1A 5BV6A 1AR83 1ENSA 1UOBA 4C90A 3PUAA 1ENXA 3AKTA 1AR62 4RSUA 5EP9A 2Y6GA 2UWAA 2IXLA 1ULCA 2NQYA 2AEZA 2WSVA 4ASMB 4CCLA 1N3PA 1WA6X 3H1YA 5FUNA 1QDOA 3IN9A 3LA7A 3W20A 5F5AA 3DYPA 1U5YA 3LSDA 4CCEA 1UZZA 4JKMA 1NE4A 1UZ0A 1W6MB 1CAWA 1H2LA 3E5XA 5A32B 5FY5A 4CRQA 1VIWB 4D3WA 1ND2A 2QCSB 4XFCA 3BALA 3HNMA 3UNPA 2BBVA 2BFUL 1GQHA 4RA0A 1HRV3 4ZY9A 4Z92B 3MIGA 3O1VA 4WVVA 2O8QA 4QHZA 3CMGA 3SEEA 2VE1A 4Q4Y1 2VUJA 3E1F1 4UFKA 3J7MA 1VBD3 5CVRA 2GC2A 3O5SA 1LHWA 4KQ7A 4XUPA 4H14A 1ONAA 1G9CA 3V0AB 4RN5A 3L2YA 3KCCA 1IQAA 1W8UA 1XE8A 4BDVB 3WW2A 2F4LA 2CDOA 2ZZJA 1HW5A 4PIZA 4G9SB 4M0NA 5GJ6A 4MZUA 2JKXA 1RMU2 4Q5OA 3OBZA 5LRRA 3RDIA 3OJBA 1GOGA 4Q8LA 3VZOA 4D69A 4QHOA 1FOD3 3JQWA 4OHXA 3RZZA 5FFOC 1XYNA 2ZOEB 5FO9B 1K3IA 1GWMA 2WQ4A 4UFJA 4GXLA 2JG9C 2QTWB 1CAUB 4W50A 1GWKA 2EIDA 2WO1A 1W6MA 4NPLA 1TQ5A 1WW4A 3ZKUA 5A32A 3U0ZA 4Z2AA 4NAOA 1W8TA 3D3AA 4GWMA 4OQ9A 4AHYA 1MEC2 2GN7A 5APAA 5LATA 4BMBA 4DXTA 5FPLA 1H9PA 4NIGA 4I0WB 2A73B 2BERA 2BV4A 1S2EA 4MGYE 2RJKA 4KU7A 3FUOA 5FBJA 4XF1A 1KS4A 2KM2A 4NO4A 4AW7A 3LEMA 4FPKA 1S0DA 4HL0A 4LBKA 3FMGA 4MHRA 4NWVA 4Y1VA 4MGIE 5HCBA 3ZXLA 4DQAA 1JXNA 4FQ4A 3T2QA 3V0AA 1HV1A 1OLQA 2YB7A 3VDAA 4R4ZA 1YQ6A 1Q8PA 3G6JB 2HWE3 2Y34A 1O4YA 3GF6A 4GB32 1UNBA 4OULA 2DU0A 4P14A 4PI0A 5IAXA 2EIBA 1ZRDA 3IT8A 3L2HA 2GH8A 2CDPA 2WZEA 2WO2A 5A3MA 5FAXA 4KI5M 2JG8B 2ADEA 3ZPOA 5FY8A 2RM23 3A21A 2F17A 3ENRA 5GM0A 1LOFA 2CTVA 2HWD3 2X53S 3A0KA 3NNLA 5J98B 3U78A 4A6OA 2LUWA 3B9CA 3N9LA 1CAUA 2DVGA 2BOJA 2ZEWA 3H7JA 5F2SA 3U4SA 1BMV1 3DEMA 1VBD2 4ZS3A 3S0MA 1PIV3 4IW3A 2VOWA 2D98A 3PIJA 3JBG3 4GQ7A 4SLIA 5KXCA 2OW4A 4XJUA 1G7YA 2W47A 3S7EA 5IFPA 3NV1A 4GIQA 4MGTA 3PJQA 1DGWA 1A8MA 5F39A 2X10A 3WEZA 3H9AA 4K7JA 2Y60A 2DCKA 4IEZA 3UJQA 4D7TA 5JZGB 4OI0A 2OYZA 1FOD2 2ORZA 3LPGA 4DXSA 4GJYA 5FYSA 3TEXA 1CQ9A 2B46X 1OPMA 3FX3A 4Y22B 3UV9A 5IVCA 2VMHA 3WDUA 5F6LB 3I7DA 4MX3A 4LBNA 4JV4A 1N47A 2JECA 4AHWA 2BWCA 2YFUA 3PVEA 1NCRA 2A7AA 3ORJA 4KMQA 1EAH3 2OZ6A 1HN0A 3DPRB 5A7OA 1LKNA 2YU2A 2JG8A 2FHRA 3G7DA 3ROUA 5FRAA 3GHNA 4A7KA 4J1WA 1HXS3 3BYWA 1DQ2A 3M70A 4B4RA 4XBQA 3IWZA 1DYPA 2VZTA 2CGNA 3VZJA 5HI0A 4QWNA 5BNPC 5CFDC 2TNFA 2I74A 1XYPA 2VTXJ 2WLQA 2GMPA 4Y5Z0 4WV8A 2YFZA 4K40A 4M01A 4P9IA 2RMU3 2WC2A 3AP6A 4Q4W1 3ZSLA 4XFFA 5C4WB 1EV12 3CZUA 4RL7A 3WV6A 1W2NA 1SBFA 2W87A 4NRMA 4E4ZA 5KXBA 1O3QA 1NG0A 3KT7A 2BU9A 5JR2A 2D6PA 3SNMA 1DBNA 1PZ9A 3H50A 2VNRA 2CNAA 2RM22 1SLCA 4GWNA 3W9AA 3ZSJA 2PQQA 2HWD2 1HQNA 4Y22A 3RZLA 1JZ3A 1FXZA 1UCXA 3F95A 5FYUA 2EXIA 3GDBA 2XPJA 4P5YA 4CDUB 4E27A 5HCHA 3DKQA 4N8MA 1BYHA 1ULPA 3IIIA 4K20A 1PIV2 2VVDA 4P9WA 4ZONA 3DPRA 5DG1A 1S0FA 2CHHA 4BU2A 5LA1A 2CWSA 5T54A 2HEVF 4I01A 3JBG2 2Y6HA 4L0PA 4NROA 1X9PA 2E33A 1V00A 2IFWA 5A7WB 5CFCB 2ZX1A 1DGWX 4Y4YA 1OOPA 3ZXEA 3S30A 4D6SA 3ZXDA 4CCMA 1SACA 1NOVA 1O8PA 1VBB1 5FP9A 4E2GA 3CEWA 1LGBA 2LALA 4IV3B 4CTEA 3DECA 4Y3OA 3N9NA 1HRI2 1F31A 4JX0A 5C4WA 5FOJB 3JUUA 3LOIA 5F5QA 3WG4A 1QJU1 2ENRA 2PLV1 1FMD2 4CEYB 4AEJA 3VBSC 3TNPB 1EAH2 2W94A 2BZDA 4XW3A 1Y9GA 3AVRA 5D8AA 3THCA 3VV1A 3K4ZA 4QU2A 4GAZA 1HXS2 2WABA 4N53C 3DL3A 4IE0A 5J7MA 1GUIA 3VD9A 3M3QA 5FPBA 2J7MA 2GC3A 1QJX3 1PO21 4P9LA 4XAEA 4EE2A 3DCQA 4CDUA 5AVPA 1BBT1 2VXRA 4LA3A 4LHSA 4JC1A 5C71A 3IPVB 3ETPA 1F5JA 5FYYA 2P1BA 2RMU2 2WQZC 3OCPA 4Y5TA 1I3HA 4BQXA 2BGCA 1SEFA 1GYKA 2XL7A 3U07A 4QX0A 2OQ7A 5A7WA 3ZFFB 5CFCA 1ODMA 2HWB1 3VDBA 1NA1B 1REFA 3I2IA 4Y1YA 5FPXA 4PLNA 1K12A 2HBTA 2DUOA 5LCWL 3LEIA 3MBWA 5K4LA 2Y64A 4ARYA 5FYIA 4YG6A 1BVP1 3T2OA 2QUOA 2NPIA 5JI9A 4IV3A 2RR13 4L97A 4EN7B 4YW5A 1PGL1 5DZEA 4UFIA 2VXJA 5EYXA 2A6XA 2EF6A 1VBC3 2IVIB 1HQWA 2P3YA 2Z79A 2ID4A 4XURA 2PFWA 2R043 2Y26A 3Q8EA 4RS5C 5EQUA 4CEYA 3NV2A 3HT1A 4TN7A 3RZGA 1OI6A 3D0SA 5M0TA 5AVAA 3ES1A 4LO5B 3VZNA 4EN8B 4CCJA 4ZKTB 1E5IA 3SISA 2BJSA 2NYYA 4COUA 4DY5A 2ZZQA 4Q4W3 2AH2A 1HB4A 2C0ZA 1QXPA 3VD5A 3MI8A 5C9AB 3AXDA 2C9AA 5ABJC 4EROA 1TNFA 3MUZ1 3ZFFA 4U2AA 1PVC1 4LA2A 2YPJA 2ZABA 1KITA 2I2SA 1IGOA 1PNFA 2TEPA 2VD7A 2PHUA 4DUVA 4DS0A 3SC7X 1RHI2 2BVVA 3C7GA 3VKMA 4AI1A 2JDNA 1Y3TA 4QB2A 5ERLA 5L7OA 1JYIA 4F7ZA 3ZN5A 1K5MB 4PIXA 2ZACA 1LESA 5GZDA 1RUOA 1DYKA 1QJX2 3K75B 1NT0A 1EP0A 4QQHA 5FXXA 4QU1A 2R1BA 1PGSA 4M0HA 1ZBA3 2VAUA 1PHMA 3I3MA 1W0PA 2WWSA 1OA4A 1NY71 3WSOA 3KHBA 1ZA4A 1UXZA 4B7KA 2EVXA 4B4PA 2GH2A 4A42A 2WL1A 3GZAA 1YFUA 2YXSA 3WNPA 4DY3A 1VRH1 3WVJA 1S55A 1M06G 2RR12 4IEQA 4KG8A 2H6BA 4JKLA 4QAWA 4AXOA 1NAEA 2BEOA 5C9AA 1BJQA 1QJU3 4XBNA 1VBC2 1UMIA 1MS0A 2CV6A 2PXJA 3EQEA 2R042 1W05A 3F2ZA 2OVUA 2WO7A 4TSVA 4YFWA 4NIAA 4DOUA 5CYYA 4TLGA 3AVSA 2XKPA 1JOPA 5A6XA 1G9FA 1ASJ3 1GZ9A 3CO2A 4GMP0 1UYYA 2DCTA 1YYNA 1H8TC 1VLNA 4OUEA 1PO23 5L73A 1K5MA 1ACCA 3H8UA 5HBAA 4CDQC 5T55A 1WCSA 2TBVA 1S0JA 4YVWC 1YFWA 3ZMNA 1UKRA 1WD4A 3N7MA 3OBTA 1YUDA 2QFEA 4UFMA 4Q4W2 2FZ2A 4E4SA 1XNKA 4ET7A 1R093 1UN1A 2PHTA 4FPEA 5KHHA 5GLTA 1EYBA 2ZHKA 1QJY1 3N35A 1RB8G 2CAVA 1BXHA 4BQ5A 1QWRA 2J42A 1CJPA 2PHRA 4BA6A 3IAPA 4XCAA 3LDBA 5CU1A 4CUGA 2MPFA 1LOEA 2HLEA 4JDNA 1NZIA 2B5HA 3R4SA 4IGQA 3ZO0B 2D43A 3AMMA 4GJZA 2AENA 3RZJA 4QB1A 5FZCA 1ZBA2 2VZ1A 3BKZA 4CP9B 1H4GA 2GNTA 4AG4A 4A3XA 4CU9A 1URXA 4XJAA 4OHWA 5FMDA 1SBDA 2UU8A 2VQUA 2J1UA 4BXFA 2JB8A 2JDHA 5CKNA 1VRBA 2W1UA 2VL4A 3KQRA 4PDWC 5IHRA 4JRAA 5L9VA 1TE1B 5IW0A 1ZYBA 4LNVA 1JOJA 1QJFA 4LE3A 4AL9A 1RUG2 3VBHC 3ZN4A 2WN3A 1OUSA 1U5ZA 1QJU2 4OVEA 2Q8EA 3RI9A 3SKJE 3RZHA 2JG9B 1V9U1 3NNFA 3CBNA 4LBMA 2VW1A 2R6QA 2PHWA 5A1LA 5JVVA 3AJZA 1H9WA 5FBZA 3THTA 3IBMA 4P00B 1VE0A 4DMIA 3OSDA 2VVFA 5JMCA 1ASJ2 4TXWA 1DZQA 2XUEA 1AR71 3MIFA 2QBXA 4DUXA 2D40A 3BCWA 4KWKA 5DG2A 3ZXGA 4Y4RA 4JTOA 2HJIA 4CUAA 4BK4A 1BK1A 2DCZA 2OS2A 1JHJA 2XJVA 3P3NA 1WUVA 4QPWA 1S2BA 4Y20B 3VKNA 1R092 2VBDA 3ES4A 4BYYA 5JLVA 2MNGA 1YIFA 2QVSB 1QY4A 1C5HA 4ARXA 1JYCA 1OLME 5LEKA 4C1XA 1SCRA 3OBAA 4LITA 4S2DA 4D7SA 2E32A 1OSGA 4X6QB 2PAKA 2JKBA 1ENRA 2ZGTA 2Q1FA 2ZGNA 4A3ZA 2OA2A 3FUQA 3NAPC 3QCWA 2JG9A 4UW3A 3ZDVA 3QH6A 3POYA 1AR61 4NHMA 4HN0A 5A7QA 3LD8A 5F1RA 3DV8A 1LOAA 4X6RB 2PA7A 2GN3A 3HQRA 2DFBA 2VZOA 5GALA 5A3PA 3E5QA 3IIAA 1VMFA 1S0BA 1LGCA 2DVAA 2B39A 4CPBD 3KV9A 3MV11 4FBFA 1PMHX 1BEV3 4FOVA 3I2OA 3PUQA 3I2GA 2CAUA 3OGSA 4Y20A 2WRAA 4LO4B 1QJY3 2A3XA 1PM7A 3UL2A 1SLIA 4XEZA 1J84A 4GD4A 1YRZA 3AL5A 2JB4A 4DINB 4QD2A 3RVHA 2JJ6A 1WW6A 1H2MA 4JQRA 3ZFEC 2WNUC 2YY1A 2WT1A 2DWRA 3IAQA 3OD4A 1BCXA 3IM0A 3DYMA 1U12A 3WP5A 3CDZB 4UAPA 1W6QB 1FT9A 2Z4FA 1ZZ6A 1CX1A 3HEIA 3KM5A 2RV9A 3PDQA 4F83A 1JW6A 1ND3C 4TLFA 2ARBA 3NV4A 1YHFA 4JDMA 4J1XA 3U1XA 1M4WA 3M3IA 4E4HA 3C7FA 1PO12 1UZVA 5FWEA 1NYWA 2GP5A 1JBCA 1DFQA 1HV0A 2PHFA 5I0UA 5J96B 2CL2A 1B09A 2QQIA 1O59A 2VZSA 1MEC1 1WW5A 3IDEA 3I49A 3H1WA 2BNMA 2W92A 2PN5A 5J36A 1V9U3 2RG4A 4AZZA 1AZDA 1RIRA 4WBBA 4YZ3A 3J26N 1UYXA 5FUIA 4HBNA 1SDDB 3LGRA 2XKOA 4JGZC 4KWJA 1QEXA 2XWJB 1SPPB 3NKGA 2SBAA 1RINA 2ZGMA 4BM8A 2A1XA 1AR73 3RS6A 1LRHA 4IUGA 1IHMA 3WNLA 2VOKA 4CCOA 4LHLA 1C57A 5J37A 3I97A 1KFXL 2WJSA 4GB31 4NRQA 1MZ5A 1V6MA 2X5IB 4C0BA 3RZKA 1YI7A 1W6QA 3MF6A 1QH7A 1BEV2 2BPA2 1XJAA 5FLJA 5CFDA 3RRDA 3AZYA 5BNOC 4PJYA 3ZKYA 1WLDA 4A44A 4BQYA 1ZRIA 3R4UA 2JIGA 4Q26A 1QJY2 5CZKA 2Y6LA 1GV9A 4QX2A 1W2AX 5IVVA 3K4DA 5H9SA 4TYSA 5BNQA 4OQ8A 1J59A 1VBD1 3N9QA 3ECQA 4WZFA 3VBSB 5HV4A 4HKWA 5GZFA 4LLOA 3S5AA 2A6WA 4FPGA 3I2FA 4JVAA 1AYM1 4GWIA 3Q8FA 4XUNA 4EWAA 5F6KA 2AYHA 5B2GB 1ULGA 1CAXB 2FDGA 4IE4A 3OPWA 5JSPA 2HH9A 2IUWA 1X33A 3IDBB 1FOD1 4WZCA 1CZTA 3ILNA 5IVJA 1SPPA 3W5MA 4OI4A 3IDAA 5LB6A 3ZSKA 2YGLA 2XVGA 4URAA 3I3QA 2XVLA 3AZWA 1ULEA 1ZZBA 2IFRA 2J1VA 5C8CC 3HBZA 4HSLA 5DAVA 2X5IA 2VUCA 2GDFA 4NJ4A 4UF0B 1SQ4A 2HWF2 1GICA 5BXXA 4HZFA 4CXWA 3PUHA 3I59B 5JMOA 5EPAA 4V2WA 2ZHMA 2LROA 4LR4A 3ON7A 4BJ0A 4Z82A 1D7PM 3ACLA 3C8XA 1V9U2 2O0OA 5DAPA 5DXDA 2YG0A 1VR3A 2AR6A 5FIXA 4AEKA 1L7RA 4IE5A 2GMEA 2B7YA 4AVCA 5C7GA 4LBLA 3KHCA 2XH6A 2HWC2 4YGCA 3O0WA 1GANA 1T2XA 3VBSA 3O1RA 3MDPA 1N1YA 1AR72 2D44A 1U5XA 1EV11 2QZ2A 3D8CA 3HNBM 1UY4A 3ZXJA 4FTSA 2BQPA 4N53A 2W1SA 4XTPA 3SKVA 4W6YA 4LE4A 2VH9A 4QGLA 1OD3A 4Y1ZA 1CAXA 5FY0A 5C8WA 4H7LA 5FREA 5CKQA 2RM21 2VZVA 2HWD1 4BE3A 1DIWA 3IDCB 2HEYF 3T1MA 1SFYA 3NWKA 4XC9A 3DXUA 1O3RA 1AX1A 4GA9A 5JSRA 1NX9A 1FATA 5ABJB 3WR0A 1NZCA 4ITCA 4UBGA 1W9WA 1DZTA 4AVBA 1TMF1 1LU1A 2Q1MA 1JYNA 5FZOB 4AFMA 4UF0A 1W3VA 3WHUA 3O1TA 1QHDA 1PIV1 1YJLA 5AC93 2ZA9A 1W8OA 3I59A 1XNAA 2UURA 4CU7A 2W52A 1HB2A 3JBG1 3JD73 1ZZ8A 4YRDA 3AKSA 2IC1A 4HOOA 1MS3A 4BQ3A 2VOTA 4KWUA 5L9BA 4HKOA 3AYDA 1OF3A 1IPSA 3I54A 4JGYC 3UKTA 4QKDA 5T52A 1UX7A 5FMOS 5FZMA 2HYXA 2P17A 2ZEZA 2IVJA 2OX0A 4FP3A 4PLOA 3MUY1 2VUDA 1HRI1 4GB33 2DTYA 4QQPA 1O8SA 3DUIA 5FMBA 1WLWA 2D97A 1UY2A 3MLJA 1A3KA 1FMD1 1PZ8A 4FO9A 4C8DA 5EJ1B 1EAH1 3VDCA 4CDXC 2PAMA 5K0UC 2QDRA 3KGLA 4HK8A 4QPIC 1QNYA 2EA7A 4RR3C 5T5LA 3WP3A 1HXS1 4I2OA 3PHMA 4JRLA 4S2HA 1UPSA 4IEYA 1SHWB 4A2UA 3D82A 1W9FA 3ATGA 1RUI3 3SHRA 5ABJA 3AX4A 4KG0A 1N3QA 5HV0A 5FZOA 4I02A 2YMZA 3ZM8A 1AYM3 5CISA 5D2AA 4QX3A 1PX3A 2RMU1 3TN93 3WG2A 1W2TA 4FPHA 5IVEA 2VBBA 3PL0A 1Y7BA 2VG9A 4Y33A 1POQA 2OUHA 2R32A 5JAXA 3OG2A 2E9QA 1H8TB 5FZAA 4LKDA 5FZBA 3O7OA 4CDQB 4XUTA 5D1IA 3VBUC 2WA4A 4LLFA 4AEDB 2WFF1 5HCFA 3TB0A 2CWMA 4XQ4A 5KBFA 4CE8A 3OEBA 2VCBA 4YGEA 2ZKNA 1EPWA 4CP1A 5FZDA 1F9KA 4XJWA 2ZKLA 1AXKA 2H6CA 4QXHA 4XFIA 3THDA 3OY8A 3WHTA 4L2NA 1D0HA 2ET7A 3MIEA 3DGTA 5AC92 1VP6A 5LBFA 1PK6C 4AVTA 4BZ4A 4CEWC 5DMYA 1UF2C 4PF5A 3NQHA 3JD72 2ZEXA 4KH9A 1ZA7A 3C7HA 3IMNA 3KV4A 4Q0UA 2FDIA 5I0SA 1IS5A 3WQBA 3BPSA 5C3RA 1F8VA 3JU9A 5DUWA 5LY2A 2GZWA 2BDRA 2WNVB 4HG6B 2BYVE 4R9DA 2K2SA 3RMYA 1GMMA 1LULA 1OHFA 1EV13 2BWAA 4Z2WA 4R9CA 5JOZA 2ARCA 1RL3A 4IGPA 1NCRB 3U75A 2YPDA 3ALQA 5E6HA 1H8TA 1UIKA 2NMNA 2VO5A 4BH9A 4BOWA 4CDQA 1YI9A 3O1UA 1Z78A 4AHXA 5EJ3A 4AEDA 1RHI1 2VVEA 1SDWA 3E97A 4PDWB 4EZ4A 1RJ8A 5LBCA 3UJOA 2BUKA 4PQQA 3D4KA 4AI2A 1MS5A 3VBHB 4ZXEA 2YBSA 1QJX1 1TMF3 2QE3A 2VMFA 2X09A 1OFSA 1RUI2 2ZGUA 3FWEA 4YGDA 5FUPA 4F3JA 1AL0G 1REDA 3GM8A 4MHUA 4ZZ8A 1LU2A 3OPZA 4XQDA 5BNNB 4XDPA 1GWLA 1AYM2 1WCDJ 5T5OA 4R9AA 5FYMA 1HDKA 3TN92 3T2PA 3ZYRA 2OQ6A 3U4XA 3C3VA 2JIJA 1W8HA 2RS53 1GSLA 4Y1XA 3EYPA 2VZRA 2WNVA 1IKQA 3A7QA 1JU3A 5FZFA 3M7AA 3BB6A 1REEA 2RR11 1HRI3 3A22A 5F2WA 1KRIA 4FXKB 4D6QA 1O5UA 5E88A 1QH6A 1FMD3 1VBC1 2VW2A 1WMEA 3VB9A 3UK9A 2PHDA 2R041 3ASIA 5FR3A 4COVA 1CR7A 3AP4A 4IL7A 4O9GA 4HVRA 1X7NA 1JZ8A 1S4CA 4PDWA 5BY5A 3H3LA 2C6SA 3QLQA 4NOTA 1OOPB 5L36A 3DXTA 5FO7B 4AK3A 1QIQA 3AMNA 3BVCA 5LEJA 3VBHA 1F4AA 3K77A 1V0AA 4KWLA 1RUE1 1PX4A 1CIYA 1JN2P 3VKOA 1ZZCA 4AAXA 2KR2A 2VU9A 3GCWA 4UW5A 1QXJA 5FZ1A 3AZVA 3AFGA 1Q8QA 4QB6A 5BNNA 3CKHA 4YLZA 1SBEA 2ZGKA 4OHVA 4B1MA 3JCIA 3KQ4B 4YYOA 2KD7A 3ZFGC 5JSOA 5ACA3 4BQ4A 1KDKA 4Q1RA 4BMEA 3D6EA 5D8AB 3Q9OA 1W03A 5I8TA 2WAAA 2WFF3 4Q4X1 1TG7A 2RE9A 3GBFA 2D6MA 4QXKA 2ADDA 4XIOA 5KHKA 4ASLA 4E8DA 1MS1A 1TMF2 3IZOA 2CU5A 1S2KA 1SZBA 1I9RA 1Q8OA 5BYNA 2OUJA 4WVWA 4BWOA 1LR5A 4XE9A 1ZBA1 4FT8A 1S1AA 4XZPA 4N43C 5F5IA 2OKXA 2YBKA 2Z5WA 1OBNA 2W08A 3VKFC 1OKQA 3U11A 5KXDA 3ZFEB 3MFCA 1NXMA 2RS52 4HPKA 1ZZ7A 1RUJ3 2VTXA 4FCAA 5DDJ2 5C3SA 4XOGA 1X8EA 3M3EA 3TEZA 3SMHA 1V6JA 2HKXA 3ACHA 4N7UA 5JOWA 3TNQA 1PGW2 4LIUA 3GJAA 4META 1AUYA 4QPGC 3V64A 5ISLA 2JDUA 1ND3B 4D0QA 3EXUA 4AI0A 4HONA 5CNAA 1RUG1 1YLLA 3WCRA 1IPKA 5J09A 1UIJA 1KDMA 2QJVA 4AQ6A 4DXRA 2WZPP 1RITA 2I45A 2VNOA 4FPCA 4NPRA 2DV9A 2VMEA 2RDQA 4P08A 4I09A 1RYYA 1O5LA 1RHI3 2R49A 2UWBA 3EB7A 4FQZA 1H6XA 2P5BA 3I3DA 4XFAA 2VOVA 3I3EA 1DDLA 4MSVA 1ASJ1 3SCGA 4IEPA 3ZOIA 2R073 1VMJA 3AP7A 3AYCA 2Y38A 5LBEA 4LPLA 1OQ1A 2A5ZA 3KV5A 3LDKA 2VR4A 3J8F2 4D7YA 2DYCA 3RZMA 2IXJA 2XR4A 3CF6E 2W0XA 2ZX4A 3MO4A 4PLMA 4JGZB 5KHGA 5EHDA 1R091 3M3CA 5F32A 1CVNA 1OXCA 4YG0A 2ILMA 5A3WA 5ACA2 2WNEA 3ZFEA 2IZWA 2WNUA 1AL23 3LDRA 5JXIA 2WFF2 4CDWC 2WUHA 4QMAA 1QQP2 3UGFA 1LCLA 4CCKA 1HLCA 4QDSA 5L7OB 1YXWA 3BOWA 4K6BA 5BNOB 4FVVA 1ND3A 4NVPA 5FPUA 1TME2 5LBBA 1J3QA 5C70A 4SBVA 5LY1A 1AF9A 4XVHA 4YW2A 4CP0A 5I8YA 4O9EA 4OFGA 5KC6A 5FYZA 5A1FA 4LMFA 3MEPA 3D5OA 4L9BA 5IWFA 4XETA 4QDQA 4MUVA 1VBE1 4XF9A 1BLZA 3ABZA 4MLOA 2ZMLA 3AMQA 1MR5A 2W46A 4QQ2A 5C3OA 4YVSC 1RUE3 3BU7A 1RUJ2 3LB9A 3NV3A 4UT5A 5FJHA 3ZXKA 2GNMA 1QGLA 2R0FA 2CSGA 2VECA 2XB6C 4L99A 4CZSA 2C4XA 3O1OA 3A4UA 2D6LX 4FPOB 1AYN3 4GH4B 1RJ7A 3INAA 4JGZA 4RGGA 4EN0A 1J3PA 1C8M1 4NR1A 2A6VA 4YFZA 3H7YA 3U10A 3PU3A 5C8CB 2XVKA 4Q4X3 1XU2A 1YCIA 3LSEA 3USUB 1H2KA 1UZWA 1W6NB 3AYAA 3KCYA 1RUD2 2R0HA 4QXBA 1BVVA 2R1DA 5BNOA 2D6NA 1UD1A 4MYEA 3T0AA 2R072 1F5FA 2PMWB 3HNYM 4FPJA 3RJRA 1VAMA 2CY6A 2QQOA 2VMDA 3NJXA 3I8TA 1UMZA 1YQ5A 3AP5A 2XGXA 3VL9A 4OZXA 1BKZA 3CL1A 1JZ4A 1DQ5A 1WW7A 1GQPA 3N7LA 4FFGA 3RYPA 1UZYA 4FP2A 1PM4A 4Z8BA 3JB8A 2C5DA 2K46A 3OOXA 2CYFA 1PO11 2D93A 1HJFA 1AL22 2WQ8A 2WNOA 4FPLA 1N3OA 2PHXA 1ZBE1 3B3QE 1RUG3 3O0VA 3KF5A 3V56A 2ORXA 4GH4A 4AE2A 4J25A 4CP2A 4EQVA 1CZSA 5FXZA 3ZDSA 2VZ3A 2FMYA 1WZXA 4LK6A 4N9HA 2F4PA 4AFAA 2LW8A 5C8CA 3ITQA 1UW8A 5H9QA 1POV1 3MV01 3USUA 3K46A 2P34A 1W6NA 3LA3A 5I8SA 3LWCA 1WA4A 4NHLA 5LASA 1U0AA 1AXYA 1GKBA 4DO0A 2XWBB 1RUE2 4XHXA 2C1FA 5HCAA 1CIWA 3PURA 4WVZA 1O6UA 1HQLA 2Y0IA 4COYA 3N7KA 1BEV1 1MPXA 1BHGA 3PJYA 1C3HA 2VW0A 5LW9A 1AYN2 2GMMA 4E2SA 3AL6A 4XF3A 2XOMA 3KWVA 1RTVA 3TBDA 2FDKA 2TUNA 1OKOA 3BTAA 3KGZA 3I2KA 2VQTA 2FDHA 2W68A 4IEOA 3WDXA 3RYKA 1Q8SA 1J83A 2JX9A 2DBNA 2IXCA 4Q4X2 4QQLA 4LO7A 2VM9A 3VHOA 1NCQC 2P3IA 4P9JA 5FWJA 3WG3A 3VUOA 1V70A 1WCKA 2RS13 2VCMA 1A8DA 5K0UB 1JYWA 4QPIB 4RR3B 2LM3A 1IG3A 2BW8A 2EAAA 2ZEYA 3KVAA 2GC0A 4OI2A 4QGNA 1W39A 3C2UA 5JI7A 1UMHA 1L7QA 2PTMA 4LQRA 1UYZA 4AVSA 4RQPC 3SXWA 1Y9QA 3M4FA 1JHNA 1KXGA 2Z2SB 3P6BA 1VBE3 1BK0A 2O8OA 3J7HA 3KT4A 4K8FA 4LIVA 4NHYA 3DKWA 4MXWB 1XSQA 5E16A 4ORFA 4BXSV 5FZHA 4OHYA 4OZOA 4LJHA 3T1LA 1F15A 2ZHNA 1NQJA 1OH3A 1OA3A 4MG2A 2EIEA 2LTNA 2D5FA 5A3LA 3TEYA 2MEV1 3CJXA 1LNSA 3EJKA 1D4M2 3PUSA 1FX5A 1JH5A 2VMCA 4AHZA 3POEA 4E8CA 1D4VB 3ZXFA 3ACFA 4XCBA 2HWF1 2QQJA 4Z1VA 3SEPA 3X29B 3NO8A 1WLTA 4NN0A 1SLLA 4R9BA 3VBUB 1HX6A 4BQWA 1YO8A 1CGPA 1C8M3 4S2FA 2WWUA 3POBA 1VAVA 2E7AA 2V09A 3M2MA 3FLPA 1QOTA 4L92A 5FKCA 2LS6A 3UGHA 2D3SA 4K21A 1H30A 4GALA 1CJDA 3R6SA 3CQOA 4QPYA 1DLLA 2HEWF 2HWC1 2W95A 4AQSA 2Y0OA 4UYBA 1PK6B 4YM2A 5K0UA 4CEWB 4COWA 1CZVA 4QPIA 4YW4A 5C33A 4RR3A 3AJYA 5JWPA 2X29A 3RPQA 5JXHA 2R16A 2YU1A 4KGGA 4YG3A 2YC0A 4W6WA 3RSJA 4ES9A 3WF2A 3ETQA 3FL7A 2WSUA 5JPNB 2QQNA 4A7YA 2WKKA 1APNA 4MXWA 4XDOA 3E6DA 4Q1PA 4FFFA 1PO13 4NUBA 2NZ9A 1UOGA 3HAGA 3VBFC 2PYTA 1ZBE3 5FXVA 3ZSMA 1KQRA 2BNOA 3OUIA 4NE9A 4UXAA 3T08A 5JZGC 3POFA 4OUMA 4RFRB 5DN2A 4EV0A 1SLTA 3R0RA 3VBUA 2RS12 5CG8A 3MW3A 4W8JA 3EHKA 4KNCA 5F7UA 2BFUS 3BGAA 1RC6A 3AK0A 1POV3 4M4PA 4PHZA 1SCSA 5CEHA 1VBE2 4IETA 3CJIC 1WMDA 4A7ZA 3ZX7A 3J7NA 1GU3A 4FTBA 3A0NA 4XACA 1PK6A 5FYCA 4CEWA 1AHSA 1Z7S3 4QQOA 4QX5A 5F5CA 3FBMA 1WMXA 5LA9A 3O1MA 3ILFA 1A78A 1COV3 3THPA 3MW4A 4CCCA 5FPZA 1LOBA 2ZHLA 3ZYJB 3KS7A 5J3UA 3DF0A 5JOXA 3V0BB 1JOBA 2RHPA 5KWRA 2VC9A 2J1AA 3GZEA 2NLRA 5KXEA 4UOJA 1C8M2 1MZ6A 3M3OA 4W6XA 1ZX5A 3BN6A 1H6YA 3FJSA 1FNZA 2WYSA 5DUVA 5D21A 3NMBA 5SV8A 1UU6A 3MLLA 3WDYA 3OGGA 3CNAA 4AGRA 2EIGA 3ACGA 4LULA 3APBA 2K9ZA 1RXGA 5EFUA 2BGOA 4P9XA 1DCSA 3IB3A 3SH4A 3A23A 4I3GA 1DQ0A 1W2OA 3HVDA 5BPXA 5BNPB 1MQTC 2E7QA 1QU0A 1KFUL 4BB3A 5CFDB 1S0EA 4LO6B 1UO9A 3AYEA 1FNYA 1AJOA 3RGBA 3CU7A 3AZZA 3ST7A 4HANA 2ZBJA 3J7LA 1XNDA 5FCCA 4BIFA 2QNKA 1L3JA 5EIYB 3MIDA 2MEV3 5FZ8A 4FAHA 1MZFA 2XJSA 3ZFGB 1WBLA 2WA3A 4OMDA 2JD4A 3NVCA 2HWF3 1MZEA 4YM1A 4YW6A 1ZBE2 4AFCA 4AR2A 3JXSA 2EXKA 3FHAA 3O0XA 3KV6A 3OGJA 1H0BA 2WZ8A 4RGKA 5AC91 3V0BA 4AI8A 3BTYA 1LODA 1W06A 2JEMA 2YC2A 3GBWA 2JDMA 3JD71 2DF7A 1D2QA 1DP0A 1KD7A 1S0CA 1JUHA 3BPZA 4IV3C 5A7SA 1CD3G 3U14A 4LEJA 4DFSA 4HVOA 3GHMA 1EUTA 4HSJA 5F37A 2HWC3 2XQRA 2E7TA 2F6BA 3E6CC 4FSJA 2OPWA 1OURA 1QF3A 3RWKX 1Z7S2 4N43B 5FP8A 4I3PA 3PVOA 3SH5A 4WM7C 2VNGA 2YHJA 1COV2 1Q5OA 1GOFA 5DUXA 3W21A 2Y6KA 4B3NA 5BNPA 3N4MA 2P3KA 4KL1A 4P9YA 4QHBA 5EYYA 3O12A 5FY7A 3RG0A 1N1VA 3AB0A 2NN8A 4Q4V3 4RHV1 3OPTA 3TRSB 3OGRA 4IV1C 3KZ4C 1MS4A 4RD7A 3NSTA 5JOYA 2W91A 4ATFA 1Q8VA 3KMHA 2J1SA 5F8PA 4BCUA 2RVAA 4E2QA 4Q8KA 2W1QA 3ZFGA 1F4HA 1RUI1 5GZCA 1NA1C 1R1A2 3SQOA 3ZYHA 4UW6A 3HBKA 4MGSA 4PBOA 3TEWA 1CPNA 1GNYA 5FZ3A 2XLAA 5JIUA 3BI3A 2AC1A 3PNAA 1LAJA 1NLSA 2NM1A 1GNHA 5H9RA 3TN91 2OZJA 4N53B 5K7PA 3DN7A 2ZCWA 1HB1A 1NKGA 3I2JA 1R1ZA 2C9KA 4FAGA 4YWAA 4AOCA 5GLZA 1JODA 3JQXA 1T6BX 3Q8AA 4AQTA 3VHPA 3WQ7A 3GNEA 1W8NA 5C3PA 4IEVA 4N43A 3VN4A 3FZ3A 3QACA 2MEV2 2W2IA 3WZ1A 3LZZA 1H2NA 5A3NA 1O4TA 4ZU7A 2VQ0A 3LF7A 3PMSA 5CKMA 1UU5A 2OXBA 3PLQA 5EXOA 4JHZA 3POWA 2YROA 4I0AA 3WUDA 3FHQA 3QH7A 3PTRB 5C9AC 1GR3A 2GSYA 2Q5TA 3OYWB 3IMMA 4XYXA 5T3NA 3S57A 1ULDA 3ILRA 1JTZX 2A6YA 3FFZA 4RS5B 4H3WA 2ET1A 2JE8A 4UWDA 1XXNA 2FDJA 5FKBA 3N9OA 3P3PA 2DU1A 4R52A 3S6PA 3PMEA 1DGRN 2VMIA 1RVF3 2J1TA 4NWWA 3HJRA 2RDSA 1JI6A 4X8NA 4BLJA 2DBIA 4W65A 4DIQA 4YVSB 1W28A 3VBRC 2E6VA 2P4EA 4Q4V2 2W1WA 1E5HA 5FY9A 1V6NA 2YBPA 3OGVA 4KBBA 4LBQB 4K8RB 1X8MA 5B4XA 4JHTA 5A70A 3VHNA 5DAQA 4UBHA 5A7NA 3SH3A 1EUUA 5FZ9A 2E31A 3V65A 3CLPA 3MZHA 3RMXA 3WQ0A 1IS4A 1FV3A 4KBZA 3HN1A 4XIKA 3SITA 1J1LA 4YNIA 1LEMA 5JIAA 5TSWA 2XUMA 3T4HB 5FP3A 3B69A 2G9ZA 5FMCA 3VD7A 3ZMOA 4ZU5A 2WBKA 5EJZB 3P1IA 4CYDA 4CU6A 1UOJA 2RS51 3DYOA 1H1IA 4LKEA 5DDJ1 5JCTA 2JE9A 5LA0A 2IXHA 3OYWA 4IE6A 2DDUA 1CN1A 3GALA 4RS5A 2YUEA 3VBOC 5FK7A 5CA6A 3Q8BA 4IERA 4LT5A 1PGW1 5CB7A 4K3UA 3NW4A 4EWEA 1LHVA 1IPJA 1WCQA 2E63A 2GNDA 4CUCA 1TVGA 2KA3A 2GU9A 3OY8B 5F3IA 1WD3A 3BIWE 4DZGA 1ZRCA 2DUQA 1UXXX 4FPYA 1K45A 5IVYA 4AYUA 1RUF3 5L19A 4P02B 3R05A 4RHV3 4WM8C 4YVSA 2WDBA 2XHNA 1MS9A 3VKLA 2QQKA 4Y5SA 5IUQA 5A3UA 2WIIB 4CU8A 2X8KA 5LRSA 4GZ9A 1XOYA 4LBQA 3VD3A 3AP9A 1RUH3 1R083 4UFLA 4EZHA 2R7EB 1N1TA 3I3BA 1X50A 4JKKA 1GP5A 3POGA 1G9BA 4O61A 4XQWA 2GP3A 2B42B 5FP4A 2QQVA 2D5HA 2QQWA 2ZX0A 4MO3M 3J8F1 2FMDA 4A45A 4PQ9A 4A4AA 1OD5A 1WBFA 3PUIA 4S2GA 4M3CB 2XLGA 5GZEA 1RVF2 1ODNA 1T6GC 3OEAA 5ACA1 5DAXA 5FZ6A 1GZTA 4JZRA 4YVWB 1Q43A 2FBEA 4FXGB 4L11A 5G05L 4AAPA 1QQP1 5FZKA 4IEUA 4B4QA 2P3JA 3HQUA 1I1EA 1TME1 1W3XA 2ZS6B 3HN3A 2ETEA 3C7OA 4XXPA 4BISA 2XBO2 3POSA 4CXXA 1D0GA 5JR7B 2WR9A 3CIHA 1W6OB 1RUC3 1A6CA 1ZNPA 4EN6B 1NCQB 1VPHA 2FDFA 2V4AA 4LBOA 3WXPA 1AXZA 4G3YC 1UL9A 2R063 5E89A 2WT0A 1UQXA 1RUJ1 2JE7A 2WZR3 4LOSA 5F3CA 4TWTA 5L9RA 3WY6A 5FDBA 3WX5A 3UGGA 2A3WA 3FC0A 2B9UA 4RQPB 2OIIA 2W39A 3NNMA 4LUKA 5FQ0B 1IOAA 2XHKA 1ZRRA 4M3CA 1GFF2 2IXIA 2VULA 3SCHA 4D94A 1C28A 3RI8A 1MVEA 1LHUA 5J1XA 3K48A 3KD4A 3S7IA 4B29A 1YWKA 4UW4A 1RUF2 3VL8A 1YJKA 3JB4C 4RHV2 4YVWA 3UETA 4XHBA 1AR82 3LIGA 4PBPA 3TWIA 5IK4A 3P5BA 1RUD1 1RUH2 1R082 2DVBA 2V4VA 4YPJA 1V6KA 3AKPA 4OCTA 2VNVA 2BGPA 4NRPA 5C5TA 2R071 4XFGA 1JZ2A 2H0BA 2YYOA 1DLCA 4XF4A 2UWCA 3GBGA 1WCUA 3B7MA 1FPN3 1W0OA 4G4FA 1F35A 4L8QA 4WVMB 2WS91 1W6OA 1KJRA 3ZR6A 5SV5A 3QBQA 5LK7B 4DUWA 1NCQA 5FTTC 1W6PB 1AVBA 3UYJA 5KC5A 1E5SA 3HT2A 4IEWA 3MHZA 5DDJ3 3B02A 2XG3A 2AACA 1VALA 1JYVA 1OA2A 1AL21 5A33B 1HRV2 1QJEA 2Y6JA 2YC4A 5A7PA 4RQPA 1STMA 2A71A 3WDVA 2ZAHA 5FQ0A 1LENA 1JS9A 2O14A 3M1HA 4K1YA 2FCUA 3BTZA 2Z69A 1JU4A 1D2SA 3S5QA 3HMYA 4P5HA 4LBJA 3VBFB 5HPOA 4I0BA 1RGSA 1RUC2 1VB2A 2RS31 3AMPA 4O7XA 5IJRA 1CESA 3URFA 3J9SA 4HPKB 2JICA 3TOJA 3MF9A 3KVBA 4CCNA 1OFNA 2R062 2BVBA 1FI2A 5FYBA 2WZR2 2XJQA 3LFMA 3N9MA 3NAPB 3SCFA 3I2DA 3J8F3 3NJYA 2DTWA 2VOXA 3NNJA 3BOPA 3PVNA 2E53A 4YM0A 1S0IA 5LA2A 2AREA 4WVMA 4ZHNA 1YC61 4ZS2A 1AYN1 3CJIB 1C1FA 2Q30A 4JAAA 1W6PA 4HVQA 4PIYA 3CZJA 2EICA 2PHLA 2RDRA 4DEVA 1G8WA 4MGKE 4Q27A 2OPKA 1OH4A 4IQPA 4UFHA 5A33A 1QQP3 2V5YA 4Q4Y3 1QDCA 1ZZ9A 4IDZA 4NIHA 1TME3 1SFNA 5LWBA 4QM8A 3QD6A 5BUVA 1JZ5A 5FZ0A 4EYUA 1LEDA 3H3UA 4IXLA 1FPN2 1DQ6A 2ZAAA 4FPFA 3U37A 3VBFA 4CA9A 3LCPA 2PELA 2P37A 2HWE2 5B4NA 3H0OA 3ME2A 1ULFA 2EAKA 2XQXA 1GZCA 4FOQA 4LHKA 5JZGA 2GNBA 2WNUB 2YV8A 3T09A 4ISRA 1JYXA 4BLIA 2AGSA 4OLLA 3NAPA 1D4M1 1HB3A 1WLCA 1MQTB 4LK7A 1Q3EA 4C1WA 4LXLA 2ARXA 4PI2A 5ANQA 3E5UA 5FPVA 4CSWA 5A6YA 1LJ7A 3CJIA 3MW2A 5E8AA 2K0GA 3VDDC 1LB2A 3B94A 1OLRA 3WDWA 1DG6A 2D3RA 1G9AA 3N7JA 3UKVA 3WD5A 3LKJA 2X5IC 4QKNA 4X8PA 1RUD3 1E5RA 1SLBA 3AMHA 1FYUA 1NLQA 3D0JA 2PQSA 3NRUA 5FZ7A 4K1ZA 4HLTA 4YGBA 2G19A 1SG3A 2UYAA 1UY3A 2XJPA 4NHKA 2WS93 4AVAA 5I91A 5FY4A 1LHOA 5GLUA 3OF1A 3O1SA 3WF3A 2DURA 1L7LA 3ZIXA 5CADA 4Q0SA 2XXZA 4M3CF
chains in the Genus database with same CATH topology
5GLVA 1W2UA 3ZVXA 4COZA 4IEXA 1B35C 5JPMB 4WM7B 2VY0A 3O14A 1EPZA 1BZWA 4XJ9A 4ATEA 1ZRFA 1MQTA 1DZRA 4Q4Y2 2ERFA 5FMOL 3LOBA 5IK7A 5DZGA 2RS11 1IZ3A 1QKQA 2RJLA 2DFCA 4IV1B 1UX6A 2GALA 2XL9A 2VPVA 2ZGOA 4OHZA 4YZ2A 4Q0QA 3TAYA 4J6GA 4C0HA 3FLRA 4LHNA 2RS33 3MIBA 4FOWA 4Q2FA 4XTMA 4AGVA 1DGLA 2ZX2A 1GLHA 3I4IA 4XXAA 3E6BA 4DPNA 1S0GA 5AFEA 3W58A 1QMJA 3B00A 3AKRA 2YGMA 3WLUA 3ZYIB 4AF9A 2ZGLA 4KU8A 4EWDA 3WW4A 4Q0PA 3VLBB 3BODA 4WM7A 1DHKB 4E4DX 1ND2C 1CX4A 1NE6A 1XU1A 5I93A 3AFKA 4JDOA 3WW1A 2UY8A 3WOGA 2ZJCA 3IPVA 4IV1A 1PNGA 2EALA 1IS3A 4OI1A 1POV0 5IK8A 3M8LA 1NXD1 2Q4SA 2WS92 2EXJA 1NA1A 4AVVA 3K51A 1AX0A 1PVXA 3NJZA 2QKDA 2ZMKA 1DGRA 1V6IA 4YZ4A 4BQ1A 4DB5A 5I0TA 3GZUC 1D4M3 2V73A 4JCKA 4BIOA 1GBGA 3L9JT 1H4HA 1BMV2 1C1LA 4RFT0 3VBRB 5J48A 1DU3D 4QM9A 1MACA 2A70A 1CAVB 1J58A 2B8MA 3VGIA 4P9GA 4U36A 1N1SA 1PMIA 1QXRA 4AFDA 5IT6A 5T50A 2RS32 1EY2A 1BQPA 1QJZA 1VBB3 5CAZA 2DCYA 3MYXA 1CPMA 1NLRA 1Z7S1 4B7EA 1COV1 3FHIB 3FE5A 3TYJA 4Y24A 1O3TA 2BNNA 2MHFA 4JGYB 2PLV3 4V1PA 1UPIA 2B45X 1V6OA 3VBOB 3EBRA 4LTAA 3WQ1A 1G9DA 2KXLA 2UY9A 3W59A 5FOBB 4XFBA 4C91A 3FBYA 4TZDA 5FLIA 3RNSA 3SLIA 3H3ZA 1R1A1 1KJLA 4WM8B 1BBT3 4CDXB 1LOFC 1Z0HA 2D7FA 1Q56A 3VBRA 4AEDC 2SLIA 2UYBA 1XQNA 1F2NA 4H7MA 1CAVA 3RYRA 2Q1ZB 1QOSA 2ZPXA 4F8AA 3WT3A 1WMFA 2HWB3 2XJTA 2G4IA 2VGDA 1OQDA 3OTFA 3HD8B 4LO8A 3MPBA 1GNZA 1JUIA 3ZIWA 3WNXA 1FAYA 2FQPA 4JTNA 2R30A 3PVBB 1FV2A 4GMP1 5KHJA 4E9KA 1O91A 2DUPA 2NP0A 1CONA 4JGYA 2WNVC 1XRUA 1TNRA 3VBOA 3KB5A 3RJ2X 3KLSA 4AFBA 4KGQA 1J1TA 4N90A 3T2TA 1NCRC 1DQ4A 3GYDA 4XF0A 2JG8C 4WM8A 4AWDA 4CDXA 3NKTA 5FLHA 1VBB2 2CGPA 2N7GA 4LUMA 4Q29A 4B8EA 1X82A 1E57A 3MPPG 1KS5A 1DQ1A 3FFQA 1PVC3 1I5ZA 2PLV2 3KCXA 1C4RA 4Q4V1 3AKQA 2JENA 4AGGA 4YM3A 5K9YA 5GLWA 5BNNC 1VBA1 4INDA 4QGMA 4ES8A 1HIXA 5H9PA 3QOPA 4Z07A 3ZSEA 3WINE 3MGUA 1PO22 1ENQA 1ALYA 1BBT2 3B9IA 3HR9A 1XNCA 5I0RA 3IKWA 4HFSA 2CGOA 2ES3A 4ONUA 2HWB2 1LECA 3DPRC 4EJRA 1AR91 2ZGSA 5LK5A 4URTA 1VRH3 3ELNA 2IXKA 4Y26A 4XPVA 2PAEA 3HIFA 2Q8OA 1PGL2 3WDTA 1OOPC 2I07B 2XJUA 2QDNA 2QQPA 5T5PA 4HN1A 1H1MA 1UKGA 1C8NA 3VZKA 4AQ2A 5EZWA 5JDBA 2BTVC 4H55A 5C4WC 4XJ8A 2JXAA 4MVTA 4MGZE 2XLFA 4FTEA 1R1A3 4I30A 2A6ZA 3MIHA 3WUCA 4YW1A 5D8AC 3HWJA 3PTYA 1UAIA 3WCSA 2GC1A 1H1AA 1RVF1 2NMOA 1ZVFA 3AZXA 4ZXKA 4HMZA 4N7IA 4BHPA 4XILA 4XMIA 3LAGA 4CDUC 5IK5A 3HQXA 2WINB 1PVC2 1IS6A 5KHIA 1O4ZA 2QZ3A 3MFAA 2ZGQA 3H1MA 2YZ4A 5EV7A 1QNWA 3OD0A 3VHRA 5CFCC 2XBO1 1UU4A 3EO6A 4GMP3 1GQGA 2A75A 5HXVA 1V6LA 2A3YA 4QT6A 3MICA 2G9GA 1RMU1 3ZYGA 3B5LB 3UKNA 1Y43B 1H8VA 3VZMA 1VJ2A 1RUNA 2WT2A 1NY72 5DUUA 3MLKA 3B01A 3WW3A 3RQ0A 1X36A 4YZ5A 1PZ7A 1ZM1A 4OUSA 2ZX3A 4MV2A 5EWSA 4CEYC 1G6NA 1HKDA 3B93A 3WG1A 3KT1A 5CG9A 1SLAA 1VRH2 1YNAA 4XBLA 4FOYA 4MH0E 1RUF1 1LOCA 3J4UH 3OBRA 2WFPA 1MVQA 1LOGA 1AR81 5F9TA 4QPGB 1GZWB 1VAKA 4M3CE 1RUH1 1R081 1VBA3 4M00A 2ZGPA 4R4XA 3ZFFC 3VDDB 1YFYA 1O7FA 4PCRA 3ZXAC 2VMGA 2ZGRA 4LBQD 4HK9A 5L7OC 5CBLA 2WLPA 5C6CA 3WP4A 4ZU4A 1C5IA 5AFBA 2O1QA 5E1RA 1DF0A 4HKLA 2VUAA 1HRV1 4HT1T 1AR93 2P2KA 1AX2A 4R8HA 3KSCA 2G9FA 4K9SA 3R4DB 2H0VA 2XJRA 4Y1UA 4MXVA 2D6KA 3LA2A 3RWNA 2ATFA 2Z42A 3AXEA 1B35B 4ISQA 4AI3A 5K8SA 4XJZA 4CDWB 3NL1A 1RUC1 2DCJA 2DVFA 1LGNA 1AR63 1NQDA 4QPGA 1GZWA 4GH4C 2R061 4XFHA 2DVDA 3ZN6B 2WZR1 3VDDA 1OQEA 1U5IA 4BPZA 5GZGA 5T5JA 2AUYA 3GZTB 1I6XA 1YIPA 4YZ1A 3ZPYA 1K5MC 5GKAC 1XNBA 4XMAA 3N36A 4AEMA 2EXHA 2VQAA 3WP6A 5FO8B 1XE7A 1IKPA 4GULA 1LHNA 3JZVA 4RGAA 5DZFA 1ZREA 1YFXA 2GAUA 1VBA2 4IESA 2D3PA 2XBO3 2Q0AA 1OMIA 3USSA 3VZLA 1O3SA 2ZMNA 4YW3A 4DRRA 1B35A 1CAWB 1FPN1 1RMU3 2JDZA 2ZTNA 4GKYA 4XDQA 4CDWA 1ND2B 2HWE1 3ZYPA 1AJKA 2HYKA 2AZ5A 3FLTA 1LTEA 4GKXA 2E51A 1TEIA 4HETA 3ZN6A 4DNYA 1MS8A 1J3RA 1G86A 2D6OX 2YDEA 4N9IA 4EN9B 1QOOA 1AR92 1OPOA 4DXZA 4Q0VA 1VB4A 5CIRA 1MEC3 1XYOA 2IWGB 3AM2A 3N3HA 1WGPA 4DRVA 4YARA 1SMVA 2FZ1A 5BV6A 1AR83 1ENSA 4C90A 1ENXA 3AKTA 1AR62 4RSUA 2UWAA 2IXLA 1ULCA 2NQYA 2WSVA 4ASMB 1N3PA 3H1YA 1QDOA 3IN9A 3LA7A 1U5YA 3LSDA 1UZZA 1NE4A 1W6MB 3E5XA 1CAWA 1H2LA 5A32B 4CRQA 1VIWB 4D3WA 1ND2A 2QCSB 4XFCA 3BALA 2BBVA 2BFUL 1GQHA 4RA0A 1HRV3 4Z92B 3MIGA 4WVVA 2O8QA 4Z2WA 4Q4Y1 5CVRA 2VUJA 1VBD3 2GC2A 3O5SA 1LHWA 4KQ7A 1G9CA 4H14A 1ONAA 3V0AB 3L2YA 3KCCA 1IQAA 1XE8A 3WW2A 2ZZJA 1HW5A 4PIZA 4G9SB 4M0NA 5GJ6A 4MZUA 1RMU2 5LRRA 3RDIA 3OJBA 4Q8LA 3VZOA 4D69A 1FOD3 3JQWA 4OHXA 3RZZA 5FFOC 1XYNA 2ZOEB 5FO9B 2WQ4A 4GXLA 2JG9C 1CAUB 1W6MA 1TQ5A 1WW4A 5A32A 3U0ZA 4GWMA 4AHYA 1MEC2 2GN7A 4BMBA 1H9PA 4I0WB 2A73B 4MGYE 2RJKA 4KU7A 3FUOA 4XF1A 1KS4A 2KM2A 4NO4A 4AW7A 4FPKA 1S0DA 4HL0A 4LBKA 3FMGA 4NWVA 4Y1VA 5HCBA 4MGIE 3ZXLA 4DQAA 3V0AA 1JXNA 4FQ4A 1HV1A 1OLQA 4R4ZA 1Q8PA 3G6JB 2HWE3 1O4YA 3GF6A 4GB32 4P14A 4OULA 2DU0A 1ZRDA 3IT8A 3L2HA 2GH8A 5A3MA 5FAXA 2JG8B 5GM0A 2RM23 3ENRA 1LOFA 2CTVA 2HWD3 2X53S 3A0KA 5J98B 2LUWA 3B9CA 1CAUA 2DVGA 3H7JA 1BMV1 1VBD2 3S0MA 1PIV3 2VOWA 2D98A 4GQ7A 3JBG3 5KXCA 4SLIA 2OW4A 4XJUA 1G7YA 3S7EA 3NV1A 4GIQA 3PJQA 1DGWA 1A8MA 3H9AA 4K7JA 3UJQA 2DCKA 4IEZA 4D7TA 5JZGB 4OI0A 2OYZA 1FOD2 3UV9A 1CQ9A 2B46X 1OPMA 3FX3A 4Y22B 2VMHA 3WDUA 5F6LB 3I7DA 4MX3A 4LBNA 4JV4A 1N47A 2JECA 4AHWA 2BWCA 3PVEA 1NCRA 2A7AA 1EAH3 2OZ6A 3DPRB 1LKNA 3G7DA 2JG8A 2FHRA 3ROUA 5FRAA 3GHNA 4A7KA 4J1WA 1HXS3 1DQ2A 3M70A 4B4RA 4XBQA 3IWZA 1DYPA 2CGNA 3VZJA 5HI0A 5BNPC 5CFDC 2TNFA 2I74A 1XYPA 2WLQA 2GMPA 4Y5Z0 4WV8A 4K40A 4M01A 4P9IA 2RMU3 2WC2A 3AP6A 4Q4W1 3ZSLA 4XFFA 5C4WB 1EV12 4RL7A 3WV6A 1SBFA 4E4ZA 5KXBA 1O3QA 1NG0A 3KT7A 2D6PA 3SNMA 1DBNA 1PZ9A 3H50A 2VNRA 2CNAA 2RM22 1SLCA 4GWNA 3W9AA 3ZSJA 2PQQA 2HWD2 1HQNA 4Y22A 1FXZA 1UCXA 2EXIA 2XPJA 4CDUB 4E27A 1BYHA 4K20A 1PIV2 2VVDA 4P9WA 5DG1A 3DPRA 1S0FA 2CWSA 5T54A 2HEVF 4I01A 3JBG2 2IFWA 1V00A 5CFCB 2ZX1A 1DGWX 4Y4YA 1OOPA 3ZXEA 3S30A 3ZXDA 1SACA 1NOVA 1VBB1 4E2GA 3CEWA 1LGBA 2LALA 4IV3B 4CTEA 1HRI2 1F31A 5C4WA 5FOJB 3JUUA 3LOIA 5F5QA 3WG4A 1QJU1 2ENRA 2PLV1 1FMD2 4CEYB 4AEJA 3VBSC 3TNPB 1EAH2 4XW3A 3VV1A 5D8AA 4QU2A 1HXS2 4N53C 3DL3A 5J7MA 3M3QA 2GC3A 1QJX3 1PO21 4P9LA 4CDUA 5AVPA 1BBT1 2VXRA 4LA3A 4JC1A 3IPVB 1F5JA 2RMU2 2WQZC 3OCPA 1I3HA 2BGCA 1SEFA 1GYKA 2XL7A 3ZFFB 5CFCA 2HWB1 1NA1B 1REFA 4Y1YA 5FPXA 4PLNA 2DUOA 4YG6A 1BVP1 2QUOA 2NPIA 5JI9A 4IV3A 2RR13 4L97A 4EN7B 4YW5A 1PGL1 5DZEA 5EYXA 2A6XA 2EF6A 1VBC3 1HQWA 2Z79A 2PFWA 2R043 2Y26A 4RS5C 4CEYA 3NV2A 3HT1A 1OI6A 3D0SA 5AVAA 3ES1A 4LO5B 3VZNA 4EN8B 3SISA 2NYYA 4COUA 4DY5A 2ZZQA 4Q4W3 2AH2A 2C0ZA 1QXPA 5C9AB 3MI8A 3AXDA 2C9AA 5ABJC 4EROA 1TNFA 3ZFFA 4U2AA 1PVC1 4LA2A 2YPJA 2ZABA 1KITA 2I2SA 1IGOA 1PNFA 2TEPA 2PHUA 4DS0A 1RHI2 2BVVA 3VKMA 4AI1A 1Y3TA 5L7OA 1JYIA 4F7ZA 3ZN5A 1K5MB 4PIXA 2ZACA 1LESA 5GZDA 1RUOA 1DYKA 1QJX2 1EP0A 4QQHA 2R1BA 1PGSA 4M0HA 1ZBA3 1PHMA 1W0PA 2WWSA 1OA4A 1NY71 1ZA4A 4B7KA 2EVXA 4B4PA 2GH2A 2WL1A 3GZAA 1YFUA 2YXSA 4DY3A 1VRH1 3WVJA 1S55A 1M06G 2RR12 4IEQA 4KG8A 2H6BA 4AXOA 2BEOA 5C9AA 1BJQA 1QJU3 4XBNA 1VBC2 2CV6A 1MS0A 3EQEA 2R042 2OVUA 4TSVA 4YFWA 4DOUA 2XKPA 1G9FA 1ASJ3 1GZ9A 3CO2A 4GMP0 4ZKTB 1YYNA 2DCTA 1H8TC 1VLNA 5L73A 1PO23 4YSFA 1K5MA 3H8UA 5HBAA 4CDQC 5T55A 1WCSA 2TBVA 1S0JA 4YVWC 1YFWA 3ZMNA 1UKRA 1WD4A 3N7MA 3OBTA 1YUDA 2QFEA 4Q4W2 2FZ2A 4E4SA 1XNKA 1R093 1UN1A 2PHTA 4FPEA 5KHHA 5GLTA 1EYBA 2ZHKA 1QJY1 3N35A 1RB8G 2CAVA 1BXHA 1QWRA 1CJPA 2PHRA 4BA6A 5CU1A 2MPFA 1LOEA 4JDNA 3R4SA 2B5HA 3ZO0B 2D43A 3AMMA 2AENA 1ZBA2 1H4GA 2GNTA 4AG4A 4A3XA 1URXA 4XJAA 4OHWA 1SBDA 2UU8A 4PDWC 3KQRA 4JRAA 1TE1B 1ZYBA 4LNVA 1JOJA 4LE3A 1RUG2 3VBHC 3ZN4A 1U5ZA 1QJU2 4OVEA 3RI9A 2JG9B 1V9U1 4LBMA 2VW1A 2R6QA 2PHWA 5JVVA 3AJZA 1H9WA 5FBZA 3THTA 3IBMA 4DMIA 2VVFA 5JMCA 1ASJ2 1DZQA 1AR71 3MIFA 2D40A 3BCWA 4KWKA 5DG2A 3ZXGA 4JTOA 2HJIA 1BK1A 2DCZA 2XJVA 3P3NA 1WUVA 1S2BA 4Y20B 3VKNA 1R092 4BYYA 3ES4A 5JLVA 2MNGA 1YIFA 2QVSB 1QY4A 1C5HA 1JYCA 5LEKA 4C1XA 1SCRA 4S2DA 4D7SA 1OSGA 4X6QB 2PAKA 2JKBA 1ENRA 2ZGTA 2ZGNA 2OA2A 3FUQA 3NAPC 3QCWA 2JG9A 4UW3A 3QH6A 3POYA 1AR61 4NHMA 4HN0A 5F1RA 3DV8A 1LOAA 4X6RB 2PA7A 2GN3A 5GALA 2DFBA 3E5QA 3IIAA 2DVAA 1S0BA 1LGCA 2B39A 4FBFA 1BEV3 4FOVA 2CAUA 4Y20A 4LO4B 1QJY3 2A3XA 1PM7A 3UL2A 1SLIA 4XEZA 1YRZA 4DINB 4QD2A 2JJ6A 1WW6A 1H2MA 4JQRA 3ZFEC 2WNUC 2YY1A 2WT1A 2DWRA 3OD4A 1BCXA 3IM0A 1U12A 3WP5A 1W6QB 1FT9A 1ZZ6A 3KM5A 4F83A 1JW6A 1ND3C 4TLFA 2ARBA 3NV4A 1YHFA 4JDMA 4J1XA 1M4WA 3M3IA 1PO12 1NYWA 1JBCA 1DFQA 1HV0A 2PHFA 5I0UA 5J96B 2CL2A 1B09A 1MEC1 1WW5A 3IDEA 3H1WA 2BNMA 2PN5A 5J36A 1V9U3 1AZDA 1RIRA 4WBBA 4YZ3A 3J26N 4HBNA 3LGRA 2XKOA 4JGZC 4KWJA 2XWJB 3NKGA 2SBAA 1RINA 2ZGMA 4BM8A 1AR73 3RS6A 1LRHA 1IHMA 2VOKA 4LHLA 1C57A 5J37A 1KFXL 2WJSA 4GB31 1MZ5A 1V6MA 2X5IB 4C0BA 1W6QA 1YI7A 3MF6A 1QH7A 1BEV2 2BPA2 5CFDA 5FLJA 3RRDA 3AZYA 5BNOC 4PJYA 1WLDA 4Q26A 3R4UA 1QJY2 1GV9A 5H9SA 4TYSA 5BNQA 1VBD1 3ECQA 4WZFA 3VBSB 4HKWA 5GZFA 4LLOA 2A6WA 4FPGA 4JVAA 1AYM1 4EWAA 5F6KA 2AYHA 5B2GB 1ULGA 1CAXB 5JSPA 3IDBB 1X33A 1FOD1 4WZCA 3ILNA 4OI4A 3ZSKA 2YGLA 2XVGA 2XVLA 3AZWA 1ULEA 1ZZBA 2IFRA 5C8CC 3HBZA 4HSLA 2X5IA 2GDFA 1SQ4A 2HWF2 1GICA 5BXXA 4HZFA 3I59B 2ZHMA 4LR4A 4Z82A 3ACLA 1V9U2 2O0OA 5DXDA 1VR3A 2AR6A 4AEKA 2GMEA 2B7YA 4AVCA 4LBLA 2XH6A 2HWC2 4YGCA 3O0WA 1GANA 3VBSA 3MDPA 1N1YA 1AR72 2D44A 1U5XA 1EV11 2QZ2A 3D8CA 3ZXJA 4FTSA 2BQPA 4N53A 4XTPA 4W6YA 4LE4A 2VH9A 4QGLA 4Y1ZA 1CAXA 5C8WA 4H7LA 5FREA 2RM21 2HWD1 4BE3A 1DIWA 3IDCB 2HEYF 3T1MA 1SFYA 3NWKA 1O3RA 1AX1A 4GA9A 5JSRA 1FATA 5ABJB 3WR0A 1NZCA 4ITCA 4UBGA 1DZTA 4AVBA 1TMF1 1LU1A 2Q1MA 4AFMA 3WHUA 1QHDA 1PIV1 1YJLA 5AC93 2ZA9A 3I59A 2UURA 2W52A 3JBG1 3JD73 1ZZ8A 4YRDA 3AKSA 2IC1A 1MS3A 4HKOA 3AYDA 4JGYC 3I54A 3UKTA 5T52A 5FMOS 2P17A 4FP3A 4PLOA 1HRI1 4GB33 2DTYA 4QQPA 3DUIA 1WLWA 2D97A 3MLJA 1A3KA 1FMD1 1PZ8A 4FO9A 1EAH1 4CDXC 5K0UC 2PAMA 2QDRA 3KGLA 4HK8A 4QPIC 1QNYA 2EA7A 4RR3C 5T5LA 3WP3A 1HXS1 4I2OA 3PHMA 4JRLA 4S2HA 1UPSA 4IEYA 4A2UA 3D82A 3ATGA 1RUI3 3SHRA 5ABJA 3AX4A 4KG0A 1N3QA 4I02A 2YMZA 1AYM3 2RMU1 3TN93 3WG2A 4FPHA 1Y7BA 2VG9A 2OUHA 2R32A 5JAXA 2E9QA 1H8TB 3O7OA 4CDQB 5D1IA 3VBUC 2WA4A 4LLFA 4AEDB 2WFF1 5HCFA 3TB0A 2CWMA 4XQ4A 5KBFA 4YGEA 2ZKNA 1EPWA 4CP1A 1F9KA 4XJWA 2ZKLA 1AXKA 2H6CA 4XFIA 3WHTA 3OY8A 4L2NA 1D0HA 2ET7A 3MIEA 3DGTA 5AC92