5IVJA

Linked kdm5a jmj domain bound to the inhibitor n11 [3-({1-[2-(4,4-difluoropiperidin-1-yl)ethyl]-5-fluoro-1h-indazol-3-yl}amino)pyridine-4-carboxylic acid]
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
317
structure length
296
Chain Sequence
EFVPPPECPVFEPSWEEFTDPLSFIGRIRPLAEKTGICKIRPPKDWQPPFACEVKSFRFTPRVQRLNELEAMGFEQAVREYTLQSFGEMADNFKSDYFNMPVHMVPTELVEKEFWRLVSSIEEDVIVEYGADISSKDFGSGFPVKDGRRKILPEEEEYALSGWNLNNMPVLEQSKVPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPSHAAEQLEEVMRELAPELFESQPDLLHQLVTIMNPNVLMEHGVPVYRTNQCAGEFVVTFPRAYHSGFNQGYNFAEAVNFCT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysine-specific demethylase 5A
publication title Structural Basis for KDM5A Histone Lysine Demethylase Inhibition by Diverse Compounds.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 91
structure length 296
sequence length 317
ec nomenclature ec 1.14.11.-:
pdb deposition date 2016-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5ivjA00
5FY8A 3K3NA 5FZDA 5FPLA 5FZOB 5FZ8A 5K4LA 5LY2A 4BU2A 5FPUA 5LWBA 5F3GA 5F37A 2OX0A 4CCKA 5FPVA 2XMLA 3DXTA 4XDPA 3KV4A 5FP4A 2GP5A 5FWEA 5F5CA 3UYJA 4Y33A 2OQ7A 4D6RA 3K2OA 5ANQA 5F3CA 5IVVA 3KVBA 2YBPA 5FXWA 5FYMA 5A7SA 4CSWA 5F2SA 2Q8EA 5FZKA 3AL5A 4V2WA 5FYHA 5FZ7A 4D6SA 5A3NA 5FY4A 3KVAA 3N9QA 5FPAA 5FYVA 5A3WA 5FJKA 3PURA 5FYYA 3KV5A 4BISA 5FXVA 5FBJA 5F32A 4XDOA 2XDVA 4EZHA 2OT7A 4HONA 2OQ6A 5FYSA 5FYUA 3K3OA 5CEHA 3AVRA 5FJHA 5A80A 5LY1A 4CCNA 4LITA 4QU1A 2YPDA 2W2IA 3PUQA 4CUGA 5FPBA 5FY7A 5LW9A 2P5BA 3AVSA 4DIQA 3PU8A 5FP3A 5FXZA 5FZ9A 4CCLA 4GD4A 4AI9A 4GJYA 3PTRB 4IGQA 4QX8A 2PXJA 3KV6A 4QWNA 5F39A 5FYIA 5A3PA 1VRBA 4LXLA 5IVCA 3PDQA 4C8DA 4QX7A 4IGOA 4LIVA 3PU3A 5F3IA 3AL6A 2Q8DA 2YU2A 5IW0A 4CCOA 4ASKA 5E6HA 5A7NA 5FZAA 3PUSA 5ISLA 3U4SA 5IVBA 4IGPA 4UF0A 5FP9A 4GJZA 3ZPOA 5FP7A 2WWUA 5IVYA 5FZFA 4D6QA 4QXCA 5IVFA 4EYUA 5FZBA 2OS2A 4HOOA 5FZIA 2XUEA 5A1FA 5FZLA 5FWJA 4UF0B 4LIUA 2Q8CA 4QXBA 4Y3OA 5FZGA 5FYBA 2VD7A 5IVEA 5FY9A 5FZ3A 5FZHA 3N9PA 3ZLIA 4BXFA 5IVJA 5A7QA 5FZ4A 5FUNA 4NUBA 3LD8A 5FZ1A 4QXHA 5IWFA 3NJYA 5FP8A 4E4HA 5A7PA 5FUPA 5A7OA 3LDBA 3N9OA 3OPTA 3U78A 2YU1A 5A7WA 5F5IA 4EZ4A 3N9NA 5FXXA 4DO0A 5FYCA 5FZ0A 4TN7A 5FYZA 5FZMA 3RVHA 5KR7A 2WWJA 3OPWA 5F2WA 5A3TA 2GP3A 5A1LA 5FYTA 5FZOA 5FZ6A 5FZEA 2XXZA 3N9MA 5F5AA 5FV3A 5A7WB 5FZCA 2YBSA 5F3EA 5FY1A 5FY0A 4V2VA 4AAPA 4GAZA 3DXUA 4URAA 4CCMA 3PUAA 4Y4RA 3N9LA 5FY5A 2YBKA 3KV9A 4CCJA
chains in the Genus database with same CATH superfamily
2TNFA 5LBFA 5FO7B 1AHSA 3NKTA 3NNFA 2XPJA 3C8XA 3CIHA 1PIV2 5JXJA 5FPUA 3M70A 1CZTA 1T2XA 3RG0A 2WNUB 2WUHA 1MZFA 4NR1A 2A75A 5FOBB 1AR82 3ZSLA 4XDPA 1VBE3 2XKPA 1C57A 3ILFA 2WO1A 1ZBE2 4XC9A 3R6SA 1MS9A 3USUB 5FFOC 4M0HA 5CA6A 1MPXA 1VIWB 4B3NA 4I0WB 1X9PA 2DCTA 2VJXA 2ORXA 1R082 4LA2A 5F8PA 5FXWA 3OD0A 1XNDA 4BPZA 1IKQA 1D0HA 4E27A 1O91A 1PVC3 3NNGA 4D6SA 5JIUA 1PVC1 1V0AA 4IEWA 2VOWA 2VTXJ 1FX5A 4XXAA 5J98B 5FMDA 4BQ5A 2CWSA 3OY8A 1W6OA 3OF1A 5FDBA 2J7MA 1MEC2 3K3OA 4QQ2A 3G7DA 2EIDA 4Q4Y2 1A78A 2BZDA 3T30A 4AHYA 1PO22 1T6GC 5BNPC 2AACA 1XNTA 2PLV3 2WZR3 3VKNA 4P9LA 2ZAAA 3KT4A 2PLV1 2WZR1 3WDWA 1FPN3 1OOPB 2XLGA 5FZ9A 2HWE3 4LUKA 3TNQA 1FPN1 2VULA 1O8SA 2HWE1 2PQQA 4N53B 1W99A 4AE2A 5F39A 4I2OA 2PELA 3SQOA 3POEA 4FP3A 4ZHNA 1UO9A 3I54A 1SACA 2BYVE 4D8MA 1GNYA 5A3MA 2YDEA 4C1XA 4XAAA 4WBBA 1DYKA 4R52A 5FP7A 5E1RA 5LBBA 1RJ7A 2EVXA 2ZX2A 1RGSA 3K4DA 4QX3A 5BNPA 1XXNA 1O3SA 3GZUC 3TYJA 3ZSEA 1GOGA 1TMF2 4D3WA 1SFYA 2FBEA 3GBWA 1FMD1 3T3YA 2Y6GA 3MV01 5B4NA 2D3PA 4B1MA 1G9CA 5HI0A 4FTBA 1NY71 3ACLA 1DU3D 2WNUC 4RL7A 3AJYA 2WABA 1MZ5A 3D3AA 2VH9A 4FT8A 2VUAA 3KM5A 4D0QA 4KG8A 2D6OX 4OHWA 3BOPA 3ZLIA 5CKNA 3ACIA 1QY4A 1DBNA 5FUNA 1W6PB 4LLFA 1W90A 4LBLA 1GNHA 1VMFA 2V4AA 3A0KA 3N3HA 2PHXA 4A3ZA 4BQ3A 2YU1A 3K51A 1AYM2 1C8NA 5B4XA 5T5LA 3VD5A 4E9KA 2VW0A 3SH3A 3WNNA 3TRSB 4Q26A 2HWD2 4YVSB 4L8QA 3VDAA 1GP5A 4ZZ8A 3AKPA 4J25A 3RWNA 1IPKA 3VBSC 2XONA 3GJAA 4GXLA 4JHTA 4Q4V2 3QH6A 2ZEWA 4I30A 4S2GA 4AAPA 5FQ0A 4V2VA 2QQMA 5FPZA 4HKLA 2QQIA 5CU1A 1JOBA 3QH7A 2V72A 3PIGA 4W6YA 2YHJA 1LHWA 3Q8AA 3USUA 1OOPC 3PIJA 2JECA 1WBLA 1FNZA 1IG0A 1LOCA 5C3SA 1LGNA 4B8EA 3OBZA 1QHDA 1AL23 1E5IA 1W3VA 4RFT0 5FPVA 4BHPA 1UPIA 3SHRA 1AL21 2BNNA 3DXTA 3ENRA 3VBHB 1VAMA 2VZSA 2J22A 3KV4A 5FP4A 5GZCA 3ASIA 3EMRA 3TWIA 4QU2A 1BLZA 2ZZJA 3H9AA 1ZRFA 1WMFA 2QBXA 2OPWA 4HMZA 1UOJA 4K21A 4XVHA 3POWA 4M3CE 4QB2A 4Z07A 1AXYA 3RGBA 3VBSA 3ZXFA 5LA9A 5JSRA 1JYXA 4TSVA 4CCDA 4HK9A 1JYVA 4NIGA 4FQ4A 2VOXA 2JE8A 5A3WA 1CAUB 2EXJA 3WF4A 1F9KA 4JGZA 3B93A 4KMQA 1OOPA 2ZX3A 3NJXA 4L2NA 1NQJA 3T2QA 1OD5A 3MYXA 3W9AA 5FJHA 5CEHA 3ZXKA 1FV3A 3HJRA 4QDSA 4X8NA 3DEMA 1W8UA 2WQZC 3J26N 4AHZA 1O3TA 1S55A 2VL4A 3DYOA 5HV4A 2ZGLA 3AVSA 4DUVA 1GR3A 1SBEA 4EWDA 3ETPA 2DVFA 2FHRA 2C26A 2JD4A 4CP9A 4CPBA 1F31A 3C7HA 4IGQA 2WYSA 4Y26A 2NMOA 5A3PA 4I3PA 1G9DA 5FYIA 1QXRA 3RJ2X 1WD4A 4E4SA 1RUE2 4UW4A 1E5HA 4LKSA 3A4UA 1RMU3 3GZTB 2BNOA 1OC1A 2YB7A 2V09A 3H8UA 1VB4A 4IGOA 4LIVA 4NRMA 4Q4W2 4R4ZA 1RMU1 1FI2A 5F3IA 3MZHA 3TEYA 4B1LA 1GU3A 3RQ0A 4MZUA 1PO11 2A1XA 2BVBA 2WWUA 4OHVA 1YI7A 5DDJ3 2VOVA 3OG2A 4RGAA 1JBCA 1QGLA 3H1WA 4FOQA 1X8EA 4M01A 4RGKA 1ASJ3 1W6PA 3VB9A 2P37A 3JXSA 4MUVA 1O5UA 1ASJ1 2YUEA 2GC3A 2YXSA 3C7OA 2B46X 5EQUA 3VBHC 5FY9A 5JMOA 2PAEA 1KDKA 3AXEA 2IXJA 2GALA 3UNPA 4XJ9A 4OI0A 2ADDA 1PIV1 3GZEA 4NAOA 2RS32 2RDRA 2OIIA 1HRI2 4L0PA 1VRH2 1X50A 2C24A 2VZ1A 2GNBA 3ME2A 3O1RA 1GMMA 1XU1A 1ZBE3 1AR81 3HEIA 3GCXA 2WS93 1SBFA 1ZBE1 3W21A 1TE1B 2YFUA 3B94A 3HBKA 3WNLA 3AP7A 3NSTA 3O14A 3AP9A 2D6PA 1XBFA 1QJU3 4YG6A 4CU8A 1R081 4COYA 4S2HA 3RS6A 2R49A 2CU5A 1JI6A 3UKVA 2X09A 3U10A 5JOWA 2Y6JA 4P5HA 4JDNA 4G9SB 1EV11 4ZU7A 4EN8B 1FV2A 3K3NA 5TSWA 1MEC3 2C6SA 2VUDA 2JDKA 5GZEA 4Q4Y3 1VLNA 5LY2A 1RIRA 3TNPB 2Z2SB 3P1IA 4Q4Y1 4XETA 2OX0A 3WDXA 2JDNA 1LOGA 1PO21 1DQ2A 2VOKA 4L97A 4COZA 1U5XA 1HB4A 3B5LB 4B7EA 1QJEA 2OQ7A 4QM8A 1CAUA 3BTAA 4EWEA 5F3CA 2G4IA 5H9QA 1OA4A 4XPVA 2WN3A 2DUQA 3MEPA 5FIXA 4N7IA 3BU0A 2RE9A 3H3LA 4P08A 2PAKA 3FFQA 1OQEA 1JTZX 4NVPA 3MIEA 3OPZA 3ZYFA 1UX7A 3AJZA 2Y0OA 3BI3A 4Q4X2 1H1IA 1VMHA 2JG8C 4OZXA 2E33A 2JX9A 4QQPA 1AJKA 4COVA 5FXVA 4A6OA 2RMU2 2DURA 5F32A 4XDOA 4DINB 4FAHA 4PBPA 5CFDB 3POIA 3IDBB 5FYSA 1VBB3 2KR2A 4YW7A 3EYPA 2RG4A 1W03A 1WCDJ 1VBC2 2ZEZA 4FXGB 4GWJA 4KBBA 3SEPA 1AYN3 1TMF1 4XFHA 5FO9B 1H2LA 1YQ8A 3WHUA 4BB3A 3BALA 3I2KA 4J6GA 3OOXA 2ZGOA 4EN9B 2DFCA 1C1LA 5A3OA 3IWZA 4LHNA 4EJRA 1YXWA 4QX2A 2VECA 3BODA 2JG8A 1W9WA 4YFWA 1AYM3 1N3OA 4Z92B 3TAYA 2XGXA 5BXXA 3ZXDA 2QDNA 2UY9A 2GN3A 1Y9MA 2G19A 4Q1PA 2HWD3 5JUVA 4OI2A 5JAXA 3LE0A 2H0VA 1FOD3 4KG0A 2HWD1 3SEEA 2ZGQA 1G86A 3I4IA 4P9XA 5IATA 3NV4A 2W1WA 4Q4V3 2PHUA 4AOCA 1CPMA 3WW1A 1WZXA 4Q4V1 3VBUA 5CISA 2A6XA 4IV1B 2J1VA 2BPA2 2GC2A 1D2QA 1NXD1 2FDJA 4NMIA 5C33A 5C8WA 4NN0A 2X10A 1C28A 1TG7A 4ES9A 4HVQA 2GC0A 1DHKB 3OUHA 1OFNA 2C0ZA 1RUI2 5FZ4A 3CEWA 4GB32 5APAA 2KA3A 1UL9A 4OVEA 2UWCA 5FUPA 4MSVA 3LFIA 2PFWA 3H50A 4GWIA 4CP0A 1COV2 2JD9A 5GALA 4D7TA 4G4FA 1GBGA 3O1OA 1S0FA 4HSJA 3AKQA 2DVAA 4JQRA 1YI9A 5JLVA 2DVGA 5CFDC 2WO3A 1MQTB 3HQUA 4MYEA 3ES4A 3FUQA 2XXZA 4MGTA 4GWMA 1E5RA 4W6XA 5LEJA 1PGL2 2G9FA 2W9XA 3M3OA 3DXUA 3MIFA 3H0OA 4FP2A 1LOFC 4CA9A 4RFRB 3RYPA 4CXYA 2R0FA 5C5UA 1WLWA 5JXGA 1UU4A 3ATGA 3OD4A 3P5BA 1UY4A 2ZGKA 1PX3A 2AUYA 2R073 2XKOA 3N7KA 4P5YA 3FBYA 4P9GA 1BKZA 3WW2A 4IUGA 1ZZ6A 2RR13 1YIPA 2Q1ZB 3ZR5A 1V6KA 4FFIA 1V00A 1POV0 1H4GA 1SFNA 2DDUA 1REEA 5AC92 2BJSA 4LBNA 4DUXA 5DABA 3VL9A 3E6DA 3EJKA 3LOIA 1W6NB 1AXZA 4QB6A 4YVWB 5CFDA 3FX3A 3OJBA 4QKBA 3KCYA 5JIAA 2YBPA 3GJBA 2B9VA 4LMFA 5FLHA 1RUE1 2ORZA 3AMQA 3WP4A 4QQHA 4Q4W3 4LHSA 4Q4W1 1LOFA 1F5FA 5I8SA 5DUXA 1VALA 1MS0A 3NVCA 4PIYA 4OHXA 3RZLA 2J1RA 4IV1C 2QQOA 2VVEA 4MADA 2E9QA 1OI6A 3BB6A 3ES1A 4QPWA 2A6YA 5LATA 4E2QA 4F83A 1ZM1A 4QGNA 3WQ7A 3JQXA 3HVDA 2PA7A 1YWKA 4PI0A 2XJSA 3T0AA 2ZEXA 1R64A 3WNOA 4Q1RA 2YGLA 1WUVA 4UW3A 3TEXA 3ZXAC 3BGAA 3PTRB 1LESA 3AKTA 3WR0A 4YGBA 2G9GA 4A6SA 1JODA 2GC1A 1V9U3 2ARXA 2Y38A 3OGGA 2B39A 4K1ZA 1VRH3 1V70A 2RS31 1MQTC 3NL1A 1HRI1 4AL9A 1VRH1 3OEAA 2ZGTA 1OH3A 1OPMA 4IV1A 3ZKYA 1W8FA 4MOAA 5IVYA 5L36A 1OF3A 2GH2A 2VNOA 5DAVA 2K2SA 1GP4A 3WF3A 1NZCA 2ZGRA 3V0BA 3T09A 3CMGA 4DOUA 5FKBA 1UAIA 4BA6A 4FOVA 2RS12 4DEVA 1IQAA 2HEVF 2VTFA 1S0CA 2VZTA 3IAQA 3MF6A 2AEYA 2WRAA 4Y3OA 3WUCA 5A6XA 3BYWA 4A7YA 2YY1A 2VCCA 1ULOA 5FK7A 3H7YA 1H2MA 3ZYIB 1WCSA 1J1LA 4MVTA 5DUWA 5FP8A 3W58A 2V73A 3WUDA 5FLJA 3IMMA 3RYKA 2VNGA 3BIWE 4DZGA 1HXS2 5CZKA 2WL1A 4CEWA 3NV3A 1XNKA 3ZDVA 1UY3A 2PHRA 2YC2A 3DPRB 5I8TA 4IL7A 3O1UA 1UQXA 3Q9OA 1ZVFA 3S7EA 4FPCA 1OQDA 4K8FA 3FZ3A 4IESA 1QDOA 4HANA 2D5FA 4YM2A 4AVCA 1ZZ9A 3OYWA 2GNTA 5A1AA 5BY5A 1IS6A 1O6UA 2FD8A 4Q4X3 2QTWB 4Q27A 5C8CC 3TN93 3CQOA 3N9LA 4Q4X1 1HQLA 2RMU3 1DQ4A 2JIGA 1WCKA 2RMU1 3UGFA 3LEMA 4XFFA 4WVMB 3LDRA 3WNPA 1W6NA 1VBC3 5EHDA 3O7OA 1ZRRA 4Q8KA 2O8OA 4BM8A 3KQRA 2XMLA 1BBT3 1CIYA 2FZ2A 2VZ3A 2JG9B 1QXJA 2Y0IA 3AC0A 1JZ2A 3ZYPA 3OUIA 2ARAA 5T55A 2RJKA 2QZ3A 1BVP1 4WM8B 2W1QA 3T1MA 4XZUG 2DUOA 2WDBA 4CSWA 1HIXA 4XF4A 4IXLA 3I49A 5FZKA 2IXLA 2J1AA 2L9LA 5C8CA 1H4HA 2FDFA 2PN5A 3KV5A 1ZRCA 2HWB2 5AVAA 3ZR6A 5IK4A 3IZOA 3MBWA 3PMEA 4IE6A 3ON7A 4Y1XA 2X53S 3VL8A 2W91A 2FMYA 3I2IA 3M1HA 2FDGA 4P02B 3FBMA 4CCNA 1XB9A 2BW8A 1R1A2 5CYYA 1I1EA 2HWF2 2VMIA 3R4SA 2VBBA 2R042 4MGQA 2XJQA 1IQDC 3AP6A 2LALA 2PHWA 3LZZA 4COUA 4EQVA 4OUMA 5GZDA 3T1LA 4BXSV 4NE9A 1GZCA 2QFEA 2DU1A 3VKMA 3HPNA 1ULDA 4GIQA 3I2GA 1RUI3 1QKQA 3IMNA 3ZOIA 3DPRC 4GB33 3THCA 2ENRA 1RUI1 1GZTA 4AI3A 3BPSA 1COV3 1UZ0A 2IWGB 5IW0A 3UKTA 1HB1A 4CP2A 1LULA 1COV1 1H30A 4IGPA 2JXAA 5JPMB 4AAXA 4QM9A 3WCSA 3AZYA 3ZXGA 4C0HA 1O3QA 3MIDA 3M3CA 3MUY1 1FT9A 1OD3A 4PQ9A 4E2SA 1NCRB 4BE3A 1EY2A 2ZACA 3MW4A 1DGRA 2Y64A 3I2DA 4UI9L 1GICA 2BP6A 2VR4A 4RR3A 3UETA 1PGL1 2XH6A 1MS4A 2BVVA 4OUSA 3LSEA 1UYZA 1AX0A 4L9BA 3T2TA 3FE5A 2JG9C 5CIRA 5IVJA 3HD8B 4XBQA 3CBNA 3DPRA 1RUNA 1BK1A 5KWRA 3LSDA 5D8AB 4JHZA 1VPHA 4LT5A 3ETQA 4WM8C 1H1AA 3TEZA 1FATA 4IEZA 1K42A 2B45X 1ONAA 3POJA 2WZPP 4OQ9A 3AMNA 1AR62 3W5MA 5AC91 2I07B 1KD7A 2GDFA 2PTMA 4NHLA 5LBEA 3WF2A 4FCAA 5DXDA 1KS5A 2W94A 3RJRA 2GP3A 2ZAHA 4WVMA 2YFZA 5DG2A 4E4ZA 2ZMKA 4AFCA 2FQPA 4XOGA 3M7AA 1YFWA 5FY0A 1PM7A 3WQ1A 4E4DX 3HIFA 3VKLA 3THDA 2AR6A 1XNAA 2YBKA 2XQRA 2JG9A 2LROA 1HRV3 5J36A 5FZDA 4B7KA 2NP0A 1AUYA 5ACA3 2CHHA 1CONA 4BU2A 1F4AA 1WA4A 1L3JA 5F3GA 3S57A 1JHJA 3WSOA 1UYXA 1RUOA 1NT0A 3VZMA 3S5AA 2CYFA 1UWWA 4BCUA 2A5ZA 1W2UA 2A3XA 3HOBA 5F5CA 4AVTA 1ULFA 4QHZA 4SLIA 1FYUA 4XW3A 2WT0A 4QGLA 4YM0A 2XBO1 3WP3A 2RVAA 4MHUA 1LKNA 2LM3A 3O1VA 5DAWA 5A3NA 5FZ7A 1W6MB 3AP4A 1NCRC 1UF2C 3HMYA 3VBRB 1N1YA 5SV8A 1JYCA 2QKDA 1SCSA 3NKGA 3L9JT 2JDUA 3USSA 1MS3A 1PK6A 4A4AA 1IGOA 1J3PA 4BQ4A 3GCWA 5A80A 2O1QA 4YRDA 1WLCA 1R092 5IHRA 3AZWA 1KJRA 4CUGA 2XWJB 1CZVA 4QGMA 5D8AC 2RS13 3VHOA 4A3XA 2A7AA 4LBOA 2LRPA 4M3CB 4JZRA 2RS11 4LK7A 1H0BA 4IE5A 2ZKLA 2VXRA 4K8RB 1DG6A 4RGGA 1H6YA 2VZVA 2Q8OA 1YNAA 5GM0A 3AZVA 3A7QA 2UYBA 1LB2A 4RD7A 4WM7B 1W9YA 4QX7A 4A44A 4C8DA 2WNOA 1NCRA 4Y1UA 4AGVA 1DLLA 5B2GB 1EV12 1HXS3 1B09A 2P3KA 4OLLA 4UWDA 4XJUA 4ZY9A 4LKDA 4WZFA 4CDXB 1HXS1 1YQ2A 2ARCA 2CDPA 3APBA 3K77A 4M4PA 4R9BA 5DPNA 3V65A 3H8OA 5JCTA 1KJLA 1JUIA 3OBAA 2Z5WA 5SV5A 5FPXA 4NHYA 1W2AX 1QMJA 5D8AA 3TEWA 3PJYA 3ILRA 4OHYA 2GN7A 3C2UA 3LWCA 4ISRA 3NQHA 4BQ1A 4J1XA 1OHFA 2OKXA 4K20A 1IPSA 1OKQA 1SZBA 2DCYA 2W47A 3PVOA 4IEXA 4JC1A 1VBA2 4QQLA 4A41A 3FHIB 3CJXA 2D3RA 5CKMA 1U5ZA 3ALQA 3HR9A 4QXHA 3SKJE 4HKWA 1BYHA 2VM9A 3AM2A 5A7PA 3WQ0A 2QNKA 1V6OA 2VNVA 2W87A 4YARA 4AGRA 5AFEA 1I9RA 1PM4A 2D7FA 3OGJA 4XTPA 3AMPA 3N9NA 1S0JA 1PNFA 3A23A 4LE3A 5FZMA 3ST7A 3ZDSA 3VBRC 1QU0A 2VBPA 3MGUA 4GKXA 2DVBA 2PYTA 1FMD3 2QUOA 1DQ6A 2DBNA 1NQDA 2RS52 1WCUA 1UU6A 2XJRA 3KMHA 4URTA 5F2WA 5I0TA 2ES3A 2H6CA 5A7WB 1TME2 2BGCA 4UFKA 1D7PM 4HZFA 4UT5A 2JB4A 2WQ8A 3VBFB 1W8ZA 1BEV2 1ACCA 2HWB3 1ENXA 5IYYA 3T2OA 2D43A 4BIFA 2HWB1 4LO8A 1IS4A 1JOPA 1NKGA 4MHRA 5FREA 5HCHA 3E1F1 3FUOA 4U2AA 1JXNA 4Q2FA 5KHKA 1UMIA 2HKXA 2HWF3 3AKSA 4LBJA 1DQ1A 4WV8A 5T5JA 3WG3A 1H1MA 1R1A1 5C71A 2HWF1 5C3QA 5C9AB 4WM7C 2R041 2X8KA 2AGSA 2FMDA 2ZS6B 1QF3A 3I8TA 4ARYA 2D93A 1Y7BA 1J1TA 4WVZA 2CWMA 1AL0G 5ANQA 4AI0A 4ASLA 4C91A 5C5TA 4HKOA 2JDYA 2P2KA 1LOBA 1WW7A 4CDXC 1KITA 1EYBA 2D44A 2XVGA 3JCIA 3RFRA 2VO5A 2J42A 1AR72 5KXEA 2WNUA 4QT6A 3AL5A 5D1IA 1H2NA 1EPWA 2WLQA 4FOYA 3PMSA 1SHWB 2FCTA 4H14A 5H9SA 5FJKA 3PURA 1UOBA 4JAAA 4MLOA 1DQ5A 1Q8OA 2F17A 3RRDA 2GSYA 5KC5A 3BKZA 3NJVA 4HPKB 1C5IA 3MPBA 4HLTA 4ZPIA 1AXKA 4K3UA 3BUCA 4N53C 4AR2A 5JZGB 2ZXQA 2O0OA 3S6PA 4BLIA 5L7OB 2P3YA 3AZZA 3VHRA 4DXRA 3LOBA 2P6CA 4WM7A 3V56A 1YO8A 1W6QB 5EJZB 5A6ZA 4GD4A 4DY5A 2QQLA 2YROA 3GXUA 4NRQA 4AQSA 2QQVA 3KGLA 1YQ6A 3SCFA 3AKRA 4RA0A 1DZQA 2I45A 3NNMA 3PDQA 1LGCA 1CVNA 2Y6HA 1Q8SA 1DF0A 4AHWA 1UMHA 4DXZA 3WF1A 1S1AA 3WDVA 5A33B 5F1RA 2NN8A 2B9UA 4JGYB 2VMDA 3CO2A 4CCOA 1LR5A 1NX9A 1PGW2 5E6HA 4XUQA 3PUSA 5BUVA 3WINE 1AR63 1EUUA 4NIAA 2CSGA 4H7MA 1US2A 5GLUA 4E2GA 5ERLA 1QEXA 3BCWA 1AR61 4YNIA 4N53A 5DQ0A 3VBFC 1LAJA 1CX1A 1HJGA 4B29A 2Q30A 3CJIB 3CLPA 1KFXL 4IV3B 2Z42A 2FDHA 1VP6A 4W8JA 4Z82A 4I09A 1ZA4A 4LO5B 2WSVA 3KT7A 1O8PA 1OF4A 3FHQA 4FI9A 5C9AC 2QQWA 3V64A 1Z7S2 5J96B 3WNKA 3T4HB 5M0TA 2P1BA 1W39A 4YVSC 1JZ3A 5DAQA 2BOIA 3UV9A 4IE4A 2B4KA 5A70A 3M3EA 3OPTA 3U14A 1PO13 2DUPA 2IXHA 5A7WA 4MGKE 4EZ4A 2XJVA 4M00A 4E8DA 3VBFA 4F7ZA 1EUTA 2Z4FA 5DAXA 2ADEA 2GMMA 1D4VB 5IK8A 3PL0A 1ALYA 4I0BA 3KSCA 2P3JA 1G9AA 2R062 4QX5A 5F5QA 3RZHA 1HQWA 5JZGC 3I59B 5L7OC 2YC0A 1XC6A 4XABA 4YW4A 4COWA 3RZJA 2JDAA 3OCPA 4W65A 1W8NA 2HBTA 4Y4RA 4ASMB 2P34A 1W8OA 1PIV3 4XDQA 2TBVA 2C5DA 5JOYA 2WAAA 4P00B 4YVSA 4AI2A 4EN6B 1J83A 3IIAA 3B9IA 3PUHA 1R093 1JS9A 1HN0A 4CUBA 3VZLA 1W2TA 3WG4A 4AZZA 1AR83 4X8PA 1QJX2 1R091 2HWC2 3MW3A 3NJZA 3IDAA 5HCFA 2BFUL 4IQPA 2VZQA 1TEIA 4QHOA 4Q8LA 2DV9A 4Z2WA 3TOJA 3WF0A 1BJQA 2I74A 4JGYC 4LJHA 4XFBA 1GSLA 5CB7A 4X6RB 4ZKTB 1R083 1XYOA 2LTNA 4Z1VA 1PZ9A 3TBDA 4HPKA 1JUHA 4AI1A 3ELNA 3B3QE 5FYHA 5JZGA 4QKNA 5LCWL 5L7OA 1OUSA 2EA7A 1GQHA 2WZEA 1EV13 3GBFA 1W3XA 2UU8A 3QD6A 4BISA 3VBHA 4IV3C 4Q0QA 4BZ4A 1JN2P 1EPZA 4FPKA 4XBNA 2OZJA 4CZSA 1HV1A 2EIEA 3INAA 3KF5A 3WVJA 4GWNA 3CZUA 2VAUA 3AVRA 1PO23 3H1MA 5IAVA 3HN3A 2BGOA 4YW6A 5I0SA 1G9FA 2FDIA 4JRLA 4FPHA 3MI8A 1S0IA 2YPDA 4HG6B 1Y43B 5A6YA 5FMOL 4DIQA 3J7HA 3PU8A 2A70A 4PI2A 3LPFA 2JENA 4AGGA 2A73B 5A33A 4JGYA 4I3GA 5H9RA 1VBA3 1XE8A 3LKJA 3OEBA 2EXIA 4NOTA 4QWNA 1VBA1 4XQWA 2E7AA 2A6WA 2F4PA 3CZJA 4JDOA 1SEFA 4Y5SA 4JQTA 5AVPA 3U0ZA 1YEWA 2CY6A 2B8MA 4GMP0 4MX3A 4XJAA 1JYNA 4QQOA 3HN1A 5DZGA 1LOAA 1VBD2 2AC1A 5ISLA 2DWRA 3U4SA 3ZPOA 3KCCA 4D6QA 2JJ6A 3W5NA 3ZXLA 4AF9A 1XYNA 3UGHA 3I2JA 3DECA 1TMF3 4R9CA 3ZIWA 4OQ8A 2W0XA 5A3UA 2RS51 3ZSKA 1GWKA 2ZCWA 1RHI2 4EN7B 1AJOA 2VMHA 1TME1 4N90A 4PF5A 1D4M2 4JKKA 1BEV3 3EB7A 2WBKA 4Y5Z0 1BEV1 4C1WA 1F4HA 2V5YA 2VC9A 4PIXA 5HCBA 5GLZA 5JPNB 5LK7B 4L92A 4LTAA 1KEXA 1F15A 1CAXB 4JCKA 4ZU4A 3AFGA 1TQ5A 1RUH2 1JHNA 3C7GA 5F5IA 3NWKA 4LKEA 1KXGA 4QMAA 2CTVA 1FAYA 1L7QA 2HEYF 3I59A 2VCAA 5C6CA 3CHXA 4K6BA 4KWJA 2FCVA 1YLLA 4D69A 2XJTA 1QH7A 2MPFA 2WAOA 4ZXKA 4QDRA 2BBVA 2VZRA 1AR73 5JDBA 1HV0A 3DF0A 5FV3A 2VMGA 5J48A 3I3MA 1L7LA 4AG4A 1AR71 3ILNA 5F3EA 4FPYA 2JKBA 4GAZA 3GNEA 4P14A 3UK9A 3O1MA 2DBIA 1T6BX 2JDMA 1CAVB 2VMFA 3MF9A 3ITQA 4FPLA 1UOGA 4XIKA 1HQNA 1OLRA 1ZYBA 4O7XA 3WX5A 3OSDA 3UJOA 1I3HA 3IDCB 2IVJA 4NPLA 1JYTA 1GFF2 1U0AA 2ZGMA 1X8MA 1XNCA 2C9KA 1C4RA 4Q0PA 3ZFGB 3HNMA 3NV1A 1JMUB 5BNOB 1LTEA 2GP5A 1LHVA 4KU8A 4R8HA 5FWEA 5J7MA 3GHMA 4HBNA 4LLOA 4Y24A 4Y33A 2E63A 4HN0A 3AK0A 3KVBA 2ZGUA 1GP6A 3FL7A 3POYA 4FTSA 1CAWB 3RDIA 3KF3A 1VMJA 5HXMA 3ACFA 2Q8EA 4ZS3A 1S2KA 4RQPB 4CE8A 5GJ6A 4OI4A 4NIIA 2A3WA 2VQUA 2QZ2A 2W95A 1H8TB 4PDWB 2XQXA 1PGW1 2RDNA 2XDVA 4LQRA 2DCKA 5FYUA 2HH9A 1UMZA 4LE4A 1OURA 4XJ8A 3EBRA 1NCQB 5FBZA 2ZJCA 1WMDA 1SLIA 1QXPA 1JZ8A 5LW9A 1CR7A 2P5BA 2Z79A 5FXZA 1UZZA 1J3RA 4N7UA 3U1XA 1UU5A 5FAXA 3AYCA 1W9FA 5FK8A 1SLBA 1RUE3 2PXJA 3DYPA 1K5JA 3MW2A 1RXFA 1AZDA 1C5HA 2AENA 2MEV2 2UYAA 1Z7S1 3UESA 3RMXA 3FLPA 2BTVC 4LO4B 4PLMA 1LGBA 3C3VA 3LDKA 2F4LA 2QQNA 2VZUA 1H9PA 1QQP2 3O0VA 1UZVA 3JZVA 5FZAA 1MZ6A 3GYDA 3RZGA 3GZAA 3PHMA 5DAPA 2QQPA 2YGMA 2GMPA 4QXCA 2ZPXA 4XMIA 5H9PA 5EFUA 4C0BA 1LEDA 5FZBA 3POBA 5IFTA 2XOMA 1Q8VA 4AFDA 2EALA 4GULA 4XUPA 4TZDA 1MS1A 2R063 1TNRA 4N8MA 1YIFA 4HETA 4XHBA 4MG2A 2C4XA 2R061 4IW3A 1CAXA 1NUKA 3ZFGC 5I0DA 2BQPA 3OTFA 2VD7A 2XBO2 2Q0AA 4BIOA 1G9BA 3G6JB 3EQEA 3HQXA 1O7FA 5BNOC 3EHKA 2P6HA 4JKLA 4CUCA 1JZ7A 5A7QA 3GHNA 4GA9A 2RS33 4Q0VA 5LA1A 3PNAA 2DF7A 1HRI3 4KGQA 3IIIA 1OLMA 5CNAA 1POQA 5IWFA 5E16A 1ZNPA 2PHDA 1QJX3 2HWC3 3ZO0B 2FDKA 1UY2A 1N3PA 2X5IB 4QPGB 3U78A 2Y6LA 1QJX1 1F35A 2HWC1 4XZPA 3E6CC 1CX4A 4Q5OA 5DZEA 4RQPC 5FYCA 3S5QA 3T08A 5KHIA 3ACGA 3BTXA 4ORFA 1CAVA 3FMGA 2WWJA 1H8TC 2E26A 4PDWC 5C3PA 1DGLA 1WWYA 5A1LA 5LBCA 4UOJA 5F5AA 1E57A 1NCQC 4B4PA 1BZWA 1WMEA 1LJ7A 3SITA 4EN0A 1DFQA 3MLLA 3ZFGA 1ENQA 2CNAA 3PUAA 4Y20B 4K1YA 3KZ4C 2ZX1A 3NNLA 4M0NA 5BNOA 3AP5A 2PHTA 4FPFA 2ILMA 4OI1A 3VDCA 2P4EA 4UFHA 1REDA 1O3RA 4QPIB 2BDRA 2CGNA 4YVWC 4INDA 3UJQA 1MQTA 1LU2A 2VPVA 4UAPA 3UGGA 2V5DA 4YGEA 5IUQA 4AQ2A 3WCRA 3MIGA 3CU7A 3SISA 1VBE2 3E5QA 5EYXA 3ORJA 5DZFA 4OHZA 1L7RA 1SPPB 1ND2B 4LUMA 3ZM8A 3WNMA 1H8TA 5C70A 1US3A 3LEIA 4PDWA 4LBMA 1KFUL 2R32A 5GLWA 1YJKA 3BTZA 5A7SA 2R0HA 1XU2A 4NPMA 3WEZA 4IERA 4UFMA 1NCQA 4CU9A 4E8CA 3IB3A 1WGPA 2IUWA 3BOWA 2ETEA 1CJDA 3M8LA 1VBD3 4PLOA 4HK8A 3VBOB 5BV6A 1X9TA 4Y4YA 1VBD1 2WYFA 1OMIA 2OT7A 4XCBA 5T5PA 5K9YA 1S2BA 4YVWA 2QVSB 4BMBA 4LITA 1RUF2 4FPEA 4L11A 2JWPA 1DP0A 4BK5A 3K75B 1HDKA 2D6KA 3A21A 3T2PA 1RHI3 3R4DB 2Y8KA 5FRAA 1RHI1 4RSUA 1D4M3 2C9AA 2VG9A 2VQAA 4AI9A 1CPNA 1D4M1 1SLCA 2X5IC 4QPGC 1QWRA 4HVOA 3WOGA 1HB3A 4LA3A 2DYCA 4CEYB 2ID4A 2A6ZA 2D40A 2XHKA 1GLHA 2JICA 3U37A 1LECA 1RUC2 2YPJA 2X05A 3VD3A 5IVCA 5GKAC 3PU3A 2E53A 3MDPA 2BRTA 2VBDA 3MV11 1O5LA 1RUH3 2XJUA 3FHAA 2ZGNA 1RUH1 4PF1A 3PTYA 3HWJA 5FP9A 4GJZA 2BNMA 1VAVA 1ND3B 2VVDA 5FZFA 2JE9A 4IDZA 3ZIXA 5I0UA 4QPYA 3SXWA 4ATFA 2OS2A 1VAKA 2OYZA 3WQBA 5C4WB 4YZ4A 2ZKNA 5EWSA 5J3UA 5FWJA 1PHMA 4QPIC 1HW5A 1X82A 3S7IA 3VZKA 4QPGA 3W20A 5FYBA 3VKFC 2CV6A 4YFZA 2ZGPA 1W05A 2XL9A 5C3RA 2DU0A 2GNMA 2Y6FA 4NWWA 1GWMA 1ND2C 2N7GA 2ZX4A 5EJ1B 3ZMOA 1DQ0A 4ITCA 1DDLA 4CDUB 3MIHA 1XJAA 3H8RA 4FAGA 3JQWA 1IOAA 4XAEA 3Q8FA 3F2ZA 2B5HA 2D98A 2XL7A 3FFZA 5FXXA 3JUUA 2VY0A 2RM22 3LA7A 4NJ4A 3VBOC 1Y4WA 2VW2A 1OT5A 1G6NA 4H2AA 4I0AA 2QCSB 2A3YA 2ZX0A 4QPIA 1QJY2 3O1TA 1GANA 4QXKA 1Q5OA 2PHLA 2VVFA 4XJWA 1RL3A 2QJVA 1OXCA 4QX1A 3AB0A 4B4RA 2E31A 2Z69A 4CCJA 1POV1 2W1UA 2WINB 5CBLA 4XFIA 5LA0A 2JB8A 3J4UH 3J8F2 2VUCA 4XEZA 1CZSA 3Q8CA 4CEYC 4KNCA 4SBVA 5F37A 1G7YA 2GAUA 1I6XA 4QX0A 3IBMA 1Y3TA 3SCGA 5AC93 4META 4M3CF 2JEMA 4NROA 1AX1A 1GOFA 1OVPA 3OY8B 1CJPA 3K2OA 3NAPB 1CGPA 1DYOA 5GZFA 2BOJA 5KHHA 4TYSA 1NOVA 3VBOA 4JTOA 3VUOA 2VOTA 2RHPA 1O4YA 5FYMA 1ND3C 2MEV1 1UPSA 3BVCA 2W46A 4JKMA 1P8JA 5FY4A 3OBRA 4YZ5A 5FYVA 1QQP3 1RC6A 2PMWB 5FYYA 2O14A 4YPJA 1QQP1 1RXGA 1YHFA 1BMV2 1YFXA 4A2UA 4EZHA 3O12A 2QDRA 3A0NA 3U11A 5KHJA 4HXCA 3AYDA 1YCIA 3MUZ1 4C90A 3WT3A 4WM8A 3VZJA 3Q8BA 2VUJA 3LCPA 2K46A 4DXSA 1V6MA 1GKBA 1YUDA 1OBNA 4XACA 1R1ZA 1A6CA 4F3JA 3RZKA 4CDUC 4YG3A 5KC6A 1W8TA 2ZOEB 2XBO3 4JVAA 4BLJA 2Q5TA 5JVVA 1K5MB 2W92A 1U12A 2W3JA 4KWKA 3RPQA 2RV9A 1JU4A 1J58A 1QOTA 1PX4A 4GZ9A 1HKDA 1JOJA 2WA4A 4RHV2 5EP9A 4YW3A 2VZPA 4CVUA 3KWVA 5J37A 2BERA 1UIKA 2YZ4A 4XQDA 4RYDA 1RUJ2 1A8MA 1V6NA 5IVFA 4AYUA 5EV7A 2VU9A 3O1SA 3E5UA 1MZEA 4XJZA 2CAUA 3N36A 4MH0E 1EP0A 5DDJ2 4K40A 3H8XA 4WZCA 5A1FA 1LHNA 5I91A 1Q43A 3J7LA 4XE9A 3ZXJA 2V4VA 1Y9QA 2VZOA 3S0MA 4CDUA 2XB6C 4LIUA 4XMAA 5T54A 4KBZA 3MO4A 1KQRA 2VXJA 1X36A 1YC61 5IVEA 4NHMA 1ULCA 4YWAA 4LBQD 2GMEA 4V1PA 3HNYM 2PAMA 1XE0A 3NAPC 5FZ1A 3KB5A 4CP1A 1N1TA 4OULA 1K45A 3FN9A 1SDWA 5C3OA 1B35B 2NZ9A 3OGVA 3LDBA 2R16A 5FQ0B 2H0BA 4CTEA 3HQRA 3R05A 4W50A 3BTYA 2HLEA 5JR7B 3WW4A 2A6VA 2RJLA 4Q0UA 5L73A 1VBE1 2WS92 1F5JA 3I3BA 5DN2A 5EXOA 5KR7A 4IEOA 2GH8A 3GALA 4B4QA 2K0GA 1QJU2 1TNFA 3ZN5A 4BQWA 2R6QA 4URAA 4TLFA 2VCBA 4CCMA 2WNVB 4CXWA 3H7JA 3KV9A 2XUMA 3JBG2 3OUJA 3POFA 5FZOB 5FZ8A 1RB8G 3VBSB 3NAPA 1PMHX 5GZGA 2OUJA 1FXZA 1RUF3 3VZNA 1XNBA 1K5MC 1UXXX 3AZXA 3N7MA 1RUD2 1RUF1 3J9SA 4FVVA 1OVSA 4ZS2A 4CCKA 4DMIA 3LIGA 1GQPA 2XVKA 3QBQA 4JGZB 2W1SA 1Q8PA 1W8WA 4AWDA 2JIJA 5KXDA 5IVVA 1DGRN 3KCXA 1OQ1A 2OPKA 1WLDA 1RUC3 1ZZ7A 1JYWA 4DUWA 3T4VA 5F2SA 5G05L 1RUC1 3BIEA 1OPOA 2VW1A 1H6XA 2R30A 2XVLA 2XLAA 4IETA 3N9QA 4XF0A 3MIBA 3SC7X 1W0NA 4CP9B 4AQ6A 1S0EA 5K0UB 3GM8A 1EAH2 2OQ6A 2W39A 4FPGA 4LO6B 3GF6A 4WVWA 1R1A3 3DGTA 1K5MA 1UN1A 1VBB2 2EIGA 4N9HA 4AEDB 3EXUA 3J7MA 2G1MA 2R043 5A3LA 4DY3A 3I2HA 2IZWA 5FPBA 2BWAA 5FY7A 2LUWA 1W6MA 5FP3A 1AYN2 1J84A 1B35C 3D0JA 1WKYA 4R9DA 3VBRA 2D6NA 2YG0A 2WO7A 4XF3A 1J3QA 4AFBA 4ATEA 3WHTA 4XUOA 4FFHA 5F6KA 4LXLA 4DNYA 4LKFA 4XQ4A 1NE4A 4JX0A 2IXKA 1BK0A 2ARBA 3AL6A 1UY0A 3AYAA 1GZWB 3S30A 1WD3A 1JZ5A 3CKHA 2PQSA 5A7NA 1Z0HA 4M3CA 4P9YA 3LPGA 4PBOA 3B9CA 2RM23 3ABZA 2UWBA 3H1YA 4W6WA 1IKPA 1JU3A 2WNVC 2AH2A 2RM21 1QH6A 2KD7A 4HSLA 5F9TA 3MHZA 1IS5A 2TUNA 5FO8B 1FOD2 5FZIA 4OFGA 2XUEA 4F8AA 3VD4A 3OGSA 3KLSA 4A7KA 1QJY3 3KS7A 1QNYA 1AX2A 1QJY1 1B35A 1D0GA 5HXVA 4NHXA 1ODMA 4P9IA 1S0BA 4PIZA 4CDXA 3PVEA 1H9WA 5FZ3A 1YYNA 3FLRA 4JGZC 1E5SA 2CGPA 3J8F3 1UD1A 1UW8A 4DRRA 3SH4A 5EYYA 3N4MA 4LHLA 1DCSA 3ACHA 2ET1A 3J8F1 4P9WA 3HAGA 4E4HA 2YV8A 4K7JA 1VR3A 2D3SA 2H6BA 1RJ8A 5DG1A 1W28A 3DUIA 4AQTA 4IEUA 5FZ0A 4TN7A 2ERFA 4HL0A 1PGSA 1ZZBA 4R9AA 2WNVA 1ODNA 1YQ5A 2R7EB 5K0UC 5FZOA 1DLCA 5GLTA 5HV0A 5JR2A 2WT2A 1LU1A 5EPAA 1URXA 2OA2A 2LW8A 4AEDC 3B69A 1XQNA 5HCAA 2WA3A 1XRUA 4YZ3A 3VHNA 3O0XA 4MXVA 4CU7A 4AW7A 1TZOA 1CQ9A 1SLAA 4PJYA 3SKVA 5K7PA 2VMCA 5FPLA 3WV6A 1BMV1 2WQ4A 4GQ7A 5LWBA 2DCZA 3WZ1A 4BK4A 3URFA 1LENA 4LNVA 2R072 1JZ4A 5T3NA 3HNBM 1C3HA 4Q29A 3L2YA 3H42B 2E7QA 3VV1A 1UKGA 2RR12 3AX4A 3LEKA 3WP5A 3LEGA 2JE7A 2WWSA 4FFFA 3UYJA 3NRUA 1C8M2 2K9ZA 4AVBA 4IE7A 2B42B 2X29A 4CDQB 4A7ZA 4NO4A 1IS3A 3U07A 3L2HA 2BEOA 1ULPA 3IT8A 3BPZA 5K0UA 5L9RA 1U5IA 2E51A 4PT6A 3WDTA 1JH5A 4ES8A 5KHGA 4RHV3 5DMYA 1DYPA 3QACA 4V2WA 1DIWA 4RN5A 2WN2A 4RHV1 1I5PA 3H3ZA 4MXWB 5C9AA 4YLZA 3WLUA 3LA3A 4D7SA 2J1SA 1RUJ3 1ZRIA 2ET7A 1M06G 4BWOA 1A34A 3R4UA 3Q8EA 1SCRA 1RUJ1 3NW4A 3AFKA 3NMBA 3VDDB 3ZFEB 3ZN6B 4XFGA 2JDZA 5LY1A 4OUEA 3VN4A 4ZONA 4XHXA 1W04A 4QU1A 2ATFA 5DDJ1 2JG8B 4YM3A 5JOXA 4DRVA 1HJFA 2Q4SA 2ZHNA 3P3PA 4O9EA 4QAWA 1SBDA 4FQZA 1GZWA 4GJYA 4JRAA 2J1UA 2R1DA 1C1FA 1KS4A 1OLQA 2ZGSA 3LB9A 2F6BA 4FBFA 4TXWA 2RDSA 2XJPA 1MVQA 1W2OA 1V9U2 3VBUB 4LHKA 1SG3A 3CJIC 4UFJA 3CL1A 2WLPA 5L19A 1W6QA 1M4WA 3D5OA 4GKYA 4A42A 5JSPA 3IAPA 5EZWA 1V6JA 4XYXA 4EYUA 5AFBA 2WS91 3LGRA 4MV2A 2DFBA 4D7YA 2WNEA 1ST8A 4OMCA 2EF6A 5FZLA 4ZXEA 4MGYE 4XBLA 4BYYA 1LOEA 4CDWB 1QJU1 3MPPG 3ZYBA 2BFUS 4UF0B 4YZ2A 1PVXA 3LF7A 4YSFA 4MGSA 5CADA 4XURA 1SQ4A 1NG0A 2P17A 2HEWF 3JBG3 1A3KA 3MICA 1IHMA 5FZHA 3JBG1 1DGWA 4DFSA 1N3QA 3WG1A 5LK5A 3PJQA 4CUAA 5FOJB 2AEZA 4CDQC 2UWAA 2C1FA 1MEC1 4YYOA 1RUD3 1IG3A 3SMHA 5A7OA 2DTYA 1W06A 3CJIA 4IV3A 4LBKA 1NLRA 3LQCA 1RUD1 3P3NA 3WW3A 5BYNA 2ZHKA 3FWEA 3U4XA 1WA6X 4MGIE 4DS0A 2QQJA 3I97A 4LEJA 2HBUA 1UYYA 5K8SA 1LODA 5JI7A 1V6IA 4XUTA 1YQCA 4YW5A 4CCCA 2RS53 3VLBB 1VE0A 4PQQA 1LHOA 2QE3A 3B02A 3BN6A 4I02A 4Y1ZA 4Z8BA 1TME3 5DUVA 3H3UA 5FYTA 1XOYA 5E8AA 5FZEA 3VDDC 3ZFEC 4ET7A 5LZ6A 2WT1A 3D4KA 2SBAA 1CESA 4Y22B 5FMOS 2D97A 3D8CA 2YYOA 4LBQB 3E5XA 1BXHA 3IM0A 3TN92 1W9SA 3UKNA 2TEPA 1UYPA 1EAH3 1GUIA 1NLSA 1EAH1 4OMDA 4CDQA 4QKDA 4KWLA 1ZREA 3POSA 4Q0SA 1KGYA 2CGOA 1VBB1 4J1WA 1BHGA 4UW6A 5T52A 1UZWA 4A45A 3VD7A 2VMEA 5JOZA 2IC1A 1BBT2 4QHBA 5DUUA 3VBUC 1AYN1 2RDQA 1WBFA 4MXWA 3VD9A 2Y33A 1DZTA 3KGZA 5JI9A 1AR92 1CIWA 1HN1A 3KD4A 3M2MA 2DTWA 3VDDA 4FPJA 3ZN6A 3ZFEA 1OA3A 5A32B 3ZN4A 4O61A 4ZZ5A 3ZYJB 1PMIA 3KVAA 1LRHA 3ZX7A 1HB2A 1OSGA 1W8HA 3QCWA 1CD3G 4N43B 1O4ZA 4IEPA 3IN9A 1RUG2 2JDHA 5E89A 4UBGA 3VHPA 1WCQA 4CDWC 5IK5A 1Y9GA 5JMCA 1AYM1 4OYUA 3KT1A 2WO2A 3GGLA 5FMBA 2FZ1A 3PVBB 4XXPA 5BPXA 2D5HA 1FOD1 1Q8QA 5LASA 2FCUA 5L9BA 3SNMA 2WIIB 4CCLA 5CG9A 5JXIA 3KHCA 5D21A 3O1PA 4FPOB 3TB0A 4AHXA 1DZRA 3KV6A 3RNSA 1QDCA 1YRZA 1RVF2 2KXLA 2NMNA 3ZVXA 3V0BB 1VRBA 3POGA 1JZ6A 1UXZA 5BNNB 4UBHA 2Q8DA 5EJ3A 2YU2A 1QIQA 1F8VA 2YC4A 4OCTA 4TLGA 2XWBB 1H8VA 4HFSA 3I3DA 4NRPA 3I3EA 4CDWA 4UF0A 4UW5A 1OA2A 3T0BA 2Y60A 3JB4C 2NPIA 1MR5A 1W0OA 4XILA 4XUNA 3PUIA 2ZA9A 5LRSA 2EAAA 5FKCA 3OBTA 3MFCA 4CEWB 4AVSA 2HYKA 4HN1A 5FZGA 2ZABA 3R0RA 5KXBA 1Z7S3 1LCLA 2WFPA 3AYEA 4AVVA 4HVRA 4FO9A 4NAMA 5T50A 1ZRDA 1NA1B 2IXCA 2E7TA 4RS5B 4Y5TA 5FCCA 5CFCB 3IKWA 3FLTA 1UZYA 1OH4A 3N7JA 3NJYA 4LOTA 2B7YA 3OYWB 2Q1FA 1OUXA 2WR9A 3UT0A 2R071 3JU9A 3WDYA 1ZBA2 3RYRA 1XE7A 2VQ0A 2RR11 4Y22A 3ECQA 4DO0A 1C8M3 5F7UA 2W5FA 4LBQA 5GLVA 4N43C 4YGCA 1C8M1 2CL2A 2PHFA 4FOWA 2W68A 1F2NA 1HX6A 1PZ7A 4CCEA 1W0PA 5A3TA 2XR4A 3PLQA 1IPJA 3ZYHA 5EIYB 5FZCA 1SMVA 2EXKA 3IPVB 1NZIA 1PNGA 1A8DA 2YBSA 4LK6A 2D6LX 3NO8A 2GZWA 1XSRA 3O0WA 5F6LB 1K12A 3DCQA 5FY8A 2LS6A 5I93A 2BU9A 3N7LA 1WW5A 1HRV2 1QJZA 2WFF2 5K4LA 4AK3A 2R1BA 5ACA2 5FTTC 1W9TA 2QQKA 2AZ5A 5FLIA 5C8CB 2XG3A 5A32A 3B00A 1UNBA 2YMZA 4H55A 3FJSA 5BNNC 2O8QA 3EO6A 4LORA 4PLNA 4N43A 4XFAA 1XPWA 4AFMA 4D6RA 3NNJA 2AYHA 4BDVB 5BNQA 3JD72 3ZYRA 5KXCA 1S4CA 4D94A 1LEMA 1XYPA 2EAKA 4YW1A 2J1EA 1W2NA 1ZA7A 1BQPA 2EICA 3LIHA 1V9U1 3MLJA 1SLLA 2WKKA 2ZMNA 1O4TA 4KQ7A 5C7GA 4CPBD 2XHNA 4CEWC 4HONA 1MVEA 4L99A 4LULA 3WD5A 4GALA 4CXXA 4BMEA 4DB5A 3HBZA 2NM1A 3AMHA 2VCMA 4H7LA 4K9SA 4YM1A 1PZ8A 3FC0A 5FMCA 4BQ2A 1CAWA 1PMJX 4UFIA 3PUQA 1NA1C 2WZ8A 4RS5C 5CFCC 2A71A 2RJ2A 4RQPA 3W59A 2IXIA 1OLME 4GMP3 5BNNA 4BOWA 4IEVA 1XSQA 4AXOA 3LFMA 2E32A 4GMP1 5I0RA 3T0DA 3AMMA 4XF9A 4EV0A 3RSJA 3D0SA 2GNDA 3THTA 5CAZA 1RYYA 1PVC2 4LOSA 4XCAA 1VJ2A 1J59A 1SLTA 2ZMLA 2JKXA 1STMA 3F95A 3IDEA 2CAVA 4RR3B 4UFLA 4WVVA 4X6QB 5IT6A 3K48A 3SCHA 5L9VA 4NHKA 2OW4A 1ZZ8A 4LPLA 1UX6A 5IVBA 4O65A 4M4RA 2VTXA 1RTVA 3WG2A 4ONUA 4AVAA 1VB2A 3SH5A 3DL3A 1SDDB 4XF1A 1NA1A 4RS5A 2ZEYA 5CFCA 1N47A 4FTEA 3CNAA 1QOOA 1GWLA 1FNYA 1HLCA 2PLV2 2UY8A 2WZR2 4FXKB 3C7EA 5HBAA 4NPRA 4TWTA 3A22A 4QKFA 5CG8A 1FPN2 4HT1T 5JSOA 2HWE2 1GYKA 4QXBA 2DCJA 2BUKA 3ROUA 3GBGA 2JDPA 2SLIA 3N9PA 3RMYA 3TN91 4BXFA 2Q1MA 3MFAA 2Y34A 3CF6E 1GOHA 5ABJB 2BGPA 2VGDA 3LD8A 1AF9A 4MO3M 4AEMA 1SFPA 3M3IA 3V0AB 4NIDA 3ZKUA 1O59A 5LB6A 1ZZCA 2VE1A 4JV4A 3ZXEA 1VBC1 1AVBA 1N1VA 3B7MA 3IPVA 2J1TA 3DKQA 4IEQA 4U36A 2D6MA 1KDMA 2VNRA 3NV2A 4AEKA 1BBT1 1GQGA 2CDOA 1U5YA 2P3IA 1AR93 4EWAA 1X33A 1S2EA 3OPWA 3B01A 3RI8A 1AR91 1Q56A 1FMD2 1APNA 3HT1A 1NY72 4PHZA 1K3IA 2X5IA 5D2AA 5FY1A 4P9JA 3N35A 1G8WA 1RUG3 2NYYA 1ULGA 4YW2A 5JXHA 2BWCA 3ZFFB 1N1SA 1RUG1 3OGRA 2ZHMA 5LEKA 3PVNA 3THPA 3JB8A 2OVUA 4GH4B 3KHBA 4JTNA 4KU7A 4NWVA 4OZOA 4AI8A 4QDQA 4BQYA 3D82A 4YG0A 5IK7A 3RZMA 1OKOA 2ZTNA 1V6LA 5LA2A 3VKOA 3SLIA 1LNSA 4Y20A 1PK6B 1S0GA 3ZSMA 4RR3C 4YZ1A 1GZ9A 2ZZQA 3I7DA 1QNWA 5T5OA 3HT2A 4S2DA 1IZ3A 1RVF3 4XIOA 3U75A 2NLRA 1ULEA 1RVF1 1REFA 4QB1A 1LHUA 2IVIB 4XTMA 1BCXA 1GV9A 1MACA 3E6BA 3P6BA 1UCXA 1Z78A 4GB31 3K46A 1POV3 1BVVA 1MS5A 2EIBA 2WSUA 3BU7A 4LR4A 5FPAA 5IJRA 3I2OA 4FSJA 3M4FA 1TVGA 4TTGA 5FBJA 4DPNA 2QQUA 3VDBA 5J09A 1SPPA 1WW4A 2BBAA 1ND2A 2DVDA 2HJIA 3VGIA 1RITA 3WP6A 4YGDA 3WXPA 2I2SA 4BJ0A 1DGWX 4N9IA 5CVRA 4AFAA 1ZX5A 1UIJA 1AL22 2AREA 2GU9A 3E97A 2W2IA 1YJLA 2Y6KA 3D6EA 3LAGA 1Q3EA 5J1XA 3RZZA 3M3QA 5ABJC 5KBFA 2W08A 1H2KA 3WDUA 3ZMNA 1W6OB 4KH9A 3WNXA 1QOSA 4QX8A 5G04L 2MEV3 4ISQA 2ZHLA 5I8YA 4BH9A 4UYBA 4Y1YA 4O9GA 4KL1A 2IFWA 5CKQA 5HPOA 1NAEA 3I3QA 5LRRA 3GDBA 2EXHA 4H3WA 5IAXA 1CWPA 1YFUA 4S2FA 4CYDA 4PCRA 2HYXA 3DN7A 1WMXA 3K4ZA 2KM2A 3K4AA 1ZBA3 5ANNA 5A6QA 1MS8A 5C4WC 1KRIA 4ASKA 1I5ZA 4DXTA 1ZBA1 3DKWA 3WY6A 4DEQA 2ZBJA 4CEYA 2XLFA 4UXAA 3ZSJA 3DYMA 1X7NA 1UOFA 2G9ZA 3DV8A 3J7NA 3KQ4B 4LO7A 3ZFFC 4EROA 1JW6A 4Y1VA 4HOOA 1JYIA 3OB8A 4G3YC 1S0DA 5ABJA 4GH4C 3V0AA 1ENSA 4XFCA 3RI9A 1GNZA 4EE2A 2BV4A 2OUHA 3C7FA 3CDZB 2MNGA 3ZPYA 2UURA 3AXDA 3QLQA 1OFSA 4QD2A 2Q8CA 3LA2A 3ZYGA 5FR3A 4R4XA 5IFPA 2Y26A 1NYWA 4ZU5A 5BNPB 2W52A 1NLQA 1NXMA 1ND3A 1ENRA 1UKRA 2WFF3 3QOPA 1PK6C 4NUBA 1D2SA 1QJFA 1HRV1 2IFRA 2WFF1 1RMU2 1WLTA 4I01A 4ARXA 5ACA1 4DQAA 1YFYA 3N9OA 5E88A 5C4WA 4CRQA 3UL2A 2VQTA 1NE6A 1PO12 4NIHA 4KGGA 3RWKX 4KWUA 4MGZE 2MHFA 4KI5M 4FFGA 5FYZA 2WJSA 1WW6A 3RVHA 1RINA 3I2FA 3JD73 1UY1A 3ZFFA 2E6VA 4IEYA 4BQXA 2NQYA 3JD71 5JWPA 5FZ6A 3MLKA 4GH4A 1CN1A 3N9MA 4JDMA 1ASJ2 2OZ6A 4W4ZA 5FUIA 2OXBA 3VZOA 4AEDA 3X29B 4Z2AA 5FY5A 4IE0A 3O5SA 4AEJA 4CU6A 2WC2A
chains in the Genus database with same CATH topology
5FY8A 3K3NA 5FZDA 5FPLA 5FZOB 5FZ8A 5K4LA 5LY2A 4BU2A 5FPUA 5LWBA 5F3GA 5F37A 2OX0A 4CCKA 5FPVA 2XMLA 3DXTA 4XDPA 3KV4A 5FP4A 2GP5A 5FWEA 5F5CA 3UYJA 4Y33A 2OQ7A 4D6RA 3K2OA 5ANQA 5F3CA 5IVVA 3KVBA 2YBPA 5FXWA 5FYMA 5A7SA 4CSWA 5F2SA 2Q8EA 5FZKA 3AL5A 4V2WA 5FYHA 5FZ7A 4D6SA 5A3NA 5FY4A 3KVAA 3N9QA 5FPAA 5FYVA 5A3WA 5FJKA 3PURA 5FYYA 3KV5A 4BISA 5FXVA 5FBJA 5F32A 4XDOA 2XDVA 4EZHA 2OT7A 4HONA 2OQ6A 5FYSA 5FYUA 3K3OA 5CEHA 3AVRA 5FJHA 5A80A 5LY1A 4CCNA 4LITA 4QU1A 2YPDA 2W2IA 3PUQA 4CUGA 5FPBA 5FY7A 5LW9A 2P5BA 3AVSA 4DIQA 3PU8A 5FP3A 5FXZA 5FZ9A 4CCLA 4GD4A 4AI9A 4GJYA 3PTRB 4IGQA 4QX8A 2PXJA 3KV6A 4QWNA 5F39A 5FYIA 5A3PA 1VRBA 4LXLA 5IVCA 3PDQA 4C8DA 4QX7A 4IGOA 4LIVA 3PU3A 5F3IA 3AL6A 2Q8DA 2YU2A 5IW0A 4CCOA 4ASKA 5E6HA 5A7NA 5FZAA 3PUSA 5ISLA 3U4SA 5IVBA 4IGPA 4UF0A 5FP9A 4GJZA 3ZPOA 5FP7A 2WWUA 5IVYA 5FZFA 4D6QA 4QXCA 5IVFA 4EYUA 5FZBA 2OS2A 4HOOA 5FZIA 2XUEA 5A1FA 5FZLA 5FWJA 4UF0B 4LIUA 2Q8CA 4QXBA 4Y3OA 5FZGA 5FYBA 2VD7A 5IVEA 5FY9A 5FZ3A 5FZHA 3N9PA 3ZLIA 4BXFA 5IVJA 5A7QA 5FZ4A 5FUNA 4NUBA 3LD8A 5FZ1A 4QXHA 5IWFA 3NJYA 5FP8A 4E4HA 5A7PA 5FUPA 5A7OA 3LDBA 3N9OA 3OPTA 3U78A 2YU1A 5A7WA 5F5IA 4EZ4A 3N9NA 5FXXA 4DO0A 5FYCA 5FZ0A 4TN7A 5FYZA 5FZMA 3RVHA 5KR7A 2WWJA 3OPWA 5F2WA 5A3TA 2GP3A 5A1LA 5FYTA 5FZOA 5FZ6A 5FZEA 2XXZA 3N9MA 5F5AA 5FV3A 5A7WB 5FZCA 2YBSA 5F3EA 5FY1A 5FY0A 4V2VA 4AAPA 4GAZA 3DXUA 4URAA 4CCMA 3PUAA 4Y4RA 3N9LA 5FY5A 2YBKA 3KV9A 4CCJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FY8 A;  3K3N A;  5FZD A;  5FPL A;  5FZO B;  5FZ8 A;  5K4L A;  5LY2 A;  4BU2 A;  5FPU A;  5LWB A;  5F3G A;  5F37 A;  2OX0 A;  4CCK A;  5FPV A;  2XML A;  3DXT A;  4XDP A;  3KV4 A;  5FP4 A;  2GP5 A;  5FWE A;  5F5C A;  3UYJ A;  4Y33 A;  2OQ7 A;  4D6R A;  3K2O A;  5ANQ A;  5F3C A;  5IVV A;  3KVB A;  2YBP A;  5FXW A;  5FYM A;  5A7S A;  4CSW A;  5F2S A;  2Q8E A;  5FZK A;  3AL5 A;  4V2W A;  5FYH A;  5FZ7 A;  4D6S A;  5A3N A;  5FY4 A;  3KVA A;  3N9Q A;  5FPA A;  5FYV A;  5A3W A;  5FJK A;  3PUR A;  5FYY A;  3KV5 A;  4BIS A;  5FXV A;  5FBJ A;  5F32 A;  4XDO A;  2XDV A;  4EZH A;  2OT7 A;  4HON A;  2OQ6 A;  5FYS A;  5FYU A;  3K3O A;  5CEH A;  3AVR A;  5FJH A;  5A80 A;  5LY1 A;  4CCN A;  4LIT A;  4QU1 A;  2YPD A;  2W2I A;  3PUQ A;  4CUG A;  5FPB A;  5FY7 A;  5LW9 A;  2P5B A;  3AVS A;  4DIQ A;  3PU8 A;  5FP3 A;  5FXZ A;  5FZ9 A;  4CCL A;  4GD4 A;  4AI9 A;  4GJY A;  3PTR B;  4IGQ A;  4QX8 A;  2PXJ A;  3KV6 A;  4QWN A;  5F39 A;  5FYI A;  5A3P A;  1VRB A;  4LXL A;  5IVC A;  3PDQ A;  4C8D A;  4QX7 A;  4IGO A;  4LIV A;  3PU3 A;  5F3I A;  3AL6 A;  2Q8D A;  2YU2 A;  5IW0 A;  4CCO A;  4ASK A;  5E6H A;  5A7N A;  5FZA A;  3PUS A;  5ISL A;  3U4S A;  5IVB A;  4IGP A;  4UF0 A;  5FP9 A;  4GJZ A;  3ZPO A;  5FP7 A;  2WWU A;  5IVY A;  5FZF A;  4D6Q A;  4QXC A;  5IVF A;  4EYU A;  5FZB A;  2OS2 A;  4HOO A;  5FZI A;  2XUE A;  5A1F A;  5FZL A;  5FWJ A;  4UF0 B;  4LIU A;  2Q8C A;  4QXB A;  4Y3O A;  5FZG A;  5FYB A;  2VD7 A;  5IVE A;  5FY9 A;  5FZ3 A;  5FZH A;  3N9P A;  3ZLI A;  4BXF A;  5IVJ A;  5A7Q A;  5FZ4 A;  5FUN A;  4NUB A;  3LD8 A;  5FZ1 A;  4QXH A;  5IWF A;  3NJY A;  5FP8 A;  4E4H A;  5A7P A;  5FUP A;  5A7O A;  3LDB A;  3N9O A;  3OPT A;  3U78 A;  2YU1 A;  5A7W A;  5F5I A;  4EZ4 A;  3N9N A;  5FXX A;  4DO0 A;  5FYC A;  5FZ0 A;  4TN7 A;  5FYZ A;  5FZM A;  3RVH A;  5KR7 A;  2WWJ A;  3OPW A;  5F2W A;  5A3T A;  2GP3 A;  5A1L A;  5FYT A;  5FZO A;  5FZ6 A;  5FZE A;  2XXZ A;  3N9M A;  5F5A A;  5FV3 A;  5A7W B;  5FZC A;  2YBS A;  5F3E A;  5FY1 A;  5FY0 A;  4V2V A;  4AAP A;  4GAZ A;  3DXU A;  4URA A;  4CCM A;  3PUA A;  4Y4R A;  3N9L A;  5FY5 A;  2YBK A;  3KV9 A;  4CCJ A; 
#chains in the Genus database with same CATH topology
 2TNF A;  5LBF A;  5FO7 B;  1AHS A;  3NKT A;  3NNF A;  2XPJ A;  3C8X A;  3CIH A;  1PIV 2;  5JXJ A;  5FPU A;  3M70 A;  1CZT A;  1T2X A;  3RG0 A;  2WNU B;  2WUH A;  1MZF A;  4NR1 A;  2A75 A;  5FOB B;  1AR8 2;  3ZSL A;  4XDP A;  1VBE 3;  2XKP A;  1C57 A;  3ILF A;  2WO1 A;  1ZBE 2;  4XC9 A;  3R6S A;  1MS9 A;  3USU B;  5FFO C;  4M0H A;  5CA6 A;  1MPX A;  1VIW B;  4B3N A;  4I0W B;  1X9P A;  2DCT A;  2VJX A;  2ORX A;  1R08 2;  4LA2 A;  5F8P A;  5FXW A;  3OD0 A;  1XND A;  4BPZ A;  1IKQ A;  1D0H A;  4E27 A;  1O91 A;  1PVC 3;  3NNG A;  4D6S A;  5JIU A;  1PVC 1;  1V0A A;  4IEW A;  2VOW A;  2VTX J;  1FX5 A;  4XXA A;  5J98 B;  5FMD A;  4BQ5 A;  2CWS A;  3OY8 A;  1W6O A;  3OF1 A;  5FDB A;  2J7M A;  1MEC 2;  3K3O A;  4QQ2 A;  3G7D A;  2EID A;  4Q4Y 2;  1A78 A;  2BZD A;  3T30 A;  4AHY A;  1PO2 2;  1T6G C;  5BNP C;  2AAC A;  1XNT A;  2PLV 3;  2WZR 3;  3VKN A;  4P9L A;  2ZAA A;  3KT4 A;  2PLV 1;  2WZR 1;  3WDW A;  1FPN 3;  1OOP B;  2XLG A;  5FZ9 A;  2HWE 3;  4LUK A;  3TNQ A;  1FPN 1;  2VUL A;  1O8S A;  2HWE 1;  2PQQ A;  4N53 B;  1W99 A;  4AE2 A;  5F39 A;  4I2O A;  2PEL A;  3SQO A;  3POE A;  4FP3 A;  4ZHN A;  1UO9 A;  3I54 A;  1SAC A;  2BYV E;  4D8M A;  1GNY A;  5A3M A;  2YDE A;  4C1X A;  4XAA A;  4WBB A;  1DYK A;  4R52 A;  5FP7 A;  5E1R A;  5LBB A;  1RJ7 A;  2EVX A;  2ZX2 A;  1RGS A;  3K4D A;  4QX3 A;  5BNP A;  1XXN A;  1O3S A;  3GZU C;  3TYJ A;  3ZSE A;  1GOG A;  1TMF 2;  4D3W A;  1SFY A;  2FBE A;  3GBW A;  1FMD 1;  3T3Y A;  2Y6G A;  3MV0 1;  5B4N A;  2D3P A;  4B1M A;  1G9C A;  5HI0 A;  4FTB A;  1NY7 1;  3ACL A;  1DU3 D;  2WNU C;  4RL7 A;  3AJY A;  2WAB A;  1MZ5 A;  3D3A A;  2VH9 A;  4FT8 A;  2VUA A;  3KM5 A;  4D0Q A;  4KG8 A;  2D6O X;  4OHW A;  3BOP A;  3ZLI A;  5CKN A;  3ACI A;  1QY4 A;  1DBN A;  5FUN A;  1W6P B;  4LLF A;  1W90 A;  4LBL A;  1GNH A;  1VMF A;  2V4A A;  3A0K A;  3N3H A;  2PHX A;  4A3Z A;  4BQ3 A;  2YU1 A;  3K51 A;  1AYM 2;  1C8N A;  5B4X A;  5T5L A;  3VD5 A;  4E9K A;  2VW0 A;  3SH3 A;  3WNN A;  3TRS B;  4Q26 A;  2HWD 2;  4YVS B;  4L8Q A;  3VDA A;  1GP5 A;  4ZZ8 A;  3AKP A;  4J25 A;  3RWN A;  1IPK A;  3VBS C;  2XON A;  3GJA A;  4GXL A;  4JHT A;  4Q4V 2;  3QH6 A;  2ZEW A;  4I30 A;  4S2G A;  4AAP A;  5FQ0 A;  4V2V A;  2QQM A;  5FPZ A;  4HKL A;  2QQI A;  5CU1 A;  1JOB A;  3QH7 A;  2V72 A;  3PIG A;  4W6Y A;  2YHJ A;  1LHW A;  3Q8A A;  3USU A;  1OOP C;  3PIJ A;  2JEC A;  1WBL A;  1FNZ A;  1IG0 A;  1LOC A;  5C3S A;  1LGN A;  4B8E A;  3OBZ A;  1QHD A;  1AL2 3;  1E5I A;  1W3V A;  4RFT 0;  5FPV A;  4BHP A;  1UPI A;  3SHR A;  1AL2 1;  2BNN A;  3DXT A;  3ENR A;  3VBH B;  1VAM A;  2VZS A;  2J22 A;  3KV4 A;  5FP4 A;  5GZC A;  3ASI A;  3EMR A;  3TWI A;  4QU2 A;  1BLZ A;  2ZZJ A;  3H9A A;  1ZRF A;  1WMF A;  2QBX A;  2OPW A;  4HMZ A;  1UOJ A;  4K21 A;  4XVH A;  3POW A;  4M3C E;  4QB2 A;  4Z07 A;  1AXY A;  3RGB A;  3VBS A;  3ZXF A;  5LA9 A;  5JSR A;  1JYX A;  4TSV A;  4CCD A;  4HK9 A;  1JYV A;  4NIG A;  4FQ4 A;  2VOX A;  2JE8 A;  5A3W A;  1CAU B;  2EXJ A;  3WF4 A;  1F9K A;  4JGZ A;  3B93 A;  4KMQ A;  1OOP A;  2ZX3 A;  3NJX A;  4L2N A;  1NQJ A;  3T2Q A;  1OD5 A;  3MYX A;  3W9A A;  5FJH A;  5CEH A;  3ZXK A;  1FV3 A;  3HJR A;  4QDS A;  4X8N A;  3DEM A;  1W8U A;  2WQZ C;  3J26 N;  4AHZ A;  1O3T A;  1S55 A;  2VL4 A;  3DYO A;  5HV4 A;  2ZGL A;  3AVS A;  4DUV A;  1GR3 A;  1SBE A;  4EWD A;  3ETP A;  2DVF A;  2FHR A;  2C26 A;  2JD4 A;  4CP9 A;  4CPB A;  1F31 A;  3C7H A;  4IGQ A;  2WYS A;  4Y26 A;  2NMO A;  5A3P A;  4I3P A;  1G9D A;  5FYI A;  1QXR A;  3RJ2 X;  1WD4 A;  4E4S A;  1RUE 2;  4UW4 A;  1E5H A;  4LKS A;  3A4U A;  1RMU 3;  3GZT B;  2BNO A;  1OC1 A;  2YB7 A;  2V09 A;  3H8U A;  1VB4 A;  4IGO A;  4LIV A;  4NRM A;  4Q4W 2;  4R4Z A;  1RMU 1;  1FI2 A;  5F3I A;  3MZH A;  3TEY A;  4B1L A;  1GU3 A;  3RQ0 A;  4MZU A;  1PO1 1;  2A1X A;  2BVB A;  2WWU A;  4OHV A;  1YI7 A;  5DDJ 3;  2VOV A;  3OG2 A;  4RGA A;  1JBC A;  1QGL A;  3H1W A;  4FOQ A;  1X8E A;  4M01 A;  4RGK A;  1ASJ 3;  1W6P A;  3VB9 A;  2P37 A;  3JXS A;  4MUV A;  1O5U A;  1ASJ 1;  2YUE A;  2GC3 A;  2YXS A;  3C7O A;  2B46 X;  5EQU A;  3VBH C;  5FY9 A;  5JMO A;  2PAE A;  1KDK A;  3AXE A;  2IXJ A;  2GAL A;  3UNP A;  4XJ9 A;  4OI0 A;  2ADD A;  1PIV 1;  3GZE A;  4NAO A;  2RS3 2;  2RDR A;  2OII A;  1HRI 2;  4L0P A;  1VRH 2;  1X50 A;  2C24 A;  2VZ1 A;  2GNB A;  3ME2 A;  3O1R A;  1GMM A;  1XU1 A;  1ZBE 3;  1AR8 1;  3HEI A;  3GCX A;  2WS9 3;  1SBF A;  1ZBE 1;  3W21 A;  1TE1 B;  2YFU A;  3B94 A;  3HBK A;  3WNL A;  3AP7 A;  3NST A;  3O14 A;  3AP9 A;  2D6P A;  1XBF A;  1QJU 3;  4YG6 A;  4CU8 A;  1R08 1;  4COY A;  4S2H A;  3RS6 A;  2R49 A;  2CU5 A;  1JI6 A;  3UKV A;  2X09 A;  3U10 A;  5JOW A;  2Y6J A;  4P5H A;  4JDN A;  4G9S B;  1EV1 1;  4ZU7 A;  4EN8 B;  1FV2 A;  3K3N A;  5TSW A;  1MEC 3;  2C6S A;  2VUD A;  2JDK A;  5GZE A;  4Q4Y 3;  1VLN A;  5LY2 A;  1RIR A;  3TNP B;  2Z2S B;  3P1I A;  4Q4Y 1;  4XET A;  2OX0 A;  3WDX A;  2JDN A;  1LOG A;  1PO2 1;  1DQ2 A;  2VOK A;  4L97 A;  4COZ A;  1U5X A;  1HB4 A;  3B5L B;  4B7E A;  1QJE A;  2OQ7 A;  4QM8 A;  1CAU A;  3BTA A;  4EWE A;  5F3C A;  2G4I A;  5H9Q A;  1OA4 A;  4XPV A;  2WN3 A;  2DUQ A;  3MEP A;  5FIX A;  4N7I A;  3BU0 A;  2RE9 A;  3H3L A;  4P08 A;  2PAK A;  3FFQ A;  1OQE A;  1JTZ X;  4NVP A;  3MIE A;  3OPZ A;  3ZYF A;  1UX7 A;  3AJZ A;  2Y0O A;  3BI3 A;  4Q4X 2;  1H1I A;  1VMH A;  2JG8 C;  4OZX A;  2E33 A;  2JX9 A;  4QQP A;  1AJK A;  4COV A;  5FXV A;  4A6O A;  2RMU 2;  2DUR A;  5F32 A;  4XDO A;  4DIN B;  4FAH A;  4PBP A;  5CFD B;  3POI A;  3IDB B;  5FYS A;  1VBB 3;  2KR2 A;  4YW7 A;  3EYP A;  2RG4 A;  1W03 A;  1WCD J;  1VBC 2;  2ZEZ A;  4FXG B;  4GWJ A;  4KBB A;  3SEP A;  1AYN 3;  1TMF 1;  4XFH A;  5FO9 B;  1H2L A;  1YQ8 A;  3WHU A;  4BB3 A;  3BAL A;  3I2K A;  4J6G A;  3OOX A;  2ZGO A;  4EN9 B;  2DFC A;  1C1L A;  5A3O A;  3IWZ A;  4LHN A;  4EJR A;  1YXW A;  4QX2 A;  2VEC A;  3BOD A;  2JG8 A;  1W9W A;  4YFW A;  1AYM 3;  1N3O A;  4Z92 B;  3TAY A;  2XGX A;  5BXX A;  3ZXD A;  2QDN A;  2UY9 A;  2GN3 A;  1Y9M A;  2G19 A;  4Q1P A;  2HWD 3;  5JUV A;  4OI2 A;  5JAX A;  3LE0 A;  2H0V A;  1FOD 3;  4KG0 A;  2HWD 1;  3SEE A;  2ZGQ A;  1G86 A;  3I4I A;  4P9X A;  5IAT A;  3NV4 A;  2W1W A;  4Q4V 3;  2PHU A;  4AOC A;  1CPM A;  3WW1 A;  1WZX A;  4Q4V 1;  3VBU A;  5CIS A;  2A6X A;  4IV1 B;  2J1V A;  2BPA 2;  2GC2 A;  1D2Q A;  1NXD 1;  2FDJ A;  4NMI A;  5C33 A;  5C8W A;  4NN0 A;  2X10 A;  1C28 A;  1TG7 A;  4ES9 A;  4HVQ A;  2GC0 A;  1DHK B;  3OUH A;  1OFN A;  2C0Z A;  1RUI 2;  5FZ4 A;  3CEW A;  4GB3 2;  5APA A;  2KA3 A;  1UL9 A;  4OVE A;  2UWC A;  5FUP A;  4MSV A;  3LFI A;  2PFW A;  3H50 A;  4GWI A;  4CP0 A;  1COV 2;  2JD9 A;  5GAL A;  4D7T A;  4G4F A;  1GBG A;  3O1O A;  1S0F A;  4HSJ A;  3AKQ A;  2DVA A;  4JQR A;  1YI9 A;  5JLV A;  2DVG A;  5CFD C;  2WO3 A;  1MQT B;  3HQU A;  4MYE A;  3ES4 A;  3FUQ A;  2XXZ A;  4MGT A;  4GWM A;  1E5R A;  4W6X A;  5LEJ A;  1PGL 2;  2G9F A;  2W9X A;  3M3O A;  3DXU A;  3MIF A;  3H0O A;  4FP2 A;  1LOF C;  4CA9 A;  4RFR B;  3RYP A;  4CXY A;  2R0F A;  5C5U A;  1WLW A;  5JXG A;  1UU4 A;  3ATG A;  3OD4 A;  3P5B A;  1UY4 A;  2ZGK A;  1PX3 A;  2AUY A;  2R07 3;  2XKO A;  3N7K A;  4P5Y A;  3FBY A;  4P9G A;  1BKZ A;  3WW2 A;  4IUG A;  1ZZ6 A;  2RR1 3;  1YIP A;  2Q1Z B;  3ZR5 A;  1V6K A;  4FFI A;  1V00 A;  1POV 0;  1H4G A;  1SFN A;  2DDU A;  1REE A;  5AC9 2;  2BJS A;  4LBN A;  4DUX A;  5DAB A;  3VL9 A;  3E6D A;  3EJK A;  3LOI A;  1W6N B;  1AXZ A;  4QB6 A;  4YVW B;  5CFD A;  3FX3 A;  3OJB A;  4QKB A;  3KCY A;  5JIA A;  2YBP A;  3GJB A;  2B9V A;  4LMF A;  5FLH A;  1RUE 1;  2ORZ A;  3AMQ A;  3WP4 A;  4QQH A;  4Q4W 3;  4LHS A;  4Q4W 1;  1LOF A;  1F5F A;  5I8S A;  5DUX A;  1VAL A;  1MS0 A;  3NVC A;  4PIY A;  4OHX A;  3RZL A;  2J1R A;  4IV1 C;  2QQO A;  2VVE A;  4MAD A;  2E9Q A;  1OI6 A;  3BB6 A;  3ES1 A;  4QPW A;  2A6Y A;  5LAT A;  4E2Q A;  4F83 A;  1ZM1 A;  4QGN A;  3WQ7 A;  3JQX A;  3HVD A;  2PA7 A;  1YWK A;  4PI0 A;  2XJS A;  3T0A A;  2ZEX A;  1R64 A;  3WNO A;  4Q1R A;  2YGL A;  1WUV A;  4UW3 A;  3TEX A;  3ZXA C;  3BGA A;  3PTR B;  1LES A;  3AKT A;  3WR0 A;  4YGB A;  2G9G A;  4A6S A;  1JOD A;  2GC1 A;  1V9U 3;  2ARX A;  2Y38 A;  3OGG A;  2B39 A;  4K1Z A;  1VRH 3;  1V70 A;  2RS3 1;  1MQT C;  3NL1 A;  1HRI 1;  4AL9 A;  1VRH 1;  3OEA A;  2ZGT A;  1OH3 A;  1OPM A;  4IV1 A;  3ZKY A;  1W8F A;  4MOA A;  5IVY A;  5L36 A;  1OF3 A;  2GH2 A;  2VNO A;  5DAV A;  2K2S A;  1GP4 A;  3WF3 A;  1NZC A;  2ZGR A;  3V0B A;  3T09 A;  3CMG A;  4DOU A;  5FKB A;  1UAI A;  4BA6 A;  4FOV A;  2RS1 2;  4DEV A;  1IQA A;  2HEV F;  2VTF A;  1S0C A;  2VZT A;  3IAQ A;  3MF6 A;  2AEY A;  2WRA A;  4Y3O A;  3WUC A;  5A6X A;  3BYW A;  4A7Y A;  2YY1 A;  2VCC A;  1ULO A;  5FK7 A;  3H7Y A;  1H2M A;  3ZYI B;  1WCS A;  1J1L A;  4MVT A;  5DUW A;  5FP8 A;  3W58 A;  2V73 A;  3WUD A;  5FLJ A;  3IMM A;  3RYK A;  2VNG A;  3BIW E;  4DZG A;  1HXS 2;  5CZK A;  2WL1 A;  4CEW A;  3NV3 A;  1XNK A;  3ZDV A;  1UY3 A;  2PHR A;  2YC2 A;  3DPR B;  5I8T A;  4IL7 A;  3O1U A;  1UQX A;  3Q9O A;  1ZVF A;  3S7E A;  4FPC A;  1OQD A;  4K8F A;  3FZ3 A;  4IES A;  1QDO A;  4HAN A;  2D5F A;  4YM2 A;  4AVC A;  1ZZ9 A;  3OYW A;  2GNT A;  5A1A A;  5BY5 A;  1IS6 A;  1O6U A;  2FD8 A;  4Q4X 3;  2QTW B;  4Q27 A;  5C8C C;  3TN9 3;  3CQO A;  3N9L A;  4Q4X 1;  1HQL A;  2RMU 3;  1DQ4 A;  2JIG A;  1WCK A;  2RMU 1;  3UGF A;  3LEM A;  4XFF A;  4WVM B;  3LDR A;  3WNP A;  1W6N A;  1VBC 3;  5EHD A;  3O7O A;  1ZRR A;  4Q8K A;  2O8O A;  4BM8 A;  3KQR A;  2XML A;  1BBT 3;  1CIY A;  2FZ2 A;  2VZ3 A;  2JG9 B;  1QXJ A;  2Y0I A;  3AC0 A;  1JZ2 A;  3ZYP A;  3OUI A;  2ARA A;  5T55 A;  2RJK A;  2QZ3 A;  1BVP 1;  4WM8 B;  2W1Q A;  3T1M A;  4XZU G;  2DUO A;  2WDB A;  4CSW A;  1HIX A;  4XF4 A;  4IXL A;  3I49 A;  5FZK A;  2IXL A;  2J1A A;  2L9L A;  5C8C A;  1H4H A;  2FDF A;  2PN5 A;  3KV5 A;  1ZRC A;  2HWB 2;  5AVA A;  3ZR6 A;  5IK4 A;  3IZO A;  3MBW A;  3PME A;  4IE6 A;  3ON7 A;  4Y1X A;  2X53 S;  3VL8 A;  2W91 A;  2FMY A;  3I2I A;  3M1H A;  2FDG A;  4P02 B;  3FBM A;  4CCN A;  1XB9 A;  2BW8 A;  1R1A 2;  5CYY A;  1I1E A;  2HWF 2;  2VMI A;  3R4S A;  2VBB A;  2R04 2;  4MGQ A;  2XJQ A;  1IQD C;  3AP6 A;  2LAL A;  2PHW A;  3LZZ A;  4COU A;  4EQV A;  4OUM A;  5GZD A;  3T1L A;  4BXS V;  4NE9 A;  1GZC A;  2QFE A;  2DU1 A;  3VKM A;  3HPN A;  1ULD A;  4GIQ A;  3I2G A;  1RUI 3;  1QKQ A;  3IMN A;  3ZOI A;  3DPR C;  4GB3 3;  3THC A;  2ENR A;  1RUI 1;  1GZT A;  4AI3 A;  3BPS A;  1COV 3;  1UZ0 A;  2IWG B;  5IW0 A;  3UKT A;  1HB1 A;  4CP2 A;  1LUL A;  1COV 1;  1H30 A;  4IGP A;  2JXA A;  5JPM B;  4AAX A;  4QM9 A;  3WCS A;  3AZY A;  3ZXG A;  4C0H A;  1O3Q A;  3MID A;  3M3C A;  3MUY 1;  1FT9 A;  1OD3 A;  4PQ9 A;  4E2S A;  1NCR B;  4BE3 A;  1EY2 A;  2ZAC A;  3MW4 A;  1DGR A;  2Y64 A;  3I2D A;  4UI9 L;  1GIC A;  2BP6 A;  2VR4 A;  4RR3 A;  3UET A;  1PGL 1;  2XH6 A;  1MS4 A;  2BVV A;  4OUS A;  3LSE A;  1UYZ A;  1AX0 A;  4L9B A;  3T2T A;  3FE5 A;  2JG9 C;  5CIR A;  5IVJ A;  3HD8 B;  4XBQ A;  3CBN A;  3DPR A;  1RUN A;  1BK1 A;  5KWR A;  3LSD A;  5D8A B;  4JHZ A;  1VPH A;  4LT5 A;  3ETQ A;  4WM8 C;  1H1A A;  3TEZ A;  1FAT A;  4IEZ A;  1K42 A;  2B45 X;  1ONA A;  3POJ A;  2WZP P;  4OQ9 A;  3AMN A;  1AR6 2;  3W5M A;  5AC9 1;  2I07 B;  1KD7 A;  2GDF A;  2PTM A;  4NHL A;  5LBE A;  3WF2 A;  4FCA A;  5DXD A;  1KS5 A;  2W94 A;  3RJR A;  2GP3 A;  2ZAH A;  4WVM A;  2YFZ A;  5DG2 A;  4E4Z A;  2ZMK A;  4AFC A;  2FQP A;  4XOG A;  3M7A A;  1YFW A;  5FY0 A;  1PM7 A;  3WQ1 A;  4E4D X;  3HIF A;  3VKL A;  3THD A;  2AR6 A;  1XNA A;  2YBK A;  2XQR A;  2JG9 A;  2LRO A;  1HRV 3;  5J36 A;  5FZD A;  4B7K A;  2NP0 A;  1AUY A;  5ACA 3;  2CHH A;  1CON A;  4BU2 A;  1F4A A;  1WA4 A;  1L3J A;  5F3G A;  3S57 A;  1JHJ A;  3WSO A;  1UYX A;  1RUO A;  1NT0 A;  3VZM A;  3S5A A;  2CYF A;  1UWW A;  4BCU A;  2A5Z A;  1W2U A;  2A3X A;  3HOB A;  5F5C A;  4AVT A;  1ULF A;  4QHZ A;  4SLI A;  1FYU A;  4XW3 A;  2WT0 A;  4QGL A;  4YM0 A;  2XBO 1;  3WP3 A;  2RVA A;  4MHU A;  1LKN A;  2LM3 A;  3O1V A;  5DAW A;  5A3N A;  5FZ7 A;  1W6M B;  3AP4 A;  1NCR C;  1UF2 C;  3HMY A;  3VBR B;  1N1Y A;  5SV8 A;  1JYC A;  2QKD A;  1SCS A;  3NKG A;  3L9J T;  2JDU A;  3USS A;  1MS3 A;  1PK6 A;  4A4A A;  1IGO A;  1J3P A;  4BQ4 A;  3GCW A;  5A80 A;  2O1Q A;  4YRD A;  1WLC A;  1R09 2;  5IHR A;  3AZW A;  1KJR A;  4CUG A;  2XWJ B;  1CZV A;  4QGM A;  5D8A C;  2RS1 3;  3VHO A;  4A3X A;  2A7A A;  4LBO A;  2LRP A;  4M3C B;  4JZR A;  2RS1 1;  4LK7 A;  1H0B A;  4IE5 A;  2ZKL A;  2VXR A;  4K8R B;  1DG6 A;  4RGG A;  1H6Y A;  2VZV A;  2Q8O A;  1YNA A;  5GM0 A;  3AZV A;  3A7Q A;  2UYB A;  1LB2 A;  4RD7 A;  4WM7 B;  1W9Y A;  4QX7 A;  4A44 A;  4C8D A;  2WNO A;  1NCR A;  4Y1U A;  4AGV A;  1DLL A;  5B2G B;  1EV1 2;  1HXS 3;  1B09 A;  2P3K A;  4OLL A;  4UWD A;  4XJU A;  4ZY9 A;  4LKD A;  4WZF A;  4CDX B;  1HXS 1;  1YQ2 A;  2ARC A;  2CDP A;  3APB A;  3K77 A;  4M4P A;  4R9B A;  5DPN A;  3V65 A;  3H8O A;  5JCT A;  1KJL A;  1JUI A;  3OBA A;  2Z5W A;  5SV5 A;  5FPX A;  4NHY A;  1W2A X;  1QMJ A;  5D8A A;  3TEW A;  3PJY A;  3ILR A;  4OHY A;  2GN7 A;  3C2U A;  3LWC A;  4ISR A;  3NQH A;  4BQ1 A;  4J1X A;  1OHF A;  2OKX A;  4K20 A;  1IPS A;  1OKQ A;  1SZB A;  2DCY A;  2W47 A;  3PVO A;  4IEX A;  4JC1 A;  1VBA 2;  4QQL A;  4A41 A;  3FHI B;  3CJX A;  2D3R A;  5CKM A;  1U5Z A;  3ALQ A;  3HR9 A;  4QXH A;  3SKJ E;  4HKW A;  1BYH A;  2VM9 A;  3AM2 A;  5A7P A;  3WQ0 A;  2QNK A;  1V6O A;  2VNV A;  2W87 A;  4YAR A;  4AGR A;  5AFE A;  1I9R A;  1PM4 A;  2D7F A;  3OGJ A;  4XTP A;  3AMP A;  3N9N A;  1S0J A;  1PNF A;  3A23 A;  4LE3 A;  5FZM A;  3ST7 A;  3ZDS A;  3VBR C;  1QU0 A;  2VBP A;  3MGU A;  4GKX A;  2DVB A;  2PYT A;  1FMD 3;  2QUO A;  1DQ6 A;  2DBN A;  1NQD A;  2RS5 2;  1WCU A;  1UU6 A;  2XJR A;  3KMH A;  4URT A;  5F2W A;  5I0T A;  2ES3 A;  2H6C A;  5A7W B;  1TME 2;  2BGC A;  4UFK A;  1D7P M;  4HZF A;  4UT5 A;  2JB4 A;  2WQ8 A;  3VBF B;  1W8Z A;  1BEV 2;  1ACC A;  2HWB 3;  1ENX A;  5IYY A;  3T2O A;  2D43 A;  4BIF A;  2HWB 1;  4LO8 A;  1IS4 A;  1JOP A;  1NKG A;  4MHR A;  5FRE A;  5HCH A;  3E1F 1;  3FUO A;  4U2A A;  1JXN A;  4Q2F A;  5KHK A;  1UMI A;  2HKX A;  2HWF 3;  3AKS A;  4LBJ A;  1DQ1 A;  4WV8 A;  5T5J A;  3WG3 A;  1H1M A;  1R1A 1;  5C71 A;  2HWF 1;  5C3Q A;  5C9A B;  4WM7 C;  2R04 1;  2X8K A;  2AGS A;  2FMD A;  2ZS6 B;  1QF3 A;  3I8T A;  4ARY A;  2D93 A;  1Y7B A;  1J1T A;  4WVZ A;  2CWM A;  1AL0 G;  5ANQ A;  4AI0 A;  4ASL A;  4C91 A;  5C5T A;  4HKO A;  2JDY A;  2P2K A;  1LOB A;  1WW7 A;  4CDX C;  1KIT A;  1EYB A;  2D44 A;  2XVG A;  3JCI A;  3RFR A;  2VO5 A;  2J42 A;  1AR7 2;  5KXE A;  2WNU A;  4QT6 A;  3AL5 A;  5D1I A;  1H2N A;  1EPW A;  2WLQ A;  4FOY A;  3PMS A;  1SHW B;  2FCT A;  4H14 A;  5H9S A;  5FJK A;  3PUR A;  1UOB A;  4JAA A;  4MLO A;  1DQ5 A;  1Q8O A;  2F17 A;  3RRD A;  2GSY A;  5KC5 A;  3BKZ A;  3NJV A;  4HPK B;  1C5I A;  3MPB A;  4HLT A;  4ZPI A;  1AXK A;  4K3U A;  3BUC A;  4N53 C;  4AR2 A;  5JZG B;  2ZXQ A;  2O0O A;  3S6P A;  4BLI A;  5L7O B;  2P3Y A;  3AZZ A;  3VHR A;  4DXR A;  3LOB A;  2P6C A;  4WM7 A;  3V56 A;  1YO8 A;  1W6Q B;  5EJZ B;  5A6Z A;  4GD4 A;  4DY5 A;  2QQL A;  2YRO A;  3GXU A;  4NRQ A;  4AQS A;  2QQV A;  3KGL A;  1YQ6 A;  3SCF A;  3AKR A;  4RA0 A;  1DZQ A;  2I45 A;  3NNM A;  3PDQ A;  1LGC A;  1CVN A;  2Y6H A;  1Q8S A;  1DF0 A;  4AHW A;  1UMH A;  4DXZ A;  3WF1 A;  1S1A A;  3WDV A;  5A33 B;  5F1R A;  2NN8 A;  2B9U A;  4JGY B;  2VMD A;  3CO2 A;  4CCO A;  1LR5 A;  1NX9 A;  1PGW 2;  5E6H A;  4XUQ A;  3PUS A;  5BUV A;  3WIN E;  1AR6 3;  1EUU A;  4NIA A;  2CSG A;  4H7M A;  1US2 A;  5GLU A;  4E2G A;  5ERL A;  1QEX A;  3BCW A;  1AR6 1;  4YNI A;  4N53 A;  5DQ0 A;  3VBF C;  1LAJ A;  1CX1 A;  1HJG A;  4B29 A;  2Q30 A;  3CJI B;  3CLP A;  1KFX L;  4IV3 B;  2Z42 A;  2FDH A;  1VP6 A;  4W8J A;  4Z82 A;  4I09 A;  1ZA4 A;  4LO5 B;  2WSV A;  3KT7 A;  1O8P A;  1OF4 A;  3FHQ A;  4FI9 A;  5C9A C;  2QQW A;  3V64 A;  1Z7S 2;  5J96 B;  3WNK A;  3T4H B;  5M0T A;  2P1B A;  1W39 A;  4YVS C;  1JZ3 A;  5DAQ A;  2BOI A;  3UV9 A;  4IE4 A;  2B4K A;  5A70 A;  3M3E A;  3OPT A;  3U14 A;  1PO1 3;  2DUP A;  2IXH A;  5A7W A;  4MGK E;  4EZ4 A;  2XJV A;  4M00 A;  4E8D A;  3VBF A;  4F7Z A;  1EUT A;  2Z4F A;  5DAX A;  2ADE A;  2GMM A;  1D4V B;  5IK8 A;  3PL0 A;  1ALY A;  4I0B A;  3KSC A;  2P3J A;  1G9A A;  2R06 2;  4QX5 A;  5F5Q A;  3RZH A;  1HQW A;  5JZG C;  3I59 B;  5L7O C;  2YC0 A;  1XC6 A;  4XAB A;  4YW4 A;  4COW A;  3RZJ A;  2JDA A;  3OCP A;  4W65 A;  1W8N A;  2HBT A;  4Y4R A;  4ASM B;  2P34 A;  1W8O A;  1PIV 3;  4XDQ A;  2TBV A;  2C5D A;  5JOY A;  2WAA A;  4P00 B;  4YVS A;  4AI2 A;  4EN6 B;  1J83 A;  3IIA A;  3B9I A;  3PUH A;  1R09 3;  1JS9 A;  1HN0 A;  4CUB A;  3VZL A;  1W2T A;  3WG4 A;  4AZZ A;  1AR8 3;  4X8P A;  1QJX 2;  1R09 1;  2HWC 2;  3MW3 A;  3NJZ A;  3IDA A;  5HCF A;  2BFU L;  4IQP A;  2VZQ A;  1TEI A;  4QHO A;  4Q8L A;  2DV9 A;  4Z2W A;  3TOJ A;  3WF0 A;  1BJQ A;  2I74 A;  4JGY C;  4LJH A;  4XFB A;  1GSL A;  5CB7 A;  4X6R B;  4ZKT B;  1R08 3;  1XYO A;  2LTN A;  4Z1V A;  1PZ9 A;  3TBD A;  4HPK A;  1JUH A;  4AI1 A;  3ELN A;  3B3Q E;  5FYH A;  5JZG A;  4QKN A;  5LCW L;  5L7O A;  1OUS A;  2EA7 A;  1GQH A;  2WZE A;  1EV1 3;  3GBF A;  1W3X A;  2UU8 A;  3QD6 A;  4BIS A;  3VBH A;  4IV3 C;  4Q0Q A;  4BZ4 A;  1JN2 P;  1EPZ A;  4FPK A;  4XBN A;  2OZJ A;  4CZS A;  1HV1 A;  2EIE A;  3INA A;  3KF5 A;  3WVJ A;  4GWN A;  3CZU A;  2VAU A;  3AVR A;  1PO2 3;  3H1M A;  5IAV A;  3HN3 A;  2BGO A;  4YW6 A;  5I0S A;  1G9F A;  2FDI A;  4JRL A;  4FPH A;  3MI8 A;  1S0I A;  2YPD A;  4HG6 B;  1Y43 B;  5A6Y A;  5FMO L;  4DIQ A;  3J7H A;  3PU8 A;  2A70 A;  4PI2 A;  3LPF A;  2JEN A;  4AGG A;  2A73 B;  5A33 A;  4JGY A;  4I3G A;  5H9R A;  1VBA 3;  1XE8 A;  3LKJ A;  3OEB A;  2EXI A;  4NOT A;  4QWN A;  1VBA 1;  4XQW A;  2E7A A;  2A6W A;  2F4P A;  3CZJ A;  4JDO A;  1SEF A;  4Y5S A;  4JQT A;  5AVP A;  3U0Z A;  1YEW A;  2CY6 A;  2B8M A;  4GMP 0;  4MX3 A;  4XJA A;  1JYN A;  4QQO A;  3HN1 A;  5DZG A;  1LOA A;  1VBD 2;  2AC1 A;  5ISL A;  2DWR A;  3U4S A;  3ZPO A;  3KCC A;  4D6Q A;  2JJ6 A;  3W5N A;  3ZXL A;  4AF9 A;  1XYN A;  3UGH A;  3I2J A;  3DEC A;  1TMF 3;  4R9C A;  3ZIW A;  4OQ8 A;  2W0X A;  5A3U A;  2RS5 1;  3ZSK A;  1GWK A;  2ZCW A;  1RHI 2;  4EN7 B;  1AJO A;  2VMH A;  1TME 1;  4N90 A;  4PF5 A;  1D4M 2;  4JKK A;  1BEV 3;  3EB7 A;  2WBK A;  4Y5Z 0;  1BEV 1;  4C1W A;  1F4H A;  2V5Y A;  2VC9 A;  4PIX A;  5HCB A;  5GLZ A;  5JPN B;  5LK7 B;  4L92 A;  4LTA A;  1KEX A;  1F15 A;  1CAX B;  4JCK A;  4ZU4 A;  3AFG A;  1TQ5 A;  1RUH 2;  1JHN A;  3C7G A;  5F5I A;  3NWK A;  4LKE A;  1KXG A;  4QMA A;  2CTV A;  1FAY A;  1L7Q A;  2HEY F;  3I59 A;  2VCA A;  5C6C A;  3CHX A;  4K6B A;  4KWJ A;  2FCV A;  1YLL A;  4D69 A;  2XJT A;  1QH7 A;  2MPF A;  2WAO A;  4ZXK A;  4QDR A;  2BBV A;  2VZR A;  1AR7 3;  5JDB A;  1HV0 A;  3DF0 A;  5FV3 A;  2VMG A;  5J48 A;  3I3M A;  1L7L A;  4AG4 A;  1AR7 1;  3ILN A;  5F3E A;  4FPY A;  2JKB A;  4GAZ A;  3GNE A;  4P14 A;  3UK9 A;  3O1M A;  2DBI A;  1T6B X;  2JDM A;  1CAV B;  2VMF A;  3MF9 A;  3ITQ A;  4FPL A;  1UOG A;  4XIK A;  1HQN A;  1OLR A;  1ZYB A;  4O7X A;  3WX5 A;  3OSD A;  3UJO A;  1I3H A;  3IDC B;  2IVJ A;  4NPL A;  1JYT A;  1GFF 2;  1U0A A;  2ZGM A;  1X8M A;  1XNC A;  2C9K A;  1C4R A;  4Q0P A;  3ZFG B;  3HNM A;  3NV1 A;  1JMU B;  5BNO B;  1LTE A;  2GP5 A;  1LHV A;  4KU8 A;  4R8H A;  5FWE A;  5J7M A;  3GHM A;  4HBN A;  4LLO A;  4Y24 A;  4Y33 A;  2E63 A;  4HN0 A;  3AK0 A;  3KVB A;  2ZGU A;  1GP6 A;  3FL7 A;  3POY A;  4FTS A;  1CAW B;  3RDI A;  3KF3 A;  1VMJ A;  5HXM A;  3ACF A;  2Q8E A;  4ZS3 A;  1S2K A;  4RQP B;  4CE8 A;  5GJ6 A;  4OI4 A;  4NII A;  2A3W A;  2VQU A;  2QZ2 A;  2W95 A;  1H8T B;  4PDW B;  2XQX A;  1PGW 1;  2RDN A;  2XDV A;  4LQR A;  2DCK A;  5FYU A;  2HH9 A;  1UMZ A;  4LE4 A;  1OUR A;  4XJ8 A;  3EBR A;  1NCQ B;  5FBZ A;  2ZJC A;  1WMD A;  1SLI A;  1QXP A;  1JZ8 A;  5LW9 A;  1CR7 A;  2P5B A;  2Z79 A;  5FXZ A;  1UZZ A;  1J3R A;  4N7U A;  3U1X A;  1UU5 A;  5FAX A;  3AYC A;  1W9F A;  5FK8 A;  1SLB A;  1RUE 3;  2PXJ A;  3DYP A;  1K5J A;  3MW2 A;  1RXF A;  1AZD A;  1C5H A;  2AEN A;  2MEV 2;  2UYA A;  1Z7S 1;  3UES A;  3RMX A;  3FLP A;  2BTV C;  4LO4 B;  4PLM A;  1LGB A;  3C3V A;  3LDK A;  2F4L A;  2QQN A;  2VZU A;  1H9P A;  1QQP 2;  3O0V A;  1UZV A;  3JZV A;  5FZA A;  1MZ6 A;  3GYD A;  3RZG A;  3GZA A;  3PHM A;  5DAP A;  2QQP A;  2YGM A;  2GMP A;  4QXC A;  2ZPX A;  4XMI A;  5H9P A;  5EFU A;  4C0B A;  1LED A;  5FZB A;  3POB A;  5IFT A;  2XOM A;  1Q8V A;  4AFD A;  2EAL A;  4GUL A;  4XUP A;  4TZD A;  1MS1 A;  2R06 3;  1TNR A;  4N8M A;  1YIF A;  4HET A;  4XHB A;  4MG2 A;  2C4X A;  2R06 1;  4IW3 A;  1CAX A;  1NUK A;  3ZFG C;  5I0D A;  2BQP A;  3OTF A;  2VD7 A;  2XBO 2;  2Q0A A;  4BIO A;  1G9B A;  3G6J B;  3EQE A;  3HQX A;  1O7F A;  5BNO C;  3EHK A;  2P6H A;  4JKL A;  4CUC A;  1JZ7 A;  5A7Q A;  3GHN A;  4GA9 A;  2RS3 3;  4Q0V A;  5LA1 A;  3PNA A;  2DF7 A;  1HRI 3;  4KGQ A;  3III A;  1OLM A;  5CNA A;  1POQ A;  5IWF A;  5E16 A;  1ZNP A;  2PHD A;  1QJX 3;  2HWC 3;  3ZO0 B;  2FDK A;  1UY2 A;  1N3P A;  2X5I B;  4QPG B;  3U78 A;  2Y6L A;  1QJX 1;  1F35 A;  2HWC 1;  4XZP A;  3E6C C;  1CX4 A;  4Q5O A;  5DZE A;  4RQP C;  5FYC A;  3S5Q A;  3T08 A;  5KHI A;  3ACG A;  3BTX A;  4ORF A;  1CAV A;  3FMG A;  2WWJ A;  1H8T C;  2E26 A;  4PDW C;  5C3P A;  1DGL A;  1WWY A;  5A1L A;  5LBC A;  4UOJ A;  5F5A A;  1E57 A;  1NCQ C;  4B4P A;  1BZW A;  1WME A;  1LJ7 A;  3SIT A;  4EN0 A;  1DFQ A;  3MLL A;  3ZFG A;  1ENQ A;  2CNA A;  3PUA A;  4Y20 B;  4K1Y A;  3KZ4 C;  2ZX1 A;  3NNL A;  4M0N A;  5BNO A;  3AP5 A;  2PHT A;  4FPF A;  2ILM A;  4OI1 A;  3VDC A;  2P4E A;  4UFH A;  1RED A;  1O3R A;  4QPI B;  2BDR A;  2CGN A;  4YVW C;  4IND A;  3UJQ A;  1MQT A;  1LU2 A;  2VPV A;  4UAP A;  3UGG A;  2V5D A;  4YGE A;  5IUQ A;  4AQ2 A;  3WCR A;  3MIG A;  3CU7 A;  3SIS A;  1VBE 2;  3E5Q A;  5EYX A;  3ORJ A;  5DZF A;  4OHZ A;  1L7R A;  1SPP B;  1ND2 B;  4LUM A;  3ZM8 A;  3WNM A;  1H8T A;  5C70 A;  1US3 A;  3LEI A;  4PDW A;  4LBM A;  1KFU L;  2R32 A;  5GLW A;  1YJK A;  3BTZ A;  5A7S A;  2R0H A;  1XU2 A;  4NPM A;  3WEZ A;  4IER A;  4UFM A;  1NCQ A;  4CU9 A;  4E8C A;  3IB3 A;  1WGP A;  2IUW A;  3BOW A;  2ETE A;  1CJD A;  3M8L A;  1VBD 3;  4PLO A;  4HK8 A;  3VBO B;  5BV6 A;  1X9T A;  4Y4Y A;  1VBD 1;  2WYF A;  1OMI A;  2OT7 A;  4XCB A;  5T5P A;  5K9Y A;  1S2B A;  4YVW A;  2QVS B;  4BMB A;  4LIT A;  1RUF 2;  4FPE A;  4L11 A;  2JWP A;  1DP0 A;  4BK5 A;  3K75 B;  1HDK A;  2D6K A;  3A21 A;  3T2P A;  1RHI 3;  3R4D B;  2Y8K A;  5FRA A;  1RHI 1;  4RSU A;  1D4M 3;  2C9A A;  2VG9 A;  2VQA A;  4AI9 A;  1CPN A;  1D4M 1;  1SLC A;  2X5I C;  4QPG C;  1QWR A;  4HVO A;  3WOG A;  1HB3 A;  4LA3 A;  2DYC A;  4CEY B;  2ID4 A;  2A6Z A;  2D40 A;  2XHK A;  1GLH A;  2JIC A;  3U37 A;  1LEC A;  1RUC 2;  2YPJ A;  2X05 A;  3VD3 A;  5IVC A;  5GKA C;  3PU3 A;  2E53 A;  3MDP A;  2BRT A;  2VBD A;  3MV1 1;  1O5L A;  1RUH 3;  2XJU A;  3FHA A;  2ZGN A;  1RUH 1;  4PF1 A;  3PTY A;  3HWJ A;  5FP9 A;  4GJZ A;  2BNM A;  1VAV A;  1ND3 B;  2VVD A;  5FZF A;  2JE9 A;  4IDZ A;  3ZIX A;  5I0U A;  4QPY A;  3SXW A;  4ATF A;  2OS2 A;  1VAK A;  2OYZ A;  3WQB A;  5C4W B;  4YZ4 A;  2ZKN A;  5EWS A;  5J3U A;  5FWJ A;  1PHM A;  4QPI C;  1HW5 A;  1X82 A;  3S7I A;  3VZK A;  4QPG A;  3W20 A;  5FYB A;  3VKF C;  2CV6 A;  4YFZ A;  2ZGP A;  1W05 A;  2XL9 A;  5C3R A;  2DU0 A;  2GNM A;  2Y6F A;  4NWW A;  1GWM A;  1ND2 C;  2N7G A;  2ZX4 A;  5EJ1 B;  3ZMO A;  1DQ0 A;  4ITC A;  1DDL A;  4CDU B;  3MIH A;  1XJA A;  3H8R A;  4FAG A;  3JQW A;  1IOA A;  4XAE A;  3Q8F A;  3F2Z A;  2B5H A;  2D98 A;  2XL7 A;  3FFZ A;  5FXX A;  3JUU A;  2VY0 A;  2RM2 2;  3LA7 A;  4NJ4 A;  3VBO C;  1Y4W A;  2VW2 A;  1OT5 A;  1G6N A;  4H2A A;  4I0A A;  2QCS B;  2A3Y A;  2ZX0 A;  4QPI A;  1QJY 2;  3O1T A;  1GAN A;  4QXK A;  1Q5O A;  2PHL A;  2VVF A;  4XJW A;  1RL3 A;  2QJV A;  1OXC A;  4QX1 A;  3AB0 A;  4B4R A;  2E31 A;  2Z69 A;  4CCJ A;  1POV 1;  2W1U A;  2WIN B;  5CBL A;  4XFI A;  5LA0 A;  2JB8 A;  3J4U H;  3J8F 2;  2VUC A;  4XEZ A;  1CZS A;  3Q8C A;  4CEY C;  4KNC A;  4SBV A;  5F37 A;  1G7Y A;  2GAU A;  1I6X A;  4QX0 A;  3IBM A;  1Y3T A;  3SCG A;  5AC9 3;  4MET A;  4M3C F;  2JEM A;  4NRO A;  1AX1 A;  1GOF A;  1OVP A;  3OY8 B;  1CJP A;  3K2O A;  3NAP B;  1CGP A;  1DYO A;  5GZF A;  2BOJ A;  5KHH A;  4TYS A;  1NOV A;  3VBO A;  4JTO A;  3VUO A;  2VOT A;  2RHP A;  1O4Y A;  5FYM A;  1ND3 C;  2MEV 1;  1UPS A;  3BVC A;  2W46 A;  4JKM A;  1P8J A;  5FY4 A;  3OBR A;  4YZ5 A;  5FYV A;  1QQP 3;  1RC6 A;  2PMW B;  5FYY A;  2O14 A;  4YPJ A;  1QQP 1;  1RXG A;  1YHF A;  1BMV 2;  1YFX A;  4A2U A;  4EZH A;  3O12 A;  2QDR A;  3A0N A;  3U11 A;  5KHJ A;  4HXC A;  3AYD A;  1YCI A;  3MUZ 1;  4C90 A;  3WT3 A;  4WM8 A;  3VZJ A;  3Q8B A;  2VUJ A;  3LCP A;  2K46 A;  4DXS A;  1V6M A;  1GKB A;  1YUD A;  1OBN A;  4XAC A;  1R1Z A;  1A6C A;  4F3J A;  3RZK A;  4CDU C;  4YG3 A;  5KC6 A;  1W8T A;  2ZOE B;  2XBO 3;  4JVA A;  4BLJ A;  2Q5T A;  5JVV A;  1K5M B;  2W92 A;  1U12 A;  2W3J A;  4KWK A;  3RPQ A;  2RV9 A;  1JU4 A;  1J58 A;  1QOT A;  1PX4 A;  4GZ9 A;  1HKD A;  1JOJ A;  2WA4 A;  4RHV 2;  5EP9 A;  4YW3 A;  2VZP A;  4CVU A;  3KWV A;  5J37 A;  2BER A;  1UIK A;  2YZ4 A;  4XQD A;  4RYD A;  1RUJ 2;  1A8M A;  1V6N A;  5IVF A;  4AYU A;  5EV7 A;  2VU9 A;  3O1S A;  3E5U A;  1MZE A;  4XJZ A;  2CAU A;  3N36 A;  4MH0 E;  1EP0 A;  5DDJ 2;  4K40 A;  3H8X A;  4WZC A;  5A1F A;  1LHN A;  5I91 A;  1Q43 A;  3J7L A;  4XE9 A;  3ZXJ A;  2V4V A;  1Y9Q A;  2VZO A;  3S0M A;  4CDU A;  2XB6 C;  4LIU A;  4XMA A;  5T54 A;  4KBZ A;  3MO4 A;  1KQR A;  2VXJ A;  1X36 A;  1YC6 1;  5IVE A;  4NHM A;  1ULC A;  4YWA A;  4LBQ D;  2GME A;  4V1P A;  3HNY M;  2PAM A;  1XE0 A;  3NAP C;  5FZ1 A;  3KB5 A;  4CP1 A;  1N1T A;  4OUL A;  1K45 A;  3FN9 A;  1SDW A;  5C3O A;  1B35 B;  2NZ9 A;  3OGV A;  3LDB A;  2R16 A;  5FQ0 B;  2H0B A;  4CTE A;  3HQR A;  3R05 A;  4W50 A;  3BTY A;  2HLE A;  5JR7 B;  3WW4 A;  2A6V A;  2RJL A;  4Q0U A;  5L73 A;  1VBE 1;  2WS9 2;  1F5J A;  3I3B A;  5DN2 A;  5EXO A;  5KR7 A;  4IEO A;  2GH8 A;  3GAL A;  4B4Q A;  2K0G A;  1QJU 2;  1TNF A;  3ZN5 A;  4BQW A;  2R6Q A;  4URA A;  4TLF A;  2VCB A;  4CCM A;  2WNV B;  4CXW A;  3H7J A;  3KV9 A;  2XUM A;  3JBG 2;  3OUJ A;  3POF A;  5FZO B;  5FZ8 A;  1RB8 G;  3VBS B;  3NAP A;  1PMH X;  5GZG A;  2OUJ A;  1FXZ A;  1RUF 3;  3VZN A;  1XNB A;  1K5M C;  1UXX X;  3AZX A;  3N7M A;  1RUD 2;  1RUF 1;  3J9S A;  4FVV A;  1OVS A;  4ZS2 A;  4CCK A;  4DMI A;  3LIG A;  1GQP A;  2XVK A;  3QBQ A;  4JGZ B;  2W1S A;  1Q8P A;  1W8W A;  4AWD A;  2JIJ A;  5KXD A;  5IVV A;  1DGR N;  3KCX A;  1OQ1 A;  2OPK A;  1WLD A;  1RUC 3;  1ZZ7 A;  1JYW A;  4DUW A;  3T4V A;  5F2S A;  5G05 L;  1RUC 1;  3BIE A;  1OPO A;  2VW1 A;  1H6X A;  2R30 A;  2XVL A;  2XLA A;  4IET A;  3N9Q A;  4XF0 A;  3MIB A;  3SC7 X;  1W0N A;  4CP9 B;  4AQ6 A;  1S0E A;  5K0U B;  3GM8 A;  1EAH 2;  2OQ6 A;  2W39 A;  4FPG A;  4LO6 B;  3GF6 A;  4WVW A;  1R1A 3;  3DGT A;  1K5M A;  1UN1 A;  1VBB 2;  2EIG A;  4N9H A;  4AED B;  3EXU A;  3J7M A;  2G1M A;  2R04 3;  5A3L A;  4DY3 A;  3I2H A;  2IZW A;  5FPB A;  2BWA A;  5FY7 A;  2LUW A;  1W6M A;  5FP3 A;  1AYN 2;  1J84 A;  1B35 C;  3D0J A;  1WKY A;  4R9D A;  3VBR A;  2D6N A;  2YG0 A;  2WO7 A;  4XF3 A;  1J3Q A;  4AFB A;  4ATE A;  3WHT A;  4XUO A;  4FFH A;  5F6K A;  4LXL A;  4DNY A;  4LKF A;  4XQ4 A;  1NE4 A;  4JX0 A;  2IXK A;  1BK0 A;  2ARB A;  3AL6 A;  1UY0 A;  3AYA A;  1GZW B;  3S30 A;  1WD3 A;  1JZ5 A;  3CKH A;  2PQS A;  5A7N A;  1Z0H A;  4M3C A;  4P9Y A;  3LPG A;  4PBO A;  3B9C A;  2RM2 3;  3ABZ A;  2UWB A;  3H1Y A;  4W6W A;  1IKP A;  1JU3 A;  2WNV C;  2AH2 A;  2RM2 1;  1QH6 A;  2KD7 A;  4HSL A;  5F9T A;  3MHZ A;  1IS5 A;  2TUN A;  5FO8 B;  1FOD 2;  5FZI A;  4OFG A;  2XUE A;  4F8A A;  3VD4 A;  3OGS A;  3KLS A;  4A7K A;  1QJY 3;  3KS7 A;  1QNY A;  1AX2 A;  1QJY 1;  1B35 A;  1D0G A;  5HXV A;  4NHX A;  1ODM A;  4P9I A;  1S0B A;  4PIZ A;  4CDX A;  3PVE A;  1H9W A;  5FZ3 A;  1YYN A;  3FLR A;  4JGZ C;  1E5S A;  2CGP A;  3J8F 3;  1UD1 A;  1UW8 A;  4DRR A;  3SH4 A;  5EYY A;  3N4M A;  4LHL A;  1DCS A;  3ACH A;  2ET1 A;  3J8F 1;  4P9W A;  3HAG A;  4E4H A;  2YV8 A;  4K7J A;  1VR3 A;  2D3S A;  2H6B A;  1RJ8 A;  5DG1 A;  1W28 A;  3DUI A;  4AQT A;  4IEU A;  5FZ0 A;  4TN7 A;  2ERF A;  4HL0 A;  1PGS A;  1ZZB A;  4R9A A;  2WNV A;  1ODN A;  1YQ5 A;  2R7E B;  5K0U C;  5FZO A;  1DLC A;  5GLT A;  5HV0 A;  5JR2 A;  2WT2 A;  1LU1 A;  5EPA A;  1URX A;  2OA2 A;  2LW8 A;  4AED C;  3B69 A;  1XQN A;  5HCA A;  2WA3 A;  1XRU A;  4YZ3 A;  3VHN A;  3O0X A;  4MXV A;  4CU7 A;  4AW7 A;  1TZO A;  1CQ9 A;  1SLA A;  4PJY A;  3SKV A;  5K7P A;  2VMC A;  5FPL A;  3WV6 A;  1BMV 1;  2WQ4 A;  4GQ7 A;  5LWB A;  2DCZ A;  3WZ1 A;  4BK4 A;  3URF A;  1LEN A;  4LNV A;  2R07 2;  1JZ4 A;  5T3N A;  3HNB M;  1C3H A;  4Q29 A;  3L2Y A;  3H42 B;  2E7Q A;  3VV1 A;  1UKG A;  2RR1 2;  3AX4 A;  3LEK A;  3WP5 A;  3LEG A;  2JE7 A;  2WWS A;  4FFF A;  3UYJ A;  3NRU A;  1C8M 2;  2K9Z A;  4AVB A;  4IE7 A;  2B42 B;  2X29 A;  4CDQ B;  4A7Z A;  4NO4 A;  1IS3 A;  3U07 A;  3L2H A;  2BEO A;  1ULP A;  3IT8 A;  3BPZ A;  5K0U A;  5L9R A;  1U5I A;  2E51 A;  4PT6 A;  3WDT A;  1JH5 A;  4ES8 A;  5KHG A;  4RHV 3;  5DMY A;  1DYP A;  3QAC A;  4V2W A;  1DIW A;  4RN5 A;  2WN2 A;  4RHV 1;  1I5P A;  3H3Z A;  4MXW B;  5C9A A;  4YLZ A;  3WLU A;  3LA3 A;  4D7S A;  2J1S A;  1RUJ 3;  1ZRI A;  2ET7 A;  1M06 G;  4BWO A;  1A34 A;  3R4U A;  3Q8E A;  1SCR A;  1RUJ 1;  3NW4 A;  3AFK A;  3NMB A;  3VDD B;  3ZFE B;  3ZN6 B;  4XFG A;  2JDZ A;  5LY1 A;  4OUE A;  3VN4 A;  4ZON A;  4XHX A;  1W04 A;  4QU1 A;  2ATF A;  5DDJ 1;  2JG8 B;  4YM3 A;  5JOX A;  4DRV A;  1HJF A;  2Q4S A;  2ZHN A;  3P3P A;  4O9E A;  4QAW A;  1SBD A;  4FQZ A;  1GZW A;  4GJY A;  4JRA A;  2J1U A;  2R1D A;  1C1F A;  1KS4 A;  1OLQ A;  2ZGS A;  3LB9 A;  2F6B A;  4FBF A;  4TXW A;  2RDS A;  2XJP A;  1MVQ A;  1W2O A;  1V9U 2;  3VBU B;  4LHK A;  1SG3 A;  3CJI C;  4UFJ A;  3CL1 A;  2WLP A;  5L19 A;  1W6Q A;  1M4W A;  3D5O A;  4GKY A;  4A42 A;  5JSP A;  3IAP A;  5EZW A;  1V6J A;  4XYX A;  4EYU A;  5AFB A;  2WS9 1;  3LGR A;  4MV2 A;  2DFB A;  4D7Y A;  2WNE A;  1ST8 A;  4OMC A;  2EF6 A;  5FZL A;  4ZXE A;  4MGY E;  4XBL A;  4BYY A;  1LOE A;  4CDW B;  1QJU 1;  3MPP G;  3ZYB A;  2BFU S;  4UF0 B;  4YZ2 A;  1PVX A;  3LF7 A;  4YSF A;  4MGS A;  5CAD A;  4XUR A;  1SQ4 A;  1NG0 A;  2P17 A;  2HEW F;  3JBG 3;  1A3K A;  3MIC A;  1IHM A;  5FZH A;  3JBG 1;  1DGW A;  4DFS A;  1N3Q A;  3WG1 A;  5LK5 A;  3PJQ A;  4CUA A;  5FOJ B;  2AEZ A;  4CDQ C;  2UWA A;  2C1F A;  1MEC 1;  4YYO A;  1RUD 3;  1IG3 A;  3SMH A;  5A7O A;  2DTY A;  1W06 A;  3CJI A;  4IV3 A;  4LBK A;  1NLR A;  3LQC A;  1RUD 1;  3P3N A;  3WW3 A;  5BYN A;  2ZHK A;  3FWE A;  3U4X A;  1WA6 X;  4MGI E;  4DS0 A;  2QQJ A;  3I97 A;  4LEJ A;  2HBU A;  1UYY A;  5K8S A;  1LOD A;  5JI7 A;  1V6I A;  4XUT A;  1YQC A;  4YW5 A;  4CCC A;  2RS5 3;  3VLB B;  1VE0 A;  4PQQ A;  1LHO A;  2QE3 A;  3B02 A;  3BN6 A;  4I02 A;  4Y1Z A;  4Z8B A;  1TME 3;  5DUV A;  3H3U A;  5FYT A;  1XOY A;  5E8A A;  5FZE A;  3VDD C;  3ZFE C;  4ET7 A;  5LZ6 A;  2WT1 A;  3D4K A;  2SBA A;  1CES A;  4Y22 B;  5FMO S;  2D97 A;  3D8C A;  2YYO A;  4LBQ B;  3E5X A;  1BXH A;  3IM0 A;  3TN9 2;  1W9S A;  3UKN A;  2TEP A;  1UYP A;  1EAH 3;  1GUI A;  1NLS A;  1EAH 1;  4OMD A;  4CDQ A;  4QKD A;  4KWL A;  1ZRE A;  3POS A;  4Q0S A;  1KGY A;  2CGO A;  1VBB 1;  4J1W A;  1BHG A;  4UW6 A;  5T52 A;  1UZW A;  4A45 A;  3VD7 A;  2VME A;  5JOZ A;  2IC1 A;  1BBT 2;  4QHB A;  5DUU A;  3VBU C;  1AYN 1;  2RDQ A;  1WBF A;  4MXW A;  3VD9 A;  2Y33 A;  1DZT A;  3KGZ A;  5JI9 A;  1AR9 2;  1CIW A;  1HN1 A;  3KD4 A;  3M2M A;  2DTW A;  3VDD A;  4FPJ A;  3ZN6 A;  3ZFE A;  1OA3 A;  5A32 B;  3ZN4 A;  4O61 A;  4ZZ5 A;  3ZYJ B;  1PMI A;  3KVA A;  1LRH A;  3ZX7 A;  1HB2 A;  1OSG A;  1W8H A;  3QCW A;  1CD3 G;  4N43 B;  1O4Z A;  4IEP A;  3IN9 A;  1RUG 2;  2JDH A;  5E89 A;  4UBG A;  3VHP A;  1WCQ A;  4CDW C;  5IK5 A;  1Y9G A;  5JMC A;  1AYM 1;  4OYU A;  3KT1 A;  2WO2 A;  3GGL A;  5FMB A;  2FZ1 A;  3PVB B;  4XXP A;  5BPX A;  2D5H A;  1FOD 1;  1Q8Q A;  5LAS A;  2FCU A;  5L9B A;  3SNM A;  2WII B;  4CCL A;  5CG9 A;  5JXI A;  3KHC A;  5D21 A;  3O1P A;  4FPO B;  3TB0 A;  4AHX A;  1DZR A;  3KV6 A;  3RNS A;  1QDC A;  1YRZ A;  1RVF 2;  2KXL A;  2NMN A;  3ZVX A;  3V0B B;  1VRB A;  3POG A;  1JZ6 A;  1UXZ A;  5BNN B;  4UBH A;  2Q8D A;  5EJ3 A;  2YU2 A;  1QIQ A;  1F8V A;  2YC4 A;  4OCT A;  4TLG A;  2XWB B;  1H8V A;  4HFS A;  3I3D A;  4NRP A;  3I3E A;  4CDW A;  4UF0 A;  4UW5 A;  1OA2 A;  3T0B A;  2Y60 A;  3JB4 C;  2NPI A;  1MR5 A;  1W0O A;  4XIL A;  4XUN A;  3PUI A;  2ZA9 A;  5LRS A;  2EAA A;  5FKC A;  3OBT A;  3MFC A;  4CEW B;  4AVS A;  2HYK A;  4HN1 A;  5FZG A;  2ZAB A;  3R0R A;  5KXB A;  1Z7S 3;  1LCL A;  2WFP A;  3AYE A;  4AVV A;  4HVR A;  4FO9 A;  4NAM A;  5T50 A;  1ZRD A;  1NA1 B;  2IXC A;  2E7T A;  4RS5 B;  4Y5T A;  5FCC A;  5CFC B;  3IKW A;  3FLT A;  1UZY A;  1OH4 A;  3N7J A;  3NJY A;  4LOT A;  2B7Y A;  3OYW B;  2Q1F A;  1OUX A;  2WR9 A;  3UT0 A;  2R07 1;  3JU9 A;  3WDY A;  1ZBA 2;  3RYR A;  1XE7 A;  2VQ0 A;  2RR1 1;  4Y22 A;  3ECQ A;  4DO0 A;  1C8M 3;  5F7U A;  2W5F A;  4LBQ A;  5GLV A;  4N43 C;  4YGC A;  1C8M 1;  2CL2 A;  2PHF A;  4FOW A;  2W68 A;  1F2N A;  1HX6 A;  1PZ7 A;  4CCE A;  1W0P A;  5A3T A;  2XR4 A;  3PLQ A;  1IPJ A;  3ZYH A;  5EIY B;  5FZC A;  1SMV A;  2EXK A;  3IPV B;  1NZI A;  1PNG A;  1A8D A;  2YBS A;  4LK6 A;  2D6L X;  3NO8 A;  2GZW A;  1XSR A;  3O0W A;  5F6L B;  1K12 A;  3DCQ A;  5FY8 A;  2LS6 A;  5I93 A;  2BU9 A;  3N7L A;  1WW5 A;  1HRV 2;  1QJZ A;  2WFF 2;  5K4L A;  4AK3 A;  2R1B A;  5ACA 2;  5FTT C;  1W9T A;  2QQK A;  2AZ5 A;  5FLI A;  5C8C B;  2XG3 A;  5A32 A;  3B00 A;  1UNB A;  2YMZ A;  4H55 A;  3FJS A;  5BNN C;  2O8Q A;  3EO6 A;  4LOR A;  4PLN A;  4N43 A;  4XFA A;  1XPW A;  4AFM A;  4D6R A;  3NNJ A;  2AYH A;  4BDV B;  5BNQ A;  3JD7 2;  3ZYR A;  5KXC A;  1S4C A;  4D94 A;  1LEM A;  1XYP A;  2EAK A;  4YW1 A;  2J1E A;  1W2N A;  1ZA7 A;  1BQP A;  2EIC A;  3LIH A;  1V9U 1;  3MLJ A;  1SLL A;  2WKK A;  2ZMN A;  1O4T A;  4KQ7 A;  5C7G A;  4CPB D;  2XHN A;  4CEW C;  4HON A;  1MVE A;  4L99 A;  4LUL A;  3WD5 A;  4GAL A;  4CXX A;  4BME A;  4DB5 A;  3HBZ A;  2NM1 A;  3AMH A;  2VCM A;  4H7L A;  4K9S A;  4YM1 A;  1PZ8 A;  3FC0 A;  5FMC A;  4BQ2 A;  1CAW A;  1PMJ X;  4UFI A;  3PUQ A;  1NA1 C;  2WZ8 A;  4RS5 C;  5CFC C;  2A71 A;  2RJ2 A;  4RQP A;  3W59 A;  2IXI A;  1OLM E;  4GMP 3;  5BNN A;  4BOW A;  4IEV A;  1XSQ A;  4AXO A;  3LFM A;  2E32 A;  4GMP 1;  5I0R A;  3T0D A;  3AMM A;  4XF9 A;  4EV0 A;  3RSJ A;  3D0S A;  2GND A;  3THT A;  5CAZ A;  1RYY A;  1PVC 2;  4LOS A;  4XCA A;  1VJ2 A;  1J59 A;  1SLT A;  2ZML A;  2JKX A;  1STM A;  3F95 A;  3IDE A;  2CAV A;  4RR3 B;  4UFL A;  4WVV A;  4X6Q B;  5IT6 A;  3K48 A;  3SCH A;  5L9V A;  4NHK A;  2OW4 A;  1ZZ8 A;  4LPL A;  1UX6 A;  5IVB A;  4O65 A;  4M4R A;  2VTX A;  1RTV A;  3WG2 A;  4ONU A;  4AVA A;  1VB2 A;  3SH5 A;  3DL3 A;  1SDD B;  4XF1 A;  1NA1 A;  4RS5 A;  2ZEY A;  5CFC A;  1N47 A;  4FTE A;  3CNA A;  1QOO A;  1GWL A;  1FNY A;  1HLC A;  2PLV 2;  2UY8 A;  2WZR 2;  4FXK B;  3C7E A;  5HBA A;  4NPR A;  4TWT A;  3A22 A;  4QKF A;  5CG8 A;  1FPN 2;  4HT1 T;  5JSO A;  2HWE 2;  1GYK A;  4QXB A;  2DCJ A;  2BUK A;  3ROU A;  3GBG A;  2JDP A;  2SLI A;  3N9P A;  3RMY A;  3TN9 1;  4BXF A;  2Q1M A;  3MFA A;  2Y34 A;  3CF6 E;  1GOH A;  5ABJ B;  2BGP A;  2VGD A;  3LD8 A;  1AF9 A;  4MO3 M;  4AEM A;  1SFP A;  3M3I A;  3V0A B;  4NID A;  3ZKU A;  1O59 A;  5LB6 A;  1ZZC A;  2VE1 A;  4JV4 A;  3ZXE A;  1VBC 1;  1AVB A;  1N1V A;  3B7M A;  3IPV A;  2J1T A;  3DKQ A;  4IEQ A;  4U36 A;  2D6M A;  1KDM A;  2VNR A;  3NV2 A;  4AEK A;  1BBT 1;  1GQG A;  2CDO A;  1U5Y A;  2P3I A;  1AR9 3;  4EWA A;  1X33 A;  1S2E A;  3OPW A;  3B01 A;  3RI8 A;  1AR9 1;  1Q56 A;  1FMD 2;  1APN A;  3HT1 A;  1NY7 2;  4PHZ A;  1K3I A;  2X5I A;  5D2A A;  5FY1 A;  4P9J A;  3N35 A;  1G8W A;  1RUG 3;  2NYY A;  1ULG A;  4YW2 A;  5JXH A;  2BWC A;  3ZFF B;  1N1S A;  1RUG 1;  3OGR A;  2ZHM A;  5LEK A;  3PVN A;  3THP A;  3JB8 A;  2OVU A;  4GH4 B;  3KHB A;  4JTN A;  4KU7 A;  4NWV A;  4OZO A;  4AI8 A;  4QDQ A;  4BQY A;  3D82 A;  4YG0 A;  5IK7 A;  3RZM A;  1OKO A;  2ZTN A;  1V6L A;  5LA2 A;  3VKO A;  3SLI A;  1LNS A;  4Y20 A;  1PK6 B;  1S0G A;  3ZSM A;  4RR3 C;  4YZ1 A;  1GZ9 A;  2ZZQ A;  3I7D A;  1QNW A;  5T5O A;  3HT2 A;  4S2D A;  1IZ3 A;  1RVF 3;  4XIO A;  3U75 A;  2NLR A;  1ULE A;  1RVF 1;  1REF A;  4QB1 A;  1LHU A;  2IVI B;  4XTM A;  1BCX A;  1GV9 A;  1MAC A;  3E6B A;  3P6B A;  1UCX A;  1Z78 A;  4GB3 1;  3K46 A;  1POV 3;  1BVV A;  1MS5 A;  2EIB A;  2WSU A;  3BU7 A;  4LR4 A;  5FPA A;  5IJR A;  3I2O A;  4FSJ A;  3M4F A;  1TVG A;  4TTG A;  5FBJ A;  4DPN A;  2QQU A;  3VDB A;  5J09 A;  1SPP A;  1WW4 A;  2BBA A;  1ND2 A;  2DVD A;  2HJI A;  3VGI A;  1RIT A;  3WP6 A;  4YGD A;  3WXP A;  2I2S A;  4BJ0 A;  1DGW X;  4N9I A;  5CVR A;  4AFA A;  1ZX5 A;  1UIJ A;  1AL2 2;  2ARE A;  2GU9 A;  3E97 A;  2W2I A;  1YJL A;  2Y6K A;  3D6E A;  3LAG A;  1Q3E A;  5J1X A;  3RZZ A;  3M3Q A;  5ABJ C;  5KBF A;  2W08 A;  1H2K A;  3WDU A;  3ZMN A;  1W6O B;  4KH9 A;  3WNX A;  1QOS A;  4QX8 A;  5G04 L;  2MEV 3;  4ISQ A;  2ZHL A;  5I8Y A;  4BH9 A;  4UYB A;  4Y1Y A;  4O9G A;  4KL1 A;  2IFW A;  5CKQ A;  5HPO A;  1NAE A;  3I3Q A;  5LRR A;  3GDB A;  2EXH A;  4H3W A;  5IAX A;  1CWP A;  1YFU A;  4S2F A;  4CYD A;  4PCR A;  2HYX A;  3DN7 A;  1WMX A;  3K4Z A;  2KM2 A;  3K4A A;  1ZBA 3;  5ANN A;  5A6Q A;  1MS8 A;  5C4W C;  1KRI A;  4ASK A;  1I5Z A;  4DXT A;  1ZBA 1;  3DKW A;  3WY6 A;  4DEQ A;  2ZBJ A;  4CEY A;  2XLF A;  4UXA A;  3ZSJ A;  3DYM A;  1X7N A;  1UOF A;  2G9Z A;  3DV8 A;  3J7N A;  3KQ4 B;  4LO7 A;  3ZFF C;  4ERO A;  1JW6 A;  4Y1V A;  4HOO A;  1JYI A;  3OB8 A;  4G3Y C;  1S0D A;  5ABJ A;  4GH4 C;  3V0A A;  1ENS A;  4XFC A;  3RI9 A;  1GNZ A;  4EE2 A;  2BV4 A;  2OUH A;  3C7F A;  3CDZ B;  2MNG A;  3ZPY A;  2UUR A;  3AXD A;  3QLQ A;  1OFS A;  4QD2 A;  2Q8C A;  3LA2 A;  3ZYG A;  5FR3 A;  4R4X A;  5IFP A;  2Y26 A;  1NYW A;  4ZU5 A;  5BNP B;  2W52 A;  1NLQ A;  1NXM A;  1ND3 A;  1ENR A;  1UKR A;  2WFF 3;  3QOP A;  1PK6 C;  4NUB A;  1D2S A;  1QJF A;  1HRV 1;  2IFR A;  2WFF 1;  1RMU 2;  1WLT A;  4I01 A;  4ARX A;  5ACA 1;  4DQA A;  1YFY A;  3N9O A;  5E88 A;  5C4W A;  4CRQ A;  3UL2 A;  2VQT A;  1NE6 A;  1PO1 2;  4NIH A;  4KGG A;  3RWK X;  4KWU A;  4MGZ E;  2MHF A;  4KI5 M;  4FFG A;  5FYZ A;  2WJS A;  1WW6 A;  3RVH A;  1RIN A;  3I2F A;  3JD7 3;  1UY1 A;  3ZFF A;  2E6V A;  4IEY A;  4BQX A;  2NQY A;  3JD7 1;  5JWP A;  5FZ6 A;  3MLK A;  4GH4 A;  1CN1 A;  3N9M A;  4JDM A;  1ASJ 2;  2OZ6 A;  4W4Z A;  5FUI A;  2OXB A;  3VZO A;  4AED A;  3X29 B;  4Z2A A;  5FY5 A;  4IE0 A;  3O5S A;  4AEJ A;  4CU6 A;  2WC2 A; 
#chains in the Genus database with same CATH homology
 5FY8 A;  3K3N A;  5FZD A;  5FPL A;  5FZO B;  5FZ8 A;  5K4L A;  5LY2 A;  4BU2 A;  5FPU A;  5LWB A;  5F3G A;  5F37 A;  2OX0 A;  4CCK A;  5FPV A;  2XML A;  3DXT A;  4XDP A;  3KV4 A;  5FP4 A;  2GP5 A;  5FWE A;  5F5C A;  3UYJ A;  4Y33 A;  2OQ7 A;  4D6R A;  3K2O A;  5ANQ A;  5F3C A;  5IVV A;  3KVB A;  2YBP A;  5FXW A;  5FYM A;  5A7S A;  4CSW A;  5F2S A;  2Q8E A;  5FZK A;  3AL5 A;  4V2W A;  5FYH A;  5FZ7 A;  4D6S A;  5A3N A;  5FY4 A;  3KVA A;  3N9Q A;  5FPA A;  5FYV A;  5A3W A;  5FJK A;  3PUR A;  5FYY A;  3KV5 A;  4BIS A;  5FXV A;  5FBJ A;  5F32 A;  4XDO A;  2XDV A;  4EZH A;  2OT7 A;  4HON A;  2OQ6 A;  5FYS A;  5FYU A;  3K3O A;  5CEH A;  3AVR A;  5FJH A;  5A80 A;  5LY1 A;  4CCN A;  4LIT A;  4QU1 A;  2YPD A;  2W2I A;  3PUQ A;  4CUG A;  5FPB A;  5FY7 A;  5LW9 A;  2P5B A;  3AVS A;  4DIQ A;  3PU8 A;  5FP3 A;  5FXZ A;  5FZ9 A;  4CCL A;  4GD4 A;  4AI9 A;  4GJY A;  3PTR B;  4IGQ A;  4QX8 A;  2PXJ A;  3KV6 A;  4QWN A;  5F39 A;  5FYI A;  5A3P A;  1VRB A;  4LXL A;  5IVC A;  3PDQ A;  4C8D A;  4QX7 A;  4IGO A;  4LIV A;  3PU3 A;  5F3I A;  3AL6 A;  2Q8D A;  2YU2 A;  5IW0 A;  4CCO A;  4ASK A;  5E6H A;  5A7N A;  5FZA A;  3PUS A;  5ISL A;  3U4S A;  5IVB A;  4IGP A;  4UF0 A;  5FP9 A;  4GJZ A;  3ZPO A;  5FP7 A;  2WWU A;  5IVY A;  5FZF A;  4D6Q A;  4QXC A;  5IVF A;  4EYU A;  5FZB A;  2OS2 A;  4HOO A;  5FZI A;  2XUE A;  5A1F A;  5FZL A;  5FWJ A;  4UF0 B;  4LIU A;  2Q8C A;  4QXB A;  4Y3O A;  5FZG A;  5FYB A;  2VD7 A;  5IVE A;  5FY9 A;  5FZ3 A;  5FZH A;  3N9P A;  3ZLI A;  4BXF A;  5IVJ A;  5A7Q A;  5FZ4 A;  5FUN A;  4NUB A;  3LD8 A;  5FZ1 A;  4QXH A;  5IWF A;  3NJY A;  5FP8 A;  4E4H A;  5A7P A;  5FUP A;  5A7O A;  3LDB A;  3N9O A;  3OPT A;  3U78 A;  2YU1 A;  5A7W A;  5F5I A;  4EZ4 A;  3N9N A;  5FXX A;  4DO0 A;  5FYC A;  5FZ0 A;  4TN7 A;  5FYZ A;  5FZM A;  3RVH A;  5KR7 A;  2WWJ A;  3OPW A;  5F2W A;  5A3T A;  2GP3 A;  5A1L A;  5FYT A;  5FZO A;  5FZ6 A;  5FZE A;  2XXZ A;  3N9M A;  5F5A A;  5FV3 A;  5A7W B;  5FZC A;  2YBS A;  5F3E A;  5FY1 A;  5FY0 A;  4V2V A;  4AAP A;  4GAZ A;  3DXU A;  4URA A;  4CCM A;  3PUA A;  4Y4R A;  3N9L A;  5FY5 A;  2YBK A;  3KV9 A;  4CCJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...