3OCPA

Crystal structure of camp bound cgmp-dependent protein kinase(92-227)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
127
structure length
127
Chain Sequence
SHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PRKG1 protein
publication title Co-Crystal Structures of PKG Ibeta (92-227) with cGMP and cAMP Reveal the Molecular Details of Cyclic-Nucleotide Binding
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature ec 2.7.11.12: cGMP-dependent protein kinase.
pdb deposition date 2010-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ocpA00
2XLGA 4AQ6A 2CV6A 5KHGA 1O4TA 4E2QA 4IEVA 4TLFA 1YFWA 1ZRDA 4AQ2A 1ZRCA 5I91A 4JTOA 2QCSB 3OTFA 4MH0E 3U10A 4L11A 3RPQA 2ET1A 1ZZCA 2OA2A 1QWRA 3H1YA 4NVPA 1FI2A 4IEXA 5I93A 1VP6A 4XF0A 1OI6A 4XFIA 1EP0A 4F8AA 1CAVA 4H7LA 4DINB 1QXRA 5E16A 2VPVA 3WW3A 4LUMA 2GC1A 1CAWB 1UPIA 3MDPA 4QGNA 1VJ2A 4Q0VA 4LTAA 4O9EA 5J48A 2MNGA 1JUHA 3ES1A 3B02A 1Q43A 4R8HA 3ETQA 5FLHA 2ET7A 3IIAA 2IXIA 4PIXA 2PAMA 2GC2A 4MGKE 3DV8A 3IDBB 2UY8A 2E9QA 3H7JA 4I2OA 3BU7A 1OFNA 5FLIA 4E2GA 4OFGA 3H7YA 1U12A 5C8WA 2IXHA 3U0ZA 2IC1A 1NE4A 5CADA 5CVRA 2B9UA 4D7TA 4IEOA 1CAXB 4N9IA 1DZRA 1OMIA 2FMYA 4Q0SA 5EFUA 1YHFA 2Q1ZB 4QXKA 1CGPA 5BXXA 4LEJA 4UBHA 3IBMA 4MX3A 2XKOA 3WW4A 2Q4SA 3CLPA 3DKWA 3OCPA 2WC2A 3E5QA 3JZVA 3E97A 5I0UA 4ZU5A 3RDIA 3USSA 2EA7A 3N4MA 1DZTA 2QJVA 3C3VA 3LA3A 4MUVA 1SQ4A 4L2NA 1I5ZA 1NYWA 4MV2A 4UBGA 2Z2SB 1ZRFA 1EYBA 3BALA 1O5LA 2XGXA 4QM9A 4BYYA 3EO6A 2N7GA 4YARA 1O3SA 3L2HA 5FPZA 5FQ0B 4IERA 4GULA 2H6CA 4XFGA 2D93A 2QDRA 4P9GA 2DCTA 3BB6A 4HMZA 1NZCA 3EJKA 2EAAA 2MHFA 5BV6A 3ROUA 1RUNA 2Y0OA 5JR7B 3SCHA 2ZKLA 2XHKA 3LZZA 1LR5A 3M3IA 3OGJA 4HVOA 1O7FA 2UYAA 3QOPA 1ZNPA 4EV0A 2P17A 3EHKA 4QX5A 3SHRA 3FZ3A 3M70A 1EPZA 5BY5A 3LWCA 2CAVA 4IETA 3O14A 1X7NA 4CYDA 5FPXA 1IPKA 5FCCA 2OYZA 2BNMA 4J1WA 3MZHA 5KHIA 1YFUA 5JSPA 5K8SA 4QGMA 1UIJA 3H1WA 3PLQA 3NVCA 2B5HA 3FX3A 4I01A 4UXAA 4QMAA 3VHRA 5BPXA 1NXMA 4FT8A 3D82A 1EY2A 1FXZA 3I59B 2GZWA 4BIFA 2IXKA 3CF6E 1ZZ9A 1Q3EA 5J7MA 4Q0PA 4HLTA 2H6BA 3G7DA 2GC3A 3H9AA 1YFYA 1OD5A 3I54A 1J59A 2O8QA 3RYKA 2GC0A 3CEWA 3LAGA 4Q0UA 2PHDA 1LRHA 4I02A 2XLFA 3OF1A 3H8UA 2PYTA 5LEKA 2GU9A 3PVBB 4FAHA 4HN1A 3FHIB 3UKNA 4LLOA 4MGIE 4FBFA 4LA2A 3E5XA 3MPBA 1WLTA 2ZCWA 3UKTA 2WFPA 1ZREA 1Y3TA 3NW4A 4HBNA 2QVSB 1TQ5A 1ZZBA 1X8MA 3NKTA 5I0SA 1L3JA 1YFXA 3E6BA 5AVPA 4OLLA 1XRUA 3KMHA 1HW5A 1XE7A 2Z69A 1O3TA 2BEOA 2D40A 4HVRA 4ZU4A 4Z82A 1X8EA 3IDCB 4XF4A 3H3ZA 5KHHA 4N9HA 4YNIA 1O5UA 3RYPA 4AVAA 1UD1A 2CAUA 4K8FA 4XFCA 2OZ6A 2XLAA 2K0GA 4I0AA 1J3QA 2XL7A 3LOIA 1YLLA 3FFQA 1FT9A 4J1XA 2BYVE 1DGRA 3CL1A 3HIFA 3PNAA 4XEZA 1H1IA 5JSOA 4I09A 5I0TA 2ATFA 3LA7A 2QNKA 5KBFA 1RTVA 1PMIA 1Y9QA 3EBRA 1YWKA 5JAXA 3FE5A 4Q29A 3KCCA 3CJXA 4I3PA 1X82A 2HJIA 3RZZA 1LKNA 3NJZA 1NE6A 5I8YA 5KHJA 3BCWA 1DGWA 4EROA 3RYRA 4IEYA 3GYDA 3MYXA 4AVCA 1UW8A 4KWKA 1J58A 3KGLA 2K9ZA 1CAWA 4QGLA 1WGPA 1UCXA 3E5UA 3S7IA 3HT1A 5JSRA 4HVQA 4YYOA 5LRRA 4XF1A 4XF3A 2MPFA 2HKXA 2KXLA 4HZFA 5BUVA 3ZDSA 2ETEA 3ST7A 4IEQA 2GH2A 4AVBA 2GAUA 2H0VA 1O3QA 4XF9A 4IEPA 4YRDA 2I45A 4R52A 1QY4A 5JCTA 2CGPA 3GBFA 3DN7A 4ONUA 1IPJA 2D5HA 4B29A 1CAUB 1SEFA 4LULA 4X6RB 1Q5OA 2UYBA 5KHKA 4RD7A 1QXJA 2PAEA 1CAXA 3ES4A 1YUDA 4XFHA 2OPKA 4HN0A 3LA2A 2F4PA 1J1LA 4I0BA 4HSJA 3HQXA 3TNPB 5HI0A 4IEZA 3WW1A 1ZZ6A 4JTNA 4IEUA 3U11A 4AXOA 3SXWA 2IXLA 5EZWA 1ZZ7A 4XETA 2OZJA 2V09A 3DL3A 2BNNA 4O9GA 4X6QB 4LA3A 4META 3UKVA 3KSCA 1RL3A 2IXJA 4PIZA 3H3UA 3FJSA 4KWJA 4KL1A 2UY9A 4A2UA 1RUOA 2XKPA 5CU1A 3H1MA 1PM7A 4MZUA 2XL9A 1RGSA 1CX4A 5I8TA 1UIKA 3TNQA 3E6DA 1LB2A 5FQ0A 4KWLA 5I0RA 4BH9A 5J3UA 4KU7A 5C6CA 3D0SA 4IESA 1RC6A 4JVAA 3IWZA 5E1RA 4D7SA 3ACLA 1ZVFA 1CAVB 2BGCA 5F1RA 5I8SA 1V70A 4WZCA 1VR3A 1ZZ8A 3RNSA 3KGZA 4F7ZA 2PHLA 3QACA 2BNOA 3H50A 4WVZA 2IXCA 4PJYA 4LUKA 3FWEA 4IEWA 5FLJA 4EWDA 3E6CC 1WA4A 4Z07A 2O1QA 5FDBA 3S7EA 4HSLA 3R6SA 4Q0QA 1GQHA 3I7DA 1ZX5A 2Q30A 2EVXA 4XFFA 2VECA 5LEJA 1J3RA 3WW2A 4E2SA 3SMHA 4YSFA 4JV4A 1GQGA 2Q0AA 3S0MA 3I59A 1J3PA 4ORFA 1SFNA 4PIYA 2C0ZA 1O3RA 2PTMA 1G6NA 1CAUA 2D5FA 3OD0A 1I6XA 5LRSA 3SCGA 2PA7A 4BHPA 4EWAA 2PAKA 4KU8A 2PQQA 3SCFA 2B8MA 3NSTA 4QM8A 1XE8A 4XFAA 4EWEA 4ZU7A 1ZRRA 5D1IA 3HT2A 4XFBA 3ELNA 4FAGA 3CO2A 4WBBA 3EQEA 1H1MA 2PFWA 4MGYE 3NL1A 4MGZE 3D0JA 2VQAA 2FQPA 5T3NA 3BPZA
chains in the Genus database with same CATH superfamily
5GZEA 5LK5A 3VHPA 3AKQA 4P9LA 3VZMA 1HIXA 4OMDA 1OLRA 2GP5A 4IEVA 5EPAA 2RS33 3IDEA 3PHMA 1XQNA 1ZRCA 3P3NA 2F4LA 3V0BB 1W6OA 1ULOA 4DZGA 5CFDC 1W9FA 3VD4A 1NAEA 1TNRA 3OTFA 1OPMA 1V6JA 4GB31 3N3HA 3U10A 2PLV3 5FXWA 2OPWA 1KEXA 3AMMA 3Q8AA 3RPQA 1PO13 4OHWA 1JZ4A 2VQ0A 1AR91 1AR72 1QWRA 4O61A 4COYA 3H1YA 1ENSA 2BQPA 3KVAA 1AR61 1GLHA 3VBHA 3T0BA 2CNAA 2ZGUA 1VP6A 5I93A 4Q4X2 2BERA 2HWD2 3E1F1 1OI6A 1DQ2A 2PHFA 4F8AA 2VCMA 5A7OA 1VBC1 1RUG3 5C5TA 3BN6A 3O1TA 1Q8PA 2Y0IA 2E53A 2ZGMA 1GFF2 4PDWC 1F15A 5FP8A 5GKAC 3RZJA 1QJEA 5IVYA 1W2UA 3AL5A 4JHZA 4LHNA 4Y5Z0 1HJFA 1MQTC 2WA3A 2X5IC 4FPKA 1Q56A 4LUMA 2HWB1 2EAKA 4AVSA 4AQSA 4AAPA 5F5CA 3MDPA 4DXSA 1AX0A 2DV9A 2JDNA 4LTAA 4Q0VA 1ND3C 4ZHNA 3ILFA 1E5HA 4NIHA 1Q8SA 1W04A 1JN2P 3THCA 5IHRA 1WCSA 3FHAA 1RUI3 4R8HA 2JDPA 1P8JA 2OQ6A 4PBOA 1GNZA 1V6OA 3ETQA 4JHTA 4UI9L 3T1LA 1VBE3 5FBZA 3RS6A 1H8TA 2WQ4A 2BW8A 4NAOA 4CU7A 3B01A 1IS5A 3FBMA 4MGKE 3DV8A 2UY8A 4YZ4A 4XZUG 5DG1A 3HAGA 3ME2A 2RM23 1O4YA 1UU4A 3BU7A 5FKBA 5CFCB 3BTZA 4ES8A 3V65A 2G9GA 4OFGA 1H6XA 1QOSA 3NWKA 3PJQA 5IVCA 3H7YA 1QJU3 2ZAHA 3N9OA 4XQWA 5C8WA 1GBGA 4EN8B 3OYWB 1KJRA 4EN7B 5CVRA 2JEMA 1C1FA 4XYXA 4WVMB 4IEOA 5GZDA 4AWDA 1LGCA 1DZRA 1OMIA 1RVF2 1UOJA 1YXWA 2FMYA 3G6JB 3RJRA 1YHFA 2Y6FA 4AI9A 2QQKA 2VVEA 4CPBD 4W6XA 1QIQA 4LEJA 5BXXA 4CP0A 2WBKA 4LBKA 2NMOA 4AF9A 2YHJA 1RMU2 5FMCA 4H14A 1VMHA 1SACA 4NOTA 1HV0A 1NUKA 2LUWA 2WFF3 3E5QA 4H2AA 4UAPA 4FFIA 5JMCA 5EYYA 5B2GB 1SFPA 2QQOA 3ZDVA 1OOPA 1QJZA 4FPCA 4KBZA 3RSJA 3AMNA 5C9AC 1YIFA 2SBAA 4OUMA 3AP9A 5FYSA 4CDWB 2OVUA 4AHWA 5DAVA 1UPSA 1MS3A 1U5XA 3AKTA 1OA4A 4MSVA 5IVJA 1NYWA 1GV9A 1D4M3 1BJQA 1XC6A 4LKEA 2XGXA 1UY4A 4AEMA 2IUWA 1UX7A 4QM9A 1MVEA 1A6CA 2N7GA 3GM8A 3B5LB 5DZEA 4GJYA 1WLWA 3SEPA 5FPVA 2RDNA 4IERA 4GULA 3CKHA 2ZXQA 2D93A 1XB9A 1F5JA 1H2LA 4XFGA 4XE9A 4HMZA 4LBQD 4LBJA 1RUJ1 1V6NA 1MVQA 1UX6A 1COV1 3VBFC 4NWWA 3K4AA 1V9U2 2DU1A 2RJ2A 2J42A 1HV1A 2ZX4A 4P08A 5GZCA 4NHLA 3SCHA 2ADDA 3M3IA 4CEWA 3WF4A 2DCZA 2R30A 3M7AA 1O7FA 2K2SA 4MHRA 2GMMA 3QOPA 4OHXA 2RMU2 4K8RB 2BWAA 2P17A 1ZA4A 3PUSA 2MEV2 3ZXFA 1OH3A 4B1LA 4QX5A 4K1YA 3O1SA 4Q1PA 1EPZA 3KF5A 5FZOA 3LFMA 5BY5A 2XBO3 1AX1A 4QPGC 3O1RA 3WP3A 4JRLA 2VULA 3GZEA 3SITA 1PZ7A 4Y1YA 5JI9A 3BKZA 1IPKA 1TMF1 1ND2C 4J1WA 3ALQA 3MZHA 1YO8A 5JXIA 1YFUA 5JSPA 1GZ9A 1SLAA 2XQRA 2AEYA 1Z78A 2Y6JA 3H1WA 5FZ4A 1OF4A 1WA6X 3FX3A 1W2TA 3NVCA 3NJXA 4NJ4A 4BQ3A 1HB2A 1QJFA 1T6BX 3ZPOA 5LA0A 3J8F3 3OGVA 1UMHA 4GWIA 4BA6A 3VHRA 4G4FA 5DAPA 3VKNA 2VXRA 4IV3A 2GZWA 1KITA 2CDPA 5A3NA 3CF6E 4O7XA 5D8AB 3LEIA 1OPOA 3ZXEA 2GNMA 2BPA2 3GJBA 3C8XA 3O1PA 3CJIB 3JQWA 4HPKA 4Q0PA 2JIJA 2H6BA 2A6VA 3LF7A 1O59A 2GC3A 1YFYA 3B94A 2BGPA 5FY0A 1OD5A 1HXS2 5DAXA 2A71A 2DUOA 5IFTA 2O8QA 1J59A 3RYKA 2FCVA 2A75A 1W6QA 1RUC3 2YROA 1BVVA 1YJKA 3ACGA 3D8CA 3OPZA 3KHCA 4MGSA 5F6LB 2VC9A 5FFOC 3FFZA 1S0CA 2ZGKA 5DMYA 3OBTA 1ST8A 5LASA 2PYTA 1QKQA 3N9LA 3WX5A 1M06G 1REDA 4W4ZA 2W1SA 3AVRA 3VBUB 1PVC2 4FAHA 3N7KA 2A6WA 1FMD1 1UL9A 3FHIB 4LA2A 3E5XA 3BUCA 5LCWL 4P9WA 1OLME 5FZLA 1HRI1 2W46A 4N43A 1PNFA 2XQXA 1UKRA 1V0AA 2VZRA 2ZBJA 1MEC2 4XCAA 2CY6A 4YG6A 4BMEA 5EYXA 1JOBA 3CDZB 4AOCA 3O1UA 2D6OX 2Z4FA 5F3EA 3ZKYA 3KQRA 1PIV2 1MPXA 1Y3TA 3NW4A 4HBNA 3WQ0A 4AFMA 1W6OB 4Y5SA 1OH4A 3NJVA 4D6RA 2P34A 3LOBA 4ZONA 4D6SA 1TQ5A 2YYOA 1R1ZA 1X8MA 5I0SA 3JU9A 2CGOA 5FPUA 1YFXA 4AI3A 3E6BA 1W99A 1EUUA 2LW8A 4OLLA 4OVEA 2WAOA 1NCRA 3WR0A 1ENRA 5FZMA 2JXAA 3I3MA 1CVNA 2DUPA 2Z69A 1O3TA 4LHLA 3K3OA 1HRV3 1EV12 1RINA 2AC1A 1S0FA 2ZGLA 3IDCB 2LALA 3LDRA 4XAEA 5L9RA 3B9CA 2WN3A 2X09A 5AFBA 5CFCC 4NMIA 1IQDC 1URXA 1Z7S1 1BQPA 1VBB2 4GMP0 1OQEA 3DYMA 2UURA 2WDBA 1A8MA 2Z42A 4RR3B 5FP4A 1CQ9A 2VY0A 4GB33 5C3RA 1J3QA 4FSJA 3LOIA 1YLLA 4IQPA 1D4VB 2OXBA 3CMGA 3FFQA 3ZFEA 3ZYHA 5K9YA 2WYSA 5L7OA 3KS7A 1XU2A 2BYVE 2PQSA 3CL1A 3PNAA 2A1XA 1AR63 3T0DA 4XEZA 1RHI2 1H8TB 1HQNA 1PO22 3O1MA 2AYHA 5KXCA 3I2OA 1VBC3 4QXHA 4RHV1 3NO8A 2QQVA 5A7NA 5LK7B 1UOFA 3B9IA 3MFAA 5DPNA 1D0HA 2WLPA 2ZMKA 2CU5A 1R1A1 3EBRA 4CDUC 5FYUA 3MFCA 3WLUA 3MBWA 2HWB3 5F8PA 1WD3A 1XNKA 1YQ5A 4CDWC 1W2NA 3RZZA 3NJZA 1NE6A 2ERFA 3GHMA 3BCWA 1DGWA 4EROA 3ZYPA 1AL21 4QQLA 2W68A 2HYXA 3UL2A 4FCAA 2CWSA 4RHV2 5ABJC 1V00A 5HV4A 3D5OA 3WINE 3R4DB 3VDDA 1S0JA 2RS11 1ASJ1 1F35A 3MGUA 1GOGA 1JU3A 1F9KA 1GMMA 1WGPA 1ZBA2 1RUH2 2R073 1YYNA 2E7TA 5LRRA 4YYOA 5JPMB 1W05A 4XF3A 5IATA 1B35A 1OOPB 2DYCA 4A6SA 2HKXA 3T0AA 3OPWA 1O91A 2SLIA 2ZJCA 4QQOA 2YBKA 3ENRA 4WM7B 5FYTA 3ST7A 5IUQA 3ZDSA 1JZ2A 3UESA 3VLBB 1DG6A 1ALYA 2GAUA 1FPN2 1O8SA 4NUBA 2WN2A 2RS12 1ASJ2 2BBAA 3LGRA 4HL0A 2FMDA 4KNCA 2WA4A 3BIEA 2WWSA 1GZWA 1GZTA 3VD3A 3O12A 1BHGA 2DFBA 4DUWA 1G7YA 2OIIA 2D5HA 2VMGA 4B29A 5FIXA 4LULA 3IMNA 4XBQA 4E9KA 1Q5OA 2JE8A 2YY1A 1C5HA 2UYBA 4N53C 5L36A 3F2ZA 3CU7A 1CAXA 4LO5B 5A6XA 4Y4RA 5LBFA 2OPKA 4HN0A 1AYM3 2WL1A 3OUJA 3GZUC 4MXWB 2ZGOA 2ZX2A 2RR12 2RVAA 1AF9A 4EN0A 1RUD1 4GZ9A 1PK6A 1S4CA 5JOWA 4IEZA 1ZZ6A 4CEWB 5T5PA 3U11A 3GNEA 5C33A 4FOVA 1LU2A 2XH6A 5J37A 5M0TA 1PZ8A 2RS52 2IXLA 3DPRA 1W3VA 1XOYA 1ZZ7A 2BVVA 3KV5A 4JQRA 4CVUA 1LOAA 5LY1A 3DL3A 4LA3A 4QWNA 3LQCA 2WNUA 4QHOA 5D8AC 5FZOB 4META 3KCXA 1QDCA 1UN1A 4URTA 4NPRA 3A22A 4PIZA 5F39A 4YM1A 4E4SA 4ISRA 1SDWA 4A42A 1RUJ3 4KL1A 1UXXX 1COV3 2RHPA 2P3IA 2W39A 4XW3A 2XKPA 3LSEA 3AC0A 5CU1A 5FWEA 1PM7A 3W58A 3AKPA 1GWKA 1QJY1 1RJ7A 5FY5A 1APNA 4RGKA 1DYOA 2XL9A 3SQOA 5IAXA 4A3XA 4UT5A 1IGOA 4FPJA 3TNQA 2RG4A 4FPLA 5FQ0A 4QXBA 4BH9A 3ZPYA 5ISLA 5IVBA 5C6CA 2HBTA 3K48A 3IDAA 1TME1 4IV3B 4IESA 2E51A 4QDSA 2ZGQA 1VMJA 2WINB 2YGMA 5A32B 3VBUC 4YZ5A 3B93A 5HPOA 3IZOA 5I8SA 4HPKB 4BIOA 4OYUA 2YMZA 5JI7A 2TUNA 1BEV1 1VR3A 3WDVA 3ACIA 2RJLA 2P3YA 2P37A 4TZDA 3VL8A 1YRZA 1NQJA 3UT0A 2PHLA 2WSUA 3IPVB 4NHKA 2BNOA 1KFXL 4G9SB 5LA2A 4YVWA 4DNYA 1KS5A 1W6QB 4DQAA 4BCUA 3FWEA 5FLJA 4EWDA 2RJKA 3WNNA 1LECA 5FDBA 3S7EA 3THPA 1XBFA 5EJ1B 3WSOA 1UWWA 2V5YA 3POBA 3VBHC 1GQHA 5JOXA 1NG0A 4YW3A 4YZ1A 1VRBA 1OFSA 4CCNA 1U5ZA 4ASLA 1J3RA 1Y9GA 3N9MA 4FQZA 4P14A 1QJX1 1ENQA 1NA1A 3NNGA 4XDQA 4Z92B 3I49A 2QUOA 4SBVA 1H2MA 2WZEA 1LCLA 1PZ9A 4F83A 1S0BA 3AVSA 3N9NA 1GNHA 1WUVA 2VXJA 3I59A 1AJKA 3I2JA 5JPNB 2J1RA 1IZ3A 1WW5A 1SFNA 1WBLA 4RR3C 4EJRA 4PIYA 3Q8BA 1G6NA 1CAUA 2A3WA 1SFYA 2DCYA 2PLV2 1PO12 2WO1A 4YZ3A 4B4QA 2VNOA 3N7LA 1NCRB 3OGSA 1I6XA 1AX2A 2WYFA 2Y38A 3VDBA 1CONA 3WQBA 1FNZA 5LRSA 4EWAA 1BBT1 4BHPA 5IK5A 1H8TC 1FV2A 3NMBA 4MADA 1JZ6A 1FMD3 3SCFA 4KG8A 4W8JA 1RUG2 1XE8A 2WO3A 1W0OA 2YUEA 4EWEA 1HRI3 1ZRRA 3HBZA 2CYFA 2ZGRA 3W5NA 2FHRA 4XFBA 5FY1A 3SC7X 2YG0A 4WBBA 1H1MA 4Q4V2 3TYJA 4AYUA 4KH9A 4YW1A 4ES9A 3SKJE 4IGOA 1UF2C 2WZ8A 4EN6B 1W8HA 4MGZE 1GSLA 5FYYA 4URAA 2R49A 1I3HA 1HN0A 1BZWA 2FQPA 4PDWB 5T52A 1HQLA 4AQ6A 2CV6A 1G9FA 4KBBA 1O4TA 3LCPA 4B1MA 4CXWA 5TSWA 5F9TA 2G9ZA 3FC0A 3OSDA 5A33A 1JXNA 1VBA3 4WZFA 2QCSB 4FPYA 4AZZA 1ZZCA 4HKOA 1Z7S3 1CESA 1OOPC 2LROA 4NVPA 3ITQA 4BB3A 1FI2A 1NLRA 1QJU2 1WMDA 1GU3A 1T2XA 4IEXA 5ACA2 4BXFA 1AR83 2ZEWA 3LE0A 1EP0A 2BRTA 1PNGA 4CCCA 4QKBA 1IG0A 1CAVA 4H7LA 3K4DA 4ARXA 3AMPA 1L7QA 2VD7A 3A21A 2VPVA 3JQXA 4C1WA 2R16A 2YZ4A 3BODA 3VDDB 2V4VA 2JKBA 3KT1A 4CUCA 4QGNA 1VJ2A 2UWAA 3RG0A 2ZGSA 4CP1A 1VAVA 2ZS6B 2ZGTA 5IYYA 3LFIA 5DAWA 3LSDA 3U14A 2VM9A 2I2SA 3OBRA 1B35B 2WO7A 3B3QE 1GNYA 3VZKA 5LW9A 1QNYA 3LIHA 2IXIA 2Q8OA 4CDQA 4E4HA 3H8OA 2GC2A 3GZAA 1W28A 3IDBB 4CEWC 4LR4A 1F4AA 1LENA 2DCKA 4Y5TA 1AL23 1ZBE2 1GZWB 3KM5A 2UWCA 3VGIA 4XMIA 1D4M2 1EAH2 1W39A 3P1IA 1FOD1 3PIGA 3ZYRA 1V6KA 2BV4A 2EIGA 1Z0HA 4LHKA 3U0ZA 2VCBA 2A70A 2B9UA 4UFKA 2VO5A 3RJ2X 3TEXA 2HWC1 3VKOA 5FO7B 1CAXB 2PHUA 2GH8A 2XB6C 3AFGA 4N9IA 4Q0SA 2YPDA 4LPLA 5FKCA 5ANQA 2Q1ZB 1W2OA 2DVFA 3KHBA 4FPFA 5FK7A 1CGPA 4D7YA 3IBMA 4LBNA 2C6SA 4XQDA 1EPWA 4YM2A 3WDXA 1U5YA 1SG3A 1HB4A 2VZQA 2VW2A 3MIFA 1PK6B 4JGZA 4PQQA 5JVVA 4QX2A 3T30A 1MR5A 4V2VA 5IVVA 3CLPA 4EN9B 1UU6A 1N3PA 3DKWA 4PLOA 3OCPA 1XNBA 1G9BA 2UWBA 3DPRB 3MW2A 3VBFB 2FDHA 4WVVA 5I0UA 1PVXA 2PN5A 4LBLA 4IV3C 4R4ZA 4ZU5A 5CBLA 1PM4A 5EQUA 2EA7A 2YFUA 4IXLA 4LITA 4E4DX 2WNVA 2HYKA 1O4ZA 1DGRN 3C3VA 3GJAA 1ENXA 4P9XA 5CISA 1W8FA 4L2NA 3VBOA 4LT5A 2FCTA 3PUHA 1XNCA 1K45A 3TN91 2O8OA 2LS6A 4OULA 1ZRFA 4EYUA 4D69A 3ZMOA 2XR4A 4QX0A 5SV5A 1RUD3 1SBEA 2CGNA 2X05A 3AMQA 2NQYA 3EO6A 4BYYA 2IZWA 3K75B 4C90A 2XVKA 3L2HA 1O3SA 4UOJA 1AVBA 2VOWA 5FQ0B 5FXXA 4NHMA 4LO7A 3N9PA 3GALA 1S1AA 4XJ8A 1NZCA 4QX3A 3UK9A 3KZ4C 1SLIA 1SLTA 1WW6A 1AXYA 2WS92 2XUEA 1POV0 2JB8A 5HV0A 2MHFA 3IMMA 5CA6A 1RUNA 2Y0OA 2XJRA 4FPOB 4KG0A 4YWAA 2H0BA 3LZZA 1LR5A 3MIEA 4JX0A 4K6BA 4N43C 3OGJA 4CZSA 5E89A 1GWLA 3Q8CA 5FY7A 3WHTA 4YFWA 2J7MA 2UYAA 3AM2A 4EV0A 1NOVA 1M4WA 4FFFA 4OMCA 4JKKA 5FP7A 3BI3A 3RZGA 1C3HA 4XUTA 1TG7A 1AZDA 3A0NA 2TBVA 3M70A 5DUUA 1AR71 4YVWB 5C3QA 4COWA 4YW2A 3JCIA 1JYNA 4IETA 1HLCA 3O14A 2XJTA 5FYBA 5FPXA 4Q4X1 2HWD1 4A7ZA 1NCRC 2QQNA 3I3BA 3OBZA 3K2OA 2VMEA 1TME3 2ZEYA 4QX8A 5H9QA 3WNXA 4JKMA 1MZEA 5T55A 5LA1A 4L9BA 1K5JA 3GDBA 1SPPA 2B5HA 5K7PA 4A7YA 3HVDA 1BEV3 4D0QA 4QMAA 2DVAA 3L9JT 3WG2A 5FY4A 3ZYIB 1NXMA 3JBG2 1EY2A 3Q8FA 3I59B 3SH4A 5IFPA 2VTXJ 2E7AA 3RRDA 4JGYA 1ZZ9A 3ON7A 3T2OA 4CUGA 2Y6GA 5AFEA 1JOPA 3ZFEC 3MO4A 5KXEA 2NZ9A 1W8NA 3G7DA 5L7OC 2WIIB 2VUDA 2D44A 4GJZA 1MZ5A 4M4PA 5L73A 5JXHA 4MG2A 4W65A 1BMV2 1UYYA 1W8TA 1CX1A 1F2NA 1UOGA 2B46X 2WWUA 1OA2A 1YNAA 5C3SA 4P5YA 1Q8OA 1WCUA 1QJX3 1N1YA 1J84A 2E6VA 2NMNA 2WWJA 3WG4A 2Q1FA 4LIVA 2VU9A 1YCIA 1A3KA 3UNPA 1Q8VA 5H9RA 3H8UA 3OD4A 4RA0A 3RWNA 2PELA 1RVF1 2GU9A 1C8NA 1TNFA 1XSQA 2ZAAA 4L0PA 3S30A 4JDMA 4TTGA 4FFGA 4HG6B 2VMIA 4COUA 4FBFA 4L97A 1JU4A 4QX1A 2GNTA 1QQP3 3MLJA 4GWNA 2XVGA 1RMU1 2WJSA 1WKYA 2X53S 4QKFA 4AR2A 4CEYA 1DLLA 4CU8A 1YQ6A 4TXWA 3W21A 4M0NA 1X33A 3POEA 4AL9A 3VDDC 1V6LA 1WW4A 2J1TA 1UNBA 3R4SA 5A33B 2GNBA 3KD4A 3OUHA 3RZHA 2HWF1 2QVSB 2BFUL 3J26N 3WDWA 1WZXA 1ZZBA 4ZS3A 3NKTA 4HONA 3WT3A 1L3JA 1FAYA 2W95A 4V2WA 4XMAA 2A7AA 1CZVA 4Q4W3 3LIGA 1UZYA 1B35C 2BVBA 4XIOA 3KMHA 5FZ3A 3DEMA 5HXMA 3UV9A 1HW5A 3RZLA 2I74A 4MYEA 4NROA 5FZBA 4HVRA 3TAYA 5FUIA 4Z82A 1X8EA 5T54A 3W5MA 2I07B 1XYPA 3ZFFA 2L9LA 5FUPA 1UO9A 4OQ9A 4CDUB 2HWF2 1HX6A 4N9HA 3KT7A 4YNIA 3RYPA 2OQ7A 2YDEA 2XUMA 4AVAA 1UD1A 4DY5A 1YI7A 4JDOA 4BLIA 1GANA 2CAUA 4XFCA 4E8CA 1D2QA 1W8WA 4EQVA 5CB7A 2R072 5IW0A 3GCWA 1DQ5A 5FMBA 1LGBA 1V9U1 2C4XA 1W6NA 2ZZQA 1FT9A 2XXZA 3VB9A 5ABJB 4ZY9A 1QOOA 2O14A 2BUKA 3K4ZA 3MW3A 2XMLA 1H1IA 4N7IA 1H0BA 4CDQB 2YV8A 5FXVA 5JSOA 4G3YC 2RMU1 2QQJA 5CIRA 1C1LA 3LA7A 1PK6C 4GMP1 2MEV1 4TLGA 2QNKA 2GMEA 5DDJ2 4M3CA 2ZX1A 1JZ5A 2JB4A 2WT1A 1NCQA 1S2KA 3OY8A 3DPRC 3K46A 2ZTNA 3WQ1A 5JAXA 3THTA 5ANNA 3KF3A 2WNUC 1W03A 1WCQA 3VZOA 1OT5A 1ZYBA 3POJA 3KT4A 1DIWA 3WNOA 2V72A 1Y4WA 5BYNA 2JECA 5LATA 5A7QA 2FDFA 5I8YA 5KHJA 5L19A 1S2EA 2WRAA 4BQ4A 3VD7A 4RQPA 4IEYA 3WP5A 1AYM2 2DF7A 3GYDA 4Y1XA 4ZKTB 4AVCA 3DKQA 1GWMA 3WF2A 2F6BA 1H4GA 1UMIA 1CAWA 4JGZB 4N53B 4BDVB 3RMYA 2D43A 3D6EA 5JSRA 3HNYM 2BBVA 1QGLA 1HQWA 3AFKA 2VZUA 4Q8KA 1FOD3 5A1FA 4FPHA 3OPTA 2MPFA 2KXLA 1WMXA 1E5SA 5BUVA 2A73B 5F3CA 4IEQA 1HXS1 4WVWA 4RS5A 4B4PA 4YG0A 3AP6A 3PU8A 4LOTA 4M3CF 3VBOB 4XF9A 3VZNA 3EXUA 3WCSA 2VZTA 3AXDA 4IEPA 5A6QA 2KM2A 2I45A 4R52A 1QY4A 1RUF2 3J7MA 1OF3A 3NNFA 5LBCA 2LRPA 4UW4A 3J7HA 4YVWC 1DF0A 1SEFA 2BP6A 2E26A 5F32A 2GMPA 2B45X 2YC0A 3NNMA 4X6RB 4AHZA 1OKQA 3AZXA 5FP3A 5KHKA 4RD7A 1QXJA 1K3IA 1PVC1 3PMEA 1DYKA 4OUSA 1JYCA 1NT0A 2VZVA 4XAAA 4XUNA 2JE7A 3ATGA 3RI9A 3U75A 3VD5A 3WF1A 5C8CA 1X9TA 5DXDA 1RXFA 4FOYA 3WNPA 5IT6A 5LZ6A 3VL9A 1W9WA 2F4PA 4R9DA 2RDRA 3GBGA 1MEC1 3HPNA 3UJOA 1K5MA 1MS1A 4I0BA 3JD73 5FXZA 4CCJA 1CIWA 3HQXA 3CQOA 4HSJA 1NA1C 1PIV1 1RUE2 3HJRA 3WW1A 4IEUA 5JOZA 4FTEA 2BWCA 4GWMA 5FZAA 4CU9A 4YZ2A 1WWYA 3POGA 4K3UA 4LHSA 5EZWA 4CA9A 5GLVA 1BK1A 5KXDA 3BTYA 2W9XA 4NAMA 4HXCA 4XCBA 5EIYB 4X6QB 3WP4A 1SCRA 2R042 3OGGA 2VMCA 4FP2A 1NY72 5FZ1A 3KSCA 2YC2A 4RFT0 3U07A 2IXJA 3UETA 1JYXA 3H8XA 2HWE3 3H3UA 3P5BA 4XJZA 1EV11 4A7KA 5G05L 5J36A 3C7FA 1JTZX 4K9SA 4OI4A 5F2WA 4GALA 4XURA 1JMUB 3DECA 1ODMA 4MZUA 1VBB1 1SPPB 3R4UA 4UFJA 3AMHA 3NV2A 3RGBA 2R1BA 1DLCA 4IW3A 1E57A 5C3OA 1OLQA 5J3UA 2AGSA 4XILA 4KU7A 4BLJA 3VBHB 4INDA 4FPGA 2R062 4NIDA 3NAPA 2JDAA 2IFRA 1RC6A 4LE4A 1AR73 1C8M2 2NLRA 1UY1A 3M3QA 2RDSA 4JGYB 5E1RA 4D7SA 3ACLA 4CUBA 2G19A 3SH3A 2UU8A 1RHI1 3KLSA 1V70A 4Q4X3 2IWGB 1FV3A 4H3WA 2F17A 1PO21 3I2HA 4XHBA 2JJ6A 1WCKA 1EUTA 2B9VA 3ILNA 3ZN5A 5FR3A 1NLQA 3QACA 4ARYA 4IV1A 4LQRA 2IXCA 3WG3A 3JB8A 4L8QA 3KV4A 4YLZA 5FOJB 3HQRA 4IEWA 5FYCA 1IS6A 1KRIA 1AR93 1WA4A 1H9PA 2W5FA 4UF0A 1UMZA 4DFSA 1AJOA 1KD7A 3V0AA 2Q8CA 2LM3A 2VBBA 1FX5A 4Y24A 3U78A 1W6MA 4AI1A 2EVXA 2OT7A 4MO3M 2QQLA 2VECA 5A3OA 4N7UA 3BOPA 3BIWE 2GDFA 2VBDA 2XJVA 3HEIA 2HH9A 3FN9A 4QKDA 4YSFA 4BZ4A 4CEYB 4JV4A 1VBD1 1OVSA 2R32A 2Q0AA 5BNNA 4NPMA 1ZBA1 4Q1RA 1RUH1 5FMOL 5A80A 3ORJA 4BK5A 5ERLA 1R082 1IS4A 1SBFA 4UFMA 1O3RA 2ZABA 3M3OA 1A78A 1H4HA 4K40A 4RGGA 2Y6HA 4QB2A 2D5FA 4NRPA 5F5AA 2VCCA 3R05A 1FPN1 4I3GA 1AHSA 1Y9MA 1RVF3 2VE1A 5FYZA 1AR82 2PA7A 3SCGA 1JI6A 4CDQC 3TEWA 1VBD2 5IVFA 3CHXA 5FPBA 2GNDA 2AUYA 4Y22A 2ARXA 2DCJA 4XFAA 4ZU7A 1F4HA 1GP6A 1RMU3 1YQ2A 4FVVA 4Y33A 5FZ6A 5CG9A 3C7GA 4Q4Y2 4R9AA 2XJPA 1C4RA 3CO2A 1OUSA 3EQEA 2B39A 5A7PA 1PGL2 4YW5A 2ARAA 2VG9A 4LE3A 1U0AA 5FZ0A 2EXKA 3D0JA 3ZOIA 2W08A 2WZR2 3DXUA 5T3NA 2R0FA 3BPZA 4OZOA 3VDCA 4CPBA 3POFA 3TOJA 2XLGA 1W6NB 2RR11 3OB8A 5CAZA 1IQAA 3ZM8A 4E2QA 2X29A 4CSWA 3Q9OA 5A7WA 2W1WA 4X8PA 2RS51 2W94A 2V4AA 3DUIA 1WLCA 3PUQA 4QB1A 4JKLA 3OEBA 3PURA 2R1DA 4JGZC 1J83A 4M3CB 2JG9A 3ILRA 2Z5WA 1UY3A 2VW0A 3H8RA 1NCQB 3OY8B 4S2GA 4L11A 2ET1A 2P3KA 2OA2A 3WNMA 3POWA 3MPPG 4NIIA 5L7OB 4AAXA 2G4IA 2P1BA 2WNVC 1MS5A 4SLIA 4XF0A 3NJYA 1BYHA 5FPAA 3U37A 3VBOC 2VW1A 3W59A 3I97A 3VHOA 5DG2A 4RQPB 4NR1A 2YGLA 5E16A 4QQ2A 3IT8A 5K0UA 5LB6A 4EZHA 3FUOA 4X8NA 3WW3A 1SCSA 2GC1A 4J25A 1FYUA 2RMU3 5EWSA 5B4XA 5IK7A 4ZXKA 1CAWB 2W3JA 1R092 4Y26A 3SEEA 5J48A 1F8VA 2VAUA 2VL4A 4CU6A 4QD2A 3ZLIA 3C2UA 1VRH1 3ES1A 2VNVA 1Q43A 4LORA 4M3CE 1HB3A 3CIHA 2ZHKA 2ET7A 3MV01 3IIAA 5B4NA 3WNKA 1LAJA 4PIXA 1GZCA 3TRSB 2VNRA 4LKFA 1O8PA 2JD4A 4RS5B 4GAZA 4YVSA 4ZXEA 4U2AA 3RZMA 1WMFA 2JDYA 2QTWB 2DU0A 1OFNA 2YPJA 4LO8A 1WLDA 1LESA 2EIDA 1F5FA 1VRH2 1PMJX 2WT0A 4E8DA 2IXHA 2PHRA 5A1LA 1GUIA 2IC1A 2FDIA 1TMF3 3M1HA 4W6WA 4V1PA 1BKZA 1OA3A 5H9SA 4D7TA 4LNVA 4C8DA 2EF6A 5EFUA 5C8CB 2JX9A 1HN1A 1NZIA 3ZN6A 1XNDA 1PMHX 1K12A 4UBHA 1AYN2 5IJRA 1JH5A 1CPMA 1K5MB 2DUQA 2ZACA 4BQYA 1H2KA 2QBXA 2VQUA 2Q4SA 2W92A 5EP9A 4A3ZA 2W1UA 1LOGA 3M2MA 5A3WA 2WC2A 1K42A 2Q1MA 5AC92 4CCEA 5FZ8A 3T1MA 3ZMNA 2PLV1 3RDIA 4CTEA 1SZBA 5EHDA 1PO11 1B09A 1RXGA 4S2DA 1ULGA 2ZX0A 4JGYC 3USSA 3N4MA 2XWJB 1OSGA 3AXEA 2QJVA 3HBKA 3M4FA 1FNYA 4N43B 2J1UA 3LA3A 4MUVA 2ZEXA 1PVC3 4GKYA 2RS32 2AEZA 1RUG1 4MV2A 5F2SA 5BNQA 4IE5A 2Z2SB 2JDZA 2BU9A 1EYBA 1MEC3 3BALA 4O65A 2KD7A 1ZA7A 3V56A 1OURA 1O5LA 2QQUA 4MOAA 1DZQA 1QEXA 2W91A 3L2YA 4Q4V1 3MLKA 4YARA 3V0BA 3ZVXA 3KCYA 5FPZA 2ZMLA 2VZ3A 1N47A 2HLEA 1R64A 2DTYA 2PMWB 4RFRB 2QDRA 4L92A 2DCTA 5FV3A 3BB6A 4Y4YA 1YI9A 1VLNA 2NP0A 4LK6A 1QF3A 3DGTA 5FZFA 1RUI1 2DVBA 3PJYA 5FYMA 2EAAA 4OCTA 5JR2A 1Q8QA 1FATA 3ROUA 1H2NA 5KWRA 2XHKA 3UGFA 3O0WA 4HVOA 5F37A 5HBAA 4CEYC 2VOXA 4ASKA 4JC1A 1LOBA 2D3SA 3H3LA 1W90A 4W50A 3EHKA 3SHRA 3WEZA 4S2FA 1JOJA 4YW6A 4IV1B 4IE7A 4BK4A 1GICA 5ACA1 1QJU1 2VUJA 2ZKNA 3VKMA 3ZFEB 1RUI2 5FYHA 4QU1A 1POV1 3WY6A 1CIYA 4UF0B 5A6YA 1KQRA 4Q5OA 1V6IA 2EIEA 2GP3A 1VBE2 4KQ7A 2OYZA 2BNMA 4M01A 1DQ0A 5KHIA 3I4IA 4UWDA 4ZS2A 5H9PA 4PT6A 1W6MB 4AFBA 2D6KA 4Y20A 4QGMA 3T2QA 1UIJA 4QHZA 3VV1A 4JQTA 3RI8A 4UXAA 2RM22 3ZFFC 4I01A 3VKFC 1QQP2 4OQ8A 1PO23 1XYNA 4RL7A 5IVEA 4UW6A 2P2KA 5SV8A 2DBNA 3LPGA 5BPXA 4Z1VA 3D82A 4CP9A 3I2KA 4LOSA 4M0HA 2X10A 4BIFA 3ECQA 2IXKA 2VOVA 4Y3OA 5AVAA 3BTAA 1Q3EA 3IN9A 2BJSA 5J7MA 4HLTA 3OUIA 4Q4W2 5GALA 3F95A 3H9AA 4WVMA 2VZ1A 1STMA 1QHDA 3CZJA 4XDOA 5CZKA 5GZFA 3THDA 3WHUA 1ZBE1 1H30A 2C5DA 2GC0A 1D4M1 1EAH1 2R7EB 3LAGA 4RHV3 3LDBA 1XSRA 4Y22B 5FBJA 2WFF2 4YW4A 2E31A 3POYA 1JS9A 2C24A 2XG3A 1MS9A 4FQ4A 4I02A 3WD5A 1NCQC 1R1A3 5JMOA 3H42B 1KGYA 2CWMA 2GSYA 5A3UA 3MUZ1 1LHNA 1ZBA3 2XLFA 3OF1A 5J98B 2VUCA 1SDDB 3UYJA 1BCXA 4JCKA 3PVBB 5E88A 2R6QA 1H9WA 2KR2A 5D21A 4HN1A 5FMDA 3UKNA 4LLOA 2CTVA 4NPLA 5EJ3A 3QBQA 4Z2AA 5KC5A 4BPZA 2EXJA 4QQHA 1W6PA 3WOGA 4TN7A 3ZXGA 4RQPC 5GLWA 1FPN3 2RS13 4BQ5A 1ASJ3 1VMFA 3UKTA 5A7WB 1WMEA 1ZREA 3AP4A 1D0GA 5CG8A 5A3TA 3IB3A 1QXPA 3DYPA 2D6PA 3ZSJA 4AVTA 3T4HB 1JHJA 2JWPA 3VD9A 1UQXA 1IKQA 2QE3A 3GXUA 3UGHA 5AVPA 4ISQA 1S55A 3T2PA 2JDUA 1XRUA 2B4KA 2VOKA 2YU1A 4QB6A 2B42B 1VAKA 3WXPA 3I3EA 5L9VA 2D3PA 2D40A 3CNAA 4RS5C 2Y33A 4BM8A 1VPHA 4NO4A 5F5QA 1MACA 1MZFA 4XF4A 2RR13 2QQMA 3FL7A 3H3ZA 5FO9B 2OKXA 4MXVA 3NNLA 1O5UA 3J8F1 2VR4A 2WNUB 1LJ7A 3FUQA 2AZ5A 2ENRA 2JKXA 2XBO2 3LEMA 2RS53 1CWPA 3T4VA 4DEVA 1NX9A 2OZ6A 4JAAA 2K0GA 2WS91 1IHMA 1JZ8A 1LOFA 3ZN4A 1MS4A 3DCQA 3RWKX 2XJSA 5C8CC 2RE9A 4J1XA 1OC1A 4AI2A 1HDKA 3HIFA 3J7LA 1WW7A 4FTBA 4XBNA 4LJHA 2CHHA 5JLVA 4I09A 1K5MC 3T2TA 3C7OA 4FOWA 3J8F2 3ZR6A 1DQ6A 4DO0A 4YVSB 5KBFA 5DZGA 1C28A 4QHBA 1PMIA 3DXTA 1RUC1 1LNSA 2YB7A 4XC9A 4CE8A 3O0VA 3S6PA 1YWKA 1JYWA 1JHNA 1N3OA 4IE0A 4Q29A 5GM0A 2YC4A 3AYDA 1SHWB 4AGGA 3I2DA 1LKNA 4UW5A 1PGSA 3HNBM 1BXHA 4D94A 4KI5M 5FZIA 1QH7A 4BQWA 1ULDA 2P3JA 3CJIA 3RYRA 3ZN6B 1VB2A 4W6YA 1UW8A 3S5QA 1QJY3 1RUC2 1S0EA 2FDKA 5FY8A 3JD72 4WV8A 1KFUL 3JBG1 1OQ1A 4XTPA 3E5UA 4D8MA 2WO2A 3AK0A 3HT1A 2P6CA 2XHNA 4HVQA 1PGW1 3KWVA 5C4WA 4XF1A 3HWJA 1WD4A 3EB7A 3D4KA 2PHTA 2FZ2A 5EV7A 3NAPC 4Q8LA 5JXGA 4LMFA 5GLTA 2ORXA 3AP7A 3M3CA 4D3WA 1LTEA 1SBDA 3ZR5A 1NA1B 3WUCA 4XBLA 4BJ0A 1BMV1 5FP9A 4AVBA 3AYAA 4CRQA 1O3QA 1DQ4A 4K1ZA 2YBSA 5HCAA 3MLLA 1NKGA 1YC61 2XVLA 2CGPA 4XOGA 5LBEA 4A45A 1PGW2 2A5ZA 2JE9A 2VTXA 2ZHNA 3DN7A 2A3XA 3LEGA 4HANA 4IV1C 1CAUB 4JRAA 4ONUA 1WCDJ 4OZXA 5HCBA 1J1TA 3JB4C 3I3QA 2Z79A 2PAEA 4P00B 1CZSA 1DFQA 3ES4A 4XFHA 1DHKB 3K51A 2WR9A 3LA2A 1UZZA 2AACA 1HRV2 1Y7BA 2VNGA 4ZZ5A 4GH4A 4LBMA 1JYVA 4HOOA 3AKRA 3I2FA 2WZPP 4CCLA 1ULCA 1DQ1A 2P6HA 4R4XA 2C9KA 1N1TA 5DN2A 1OVPA 3WQ7A 3ZIXA 4AXOA 4K7JA 5HCHA 3J4UH 2IFWA 1YJLA 4AEDA 4AFCA 3CZUA 3SXWA 5BNNC 2X8KA 2J1EA 1CR7A 5IWFA 2ZPXA 4Q26A 4XETA 2WQ8A 2DVGA 2OZJA 2VCAA 4B7KA 4YGBA 4O9GA 2TEPA 1LHWA 1JUIA 1N1SA 4GB32 3T08A 2WAAA 4Q4V3 3M8LA 1XXNA 1AR92 2EALA 2PXJA 4RR3A 1S0DA 4YGDA 3W20A 1UU5A 4PLMA 1AR62 3LD8A 4DRVA 1BBT3 3EMRA 1QMJA 2TNFA 2UY9A 4A2UA 1RUOA 2FBEA 5FPLA 3VBRA 3TEZA 1VBC2 4QX7A 4Y20B 3ZO0B 1X50A 2ES3A 1MZ6A 1RGSA 1S0GA 3WDTA 3LDKA 2FD8A 1UIKA 4C1XA 3E6DA 4XDPA 2K46A 5I0RA 2HWB2 5K4LA 2R071 1DGWX 4CP9B 2DTWA 4Z2WA 1DYPA 4WM8A 1W3XA 5ACA3 2JG8A 3PMSA 1POQA 1CAVB 3KV9A 4FFHA 1POV3 1JZ7A 4B4RA 3GBWA 3ETPA 4WZCA 2ZOEB 2Y26A 3GHNA 1ZZ8A 3U1XA 4ZPIA 5DDJ1 4CDXA 4PQ9A 4BQ1A 3RNSA 1LGNA 5EJZB 2A6YA 4GWJA 3H50A 5F3GA 5DUWA 1L7RA 2VVDA 3MIBA 4FTSA 5FZEA 2FCUA 2JG9C 2XDVA 2G1MA 2KA3A 4JDNA 1JYTA 1E5RA 3RMXA 4XZPA 2W2IA 4ASMB 2XJQA 4OI0A 3VKLA 3HN3A 4HSLA 2FDJA 4Q0QA 3FLPA 3CBNA 4XUQA 1MS8A 2Q8DA 3I7DA 2Q30A 1IPSA 4I0WB 2XOMA 1LU1A 1AYM1 4XFFA 3SKVA 5JOYA 2VVFA 3N9QA 3WW2A 4WM7A 3U4XA 2OW4A 1W6PB 3Q8EA 3ZFGA 3ZYFA 1GQGA 5K0UC 1NQDA 2AENA 1UYXA 1ZBE3 3S0MA 4QQPA 1W0PA 1IS3A 1UOBA 4YM0A 1EAH3 3AZVA 3IAQA 2LTNA 2C0ZA 2PTMA 4LK7A 3N36A 4QU2A 1VE0A 1AUYA 4DUXA 3OD0A 4B7EA 2QQIA 1JYIA 3LKJA 2ZA9A 5FZGA 4K20A 3ZYBA 4H7MA 3FLRA 4PLNA 1IKPA 2XONA 2ZHLA 2ZHMA 3SNMA 1IOAA 5APAA 1XNAA 1RUF1 2PQQA 1DCSA 3AJZA 2B8MA 3ACFA 4QM8A 4RN5A 4MXWA 4YVSC 5FJKA 3GGLA 5C7GA 3BTXA 5FK8A 2IVJA 3MI8A 5D1IA 3ELNA 2VZOA 2HEVF 4KGGA 3PTYA 3I8TA 1NXD1 4YGEA 2W47A 2WNVB 3POIA 2WKKA 1XU1A 3A23A 2HWC3 3NL1A 4XJUA 2VQAA 3MW4A 1HJGA 3NV1A 2GN7A 2CSGA 1RUJ2 4CCKA 1COV2 2BGOA 4A6OA 4QPYA 4IDZA 1UYZA 5KHGA 1RUE1 4TLFA 4BWOA 1YFWA 4YPJA 1ZRDA 4AQ2A 2W87A 5I91A 4BQ2A 4JTOA 3I2IA 5J96B 5LA9A 4MH0E 2R041 2XPJA 2BFUS 1VB4A 3O1VA 1S2BA 2NPIA 1NY71 4N90A 1AL0G 2QZ3A 2VMFA 3N35A 5FZHA 4YM3A 5J09A 1AXKA 1TMF2 3A4UA 4XFIA 1W8ZA 4HKWA 3IM0A 3USUA 2WS93 5A32A 1D7PM 5BNPA 3J7NA 3TN93 5HCFA 4QPIA 1VALA 3DYOA 4DINB 4ET7A 1QXRA 3OBAA 3FBYA 3IIIA 3RVHA 1UZ0A 5A3LA 1H6YA 3UJQA 4OHVA 3HMYA 1SLBA 4XIKA 1UXZA 3D3AA 3MICA 1KXGA 3IPVA 1UPIA 2R061 3B69A 3KVBA 4XJAA 5FZ9A 5JZGA 4O9EA 1LEMA 4YG3A 2MNGA 5FYIA 2WNEA 3MF6A 1C8M1 2CL2A 2JDHA 4FO9A 5C4WB 1JUHA 1S0IA 3B02A 4IE4A 5FLHA 1ACCA 1JW6A 5CYYA 3SLIA 3ZSKA 5JXJA 5DUVA 3PIJA 2PAMA 3EYPA 3VBSA 3O1OA 4KGQA 2PHWA 2JDMA 4P5HA 2E9QA 5CEHA 3U4SA 5FJHA 4BXSV 4CP2A 3H7JA 2ORZA 3MEPA 4M4RA 4I2OA 2E63A 5FLIA 4E2GA 5KR7A 3VN4A 3ZSMA 3ZSEA 2AH2A 2QFEA 1ULEA 3HQUA 5BNOA 4FI9A 1U12A 3VZLA 2QDNA 3JBG3 2VJXA 2DWRA 4NHXA 4OI2A 3MUY1 1NE4A 2HWD3 5CADA 3BPSA 4GD4A 5FZ7A 2C1FA 4IGQA 2NYYA 4XXPA 2WABA 4QXKA 4AW7A 5LY2A 3M3EA 4MGTA 1FMD2 5DZFA 1OUXA 4GH4B 4MX3A 2XKOA 4COZA 1HRI2 5FREA 1DGLA 1W8OA 5FY9A 2VMDA 3WW4A 3AL6A 5CFDA 4E4ZA 3I2GA 1R081 5IK8A 4AEDB 1VBA1 4LKDA 5E6HA 3JZVA 3A0KA 3E97A 3TWIA 1YEWA 4DOUA 4GQ7A 1DP0A 4MGQA 2R0HA 1CZTA 1DZTA 5GJ6A 2BZDA 4BOWA 1F31A 1PX4A 3FMGA 4S2HA 1AR81 3AP5A 4AGRA 4K21A 1SQ4A 1ZRIA 1I5ZA 1MS0A 4PDWA 2ZZJA 3JXSA 1YQ8A 4Q27A 4UBGA 1XNTA 2E7QA 4CCOA 3VBRB 4NN0A 1VBA2 1MQTA 2X5IA 2QQPA 3PTRB 4LIUA 4Q4Y1 4P9JA 1QDOA 2B7YA 1PGL1 2V73A 1LODA 3OOXA 1DBNA 1Z7S2 4XQ4A 5FYVA 4AG4A 1ND3A 4IL7A 1SLLA 3BU0A 1QU0A 3ZX7A 2JICA 2H6CA 4HT1T 4P9GA 2WZR1 4F3JA 5A3PA 3ZXJA 3EJKA 1OD3A 2JDKA 3PL0A 1IG3A 2P5BA 2J22A 3R0RA 4WM8B 5D2AA 3ZFFB 5BV6A 3POSA 2JG8B 2Q8EA 5JR7B 5T5JA 2ZKLA 3WCRA 4TYSA 2DFCA 2EIBA 1PHMA 2Q5TA 3SH5A 1ZNPA 4CDXB 3UGGA 1JODA 3FZ3A 2HWF3 5JUVA 3IAPA 3BVCA 3BOWA 5C70A 5FOBB 3LWCA 1US3A 3TBDA 2WLQA 2BTVC 2CAVA 1R1A2 4MLOA 2RDQA 4C0BA 3JUUA 1X7NA 4CYDA 5F3IA 5KC6A 5FCCA 4L99A 3HN1A 1LHVA 2D6NA 3PVOA 1OBNA 5K8SA 2A6XA 1W8UA 1E5IA 1GYKA 2Y6KA 1GR3A 2HEWF 1AL22 2ZGNA 3PLQA 3URFA 1RIRA 2VH9A 4DRRA 3ZFGB 4FOQA 1WBFA 1R091 2WUHA 5DDJ3 4LKSA 4R9BA 1X36A 2VQTA 4FT8A 5JIAA 1T6GC 1FXZA 3VZJA 2VUAA 5CKNA 1KDMA 5JIUA 1C57A 4GA9A 2QZ2A 5DQ0A 4DXTA 4QDRA 5C9AA 3S5AA 4UFIA 3C7HA 1V9U3 1W06A 2Y34A 2JENA 4H55A 1LOFC 2BOJA 3KB5A 4DXZA 4KWUA 1U5IA 3I54A 2Y64A 2YXSA 3MF9A 4Y1VA 4GMP3 3B00A 5JWPA 1A34A 2MEV3 2VOTA 3WP6A 3CEWA 4Q0UA 2PHDA 4NRMA 1LRHA 4P02B 3LB9A 4LBQA 5T5OA 2D6LX 4XJ9A 4DEQA 1G8WA 3VBFA 5DAQA 1LHUA 5DABA 4QPWA 5LEKA 3J9SA 4AHYA 4KMQA 3C7EA 2EICA 1AYN1 4MGIE 5LWBA 4QAWA 1RITA 2OX0A 2D97A 1RJ8A 3MPBA 2J1VA 2VZPA 3DF0A 2BDRA 3CJIC 3WUDA 1WLTA 1N1VA 2ZCWA 1G9DA 1RUD2 3QH6A 1OQDA 2WFPA 1VIWB 5FMOS 5AC91 5CKQA 1RUF3 2Y6LA 4XVHA 3VDAA 2XWBB 4HETA 5C5UA 3TEYA 1W9TA 4QPGA 5FRAA 2G9FA 3PUAA 2DDUA 3NKGA 3WF0A 3AYCA 5C4WC 4DS0A 4LXLA 1ODNA 1QH6A 3N7MA 5I0DA 2E32A 4EZ4A 4NHYA 1ND2A 3O5SA 4QKNA 3VHNA 1LOCA 2ADEA 2IVIB 2RS31 1HXS3 3WZ1A 3ACHA 1XE7A 3ZSLA 5A70A 1SMVA 2BEOA 4LLFA 3USUB 4AK3A 5J1XA 4ZU4A 1I9RA 2BOIA 4DIQA 5BNPB 4B3NA 4BQXA 4QDQA 4QPIB 5KHHA 1L7LA 1RUE3 4NIGA 3MIDA 1UZWA 1QJY2 2QKDA 1N3QA 4BMBA 3AZZA 4AI8A 3K3NA 1GOFA 4PF5A 5FZDA 2EXIA 3FHQA 4K8FA 2XLAA 1W9SA 4HK8A 4XTMA 4ITCA 2R043 5JZGB 4I0AA 1GP5A 2XL7A 1TME2 2ZEZA 3B7MA 4MVTA 4XHXA 2ARCA 4NRQA 3RQ0A 1DGRA 3AZYA 4JZRA 3IKWA 1TEIA 4GH4C 3NRUA 2C26A 4A44A 3VBSB 1PIV3 1JBCA 5I0TA 1BEV2 2ATFA 4OI1A 2NM1A 3WV6A 1RTVA 4A41A 4AEDC 1REFA 1OXCA 1XJAA 3O7OA 1W0NA 1UY0A 3NAPB 1DDLA 1Y9QA 1OKOA 5JDBA 2GN3A 3FE5A 4IE6A 4AGVA 3KQ4B 1G9CA 3KCCA 1VBE1 4CXXA 3CJXA 5BNOB 4I3PA 4Z8BA 1X82A 3OEAA 3NV4A 2R063 2HJIA 3RFRA 4FP3A 3KV6A 4YFZA 1O6UA 1XPWA 1C8M3 1EV13 4HK9A 4ATFA 4YGCA 1VAMA 3WVJA 3TB0A 2RM21 4IUGA 5C71A 1QQP1 4XXAA 1C5IA 3MYXA 3VBRC 4AI0A 3NQHA 4DXRA 1VBB3 2D98A 1GQPA 4KWKA 2CDOA 1QJX2 3NV3A 1J58A 4GIQA 2D3RA 3KGLA 4IGPA 2K9ZA 3QH7A 2JD9A 4QGLA 1BVP1 1UCXA 5CFDB 2WQZC 3S7IA 2J1AA 3ZXAC 3V0AB 4B8EA 2A3YA 4LO6B 5A7SA 4TSVA 4BU2A 2P4EA 4OHYA 4P9IA 1LULA 2AR6A 1X9PA 2D6MA 4Q4W1 1SLCA 1ONAA 1OHFA 2WNOA 2ZMNA 4HZFA 4WM8C 4DPNA 1DU3D 1CD3G 1RHI3 3AX4A 2JG8C 2ETEA 4XUPA 2GH2A 3AJYA 3W9AA 4A4AA 4P9YA 5C3PA 3QD6A 5LBBA 2H0VA 3ZYJB 3T09A 5BNNB 1XE0A 2HBUA 3AZWA 1BBT2 3BYWA 4NE9A 4YRDA 2WFF1 4AFAA 3ASIA 3AB0A 4C0HA 4CDXC 5CFCA 5JCTA 4AHXA 3A7QA 3GBFA 4R9CA 3AYEA 3PVEA 3GCXA 1MQTB 2X5IB 1IPJA 1QOTA 2DURA 3ZYGA 3PUIA 2A6ZA 4PI2A 5IAVA 5IK4A 3OYWA 3S57A 1CN1A 5F7UA 1RB8G 1ND3B 1R083 3GF6A 4XABA 4PHZA 4AEJA 4ZZ8A 4PF1A 1YUDA 1US2A 5A6ZA 4MHUA 2WT2A 4FPEA 1HB1A 1YIPA 5FO8B 4ATEA 4HKLA 5L9BA 1J1LA 3P3PA 4WM7C 3T3YA 5HI0A 3TNPB 4C91A 1VBD3 4JTNA 3ZFGC 1RUH3 2C9AA 4UYBA 5FZCA 2FZ1A 3PU3A 1UYPA 5G04L 1W9YA 2V09A 3QLQA 4AFDA 2BNNA 2ID4A 4CDUA 4Q4Y3 2VGDA 3NNJA 1CPNA 1I1EA 2VTFA 3UKVA 2RV9A 3WNLA 3ABZA 5T50A 4CDWA 1RL3A 1REEA 3OJBA 3N7JA 1TZOA 4XACA 2WZR3 3FJSA 3WDUA 1AXZA 4KWJA 3WG1A 2YBPA 4DUVA 3ZKUA 2ARBA 4PCRA 2DVDA 2J1SA 5ABJA 2NN8A 1KJLA 3H1MA 2EXHA 4Q2FA 1UAIA 2D7FA 2JG9B 5HXVA 4EE2A 5KXBA 1A8DA 2XBO1 1CX4A 3O0XA 4CCMA 4DMIA 5I8TA 1YQCA 3WDYA 2ZX3A 3K77A 5A3MA 2YFZA 1LB2A 2XJUA 4KWLA 4BE3A 2WSVA 4AEKA 4AE2A 3D0SA 3MIGA 4I30A 2GALA 1LOEA 4LBOA 4RYDA 3ZIWA 5GLUA 1GOHA 4Y1UA 4JVAA 4GXLA 5C9AB 3IWZA 4UFLA 5CNAA 1ZVFA 2BGCA 1Y43B 2QQWA 3INAA 3LPFA 4QXCA 5F1RA 1H1AA 2VMHA 1UY2A 5K0UB 2VBPA 3LEKA 1KDKA 5FUNA 3HOBA 2VZSA 3AKSA 1BLZA 3KGZA 1NLSA 3HD8B 4LO4B 1LHOA 1TVGA 5EXOA 4F7ZA 3HNMA 1RYYA 3I3DA 1JZ3A 3QCWA 4WVZA 4PI0A 2OUJA 3FLTA 4PJYA 1TE1B 3ZXDA 4DY3A 4LBQB 1G9AA 4LUKA 1FOD2 3APBA 4XJWA 3E6CC 2JIGA 4N53A 1LEDA 4OUEA 4Z07A 1R093 4AVVA 4CXYA 2FDGA 3VUOA 1ZM1A 2O1QA 2W0XA 4OHZA 4CUAA 2Y8KA 1QNWA 3R6SA 1ULPA 2ZGPA 1ZX5A 2HWC2 3H0OA 4FXGB 4TWTA 4AQTA 3GZTB 5LEJA 3ZXKA 1UZVA 4E2SA 1CJDA 1V6MA 4UFHA 5F6KA 5BNPC 3RZKA 3JD71 3PVNA 4QPIC 3P6BA 3SMHA 1W2AX 4HFSA 5DUXA 3WF3A 3MHZA 2DBIA 3BGAA 4U36A 3V64A 3X29B 1UKGA 4BISA 5FTTC 1J3PA 2YU2A 4ORFA 1OLMA 1I5PA 2O0OA 2OS2A 4FXKB 4RSUA 5D8AA 2HEYF 4QPGB 3OGRA 5FZKA 5JZGC 4DB5A 1VRH3 4QT6A 5CKMA 1G86A 1HKDA 4N8MA 1ND2B 2HWE1 1H8VA 2AREA 4GKXA 1CJPA 1BK0A 1GKBA 4UW3A 3ZXLA 4COVA 2OUHA 4J6GA 4PBPA 4RGAA 2Y60A 3VBSC 2ILMA 1ULFA 2PAKA 4KU8A 1AYN3 1XYOA 5T5LA 1KS4A 3NSTA 3TN92 3MV11 5GLZA 5FWJA 4D6QA 4NIAA 4M00A 2W1QA 3HR9A 2E33A 3HT2A 4FAGA 4NWVA 4E27A 5F5IA 4XUOA 5A1AA 1PX3A 3OG2A 2W52A 5BNOC 2PFWA 4MGYE 2PHXA 5AC93 4CCDA 1D2SA 2V5DA 4XPVA 2HWE2 3VBUA 5E8AA 3PDQA 1HRV1 4Y1ZA 4YW7A 3SISA 5GZGA 5FAXA 1GP4A 3MIHA
chains in the Genus database with same CATH topology
5GZEA 5LK5A 3VHPA 3AKQA 4P9LA 3VZMA 1HIXA 1OLRA 4IEVA 2RS33 3IDEA 3PHMA 1XQNA 1ZRCA 3P3NA 3V0BB 1W6OA 4DZGA 5CFDC 1TNRA 3OTFA 1OPMA 1V6JA 4GB31 3N3HA 3U10A 2PLV3 3AMMA 3RPQA 1PO13 4OHWA 2VQ0A 1AR91 1AR72 1QWRA 4COYA 3H1YA 1ENSA 2BQPA 1AR61 1GLHA 3VBHA 5I93A 2CNAA 2ZGUA 1VP6A 4Q4X2 2HWD2 1OI6A 1DQ2A 2PHFA 4F8AA 1VBC1 1RUG3 1Q8PA 2Y0IA 2E53A 2ZGMA 1GFF2 4PDWC 5GKAC 1W2UA 4LHNA 4Y5Z0 1MQTC 2WA3A 2X5IC 4FPKA 1Q56A 4LUMA 2HWB1 2EAKA 4AVSA 4AQSA 3MDPA 1AX0A 2DV9A 4Q0VA 4LTAA 1ND3C 3ILFA 1Q8SA 1JN2P 1WCSA 4R8HA 1RUI3 4PBOA 1GNZA 1V6OA 3ETQA 3T1LA 1VBE3 5FBZA 3RS6A 1H8TA 2WQ4A 2BW8A 3B01A 1IS5A 3FBMA 4MGKE 3DV8A 2UY8A 4YZ4A 5DG1A 3HAGA 3ME2A 2RM23 1O4YA 1UU4A 3BU7A 5CFCB 4ES8A 3V65A 2G9GA 4OFGA 1QOSA 3NWKA 3PJQA 3H7YA 1QJU3 2ZAHA 4XQWA 5C8WA 1GBGA 4EN8B 3OYWB 1KJRA 4EN7B 5CVRA 2JEMA 1C1FA 4XYXA 4WVMB 4IEOA 5GZDA 4AWDA 1LGCA 1DZRA 1OMIA 1RVF2 1YXWA 2FMYA 3G6JB 3RJRA 1YHFA 2VVEA 4W6XA 5BXXA 4LEJA 4CP0A 4LBKA 2NMOA 4AF9A 2YHJA 1RMU2 4H14A 1SACA 4NOTA 1HV0A 2WFF3 2LUWA 3E5QA 5JMCA 5EYYA 5B2GB 1OOPA 1QJZA 4FPCA 3RSJA 3AMNA 5C9AC 1YIFA 2SBAA 4OUMA 3AP9A 4CDWB 2OVUA 4AHWA 1UPSA 1MS3A 1U5XA 3AKTA 1OA4A 4MSVA 1NYWA 1GV9A 1D4M3 1BJQA 2XGXA 4AEMA 4QM9A 1MVEA 1A6CA 2N7GA 5DZEA 3B5LB 1WLWA 4IERA 4GULA 4XFGA 2D93A 1F5JA 1H2LA 4XE9A 4HMZA 4LBQD 4LBJA 1RUJ1 1V6NA 1MVQA 1UX6A 1COV1 3VBFC 4NWWA 1V9U2 2DU1A 2ZX4A 1HV1A 5GZCA 4NHLA 3SCHA 3M3IA 4CEWA 2DCZA 2R30A 3M7AA 1O7FA 2K2SA 2GMMA 3QOPA 4OHXA 2RMU2 2BWAA 2P17A 1ZA4A 2MEV2 3ZXFA 4QX5A 4K1YA 4Q1PA 1EPZA 5BY5A 2XBO3 1AX1A 4QPGC 3WP3A 4JRLA 2VULA 3SITA 1PZ7A 4Y1YA 5JI9A 1IPKA 1TMF1 1ND2C 4J1WA 3ALQA 3MZHA 1YO8A 1YFUA 5JSPA 1GZ9A 1SLAA 3H1WA 1Z78A 3NVCA 3FX3A 3J8F3 4BA6A 3VHRA 4G4FA 3VKNA 2VXRA 4IV3A 2GZWA 1KITA 3CF6E 5D8AB 1OPOA 3ZXEA 2GNMA 2BPA2 3CJIB 3JQWA 4HPKA 4Q0PA 2H6BA 2A6VA 2GC3A 1YFYA 3B94A 1OD5A 1HXS2 2A71A 2DUOA 1J59A 2O8QA 3RYKA 2A75A 1W6QA 1RUC3 2YROA 1BVVA 1YJKA 3D8CA 3OPZA 5F6LB 5FFOC 3FFZA 1S0CA 2ZGKA 3OBTA 2PYTA 1QKQA 1M06G 3WX5A 1REDA 3VBUB 4FAHA 1PVC2 3N7KA 2A6WA 1FMD1 1UL9A 3FHIB 4LA2A 3E5XA 4P9WA 1HRI1 4N43A 1PNFA 2ZBJA 1UKRA 5HBAA 4YG6A 1MEC2 2CY6A 4BMEA 5EYXA 2D6OX 3KQRA 1PIV2 1Y3TA 3NW4A 4HBNA 3LOBA 3WQ0A 4AFMA 1W6OB 2P34A 1TQ5A 2YYOA 1R1ZA 1X8MA 5I0SA 3JU9A 2CGOA 1YFXA 4AI3A 3E6BA 4OVEA 4OLLA 1NCRA 3WR0A 1ENRA 2JXAA 1CVNA 2DUPA 2Z69A 1O3TA 4LHLA 1HRV3 1EV12 1RINA 2ZGLA 1S0FA 3IDCB 2LALA 3B9CA 5AFBA 5CFCC 1URXA 1Z7S1 1BQPA 1VBB2 4GMP0 1OQEA 2UURA 1A8MA 2Z42A 4RR3B 1CQ9A 2VY0A 4GB33 4FSJA 1J3QA 3LOIA 1YLLA 4IQPA 1D4VB 3FFQA 3ZFEA 5K9YA 5L7OA 3KS7A 1XU2A 2BYVE 3CL1A 3PNAA 1AR63 4XEZA 1RHI2 1H8TB 1HQNA 1PO22 2AYHA 5KXCA 1VBC3 4RHV1 3NO8A 5LK7B 3B9IA 3MFAA 1D0HA 2WLPA 2ZMKA 3EBRA 1R1A1 4CDUC 3MFCA 3WLUA 2HWB3 1WD3A 1XNKA 4CDWC 3RZZA 3NJZA 1NE6A 2ERFA 3GHMA 3BCWA 1DGWA 4EROA 3ZYPA 1AL21 4QQLA 2W68A 3UL2A 4FCAA 2CWSA 4RHV2 5ABJC 1V00A 3D5OA 3WINE 3R4DB 3VDDA 1S0JA 2RS11 1ASJ1 3MGUA 1F9KA 1WGPA 1ZBA2 1RUH2 2R073 1YYNA 2E7TA 5LRRA 4YYOA 5JPMB 4XF3A 1B35A 1OOPB 2DYCA 2HKXA 1O91A 2SLIA 2ZJCA 4QQOA 4WM7B 3ENRA 3ZDSA 3ST7A 5IUQA 3VLBB 1DG6A 1ALYA 2GAUA 1FPN2 2RS12 1ASJ2 4HL0A 3LGRA 4KNCA 2FMDA 2WA4A 2WWSA 1GZWA 3O12A 2DFBA 1G7YA 2OIIA 2D5HA 2VMGA 4B29A 4LULA 3IMNA 4XBQA 4E9KA 1Q5OA 2YY1A 1C5HA 2UYBA 4N53C 5L36A 3CU7A 1CAXA 4LO5B 2OPKA 4HN0A 1AYM3 2WL1A 3GZUC 4MXWB 2ZGOA 2ZX2A 2RR12 4EN0A 1AF9A 1RUD1 1PK6A 5JOWA 4IEZA 1ZZ6A 4CEWB 5T5PA 3U11A 3GNEA 5C33A 4FOVA 1LU2A 2XH6A 5J37A 1PZ8A 2RS52 2IXLA 3DPRA 1ZZ7A 2BVVA 4JQRA 1LOAA 3DL3A 4LA3A 5D8AC 2WNUA 4META 3KCXA 1QDCA 1UN1A 4URTA 4NPRA 4PIZA 4YM1A 4E4SA 4ISRA 1SDWA 1RUJ3 4KL1A 1COV3 2RHPA 2P3IA 2W39A 4XW3A 2XKPA 3LSEA 5CU1A 1PM7A 3W58A 3AKPA 1QJY1 1RJ7A 1APNA 2XL9A 4A3XA 1IGOA 4FPJA 3TNQA 4FPLA 5FQ0A 4BH9A 3ZPYA 5C6CA 3K48A 1TME1 4IV3B 4IESA 2E51A 2ZGQA 2YGMA 2WINB 5A32B 3VBUC 4YZ5A 3B93A 5I8SA 4HPKB 4BIOA 2YMZA 5JI7A 2TUNA 1BEV1 1VR3A 3WDVA 2RJLA 2P37A 4TZDA 3VL8A 1YRZA 1NQJA 2PHLA 2WSUA 3IPVB 4NHKA 2BNOA 1KFXL 4G9SB 5A3MA 4YVWA 4DNYA 1KS5A 1W6QB 4DQAA 4BCUA 3FWEA 5FLJA 4EWDA 2RJKA 1LECA 5FDBA 3S7EA 3THPA 2V5YA 3VBHC 1GQHA 5JOXA 1NG0A 4YW3A 4YZ1A 1OFSA 1U5ZA 4ASLA 1J3RA 4P14A 4FQZA 1QJX1 1ENQA 1NA1A 4XDQA 2QUOA 4SBVA 1H2MA 1LCLA 1PZ9A 4F83A 1S0BA 1GNHA 1WUVA 3I59A 1AJKA 5JPNB 4EJRA 1IZ3A 1WW5A 1SFNA 1WBLA 4RR3C 4PIYA 1G6NA 1CAUA 2A3WA 1SFYA 2DCYA 2PLV2 1PO12 4B4QA 4YZ3A 2VNOA 3N7LA 1NCRB 1I6XA 1AX2A 2Y38A 5LRSA 1CONA 1FNZA 4EWAA 1BBT1 4BHPA 5IK5A 1H8TC 1FV2A 1FMD3 3SCFA 4KG8A 1RUG2 1XE8A 2YUEA 1W0OA 4EWEA 1HRI3 1ZRRA 3HBZA 2CYFA 2ZGRA 2FHRA 4XFBA 4WBBA 1H1MA 4Q4V2 3TYJA 4AYUA 4KH9A 4YW1A 4ES9A 1UF2C 4EN6B 4MGZE 1GSLA 2R49A 1I3HA 1BZWA 2FQPA 4PDWB 5T52A 1HQLA 4AQ6A 2CV6A 1G9FA 4KBBA 1O4TA 3LCPA 5TSWA 5F9TA 3FC0A 5A33A 1JXNA 1VBA3 4WZFA 2QCSB 4FPYA 1ZZCA 4HKOA 1Z7S3 1CESA 1OOPC 4NVPA 1FI2A 1NLRA 1QJU2 1WMDA 4IEXA 5ACA2 1AR83 1EP0A 1PNGA 1CAVA 4H7LA 3AMPA 2VPVA 3JQXA 4C1WA 2R16A 2YZ4A 3BODA 3VDDB 2JKBA 3KT1A 4QGNA 1VJ2A 2UWAA 3RG0A 2ZGSA 4CP1A 1VAVA 2ZS6B 2ZGTA 3LSDA 2I2SA 3OBRA 1B35B 3B3QE 3VZKA 1QNYA 2IXIA 2Q8OA 4CDQA 2GC2A 3GZAA 3IDBB 4CEWC 4LR4A 1LENA 2DCKA 1AL23 1ZBE2 1GZWB 3KM5A 2UWCA 3VGIA 4XMIA 1D4M2 1EAH2 1W39A 1FOD1 3ZYRA 1V6KA 2EIGA 1Z0HA 4LHKA 3U0ZA 2A70A 2B9UA 3RJ2X 1RB8G 2HWC1 3VKOA 5FO7B 1CAXB 2PHUA 2GH8A 2XB6C 3AFGA 4N9IA 4Q0SA 2Q1ZB 2DVFA 4FPFA 1CGPA 4D7YA 3IBMA 4LBNA 4XQDA 1EPWA 4YM2A 3WDXA 1U5YA 2VW2A 3MIFA 1PK6B 4JGZA 5JVVA 1MR5A 3CLPA 4EN9B 1UU6A 1N3PA 3DKWA 4PLOA 3OCPA 1XNBA 1G9BA 2UWBA 3DPRB 3MW2A 3VBFB 4WVVA 5I0UA 1PVXA 2PN5A 4LBLA 4IV3C 4R4ZA 4ZU5A 5CBLA 2EA7A 4E4DX 4IXLA 2WNVA 2HYKA 1O4ZA 1DGRN 3C3VA 4P9XA 1ENXA 4L2NA 3VBOA 4LT5A 1XNCA 3TN91 2O8OA 4OULA 1ZRFA 4D69A 3ZMOA 5SV5A 1RUD3 1SBEA 2CGNA 4BYYA 3AMQA 2NQYA 3EO6A 2IZWA 4C90A 2XVKA 3L2HA 1O3SA 1AVBA 2VOWA 5FQ0B 4NHMA 4LO7A 3UK9A 3GALA 1S1AA 4XJ8A 1NZCA 3KZ4C 1SLIA 1SLTA 1WW6A 1AXYA 2WS92 1POV0 2MHFA 5CA6A 1RUNA 2Y0OA 2XJRA 4FPOB 4KG0A 2H0BA 3LZZA 1LR5A 3MIEA 4K6BA 4N43C 4CZSA 3OGJA 5E89A 3WHTA 4YFWA 2UYAA 3AM2A 4EV0A 1NOVA 1M4WA 1C3HA 3M70A 1AZDA 3A0NA 2TBVA 5DUUA 4YVWB 1AR71 4COWA 4YW2A 3JCIA 4IETA 1HLCA 3O14A 2XJTA 5FPXA 4Q4X1 2HWD1 4A7ZA 1NCRC 1TME3 5H9QA 3WNXA 1MZEA 5T55A 4L9BA 2B5HA 5K7PA 4A7YA 1BEV3 4QMAA 2DVAA 3L9JT 3WG2A 3ZYIB 1NXMA 3JBG2 1EY2A 3I59B 3SH4A 2E7AA 3RRDA 4JGYA 1ZZ9A 5AFEA 3ZFEC 5KXEA 2NZ9A 3G7DA 5L7OC 2WIIB 2D44A 1MZ5A 5L73A 4W65A 1BMV2 1F2NA 2B46X 1OA2A 1YNAA 1Q8OA 1QJX3 1N1YA 2E6VA 2NMNA 3WG4A 2VU9A 1YCIA 1A3KA 1Q8VA 5H9RA 3H8UA 3OD4A 4RA0A 3RWNA 2PELA 1RVF1 2GU9A 1C8NA 1TNFA 2ZAAA 3S30A 4JDMA 2VMIA 4COUA 4FBFA 4L97A 2GNTA 1QQP3 3MLJA 4GWNA 2XVGA 1RMU1 2WJSA 2X53S 4CEYA 1DLLA 4M0NA 1X33A 3VDDC 1V6LA 1WW4A 3R4SA 5A33B 2GNBA 3KD4A 2HWF1 2QVSB 2BFUL 3J26N 3WDWA 1ZZBA 3NKTA 3WT3A 1L3JA 1FAYA 4XMAA 2A7AA 4Q4W3 1UZYA 1B35C 2BVBA 4XIOA 3KMHA 3UV9A 1HW5A 2I74A 4MYEA 3TAYA 4HVRA 4Z82A 1X8EA 5T54A 2I07B 1XYPA 3ZFFA 4CDUB 2HWF2 1HX6A 4N9HA 3KT7A 4YNIA 3RYPA 2YDEA 2XUMA 4AVAA 1UD1A 4DY5A 1YI7A 4JDOA 4BLIA 1GANA 2CAUA 4XFCA 1D2QA 5CB7A 2R072 1DQ5A 1LGBA 1V9U1 1W6NA 2ZZQA 1FT9A 5ABJB 1QOOA 2BUKA 3MW3A 1H1IA 4N7IA 1H0BA 4CDQB 2YV8A 5JSOA 4G3YC 2RMU1 5CIRA 1C1LA 3LA7A 1PK6C 4GMP1 2MEV1 2QNKA 2GMEA 5DDJ2 4M3CA 2ZX1A 2WT1A 1NCQA 1S2KA 3OY8A 3DPRC 2ZTNA 3WQ1A 5JAXA 3THTA 2WNUC 3VZOA 1ZYBA 3KT4A 1DIWA 5BYNA 2JECA 5I8YA 5KHJA 5L19A 4RQPA 4IEYA 3WP5A 1AYM2 2DF7A 3GYDA 4Y1XA 4ZKTB 4AVCA 2F6BA 1H4GA 1CAWA 4JGZB 4N53B 3RMYA 2D43A 3D6EA 5JSRA 2BBVA 1QGLA 1HQWA 3AFKA 4Q8KA 1FOD3 4FPHA 2MPFA 2KXLA 5BUVA 2A73B 4IEQA 1HXS1 4WVWA 4RS5A 4B4PA 4YG0A 3AP6A 4M3CF 3VBOB 3VZNA 4XF9A 3EXUA 3WCSA 3AXDA 4IEPA 2KM2A 2I45A 4R52A 1QY4A 1RUF2 4Z92B 4UW4A 4YVWC 1DF0A 1SEFA 2GMPA 2B45X 2YC0A 4X6RB 4AHZA 1OKQA 3AZXA 5KHKA 4RD7A 1QXJA 3PMEA 1PVC1 1DYKA 4OUSA 1JYCA 3RI9A 5C8CA 2JE7A 3ATGA 5IT6A 5DXDA 4FOYA 3VL9A 2F4PA 4R9DA 3GBGA 1MEC1 3UJOA 1K5MA 1MS1A 4I0BA 3JD73 1CIWA 3HQXA 4HSJA 1NA1C 1PIV1 1RUE2 3WW1A 5JOZA 4IEUA 4FTEA 2BWCA 4GWMA 4YZ2A 4K3UA 5EZWA 5GLVA 1BK1A 5KXDA 4X6QB 3WP4A 1SCRA 2R042 3OGGA 4FP2A 1NY72 3KSCA 4RFT0 3U07A 2IXJA 2HWE3 3H3UA 4XJZA 1EV11 4A7KA 5J36A 1JTZX 4K9SA 4OI4A 4GALA 4MZUA 1VBB1 3R4UA 3AMHA 3NV2A 2R1BA 1E57A 1OLQA 5J3UA 2AGSA 4XILA 4KU7A 4BLJA 3VBHB 4INDA 4FPGA 2R062 3NAPA 2IFRA 1RC6A 4LE4A 1AR73 1C8M2 2NLRA 3M3QA 4JGYB 5E1RA 4D7SA 3ACLA 3SH3A 2UU8A 1RHI1 3KLSA 1V70A 4Q4X3 2IWGB 1FV3A 4H3WA 4XHBA 1PO21 2JJ6A 1WCKA 3ZN5A 3ILNA 3QACA 4IV1A 2IXCA 3WG3A 3JB8A 4L8QA 5FOJB 4YLZA 4IEWA 1KRIA 1IS6A 1AR93 1WA4A 1H9PA 1UMZA 4DFSA 1AJOA 1KD7A 3V0AA 2LM3A 4Y24A 1FX5A 4AI1A 1W6MA 2EVXA 2VECA 4N7UA 3BOPA 3BIWE 2GDFA 2XJVA 4YSFA 4BZ4A 4CEYB 4JV4A 1VBD1 2R32A 2Q0AA 5BNNA 1ZBA1 4Q1RA 1RUH1 5FMOL 1R082 1IS4A 1SBFA 1O3RA 2ZABA 3M3OA 1A78A 1H4HA 4K40A 4RGGA 2D5FA 3R05A 1FPN1 4I3GA 1AHSA 1RVF3 1AR82 2PA7A 3SCGA 4CDQC 1VBD2 2AUYA 2GNDA 4Y22A 2ARXA 2DCJA 4XFAA 4ZU7A 4FVVA 5CG9A 1RMU3 4Q4Y2 4R9AA 2XJPA 1C4RA 3CO2A 1PGL2 3EQEA 2B39A 4YW5A 2VG9A 4LE3A 1U0AA 2EXKA 3D0JA 2W08A 2WZR2 5T3NA 2R0FA 3BPZA 3TOJA 2XLGA 1W6NB 2RR11 5CAZA 1IQAA 4E2QA 2X29A 3Q9OA 4X8PA 2RS51 3DUIA 1WLCA 4JGZC 2R1DA 4M3CB 2JG9A 3ILRA 2Z5WA 2VW0A 1NCQB 3OY8B 4S2GA 4L11A 2ET1A 2P3KA 2OA2A 3POWA 3MPPG 2G4IA 2WNVC 1MS5A 4SLIA 4XF0A 1BYHA 3VBOC 2VW1A 3W59A 3VHOA 5DG2A 4RQPB 4NR1A 2YGLA 5E16A 4QQ2A 3IT8A 5K0UA 3FUOA 4X8NA 3WW3A 1SCSA 2GC1A 5IK7A 1FYUA 2RMU3 5EWSA 4ZXKA 1CAWB 1R092 4Y26A 5J48A 1F8VA 4QD2A 3C2UA 1VRH1 3ES1A 1Q43A 4M3CE 2ZHKA 2ET7A 3IIAA 4PIXA 1GZCA 3TRSB 2VNRA 2JD4A 4RS5B 4YVSA 4U2AA 1WMFA 2DU0A 1OFNA 2YPJA 4LO8A 1WLDA 1LESA 1F5FA 1VRH2 2WT0A 2IXHA 2PHRA 2IC1A 1TMF3 3M1HA 4W6WA 4V1PA 1BKZA 1OA3A 5H9SA 4D7TA 4LNVA 2EF6A 5EFUA 5C8CB 2JX9A 3ZN6A 1XNDA 4UBHA 1AYN2 1JH5A 1CPMA 1K5MB 2DUQA 2ZACA 1H2KA 2Q4SA 1LOGA 3M2MA 2WC2A 2Q1MA 5AC92 3T1MA 3ZMNA 2PLV1 3RDIA 4CTEA 1PO11 1B09A 4S2DA 1ULGA 2ZX0A 4JGYC 3USSA 3N4MA 2XWJB 1OSGA 3AXEA 2QJVA 3M4FA 1FNYA 4N43B 3LA3A 4MUVA 1PVC3 4GKYA 2RS32 1RUG1 4MV2A 5BNQA 2Z2SB 2JDZA 1EYBA 1MEC3 3BALA 3V56A 1O5LA 1DZQA 3L2YA 4Q4V1 3MLKA 4YARA 3V0BA 3ZVXA 3KCYA 5FPZA 2ZMLA 1N47A 2DTYA 2QDRA 4L92A 2DCTA 3BB6A 4Y4YA 1YI9A 1VLNA 2NP0A 1QF3A 3DGTA 1RUI1