2PHRA

Pterocarpus angolensis lectin (pal) in complex with man-7d1
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
240
structure length
240
Chain Sequence
EDSLSFGFPTFPSDQKNLIFQGDAQIKNNAVQLTKTDSNGNPVASTVGRILFSAQVHLWEKSSSRVANFQSQFSFSLKSPLSNGADGIAFFIAPPDTTIPSGSGGGLLGLFAPGTAQNTSANQVIAVEFDTFYAQDSNTWDPNYPHIGIDVNSIRSVKTVKWDRRDGQSLNVLVTFNPSTRNLDVVATYSDGTRYEVSYEVDVRSVLPEWVRVGFSAASGEQYQTHTLESWSFTSTLLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lectin
publication title How a plant lectin recognizes high mannose oligosaccharides
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 53
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2phrA00
2VUAA 5H9SA 1QKQA 4IQPA 1V6JA 4XMAA 1ZA4A 3D6EA 1WLDA 2ENRA 3AZWA 3WG1A 3WDTA 2D6OX 2UURA 3AYCA 3GALA 3MW4A 1LJ7A 2EF6A 4BMBA 2XB6C 4DQAA 1KRIA 4FPOB 4Y24A 4ISQA 4XMIA 3FUOA 3ZYPA 2PHRA 1WW4A 1FX5A 5DG2A 4BMEA 5GZEA 1SLTA 3NV1A 1LGBA 4GKXA 1MS0A 1RINA 1G9FA 5DG1A 3UJOA 1N3OA 1LOEA 3O5SA 3WHTA 1Q8PA 1AX2A 1BXHA 4Y1VA 1WCSA 2VH9A 4Y1ZA 5T55A 3UJQA 5E89A 1JOJA 3SLIA 1ULCA 2PHFA 4DRRA 1SLCA 4AVVA 3Q9OA 1YXWA 4GWNA 1V6OA 1FNYA 1A3KA 2ZGNA 2EIGA 3M1HA 2EXIA 3ILNA 2DUPA 2A6VA 2EAKA 3HN1A 2ZAAA 4FPGA 1YRZA 1C1LA 4GWMA 4FPLA 4CRQA 4DFSA 1MS3A 3AXDA 2AH2A 4M3CE 5HCAA 1ENRA 3IKWA 1V00A 1W6QB 2ZGOA 1D0HA 3AYAA 2CTVA 1JUIA 5GJ6A 4C1XA 5KXEA 1UX6A 1ULEA 1SBFA 1HQWA 1GZ9A 1S0IA 1LTEA 3POWA 2DU1A 4ISRA 2CWSA 2R0FA 1WBFA 2ZGLA 3ZSMA 1KDMA 1GICA 2Q5TA 4Q1PA 4WVWA 4XIKA 1Q8SA 5IK5A 2GMMA 4FPYA 1V6KA 3INAA 1N1VA 4YW4A 3VKOA 4LBNA 5EYYA 1VIWB 5F9TA 3PVEA 1UMZA 2VXRA 5BYNA 4YLZA 1CQ9A 1LOAA 3SITA 1LU2A 1V6MA 1MZ6A 3PJQA 5GLZA 1SFYA 4D69A 1GZWB 1AXZA 3WG2A 4NOTA 2A6XA 4FQZA 3AYEA 5EYXA 3NV3A 5CNAA 3WG3A 4XHXA 4LBJA 5E8AA 1BQPA 2P3JA 3W58A 3WZ1A 1CONA 5T54A 1CPNA 1H9WA 3OY8A 4XJUA 5GZGA 1BJQA 1R1ZA 1Q8QA 4XIOA 2ZGQA 1QU0A 1C1FA 2C5DA 4R9DA 3ZXJA 2W08A 3DGTA 1ULFA 2ZABA 4TYSA 1AZDA 1W0OA 1IKPA 3WDYA 2DUQA 1C57A 2DURA 3AZZA 4BPZA 4AGGA 1Z78A 4PQ9A 2LTNA 3TAYA 4UW6A 1OKQA 1YO8A 2E6VA 3B3QE 3MW2A 3KM5A 1LGCA 2SBAA 4P9WA 1QF3A 3ILRA 2NMOA 4LBMA 2UWBA 2ZGSA 4Q2FA 4PCRA 3WNXA 2NYYA 1AF9A 1W6OB 2VW1A 1LEMA 1MS8A 2I2SA 2JD4A 2LALA 3R05A 2ZHKA 3ZSLA 4RA0A 4XJWA 2WT2A 1ZM1A 3B69A 3PVNA 3RMYA 4YM0A 1AJKA 4FP2A 3WOGA 2ZGUA 1UKGA 1N1YA 3I8TA 2A3XA 1KJRA 3H0OA 2ZMNA 4K20A 2W39A 1WLWA 2OUHA 2ZHLA 1F5FA 2JE7A 5EXOA 3WHUA 2CNAA 4H55A 4P14A 5H9QA 3LSDA 2ES3A 1JHNA 1QOSA 2JECA 4CTEA 2YROA 4BOWA 3VUOA 3V64A 2YMZA 5IUQA 4JCKA 2D6LX 4FOYA 1W0PA 3U4XA 2R1BA 2VU9A 1N3QA 1AXYA 2ARBA 4YZ4A 1UN1A 1DHKB 1IS3A 4PBOA 2JKBA 3CNAA 3B01A 4LBLA 4XYXA 4YZ1A 2ZBJA 4HL0A 1DYPA 3SISA 5KXDA 3ZVXA 5DXDA 1HQLA 3FLPA 3SNMA 3N7KA 1F9KA 3A0NA 4M3CB 4Y22B 4YGBA 3LSEA 5L73A 1OFSA 3WV6A 1DQ0A 2DTWA 3MEPA 1VAMA 2A3WA 2PHTA 2VW0A 3N7MA 1V6NA 4XTMA 3ENRA 3AX4A 4NO4A 1DYKA 2ZGKA 3VKNA 3AXEA 3OGGA 4YZ3A 2YZ4A 1CESA 1UZZA 4Q8LA 2WLQA 1VAVA 3OPZA 1CR7A 4JRAA 2ZKNA 2A3YA 4GXLA 5E88A 4ASMB 1ENQA 1GANA 5IT6A 1U0AA 2P37A 1DQ6A 4LBQB 2XG3A 3PMEA 2ZZJA 3O0VA 5DUUA 1QGLA 3NV4A 4UW4A 1Q56A 1FAYA 1SCRA 4FPHA 1LOGA 2JDZA 2CY6A 2E53A 2R0HA 1LULA 1QDOA 1QDCA 1SLIA 4RL7A 1SLLA 1WUVA 1UZYA 1IS5A 2ARXA 3POSA 2P34A 4YG0A 2OUJA 1ULDA 1WW6A 3N3HA 1S0EA 3IMNA 1LEDA 2DYCA 3VKMA 2TEPA 1AX0A 1SBEA 3AP4A 1W6PB 4YZ2A 3AK0A 1JW6A 1MZ5A 4FPEA 3KQRA 4LBOA 3VKFC 2DVFA 1G9DA 1WW5A 5DZFA 2EXHA 1AX1A 4KBBA 4DRVA 1W6MB 1W6QA 3NWKA 5JLVA 3WDUA 1H30A 3USUB 5KXBA 4K1ZA 1N47A 3OYWA 4XE9A 1GBGA 1BKZA 4XOGA 4YM2A 1G9AA 3M3EA 1JXNA 4P9XA 2D6MA 3RMXA 4Z8BA 3IM0A 2PHXA 3R4SA 1EPWA 3V0BA 2DVGA 1O4ZA 3WVJA 1CIWA 2WSUA 1S0GA 2ZGMA 1MS5A 3M3QA 2GN7A 4C1WA 2GNMA 3C2UA 4ATFA 5F5QA 2CL2A 1MVQA 2ZGPA 3ZPYA 4FPJA 2EXKA 4XDQA 4HANA 4YW1A 3SH5A 2CYFA 1A8DA 1KJLA 2AR6A 2G4IA 4M00A 4Q1RA 5GLWA 5T5OA 3RRDA 3FLTA 4YM1A 2JJ6A 2NM1A 2SLIA 5CB7A 4ZKTB 5IK4A 2E51A 1GSLA 5H9RA 4FOQA 1LOFC 2EXJA 4M3CF 2WJSA 2ZGRA 2D44A 2UWCA 3AZVA 4Y1YA 1WD3A 2NN8A 4YG3A 1J1TA 5LK5A 3ZXKA 4AGVA 1SBDA 1MS1A 2A70A 2E7QA 1DZQA 3B9CA 3D5OA 2DTYA 1CPMA 3MW3A 1JYIA 1UPSA 1LGNA 2GALA 1A78A 1HLCA 2ZMKA 3QCWA 4FOVA 2PELA 3RQ0A 4CZSA 5FRAA 1W6NB 1AXKA 3T1LA 3OY8B 1DQ1A 3MPPG 1G7YA 2GNDA 3ASIA 2VY0A 3UL2A 2YY1A 2NMNA 3WUDA 1G86A 1FV2A 1YYNA 1GYKA 1I3HA 3WG4A 1Q8VA 5DZGA 3N7JA 1RIRA 2ERFA 2YV8A 3O0XA 4P9YA 3M3OA 1TEIA 1KITA 4XZPA 1AVBA 3B00A 5T5PA 1DQ2A 4XJZA 1IS6A 4UW5A 2KM2A 4JC1A 1WLCA 1G8WA 4Y20B 1QNYA 5JDBA 5HCBA 3BIWE 4Y1XA 5T50A 3V0AB 1V6LA 1NXD1 5JMCA 5CBLA 1JN2P 2OW4A 2WKKA 1DGLA 3O12A 3HR9A 3FLRA 4GA9A 4WZFA 4YW5A 2D6NA 3JU9A 3ZXEA 3ZXLA 4YW3A 4XJ8A 2ZMLA 1JBCA 1QOOA 4XJAA 3PVOA 1GNZA 5HCFA 1GLHA 5KXCA 2W52A 2AENA 5JVVA 1WBLA 2P3KA 3FFZA 5GZCA 4YGCA 1X50A 3M3CA 2AYHA 4ATEA 1APNA 1ONAA 1BYHA 4YGDA 5FREA 5H9PA 2Z42A 1F31A 2GNTA 5JOYA 2R1DA 2R16A 3BODA 3IPVA 5DUXA 5CA6A 4AVSA 3NV2A 5IK7A 1QOTA 4XTPA 2DUOA 3TB0A 3M2MA 1MACA 1SCSA 2PHUA 3AP5A 2D7FA 2W68A 4YZ5A 3WDWA 4M3CA 3AYDA 1LU1A 1FYUA 3V65A 1SLBA 1UAIA 1FATA 2WT1A 1VLNA 2JE9A 3SH4A 3AP6A 3ZXFA 1Y7BA 5T52A 5JOXA 4R9AA 4Y26A 2WT0A 3N36A 3WLUA 2P2KA 2A6ZA 1V6IA 2WSVA 3RSJA 1N3PA 2D3PA 3L2YA 5DZEA 3T2TA 4K21A 4DS0A 2ZACA 1N1SA 4ZXKA 3ZSJA 2GMEA 4LBQA 1GZCA 1LHWA 4YM3A 3HMYA 1G9BA 4U2AA 2A71A 3GNEA 3O0WA 1MS4A 4AGRA 1YIFA 5DUVA 4YFZA 2D3RA 3RS6A 2AREA 1HKDA 2D3SA 1LCLA 3OBTA 4FOWA 4PF5A 5T5LA 4Q8KA 3N35A 2A7AA 1IOAA 3N7LA 1LODA 2A5ZA 4BM8A 3WDXA 3SH3A 2NZ9A 4ITCA 2UU8A 1W6PA 1S0FA 2HYKA 1MR5A 3POYA 4SLIA 4XXAA 1G9CA 2A75A 1S0DA 1MS9A 5SV8A 2WQZC 1S0JA 3ZSKA 1W6MA 4YG6A 3W59A 2BQPA 4XJ9A 1LECA 3BOPA 4YGEA 3USUA 1KQRA 2EALA 2YXSA 1B09A 4AVTA 3AZXA 1GKBA 2DVDA 1PZ9A 1D2SA 1NLSA 1N1TA 4XBLA 2NP0A 5IK8A 4K1YA 1WW7A 2D6PA 4AYUA 1H9PA 2R49A 1CJPA 5GLVA 1VALA 5T5JA 1PZ8A 3OYWB 5GM0A 1ENSA 1LHVA 1FV3A 1GZWA 1YI7A 5EWSA 2ZHMA 4FVVA 3UK9A 1ULGA 4F83A 4M01A 1LESA 1WD4A 3V0BB 1DQ4A 2UWAA 1LENA 1RITA 1URXA 1SLAA 4FPCA 2A6WA 4WVVA 1BZWA 1UL9A 4GALA 1S1AA 2FHRA 1DQ5A 2GDFA 4BQ1A 3VV1A 4FPFA 3FUQA 5GALA 2AGSA 1Q8OA 1QMJA 3APBA 3FBYA 1DFQA 4AWDA 3AP7A 4L8QA 1I1EA 2H0BA 1IKQA 3JUUA 4R9BA 4FP3A 1S0CA 3OJBA 1KDKA 4BLJA 5JOWA 1W6NA 4UW3A 2GMPA 3BTAA 2E7TA 4PBPA 4Q26A 1DBNA 2ZHNA 3AZYA 4U36A 3R4UA 4XXPA 5GLUA 5GZFA 1AJOA 3IN9A 1IS4A 2DVAA 2FMDA 4W65A 3D4KA 1W6OA 1HDKA 1LOBA 4FQ4A 1PZ7A 2D6KA 4YW2A 2GNBA 2VW2A 5GLTA 4FPKA 1QNWA 1XQNA 3AJYA 4Q27A 4Y20A 5JOZA 2GN3A 1SACA 4LBKA 4XBNA 3V0AA 3QLQA 2V5YA 3OBRA 1S0BA 2PHWA 2OVUA 2A6YA 3I4IA 3WDVA 4LBQD 4MYEA 3WCSA 4TZDA 1OQ1A 4XBQA 3A4UA 1Z0HA 1LHNA 2DVBA 5DUWA 1MVEA 2AUYA 3LCPA 4GKYA 2ZA9A 3AJZA 3AFKA 1LHUA 4OZXA 5AVAA 3AP9A 4XHBA 1GV9A 4XILA 2V73A 3DUIA 2P3IA 2CWMA 3RG0A 5GZDA 1FNZA 2ZGTA 4I30A 2DWRA 1O4YA 1LHOA 1CN1A 3T1MA 4R9CA 3ZYRA 2WNEA 1LOCA 2D43A 2B7YA 4Y1UA 4WV8A 4DPNA 4YFWA 5CAZA 4BLIA 4Y22A 3ATGA 3WUCA 2RHPA 3VKLA 1DIWA 1LOFA 2C9AA 3WCRA 1DLLA 1GNHA 2DV9A 1C4RA 2DU0A 1JYCA 3A0KA 3IPVB 3ILFA 1CVNA
chains in the Genus database with same CATH superfamily
2VUAA 5H9SA 3D6EA 2BFUS 3HT2A 3U75A 3WG1A 1JYXA 5DAQA 3GALA 3PVBB 1LJ7A 2XBO2 4C8DA 2XB6C 4CCNA 3K48A 4CCKA 4DOUA 1UY3A 3IT8A 1WW4A 4B1LA 3NV1A 2VVDA 1H2LA 1RUH2 1G9FA 2RVAA 3RVHA 1H8TC 1QJU2 1RUE2 1VJ2A 2W2IA 3IDAA 3O5SA 4QQLA 5EJ1B 4E8CA 3I3BA 4Y1VA 5L9BA 5T55A 3UJQA 3UETA 4IEOA 4RHV3 3W21A 1JOJA 1ULCA 3CKHA 1UIJA 2UYAA 2BOJA 2C9KA 2HWD3 3ACFA 1SLCA 4AVVA 1L7QA 3LD8A 4DRRA 1WMEA 5JUVA 1V6OA 1UOFA 2DBIA 2VCCA 1MPXA 2ZGNA 3M1HA 3WF4A 1E5IA 1R092 2EAKA 2ET7A 4CDWB 2JDAA 3EBRA 5FUIA 3MGUA 1K45A 4FPLA 4GWMA 5CFCC 2RG4A 1KGYA 4AI0A 1WA4A 2PAEA 1JUHA 2VNGA 2C24A 2ET1A 3HNYM 1W6QB 2JE8A 1H2MA 1JUIA 3M4FA 4C1XA 5KXEA 2VZ3A 4EWAA 4EJRA 2BNOA 5ABJB 4P00B 1HQWA 4D6RA 2RR11 1S0IA 2F4LA 1LTEA 3POWA 1DZRA 2R0FA 3U37A 1WBFA 5HV4A 2GP3A 2O1QA 4BXSV 4AFCA 2F6BA 1E57A 5JIUA 3CEWA 2GMMA 2QDNA 1N1VA 5B2GB 3SKJE 5C3RA 4KGQA 2HWE2 5LWBA 4F8AA 3IAPA 4G3YC 1PGL2 5J98B 3B93A 2LUWA 4HK9A 2BOIA 5FV3A 3JD72 1ND2A 4YVWA 4OHVA 4ZZ5A 4B29A 2E9QA 4MLOA 4XHXA 2GC2A 2Q8CA 1VRBA 4BK5A 4QX0A 2PN5A 5J09A 4IGOA 4GZ9A 1VBE2 1MQTB 3B02A 1CPNA 1PO22 2JG8C 2VPVA 3IZOA 3OY8A 3VDCA 1ZBE2 1R1ZA 5C3OA 4R9DA 2C5DA 1WZXA 2FMYA 3ON7A 4YVSA 3ZXJA 3DGTA 3ZDVA 2ZABA 4RR3C 3SEEA 1W0OA 2PLV3 4N43B 1RUF1 1K3IA 4FAHA 3EMRA 2RJ2A 4PQ9A 2LTNA 1ZA7A 3KS7A 4YARA 5A80A 1YO8A 2R062 3KM5A 1LGCA 1OLQA 1YEWA 5A1AA 4LBMA 3ILRA 4AFDA 1AR91 2RS12 2VGDA 1CAWB 2NYYA 3CQOA 1WCKA 1W6OB 2VW1A 4MXWB 3R05A 4Y33A 1ZVFA 4HKLA 2MNGA 5FMOL 1CJDA 2Y0OA 1VBB2 1Y9GA 3PUSA 2BRTA 5IHRA 4UFIA 3GDBA 3OGSA 4JTNA 1AJKA 3IIAA 4PIYA 2R32A 1O59A 4K20A 1OF3A 4XURA 2QQMA 5IVYA 4FFHA 4IV3A 2RDSA 1BBT3 3U0ZA 1F5FA 1Y3TA 4CDQA 4Q4V1 3D82A 2CNAA 3VBFB 4H55A 4P14A 3ZM8A 3LSDA 2ES3A 2JECA 1QOSA 4E2GA 4QHBA 3HIFA 1NCQA 3GZUC 1H1MA 2YMZA 4ZU5A 4NAMA 5IUQA 4UXAA 1W0PA 2YBKA 5HPOA 2R1BA 1V70A 1YQ8A 1N3QA 3RNSA 1IPSA 3ZR5A 4ZS3A 1IZ3A 3H3LA 2V09A 3B01A 4LBLA 4RD7A 2Z79A 4CCEA 2Q1ZB 3LIGA 2QQUA 1JZ3A 2ATFA 4OHXA 2LW8A 4P5HA 5DXDA 1PK6B 1QJFA 3ZVXA 1IG0A 2PHDA 5BNPB 2VC9A 2B45X 4FT8A 2VG9A 1F9KA 4OCTA 4M3CB 2ZXQA 4WM8A 3LSEA 5L73A 1DQ0A 2DTWA 1ULPA 1VAMA 2WNVC 3SCFA 4ZU7A 5B4XA 2BFUL 3AX4A 3J8F1 2EAAA 4QKDA 4RGAA 4LEJA 3VD9A 3B9IA 4D94A 3GGLA 2J1AA 3BUCA 3OGGA 4IV1A 3BKZA 4JDOA 4E4ZA 2VCAA 1VAVA 2HBUA 5A7PA 2RR12 4GXLA 4OYUA 5FO9B 1RUI1 3NL1A 4OLLA 5IT6A 3HJRA 1FPN3 4Y5SA 4MZUA 5FUNA 2VOWA 3NAPA 2JX9A 1VPHA 3T2PA 3DPRC 3NV4A 1Q56A 1NLRA 1FAYA 1NA1C 3R0RA 4URTA 4BQXA 1W9WA 4EN0A 4D8MA 4DXRA 4E8DA 3PJYA 3C7HA 1PO11 1SLIA 1WMXA 3EHKA 2QQKA 2WR9A 4UFKA 4YG0A 4EN7B 4ZXEA 4DB5A 3GCXA 3N9NA 1K5MA 1ULDA 1WW6A 2VVEA 1EV11 3BPSA 3N3HA 1S0EA 1UOJA 2D40A 2DYCA 2NLRA 4JDNA 5FXZA 1AX0A 3WEZA 3AP4A 1AYN1 2LS6A 4OI0A 3G6JB 3NNJA 2JIGA 5JR2A 3VZNA 4LBOA 2DVFA 4PLMA 1YWKA 5JLVA 1ZRIA 3WDUA 4JV4A 3GF6A 4QX8A 5FZFA 2RDRA 3B5LB 2RS31 3OYWA 1RMU3 1L3JA 4ZZ8A 3AMNA 2VOKA 1WMFA 2D6MA 3MLJA 5FZLA 1KEXA 3ZFEB 5K8SA 1H1AA 3VBRA 1O4ZA 1RUF2 4QB1A 1CIWA 4L9BA 3RZLA 4Q0SA 1OBNA 1OVPA 2BJSA 4GB33 1XNCA 1PHMA 1QH6A 2ZGMA 1MS5A 2OZ6A 4GH4C 5ANQA 5FZEA 4ATFA 3P5BA 2CL2A 1UKRA 3BB6A 1OUXA 4GWIA 1AR92 4JKMA 1MEC1 5IVJA 4XQDA 2IXHA 4Q4Y1 4BQ2A 5LEJA 1JTZX 4Q1RA 2XMLA 1B35A 4YM1A 2NM1A 2W5FA 4P5YA 4ZKTB 1F8VA 4NHLA 1DGRA 1XU1A 2VTXA 3OCPA 5FZHA 4BJ0A 5FZBA 4FOQA 1LOFC 3GJBA 4IEQA 3KB5A 3A21A 4Y1YA 2NN8A 1POV1 4CU8A 4NIGA 2BNMA 4FTEA 2WA3A 3PTYA 4URAA 4HKOA 4QKFA 2XBO3 4D6QA 1CPMA 4WM7B 4EWDA 4QKBA 2ZTNA 4CZSA 5FRAA 1W6NB 1AXKA 2VZPA 4Q4V2 1DQ1A 2BTVC 1ZRDA 3U14A 2Q0AA 1RUE3 1OI6A 5J37A 1W8NA 3HBKA 1A8MA 5DZGA 1NQJA 2ERFA 2K46A 2WBKA 2YV8A 3O0XA 5FY7A 5C8CB 4DUXA 1F5JA 3B00A 4UAPA 5FK7A 2LROA 4UW5A 3ST7A 5I8YA 5JXIA 3HQXA 1D4VB 4JC1A 3THTA 5FPZA 1R093 1C5HA 1R083 3FMGA 1PM4A 2E33A 2WAOA 3GBWA 3OPWA 4LK7A 2RS53 1JN2P 3FL7A 3M70A 3FLRA 4WZFA 3JU9A 4B8EA 2ZMLA 1JBCA 2CDOA 3PU3A 4OVEA 4QDRA 3J8F2 2BNNA 2P1BA 4NIIA 4AFAA 1J1LA 1OKOA 1D4M3 4D7YA 2XDVA 1GLHA 3KHCA 1L7RA 1QQP1 2W52A 4IESA 1AR83 3S6PA 1J59A 3S7EA 5JI7A 4DXSA 1WBLA 1STMA 1X50A 1RUI2 3RZGA 1SDDB 3WY6A 4ATEA 1ONAA 4QX1A 4A45A 5L7OA 3THPA 4B4PA 4N9HA 4RGGA 3LA2A 2FZ1A 2XJSA 2J1VA 1HW5A 1GQPA 5CA6A 3NV2A 1PO12 2K2SA 1QOTA 4XTPA 4XDPA 2B39A 3JD73 2OZJA 5FJKA 4K9SA 3T4VA 1MACA 2PHUA 2QJVA 3AKRA 4LKEA 4CXYA 4Q0QA 1MZFA 4A6SA 1EV12 2XONA 2XL7A 1AYN2 2W47A 3ROUA 2O14A 1XNDA 2WT1A 1AL21 5FZMA 2ORZA 4AHZA 1NLQA 2P6HA 4XAAA 1TME3 5APAA 3E5QA 4DXZA 3SCGA 2AC1A 4AVCA 2RS32 3O14A 3NNMA 2I07B 2V72A 1WLTA 3RSJA 3Q8BA 2VOVA 3CJIA 4PQQA 1GZCA 4YVSC 5FWEA 5I0RA 3H8RA 2HKXA 2A71A 3O0WA 2CU5A 4MH0E 1W03A 1F2NA 4NWVA 2OYZA 3D8CA 4UT5A 4JGZB 1CAXA 2A7AA 1HB4A 3WP5A 2YBSA 4N43C 2A5ZA 2D98A 3J7NA 4RS5B 1MEC2 2MEV1 4Q4Y2 3SH3A 2NZ9A 3ZN6A 1IPKA 2UU8A 1W6PA 1S0FA 4LPLA 1COV1 2QTWB 4SLIA 4LHNA 1S0DA 3LFMA 3AB0A 5I0DA 1W04A 1ODMA 3BOPA 1SPPA 1R1A1 2TUNA 1VRH3 2EALA 2WNUA 3UKVA 2B5HA 2GC3A 2WN2A 2DVDA 2X5IB 3FJSA 1NLSA 1IQDC 1N1TA 2RM23 1YJKA 2J42A 5IK8A 2D6PA 2YB7A 5I8TA 5LZ6A 3VDBA 1H9PA 3SMHA 2R49A 1CJPA 2Y33A 4IV3C 1PZ8A 1RUNA 3PUAA 1HN1A 3RFRA 2WO1A 4LE3A 5BY5A 3HN3A 1FV3A 1GZWA 2JDPA 4ASKA 4TLFA 1NCQC 4FSJA 2QCSB 3RZHA 1WD4A 3VD7A 3H8XA 1URXA 1TZOA 4BWOA 2A6WA 2VMGA 4WVVA 3UYJA 5FOJB 2FHRA 4CYDA 3I2GA 1ASJ1 4FPFA 1W3VA 5GALA 2AGSA 3APBA 3FBYA 3PHMA 4AWDA 1JODA 1SDWA 3I2KA 1H8TA 3HT1A 1TE1B 2QBXA 1RJ7A 3JCIA 2IWGB 3E1F1 2H0BA 2ZX2A 4IE4A 1OOPC 4QDQA 2LM3A 2VMFA 3K4ZA 4Q26A 1QQP2 1JYVA 3POGA 4OI2A 4U36A 4XXPA 2WO7A 2VZRA 3E6DA 4V2WA 4RFRB 4A7KA 3VZKA 1O3TA 1NAEA 3IN9A 3CO2A 5F39A 5JWPA 1IS4A 3CIHA 1NY71 5FP9A 4LE4A 3HNBM 4FFIA 2WIIB 1RHI1 2D6KA 5F6LB 4DY5A 4B4QA 1T6BX 1Z7S1 1UU6A 5G05L 2W3JA 4FPKA 4OUSA 4P08A 4JKLA 1D0GA 1XQNA 4JRLA 4I09A 4K40A 3OBAA 5JOZA 2YBPA 3FFQA 3Q8AA 4CE8A 4LBKA 3WP3A 3WF0A 4MUVA 3VBSB 4V2VA 5ISLA 3NNFA 1UMHA 3OBRA 1X9TA 1S0BA 4DIQA 2A6YA 3I59B 4LBQD 4UBHA 4TZDA 1AL22 3PL0A 4XBQA 4XEZA 3A4UA 5FZ8A 1NZCA 4MXVA 2ZA9A 3AJZA 3RJ2X 1W9FA 4OZXA 5AVAA 3POFA 1GV9A 4FTBA 1RUF3 4GAZA 3OF1A 3LDKA 1UX7A 3RG0A 5GZDA 3S57A 2ZGTA 2FDGA 4SBVA 1XNTA 3OEBA 4CEWA 1JMUB 4COVA 4HVQA 1AR93 5L36A 3MIBA 3POJA 3WUCA 3VZJA 2JG8A 2WZPP 3LEIA 4N90A 3WNMA 1JH5A 1DLLA 3ACHA 4E4DX 1DGRN 2MEV2 3CF6E 4RR3A 1VBC3 3ETPA 3IPVB 3ILFA 2CGNA 1JYTA 1K42A 1COV2 1CAUB 4QGNA 4YRDA 1OHFA 1EUTA 1B35C 4HETA 5T5JA 4XMAA 1PX4A 2GC0A 1T2XA 2JWPA 4CPBA 1R1A2 2CHHA 1KRIA 2Z5WA 3ZO0B 4BMBA 2XLAA 5K0UC 2YYOA 3RYKA 4I0WB 4Q4V3 3ETQA 5HXVA 3ZYPA 2PHRA 1FMD1 5DG2A 4AOCA 1VMHA 4BMEA 2OX0A 1LGBA 4MADA 1RINA 3WHTA 3I2IA 3JZVA 3NO8A 4AAXA 4WM7C 1AX2A 2QQJA 3GBGA 1BXHA 1WCSA 3JXSA 3KV4A 5E89A 5KHHA 3Q9OA 2V5DA 4NPRA 2W95A 3VLBB 1RL3A 1FNYA 3H1MA 3DYPA 3ZFFB 5IAXA 1C8M3 2EXIA 2WFPA 4KGGA 4AEDB 4BH9A 1QJZA 2ZAAA 4HVRA 1ENXA 4X6RB 1ASJ2 1YRZA 3VDDB 4CP9A 2VXJA 4DFSA 2VR4A 4E2QA 5CG8A 1MS3A 4MGTA 3AXDA 4CDXA 1YLLA 2CGOA 5CIRA 5IATA 3AMPA 2BBVA 5HCAA 4P9JA 1ENRA 1UZVA 1V00A 3AYAA 1HIXA 1UZ0A 2CDPA 1GUIA 2Y60A 3A22A 4LHKA 1UX6A 1ULEA 5A7WB 4JZRA 3PNAA 1T6GC 3VBHB 3WD5A 2Y26A 3VHPA 3EJKA 2CWSA 4ISRA 2ZGLA 1RUI3 4BCUA 4BQWA 2Z69A 1XNAA 1GICA 2Z2SB 4R8HA 1X33A 4OMCA 2YFZA 1E5HA 3AMQA 3I2JA 3UESA 5FYIA 5IW0A 2WNVA 4AI2A 3BALA 5F9TA 1PO13 1RHI2 1VBD1 2FCVA 3LE0A 3ZN4A 4BISA 1SFNA 4OFGA 3K77A 5L7OC 1Z7S2 1MZ6A 2WLPA 3BPZA 1OD3A 5GLZA 4D69A 3LPGA 3O1RA 2HJIA 1AXZA 3WG2A 2HWF3 5EYXA 5JR7B 3NV3A 1AYN3 5CNAA 4C0BA 1CAVA 2Q1FA 5E8AA 5FZ1A 5F5CA 5CG9A 4AHXA 4CXWA 5BNOA 3OBZA 3MO4A 3MFAA 3QBQA 3WNKA 3VGIA 5A1FA 3J7LA 4XJUA 3DPRA 5CU1A 1NA1A 1Q8QA 2Y6JA 2QZ2A 5C9AB 1C1FA 3N9OA 2QQVA 2W08A 4RFT0 1ULFA 5LASA 5D8AA 3ZR6A 2GSYA 1PNFA 3WDYA 2FD8A 1ULOA 1C57A 2DUQA 4H7MA 4O61A 1W99A 4AGGA 3TAYA 1HB2A 3LA3A 1OKQA 2E6VA 3B3QE 2ZKLA 3CJIC 1HB1A 2HWB1 3ZX7A 5LBBA 2UWBA 4UFJA 4CU6A 4PCRA 5CVRA 2RV9A 5FMOS 5F6KA 1AF9A 1QXJA 2CV6A 4S2FA 4FCAA 2WFF1 4OI1A 5KC5A 1YJLA 2PFWA 4KWLA 1UCXA 3ZSLA 1GP5A 3M7AA 1X8EA 2WT2A 3LKJA 4JGZC 2GH8A 4XFAA 3L9JT 1RUC1 5ERLA 2C4XA 1UKGA 2C26A 5FZGA 2GZWA 4K8RB 3I54A 3H0OA 2ZEXA 3KVAA 4EYUA 5A3MA 1RGSA 2IXKA 2WQ4A 5KHIA 2MHFA 5A32B 3OOXA 2OUHA 4BQ4A 2FDJA 4WBBA 3WHUA 1QXRA 2WNUC 3BOWA 1NE6A 3KMHA 4COYA 1FMD2 3FHQA 2V4VA 4QHZA 5FZ6A 5LEKA 5IVEA 2PMWB 2UYBA 4LLFA 5E6HA 4YSFA 2VU9A 1J58A 3MDPA 3CBNA 2RJKA 3KCYA 3MFCA 4AR2A 4DO0A 3ZFGB 2B46X 5J96B 1IS3A 2I45A 5I8SA 4HL0A 1DYPA 2OQ7A 4Q4W1 5K9YA 1U5YA 2W91A 4NWWA 1X36A 3POEA 4HBNA 1HV1A 3VHRA 4IEPA 4META 3E6BA 5JMOA 5DPNA 1BK0A 2B8MA 2YC4A 5DMYA 5AC92 3WXPA 2PHTA 2IVJA 5F37A 1M06G 5JSPA 4R52A 3OB8A 3ENRA 1A34A 4RQPB 4NO4A 1MZEA 1OMIA 3VKNA 1QJX3 4YZ3A 5J7MA 3ZYFA 4Q8LA 2VZTA 2N7GA 2EA7A 1QQP3 2WLQA 4KG8A 1W9TA 3OPZA 3VBUB 5E88A 3DYOA 1FOD1 2YUEA 4CDUB 3WX5A 4I3PA 3FHIB 2P37A 4L99A 4XUPA 1VE0A 2XVKA 5CKMA 4B1MA 1GNYA 3AMMA 3O0VA 3PMEA 2PTMA 4KI5M 1LKNA 3IDEA 1SCRA 3NKGA 5C4WB 2JKXA 5JPMB 1QDOA 1QDCA 4FAGA 1QHDA 1WUVA 2QQNA 1W9YA 2VUJA 1VBD2 5CKNA 3IMNA 4AXOA 4MVTA 4CDWA 3MIFA 4EN9B 3I2FA 1JW6A 1UIKA 4MSVA 5EPAA 4FPEA 2OKXA 3WR0A 4Y3OA 5JI9A 3MF9A 3PUQA 4QWNA 1AL23 1Y4WA 2EXHA 3ES4A 1W6QA 2WWJA 3KF5A 1ZZ9A 1SMVA 2BP6A 1JI6A 2WNOA 4PHZA 4NVPA 2ADEA 4FO9A 5FP8A 4P9XA 5FYHA 3RI9A 3ZKUA 4XPVA 3RMXA 4QB2A 5IAVA 3ZYBA 2H6BA 4PLNA 1S0GA 4MGSA 3RZMA 3LA7A 2GN7A 4MX3A 3ZYHA 4J6GA 3O1VA 2GNMA 2O8QA 3MLLA 2ZGPA 2HWB2 4HG6B 4LTAA 2Q30A 3ZPYA 4HANA 4ZONA 2BEOA 4CEWC 1KJLA 4M00A 1Y9MA 5GLWA 3OUJA 3N4MA 2A73B 3FLTA 3H1WA 1HRV1 5FTTC 2WFF2 2E51A 1GSLA 1RYYA 2WL1A 4QPIC 2EXJA 2EIEA 2ZX1A 2J22A 2WJSA 3MIHA 1WD3A 4QQ2A 1J1TA 5LK5A 1MQTA 1ND2B 1RUC2 2A70A 1PM7A 3B9CA 4OI4A 3MW3A 3VBOC 1UPSA 2GALA 2ZMKA 3E6CC 1I5PA 2PELA 1F35A 4N53C 1DG6A 4IE6A 4FXKB 1RVF3 4N43A 5F3CA 4MHUA 3OY8B 1G7YA 5FYUA 4XC9A 2VY0A 1RUD1 1UMIA 3ITQA 3LWCA 5FKBA 1CWPA 5A6QA 5G04L 1FV2A 4Z92B 4BXFA 1XE7A 1Q8VA 2AZ5A 2Y38A 1RIRA 3GXUA 4P9YA 2MPFA 3H42B 3F95A 3JBG1 4XZPA 1CAWA 1DQ2A 4PI0A 1IS6A 4S2DA 4XJZA 5T5PA 5EFUA 3ZIXA 2R043 3LOBA 4QXBA 4Q4W2 2DDUA 1G8WA 4Y20B 5L19A 1QNYA 1O3SA 1ASJ3 5HCBA 4A41A 4I3GA 4Z2WA 5EV7A 1V6LA 2GAUA 2F4PA 2IUWA 5JMCA 1NOVA 3FX3A 1DGLA 1H1IA 4YW5A 3ZXLA 5LY1A 5JCTA 1SQ4A 1ZRCA 4AVAA 4AEKA 3KWVA 2BVBA 3ZFFC 4CEYC 2ARAA 3JB8A 2ZEYA 3PVOA 1GNZA 1PVC2 4CDXC 1KXGA 5KXCA 1RC6A 4I02A 3VBFA 1ST8A 4LMFA 3LDRA 4QMAA 2BPA2 4LO4B 4C0HA 5IVFA 1BMV1 2J1EA 4LA3A 5A3UA 1FOD2 1YIPA 3M3CA 5C3SA 1RXFA 1APNA 1NYWA 1XOYA 1GU3A 4CDQB 4EQVA 4I2OA 1BYHA 1NCRC 4YGDA 1RHI3 1UQXA 2Z42A 1F31A 5AFBA 1ZBA3 2YGMA 3BODA 1IGOA 2G9ZA 4AVSA 2Y6KA 2Y8KA 4OQ8A 2EVXA 1PK6A 3TB0A 5A3LA 1OOPA 5A3NA 1OLMA 3AP5A 1ZZ7A 2RJLA 4Z07A 2J7MA 5BNPA 1XU2A 2W68A 1I9RA 4HPKA 4PF1A 4M3CA 1J3PA 3I2OA 3V65A 1SLBA 1CD3G 1OA4A 1S4CA 3ZKYA 1UAIA 1W8ZA 3B7MA 5FPLA 2YG0A 4E2SA 3EO6A 2WS91 3EB7A 3VHOA 4JQTA 3SH4A 5FP3A 3HQRA 2E7AA 2RDQA 5T52A 5JOXA 4Y26A 3N36A 5BNOC 1DF0A 2P2KA 4LORA 2QQPA 1N3PA 5DZEA 5F32A 4DS0A 2XHKA 2ZACA 1RUJ1 5A3WA 1PMIA 1WA6X 3ZSJA 5F1RA 4NIAA 1G9BA 4NRPA 4IV1B 3GNEA 5D8AC 2ID4A 2R071 1YIFA 4O9EA 1WCDJ 3J9SA 3GYDA 5C9AC 4COWA 2D3RA 2PAMA 1OXCA 3RS6A 1HKDA 2BW8A 1LCLA 2D3SA 3TNPB 5T5LA 3GCWA 4UI9L 3I7DA 4GMP1 3N7LA 2JDHA 1LODA 4IE5A 1VBA2 4IL7A 3KZ4C 4W6XA 1OFNA 1AYM1 3O1PA 1O3QA 1ZREA 4QX5A 3WDXA 3TN93 4K7JA 1D7PM 1HRV2 2VMDA 1GQGA 3IB3A 2EIDA 2HYKA 2GH2A 4XXAA 4AHWA 1G9CA 4MGQA 2A75A 4QGLA 2WQZC 1S0JA 3ZSKA 3W59A 4NHXA 5FZDA 3I3DA 1F4AA 1ALYA 4CCLA 1KQRA 1Q3EA 1EY2A 2Y0IA 1B09A 1JS9A 4R4XA 1KS4A 3O1OA 1V0AA 4J1XA 5FOBB 3DL3A 3ES1A 2Y6FA 1HXS1 2TNFA 3C7FA 4QHOA 2R7EB 4WVMB 3CU7A 1KFXL 3SC7X 3OYWB 3TEZA 1RUD2 3WF2A 4XFCA 2JENA 4XF9A 2WYSA 1LHVA 4G4FA 4MGYE 1EYBA 3IDCB 2ORXA 1EAH2 2IXIA 2XOMA 3VBRB 2CAUA 1RJ8A 4F83A 1VB2A 1W9SA 1DQ4A 2QQIA 3WQ1A 2XPJA 2UWAA 1RITA 3JBG2 4FPCA 1QEXA 3ZN5A 4LA2A 1UL9A 5FP7A 3AC0A 1S1AA 4GQ7A 2XJQA 5K0UA 5BNNB 5HV0A 5C6CA 3GZTB 1PMHX 4BYYA 4DNYA 1W8HA 3NJXA 3ZFGC 3J7MA 1S2BA 4E27A 4PDWB 3AP7A 1ZNPA 3BU7A 4A4AA 2YU2A 4WM7A 1UYXA 1RUH3 4NIHA 1QXPA 4LO6B 3JUUA 1SEFA 1QJU3 3OJBA 1KDKA 3Q8EA 5EZWA 1W6NA 2GMPA 2E7TA 5TSWA 5GZFA 4UF0B 4W8JA 3R4UA 3ORJA 2XQRA 2JB8A 4XUOA 1BMV2 4NIDA 2G19A 2P4EA 5CYYA 2FMDA 3NJYA 2OIIA 4AL9A 4AQ6A 5C8CA 2P5BA 4EZHA 1GOGA 4Y4RA 3VBUC 2B42B 3BYWA 1WMDA 4LQRA 1JOBA 2GNBA 2VW2A 1W2OA 1JU4A 5GKAC 3ACLA 1QNWA 4UBGA 1RUG1 5LW9A 1GWMA 2PYTA 1QJY1 2YPDA 5FZ3A 3TRSB 2GN3A 1SACA 1NX9A 1YUDA 2NQYA 3QLQA 1O3RA 4O9GA 1W8OA 4CUCA 1PGW1 1NT0A 2PHWA 2OVUA 3I4IA 2L9LA 3VZOA 4CDWC 2WS92 4B7KA 1Z0HA 4PLOA 1LHNA 3AVSA 4NE9A 3BTZA 1YFUA 2ILMA 4QQHA 3I3EA 2RMU1 2XUEA 1ZZCA 3AFKA 4K6BA 4DMIA 3B94A 1OPOA 3O7OA 1OLRA 2V73A 4XILA 2HWE3 2P3IA 2CWMA 2F17A 5ABJC 1RUJ2 2WRAA 1CIYA 2DWRA 3OTFA 1O4YA 4MGIE 4Y4YA 3K4AA 2IC1A 2R072 3SXWA 1O8SA 4CUAA 5J1XA 4X8NA 4ES9A 3BGAA 5FY8A 4F3JA 4Y22A 3RDIA 2XUMA 1BVP1 2OXBA 3WNOA 3O1UA 3E5XA 2C9AA 1VBE3 4KWUA 3WCRA 1AYM2 1PO23 4RHV1 4CU9A 4DINB 5FPVA 1ZBE3 1NG0A 1JYCA 2HEWF 4PT6A 1RUOA 4IERA 4DUWA 4O7XA 2VM9A 4HXCA 4QU1A 1RUC3 4CSWA 1CVNA 3K51A 2VJXA 1V6JA 1SFPA 3AM2A 2WDBA 3F2ZA 3N9QA 1WLDA 1UY2A 2ENRA 4B3NA 1TNRA 1W90A 2D6OX 3AYCA 4DQAA 4OQ9A 2EF6A 2DCYA 4B7EA 2R063 4FPOB 4P9LA 1OSGA 4XMIA 1MQTC 3FUOA 3VB9A 1FX5A 2RS13 3UV9A 1HXS2 4OUEA 3T4HB 4EN8B 4AI9A 3M3IA 5IYYA 2K0GA 4M0HA 3CLPA 1MS0A 4XUTA 3VDAA 5DG1A 4MGKE 1N3OA 2QE3A 5LRSA 1Q8PA 4JGZA 2BZDA 4Y1ZA 1TMF1 2ZZQA 3UGHA 3SLIA 2PHFA 2VZVA 4TSVA 1VP6A 2E31A 1VBB3 3K3OA 4XVHA 1YXWA 4JGYB 1A3KA 1VAKA 4B4RA 3AKTA 1ZZ6A 2A6VA 3BVCA 4YW7A 5LCWL 1ZRFA 5A7NA 4FPGA 3NW4A 1C1LA 4CRQA 1DLCA 4IGQA 3DCQA 5DDJ1 2AH2A 1UF2C 2VUDA 3IKWA 3ZN6B 4LITA 2ZGOA 1JZ8A 3KCXA 1J84A 2CTVA 5GJ6A 3IIIA 4UYBA 3A23A 1SBFA 2Q8OA 5E16A 4NRQA 1GZ9A 5FDBA 4AAPA 3IWZA 3ZSMA 4QPGB 4ASLA 1DCSA 1I5ZA 2Q5TA 3MUY1 4Q1PA 4MHRA 4FPYA 2BGOA 2QZ3A 3VBFC 4IEWA 3ZDSA 5JZGB 2PLV1 3INAA 3HVDA 4H2AA 3VKOA 2ZX0A 4KL1A 2BV4A 4LBNA 5EYYA 5FLIA 4AF9A 2VXRA 4HSLA 2VAUA 5FIXA 1PNGA 3WF1A 5BYNA 2WC2A 4FFGA 4CA9A 1JOPA 3ZXGA 3TEYA 1LOAA 1LU2A 3LEGA 3PU8A 3KGLA 1SFYA 4N9IA 1GZWB 3H8UA 1RUG2 2A6XA 1NXMA 4BDVB 1QJY2 1GR3A 3AYEA 4BIFA 4BU2A 3CL1A 3WG3A 4QX7A 1PK6C 1WCUA 3WW1A 3W58A 5BNPC 1CONA 4X6QB 2RR13 4A3XA 1PGW2 1JZ5A 5DAVA 3T0AA 4QKNA 1H9WA 1US3A 5GZGA 1BJQA 5L9VA 1QU0A 4RYDA 3I2HA 2WO2A 3KF3A 4Q4X2 5DQ0A 1XJAA 2RMU2 4TYSA 5FUPA 2IVIB 1AZDA 4CCOA 2XJPA 1H8TB 1IKPA 5SV5A 4AEJA 2VVFA 2HBTA 2DURA 2VL4A 3DV8A 4HONA 3AZZA 1Q43A 4BPZA 3AKQA 5LA1A 1Z78A 4CP0A 4UW6A 4ARYA 5CZKA 5KR7A 2VBBA 5FZOA 3MW2A 2SBAA 1H8VA 1L7LA 3V56A 4Q2FA 4MV2A 3W5NA 2DCZA 3I97A 3K75B 2ZPXA 5FY5A 1YCIA 1LEMA 4CPBD 5CFCB 5E1RA 4HK8A 1UD1A 5FKCA 3VBSA 1XRUA 2VZOA 4RHV2 3Q8FA 4EV0A 4RA0A 1U5ZA 5FQ0B 4XJWA 1YQ5A 5FK8A 1XBFA 2W9XA 3PVNA 5C4WC 3I59A 1IPJA 5FLJA 5CFDB 4HN0A 5F2SA 2ZGUA 4IW3A 4YNIA 3WOGA 1N1YA 5A70A 2WABA 4OHWA 1KJRA 2ZMNA 5AFEA 3QOPA 1HV0A 1WLWA 2ZHLA 4M4PA 1W2NA 3BIEA 1JHNA 1H2KA 4YYOA 1RUD3 4BOWA 3VUOA 3NJVA 5FYVA 4MOAA 3V64A 3W20A 1K5JA 3MYXA 1GWKA 2D6LX 2G9GA 3HBZA 4JCKA 4NJ4A 3ZFEC 3U4XA 3RZKA 1UXZA 4QPIA 1AXYA 4PBOA 2JKBA 3CNAA 1YHFA 1TMF2 1FPN1 3JQWA 3THDA 2ZBJA 4YZ1A 4L11A 3SISA 1BHGA 3VBOA 2R30A 1QJEA 2J1SA 3KV6A 4OHZA 1S2EA 4N53A 3FLPA 1IG3A 3N7KA 2BERA 4JDMA 4DZGA 2EICA 4YGBA 4ARXA 4TTGA 1AR61 4JX0A 3POBA 2VUCA 3DN7A 2WA4A 2JD9A 5C3PA 5DDJ2 3N7MA 1GOHA 4XTMA 4RR3B 1DYKA 2XKOA 1OH3A 1J83A 1FI2A 5BNNC 2W1QA 3KQ4B 4LHSA 2YZ4A 1UZZA 3ECQA 1GWLA 4QDSA 1UYYA 2A3YA 3K46A 3DXTA 4CVUA 1GANA 4AZZA 4D0QA 1RMU1 2XJRA 3MIDA 1DQ6A 4LBQB 1ND3B 5A7OA 2VMEA 2XG3A 3H9AA 4Q0VA 4UFLA 4BE3A 1YFXA 5DUUA 1QGLA 1OF4A 2W94A 2XXZA 4UW4A 4FPHA 1SZBA 2OPKA 2PLV2 2JDZA 2I74A 2CY6A 2R0HA 3NQHA 1SLLA 5FMDA 1IS5A 2ARXA 2CSGA 4GB31 5C71A 5AC91 5C8CC 1OT5A 3ZFFA 4CEYA 4CCDA 3WW2A 4AEDA 1FT9A 1LEDA 2YC2A 3VKMA 2TEPA 4XQWA 3WQ0A 3J8F3 1A6CA 1V9U1 4YZ2A 3AK0A 1MZ5A 4IUGA 4UFHA 2QUOA 1XC6A 2Q8DA 4AW7A 3LIHA 5I0UA 1G9DA 3O1SA 2QQLA 2WS93 5DZFA 4KBBA 4DRVA 1W6MB 3P6BA 3NWKA 3USUB 4AQ2A 4Z2AA 1NCRA 3OGJA 4NN0A 3SEPA 2PXJA 4CP9B 5A7WA 4KH9A 3ACGA 4DEVA 2C6SA 3M3EA 1JXNA 4XFGA 3WW3A 1JZ7A 5FZAA 2JXAA 3IM0A 3M8LA 3BU0A 2PHXA 1EPWA 1SHWB 2DVGA 4TLGA 3WVJA 3V0BA 2WSUA 1C28A 3BCWA 4A42A 2VMIA 5FCCA 3M3QA 4L0PA 5A33A 3C2UA 1EV13 2ZCWA 5F5QA 4ZU4A 3RZZA 1UOGA 2D5HA 4JQRA 4FPJA 2LRPA 2EXKA 4XDQA 4YW1A 3SH5A 1PIV1 2CYFA 2X09A 2KD7A 5KHKA 3MIEA 1IHMA 1X9PA 2JJ6A 2SLIA 4NPLA 5FY4A 4KQ7A 3AMHA 5H9RA 2RS33 4HZFA 1TG7A 2D44A 2UWCA 4YG3A 3ZXKA 1R081 4EWEA 1NZIA 1MS1A 3AFGA 4QD2A 3ZOIA 1DZQA 1LAJA 5C9AA 2RS51 1A78A 1HLCA 2VZQA 3QCWA 2VTXJ 3HQUA 4ZPIA 1HXS3 4MO3M 3MF6A 4HN1A 3THCA 3T1LA 3DPRB 2GNDA 3ASIA 1QH7A 3FHAA 4KBZA 3NJZA 5D2AA 5FXWA 3UL2A 4J25A 4QX3A 2YY1A 3HOBA 1UU5A 3MI8A 4EROA 2QVSB 1MEC3 1AR81 1GYKA 1I3HA 1YYNA 2W1SA 4Q4Y3 4R4ZA 5DAXA 4C91A 3N7JA 4DY3A 5CISA 4AQTA 1W8WA 1KITA 2BDRA 4BQ5A 1AVBA 1W8UA 1WKYA 2XLFA 3LAGA 1FPN2 1POV0 3D0SA 4QPWA 1W3XA 4FI9A 1POV3 4NMIA 3RGBA 2YFUA 1XYNA 3BIWE 4Y1XA 5T50A 3T2OA 3V0AB 4A44A 4RS5C 5CBLA 3HR9A 3WT3A 4ASMB 1AR62 2D6NA 2WUHA 3O1MA 4YW3A 2X10A 5FY9A 3WNNA 2VECA 3I3MA 3MZHA 5F3GA 1QOOA 2FDFA 3GHMA 4JGYC 4NUBA 4H14A 2HWC1 3LGRA 4NRMA 5A32A 5HCFA 4BQ3A 2JG9B 4JVAA 3H8OA 2WAAA 3FE5A 3P3NA 3EXUA 2X5IC 1TME1 2P3KA 3FFZA 3NSTA 4GH4B 5GZCA 4YGCA 2JIJA 1XE0A 2YHJA 1OH4A 2AYHA 4HKWA 3H7JA 3X29B 1RMU2 4OULA 1Y43B 1OVSA 3ZFGA 5FREA 3KSCA 5H9PA 3MV01 2GNTA 4GULA 5JOYA 4E9KA 2R1DA 3RYRA 5DUXA 3TEWA 3RZJA 2IXJA 2PAKA 4WVZA 2DUOA 4GB32 1RUG3 1UY1A 4QPGC 4QXHA 2VOXA 5F2WA 4XFFA 2D7FA 1U5IA 1ZYBA 3C3VA 4IGPA 4YZ5A 4Q29A 3WDWA 2KXLA 1AUYA 3AYDA 4HSJA 1FYUA 3UGFA 1AHSA 4BZ4A 1PVC1 1V9U2 4PJYA 3RWNA 1W39A 3DEMA 1RB8G 4IEUA 3AL6A 4OZOA 4XABA 2JE9A 4RQPA 3U11A 1E5SA 5LATA 1Y7BA 4R9AA 2DCJA 2RMU3 3VBUA 4A3ZA 4JHZA 4N8MA 2A6ZA 1V6IA 2D5FA 4W6WA 2D3PA 3L2YA 1G6NA 3QH6A 3T2TA 1VRH1 4K21A 3NVCA 2Q1MA 1EPZA 4AHYA 4CDUA 4COZA 4ZXKA 4ORFA 2VULA 5KC6A 2RM21 3ZLIA 3K4DA 1MS4A 5FZ0A 4LT5A 3DKWA 5C4WA 2AREA 4I0AA 3VHNA 2VNOA 4FOWA 1BVVA 4GWJA 5FXXA 1H6XA 3WNLA 2AEZA 1H4HA 1IOAA 1E5RA 1YQCA 2QFEA 1GP6A 1DDLA 5LBEA 1PIV2 2OA2A 3SQOA 2GC1A 4S2GA 3PIGA 3UKTA 3VZMA 1HJFA 1BLZA 4Y5Z0 3ZMOA 1DGWX 1MR5A 3L2HA 3POYA 3SKVA 2JDUA 4QQOA 5ABJA 1MS9A 5SV8A 3LB9A 4AI1A 5HI0A 1LECA 1R082 3VBSC 4AVTA 3P3PA 1D2SA 3CZUA 2RS52 4XBLA 5F5IA 4FTSA 2XVGA 1PMJX 3QD6A 5FYMA 4K1YA 1WW7A 4AYUA 2O0OA 3D0JA 5FO7B 3KHBA 5CFDC 2VTFA 2ZX3A 5GM0A 1D4M2 1VBA1 1ENSA 1W8FA 2ZAHA 3Q8CA 1AR82 4INDA 3FWEA 2MEV3 1TMF3 5C33A 5A7SA 3KT1A 1LESA 4Q5OA 5EIYB 2W46A 1X8MA 1LENA 1COV3 5IFPA 1SLAA 5F3IA 1BZWA 1VMJA 4HLTA 3DF0A 3PMSA 4X8PA 3VV1A 1R1A3 4YVWB 5J3UA 3FUQA 1KFUL 5IVVA 1Q8OA 1QMJA 5DDJ3 1DFQA 4UOJA 4L8QA 1O7FA 5FZKA 5DABA 1ACCA 1ODNA 3LF7A 1UWWA 3AKPA 5FMBA 1I1EA 2OQ6A 5FZ9A 4R9BA 1FXZA 2HWC2 4YVSB 4XFHA 3DECA 4AG4A 5JOWA 3BTAA 4PBPA 5EJZB 5IVCA 4ES8A 1H6YA 1PGSA 1R64A 3WINE 1EAH1 3AZYA 5GLUA 3PTRB 1H2NA 4C90A 1TME2 2VNVA 1IQAA 4W4ZA 3FN9A 2DVAA 4L2NA 1W6OA 4MXWA 4LIVA 5HBAA 1PZ7A 5LRRA 5LB6A 1OURA 2WZR1 5GLTA 4AE2A 5FPAA 4KNCA 1JZ2A 5DAPA 4LUMA 3AJYA 2DCTA 4Y20A 2DF7A 2ARCA 5J48A 1ND3C 1WGPA 2XR4A 2VZ1A 2VQ0A 4XBNA 4IE0A 5IWFA 4IDZA 4KU8A 5HCHA 4BB3A 3URFA 2FCTA 2V5YA 4KG0A 4AEDC 2ADDA 3VL9A 3VN4A 3MPBA 4M0NA 4CP2A 3WDVA 4MYEA 5JAXA 3H50A 1VBC1 1OQ1A 3E5UA 3VDDC 1UYPA 2DVBA 5DUWA 1TVGA 1CZSA 2AUYA 3LCPA 3KCCA 4GKYA 5JPNB 4IV3B 4HVOA 3IDBB 1LHUA 5BXXA 4XHBA 1JZ4A 5L9RA 5I91A 4XUQA 3DUIA 3KT7A 1VRH2 5FLHA 4XDOA 1FNZA 2W1WA 1NCQB 3VBHC 2BGPA 2XQXA 1LHOA 1Z7S3 4R9CA 3RJRA 1REEA 1HX6A 2RM22 4XW3A 3ZYRA 2WNEA 1GQHA 1LOCA 4Y1UA 3A7QA 4CXXA 1CZVA 2QDRA 4QXCA 2A1XA 2X53S 1JYWA 4DPNA 4BLIA 1H4GA 3ATGA 2W92A 3GM8A 1Q5OA 2RHPA 3QACA 3WP6A 4ZS2A 4IEZA 1AR71 3HAGA 5FZCA 3BTXA 1GNHA 4QPYA 1C4RA 3OGVA 2DU0A 5ACA1 1UYZA 3A0KA 5A1LA 5C7GA 3OG2A 3FBMA 3R4DB 4WM8B 4JAAA 3K3NA 4IXLA 1OOPB 3WW4A 1W0NA 3KD4A 3RI8A 1C8M1 1QKQA 4IQPA 5FZ7A 1ZA4A 4HPKB 4NHMA 3AZWA 3C7OA 3WDTA 2UURA 3CHXA 3MW4A 1LRHA 1YFWA 1QY4A 1XYPA 3HD8B 4Y24A 1W2AX 4ISQA 4AFMA 2FDKA 5CADA 2X29A 1GP4A 5FJHA 2W1UA 4NPMA 1QWRA 2J1RA 4JHTA 2X05A 4UWDA 4KMQA 5GZEA 5A3PA 1SLTA 4GKXA 4LKFA 2FCUA 2W87A 1YQ2A 4QU2A 3GBFA 3UJOA 3AKSA 3HPNA 3LFIA 2Q8EA 1LOEA 5A3OA 4BA6A 5HXMA 3NAPB 5FYTA 3ZIWA 2VH9A 4CCJA 2ZS6B 4O65A 3POIA 4CUBA 2YGLA 4LIUA 4GWNA 4AEMA 5FMCA 2PHLA 2C1FA 2EIGA 1K5MB 3ILNA 3PLQA 2VOTA 2DUPA 3ALQA 3HN1A 2XLGA 1OLME 4AK3A 1AR63 1RTVA 5C5TA 1W2TA 4RN5A 4M3CE 5JXJA 1M4WA 1SG3A 2HWF1 3OUIA 3ZYIB 3ZFEA 1UXXX 1VR3A 2G1MA 1D0HA 1FMD3 1BEV1 4J1WA 3LZZA 2R6QA 5FBJA 3OPTA 2VBPA 3LOIA 2IFWA 2DU1A 4WVMA 1P8JA 3PUHA 1KDMA 2XL9A 4WVWA 4XIKA 5F3EA 1Q8SA 2VNRA 4F7ZA 5IK5A 3DKQA 2KR2A 1V6KA 1AL0G 2Y6LA 3MICA 4YW4A 2VQTA 2BWAA 1NUKA 5EQUA 1US2A 1VIWB 2PQQA 3KVBA 1UMZA 1TNFA 2JG9C 3PVEA 4OUMA 5JSOA 1EUUA 4YLZA 1CQ9A 2WZR2 3SITA 5AC93 1V6MA 3PJQA 3WNPA 2B4KA 5BNNA 2JDNA 2VO5A 4NOTA 4FQZA 1B35B 5I0SA 1QIQA 1V9U3 5LBFA 1UO9A 4LBJA 2ZJCA 2DFBA 2VZSA 1BQPA 2VMCA 2WYFA 2P3JA 2XWBB 3GZEA 3OD4A 2EIBA 4PDWA 4Y5TA 3SCHA 4XZUG 5T54A 3WZ1A 5K0UB 4N7UA 1DP0A 2DCKA 3KT4A 4XF4A 1VBC2 4XIOA 3U78A 5BUVA 2ZGQA 5D1IA 2C0ZA 1CZTA 1HQNA 3ELNA 1EP0A 4RQPC 3H1YA 2ZOEB 4UF0A 4AI3A 3BTYA 4LO7A 1VBD3 5FWJA 1REDA 3U10A 3TOJA 4S2HA 4CDUC 3W5MA 4NHKA 4P9WA 5JXHA 1QF3A 1HRI1 1JHJA 1TQ5A 2NMOA 3AL5A 3NNGA 3QH7A 4XFBA 2ZGSA 2D93A 2FQPA 3WNXA 1PIV3 5FFOC 4W50A 1OD5A 1MS8A 2I2SA 1XB9A 2JD4A 2LALA 1AR72 2WO3A 4LO8A 4M4RA 1W8TA 5EJ3A 3S5QA 4BK4A 3VD4A 2YC0A 4MG2A 2ZHKA 5ACA2 1O6UA 3H3UA 1ZM1A 4Q4X1 3B69A 5F8PA 2B9UA 2XJVA 4XFIA 3RMYA 4YM0A 4FP2A 1W05A 1C8M2 3I8TA 2A3XA 4K3UA 5M0TA 2W39A 1C8NA 2GP5A 2JE7A 3HEIA 4BHPA 5EXOA 5BV6A 4LO5B 3CZJA 5H9QA 4Q0UA 2BGCA 2HWB3 1QJX1 2YROA 3AVRA 4CTEA 1O5LA 2WQ8A 4GIQA 3U07A 4DEQA 1OA2A 5LBCA 4FOYA 4IEVA 3N9LA 4TXWA 5L7OB 5FYCA 1NKGA 2ARBA 2WFF3 1UN1A 4YZ4A 1DHKB 3RWKX 4YWAA 1U5XA 2OT7A 4XYXA 3T2QA 2HWD1 4L92A 2E63A 5KXDA 2UY8A 3TWIA 1C5IA 1HQLA 2ETEA 5FBZA 3SNMA 1GFF2 2E32A 3A0NA 4I01A 3ZXDA 4Y22B 3MLKA 2FDHA 1S55A 1OFSA 3WV6A 1LNSA 2IXLA 3MEPA 2A3WA 3LDBA 4D7SA 2VW0A 1V6NA 2JDYA 3PDQA 2HWF2 4DUVA 4COUA 2ZGKA 4HOOA 5ANNA 2HWC3 4LKDA 3AXEA 3H3ZA 5FXVA 4LOSA 4LULA 4QM8A 1BEV2 1CESA 1ND2C 1YFYA 2QQOA 4NHYA 4YVWC 5LA0A 1CR7A 3MIGA 4A6OA 4JRAA 5K7PA 2ZKNA 2G9FA 2WWSA 3IMMA 3CJIB 1ENQA 4Q0PA 3UKNA 1X7NA 1U0AA 2HH9A 4CU7A 1ZZ8A 2JDMA 2ZZJA 4Q4W3 4RS5A 5JIAA 1LOGA 2P6CA 4TN7A 2E53A 1LULA 1CAXB 2BYVE 2VD7A 4RL7A 3POSA 4A2UA 1UZYA 4A7YA 4AQSA 2D97A 2P34A 5FYZA 4JGYA 4LXLA 5LA2A 3UNPA 1OQDA 1PVXA 2OUJA 1GOFA 4YPJA 5C70A 4OHYA 4EE2A 2VBDA 1SBEA 1W6PB 2X5IA 1PVC3 3NMBA 3KQRA 3C7EA 3VKFC 2VCBA 1WW5A 4LKSA 4XF1A 1AX1A 2GU9A 3K2OA 2XKPA 1H30A 1SPPB 4ONUA 3USSA 5KXBA 4K1ZA 1FOD3 2WNUB 1N47A 1XNKA 2JB4A 3EQEA 4XE9A 1GBGA 3WQ7A 4CP1A 1BKZA 2O8OA 4LR4A 4XOGA 4YM2A 1G9AA 3DYMA 1JZ6A 3TNQA 1LR5A 4XCBA 4Z8BA 5A7QA 4QPGA 4K8FA 3NKTA 3R4SA 3J26N 1BK1A 3CDZB 5J36A 5JZGA 2RDNA 2CGPA 1RVF1 4BIOA 4E4HA 4C1WA 2AEYA 1MVQA 4CCMA 3WF3A 1HRI2 3KLSA 4LJHA 4CDQC 2Z4FA 1A8DA 1O91A 2AR6A 2G4IA 2H6CA 4P9GA 5T5OA 3RRDA 5B4NA 1ZRRA 5CB7A 5IK4A 3ACIA 4IEYA 2WWUA 4QQPA 5FPBA 5A6XA 2R041 5K4LA 1ZZBA 2Y34A 4M3CF 3BI3A 4YW6A 3EYPA 3MV11 2ZGRA 3AZVA 5FR3A 3T3YA 4G9SB 1SBDA 2UY9A 3C7GA 4AGVA 3S30A 4L97A 2E7QA 5A3TA 3USUA 1JYIA 3D5OA 2DTYA 2K9ZA 3S5AA 2HYXA 1LGNA 4QAWA 4FOVA 4N7IA 3RQ0A 5IFTA 1C3HA 1BBT1 4FXGB 1D2QA 5KBFA 4IETA 4WM8C 3MPPG 2RE9A 1XSRA 1QJX2 2NMNA 3WUDA 1JU3A 1G86A 1VBA3 5FP4A 5FZ4A 3ZSEA 1W06A 2VCMA 4H3WA 5FYSA 3WG4A 4AI8A 4FBFA 1UW8A 3HNMA 2J1TA 1O5UA 1HRV3 3M3OA 1TEIA 4IV1C 1YI9A 4XETA 2XJTA 4D7TA 1KD7A 3I2DA 2X8KA 3BN6A 2KM2A 5EP9A 1UNBA 2HWD2 5FZOB 5FPUA 1VB4A 3S7IA 5CFCA 1WLCA 3LEMA 2B9VA 5JDBA 1ZBA1 5C3QA 5DN2A 5FQ0A 3NAPC 1LB2A 3KV5A 1HB3A 1NXD1 4FFFA 5F5AA 3ZPOA 2WKKA 2OW4A 3O12A 3ZXEA 2HEYF 4GA9A 5CFDA 3FC0A 4JTOA 2CAVA 4XJ8A 2VQAA 4QM9A 4NROA 3R6SA 5KHGA 4KWKA 5FO8B 4XJAA 4KWJA 1K5MC 3WP4A 2WZ8A 4LHLA 3T08A 2FBEA 3CJXA 3LEKA 5LA9A 4GD4A 2AENA 4WZCA 5JVVA 1EAH3 3J4UH 3TBDA 5A6ZA 4W6YA 4XF0A 4I0BA 4PI2A 4LOTA 2OS2A 4AVBA 3JBG3 4PIXA 1X82A 2XJUA 4P9IA 1NQDA 1CX1A 1YC61 3GZAA 3RPQA 1BCXA 3D3AA 4CEWB 4KU7A 1U12A 2R16A 2WZR3 3IPVA 4OMDA 5LK7B 5IK7A 2ZEWA 1UY0A 2JG8B 1CAUA 2BWCA 3H7YA 3GJAA 3M2MA 4QPIB 1SCSA 3VBRC 4BQYA 4TWTA 5FYBA 5KWRA 2AACA 2QQWA 1LU1A 2JEMA 4E4SA 1OA3A 1OPMA 3VBOB 1FATA 3TN91 1VLNA 1UU4A 4N53B 4Z1VA 2ZX4A 2XHNA 3AP6A 3ZXFA 1DYOA 5C8WA 1CGPA 1O8PA 1XPWA 4PDWC 2WT0A 5BNQA 3WLUA 3JB4C 4IEXA 4QB6A 3VZLA 2V4AA 2WSVA 2IFRA 2QNKA 3WSOA 4EN6B 1N1SA 3S0MA 4XUNA 3I49A 2GMEA 4LBQA 1LHWA 4YM3A 1CX4A 1ND3A 3DXUA 1UZWA 3HMYA 4U2AA 5FYYA 3T0DA 3NRUA 4AGRA 2JICA 5DUVA 5FZIA 2KA3A 1RVF2 2XH6A 3WQBA 4YFZA 1GZTA 3KV9A 3OSDA 4PF5A 3OBTA 3TEXA 2J1UA 4HMZA 3IBMA 4Q8KA 3N35A 1GMMA 1UY4A 3VDDA 4GJZA 2DFCA 2TBVA 3G7DA 5I93A 5FAXA 4PIZA 1AR73 1XNBA 2ZEZA 3ABZA 5CKQA 3U4SA 4BM8A 5A6YA 4ITCA 2VZUA 3C8XA 2DBNA 2PQSA 3OGRA 5ACA3 3TYJA 2XGXA 4NAOA 2Q4SA 4ET7A 3MUZ1 1DU3D 3VD3A 3ZXAC 2R042 4CEYB 3VBHA 4CDXB 1REFA 1W6MA 4GJYA 2BQPA 2OPWA 4XJ9A 4YG6A 3U1XA 2YDEA 2BU9A 1XYOA 4YGEA 2YXSA 3HWJA 2Y6HA 1F4HA 1RUJ3 3JQXA 3LPFA 2XBO1 3OEAA 4QGMA 3AZXA 1GKBA 5JSRA 1PZ9A 1WWYA 1F15A 5IJRA 2IZWA 4LNVA 4H7LA 3N9MA 3UT0A 2NP0A 1S2KA 2R073 2Y6GA 2YU1A 4IE7A 4QT6A 1W28A 4EZ4A 1BBT2 1Y9QA 3VL8A 4QXKA 4GMP0 1RUH1 1NCRB 2VQUA 5GLVA 1VALA 3ZYJB 3PUIA 1QJU1 1RUE1 1W2UA 4GMP3 5I0TA 2HLEA 1AYM3 1YI7A 5EWSA 2ZHMA 4FVVA 5LY2A 3UK9A 1ULGA 2WINB 2FDIA 1J3RA 4M01A 5F7UA 2WNVB 3V0BB 4XF3A 3W9AA 3MHZA 4GALA 1NY72 4ZY9A 4P02B 3PURA 1DZTA 1DQ5A 1R091 2GDFA 5A33B 4BQ1A 1ZBA2 2W0XA 3LQCA 4ZHNA 4Z82A 1CAVB 3T09A 1OUSA 3OUHA 1YNAA 1UOBA 2WN3A 3CMGA 5BNOB 2FZ2A 1KS5A 1BEV3 5FY1A 5C5UA 1IKQA 1NA1B 4LLOA 4D6SA 4BLJA 1D4M1 1S0CA 2XWJB 4FP3A 4AFBA 1XE8A 4UW3A 5D8AB 1DBNA 2ZHNA 1POQA 2IXCA 2BUKA 2Y64A 5BPXA 1AJOA 1XXNA 3FZ3A 4LUKA 2BBAA 3P1IA 4W65A 1PX3A 3D4KA 1HDKA 1LOBA 3IAQA 4FQ4A 5T3NA 1WCQA 3I3QA 3KGZA 2HWE1 4LK6A 1XSQA 4NR1A 3UGGA 3MBWA 4YW2A 2HEVF 4RSUA 2JDKA 3OD0A 1PGL1 4JKKA 4XQ4A 4A7ZA 4Q27A 3JD71 4MGZE 2WZEA 3RYPA 3ZYGA 5CEHA 3T30A 3V0AA 2QKDA 4XAEA 5IVBA 4HT1T 2VE1A 1RXGA 4D3WA 3ME2A 1YQ6A 1NE4A 1VBE1 2BVVA 1I6XA 5KHJA 1PO21 3ZMNA 3WCSA 1ZBE1 1VMFA 3TN92 1UPIA 1MVEA 1O4TA 2JG9A 3NNLA 3T0BA 3AP9A 4GH4A 3O1TA 2PA7A 4I30A 2R061 1CN1A 3T1MA 5JXGA 3PIJA 2D43A 2B7YA 1H0BA 1HN0A 2VMHA 2YPJA 2H0VA 1QJY3 2RS11 4QX2A 5D21A 1HRI3 4WV8A 4UFMA 4HFSA 5AVPA 3E97A 4CUGA 1OQEA 4YFWA 5FPXA 2P17A 4XCAA 5CAZA 2XVLA 3J7HA 5DAWA 5JZGC 1ZX5A 3VKLA 1DIWA 4V1PA 1LOFA 2P3YA 4RGKA 1HJGA 2DV9A 4CCCA 4DXTA 1DGWA 3VD5A 2E26A 3N9PA 1K12A 4XACA 5EHDA 1OC1A 1VBB1 2NPIA 3GHNA 3SHRA 4Q4X3 1J3QA 5FY0A 1JYNA
chains in the Genus database with same CATH topology
2VUAA 5H9SA 3D6EA 2BFUS 3HT2A 3WG1A 3GALA 3PVBB 1LJ7A 2XBO2 2XB6C 3K48A 3IT8A 1WW4A 3NV1A 2VVDA 1H2LA 1RUH2 1G9FA 1H8TC 1QJU2 1RUE2 1VJ2A 3O5SA 4QQLA 4Y1VA 5T55A 3UJQA 4IEOA 4RHV3 1JOJA 1ULCA 1UIJA 2UYAA 4DRRA 2HWD3 1SLCA 4AVVA 1WMEA 1V6OA 2ZGNA 3M1HA 1R092 2EAKA 2ET7A 4CDWB 3EBRA 3MGUA 4GWMA 4FPLA 5CFCC 4AI0A 1WA4A 2PAEA 1JUHA 2VNGA 2ET1A 1W6QB 1H2MA 1JUIA 3M4FA 4C1XA 5KXEA 4EWAA 4EJRA 2BNOA 5ABJB 1HQWA 2RR11 1S0IA 1LTEA 3POWA 1DZRA 2R0FA 1WBFA 2O1QA 4AFCA 2F6BA 1E57A 5JIUA 3CEWA 2GMMA 2QDNA 1N1VA 5B2GB 4KGQA 2HWE2 4F8AA 1PGL2 4G3YC 5J98B 3B93A 2LUWA 4HK9A 3JD72 1ND2A 4YVWA 4OHVA 4B29A 2E9QA 4MLOA 4XHXA 2GC2A 2PN5A 5J09A 1VBE2 1MQTB 3B02A 1CPNA 1PO22 2JG8C 2VPVA 3OY8A 1ZBE2 1R1ZA 4R9DA 2C5DA 2FMYA 4YVSA 3ZXJA 3DGTA 2ZABA 4RR3C 1W0OA 2PLV3 4N43B 1RUF1 4FAHA 4PQ9A 2LTNA 3KS7A 4YARA 1YO8A 2R062 3KM5A 1LGCA 1OLQA 4LBMA 3ILRA 4AFDA 1AR91 2RS12 2VGDA 1CAWB 2NYYA 1WCKA 1W6OB 2VW1A 4MXWB 3R05A 1ZVFA 4HKLA 2MNGA 5FMOL 1CJDA 2Y0OA 1VBB2 4JTNA 1AJKA 3IIAA 4PIYA 2R32A 4K20A 4IV3A 1BBT3 3U0ZA 1F5FA 1Y3TA 4CDQA 4Q4V1 3D82A 2CNAA 3VBFB 4H55A 4P14A 4E2GA 3LSDA 2ES3A 2JECA 1QOSA 4QHBA 3HIFA 1NCQA 3GZUC 1H1MA 2YMZA 4ZU5A 5IUQA 4UXAA 1W0PA 2R1BA 1V70A 3RNSA 1N3QA 1IZ3A 2V09A 3B01A 4LBLA 4RD7A 2Z79A 2Q1ZB 2ATFA 4OHXA 4P5HA 3ZVXA 5DXDA 1PK6B 2PHDA 5BNPB 2B45X 4FT8A 2VG9A 1F9KA 4M3CB 4WM8A 3LSEA 5L73A 1DQ0A 2DTWA 3SCFA 1VAMA 2WNVC 4ZU7A 2BFUL 3AX4A 3J8F1 2EAAA 4RGAA 4LEJA 3B9IA 4D94A 3OGGA 4IV1A 4JDOA 4E4ZA 1VAVA 2RR12 4GXLA 5FO9B 1RUI1 3NL1A 4OLLA 5IT6A 1FPN3 4MZUA 2VOWA 3NAPA 2JX9A 3DPRC 3NV4A 1Q56A 1NLRA 1FAYA 1NA1C 3R0RA 4URTA 4EN0A 3PJYA 1PO11 1SLIA 3EHKA 4YG0A 4EN7B 4DB5A 1K5MA 1ULDA 1WW6A 2VVEA 1EV11 3N3HA 4XFIA 1S0EA 2D40A 2DYCA 4JDNA 2NLRA 1AX0A 3AP4A 1AYN1 4OI0A 3G6JB 3VZNA 4LBOA 2DVFA 4PLMA 1YWKA 5JLVA 3WDUA 4JV4A 3GF6A 3B5LB 2RS31 3OYWA 1RMU3 1L3JA 3AMNA 2VOKA 1WMFA 2D6MA 3MLJA 3ZFEB 5K8SA 1H1AA 3VBRA 1O4ZA 1RUF2 1CIWA 4L9BA 4Q0SA 4GB33 1XNCA 1PHMA 1QH6A 2ZGMA 1MS5A 2OZ6A 4GH4C 4ATFA 2CL2A 1UKRA 3BB6A 1AR92 1MEC1 4XQDA 2IXHA 4Q4Y1 5LEJA 1JTZX 4Q1RA 1F8VA 1B35A 4YM1A 2NM1A 4ZKTB 4NHLA 1DGRA 1XU1A 3OCPA 4FOQA 1LOFC 4IEQA 3KB5A 4Y1YA 2NN8A 1POV1 2BNMA 4FTEA 2WA3A 3PTYA 4HKOA 2XBO3 1CPMA 4WM7B 4EWDA 2ZTNA 4CZSA 5FRAA 1W6NB 1AXKA 4Q4V2 1DQ1A 2BTVC 1ZRDA 2Q0AA 1RUE3 1OI6A 5J37A 1A8MA 5DZGA 1NQJA 2ERFA 2YV8A 3O0XA 5C8CB 1F5JA 3B00A 4UW5A 3ST7A 5I8YA 3HQXA 1D4VB 4JC1A 3THTA 5FPZA 1R093 1C5HA 1R083 3FMGA 3GBWA 2RS53 1JN2P 3M70A 3FLRA 4WZFA 3JU9A 4B8EA 2ZMLA 1JBCA 4OVEA 3J8F2 2BNNA 4AFAA 1J1LA 1D4M3 4D7YA 1GLHA 1QQP1 2W52A 4IESA 1AR83 3S6PA 1J59A 3S7EA 5JI7A 1WBLA 1X50A 1RUI2 3WY6A 4ATEA 1ONAA 5L7OA 3THPA 4B4PA 4N9HA 4RGGA 3LA2A 2FZ1A 2XJSA 1HW5A 5CA6A 3NV2A 1PO12 2K2SA 1QOTA 4XTPA 2B39A 3JD73 2OZJA 4K9SA 1MACA 2PHUA 2QJVA 3AKRA 4Q0QA 1MZFA 1EV12 2XL7A 1AYN2 3ROUA 1XNDA 2WT1A 1AL21 4AHZA 1TME3 3E5QA 4DXZA 3SCGA 4AVCA 2RS32 3O14A 2I07B 3RSJA 1WLTA 2VOVA 3CJIA 1GZCA 4YVSC 5I0RA 2HKXA 2A71A 3O0WA 4MH0E 1F2NA 4NWVA 2OYZA 3D8CA 4JGZB 1CAXA 2A7AA 3WP5A 4N43C 2A5ZA 2D98A 4RS5B 1MEC2 2MEV1 4Q4Y2 3SH3A 2NZ9A 3ZN6A 1IPKA 2UU8A 1W6PA 1S0FA 1COV1 4SLIA 4LHNA 1S0DA 3AB0A 3BOPA 1R1A1 2TUNA 1VRH3 2EALA 2WNUA 3UKVA 2B5HA 2GC3A 3FJSA 2DVDA 2X5IB 1NLSA 1N1TA 2RM23 1YJKA 5IK8A 2D6PA 5I8TA 1H9PA 3SMHA 2R49A 1CJPA 4IV3C 1PZ8A 1RUNA 4LE3A 5BY5A 1FV3A 1GZWA 4TLFA 1NCQC 4FSJA 2QCSB 1WD4A 1URXA 4BWOA 2A6WA 2VMGA 4WVVA 5FOJB 2FHRA 4CYDA 1ASJ1 4FPFA 5GALA 2AGSA 3APBA 3FBYA 3PHMA 4AWDA 1SDWA 1H8TA 3HT1A 1TE1B 1RJ7A 3JCIA 2IWGB 2H0BA 2ZX2A 1OOPC 2LM3A 4Q26A 1QQP2 4OI2A 4U36A 4XXPA 3E6DA 4A7KA 1O3TA 3VZKA 3IN9A 3CO2A 5JWPA 1IS4A 1NY71 4LE4A 2WIIB 1RHI1 2D6KA 5F6LB 4DY5A 4B4QA 1Z7S1 1UU6A 4FPKA 4OUSA 1D0GA 1XQNA 4JRLA 4I09A 4K40A 5JOZA 3FFQA 4LBKA 4MUVA 3VBSB 3OBRA 1S0BA 2A6YA 3I59B 4LBQD 4UBHA 4TZDA 1AL22 4XBQA 4XEZA 3A4UA 1NZCA 4MXVA 2ZA9A 3AJZA 3RJ2X 4OZXA 5AVAA 1GV9A 4FTBA 1RUF3 3OF1A 3RG0A 5GZDA 2ZGTA 4SBVA 4CEWA 4COVA 4HVQA 1AR93 5L36A 3MIBA 3WUCA 3VZJA 2JG8A 2WZPP 4N90A 1JH5A 1DLLA 4E4DX 1DGRN 2MEV2 3CF6E 4RR3A 1VBC3 3IPVB 3ILFA 2CGNA 1COV2 1CAUB 4QGNA 4YRDA 1OHFA 1B35C 4HETA 5T5JA 4XMAA 2GC0A 1R1A2 1KRIA 2Z5WA 3ZO0B 4BMBA 2XLAA 5K0UC 2YYOA 3RYKA 4I0WB 4Q4V3 3ETQA 5HXVA 3ZYPA 2PHRA 1FMD1 5DG2A 4BMEA 1LGBA 1RINA 3WHTA 3JZVA 3NO8A 4WM7C 1AX2A 3GBGA 1BXHA 1WCSA 5E89A 5KHHA 3Q9OA 4NPRA 3VLBB 1RL3A 1FNYA 3H1MA 3ZFFB 1C8M3 2EXIA 2WFPA 4KGGA 4AEDB 4BH9A 1QJZA 2ZAAA 4HVRA 1ENXA 4X6RB 1ASJ2 1YRZA 3VDDB 4DFSA 4E2QA 5CG8A 1MS3A 3AXDA 4CDXA 1YLLA 2CGOA 5CIRA 3AMPA 2BBVA 5HCAA 4P9JA 1ENRA 1V00A 3AYAA 1HIXA 4LHKA 1UX6A 1ULEA 3PNAA 1T6GC 3VBHB 3WD5A 2Y26A 3VHPA 3EJKA 2CWSA 4ISRA 2ZGLA 1RUI3 4BCUA 2Z69A 1GICA 2Z2SB 4R8HA 1X33A 3AMQA 2WNVA 4AI2A 3BALA 5F9TA 1PO13 1RHI2 1VBD1 3ZN4A 1SFNA 4OFGA 5L7OC 1Z7S2 1MZ6A 2WLPA 3BPZA 5GLZA 4D69A 2HJIA 1AXZA 3WG2A 2HWF3 5EYXA 5JR7B 3NV3A 1AYN3 5CNAA 4C0BA 1CAVA 5E8AA 5CG9A 4AHXA 5BNOA 3MFAA 3QBQA 3VGIA 4XJUA 3DPRA 5CU1A 1NA1A 1Q8QA 2QZ2A 5C9AB 1C1FA 2W08A 4RFT0 1ULFA 5D8AA 2GSYA 1PNFA 3WDYA 2DUQA 1C57A 4H7MA 4AGGA 3TAYA 3LA3A 1OKQA 2E6VA 3B3QE 2ZKLA 3CJIC 2HWB1 3ZX7A 2UWBA 4PCRA 5CVRA 5FMOS 5F6KA 1AF9A 1QXJA 2CV6A 4S2FA 4FCAA 2WFF1 4OI1A 5KC5A 1YJLA 2PFWA 4KWLA 1UCXA 3ZSLA 3M7AA 1X8EA 2WT2A 3LKJA 4JGZC 2GH8A 4XFAA 3L9JT 1RUC1 1UKGA 2GZWA 3I54A 3H0OA 5A3MA 1RGSA 2IXKA 2WQ4A 5KHIA 2MHFA 5A32B 2OUHA 4WBBA 3WHUA 1QXRA 2WNUC 3BOWA 1NE6A 3KMHA 4COYA 1FMD2 5LEKA 2UYBA 4LLFA 4YSFA 2VU9A 1J58A 3MDPA 2RJKA 3KCYA 3MFCA 3ZFGB 2B46X 5J96B 1IS3A 2I45A 5I8SA 4HL0A 1DYPA 4Q4W1 5K9YA 1U5YA 4NWWA 1X36A 4HBNA 1HV1A 3VHRA 4IEPA 4META 3E6BA 2B8MA 5AC92 3WXPA 2PHTA 1M06G 5JSPA 4R52A 3ENRA 4RQPB 4NO4A 1MZEA 1OMIA 3VKNA 1QJX3 4YZ3A 5J7MA 4Q8LA 2N7GA 2EA7A 1QQP3 2WLQA 4KG8A 3OPZA 3VBUB 5E88A 1FOD1 2YUEA 4CDUB 3WX5A 4I3PA 3FHIB 2P37A 4L99A 2XVKA 3PMEA 3AMMA 3O0VA 2PTMA 1LKNA 3IDEA 1SCRA 3NKGA 5C4WB 5JPMB 1QDOA 1QDCA 4FAGA 1QHDA 1WUVA 2VUJA 1VBD2 3IMNA 4AXOA 4MVTA 4CDWA 3MIFA 4EN9B 1JW6A 1UIKA 4MSVA 4FPEA 3WR0A 5JI9A 3MF9A 1AL23 2EXHA 3ES4A 1W6QA 1ZZ9A 1SMVA 4NVPA 4FO9A 4P9XA 3RI9A 4XPVA 3RMXA 2H6BA 4PLNA 1S0GA 3LA7A 2GN7A 4MX3A 4J6GA 2GNMA 2O8QA 3MLLA 2ZGPA 2HWB2 4LTAA 3ZPYA 2Q30A 4HANA 2BEOA 4CEWC 1KJLA 4M00A 5GLWA 3N4MA 2A73B 3FLTA 3H1WA 1HRV1 5FTTC 2WFF2 2E51A 1GSLA 2WL1A 4QPIC 2EXJA 2ZX1A 2WJSA 3MIHA 1WD3A 4QQ2A 1J1TA 5LK5A 1MQTA 1ND2B 1RUC2 2A70A 1PM7A 3B9CA 4OI4A 3MW3A 3VBOC 1UPSA 2GALA 2ZMKA 3E6CC 2PELA 4N53C 1DG6A 4FXKB 1RVF3 4N43A 3OY8B 1G7YA 2VY0A 1RUD1 3LWCA 1FV2A 4Z92B 1XE7A 1Q8VA 2AZ5A 2Y38A 1RIRA 4P9YA 2MPFA 3JBG1 4XZPA 1CAWA 1DQ2A 4S2DA 1IS6A 4XJZA 5T5PA 3ZIXA 5EFUA 3LOBA 2R043 4Q4W2 4Y20B 1G8WA 5L19A 1QNYA 1O3SA 1ASJ3 5HCBA 4I3GA 4Z2WA 5EV7A 1V6LA 2GAUA 2F4PA 5JMCA 1NOVA 3FX3A 1DGLA 1H1IA 4YW5A 3ZXLA 5JCTA 1SQ4A 1ZRCA 4AVAA 4AEKA 2BVBA 3ZFFC 4CEYC 3JB8A 3PVOA 4CDXC 1GNZA 1PVC2 1KXGA 5KXCA 1RC6A 4I02A 3VBFA 4QMAA 2BPA2 4LO4B 4C0HA 1BMV1 4LA3A 1FOD2 1YIPA 3M3CA 1APNA 1NYWA 4I2OA 4CDQB 1BYHA 1NCRC 4YGDA 1RHI3 2Z42A 5AFBA 1F31A 1ZBA3 2YGMA 3BODA 1IGOA 4AVSA 2EVXA 1PK6A 3TB0A 5A3LA 1OOPA 3AP5A 1ZZ7A 2RJLA 4Z07A 5BNPA 1XU2A 2W68A 1I9RA 4HPKA 4M3CA 1J3PA 3V65A 1SLBA 1CD3G 1OA4A 1UAIA 4E2SA 3B7MA 3EO6A 2WS91 3VHOA 3SH4A 2E7AA 5T52A 5JOXA 4Y26A 3N36A 5BNOC 1DF0A 2P2KA 2QQPA 1N3PA 5DZEA 4DS0A 2XHKA 2ZACA 1RUJ1 1PMIA 3ZSJA 5F1RA 1G9BA 4IV1B 3GNEA 5D8AC 2R071 1YIFA 4O9EA 1WCDJ 3J9SA 3GYDA 5C9AC 4COWA 2D3RA 2PAMA 3RS6A 1HKDA 2BW8A 1LCLA 2D3SA 3TNPB 5T5LA 3I7DA 4GMP1 3N7LA 1LODA 4IL7A 1VBA2 4W6XA 3KZ4C 1OFNA 1AYM1 1O3QA 1ZREA 4QX5A 3WDXA 3TN93 4K7JA 1HRV2 1GQGA 2HYKA 4AHWA 2GH2A 4XXAA 1G9CA 2A75A 4QGLA 2WQZC 1S0JA 3ZSKA 3W59A 1ALYA 1KQRA 1Q3EA 1EY2A 2Y0IA 1B09A 4R4XA 1KS4A 4J1XA 5FOBB 3DL3A 3ES1A 1HXS1 2TNFA 4WVMB 3CU7A 1KFXL