2PHRA

Pterocarpus angolensis lectin (pal) in complex with man-7d1
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
240
structure length
240
Chain Sequence
EDSLSFGFPTFPSDQKNLIFQGDAQIKNNAVQLTKTDSNGNPVASTVGRILFSAQVHLWEKSSSRVANFQSQFSFSLKSPLSNGADGIAFFIAPPDTTIPSGSGGGLLGLFAPGTAQNTSANQVIAVEFDTFYAQDSNTWDPNYPHIGIDVNSIRSVKTVKWDRRDGQSLNVLVTFNPSTRNLDVVATYSDGTRYEVSYEVDVRSVLPEWVRVGFSAASGEQYQTHTLESWSFTSTLLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Lectin
publication title How a plant lectin recognizes high mannose oligosaccharides
pubmed doi rcsb
total genus 53
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2phrA00
2CL2A 1UX6A 2DU0A 2DU1A 2WQZC 5EWSA 3HMYA 1URXA 4FPCA 2W39A 3V0AA 2AREA 5DUUA 2A3YA 2WT2A 2P3JA 3M3QA 3WG1A 4ZKTB 3U4XA 1ZA4A 4YZ1A 3A0KA 1I1EA 4XHBA 1F31A 2YROA 5H9PA 3SNMA 4XJZA 2YY1A 1W6NA 1CQ9A 1H30A 1Q8SA 3B69A 3RMYA 2VUAA 2D6NA 4PBPA 2CWMA 1DZQA 5CB7A 1LJ7A 2W68A 1DFQA 1LGCA 3AYEA 1MVQA 1V6JA 4XTPA 1GANA 1AZDA 4LBQA 2DURA 1QOOA 3AZWA 4R9DA 5DZFA 5GZCA 4YZ2A 1F9KA 2A3XA 1AX2A 3GNEA 3DUIA 3AFKA 3AK0A 5HCAA 2ZGKA 1O4ZA 4XJUA 2WT0A 1HQLA 2A7AA 4Y1VA 1W6OB 5DUVA 5EYXA 2EIGA 5IK8A 1IS5A 2WLQA 2A70A 1N1TA 2YXSA 3WG3A 3OBTA 3WDXA 3WUCA 1LESA 4BPZA 1LOFC 2P34A 3MW2A 1G7YA 3NV1A 4BLJA 1DHKB 4Y1ZA 5JOXA 1DQ6A 2UWBA 2VW0A 5IUQA 3WCRA 3LSEA 1AX1A 1AF9A 3KQRA 1YRZA 1CN1A 3AYAA 4KBBA 4P9WA 1G9FA 2D6KA 1MR5A 4Q2FA 3T1MA 2GMMA 3I4IA 1G86A 1C1LA 1CIWA 1GZWB 3FLPA 1SLLA 1CESA 1SFYA 1C1FA 1FATA 1DIWA 3UK9A 1LOAA 3POSA 1KJRA 3AP7A 5GM0A 3NV3A 2ZHNA 1N1SA 1Q56A 2GMEA 3WCSA 3WDWA 2E51A 3BTAA 1LCLA 4YM1A 2NM1A 2Q5TA 4H55A 5GZEA 1VLNA 5L73A 4BMEA 1MS8A 1BJQA 2ZMKA 2ERFA 2GMPA 5HCFA 3LSDA 2A75A 4L8QA 2R1BA 3ZXLA 5JOYA 2EXJA 3M1HA 3OYWB 4YW1A 3TAYA 2EF6A 1YXWA 5F9TA 1WW7A 4XJAA 4ISRA 2P2KA 5F5QA 4UW5A 4XMIA 1N3PA 2DVFA 2ZGLA 1W6OA 4R9AA 3N3HA 4JCKA 2D44A 1GZ9A 2PHRA 5SV8A 1UMZA 1DQ4A 1SLIA 3RG0A 3VKOA 2D3SA 1WBLA 4Q27A 3OJBA 1LOCA 5GLZA 3UL2A 2ZGMA 3B9CA 5GZGA 4ZXKA 1AXKA 2H0BA 2PHTA 3MW3A 2ZGPA 4NOTA 4M3CA 1VAVA 2ENRA 2AGSA 2CWSA 1WCSA 1SLAA 2PHUA 1W6PB 1V6KA 2JKBA 3RRDA 3VKLA 2ZZJA 2ZGQA 3FLTA 2GDFA 5GLUA 5KXDA 2D43A 3ZXJA 1X50A 3R4UA 2JE9A 4PF5A 4FP2A 1SACA 4P9XA 1A8DA 4RA0A 1QDOA 4LBJA 1DBNA 2SLIA 2EXHA 3R4SA 2JDZA 2ZHKA 1Q8OA 4FPHA 3WHTA 5IK7A 2PHXA 1LHUA 1DLLA 3O0VA 2DVDA 3OGGA 2PHFA 3VV1A 4DFSA 4YGDA 2DVGA 1ULFA 1LENA 4FOVA 4RL7A 3W58A 1HKDA 4LBLA 1QGLA 4AYUA 2NZ9A 4XXAA 1UZYA 2D6LX 2GALA 4Y1XA 2EALA 5DUXA 1FV2A 1LHOA 1LECA 2OVUA 2WT1A 1AXZA 1UN1A 2ZGUA 4K20A 4YG6A 3WG4A 5H9RA 1QNWA 2ARBA 4YLZA 2A71A 1U0AA 1N3OA 1W0OA 4GKXA 3OY8B 4XOGA 1YO8A 3UJQA 1S0BA 1WUVA 2R0HA 5E88A 5FREA 3BOPA 4CZSA 3AZVA 2ZHLA 1S0FA 2GNDA 4GKYA 1JYIA 2P3IA 1A78A 1W6PA 3AX4A 5H9SA 1FYUA 1QOSA 3NV2A 2A6VA 1LGBA 4YFZA 3OPZA 2RHPA 3RSJA 3SLIA 4WZFA 3AP5A 2NP0A 3IPVB 2ZACA 4ITCA 4ISQA 4YM2A 2P37A 3V65A 1QKQA 2A6XA 3AXEA 2A6YA 4YGBA 3FUQA 1LULA 2G4IA 2WNEA 1JW6A 3SH3A 2JE7A 1GNHA 3MW4A 5DXDA 1W0PA 4W65A 1S0DA 2BQPA 2ES3A 4Y22A 4Q1PA 3ZSJA 3VKMA 2VW1A 4IQPA 3N7KA 4XYXA 4XMAA 5EYYA 1NXD1 1ONAA 1QOTA 3POYA 1PZ7A 3QLQA 1UAIA 1SBDA 2ZGSA 3SISA 5IT6A 3FFZA 2D6PA 4Q1RA 3SH4A 1ENRA 3V0BB 4M3CB 5T54A 3V64A 4AGVA 3ILNA 4SLIA 3OY8A 4GXLA 3N35A 1SLCA 3MEPA 2KM2A 1LU2A 4XIKA 4Y1YA 1BXHA 1IS4A 2V5YA 2Z42A 2ZGOA 5GJ6A 1UZZA 1KJLA 4K21A 4TZDA 5JVVA 4BM8A 2ARXA 4PCRA 5DZGA 5GZDA 5H9QA 3WDYA 1WW6A 3B3QE 1WD4A 2ZAAA 3IPVA 4WVWA 2XG3A 2P3KA 1OKQA 3NV4A 4P9YA 2R1DA 5GALA 3ZXEA 1GYKA 3OBRA 2A6ZA 4I30A 1FAYA 2AENA 3CNAA 3UJOA 1C57A 1DQ0A 1G8WA 1IKPA 1MS1A 2W52A 5E8AA 1QDCA 1WLWA 3AP6A 4YFWA 4FPLA 4F83A 2I2SA 5KXCA 1ULCA 1TEIA 1AX0A 2DTYA 3HR9A 2VY0A 5GLTA 2AH2A 3INAA 4U36A 2DVAA 3AYCA 4XE9A 1V00A 2ZA9A 4FOQA 4YZ3A 3WV6A 4Z8BA 3ATGA 1IS3A 5JLVA 2XB6C 1N3QA 5CAZA 1F5FA 1JYCA 3QCWA 3AXDA 3V0BA 2NMOA 5JOZA 2ZKNA 3A0NA 3O0XA 1MS4A 1MVEA 2TEPA 2DUQA 1OFSA 4U2AA 4NO4A 1H9PA 3AP9A 2D3PA 5DG1A 2B7YA 5FRAA 3ENRA 1LU1A 1V6LA 3O12A 3JUUA 1ZM1A 3PVNA 4XJ9A 4LBNA 3TB0A 3GALA 3I8TA 5IK4A 2DVBA 4FPOB 3WVJA 3VUOA 1AXYA 4GA9A 3AJYA 3M3CA 4FPFA 1EPWA 1WBFA 4YG0A 4R9CA 1N47A 4GALA 4K1YA 1JUIA 1CR7A 3BIWE 3IMNA 1XQNA 2NN8A 4YGCA 3WDVA 5BYNA 3ILRA 2CYFA 2AYHA 1DQ2A 1CJPA 5KXEA 3APBA 3WOGA 1SCRA 1IS6A 3D6EA 3W59A 1IKQA 2JJ6A 1Y7BA 2DUPA 1G9CA 3PVEA 4FPGA 2DV9A 4Y22B 1O4YA 5CBLA 1LOEA 2A5ZA 3FBYA 4Q8LA 2A6WA 1VALA 3POWA 1MZ5A 4YZ4A 2R49A 3D5OA 4LBMA 1AJKA 2ZGNA 3BODA 1PZ8A 3IM0A 4WV8A 4YGEA 1UKGA 1IOAA 1GNZA 5GLVA 3LCPA 3IN9A 1ULDA 1GICA 4YZ5A 2DTWA 3M3OA 1MACA 3MPPG 3O5SA 3ZYRA 2UWCA 3RS6A 4FPEA 1GBGA 2OUJA 4YM3A 4FOWA 4JC1A 5LK5A 1CVNA 4MYEA 1Q8VA 4LBQD 4AGRA 5IK5A 1WLCA 4XBLA 2D6OX 1GKBA 1UPSA 3NWKA 2VW2A 3KM5A 3ZXFA 3WLUA 3ZSKA 3B01A 5DUWA 3AZYA 3M2MA 2DYCA 2SBAA 3AYDA 1BZWA 1LTEA 4Y1UA 4FQ4A 2WKKA 4C1WA 1AJOA 1S0IA 2C9AA 3SITA 4YW5A 1S0CA 2CNAA 2JECA 1D2SA 2UWAA 1LHVA 5JDBA 1A3KA 1KRIA 4HANA 3DGTA 5T5OA 1FV3A 1QU0A 2GN3A 3T1LA 1KITA 5AVAA 5GZFA 1FX5A 2GNBA 1SCSA 3FLRA 1LODA 3WUDA 3O0WA 3WNXA 3M3EA 1G9DA 4M01A 2LTNA 2ZGRA 4CRQA 2ZMNA 4BOWA 5GLWA 1MS3A 1YYNA 3D4KA 3WDTA 1PZ9A 1FNYA 1S1AA 1DYKA 5T5LA 4Q8KA 1R1ZA 4XJWA 5KXBA 2CY6A 1CONA 2OW4A 1UL9A 2FHRA 4WVVA 3SH5A 3USUB 4DRVA 4DS0A 1GSLA 1Z78A 1VIWB 5CA6A 2GNMA 3L2YA 3ZVXA 3C2UA 1GV9A 4BMBA 1J1TA 4XTMA 4XIOA 1QMJA 1V6OA 2UURA 4AVVA 2E53A 3N7JA 4FPJA 2VU9A 1B09A 4UW3A 1KDMA 2ZBJA 5E89A 1ULEA 4GWNA 2R0FA 1DQ1A 2VXRA 1Z0HA 1BQPA 1VAMA 1WD3A 1LEDA 3AP4A 4XBNA 4BQ1A 1W6MB 3ZPYA 3PMEA 1DQ5A 4FPYA 2VH9A 4Y24A 5JMCA 4FQZA 2EXIA 4FPKA 4R9BA 3ZSLA 5EXOA 4FP3A 4M3CF 1NLSA 1YIFA 4YW4A 1DGLA 1W6QB 2D7FA 4XZPA 4GWMA 4YW2A 1RINA 3FUOA 1JXNA 4YM0A 4ATEA 2W08A 3N7LA 3ZXKA 3ILFA 4XDQA 3WHUA 2ZHMA 4K1ZA 4LBOA 2JD4A 2CTVA 2R16A 1QF3A 5CNAA 3WG2A 4Q26A 1Q8PA 1V6MA 1RITA 3R05A 2ZMLA 2UU8A 1QNYA 2AR6A 3USUA 1GLHA 3ZSMA 5T5PA 1WW5A 3AZXA 4AVSA 4PBOA 1V6NA 1ENQA 3AZZA 4DPNA 3VKNA 3VKFC 1LOGA 1V6IA 3PJQA 1WLDA 1H9WA 2PHWA 4Y20B 1C4RA 1JN2P 1JOJA 1S0EA 2AUYA 4XHXA 3HN1A 2DUOA 4AWDA 5T50A 1APNA 2NYYA 2HYKA 2DWRA 4XBQA 4ASMB 3ASIA 1BYHA 1Q8QA 1HDKA 3B00A 2PELA 1N1VA 4JRAA 3N36A 2WSUA 1W6MA 5DG2A 1SLTA 1G9AA 1G9BA 1SBFA 4CTEA 1HQWA 1CPMA 1YI7A 2D6MA 2FMDA 1AVBA 3Q9OA 3V0AB 1JBCA 5HCBA 1HLCA 5T5JA 2V73A 1DYPA 2EAKA 1MS5A 3A4UA 4TYSA 1GZWA 2GNTA 3ZYPA 2ZGTA 1N1YA 4HL0A 1W6QA 2LALA 1S0GA 4M3CE 4XXPA 3T2TA 2D3RA 4DRRA 4Y26A 1KQRA 2WJSA 2YZ4A 3WZ1A 1SBEA 1W6NB 4XJ8A 3RMXA 1RIRA 2C5DA 2YV8A 4P14A 1GZCA 1S0JA 4LBKA 4PQ9A 1LOFA 3PVOA 5T52A 1MS0A 2GN7A 1I3HA 3H0OA 4LBQB 1ULGA 3N7MA 4UW6A 5DZEA 2ZABA 4YG3A 1LGNA 4D69A 4BLIA 1CPNA 1KDKA 3OYWA 1FNZA 3RQ0A 4AVTA 4FOYA 1OQ1A 2YMZA 2NMNA 5T55A 4DQAA 1LEMA 4Y20A 1WW4A 1LHWA 2EXKA 3AJZA 1ENSA 2WSVA 4M00A 1SLBA 2E7QA 4OZXA 4YW3A 2A3WA 2E6VA 4FVVA 3WDUA 3IKWA 4XILA 2OUHA 4C1XA 1MS9A 1LHNA 1D0HA 4UW4A 4ATFA 1BKZA 1MZ6A 1LOBA 4AGGA 3JU9A 1JHNA 5JOWA 2E7TA
chains in the Genus database with same CATH superfamily
1VP6A 2CL2A 2AEZA 1RHI3 2DU1A 1WMXA 4FPCA 3NAPB 4GULA 2HEWF 5DUUA 2VULA 4JGYA 4INDA 1RUE3 3M3QA 1X82A 5IVYA 4ZKTB 1JUHA 2B4KA 2HEVF 2XHNA 3HPNA 3U4XA 3A0KA 2IXJA 1W8UA 2VCMA 4UBHA 5F6LB 2IXIA 1ZVFA 4XJZA 3A22A 4LEJA 1CQ9A 3UKVA 2D6NA 2ADDA 5FPVA 1AL23 5CKMA 5CB7A 4UF0B 1LGCA 5JZGA 2J22A 3DPRB 4LA3A 1Y3TA 4AHZA 5BNPB 2DURA 3BIEA 1QOOA 4R9DA 2PAEA 1AYN2 1F9KA 2IFWA 4YZ2A 2BGOA 4XC9A 5FQ0A 3LPGA 1RUD3 4YYOA 5HCAA 2WT0A 1HQLA 3QBQA 5EYXA 3FC0A 2XQRA 5IK8A 3IDBB 3PURA 2WLQA 3KGZA 2RS53 3WG3A 3E5UA 2ZX4A 3WUCA 5KC5A 4QX5A 4A42A 3CEWA 4QB2A 4BPZA 5A32A 5JOXA 2VE1A 1DQ6A 3DKQA 4MUVA 2RG4A 1XC6A 2WNVC 1BK1A 4IEQA 4Q0VA 4JDNA 4QXKA 2G1MA 2XMLA 3W21A 4E4SA 3KQRA 1AR91 3B02A 5CVRA 4FSJA 2EVXA 1G9FA 2XJSA 3GHMA 3OUJA 3T1MA 3P1IA 2FD8A 2CGOA 1G86A 3ACIA 3B9IA 2B9UA 1GZWB 1PM7A 2RS12 3NAPA 5FYYA 1F4HA 4HXCA 3POSA 2VNOA 3NV3A 1Q56A 2GMEA 1ZYBA 2PLV3 5E16A 4L9BA 2E51A 4YM1A 5ANQA 4EN0A 4ZZ5A 2HWD1 2NM1A 3J8F3 5FXWA 2Q5TA 4H55A 4FBFA 4BMEA 1MS8A 4XABA 2MHFA 4L8QA 5CKNA 4UF0A 1HXS1 4JGYC 4DZGA 5FK7A 5BNPA 4HN0A 4LK7A 4PDWB 4AEDB 2EF6A 1YXWA 4BHPA 4E4ZA 1F8VA 5FZMA 2X53S 2BFUS 4IGQA 4QQ2A 4XMIA 5FKBA 2DVFA 3W20A 4UT5A 2BNNA 3O1SA 4JDMA 4LIVA 3VBRB 4JCKA 4GJZA 5JZGC 1OBNA 1CZTA 1GZ9A 2CGPA 4KMQA 1SLIA 3H50A 1QXRA 4L0PA 4BU2A 3ZYFA 4CCCA 2D3SA 4MSVA 3ZFEB 3ZLIA 2PXJA 4IEUA 4Q27A 1LOCA 1W8OA 4ZU5A 4ORFA 2ZGMA 5J36A 2H0BA 3OD4A 5FZ6A 2MNGA 1VBC2 3ACGA 5FO8B 3U0ZA 4PIXA 5FDBA 2ENRA 4FTBA 2ATFA 1ULPA 5DAQA 4LK6A 4LE4A 2JKBA 1AYN1 5CKQA 4LIUA 2F4LA 2GDFA 3UETA 1X50A 1F15A 5H9SA 4RHV3 1HB4A 5DDJ2 5A1LA 2VZOA 4QQOA 4AI2A 1R082 5LA1A 1UX7A 3KV9A 5IJRA 2ZHKA 2XKPA 4FPHA 3RDIA 3NAPC 5C3PA 2DVDA 3OGGA 1M4WA 1UZWA 4RQPA 4YGDA 5C9AB 1ULFA 4RL7A 2XJUA 3O7OA 1H1MA 4NN0A 4PJYA 2GAUA 4CU9A 4AYUA 4YVWB 1VRH2 3KS7A 4B4RA 2VZ1A 2FDGA 2O8OA 2JDAA 4S2HA 1LHOA 5E1RA 5A7NA 1O8SA 2RS11 1UN1A 4K20A 4YG6A 3WG4A 4NROA 3DPRC 4DXZA 2RDRA 2ARBA 5BNPC 1C8M2 2HWF2 2VM9A 1ZREA 3ZFEA 4KU8A 1PM4A 4S2GA 5FKCA 1ODMA 1XSRA 1YO8A 1GR3A 3FFQA 4AFBA 2IXCA 2ZPXA 1YC61 1SHWB 4CZSA 4FFFA 2ZHLA 4PI2A 1S0FA 1O7FA 1WZXA 4UAPA 4D3WA 3B7MA 5CFCB 5D1IA 2IVIB 2Q1ZB 1LB2A 4KH9A 3SC7X 4DXTA 1FOD2 1NQJA 4TXWA 3RSJA 5J3UA 4WZFA 2KXLA 4XDOA 2NP0A 2D5FA 1DP0A 2ZACA 3K4AA 3K4DA 3KT4A 4ITCA 4ISQA 5CISA 3OEAA 4NWVA 3BI3A 3DCQA 2WQ4A 5AC92 4C1XA 4AZZA 3RFRA 2A6YA 4YGBA 1MEC3 2PAMA 1R1A3 3ELNA 3MZHA 5C9AA 1ZBA2 1ULOA 3FUQA 2PHLA 1VMFA 3VHRA 2VZVA 2WNEA 1H2KA 1GNHA 2W92A 3MW4A 3WQ0A 2HWB2 4RGKA 1VBC1 1XNAA 4Q1PA 2WWSA 3I2JA 3LKJA 4XYXA 2WA3A 4XMAA 1ONAA 5EFUA 4RQPC 2XVKA 4NUBA 1SBDA 2Y8KA 4LA2A 1PX4A 4QKFA 3WINE 1RUG2 2JG9A 2VO5A 5DDJ1 2PTMA 5T54A 3UGFA 1OQDA 1R081 1TNFA 1UWWA 5BNQA 3N35A 3OBAA 2IVJA 2KM2A 1RL3A 4JKKA 4XIKA 3VBRC 2VQ0A 2J7MA 4RGAA 4CE8A 3OPWA 2HKXA 2V5YA 4L99A 1T6BX 4MXVA 3WNLA 1GP4A 4TZDA 4A7YA 4BM8A 1BEV2 2QDNA 3ZFEC 4CSWA 1VRH1 4ZU7A 3KT1A 3G6JB 5H9QA 3ZMOA 1UU6A 3T08A 2EIDA 4M4PA 2JB8A 2XG3A 2P3KA 2Y60A 3NV4A 4PIYA 2CU5A 2R1DA 5GALA 1GOHA 3GJBA 1C8M1 1VBD2 2F4PA 3OGSA 1IGOA 4V2WA 2HWF1 3RNSA 2RM22 5FYTA 1RB8G 1PO12 2AENA 1BVP1 3KCXA 3RWNA 4CUGA 1QDCA 5KXCA 4E9KA 2I2SA 2K0GA 1E5RA 4BQ5A 3W5NA 2WFPA 5I91A 4P5YA 3LQCA 1AYM3 4X8NA 2DVAA 1CAXB 2P6HA 4HETA 4XE9A 2VBBA 5C9AC 1V00A 3CDZB 1FOD1 3ATGA 2Q8OA 1IS3A 1NCQA 5FZOA 2VAUA 5F1RA 1N3QA 5CAZA 1JYCA 3QCWA 2ZKNA 4CP9B 4AAPA 4Q4W3 1MS4A 3PIGA 2TEPA 1WGPA 1P8JA 1OFSA 2DUQA 3I54A 2VCBA 4U2AA 3AP9A 1OH4A 1RXFA 4Q0SA 4XETA 2B7YA 2PN5A 3MIHA 5FYMA 5AC91 3JUUA 2Y64A 2K2SA 5EP9A 3A21A 1ZBA1 1UOJA 3TB0A 1RMU2 3VUOA 3BB6A 3KF3A 4CA9A 4DUVA 1JH5A 1AXYA 2HWB1 3T3YA 1WCUA 3RZLA 1WBFA 3G7DA 4OFGA 4IUGA 1US2A 4D94A 2B5HA 4QQHA 2CYFA 3IDEA 4P08A 1RYYA 5G04L 3T0BA 4QQLA 1SCRA 4CPBD 2VVFA 2XXZA 5CEHA 1IS6A 2VCAA 5CFCC 5LA9A 3W59A 1ND3B 2YYOA 1RUG1 3GM8A 4OMDA 1FPN3 2ARAA 2DV9A 5F5AA 4B7KA 1O4YA 2Y34A 2O0OA 1LOEA 3FBYA 1B35B 1S4CA 2O1QA 5FJHA 1VBA3 3S5QA 1W9TA 1O4TA 2A6WA 1ST8A 4YZ4A 3VBHB 2C9KA 2R49A 1PZ8A 4WV8A 4JTNA 1CAVB 3FE5A 4J6GA 2ZKLA 3HJRA 5FCCA 2WL1A 3ST7A 1BEV1 1GNZA 2YB7A 1GNYA 3IN9A 1GICA 3DYOA 1NAEA 5FTTC 2DTWA 3AMPA 4F3JA 5EPAA 2UWCA 4OQ8A 4FPEA 1FXZA 2OUJA 2FMYA 4UBGA 4JC1A 5LK5A 1CVNA 4AGRA 4P00B 4TTGA 2D6OX 1U12A 4PQQA 5A7OA 5DUWA 1VBD1 3AZYA 2RM21 1VRBA 5JWPA 1PO11 5C3SA 4JAAA 2WKKA 3AKTA 2PAKA 4C1WA 1S0IA 3UKNA 2WFF2 5FOJB 2Q8CA 1NT0A 3CJIA 3VDCA 3ZX7A 2B9VA 4YW5A 4E2GA 2IZWA 1S0CA 1OVPA 1EAH2 5KHHA 2UWAA 1XNBA 1KRIA 2VMGA 1UMIA 1IQDC 1UZ0A 3HQUA 3DGTA 3VZMA 2GN3A 5FZ8A 2Y6KA 4DXSA 4AK3A 4UFKA 1JZ5A 5EQUA 2WO7A 2HBTA 5A3NA 4YW6A 3O0WA 2FCVA 3WNXA 2WA4A 1EUUA 2LTNA 2ZGRA 3THDA 2VZUA 5BNNB 3ETPA 4BOWA 1B35A 1PZ9A 1S1AA 1W8HA 5FO7B 1OT5A 2WR9A 1OH3A 4OHXA 4HOOA 4BYYA 4CCEA 2CY6A 1O3TA 2OW4A 3R0RA 4WM7B 4WVVA 3SH5A 1TMF3 4E2QA 4DRVA 3RYRA 1RMU1 2WZR3 4DS0A 1CAVA 5LBFA 4QPIA 4D0QA 4XIOA 1V6OA 3FX3A 3N7JA 4FPJA 4N90A 2WQ8A 4GQ7A 4K3UA 4UW3A 1KDMA 2V4VA 1QJZA 2E63A 2ZBJA 4EE2A 1Z7S2 1RVF3 1LEDA 2QZ2A 1W6MB 4IL7A 4L2NA 3EMRA 4WVZA 3ZPYA 1NUKA 3JQWA 1JHJA 4A7ZA 4FPYA 1H1AA 1QEXA 4V2VA 1GUIA 4FQZA 1W9SA 5IVEA 3ZSLA 4LT5A 4J1WA 4NMIA 2ZOEB 2R073 1NLSA 1I5PA 4M3CF 4N7UA 4DOUA 1JODA 2FQPA 1W6QB 2HWF3 1W9YA 2D7FA 2VQAA 3LB9A 4XZPA 3RGBA 4YW2A 5HPOA 1VBE3 4QDRA 4FAGA 1K5MB 4XDQA 3CJIC 3O1TA 1UYPA 5FYBA 5IFPA 4Q4Y2 1W2OA 2JD4A 2EICA 2R16A 1QF3A 1EYBA 1V6MA 5A7WB 1X36A 1D4VB 1QQP2 3VN4A 1RITA 5J37A 1OA4A 1IPSA 1PGW2 1UNBA 3VD9A 2AR6A 1GLHA 2JDHA 1WW5A 2MEV2 1OF3A 1ND3C 2WFF1 1V6NA 1ENQA 2RJLA 3VKNA 2AEYA 1LOGA 2AC1A 1V6IA 3M8LA 3RWKX 3PJQA 1EAH1 1QIQA 1B35C 3PL0A 3EXUA 1JOJA 1UYZA 4HK9A 2DUOA 4Q4X3 1ENXA 3VBHC 2DCJA 3OGVA 1I9RA 2NYYA 3RVHA 2HYKA 5HXVA 4XBQA 1HDKA 1UCXA 1JYWA 4N43B 3FL7A 1W6MA 1MZFA 5DG2A 1SLTA 1HRI3 3D0SA 3NSTA 4QPIC 3PTRB 4OQ9A 4BXFA 2RJ2A 4CTEA 1HQWA 1CPMA 1JZ4A 2FMDA 5A33B 3V0AB 1HLCA 3MO4A 3N9LA 4NRMA 3H3UA 3A4UA 3ZYPA 5FPXA 1QH7A 2XGXA 3DF0A 4KBZA 1UU5A 1W6QA 4M3CE 2VZTA 4SBVA 2EIEA 3WZ1A 3MIBA 1K5MA 2QQIA 5CIRA 1JTZX 4Y4RA 5I0TA 1RIRA 3AMNA 3RMXA 2YPJA 2FDKA 1XYOA 1GZCA 1S0JA 2R063 2VMDA 3DN7A 4PQ9A 5FZDA 1BBT2 1LOFA 3PVOA 1QXPA 1I3HA 3TN92 4DY5A 4EQVA 1Z7S1 2GSYA 4CDQA 1LGNA 1W90A 4AG4A 5BXXA 1CPNA 1QH6A 1HQNA 4FOYA 1OQ1A 4NPRA 4TLGA 2YMZA 4X8PA 5FPUA 3TEWA 4DUXA 1DLCA 3BN6A 2BYVE 4QHZA 1O3QA 3AKRA 2JIGA 1VBB3 2ZX0A 5T55A 2R042 3POBA 3SEPA 4BH9A 2A73B 3AJZA 3THPA 3SEEA 2A3WA 3UESA 4FVVA 5A7SA 4WM7C 1U5ZA 5FYUA 5AFEA 4EJRA 4HONA 1S2EA 3NW4A 4D7SA 2J1RA 1BMV2 4DINB 4N43A 2DFBA 5I0DA 3NVCA 4KWKA 4Q4Y1 3HT2A 1YQ2A 1FT9A 1QQP1 3AVRA 3HMYA 3OG2A 1PGW1 5A33A 4CXWA 4XURA 5KR7A 2AREA 3V0AA 3LFIA 5K9YA 2WT2A 4GMP3 2MEV1 4XUQA 4B1LA 3WG1A 3BTYA 5FLIA 1ZA4A 4XHBA 2GP5A 5JI7A 4HMZA 5H9PA 2JKXA 2IXLA 3WNMA 3ABZA 3WNPA 4QX2A 5ABJA 1EP0A 1O3SA 4YRDA 3RZMA 2W91A 5L19A 3PUSA 3CBNA 1PIV3 5FPZA 1DFQA 3AYEA 1MVQA 5ERLA 1QJX3 2VTXA 1AZDA 4COYA 5A3LA 4A45A 5DZFA 5JMOA 4ZONA 1XB9A 1RUC2 3GNEA 4L92A 3AFKA 5HBAA 2VC9A 1O4ZA 1K5MC 4JDOA 4Y1VA 1W6OB 1LRHA 3UV9A 5BUVA 3MLLA 4LR4A 5LATA 3OBTA 3WDXA 4JTOA 1LOFC 3FN9A 4XFGA 2C0ZA 3PMSA 4BLJA 5HCHA 4COUA 4XEZA 2WNUA 2UWBA 2VW0A 1HW5A 5FLHA 5IUQA 3WCRA 2NQYA 4XUPA 1OA2A 4KBBA 1OC1A 2OXBA 4P9WA 2D6KA 1MR5A 3FHQA 4AEKA 4GWJA 1NCRB 1NA1A 4OHVA 5JIAA 4BK4A 3UT0A 1BBT1 1C1LA 2BWAA 4XVHA 2RS32 3TN91 1C1FA 1HRV2 3N9QA 4L97A 5HV4A 2ZHNA 1N1SA 1PHMA 4XDPA 3C7HA 4N43C 1BHGA 1EY2A 1U5IA 4LO8A 1LCLA 1EPZA 3AKSA 4BQWA 3CKHA 4I09A 4A4AA 1NYWA 2R041 1XE7A 4XF3A 2XLFA 1TE1B 4IV3A 4HG6B 2XPJA 2ERFA 4PLMA 1VMJA 5HCFA 3LSDA 2A75A 2R1BA 5CG9A 2WNVB 3VDDB 1S55A 2E32A 2EXJA 1J83A 3M1HA 2ZEWA 1BMV1 3MGUA 4HK8A 5F37A 1JI6A 1JMUB 4LLFA 1XNTA 4NHLA 3PUHA 5CFDB 2P2KA 4MGZE 3J7LA 5F5QA 1W28A 1W6OA 1ZZCA 2PMWB 3N3HA 1VR3A 2B8MA 1PVC3 4QXBA 2D44A 2PHRA 4QPGA 4PHZA 5SV8A 4B8EA 1I6XA 4HPKB 3EB7A 3VKOA 1S2BA 5LBCA 4IEXA 5I8YA 1HB2A 3WQ7A 2WYFA 2MPFA 4EZ4A 3MUZ1 1W8WA 3B9CA 3NJZA 1J3RA 2QTWB 3POIA 2PHTA 3LDKA 3MLKA 4K9SA 1IPJA 3MW3A 5FMOL 2ZGPA 3X29B 4M3CA 1NCRA 1NLRA 2BJSA 1SZBA 2AGSA 4JGYB 1Y9QA 1WCSA 1SLAA 4RYDA 4OI2A 1IG3A 1W6PB 1V6KA 3WW2A 2WNUC 3GF6A 5LK7B 3OOXA 3RRDA 3VKLA 2ZZJA 3FLTA 1RUC1 4IESA 4AFDA 3O14A 3VGIA 1AR82 2Y38A 4P9XA 5C7GA 3GGLA 1EV12 1H2LA 1DBNA 2DF7A 2SLIA 5A3OA 5JZGB 1NA1C 1JYVA 2YBKA 4Z07A 1Q8OA 3VD4A 5LZ6A 5HXMA 1DLLA 5FZ9A 1DYOA 4BDVB 1CAWB 4MADA 3VV1A 3K3OA 3VDDA 2R6QA 3HVDA 1LENA 2ZEXA 4LBLA 3IB3A 1QGLA 1CZVA 4CCNA 3ZXGA 5CFDA 3MBWA 1G6NA 5A32B 5FPLA 2EALA 4IE4A 4CUAA 1FV2A 2RS31 4IV3C 1LECA 1HRV1 2OPWA 1AXZA 2ZGUA 2BOJA 2X8KA 4YW7A 5H9RA 2VQTA 4XUOA 4YLZA 4I3GA 2B39A 3VBFB 2E26A 3O1RA 1FI2A 4UYBA 1JU4A 3NNFA 1W0OA 1QHDA 4GKXA 2OYZA 4BQYA 4XOGA 1QQP3 3UJQA 1S0BA 1XXNA 3BOPA 4EN9B 3LFMA 4QPGC 4GKYA 3J4UH 4CCOA 2P3IA 4BXSV 4NWWA 4XFFA 3SCGA 1W6PA 5LASA 3VD7A 1FYUA 3KCYA 3NV2A 1XYPA 1LGBA 2XVGA 4UFIA 1YQCA 5A1FA 2W1UA 1E5SA 4EYUA 1NCRC 2TUNA 3FMGA 5FBZA 4AR2A 4HKWA 1LAJA 2UYAA 2HWE3 4Q5OA 1V9U3 1SFPA 4DIQA 2A6XA 4YPJA 1PX3A 4IW3A 1CAWA 1DCSA 3GBWA 1ZZBA 3VD3A 1CWPA 3AMQA 4IE7A 4QMAA 2JE7A 3SH3A 3IAQA 4NPMA 5FZ4A 2V09A 3WP4A 1KEXA 2C1FA 4R4XA 2Q0AA 2ES3A 1ZBE3 1IHMA 2ET1A 3ZSJA 5FPAA 1X33A 3VKMA 3HAGA 3JBG3 3M3IA 4B1MA 1NXD1 1QOTA 3VDDC 3K3NA 3EO6A 4OMCA 2G9FA 1VB2A 5IT6A 3VHNA 3JXSA 1QY4A 3KV4A 4IV1B 1AR81 4Q1RA 4ZS2A 1NQDA 2I07B 3SH4A 2D97A 3VBFA 3ZO0B 3V0BB 1F5JA 1EV11 3BTZA 5CFDC 4SLIA 4WBBA 4HT1T 5EV7A 4GXLA 4UFHA 1QJU2 1SLCA 1RXGA 3PUIA 3WF1A 2JDYA 3LEMA 4L11A 1BXHA 4NRQA 4Y1YA 4I0WB 5AFBA 5C70A 5LRRA 2Z42A 5FYSA 1UZZA 2WS92 4K21A 1OF4A 4BISA 5DZGA 5JI9A 3PU3A 3I97A 3VZLA 4QX3A 1HJGA 5FMBA 3WDYA 4KGQA 1WW6A 2W3JA 3B3QE 1WD4A 4RSUA 2IXKA 5ACA3 1YNAA 4WVWA 4KU7A 4H3WA 4RQPB 4HSLA 2BW8A 1AR72 1PMJX 1XU1A 5LEJA 1W8FA 2A6ZA 3ZMNA 4E8DA 1FAYA 1JU3A 2UY9A 3CNAA 5FYHA 4EN6B 3GZTB 4A41A 2P17A 1SMVA 4YFWA 4FPLA 3KZ4C 1TEIA 3HR9A 2VY0A 3ACFA 1XBFA 3VBUA 5JAXA 4PIZA 4CU8A 4U36A 3H3ZA 2IC1A 3SXWA 1H8VA 3LWCA 1D4M3 3K48A 5CADA 5LBEA 5JXJA 5K8SA 5CG8A 4EN8B 2Q4SA 1UXXX 3ON7A 4IV1A 3U14A 2XB6C 1F5FA 4IEZA 1HIXA 3WW1A 4XPVA 3V0BA 5FOBB 4COVA 3A0NA 4W6XA 1WLTA 2QBXA 4QU2A 3WW3A 4Z92B 4EWEA 1H4GA 2D3PA 4BQ4A 1V70A 2W0XA 1V6LA 3O12A 2OKXA 2VOTA 1W0NA 1ZM1A 4QDSA 2BUKA 4FI9A 4XJ9A 3RJRA 4Y4YA 1ZA7A 2XWBB 4FFIA 3GALA 4IEWA 5IK4A 5IHRA 2WN2A 4LTAA 1TQ5A 4R52A 3VBFC 1RUI2 1BLZA 3M3CA 4IGOA 3OEBA 4GALA 4K1YA 4MOAA 4LJHA 3M70A 2Y33A 1CR7A 3PTYA 5E8AA 5K0UB 2JEMA 2GH2A 2NN8A 4YGCA 3WDVA 5ISLA 4ZHNA 2O14A 4CP2A 2AYHA 2OQ6A 3APBA 1O59A 3ZIWA 5K4LA 1W2AX 1KS5A 1RUF3 2RMU3 1AR62 2JJ6A 1Y7BA 2DUPA 4GD4A 5FK8A 4C8DA 4FPGA 1OSGA 5FZLA 4ZZ8A 4AHXA 4Z82A 1REEA 5A7QA 1QJU1 2HWC3 3PUQA 1X7NA 1HRV3 1E5IA 4JHTA 3E97A 3UGGA 1QJY2 1AJKA 1AUYA 4YGEA 2GC1A 2WS91 3ZR6A 2JG9B 2V4AA 3LCPA 4MGYE 3NJXA 4CCKA 4FTEA 1GFF2 3NO8A 1TME2 4BJ0A 2DBNA 3HNBM 1REFA 1O5LA 5J96B 3J7NA 5F8PA 1J59A 4HSJA 3LIHA 4LBQD 3C7GA 3AL6A 1AR71 1WLCA 1JZ6A 3WY6A 1GKBA 1UPSA 3VBUC 2VL4A 2VCCA 4BA6A 3AYDA 1W05A 4BIFA 4Y1UA 4K6BA 4FQ4A 2BRTA 2JX9A 1RUJ2 2VOVA 3E5QA 2C4XA 4MGTA 3SITA 2BBAA 4IV1C 4HVQA 3DV8A 4GJYA 2JECA 2VUDA 4HKLA 5K0UA 4AQ2A 5JUVA 4LHKA 3DECA 3TNPB 5JDBA 1UIKA 2QE3A 3E1F1 2XUMA 5GZFA 1FX5A 2GC2A 4QQPA 4QD2A 3FLRA 4OULA 1PO22 1G9DA 3M3EA 1L7QA 4M01A 1C3HA 2XHKA 2QQKA 3WF3A 1W3XA 4LULA 2ZMNA 4URTA 2XDVA 1FNYA 2PFWA 5T5LA 5KXBA 4Q4V2 1WCDJ 2FHRA 4NJ4A 3USUB 1BK0A 3H3LA 1AR93 1H2NA 1NCQB 1OOPA 1F4AA 1R64A 5FZOB 1CD3G 1RUI1 1VAKA 2GNMA 2VNVA 3CJXA 3C2UA 4BMBA 4KNCA 1ALYA 2VD7A 3SQOA 4AVVA 1QMJA 2UURA 3PU8A 4H14A 3F2ZA 4NAMA 1B09A 4JKMA 4CU6A 1E57A 3KT7A 1ULEA 5FZHA 4GWNA 4D6QA 4YARA 1IPKA 2OX0A 5JSOA 1AR61 3ZKUA 1WWYA 4I02A 5FY0A 3H7YA 2HWD3 4HKOA 4KG0A 4XBNA 4BQ1A 4XCBA 3E6BA 2E31A 2QVSB 2XBO2 1XU2A 4JQTA 1DQ5A 4QPWA 1YI9A 2VH9A 3Q8CA 4C90A 4EWAA 1HXS3 4R9BA 5TSWA 4AEMA 1QJY1 3CU7A 4FP3A 3RZKA 2BNMA 1H0BA 1MZEA 4BCUA 2F6BA 4QPYA 1RINA 3HOBA 3FUOA 4WZCA 4NHMA 3IDAA 2RR12 3N7LA 1GWMA 1TME1 4YM0A 4ATEA 4ZU4A 1DF0A 2ZHMA 5FZIA 4LBOA 3UYJA 4DEVA 2RDNA 3WQBA 5K0UC 4OUEA 4QU1A 5CNAA 5A80A 3DYPA 5A3PA 3E6DA 3W5MA 1D0GA 3RPQA 5BNOB 4DEQA 2BVBA 4GB32 2PYTA 2OZ6A 2R7EB 3USUA 4FTSA 1GQGA 3GBFA 1RUJ1 5LB6A 1AL0G 4TLFA 2E33A 3LDBA 2VVEA 3AZZA 4LNVA 4DPNA 1OPOA 3ACHA 3I59A 3IT8A 3EQEA 1JOPA 1H9WA 2PHWA 4Y20B 3I7DA 1C4RA 4QWNA 5FY4A 2D93A 2HYXA 4WVMA 3VL9A 3ZPOA 1S0EA 1Q5OA 3E5XA 4QKNA 2W1WA 2CDOA 1AYN3 3MIFA 5FMOS 3T4HB 4RD7A 1C5IA 3ASIA 1BYHA 2VTFA 2XUEA 4NHKA 3THTA 1OOPC 3B00A 1PO21 2JG9C 3CJIB 3NL1A 4D6RA 4JRAA 3N36A 2WSUA 3K4ZA 3MDPA 5F6KA 4AI8A 4P9GA 1J1LA 5F5CA 3LEKA 3UKTA 1Q3EA 3QH7A 3J26N 4QX0A 3ZFFB 2D6MA 3NNJA 5D8AA 5APAA 3PJYA 4Q4V1 1JZ3A 2VUJA 5HCBA 5DPNA 3UGHA 5JXGA 2D40A 1DYPA 2WDBA 4J1XA 4ARYA 2JWPA 4XXPA 2DCYA 2WO2A 3CZJA 3FJSA 4Y26A 5I93A 3IZOA 5J7MA 4FCAA 3KLSA 2YZ4A 3WD5A 4XJ8A 4C91A 3OUHA 5A7PA 2QQPA 2C5DA 2YV8A 2RS13 1O5UA 1GQPA 3ZN6B 1TVGA 3A23A 2W47A 4H7LA 5CYYA 2WLPA 2XJPA 4XFBA 1PNFA 5T52A 2AACA 5B4NA 2WS93 2J1EA 3MUY1 4KGGA 3N7MA 4LMFA 4RGGA 3RJ2X 5BNOA 2XJRA 2DCKA 4YG3A 4QPIB 2LM3A 1KDKA 3OYWA 4KWLA 5FIXA 4BIOA 2XBO1 5M0TA 3VL8A 2NMNA 3BVCA 3N9PA 4DQAA 1RTVA 4Y20A 2Y6GA 2ZJCA 4A44A 1DGWA 1LHWA 5BPXA 2A1XA 2H6CA 5SV5A 4OZXA 4YW3A 3S7IA 4CUCA 1UPIA 2E6VA 1Y9GA 5FUPA 1UOGA 5JIUA 2DCZA 2RR11 3ZN6A 4CVUA 1NCQC 2Z79A 2OUHA 4LE3A 1OD3A 1LHNA 1LNSA 4KL1A 4UFJA 1I5ZA 1UD1A 4XQ4A 1R092 3WF0A 2XL7A 2VECA 1MZ6A 3WR0A 1LOBA 3EBRA 3JU9A 1OLRA 1JHNA 4OCTA 5C5TA 4MGIE 2E7TA 2W94A 2DU0A 2WQZC 3MPBA 3WQ1A 3ZFFA 3KV5A 1URXA 3Q8FA 3PIJA 2W39A 4QX7A 4GB31 4FFGA 3JD72 4MO3M 5LY2A 2A3YA 4B4PA 1OMIA 2P3JA 2Z4FA 1PMHX 2Y6JA 1VBC3 3NJVA 4IGPA 5I8SA 4LKEA 5L9BA 2YROA 5FMDA 1GWLA 1KGYA 1SEFA 2WAAA 2H6BA 1H6XA 2YY1A 3B69A 1H30A 3RMYA 2VUAA 4QX8A 1DZQA 3KCCA 1Y4WA 2FCTA 3T0DA 2QQJA 1V6JA 2X29A 4LOSA 5FZ0A 3AZWA 5GZCA 3I2KA 5DDJ3 2V5DA 2WNOA 2YDEA 1GU3A 3PHMA 4NIIA 1R083 1AX2A 2A3XA 2W2IA 2GZWA 3AK0A 1UY1A 2QNKA 2ZGKA 5FUNA 1KFXL 2VZSA 2J42A 2EIGA 1IS5A 1SG3A 1GOGA 3GZAA 1COV2 2YXSA 4QGLA 4B29A 2JDPA 2Y6FA 2FZ2A 3MW2A 5JXIA 1G7YA 1DHKB 4Y1ZA 2VUCA 4NIAA 5BNOC 1VRH3 2CSGA 4URAA 3LSEA 1AX1A 1AF9A 1YRZA 3AYAA 3GXUA 4LKFA 4S2DA 1CGPA 1YFWA 2Z5WA 3I4IA 3OB8A 4DO0A 2VZQA 3U07A 5FO9B 4I2OA 3IBMA 1CIWA 2Z2SB 2OPKA 3FLPA 1C8M3 1CESA 1SLLA 1DIWA 1LOAA 5FY9A 4YVSA 1KJRA 4QAWA 3AP7A 2XLAA 1SFNA 2Y0OA 3WCSA 4C0BA 2JIJA 1TME3 4AL9A 4AI3A 1UOBA 4MLOA 2WN3A 3DXTA 2VG9A 3H8RA 1PVXA 5GZEA 1VLNA 5FXXA 1RUH2 5T3NA 1BJQA 3ZFFC 3ZDSA 2GMPA 4O9EA 4CDQB 1VB4A 1OLQA 3LPFA 3ZXLA 4XF1A 1FOD3 4YW1A 1H1IA 5IYYA 5F9TA 4IE5A 3POGA 1R091 5A70A 1YQ8A 1OXCA 1OQEA 2QDRA 3ZYHA 5FPBA 4CP1A 5AC93 4LO4B 2YPDA 3I2GA 1NLQA 1HJFA 3RI8A 5JR7B 1ZBA3 3JD71 5DAPA 5KBFA 2YBPA 1RHI2 3RG0A 2HWB3 3POFA 5GZGA 1YJLA 2QQMA 2PQQA 3H8UA 4NIGA 1JZ8A 1UY0A 5GLZA 1OD5A 1RUE2 1AXKA 2VMCA 4COZA 2BPA2 5FP3A 2W46A 3WNOA 3S5AA 1Y43B 3DKWA 1POQA 3D0JA 4P9LA 2XLGA 2YG0A 3JCIA 1RUG3 2BVVA 4MGKE 3KHCA 1AL22 3POEA 2ZGQA 3K75B 1LR5A 4AQTA 5KXDA 3QOPA 4FFHA 3HQRA 3ZXJA 5ABJB 1ND2B 2J1SA 2JE9A 2XVLA 3R4UA 4FP2A 4PF5A 5FLJA 3C7EA 3KD4A 2XH6A 5IVFA 2EXHA 1COV1 1RUOA 3FZ3A 1RUD2 1VMHA 3LD8A 1XYNA 2IXHA 2PHXA 5IK7A 5C3OA 1ZZ6A 4QXHA 3O0VA 1DDLA 1BEV3 4UXAA 4XFIA 4BQXA 1W8TA 2RS52 3HN3A 4KI5M 5C33A 3ZYBA 3W58A 1HKDA 1RJ7A 3URFA 2W87A 4XXAA 1UZYA 2D6LX 2GALA 3KHBA 1CJDA 2QCSB 2I45A 5FZCA 3VZOA 5DAVA 5DUXA 1VBD3 4MXWB 5FZEA 2OVUA 2R30A 2WNUB 3HNMA 4FXGB 2RM23 5E6HA 5FWEA 4CXXA 1PO13 5F7UA 4D8MA 1QNWA 4LORA 2JE8A 1Q43A 2Q8EA 4EWDA 2A71A 3MV11 4ZS3A 2D5HA 1NA1B 1FMD2 1RGSA 2VMHA 3MFCA 4BQ2A 1N3OA 1D2QA 1ZRFA 1RUH1 2PLV2 5I0RA 5FXVA 1WUVA 2R0HA 3ECQA 4GWIA 5E88A 5FREA 2W1SA 3LOIA 5IWFA 3J8F2 2XOMA 5C8WA 5L7OB 2VBDA 3WP5A 1JYIA 2W1QA 3ZDVA 4AHYA 3AX4A 3MIDA 2YC4A 3AL5A 5JSRA 1QOSA 3VB9A 3LE0A 3RZGA 2A6VA 4YFZA 4QT6A 2GH8A 3OPZA 2RHPA 3AB0A 1PMIA 1ND2A 4IV3B 3SLIA 2W5FA 4X6QB 4AI9A 3I2IA 3LEGA 2QQUA 4RFT0 3J9SA 2G19A 4YM2A 3L2HA 4J25A 1RMU3 4ES9A 5C71A 2VOWA 1QKQA 1RHI1 3V65A 3AXEA 4MVTA 1W2UA 4CPBA 1X9TA 2YC2A 3TBDA 1NKGA 2ZEYA 3WT3A 1LULA 3R6SA 4W4ZA 3T0AA 2P5BA 5FWJA 3J7HA 3KVBA 1RUE1 3LIGA 5DXDA 4AI1A 3T2QA 4W65A 3U10A 1S0DA 2BQPA 3MLJA 4Y22A 5K7PA 2R32A 4QPGB 4MHUA 4A7KA 1O6UA 2PA7A 2VW1A 4MXWA 3N7KA 4CDQC 5LBBA 1AL21 3T2PA 3IMMA 3POYA 3O1PA 4N8MA 4QDQA 5BY5A 3QLQA 1UAIA 4XZUG 4DY3A 3SISA 1YJKA 1STMA 4AXOA 3FHIB 1ENRA 3ZM8A 5CU1A 4M3CB 4XF9A 3F95A 3M4FA 1PK6B 4JKLA 4ES8A 3VLBB 4CU7A 1RUD1 4YSFA 4GZ9A 2JXAA 4PF1A 2X10A 4CDXB 4RHV2 5JPNB 3E6CC 5L7OA 2RS51 4HVOA 3HNYM 3ROUA 5FXZA 4CEWB 5FV3A 3RZJA 5FBJA 2ZGOA 5GJ6A 3I3MA 4F8AA 4PCRA 1VJ2A 2BGPA 3TWIA 2VJXA 5GZDA 4AFMA 5J1XA 2BV4A 1IQAA 1CIYA 2H0VA 2E9QA 5D2AA 1OKQA 5FUIA 1YEWA 1ZZ8A 4KWJA 3ZXEA 2WFF3 4ARXA 1GQHA 3OBRA 3WF4A 4LHLA 3ZR5A 2QQLA 2FZ1A 4XAAA 1EAH3 1FMD1 2C6SA 5ABJC 3VHPA 4QGMA 2P4EA 4OI1A 1G8WA 1DQ0A 1ND2C 1IKPA 1MS1A 2PLV1 4NIDA 2W52A 4UFMA 3AP6A 1GMMA 1WLWA 2CGNA 3ES1A 2XQXA 4IEYA 4IE6A 4F83A 3J8F1 1ULCA 4EV0A 4TSVA 2JG8A 3POJA 5DN2A 1HX6A 3INAA 5GLTA 2ZAHA 2WAOA 1W99A 3KGLA 5FZFA 1L7RA 4FOQA 1W3VA 1XE0A 3TOJA 5JLVA 1KS4A 4X6RB 3V56A 3GZUC 3WP3A 1ZNPA 2NMOA 4B7EA 1PK6A 4O9GA 1H8TA 4CDWB 1MVEA 2CAUA 1CZSA 2DFCA 4WM8B 2WWUA 4N53B 2LW8A 4CDXA 4B3NA 4R4ZA 4AI0A 2OS2A 4PT6A 5LCWL 4XFAA 3J7MA 2DDUA 4NVPA 3PVNA 1DU3D 2VMFA 2K46A 4JHZA 4CEWA 3N4MA 4FPOB 1UXZA 4QB6A 5KWRA 2L9LA 3C7FA 2ZEZA 1MEC2 2YU1A 1R1A2 4FPFA 4LKDA 4YG0A 5A3WA 1N47A 2QZ3A 3FHAA 1HB3A 3BIWE 1OUSA 3IMNA 4LOTA 1WCQA 2WABA 1Z7S3 3ILRA 4M4RA 1NE4A 5KHJA 1CJPA 5L7OC 3OD0A 2VBPA 3VZNA 3T4VA 3D6EA 3OSDA 4CP0A 1GZTA 4GH4B 5LA2A 5C4WB 5J09A 4OHYA 3KB5A 4AFCA 3LZZA 1NE6A 2A5ZA 3WW4A 5A6YA 1J3PA 3NKGA 2B45X 3H9AA 4RHV1 5GKAC 1DGRN 2X5IA 3POWA 1MZ5A 2ORXA 4QHBA 1JS9A 2ZGNA 4LBMA 3U37A 2GC0A 4N7IA 3S6PA 4Q4Y3 3ES4A 1H2MA 4Z2WA 1ULDA 3ZN4A 3JB8A 3VHOA 3GJAA 4YZ5A 3M3OA 2J1AA 1RJ8A 3LF7A 1GOFA 3MPPG 3ZYRA 3RS6A 3LAGA 1JYTA 4YM3A 2KD7A 3DL3A 4FOWA 4CDWA 1Q8VA 4WM8A 4N53A 3K46A 1JOBA 1K12A 2JG8C 2MEV3 2VW2A 2YBSA 4JGZB 5LA0A 4MG2A 2DYCA 4FAHA 1A6CA 4QHOA 4RN5A 1BZWA 1UU4A 1ASJ2 3K51A 2YU2A 3RI9A 1NG0A 2ZCWA 1OFNA 1QJEA 4H7MA 1PK6C 2CNAA 1H8TC 2ZX1A 1D2SA 1UY2A 1W9WA 1YFYA 1LHVA 2Y0IA 1A3KA 3NNGA 5AVPA 4HANA 4CDXC 1UW8A 1FV3A 5F32A 1QU0A 1KITA 3BALA 5AVAA 4CEWC 3K77A 1SCSA 4OZOA 4UI9L 1LODA 1PNGA 4GH4A 2JDKA 1AYM2 5C4WA 5C6CA 5DAXA 3VBOB 3GCXA 5EJZB 3EHKA 4LUMA 1F35A 5GLWA 2LROA 1MS3A 1YYNA 3D4KA 1WMFA 3VBUB 3WNKA 4DB5A 4Q8KA 5KHGA 4MHRA 4AHWA 4ASLA 1UY4A 3C3VA 3OUIA 1CONA 3IDCB 3CMGA 4Q4W2 5FZ7A 2WO3A 1K3IA 5FJKA 3B94A 4TN7A 4ET7A 2OIIA 4AFAA 1GSLA 1Z78A 3C7OA 4XF0A 5IVJA 3L2YA 4XQDA 1MEC1 3Q8BA 1O91A 1GV9A 1R1A1 3ZVXA 1J1TA 1BBT3 4O65A 3T2OA 2E53A 5LEKA 3TN93 5C8CB 2X5IC 5E89A 4E4HA 3BUCA 2E7AA 4GIQA 3JQXA 4JGZA 4CDUA 1DQ1A 1VE0A 1M06G 1Z0HA 4LO7A 1BQPA 1VAMA 1TG7A 5DMYA 2C26A 5FZKA 4HLTA 2R043 2LUWA 3CZUA 4RR3B 2VOXA 3PMEA 3QACA 2BBVA 3JZVA 4I01A 4E4DX 1FPN2 4O7XA 4CDWC 3ZFGB 4LO6B 4FPKA 2EXIA 4WM8C 1W2TA 4N53C 5EXOA 3TEYA 1XE8A 1YIFA 1VBA2 4YW4A 1DGLA 5FP8A 2XJQA 3OTFA 1REDA 1FMD3 3K2OA 2W08A 3ZXKA 2DBIA 3ILFA 3KMHA 3S57A 3AKQA 3VBOA 1JYXA 3BPZA 2CTVA 3UL2A 1US3A 2XR4A 2BP6A 3KSCA 4EN7B 3Q8EA 1UO9A 2GU9A 1Q8PA 1UKRA 4Q26A 1AHSA 3RYKA 4AAXA 3R05A 3OF1A 2ZMLA 2Z69A 1CX4A 1ASJ1 3ZSMA 5IVCA 3DPRA 3L9JT 5HI0A 5KHIA 5ANNA 4DUWA 3AZXA 4GH4C 4PBOA 3RZZA 3PVBB 4NPLA 5C4WC 5EHDA 1X9PA 2RVAA 4LHNA 3TEZA 2Q1MA 4NIHA 1POV0 2JD9A 4BB3A 2BGCA 5LW9A 1JN2P 2AUYA 2JDNA 3RYPA 4MGSA 4XHXA 3HN1A 5C8CA 5L36A 2WYSA 4AWDA 5LRSA 1WMEA 4ZXEA 3T30A 2WWJA 1RUC3 4ASMB 4QM8A 1SQ4A 3D3AA 3EYPA 3SHRA 1CX1A 1AYM1 1N1VA 2OA2A 1EUTA 1OA3A 3BU0A 3P6BA 4LKSA 4RR3A 1G9BA 1SBFA 2P6CA 1PGL2 3ALQA 4GMP0 4OVEA 3O1UA 1YI7A 3ZOIA 3ZFGA 3Q9OA 2OQ7A 4Q4W1 2VMEA 5T5JA 2V73A 5I0SA 4JGZC 4JZRA 4TYSA 4Y3OA 1GZWA 2GNTA 5FAXA 1GWKA 4CDUC 3BTXA 1ACCA 1N1YA 3B5LB 2OT7A 1S0GA 2DCTA 1HV1A 3AM2A 3WSOA 3HBKA 3AVSA 1TMF2 5L9RA 4QGNA 1KQRA 2VOKA 2WJSA 4EZHA 2WZR2 1W6NB 3SMHA 1C8NA 4BE3A 5LWBA 2RS33 3SKJE 2ZX3A 2ADEA 4P14A 1XNKA 1JZ7A 4LBKA 1UQXA 4IEVA 4OLLA 3RZHA 3EJKA 3B93A 1OOPB 2GN7A 3H0OA 4LBQB 4LXLA 4UW6A 4W50A 3BKZA 2ZABA 2QQWA 3OBZA 5FR3A 4BWOA 1YCIA 3RQ0A 4AVTA 4PDWA 4RFRB 4AEDA 4BQ3A 3VBOC 3LA7A 2HH9A 5D21A 1RVF2 1FPN1 5FMCA 2ZZQA 3THCA 2EXKA 4IE0A 4LUKA 4M00A 5F39A 5FY7A 1VBA1 2E7QA 5CZKA 3ETQA 3VBRA 3IKWA 5EZWA 3WF2A 4XILA 2R072 5DABA 3ZXAC 4ATFA 5IFTA 1BKZA 4I0AA 2P3YA 3ZYJB 1VBE2 2IFRA 4AGGA 1OURA 4AVCA 4JRLA 1UX6A 5EWSA 5C8CC 3H1YA 5FZBA 4ASKA 2GP3A 3HT1A 5JR2A 3BPSA 4YZ1A 2QKDA 5KHKA 1I1EA 1H6YA 1F31A 3SNMA 3USSA 2WZEA 4LHSA 3NQHA 1RC6A 4RR3C 1W6NA 4CCLA 2ORZA 3AC0A 1Q8SA 1KD7A 4PBPA 2CWMA 3TNQA 3ZFGC 1LJ7A 2W68A 3A7QA 3PNAA 1K42A 2ET7A 1XPWA 4HVRA 1SDWA 4XTPA 3VD5A 3H8XA 1GANA 1AR83 4LBQA 2VZ3A 3MF6A 2VMIA 3CL1A 1T2XA 2VZRA 3I59B 1EV13 4Q4X2 2CV6A 3DUIA 4XFHA 3LA3A 1NOVA 4K8FA 4XJUA 2BEOA 2IUWA 2A7AA 4WVMB 5G05L 1PGL1 4NHYA 5DUVA 4YVWA 2G9GA 2A70A 1N1TA 4JQRA 1HRI2 2XWJB 1YWKA 3GHNA 3MYXA 1LESA 4Y5TA 2P34A 4QB1A 3NV1A 2CAVA 4AF9A 5I8TA 2VVDA 1PGSA 1TMF1 2WZR1 4PDWC 4AEDC 1CN1A 2ARCA 3H1MA 3OGJA 5D8AB 4W6YA 4Q2FA 1YIPA 4LITA 1OI6A 2GMMA 5FP9A 4Q29A 4OI0A 2CHHA 1YHFA 1ZRDA 1SFYA 4LQRA 3P5BA 1FATA 3UK9A 2O8QA 1OLME 2KR2A 2R062 5GM0A 5C5UA 2HEYF 3WDWA 5CFCA 1OUXA 3BTAA 4NHXA 1RVF1 1UYYA 3D82A 2XL9A 4RS5B 4Y33A 5L73A 4TWTA 4A6OA 4N9IA 1K5JA 2ZMKA 3LGRA 3ORJA 1VBB2 5JOYA 1ASJ3 4IXLA 4XF4A 3H7JA 3OYWB 3TAYA 2R071 4HFSA 4DNYA 3LOBA 1S2KA 1WW7A 4G9SB 4XJAA 2FDJA 3IWZA 3I3DA 4ISRA 1VBE1 4W8JA 3ZKYA 1W04A 4UW5A 1DZRA 1N3PA 2ZGLA 4R9AA 1QJFA 3MIEA 5BV6A 3N9OA 2FDIA 4KG8A 4A2UA 3NNMA 1UMZA 1DQ4A 2ZTNA 2RV9A 3MI8A 3WNNA 1WBLA 3OJBA 4MGQA 4CCJA 3I3BA 1YLLA 4ZXKA 2VNRA 5FZ3A 4NOTA 1ZRRA 1VAVA 1L3JA 2YC0A 4YVWC 5J48A 5LY1A 4JX0A 3O1MA 2CWSA 2YFUA 2PHUA 1NX9A 2BU9A 4Q4X1 2F17A 4UWDA 1PIV2 2RDQA 5GLUA 1HV0A 1QJU3 1QJX2 2D43A 1YFUA 4OYUA 2ID4A 3U78A 1SACA 1A8DA 4RA0A 1QDOA 2HJIA 2Y6HA 3R4SA 4LBJA 4OHZA 4RS5A 3WXPA 4AOCA 4CUBA 2TBVA 1HRI1 1BCXA 1OVSA 2JDZA 2W9XA 4IDZA 3WHTA 2QFEA 1WA4A 1U5XA 1LHUA 3IIIA 4KWUA 5C3RA 4DFSA 2PHFA 1WA6X 2WC2A 4W6WA 2DVGA 3OGRA 4FOVA 4FXKB 3P3PA 2JB4A 2ZXQA 2NZ9A 5JXHA 2BERA 4Y1XA 1J3QA 4LLOA 1AR73 3PDQA 1A8MA 2XONA 3TRSB 1MQTB 5I0UA 2WT1A 3U1XA 3TYJA 4QXCA 2R061 1XNCA 2VPVA 4XCAA 1QWRA 2ETEA 3BYWA 1KFUL 2LRPA 3PLQA 4JV4A 1X8EA 1Y9MA 4PI0A 4XAEA 1CAXA 2YHJA 1U0AA 3CIHA 3OY8B 5L9VA 2C24A 3I3QA 3KWVA 2WRAA 2P1BA 1TNRA 3AZVA 4LPLA 4YVSB 4CP9A 1VBB1 2GNDA 4KQ7A 1U5YA 2B42B 1A78A 1W39A 2FDFA 3HWJA 1ZZ9A 1SPPB 1W2NA 1OKOA 4QKDA 1POV1 2BOIA 4QX1A 4Z1VA 2VQUA 2NLRA 2Q8DA 1HN0A 3AP5A 5D8AC 3IPVB 1HN1A 2IWGB 3BOWA 4XUTA 2P37A 4Z2AA 3VZJA 2YUEA 4AVBA 4Q0UA 4NR1A 1RUI3 1NXMA 1PVC2 4QKBA 4D6SA 4M0HA 1XSQA 1CAUB 2G4IA 5IAVA 1JW6A 3ACLA 4CCDA 3H8OA 4GMP1 1ND3A 1W0PA 5DAWA 3CQOA 3OCPA 4RS5C 4I0BA 2XJTA 2ZS6B 1MQTA 4IQPA 1AR63 2GC3A 2J1TA 3JB4C 5EYYA 1PIV1 3VBHA 1PZ7A 2HBUA 1W8NA 2ZGSA 2TNFA 4IEPA 1QJX1 2BWCA 2RE9A 2D6PA 3FFZA 1YQ5A 3V64A 4AGVA 3ILNA 5FY8A 2VZPA 1OLMA 1QJY3 3OY8A 4XW3A 5IATA 1UYXA 3MEPA 1LU2A 3C8XA 1J84A 2VTXJ 1MPXA 3I3EA 3VDBA 5B4XA 1JZ2A 4FT8A 4HZFA 2B46X 1IS4A 5C3QA 1OPMA 3NMBA 4YWAA 1KJLA 2WZPP 3KQ4B 1SPPA 5JVVA 2ARXA 4F7ZA 4NRPA 3S0MA 3PUAA 2VNGA 2HLEA 1VPHA 4A3XA 2ZAAA 4HBNA 3IPVA 5JSPA 1UMHA 4H2AA 3S30A 4P02B 4P9YA 4IEOA 3T09A 1RUJ3 2X09A 3MFAA 3R4DB 4XQWA 3AMHA 2AZ5A 1UY3A 1GYKA 3ZN5A 2XJVA 4I30A 3ZIXA 5A3MA 5IVBA 5FZGA 3UJOA 3Q8AA 1CAUA 3N9MA 3NNLA 3QH6A 4Y5Z0 1T6GC 1C57A 2WIIB 4OUSA 4LO5B 4IERA 4ZPIA 5BNNA 2DTYA 1AX0A 3NKTA 4B4QA 3HD8B 2AH2A 1PO23 4XACA 3O1OA 5F2SA 4Q0PA 3AYCA 1DZTA 1GP5A 2BFUL 4WM7A 2ZA9A 4Z8BA 4YZ3A 3WV6A 1ZRCA 3SKVA 3AXDA 3DEMA 2WO1A 3HIFA 4Q4V3 5JOZA 1NZCA 3O0XA 1K45A 2I74A 3VZKA 4NO4A 2J1VA 1H9PA 5F3CA 1MQTC 5DG1A 4K40A 5F3EA 5FRAA 2QUOA 3ENRA 1LU1A 3VBSB 3I2DA 1PVC1 4DMIA 3ME2A 4LBNA 2HWE2 3N9NA 1V9U2 3I8TA 2DVBA 2XKOA 3WVJA 2EA7A 4E2SA 5JCTA 2FBEA 4GA9A 3W9AA 3AJYA 3OPTA 1EPWA 4R9CA 3ZXDA 5FP4A 3VDAA 3AKPA 1JUIA 1NY72 1XQNA 5A1AA 5BYNA 5B2GB 5KXEA 1DQ2A 1ZBE2 4YVSC 1V0AA 2VGDA 4IETA 1YQ6A 4MZUA 3WOGA 1UF2C 3CLPA 2XBO3 1SDDB 1YUDA 3JBG2 1IKQA 1G9CA 3PVEA 3LEIA 4CXYA 4Y22B 3NJYA 2PQSA 1YFXA 4XUNA 2W95A 3BCWA 4DXRA 5CBLA 4Q8LA 2Y6LA 3TEXA 1XJAA 3KVAA 5HV0A 2K9ZA 4I3PA 4E8CA 1VALA 2YGLA 3D5OA 4PLOA 2RR13 3BODA 5FFOC 5A7WA 3IM0A 1D7PM 5IAXA 1UKGA 1IOAA 3HQXA 5GLVA 1W03A 5EJ1B 4OUMA 1MACA 3ZYIB 1RUNA 3O5SA 4V1PA 3U75A 3S7EA 1GBGA 5A3UA 4GB33 3FWEA 4M0NA 1ZRIA 4MYEA 4OHWA 4XFCA 4MH0E 4XBLA 5BNNC 1XNDA 5JPMB 5IK5A 3NWKA 3KM5A 3ZXFA 3WLUA 3ZSKA 3B01A 4C0HA 3M2MA 1J58A 3VBSA 5ACA2 2SBAA 2WZ8A 3H1WA 5A6QA 1QXJA 1LTEA 5IW0A 1POV3 1AJOA 4CCMA 2C9AA 1H4HA 4GAZA 1L7LA 3I2OA 3DXUA 3CO2A 1UOFA 4P9IA 1DGRA 5T5OA 3T1LA 1TZOA 4CEYB 3I49A 3BU7A 2GNBA 5FYCA 1W8ZA 3WUDA 4D7TA 2D98A 1D4M2 5F3GA 4CRQA 3UNPA 5EJ3A 3WDTA 2JG8B 3O1VA 2EAAA 3D8CA 1DYKA 3DYMA 1R1ZA 4XJWA 1UL9A 1C28A 5IVVA 1JYNA 2HWE1 4NE9A 1LKNA 1V9U1 2NPIA 3HEIA 3M7AA 3MV01 4YNIA 1VIWB 4AVAA 3GCWA 5CA6A 1H8TB 1O8PA 2UY8A 3GBGA 4A3ZA 2JDUA 1WKYA 4Q0QA 4XTMA 2EIBA 1NY71 2VU9A 2JENA 3WP6A 2BDRA 3GZEA 4K8RB 1ZBE1 2OZJA 2V72A 2R0FA 1IZ3A 5FP7A 2VXRA 2ZX2A 3KV6A 3JBG1 4NAOA 1DG6A 1WD3A 3AP4A 4AEJA 4UFLA 2QJVA 4P9JA 3U11A 4D7YA 1RUF2 2RMU2 4BK5A 2G9ZA 4Y24A 5JMCA 2FDHA 5F3IA 5DQ0A 4OI4A 4A6SA 3I2FA 2WINB 3FBMA 3IIAA 2HWC2 4ONUA 5A6XA 1ZZ7A 3VBSC 5A6ZA 3ZSEA 1R093 4CEYA 1WCKA 1X8MA 4GWMA 3MF9A 2JDMA 1JXNA 1F2NA 3WHUA 2VXJA 4K1ZA 2BNOA 3ITQA 2X5IB 4AQSA 2QQNA 3JD73 3ZYGA 3WG2A 2LS6A 2QQOA 4Y5SA 2YGMA 5FY1A 5ACA1 2UU8A 4S2FA 5FY5A 4BZ4A 1QNYA 2YFZA 5FYVA 5T5PA 4COWA 5A3TA 3AFGA 4N9HA 4AVSA 4O61A 4AE2A 4CYDA 3GDBA 3VKFC 2KA3A 2RJKA 3SCFA 1WLDA 1GP6A 5J98B 4P5HA 1C5HA 2FCUA 5FZAA 3SCHA 4AQ6A 2RDSA 4JVAA 4AW7A 5FYIA 5T50A 1APNA 2BTVC 2Q30A 2CDPA 2DWRA 4ZY9A 1Q8QA 4UOJA 3MHZA 1ZX5A 2PELA 1HB1A 2J1UA 4FO9A 3CF6E 1COV3 1D4M1 3P3NA 4HN1A 1G9AA 1OHFA 4G4FA 1IG0A 3KF5A 1AVBA 3LDRA 4QM9A 4E27A 3WEZA 1JBCA 2N7GA 1UZVA 2EAKA 1MS5A 4PLNA 3IAPA 1A34A 2ZGTA 4HL0A 3T2TA 2LALA 3H42B 1WMDA 2D3RA 4DRRA 4EROA 3WX5A 5FZ1A 1SBEA 5EIYB 1AR92 3BGAA 1W9FA 2WBKA 4R8HA 1E5HA 4G3YC 3I2HA 1BVVA 5KC6A 1ODNA 2JICA 2Q1FA 2BZDA 1MS0A 1UIJA 5F5IA 1KXGA 1ULGA 2WUHA 4CEYC 5DZEA 3MICA 2WNVA 3LA2A 4D69A 1NZIA 2PHDA 4BLIA 5FQ0B 2VR4A 1FNZA 1RUH3 3MIGA 3GYDA 4MX3A 3AMMA 5F2WA 1RUF1 2RMU1 1XOYA 2HWD2 4MV2A 1LEMA 3HBZA 1WW4A 2QQVA 3U4SA 4CDUB 4META 2HWC1 1ENSA 2WSVA 1DGWX 1SLBA 3CHXA 2Y26A 1HXS2 3WDUA 1XRUA 4K7JA 4HPKA 1MS9A 1D0HA 3QD6A 4UW4A 1O3RA 2ILMA 5FYZA 2X05A 3NRUA 1W06A 5JOWA 2UYBA
chains in the Genus database with same CATH topology
1VP6A 2CL2A 1RHI3 2DU1A 4FPCA 3NAPB 4GULA 2HEWF 5DUUA 2VULA 4JGYA 4INDA 1RUE3 3M3QA 1X82A 4ZKTB 1JUHA 2HEVF 3U4XA 3A0KA 2IXJA 4UBHA 5F6LB 2IXIA 1ZVFA 4XJZA 4LEJA 1CQ9A 3UKVA 2D6NA 1AL23 5CB7A 5JZGA 1LGCA 3DPRB 4LA3A 1Y3TA 4AHZA 5BNPB 2DURA 1QOOA 4R9DA 2PAEA 1AYN2 1F9KA 2IFWA 4YZ2A 5FQ0A 4YYOA 1RUD3 5HCAA 2WT0A 1HQLA 3QBQA 5EYXA 3FC0A 5IK8A 3IDBB 2WLQA 3KGZA 2RS53 3WG3A 3E5UA 2ZX4A 3WUCA 5KC5A 4QX5A 3CEWA 4BPZA 5A32A 5JOXA 1DQ6A 4MUVA 2WNVC 1BK1A 4IEQA 4Q0VA 4JDNA 4QXKA 4E4SA 3KQRA 1AR91 3B02A 5CVRA 4FSJA 2EVXA 1G9FA 2XJSA 3GHMA 3T1MA 2CGOA 1G86A 3B9IA 2B9UA 1GZWB 1PM7A 2RS12 3NAPA 3POSA 2VNOA 3NV3A 1Q56A 2GMEA 1ZYBA 2PLV3 5E16A 4L9BA 2E51A 4YM1A 4EN0A 2HWD1 2NM1A 3J8F3 2Q5TA 4H55A 4FBFA 4BMEA 1MS8A 2MHFA 4L8QA 1HXS1 4JGYC 4DZGA 5BNPA 4HN0A 4PDWB 4AEDB 4BHPA 2EF6A 1YXWA 4E4ZA 1F8VA 2X53S 2BFUS 4QQ2A 4XMIA 2DVFA 2BNNA 4JDMA 3VBRB 4JCKA 5JZGC 1GZ9A 2CGPA 1SLIA 3H50A 1QXRA 2D3SA 4MSVA 3ZFEB 4IEUA 4Q27A 1LOCA 4ZU5A 4ORFA 2ZGMA 5J36A 2H0BA 3OD4A 3U0ZA 2MNGA 1VBC2 5FO8B 4PIXA 5FDBA 2ENRA 4FTBA 2ATFA 4LE4A 2JKBA 1AYN1 2GDFA 1X50A 5H9SA 4RHV3 5DDJ2 4QQOA 4AI2A 1R082 2ZHKA 2XKPA 4FPHA 3RDIA 3NAPC 2DVDA 3OGGA 1M4WA 4RQPA 4YGDA 5C9AB 1ULFA 4RL7A 2XJUA 3O7OA 1H1MA 4NN0A 4PJYA 2GAUA 4AYUA 4YVWB 1VRH2 3KS7A 4B4RA 2O8OA 4S2HA 1LHOA 5E1RA 2RS11 1UN1A 4K20A 4YG6A 3WG4A 3DPRC 4DXZA 2ARBA 5BNPC 1C8M2 2HWF2 1ZREA 3ZFEA 4KU8A 4S2GA 1YO8A 1GR3A 3FFQA 4AFBA 2IXCA 2ZPXA 4CZSA 2ZHLA 1S0FA 1O7FA 3B7MA 5CFCB 5D1IA 2Q1ZB 1LB2A 4KH9A 1FOD2 1NQJA 3RSJA 5J3UA 4WZFA 2KXLA 2NP0A 2D5FA 2ZACA 3KT4A 4ITCA 4ISQA 4NWVA 2WQ4A 5AC92 2A6YA 4YGBA 1MEC3 2PAMA 1R1A3 3ELNA 3MZHA 5C9AA 1ZBA2 3FUQA 2PHLA 3VHRA 2WNEA 1H2KA 1GNHA 3MW4A 3WQ0A 2HWB2 1VBC1 4Q1PA 2WWSA 3LKJA 4XYXA 2WA3A 4XMAA 1ONAA 5EFUA 4RQPC 2XVKA 1SBDA 4LA2A 3WINE 1RUG2 2JG9A 5DDJ1 2PTMA 5T54A 1OQDA 1R081 1TNFA 5BNQA 3N35A 2KM2A 1RL3A 4XIKA 3VBRC 2VQ0A 4RGAA 2HKXA 2V5YA 4L99A 4MXVA 4TZDA 4A7YA 4BM8A 1BEV2 2QDNA 3ZFEC 1VRH1 4ZU7A 3KT1A 3G6JB 5H9QA 3ZMOA 1UU6A 2XG3A 2P3KA 3NV4A 4PIYA 2R1DA 5GALA 1C8M1 1VBD2 2F4PA 1RB8G 1IGOA 3RNSA 2HWF1 2RM22 1PO12 2AENA 1BVP1 3KCXA 3RWNA 1QDCA 5KXCA 4E9KA 2I2SA 2K0GA 2WFPA 5I91A 1AYM3 4X8NA 2DVAA 1CAXB 4HETA 4XE9A 5C9AC 1V00A 1FOD1 3ATGA 2Q8OA 1IS3A 1NCQA 5F1RA 1N3QA 5CAZA 1JYCA 3QCWA 2ZKNA 4Q4W3 1MS4A 2TEPA 1WGPA 2DUQA 1OFSA 3I54A 4U2AA 4XETA 4AFMA 3AP9A 4Q0SA 5AC91 2B7YA 2PN5A 3MIHA 3JUUA 2K2SA 1ZBA1 3TB0A 1RMU2 3VUOA 3BB6A 1JH5A 1AXYA 2HWB1 1WBFA 3G7DA 4OFGA 4D94A 2B5HA 4QQHA 2CYFA 3IDEA 4QQLA 1SCRA 2VVFA 1IS6A 5CFCC 3W59A 1ND3B 2YYOA 1RUG1 1FPN3 2DV9A 4B7KA 1O4YA 2O0OA 1LOEA 3FBYA 1B35B 2O1QA 1VBA3 1O4TA 2A6WA 4YZ4A 3VBHB 2R49A 1PZ8A 4WV8A 4JTNA 1CAVB 3FE5A 4J6GA 2ZKLA 5FCCA 2WL1A 3ST7A 1BEV1 1GNZA 3IN9A 1GICA 5FTTC 2DTWA 3AMPA 4F3JA 2UWCA 4FPEA 1FXZA 2OUJA 2FMYA 4UBGA 4JC1A 5LK5A 1CVNA 4AGRA 2D6OX 1U12A 5DUWA 1VBD1 3AZYA 2RM21 5JWPA 1PO11 4JAAA 2WKKA 3AKTA 2PAKA 4C1WA 1S0IA 3UKNA 2WFF2 5FOJB 3CJIA 3ZX7A 4YW5A 4E2GA 2IZWA 1S0CA 1EAH2 5KHHA 2UWAA 1XNBA 1KRIA 2VMGA 3VZMA 3DGTA 2GN3A 4AK3A 3O0WA 3WNXA 2WA4A 2LTNA 2ZGRA 5BNNB 4BOWA 1B35A 1PZ9A 1S1AA 5FO7B 4OHXA 4BYYA 1O3TA 2CY6A 2OW4A 3R0RA 4WM7B 4WVVA 3SH5A 1TMF3 4E2QA 4DRVA 3RYRA 1RMU1 2WZR3 4DS0A 1CAVA 4QPIA 4XIOA 1V6OA 3FX3A 3N7JA 4FPJA 4N90A 4GQ7A 4K3UA 4UW3A 1KDMA 2ZBJA 1QJZA 2E63A 1Z7S2 1RVF3 1LEDA 2QZ2A 1W6MB 4IL7A 4L2NA 4WVZA 3ZPYA 3JQWA 4A7ZA 4FPYA 1H1AA 4FQZA 3ZSLA 4LT5A 4J1WA 2ZOEB 2R073 1NLSA 4M3CF 4N7UA 4DOUA 2FQPA 1W6QB 2HWF3 2D7FA 2VQAA 3LB9A 4XZPA 4YW2A 1VBE3 4FAGA 1K5MB 4XDQA 3CJIC 4Q4Y2 2JD4A 2R16A 1QF3A 1EYBA 1V6MA 3VN4A 1X36A 1D4VB 1QQP2 5J37A 1RITA 1OA4A 1PGW2 2AR6A 1GLHA 1WW5A 2MEV2 1ND3C 2WFF1 1V6NA 1ENQA 2RJLA 3VKNA 1LOGA 1V6IA 3M8LA 3PJQA 1EAH1 1B35C 3EXUA 1JOJA 4HK9A 2DUOA 4Q4X3 1ENXA 3VBHC 2DCJA 1I9RA 2NYYA 2HYKA 5HXVA 4XBQA 1HDKA 1UCXA 4N43B 1W6MA 1MZFA 5DG2A 1SLTA 1HRI3 3D0SA 3NSTA 4QPIC 4CTEA 1HQWA 1CPMA 2FMDA 5A33B 3V0AB 1HLCA 3H3UA 3A4UA 3ZYPA 5FPXA 1QH7A 2XGXA 3DF0A 1UU5A 1W6QA 4M3CE 4SBVA 3WZ1A 3MIBA 1K5MA 5CIRA 1JTZX 5I0TA 1RIRA 3AMNA 3RMXA 2YPJA 1XYOA 1GZCA 1S0JA 2R063 4PQ9A 3DN7A 1BBT2 1LOFA 3PVOA 1QXPA 1I3HA 3TN92 4DY5A 1Z7S1 2GSYA 4CDQA 1LGNA 4AG4A 5BXXA 1CPNA 1QH6A 1HQNA 4FOYA 1OQ1A 4NPRA 2YMZA 4X8PA 1O3QA 2BYVE 3AKRA 4BH9A 1VBB3 2ZX0A 5T55A 2R042 2A73B 3AJZA 3THPA 2A3WA 5AFEA 4FVVA 4WM7C 1U5ZA 4EJRA 3NW4A 4D7SA 1BMV2 4DINB 4N43A 2DFBA 3NVCA 4KWKA 4Q4Y1 3HT2A 1FT9A 1QQP1 3HMYA 1PGW1 5A33A 3V0AA 2AREA 5K9YA 2WT2A 4GMP3 2MEV1 3WG1A 5FLIA 1ZA4A 4XHBA 5JI7A 4HMZA 5H9PA 2IXLA 5ABJA 1EP0A 1O3SA 4YRDA 5L19A 1PIV3 5FPZA 1DFQA 3AYEA 1MVQA 1QJX3 5A3LA 1AZDA 4COYA 5DZFA 1RUC2 3GNEA 4L92A 3AFKA 5HBAA 1O4ZA 1K5MC 4JDOA 4Y1VA 1W6OB 1LRHA 3UV9A 5BUVA 3MLLA 4LR4A 3OBTA 3WDXA 4JTOA 1LOFC 4XFGA 2C0ZA 3PMSA 4BLJA 4COUA 4XEZA 2WNUA 2UWBA 2VW0A 1HW5A 5FLHA 5IUQA 3WCRA 2NQYA 1OA2A 4KBBA 4P9WA 2D6KA 1MR5A 4AEKA 1NCRB 1NA1A 4OHVA 5JIAA 1BBT1 1C1LA 2BWAA 2RS32 3TN91 1C1FA 1HRV2 4L97A 2ZHNA 1N1SA 1PHMA 4N43C 1EY2A 1U5IA 4LO8A 1LCLA 1EPZA 3AKSA 4I09A 1NYWA 2R041 1XE7A 4XF3A 2XLFA 1TE1B 4IV3A 2XPJA 2ERFA 4PLMA 5HCFA 3LSDA 2A75A 2R1BA 5CG9A 2WNVB 3VDDB 1S55A 2EXJA 1BMV1 3M1HA 3MGUA 4HK8A 4LLFA 4NHLA 5CFDB 2P2KA 4MGZE 5F5QA 1W6OA 1ZZCA 3N3HA 1VR3A 2B8MA 1PVC3 2D44A 2PHRA 4QPGA 5SV8A 4B8EA 1I6XA 4HPKB 3VKOA 1S2BA 5I8YA 4IEXA 3WQ7A 2MPFA 3UL2A 3B9CA 3NJZA 1J3RA 4K9SA 5GZGA 2PHTA 3MLKA 3X29B 1IPJA 3MW3A 5FMOL 2ZGPA 4M3CA 1NCRA 1NLRA 4JGYB 2AGSA 1Y9QA 1WCSA 1SLAA 4OI2A 1W6PB 1V6KA 3WW2A 2WNUC 3GF6A 5LK7B 3RRDA 3VKLA 2ZZJA 3FLTA 1RUC1 4IESA 4AFDA 3O14A 3VGIA 1AR82 2Y38A 4P9XA 1EV12 1H2LA 1DBNA 2DF7A 2SLIA 5JZGB 1NA1C 4Z07A 1Q8OA 1DLLA 1CAWB 3VV1A 3VDDA 2R6QA 1LENA 4LBLA 1QGLA 3ZXGA 5CFDA 1G6NA 5A32B 2EALA 1FV2A 2RS31 4IV3C 1LECA 1HRV1 1AXZA 2ZGUA 2X8KA 5H9RA 4YLZA 4I3GA 2B39A 3VBFB 1FI2A 1W0OA 1QHDA 4GKXA 2OYZA 4XOGA 1QQP3 3UJQA 1S0BA 1XXNA 3BOPA 4EN9B 4QPGC 4GKYA 3J4UH 2P3IA 4NWWA 4XFFA 3SCGA 1W6PA 1FYUA 3KCYA 3NV2A 1XYPA 1LGBA 2XVGA 1NCRC 2TUNA 3FMGA 5FBZA 4HKWA 2UYAA 2HWE3 1V9U3 2A6XA 1CAWA 3GBWA 1ZZBA 3AMQA 4QMAA 2JE7A 3SH3A 2V09A 3WP4A 2C1FA 4R4XA 2Q0AA 2ES3A 1ZBE3 1IHMA 2ET1A 3ZSJA 1X33A 3VKMA 3HAGA 3JBG3 3M3IA 1NXD1 1QOTA 3VDDC 3EO6A 2G9FA 1VB2A 5IT6A 3VHNA 1QY4A 4IV1B 1AR81 4Q1RA 3SH4A 1NQDA 2I07B 3VBFA 2D97A 3ZO0B 3V0BB 1F5JA 1EV11 5CFDC 4SLIA 4WBBA 4HT1T 5EV7A 4GXLA 1QJU2 1SLCA 4L11A 4Y1YA 1BXHA 5AFBA 4I0WB 5LRRA 2Z42A 1UZZA 2WS92 4K21A 5DZGA 5JI9A 3VZLA 3WDYA 4KGQA 1WW6A 3B3QE 1WD4A 4RSUA 2IXKA 5ACA3 1YNAA 4WVWA 4KU7A 4H3WA 4RQPB 4HSLA 2BW8A 1AR72 1XU1A 5LEJA 2A6ZA 3ZMNA 1FAYA 2UY9A 3CNAA 4EN6B 3GZTB 2P17A 1SMVA 4YFWA 4FPLA 3KZ4C 1TEIA 3HR9A 2VY0A 3VBUA 5JAXA 4PIZA 4U36A 3H3ZA 2IC1A 3SXWA 1H8VA 3LWCA 1D4M3 3K48A 5CADA 5K8SA 5CG8A 4EN8B 2Q4SA 4IV1A 2XB6C 1F5FA 4IEZA 1HIXA 3WW1A 4XPVA 3V0BA 5FOBB 4COVA 3A0NA 4W6XA 1WLTA 4QU2A 3WW3A 4Z92B 4EWEA 1H4GA 2D3PA 1V70A 2W0XA 1V6LA 3O12A 1ZM1A 2BUKA 4XJ9A 3RJRA 4Y4YA 2XWBB 3GALA 4IEWA 5IK4A 4LTAA 1TQ5A 4R52A 3VBFC 1RUI2 3M3CA 4GALA 4K1YA 5K0UB 3M70A 3PTYA 1CR7A 2JEMA 2GH2A 2NN8A 4YGCA 3WDVA 4CP2A 2AYHA 3APBA 3ZIWA 1KS5A 1RUF3 2RMU3 1AR62 2JJ6A 1Y7BA 2DUPA 4FPGA 1OSGA 4AHXA 4Z82A 1REEA 1QJU1 2HWC3 1X7NA 1HRV3 3E97A 1QJY2 1AJKA 1AUYA 4YGEA 2GC1A 2WS91 2JG9B 3LCPA 4MGYE 4FTEA 1GFF2 3NO8A 1TME2 1REFA 1O5LA 5J96B 1J59A 4HSJA 4LBQD 1AR71 1WLCA 3WY6A 1GKBA 1UPSA 3VBUC 4BA6A 3AYDA 4BIFA 4Y1UA 4K6BA 4FQ4A 2JX9A 1RUJ2 2VOVA 3E5QA 3SITA 4IV1C 4HVQA 3DV8A 2JECA 4HKLA 5K0UA 4AQ2A 4LHKA 5JDBA 3TNPB 1UIKA 2QE3A 2XUMA 5GZFA 1FX5A 2GC2A 4QQPA 4QD2A 3FLRA 4OULA 1PO22 1G9DA 3M3EA 4M01A 1C3HA 2XHKA 4LULA 2ZMNA 4URTA 1FNYA 2PFWA 5T5LA 5KXBA 4Q4V2 1WCDJ 2FHRA 3USUB 1AR93 1H2NA 1NCQB 1OOPA 1CD3G 1RUI1 1VAKA 2GNMA 3CJXA 3C2UA 4BMBA 4KNCA 1ALYA 4AVVA